data_2VM8
# 
_entry.id   2VM8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2VM8         
PDBE  EBI-35104    
WWPDB D_1290035104 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2GSE 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'CRYSTAL STRUCTURE OF HUMAN DIHYDROPYRIMIDINEASE -LIKE 2' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2VM8 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2008-01-24 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Kursula, P.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Crystal and Solution Structure, Stability and Post- Translational Modifications of Collapsin Response Mediator Protein 2.' 
_citation.journal_abbrev            'FEBS J.' 
_citation.journal_volume            275 
_citation.page_first                4583 
_citation.page_last                 ? 
_citation.year                      2008 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           1742-464X 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18699782 
_citation.pdbx_database_id_DOI      10.1111/J.1742-4658.2008.06601.X 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Majava, V.'    1 
primary 'Loytynoja, N.' 2 
primary 'Chen, W.Q.'    3 
primary 'Lubec, G.'     4 
primary 'Kursula, P.'   5 
# 
_cell.entry_id           2VM8 
_cell.length_a           86.510 
_cell.length_b           126.240 
_cell.length_c           209.750 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2VM8 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DIHYDROPYRIMIDINASE-RELATED PROTEIN 2' 55096.969 4    ? ? 'RESIDUES 13-490' ? 
2 non-polymer syn 'MAGNESIUM ION'                         24.305    3    ? ? ?                 ? 
3 water       nat water                                   18.015    1793 ? ? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'COLLAPSIN RESPONSE MEDIATOR PROTEIN 2, DRP-2, CRMP-2, N2A3' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHSSGVDLGTENLYFQSMTSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGG
IDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQ
EEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPE
EVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSP
DPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAA
KVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYI
PRKPFPDFVYKRIKARSRLAE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGVDLGTENLYFQSMTSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGG
IDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQ
EEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPE
EVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSP
DPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAA
KVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYI
PRKPFPDFVYKRIKARSRLAE
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  MET n 
1 24  THR n 
1 25  SER n 
1 26  ASP n 
1 27  ARG n 
1 28  LEU n 
1 29  LEU n 
1 30  ILE n 
1 31  LYS n 
1 32  GLY n 
1 33  GLY n 
1 34  LYS n 
1 35  ILE n 
1 36  VAL n 
1 37  ASN n 
1 38  ASP n 
1 39  ASP n 
1 40  GLN n 
1 41  SER n 
1 42  PHE n 
1 43  TYR n 
1 44  ALA n 
1 45  ASP n 
1 46  ILE n 
1 47  TYR n 
1 48  MET n 
1 49  GLU n 
1 50  ASP n 
1 51  GLY n 
1 52  LEU n 
1 53  ILE n 
1 54  LYS n 
1 55  GLN n 
1 56  ILE n 
1 57  GLY n 
1 58  GLU n 
1 59  ASN n 
1 60  LEU n 
1 61  ILE n 
1 62  VAL n 
1 63  PRO n 
1 64  GLY n 
1 65  GLY n 
1 66  VAL n 
1 67  LYS n 
1 68  THR n 
1 69  ILE n 
1 70  GLU n 
1 71  ALA n 
1 72  HIS n 
1 73  SER n 
1 74  ARG n 
1 75  MET n 
1 76  VAL n 
1 77  ILE n 
1 78  PRO n 
1 79  GLY n 
1 80  GLY n 
1 81  ILE n 
1 82  ASP n 
1 83  VAL n 
1 84  HIS n 
1 85  THR n 
1 86  ARG n 
1 87  PHE n 
1 88  GLN n 
1 89  MET n 
1 90  PRO n 
1 91  ASP n 
1 92  GLN n 
1 93  GLY n 
1 94  MET n 
1 95  THR n 
1 96  SER n 
1 97  ALA n 
1 98  ASP n 
1 99  ASP n 
1 100 PHE n 
1 101 PHE n 
1 102 GLN n 
1 103 GLY n 
1 104 THR n 
1 105 LYS n 
1 106 ALA n 
1 107 ALA n 
1 108 LEU n 
1 109 ALA n 
1 110 GLY n 
1 111 GLY n 
1 112 THR n 
1 113 THR n 
1 114 MET n 
1 115 ILE n 
1 116 ILE n 
1 117 ASP n 
1 118 HIS n 
1 119 VAL n 
1 120 VAL n 
1 121 PRO n 
1 122 GLU n 
1 123 PRO n 
1 124 GLY n 
1 125 THR n 
1 126 SER n 
1 127 LEU n 
1 128 LEU n 
1 129 ALA n 
1 130 ALA n 
1 131 PHE n 
1 132 ASP n 
1 133 GLN n 
1 134 TRP n 
1 135 ARG n 
1 136 GLU n 
1 137 TRP n 
1 138 ALA n 
1 139 ASP n 
1 140 SER n 
1 141 LYS n 
1 142 SER n 
1 143 CYS n 
1 144 CYS n 
1 145 ASP n 
1 146 TYR n 
1 147 SER n 
1 148 LEU n 
1 149 HIS n 
1 150 VAL n 
1 151 ASP n 
1 152 ILE n 
1 153 SER n 
1 154 GLU n 
1 155 TRP n 
1 156 HIS n 
1 157 LYS n 
1 158 GLY n 
1 159 ILE n 
1 160 GLN n 
1 161 GLU n 
1 162 GLU n 
1 163 MET n 
1 164 GLU n 
1 165 ALA n 
1 166 LEU n 
1 167 VAL n 
1 168 LYS n 
1 169 ASP n 
1 170 HIS n 
1 171 GLY n 
1 172 VAL n 
1 173 ASN n 
1 174 SER n 
1 175 PHE n 
1 176 LEU n 
1 177 VAL n 
1 178 TYR n 
1 179 MET n 
1 180 ALA n 
1 181 PHE n 
1 182 LYS n 
1 183 ASP n 
1 184 ARG n 
1 185 PHE n 
1 186 GLN n 
1 187 LEU n 
1 188 THR n 
1 189 ASP n 
1 190 CYS n 
1 191 GLN n 
1 192 ILE n 
1 193 TYR n 
1 194 GLU n 
1 195 VAL n 
1 196 LEU n 
1 197 SER n 
1 198 VAL n 
1 199 ILE n 
1 200 ARG n 
1 201 ASP n 
1 202 ILE n 
1 203 GLY n 
1 204 ALA n 
1 205 ILE n 
1 206 ALA n 
1 207 GLN n 
1 208 VAL n 
1 209 HIS n 
1 210 ALA n 
1 211 GLU n 
1 212 ASN n 
1 213 GLY n 
1 214 ASP n 
1 215 ILE n 
1 216 ILE n 
1 217 ALA n 
1 218 GLU n 
1 219 GLU n 
1 220 GLN n 
1 221 GLN n 
1 222 ARG n 
1 223 ILE n 
1 224 LEU n 
1 225 ASP n 
1 226 LEU n 
1 227 GLY n 
1 228 ILE n 
1 229 THR n 
1 230 GLY n 
1 231 PRO n 
1 232 GLU n 
1 233 GLY n 
1 234 HIS n 
1 235 VAL n 
1 236 LEU n 
1 237 SER n 
1 238 ARG n 
1 239 PRO n 
1 240 GLU n 
1 241 GLU n 
1 242 VAL n 
1 243 GLU n 
1 244 ALA n 
1 245 GLU n 
1 246 ALA n 
1 247 VAL n 
1 248 ASN n 
1 249 ARG n 
1 250 ALA n 
1 251 ILE n 
1 252 THR n 
1 253 ILE n 
1 254 ALA n 
1 255 ASN n 
1 256 GLN n 
1 257 THR n 
1 258 ASN n 
1 259 CYS n 
1 260 PRO n 
1 261 LEU n 
1 262 TYR n 
1 263 ILE n 
1 264 THR n 
1 265 LYS n 
1 266 VAL n 
1 267 MET n 
1 268 SER n 
1 269 LYS n 
1 270 SER n 
1 271 SER n 
1 272 ALA n 
1 273 GLU n 
1 274 VAL n 
1 275 ILE n 
1 276 ALA n 
1 277 GLN n 
1 278 ALA n 
1 279 ARG n 
1 280 LYS n 
1 281 LYS n 
1 282 GLY n 
1 283 THR n 
1 284 VAL n 
1 285 VAL n 
1 286 TYR n 
1 287 GLY n 
1 288 GLU n 
1 289 PRO n 
1 290 ILE n 
1 291 THR n 
1 292 ALA n 
1 293 SER n 
1 294 LEU n 
1 295 GLY n 
1 296 THR n 
1 297 ASP n 
1 298 GLY n 
1 299 SER n 
1 300 HIS n 
1 301 TYR n 
1 302 TRP n 
1 303 SER n 
1 304 LYS n 
1 305 ASN n 
1 306 TRP n 
1 307 ALA n 
1 308 LYS n 
1 309 ALA n 
1 310 ALA n 
1 311 ALA n 
1 312 PHE n 
1 313 VAL n 
1 314 THR n 
1 315 SER n 
1 316 PRO n 
1 317 PRO n 
1 318 LEU n 
1 319 SER n 
1 320 PRO n 
1 321 ASP n 
1 322 PRO n 
1 323 THR n 
1 324 THR n 
1 325 PRO n 
1 326 ASP n 
1 327 PHE n 
1 328 LEU n 
1 329 ASN n 
1 330 SER n 
1 331 LEU n 
1 332 LEU n 
1 333 SER n 
1 334 CYS n 
1 335 GLY n 
1 336 ASP n 
1 337 LEU n 
1 338 GLN n 
1 339 VAL n 
1 340 THR n 
1 341 GLY n 
1 342 SER n 
1 343 ALA n 
1 344 HIS n 
1 345 CYS n 
1 346 THR n 
1 347 PHE n 
1 348 ASN n 
1 349 THR n 
1 350 ALA n 
1 351 GLN n 
1 352 LYS n 
1 353 ALA n 
1 354 VAL n 
1 355 GLY n 
1 356 LYS n 
1 357 ASP n 
1 358 ASN n 
1 359 PHE n 
1 360 THR n 
1 361 LEU n 
1 362 ILE n 
1 363 PRO n 
1 364 GLU n 
1 365 GLY n 
1 366 THR n 
1 367 ASN n 
1 368 GLY n 
1 369 THR n 
1 370 GLU n 
1 371 GLU n 
1 372 ARG n 
1 373 MET n 
1 374 SER n 
1 375 VAL n 
1 376 ILE n 
1 377 TRP n 
1 378 ASP n 
1 379 LYS n 
1 380 ALA n 
1 381 VAL n 
1 382 VAL n 
1 383 THR n 
1 384 GLY n 
1 385 LYS n 
1 386 MET n 
1 387 ASP n 
1 388 GLU n 
1 389 ASN n 
1 390 GLN n 
1 391 PHE n 
1 392 VAL n 
1 393 ALA n 
1 394 VAL n 
1 395 THR n 
1 396 SER n 
1 397 THR n 
1 398 ASN n 
1 399 ALA n 
1 400 ALA n 
1 401 LYS n 
1 402 VAL n 
1 403 PHE n 
1 404 ASN n 
1 405 LEU n 
1 406 TYR n 
1 407 PRO n 
1 408 ARG n 
1 409 LYS n 
1 410 GLY n 
1 411 ARG n 
1 412 ILE n 
1 413 ALA n 
1 414 VAL n 
1 415 GLY n 
1 416 SER n 
1 417 ASP n 
1 418 ALA n 
1 419 ASP n 
1 420 LEU n 
1 421 VAL n 
1 422 ILE n 
1 423 TRP n 
1 424 ASP n 
1 425 PRO n 
1 426 ASP n 
1 427 SER n 
1 428 VAL n 
1 429 LYS n 
1 430 THR n 
1 431 ILE n 
1 432 SER n 
1 433 ALA n 
1 434 LYS n 
1 435 THR n 
1 436 HIS n 
1 437 ASN n 
1 438 SER n 
1 439 SER n 
1 440 LEU n 
1 441 GLU n 
1 442 TYR n 
1 443 ASN n 
1 444 ILE n 
1 445 PHE n 
1 446 GLU n 
1 447 GLY n 
1 448 MET n 
1 449 GLU n 
1 450 CYS n 
1 451 ARG n 
1 452 GLY n 
1 453 SER n 
1 454 PRO n 
1 455 LEU n 
1 456 VAL n 
1 457 VAL n 
1 458 ILE n 
1 459 SER n 
1 460 GLN n 
1 461 GLY n 
1 462 LYS n 
1 463 ILE n 
1 464 VAL n 
1 465 LEU n 
1 466 GLU n 
1 467 ASP n 
1 468 GLY n 
1 469 THR n 
1 470 LEU n 
1 471 HIS n 
1 472 VAL n 
1 473 THR n 
1 474 GLU n 
1 475 GLY n 
1 476 SER n 
1 477 GLY n 
1 478 ARG n 
1 479 TYR n 
1 480 ILE n 
1 481 PRO n 
1 482 ARG n 
1 483 LYS n 
1 484 PRO n 
1 485 PHE n 
1 486 PRO n 
1 487 ASP n 
1 488 PHE n 
1 489 VAL n 
1 490 TYR n 
1 491 LYS n 
1 492 ARG n 
1 493 ILE n 
1 494 LYS n 
1 495 ALA n 
1 496 ARG n 
1 497 SER n 
1 498 ARG n 
1 499 LEU n 
1 500 ALA n 
1 501 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PNIC-BSA4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2VM8        1 ? ? 2VM8   ? 
2 UNP DPYL2_HUMAN 1 ? ? Q16555 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2VM8 A 1  ? 23  ? 2VM8   -10 ? 12  ? -10 12  
2 2 2VM8 A 24 ? 501 ? Q16555 13  ? 490 ? 13  490 
3 1 2VM8 B 1  ? 23  ? 2VM8   -10 ? 12  ? -10 12  
4 2 2VM8 B 24 ? 501 ? Q16555 13  ? 490 ? 13  490 
5 1 2VM8 C 1  ? 23  ? 2VM8   -10 ? 12  ? -10 12  
6 2 2VM8 C 24 ? 501 ? Q16555 13  ? 490 ? 13  490 
7 1 2VM8 D 1  ? 23  ? 2VM8   -10 ? 12  ? -10 12  
8 2 2VM8 D 24 ? 501 ? Q16555 13  ? 490 ? 13  490 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2VM8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.47 
_exptl_crystal.density_percent_sol   49.88 
_exptl_crystal.description           NONE 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2006-10-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0408 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I911-2' 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I911-2 
_diffrn_source.pdbx_wavelength             1.0408 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2VM8 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.00 
_reflns.d_resolution_high            1.90 
_reflns.number_obs                   170498 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94.2 
_reflns.pdbx_Rmerge_I_obs            0.12 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.40 
_reflns.B_iso_Wilson_estimate        22.00 
_reflns.pdbx_redundancy              6.0 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              2.00 
_reflns_shell.percent_possible_all   83.7 
_reflns_shell.Rmerge_I_obs           0.47 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.80 
_reflns_shell.pdbx_redundancy        5.5 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2VM8 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     162237 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    94.5 
_refine.ls_R_factor_obs                          0.259 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.256 
_refine.ls_R_factor_R_free                       0.325 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  8539 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.915 
_refine.correlation_coeff_Fo_to_Fc_free          0.847 
_refine.B_iso_mean                               17.39 
_refine.aniso_B[1][1]                            -2.04000 
_refine.aniso_B[2][2]                            -0.41000 
_refine.aniso_B[3][3]                            2.45000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. DUE TO PSEUDOTRANSLATIONAL SYMMETRY, THE R FACTORS REMAINED HIGHER THAN EXPECTED DURING REFINEMENT.
;
_refine.pdbx_starting_model                      'PDB ENTRY 2GSE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.209 
_refine.pdbx_overall_ESU_R_Free                  0.204 
_refine.overall_SU_ML                            0.211 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             7.571 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        14674 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             1793 
_refine_hist.number_atoms_total               16470 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.016  0.022  ? 15057 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 10053 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.579  1.951  ? 20454 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.984  3.000  ? 24649 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.645  5.000  ? 1929  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       38.435 24.797 ? 665   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.061 15.000 ? 2559  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.645 15.000 ? 77    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.087  0.200  ? 2311  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 16902 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 2907  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.226  0.200  ? 3900  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.209  0.200  ? 11546 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.184  0.200  ? 7390  'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.090  0.200  ? 8123  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.245  0.200  ? 1472  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.183  0.200  ? 7     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.236  0.200  ? 38    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.176  0.200  ? 13    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.471  2.000  ? 12242 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.891  3.000  ? 15384 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.670  4.000  ? 6371  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.428  5.000  ? 5056  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.90 
_refine_ls_shell.d_res_low                        1.95 
_refine_ls_shell.number_reflns_R_work             10173 
_refine_ls_shell.R_factor_R_work                  0.3840 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.4190 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             535 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2VM8 
_struct.title                     'Human CRMP-2 crystallised in the presence of Mg' 
_struct.pdbx_descriptor           'DIHYDROPYRIMIDINASE-RELATED PROTEIN 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2VM8 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;NEUROGENESIS, PHOSPHOPROTEIN, DIFFERENTIATION, CRMP, CYTOPLASM, TIM BARREL, POLYMORPHISM, AXONAL PATHFINDING, DEVELOPMENTAL PROTEIN, SIGNALING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 99  ? GLY A 110 ? ASP A 88  GLY A 99  1 ? 12 
HELX_P HELX_P2  2  SER A 126 ? SER A 142 ? SER A 115 SER A 131 1 ? 17 
HELX_P HELX_P3  3  HIS A 156 ? HIS A 170 ? HIS A 145 HIS A 159 1 ? 15 
HELX_P HELX_P4  4  THR A 188 ? GLY A 203 ? THR A 177 GLY A 192 1 ? 16 
HELX_P HELX_P5  5  ASN A 212 ? ASP A 225 ? ASN A 201 ASP A 214 1 ? 14 
HELX_P HELX_P6  6  PRO A 231 ? ARG A 238 ? PRO A 220 ARG A 227 1 ? 8  
HELX_P HELX_P7  7  PRO A 239 ? ASN A 258 ? PRO A 228 ASN A 247 1 ? 20 
HELX_P HELX_P8  8  SER A 268 ? LYS A 281 ? SER A 257 LYS A 270 1 ? 14 
HELX_P HELX_P9  9  ILE A 290 ? THR A 296 ? ILE A 279 THR A 285 1 ? 7  
HELX_P HELX_P10 10 ASP A 297 ? SER A 303 ? ASP A 286 SER A 292 5 ? 7  
HELX_P HELX_P11 11 ASN A 305 ? PHE A 312 ? ASN A 294 PHE A 301 1 ? 8  
HELX_P HELX_P12 12 THR A 323 ? CYS A 334 ? THR A 312 CYS A 323 1 ? 12 
HELX_P HELX_P13 13 ASN A 348 ? ALA A 353 ? ASN A 337 ALA A 342 1 ? 6  
HELX_P HELX_P14 14 VAL A 354 ? LYS A 356 ? VAL A 343 LYS A 345 5 ? 3  
HELX_P HELX_P15 15 ASN A 358 ? ILE A 362 ? ASN A 347 ILE A 351 5 ? 5  
HELX_P HELX_P16 16 GLU A 371 ? VAL A 381 ? GLU A 360 VAL A 370 1 ? 11 
HELX_P HELX_P17 17 ASP A 387 ? SER A 396 ? ASP A 376 SER A 385 1 ? 10 
HELX_P HELX_P18 18 SER A 396 ? ASN A 404 ? SER A 385 ASN A 393 1 ? 9  
HELX_P HELX_P19 19 PRO A 486 ? LEU A 499 ? PRO A 475 LEU A 488 1 ? 14 
HELX_P HELX_P20 20 ASP B 99  ? GLY B 110 ? ASP B 88  GLY B 99  1 ? 12 
HELX_P HELX_P21 21 SER B 126 ? SER B 142 ? SER B 115 SER B 131 1 ? 17 
HELX_P HELX_P22 22 GLY B 158 ? HIS B 170 ? GLY B 147 HIS B 159 1 ? 13 
HELX_P HELX_P23 23 THR B 188 ? GLY B 203 ? THR B 177 GLY B 192 1 ? 16 
HELX_P HELX_P24 24 ASN B 212 ? LEU B 226 ? ASN B 201 LEU B 215 1 ? 15 
HELX_P HELX_P25 25 PRO B 231 ? SER B 237 ? PRO B 220 SER B 226 1 ? 7  
HELX_P HELX_P26 26 PRO B 239 ? ASN B 258 ? PRO B 228 ASN B 247 1 ? 20 
HELX_P HELX_P27 27 SER B 268 ? LYS B 281 ? SER B 257 LYS B 270 1 ? 14 
HELX_P HELX_P28 28 ILE B 290 ? THR B 296 ? ILE B 279 THR B 285 1 ? 7  
HELX_P HELX_P29 29 ASP B 297 ? SER B 303 ? ASP B 286 SER B 292 5 ? 7  
HELX_P HELX_P30 30 ASN B 305 ? ALA B 310 ? ASN B 294 ALA B 299 1 ? 6  
HELX_P HELX_P31 31 ALA B 311 ? VAL B 313 ? ALA B 300 VAL B 302 5 ? 3  
HELX_P HELX_P32 32 THR B 323 ? CYS B 334 ? THR B 312 CYS B 323 1 ? 12 
HELX_P HELX_P33 33 ASN B 348 ? ALA B 353 ? ASN B 337 ALA B 342 1 ? 6  
HELX_P HELX_P34 34 VAL B 354 ? LYS B 356 ? VAL B 343 LYS B 345 5 ? 3  
HELX_P HELX_P35 35 ASN B 358 ? ILE B 362 ? ASN B 347 ILE B 351 5 ? 5  
HELX_P HELX_P36 36 GLU B 371 ? VAL B 381 ? GLU B 360 VAL B 370 1 ? 11 
HELX_P HELX_P37 37 ASP B 387 ? SER B 396 ? ASP B 376 SER B 385 1 ? 10 
HELX_P HELX_P38 38 SER B 396 ? PHE B 403 ? SER B 385 PHE B 392 1 ? 8  
HELX_P HELX_P39 39 PRO B 486 ? ARG B 498 ? PRO B 475 ARG B 487 1 ? 13 
HELX_P HELX_P40 40 ASP C 99  ? GLY C 110 ? ASP C 88  GLY C 99  1 ? 12 
HELX_P HELX_P41 41 SER C 126 ? SER C 142 ? SER C 115 SER C 131 1 ? 17 
HELX_P HELX_P42 42 GLY C 158 ? HIS C 170 ? GLY C 147 HIS C 159 1 ? 13 
HELX_P HELX_P43 43 THR C 188 ? GLY C 203 ? THR C 177 GLY C 192 1 ? 16 
HELX_P HELX_P44 44 ASN C 212 ? LEU C 226 ? ASN C 201 LEU C 215 1 ? 15 
HELX_P HELX_P45 45 PRO C 231 ? ARG C 238 ? PRO C 220 ARG C 227 1 ? 8  
HELX_P HELX_P46 46 PRO C 239 ? ASN C 258 ? PRO C 228 ASN C 247 1 ? 20 
HELX_P HELX_P47 47 SER C 268 ? LYS C 281 ? SER C 257 LYS C 270 1 ? 14 
HELX_P HELX_P48 48 ILE C 290 ? THR C 296 ? ILE C 279 THR C 285 1 ? 7  
HELX_P HELX_P49 49 ASP C 297 ? TRP C 302 ? ASP C 286 TRP C 291 5 ? 6  
HELX_P HELX_P50 50 ASN C 305 ? PHE C 312 ? ASN C 294 PHE C 301 1 ? 8  
HELX_P HELX_P51 51 THR C 323 ? CYS C 334 ? THR C 312 CYS C 323 1 ? 12 
HELX_P HELX_P52 52 ASN C 348 ? VAL C 354 ? ASN C 337 VAL C 343 1 ? 7  
HELX_P HELX_P53 53 GLY C 355 ? ILE C 362 ? GLY C 344 ILE C 351 5 ? 8  
HELX_P HELX_P54 54 GLU C 371 ? VAL C 381 ? GLU C 360 VAL C 370 1 ? 11 
HELX_P HELX_P55 55 ASP C 387 ? VAL C 394 ? ASP C 376 VAL C 383 1 ? 8  
HELX_P HELX_P56 56 SER C 396 ? PHE C 403 ? SER C 385 PHE C 392 1 ? 8  
HELX_P HELX_P57 57 PRO C 486 ? LEU C 499 ? PRO C 475 LEU C 488 1 ? 14 
HELX_P HELX_P58 58 ASP D 99  ? ALA D 109 ? ASP D 88  ALA D 98  1 ? 11 
HELX_P HELX_P59 59 SER D 126 ? SER D 142 ? SER D 115 SER D 131 1 ? 17 
HELX_P HELX_P60 60 GLY D 158 ? HIS D 170 ? GLY D 147 HIS D 159 1 ? 13 
HELX_P HELX_P61 61 THR D 188 ? GLY D 203 ? THR D 177 GLY D 192 1 ? 16 
HELX_P HELX_P62 62 ASN D 212 ? ASP D 225 ? ASN D 201 ASP D 214 1 ? 14 
HELX_P HELX_P63 63 PRO D 231 ? SER D 237 ? PRO D 220 SER D 226 1 ? 7  
HELX_P HELX_P64 64 PRO D 239 ? ASN D 258 ? PRO D 228 ASN D 247 1 ? 20 
HELX_P HELX_P65 65 SER D 268 ? LYS D 281 ? SER D 257 LYS D 270 1 ? 14 
HELX_P HELX_P66 66 ILE D 290 ? THR D 296 ? ILE D 279 THR D 285 1 ? 7  
HELX_P HELX_P67 67 ASP D 297 ? SER D 303 ? ASP D 286 SER D 292 5 ? 7  
HELX_P HELX_P68 68 ASN D 305 ? PHE D 312 ? ASN D 294 PHE D 301 1 ? 8  
HELX_P HELX_P69 69 THR D 323 ? CYS D 334 ? THR D 312 CYS D 323 1 ? 12 
HELX_P HELX_P70 70 ASN D 348 ? ALA D 353 ? ASN D 337 ALA D 342 1 ? 6  
HELX_P HELX_P71 71 VAL D 354 ? LYS D 356 ? VAL D 343 LYS D 345 5 ? 3  
HELX_P HELX_P72 72 ASN D 358 ? ILE D 362 ? ASN D 347 ILE D 351 5 ? 5  
HELX_P HELX_P73 73 GLU D 371 ? VAL D 381 ? GLU D 360 VAL D 370 1 ? 11 
HELX_P HELX_P74 74 ASP D 387 ? SER D 396 ? ASP D 376 SER D 385 1 ? 10 
HELX_P HELX_P75 75 SER D 396 ? PHE D 403 ? SER D 385 PHE D 392 1 ? 8  
HELX_P HELX_P76 76 PRO D 486 ? LEU D 499 ? PRO D 475 LEU D 488 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E MG . MG ? ? ? 1_555 H HOH . O ? ? A MG 1491 A HOH 2322 1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc2  metalc ? ? E MG . MG ? ? ? 1_555 H HOH . O ? ? A MG 1491 A HOH 2061 1_555 ? ? ? ? ? ? ? 2.236 ? 
metalc3  metalc ? ? E MG . MG ? ? ? 1_555 H HOH . O ? ? A MG 1491 A HOH 2317 1_555 ? ? ? ? ? ? ? 2.493 ? 
metalc4  metalc ? ? E MG . MG ? ? ? 1_555 H HOH . O ? ? A MG 1491 A HOH 2062 1_555 ? ? ? ? ? ? ? 2.315 ? 
metalc5  metalc ? ? F MG . MG ? ? ? 1_555 I HOH . O ? ? B MG 1491 B HOH 2059 1_555 ? ? ? ? ? ? ? 2.508 ? 
metalc6  metalc ? ? F MG . MG ? ? ? 1_555 I HOH . O ? ? B MG 1491 B HOH 2058 1_555 ? ? ? ? ? ? ? 2.683 ? 
metalc7  metalc ? ? F MG . MG ? ? ? 1_555 I HOH . O ? ? B MG 1491 B HOH 2292 1_555 ? ? ? ? ? ? ? 1.967 ? 
metalc8  metalc ? ? F MG . MG ? ? ? 1_555 I HOH . O ? ? B MG 1491 B HOH 2293 1_555 ? ? ? ? ? ? ? 2.163 ? 
metalc9  metalc ? ? G MG . MG ? ? ? 1_555 J HOH . O ? ? C MG 1491 C HOH 2375 1_555 ? ? ? ? ? ? ? 2.367 ? 
metalc10 metalc ? ? G MG . MG ? ? ? 1_555 J HOH . O ? ? C MG 1491 C HOH 2374 1_555 ? ? ? ? ? ? ? 1.909 ? 
metalc11 metalc ? ? G MG . MG ? ? ? 1_555 J HOH . O ? ? C MG 1491 C HOH 2076 1_555 ? ? ? ? ? ? ? 2.551 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 315 A . ? SER 304 A PRO 316 A ? PRO 305 A 1 -1.76 
2 TYR 406 A . ? TYR 395 A PRO 407 A ? PRO 396 A 1 4.49  
3 SER 315 B . ? SER 304 B PRO 316 B ? PRO 305 B 1 -7.63 
4 TYR 406 B . ? TYR 395 B PRO 407 B ? PRO 396 B 1 1.05  
5 SER 315 C . ? SER 304 C PRO 316 C ? PRO 305 C 1 -4.90 
6 TYR 406 C . ? TYR 395 C PRO 407 C ? PRO 396 C 1 0.06  
7 SER 315 D . ? SER 304 D PRO 316 D ? PRO 305 D 1 -5.56 
8 TYR 406 D . ? TYR 395 D PRO 407 D ? PRO 396 D 1 -2.43 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 8 ? 
AC ? 7 ? 
AD ? 2 ? 
BA ? 4 ? 
BB ? 7 ? 
BC ? 7 ? 
BD ? 2 ? 
CA ? 4 ? 
CB ? 7 ? 
CC ? 7 ? 
CD ? 2 ? 
DA ? 4 ? 
DB ? 7 ? 
DC ? 7 ? 
DD ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? parallel      
AB 4 5 ? anti-parallel 
AB 5 6 ? anti-parallel 
AB 6 7 ? anti-parallel 
AB 7 8 ? anti-parallel 
AC 1 2 ? parallel      
AC 2 3 ? parallel      
AC 3 4 ? parallel      
AC 4 5 ? parallel      
AC 5 6 ? parallel      
AC 6 7 ? parallel      
AD 1 2 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? parallel      
BB 1 2 ? anti-parallel 
BB 2 3 ? parallel      
BB 3 4 ? anti-parallel 
BB 4 5 ? anti-parallel 
BB 5 6 ? anti-parallel 
BB 6 7 ? anti-parallel 
BC 1 2 ? parallel      
BC 2 3 ? parallel      
BC 3 4 ? parallel      
BC 4 5 ? parallel      
BC 5 6 ? parallel      
BC 6 7 ? parallel      
BD 1 2 ? anti-parallel 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? parallel      
CB 1 2 ? anti-parallel 
CB 2 3 ? parallel      
CB 3 4 ? anti-parallel 
CB 4 5 ? anti-parallel 
CB 5 6 ? anti-parallel 
CB 6 7 ? anti-parallel 
CC 1 2 ? parallel      
CC 2 3 ? parallel      
CC 3 4 ? parallel      
CC 4 5 ? parallel      
CC 5 6 ? parallel      
CC 6 7 ? parallel      
CD 1 2 ? anti-parallel 
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
DA 3 4 ? parallel      
DB 1 2 ? anti-parallel 
DB 2 3 ? parallel      
DB 3 4 ? anti-parallel 
DB 4 5 ? anti-parallel 
DB 5 6 ? anti-parallel 
DB 6 7 ? anti-parallel 
DC 1 2 ? parallel      
DC 2 3 ? parallel      
DC 3 4 ? parallel      
DC 4 5 ? parallel      
DC 5 6 ? parallel      
DC 6 7 ? parallel      
DD 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 LEU A 52  ? GLY A 57  ? LEU A 41  GLY A 46  
AA 2 SER A 41  ? GLU A 49  ? SER A 30  GLU A 38  
AA 3 LEU A 28  ? VAL A 36  ? LEU A 17  VAL A 25  
AA 4 THR A 68  ? GLU A 70  ? THR A 57  GLU A 59  
AB 1 LEU A 52  ? GLY A 57  ? LEU A 41  GLY A 46  
AB 2 SER A 41  ? GLU A 49  ? SER A 30  GLU A 38  
AB 3 LEU A 28  ? VAL A 36  ? LEU A 17  VAL A 25  
AB 4 MET A 75  ? PRO A 78  ? MET A 64  PRO A 67  
AB 5 LEU A 420 ? THR A 430 ? LEU A 409 THR A 419 
AB 6 GLU A 449 ? SER A 459 ? GLU A 438 SER A 448 
AB 7 LYS A 462 ? GLU A 466 ? LYS A 451 GLU A 455 
AB 8 THR A 469 ? LEU A 470 ? THR A 458 LEU A 459 
AC 1 GLY A 80  ? THR A 85  ? GLY A 69  THR A 74  
AC 2 THR A 112 ? VAL A 119 ? THR A 101 VAL A 108 
AC 3 ASP A 145 ? ASP A 151 ? ASP A 134 ASP A 140 
AC 4 SER A 174 ? TYR A 178 ? SER A 163 TYR A 167 
AC 5 ILE A 205 ? HIS A 209 ? ILE A 194 HIS A 198 
AC 6 LEU A 261 ? VAL A 266 ? LEU A 250 VAL A 255 
AC 7 VAL A 285 ? PRO A 289 ? VAL A 274 PRO A 278 
AD 1 PRO A 90  ? ASP A 91  ? PRO A 79  ASP A 80  
AD 2 MET A 94  ? THR A 95  ? MET A 83  THR A 84  
BA 1 LEU B 52  ? GLY B 57  ? LEU B 41  GLY B 46  
BA 2 ASP B 45  ? GLU B 49  ? ASP B 34  GLU B 38  
BA 3 LEU B 28  ? LYS B 31  ? LEU B 17  LYS B 20  
BA 4 LYS B 67  ? GLU B 70  ? LYS B 56  GLU B 59  
BB 1 SER B 41  ? TYR B 43  ? SER B 30  TYR B 32  
BB 2 LYS B 34  ? VAL B 36  ? LYS B 23  VAL B 25  
BB 3 MET B 75  ? PRO B 78  ? MET B 64  PRO B 67  
BB 4 LEU B 420 ? THR B 430 ? LEU B 409 THR B 419 
BB 5 GLU B 449 ? SER B 459 ? GLU B 438 SER B 448 
BB 6 LYS B 462 ? GLU B 466 ? LYS B 451 GLU B 455 
BB 7 THR B 469 ? LEU B 470 ? THR B 458 LEU B 459 
BC 1 GLY B 80  ? ASP B 82  ? GLY B 69  ASP B 71  
BC 2 THR B 112 ? VAL B 119 ? THR B 101 VAL B 108 
BC 3 ASP B 145 ? ASP B 151 ? ASP B 134 ASP B 140 
BC 4 SER B 174 ? TYR B 178 ? SER B 163 TYR B 167 
BC 5 ILE B 205 ? HIS B 209 ? ILE B 194 HIS B 198 
BC 6 LEU B 261 ? VAL B 266 ? LEU B 250 VAL B 255 
BC 7 VAL B 285 ? PRO B 289 ? VAL B 274 PRO B 278 
BD 1 PRO B 90  ? ASP B 91  ? PRO B 79  ASP B 80  
BD 2 MET B 94  ? THR B 95  ? MET B 83  THR B 84  
CA 1 LEU C 52  ? GLY C 57  ? LEU C 41  GLY C 46  
CA 2 ASP C 45  ? GLU C 49  ? ASP C 34  GLU C 38  
CA 3 LEU C 28  ? LYS C 31  ? LEU C 17  LYS C 20  
CA 4 LYS C 67  ? GLU C 70  ? LYS C 56  GLU C 59  
CB 1 SER C 41  ? TYR C 43  ? SER C 30  TYR C 32  
CB 2 LYS C 34  ? VAL C 36  ? LYS C 23  VAL C 25  
CB 3 MET C 75  ? PRO C 78  ? MET C 64  PRO C 67  
CB 4 LEU C 420 ? ILE C 431 ? LEU C 409 ILE C 420 
CB 5 MET C 448 ? SER C 459 ? MET C 437 SER C 448 
CB 6 LYS C 462 ? GLU C 466 ? LYS C 451 GLU C 455 
CB 7 THR C 469 ? LEU C 470 ? THR C 458 LEU C 459 
CC 1 GLY C 80  ? ASP C 82  ? GLY C 69  ASP C 71  
CC 2 THR C 112 ? VAL C 119 ? THR C 101 VAL C 108 
CC 3 ASP C 145 ? ILE C 152 ? ASP C 134 ILE C 141 
CC 4 SER C 174 ? TYR C 178 ? SER C 163 TYR C 167 
CC 5 ILE C 205 ? HIS C 209 ? ILE C 194 HIS C 198 
CC 6 LEU C 261 ? VAL C 266 ? LEU C 250 VAL C 255 
CC 7 VAL C 285 ? PRO C 289 ? VAL C 274 PRO C 278 
CD 1 PRO C 90  ? ASP C 91  ? PRO C 79  ASP C 80  
CD 2 MET C 94  ? THR C 95  ? MET C 83  THR C 84  
DA 1 LEU D 52  ? GLY D 57  ? LEU D 41  GLY D 46  
DA 2 ASP D 45  ? GLU D 49  ? ASP D 34  GLU D 38  
DA 3 LEU D 28  ? LYS D 31  ? LEU D 17  LYS D 20  
DA 4 THR D 68  ? GLU D 70  ? THR D 57  GLU D 59  
DB 1 SER D 41  ? TYR D 43  ? SER D 30  TYR D 32  
DB 2 LYS D 34  ? VAL D 36  ? LYS D 23  VAL D 25  
DB 3 MET D 75  ? PRO D 78  ? MET D 64  PRO D 67  
DB 4 LEU D 420 ? ILE D 431 ? LEU D 409 ILE D 420 
DB 5 MET D 448 ? SER D 459 ? MET D 437 SER D 448 
DB 6 LYS D 462 ? GLU D 466 ? LYS D 451 GLU D 455 
DB 7 THR D 469 ? LEU D 470 ? THR D 458 LEU D 459 
DC 1 GLY D 80  ? ASP D 82  ? GLY D 69  ASP D 71  
DC 2 THR D 112 ? VAL D 119 ? THR D 101 VAL D 108 
DC 3 ASP D 145 ? ASP D 151 ? ASP D 134 ASP D 140 
DC 4 SER D 174 ? TYR D 178 ? SER D 163 TYR D 167 
DC 5 ILE D 205 ? HIS D 209 ? ILE D 194 HIS D 198 
DC 6 LEU D 261 ? VAL D 266 ? LEU D 250 VAL D 255 
DC 7 VAL D 285 ? PRO D 289 ? VAL D 274 PRO D 278 
DD 1 PRO D 90  ? ASP D 91  ? PRO D 79  ASP D 80  
DD 2 MET D 94  ? THR D 95  ? MET D 83  THR D 84  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLY A 57  ? N GLY A 46  O ASP A 45  ? O ASP A 34  
AA 2 3 N MET A 48  ? N MET A 37  O LEU A 28  ? O LEU A 17  
AA 3 4 N LYS A 31  ? N LYS A 20  O ILE A 69  ? O ILE A 58  
AB 1 2 N GLY A 57  ? N GLY A 46  O ASP A 45  ? O ASP A 34  
AB 2 3 N MET A 48  ? N MET A 37  O LEU A 28  ? O LEU A 17  
AB 3 4 N VAL A 36  ? N VAL A 25  O VAL A 76  ? O VAL A 65  
AB 4 5 N ILE A 77  ? N ILE A 66  O VAL A 421 ? O VAL A 410 
AB 5 6 N LYS A 429 ? N LYS A 418 O CYS A 450 ? O CYS A 439 
AB 6 7 N SER A 459 ? N SER A 448 O LYS A 462 ? O LYS A 451 
AB 7 8 N GLU A 466 ? N GLU A 455 O THR A 469 ? O THR A 458 
AC 1 2 O GLY A 80  ? O GLY A 69  N THR A 113 ? N THR A 102 
AC 2 3 N ILE A 115 ? N ILE A 104 O ASP A 145 ? O ASP A 134 
AC 3 4 N VAL A 150 ? N VAL A 139 O SER A 174 ? O SER A 163 
AC 4 5 N PHE A 175 ? N PHE A 164 O ILE A 205 ? O ILE A 194 
AC 5 6 N VAL A 208 ? N VAL A 197 O TYR A 262 ? O TYR A 251 
AC 6 7 N ILE A 263 ? N ILE A 252 O TYR A 286 ? O TYR A 275 
AD 1 2 N ASP A 91  ? N ASP A 80  O MET A 94  ? O MET A 83  
BA 1 2 N GLY B 57  ? N GLY B 46  O ASP B 45  ? O ASP B 34  
BA 2 3 N MET B 48  ? N MET B 37  O LEU B 28  ? O LEU B 17  
BA 3 4 N LEU B 29  ? N LEU B 18  O LYS B 67  ? O LYS B 56  
BB 1 2 N PHE B 42  ? N PHE B 31  O ILE B 35  ? O ILE B 24  
BB 2 3 N VAL B 36  ? N VAL B 25  O VAL B 76  ? O VAL B 65  
BB 3 4 N ILE B 77  ? N ILE B 66  O VAL B 421 ? O VAL B 410 
BB 4 5 N LYS B 429 ? N LYS B 418 O CYS B 450 ? O CYS B 439 
BB 5 6 N SER B 459 ? N SER B 448 O LYS B 462 ? O LYS B 451 
BB 6 7 N GLU B 466 ? N GLU B 455 O THR B 469 ? O THR B 458 
BC 1 2 O GLY B 80  ? O GLY B 69  N THR B 113 ? N THR B 102 
BC 2 3 N ILE B 115 ? N ILE B 104 O ASP B 145 ? O ASP B 134 
BC 3 4 N VAL B 150 ? N VAL B 139 O SER B 174 ? O SER B 163 
BC 4 5 N PHE B 175 ? N PHE B 164 O ILE B 205 ? O ILE B 194 
BC 5 6 N VAL B 208 ? N VAL B 197 O TYR B 262 ? O TYR B 251 
BC 6 7 N ILE B 263 ? N ILE B 252 O TYR B 286 ? O TYR B 275 
BD 1 2 N ASP B 91  ? N ASP B 80  O MET B 94  ? O MET B 83  
CA 1 2 N GLY C 57  ? N GLY C 46  O ASP C 45  ? O ASP C 34  
CA 2 3 N MET C 48  ? N MET C 37  O LEU C 28  ? O LEU C 17  
CA 3 4 N LEU C 29  ? N LEU C 18  O LYS C 67  ? O LYS C 56  
CB 1 2 N PHE C 42  ? N PHE C 31  O ILE C 35  ? O ILE C 24  
CB 2 3 N VAL C 36  ? N VAL C 25  O VAL C 76  ? O VAL C 65  
CB 3 4 N ILE C 77  ? N ILE C 66  O VAL C 421 ? O VAL C 410 
CB 4 5 N ILE C 431 ? N ILE C 420 O MET C 448 ? O MET C 437 
CB 5 6 N SER C 459 ? N SER C 448 O LYS C 462 ? O LYS C 451 
CB 6 7 N GLU C 466 ? N GLU C 455 O THR C 469 ? O THR C 458 
CC 1 2 O GLY C 80  ? O GLY C 69  N THR C 113 ? N THR C 102 
CC 2 3 N ILE C 115 ? N ILE C 104 O ASP C 145 ? O ASP C 134 
CC 3 4 N VAL C 150 ? N VAL C 139 O SER C 174 ? O SER C 163 
CC 4 5 N PHE C 175 ? N PHE C 164 O ILE C 205 ? O ILE C 194 
CC 5 6 N VAL C 208 ? N VAL C 197 O TYR C 262 ? O TYR C 251 
CC 6 7 N ILE C 263 ? N ILE C 252 O TYR C 286 ? O TYR C 275 
CD 1 2 N ASP C 91  ? N ASP C 80  O MET C 94  ? O MET C 83  
DA 1 2 N GLY D 57  ? N GLY D 46  O ASP D 45  ? O ASP D 34  
DA 2 3 N MET D 48  ? N MET D 37  O LEU D 28  ? O LEU D 17  
DA 3 4 N LYS D 31  ? N LYS D 20  O ILE D 69  ? O ILE D 58  
DB 1 2 N PHE D 42  ? N PHE D 31  O ILE D 35  ? O ILE D 24  
DB 2 3 N VAL D 36  ? N VAL D 25  O VAL D 76  ? O VAL D 65  
DB 3 4 N ILE D 77  ? N ILE D 66  O VAL D 421 ? O VAL D 410 
DB 4 5 N ILE D 431 ? N ILE D 420 O MET D 448 ? O MET D 437 
DB 5 6 N SER D 459 ? N SER D 448 O LYS D 462 ? O LYS D 451 
DB 6 7 N GLU D 466 ? N GLU D 455 O THR D 469 ? O THR D 458 
DC 1 2 O GLY D 80  ? O GLY D 69  N THR D 113 ? N THR D 102 
DC 2 3 N ILE D 115 ? N ILE D 104 O ASP D 145 ? O ASP D 134 
DC 3 4 N VAL D 150 ? N VAL D 139 O SER D 174 ? O SER D 163 
DC 4 5 N PHE D 175 ? N PHE D 164 O ILE D 205 ? O ILE D 194 
DC 5 6 N VAL D 208 ? N VAL D 197 O TYR D 262 ? O TYR D 251 
DC 6 7 N ILE D 263 ? N ILE D 252 O TYR D 286 ? O TYR D 275 
DD 1 2 N ASP D 91  ? N ASP D 80  O MET D 94  ? O MET D 83  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG B 1491' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 1491' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG C 1491' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 GLU B 364 ? GLU B 353  . ? 1_555 ? 
2  AC1 5 HOH I .   ? HOH B 2058 . ? 1_555 ? 
3  AC1 5 HOH I .   ? HOH B 2059 . ? 1_555 ? 
4  AC1 5 HOH I .   ? HOH B 2292 . ? 1_555 ? 
5  AC1 5 HOH I .   ? HOH B 2293 . ? 1_555 ? 
6  AC2 6 GLN A 92  ? GLN A 81   . ? 1_555 ? 
7  AC2 6 GLU A 364 ? GLU A 353  . ? 1_555 ? 
8  AC2 6 HOH H .   ? HOH A 2061 . ? 1_555 ? 
9  AC2 6 HOH H .   ? HOH A 2062 . ? 1_555 ? 
10 AC2 6 HOH H .   ? HOH A 2317 . ? 1_555 ? 
11 AC2 6 HOH H .   ? HOH A 2322 . ? 1_555 ? 
12 AC3 5 GLN C 92  ? GLN C 81   . ? 1_555 ? 
13 AC3 5 THR C 360 ? THR C 349  . ? 1_555 ? 
14 AC3 5 HOH J .   ? HOH C 2076 . ? 1_555 ? 
15 AC3 5 HOH J .   ? HOH C 2374 . ? 1_555 ? 
16 AC3 5 HOH J .   ? HOH C 2375 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2VM8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2VM8 
_atom_sites.fract_transf_matrix[1][1]   0.011559 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007921 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004768 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . SER A 1 25  ? 44.634  15.078  6.413    1.00 57.03 ? 14   SER A N   1 
ATOM   2     C  CA  . SER A 1 25  ? 43.251  15.362  5.930    1.00 56.11 ? 14   SER A CA  1 
ATOM   3     C  C   . SER A 1 25  ? 42.459  16.112  7.010    1.00 55.98 ? 14   SER A C   1 
ATOM   4     O  O   . SER A 1 25  ? 42.661  17.318  7.198    1.00 56.04 ? 14   SER A O   1 
ATOM   5     C  CB  . SER A 1 25  ? 42.563  14.052  5.535    1.00 56.52 ? 14   SER A CB  1 
ATOM   6     O  OG  . SER A 1 25  ? 42.487  13.170  6.646    1.00 56.13 ? 14   SER A OG  1 
ATOM   7     N  N   . ASP A 1 26  ? 41.568  15.399  7.708    1.00 55.36 ? 15   ASP A N   1 
ATOM   8     C  CA  . ASP A 1 26  ? 40.805  15.951  8.830    1.00 54.63 ? 15   ASP A CA  1 
ATOM   9     C  C   . ASP A 1 26  ? 39.802  17.058  8.417    1.00 53.78 ? 15   ASP A C   1 
ATOM   10    O  O   . ASP A 1 26  ? 39.666  17.403  7.240    1.00 53.35 ? 15   ASP A O   1 
ATOM   11    C  CB  . ASP A 1 26  ? 41.777  16.448  9.919    1.00 55.30 ? 15   ASP A CB  1 
ATOM   12    C  CG  . ASP A 1 26  ? 41.128  16.566  11.283   1.00 55.74 ? 15   ASP A CG  1 
ATOM   13    O  OD1 . ASP A 1 26  ? 40.764  15.523  11.868   1.00 57.56 ? 15   ASP A OD1 1 
ATOM   14    O  OD2 . ASP A 1 26  ? 40.976  17.713  11.761   1.00 57.52 ? 15   ASP A OD2 1 
ATOM   15    N  N   . ARG A 1 27  ? 39.118  17.606  9.417    1.00 52.56 ? 16   ARG A N   1 
ATOM   16    C  CA  . ARG A 1 27  ? 37.959  18.492  9.241    1.00 51.57 ? 16   ARG A CA  1 
ATOM   17    C  C   . ARG A 1 27  ? 38.078  19.656  8.241    1.00 49.34 ? 16   ARG A C   1 
ATOM   18    O  O   . ARG A 1 27  ? 39.126  20.275  8.099    1.00 48.96 ? 16   ARG A O   1 
ATOM   19    C  CB  . ARG A 1 27  ? 37.514  19.009  10.620   1.00 52.26 ? 16   ARG A CB  1 
ATOM   20    C  CG  . ARG A 1 27  ? 36.564  18.042  11.307   1.00 53.42 ? 16   ARG A CG  1 
ATOM   21    C  CD  . ARG A 1 27  ? 36.420  18.260  12.794   1.00 54.25 ? 16   ARG A CD  1 
ATOM   22    N  NE  . ARG A 1 27  ? 37.532  17.633  13.501   1.00 56.68 ? 16   ARG A NE  1 
ATOM   23    C  CZ  . ARG A 1 27  ? 38.535  18.278  14.102   1.00 57.83 ? 16   ARG A CZ  1 
ATOM   24    N  NH1 . ARG A 1 27  ? 38.593  19.619  14.129   1.00 58.29 ? 16   ARG A NH1 1 
ATOM   25    N  NH2 . ARG A 1 27  ? 39.490  17.562  14.699   1.00 58.14 ? 16   ARG A NH2 1 
ATOM   26    N  N   . LEU A 1 28  ? 36.969  19.917  7.549    1.00 46.83 ? 17   LEU A N   1 
ATOM   27    C  CA  . LEU A 1 28  ? 36.839  21.035  6.610    1.00 45.45 ? 17   LEU A CA  1 
ATOM   28    C  C   . LEU A 1 28  ? 35.366  21.214  6.317    1.00 43.71 ? 17   LEU A C   1 
ATOM   29    O  O   . LEU A 1 28  ? 34.652  20.239  6.145    1.00 43.76 ? 17   LEU A O   1 
ATOM   30    C  CB  . LEU A 1 28  ? 37.595  20.758  5.308    1.00 44.83 ? 17   LEU A CB  1 
ATOM   31    C  CG  . LEU A 1 28  ? 37.491  21.810  4.203    1.00 45.37 ? 17   LEU A CG  1 
ATOM   32    C  CD1 . LEU A 1 28  ? 37.988  23.166  4.666    1.00 44.15 ? 17   LEU A CD1 1 
ATOM   33    C  CD2 . LEU A 1 28  ? 38.253  21.362  2.960    1.00 44.73 ? 17   LEU A CD2 1 
ATOM   34    N  N   . LEU A 1 29  ? 34.912  22.459  6.279    1.00 42.57 ? 18   LEU A N   1 
ATOM   35    C  CA  . LEU A 1 29  ? 33.507  22.770  6.005    1.00 41.48 ? 18   LEU A CA  1 
ATOM   36    C  C   . LEU A 1 29  ? 33.400  23.745  4.847    1.00 40.53 ? 18   LEU A C   1 
ATOM   37    O  O   . LEU A 1 29  ? 33.910  24.868  4.945    1.00 41.99 ? 18   LEU A O   1 
ATOM   38    C  CB  . LEU A 1 29  ? 32.844  23.403  7.232    1.00 41.24 ? 18   LEU A CB  1 
ATOM   39    C  CG  . LEU A 1 29  ? 31.336  23.614  7.061    1.00 41.80 ? 18   LEU A CG  1 
ATOM   40    C  CD1 . LEU A 1 29  ? 30.584  22.428  7.644    1.00 41.07 ? 18   LEU A CD1 1 
ATOM   41    C  CD2 . LEU A 1 29  ? 30.857  24.925  7.681    1.00 40.90 ? 18   LEU A CD2 1 
ATOM   42    N  N   . ILE A 1 30  ? 32.757  23.344  3.750    1.00 38.01 ? 19   ILE A N   1 
ATOM   43    C  CA  . ILE A 1 30  ? 32.411  24.321  2.737    1.00 36.76 ? 19   ILE A CA  1 
ATOM   44    C  C   . ILE A 1 30  ? 31.041  24.885  3.087    1.00 36.12 ? 19   ILE A C   1 
ATOM   45    O  O   . ILE A 1 30  ? 30.061  24.150  3.230    1.00 35.43 ? 19   ILE A O   1 
ATOM   46    C  CB  . ILE A 1 30  ? 32.436  23.769  1.310    1.00 36.47 ? 19   ILE A CB  1 
ATOM   47    C  CG1 . ILE A 1 30  ? 33.857  23.348  0.942    1.00 35.04 ? 19   ILE A CG1 1 
ATOM   48    C  CG2 . ILE A 1 30  ? 31.945  24.839  0.338    1.00 36.82 ? 19   ILE A CG2 1 
ATOM   49    C  CD1 . ILE A 1 30  ? 34.051  23.000  -0.510   1.00 34.54 ? 19   ILE A CD1 1 
ATOM   50    N  N   . LYS A 1 31  ? 30.990  26.207  3.224    1.00 35.94 ? 20   LYS A N   1 
ATOM   51    C  CA  . LYS A 1 31  ? 29.843  26.878  3.803    1.00 35.37 ? 20   LYS A CA  1 
ATOM   52    C  C   . LYS A 1 31  ? 29.125  27.733  2.767    1.00 33.69 ? 20   LYS A C   1 
ATOM   53    O  O   . LYS A 1 31  ? 29.740  28.574  2.100    1.00 33.23 ? 20   LYS A O   1 
ATOM   54    C  CB  . LYS A 1 31  ? 30.288  27.717  5.012    1.00 35.73 ? 20   LYS A CB  1 
ATOM   55    C  CG  . LYS A 1 31  ? 29.142  28.133  5.924    1.00 37.35 ? 20   LYS A CG  1 
ATOM   56    C  CD  . LYS A 1 31  ? 29.642  28.690  7.266    1.00 37.74 ? 20   LYS A CD  1 
ATOM   57    C  CE  . LYS A 1 31  ? 28.533  29.370  8.067    1.00 39.06 ? 20   LYS A CE  1 
ATOM   58    N  NZ  . LYS A 1 31  ? 27.887  30.477  7.298    1.00 41.01 ? 20   LYS A NZ  1 
ATOM   59    N  N   . GLY A 1 32  ? 27.824  27.477  2.628    1.00 32.85 ? 21   GLY A N   1 
ATOM   60    C  CA  . GLY A 1 32  ? 26.925  28.273  1.792    1.00 32.01 ? 21   GLY A CA  1 
ATOM   61    C  C   . GLY A 1 32  ? 27.223  28.345  0.297    1.00 31.97 ? 21   GLY A C   1 
ATOM   62    O  O   . GLY A 1 32  ? 27.067  29.414  -0.333   1.00 33.67 ? 21   GLY A O   1 
ATOM   63    N  N   . GLY A 1 33  ? 27.627  27.223  -0.286   1.00 29.34 ? 22   GLY A N   1 
ATOM   64    C  CA  . GLY A 1 33  ? 27.786  27.146  -1.739   1.00 28.01 ? 22   GLY A CA  1 
ATOM   65    C  C   . GLY A 1 33  ? 26.561  26.554  -2.413   1.00 26.06 ? 22   GLY A C   1 
ATOM   66    O  O   . GLY A 1 33  ? 25.601  26.163  -1.767   1.00 24.21 ? 22   GLY A O   1 
ATOM   67    N  N   . LYS A 1 34  ? 26.607  26.488  -3.732   1.00 25.76 ? 23   LYS A N   1 
ATOM   68    C  CA  . LYS A 1 34  ? 25.590  25.793  -4.492   1.00 25.29 ? 23   LYS A CA  1 
ATOM   69    C  C   . LYS A 1 34  ? 26.153  24.453  -4.988   1.00 24.94 ? 23   LYS A C   1 
ATOM   70    O  O   . LYS A 1 34  ? 26.810  24.395  -6.028   1.00 25.56 ? 23   LYS A O   1 
ATOM   71    C  CB  . LYS A 1 34  ? 25.151  26.663  -5.664   1.00 25.73 ? 23   LYS A CB  1 
ATOM   72    C  CG  . LYS A 1 34  ? 23.979  26.112  -6.447   1.00 25.44 ? 23   LYS A CG  1 
ATOM   73    C  CD  . LYS A 1 34  ? 23.774  26.895  -7.713   1.00 24.84 ? 23   LYS A CD  1 
ATOM   74    C  CE  . LYS A 1 34  ? 24.852  26.574  -8.729   1.00 24.49 ? 23   LYS A CE  1 
ATOM   75    N  NZ  . LYS A 1 34  ? 24.646  27.285  -9.996   1.00 26.59 ? 23   LYS A NZ  1 
ATOM   76    N  N   . ILE A 1 35  ? 25.883  23.378  -4.262   1.00 23.81 ? 24   ILE A N   1 
ATOM   77    C  CA  . ILE A 1 35  ? 26.280  22.047  -4.711   1.00 23.32 ? 24   ILE A CA  1 
ATOM   78    C  C   . ILE A 1 35  ? 25.697  21.816  -6.111   1.00 23.29 ? 24   ILE A C   1 
ATOM   79    O  O   . ILE A 1 35  ? 24.489  21.862  -6.273   1.00 23.45 ? 24   ILE A O   1 
ATOM   80    C  CB  . ILE A 1 35  ? 25.777  20.953  -3.762   1.00 23.01 ? 24   ILE A CB  1 
ATOM   81    C  CG1 . ILE A 1 35  ? 26.401  21.137  -2.373   1.00 23.66 ? 24   ILE A CG1 1 
ATOM   82    C  CG2 . ILE A 1 35  ? 26.110  19.575  -4.328   1.00 24.10 ? 24   ILE A CG2 1 
ATOM   83    C  CD1 . ILE A 1 35  ? 25.904  20.151  -1.333   1.00 22.74 ? 24   ILE A CD1 1 
ATOM   84    N  N   . VAL A 1 36  ? 26.564  21.604  -7.106   1.00 22.29 ? 25   VAL A N   1 
ATOM   85    C  CA  . VAL A 1 36  ? 26.158  21.260  -8.473   1.00 21.32 ? 25   VAL A CA  1 
ATOM   86    C  C   . VAL A 1 36  ? 26.575  19.832  -8.880   1.00 20.76 ? 25   VAL A C   1 
ATOM   87    O  O   . VAL A 1 36  ? 27.749  19.562  -9.128   1.00 22.10 ? 25   VAL A O   1 
ATOM   88    C  CB  . VAL A 1 36  ? 26.778  22.210  -9.458   1.00 21.57 ? 25   VAL A CB  1 
ATOM   89    C  CG1 . VAL A 1 36  ? 26.336  21.885  -10.871  1.00 19.90 ? 25   VAL A CG1 1 
ATOM   90    C  CG2 . VAL A 1 36  ? 26.403  23.625  -9.094   1.00 23.08 ? 25   VAL A CG2 1 
ATOM   91    N  N   . ASN A 1 37  ? 25.603  18.922  -8.919   1.00 19.73 ? 26   ASN A N   1 
ATOM   92    C  CA  . ASN A 1 37  ? 25.805  17.543  -9.383   1.00 18.70 ? 26   ASN A CA  1 
ATOM   93    C  C   . ASN A 1 37  ? 25.212  17.462  -10.756  1.00 17.81 ? 26   ASN A C   1 
ATOM   94    O  O   . ASN A 1 37  ? 24.749  18.470  -11.257  1.00 18.76 ? 26   ASN A O   1 
ATOM   95    C  CB  . ASN A 1 37  ? 25.150  16.534  -8.461   1.00 16.93 ? 26   ASN A CB  1 
ATOM   96    C  CG  . ASN A 1 37  ? 25.953  16.327  -7.199   1.00 20.76 ? 26   ASN A CG  1 
ATOM   97    O  OD1 . ASN A 1 37  ? 27.191  16.410  -7.230   1.00 21.47 ? 26   ASN A OD1 1 
ATOM   98    N  ND2 . ASN A 1 37  ? 25.276  16.061  -6.090   1.00 18.97 ? 26   ASN A ND2 1 
ATOM   99    N  N   . ASP A 1 38  ? 25.235  16.277  -11.343  1.00 18.16 ? 27   ASP A N   1 
ATOM   100   C  CA  . ASP A 1 38  ? 24.824  16.093  -12.732  1.00 19.10 ? 27   ASP A CA  1 
ATOM   101   C  C   . ASP A 1 38  ? 23.315  15.994  -12.858  1.00 19.02 ? 27   ASP A C   1 
ATOM   102   O  O   . ASP A 1 38  ? 22.769  16.201  -13.937  1.00 20.35 ? 27   ASP A O   1 
ATOM   103   C  CB  . ASP A 1 38  ? 25.568  14.881  -13.364  1.00 19.69 ? 27   ASP A CB  1 
ATOM   104   C  CG  . ASP A 1 38  ? 24.851  13.554  -13.182  1.00 21.83 ? 27   ASP A CG  1 
ATOM   105   O  OD1 . ASP A 1 38  ? 24.637  13.128  -12.027  1.00 21.68 ? 27   ASP A OD1 1 
ATOM   106   O  OD2 . ASP A 1 38  ? 24.492  12.935  -14.220  1.00 21.91 ? 27   ASP A OD2 1 
ATOM   107   N  N   . ASP A 1 39  ? 22.648  15.698  -11.742  1.00 19.35 ? 28   ASP A N   1 
ATOM   108   C  CA  . ASP A 1 39  ? 21.218  15.497  -11.706  1.00 19.41 ? 28   ASP A CA  1 
ATOM   109   C  C   . ASP A 1 39  ? 20.434  16.697  -11.158  1.00 20.63 ? 28   ASP A C   1 
ATOM   110   O  O   . ASP A 1 39  ? 19.229  16.805  -11.384  1.00 22.00 ? 28   ASP A O   1 
ATOM   111   C  CB  . ASP A 1 39  ? 20.926  14.264  -10.879  1.00 19.46 ? 28   ASP A CB  1 
ATOM   112   C  CG  . ASP A 1 39  ? 21.028  14.537  -9.411   1.00 21.14 ? 28   ASP A CG  1 
ATOM   113   O  OD1 . ASP A 1 39  ? 21.934  15.325  -9.055   1.00 17.51 ? 28   ASP A OD1 1 
ATOM   114   O  OD2 . ASP A 1 39  ? 20.188  14.001  -8.647   1.00 24.74 ? 28   ASP A OD2 1 
ATOM   115   N  N   . GLN A 1 40  ? 21.086  17.577  -10.401  1.00 21.23 ? 29   GLN A N   1 
ATOM   116   C  CA  . GLN A 1 40  ? 20.481  18.855  -10.009  1.00 21.44 ? 29   GLN A CA  1 
ATOM   117   C  C   . GLN A 1 40  ? 21.486  19.812  -9.358   1.00 20.01 ? 29   GLN A C   1 
ATOM   118   O  O   . GLN A 1 40  ? 22.660  19.501  -9.254   1.00 15.83 ? 29   GLN A O   1 
ATOM   119   C  CB  . GLN A 1 40  ? 19.297  18.634  -9.077   1.00 22.55 ? 29   GLN A CB  1 
ATOM   120   C  CG  . GLN A 1 40  ? 19.627  17.828  -7.826   1.00 25.76 ? 29   GLN A CG  1 
ATOM   121   C  CD  . GLN A 1 40  ? 18.524  17.900  -6.795   1.00 24.60 ? 29   GLN A CD  1 
ATOM   122   O  OE1 . GLN A 1 40  ? 18.199  16.912  -6.164   1.00 31.36 ? 29   GLN A OE1 1 
ATOM   123   N  NE2 . GLN A 1 40  ? 17.943  19.073  -6.628   1.00 31.94 ? 29   GLN A NE2 1 
ATOM   124   N  N   . SER A 1 41  ? 21.031  21.008  -8.998   1.00 21.77 ? 30   SER A N   1 
ATOM   125   C  CA  . SER A 1 41  ? 21.822  21.895  -8.137   1.00 24.21 ? 30   SER A CA  1 
ATOM   126   C  C   . SER A 1 41  ? 21.012  22.275  -6.906   1.00 25.24 ? 30   SER A C   1 
ATOM   127   O  O   . SER A 1 41  ? 19.788  22.251  -6.940   1.00 25.44 ? 30   SER A O   1 
ATOM   128   C  CB  . SER A 1 41  ? 22.265  23.123  -8.898   1.00 23.86 ? 30   SER A CB  1 
ATOM   129   O  OG  . SER A 1 41  ? 23.027  22.744  -10.024  1.00 26.60 ? 30   SER A OG  1 
ATOM   130   N  N   . PHE A 1 42  ? 21.693  22.581  -5.801   1.00 26.94 ? 31   PHE A N   1 
ATOM   131   C  CA  . PHE A 1 42  ? 21.009  22.957  -4.554   1.00 27.70 ? 31   PHE A CA  1 
ATOM   132   C  C   . PHE A 1 42  ? 21.958  23.557  -3.539   1.00 28.38 ? 31   PHE A C   1 
ATOM   133   O  O   . PHE A 1 42  ? 23.158  23.275  -3.574   1.00 28.71 ? 31   PHE A O   1 
ATOM   134   C  CB  . PHE A 1 42  ? 20.294  21.761  -3.931   1.00 28.69 ? 31   PHE A CB  1 
ATOM   135   C  CG  . PHE A 1 42  ? 21.198  20.627  -3.563   1.00 29.18 ? 31   PHE A CG  1 
ATOM   136   C  CD1 . PHE A 1 42  ? 21.675  19.771  -4.534   1.00 29.86 ? 31   PHE A CD1 1 
ATOM   137   C  CD2 . PHE A 1 42  ? 21.543  20.394  -2.227   1.00 31.07 ? 31   PHE A CD2 1 
ATOM   138   C  CE1 . PHE A 1 42  ? 22.490  18.708  -4.190   1.00 30.75 ? 31   PHE A CE1 1 
ATOM   139   C  CE2 . PHE A 1 42  ? 22.353  19.339  -1.875   1.00 29.14 ? 31   PHE A CE2 1 
ATOM   140   C  CZ  . PHE A 1 42  ? 22.836  18.490  -2.856   1.00 30.23 ? 31   PHE A CZ  1 
ATOM   141   N  N   . TYR A 1 43  ? 21.402  24.375  -2.640   1.00 29.47 ? 32   TYR A N   1 
ATOM   142   C  CA  . TYR A 1 43  ? 22.190  25.122  -1.655   1.00 29.93 ? 32   TYR A CA  1 
ATOM   143   C  C   . TYR A 1 43  ? 22.379  24.342  -0.364   1.00 31.14 ? 32   TYR A C   1 
ATOM   144   O  O   . TYR A 1 43  ? 21.419  24.074  0.378    1.00 32.07 ? 32   TYR A O   1 
ATOM   145   C  CB  . TYR A 1 43  ? 21.546  26.468  -1.359   1.00 29.91 ? 32   TYR A CB  1 
ATOM   146   C  CG  . TYR A 1 43  ? 21.630  27.413  -2.528   1.00 30.26 ? 32   TYR A CG  1 
ATOM   147   C  CD1 . TYR A 1 43  ? 22.822  28.060  -2.827   1.00 30.51 ? 32   TYR A CD1 1 
ATOM   148   C  CD2 . TYR A 1 43  ? 20.529  27.647  -3.349   1.00 31.48 ? 32   TYR A CD2 1 
ATOM   149   C  CE1 . TYR A 1 43  ? 22.919  28.926  -3.892   1.00 30.64 ? 32   TYR A CE1 1 
ATOM   150   C  CE2 . TYR A 1 43  ? 20.623  28.519  -4.440   1.00 30.28 ? 32   TYR A CE2 1 
ATOM   151   C  CZ  . TYR A 1 43  ? 21.821  29.149  -4.702   1.00 29.01 ? 32   TYR A CZ  1 
ATOM   152   O  OH  . TYR A 1 43  ? 21.949  30.014  -5.764   1.00 30.06 ? 32   TYR A OH  1 
ATOM   153   N  N   . ALA A 1 44  ? 23.624  23.964  -0.095   1.00 31.03 ? 33   ALA A N   1 
ATOM   154   C  CA  . ALA A 1 44  ? 23.920  23.227  1.107    1.00 30.69 ? 33   ALA A CA  1 
ATOM   155   C  C   . ALA A 1 44  ? 25.368  23.462  1.517    1.00 31.16 ? 33   ALA A C   1 
ATOM   156   O  O   . ALA A 1 44  ? 26.195  23.869  0.699    1.00 30.62 ? 33   ALA A O   1 
ATOM   157   C  CB  . ALA A 1 44  ? 23.631  21.753  0.912    1.00 30.41 ? 33   ALA A CB  1 
ATOM   158   N  N   . ASP A 1 45  ? 25.619  23.271  2.815    1.00 31.20 ? 34   ASP A N   1 
ATOM   159   C  CA  . ASP A 1 45  ? 26.956  23.206  3.366    1.00 30.84 ? 34   ASP A CA  1 
ATOM   160   C  C   . ASP A 1 45  ? 27.441  21.784  3.197    1.00 30.34 ? 34   ASP A C   1 
ATOM   161   O  O   . ASP A 1 45  ? 26.652  20.845  3.289    1.00 29.72 ? 34   ASP A O   1 
ATOM   162   C  CB  . ASP A 1 45  ? 26.960  23.599  4.853    1.00 30.64 ? 34   ASP A CB  1 
ATOM   163   C  CG  . ASP A 1 45  ? 26.583  25.062  5.081    1.00 30.66 ? 34   ASP A CG  1 
ATOM   164   O  OD1 . ASP A 1 45  ? 26.368  25.801  4.092    1.00 28.74 ? 34   ASP A OD1 1 
ATOM   165   O  OD2 . ASP A 1 45  ? 26.512  25.477  6.255    1.00 27.40 ? 34   ASP A OD2 1 
ATOM   166   N  N   . ILE A 1 46  ? 28.733  21.630  2.926    1.00 31.16 ? 35   ILE A N   1 
ATOM   167   C  CA  . ILE A 1 46  ? 29.365  20.303  2.872    1.00 31.08 ? 35   ILE A CA  1 
ATOM   168   C  C   . ILE A 1 46  ? 30.441  20.216  3.930    1.00 31.44 ? 35   ILE A C   1 
ATOM   169   O  O   . ILE A 1 46  ? 31.192  21.161  4.141    1.00 31.42 ? 35   ILE A O   1 
ATOM   170   C  CB  . ILE A 1 46  ? 30.061  20.033  1.546    1.00 30.91 ? 35   ILE A CB  1 
ATOM   171   C  CG1 . ILE A 1 46  ? 29.147  20.334  0.374    1.00 30.40 ? 35   ILE A CG1 1 
ATOM   172   C  CG2 . ILE A 1 46  ? 30.559  18.596  1.506    1.00 31.27 ? 35   ILE A CG2 1 
ATOM   173   C  CD1 . ILE A 1 46  ? 29.902  20.454  -0.893   1.00 30.41 ? 35   ILE A CD1 1 
ATOM   174   N  N   . TYR A 1 47  ? 30.520  19.066  4.565    1.00 32.38 ? 36   TYR A N   1 
ATOM   175   C  CA  . TYR A 1 47  ? 31.462  18.853  5.611    1.00 34.68 ? 36   TYR A CA  1 
ATOM   176   C  C   . TYR A 1 47  ? 32.252  17.573  5.310    1.00 34.96 ? 36   TYR A C   1 
ATOM   177   O  O   . TYR A 1 47  ? 31.660  16.508  5.101    1.00 35.29 ? 36   TYR A O   1 
ATOM   178   C  CB  . TYR A 1 47  ? 30.715  18.760  6.931    1.00 36.88 ? 36   TYR A CB  1 
ATOM   179   C  CG  . TYR A 1 47  ? 31.576  18.288  8.051    1.00 39.15 ? 36   TYR A CG  1 
ATOM   180   C  CD1 . TYR A 1 47  ? 32.656  19.053  8.484    1.00 40.52 ? 36   TYR A CD1 1 
ATOM   181   C  CD2 . TYR A 1 47  ? 31.343  17.065  8.661    1.00 40.12 ? 36   TYR A CD2 1 
ATOM   182   C  CE1 . TYR A 1 47  ? 33.463  18.624  9.502    1.00 40.35 ? 36   TYR A CE1 1 
ATOM   183   C  CE2 . TYR A 1 47  ? 32.143  16.625  9.679    1.00 40.49 ? 36   TYR A CE2 1 
ATOM   184   C  CZ  . TYR A 1 47  ? 33.198  17.412  10.101   1.00 41.11 ? 36   TYR A CZ  1 
ATOM   185   O  OH  . TYR A 1 47  ? 33.988  16.965  11.123   1.00 42.81 ? 36   TYR A OH  1 
ATOM   186   N  N   . MET A 1 48  ? 33.580  17.697  5.292    1.00 34.67 ? 37   MET A N   1 
ATOM   187   C  CA  . MET A 1 48  ? 34.485  16.615  4.931    1.00 34.85 ? 37   MET A CA  1 
ATOM   188   C  C   . MET A 1 48  ? 35.351  16.239  6.105    1.00 35.56 ? 37   MET A C   1 
ATOM   189   O  O   . MET A 1 48  ? 35.778  17.116  6.875    1.00 35.74 ? 37   MET A O   1 
ATOM   190   C  CB  . MET A 1 48  ? 35.407  17.069  3.813    1.00 34.60 ? 37   MET A CB  1 
ATOM   191   C  CG  . MET A 1 48  ? 34.766  17.131  2.469    1.00 34.02 ? 37   MET A CG  1 
ATOM   192   S  SD  . MET A 1 48  ? 35.522  18.415  1.467    1.00 36.36 ? 37   MET A SD  1 
ATOM   193   C  CE  . MET A 1 48  ? 34.515  19.815  1.915    1.00 29.71 ? 37   MET A CE  1 
ATOM   194   N  N   . GLU A 1 49  ? 35.628  14.938  6.217    1.00 35.93 ? 38   GLU A N   1 
ATOM   195   C  CA  . GLU A 1 49  ? 36.491  14.378  7.257    1.00 36.40 ? 38   GLU A CA  1 
ATOM   196   C  C   . GLU A 1 49  ? 37.092  13.075  6.758    1.00 35.90 ? 38   GLU A C   1 
ATOM   197   O  O   . GLU A 1 49  ? 36.422  12.306  6.057    1.00 35.90 ? 38   GLU A O   1 
ATOM   198   C  CB  . GLU A 1 49  ? 35.700  14.090  8.549    1.00 36.75 ? 38   GLU A CB  1 
ATOM   199   C  CG  . GLU A 1 49  ? 35.965  15.043  9.717    1.00 39.14 ? 38   GLU A CG  1 
ATOM   200   C  CD  . GLU A 1 49  ? 36.073  14.321  11.078   1.00 38.87 ? 38   GLU A CD  1 
ATOM   201   O  OE1 . GLU A 1 49  ? 35.108  14.382  11.879   1.00 40.85 ? 38   GLU A OE1 1 
ATOM   202   O  OE2 . GLU A 1 49  ? 37.126  13.681  11.330   1.00 42.66 ? 38   GLU A OE2 1 
ATOM   203   N  N   . ASP A 1 50  ? 38.348  12.821  7.123    1.00 35.54 ? 39   ASP A N   1 
ATOM   204   C  CA  . ASP A 1 50  ? 39.000  11.537  6.828    1.00 35.19 ? 39   ASP A CA  1 
ATOM   205   C  C   . ASP A 1 50  ? 38.975  11.170  5.335    1.00 33.95 ? 39   ASP A C   1 
ATOM   206   O  O   . ASP A 1 50  ? 38.818  10.000  4.980    1.00 34.53 ? 39   ASP A O   1 
ATOM   207   C  CB  . ASP A 1 50  ? 38.351  10.421  7.671    1.00 36.60 ? 39   ASP A CB  1 
ATOM   208   C  CG  . ASP A 1 50  ? 38.381  10.732  9.185    1.00 38.84 ? 39   ASP A CG  1 
ATOM   209   O  OD1 . ASP A 1 50  ? 39.325  11.432  9.620    1.00 42.11 ? 39   ASP A OD1 1 
ATOM   210   O  OD2 . ASP A 1 50  ? 37.469  10.292  9.934    1.00 40.56 ? 39   ASP A OD2 1 
ATOM   211   N  N   . GLY A 1 51  ? 39.120  12.178  4.473    1.00 32.50 ? 40   GLY A N   1 
ATOM   212   C  CA  . GLY A 1 51  ? 39.115  11.994  3.000    1.00 31.28 ? 40   GLY A CA  1 
ATOM   213   C  C   . GLY A 1 51  ? 37.753  11.844  2.337    1.00 29.87 ? 40   GLY A C   1 
ATOM   214   O  O   . GLY A 1 51  ? 37.661  11.687  1.111    1.00 26.77 ? 40   GLY A O   1 
ATOM   215   N  N   . LEU A 1 52  ? 36.697  11.904  3.145    1.00 29.12 ? 41   LEU A N   1 
ATOM   216   C  CA  . LEU A 1 52  ? 35.318  11.626  2.708    1.00 29.79 ? 41   LEU A CA  1 
ATOM   217   C  C   . LEU A 1 52  ? 34.394  12.814  2.983    1.00 29.68 ? 41   LEU A C   1 
ATOM   218   O  O   . LEU A 1 52  ? 34.620  13.593  3.923    1.00 30.50 ? 41   LEU A O   1 
ATOM   219   C  CB  . LEU A 1 52  ? 34.777  10.372  3.415    1.00 29.16 ? 41   LEU A CB  1 
ATOM   220   C  CG  . LEU A 1 52  ? 35.645  9.125   3.235    1.00 27.69 ? 41   LEU A CG  1 
ATOM   221   C  CD1 . LEU A 1 52  ? 35.236  8.030   4.184    1.00 28.79 ? 41   LEU A CD1 1 
ATOM   222   C  CD2 . LEU A 1 52  ? 35.584  8.636   1.782    1.00 28.69 ? 41   LEU A CD2 1 
ATOM   223   N  N   . ILE A 1 53  ? 33.358  12.955  2.168    1.00 28.80 ? 42   ILE A N   1 
ATOM   224   C  CA  . ILE A 1 53  ? 32.309  13.924  2.459    1.00 29.18 ? 42   ILE A CA  1 
ATOM   225   C  C   . ILE A 1 53  ? 31.377  13.299  3.483    1.00 30.28 ? 42   ILE A C   1 
ATOM   226   O  O   . ILE A 1 53  ? 30.807  12.236  3.241    1.00 30.57 ? 42   ILE A O   1 
ATOM   227   C  CB  . ILE A 1 53  ? 31.485  14.289  1.232    1.00 28.31 ? 42   ILE A CB  1 
ATOM   228   C  CG1 . ILE A 1 53  ? 32.381  14.829  0.108    1.00 28.59 ? 42   ILE A CG1 1 
ATOM   229   C  CG2 . ILE A 1 53  ? 30.439  15.306  1.628    1.00 28.60 ? 42   ILE A CG2 1 
ATOM   230   C  CD1 . ILE A 1 53  ? 31.629  15.134  -1.203   1.00 23.56 ? 42   ILE A CD1 1 
ATOM   231   N  N   . LYS A 1 54  ? 31.224  13.956  4.630    1.00 32.44 ? 43   LYS A N   1 
ATOM   232   C  CA  . LYS A 1 54  ? 30.585  13.338  5.791    1.00 32.66 ? 43   LYS A CA  1 
ATOM   233   C  C   . LYS A 1 54  ? 29.171  13.814  5.987    1.00 33.60 ? 43   LYS A C   1 
ATOM   234   O  O   . LYS A 1 54  ? 28.273  13.012  6.252    1.00 33.96 ? 43   LYS A O   1 
ATOM   235   C  CB  . LYS A 1 54  ? 31.390  13.626  7.063    1.00 33.94 ? 43   LYS A CB  1 
ATOM   236   C  CG  . LYS A 1 54  ? 32.725  12.882  7.155    1.00 35.03 ? 43   LYS A CG  1 
ATOM   237   C  CD  . LYS A 1 54  ? 32.604  11.406  6.769    1.00 35.90 ? 43   LYS A CD  1 
ATOM   238   C  CE  . LYS A 1 54  ? 33.748  10.591  7.323    1.00 36.16 ? 43   LYS A CE  1 
ATOM   239   N  NZ  . LYS A 1 54  ? 33.552  10.267  8.755    1.00 38.07 ? 43   LYS A NZ  1 
ATOM   240   N  N   . GLN A 1 55  ? 28.972  15.118  5.887    1.00 33.24 ? 44   GLN A N   1 
ATOM   241   C  CA  . GLN A 1 55  ? 27.639  15.652  6.003    1.00 34.98 ? 44   GLN A CA  1 
ATOM   242   C  C   . GLN A 1 55  ? 27.339  16.635  4.910    1.00 34.80 ? 44   GLN A C   1 
ATOM   243   O  O   . GLN A 1 55  ? 28.214  17.341  4.423    1.00 33.88 ? 44   GLN A O   1 
ATOM   244   C  CB  . GLN A 1 55  ? 27.416  16.308  7.369    1.00 35.16 ? 44   GLN A CB  1 
ATOM   245   C  CG  . GLN A 1 55  ? 27.139  15.293  8.464    1.00 36.37 ? 44   GLN A CG  1 
ATOM   246   C  CD  . GLN A 1 55  ? 27.080  15.900  9.837    1.00 36.56 ? 44   GLN A CD  1 
ATOM   247   O  OE1 . GLN A 1 55  ? 26.916  17.117  10.009   1.00 36.99 ? 44   GLN A OE1 1 
ATOM   248   N  NE2 . GLN A 1 55  ? 27.210  15.045  10.840   1.00 41.29 ? 44   GLN A NE2 1 
ATOM   249   N  N   . ILE A 1 56  ? 26.075  16.680  4.543    1.00 35.92 ? 45   ILE A N   1 
ATOM   250   C  CA  . ILE A 1 56  ? 25.628  17.625  3.555    1.00 37.70 ? 45   ILE A CA  1 
ATOM   251   C  C   . ILE A 1 56  ? 24.319  18.197  4.054    1.00 38.46 ? 45   ILE A C   1 
ATOM   252   O  O   . ILE A 1 56  ? 23.392  17.447  4.347    1.00 38.15 ? 45   ILE A O   1 
ATOM   253   C  CB  . ILE A 1 56  ? 25.475  16.961  2.150    1.00 37.48 ? 45   ILE A CB  1 
ATOM   254   C  CG1 . ILE A 1 56  ? 26.826  16.404  1.673    1.00 36.42 ? 45   ILE A CG1 1 
ATOM   255   C  CG2 . ILE A 1 56  ? 24.915  17.973  1.139    1.00 36.27 ? 45   ILE A CG2 1 
ATOM   256   C  CD1 . ILE A 1 56  ? 26.845  15.953  0.257    1.00 36.42 ? 45   ILE A CD1 1 
ATOM   257   N  N   . GLY A 1 57  ? 24.257  19.517  4.180    1.00 40.49 ? 46   GLY A N   1 
ATOM   258   C  CA  . GLY A 1 57  ? 23.001  20.183  4.489    1.00 42.70 ? 46   GLY A CA  1 
ATOM   259   C  C   . GLY A 1 57  ? 23.144  21.660  4.769    1.00 44.43 ? 46   GLY A C   1 
ATOM   260   O  O   . GLY A 1 57  ? 24.136  22.278  4.392    1.00 43.87 ? 46   GLY A O   1 
ATOM   261   N  N   . GLU A 1 58  ? 22.128  22.223  5.420    1.00 47.21 ? 47   GLU A N   1 
ATOM   262   C  CA  . GLU A 1 58  ? 22.207  23.584  5.953    1.00 49.00 ? 47   GLU A CA  1 
ATOM   263   C  C   . GLU A 1 58  ? 22.416  23.515  7.459    1.00 50.32 ? 47   GLU A C   1 
ATOM   264   O  O   . GLU A 1 58  ? 22.111  22.496  8.091    1.00 49.95 ? 47   GLU A O   1 
ATOM   265   C  CB  . GLU A 1 58  ? 20.952  24.398  5.611    1.00 49.89 ? 47   GLU A CB  1 
ATOM   266   C  CG  . GLU A 1 58  ? 21.109  25.319  4.388    1.00 52.03 ? 47   GLU A CG  1 
ATOM   267   C  CD  . GLU A 1 58  ? 22.083  26.491  4.612    1.00 54.59 ? 47   GLU A CD  1 
ATOM   268   O  OE1 . GLU A 1 58  ? 22.561  26.674  5.756    1.00 56.18 ? 47   GLU A OE1 1 
ATOM   269   O  OE2 . GLU A 1 58  ? 22.371  27.235  3.637    1.00 56.09 ? 47   GLU A OE2 1 
ATOM   270   N  N   . ASN A 1 59  ? 22.956  24.600  8.010    1.00 51.87 ? 48   ASN A N   1 
ATOM   271   C  CA  . ASN A 1 59  ? 23.306  24.698  9.433    1.00 53.27 ? 48   ASN A CA  1 
ATOM   272   C  C   . ASN A 1 59  ? 23.891  23.409  10.019   1.00 54.02 ? 48   ASN A C   1 
ATOM   273   O  O   . ASN A 1 59  ? 23.405  22.895  11.034   1.00 54.29 ? 48   ASN A O   1 
ATOM   274   C  CB  . ASN A 1 59  ? 22.103  25.187  10.255   1.00 54.42 ? 48   ASN A CB  1 
ATOM   275   C  CG  . ASN A 1 59  ? 21.856  26.679  10.093   1.00 56.33 ? 48   ASN A CG  1 
ATOM   276   O  OD1 . ASN A 1 59  ? 21.900  27.432  11.070   1.00 58.60 ? 48   ASN A OD1 1 
ATOM   277   N  ND2 . ASN A 1 59  ? 21.618  27.119  8.850    1.00 57.97 ? 48   ASN A ND2 1 
ATOM   278   N  N   . LEU A 1 60  ? 24.951  22.916  9.378    1.00 54.35 ? 49   LEU A N   1 
ATOM   279   C  CA  . LEU A 1 60  ? 25.560  21.633  9.731    1.00 54.74 ? 49   LEU A CA  1 
ATOM   280   C  C   . LEU A 1 60  ? 26.241  21.678  11.088   1.00 55.22 ? 49   LEU A C   1 
ATOM   281   O  O   . LEU A 1 60  ? 26.970  22.619  11.391   1.00 55.32 ? 49   LEU A O   1 
ATOM   282   C  CB  . LEU A 1 60  ? 26.562  21.198  8.657    1.00 54.60 ? 49   LEU A CB  1 
ATOM   283   C  CG  . LEU A 1 60  ? 25.963  20.549  7.403    1.00 54.30 ? 49   LEU A CG  1 
ATOM   284   C  CD1 . LEU A 1 60  ? 26.963  20.536  6.272    1.00 53.44 ? 49   LEU A CD1 1 
ATOM   285   C  CD2 . LEU A 1 60  ? 25.475  19.134  7.705    1.00 53.92 ? 49   LEU A CD2 1 
ATOM   286   N  N   . ILE A 1 61  ? 25.996  20.653  11.900   1.00 56.30 ? 50   ILE A N   1 
ATOM   287   C  CA  . ILE A 1 61  ? 26.544  20.592  13.256   1.00 56.74 ? 50   ILE A CA  1 
ATOM   288   C  C   . ILE A 1 61  ? 28.007  20.129  13.225   1.00 57.01 ? 50   ILE A C   1 
ATOM   289   O  O   . ILE A 1 61  ? 28.319  19.004  12.823   1.00 57.34 ? 50   ILE A O   1 
ATOM   290   C  CB  . ILE A 1 61  ? 25.676  19.700  14.197   1.00 57.38 ? 50   ILE A CB  1 
ATOM   291   C  CG1 . ILE A 1 61  ? 26.023  19.976  15.670   1.00 58.37 ? 50   ILE A CG1 1 
ATOM   292   C  CG2 . ILE A 1 61  ? 25.809  18.208  13.850   1.00 57.53 ? 50   ILE A CG2 1 
ATOM   293   C  CD1 . ILE A 1 61  ? 27.458  19.571  16.085   1.00 58.81 ? 50   ILE A CD1 1 
ATOM   294   N  N   . VAL A 1 62  ? 28.892  21.010  13.683   1.00 57.09 ? 51   VAL A N   1 
ATOM   295   C  CA  . VAL A 1 62  ? 30.335  20.862  13.497   1.00 56.63 ? 51   VAL A CA  1 
ATOM   296   C  C   . VAL A 1 62  ? 31.057  21.606  14.639   1.00 56.53 ? 51   VAL A C   1 
ATOM   297   O  O   . VAL A 1 62  ? 30.436  22.436  15.315   1.00 56.93 ? 51   VAL A O   1 
ATOM   298   C  CB  . VAL A 1 62  ? 30.730  21.396  12.075   1.00 56.72 ? 51   VAL A CB  1 
ATOM   299   C  CG1 . VAL A 1 62  ? 32.132  22.002  12.036   1.00 55.87 ? 51   VAL A CG1 1 
ATOM   300   C  CG2 . VAL A 1 62  ? 30.573  20.284  11.022   1.00 56.43 ? 51   VAL A CG2 1 
ATOM   301   N  N   . PRO A 1 63  ? 32.342  21.269  14.906   1.00 55.82 ? 52   PRO A N   1 
ATOM   302   C  CA  . PRO A 1 63  ? 33.200  22.072  15.815   1.00 55.09 ? 52   PRO A CA  1 
ATOM   303   C  C   . PRO A 1 63  ? 33.400  23.563  15.454   1.00 54.15 ? 52   PRO A C   1 
ATOM   304   O  O   . PRO A 1 63  ? 32.839  24.061  14.483   1.00 53.93 ? 52   PRO A O   1 
ATOM   305   C  CB  . PRO A 1 63  ? 34.551  21.339  15.762   1.00 55.25 ? 52   PRO A CB  1 
ATOM   306   C  CG  . PRO A 1 63  ? 34.220  19.940  15.329   1.00 55.78 ? 52   PRO A CG  1 
ATOM   307   C  CD  . PRO A 1 63  ? 33.030  20.049  14.431   1.00 55.79 ? 52   PRO A CD  1 
ATOM   308   N  N   . GLY A 1 64  ? 34.202  24.249  16.268   1.00 53.51 ? 53   GLY A N   1 
ATOM   309   C  CA  . GLY A 1 64  ? 34.570  25.662  16.063   1.00 52.75 ? 53   GLY A CA  1 
ATOM   310   C  C   . GLY A 1 64  ? 36.019  25.885  15.645   1.00 51.70 ? 53   GLY A C   1 
ATOM   311   O  O   . GLY A 1 64  ? 36.404  27.000  15.296   1.00 50.98 ? 53   GLY A O   1 
ATOM   312   N  N   . GLY A 1 65  ? 36.823  24.826  15.683   1.00 51.13 ? 54   GLY A N   1 
ATOM   313   C  CA  . GLY A 1 65  ? 38.182  24.869  15.145   1.00 50.81 ? 54   GLY A CA  1 
ATOM   314   C  C   . GLY A 1 65  ? 38.270  24.571  13.656   1.00 50.11 ? 54   GLY A C   1 
ATOM   315   O  O   . GLY A 1 65  ? 39.301  24.834  13.023   1.00 49.78 ? 54   GLY A O   1 
ATOM   316   N  N   . VAL A 1 66  ? 37.194  24.024  13.092   1.00 49.66 ? 55   VAL A N   1 
ATOM   317   C  CA  . VAL A 1 66  ? 37.200  23.544  11.704   1.00 49.28 ? 55   VAL A CA  1 
ATOM   318   C  C   . VAL A 1 66  ? 37.438  24.690  10.710   1.00 48.67 ? 55   VAL A C   1 
ATOM   319   O  O   . VAL A 1 66  ? 36.790  25.739  10.788   1.00 48.79 ? 55   VAL A O   1 
ATOM   320   C  CB  . VAL A 1 66  ? 35.875  22.813  11.355   1.00 49.18 ? 55   VAL A CB  1 
ATOM   321   C  CG1 . VAL A 1 66  ? 35.882  22.345  9.910    1.00 50.27 ? 55   VAL A CG1 1 
ATOM   322   C  CG2 . VAL A 1 66  ? 35.644  21.627  12.288   1.00 49.23 ? 55   VAL A CG2 1 
ATOM   323   N  N   . LYS A 1 67  ? 38.374  24.492  9.785    1.00 48.09 ? 56   LYS A N   1 
ATOM   324   C  CA  . LYS A 1 67  ? 38.669  25.510  8.771    1.00 47.84 ? 56   LYS A CA  1 
ATOM   325   C  C   . LYS A 1 67  ? 37.526  25.609  7.778    1.00 46.97 ? 56   LYS A C   1 
ATOM   326   O  O   . LYS A 1 67  ? 37.265  24.671  7.044    1.00 47.13 ? 56   LYS A O   1 
ATOM   327   C  CB  . LYS A 1 67  ? 39.958  25.196  8.007    1.00 48.15 ? 56   LYS A CB  1 
ATOM   328   C  CG  . LYS A 1 67  ? 40.351  26.316  7.059    1.00 48.28 ? 56   LYS A CG  1 
ATOM   329   C  CD  . LYS A 1 67  ? 41.545  25.976  6.221    1.00 48.64 ? 56   LYS A CD  1 
ATOM   330   C  CE  . LYS A 1 67  ? 42.106  27.221  5.528    1.00 49.81 ? 56   LYS A CE  1 
ATOM   331   N  NZ  . LYS A 1 67  ? 41.051  28.107  4.949    1.00 50.22 ? 56   LYS A NZ  1 
ATOM   332   N  N   . THR A 1 68  ? 36.881  26.767  7.727    1.00 46.13 ? 57   THR A N   1 
ATOM   333   C  CA  . THR A 1 68  ? 35.642  26.918  6.990    1.00 45.94 ? 57   THR A CA  1 
ATOM   334   C  C   . THR A 1 68  ? 35.776  27.834  5.792    1.00 45.43 ? 57   THR A C   1 
ATOM   335   O  O   . THR A 1 68  ? 36.195  28.981  5.926    1.00 45.50 ? 57   THR A O   1 
ATOM   336   C  CB  . THR A 1 68  ? 34.565  27.441  7.919    1.00 45.70 ? 57   THR A CB  1 
ATOM   337   O  OG1 . THR A 1 68  ? 34.580  26.644  9.109    1.00 44.82 ? 57   THR A OG1 1 
ATOM   338   C  CG2 . THR A 1 68  ? 33.201  27.345  7.256    1.00 46.83 ? 57   THR A CG2 1 
ATOM   339   N  N   . ILE A 1 69  ? 35.398  27.313  4.625    1.00 45.18 ? 58   ILE A N   1 
ATOM   340   C  CA  . ILE A 1 69  ? 35.486  28.029  3.355    1.00 45.48 ? 58   ILE A CA  1 
ATOM   341   C  C   . ILE A 1 69  ? 34.161  28.687  2.982    1.00 45.95 ? 58   ILE A C   1 
ATOM   342   O  O   . ILE A 1 69  ? 33.222  27.995  2.604    1.00 47.17 ? 58   ILE A O   1 
ATOM   343   C  CB  . ILE A 1 69  ? 35.872  27.052  2.226    1.00 45.38 ? 58   ILE A CB  1 
ATOM   344   C  CG1 . ILE A 1 69  ? 37.314  26.567  2.440    1.00 45.47 ? 58   ILE A CG1 1 
ATOM   345   C  CG2 . ILE A 1 69  ? 35.673  27.691  0.850    1.00 44.95 ? 58   ILE A CG2 1 
ATOM   346   C  CD1 . ILE A 1 69  ? 37.892  25.806  1.297    1.00 45.71 ? 58   ILE A CD1 1 
ATOM   347   N  N   . GLU A 1 70  ? 34.085  30.014  3.068    1.00 45.89 ? 59   GLU A N   1 
ATOM   348   C  CA  . GLU A 1 70  ? 32.853  30.740  2.735    1.00 46.04 ? 59   GLU A CA  1 
ATOM   349   C  C   . GLU A 1 70  ? 32.658  30.753  1.219    1.00 46.76 ? 59   GLU A C   1 
ATOM   350   O  O   . GLU A 1 70  ? 33.290  31.558  0.528    1.00 48.01 ? 59   GLU A O   1 
ATOM   351   C  CB  . GLU A 1 70  ? 32.914  32.176  3.268    1.00 45.99 ? 59   GLU A CB  1 
ATOM   352   C  CG  . GLU A 1 70  ? 33.066  32.277  4.795    1.00 46.75 ? 59   GLU A CG  1 
ATOM   353   C  CD  . GLU A 1 70  ? 31.864  31.740  5.564    1.00 47.14 ? 59   GLU A CD  1 
ATOM   354   O  OE1 . GLU A 1 70  ? 30.744  31.696  4.999    1.00 47.82 ? 59   GLU A OE1 1 
ATOM   355   O  OE2 . GLU A 1 70  ? 32.035  31.375  6.750    1.00 48.21 ? 59   GLU A OE2 1 
ATOM   356   N  N   . ALA A 1 71  ? 31.789  29.868  0.708    1.00 46.41 ? 60   ALA A N   1 
ATOM   357   C  CA  . ALA A 1 71  ? 31.643  29.643  -0.749   1.00 45.39 ? 60   ALA A CA  1 
ATOM   358   C  C   . ALA A 1 71  ? 30.846  30.735  -1.463   1.00 44.99 ? 60   ALA A C   1 
ATOM   359   O  O   . ALA A 1 71  ? 30.987  30.917  -2.672   1.00 45.45 ? 60   ALA A O   1 
ATOM   360   C  CB  . ALA A 1 71  ? 31.011  28.279  -1.015   1.00 45.71 ? 60   ALA A CB  1 
ATOM   361   N  N   . HIS A 1 72  ? 30.009  31.446  -0.711   1.00 43.85 ? 61   HIS A N   1 
ATOM   362   C  CA  . HIS A 1 72  ? 29.264  32.621  -1.214   1.00 42.93 ? 61   HIS A CA  1 
ATOM   363   C  C   . HIS A 1 72  ? 28.323  32.344  -2.390   1.00 41.20 ? 61   HIS A C   1 
ATOM   364   O  O   . HIS A 1 72  ? 28.297  33.076  -3.384   1.00 40.21 ? 61   HIS A O   1 
ATOM   365   C  CB  . HIS A 1 72  ? 30.218  33.795  -1.483   1.00 43.70 ? 61   HIS A CB  1 
ATOM   366   C  CG  . HIS A 1 72  ? 30.777  34.385  -0.224   1.00 45.71 ? 61   HIS A CG  1 
ATOM   367   N  ND1 . HIS A 1 72  ? 32.124  34.380  0.071    1.00 47.58 ? 61   HIS A ND1 1 
ATOM   368   C  CD2 . HIS A 1 72  ? 30.159  34.944  0.846    1.00 45.95 ? 61   HIS A CD2 1 
ATOM   369   C  CE1 . HIS A 1 72  ? 32.312  34.929  1.259    1.00 47.39 ? 61   HIS A CE1 1 
ATOM   370   N  NE2 . HIS A 1 72  ? 31.136  35.279  1.750    1.00 45.75 ? 61   HIS A NE2 1 
ATOM   371   N  N   . SER A 1 73  ? 27.524  31.289  -2.225   1.00 39.51 ? 62   SER A N   1 
ATOM   372   C  CA  . SER A 1 73  ? 26.545  30.848  -3.221   1.00 38.25 ? 62   SER A CA  1 
ATOM   373   C  C   . SER A 1 73  ? 27.150  30.463  -4.573   1.00 36.51 ? 62   SER A C   1 
ATOM   374   O  O   . SER A 1 73  ? 26.431  30.382  -5.555   1.00 35.46 ? 62   SER A O   1 
ATOM   375   C  CB  . SER A 1 73  ? 25.438  31.894  -3.409   1.00 38.62 ? 62   SER A CB  1 
ATOM   376   O  OG  . SER A 1 73  ? 24.682  32.048  -2.214   1.00 41.05 ? 62   SER A OG  1 
ATOM   377   N  N   . ARG A 1 74  ? 28.456  30.188  -4.607   1.00 35.20 ? 63   ARG A N   1 
ATOM   378   C  CA  . ARG A 1 74  ? 29.136  29.817  -5.848   1.00 33.69 ? 63   ARG A CA  1 
ATOM   379   C  C   . ARG A 1 74  ? 29.111  28.309  -6.060   1.00 30.25 ? 63   ARG A C   1 
ATOM   380   O  O   . ARG A 1 74  ? 28.984  27.543  -5.124   1.00 27.94 ? 63   ARG A O   1 
ATOM   381   C  CB  . ARG A 1 74  ? 30.581  30.322  -5.847   1.00 35.20 ? 63   ARG A CB  1 
ATOM   382   C  CG  . ARG A 1 74  ? 30.738  31.775  -6.259   1.00 36.77 ? 63   ARG A CG  1 
ATOM   383   C  CD  . ARG A 1 74  ? 32.030  32.372  -5.708   1.00 37.98 ? 63   ARG A CD  1 
ATOM   384   N  NE  . ARG A 1 74  ? 32.490  33.529  -6.489   1.00 41.11 ? 63   ARG A NE  1 
ATOM   385   C  CZ  . ARG A 1 74  ? 33.357  34.445  -6.055   1.00 42.03 ? 63   ARG A CZ  1 
ATOM   386   N  NH1 . ARG A 1 74  ? 33.874  34.376  -4.822   1.00 41.98 ? 63   ARG A NH1 1 
ATOM   387   N  NH2 . ARG A 1 74  ? 33.709  35.448  -6.854   1.00 41.00 ? 63   ARG A NH2 1 
ATOM   388   N  N   . MET A 1 75  ? 29.261  27.910  -7.318   1.00 27.94 ? 64   MET A N   1 
ATOM   389   C  CA  . MET A 1 75  ? 29.159  26.517  -7.734   1.00 26.78 ? 64   MET A CA  1 
ATOM   390   C  C   . MET A 1 75  ? 30.120  25.680  -6.945   1.00 26.34 ? 64   MET A C   1 
ATOM   391   O  O   . MET A 1 75  ? 31.296  26.020  -6.825   1.00 27.67 ? 64   MET A O   1 
ATOM   392   C  CB  . MET A 1 75  ? 29.498  26.362  -9.231   1.00 25.90 ? 64   MET A CB  1 
ATOM   393   C  CG  . MET A 1 75  ? 28.823  27.356  -10.142  1.00 24.54 ? 64   MET A CG  1 
ATOM   394   S  SD  . MET A 1 75  ? 29.162  27.183  -11.923  1.00 23.32 ? 64   MET A SD  1 
ATOM   395   C  CE  . MET A 1 75  ? 29.030  25.404  -12.108  1.00 22.03 ? 64   MET A CE  1 
ATOM   396   N  N   . VAL A 1 76  ? 29.622  24.594  -6.376   1.00 25.54 ? 65   VAL A N   1 
ATOM   397   C  CA  . VAL A 1 76  ? 30.488  23.542  -5.859   1.00 24.33 ? 65   VAL A CA  1 
ATOM   398   C  C   . VAL A 1 76  ? 30.250  22.257  -6.650   1.00 23.60 ? 65   VAL A C   1 
ATOM   399   O  O   . VAL A 1 76  ? 29.190  21.621  -6.536   1.00 22.61 ? 65   VAL A O   1 
ATOM   400   C  CB  . VAL A 1 76  ? 30.260  23.288  -4.369   1.00 24.76 ? 65   VAL A CB  1 
ATOM   401   C  CG1 . VAL A 1 76  ? 31.288  22.273  -3.848   1.00 26.99 ? 65   VAL A CG1 1 
ATOM   402   C  CG2 . VAL A 1 76  ? 30.356  24.603  -3.599   1.00 23.79 ? 65   VAL A CG2 1 
ATOM   403   N  N   . ILE A 1 77  ? 31.264  21.879  -7.427   1.00 22.77 ? 66   ILE A N   1 
ATOM   404   C  CA  . ILE A 1 77  ? 31.197  20.714  -8.303   1.00 22.45 ? 66   ILE A CA  1 
ATOM   405   C  C   . ILE A 1 77  ? 32.150  19.577  -7.850   1.00 21.66 ? 66   ILE A C   1 
ATOM   406   O  O   . ILE A 1 77  ? 33.172  19.835  -7.193   1.00 21.73 ? 66   ILE A O   1 
ATOM   407   C  CB  . ILE A 1 77  ? 31.487  21.125  -9.790   1.00 22.47 ? 66   ILE A CB  1 
ATOM   408   C  CG1 . ILE A 1 77  ? 32.933  21.588  -9.979   1.00 24.51 ? 66   ILE A CG1 1 
ATOM   409   C  CG2 . ILE A 1 77  ? 30.576  22.230  -10.233  1.00 20.51 ? 66   ILE A CG2 1 
ATOM   410   C  CD1 . ILE A 1 77  ? 33.389  21.555  -11.416  1.00 21.32 ? 66   ILE A CD1 1 
ATOM   411   N  N   . PRO A 1 78  ? 31.831  18.318  -8.223   1.00 20.26 ? 67   PRO A N   1 
ATOM   412   C  CA  . PRO A 1 78  ? 32.836  17.270  -8.081   1.00 19.21 ? 67   PRO A CA  1 
ATOM   413   C  C   . PRO A 1 78  ? 34.085  17.531  -8.939   1.00 18.97 ? 67   PRO A C   1 
ATOM   414   O  O   . PRO A 1 78  ? 33.982  18.144  -10.011  1.00 19.76 ? 67   PRO A O   1 
ATOM   415   C  CB  . PRO A 1 78  ? 32.088  15.995  -8.518   1.00 18.04 ? 67   PRO A CB  1 
ATOM   416   C  CG  . PRO A 1 78  ? 30.644  16.358  -8.524   1.00 18.29 ? 67   PRO A CG  1 
ATOM   417   C  CD  . PRO A 1 78  ? 30.567  17.801  -8.769   1.00 18.94 ? 67   PRO A CD  1 
ATOM   418   N  N   . GLY A 1 79  ? 35.248  17.073  -8.483   1.00 17.63 ? 68   GLY A N   1 
ATOM   419   C  CA  . GLY A 1 79  ? 36.480  17.345  -9.181   1.00 18.51 ? 68   GLY A CA  1 
ATOM   420   C  C   . GLY A 1 79  ? 36.407  16.667  -10.534  1.00 19.16 ? 68   GLY A C   1 
ATOM   421   O  O   . GLY A 1 79  ? 35.739  15.651  -10.682  1.00 19.47 ? 68   GLY A O   1 
ATOM   422   N  N   . GLY A 1 80  ? 37.073  17.227  -11.534  1.00 19.90 ? 69   GLY A N   1 
ATOM   423   C  CA  . GLY A 1 80  ? 37.075  16.626  -12.850  1.00 19.40 ? 69   GLY A CA  1 
ATOM   424   C  C   . GLY A 1 80  ? 37.774  15.294  -12.855  1.00 19.64 ? 69   GLY A C   1 
ATOM   425   O  O   . GLY A 1 80  ? 38.641  15.064  -12.038  1.00 18.84 ? 69   GLY A O   1 
ATOM   426   N  N   . ILE A 1 81  ? 37.387  14.418  -13.793  1.00 20.89 ? 70   ILE A N   1 
ATOM   427   C  CA  . ILE A 1 81  ? 38.127  13.198  -14.073  1.00 20.27 ? 70   ILE A CA  1 
ATOM   428   C  C   . ILE A 1 81  ? 38.659  13.217  -15.504  1.00 21.17 ? 70   ILE A C   1 
ATOM   429   O  O   . ILE A 1 81  ? 37.874  13.241  -16.484  1.00 20.73 ? 70   ILE A O   1 
ATOM   430   C  CB  . ILE A 1 81  ? 37.289  11.951  -13.868  1.00 21.19 ? 70   ILE A CB  1 
ATOM   431   C  CG1 . ILE A 1 81  ? 36.726  11.914  -12.454  1.00 20.41 ? 70   ILE A CG1 1 
ATOM   432   C  CG2 . ILE A 1 81  ? 38.130  10.711  -14.117  1.00 21.67 ? 70   ILE A CG2 1 
ATOM   433   C  CD1 . ILE A 1 81  ? 35.727  10.780  -12.227  1.00 20.46 ? 70   ILE A CD1 1 
ATOM   434   N  N   . ASP A 1 82  ? 39.997  13.255  -15.619  1.00 19.84 ? 71   ASP A N   1 
ATOM   435   C  CA  . ASP A 1 82  ? 40.677  13.091  -16.920  1.00 18.75 ? 71   ASP A CA  1 
ATOM   436   C  C   . ASP A 1 82  ? 40.837  11.581  -17.211  1.00 18.39 ? 71   ASP A C   1 
ATOM   437   O  O   . ASP A 1 82  ? 41.724  10.870  -16.715  1.00 17.49 ? 71   ASP A O   1 
ATOM   438   C  CB  . ASP A 1 82  ? 41.992  13.872  -16.973  1.00 17.38 ? 71   ASP A CB  1 
ATOM   439   C  CG  . ASP A 1 82  ? 42.490  14.104  -18.393  1.00 19.15 ? 71   ASP A CG  1 
ATOM   440   O  OD1 . ASP A 1 82  ? 42.065  13.348  -19.288  1.00 10.06 ? 71   ASP A OD1 1 
ATOM   441   O  OD2 . ASP A 1 82  ? 43.292  15.056  -18.599  1.00 16.71 ? 71   ASP A OD2 1 
ATOM   442   N  N   . VAL A 1 83  ? 39.914  11.093  -18.028  1.00 19.18 ? 72   VAL A N   1 
ATOM   443   C  CA  . VAL A 1 83  ? 39.902  9.716   -18.443  1.00 18.33 ? 72   VAL A CA  1 
ATOM   444   C  C   . VAL A 1 83  ? 41.091  9.368   -19.327  1.00 19.87 ? 72   VAL A C   1 
ATOM   445   O  O   . VAL A 1 83  ? 41.265  8.188   -19.639  1.00 23.26 ? 72   VAL A O   1 
ATOM   446   C  CB  . VAL A 1 83  ? 38.618  9.382   -19.234  1.00 18.30 ? 72   VAL A CB  1 
ATOM   447   C  CG1 . VAL A 1 83  ? 37.401  9.563   -18.373  1.00 18.42 ? 72   VAL A CG1 1 
ATOM   448   C  CG2 . VAL A 1 83  ? 38.541  10.227  -20.468  1.00 16.70 ? 72   VAL A CG2 1 
ATOM   449   N  N   . HIS A 1 84  ? 41.873  10.354  -19.767  1.00 18.37 ? 73   HIS A N   1 
ATOM   450   C  CA  . HIS A 1 84  ? 42.979  10.085  -20.673  1.00 17.85 ? 73   HIS A CA  1 
ATOM   451   C  C   . HIS A 1 84  ? 44.225  10.958  -20.460  1.00 18.86 ? 73   HIS A C   1 
ATOM   452   O  O   . HIS A 1 84  ? 44.370  12.048  -21.032  1.00 20.96 ? 73   HIS A O   1 
ATOM   453   C  CB  . HIS A 1 84  ? 42.524  10.187  -22.139  1.00 17.38 ? 73   HIS A CB  1 
ATOM   454   C  CG  . HIS A 1 84  ? 43.479  9.557   -23.104  1.00 17.42 ? 73   HIS A CG  1 
ATOM   455   N  ND1 . HIS A 1 84  ? 43.113  9.174   -24.375  1.00 17.27 ? 73   HIS A ND1 1 
ATOM   456   C  CD2 . HIS A 1 84  ? 44.794  9.252   -22.985  1.00 18.04 ? 73   HIS A CD2 1 
ATOM   457   C  CE1 . HIS A 1 84  ? 44.157  8.643   -24.985  1.00 16.30 ? 73   HIS A CE1 1 
ATOM   458   N  NE2 . HIS A 1 84  ? 45.194  8.707   -24.172  1.00 15.42 ? 73   HIS A NE2 1 
ATOM   459   N  N   . THR A 1 85  ? 45.176  10.429  -19.704  1.00 18.72 ? 74   THR A N   1 
ATOM   460   C  CA  . THR A 1 85  ? 46.473  11.053  -19.590  1.00 18.48 ? 74   THR A CA  1 
ATOM   461   C  C   . THR A 1 85  ? 47.563  10.055  -19.919  1.00 18.72 ? 74   THR A C   1 
ATOM   462   O  O   . THR A 1 85  ? 47.421  8.862   -19.680  1.00 17.25 ? 74   THR A O   1 
ATOM   463   C  CB  . THR A 1 85  ? 46.686  11.580  -18.148  1.00 17.87 ? 74   THR A CB  1 
ATOM   464   O  OG1 . THR A 1 85  ? 46.571  10.488  -17.249  1.00 18.08 ? 74   THR A OG1 1 
ATOM   465   C  CG2 . THR A 1 85  ? 45.647  12.618  -17.803  1.00 16.96 ? 74   THR A CG2 1 
ATOM   466   N  N   . ARG A 1 86  ? 48.664  10.567  -20.467  1.00 19.57 ? 75   ARG A N   1 
ATOM   467   C  CA  . ARG A 1 86  ? 49.864  9.775   -20.722  1.00 19.44 ? 75   ARG A CA  1 
ATOM   468   C  C   . ARG A 1 86  ? 51.111  10.443  -20.141  1.00 19.42 ? 75   ARG A C   1 
ATOM   469   O  O   . ARG A 1 86  ? 52.064  10.746  -20.850  1.00 18.23 ? 75   ARG A O   1 
ATOM   470   C  CB  . ARG A 1 86  ? 49.994  9.525   -22.221  1.00 18.51 ? 75   ARG A CB  1 
ATOM   471   C  CG  . ARG A 1 86  ? 48.787  8.763   -22.749  1.00 20.78 ? 75   ARG A CG  1 
ATOM   472   C  CD  . ARG A 1 86  ? 49.028  8.239   -24.133  1.00 19.47 ? 75   ARG A CD  1 
ATOM   473   N  NE  . ARG A 1 86  ? 47.926  7.436   -24.669  1.00 21.10 ? 75   ARG A NE  1 
ATOM   474   C  CZ  . ARG A 1 86  ? 47.839  6.101   -24.686  1.00 20.26 ? 75   ARG A CZ  1 
ATOM   475   N  NH1 . ARG A 1 86  ? 48.769  5.323   -24.139  1.00 21.30 ? 75   ARG A NH1 1 
ATOM   476   N  NH2 . ARG A 1 86  ? 46.781  5.536   -25.256  1.00 15.75 ? 75   ARG A NH2 1 
ATOM   477   N  N   . PHE A 1 87  ? 51.115  10.610  -18.819  1.00 20.11 ? 76   PHE A N   1 
ATOM   478   C  CA  . PHE A 1 87  ? 52.219  11.277  -18.146  1.00 20.91 ? 76   PHE A CA  1 
ATOM   479   C  C   . PHE A 1 87  ? 53.468  10.409  -18.164  1.00 21.62 ? 76   PHE A C   1 
ATOM   480   O  O   . PHE A 1 87  ? 53.404  9.185   -17.996  1.00 22.57 ? 76   PHE A O   1 
ATOM   481   C  CB  . PHE A 1 87  ? 51.882  11.662  -16.687  1.00 21.48 ? 76   PHE A CB  1 
ATOM   482   C  CG  . PHE A 1 87  ? 50.700  12.561  -16.540  1.00 21.43 ? 76   PHE A CG  1 
ATOM   483   C  CD1 . PHE A 1 87  ? 50.485  13.627  -17.403  1.00 23.08 ? 76   PHE A CD1 1 
ATOM   484   C  CD2 . PHE A 1 87  ? 49.810  12.369  -15.481  1.00 23.03 ? 76   PHE A CD2 1 
ATOM   485   C  CE1 . PHE A 1 87  ? 49.360  14.461  -17.250  1.00 24.20 ? 76   PHE A CE1 1 
ATOM   486   C  CE2 . PHE A 1 87  ? 48.704  13.200  -15.322  1.00 21.90 ? 76   PHE A CE2 1 
ATOM   487   C  CZ  . PHE A 1 87  ? 48.477  14.249  -16.193  1.00 20.34 ? 76   PHE A CZ  1 
ATOM   488   N  N   . GLN A 1 88  ? 54.604  11.083  -18.352  1.00 22.42 ? 77   GLN A N   1 
ATOM   489   C  CA  . GLN A 1 88  ? 55.917  10.471  -18.570  1.00 21.81 ? 77   GLN A CA  1 
ATOM   490   C  C   . GLN A 1 88  ? 55.880  9.220   -19.419  1.00 22.71 ? 77   GLN A C   1 
ATOM   491   O  O   . GLN A 1 88  ? 56.416  8.163   -19.038  1.00 22.52 ? 77   GLN A O   1 
ATOM   492   C  CB  . GLN A 1 88  ? 56.650  10.229  -17.253  1.00 22.42 ? 77   GLN A CB  1 
ATOM   493   C  CG  . GLN A 1 88  ? 55.915  9.431   -16.206  1.00 20.41 ? 77   GLN A CG  1 
ATOM   494   C  CD  . GLN A 1 88  ? 56.667  9.417   -14.868  1.00 20.95 ? 77   GLN A CD  1 
ATOM   495   O  OE1 . GLN A 1 88  ? 56.315  10.147  -13.959  1.00 15.94 ? 77   GLN A OE1 1 
ATOM   496   N  NE2 . GLN A 1 88  ? 57.696  8.580   -14.761  1.00 22.32 ? 77   GLN A NE2 1 
ATOM   497   N  N   . MET A 1 89  ? 55.247  9.354   -20.581  1.00 21.61 ? 78   MET A N   1 
ATOM   498   C  CA  . MET A 1 89  ? 55.151  8.251   -21.514  1.00 22.24 ? 78   MET A CA  1 
ATOM   499   C  C   . MET A 1 89  ? 56.491  8.070   -22.233  1.00 23.14 ? 78   MET A C   1 
ATOM   500   O  O   . MET A 1 89  ? 57.067  9.045   -22.732  1.00 20.94 ? 78   MET A O   1 
ATOM   501   C  CB  . MET A 1 89  ? 54.008  8.470   -22.535  1.00 21.66 ? 78   MET A CB  1 
ATOM   502   C  CG  . MET A 1 89  ? 53.465  7.174   -23.106  1.00 20.78 ? 78   MET A CG  1 
ATOM   503   S  SD  . MET A 1 89  ? 52.704  7.246   -24.735  1.00 20.27 ? 78   MET A SD  1 
ATOM   504   C  CE  . MET A 1 89  ? 53.663  8.515   -25.594  1.00 18.91 ? 78   MET A CE  1 
ATOM   505   N  N   . PRO A 1 90  ? 57.000  6.824   -22.259  1.00 24.33 ? 79   PRO A N   1 
ATOM   506   C  CA  . PRO A 1 90  ? 58.117  6.447   -23.083  1.00 25.13 ? 79   PRO A CA  1 
ATOM   507   C  C   . PRO A 1 90  ? 57.783  6.488   -24.566  1.00 25.66 ? 79   PRO A C   1 
ATOM   508   O  O   . PRO A 1 90  ? 56.759  5.982   -24.973  1.00 26.43 ? 79   PRO A O   1 
ATOM   509   C  CB  . PRO A 1 90  ? 58.400  5.005   -22.640  1.00 25.10 ? 79   PRO A CB  1 
ATOM   510   C  CG  . PRO A 1 90  ? 57.814  4.902   -21.285  1.00 25.34 ? 79   PRO A CG  1 
ATOM   511   C  CD  . PRO A 1 90  ? 56.581  5.712   -21.396  1.00 25.01 ? 79   PRO A CD  1 
ATOM   512   N  N   . ASP A 1 91  ? 58.651  7.061   -25.374  1.00 27.64 ? 80   ASP A N   1 
ATOM   513   C  CA  . ASP A 1 91  ? 58.418  7.089   -26.812  1.00 28.77 ? 80   ASP A CA  1 
ATOM   514   C  C   . ASP A 1 91  ? 59.735  7.229   -27.544  1.00 30.31 ? 80   ASP A C   1 
ATOM   515   O  O   . ASP A 1 91  ? 60.583  7.979   -27.100  1.00 32.94 ? 80   ASP A O   1 
ATOM   516   C  CB  . ASP A 1 91  ? 57.518  8.268   -27.130  1.00 28.86 ? 80   ASP A CB  1 
ATOM   517   C  CG  . ASP A 1 91  ? 57.217  8.387   -28.592  1.00 29.75 ? 80   ASP A CG  1 
ATOM   518   O  OD1 . ASP A 1 91  ? 56.831  7.358   -29.198  1.00 33.41 ? 80   ASP A OD1 1 
ATOM   519   O  OD2 . ASP A 1 91  ? 57.375  9.512   -29.123  1.00 32.05 ? 80   ASP A OD2 1 
ATOM   520   N  N   . GLN A 1 92  ? 59.925  6.501   -28.638  1.00 31.26 ? 81   GLN A N   1 
ATOM   521   C  CA  . GLN A 1 92  ? 61.159  6.594   -29.442  1.00 32.07 ? 81   GLN A CA  1 
ATOM   522   C  C   . GLN A 1 92  ? 62.438  6.949   -28.652  1.00 31.80 ? 81   GLN A C   1 
ATOM   523   O  O   . GLN A 1 92  ? 63.180  7.860   -29.030  1.00 33.60 ? 81   GLN A O   1 
ATOM   524   C  CB  . GLN A 1 92  ? 60.979  7.636   -30.535  1.00 32.83 ? 81   GLN A CB  1 
ATOM   525   C  CG  . GLN A 1 92  ? 60.035  7.230   -31.656  1.00 34.68 ? 81   GLN A CG  1 
ATOM   526   C  CD  . GLN A 1 92  ? 60.093  8.231   -32.833  1.00 35.51 ? 81   GLN A CD  1 
ATOM   527   O  OE1 . GLN A 1 92  ? 60.542  9.378   -32.664  1.00 36.64 ? 81   GLN A OE1 1 
ATOM   528   N  NE2 . GLN A 1 92  ? 59.650  7.795   -34.016  1.00 35.01 ? 81   GLN A NE2 1 
ATOM   529   N  N   . GLY A 1 93  ? 62.682  6.240   -27.561  1.00 30.86 ? 82   GLY A N   1 
ATOM   530   C  CA  . GLY A 1 93  ? 63.849  6.490   -26.739  1.00 29.92 ? 82   GLY A CA  1 
ATOM   531   C  C   . GLY A 1 93  ? 63.784  7.805   -26.000  1.00 29.16 ? 82   GLY A C   1 
ATOM   532   O  O   . GLY A 1 93  ? 64.802  8.293   -25.528  1.00 28.91 ? 82   GLY A O   1 
ATOM   533   N  N   . MET A 1 94  ? 62.582  8.352   -25.861  1.00 28.46 ? 83   MET A N   1 
ATOM   534   C  CA  . MET A 1 94  ? 62.359  9.609   -25.170  1.00 28.46 ? 83   MET A CA  1 
ATOM   535   C  C   . MET A 1 94  ? 61.306  9.411   -24.079  1.00 28.45 ? 83   MET A C   1 
ATOM   536   O  O   . MET A 1 94  ? 60.851  8.302   -23.837  1.00 28.54 ? 83   MET A O   1 
ATOM   537   C  CB  . MET A 1 94  ? 61.900  10.685  -26.170  1.00 29.08 ? 83   MET A CB  1 
ATOM   538   C  CG  . MET A 1 94  ? 63.002  11.244  -27.025  1.00 29.53 ? 83   MET A CG  1 
ATOM   539   S  SD  . MET A 1 94  ? 62.372  12.506  -28.118  1.00 27.78 ? 83   MET A SD  1 
ATOM   540   C  CE  . MET A 1 94  ? 61.674  11.499  -29.413  1.00 32.77 ? 83   MET A CE  1 
ATOM   541   N  N   . THR A 1 95  ? 60.931  10.494  -23.415  1.00 28.25 ? 84   THR A N   1 
ATOM   542   C  CA  . THR A 1 95  ? 59.993  10.430  -22.316  1.00 27.83 ? 84   THR A CA  1 
ATOM   543   C  C   . THR A 1 95  ? 59.354  11.770  -22.127  1.00 28.27 ? 84   THR A C   1 
ATOM   544   O  O   . THR A 1 95  ? 60.057  12.781  -22.064  1.00 29.01 ? 84   THR A O   1 
ATOM   545   C  CB  . THR A 1 95  ? 60.692  10.100  -21.056  1.00 27.74 ? 84   THR A CB  1 
ATOM   546   O  OG1 . THR A 1 95  ? 60.992  8.703   -21.065  1.00 30.72 ? 84   THR A OG1 1 
ATOM   547   C  CG2 . THR A 1 95  ? 59.817  10.437  -19.867  1.00 26.34 ? 84   THR A CG2 1 
ATOM   548   N  N   . SER A 1 96  ? 58.027  11.761  -22.002  1.00 28.02 ? 85   SER A N   1 
ATOM   549   C  CA  . SER A 1 96  ? 57.214  12.969  -21.993  1.00 26.96 ? 85   SER A CA  1 
ATOM   550   C  C   . SER A 1 96  ? 57.644  13.958  -20.935  1.00 26.09 ? 85   SER A C   1 
ATOM   551   O  O   . SER A 1 96  ? 57.880  13.586  -19.776  1.00 26.26 ? 85   SER A O   1 
ATOM   552   C  CB  . SER A 1 96  ? 55.731  12.608  -21.803  1.00 27.27 ? 85   SER A CB  1 
ATOM   553   O  OG  . SER A 1 96  ? 54.962  13.767  -21.578  1.00 29.54 ? 85   SER A OG  1 
ATOM   554   N  N   . ALA A 1 97  ? 57.686  15.226  -21.337  1.00 25.19 ? 86   ALA A N   1 
ATOM   555   C  CA  . ALA A 1 97  ? 58.227  16.317  -20.507  1.00 25.38 ? 86   ALA A CA  1 
ATOM   556   C  C   . ALA A 1 97  ? 57.487  16.503  -19.204  1.00 25.43 ? 86   ALA A C   1 
ATOM   557   O  O   . ALA A 1 97  ? 58.058  17.019  -18.229  1.00 24.99 ? 86   ALA A O   1 
ATOM   558   C  CB  . ALA A 1 97  ? 58.217  17.610  -21.266  1.00 25.27 ? 86   ALA A CB  1 
ATOM   559   N  N   . ASP A 1 98  ? 56.221  16.101  -19.174  1.00 24.86 ? 87   ASP A N   1 
ATOM   560   C  CA  . ASP A 1 98  ? 55.442  16.185  -17.941  1.00 25.80 ? 87   ASP A CA  1 
ATOM   561   C  C   . ASP A 1 98  ? 55.361  14.832  -17.289  1.00 26.28 ? 87   ASP A C   1 
ATOM   562   O  O   . ASP A 1 98  ? 54.789  13.906  -17.866  1.00 26.75 ? 87   ASP A O   1 
ATOM   563   C  CB  . ASP A 1 98  ? 54.041  16.729  -18.203  1.00 25.10 ? 87   ASP A CB  1 
ATOM   564   C  CG  . ASP A 1 98  ? 54.049  18.176  -18.560  1.00 25.38 ? 87   ASP A CG  1 
ATOM   565   O  OD1 . ASP A 1 98  ? 54.965  18.906  -18.113  1.00 25.95 ? 87   ASP A OD1 1 
ATOM   566   O  OD2 . ASP A 1 98  ? 53.135  18.586  -19.295  1.00 26.11 ? 87   ASP A OD2 1 
ATOM   567   N  N   . ASP A 1 99  ? 55.937  14.724  -16.085  1.00 27.25 ? 88   ASP A N   1 
ATOM   568   C  CA  . ASP A 1 99  ? 55.912  13.473  -15.363  1.00 26.62 ? 88   ASP A CA  1 
ATOM   569   C  C   . ASP A 1 99  ? 54.644  13.373  -14.516  1.00 27.20 ? 88   ASP A C   1 
ATOM   570   O  O   . ASP A 1 99  ? 53.808  14.278  -14.504  1.00 28.56 ? 88   ASP A O   1 
ATOM   571   C  CB  . ASP A 1 99  ? 57.221  13.232  -14.584  1.00 27.36 ? 88   ASP A CB  1 
ATOM   572   C  CG  . ASP A 1 99  ? 57.410  14.153  -13.372  1.00 28.04 ? 88   ASP A CG  1 
ATOM   573   O  OD1 . ASP A 1 99  ? 56.438  14.638  -12.766  1.00 28.66 ? 88   ASP A OD1 1 
ATOM   574   O  OD2 . ASP A 1 99  ? 58.583  14.366  -13.000  1.00 31.55 ? 88   ASP A OD2 1 
ATOM   575   N  N   . PHE A 1 100 ? 54.492  12.259  -13.821  1.00 26.55 ? 89   PHE A N   1 
ATOM   576   C  CA  . PHE A 1 100 ? 53.323  12.065  -12.977  1.00 26.11 ? 89   PHE A CA  1 
ATOM   577   C  C   . PHE A 1 100 ? 53.127  13.183  -11.931  1.00 25.38 ? 89   PHE A C   1 
ATOM   578   O  O   . PHE A 1 100 ? 51.998  13.467  -11.543  1.00 24.88 ? 89   PHE A O   1 
ATOM   579   C  CB  . PHE A 1 100 ? 53.336  10.657  -12.355  1.00 25.72 ? 89   PHE A CB  1 
ATOM   580   C  CG  . PHE A 1 100 ? 52.647  9.620   -13.214  1.00 26.38 ? 89   PHE A CG  1 
ATOM   581   C  CD1 . PHE A 1 100 ? 51.250  9.557   -13.259  1.00 27.34 ? 89   PHE A CD1 1 
ATOM   582   C  CD2 . PHE A 1 100 ? 53.374  8.738   -14.011  1.00 26.10 ? 89   PHE A CD2 1 
ATOM   583   C  CE1 . PHE A 1 100 ? 50.603  8.612   -14.065  1.00 26.58 ? 89   PHE A CE1 1 
ATOM   584   C  CE2 . PHE A 1 100 ? 52.723  7.789   -14.822  1.00 23.79 ? 89   PHE A CE2 1 
ATOM   585   C  CZ  . PHE A 1 100 ? 51.341  7.732   -14.837  1.00 21.71 ? 89   PHE A CZ  1 
ATOM   586   N  N   . PHE A 1 101 ? 54.207  13.846  -11.511  1.00 25.52 ? 90   PHE A N   1 
ATOM   587   C  CA  . PHE A 1 101 ? 54.078  14.979  -10.573  1.00 25.43 ? 90   PHE A CA  1 
ATOM   588   C  C   . PHE A 1 101 ? 53.664  16.255  -11.289  1.00 24.18 ? 90   PHE A C   1 
ATOM   589   O  O   . PHE A 1 101 ? 52.677  16.891  -10.940  1.00 24.69 ? 90   PHE A O   1 
ATOM   590   C  CB  . PHE A 1 101 ? 55.374  15.249  -9.795   1.00 25.05 ? 90   PHE A CB  1 
ATOM   591   C  CG  . PHE A 1 101 ? 55.352  16.560  -9.054   1.00 25.17 ? 90   PHE A CG  1 
ATOM   592   C  CD1 . PHE A 1 101 ? 54.747  16.653  -7.811   1.00 25.60 ? 90   PHE A CD1 1 
ATOM   593   C  CD2 . PHE A 1 101 ? 55.900  17.705  -9.617   1.00 25.39 ? 90   PHE A CD2 1 
ATOM   594   C  CE1 . PHE A 1 101 ? 54.714  17.863  -7.136   1.00 24.11 ? 90   PHE A CE1 1 
ATOM   595   C  CE2 . PHE A 1 101 ? 55.864  18.919  -8.944   1.00 24.89 ? 90   PHE A CE2 1 
ATOM   596   C  CZ  . PHE A 1 101 ? 55.274  18.991  -7.708   1.00 24.63 ? 90   PHE A CZ  1 
ATOM   597   N  N   . GLN A 1 102 ? 54.453  16.639  -12.280  1.00 24.99 ? 91   GLN A N   1 
ATOM   598   C  CA  . GLN A 1 102 ? 54.181  17.854  -13.055  1.00 24.32 ? 91   GLN A CA  1 
ATOM   599   C  C   . GLN A 1 102 ? 52.775  17.854  -13.717  1.00 23.73 ? 91   GLN A C   1 
ATOM   600   O  O   . GLN A 1 102 ? 52.076  18.862  -13.724  1.00 24.25 ? 91   GLN A O   1 
ATOM   601   C  CB  . GLN A 1 102 ? 55.289  18.065  -14.100  1.00 23.27 ? 91   GLN A CB  1 
ATOM   602   C  CG  . GLN A 1 102 ? 55.400  19.468  -14.629  1.00 24.12 ? 91   GLN A CG  1 
ATOM   603   C  CD  . GLN A 1 102 ? 55.447  20.502  -13.514  1.00 26.73 ? 91   GLN A CD  1 
ATOM   604   O  OE1 . GLN A 1 102 ? 54.711  21.496  -13.542  1.00 25.20 ? 91   GLN A OE1 1 
ATOM   605   N  NE2 . GLN A 1 102 ? 56.297  20.260  -12.513  1.00 26.76 ? 91   GLN A NE2 1 
ATOM   606   N  N   . GLY A 1 103 ? 52.372  16.716  -14.249  1.00 23.46 ? 92   GLY A N   1 
ATOM   607   C  CA  . GLY A 1 103 ? 51.117  16.620  -14.975  1.00 23.97 ? 92   GLY A CA  1 
ATOM   608   C  C   . GLY A 1 103 ? 49.914  16.648  -14.085  1.00 24.21 ? 92   GLY A C   1 
ATOM   609   O  O   . GLY A 1 103 ? 48.887  17.182  -14.470  1.00 24.65 ? 92   GLY A O   1 
ATOM   610   N  N   . THR A 1 104 ? 50.033  16.048  -12.901  1.00 25.25 ? 93   THR A N   1 
ATOM   611   C  CA  . THR A 1 104 ? 48.937  16.020  -11.932  1.00 25.51 ? 93   THR A CA  1 
ATOM   612   C  C   . THR A 1 104 ? 48.796  17.363  -11.240  1.00 25.79 ? 93   THR A C   1 
ATOM   613   O  O   . THR A 1 104 ? 47.697  17.805  -10.961  1.00 27.00 ? 93   THR A O   1 
ATOM   614   C  CB  . THR A 1 104 ? 49.113  14.914  -10.903  1.00 25.03 ? 93   THR A CB  1 
ATOM   615   O  OG1 . THR A 1 104 ? 50.380  15.050  -10.245  1.00 26.02 ? 93   THR A OG1 1 
ATOM   616   C  CG2 . THR A 1 104 ? 49.032  13.581  -11.588  1.00 24.96 ? 93   THR A CG2 1 
ATOM   617   N  N   . LYS A 1 105 ? 49.918  18.014  -10.983  1.00 25.98 ? 94   LYS A N   1 
ATOM   618   C  CA  . LYS A 1 105 ? 49.918  19.380  -10.519  1.00 25.38 ? 94   LYS A CA  1 
ATOM   619   C  C   . LYS A 1 105 ? 49.151  20.250  -11.505  1.00 24.31 ? 94   LYS A C   1 
ATOM   620   O  O   . LYS A 1 105 ? 48.335  21.046  -11.106  1.00 24.13 ? 94   LYS A O   1 
ATOM   621   C  CB  . LYS A 1 105 ? 51.366  19.856  -10.351  1.00 26.73 ? 94   LYS A CB  1 
ATOM   622   C  CG  . LYS A 1 105 ? 51.528  21.244  -9.791   1.00 28.06 ? 94   LYS A CG  1 
ATOM   623   C  CD  . LYS A 1 105 ? 53.007  21.553  -9.490   1.00 28.82 ? 94   LYS A CD  1 
ATOM   624   C  CE  . LYS A 1 105 ? 53.223  23.042  -9.137   1.00 29.88 ? 94   LYS A CE  1 
ATOM   625   N  NZ  . LYS A 1 105 ? 54.619  23.517  -9.467   1.00 31.78 ? 94   LYS A NZ  1 
ATOM   626   N  N   . ALA A 1 106 ? 49.428  20.089  -12.798  1.00 23.59 ? 95   ALA A N   1 
ATOM   627   C  CA  . ALA A 1 106 ? 48.716  20.809  -13.866  1.00 23.09 ? 95   ALA A CA  1 
ATOM   628   C  C   . ALA A 1 106 ? 47.230  20.418  -13.918  1.00 22.17 ? 95   ALA A C   1 
ATOM   629   O  O   . ALA A 1 106 ? 46.374  21.257  -14.158  1.00 23.50 ? 95   ALA A O   1 
ATOM   630   C  CB  . ALA A 1 106 ? 49.385  20.546  -15.204  1.00 20.69 ? 95   ALA A CB  1 
ATOM   631   N  N   . ALA A 1 107 ? 46.926  19.152  -13.657  1.00 22.09 ? 96   ALA A N   1 
ATOM   632   C  CA  . ALA A 1 107 ? 45.549  18.684  -13.678  1.00 21.70 ? 96   ALA A CA  1 
ATOM   633   C  C   . ALA A 1 107 ? 44.776  19.392  -12.609  1.00 21.42 ? 96   ALA A C   1 
ATOM   634   O  O   . ALA A 1 107 ? 43.815  20.076  -12.905  1.00 21.00 ? 96   ALA A O   1 
ATOM   635   C  CB  . ALA A 1 107 ? 45.482  17.179  -13.478  1.00 21.54 ? 96   ALA A CB  1 
ATOM   636   N  N   . LEU A 1 108 ? 45.235  19.264  -11.364  1.00 20.88 ? 97   LEU A N   1 
ATOM   637   C  CA  . LEU A 1 108 ? 44.665  19.999  -10.218  1.00 21.42 ? 97   LEU A CA  1 
ATOM   638   C  C   . LEU A 1 108 ? 44.517  21.496  -10.492  1.00 21.77 ? 97   LEU A C   1 
ATOM   639   O  O   . LEU A 1 108 ? 43.467  22.073  -10.244  1.00 22.85 ? 97   LEU A O   1 
ATOM   640   C  CB  . LEU A 1 108 ? 45.541  19.807  -8.972   1.00 20.95 ? 97   LEU A CB  1 
ATOM   641   C  CG  . LEU A 1 108 ? 45.609  18.380  -8.433   1.00 22.34 ? 97   LEU A CG  1 
ATOM   642   C  CD1 . LEU A 1 108 ? 46.682  18.239  -7.372   1.00 24.08 ? 97   LEU A CD1 1 
ATOM   643   C  CD2 . LEU A 1 108 ? 44.260  17.950  -7.861   1.00 25.14 ? 97   LEU A CD2 1 
ATOM   644   N  N   . ALA A 1 109 ? 45.564  22.128  -11.015  1.00 21.55 ? 98   ALA A N   1 
ATOM   645   C  CA  . ALA A 1 109 ? 45.508  23.541  -11.337  1.00 21.66 ? 98   ALA A CA  1 
ATOM   646   C  C   . ALA A 1 109 ? 44.188  23.777  -12.024  1.00 21.97 ? 98   ALA A C   1 
ATOM   647   O  O   . ALA A 1 109 ? 43.506  24.765  -11.759  1.00 22.36 ? 98   ALA A O   1 
ATOM   648   C  CB  . ALA A 1 109 ? 46.666  23.959  -12.264  1.00 21.72 ? 98   ALA A CB  1 
ATOM   649   N  N   . GLY A 1 110 ? 43.832  22.837  -12.894  1.00 21.18 ? 99   GLY A N   1 
ATOM   650   C  CA  . GLY A 1 110 ? 42.695  22.993  -13.783  1.00 21.68 ? 99   GLY A CA  1 
ATOM   651   C  C   . GLY A 1 110 ? 41.340  22.510  -13.308  1.00 21.72 ? 99   GLY A C   1 
ATOM   652   O  O   . GLY A 1 110 ? 40.387  22.608  -14.062  1.00 23.32 ? 99   GLY A O   1 
ATOM   653   N  N   . GLY A 1 111 ? 41.246  21.999  -12.082  1.00 20.95 ? 100  GLY A N   1 
ATOM   654   C  CA  . GLY A 1 111 ? 39.973  21.513  -11.533  1.00 20.86 ? 100  GLY A CA  1 
ATOM   655   C  C   . GLY A 1 111 ? 39.792  19.999  -11.596  1.00 20.93 ? 100  GLY A C   1 
ATOM   656   O  O   . GLY A 1 111 ? 38.759  19.469  -11.181  1.00 22.51 ? 100  GLY A O   1 
ATOM   657   N  N   . THR A 1 112 ? 40.799  19.311  -12.118  1.00 20.34 ? 101  THR A N   1 
ATOM   658   C  CA  . THR A 1 112 ? 40.776  17.886  -12.362  1.00 18.91 ? 101  THR A CA  1 
ATOM   659   C  C   . THR A 1 112 ? 41.395  17.237  -11.135  1.00 19.59 ? 101  THR A C   1 
ATOM   660   O  O   . THR A 1 112 ? 42.525  17.561  -10.757  1.00 22.73 ? 101  THR A O   1 
ATOM   661   C  CB  . THR A 1 112 ? 41.560  17.593  -13.667  1.00 18.89 ? 101  THR A CB  1 
ATOM   662   O  OG1 . THR A 1 112 ? 40.802  18.072  -14.797  1.00 12.50 ? 101  THR A OG1 1 
ATOM   663   C  CG2 . THR A 1 112 ? 41.858  16.130  -13.835  1.00 21.14 ? 101  THR A CG2 1 
ATOM   664   N  N   . THR A 1 113 ? 40.644  16.384  -10.451  1.00 18.37 ? 102  THR A N   1 
ATOM   665   C  CA  . THR A 1 113 ? 41.140  15.766  -9.241   1.00 17.63 ? 102  THR A CA  1 
ATOM   666   C  C   . THR A 1 113 ? 41.306  14.275  -9.404   1.00 17.27 ? 102  THR A C   1 
ATOM   667   O  O   . THR A 1 113 ? 41.586  13.590  -8.434   1.00 15.86 ? 102  THR A O   1 
ATOM   668   C  CB  . THR A 1 113 ? 40.213  16.012  -8.023   1.00 17.75 ? 102  THR A CB  1 
ATOM   669   O  OG1 . THR A 1 113 ? 38.878  15.593  -8.350   1.00 19.30 ? 102  THR A OG1 1 
ATOM   670   C  CG2 . THR A 1 113 ? 40.254  17.497  -7.569   1.00 18.80 ? 102  THR A CG2 1 
ATOM   671   N  N   . MET A 1 114 ? 41.164  13.743  -10.617  1.00 15.83 ? 103  MET A N   1 
ATOM   672   C  CA  . MET A 1 114 ? 41.581  12.375  -10.846  1.00 17.44 ? 103  MET A CA  1 
ATOM   673   C  C   . MET A 1 114 ? 41.954  12.192  -12.291  1.00 17.90 ? 103  MET A C   1 
ATOM   674   O  O   . MET A 1 114 ? 41.302  12.740  -13.154  1.00 16.73 ? 103  MET A O   1 
ATOM   675   C  CB  . MET A 1 114 ? 40.493  11.385  -10.465  1.00 18.16 ? 103  MET A CB  1 
ATOM   676   C  CG  . MET A 1 114 ? 40.947  9.944   -10.500  1.00 17.30 ? 103  MET A CG  1 
ATOM   677   S  SD  . MET A 1 114 ? 39.596  8.828   -10.389  1.00 20.07 ? 103  MET A SD  1 
ATOM   678   C  CE  . MET A 1 114 ? 40.385  7.256   -10.676  1.00 16.59 ? 103  MET A CE  1 
ATOM   679   N  N   . ILE A 1 115 ? 43.040  11.453  -12.509  1.00 19.26 ? 104  ILE A N   1 
ATOM   680   C  CA  . ILE A 1 115 ? 43.556  11.133  -13.821  1.00 18.89 ? 104  ILE A CA  1 
ATOM   681   C  C   . ILE A 1 115 ? 43.589  9.618   -13.987  1.00 19.24 ? 104  ILE A C   1 
ATOM   682   O  O   . ILE A 1 115 ? 43.816  8.885   -13.042  1.00 22.00 ? 104  ILE A O   1 
ATOM   683   C  CB  . ILE A 1 115 ? 44.955  11.780  -14.070  1.00 19.42 ? 104  ILE A CB  1 
ATOM   684   C  CG1 . ILE A 1 115 ? 46.044  11.277  -13.091  1.00 20.41 ? 104  ILE A CG1 1 
ATOM   685   C  CG2 . ILE A 1 115 ? 44.862  13.307  -14.028  1.00 20.33 ? 104  ILE A CG2 1 
ATOM   686   C  CD1 . ILE A 1 115 ? 46.941  10.186  -13.656  1.00 17.40 ? 104  ILE A CD1 1 
ATOM   687   N  N   . ILE A 1 116 ? 43.281  9.132   -15.175  1.00 19.84 ? 105  ILE A N   1 
ATOM   688   C  CA  . ILE A 1 116 ? 43.407  7.702   -15.467  1.00 19.86 ? 105  ILE A CA  1 
ATOM   689   C  C   . ILE A 1 116 ? 44.473  7.601   -16.550  1.00 19.45 ? 105  ILE A C   1 
ATOM   690   O  O   . ILE A 1 116 ? 44.310  8.142   -17.640  1.00 18.53 ? 105  ILE A O   1 
ATOM   691   C  CB  . ILE A 1 116 ? 42.054  7.066   -15.898  1.00 20.13 ? 105  ILE A CB  1 
ATOM   692   C  CG1 . ILE A 1 116 ? 40.930  7.525   -14.940  1.00 20.57 ? 105  ILE A CG1 1 
ATOM   693   C  CG2 . ILE A 1 116 ? 42.142  5.523   -15.973  1.00 19.16 ? 105  ILE A CG2 1 
ATOM   694   C  CD1 . ILE A 1 116 ? 39.719  6.596   -14.918  1.00 19.67 ? 105  ILE A CD1 1 
ATOM   695   N  N   . ASP A 1 117 ? 45.593  6.969   -16.234  1.00 19.76 ? 106  ASP A N   1 
ATOM   696   C  CA  . ASP A 1 117 ? 46.731  6.952   -17.182  1.00 20.84 ? 106  ASP A CA  1 
ATOM   697   C  C   . ASP A 1 117 ? 46.820  5.613   -17.938  1.00 20.56 ? 106  ASP A C   1 
ATOM   698   O  O   . ASP A 1 117 ? 46.023  4.711   -17.695  1.00 21.69 ? 106  ASP A O   1 
ATOM   699   C  CB  . ASP A 1 117 ? 48.028  7.287   -16.439  1.00 21.07 ? 106  ASP A CB  1 
ATOM   700   C  CG  . ASP A 1 117 ? 48.996  8.050   -17.291  1.00 21.34 ? 106  ASP A CG  1 
ATOM   701   O  OD1 . ASP A 1 117 ? 49.080  9.289   -17.134  1.00 25.67 ? 106  ASP A OD1 1 
ATOM   702   O  OD2 . ASP A 1 117 ? 49.655  7.419   -18.136  1.00 17.70 ? 106  ASP A OD2 1 
ATOM   703   N  N   . HIS A 1 118 ? 47.760  5.506   -18.872  1.00 21.33 ? 107  HIS A N   1 
ATOM   704   C  CA  . HIS A 1 118 ? 47.872  4.349   -19.775  1.00 20.89 ? 107  HIS A CA  1 
ATOM   705   C  C   . HIS A 1 118 ? 49.195  3.599   -19.642  1.00 21.92 ? 107  HIS A C   1 
ATOM   706   O  O   . HIS A 1 118 ? 50.253  4.113   -20.016  1.00 22.98 ? 107  HIS A O   1 
ATOM   707   C  CB  . HIS A 1 118 ? 47.685  4.797   -21.226  1.00 20.91 ? 107  HIS A CB  1 
ATOM   708   C  CG  . HIS A 1 118 ? 46.265  5.114   -21.566  1.00 18.43 ? 107  HIS A CG  1 
ATOM   709   N  ND1 . HIS A 1 118 ? 45.421  4.195   -22.147  1.00 19.65 ? 107  HIS A ND1 1 
ATOM   710   C  CD2 . HIS A 1 118 ? 45.525  6.229   -21.361  1.00 16.65 ? 107  HIS A CD2 1 
ATOM   711   C  CE1 . HIS A 1 118 ? 44.232  4.749   -22.325  1.00 18.74 ? 107  HIS A CE1 1 
ATOM   712   N  NE2 . HIS A 1 118 ? 44.267  5.980   -21.855  1.00 16.92 ? 107  HIS A NE2 1 
ATOM   713   N  N   . VAL A 1 119 ? 49.125  2.379   -19.112  1.00 22.97 ? 108  VAL A N   1 
ATOM   714   C  CA  . VAL A 1 119 ? 50.274  1.509   -19.039  1.00 23.22 ? 108  VAL A CA  1 
ATOM   715   C  C   . VAL A 1 119 ? 50.590  1.098   -20.479  1.00 23.42 ? 108  VAL A C   1 
ATOM   716   O  O   . VAL A 1 119 ? 49.696  0.691   -21.187  1.00 22.46 ? 108  VAL A O   1 
ATOM   717   C  CB  . VAL A 1 119 ? 49.991  0.233   -18.215  1.00 23.21 ? 108  VAL A CB  1 
ATOM   718   C  CG1 . VAL A 1 119 ? 51.243  -0.659  -18.202  1.00 24.99 ? 108  VAL A CG1 1 
ATOM   719   C  CG2 . VAL A 1 119 ? 49.535  0.559   -16.786  1.00 22.36 ? 108  VAL A CG2 1 
ATOM   720   N  N   . VAL A 1 120 ? 51.845  1.193   -20.915  1.00 24.57 ? 109  VAL A N   1 
ATOM   721   C  CA  . VAL A 1 120 ? 52.203  0.783   -22.287  1.00 25.18 ? 109  VAL A CA  1 
ATOM   722   C  C   . VAL A 1 120 ? 53.341  -0.277  -22.313  1.00 26.84 ? 109  VAL A C   1 
ATOM   723   O  O   . VAL A 1 120 ? 54.535  0.066   -22.399  1.00 26.14 ? 109  VAL A O   1 
ATOM   724   C  CB  . VAL A 1 120 ? 52.613  1.993   -23.142  1.00 24.86 ? 109  VAL A CB  1 
ATOM   725   C  CG1 . VAL A 1 120 ? 52.590  1.630   -24.633  1.00 26.41 ? 109  VAL A CG1 1 
ATOM   726   C  CG2 . VAL A 1 120 ? 51.714  3.174   -22.881  1.00 25.84 ? 109  VAL A CG2 1 
ATOM   727   N  N   . PRO A 1 121 ? 52.982  -1.576  -22.229  1.00 28.59 ? 110  PRO A N   1 
ATOM   728   C  CA  . PRO A 1 121 ? 53.999  -2.614  -22.237  1.00 28.94 ? 110  PRO A CA  1 
ATOM   729   C  C   . PRO A 1 121 ? 54.740  -2.627  -23.537  1.00 32.01 ? 110  PRO A C   1 
ATOM   730   O  O   . PRO A 1 121 ? 54.127  -2.645  -24.614  1.00 33.66 ? 110  PRO A O   1 
ATOM   731   C  CB  . PRO A 1 121 ? 53.196  -3.912  -22.098  1.00 28.62 ? 110  PRO A CB  1 
ATOM   732   C  CG  . PRO A 1 121 ? 51.868  -3.592  -22.530  1.00 28.18 ? 110  PRO A CG  1 
ATOM   733   C  CD  . PRO A 1 121 ? 51.639  -2.162  -22.126  1.00 28.71 ? 110  PRO A CD  1 
ATOM   734   N  N   . GLU A 1 122 ? 56.057  -2.602  -23.441  1.00 34.42 ? 111  GLU A N   1 
ATOM   735   C  CA  . GLU A 1 122 ? 56.879  -2.764  -24.602  1.00 35.54 ? 111  GLU A CA  1 
ATOM   736   C  C   . GLU A 1 122 ? 56.608  -4.156  -25.130  1.00 34.77 ? 111  GLU A C   1 
ATOM   737   O  O   . GLU A 1 122 ? 56.646  -5.099  -24.349  1.00 32.83 ? 111  GLU A O   1 
ATOM   738   C  CB  . GLU A 1 122 ? 58.346  -2.648  -24.203  1.00 37.46 ? 111  GLU A CB  1 
ATOM   739   C  CG  . GLU A 1 122 ? 59.277  -2.562  -25.370  1.00 40.61 ? 111  GLU A CG  1 
ATOM   740   C  CD  . GLU A 1 122 ? 59.018  -1.339  -26.210  1.00 44.50 ? 111  GLU A CD  1 
ATOM   741   O  OE1 . GLU A 1 122 ? 58.359  -0.397  -25.699  1.00 47.29 ? 111  GLU A OE1 1 
ATOM   742   O  OE2 . GLU A 1 122 ? 59.486  -1.320  -27.373  1.00 47.48 ? 111  GLU A OE2 1 
ATOM   743   N  N   . PRO A 1 123 ? 56.356  -4.288  -26.453  1.00 34.38 ? 112  PRO A N   1 
ATOM   744   C  CA  . PRO A 1 123 ? 56.177  -5.614  -27.039  1.00 34.92 ? 112  PRO A CA  1 
ATOM   745   C  C   . PRO A 1 123 ? 57.342  -6.537  -26.655  1.00 35.06 ? 112  PRO A C   1 
ATOM   746   O  O   . PRO A 1 123 ? 58.509  -6.163  -26.804  1.00 35.03 ? 112  PRO A O   1 
ATOM   747   C  CB  . PRO A 1 123 ? 56.153  -5.338  -28.552  1.00 34.95 ? 112  PRO A CB  1 
ATOM   748   C  CG  . PRO A 1 123 ? 55.755  -3.925  -28.692  1.00 34.63 ? 112  PRO A CG  1 
ATOM   749   C  CD  . PRO A 1 123 ? 56.266  -3.222  -27.471  1.00 34.92 ? 112  PRO A CD  1 
ATOM   750   N  N   . GLY A 1 124 ? 57.020  -7.709  -26.127  1.00 34.92 ? 113  GLY A N   1 
ATOM   751   C  CA  . GLY A 1 124 ? 58.028  -8.645  -25.614  1.00 34.35 ? 113  GLY A CA  1 
ATOM   752   C  C   . GLY A 1 124 ? 58.143  -8.559  -24.101  1.00 34.81 ? 113  GLY A C   1 
ATOM   753   O  O   . GLY A 1 124 ? 58.901  -9.322  -23.471  1.00 35.61 ? 113  GLY A O   1 
ATOM   754   N  N   . THR A 1 125 ? 57.387  -7.641  -23.504  1.00 33.19 ? 114  THR A N   1 
ATOM   755   C  CA  . THR A 1 125 ? 57.497  -7.404  -22.080  1.00 32.49 ? 114  THR A CA  1 
ATOM   756   C  C   . THR A 1 125 ? 56.132  -7.655  -21.460  1.00 31.88 ? 114  THR A C   1 
ATOM   757   O  O   . THR A 1 125 ? 55.120  -7.479  -22.136  1.00 32.10 ? 114  THR A O   1 
ATOM   758   C  CB  . THR A 1 125 ? 58.017  -5.985  -21.814  1.00 32.55 ? 114  THR A CB  1 
ATOM   759   O  OG1 . THR A 1 125 ? 56.938  -5.047  -21.873  1.00 31.43 ? 114  THR A OG1 1 
ATOM   760   C  CG2 . THR A 1 125 ? 59.076  -5.616  -22.839  1.00 32.27 ? 114  THR A CG2 1 
ATOM   761   N  N   . SER A 1 126 ? 56.095  -8.087  -20.193  1.00 30.80 ? 115  SER A N   1 
ATOM   762   C  CA  . SER A 1 126 ? 54.830  -8.543  -19.613  1.00 29.09 ? 115  SER A CA  1 
ATOM   763   C  C   . SER A 1 126 ? 53.918  -7.343  -19.305  1.00 28.31 ? 115  SER A C   1 
ATOM   764   O  O   . SER A 1 126 ? 54.399  -6.247  -18.998  1.00 28.23 ? 115  SER A O   1 
ATOM   765   C  CB  . SER A 1 126 ? 55.028  -9.494  -18.416  1.00 28.45 ? 115  SER A CB  1 
ATOM   766   O  OG  . SER A 1 126 ? 54.795  -8.890  -17.156  1.00 27.08 ? 115  SER A OG  1 
ATOM   767   N  N   . LEU A 1 127 ? 52.607  -7.543  -19.476  1.00 27.33 ? 116  LEU A N   1 
ATOM   768   C  CA  . LEU A 1 127 ? 51.609  -6.572  -19.050  1.00 26.12 ? 116  LEU A CA  1 
ATOM   769   C  C   . LEU A 1 127 ? 51.767  -6.250  -17.572  1.00 25.33 ? 116  LEU A C   1 
ATOM   770   O  O   . LEU A 1 127 ? 51.594  -5.109  -17.171  1.00 26.44 ? 116  LEU A O   1 
ATOM   771   C  CB  . LEU A 1 127 ? 50.177  -7.098  -19.248  1.00 24.03 ? 116  LEU A CB  1 
ATOM   772   C  CG  . LEU A 1 127 ? 49.686  -7.558  -20.626  1.00 22.96 ? 116  LEU A CG  1 
ATOM   773   C  CD1 . LEU A 1 127 ? 48.175  -7.525  -20.653  1.00 18.08 ? 116  LEU A CD1 1 
ATOM   774   C  CD2 . LEU A 1 127 ? 50.278  -6.688  -21.664  1.00 17.12 ? 116  LEU A CD2 1 
ATOM   775   N  N   . LEU A 1 128 ? 52.055  -7.257  -16.762  1.00 26.19 ? 117  LEU A N   1 
ATOM   776   C  CA  . LEU A 1 128 ? 52.067  -7.077  -15.299  1.00 26.64 ? 117  LEU A CA  1 
ATOM   777   C  C   . LEU A 1 128 ? 53.292  -6.270  -14.785  1.00 26.46 ? 117  LEU A C   1 
ATOM   778   O  O   . LEU A 1 128 ? 53.177  -5.467  -13.849  1.00 27.60 ? 117  LEU A O   1 
ATOM   779   C  CB  . LEU A 1 128 ? 51.978  -8.446  -14.609  1.00 27.77 ? 117  LEU A CB  1 
ATOM   780   C  CG  . LEU A 1 128 ? 50.694  -9.276  -14.790  1.00 29.46 ? 117  LEU A CG  1 
ATOM   781   C  CD1 . LEU A 1 128 ? 50.892  -10.765 -14.380  1.00 28.15 ? 117  LEU A CD1 1 
ATOM   782   C  CD2 . LEU A 1 128 ? 49.566  -8.667  -13.994  1.00 31.27 ? 117  LEU A CD2 1 
ATOM   783   N  N   . ALA A 1 129 ? 54.454  -6.495  -15.394  1.00 26.10 ? 118  ALA A N   1 
ATOM   784   C  CA  . ALA A 1 129 ? 55.671  -5.759  -15.086  1.00 25.43 ? 118  ALA A CA  1 
ATOM   785   C  C   . ALA A 1 129 ? 55.545  -4.263  -15.390  1.00 26.13 ? 118  ALA A C   1 
ATOM   786   O  O   . ALA A 1 129 ? 55.987  -3.410  -14.612  1.00 24.97 ? 118  ALA A O   1 
ATOM   787   C  CB  . ALA A 1 129 ? 56.808  -6.340  -15.861  1.00 25.03 ? 118  ALA A CB  1 
ATOM   788   N  N   . ALA A 1 130 ? 54.970  -3.944  -16.555  1.00 26.64 ? 119  ALA A N   1 
ATOM   789   C  CA  . ALA A 1 130 ? 54.681  -2.558  -16.935  1.00 25.95 ? 119  ALA A CA  1 
ATOM   790   C  C   . ALA A 1 130 ? 53.690  -1.912  -15.972  1.00 25.73 ? 119  ALA A C   1 
ATOM   791   O  O   . ALA A 1 130 ? 53.772  -0.727  -15.714  1.00 26.56 ? 119  ALA A O   1 
ATOM   792   C  CB  . ALA A 1 130 ? 54.138  -2.507  -18.374  1.00 25.99 ? 119  ALA A CB  1 
ATOM   793   N  N   . PHE A 1 131 ? 52.751  -2.697  -15.444  1.00 25.35 ? 120  PHE A N   1 
ATOM   794   C  CA  . PHE A 1 131 ? 51.739  -2.175  -14.523  1.00 25.44 ? 120  PHE A CA  1 
ATOM   795   C  C   . PHE A 1 131 ? 52.481  -1.764  -13.256  1.00 26.17 ? 120  PHE A C   1 
ATOM   796   O  O   . PHE A 1 131 ? 52.280  -0.645  -12.710  1.00 26.68 ? 120  PHE A O   1 
ATOM   797   C  CB  . PHE A 1 131 ? 50.651  -3.246  -14.250  1.00 23.65 ? 120  PHE A CB  1 
ATOM   798   C  CG  . PHE A 1 131 ? 49.534  -2.799  -13.329  1.00 23.59 ? 120  PHE A CG  1 
ATOM   799   C  CD1 . PHE A 1 131 ? 48.425  -2.103  -13.826  1.00 21.50 ? 120  PHE A CD1 1 
ATOM   800   C  CD2 . PHE A 1 131 ? 49.574  -3.097  -11.954  1.00 21.32 ? 120  PHE A CD2 1 
ATOM   801   C  CE1 . PHE A 1 131 ? 47.374  -1.712  -12.971  1.00 19.63 ? 120  PHE A CE1 1 
ATOM   802   C  CE2 . PHE A 1 131 ? 48.544  -2.701  -11.114  1.00 21.11 ? 120  PHE A CE2 1 
ATOM   803   C  CZ  . PHE A 1 131 ? 47.441  -2.013  -11.609  1.00 19.81 ? 120  PHE A CZ  1 
ATOM   804   N  N   . ASP A 1 132 ? 53.357  -2.665  -12.813  1.00 25.83 ? 121  ASP A N   1 
ATOM   805   C  CA  . ASP A 1 132 ? 54.213  -2.410  -11.656  1.00 25.99 ? 121  ASP A CA  1 
ATOM   806   C  C   . ASP A 1 132 ? 55.030  -1.133  -11.800  1.00 24.96 ? 121  ASP A C   1 
ATOM   807   O  O   . ASP A 1 132 ? 55.191  -0.394  -10.832  1.00 22.18 ? 121  ASP A O   1 
ATOM   808   C  CB  . ASP A 1 132 ? 55.157  -3.583  -11.440  1.00 26.61 ? 121  ASP A CB  1 
ATOM   809   C  CG  . ASP A 1 132 ? 54.432  -4.859  -11.084  1.00 29.70 ? 121  ASP A CG  1 
ATOM   810   O  OD1 . ASP A 1 132 ? 53.208  -4.806  -10.831  1.00 32.19 ? 121  ASP A OD1 1 
ATOM   811   O  OD2 . ASP A 1 132 ? 55.090  -5.929  -11.060  1.00 34.06 ? 121  ASP A OD2 1 
ATOM   812   N  N   . GLN A 1 133 ? 55.544  -0.893  -13.007  1.00 24.87 ? 122  GLN A N   1 
ATOM   813   C  CA  . GLN A 1 133 ? 56.347  0.291   -13.320  1.00 26.57 ? 122  GLN A CA  1 
ATOM   814   C  C   . GLN A 1 133 ? 55.513  1.558   -13.290  1.00 27.17 ? 122  GLN A C   1 
ATOM   815   O  O   . GLN A 1 133 ? 55.827  2.484   -12.534  1.00 29.47 ? 122  GLN A O   1 
ATOM   816   C  CB  . GLN A 1 133 ? 57.030  0.187   -14.704  1.00 27.28 ? 122  GLN A CB  1 
ATOM   817   C  CG  . GLN A 1 133 ? 58.544  -0.076  -14.659  1.00 30.23 ? 122  GLN A CG  1 
ATOM   818   C  CD  . GLN A 1 133 ? 59.424  1.186   -14.565  1.00 31.65 ? 122  GLN A CD  1 
ATOM   819   O  OE1 . GLN A 1 133 ? 60.006  1.610   -15.566  1.00 34.73 ? 122  GLN A OE1 1 
ATOM   820   N  NE2 . GLN A 1 133 ? 59.551  1.763   -13.358  1.00 29.67 ? 122  GLN A NE2 1 
ATOM   821   N  N   . TRP A 1 134 ? 54.471  1.617   -14.116  1.00 26.16 ? 123  TRP A N   1 
ATOM   822   C  CA  . TRP A 1 134 ? 53.558  2.757   -14.081  1.00 25.25 ? 123  TRP A CA  1 
ATOM   823   C  C   . TRP A 1 134 ? 53.076  2.987   -12.672  1.00 25.47 ? 123  TRP A C   1 
ATOM   824   O  O   . TRP A 1 134 ? 52.909  4.131   -12.271  1.00 27.15 ? 123  TRP A O   1 
ATOM   825   C  CB  . TRP A 1 134 ? 52.362  2.584   -15.021  1.00 24.55 ? 123  TRP A CB  1 
ATOM   826   C  CG  . TRP A 1 134 ? 52.565  3.310   -16.301  1.00 22.95 ? 123  TRP A CG  1 
ATOM   827   C  CD1 . TRP A 1 134 ? 52.049  4.522   -16.638  1.00 23.52 ? 123  TRP A CD1 1 
ATOM   828   C  CD2 . TRP A 1 134 ? 53.400  2.910   -17.391  1.00 24.18 ? 123  TRP A CD2 1 
ATOM   829   N  NE1 . TRP A 1 134 ? 52.488  4.894   -17.881  1.00 21.89 ? 123  TRP A NE1 1 
ATOM   830   C  CE2 . TRP A 1 134 ? 53.321  3.922   -18.368  1.00 23.68 ? 123  TRP A CE2 1 
ATOM   831   C  CE3 . TRP A 1 134 ? 54.196  1.781   -17.650  1.00 24.40 ? 123  TRP A CE3 1 
ATOM   832   C  CZ2 . TRP A 1 134 ? 54.022  3.852   -19.582  1.00 23.83 ? 123  TRP A CZ2 1 
ATOM   833   C  CZ3 . TRP A 1 134 ? 54.902  1.718   -18.856  1.00 23.20 ? 123  TRP A CZ3 1 
ATOM   834   C  CH2 . TRP A 1 134 ? 54.810  2.745   -19.803  1.00 22.59 ? 123  TRP A CH2 1 
ATOM   835   N  N   . ARG A 1 135 ? 52.848  1.911   -11.924  1.00 26.10 ? 124  ARG A N   1 
ATOM   836   C  CA  . ARG A 1 135 ? 52.411  2.030   -10.512  1.00 25.66 ? 124  ARG A CA  1 
ATOM   837   C  C   . ARG A 1 135 ? 53.481  2.642   -9.619   1.00 27.03 ? 124  ARG A C   1 
ATOM   838   O  O   . ARG A 1 135 ? 53.166  3.462   -8.749   1.00 28.61 ? 124  ARG A O   1 
ATOM   839   C  CB  . ARG A 1 135 ? 52.011  0.668   -9.943   1.00 25.94 ? 124  ARG A CB  1 
ATOM   840   C  CG  . ARG A 1 135 ? 50.606  0.183   -10.303  1.00 24.94 ? 124  ARG A CG  1 
ATOM   841   C  CD  . ARG A 1 135 ? 49.492  1.107   -9.812   1.00 25.93 ? 124  ARG A CD  1 
ATOM   842   N  NE  . ARG A 1 135 ? 49.615  1.503   -8.405   1.00 21.88 ? 124  ARG A NE  1 
ATOM   843   C  CZ  . ARG A 1 135 ? 49.315  0.720   -7.380   1.00 26.72 ? 124  ARG A CZ  1 
ATOM   844   N  NH1 . ARG A 1 135 ? 48.876  -0.508  -7.583   1.00 29.65 ? 124  ARG A NH1 1 
ATOM   845   N  NH2 . ARG A 1 135 ? 49.448  1.165   -6.134   1.00 25.40 ? 124  ARG A NH2 1 
ATOM   846   N  N   . GLU A 1 136 ? 54.734  2.211   -9.808   1.00 26.51 ? 125  GLU A N   1 
ATOM   847   C  CA  A GLU A 1 136 ? 55.850  2.781   -9.054   0.50 26.40 ? 125  GLU A CA  1 
ATOM   848   C  CA  B GLU A 1 136 ? 55.890  2.764   -9.096   0.50 26.12 ? 125  GLU A CA  1 
ATOM   849   C  C   . GLU A 1 136 ? 56.020  4.261   -9.351   1.00 26.19 ? 125  GLU A C   1 
ATOM   850   O  O   . GLU A 1 136 ? 56.113  5.066   -8.415   1.00 25.65 ? 125  GLU A O   1 
ATOM   851   C  CB  A GLU A 1 136 ? 57.173  2.062   -9.335   0.50 26.65 ? 125  GLU A CB  1 
ATOM   852   C  CB  B GLU A 1 136 ? 57.168  2.032   -9.554   0.50 26.20 ? 125  GLU A CB  1 
ATOM   853   C  CG  A GLU A 1 136 ? 58.252  2.441   -8.314   0.50 27.15 ? 125  GLU A CG  1 
ATOM   854   C  CG  B GLU A 1 136 ? 58.494  2.779   -9.381   0.50 26.20 ? 125  GLU A CG  1 
ATOM   855   C  CD  A GLU A 1 136 ? 59.583  1.788   -8.567   0.50 27.56 ? 125  GLU A CD  1 
ATOM   856   C  CD  B GLU A 1 136 ? 59.642  2.068   -10.073  0.50 26.13 ? 125  GLU A CD  1 
ATOM   857   O  OE1 A GLU A 1 136 ? 60.273  2.209   -9.522   0.50 29.90 ? 125  GLU A OE1 1 
ATOM   858   O  OE1 B GLU A 1 136 ? 59.910  0.905   -9.708   0.50 27.53 ? 125  GLU A OE1 1 
ATOM   859   O  OE2 A GLU A 1 136 ? 59.946  0.874   -7.786   0.50 29.92 ? 125  GLU A OE2 1 
ATOM   860   O  OE2 B GLU A 1 136 ? 60.271  2.662   -10.975  0.50 22.26 ? 125  GLU A OE2 1 
ATOM   861   N  N   . TRP A 1 137 ? 56.049  4.610   -10.636  1.00 25.29 ? 126  TRP A N   1 
ATOM   862   C  CA  . TRP A 1 137 ? 56.227  5.989   -11.067  1.00 25.28 ? 126  TRP A CA  1 
ATOM   863   C  C   . TRP A 1 137 ? 55.181  6.886   -10.486  1.00 25.31 ? 126  TRP A C   1 
ATOM   864   O  O   . TRP A 1 137 ? 55.503  7.885   -9.841   1.00 26.30 ? 126  TRP A O   1 
ATOM   865   C  CB  . TRP A 1 137 ? 56.124  6.106   -12.581  1.00 25.34 ? 126  TRP A CB  1 
ATOM   866   C  CG  . TRP A 1 137 ? 57.284  5.607   -13.343  1.00 25.62 ? 126  TRP A CG  1 
ATOM   867   C  CD1 . TRP A 1 137 ? 58.577  5.552   -12.933  1.00 27.09 ? 126  TRP A CD1 1 
ATOM   868   C  CD2 . TRP A 1 137 ? 57.271  5.134   -14.692  1.00 25.15 ? 126  TRP A CD2 1 
ATOM   869   N  NE1 . TRP A 1 137 ? 59.368  5.053   -13.937  1.00 26.00 ? 126  TRP A NE1 1 
ATOM   870   C  CE2 . TRP A 1 137 ? 58.583  4.786   -15.026  1.00 27.76 ? 126  TRP A CE2 1 
ATOM   871   C  CE3 . TRP A 1 137 ? 56.265  4.943   -15.642  1.00 26.52 ? 126  TRP A CE3 1 
ATOM   872   C  CZ2 . TRP A 1 137 ? 58.922  4.264   -16.284  1.00 27.08 ? 126  TRP A CZ2 1 
ATOM   873   C  CZ3 . TRP A 1 137 ? 56.600  4.439   -16.877  1.00 25.65 ? 126  TRP A CZ3 1 
ATOM   874   C  CH2 . TRP A 1 137 ? 57.912  4.091   -17.186  1.00 26.41 ? 126  TRP A CH2 1 
ATOM   875   N  N   . ALA A 1 138 ? 53.917  6.545   -10.725  1.00 24.73 ? 127  ALA A N   1 
ATOM   876   C  CA  . ALA A 1 138 ? 52.818  7.407   -10.311  1.00 24.73 ? 127  ALA A CA  1 
ATOM   877   C  C   . ALA A 1 138 ? 52.548  7.327   -8.817   1.00 24.58 ? 127  ALA A C   1 
ATOM   878   O  O   . ALA A 1 138 ? 52.092  8.304   -8.244   1.00 26.24 ? 127  ALA A O   1 
ATOM   879   C  CB  . ALA A 1 138 ? 51.558  7.089   -11.093  1.00 24.24 ? 127  ALA A CB  1 
ATOM   880   N  N   . ASP A 1 139 ? 52.806  6.190   -8.181   1.00 25.94 ? 128  ASP A N   1 
ATOM   881   C  CA  . ASP A 1 139 ? 52.666  6.090   -6.707   1.00 26.45 ? 128  ASP A CA  1 
ATOM   882   C  C   . ASP A 1 139 ? 53.594  7.045   -5.944   1.00 27.78 ? 128  ASP A C   1 
ATOM   883   O  O   . ASP A 1 139 ? 53.314  7.424   -4.791   1.00 26.67 ? 128  ASP A O   1 
ATOM   884   C  CB  . ASP A 1 139 ? 52.996  4.680   -6.200   1.00 26.99 ? 128  ASP A CB  1 
ATOM   885   C  CG  . ASP A 1 139 ? 51.850  3.721   -6.298   1.00 26.72 ? 128  ASP A CG  1 
ATOM   886   O  OD1 . ASP A 1 139 ? 50.719  4.144   -6.652   1.00 31.00 ? 128  ASP A OD1 1 
ATOM   887   O  OD2 . ASP A 1 139 ? 52.090  2.525   -6.020   1.00 25.52 ? 128  ASP A OD2 1 
ATOM   888   N  N   . SER A 1 140 ? 54.724  7.372   -6.578   1.00 29.22 ? 129  SER A N   1 
ATOM   889   C  CA  . SER A 1 140 ? 55.768  8.196   -5.980   1.00 28.99 ? 129  SER A CA  1 
ATOM   890   C  C   . SER A 1 140 ? 55.559  9.654   -6.278   1.00 28.99 ? 129  SER A C   1 
ATOM   891   O  O   . SER A 1 140 ? 55.895  10.502  -5.459   1.00 29.20 ? 129  SER A O   1 
ATOM   892   C  CB  . SER A 1 140 ? 57.144  7.772   -6.495   1.00 29.25 ? 129  SER A CB  1 
ATOM   893   O  OG  . SER A 1 140 ? 57.337  8.117   -7.869   1.00 30.70 ? 129  SER A OG  1 
ATOM   894   N  N   . LYS A 1 141 ? 55.009  9.942   -7.453   1.00 28.39 ? 130  LYS A N   1 
ATOM   895   C  CA  . LYS A 1 141 ? 54.974  11.296  -7.988   1.00 28.58 ? 130  LYS A CA  1 
ATOM   896   C  C   . LYS A 1 141 ? 53.587  11.944  -7.997   1.00 28.76 ? 130  LYS A C   1 
ATOM   897   O  O   . LYS A 1 141 ? 53.477  13.144  -7.735   1.00 28.75 ? 130  LYS A O   1 
ATOM   898   C  CB  . LYS A 1 141 ? 55.535  11.297  -9.408   1.00 28.47 ? 130  LYS A CB  1 
ATOM   899   C  CG  . LYS A 1 141 ? 57.055  11.251  -9.472   1.00 28.45 ? 130  LYS A CG  1 
ATOM   900   C  CD  . LYS A 1 141 ? 57.539  11.219  -10.902  1.00 29.16 ? 130  LYS A CD  1 
ATOM   901   C  CE  . LYS A 1 141 ? 59.054  11.198  -10.972  1.00 29.33 ? 130  LYS A CE  1 
ATOM   902   N  NZ  . LYS A 1 141 ? 59.531  11.324  -12.389  1.00 30.72 ? 130  LYS A NZ  1 
ATOM   903   N  N   . SER A 1 142 ? 52.542  11.163  -8.287   1.00 28.86 ? 131  SER A N   1 
ATOM   904   C  CA  . SER A 1 142 ? 51.180  11.700  -8.494   1.00 28.08 ? 131  SER A CA  1 
ATOM   905   C  C   . SER A 1 142 ? 50.642  12.576  -7.353   1.00 27.94 ? 131  SER A C   1 
ATOM   906   O  O   . SER A 1 142 ? 50.607  12.162  -6.198   1.00 28.12 ? 131  SER A O   1 
ATOM   907   C  CB  . SER A 1 142 ? 50.174  10.572  -8.719   1.00 28.02 ? 131  SER A CB  1 
ATOM   908   O  OG  . SER A 1 142 ? 48.847  11.103  -8.763   1.00 28.45 ? 131  SER A OG  1 
ATOM   909   N  N   . CYS A 1 143 ? 50.178  13.770  -7.713   1.00 28.06 ? 132  CYS A N   1 
ATOM   910   C  CA  . CYS A 1 143 ? 49.609  14.721  -6.757   1.00 26.89 ? 132  CYS A CA  1 
ATOM   911   C  C   . CYS A 1 143 ? 48.149  14.492  -6.415   1.00 25.50 ? 132  CYS A C   1 
ATOM   912   O  O   . CYS A 1 143 ? 47.666  15.044  -5.435   1.00 24.28 ? 132  CYS A O   1 
ATOM   913   C  CB  . CYS A 1 143 ? 49.773  16.129  -7.295   1.00 26.96 ? 132  CYS A CB  1 
ATOM   914   S  SG  . CYS A 1 143 ? 51.491  16.478  -7.544   1.00 29.80 ? 132  CYS A SG  1 
ATOM   915   N  N   . CYS A 1 144 ? 47.466  13.677  -7.217   1.00 24.15 ? 133  CYS A N   1 
ATOM   916   C  CA  . CYS A 1 144 ? 46.032  13.430  -7.083   1.00 23.67 ? 133  CYS A CA  1 
ATOM   917   C  C   . CYS A 1 144 ? 45.721  11.957  -7.305   1.00 23.72 ? 133  CYS A C   1 
ATOM   918   O  O   . CYS A 1 144 ? 46.559  11.192  -7.819   1.00 22.82 ? 133  CYS A O   1 
ATOM   919   C  CB  . CYS A 1 144 ? 45.277  14.243  -8.117   1.00 23.34 ? 133  CYS A CB  1 
ATOM   920   S  SG  . CYS A 1 144 ? 45.721  13.801  -9.839   1.00 21.79 ? 133  CYS A SG  1 
ATOM   921   N  N   . ASP A 1 145 ? 44.518  11.545  -6.914   1.00 23.89 ? 134  ASP A N   1 
ATOM   922   C  CA  . ASP A 1 145 ? 44.115  10.157  -7.086   1.00 23.13 ? 134  ASP A CA  1 
ATOM   923   C  C   . ASP A 1 145 ? 44.192  9.802   -8.552   1.00 22.04 ? 134  ASP A C   1 
ATOM   924   O  O   . ASP A 1 145 ? 44.095  10.655  -9.431   1.00 21.41 ? 134  ASP A O   1 
ATOM   925   C  CB  . ASP A 1 145 ? 42.719  9.907   -6.541   1.00 24.21 ? 134  ASP A CB  1 
ATOM   926   C  CG  . ASP A 1 145 ? 42.714  9.668   -5.051   1.00 25.92 ? 134  ASP A CG  1 
ATOM   927   O  OD1 . ASP A 1 145 ? 43.789  9.433   -4.472   1.00 29.10 ? 134  ASP A OD1 1 
ATOM   928   O  OD2 . ASP A 1 145 ? 41.627  9.690   -4.452   1.00 30.64 ? 134  ASP A OD2 1 
ATOM   929   N  N   . TYR A 1 146 ? 44.426  8.537   -8.813   1.00 21.54 ? 135  TYR A N   1 
ATOM   930   C  CA  . TYR A 1 146 ? 44.621  8.108   -10.173  1.00 21.23 ? 135  TYR A CA  1 
ATOM   931   C  C   . TYR A 1 146 ? 44.262  6.654   -10.312  1.00 20.08 ? 135  TYR A C   1 
ATOM   932   O  O   . TYR A 1 146 ? 44.172  5.906   -9.314   1.00 18.35 ? 135  TYR A O   1 
ATOM   933   C  CB  . TYR A 1 146 ? 46.077  8.353   -10.595  1.00 23.09 ? 135  TYR A CB  1 
ATOM   934   C  CG  . TYR A 1 146 ? 47.034  7.263   -10.143  1.00 23.39 ? 135  TYR A CG  1 
ATOM   935   C  CD1 . TYR A 1 146 ? 47.448  7.164   -8.823   1.00 25.42 ? 135  TYR A CD1 1 
ATOM   936   C  CD2 . TYR A 1 146 ? 47.497  6.319   -11.052  1.00 26.67 ? 135  TYR A CD2 1 
ATOM   937   C  CE1 . TYR A 1 146 ? 48.312  6.145   -8.420   1.00 26.00 ? 135  TYR A CE1 1 
ATOM   938   C  CE2 . TYR A 1 146 ? 48.341  5.299   -10.673  1.00 26.44 ? 135  TYR A CE2 1 
ATOM   939   C  CZ  . TYR A 1 146 ? 48.757  5.207   -9.369   1.00 26.24 ? 135  TYR A CZ  1 
ATOM   940   O  OH  . TYR A 1 146 ? 49.606  4.169   -9.035   1.00 24.79 ? 135  TYR A OH  1 
ATOM   941   N  N   . SER A 1 147 ? 44.087  6.256   -11.567  1.00 18.73 ? 136  SER A N   1 
ATOM   942   C  CA  . SER A 1 147 ? 43.886  4.871   -11.931  1.00 19.31 ? 136  SER A CA  1 
ATOM   943   C  C   . SER A 1 147 ? 44.549  4.649   -13.285  1.00 19.25 ? 136  SER A C   1 
ATOM   944   O  O   . SER A 1 147 ? 45.057  5.605   -13.880  1.00 19.57 ? 136  SER A O   1 
ATOM   945   C  CB  . SER A 1 147 ? 42.403  4.561   -12.010  1.00 19.46 ? 136  SER A CB  1 
ATOM   946   O  OG  . SER A 1 147 ? 42.184  3.189   -11.836  1.00 18.71 ? 136  SER A OG  1 
ATOM   947   N  N   . LEU A 1 148 ? 44.553  3.402   -13.757  1.00 19.41 ? 137  LEU A N   1 
ATOM   948   C  CA  . LEU A 1 148 ? 45.336  2.997   -14.943  1.00 18.70 ? 137  LEU A CA  1 
ATOM   949   C  C   . LEU A 1 148 ? 44.620  2.090   -15.970  1.00 18.21 ? 137  LEU A C   1 
ATOM   950   O  O   . LEU A 1 148 ? 44.181  0.965   -15.652  1.00 16.72 ? 137  LEU A O   1 
ATOM   951   C  CB  . LEU A 1 148 ? 46.627  2.278   -14.471  1.00 18.06 ? 137  LEU A CB  1 
ATOM   952   C  CG  . LEU A 1 148 ? 47.717  3.104   -13.764  1.00 16.39 ? 137  LEU A CG  1 
ATOM   953   C  CD1 . LEU A 1 148 ? 48.809  2.176   -13.186  1.00 15.29 ? 137  LEU A CD1 1 
ATOM   954   C  CD2 . LEU A 1 148 ? 48.321  4.139   -14.717  1.00 14.53 ? 137  LEU A CD2 1 
ATOM   955   N  N   . HIS A 1 149 ? 44.567  2.547   -17.226  1.00 18.76 ? 138  HIS A N   1 
ATOM   956   C  CA  . HIS A 1 149 ? 44.163  1.676   -18.317  1.00 18.20 ? 138  HIS A CA  1 
ATOM   957   C  C   . HIS A 1 149 ? 45.391  0.920   -18.753  1.00 19.59 ? 138  HIS A C   1 
ATOM   958   O  O   . HIS A 1 149 ? 46.494  1.460   -18.635  1.00 21.99 ? 138  HIS A O   1 
ATOM   959   C  CB  . HIS A 1 149 ? 43.685  2.479   -19.522  1.00 17.50 ? 138  HIS A CB  1 
ATOM   960   C  CG  . HIS A 1 149 ? 42.704  3.568   -19.199  1.00 15.04 ? 138  HIS A CG  1 
ATOM   961   N  ND1 . HIS A 1 149 ? 41.386  3.322   -18.892  1.00 11.51 ? 138  HIS A ND1 1 
ATOM   962   C  CD2 . HIS A 1 149 ? 42.831  4.915   -19.243  1.00 15.75 ? 138  HIS A CD2 1 
ATOM   963   C  CE1 . HIS A 1 149 ? 40.755  4.468   -18.711  1.00 10.80 ? 138  HIS A CE1 1 
ATOM   964   N  NE2 . HIS A 1 149 ? 41.611  5.451   -18.921  1.00 15.60 ? 138  HIS A NE2 1 
ATOM   965   N  N   . VAL A 1 150 ? 45.239  -0.281  -19.319  1.00 19.41 ? 139  VAL A N   1 
ATOM   966   C  CA  . VAL A 1 150 ? 46.406  -0.989  -19.884  1.00 18.87 ? 139  VAL A CA  1 
ATOM   967   C  C   . VAL A 1 150 ? 46.309  -1.174  -21.396  1.00 19.15 ? 139  VAL A C   1 
ATOM   968   O  O   . VAL A 1 150 ? 45.375  -1.787  -21.897  1.00 18.82 ? 139  VAL A O   1 
ATOM   969   C  CB  . VAL A 1 150 ? 46.682  -2.322  -19.202  1.00 18.63 ? 139  VAL A CB  1 
ATOM   970   C  CG1 . VAL A 1 150 ? 47.863  -3.012  -19.869  1.00 19.44 ? 139  VAL A CG1 1 
ATOM   971   C  CG2 . VAL A 1 150 ? 46.996  -2.072  -17.737  1.00 12.25 ? 139  VAL A CG2 1 
ATOM   972   N  N   . ASP A 1 151 ? 47.275  -0.605  -22.100  1.00 19.75 ? 140  ASP A N   1 
ATOM   973   C  CA  . ASP A 1 151 ? 47.365  -0.718  -23.531  1.00 20.94 ? 140  ASP A CA  1 
ATOM   974   C  C   . ASP A 1 151 ? 47.956  -2.074  -23.879  1.00 22.64 ? 140  ASP A C   1 
ATOM   975   O  O   . ASP A 1 151 ? 48.753  -2.623  -23.128  1.00 24.12 ? 140  ASP A O   1 
ATOM   976   C  CB  . ASP A 1 151 ? 48.262  0.380   -24.113  1.00 21.35 ? 140  ASP A CB  1 
ATOM   977   C  CG  . ASP A 1 151 ? 47.650  1.766   -24.020  1.00 20.53 ? 140  ASP A CG  1 
ATOM   978   O  OD1 . ASP A 1 151 ? 46.672  1.941   -23.281  1.00 17.13 ? 140  ASP A OD1 1 
ATOM   979   O  OD2 . ASP A 1 151 ? 48.169  2.687   -24.687  1.00 21.91 ? 140  ASP A OD2 1 
ATOM   980   N  N   . ILE A 1 152 ? 47.547  -2.595  -25.039  1.00 23.80 ? 141  ILE A N   1 
ATOM   981   C  CA  . ILE A 1 152 ? 47.962  -3.874  -25.543  1.00 23.77 ? 141  ILE A CA  1 
ATOM   982   C  C   . ILE A 1 152 ? 48.690  -3.629  -26.852  1.00 24.35 ? 141  ILE A C   1 
ATOM   983   O  O   . ILE A 1 152 ? 48.170  -2.920  -27.735  1.00 23.13 ? 141  ILE A O   1 
ATOM   984   C  CB  . ILE A 1 152 ? 46.759  -4.750  -25.797  1.00 24.43 ? 141  ILE A CB  1 
ATOM   985   C  CG1 . ILE A 1 152 ? 45.996  -4.941  -24.479  1.00 25.87 ? 141  ILE A CG1 1 
ATOM   986   C  CG2 . ILE A 1 152 ? 47.203  -6.077  -26.407  1.00 25.23 ? 141  ILE A CG2 1 
ATOM   987   C  CD1 . ILE A 1 152 ? 44.842  -5.871  -24.548  1.00 25.50 ? 141  ILE A CD1 1 
ATOM   988   N  N   . SER A 1 153 ? 49.890  -4.201  -26.944  1.00 24.64 ? 142  SER A N   1 
ATOM   989   C  CA  . SER A 1 153 ? 50.844  -3.931  -28.009  1.00 25.23 ? 142  SER A CA  1 
ATOM   990   C  C   . SER A 1 153 ? 51.009  -5.104  -28.977  1.00 25.19 ? 142  SER A C   1 
ATOM   991   O  O   . SER A 1 153 ? 51.398  -4.916  -30.134  1.00 24.09 ? 142  SER A O   1 
ATOM   992   C  CB  . SER A 1 153 ? 52.197  -3.557  -27.383  1.00 27.15 ? 142  SER A CB  1 
ATOM   993   O  OG  . SER A 1 153 ? 52.753  -4.644  -26.661  1.00 27.69 ? 142  SER A OG  1 
ATOM   994   N  N   . GLU A 1 154 ? 50.711  -6.312  -28.508  1.00 25.36 ? 143  GLU A N   1 
ATOM   995   C  CA  . GLU A 1 154 ? 50.734  -7.510  -29.355  1.00 25.06 ? 143  GLU A CA  1 
ATOM   996   C  C   . GLU A 1 154 ? 49.818  -8.555  -28.760  1.00 24.84 ? 143  GLU A C   1 
ATOM   997   O  O   . GLU A 1 154 ? 49.471  -8.463  -27.578  1.00 24.45 ? 143  GLU A O   1 
ATOM   998   C  CB  . GLU A 1 154 ? 52.140  -8.082  -29.419  1.00 26.38 ? 143  GLU A CB  1 
ATOM   999   C  CG  . GLU A 1 154 ? 52.756  -8.304  -28.035  1.00 26.54 ? 143  GLU A CG  1 
ATOM   1000  C  CD  . GLU A 1 154 ? 54.163  -8.861  -28.115  1.00 26.80 ? 143  GLU A CD  1 
ATOM   1001  O  OE1 . GLU A 1 154 ? 54.786  -8.766  -29.218  1.00 15.78 ? 143  GLU A OE1 1 
ATOM   1002  O  OE2 . GLU A 1 154 ? 54.615  -9.380  -27.059  1.00 23.38 ? 143  GLU A OE2 1 
ATOM   1003  N  N   . TRP A 1 155 ? 49.447  -9.559  -29.554  1.00 23.03 ? 144  TRP A N   1 
ATOM   1004  C  CA  . TRP A 1 155 ? 48.403  -10.500 -29.119  1.00 23.71 ? 144  TRP A CA  1 
ATOM   1005  C  C   . TRP A 1 155 ? 48.788  -11.984 -29.223  1.00 24.67 ? 144  TRP A C   1 
ATOM   1006  O  O   . TRP A 1 155 ? 48.960  -12.531 -30.317  1.00 24.01 ? 144  TRP A O   1 
ATOM   1007  C  CB  . TRP A 1 155 ? 47.099  -10.225 -29.891  1.00 21.70 ? 144  TRP A CB  1 
ATOM   1008  C  CG  . TRP A 1 155 ? 45.944  -11.102 -29.491  1.00 20.18 ? 144  TRP A CG  1 
ATOM   1009  C  CD1 . TRP A 1 155 ? 45.266  -11.954 -30.298  1.00 17.76 ? 144  TRP A CD1 1 
ATOM   1010  C  CD2 . TRP A 1 155 ? 45.347  -11.218 -28.188  1.00 17.21 ? 144  TRP A CD2 1 
ATOM   1011  N  NE1 . TRP A 1 155 ? 44.285  -12.605 -29.588  1.00 18.49 ? 144  TRP A NE1 1 
ATOM   1012  C  CE2 . TRP A 1 155 ? 44.310  -12.176 -28.289  1.00 14.97 ? 144  TRP A CE2 1 
ATOM   1013  C  CE3 . TRP A 1 155 ? 45.598  -10.624 -26.944  1.00 18.25 ? 144  TRP A CE3 1 
ATOM   1014  C  CZ2 . TRP A 1 155 ? 43.518  -12.559 -27.196  1.00 17.30 ? 144  TRP A CZ2 1 
ATOM   1015  C  CZ3 . TRP A 1 155 ? 44.780  -10.988 -25.859  1.00 18.39 ? 144  TRP A CZ3 1 
ATOM   1016  C  CH2 . TRP A 1 155 ? 43.753  -11.944 -26.002  1.00 16.33 ? 144  TRP A CH2 1 
ATOM   1017  N  N   . HIS A 1 156 ? 48.869  -12.625 -28.062  1.00 25.62 ? 145  HIS A N   1 
ATOM   1018  C  CA  . HIS A 1 156 ? 49.047  -14.067 -27.960  1.00 26.95 ? 145  HIS A CA  1 
ATOM   1019  C  C   . HIS A 1 156 ? 48.519  -14.552 -26.632  1.00 28.88 ? 145  HIS A C   1 
ATOM   1020  O  O   . HIS A 1 156 ? 48.134  -13.754 -25.790  1.00 29.51 ? 145  HIS A O   1 
ATOM   1021  C  CB  . HIS A 1 156 ? 50.524  -14.468 -28.102  1.00 27.04 ? 145  HIS A CB  1 
ATOM   1022  C  CG  . HIS A 1 156 ? 51.467  -13.653 -27.275  1.00 24.34 ? 145  HIS A CG  1 
ATOM   1023  N  ND1 . HIS A 1 156 ? 51.536  -13.757 -25.904  1.00 24.85 ? 145  HIS A ND1 1 
ATOM   1024  C  CD2 . HIS A 1 156 ? 52.410  -12.754 -27.630  1.00 21.46 ? 145  HIS A CD2 1 
ATOM   1025  C  CE1 . HIS A 1 156 ? 52.464  -12.940 -25.447  1.00 21.75 ? 145  HIS A CE1 1 
ATOM   1026  N  NE2 . HIS A 1 156 ? 53.004  -12.312 -26.473  1.00 22.79 ? 145  HIS A NE2 1 
ATOM   1027  N  N   . LYS A 1 157 ? 48.536  -15.866 -26.448  1.00 29.63 ? 146  LYS A N   1 
ATOM   1028  C  CA  . LYS A 1 157 ? 47.830  -16.512 -25.342  1.00 30.35 ? 146  LYS A CA  1 
ATOM   1029  C  C   . LYS A 1 157 ? 48.345  -16.036 -24.003  1.00 30.48 ? 146  LYS A C   1 
ATOM   1030  O  O   . LYS A 1 157 ? 47.600  -15.998 -23.019  1.00 31.34 ? 146  LYS A O   1 
ATOM   1031  C  CB  . LYS A 1 157 ? 47.889  -18.064 -25.432  1.00 32.06 ? 146  LYS A CB  1 
ATOM   1032  C  CG  . LYS A 1 157 ? 48.922  -18.653 -26.436  1.00 34.70 ? 146  LYS A CG  1 
ATOM   1033  C  CD  . LYS A 1 157 ? 48.462  -18.492 -27.896  1.00 36.84 ? 146  LYS A CD  1 
ATOM   1034  C  CE  . LYS A 1 157 ? 49.573  -18.031 -28.839  1.00 38.40 ? 146  LYS A CE  1 
ATOM   1035  N  NZ  . LYS A 1 157 ? 49.116  -17.071 -29.907  1.00 37.49 ? 146  LYS A NZ  1 
ATOM   1036  N  N   . GLY A 1 158 ? 49.619  -15.666 -23.974  1.00 29.88 ? 147  GLY A N   1 
ATOM   1037  C  CA  . GLY A 1 158 ? 50.224  -15.126 -22.769  1.00 29.52 ? 147  GLY A CA  1 
ATOM   1038  C  C   . GLY A 1 158 ? 49.485  -13.898 -22.290  1.00 29.06 ? 147  GLY A C   1 
ATOM   1039  O  O   . GLY A 1 158 ? 49.309  -13.721 -21.103  1.00 29.73 ? 147  GLY A O   1 
ATOM   1040  N  N   . ILE A 1 159 ? 49.009  -13.082 -23.233  1.00 29.21 ? 148  ILE A N   1 
ATOM   1041  C  CA  . ILE A 1 159 ? 48.385  -11.789 -22.932  1.00 27.49 ? 148  ILE A CA  1 
ATOM   1042  C  C   . ILE A 1 159 ? 47.043  -11.916 -22.235  1.00 26.06 ? 148  ILE A C   1 
ATOM   1043  O  O   . ILE A 1 159 ? 46.790  -11.194 -21.281  1.00 27.84 ? 148  ILE A O   1 
ATOM   1044  C  CB  . ILE A 1 159 ? 48.220  -10.957 -24.214  1.00 27.53 ? 148  ILE A CB  1 
ATOM   1045  C  CG1 . ILE A 1 159 ? 49.586  -10.725 -24.881  1.00 26.34 ? 148  ILE A CG1 1 
ATOM   1046  C  CG2 . ILE A 1 159 ? 47.565  -9.609  -23.896  1.00 29.11 ? 148  ILE A CG2 1 
ATOM   1047  C  CD1 . ILE A 1 159 ? 50.693  -10.292 -23.909  1.00 22.79 ? 148  ILE A CD1 1 
ATOM   1048  N  N   . GLN A 1 160 ? 46.202  -12.842 -22.692  1.00 25.95 ? 149  GLN A N   1 
ATOM   1049  C  CA  . GLN A 1 160 ? 44.882  -13.096 -22.100  1.00 25.44 ? 149  GLN A CA  1 
ATOM   1050  C  C   . GLN A 1 160 ? 44.927  -13.430 -20.610  1.00 25.30 ? 149  GLN A C   1 
ATOM   1051  O  O   . GLN A 1 160 ? 44.272  -12.799 -19.789  1.00 23.31 ? 149  GLN A O   1 
ATOM   1052  C  CB  . GLN A 1 160 ? 44.177  -14.232 -22.850  1.00 25.92 ? 149  GLN A CB  1 
ATOM   1053  C  CG  . GLN A 1 160 ? 42.706  -14.435 -22.419  1.00 25.96 ? 149  GLN A CG  1 
ATOM   1054  C  CD  . GLN A 1 160 ? 42.043  -15.659 -23.013  1.00 25.29 ? 149  GLN A CD  1 
ATOM   1055  O  OE1 . GLN A 1 160 ? 42.371  -16.097 -24.120  1.00 28.85 ? 149  GLN A OE1 1 
ATOM   1056  N  NE2 . GLN A 1 160 ? 41.087  -16.208 -22.284  1.00 26.13 ? 149  GLN A NE2 1 
ATOM   1057  N  N   . GLU A 1 161 ? 45.711  -14.440 -20.277  1.00 26.24 ? 150  GLU A N   1 
ATOM   1058  C  CA  . GLU A 1 161 ? 45.901  -14.857 -18.898  1.00 26.87 ? 150  GLU A CA  1 
ATOM   1059  C  C   . GLU A 1 161 ? 46.414  -13.697 -17.989  1.00 25.29 ? 150  GLU A C   1 
ATOM   1060  O  O   . GLU A 1 161 ? 46.092  -13.627 -16.795  1.00 25.52 ? 150  GLU A O   1 
ATOM   1061  C  CB  . GLU A 1 161 ? 46.857  -16.060 -18.907  1.00 28.21 ? 150  GLU A CB  1 
ATOM   1062  C  CG  . GLU A 1 161 ? 47.040  -16.780 -17.557  1.00 29.91 ? 150  GLU A CG  1 
ATOM   1063  C  CD  . GLU A 1 161 ? 48.016  -17.977 -17.632  1.00 31.96 ? 150  GLU A CD  1 
ATOM   1064  O  OE1 . GLU A 1 161 ? 48.096  -18.631 -18.713  1.00 37.97 ? 150  GLU A OE1 1 
ATOM   1065  O  OE2 . GLU A 1 161 ? 48.687  -18.262 -16.600  1.00 37.70 ? 150  GLU A OE2 1 
ATOM   1066  N  N   . GLU A 1 162 ? 47.213  -12.805 -18.576  1.00 24.26 ? 151  GLU A N   1 
ATOM   1067  C  CA  . GLU A 1 162 ? 47.719  -11.584 -17.926  1.00 23.07 ? 151  GLU A CA  1 
ATOM   1068  C  C   . GLU A 1 162 ? 46.621  -10.569 -17.681  1.00 21.81 ? 151  GLU A C   1 
ATOM   1069  O  O   . GLU A 1 162 ? 46.564  -9.944  -16.618  1.00 20.13 ? 151  GLU A O   1 
ATOM   1070  C  CB  . GLU A 1 162 ? 48.796  -10.912 -18.788  1.00 23.19 ? 151  GLU A CB  1 
ATOM   1071  C  CG  . GLU A 1 162 ? 50.188  -11.503 -18.658  1.00 23.53 ? 151  GLU A CG  1 
ATOM   1072  C  CD  . GLU A 1 162 ? 51.258  -10.458 -18.829  1.00 24.13 ? 151  GLU A CD  1 
ATOM   1073  O  OE1 . GLU A 1 162 ? 51.740  -9.938  -17.801  1.00 28.79 ? 151  GLU A OE1 1 
ATOM   1074  O  OE2 . GLU A 1 162 ? 51.603  -10.133 -19.979  1.00 21.15 ? 151  GLU A OE2 1 
ATOM   1075  N  N   . MET A 1 163 ? 45.762  -10.391 -18.677  1.00 20.30 ? 152  MET A N   1 
ATOM   1076  C  CA  . MET A 1 163 ? 44.595  -9.504  -18.552  1.00 20.79 ? 152  MET A CA  1 
ATOM   1077  C  C   . MET A 1 163 ? 43.650  -9.959  -17.463  1.00 20.86 ? 152  MET A C   1 
ATOM   1078  O  O   . MET A 1 163 ? 43.215  -9.180  -16.630  1.00 19.95 ? 152  MET A O   1 
ATOM   1079  C  CB  . MET A 1 163 ? 43.862  -9.403  -19.887  1.00 20.51 ? 152  MET A CB  1 
ATOM   1080  C  CG  . MET A 1 163 ? 44.661  -8.660  -20.887  1.00 19.79 ? 152  MET A CG  1 
ATOM   1081  S  SD  . MET A 1 163 ? 44.019  -8.685  -22.586  1.00 21.21 ? 152  MET A SD  1 
ATOM   1082  C  CE  . MET A 1 163 ? 43.419  -10.333 -22.808  1.00 28.70 ? 152  MET A CE  1 
ATOM   1083  N  N   . GLU A 1 164 ? 43.358  -11.243 -17.450  1.00 21.86 ? 153  GLU A N   1 
ATOM   1084  C  CA  . GLU A 1 164 ? 42.487  -11.783 -16.438  1.00 23.36 ? 153  GLU A CA  1 
ATOM   1085  C  C   . GLU A 1 164 ? 42.988  -11.451 -15.018  1.00 22.62 ? 153  GLU A C   1 
ATOM   1086  O  O   . GLU A 1 164 ? 42.210  -11.051 -14.156  1.00 21.41 ? 153  GLU A O   1 
ATOM   1087  C  CB  . GLU A 1 164 ? 42.368  -13.301 -16.641  1.00 23.91 ? 153  GLU A CB  1 
ATOM   1088  C  CG  . GLU A 1 164 ? 41.715  -13.718 -17.976  1.00 25.58 ? 153  GLU A CG  1 
ATOM   1089  C  CD  . GLU A 1 164 ? 41.678  -15.217 -18.129  1.00 27.41 ? 153  GLU A CD  1 
ATOM   1090  O  OE1 . GLU A 1 164 ? 42.191  -15.894 -17.206  1.00 36.50 ? 153  GLU A OE1 1 
ATOM   1091  O  OE2 . GLU A 1 164 ? 41.129  -15.726 -19.143  1.00 34.43 ? 153  GLU A OE2 1 
ATOM   1092  N  N   . ALA A 1 165 ? 44.289  -11.616 -14.787  1.00 23.62 ? 154  ALA A N   1 
ATOM   1093  C  CA  . ALA A 1 165 ? 44.884  -11.411 -13.456  1.00 24.06 ? 154  ALA A CA  1 
ATOM   1094  C  C   . ALA A 1 165 ? 44.927  -9.928  -13.087  1.00 24.62 ? 154  ALA A C   1 
ATOM   1095  O  O   . ALA A 1 165 ? 44.743  -9.552  -11.937  1.00 25.46 ? 154  ALA A O   1 
ATOM   1096  C  CB  . ALA A 1 165 ? 46.282  -12.017 -13.424  1.00 24.68 ? 154  ALA A CB  1 
ATOM   1097  N  N   . LEU A 1 166 ? 45.131  -9.086  -14.092  1.00 25.01 ? 155  LEU A N   1 
ATOM   1098  C  CA  . LEU A 1 166 ? 45.055  -7.647  -13.906  1.00 24.88 ? 155  LEU A CA  1 
ATOM   1099  C  C   . LEU A 1 166 ? 43.677  -7.235  -13.404  1.00 25.23 ? 155  LEU A C   1 
ATOM   1100  O  O   . LEU A 1 166 ? 43.567  -6.482  -12.451  1.00 25.74 ? 155  LEU A O   1 
ATOM   1101  C  CB  . LEU A 1 166 ? 45.467  -6.910  -15.201  1.00 24.76 ? 155  LEU A CB  1 
ATOM   1102  C  CG  . LEU A 1 166 ? 46.995  -6.872  -15.507  1.00 22.12 ? 155  LEU A CG  1 
ATOM   1103  C  CD1 . LEU A 1 166 ? 47.316  -6.465  -16.951  1.00 19.64 ? 155  LEU A CD1 1 
ATOM   1104  C  CD2 . LEU A 1 166 ? 47.714  -5.962  -14.533  1.00 19.51 ? 155  LEU A CD2 1 
ATOM   1105  N  N   . VAL A 1 167 ? 42.631  -7.763  -14.026  1.00 26.61 ? 156  VAL A N   1 
ATOM   1106  C  CA  . VAL A 1 167 ? 41.219  -7.559  -13.578  1.00 27.06 ? 156  VAL A CA  1 
ATOM   1107  C  C   . VAL A 1 167 ? 40.853  -8.318  -12.283  1.00 27.63 ? 156  VAL A C   1 
ATOM   1108  O  O   . VAL A 1 167 ? 40.051  -7.854  -11.475  1.00 27.99 ? 156  VAL A O   1 
ATOM   1109  C  CB  . VAL A 1 167 ? 40.212  -7.972  -14.715  1.00 27.10 ? 156  VAL A CB  1 
ATOM   1110  C  CG1 . VAL A 1 167 ? 38.754  -7.815  -14.259  1.00 25.97 ? 156  VAL A CG1 1 
ATOM   1111  C  CG2 . VAL A 1 167 ? 40.481  -7.173  -15.987  1.00 24.88 ? 156  VAL A CG2 1 
ATOM   1112  N  N   . LYS A 1 168 ? 41.425  -9.505  -12.124  1.00 28.31 ? 157  LYS A N   1 
ATOM   1113  C  CA  . LYS A 1 168 ? 41.254  -10.315 -10.925  1.00 28.28 ? 157  LYS A CA  1 
ATOM   1114  C  C   . LYS A 1 168 ? 41.833  -9.576  -9.712   1.00 28.76 ? 157  LYS A C   1 
ATOM   1115  O  O   . LYS A 1 168 ? 41.115  -9.251  -8.763   1.00 28.88 ? 157  LYS A O   1 
ATOM   1116  C  CB  . LYS A 1 168 ? 41.974  -11.668 -11.128  1.00 28.61 ? 157  LYS A CB  1 
ATOM   1117  C  CG  . LYS A 1 168 ? 41.368  -12.864 -10.409  1.00 28.35 ? 157  LYS A CG  1 
ATOM   1118  C  CD  . LYS A 1 168 ? 42.151  -14.183 -10.703  1.00 28.84 ? 157  LYS A CD  1 
ATOM   1119  C  CE  . LYS A 1 168 ? 41.982  -14.774 -12.150  1.00 28.69 ? 157  LYS A CE  1 
ATOM   1120  N  NZ  . LYS A 1 168 ? 43.182  -14.631 -13.028  1.00 25.61 ? 157  LYS A NZ  1 
ATOM   1121  N  N   . ASP A 1 169 ? 43.131  -9.276  -9.786   1.00 28.80 ? 158  ASP A N   1 
ATOM   1122  C  CA  . ASP A 1 169 ? 43.918  -8.878  -8.624   1.00 28.42 ? 158  ASP A CA  1 
ATOM   1123  C  C   . ASP A 1 169 ? 44.453  -7.461  -8.632   1.00 27.84 ? 158  ASP A C   1 
ATOM   1124  O  O   . ASP A 1 169 ? 44.873  -6.974  -7.585   1.00 28.53 ? 158  ASP A O   1 
ATOM   1125  C  CB  . ASP A 1 169 ? 45.108  -9.808  -8.500   1.00 29.67 ? 158  ASP A CB  1 
ATOM   1126  C  CG  . ASP A 1 169 ? 44.718  -11.248 -8.540   1.00 30.40 ? 158  ASP A CG  1 
ATOM   1127  O  OD1 . ASP A 1 169 ? 43.560  -11.562 -8.207   1.00 33.93 ? 158  ASP A OD1 1 
ATOM   1128  O  OD2 . ASP A 1 169 ? 45.587  -12.072 -8.901   1.00 35.54 ? 158  ASP A OD2 1 
ATOM   1129  N  N   . HIS A 1 170 ? 44.450  -6.786  -9.780   1.00 25.92 ? 159  HIS A N   1 
ATOM   1130  C  CA  . HIS A 1 170 ? 45.117  -5.498  -9.848   1.00 24.32 ? 159  HIS A CA  1 
ATOM   1131  C  C   . HIS A 1 170 ? 44.222  -4.266  -9.969   1.00 22.67 ? 159  HIS A C   1 
ATOM   1132  O  O   . HIS A 1 170 ? 44.735  -3.163  -10.079  1.00 21.49 ? 159  HIS A O   1 
ATOM   1133  C  CB  . HIS A 1 170 ? 46.206  -5.567  -10.911  1.00 25.82 ? 159  HIS A CB  1 
ATOM   1134  C  CG  . HIS A 1 170 ? 47.239  -6.591  -10.583  1.00 27.50 ? 159  HIS A CG  1 
ATOM   1135  N  ND1 . HIS A 1 170 ? 48.207  -6.373  -9.629   1.00 29.32 ? 159  HIS A ND1 1 
ATOM   1136  C  CD2 . HIS A 1 170 ? 47.381  -7.877  -10.976  1.00 30.15 ? 159  HIS A CD2 1 
ATOM   1137  C  CE1 . HIS A 1 170 ? 48.934  -7.465  -9.485   1.00 30.87 ? 159  HIS A CE1 1 
ATOM   1138  N  NE2 . HIS A 1 170 ? 48.449  -8.395  -10.286  1.00 31.04 ? 159  HIS A NE2 1 
ATOM   1139  N  N   . GLY A 1 171 ? 42.905  -4.438  -9.871   1.00 20.17 ? 160  GLY A N   1 
ATOM   1140  C  CA  . GLY A 1 171 ? 41.995  -3.322  -9.900   1.00 19.06 ? 160  GLY A CA  1 
ATOM   1141  C  C   . GLY A 1 171 ? 42.003  -2.614  -11.236  1.00 17.40 ? 160  GLY A C   1 
ATOM   1142  O  O   . GLY A 1 171 ? 41.874  -1.414  -11.296  1.00 17.43 ? 160  GLY A O   1 
ATOM   1143  N  N   . VAL A 1 172 ? 42.221  -3.367  -12.298  1.00 17.34 ? 161  VAL A N   1 
ATOM   1144  C  CA  . VAL A 1 172 ? 42.103  -2.867  -13.668  1.00 15.89 ? 161  VAL A CA  1 
ATOM   1145  C  C   . VAL A 1 172 ? 40.773  -3.369  -14.221  1.00 16.13 ? 161  VAL A C   1 
ATOM   1146  O  O   . VAL A 1 172 ? 40.393  -4.525  -13.952  1.00 16.43 ? 161  VAL A O   1 
ATOM   1147  C  CB  . VAL A 1 172 ? 43.209  -3.444  -14.568  1.00 16.16 ? 161  VAL A CB  1 
ATOM   1148  C  CG1 . VAL A 1 172 ? 43.039  -3.014  -16.024  1.00 12.36 ? 161  VAL A CG1 1 
ATOM   1149  C  CG2 . VAL A 1 172 ? 44.565  -3.047  -14.082  1.00 16.06 ? 161  VAL A CG2 1 
ATOM   1150  N  N   . ASN A 1 173 ? 40.059  -2.498  -14.954  1.00 14.78 ? 162  ASN A N   1 
ATOM   1151  C  CA  . ASN A 1 173 ? 38.879  -2.902  -15.722  1.00 14.34 ? 162  ASN A CA  1 
ATOM   1152  C  C   . ASN A 1 173 ? 38.809  -2.297  -17.145  1.00 13.21 ? 162  ASN A C   1 
ATOM   1153  O  O   . ASN A 1 173 ? 37.713  -2.168  -17.685  1.00 11.66 ? 162  ASN A O   1 
ATOM   1154  C  CB  . ASN A 1 173 ? 37.574  -2.624  -14.971  1.00 13.20 ? 162  ASN A CB  1 
ATOM   1155  C  CG  . ASN A 1 173 ? 37.229  -1.129  -14.860  1.00 16.35 ? 162  ASN A CG  1 
ATOM   1156  O  OD1 . ASN A 1 173 ? 37.833  -0.266  -15.507  1.00 16.32 ? 162  ASN A OD1 1 
ATOM   1157  N  ND2 . ASN A 1 173 ? 36.254  -0.824  -13.996  1.00 13.51 ? 162  ASN A ND2 1 
ATOM   1158  N  N   . SER A 1 174 ? 39.957  -1.867  -17.673  1.00 13.52 ? 163  SER A N   1 
ATOM   1159  C  CA  . SER A 1 174 ? 40.032  -1.287  -19.009  1.00 13.45 ? 163  SER A CA  1 
ATOM   1160  C  C   . SER A 1 174 ? 41.348  -1.560  -19.729  1.00 13.98 ? 163  SER A C   1 
ATOM   1161  O  O   . SER A 1 174 ? 42.405  -1.507  -19.139  1.00 13.14 ? 163  SER A O   1 
ATOM   1162  C  CB  . SER A 1 174 ? 39.734  0.210   -18.970  1.00 14.01 ? 163  SER A CB  1 
ATOM   1163  O  OG  . SER A 1 174 ? 40.461  0.906   -17.972  1.00 17.62 ? 163  SER A OG  1 
ATOM   1164  N  N   . PHE A 1 175 ? 41.255  -1.815  -21.047  1.00 13.96 ? 164  PHE A N   1 
ATOM   1165  C  CA  . PHE A 1 175 ? 42.389  -2.227  -21.895  1.00 14.76 ? 164  PHE A CA  1 
ATOM   1166  C  C   . PHE A 1 175 ? 42.176  -1.571  -23.219  1.00 14.89 ? 164  PHE A C   1 
ATOM   1167  O  O   . PHE A 1 175 ? 41.019  -1.355  -23.573  1.00 14.39 ? 164  PHE A O   1 
ATOM   1168  C  CB  . PHE A 1 175 ? 42.430  -3.754  -22.112  1.00 15.75 ? 164  PHE A CB  1 
ATOM   1169  C  CG  . PHE A 1 175 ? 42.604  -4.517  -20.840  1.00 17.65 ? 164  PHE A CG  1 
ATOM   1170  C  CD1 . PHE A 1 175 ? 41.500  -4.958  -20.127  1.00 14.65 ? 164  PHE A CD1 1 
ATOM   1171  C  CD2 . PHE A 1 175 ? 43.862  -4.747  -20.332  1.00 19.00 ? 164  PHE A CD2 1 
ATOM   1172  C  CE1 . PHE A 1 175 ? 41.636  -5.624  -18.957  1.00 18.96 ? 164  PHE A CE1 1 
ATOM   1173  C  CE2 . PHE A 1 175 ? 44.020  -5.437  -19.125  1.00 19.74 ? 164  PHE A CE2 1 
ATOM   1174  C  CZ  . PHE A 1 175 ? 42.906  -5.862  -18.434  1.00 19.42 ? 164  PHE A CZ  1 
ATOM   1175  N  N   . LEU A 1 176 ? 43.271  -1.223  -23.907  1.00 15.05 ? 165  LEU A N   1 
ATOM   1176  C  CA  . LEU A 1 176 ? 43.210  -0.563  -25.217  1.00 14.47 ? 165  LEU A CA  1 
ATOM   1177  C  C   . LEU A 1 176 ? 43.914  -1.346  -26.305  1.00 14.96 ? 165  LEU A C   1 
ATOM   1178  O  O   . LEU A 1 176 ? 45.012  -1.875  -26.092  1.00 16.02 ? 165  LEU A O   1 
ATOM   1179  C  CB  . LEU A 1 176 ? 43.792  0.850   -25.104  1.00 13.91 ? 165  LEU A CB  1 
ATOM   1180  C  CG  . LEU A 1 176 ? 43.801  1.692   -26.386  1.00 14.87 ? 165  LEU A CG  1 
ATOM   1181  C  CD1 . LEU A 1 176 ? 43.752  3.175   -26.104  1.00 17.04 ? 165  LEU A CD1 1 
ATOM   1182  C  CD2 . LEU A 1 176 ? 45.051  1.355   -27.142  1.00 18.48 ? 165  LEU A CD2 1 
ATOM   1183  N  N   . VAL A 1 177 ? 43.306  -1.409  -27.496  1.00 16.26 ? 166  VAL A N   1 
ATOM   1184  C  CA  . VAL A 1 177 ? 43.967  -2.008  -28.667  1.00 15.21 ? 166  VAL A CA  1 
ATOM   1185  C  C   . VAL A 1 177 ? 44.133  -0.946  -29.750  1.00 16.63 ? 166  VAL A C   1 
ATOM   1186  O  O   . VAL A 1 177 ? 43.337  -0.008  -29.820  1.00 16.20 ? 166  VAL A O   1 
ATOM   1187  C  CB  . VAL A 1 177 ? 43.247  -3.325  -29.231  1.00 15.98 ? 166  VAL A CB  1 
ATOM   1188  C  CG1 . VAL A 1 177 ? 43.051  -4.369  -28.124  1.00 16.66 ? 166  VAL A CG1 1 
ATOM   1189  C  CG2 . VAL A 1 177 ? 41.887  -3.040  -29.929  1.00 13.65 ? 166  VAL A CG2 1 
ATOM   1190  N  N   . TYR A 1 178 ? 45.193  -1.088  -30.558  1.00 14.14 ? 167  TYR A N   1 
ATOM   1191  C  CA  . TYR A 1 178 ? 45.535  -0.124  -31.558  1.00 15.32 ? 167  TYR A CA  1 
ATOM   1192  C  C   . TYR A 1 178 ? 45.212  -0.741  -32.899  1.00 14.33 ? 167  TYR A C   1 
ATOM   1193  O  O   . TYR A 1 178 ? 45.340  -1.953  -33.115  1.00 14.69 ? 167  TYR A O   1 
ATOM   1194  C  CB  . TYR A 1 178 ? 47.018  0.267   -31.541  1.00 16.90 ? 167  TYR A CB  1 
ATOM   1195  C  CG  . TYR A 1 178 ? 47.493  1.054   -30.331  1.00 18.34 ? 167  TYR A CG  1 
ATOM   1196  C  CD1 . TYR A 1 178 ? 47.847  0.403   -29.155  1.00 19.70 ? 167  TYR A CD1 1 
ATOM   1197  C  CD2 . TYR A 1 178 ? 47.648  2.446   -30.387  1.00 18.92 ? 167  TYR A CD2 1 
ATOM   1198  C  CE1 . TYR A 1 178 ? 48.291  1.120   -28.035  1.00 20.33 ? 167  TYR A CE1 1 
ATOM   1199  C  CE2 . TYR A 1 178 ? 48.104  3.183   -29.257  1.00 19.47 ? 167  TYR A CE2 1 
ATOM   1200  C  CZ  . TYR A 1 178 ? 48.421  2.519   -28.103  1.00 20.07 ? 167  TYR A CZ  1 
ATOM   1201  O  OH  . TYR A 1 178 ? 48.893  3.223   -27.004  1.00 21.93 ? 167  TYR A OH  1 
ATOM   1202  N  N   . MET A 1 179 ? 44.741  0.125   -33.774  1.00 15.12 ? 168  MET A N   1 
ATOM   1203  C  CA  A MET A 1 179 ? 44.372  -0.270  -35.115  0.50 15.52 ? 168  MET A CA  1 
ATOM   1204  C  CA  B MET A 1 179 ? 44.342  -0.220  -35.133  0.50 13.18 ? 168  MET A CA  1 
ATOM   1205  C  C   . MET A 1 179 ? 45.306  0.453   -36.092  1.00 14.72 ? 168  MET A C   1 
ATOM   1206  O  O   . MET A 1 179 ? 45.289  0.175   -37.307  1.00 13.78 ? 168  MET A O   1 
ATOM   1207  C  CB  A MET A 1 179 ? 42.893  0.064   -35.340  0.50 15.93 ? 168  MET A CB  1 
ATOM   1208  C  CB  B MET A 1 179 ? 42.932  0.311   -35.416  0.50 13.07 ? 168  MET A CB  1 
ATOM   1209  C  CG  A MET A 1 179 ? 42.009  -0.309  -34.136  0.50 15.57 ? 168  MET A CG  1 
ATOM   1210  C  CG  B MET A 1 179 ? 41.855  -0.732  -35.496  0.50 9.45  ? 168  MET A CG  1 
ATOM   1211  S  SD  A MET A 1 179 ? 40.256  0.038   -34.309  0.50 19.00 ? 168  MET A SD  1 
ATOM   1212  S  SD  B MET A 1 179 ? 40.235  -0.009  -35.593  0.50 5.19  ? 168  MET A SD  1 
ATOM   1213  C  CE  A MET A 1 179 ? 39.827  -1.107  -35.615  0.50 13.71 ? 168  MET A CE  1 
ATOM   1214  C  CE  B MET A 1 179 ? 40.121  0.510   -33.861  0.50 2.00  ? 168  MET A CE  1 
ATOM   1215  N  N   . ALA A 1 180 ? 46.113  1.374   -35.532  1.00 15.94 ? 169  ALA A N   1 
ATOM   1216  C  CA  . ALA A 1 180 ? 47.175  2.098   -36.223  1.00 17.67 ? 169  ALA A CA  1 
ATOM   1217  C  C   . ALA A 1 180 ? 48.516  1.686   -35.609  1.00 18.37 ? 169  ALA A C   1 
ATOM   1218  O  O   . ALA A 1 180 ? 48.562  0.801   -34.735  1.00 19.14 ? 169  ALA A O   1 
ATOM   1219  C  CB  . ALA A 1 180 ? 46.962  3.628   -36.110  1.00 17.79 ? 169  ALA A CB  1 
ATOM   1220  N  N   . PHE A 1 181 ? 49.589  2.344   -36.060  1.00 19.24 ? 170  PHE A N   1 
ATOM   1221  C  CA  . PHE A 1 181 ? 50.992  2.002   -35.691  1.00 18.72 ? 170  PHE A CA  1 
ATOM   1222  C  C   . PHE A 1 181 ? 51.352  0.616   -36.184  1.00 18.37 ? 170  PHE A C   1 
ATOM   1223  O  O   . PHE A 1 181 ? 51.653  -0.302  -35.427  1.00 17.16 ? 170  PHE A O   1 
ATOM   1224  C  CB  . PHE A 1 181 ? 51.218  2.172   -34.191  1.00 18.81 ? 170  PHE A CB  1 
ATOM   1225  C  CG  . PHE A 1 181 ? 50.898  3.529   -33.720  1.00 19.55 ? 170  PHE A CG  1 
ATOM   1226  C  CD1 . PHE A 1 181 ? 51.656  4.602   -34.128  1.00 21.10 ? 170  PHE A CD1 1 
ATOM   1227  C  CD2 . PHE A 1 181 ? 49.817  3.754   -32.898  1.00 18.33 ? 170  PHE A CD2 1 
ATOM   1228  C  CE1 . PHE A 1 181 ? 51.344  5.881   -33.709  1.00 22.01 ? 170  PHE A CE1 1 
ATOM   1229  C  CE2 . PHE A 1 181 ? 49.506  5.013   -32.496  1.00 19.88 ? 170  PHE A CE2 1 
ATOM   1230  C  CZ  . PHE A 1 181 ? 50.265  6.080   -32.889  1.00 19.46 ? 170  PHE A CZ  1 
ATOM   1231  N  N   . LYS A 1 182 ? 51.305  0.485   -37.504  1.00 18.96 ? 171  LYS A N   1 
ATOM   1232  C  CA  . LYS A 1 182 ? 51.554  -0.766  -38.176  1.00 20.75 ? 171  LYS A CA  1 
ATOM   1233  C  C   . LYS A 1 182 ? 52.904  -1.301  -37.794  1.00 21.94 ? 171  LYS A C   1 
ATOM   1234  O  O   . LYS A 1 182 ? 53.830  -0.547  -37.569  1.00 23.21 ? 171  LYS A O   1 
ATOM   1235  C  CB  . LYS A 1 182 ? 51.489  -0.550  -39.701  1.00 19.94 ? 171  LYS A CB  1 
ATOM   1236  C  CG  . LYS A 1 182 ? 51.994  -1.685  -40.560  1.00 20.30 ? 171  LYS A CG  1 
ATOM   1237  C  CD  . LYS A 1 182 ? 52.048  -1.195  -42.006  1.00 20.89 ? 171  LYS A CD  1 
ATOM   1238  C  CE  . LYS A 1 182 ? 52.578  -2.223  -42.959  1.00 20.68 ? 171  LYS A CE  1 
ATOM   1239  N  NZ  . LYS A 1 182 ? 51.899  -2.099  -44.295  1.00 23.48 ? 171  LYS A NZ  1 
ATOM   1240  N  N   . ASP A 1 183 ? 53.001  -2.616  -37.710  1.00 24.07 ? 172  ASP A N   1 
ATOM   1241  C  CA  . ASP A 1 183 ? 54.223  -3.313  -37.260  1.00 24.93 ? 172  ASP A CA  1 
ATOM   1242  C  C   . ASP A 1 183 ? 54.847  -2.831  -35.934  1.00 25.60 ? 172  ASP A C   1 
ATOM   1243  O  O   . ASP A 1 183 ? 55.987  -3.212  -35.589  1.00 26.27 ? 172  ASP A O   1 
ATOM   1244  C  CB  . ASP A 1 183 ? 55.251  -3.325  -38.387  1.00 26.61 ? 172  ASP A CB  1 
ATOM   1245  C  CG  . ASP A 1 183 ? 54.762  -4.086  -39.605  1.00 27.74 ? 172  ASP A CG  1 
ATOM   1246  O  OD1 . ASP A 1 183 ? 54.246  -5.220  -39.427  1.00 27.03 ? 172  ASP A OD1 1 
ATOM   1247  O  OD2 . ASP A 1 183 ? 54.904  -3.549  -40.732  1.00 31.81 ? 172  ASP A OD2 1 
ATOM   1248  N  N   . ARG A 1 184 ? 54.090  -2.041  -35.176  1.00 24.80 ? 173  ARG A N   1 
ATOM   1249  C  CA  . ARG A 1 184 ? 54.481  -1.663  -33.818  1.00 23.53 ? 173  ARG A CA  1 
ATOM   1250  C  C   . ARG A 1 184 ? 53.431  -2.041  -32.763  1.00 22.45 ? 173  ARG A C   1 
ATOM   1251  O  O   . ARG A 1 184 ? 53.769  -2.735  -31.797  1.00 22.74 ? 173  ARG A O   1 
ATOM   1252  C  CB  . ARG A 1 184 ? 54.797  -0.178  -33.771  1.00 23.94 ? 173  ARG A CB  1 
ATOM   1253  C  CG  . ARG A 1 184 ? 54.599  0.470   -32.418  1.00 25.54 ? 173  ARG A CG  1 
ATOM   1254  C  CD  . ARG A 1 184 ? 55.777  1.309   -32.032  1.00 29.19 ? 173  ARG A CD  1 
ATOM   1255  N  NE  . ARG A 1 184 ? 56.804  0.477   -31.409  1.00 29.94 ? 173  ARG A NE  1 
ATOM   1256  C  CZ  . ARG A 1 184 ? 57.117  0.472   -30.118  1.00 30.61 ? 173  ARG A CZ  1 
ATOM   1257  N  NH1 . ARG A 1 184 ? 58.072  -0.339  -29.690  1.00 32.58 ? 173  ARG A NH1 1 
ATOM   1258  N  NH2 . ARG A 1 184 ? 56.506  1.270   -29.251  1.00 30.40 ? 173  ARG A NH2 1 
ATOM   1259  N  N   . PHE A 1 185 ? 52.192  -1.556  -32.920  1.00 20.83 ? 174  PHE A N   1 
ATOM   1260  C  CA  . PHE A 1 185 ? 51.084  -1.868  -31.983  1.00 20.85 ? 174  PHE A CA  1 
ATOM   1261  C  C   . PHE A 1 185 ? 49.823  -2.512  -32.611  1.00 19.40 ? 174  PHE A C   1 
ATOM   1262  O  O   . PHE A 1 185 ? 49.018  -3.175  -31.940  1.00 18.26 ? 174  PHE A O   1 
ATOM   1263  C  CB  . PHE A 1 185 ? 50.608  -0.591  -31.294  1.00 23.18 ? 174  PHE A CB  1 
ATOM   1264  C  CG  . PHE A 1 185 ? 51.567  -0.006  -30.313  1.00 24.47 ? 174  PHE A CG  1 
ATOM   1265  C  CD1 . PHE A 1 185 ? 52.342  -0.810  -29.484  1.00 26.71 ? 174  PHE A CD1 1 
ATOM   1266  C  CD2 . PHE A 1 185 ? 51.628  1.377   -30.163  1.00 26.32 ? 174  PHE A CD2 1 
ATOM   1267  C  CE1 . PHE A 1 185 ? 53.202  -0.252  -28.540  1.00 26.34 ? 174  PHE A CE1 1 
ATOM   1268  C  CE2 . PHE A 1 185 ? 52.460  1.950   -29.233  1.00 27.72 ? 174  PHE A CE2 1 
ATOM   1269  C  CZ  . PHE A 1 185 ? 53.263  1.130   -28.407  1.00 28.73 ? 174  PHE A CZ  1 
ATOM   1270  N  N   . GLN A 1 186 ? 49.625  -2.239  -33.891  1.00 16.23 ? 175  GLN A N   1 
ATOM   1271  C  CA  . GLN A 1 186 ? 48.424  -2.586  -34.608  1.00 15.86 ? 175  GLN A CA  1 
ATOM   1272  C  C   . GLN A 1 186 ? 48.056  -4.061  -34.563  1.00 15.23 ? 175  GLN A C   1 
ATOM   1273  O  O   . GLN A 1 186 ? 48.903  -4.935  -34.661  1.00 17.70 ? 175  GLN A O   1 
ATOM   1274  C  CB  . GLN A 1 186 ? 48.635  -2.177  -36.050  1.00 13.24 ? 175  GLN A CB  1 
ATOM   1275  C  CG  . GLN A 1 186 ? 47.537  -2.547  -37.007  1.00 16.21 ? 175  GLN A CG  1 
ATOM   1276  C  CD  . GLN A 1 186 ? 47.807  -1.939  -38.344  1.00 14.62 ? 175  GLN A CD  1 
ATOM   1277  O  OE1 . GLN A 1 186 ? 48.374  -0.854  -38.419  1.00 16.18 ? 175  GLN A OE1 1 
ATOM   1278  N  NE2 . GLN A 1 186 ? 47.440  -2.623  -39.410  1.00 22.72 ? 175  GLN A NE2 1 
ATOM   1279  N  N   . LEU A 1 187 ? 46.764  -4.319  -34.449  1.00 14.34 ? 176  LEU A N   1 
ATOM   1280  C  CA  . LEU A 1 187 ? 46.210  -5.668  -34.364  1.00 14.51 ? 176  LEU A CA  1 
ATOM   1281  C  C   . LEU A 1 187 ? 45.379  -5.828  -35.636  1.00 14.46 ? 176  LEU A C   1 
ATOM   1282  O  O   . LEU A 1 187 ? 44.861  -4.870  -36.144  1.00 14.75 ? 176  LEU A O   1 
ATOM   1283  C  CB  . LEU A 1 187 ? 45.360  -5.814  -33.088  1.00 15.37 ? 176  LEU A CB  1 
ATOM   1284  C  CG  . LEU A 1 187 ? 45.925  -6.538  -31.847  1.00 14.66 ? 176  LEU A CG  1 
ATOM   1285  C  CD1 . LEU A 1 187 ? 47.459  -6.412  -31.628  1.00 16.45 ? 176  LEU A CD1 1 
ATOM   1286  C  CD2 . LEU A 1 187 ? 45.155  -6.302  -30.495  1.00 14.67 ? 176  LEU A CD2 1 
ATOM   1287  N  N   . THR A 1 188 ? 45.242  -7.043  -36.123  1.00 13.87 ? 177  THR A N   1 
ATOM   1288  C  CA  . THR A 1 188 ? 44.379  -7.309  -37.259  1.00 14.74 ? 177  THR A CA  1 
ATOM   1289  C  C   . THR A 1 188 ? 42.955  -7.489  -36.733  1.00 13.75 ? 177  THR A C   1 
ATOM   1290  O  O   . THR A 1 188 ? 42.736  -7.625  -35.533  1.00 10.96 ? 177  THR A O   1 
ATOM   1291  C  CB  . THR A 1 188 ? 44.877  -8.535  -38.030  1.00 13.77 ? 177  THR A CB  1 
ATOM   1292  O  OG1 . THR A 1 188 ? 44.605  -9.710  -37.279  1.00 11.09 ? 177  THR A OG1 1 
ATOM   1293  C  CG2 . THR A 1 188 ? 46.361  -8.445  -38.213  1.00 15.54 ? 177  THR A CG2 1 
ATOM   1294  N  N   . ASP A 1 189 ? 41.999  -7.481  -37.643  1.00 14.26 ? 178  ASP A N   1 
ATOM   1295  C  CA  . ASP A 1 189 ? 40.590  -7.561  -37.280  1.00 16.28 ? 178  ASP A CA  1 
ATOM   1296  C  C   . ASP A 1 189 ? 40.263  -8.847  -36.538  1.00 16.95 ? 178  ASP A C   1 
ATOM   1297  O  O   . ASP A 1 189 ? 39.499  -8.815  -35.552  1.00 18.21 ? 178  ASP A O   1 
ATOM   1298  C  CB  . ASP A 1 189 ? 39.714  -7.432  -38.544  1.00 15.92 ? 178  ASP A CB  1 
ATOM   1299  C  CG  . ASP A 1 189 ? 39.635  -6.001  -39.052  1.00 19.21 ? 178  ASP A CG  1 
ATOM   1300  O  OD1 . ASP A 1 189 ? 39.914  -5.099  -38.226  1.00 17.27 ? 178  ASP A OD1 1 
ATOM   1301  O  OD2 . ASP A 1 189 ? 39.309  -5.783  -40.262  1.00 20.04 ? 178  ASP A OD2 1 
ATOM   1302  N  N   . CYS A 1 190 ? 40.861  -9.969  -36.955  1.00 18.29 ? 179  CYS A N   1 
ATOM   1303  C  CA  . CYS A 1 190 ? 40.639  -11.243 -36.229  1.00 19.92 ? 179  CYS A CA  1 
ATOM   1304  C  C   . CYS A 1 190 ? 41.256  -11.254 -34.816  1.00 20.48 ? 179  CYS A C   1 
ATOM   1305  O  O   . CYS A 1 190 ? 40.735  -11.937 -33.924  1.00 21.26 ? 179  CYS A O   1 
ATOM   1306  C  CB  . CYS A 1 190 ? 41.085  -12.454 -37.057  1.00 21.27 ? 179  CYS A CB  1 
ATOM   1307  S  SG  . CYS A 1 190 ? 42.849  -12.586 -37.360  1.00 33.61 ? 179  CYS A SG  1 
ATOM   1308  N  N   . GLN A 1 191 ? 42.334  -10.487 -34.604  1.00 18.55 ? 180  GLN A N   1 
ATOM   1309  C  CA  . GLN A 1 191 ? 42.936  -10.343 -33.279  1.00 17.83 ? 180  GLN A CA  1 
ATOM   1310  C  C   . GLN A 1 191 ? 42.113  -9.447  -32.404  1.00 16.90 ? 180  GLN A C   1 
ATOM   1311  O  O   . GLN A 1 191 ? 41.970  -9.704  -31.213  1.00 15.97 ? 180  GLN A O   1 
ATOM   1312  C  CB  . GLN A 1 191 ? 44.356  -9.756  -33.373  1.00 18.14 ? 180  GLN A CB  1 
ATOM   1313  C  CG  . GLN A 1 191 ? 45.382  -10.665 -34.021  1.00 18.42 ? 180  GLN A CG  1 
ATOM   1314  C  CD  . GLN A 1 191 ? 46.731  -9.989  -34.229  1.00 18.10 ? 180  GLN A CD  1 
ATOM   1315  O  OE1 . GLN A 1 191 ? 46.829  -8.881  -34.725  1.00 14.41 ? 180  GLN A OE1 1 
ATOM   1316  N  NE2 . GLN A 1 191 ? 47.772  -10.684 -33.884  1.00 15.70 ? 180  GLN A NE2 1 
ATOM   1317  N  N   . ILE A 1 192 ? 41.656  -8.329  -32.958  1.00 15.54 ? 181  ILE A N   1 
ATOM   1318  C  CA  . ILE A 1 192 ? 40.724  -7.448  -32.239  1.00 15.83 ? 181  ILE A CA  1 
ATOM   1319  C  C   . ILE A 1 192 ? 39.489  -8.242  -31.828  1.00 15.72 ? 181  ILE A C   1 
ATOM   1320  O  O   . ILE A 1 192 ? 39.084  -8.242  -30.674  1.00 14.12 ? 181  ILE A O   1 
ATOM   1321  C  CB  . ILE A 1 192 ? 40.336  -6.179  -33.078  1.00 15.31 ? 181  ILE A CB  1 
ATOM   1322  C  CG1 . ILE A 1 192 ? 41.554  -5.277  -33.229  1.00 17.30 ? 181  ILE A CG1 1 
ATOM   1323  C  CG2 . ILE A 1 192 ? 39.210  -5.391  -32.418  1.00 14.32 ? 181  ILE A CG2 1 
ATOM   1324  C  CD1 . ILE A 1 192 ? 41.297  -4.018  -34.026  1.00 16.38 ? 181  ILE A CD1 1 
ATOM   1325  N  N   . TYR A 1 193 ? 38.873  -8.939  -32.770  1.00 16.13 ? 182  TYR A N   1 
ATOM   1326  C  CA  . TYR A 1 193 ? 37.761  -9.837  -32.421  1.00 16.45 ? 182  TYR A CA  1 
ATOM   1327  C  C   . TYR A 1 193 ? 38.030  -10.616 -31.108  1.00 16.57 ? 182  TYR A C   1 
ATOM   1328  O  O   . TYR A 1 193 ? 37.217  -10.581 -30.164  1.00 14.86 ? 182  TYR A O   1 
ATOM   1329  C  CB  . TYR A 1 193 ? 37.520  -10.789 -33.601  1.00 17.11 ? 182  TYR A CB  1 
ATOM   1330  C  CG  . TYR A 1 193 ? 36.369  -11.725 -33.415  1.00 18.68 ? 182  TYR A CG  1 
ATOM   1331  C  CD1 . TYR A 1 193 ? 36.508  -12.874 -32.628  1.00 21.18 ? 182  TYR A CD1 1 
ATOM   1332  C  CD2 . TYR A 1 193 ? 35.137  -11.490 -34.041  1.00 19.23 ? 182  TYR A CD2 1 
ATOM   1333  C  CE1 . TYR A 1 193 ? 35.460  -13.740 -32.449  1.00 19.45 ? 182  TYR A CE1 1 
ATOM   1334  C  CE2 . TYR A 1 193 ? 34.068  -12.362 -33.855  1.00 19.09 ? 182  TYR A CE2 1 
ATOM   1335  C  CZ  . TYR A 1 193 ? 34.243  -13.470 -33.056  1.00 19.62 ? 182  TYR A CZ  1 
ATOM   1336  O  OH  . TYR A 1 193 ? 33.220  -14.344 -32.870  1.00 18.22 ? 182  TYR A OH  1 
ATOM   1337  N  N   . GLU A 1 194 ? 39.185  -11.304 -31.072  1.00 17.09 ? 183  GLU A N   1 
ATOM   1338  C  CA  . GLU A 1 194 ? 39.594  -12.195 -29.974  1.00 16.50 ? 183  GLU A CA  1 
ATOM   1339  C  C   . GLU A 1 194 ? 39.865  -11.476 -28.683  1.00 15.66 ? 183  GLU A C   1 
ATOM   1340  O  O   . GLU A 1 194 ? 39.550  -11.968 -27.591  1.00 17.00 ? 183  GLU A O   1 
ATOM   1341  C  CB  . GLU A 1 194 ? 40.856  -12.948 -30.389  1.00 18.82 ? 183  GLU A CB  1 
ATOM   1342  C  CG  . GLU A 1 194 ? 40.602  -14.255 -31.101  1.00 19.91 ? 183  GLU A CG  1 
ATOM   1343  C  CD  . GLU A 1 194 ? 41.883  -14.965 -31.493  1.00 20.15 ? 183  GLU A CD  1 
ATOM   1344  O  OE1 . GLU A 1 194 ? 42.978  -14.382 -31.321  1.00 24.57 ? 183  GLU A OE1 1 
ATOM   1345  O  OE2 . GLU A 1 194 ? 41.795  -16.109 -32.003  1.00 23.05 ? 183  GLU A OE2 1 
ATOM   1346  N  N   . VAL A 1 195 ? 40.484  -10.313 -28.774  1.00 15.35 ? 184  VAL A N   1 
ATOM   1347  C  CA  . VAL A 1 195 ? 40.684  -9.479  -27.575  1.00 15.05 ? 184  VAL A CA  1 
ATOM   1348  C  C   . VAL A 1 195 ? 39.355  -8.974  -27.054  1.00 14.22 ? 184  VAL A C   1 
ATOM   1349  O  O   . VAL A 1 195 ? 39.103  -8.965  -25.865  1.00 14.81 ? 184  VAL A O   1 
ATOM   1350  C  CB  . VAL A 1 195 ? 41.550  -8.252  -27.876  1.00 15.29 ? 184  VAL A CB  1 
ATOM   1351  C  CG1 . VAL A 1 195 ? 41.835  -7.502  -26.597  1.00 14.96 ? 184  VAL A CG1 1 
ATOM   1352  C  CG2 . VAL A 1 195 ? 42.861  -8.649  -28.625  1.00 15.62 ? 184  VAL A CG2 1 
ATOM   1353  N  N   . LEU A 1 196 ? 38.502  -8.518  -27.963  1.00 13.29 ? 185  LEU A N   1 
ATOM   1354  C  CA  . LEU A 1 196 ? 37.173  -8.020  -27.564  1.00 12.17 ? 185  LEU A CA  1 
ATOM   1355  C  C   . LEU A 1 196 ? 36.314  -9.141  -26.930  1.00 12.82 ? 185  LEU A C   1 
ATOM   1356  O  O   . LEU A 1 196 ? 35.605  -8.921  -25.949  1.00 12.11 ? 185  LEU A O   1 
ATOM   1357  C  CB  . LEU A 1 196 ? 36.496  -7.275  -28.754  1.00 10.31 ? 185  LEU A CB  1 
ATOM   1358  C  CG  . LEU A 1 196 ? 36.754  -5.733  -28.754  1.00 5.28  ? 185  LEU A CG  1 
ATOM   1359  C  CD1 . LEU A 1 196 ? 38.216  -5.345  -28.959  1.00 9.89  ? 185  LEU A CD1 1 
ATOM   1360  C  CD2 . LEU A 1 196 ? 35.854  -4.979  -29.685  1.00 5.96  ? 185  LEU A CD2 1 
ATOM   1361  N  N   . SER A 1 197 ? 36.421  -10.358 -27.444  1.00 12.87 ? 186  SER A N   1 
ATOM   1362  C  CA  . SER A 1 197 ? 35.731  -11.500 -26.833  1.00 13.43 ? 186  SER A CA  1 
ATOM   1363  C  C   . SER A 1 197 ? 36.200  -11.761 -25.403  1.00 13.19 ? 186  SER A C   1 
ATOM   1364  O  O   . SER A 1 197 ? 35.397  -12.005 -24.508  1.00 14.19 ? 186  SER A O   1 
ATOM   1365  C  CB  . SER A 1 197 ? 35.971  -12.713 -27.674  1.00 13.44 ? 186  SER A CB  1 
ATOM   1366  O  OG  . SER A 1 197 ? 35.417  -12.494 -28.942  1.00 14.58 ? 186  SER A OG  1 
ATOM   1367  N  N   . VAL A 1 198 ? 37.511  -11.662 -25.197  1.00 14.23 ? 187  VAL A N   1 
ATOM   1368  C  CA  . VAL A 1 198 ? 38.136  -11.813 -23.868  1.00 14.71 ? 187  VAL A CA  1 
ATOM   1369  C  C   . VAL A 1 198 ? 37.794  -10.699 -22.865  1.00 15.44 ? 187  VAL A C   1 
ATOM   1370  O  O   . VAL A 1 198 ? 37.524  -10.968 -21.665  1.00 17.47 ? 187  VAL A O   1 
ATOM   1371  C  CB  . VAL A 1 198 ? 39.676  -11.839 -24.011  1.00 15.47 ? 187  VAL A CB  1 
ATOM   1372  C  CG1 . VAL A 1 198 ? 40.354  -11.748 -22.612  1.00 11.33 ? 187  VAL A CG1 1 
ATOM   1373  C  CG2 . VAL A 1 198 ? 40.131  -13.083 -24.783  1.00 16.27 ? 187  VAL A CG2 1 
ATOM   1374  N  N   . ILE A 1 199 ? 37.896  -9.446  -23.318  1.00 14.46 ? 188  ILE A N   1 
ATOM   1375  C  CA  . ILE A 1 199 ? 37.487  -8.272  -22.510  1.00 14.99 ? 188  ILE A CA  1 
ATOM   1376  C  C   . ILE A 1 199 ? 36.020  -8.309  -22.101  1.00 14.08 ? 188  ILE A C   1 
ATOM   1377  O  O   . ILE A 1 199 ? 35.684  -7.933  -20.974  1.00 15.20 ? 188  ILE A O   1 
ATOM   1378  C  CB  . ILE A 1 199 ? 37.816  -6.918  -23.209  1.00 16.18 ? 188  ILE A CB  1 
ATOM   1379  C  CG1 . ILE A 1 199 ? 39.331  -6.651  -23.170  1.00 14.28 ? 188  ILE A CG1 1 
ATOM   1380  C  CG2 . ILE A 1 199 ? 37.039  -5.760  -22.570  1.00 13.72 ? 188  ILE A CG2 1 
ATOM   1381  C  CD1 . ILE A 1 199 ? 39.678  -5.256  -23.545  1.00 16.76 ? 188  ILE A CD1 1 
ATOM   1382  N  N   . ARG A 1 200 ? 35.164  -8.789  -23.001  1.00 14.25 ? 189  ARG A N   1 
ATOM   1383  C  CA  . ARG A 1 200 ? 33.762  -9.122  -22.660  1.00 15.00 ? 189  ARG A CA  1 
ATOM   1384  C  C   . ARG A 1 200 ? 33.644  -10.106 -21.486  1.00 14.48 ? 189  ARG A C   1 
ATOM   1385  O  O   . ARG A 1 200 ? 33.042  -9.788  -20.456  1.00 14.32 ? 189  ARG A O   1 
ATOM   1386  C  CB  . ARG A 1 200 ? 33.069  -9.690  -23.892  1.00 13.72 ? 189  ARG A CB  1 
ATOM   1387  C  CG  . ARG A 1 200 ? 31.554  -9.888  -23.726  1.00 15.76 ? 189  ARG A CG  1 
ATOM   1388  C  CD  . ARG A 1 200 ? 31.066  -10.784 -24.826  1.00 14.96 ? 189  ARG A CD  1 
ATOM   1389  N  NE  . ARG A 1 200 ? 31.685  -12.098 -24.671  1.00 14.09 ? 189  ARG A NE  1 
ATOM   1390  C  CZ  . ARG A 1 200 ? 32.034  -12.903 -25.664  1.00 16.14 ? 189  ARG A CZ  1 
ATOM   1391  N  NH1 . ARG A 1 200 ? 31.809  -12.570 -26.913  1.00 8.41  ? 189  ARG A NH1 1 
ATOM   1392  N  NH2 . ARG A 1 200 ? 32.598  -14.060 -25.400  1.00 19.33 ? 189  ARG A NH2 1 
ATOM   1393  N  N   . ASP A 1 201 ? 34.276  -11.275 -21.604  1.00 16.16 ? 190  ASP A N   1 
ATOM   1394  C  CA  A ASP A 1 201 ? 34.081  -12.335 -20.620  0.50 15.91 ? 190  ASP A CA  1 
ATOM   1395  C  CA  B ASP A 1 201 ? 34.076  -12.351 -20.621  0.50 16.45 ? 190  ASP A CA  1 
ATOM   1396  C  C   . ASP A 1 201 ? 34.639  -11.989 -19.238  1.00 16.39 ? 190  ASP A C   1 
ATOM   1397  O  O   . ASP A 1 201 ? 34.168  -12.522 -18.217  1.00 18.00 ? 190  ASP A O   1 
ATOM   1398  C  CB  A ASP A 1 201 ? 34.645  -13.656 -21.152  0.50 15.31 ? 190  ASP A CB  1 
ATOM   1399  C  CB  B ASP A 1 201 ? 34.639  -13.698 -21.122  0.50 16.81 ? 190  ASP A CB  1 
ATOM   1400  C  CG  A ASP A 1 201 ? 33.805  -14.220 -22.269  0.50 15.13 ? 190  ASP A CG  1 
ATOM   1401  C  CG  B ASP A 1 201 ? 34.295  -14.871 -20.186  0.50 18.74 ? 190  ASP A CG  1 
ATOM   1402  O  OD1 A ASP A 1 201 ? 32.578  -14.058 -22.223  0.50 12.82 ? 190  ASP A OD1 1 
ATOM   1403  O  OD1 B ASP A 1 201 ? 34.213  -14.666 -18.956  0.50 22.15 ? 190  ASP A OD1 1 
ATOM   1404  O  OD2 A ASP A 1 201 ? 34.358  -14.818 -23.206  0.50 15.97 ? 190  ASP A OD2 1 
ATOM   1405  O  OD2 B ASP A 1 201 ? 34.109  -16.012 -20.660  0.50 23.18 ? 190  ASP A OD2 1 
ATOM   1406  N  N   . ILE A 1 202 ? 35.619  -11.081 -19.192  1.00 16.99 ? 191  ILE A N   1 
ATOM   1407  C  CA  . ILE A 1 202 ? 36.271  -10.687 -17.917  1.00 15.76 ? 191  ILE A CA  1 
ATOM   1408  C  C   . ILE A 1 202 ? 35.685  -9.426  -17.251  1.00 16.61 ? 191  ILE A C   1 
ATOM   1409  O  O   . ILE A 1 202 ? 36.079  -9.044  -16.138  1.00 18.96 ? 191  ILE A O   1 
ATOM   1410  C  CB  . ILE A 1 202 ? 37.822  -10.594 -18.101  1.00 16.18 ? 191  ILE A CB  1 
ATOM   1411  C  CG1 . ILE A 1 202 ? 38.250  -9.425  -19.001  1.00 15.58 ? 191  ILE A CG1 1 
ATOM   1412  C  CG2 . ILE A 1 202 ? 38.353  -11.884 -18.684  1.00 13.56 ? 191  ILE A CG2 1 
ATOM   1413  C  CD1 . ILE A 1 202 ? 39.737  -9.149  -18.970  1.00 12.16 ? 191  ILE A CD1 1 
ATOM   1414  N  N   . GLY A 1 203 ? 34.713  -8.790  -17.904  1.00 17.51 ? 192  GLY A N   1 
ATOM   1415  C  CA  . GLY A 1 203 ? 34.013  -7.614  -17.337  1.00 16.48 ? 192  GLY A CA  1 
ATOM   1416  C  C   . GLY A 1 203 ? 34.687  -6.258  -17.495  1.00 16.90 ? 192  GLY A C   1 
ATOM   1417  O  O   . GLY A 1 203 ? 34.375  -5.307  -16.758  1.00 14.21 ? 192  GLY A O   1 
ATOM   1418  N  N   . ALA A 1 204 ? 35.568  -6.157  -18.495  1.00 17.03 ? 193  ALA A N   1 
ATOM   1419  C  CA  . ALA A 1 204 ? 36.322  -4.931  -18.758  1.00 16.69 ? 193  ALA A CA  1 
ATOM   1420  C  C   . ALA A 1 204 ? 35.777  -4.122  -19.973  1.00 16.78 ? 193  ALA A C   1 
ATOM   1421  O  O   . ALA A 1 204 ? 34.887  -4.568  -20.711  1.00 16.54 ? 193  ALA A O   1 
ATOM   1422  C  CB  . ALA A 1 204 ? 37.840  -5.265  -18.952  1.00 17.56 ? 193  ALA A CB  1 
ATOM   1423  N  N   . ILE A 1 205 ? 36.315  -2.914  -20.106  1.00 15.55 ? 194  ILE A N   1 
ATOM   1424  C  CA  . ILE A 1 205 ? 35.985  -1.993  -21.187  1.00 14.86 ? 194  ILE A CA  1 
ATOM   1425  C  C   . ILE A 1 205 ? 37.050  -2.194  -22.236  1.00 13.13 ? 194  ILE A C   1 
ATOM   1426  O  O   . ILE A 1 205 ? 38.215  -2.205  -21.910  1.00 13.65 ? 194  ILE A O   1 
ATOM   1427  C  CB  . ILE A 1 205 ? 36.009  -0.478  -20.650  1.00 14.82 ? 194  ILE A CB  1 
ATOM   1428  C  CG1 . ILE A 1 205 ? 34.995  -0.267  -19.506  1.00 11.04 ? 194  ILE A CG1 1 
ATOM   1429  C  CG2 . ILE A 1 205 ? 35.819  0.544   -21.760  1.00 13.72 ? 194  ILE A CG2 1 
ATOM   1430  C  CD1 . ILE A 1 205 ? 33.529  -0.618  -19.895  1.00 9.74  ? 194  ILE A CD1 1 
ATOM   1431  N  N   . ALA A 1 206 ? 36.642  -2.349  -23.500  1.00 13.03 ? 195  ALA A N   1 
ATOM   1432  C  CA  . ALA A 1 206 ? 37.544  -2.318  -24.654  1.00 12.81 ? 195  ALA A CA  1 
ATOM   1433  C  C   . ALA A 1 206 ? 37.769  -0.901  -25.226  1.00 12.98 ? 195  ALA A C   1 
ATOM   1434  O  O   . ALA A 1 206 ? 36.844  -0.330  -25.787  1.00 14.04 ? 195  ALA A O   1 
ATOM   1435  C  CB  . ALA A 1 206 ? 36.946  -3.178  -25.778  1.00 10.88 ? 195  ALA A CB  1 
ATOM   1436  N  N   . GLN A 1 207 ? 38.982  -0.346  -25.139  1.00 11.00 ? 196  GLN A N   1 
ATOM   1437  C  CA  . GLN A 1 207 ? 39.227  0.946   -25.752  1.00 9.66  ? 196  GLN A CA  1 
ATOM   1438  C  C   . GLN A 1 207 ? 39.960  0.714   -27.032  1.00 5.78  ? 196  GLN A C   1 
ATOM   1439  O  O   . GLN A 1 207 ? 40.556  -0.336  -27.224  1.00 4.67  ? 196  GLN A O   1 
ATOM   1440  C  CB  . GLN A 1 207 ? 40.100  1.819   -24.923  1.00 8.84  ? 196  GLN A CB  1 
ATOM   1441  C  CG  . GLN A 1 207 ? 39.640  2.109   -23.520  1.00 11.00 ? 196  GLN A CG  1 
ATOM   1442  C  CD  . GLN A 1 207 ? 40.588  3.097   -22.893  1.00 11.24 ? 196  GLN A CD  1 
ATOM   1443  O  OE1 . GLN A 1 207 ? 40.201  4.191   -22.430  1.00 13.81 ? 196  GLN A OE1 1 
ATOM   1444  N  NE2 . GLN A 1 207 ? 41.854  2.733   -22.902  1.00 14.49 ? 196  GLN A NE2 1 
ATOM   1445  N  N   . VAL A 1 208 ? 40.006  1.726   -27.860  1.00 7.79  ? 197  VAL A N   1 
ATOM   1446  C  CA  A VAL A 1 208 ? 40.660  1.573   -29.162  0.50 7.83  ? 197  VAL A CA  1 
ATOM   1447  C  CA  B VAL A 1 208 ? 40.616  1.581   -29.185  0.50 8.40  ? 197  VAL A CA  1 
ATOM   1448  C  C   . VAL A 1 208 ? 41.232  2.914   -29.659  1.00 9.95  ? 197  VAL A C   1 
ATOM   1449  O  O   . VAL A 1 208 ? 40.615  3.971   -29.501  1.00 12.40 ? 197  VAL A O   1 
ATOM   1450  C  CB  A VAL A 1 208 ? 39.690  0.913   -30.168  0.50 8.64  ? 197  VAL A CB  1 
ATOM   1451  C  CB  B VAL A 1 208 ? 39.551  1.050   -30.170  0.50 9.33  ? 197  VAL A CB  1 
ATOM   1452  C  CG1 A VAL A 1 208 ? 40.338  0.722   -31.543  0.50 2.00  ? 197  VAL A CG1 1 
ATOM   1453  C  CG1 B VAL A 1 208 ? 38.399  2.046   -30.312  0.50 5.37  ? 197  VAL A CG1 1 
ATOM   1454  C  CG2 A VAL A 1 208 ? 39.224  -0.443  -29.640  0.50 3.79  ? 197  VAL A CG2 1 
ATOM   1455  C  CG2 B VAL A 1 208 ? 40.171  0.661   -31.534  0.50 4.42  ? 197  VAL A CG2 1 
ATOM   1456  N  N   . HIS A 1 209 ? 42.461  2.876   -30.192  1.00 9.76  ? 198  HIS A N   1 
ATOM   1457  C  CA  . HIS A 1 209 ? 43.016  3.989   -30.889  1.00 10.59 ? 198  HIS A CA  1 
ATOM   1458  C  C   . HIS A 1 209 ? 42.662  3.613   -32.301  1.00 11.18 ? 198  HIS A C   1 
ATOM   1459  O  O   . HIS A 1 209 ? 43.254  2.681   -32.851  1.00 13.60 ? 198  HIS A O   1 
ATOM   1460  C  CB  . HIS A 1 209 ? 44.544  4.117   -30.745  1.00 10.92 ? 198  HIS A CB  1 
ATOM   1461  C  CG  . HIS A 1 209 ? 45.179  5.105   -31.705  1.00 11.19 ? 198  HIS A CG  1 
ATOM   1462  N  ND1 . HIS A 1 209 ? 45.923  6.186   -31.278  1.00 12.26 ? 198  HIS A ND1 1 
ATOM   1463  C  CD2 . HIS A 1 209 ? 45.150  5.194   -33.061  1.00 12.36 ? 198  HIS A CD2 1 
ATOM   1464  C  CE1 . HIS A 1 209 ? 46.355  6.868   -32.324  1.00 12.01 ? 198  HIS A CE1 1 
ATOM   1465  N  NE2 . HIS A 1 209 ? 45.870  6.308   -33.414  1.00 8.66  ? 198  HIS A NE2 1 
ATOM   1466  N  N   . ALA A 1 210 ? 41.709  4.316   -32.883  1.00 12.54 ? 199  ALA A N   1 
ATOM   1467  C  CA  . ALA A 1 210 ? 41.113  3.913   -34.164  1.00 12.32 ? 199  ALA A CA  1 
ATOM   1468  C  C   . ALA A 1 210 ? 41.529  4.821   -35.306  1.00 11.82 ? 199  ALA A C   1 
ATOM   1469  O  O   . ALA A 1 210 ? 40.910  5.858   -35.547  1.00 12.39 ? 199  ALA A O   1 
ATOM   1470  C  CB  . ALA A 1 210 ? 39.576  3.863   -34.046  1.00 9.48  ? 199  ALA A CB  1 
ATOM   1471  N  N   . GLU A 1 211 ? 42.614  4.450   -35.967  1.00 14.13 ? 200  GLU A N   1 
ATOM   1472  C  CA  . GLU A 1 211 ? 42.898  4.904   -37.346  1.00 15.69 ? 200  GLU A CA  1 
ATOM   1473  C  C   . GLU A 1 211 ? 43.272  3.696   -38.196  1.00 16.54 ? 200  GLU A C   1 
ATOM   1474  O  O   . GLU A 1 211 ? 43.773  2.718   -37.682  1.00 18.37 ? 200  GLU A O   1 
ATOM   1475  C  CB  . GLU A 1 211 ? 44.022  5.965   -37.381  1.00 16.71 ? 200  GLU A CB  1 
ATOM   1476  C  CG  . GLU A 1 211 ? 43.753  7.241   -36.547  1.00 16.02 ? 200  GLU A CG  1 
ATOM   1477  C  CD  . GLU A 1 211 ? 45.018  8.084   -36.367  1.00 19.25 ? 200  GLU A CD  1 
ATOM   1478  O  OE1 . GLU A 1 211 ? 45.786  7.846   -35.385  1.00 20.78 ? 200  GLU A OE1 1 
ATOM   1479  O  OE2 . GLU A 1 211 ? 45.261  8.986   -37.191  1.00 13.66 ? 200  GLU A OE2 1 
ATOM   1480  N  N   . ASN A 1 212 ? 43.002  3.736   -39.491  1.00 15.66 ? 201  ASN A N   1 
ATOM   1481  C  CA  . ASN A 1 212 ? 43.492  2.701   -40.374  1.00 15.16 ? 201  ASN A CA  1 
ATOM   1482  C  C   . ASN A 1 212 ? 45.038  2.789   -40.550  1.00 16.05 ? 201  ASN A C   1 
ATOM   1483  O  O   . ASN A 1 212 ? 45.550  3.605   -41.322  1.00 15.20 ? 201  ASN A O   1 
ATOM   1484  C  CB  . ASN A 1 212 ? 42.785  2.769   -41.722  1.00 15.46 ? 201  ASN A CB  1 
ATOM   1485  C  CG  . ASN A 1 212 ? 43.063  1.540   -42.583  1.00 15.93 ? 201  ASN A CG  1 
ATOM   1486  O  OD1 . ASN A 1 212 ? 44.235  1.218   -42.845  1.00 18.64 ? 201  ASN A OD1 1 
ATOM   1487  N  ND2 . ASN A 1 212 ? 42.008  0.838   -43.009  1.00 11.88 ? 201  ASN A ND2 1 
ATOM   1488  N  N   . GLY A 1 213 ? 45.770  1.935   -39.835  1.00 16.65 ? 202  GLY A N   1 
ATOM   1489  C  CA  . GLY A 1 213 ? 47.228  1.921   -39.865  1.00 16.25 ? 202  GLY A CA  1 
ATOM   1490  C  C   . GLY A 1 213 ? 47.862  1.436   -41.152  1.00 16.88 ? 202  GLY A C   1 
ATOM   1491  O  O   . GLY A 1 213 ? 49.046  1.641   -41.344  1.00 18.36 ? 202  GLY A O   1 
ATOM   1492  N  N   . ASP A 1 214 ? 47.093  0.778   -42.006  1.00 16.45 ? 203  ASP A N   1 
ATOM   1493  C  CA  . ASP A 1 214 ? 47.563  0.342   -43.323  1.00 17.82 ? 203  ASP A CA  1 
ATOM   1494  C  C   . ASP A 1 214 ? 47.644  1.532   -44.300  1.00 18.09 ? 203  ASP A C   1 
ATOM   1495  O  O   . ASP A 1 214 ? 48.688  1.765   -44.958  1.00 18.16 ? 203  ASP A O   1 
ATOM   1496  C  CB  . ASP A 1 214 ? 46.637  -0.767  -43.873  1.00 19.29 ? 203  ASP A CB  1 
ATOM   1497  C  CG  . ASP A 1 214 ? 47.141  -2.217  -43.546  1.00 22.16 ? 203  ASP A CG  1 
ATOM   1498  O  OD1 . ASP A 1 214 ? 47.938  -2.397  -42.604  1.00 11.73 ? 203  ASP A OD1 1 
ATOM   1499  O  OD2 . ASP A 1 214 ? 46.755  -3.170  -44.276  1.00 21.77 ? 203  ASP A OD2 1 
ATOM   1500  N  N   . ILE A 1 215 ? 46.553  2.296   -44.368  1.00 17.73 ? 204  ILE A N   1 
ATOM   1501  C  CA  . ILE A 1 215 ? 46.446  3.433   -45.286  1.00 17.17 ? 204  ILE A CA  1 
ATOM   1502  C  C   . ILE A 1 215 ? 47.503  4.472   -44.881  1.00 16.22 ? 204  ILE A C   1 
ATOM   1503  O  O   . ILE A 1 215 ? 48.176  5.039   -45.713  1.00 15.97 ? 204  ILE A O   1 
ATOM   1504  C  CB  . ILE A 1 215 ? 45.027  4.103   -45.244  1.00 17.34 ? 204  ILE A CB  1 
ATOM   1505  C  CG1 . ILE A 1 215 ? 43.892  3.137   -45.558  1.00 18.49 ? 204  ILE A CG1 1 
ATOM   1506  C  CG2 . ILE A 1 215 ? 44.928  5.206   -46.221  1.00 18.01 ? 204  ILE A CG2 1 
ATOM   1507  C  CD1 . ILE A 1 215 ? 42.492  3.740   -45.375  1.00 16.39 ? 204  ILE A CD1 1 
ATOM   1508  N  N   . ILE A 1 216 ? 47.639  4.705   -43.576  1.00 14.95 ? 205  ILE A N   1 
ATOM   1509  C  CA  . ILE A 1 216 ? 48.549  5.700   -43.070  1.00 15.87 ? 205  ILE A CA  1 
ATOM   1510  C  C   . ILE A 1 216 ? 50.017  5.384   -43.412  1.00 16.87 ? 205  ILE A C   1 
ATOM   1511  O  O   . ILE A 1 216 ? 50.765  6.292   -43.799  1.00 18.02 ? 205  ILE A O   1 
ATOM   1512  C  CB  . ILE A 1 216 ? 48.341  5.916   -41.511  1.00 15.37 ? 205  ILE A CB  1 
ATOM   1513  C  CG1 . ILE A 1 216 ? 47.039  6.709   -41.309  1.00 16.65 ? 205  ILE A CG1 1 
ATOM   1514  C  CG2 . ILE A 1 216 ? 49.541  6.593   -40.960  1.00 16.21 ? 205  ILE A CG2 1 
ATOM   1515  C  CD1 . ILE A 1 216 ? 46.549  6.890   -39.854  1.00 15.08 ? 205  ILE A CD1 1 
ATOM   1516  N  N   . ALA A 1 217 ? 50.410  4.115   -43.288  1.00 16.86 ? 206  ALA A N   1 
ATOM   1517  C  CA  . ALA A 1 217 ? 51.774  3.663   -43.609  1.00 18.53 ? 206  ALA A CA  1 
ATOM   1518  C  C   . ALA A 1 217 ? 52.092  3.845   -45.089  1.00 19.75 ? 206  ALA A C   1 
ATOM   1519  O  O   . ALA A 1 217 ? 53.169  4.297   -45.452  1.00 21.15 ? 206  ALA A O   1 
ATOM   1520  C  CB  . ALA A 1 217 ? 51.964  2.193   -43.200  1.00 17.42 ? 206  ALA A CB  1 
ATOM   1521  N  N   . GLU A 1 218 ? 51.151  3.516   -45.960  1.00 21.01 ? 207  GLU A N   1 
ATOM   1522  C  CA  . GLU A 1 218 ? 51.368  3.756   -47.386  1.00 21.38 ? 207  GLU A CA  1 
ATOM   1523  C  C   . GLU A 1 218 ? 51.377  5.248   -47.683  1.00 22.37 ? 207  GLU A C   1 
ATOM   1524  O  O   . GLU A 1 218 ? 52.225  5.724   -48.489  1.00 22.98 ? 207  GLU A O   1 
ATOM   1525  C  CB  . GLU A 1 218 ? 50.326  3.037   -48.245  1.00 23.14 ? 207  GLU A CB  1 
ATOM   1526  C  CG  . GLU A 1 218 ? 50.497  1.536   -48.320  1.00 26.23 ? 207  GLU A CG  1 
ATOM   1527  C  CD  . GLU A 1 218 ? 51.870  1.105   -48.806  1.00 31.05 ? 207  GLU A CD  1 
ATOM   1528  O  OE1 . GLU A 1 218 ? 52.294  1.527   -49.909  1.00 34.66 ? 207  GLU A OE1 1 
ATOM   1529  O  OE2 . GLU A 1 218 ? 52.534  0.341   -48.069  1.00 34.42 ? 207  GLU A OE2 1 
ATOM   1530  N  N   . GLU A 1 219 ? 50.486  5.995   -47.026  1.00 20.68 ? 208  GLU A N   1 
ATOM   1531  C  CA  . GLU A 1 219 ? 50.384  7.436   -47.285  1.00 20.15 ? 208  GLU A CA  1 
ATOM   1532  C  C   . GLU A 1 219 ? 51.620  8.213   -46.837  1.00 19.90 ? 208  GLU A C   1 
ATOM   1533  O  O   . GLU A 1 219 ? 52.230  8.907   -47.654  1.00 18.47 ? 208  GLU A O   1 
ATOM   1534  C  CB  . GLU A 1 219 ? 49.120  8.025   -46.678  1.00 21.19 ? 208  GLU A CB  1 
ATOM   1535  C  CG  . GLU A 1 219 ? 47.896  7.663   -47.478  1.00 21.29 ? 208  GLU A CG  1 
ATOM   1536  C  CD  . GLU A 1 219 ? 47.715  8.556   -48.670  1.00 26.24 ? 208  GLU A CD  1 
ATOM   1537  O  OE1 . GLU A 1 219 ? 47.231  9.676   -48.434  1.00 29.35 ? 208  GLU A OE1 1 
ATOM   1538  O  OE2 . GLU A 1 219 ? 48.023  8.153   -49.820  1.00 23.47 ? 208  GLU A OE2 1 
ATOM   1539  N  N   . GLN A 1 220 ? 51.984  8.067   -45.561  1.00 18.00 ? 209  GLN A N   1 
ATOM   1540  C  CA  . GLN A 1 220 ? 53.209  8.604   -45.014  1.00 18.58 ? 209  GLN A CA  1 
ATOM   1541  C  C   . GLN A 1 220 ? 54.309  8.589   -46.046  1.00 19.45 ? 209  GLN A C   1 
ATOM   1542  O  O   . GLN A 1 220 ? 54.958  9.607   -46.289  1.00 18.35 ? 209  GLN A O   1 
ATOM   1543  C  CB  . GLN A 1 220 ? 53.682  7.739   -43.861  1.00 17.94 ? 209  GLN A CB  1 
ATOM   1544  C  CG  . GLN A 1 220 ? 52.867  7.899   -42.604  1.00 19.82 ? 209  GLN A CG  1 
ATOM   1545  C  CD  . GLN A 1 220 ? 53.378  7.063   -41.483  1.00 16.22 ? 209  GLN A CD  1 
ATOM   1546  O  OE1 . GLN A 1 220 ? 54.115  6.096   -41.685  1.00 15.33 ? 209  GLN A OE1 1 
ATOM   1547  N  NE2 . GLN A 1 220 ? 53.009  7.439   -40.275  1.00 14.84 ? 209  GLN A NE2 1 
ATOM   1548  N  N   . GLN A 1 221 ? 54.494  7.412   -46.633  1.00 20.39 ? 210  GLN A N   1 
ATOM   1549  C  CA  . GLN A 1 221 ? 55.640  7.127   -47.465  1.00 21.55 ? 210  GLN A CA  1 
ATOM   1550  C  C   . GLN A 1 221 ? 55.516  7.786   -48.804  1.00 22.36 ? 210  GLN A C   1 
ATOM   1551  O  O   . GLN A 1 221 ? 56.520  8.215   -49.391  1.00 21.87 ? 210  GLN A O   1 
ATOM   1552  C  CB  . GLN A 1 221 ? 55.819  5.612   -47.635  1.00 21.85 ? 210  GLN A CB  1 
ATOM   1553  C  CG  . GLN A 1 221 ? 57.208  5.227   -48.116  1.00 22.79 ? 210  GLN A CG  1 
ATOM   1554  C  CD  . GLN A 1 221 ? 58.272  6.163   -47.550  1.00 24.95 ? 210  GLN A CD  1 
ATOM   1555  O  OE1 . GLN A 1 221 ? 58.512  6.184   -46.338  1.00 23.52 ? 210  GLN A OE1 1 
ATOM   1556  N  NE2 . GLN A 1 221 ? 58.868  6.978   -48.418  1.00 25.29 ? 210  GLN A NE2 1 
ATOM   1557  N  N   . ARG A 1 222 ? 54.278  7.860   -49.288  1.00 22.52 ? 211  ARG A N   1 
ATOM   1558  C  CA  . ARG A 1 222 ? 53.987  8.499   -50.564  1.00 23.11 ? 211  ARG A CA  1 
ATOM   1559  C  C   . ARG A 1 222 ? 54.351  9.978   -50.449  1.00 23.52 ? 211  ARG A C   1 
ATOM   1560  O  O   . ARG A 1 222 ? 54.982  10.536  -51.342  1.00 22.38 ? 211  ARG A O   1 
ATOM   1561  C  CB  . ARG A 1 222 ? 52.508  8.333   -50.926  1.00 22.54 ? 211  ARG A CB  1 
ATOM   1562  C  CG  . ARG A 1 222 ? 52.141  8.867   -52.287  1.00 22.52 ? 211  ARG A CG  1 
ATOM   1563  C  CD  . ARG A 1 222 ? 50.665  8.745   -52.520  1.00 22.80 ? 211  ARG A CD  1 
ATOM   1564  N  NE  . ARG A 1 222 ? 49.913  9.604   -51.611  1.00 21.51 ? 211  ARG A NE  1 
ATOM   1565  C  CZ  . ARG A 1 222 ? 49.701  10.897  -51.816  1.00 22.80 ? 211  ARG A CZ  1 
ATOM   1566  N  NH1 . ARG A 1 222 ? 50.195  11.500  -52.891  1.00 24.71 ? 211  ARG A NH1 1 
ATOM   1567  N  NH2 . ARG A 1 222 ? 49.017  11.602  -50.930  1.00 25.44 ? 211  ARG A NH2 1 
ATOM   1568  N  N   . ILE A 1 223 ? 53.991  10.565  -49.312  1.00 24.28 ? 212  ILE A N   1 
ATOM   1569  C  CA  . ILE A 1 223 ? 54.006  12.007  -49.103  1.00 25.15 ? 212  ILE A CA  1 
ATOM   1570  C  C   . ILE A 1 223 ? 55.425  12.487  -48.800  1.00 26.68 ? 212  ILE A C   1 
ATOM   1571  O  O   . ILE A 1 223 ? 55.844  13.508  -49.326  1.00 27.22 ? 212  ILE A O   1 
ATOM   1572  C  CB  . ILE A 1 223 ? 53.077  12.407  -47.930  1.00 25.19 ? 212  ILE A CB  1 
ATOM   1573  C  CG1 . ILE A 1 223 ? 51.664  11.778  -48.072  1.00 24.86 ? 212  ILE A CG1 1 
ATOM   1574  C  CG2 . ILE A 1 223 ? 53.014  13.950  -47.746  1.00 24.82 ? 212  ILE A CG2 1 
ATOM   1575  C  CD1 . ILE A 1 223 ? 50.556  12.677  -48.431  1.00 20.99 ? 212  ILE A CD1 1 
ATOM   1576  N  N   . LEU A 1 224 ? 56.156  11.746  -47.956  1.00 27.38 ? 213  LEU A N   1 
ATOM   1577  C  CA  . LEU A 1 224 ? 57.581  12.011  -47.693  1.00 27.53 ? 213  LEU A CA  1 
ATOM   1578  C  C   . LEU A 1 224 ? 58.360  12.087  -49.011  1.00 28.37 ? 213  LEU A C   1 
ATOM   1579  O  O   . LEU A 1 224 ? 59.161  13.025  -49.225  1.00 28.92 ? 213  LEU A O   1 
ATOM   1580  C  CB  . LEU A 1 224 ? 58.202  10.939  -46.787  1.00 27.02 ? 213  LEU A CB  1 
ATOM   1581  C  CG  . LEU A 1 224 ? 57.961  10.976  -45.277  1.00 25.86 ? 213  LEU A CG  1 
ATOM   1582  C  CD1 . LEU A 1 224 ? 58.519  9.705   -44.638  1.00 24.93 ? 213  LEU A CD1 1 
ATOM   1583  C  CD2 . LEU A 1 224 ? 58.557  12.195  -44.619  1.00 23.91 ? 213  LEU A CD2 1 
ATOM   1584  N  N   . ASP A 1 225 ? 58.101  11.126  -49.901  1.00 28.68 ? 214  ASP A N   1 
ATOM   1585  C  CA  . ASP A 1 225 ? 58.763  11.092  -51.216  1.00 28.96 ? 214  ASP A CA  1 
ATOM   1586  C  C   . ASP A 1 225 ? 58.216  12.106  -52.250  1.00 28.97 ? 214  ASP A C   1 
ATOM   1587  O  O   . ASP A 1 225 ? 58.634  12.105  -53.403  1.00 28.86 ? 214  ASP A O   1 
ATOM   1588  C  CB  . ASP A 1 225 ? 58.732  9.673   -51.802  1.00 29.84 ? 214  ASP A CB  1 
ATOM   1589  C  CG  . ASP A 1 225 ? 59.535  8.663   -50.980  1.00 31.53 ? 214  ASP A CG  1 
ATOM   1590  O  OD1 . ASP A 1 225 ? 60.552  9.028   -50.340  1.00 34.67 ? 214  ASP A OD1 1 
ATOM   1591  O  OD2 . ASP A 1 225 ? 59.141  7.473   -50.982  1.00 32.74 ? 214  ASP A OD2 1 
ATOM   1592  N  N   . LEU A 1 226 ? 57.295  12.969  -51.845  1.00 28.87 ? 215  LEU A N   1 
ATOM   1593  C  CA  . LEU A 1 226 ? 56.862  14.061  -52.696  1.00 27.70 ? 215  LEU A CA  1 
ATOM   1594  C  C   . LEU A 1 226 ? 57.724  15.255  -52.392  1.00 28.24 ? 215  LEU A C   1 
ATOM   1595  O  O   . LEU A 1 226 ? 57.879  16.131  -53.221  1.00 28.92 ? 215  LEU A O   1 
ATOM   1596  C  CB  . LEU A 1 226 ? 55.382  14.396  -52.471  1.00 27.74 ? 215  LEU A CB  1 
ATOM   1597  C  CG  . LEU A 1 226 ? 54.467  13.513  -53.320  1.00 26.64 ? 215  LEU A CG  1 
ATOM   1598  C  CD1 . LEU A 1 226 ? 53.028  13.540  -52.840  1.00 23.72 ? 215  LEU A CD1 1 
ATOM   1599  C  CD2 . LEU A 1 226 ? 54.591  13.911  -54.772  1.00 26.47 ? 215  LEU A CD2 1 
ATOM   1600  N  N   . GLY A 1 227 ? 58.298  15.280  -51.195  1.00 27.90 ? 216  GLY A N   1 
ATOM   1601  C  CA  . GLY A 1 227 ? 59.092  16.418  -50.738  1.00 27.05 ? 216  GLY A CA  1 
ATOM   1602  C  C   . GLY A 1 227 ? 58.561  17.009  -49.459  1.00 26.68 ? 216  GLY A C   1 
ATOM   1603  O  O   . GLY A 1 227 ? 59.261  17.752  -48.781  1.00 27.64 ? 216  GLY A O   1 
ATOM   1604  N  N   . ILE A 1 228 ? 57.335  16.629  -49.116  1.00 25.25 ? 217  ILE A N   1 
ATOM   1605  C  CA  . ILE A 1 228 ? 56.616  17.183  -47.988  1.00 23.74 ? 217  ILE A CA  1 
ATOM   1606  C  C   . ILE A 1 228 ? 57.142  16.524  -46.722  1.00 23.67 ? 217  ILE A C   1 
ATOM   1607  O  O   . ILE A 1 228 ? 56.941  15.321  -46.499  1.00 25.13 ? 217  ILE A O   1 
ATOM   1608  C  CB  . ILE A 1 228 ? 55.074  16.938  -48.123  1.00 23.84 ? 217  ILE A CB  1 
ATOM   1609  C  CG1 . ILE A 1 228 ? 54.515  17.476  -49.453  1.00 21.00 ? 217  ILE A CG1 1 
ATOM   1610  C  CG2 . ILE A 1 228 ? 54.335  17.570  -46.964  1.00 22.75 ? 217  ILE A CG2 1 
ATOM   1611  C  CD1 . ILE A 1 228 ? 53.137  16.950  -49.802  1.00 21.15 ? 217  ILE A CD1 1 
ATOM   1612  N  N   . THR A 1 229 ? 57.856  17.307  -45.921  1.00 22.22 ? 218  THR A N   1 
ATOM   1613  C  CA  . THR A 1 229 ? 58.497  16.818  -44.711  1.00 21.86 ? 218  THR A CA  1 
ATOM   1614  C  C   . THR A 1 229 ? 58.086  17.555  -43.441  1.00 21.38 ? 218  THR A C   1 
ATOM   1615  O  O   . THR A 1 229 ? 58.303  17.070  -42.317  1.00 19.36 ? 218  THR A O   1 
ATOM   1616  C  CB  . THR A 1 229 ? 60.004  16.967  -44.857  1.00 21.24 ? 218  THR A CB  1 
ATOM   1617  O  OG1 . THR A 1 229 ? 60.339  18.364  -44.819  1.00 21.63 ? 218  THR A OG1 1 
ATOM   1618  C  CG2 . THR A 1 229 ? 60.462  16.365  -46.191  1.00 21.18 ? 218  THR A CG2 1 
ATOM   1619  N  N   . GLY A 1 230 ? 57.514  18.740  -43.588  1.00 22.85 ? 219  GLY A N   1 
ATOM   1620  C  CA  . GLY A 1 230 ? 57.065  19.476  -42.406  1.00 22.90 ? 219  GLY A CA  1 
ATOM   1621  C  C   . GLY A 1 230 ? 55.916  18.794  -41.688  1.00 23.06 ? 219  GLY A C   1 
ATOM   1622  O  O   . GLY A 1 230 ? 55.426  17.726  -42.106  1.00 22.97 ? 219  GLY A O   1 
ATOM   1623  N  N   . PRO A 1 231 ? 55.483  19.385  -40.577  1.00 22.72 ? 220  PRO A N   1 
ATOM   1624  C  CA  . PRO A 1 231 ? 54.274  18.974  -39.865  1.00 23.10 ? 220  PRO A CA  1 
ATOM   1625  C  C   . PRO A 1 231 ? 53.066  18.652  -40.746  1.00 23.44 ? 220  PRO A C   1 
ATOM   1626  O  O   . PRO A 1 231 ? 52.502  17.561  -40.646  1.00 24.09 ? 220  PRO A O   1 
ATOM   1627  C  CB  . PRO A 1 231 ? 54.009  20.168  -38.977  1.00 22.55 ? 220  PRO A CB  1 
ATOM   1628  C  CG  . PRO A 1 231 ? 55.383  20.570  -38.593  1.00 22.61 ? 220  PRO A CG  1 
ATOM   1629  C  CD  . PRO A 1 231 ? 56.179  20.462  -39.863  1.00 21.93 ? 220  PRO A CD  1 
ATOM   1630  N  N   . GLU A 1 232 ? 52.723  19.547  -41.660  1.00 23.68 ? 221  GLU A N   1 
ATOM   1631  C  CA  . GLU A 1 232 ? 51.524  19.365  -42.478  1.00 23.47 ? 221  GLU A CA  1 
ATOM   1632  C  C   . GLU A 1 232 ? 51.417  17.938  -43.092  1.00 23.49 ? 221  GLU A C   1 
ATOM   1633  O  O   . GLU A 1 232 ? 50.321  17.431  -43.364  1.00 23.56 ? 221  GLU A O   1 
ATOM   1634  C  CB  . GLU A 1 232 ? 51.418  20.481  -43.531  1.00 24.32 ? 221  GLU A CB  1 
ATOM   1635  C  CG  . GLU A 1 232 ? 52.239  20.279  -44.778  1.00 25.23 ? 221  GLU A CG  1 
ATOM   1636  C  CD  . GLU A 1 232 ? 53.728  20.541  -44.588  1.00 26.07 ? 221  GLU A CD  1 
ATOM   1637  O  OE1 . GLU A 1 232 ? 54.152  20.839  -43.452  1.00 25.97 ? 221  GLU A OE1 1 
ATOM   1638  O  OE2 . GLU A 1 232 ? 54.458  20.446  -45.602  1.00 25.59 ? 221  GLU A OE2 1 
ATOM   1639  N  N   . GLY A 1 233 ? 52.562  17.300  -43.286  1.00 21.87 ? 222  GLY A N   1 
ATOM   1640  C  CA  . GLY A 1 233 ? 52.612  15.916  -43.668  1.00 20.13 ? 222  GLY A CA  1 
ATOM   1641  C  C   . GLY A 1 233 ? 51.906  15.045  -42.662  1.00 18.80 ? 222  GLY A C   1 
ATOM   1642  O  O   . GLY A 1 233 ? 51.215  14.107  -43.048  1.00 19.35 ? 222  GLY A O   1 
ATOM   1643  N  N   . HIS A 1 234 ? 52.038  15.356  -41.373  1.00 17.63 ? 223  HIS A N   1 
ATOM   1644  C  CA  . HIS A 1 234 ? 51.356  14.552  -40.378  1.00 16.46 ? 223  HIS A CA  1 
ATOM   1645  C  C   . HIS A 1 234 ? 49.851  14.469  -40.687  1.00 16.02 ? 223  HIS A C   1 
ATOM   1646  O  O   . HIS A 1 234 ? 49.321  13.361  -40.866  1.00 14.26 ? 223  HIS A O   1 
ATOM   1647  C  CB  . HIS A 1 234 ? 51.610  15.053  -38.952  1.00 15.36 ? 223  HIS A CB  1 
ATOM   1648  C  CG  . HIS A 1 234 ? 51.161  14.077  -37.909  1.00 18.63 ? 223  HIS A CG  1 
ATOM   1649  N  ND1 . HIS A 1 234 ? 51.614  12.776  -37.874  1.00 17.88 ? 223  HIS A ND1 1 
ATOM   1650  C  CD2 . HIS A 1 234 ? 50.264  14.189  -36.899  1.00 17.17 ? 223  HIS A CD2 1 
ATOM   1651  C  CE1 . HIS A 1 234 ? 51.033  12.136  -36.870  1.00 19.29 ? 223  HIS A CE1 1 
ATOM   1652  N  NE2 . HIS A 1 234 ? 50.193  12.961  -36.281  1.00 16.66 ? 223  HIS A NE2 1 
ATOM   1653  N  N   . VAL A 1 235 ? 49.189  15.636  -40.794  1.00 15.90 ? 224  VAL A N   1 
ATOM   1654  C  CA  . VAL A 1 235 ? 47.757  15.709  -41.031  1.00 16.00 ? 224  VAL A CA  1 
ATOM   1655  C  C   . VAL A 1 235 ? 47.348  15.338  -42.457  1.00 16.82 ? 224  VAL A C   1 
ATOM   1656  O  O   . VAL A 1 235 ? 46.202  14.954  -42.689  1.00 16.98 ? 224  VAL A O   1 
ATOM   1657  C  CB  . VAL A 1 235 ? 47.147  17.109  -40.659  1.00 16.94 ? 224  VAL A CB  1 
ATOM   1658  C  CG1 . VAL A 1 235 ? 47.793  18.247  -41.413  1.00 17.63 ? 224  VAL A CG1 1 
ATOM   1659  C  CG2 . VAL A 1 235 ? 45.661  17.118  -40.904  1.00 14.72 ? 224  VAL A CG2 1 
ATOM   1660  N  N   . LEU A 1 236 ? 48.268  15.438  -43.401  1.00 16.31 ? 225  LEU A N   1 
ATOM   1661  C  CA  . LEU A 1 236 ? 47.962  15.032  -44.775  1.00 15.81 ? 225  LEU A CA  1 
ATOM   1662  C  C   . LEU A 1 236 ? 47.956  13.495  -44.976  1.00 15.59 ? 225  LEU A C   1 
ATOM   1663  O  O   . LEU A 1 236 ? 47.273  12.978  -45.875  1.00 16.65 ? 225  LEU A O   1 
ATOM   1664  C  CB  . LEU A 1 236 ? 48.951  15.652  -45.753  1.00 16.71 ? 225  LEU A CB  1 
ATOM   1665  C  CG  . LEU A 1 236 ? 48.449  16.924  -46.389  1.00 16.74 ? 225  LEU A CG  1 
ATOM   1666  C  CD1 . LEU A 1 236 ? 49.512  17.490  -47.321  1.00 20.54 ? 225  LEU A CD1 1 
ATOM   1667  C  CD2 . LEU A 1 236 ? 47.163  16.596  -47.133  1.00 19.67 ? 225  LEU A CD2 1 
ATOM   1668  N  N   . SER A 1 237 ? 48.711  12.788  -44.145  1.00 14.44 ? 226  SER A N   1 
ATOM   1669  C  CA  . SER A 1 237 ? 48.804  11.346  -44.234  1.00 14.42 ? 226  SER A CA  1 
ATOM   1670  C  C   . SER A 1 237 ? 47.711  10.665  -43.380  1.00 14.68 ? 226  SER A C   1 
ATOM   1671  O  O   . SER A 1 237 ? 47.496  9.479   -43.502  1.00 12.99 ? 226  SER A O   1 
ATOM   1672  C  CB  . SER A 1 237 ? 50.221  10.913  -43.828  1.00 14.42 ? 226  SER A CB  1 
ATOM   1673  O  OG  . SER A 1 237 ? 50.446  11.206  -42.449  1.00 13.17 ? 226  SER A OG  1 
ATOM   1674  N  N   . ARG A 1 238 ? 47.001  11.440  -42.557  1.00 14.69 ? 227  ARG A N   1 
ATOM   1675  C  CA  . ARG A 1 238 ? 45.989  10.913  -41.649  1.00 14.03 ? 227  ARG A CA  1 
ATOM   1676  C  C   . ARG A 1 238 ? 44.610  11.623  -41.664  1.00 13.54 ? 227  ARG A C   1 
ATOM   1677  O  O   . ARG A 1 238 ? 44.056  11.880  -40.599  1.00 10.75 ? 227  ARG A O   1 
ATOM   1678  C  CB  . ARG A 1 238 ? 46.528  10.976  -40.204  1.00 14.02 ? 227  ARG A CB  1 
ATOM   1679  C  CG  . ARG A 1 238 ? 47.974  10.659  -40.044  1.00 15.12 ? 227  ARG A CG  1 
ATOM   1680  C  CD  . ARG A 1 238 ? 48.412  10.735  -38.602  1.00 15.07 ? 227  ARG A CD  1 
ATOM   1681  N  NE  . ARG A 1 238 ? 48.102  9.466   -37.957  1.00 17.42 ? 227  ARG A NE  1 
ATOM   1682  C  CZ  . ARG A 1 238 ? 48.985  8.558   -37.538  1.00 19.21 ? 227  ARG A CZ  1 
ATOM   1683  N  NH1 . ARG A 1 238 ? 48.569  7.439   -36.938  1.00 20.34 ? 227  ARG A NH1 1 
ATOM   1684  N  NH2 . ARG A 1 238 ? 50.275  8.751   -37.689  1.00 19.49 ? 227  ARG A NH2 1 
ATOM   1685  N  N   . PRO A 1 239 ? 44.025  11.889  -42.844  1.00 10.96 ? 228  PRO A N   1 
ATOM   1686  C  CA  . PRO A 1 239 ? 42.745  12.580  -42.904  1.00 13.74 ? 228  PRO A CA  1 
ATOM   1687  C  C   . PRO A 1 239 ? 41.639  11.907  -42.104  1.00 14.81 ? 228  PRO A C   1 
ATOM   1688  O  O   . PRO A 1 239 ? 41.627  10.699  -41.936  1.00 13.91 ? 228  PRO A O   1 
ATOM   1689  C  CB  . PRO A 1 239 ? 42.380  12.528  -44.389  1.00 13.61 ? 228  PRO A CB  1 
ATOM   1690  C  CG  . PRO A 1 239 ? 43.618  12.226  -45.071  1.00 12.07 ? 228  PRO A CG  1 
ATOM   1691  C  CD  . PRO A 1 239 ? 44.522  11.522  -44.183  1.00 14.06 ? 228  PRO A CD  1 
ATOM   1692  N  N   . GLU A 1 240 ? 40.669  12.672  -41.643  1.00 17.28 ? 229  GLU A N   1 
ATOM   1693  C  CA  . GLU A 1 240 ? 39.680  12.106  -40.699  1.00 17.92 ? 229  GLU A CA  1 
ATOM   1694  C  C   . GLU A 1 240 ? 38.971  10.846  -41.171  1.00 17.43 ? 229  GLU A C   1 
ATOM   1695  O  O   . GLU A 1 240 ? 38.399  10.098  -40.370  1.00 15.54 ? 229  GLU A O   1 
ATOM   1696  C  CB  . GLU A 1 240 ? 38.643  13.139  -40.298  1.00 18.94 ? 229  GLU A CB  1 
ATOM   1697  C  CG  . GLU A 1 240 ? 37.925  13.866  -41.415  1.00 20.15 ? 229  GLU A CG  1 
ATOM   1698  C  CD  . GLU A 1 240 ? 37.329  15.162  -40.897  1.00 22.15 ? 229  GLU A CD  1 
ATOM   1699  O  OE1 . GLU A 1 240 ? 38.127  16.097  -40.615  1.00 28.82 ? 229  GLU A OE1 1 
ATOM   1700  O  OE2 . GLU A 1 240 ? 36.083  15.224  -40.721  1.00 29.58 ? 229  GLU A OE2 1 
ATOM   1701  N  N   . GLU A 1 241 ? 39.029  10.628  -42.475  1.00 16.06 ? 230  GLU A N   1 
ATOM   1702  C  CA  . GLU A 1 241 ? 38.418  9.507   -43.128  1.00 16.08 ? 230  GLU A CA  1 
ATOM   1703  C  C   . GLU A 1 241 ? 39.023  8.205   -42.730  1.00 13.65 ? 230  GLU A C   1 
ATOM   1704  O  O   . GLU A 1 241 ? 38.326  7.203   -42.832  1.00 13.89 ? 230  GLU A O   1 
ATOM   1705  C  CB  . GLU A 1 241 ? 38.574  9.615   -44.633  1.00 16.17 ? 230  GLU A CB  1 
ATOM   1706  C  CG  . GLU A 1 241 ? 37.723  10.680  -45.259  1.00 23.40 ? 230  GLU A CG  1 
ATOM   1707  C  CD  . GLU A 1 241 ? 38.336  12.067  -45.207  1.00 27.36 ? 230  GLU A CD  1 
ATOM   1708  O  OE1 . GLU A 1 241 ? 38.792  12.493  -44.130  1.00 29.24 ? 230  GLU A OE1 1 
ATOM   1709  O  OE2 . GLU A 1 241 ? 38.342  12.755  -46.247  1.00 31.79 ? 230  GLU A OE2 1 
ATOM   1710  N  N   . VAL A 1 242 ? 40.311  8.202   -42.341  1.00 11.48 ? 231  VAL A N   1 
ATOM   1711  C  CA  . VAL A 1 242 ? 40.984  6.959   -41.855  1.00 11.37 ? 231  VAL A CA  1 
ATOM   1712  C  C   . VAL A 1 242 ? 40.713  6.788   -40.355  1.00 10.35 ? 231  VAL A C   1 
ATOM   1713  O  O   . VAL A 1 242 ? 40.798  5.689   -39.816  1.00 9.14  ? 231  VAL A O   1 
ATOM   1714  C  CB  . VAL A 1 242 ? 42.498  6.915   -42.137  1.00 11.14 ? 231  VAL A CB  1 
ATOM   1715  C  CG1 . VAL A 1 242 ? 42.758  7.165   -43.620  1.00 12.73 ? 231  VAL A CG1 1 
ATOM   1716  C  CG2 . VAL A 1 242 ? 43.250  7.893   -41.228  1.00 12.08 ? 231  VAL A CG2 1 
ATOM   1717  N  N   . GLU A 1 243 ? 40.351  7.883   -39.705  1.00 10.19 ? 232  GLU A N   1 
ATOM   1718  C  CA  . GLU A 1 243 ? 39.788  7.797   -38.347  1.00 9.81  ? 232  GLU A CA  1 
ATOM   1719  C  C   . GLU A 1 243 ? 38.408  7.146   -38.404  1.00 10.87 ? 232  GLU A C   1 
ATOM   1720  O  O   . GLU A 1 243 ? 38.185  6.062   -37.846  1.00 12.79 ? 232  GLU A O   1 
ATOM   1721  C  CB  . GLU A 1 243 ? 39.671  9.159   -37.703  1.00 10.04 ? 232  GLU A CB  1 
ATOM   1722  C  CG  . GLU A 1 243 ? 39.387  9.056   -36.143  1.00 6.64  ? 232  GLU A CG  1 
ATOM   1723  C  CD  . GLU A 1 243 ? 39.096  10.390  -35.485  1.00 9.95  ? 232  GLU A CD  1 
ATOM   1724  O  OE1 . GLU A 1 243 ? 39.236  11.406  -36.124  1.00 11.81 ? 232  GLU A OE1 1 
ATOM   1725  O  OE2 . GLU A 1 243 ? 38.743  10.449  -34.269  1.00 15.64 ? 232  GLU A OE2 1 
ATOM   1726  N  N   . ALA A 1 244 ? 37.486  7.787   -39.102  1.00 10.79 ? 233  ALA A N   1 
ATOM   1727  C  CA  . ALA A 1 244 ? 36.113  7.331   -39.167  1.00 10.52 ? 233  ALA A CA  1 
ATOM   1728  C  C   . ALA A 1 244 ? 36.025  5.855   -39.555  1.00 12.12 ? 233  ALA A C   1 
ATOM   1729  O  O   . ALA A 1 244 ? 35.244  5.101   -38.977  1.00 10.76 ? 233  ALA A O   1 
ATOM   1730  C  CB  . ALA A 1 244 ? 35.293  8.232   -40.106  1.00 10.13 ? 233  ALA A CB  1 
ATOM   1731  N  N   . GLU A 1 245 ? 36.847  5.426   -40.509  1.00 13.67 ? 234  GLU A N   1 
ATOM   1732  C  CA  . GLU A 1 245 ? 36.722  4.099   -41.061  1.00 13.85 ? 234  GLU A CA  1 
ATOM   1733  C  C   . GLU A 1 245 ? 37.042  3.104   -39.985  1.00 14.04 ? 234  GLU A C   1 
ATOM   1734  O  O   . GLU A 1 245 ? 36.371  2.071   -39.865  1.00 14.72 ? 234  GLU A O   1 
ATOM   1735  C  CB  . GLU A 1 245 ? 37.720  3.910   -42.189  1.00 14.20 ? 234  GLU A CB  1 
ATOM   1736  C  CG  . GLU A 1 245 ? 37.721  2.561   -42.829  1.00 14.11 ? 234  GLU A CG  1 
ATOM   1737  C  CD  . GLU A 1 245 ? 38.371  1.469   -42.027  1.00 15.05 ? 234  GLU A CD  1 
ATOM   1738  O  OE1 . GLU A 1 245 ? 39.586  1.562   -41.735  1.00 18.67 ? 234  GLU A OE1 1 
ATOM   1739  O  OE2 . GLU A 1 245 ? 37.651  0.479   -41.738  1.00 13.55 ? 234  GLU A OE2 1 
ATOM   1740  N  N   . ALA A 1 246 ? 38.038  3.440   -39.169  1.00 14.98 ? 235  ALA A N   1 
ATOM   1741  C  CA  . ALA A 1 246 ? 38.558  2.515   -38.193  1.00 13.87 ? 235  ALA A CA  1 
ATOM   1742  C  C   . ALA A 1 246 ? 37.653  2.493   -36.960  1.00 14.31 ? 235  ALA A C   1 
ATOM   1743  O  O   . ALA A 1 246 ? 37.478  1.452   -36.354  1.00 13.97 ? 235  ALA A O   1 
ATOM   1744  C  CB  . ALA A 1 246 ? 40.007  2.862   -37.844  1.00 15.68 ? 235  ALA A CB  1 
ATOM   1745  N  N   . VAL A 1 247 ? 37.074  3.638   -36.606  1.00 13.69 ? 236  VAL A N   1 
ATOM   1746  C  CA  . VAL A 1 247 ? 35.980  3.713   -35.627  1.00 11.82 ? 236  VAL A CA  1 
ATOM   1747  C  C   . VAL A 1 247 ? 34.805  2.826   -36.027  1.00 11.95 ? 236  VAL A C   1 
ATOM   1748  O  O   . VAL A 1 247 ? 34.308  2.044   -35.231  1.00 9.96  ? 236  VAL A O   1 
ATOM   1749  C  CB  . VAL A 1 247 ? 35.502  5.188   -35.407  1.00 11.00 ? 236  VAL A CB  1 
ATOM   1750  C  CG1 . VAL A 1 247 ? 34.204  5.245   -34.570  1.00 7.99  ? 236  VAL A CG1 1 
ATOM   1751  C  CG2 . VAL A 1 247 ? 36.594  6.027   -34.773  1.00 7.30  ? 236  VAL A CG2 1 
ATOM   1752  N  N   . ASN A 1 248 ? 34.376  2.932   -37.279  1.00 12.22 ? 237  ASN A N   1 
ATOM   1753  C  CA  . ASN A 1 248 ? 33.287  2.120   -37.833  1.00 12.88 ? 237  ASN A CA  1 
ATOM   1754  C  C   . ASN A 1 248 ? 33.570  0.585   -37.804  1.00 13.39 ? 237  ASN A C   1 
ATOM   1755  O  O   . ASN A 1 248 ? 32.679  -0.213  -37.502  1.00 15.98 ? 237  ASN A O   1 
ATOM   1756  C  CB  . ASN A 1 248 ? 33.005  2.560   -39.288  1.00 12.84 ? 237  ASN A CB  1 
ATOM   1757  C  CG  . ASN A 1 248 ? 31.708  1.990   -39.828  1.00 13.69 ? 237  ASN A CG  1 
ATOM   1758  O  OD1 . ASN A 1 248 ? 31.702  1.196   -40.753  1.00 14.41 ? 237  ASN A OD1 1 
ATOM   1759  N  ND2 . ASN A 1 248 ? 30.621  2.293   -39.156  1.00 15.41 ? 237  ASN A ND2 1 
ATOM   1760  N  N   . ARG A 1 249 ? 34.816  0.225   -38.121  1.00 12.29 ? 238  ARG A N   1 
ATOM   1761  C  CA  . ARG A 1 249 ? 35.310  -1.138  -38.077  1.00 11.45 ? 238  ARG A CA  1 
ATOM   1762  C  C   . ARG A 1 249 ? 35.344  -1.685  -36.680  1.00 12.08 ? 238  ARG A C   1 
ATOM   1763  O  O   . ARG A 1 249 ? 34.994  -2.834  -36.448  1.00 12.01 ? 238  ARG A O   1 
ATOM   1764  C  CB  . ARG A 1 249 ? 36.713  -1.179  -38.607  1.00 12.83 ? 238  ARG A CB  1 
ATOM   1765  C  CG  . ARG A 1 249 ? 37.292  -2.590  -38.776  1.00 13.16 ? 238  ARG A CG  1 
ATOM   1766  C  CD  . ARG A 1 249 ? 38.091  -2.654  -40.059  1.00 11.72 ? 238  ARG A CD  1 
ATOM   1767  N  NE  . ARG A 1 249 ? 38.943  -1.491  -40.209  1.00 13.74 ? 238  ARG A NE  1 
ATOM   1768  C  CZ  . ARG A 1 249 ? 40.160  -1.358  -39.678  1.00 10.58 ? 238  ARG A CZ  1 
ATOM   1769  N  NH1 . ARG A 1 249 ? 40.696  -2.289  -38.898  1.00 15.96 ? 238  ARG A NH1 1 
ATOM   1770  N  NH2 . ARG A 1 249 ? 40.830  -0.259  -39.886  1.00 9.09  ? 238  ARG A NH2 1 
ATOM   1771  N  N   . ALA A 1 250 ? 35.815  -0.857  -35.770  1.00 10.76 ? 239  ALA A N   1 
ATOM   1772  C  CA  . ALA A 1 250 ? 35.868  -1.209  -34.341  1.00 9.41  ? 239  ALA A CA  1 
ATOM   1773  C  C   . ALA A 1 250 ? 34.480  -1.436  -33.767  1.00 9.13  ? 239  ALA A C   1 
ATOM   1774  O  O   . ALA A 1 250 ? 34.262  -2.394  -33.039  1.00 8.16  ? 239  ALA A O   1 
ATOM   1775  C  CB  . ALA A 1 250 ? 36.611  -0.145  -33.602  1.00 8.00  ? 239  ALA A CB  1 
ATOM   1776  N  N   . ILE A 1 251 ? 33.536  -0.562  -34.090  1.00 10.60 ? 240  ILE A N   1 
ATOM   1777  C  CA  . ILE A 1 251 ? 32.098  -0.763  -33.781  1.00 9.80  ? 240  ILE A CA  1 
ATOM   1778  C  C   . ILE A 1 251 ? 31.451  -2.047  -34.386  1.00 10.97 ? 240  ILE A C   1 
ATOM   1779  O  O   . ILE A 1 251 ? 30.705  -2.768  -33.734  1.00 8.31  ? 240  ILE A O   1 
ATOM   1780  C  CB  . ILE A 1 251 ? 31.303  0.514   -34.188  1.00 9.99  ? 240  ILE A CB  1 
ATOM   1781  C  CG1 . ILE A 1 251 ? 31.610  1.653   -33.170  1.00 12.47 ? 240  ILE A CG1 1 
ATOM   1782  C  CG2 . ILE A 1 251 ? 29.813  0.228   -34.276  1.00 9.09  ? 240  ILE A CG2 1 
ATOM   1783  C  CD1 . ILE A 1 251 ? 31.228  3.107   -33.623  1.00 11.52 ? 240  ILE A CD1 1 
ATOM   1784  N  N   . THR A 1 252 ? 31.708  -2.330  -35.659  1.00 9.96  ? 241  THR A N   1 
ATOM   1785  C  CA  . THR A 1 252 ? 31.250  -3.531  -36.216  1.00 8.23  ? 241  THR A CA  1 
ATOM   1786  C  C   . THR A 1 252 ? 31.709  -4.770  -35.470  1.00 9.46  ? 241  THR A C   1 
ATOM   1787  O  O   . THR A 1 252 ? 30.949  -5.722  -35.408  1.00 11.49 ? 241  THR A O   1 
ATOM   1788  C  CB  . THR A 1 252 ? 31.740  -3.655  -37.656  1.00 9.57  ? 241  THR A CB  1 
ATOM   1789  O  OG1 . THR A 1 252 ? 31.333  -2.476  -38.361  1.00 5.63  ? 241  THR A OG1 1 
ATOM   1790  C  CG2 . THR A 1 252 ? 31.200  -4.917  -38.255  1.00 7.19  ? 241  THR A CG2 1 
ATOM   1791  N  N   . ILE A 1 253 ? 32.918  -4.761  -34.892  1.00 9.41  ? 242  ILE A N   1 
ATOM   1792  C  CA  . ILE A 1 253 ? 33.479  -5.934  -34.201  1.00 8.96  ? 242  ILE A CA  1 
ATOM   1793  C  C   . ILE A 1 253 ? 32.944  -6.001  -32.772  1.00 10.97 ? 242  ILE A C   1 
ATOM   1794  O  O   . ILE A 1 253 ? 32.686  -7.092  -32.248  1.00 8.55  ? 242  ILE A O   1 
ATOM   1795  C  CB  . ILE A 1 253 ? 35.054  -5.932  -34.190  1.00 7.69  ? 242  ILE A CB  1 
ATOM   1796  C  CG1 . ILE A 1 253 ? 35.605  -5.870  -35.635  1.00 9.76  ? 242  ILE A CG1 1 
ATOM   1797  C  CG2 . ILE A 1 253 ? 35.626  -7.195  -33.488  1.00 7.99  ? 242  ILE A CG2 1 
ATOM   1798  C  CD1 . ILE A 1 253 ? 37.030  -5.256  -35.758  1.00 10.49 ? 242  ILE A CD1 1 
ATOM   1799  N  N   . ALA A 1 254 ? 32.761  -4.840  -32.162  1.00 10.86 ? 243  ALA A N   1 
ATOM   1800  C  CA  . ALA A 1 254 ? 32.229  -4.778  -30.806  1.00 12.47 ? 243  ALA A CA  1 
ATOM   1801  C  C   . ALA A 1 254 ? 30.795  -5.311  -30.826  1.00 13.59 ? 243  ALA A C   1 
ATOM   1802  O  O   . ALA A 1 254 ? 30.416  -6.072  -29.938  1.00 15.12 ? 243  ALA A O   1 
ATOM   1803  C  CB  . ALA A 1 254 ? 32.310  -3.345  -30.256  1.00 11.85 ? 243  ALA A CB  1 
ATOM   1804  N  N   . ASN A 1 255 ? 30.023  -4.967  -31.864  1.00 14.62 ? 244  ASN A N   1 
ATOM   1805  C  CA  . ASN A 1 255 ? 28.615  -5.443  -31.965  1.00 14.72 ? 244  ASN A CA  1 
ATOM   1806  C  C   . ASN A 1 255 ? 28.532  -6.959  -32.207  1.00 15.27 ? 244  ASN A C   1 
ATOM   1807  O  O   . ASN A 1 255 ? 27.679  -7.627  -31.635  1.00 15.23 ? 244  ASN A O   1 
ATOM   1808  C  CB  . ASN A 1 255 ? 27.796  -4.713  -33.036  1.00 12.42 ? 244  ASN A CB  1 
ATOM   1809  C  CG  . ASN A 1 255 ? 27.248  -3.366  -32.582  1.00 14.85 ? 244  ASN A CG  1 
ATOM   1810  O  OD1 . ASN A 1 255 ? 26.965  -3.112  -31.375  1.00 2.00  ? 244  ASN A OD1 1 
ATOM   1811  N  ND2 . ASN A 1 255 ? 27.032  -2.484  -33.570  1.00 2.00  ? 244  ASN A ND2 1 
ATOM   1812  N  N   . GLN A 1 256 ? 29.418  -7.481  -33.055  1.00 17.09 ? 245  GLN A N   1 
ATOM   1813  C  CA  . GLN A 1 256 ? 29.496  -8.920  -33.337  1.00 16.84 ? 245  GLN A CA  1 
ATOM   1814  C  C   . GLN A 1 256 ? 29.921  -9.694  -32.106  1.00 16.20 ? 245  GLN A C   1 
ATOM   1815  O  O   . GLN A 1 256 ? 29.482  -10.820 -31.843  1.00 17.03 ? 245  GLN A O   1 
ATOM   1816  C  CB  . GLN A 1 256 ? 30.491  -9.185  -34.457  1.00 17.91 ? 245  GLN A CB  1 
ATOM   1817  C  CG  . GLN A 1 256 ? 29.945  -8.881  -35.825  1.00 19.79 ? 245  GLN A CG  1 
ATOM   1818  C  CD  . GLN A 1 256 ? 28.586  -9.469  -36.007  1.00 24.18 ? 245  GLN A CD  1 
ATOM   1819  O  OE1 . GLN A 1 256 ? 27.579  -8.809  -35.761  1.00 29.23 ? 245  GLN A OE1 1 
ATOM   1820  N  NE2 . GLN A 1 256 ? 28.536  -10.732 -36.395  1.00 27.55 ? 245  GLN A NE2 1 
ATOM   1821  N  N   . THR A 1 257 ? 30.781  -9.082  -31.346  1.00 15.32 ? 246  THR A N   1 
ATOM   1822  C  CA  . THR A 1 257 ? 31.326  -9.752  -30.201  1.00 14.43 ? 246  THR A CA  1 
ATOM   1823  C  C   . THR A 1 257 ? 30.573  -9.435  -28.892  1.00 15.20 ? 246  THR A C   1 
ATOM   1824  O  O   . THR A 1 257 ? 30.925  -9.949  -27.846  1.00 18.12 ? 246  THR A O   1 
ATOM   1825  C  CB  . THR A 1 257 ? 32.850  -9.457  -30.101  1.00 13.78 ? 246  THR A CB  1 
ATOM   1826  O  OG1 . THR A 1 257 ? 33.350  -10.054 -28.908  1.00 19.57 ? 246  THR A OG1 1 
ATOM   1827  C  CG2 . THR A 1 257 ? 33.132  -7.961  -30.061  1.00 3.38  ? 246  THR A CG2 1 
ATOM   1828  N  N   . ASN A 1 258 ? 29.535  -8.610  -28.943  1.00 15.49 ? 247  ASN A N   1 
ATOM   1829  C  CA  . ASN A 1 258 ? 28.853  -8.097  -27.714  1.00 13.99 ? 247  ASN A CA  1 
ATOM   1830  C  C   . ASN A 1 258 ? 29.780  -7.554  -26.599  1.00 15.66 ? 247  ASN A C   1 
ATOM   1831  O  O   . ASN A 1 258 ? 29.512  -7.723  -25.390  1.00 17.33 ? 247  ASN A O   1 
ATOM   1832  C  CB  . ASN A 1 258 ? 27.853  -9.130  -27.172  1.00 14.94 ? 247  ASN A CB  1 
ATOM   1833  C  CG  . ASN A 1 258 ? 26.973  -8.580  -26.020  1.00 15.77 ? 247  ASN A CG  1 
ATOM   1834  O  OD1 . ASN A 1 258 ? 26.733  -7.360  -25.910  1.00 12.06 ? 247  ASN A OD1 1 
ATOM   1835  N  ND2 . ASN A 1 258 ? 26.492  -9.481  -25.164  1.00 15.53 ? 247  ASN A ND2 1 
ATOM   1836  N  N   . CYS A 1 259 ? 30.810  -6.811  -27.018  1.00 14.68 ? 248  CYS A N   1 
ATOM   1837  C  CA  . CYS A 1 259 ? 31.735  -6.165  -26.111  1.00 13.55 ? 248  CYS A CA  1 
ATOM   1838  C  C   . CYS A 1 259 ? 31.612  -4.627  -26.129  1.00 13.04 ? 248  CYS A C   1 
ATOM   1839  O  O   . CYS A 1 259 ? 31.578  -4.022  -27.203  1.00 12.28 ? 248  CYS A O   1 
ATOM   1840  C  CB  . CYS A 1 259 ? 33.149  -6.579  -26.430  1.00 13.51 ? 248  CYS A CB  1 
ATOM   1841  S  SG  . CYS A 1 259 ? 34.399  -5.932  -25.361  1.00 12.93 ? 248  CYS A SG  1 
ATOM   1842  N  N   . PRO A 1 260 ? 31.591  -4.003  -24.925  1.00 11.76 ? 249  PRO A N   1 
ATOM   1843  C  CA  . PRO A 1 260 ? 31.567  -2.569  -24.733  1.00 13.90 ? 249  PRO A CA  1 
ATOM   1844  C  C   . PRO A 1 260 ? 32.796  -1.879  -25.307  1.00 14.77 ? 249  PRO A C   1 
ATOM   1845  O  O   . PRO A 1 260 ? 33.936  -2.237  -24.951  1.00 15.11 ? 249  PRO A O   1 
ATOM   1846  C  CB  . PRO A 1 260 ? 31.530  -2.379  -23.199  1.00 14.27 ? 249  PRO A CB  1 
ATOM   1847  C  CG  . PRO A 1 260 ? 31.610  -3.680  -22.597  1.00 13.32 ? 249  PRO A CG  1 
ATOM   1848  C  CD  . PRO A 1 260 ? 31.649  -4.735  -23.657  1.00 12.95 ? 249  PRO A CD  1 
ATOM   1849  N  N   . LEU A 1 261 ? 32.554  -0.883  -26.171  1.00 14.69 ? 250  LEU A N   1 
ATOM   1850  C  CA  . LEU A 1 261 ? 33.603  -0.259  -26.933  1.00 14.61 ? 250  LEU A CA  1 
ATOM   1851  C  C   . LEU A 1 261 ? 33.796  1.163   -26.458  1.00 15.07 ? 250  LEU A C   1 
ATOM   1852  O  O   . LEU A 1 261 ? 32.846  1.826   -26.097  1.00 17.04 ? 250  LEU A O   1 
ATOM   1853  C  CB  . LEU A 1 261 ? 33.279  -0.311  -28.446  1.00 13.59 ? 250  LEU A CB  1 
ATOM   1854  C  CG  . LEU A 1 261 ? 34.366  0.138   -29.413  1.00 14.31 ? 250  LEU A CG  1 
ATOM   1855  C  CD1 . LEU A 1 261 ? 35.570  -0.808  -29.481  1.00 12.76 ? 250  LEU A CD1 1 
ATOM   1856  C  CD2 . LEU A 1 261 ? 33.746  0.363   -30.804  1.00 9.35  ? 250  LEU A CD2 1 
ATOM   1857  N  N   . TYR A 1 262 ? 35.039  1.617   -26.461  1.00 14.56 ? 251  TYR A N   1 
ATOM   1858  C  CA  . TYR A 1 262 ? 35.359  2.978   -26.050  1.00 15.62 ? 251  TYR A CA  1 
ATOM   1859  C  C   . TYR A 1 262 ? 36.312  3.550   -27.051  1.00 14.61 ? 251  TYR A C   1 
ATOM   1860  O  O   . TYR A 1 262 ? 37.332  2.944   -27.345  1.00 16.97 ? 251  TYR A O   1 
ATOM   1861  C  CB  . TYR A 1 262 ? 35.991  2.933   -24.683  1.00 15.34 ? 251  TYR A CB  1 
ATOM   1862  C  CG  . TYR A 1 262 ? 36.418  4.230   -24.081  1.00 15.69 ? 251  TYR A CG  1 
ATOM   1863  C  CD1 . TYR A 1 262 ? 37.573  4.903   -24.508  1.00 17.20 ? 251  TYR A CD1 1 
ATOM   1864  C  CD2 . TYR A 1 262 ? 35.715  4.754   -23.028  1.00 17.02 ? 251  TYR A CD2 1 
ATOM   1865  C  CE1 . TYR A 1 262 ? 37.975  6.077   -23.913  1.00 16.59 ? 251  TYR A CE1 1 
ATOM   1866  C  CE2 . TYR A 1 262 ? 36.111  5.920   -22.419  1.00 19.38 ? 251  TYR A CE2 1 
ATOM   1867  C  CZ  . TYR A 1 262 ? 37.226  6.572   -22.846  1.00 16.53 ? 251  TYR A CZ  1 
ATOM   1868  O  OH  . TYR A 1 262 ? 37.571  7.722   -22.200  1.00 17.38 ? 251  TYR A OH  1 
ATOM   1869  N  N   . ILE A 1 263 ? 35.972  4.715   -27.591  1.00 15.56 ? 252  ILE A N   1 
ATOM   1870  C  CA  . ILE A 1 263 ? 36.759  5.334   -28.676  1.00 14.44 ? 252  ILE A CA  1 
ATOM   1871  C  C   . ILE A 1 263 ? 37.614  6.458   -28.111  1.00 13.21 ? 252  ILE A C   1 
ATOM   1872  O  O   . ILE A 1 263 ? 37.091  7.442   -27.587  1.00 13.53 ? 252  ILE A O   1 
ATOM   1873  C  CB  . ILE A 1 263 ? 35.864  5.831   -29.807  1.00 14.87 ? 252  ILE A CB  1 
ATOM   1874  C  CG1 . ILE A 1 263 ? 34.905  4.719   -30.247  1.00 16.48 ? 252  ILE A CG1 1 
ATOM   1875  C  CG2 . ILE A 1 263 ? 36.701  6.242   -31.047  1.00 12.88 ? 252  ILE A CG2 1 
ATOM   1876  C  CD1 . ILE A 1 263 ? 35.567  3.734   -31.261  1.00 15.01 ? 252  ILE A CD1 1 
ATOM   1877  N  N   . THR A 1 264 ? 38.935  6.286   -28.131  1.00 12.84 ? 253  THR A N   1 
ATOM   1878  C  CA  . THR A 1 264 ? 39.794  7.325   -27.596  1.00 12.43 ? 253  THR A CA  1 
ATOM   1879  C  C   . THR A 1 264 ? 39.899  8.435   -28.574  1.00 12.87 ? 253  THR A C   1 
ATOM   1880  O  O   . THR A 1 264 ? 39.747  8.255   -29.827  1.00 8.41  ? 253  THR A O   1 
ATOM   1881  C  CB  . THR A 1 264 ? 41.272  6.881   -27.218  1.00 14.50 ? 253  THR A CB  1 
ATOM   1882  O  OG1 . THR A 1 264 ? 41.911  6.267   -28.335  1.00 10.07 ? 253  THR A OG1 1 
ATOM   1883  C  CG2 . THR A 1 264 ? 41.324  5.990   -25.999  1.00 10.19 ? 253  THR A CG2 1 
ATOM   1884  N  N   . LYS A 1 265 ? 40.220  9.589   -28.036  1.00 11.82 ? 254  LYS A N   1 
ATOM   1885  C  CA  . LYS A 1 265 ? 40.658  10.662  -28.845  1.00 13.73 ? 254  LYS A CA  1 
ATOM   1886  C  C   . LYS A 1 265 ? 39.759  10.791  -30.044  1.00 13.92 ? 254  LYS A C   1 
ATOM   1887  O  O   . LYS A 1 265 ? 40.203  10.624  -31.178  1.00 12.45 ? 254  LYS A O   1 
ATOM   1888  C  CB  . LYS A 1 265 ? 42.082  10.416  -29.352  1.00 15.65 ? 254  LYS A CB  1 
ATOM   1889  C  CG  . LYS A 1 265 ? 43.146  10.302  -28.325  1.00 15.84 ? 254  LYS A CG  1 
ATOM   1890  C  CD  . LYS A 1 265 ? 44.354  9.670   -28.988  1.00 18.04 ? 254  LYS A CD  1 
ATOM   1891  C  CE  . LYS A 1 265 ? 45.684  9.930   -28.304  1.00 20.90 ? 254  LYS A CE  1 
ATOM   1892  N  NZ  . LYS A 1 265 ? 46.767  9.766   -29.362  1.00 21.02 ? 254  LYS A NZ  1 
ATOM   1893  N  N   . VAL A 1 266 ? 38.491  11.107  -29.795  1.00 14.08 ? 255  VAL A N   1 
ATOM   1894  C  CA  . VAL A 1 266 ? 37.589  11.511  -30.895  1.00 13.44 ? 255  VAL A CA  1 
ATOM   1895  C  C   . VAL A 1 266 ? 37.984  12.936  -31.388  1.00 13.94 ? 255  VAL A C   1 
ATOM   1896  O  O   . VAL A 1 266 ? 37.933  13.936  -30.628  1.00 12.49 ? 255  VAL A O   1 
ATOM   1897  C  CB  . VAL A 1 266 ? 36.101  11.408  -30.466  1.00 11.92 ? 255  VAL A CB  1 
ATOM   1898  C  CG1 . VAL A 1 266 ? 35.227  11.948  -31.552  1.00 13.62 ? 255  VAL A CG1 1 
ATOM   1899  C  CG2 . VAL A 1 266 ? 35.745  9.971   -30.173  1.00 7.32  ? 255  VAL A CG2 1 
ATOM   1900  N  N   . MET A 1 267 ? 38.377  13.008  -32.671  1.00 14.39 ? 256  MET A N   1 
ATOM   1901  C  CA  . MET A 1 267 ? 39.007  14.202  -33.236  1.00 14.18 ? 256  MET A CA  1 
ATOM   1902  C  C   . MET A 1 267 ? 38.306  14.792  -34.442  1.00 14.15 ? 256  MET A C   1 
ATOM   1903  O  O   . MET A 1 267 ? 38.517  15.955  -34.772  1.00 13.45 ? 256  MET A O   1 
ATOM   1904  C  CB  . MET A 1 267 ? 40.460  13.915  -33.613  1.00 14.51 ? 256  MET A CB  1 
ATOM   1905  C  CG  . MET A 1 267 ? 41.306  13.354  -32.468  1.00 15.02 ? 256  MET A CG  1 
ATOM   1906  S  SD  . MET A 1 267 ? 41.737  14.459  -31.110  1.00 16.55 ? 256  MET A SD  1 
ATOM   1907  C  CE  . MET A 1 267 ? 42.891  15.499  -32.004  1.00 20.59 ? 256  MET A CE  1 
ATOM   1908  N  N   . SER A 1 268 ? 37.441  14.020  -35.091  1.00 13.10 ? 257  SER A N   1 
ATOM   1909  C  CA  . SER A 1 268 ? 36.823  14.523  -36.301  1.00 13.31 ? 257  SER A CA  1 
ATOM   1910  C  C   . SER A 1 268 ? 35.308  14.585  -36.177  1.00 13.64 ? 257  SER A C   1 
ATOM   1911  O  O   . SER A 1 268 ? 34.764  14.157  -35.162  1.00 13.75 ? 257  SER A O   1 
ATOM   1912  C  CB  . SER A 1 268 ? 37.297  13.708  -37.479  1.00 12.09 ? 257  SER A CB  1 
ATOM   1913  O  OG  . SER A 1 268 ? 36.884  12.377  -37.386  1.00 10.56 ? 257  SER A OG  1 
ATOM   1914  N  N   . LYS A 1 269 ? 34.652  15.210  -37.159  1.00 14.30 ? 258  LYS A N   1 
ATOM   1915  C  CA  . LYS A 1 269 ? 33.201  15.195  -37.284  1.00 16.14 ? 258  LYS A CA  1 
ATOM   1916  C  C   . LYS A 1 269 ? 32.758  13.880  -37.915  1.00 17.06 ? 258  LYS A C   1 
ATOM   1917  O  O   . LYS A 1 269 ? 31.673  13.389  -37.632  1.00 18.93 ? 258  LYS A O   1 
ATOM   1918  C  CB  . LYS A 1 269 ? 32.688  16.354  -38.134  1.00 16.71 ? 258  LYS A CB  1 
ATOM   1919  C  CG  . LYS A 1 269 ? 32.748  17.740  -37.462  1.00 19.15 ? 258  LYS A CG  1 
ATOM   1920  C  CD  . LYS A 1 269 ? 32.569  18.882  -38.439  1.00 19.12 ? 258  LYS A CD  1 
ATOM   1921  C  CE  . LYS A 1 269 ? 31.867  18.496  -39.713  1.00 23.50 ? 258  LYS A CE  1 
ATOM   1922  N  NZ  . LYS A 1 269 ? 31.654  19.735  -40.519  1.00 25.94 ? 258  LYS A NZ  1 
ATOM   1923  N  N   . SER A 1 270 ? 33.590  13.322  -38.785  1.00 18.34 ? 259  SER A N   1 
ATOM   1924  C  CA  . SER A 1 270 ? 33.345  11.987  -39.314  1.00 17.25 ? 259  SER A CA  1 
ATOM   1925  C  C   . SER A 1 270 ? 33.245  10.907  -38.236  1.00 17.53 ? 259  SER A C   1 
ATOM   1926  O  O   . SER A 1 270 ? 32.328  10.115  -38.273  1.00 18.44 ? 259  SER A O   1 
ATOM   1927  C  CB  . SER A 1 270 ? 34.431  11.616  -40.294  1.00 17.95 ? 259  SER A CB  1 
ATOM   1928  O  OG  . SER A 1 270 ? 34.236  12.340  -41.468  1.00 21.59 ? 259  SER A OG  1 
ATOM   1929  N  N   . SER A 1 271 ? 34.187  10.885  -37.288  1.00 15.48 ? 260  SER A N   1 
ATOM   1930  C  CA  . SER A 1 271 ? 34.290  9.794   -36.339  1.00 14.52 ? 260  SER A CA  1 
ATOM   1931  C  C   . SER A 1 271 ? 33.277  9.970   -35.229  1.00 12.72 ? 260  SER A C   1 
ATOM   1932  O  O   . SER A 1 271 ? 32.731  8.990   -34.745  1.00 11.67 ? 260  SER A O   1 
ATOM   1933  C  CB  . SER A 1 271 ? 35.713  9.657   -35.778  1.00 14.22 ? 260  SER A CB  1 
ATOM   1934  O  OG  . SER A 1 271 ? 36.064  10.737  -34.942  1.00 18.40 ? 260  SER A OG  1 
ATOM   1935  N  N   . ALA A 1 272 ? 33.024  11.216  -34.849  1.00 11.95 ? 261  ALA A N   1 
ATOM   1936  C  CA  . ALA A 1 272 ? 31.939  11.571  -33.917  1.00 12.50 ? 261  ALA A CA  1 
ATOM   1937  C  C   . ALA A 1 272 ? 30.562  11.100  -34.394  1.00 12.69 ? 261  ALA A C   1 
ATOM   1938  O  O   . ALA A 1 272 ? 29.724  10.726  -33.598  1.00 13.12 ? 261  ALA A O   1 
ATOM   1939  C  CB  . ALA A 1 272 ? 31.908  13.101  -33.690  1.00 10.18 ? 261  ALA A CB  1 
ATOM   1940  N  N   . GLU A 1 273 ? 30.351  11.135  -35.706  1.00 13.46 ? 262  GLU A N   1 
ATOM   1941  C  CA  . GLU A 1 273 ? 29.077  10.789  -36.351  1.00 13.41 ? 262  GLU A CA  1 
ATOM   1942  C  C   . GLU A 1 273 ? 28.863  9.280   -36.601  1.00 11.51 ? 262  GLU A C   1 
ATOM   1943  O  O   . GLU A 1 273 ? 27.759  8.790   -36.561  1.00 9.85  ? 262  GLU A O   1 
ATOM   1944  C  CB  . GLU A 1 273 ? 28.990  11.562  -37.668  1.00 14.46 ? 262  GLU A CB  1 
ATOM   1945  C  CG  . GLU A 1 273 ? 27.613  11.660  -38.294  1.00 18.48 ? 262  GLU A CG  1 
ATOM   1946  C  CD  . GLU A 1 273 ? 26.582  12.350  -37.401  1.00 25.58 ? 262  GLU A CD  1 
ATOM   1947  O  OE1 . GLU A 1 273 ? 26.976  13.120  -36.482  1.00 29.40 ? 262  GLU A OE1 1 
ATOM   1948  O  OE2 . GLU A 1 273 ? 25.368  12.104  -37.630  1.00 27.68 ? 262  GLU A OE2 1 
ATOM   1949  N  N   . VAL A 1 274 ? 29.929  8.548   -36.865  1.00 11.15 ? 263  VAL A N   1 
ATOM   1950  C  CA  . VAL A 1 274 ? 29.872  7.100   -36.803  1.00 10.72 ? 263  VAL A CA  1 
ATOM   1951  C  C   . VAL A 1 274 ? 29.407  6.693   -35.400  1.00 10.63 ? 263  VAL A C   1 
ATOM   1952  O  O   . VAL A 1 274 ? 28.532  5.828   -35.237  1.00 11.28 ? 263  VAL A O   1 
ATOM   1953  C  CB  . VAL A 1 274 ? 31.256  6.477   -37.097  1.00 11.43 ? 263  VAL A CB  1 
ATOM   1954  C  CG1 . VAL A 1 274 ? 31.180  4.967   -37.059  1.00 9.58  ? 263  VAL A CG1 1 
ATOM   1955  C  CG2 . VAL A 1 274 ? 31.795  6.919   -38.472  1.00 8.70  ? 263  VAL A CG2 1 
ATOM   1956  N  N   . ILE A 1 275 ? 29.990  7.332   -34.390  1.00 11.12 ? 264  ILE A N   1 
ATOM   1957  C  CA  . ILE A 1 275 ? 29.645  7.023   -32.983  1.00 9.55  ? 264  ILE A CA  1 
ATOM   1958  C  C   . ILE A 1 275 ? 28.188  7.343   -32.615  1.00 9.62  ? 264  ILE A C   1 
ATOM   1959  O  O   . ILE A 1 275 ? 27.434  6.461   -32.211  1.00 11.17 ? 264  ILE A O   1 
ATOM   1960  C  CB  . ILE A 1 275 ? 30.570  7.707   -32.014  1.00 11.55 ? 264  ILE A CB  1 
ATOM   1961  C  CG1 . ILE A 1 275 ? 31.908  6.974   -31.924  1.00 13.00 ? 264  ILE A CG1 1 
ATOM   1962  C  CG2 . ILE A 1 275 ? 29.959  7.678   -30.623  1.00 6.96  ? 264  ILE A CG2 1 
ATOM   1963  C  CD1 . ILE A 1 275 ? 33.015  7.787   -31.186  1.00 10.86 ? 264  ILE A CD1 1 
ATOM   1964  N  N   . ALA A 1 276 ? 27.792  8.602   -32.737  1.00 9.79  ? 265  ALA A N   1 
ATOM   1965  C  CA  . ALA A 1 276 ? 26.362  8.984   -32.720  1.00 9.56  ? 265  ALA A CA  1 
ATOM   1966  C  C   . ALA A 1 276 ? 25.422  8.041   -33.510  1.00 8.77  ? 265  ALA A C   1 
ATOM   1967  O  O   . ALA A 1 276 ? 24.452  7.518   -32.970  1.00 3.95  ? 265  ALA A O   1 
ATOM   1968  C  CB  . ALA A 1 276 ? 26.207  10.400  -33.178  1.00 8.36  ? 265  ALA A CB  1 
ATOM   1969  N  N   . GLN A 1 277 ? 25.669  7.769   -34.797  1.00 10.84 ? 266  GLN A N   1 
ATOM   1970  C  CA  . GLN A 1 277 ? 24.801  6.796   -35.488  1.00 9.70  ? 266  GLN A CA  1 
ATOM   1971  C  C   . GLN A 1 277 ? 24.821  5.345   -34.950  1.00 10.06 ? 266  GLN A C   1 
ATOM   1972  O  O   . GLN A 1 277 ? 23.853  4.649   -35.155  1.00 13.09 ? 266  GLN A O   1 
ATOM   1973  C  CB  . GLN A 1 277 ? 25.053  6.771   -37.023  1.00 11.54 ? 266  GLN A CB  1 
ATOM   1974  C  CG  . GLN A 1 277 ? 24.749  8.104   -37.723  1.00 15.20 ? 266  GLN A CG  1 
ATOM   1975  C  CD  . GLN A 1 277 ? 23.334  8.652   -37.449  1.00 20.06 ? 266  GLN A CD  1 
ATOM   1976  O  OE1 . GLN A 1 277 ? 22.336  7.975   -37.724  1.00 27.51 ? 266  GLN A OE1 1 
ATOM   1977  N  NE2 . GLN A 1 277 ? 23.246  9.890   -36.896  1.00 20.39 ? 266  GLN A NE2 1 
ATOM   1978  N  N   . ALA A 1 278 ? 25.862  4.918   -34.226  1.00 8.56  ? 267  ALA A N   1 
ATOM   1979  C  CA  . ALA A 1 278 ? 25.978  3.544   -33.725  1.00 7.97  ? 267  ALA A CA  1 
ATOM   1980  C  C   . ALA A 1 278 ? 25.258  3.390   -32.389  1.00 10.29 ? 267  ALA A C   1 
ATOM   1981  O  O   . ALA A 1 278 ? 24.667  2.357   -32.089  1.00 8.44  ? 267  ALA A O   1 
ATOM   1982  C  CB  . ALA A 1 278 ? 27.477  3.135   -33.573  1.00 8.18  ? 267  ALA A CB  1 
ATOM   1983  N  N   . ARG A 1 279 ? 25.312  4.448   -31.615  1.00 11.21 ? 268  ARG A N   1 
ATOM   1984  C  CA  . ARG A 1 279 ? 24.559  4.513   -30.382  1.00 15.28 ? 268  ARG A CA  1 
ATOM   1985  C  C   . ARG A 1 279 ? 23.040  4.417   -30.581  1.00 15.92 ? 268  ARG A C   1 
ATOM   1986  O  O   . ARG A 1 279 ? 22.357  3.828   -29.742  1.00 16.34 ? 268  ARG A O   1 
ATOM   1987  C  CB  . ARG A 1 279 ? 24.852  5.813   -29.660  1.00 16.25 ? 268  ARG A CB  1 
ATOM   1988  C  CG  . ARG A 1 279 ? 26.250  5.926   -29.099  1.00 18.50 ? 268  ARG A CG  1 
ATOM   1989  C  CD  . ARG A 1 279 ? 26.383  7.169   -28.199  1.00 18.90 ? 268  ARG A CD  1 
ATOM   1990  N  NE  . ARG A 1 279 ? 25.418  7.242   -27.087  1.00 22.73 ? 268  ARG A NE  1 
ATOM   1991  C  CZ  . ARG A 1 279 ? 24.279  7.953   -27.099  1.00 25.73 ? 268  ARG A CZ  1 
ATOM   1992  N  NH1 . ARG A 1 279 ? 23.895  8.643   -28.180  1.00 27.06 ? 268  ARG A NH1 1 
ATOM   1993  N  NH2 . ARG A 1 279 ? 23.486  7.936   -26.033  1.00 25.38 ? 268  ARG A NH2 1 
ATOM   1994  N  N   . LYS A 1 280 ? 22.491  4.990   -31.655  1.00 12.81 ? 269  LYS A N   1 
ATOM   1995  C  CA  . LYS A 1 280 ? 21.053  4.897   -31.822  1.00 13.84 ? 269  LYS A CA  1 
ATOM   1996  C  C   . LYS A 1 280 ? 20.608  3.524   -32.331  1.00 11.97 ? 269  LYS A C   1 
ATOM   1997  O  O   . LYS A 1 280 ? 19.521  3.025   -31.979  1.00 8.53  ? 269  LYS A O   1 
ATOM   1998  C  CB  . LYS A 1 280 ? 20.516  6.042   -32.639  1.00 15.16 ? 269  LYS A CB  1 
ATOM   1999  C  CG  . LYS A 1 280 ? 21.025  6.090   -34.040  1.00 17.29 ? 269  LYS A CG  1 
ATOM   2000  C  CD  . LYS A 1 280 ? 20.260  7.167   -34.782  1.00 19.42 ? 269  LYS A CD  1 
ATOM   2001  C  CE  . LYS A 1 280 ? 18.893  6.713   -35.267  1.00 24.59 ? 269  LYS A CE  1 
ATOM   2002  N  NZ  . LYS A 1 280 ? 18.361  7.630   -36.333  1.00 23.48 ? 269  LYS A NZ  1 
ATOM   2003  N  N   . LYS A 1 281 ? 21.482  2.882   -33.118  1.00 10.37 ? 270  LYS A N   1 
ATOM   2004  C  CA  . LYS A 1 281 ? 21.270  1.521   -33.539  1.00 10.30 ? 270  LYS A CA  1 
ATOM   2005  C  C   . LYS A 1 281 ? 21.491  0.526   -32.452  1.00 11.84 ? 270  LYS A C   1 
ATOM   2006  O  O   . LYS A 1 281 ? 21.376  -0.640  -32.710  1.00 12.93 ? 270  LYS A O   1 
ATOM   2007  C  CB  . LYS A 1 281 ? 22.188  1.159   -34.712  1.00 7.36  ? 270  LYS A CB  1 
ATOM   2008  C  CG  . LYS A 1 281 ? 21.873  2.033   -35.841  1.00 6.00  ? 270  LYS A CG  1 
ATOM   2009  C  CD  . LYS A 1 281 ? 22.438  1.437   -37.104  1.00 2.19  ? 270  LYS A CD  1 
ATOM   2010  C  CE  . LYS A 1 281 ? 21.818  2.104   -38.237  1.00 7.93  ? 270  LYS A CE  1 
ATOM   2011  N  NZ  . LYS A 1 281 ? 22.635  1.737   -39.540  1.00 4.48  ? 270  LYS A NZ  1 
ATOM   2012  N  N   . GLY A 1 282 ? 21.782  0.979   -31.237  1.00 13.51 ? 271  GLY A N   1 
ATOM   2013  C  CA  . GLY A 1 282 ? 21.937  0.113   -30.097  1.00 12.92 ? 271  GLY A CA  1 
ATOM   2014  C  C   . GLY A 1 282 ? 23.354  -0.142  -29.624  1.00 14.32 ? 271  GLY A C   1 
ATOM   2015  O  O   . GLY A 1 282 ? 23.516  -0.697  -28.555  1.00 13.00 ? 271  GLY A O   1 
ATOM   2016  N  N   . THR A 1 283 ? 24.394  0.218   -30.381  1.00 14.80 ? 272  THR A N   1 
ATOM   2017  C  CA  . THR A 1 283 ? 25.802  -0.073  -29.933  1.00 14.80 ? 272  THR A CA  1 
ATOM   2018  C  C   . THR A 1 283 ? 26.205  0.456   -28.518  1.00 15.43 ? 272  THR A C   1 
ATOM   2019  O  O   . THR A 1 283 ? 25.988  1.639   -28.182  1.00 16.33 ? 272  THR A O   1 
ATOM   2020  C  CB  . THR A 1 283 ? 26.804  0.438   -30.966  1.00 15.72 ? 272  THR A CB  1 
ATOM   2021  O  OG1 . THR A 1 283 ? 26.366  0.036   -32.268  1.00 16.10 ? 272  THR A OG1 1 
ATOM   2022  C  CG2 . THR A 1 283 ? 28.204  -0.122  -30.712  1.00 15.62 ? 272  THR A CG2 1 
ATOM   2023  N  N   . VAL A 1 284 ? 26.792  -0.428  -27.697  1.00 15.16 ? 273  VAL A N   1 
ATOM   2024  C  CA  . VAL A 1 284 ? 27.386  -0.016  -26.420  1.00 14.78 ? 273  VAL A CA  1 
ATOM   2025  C  C   . VAL A 1 284 ? 28.789  0.547   -26.743  1.00 14.76 ? 273  VAL A C   1 
ATOM   2026  O  O   . VAL A 1 284 ? 29.797  -0.174  -26.843  1.00 13.89 ? 273  VAL A O   1 
ATOM   2027  C  CB  . VAL A 1 284 ? 27.431  -1.139  -25.356  1.00 13.89 ? 273  VAL A CB  1 
ATOM   2028  C  CG1 . VAL A 1 284 ? 28.036  -0.612  -24.026  1.00 16.26 ? 273  VAL A CG1 1 
ATOM   2029  C  CG2 . VAL A 1 284 ? 26.038  -1.729  -25.110  1.00 12.93 ? 273  VAL A CG2 1 
ATOM   2030  N  N   . VAL A 1 285 ? 28.815  1.855   -26.938  1.00 13.55 ? 274  VAL A N   1 
ATOM   2031  C  CA  . VAL A 1 285 ? 30.006  2.543   -27.323  1.00 15.25 ? 274  VAL A CA  1 
ATOM   2032  C  C   . VAL A 1 285 ? 30.070  3.923   -26.676  1.00 16.13 ? 274  VAL A C   1 
ATOM   2033  O  O   . VAL A 1 285 ? 29.083  4.662   -26.641  1.00 15.09 ? 274  VAL A O   1 
ATOM   2034  C  CB  . VAL A 1 285 ? 30.035  2.731   -28.858  1.00 13.51 ? 274  VAL A CB  1 
ATOM   2035  C  CG1 . VAL A 1 285 ? 28.974  3.726   -29.257  1.00 11.17 ? 274  VAL A CG1 1 
ATOM   2036  C  CG2 . VAL A 1 285 ? 31.427  3.197   -29.316  1.00 15.42 ? 274  VAL A CG2 1 
ATOM   2037  N  N   . TYR A 1 286 ? 31.245  4.251   -26.151  1.00 17.71 ? 275  TYR A N   1 
ATOM   2038  C  CA  . TYR A 1 286 ? 31.507  5.550   -25.597  1.00 17.60 ? 275  TYR A CA  1 
ATOM   2039  C  C   . TYR A 1 286 ? 32.533  6.323   -26.416  1.00 18.95 ? 275  TYR A C   1 
ATOM   2040  O  O   . TYR A 1 286 ? 33.435  5.734   -27.024  1.00 20.64 ? 275  TYR A O   1 
ATOM   2041  C  CB  . TYR A 1 286 ? 31.930  5.376   -24.158  1.00 19.44 ? 275  TYR A CB  1 
ATOM   2042  C  CG  . TYR A 1 286 ? 30.801  4.779   -23.377  1.00 19.26 ? 275  TYR A CG  1 
ATOM   2043  C  CD1 . TYR A 1 286 ? 29.827  5.588   -22.829  1.00 20.46 ? 275  TYR A CD1 1 
ATOM   2044  C  CD2 . TYR A 1 286 ? 30.674  3.414   -23.228  1.00 18.72 ? 275  TYR A CD2 1 
ATOM   2045  C  CE1 . TYR A 1 286 ? 28.761  5.064   -22.133  1.00 20.24 ? 275  TYR A CE1 1 
ATOM   2046  C  CE2 . TYR A 1 286 ? 29.601  2.874   -22.521  1.00 22.11 ? 275  TYR A CE2 1 
ATOM   2047  C  CZ  . TYR A 1 286 ? 28.657  3.719   -21.966  1.00 21.80 ? 275  TYR A CZ  1 
ATOM   2048  O  OH  . TYR A 1 286 ? 27.574  3.226   -21.259  1.00 23.66 ? 275  TYR A OH  1 
ATOM   2049  N  N   . GLY A 1 287 ? 32.335  7.643   -26.481  1.00 19.40 ? 276  GLY A N   1 
ATOM   2050  C  CA  . GLY A 1 287 ? 33.218  8.554   -27.178  1.00 18.72 ? 276  GLY A CA  1 
ATOM   2051  C  C   . GLY A 1 287 ? 33.935  9.516   -26.248  1.00 19.47 ? 276  GLY A C   1 
ATOM   2052  O  O   . GLY A 1 287 ? 33.340  10.064  -25.305  1.00 19.76 ? 276  GLY A O   1 
ATOM   2053  N  N   . GLU A 1 288 ? 35.213  9.719   -26.554  1.00 20.12 ? 277  GLU A N   1 
ATOM   2054  C  CA  . GLU A 1 288 ? 36.151  10.528  -25.766  1.00 18.81 ? 277  GLU A CA  1 
ATOM   2055  C  C   . GLU A 1 288 ? 36.765  11.616  -26.633  1.00 18.55 ? 277  GLU A C   1 
ATOM   2056  O  O   . GLU A 1 288 ? 37.856  11.437  -27.189  1.00 15.75 ? 277  GLU A O   1 
ATOM   2057  C  CB  . GLU A 1 288 ? 37.268  9.637   -25.241  1.00 20.27 ? 277  GLU A CB  1 
ATOM   2058  C  CG  . GLU A 1 288 ? 38.239  10.323  -24.270  1.00 19.27 ? 277  GLU A CG  1 
ATOM   2059  C  CD  . GLU A 1 288 ? 39.515  9.548   -24.163  1.00 17.08 ? 277  GLU A CD  1 
ATOM   2060  O  OE1 . GLU A 1 288 ? 40.313  9.549   -25.112  1.00 16.57 ? 277  GLU A OE1 1 
ATOM   2061  O  OE2 . GLU A 1 288 ? 39.688  8.879   -23.170  1.00 16.71 ? 277  GLU A OE2 1 
ATOM   2062  N  N   . PRO A 1 289 ? 36.054  12.745  -26.790  1.00 18.09 ? 278  PRO A N   1 
ATOM   2063  C  CA  . PRO A 1 289 ? 36.736  13.877  -27.400  1.00 18.13 ? 278  PRO A CA  1 
ATOM   2064  C  C   . PRO A 1 289 ? 37.737  14.358  -26.329  1.00 17.56 ? 278  PRO A C   1 
ATOM   2065  O  O   . PRO A 1 289 ? 37.560  14.044  -25.166  1.00 16.12 ? 278  PRO A O   1 
ATOM   2066  C  CB  . PRO A 1 289 ? 35.595  14.861  -27.682  1.00 18.16 ? 278  PRO A CB  1 
ATOM   2067  C  CG  . PRO A 1 289 ? 34.604  14.546  -26.604  1.00 17.69 ? 278  PRO A CG  1 
ATOM   2068  C  CD  . PRO A 1 289 ? 34.679  13.071  -26.396  1.00 17.52 ? 278  PRO A CD  1 
ATOM   2069  N  N   . ILE A 1 290 ? 38.794  15.038  -26.750  1.00 17.26 ? 279  ILE A N   1 
ATOM   2070  C  CA  . ILE A 1 290 ? 39.867  15.489  -25.874  1.00 17.73 ? 279  ILE A CA  1 
ATOM   2071  C  C   . ILE A 1 290 ? 39.952  17.010  -25.985  1.00 17.62 ? 279  ILE A C   1 
ATOM   2072  O  O   . ILE A 1 290 ? 39.298  17.571  -26.841  1.00 17.45 ? 279  ILE A O   1 
ATOM   2073  C  CB  . ILE A 1 290 ? 41.190  14.758  -26.249  1.00 16.69 ? 279  ILE A CB  1 
ATOM   2074  C  CG1 . ILE A 1 290 ? 41.563  14.961  -27.718  1.00 17.87 ? 279  ILE A CG1 1 
ATOM   2075  C  CG2 . ILE A 1 290 ? 41.046  13.232  -26.000  1.00 11.21 ? 279  ILE A CG2 1 
ATOM   2076  C  CD1 . ILE A 1 290 ? 42.849  14.292  -28.092  1.00 19.74 ? 279  ILE A CD1 1 
ATOM   2077  N  N   . THR A 1 291 ? 40.741  17.683  -25.142  1.00 18.12 ? 280  THR A N   1 
ATOM   2078  C  CA  . THR A 1 291 ? 40.780  19.173  -25.155  1.00 17.93 ? 280  THR A CA  1 
ATOM   2079  C  C   . THR A 1 291 ? 41.240  19.726  -26.501  1.00 18.45 ? 280  THR A C   1 
ATOM   2080  O  O   . THR A 1 291 ? 40.646  20.657  -27.029  1.00 19.04 ? 280  THR A O   1 
ATOM   2081  C  CB  . THR A 1 291 ? 41.656  19.778  -24.024  1.00 18.96 ? 280  THR A CB  1 
ATOM   2082  O  OG1 . THR A 1 291 ? 41.463  19.052  -22.814  1.00 19.62 ? 280  THR A OG1 1 
ATOM   2083  C  CG2 . THR A 1 291 ? 41.297  21.229  -23.777  1.00 18.75 ? 280  THR A CG2 1 
ATOM   2084  N  N   . ALA A 1 292 ? 42.270  19.131  -27.084  1.00 17.72 ? 281  ALA A N   1 
ATOM   2085  C  CA  . ALA A 1 292 ? 42.704  19.557  -28.402  1.00 16.93 ? 281  ALA A CA  1 
ATOM   2086  C  C   . ALA A 1 292 ? 41.488  19.712  -29.317  1.00 16.01 ? 281  ALA A C   1 
ATOM   2087  O  O   . ALA A 1 292 ? 41.226  20.803  -29.762  1.00 16.60 ? 281  ALA A O   1 
ATOM   2088  C  CB  . ALA A 1 292 ? 43.762  18.586  -28.989  1.00 17.78 ? 281  ALA A CB  1 
ATOM   2089  N  N   . SER A 1 293 ? 40.729  18.641  -29.559  1.00 15.36 ? 282  SER A N   1 
ATOM   2090  C  CA  . SER A 1 293 ? 39.578  18.684  -30.478  1.00 16.39 ? 282  SER A CA  1 
ATOM   2091  C  C   . SER A 1 293 ? 38.403  19.591  -30.035  1.00 15.67 ? 282  SER A C   1 
ATOM   2092  O  O   . SER A 1 293 ? 37.699  20.144  -30.868  1.00 15.41 ? 282  SER A O   1 
ATOM   2093  C  CB  . SER A 1 293 ? 39.070  17.267  -30.789  1.00 14.83 ? 282  SER A CB  1 
ATOM   2094  O  OG  . SER A 1 293 ? 38.813  16.570  -29.610  1.00 16.64 ? 282  SER A OG  1 
ATOM   2095  N  N   . LEU A 1 294 ? 38.193  19.755  -28.732  1.00 15.15 ? 283  LEU A N   1 
ATOM   2096  C  CA  . LEU A 1 294 ? 37.125  20.586  -28.237  1.00 14.48 ? 283  LEU A CA  1 
ATOM   2097  C  C   . LEU A 1 294 ? 37.470  22.096  -28.278  1.00 15.01 ? 283  LEU A C   1 
ATOM   2098  O  O   . LEU A 1 294 ? 36.584  22.952  -28.206  1.00 14.73 ? 283  LEU A O   1 
ATOM   2099  C  CB  . LEU A 1 294 ? 36.795  20.140  -26.793  1.00 14.42 ? 283  LEU A CB  1 
ATOM   2100  C  CG  . LEU A 1 294 ? 36.202  18.723  -26.676  1.00 14.70 ? 283  LEU A CG  1 
ATOM   2101  C  CD1 . LEU A 1 294 ? 36.299  18.186  -25.284  1.00 16.62 ? 283  LEU A CD1 1 
ATOM   2102  C  CD2 . LEU A 1 294 ? 34.749  18.708  -27.090  1.00 14.65 ? 283  LEU A CD2 1 
ATOM   2103  N  N   . GLY A 1 295 ? 38.759  22.412  -28.383  1.00 15.45 ? 284  GLY A N   1 
ATOM   2104  C  CA  . GLY A 1 295 ? 39.254  23.766  -28.192  1.00 16.05 ? 284  GLY A CA  1 
ATOM   2105  C  C   . GLY A 1 295 ? 39.850  24.367  -29.432  1.00 17.50 ? 284  GLY A C   1 
ATOM   2106  O  O   . GLY A 1 295 ? 39.638  25.557  -29.705  1.00 19.17 ? 284  GLY A O   1 
ATOM   2107  N  N   . THR A 1 296 ? 40.580  23.564  -30.196  1.00 17.20 ? 285  THR A N   1 
ATOM   2108  C  CA  . THR A 1 296 ? 41.254  24.097  -31.390  1.00 17.76 ? 285  THR A CA  1 
ATOM   2109  C  C   . THR A 1 296 ? 41.141  23.187  -32.595  1.00 17.21 ? 285  THR A C   1 
ATOM   2110  O  O   . THR A 1 296 ? 40.371  22.256  -32.582  1.00 18.04 ? 285  THR A O   1 
ATOM   2111  C  CB  . THR A 1 296 ? 42.732  24.564  -31.055  1.00 17.55 ? 285  THR A CB  1 
ATOM   2112  O  OG1 . THR A 1 296 ? 43.276  25.308  -32.149  1.00 17.33 ? 285  THR A OG1 1 
ATOM   2113  C  CG2 . THR A 1 296 ? 43.619  23.399  -30.662  1.00 15.05 ? 285  THR A CG2 1 
ATOM   2114  N  N   . ASP A 1 297 ? 41.852  23.524  -33.667  1.00 19.10 ? 286  ASP A N   1 
ATOM   2115  C  CA  . ASP A 1 297 ? 41.754  22.817  -34.966  1.00 18.63 ? 286  ASP A CA  1 
ATOM   2116  C  C   . ASP A 1 297 ? 43.144  22.659  -35.595  1.00 17.93 ? 286  ASP A C   1 
ATOM   2117  O  O   . ASP A 1 297 ? 44.155  23.061  -35.025  1.00 16.62 ? 286  ASP A O   1 
ATOM   2118  C  CB  . ASP A 1 297 ? 40.778  23.522  -35.926  1.00 19.71 ? 286  ASP A CB  1 
ATOM   2119  C  CG  . ASP A 1 297 ? 41.237  24.943  -36.350  1.00 21.60 ? 286  ASP A CG  1 
ATOM   2120  O  OD1 . ASP A 1 297 ? 42.454  25.196  -36.530  1.00 27.45 ? 286  ASP A OD1 1 
ATOM   2121  O  OD2 . ASP A 1 297 ? 40.359  25.809  -36.509  1.00 20.48 ? 286  ASP A OD2 1 
ATOM   2122  N  N   . GLY A 1 298 ? 43.193  22.094  -36.788  1.00 18.39 ? 287  GLY A N   1 
ATOM   2123  C  CA  . GLY A 1 298 ? 44.455  21.701  -37.343  1.00 18.66 ? 287  GLY A CA  1 
ATOM   2124  C  C   . GLY A 1 298 ? 45.097  22.738  -38.217  1.00 19.03 ? 287  GLY A C   1 
ATOM   2125  O  O   . GLY A 1 298 ? 46.155  22.475  -38.751  1.00 17.92 ? 287  GLY A O   1 
ATOM   2126  N  N   . SER A 1 299 ? 44.469  23.904  -38.372  1.00 19.48 ? 288  SER A N   1 
ATOM   2127  C  CA  . SER A 1 299 ? 44.974  24.930  -39.313  1.00 19.09 ? 288  SER A CA  1 
ATOM   2128  C  C   . SER A 1 299 ? 46.436  25.302  -39.041  1.00 19.30 ? 288  SER A C   1 
ATOM   2129  O  O   . SER A 1 299 ? 47.170  25.630  -39.959  1.00 18.11 ? 288  SER A O   1 
ATOM   2130  C  CB  . SER A 1 299 ? 44.102  26.206  -39.308  1.00 18.21 ? 288  SER A CB  1 
ATOM   2131  O  OG  . SER A 1 299 ? 43.997  26.785  -38.010  1.00 15.49 ? 288  SER A OG  1 
ATOM   2132  N  N   . HIS A 1 300 ? 46.847  25.228  -37.782  1.00 20.06 ? 289  HIS A N   1 
ATOM   2133  C  CA  . HIS A 1 300 ? 48.201  25.563  -37.395  1.00 22.42 ? 289  HIS A CA  1 
ATOM   2134  C  C   . HIS A 1 300 ? 49.254  24.511  -37.832  1.00 22.74 ? 289  HIS A C   1 
ATOM   2135  O  O   . HIS A 1 300 ? 50.443  24.707  -37.611  1.00 22.40 ? 289  HIS A O   1 
ATOM   2136  C  CB  . HIS A 1 300 ? 48.255  25.823  -35.877  1.00 23.41 ? 289  HIS A CB  1 
ATOM   2137  C  CG  . HIS A 1 300 ? 47.221  26.809  -35.400  1.00 28.20 ? 289  HIS A CG  1 
ATOM   2138  N  ND1 . HIS A 1 300 ? 47.394  28.180  -35.484  1.00 30.34 ? 289  HIS A ND1 1 
ATOM   2139  C  CD2 . HIS A 1 300 ? 45.985  26.622  -34.864  1.00 29.88 ? 289  HIS A CD2 1 
ATOM   2140  C  CE1 . HIS A 1 300 ? 46.318  28.790  -35.020  1.00 28.96 ? 289  HIS A CE1 1 
ATOM   2141  N  NE2 . HIS A 1 300 ? 45.449  27.868  -34.637  1.00 31.43 ? 289  HIS A NE2 1 
ATOM   2142  N  N   . TYR A 1 301 ? 48.831  23.420  -38.471  1.00 23.15 ? 290  TYR A N   1 
ATOM   2143  C  CA  . TYR A 1 301 ? 49.777  22.482  -39.061  1.00 23.53 ? 290  TYR A CA  1 
ATOM   2144  C  C   . TYR A 1 301 ? 50.461  23.093  -40.276  1.00 23.51 ? 290  TYR A C   1 
ATOM   2145  O  O   . TYR A 1 301 ? 51.480  22.577  -40.732  1.00 22.64 ? 290  TYR A O   1 
ATOM   2146  C  CB  . TYR A 1 301 ? 49.105  21.174  -39.487  1.00 23.74 ? 290  TYR A CB  1 
ATOM   2147  C  CG  . TYR A 1 301 ? 48.717  20.272  -38.344  1.00 24.34 ? 290  TYR A CG  1 
ATOM   2148  C  CD1 . TYR A 1 301 ? 49.651  19.858  -37.415  1.00 24.53 ? 290  TYR A CD1 1 
ATOM   2149  C  CD2 . TYR A 1 301 ? 47.408  19.821  -38.201  1.00 25.78 ? 290  TYR A CD2 1 
ATOM   2150  C  CE1 . TYR A 1 301 ? 49.295  19.040  -36.373  1.00 25.04 ? 290  TYR A CE1 1 
ATOM   2151  C  CE2 . TYR A 1 301 ? 47.041  18.993  -37.159  1.00 23.53 ? 290  TYR A CE2 1 
ATOM   2152  C  CZ  . TYR A 1 301 ? 47.980  18.598  -36.251  1.00 25.68 ? 290  TYR A CZ  1 
ATOM   2153  O  OH  . TYR A 1 301 ? 47.598  17.776  -35.199  1.00 25.49 ? 290  TYR A OH  1 
ATOM   2154  N  N   . TRP A 1 302 ? 49.897  24.164  -40.816  1.00 24.09 ? 291  TRP A N   1 
ATOM   2155  C  CA  . TRP A 1 302 ? 50.546  24.885  -41.909  1.00 24.65 ? 291  TRP A CA  1 
ATOM   2156  C  C   . TRP A 1 302 ? 51.172  26.179  -41.414  1.00 24.69 ? 291  TRP A C   1 
ATOM   2157  O  O   . TRP A 1 302 ? 51.477  27.055  -42.209  1.00 25.73 ? 291  TRP A O   1 
ATOM   2158  C  CB  . TRP A 1 302 ? 49.563  25.189  -43.026  1.00 26.43 ? 291  TRP A CB  1 
ATOM   2159  C  CG  . TRP A 1 302 ? 49.190  24.018  -43.823  1.00 27.34 ? 291  TRP A CG  1 
ATOM   2160  C  CD1 . TRP A 1 302 ? 49.693  23.657  -45.039  1.00 27.99 ? 291  TRP A CD1 1 
ATOM   2161  C  CD2 . TRP A 1 302 ? 48.222  23.040  -43.484  1.00 28.00 ? 291  TRP A CD2 1 
ATOM   2162  N  NE1 . TRP A 1 302 ? 49.098  22.511  -45.478  1.00 27.69 ? 291  TRP A NE1 1 
ATOM   2163  C  CE2 . TRP A 1 302 ? 48.188  22.105  -44.538  1.00 28.55 ? 291  TRP A CE2 1 
ATOM   2164  C  CE3 . TRP A 1 302 ? 47.380  22.854  -42.389  1.00 29.01 ? 291  TRP A CE3 1 
ATOM   2165  C  CZ2 . TRP A 1 302 ? 47.334  20.996  -44.530  1.00 28.67 ? 291  TRP A CZ2 1 
ATOM   2166  C  CZ3 . TRP A 1 302 ? 46.526  21.748  -42.379  1.00 28.44 ? 291  TRP A CZ3 1 
ATOM   2167  C  CH2 . TRP A 1 302 ? 46.517  20.834  -43.436  1.00 27.97 ? 291  TRP A CH2 1 
ATOM   2168  N  N   . SER A 1 303 ? 51.379  26.312  -40.109  1.00 23.86 ? 292  SER A N   1 
ATOM   2169  C  CA  . SER A 1 303 ? 51.951  27.523  -39.608  1.00 24.94 ? 292  SER A CA  1 
ATOM   2170  C  C   . SER A 1 303 ? 53.350  27.687  -40.202  1.00 26.92 ? 292  SER A C   1 
ATOM   2171  O  O   . SER A 1 303 ? 54.024  26.698  -40.531  1.00 27.14 ? 292  SER A O   1 
ATOM   2172  C  CB  . SER A 1 303 ? 52.029  27.510  -38.097  1.00 24.81 ? 292  SER A CB  1 
ATOM   2173  O  OG  . SER A 1 303 ? 52.781  28.632  -37.672  1.00 24.12 ? 292  SER A OG  1 
ATOM   2174  N  N   . LYS A 1 304 ? 53.769  28.944  -40.355  1.00 27.64 ? 293  LYS A N   1 
ATOM   2175  C  CA  . LYS A 1 304 ? 55.120  29.286  -40.824  1.00 27.42 ? 293  LYS A CA  1 
ATOM   2176  C  C   . LYS A 1 304 ? 56.202  28.951  -39.788  1.00 26.58 ? 293  LYS A C   1 
ATOM   2177  O  O   . LYS A 1 304 ? 57.325  28.601  -40.159  1.00 27.71 ? 293  LYS A O   1 
ATOM   2178  C  CB  . LYS A 1 304 ? 55.184  30.782  -41.169  1.00 29.77 ? 293  LYS A CB  1 
ATOM   2179  C  CG  . LYS A 1 304 ? 55.188  31.108  -42.664  1.00 33.12 ? 293  LYS A CG  1 
ATOM   2180  C  CD  . LYS A 1 304 ? 56.619  31.120  -43.256  1.00 35.78 ? 293  LYS A CD  1 
ATOM   2181  C  CE  . LYS A 1 304 ? 56.800  32.235  -44.272  1.00 33.73 ? 293  LYS A CE  1 
ATOM   2182  N  NZ  . LYS A 1 304 ? 56.487  33.450  -43.510  1.00 33.46 ? 293  LYS A NZ  1 
ATOM   2183  N  N   . ASN A 1 305 ? 55.863  29.103  -38.504  1.00 25.03 ? 294  ASN A N   1 
ATOM   2184  C  CA  . ASN A 1 305 ? 56.756  28.766  -37.389  1.00 24.42 ? 294  ASN A CA  1 
ATOM   2185  C  C   . ASN A 1 305 ? 56.770  27.255  -37.169  1.00 23.68 ? 294  ASN A C   1 
ATOM   2186  O  O   . ASN A 1 305 ? 55.778  26.664  -36.741  1.00 23.47 ? 294  ASN A O   1 
ATOM   2187  C  CB  . ASN A 1 305 ? 56.320  29.497  -36.108  1.00 24.62 ? 294  ASN A CB  1 
ATOM   2188  C  CG  . ASN A 1 305 ? 57.060  29.015  -34.870  1.00 24.36 ? 294  ASN A CG  1 
ATOM   2189  O  OD1 . ASN A 1 305 ? 57.839  28.077  -34.948  1.00 22.29 ? 294  ASN A OD1 1 
ATOM   2190  N  ND2 . ASN A 1 305 ? 56.772  29.627  -33.698  1.00 24.24 ? 294  ASN A ND2 1 
ATOM   2191  N  N   . TRP A 1 306 ? 57.908  26.631  -37.445  1.00 23.40 ? 295  TRP A N   1 
ATOM   2192  C  CA  . TRP A 1 306 ? 57.989  25.182  -37.441  1.00 22.53 ? 295  TRP A CA  1 
ATOM   2193  C  C   . TRP A 1 306 ? 57.529  24.594  -36.136  1.00 23.83 ? 295  TRP A C   1 
ATOM   2194  O  O   . TRP A 1 306 ? 56.732  23.661  -36.113  1.00 25.85 ? 295  TRP A O   1 
ATOM   2195  C  CB  . TRP A 1 306 ? 59.402  24.703  -37.715  1.00 20.23 ? 295  TRP A CB  1 
ATOM   2196  C  CG  . TRP A 1 306 ? 59.394  23.243  -37.982  1.00 18.37 ? 295  TRP A CG  1 
ATOM   2197  C  CD1 . TRP A 1 306 ? 59.209  22.623  -39.193  1.00 16.81 ? 295  TRP A CD1 1 
ATOM   2198  C  CD2 . TRP A 1 306 ? 59.533  22.212  -37.022  1.00 14.74 ? 295  TRP A CD2 1 
ATOM   2199  N  NE1 . TRP A 1 306 ? 59.228  21.259  -39.027  1.00 15.28 ? 295  TRP A NE1 1 
ATOM   2200  C  CE2 . TRP A 1 306 ? 59.394  20.992  -37.693  1.00 13.35 ? 295  TRP A CE2 1 
ATOM   2201  C  CE3 . TRP A 1 306 ? 59.731  22.203  -35.642  1.00 14.50 ? 295  TRP A CE3 1 
ATOM   2202  C  CZ2 . TRP A 1 306 ? 59.493  19.795  -37.045  1.00 17.82 ? 295  TRP A CZ2 1 
ATOM   2203  C  CZ3 . TRP A 1 306 ? 59.809  21.029  -35.012  1.00 15.22 ? 295  TRP A CZ3 1 
ATOM   2204  C  CH2 . TRP A 1 306 ? 59.703  19.834  -35.695  1.00 16.85 ? 295  TRP A CH2 1 
ATOM   2205  N  N   . ALA A 1 307 ? 58.047  25.147  -35.050  1.00 23.61 ? 296  ALA A N   1 
ATOM   2206  C  CA  . ALA A 1 307 ? 57.953  24.542  -33.723  1.00 23.22 ? 296  ALA A CA  1 
ATOM   2207  C  C   . ALA A 1 307 ? 56.534  24.578  -33.198  1.00 23.49 ? 296  ALA A C   1 
ATOM   2208  O  O   . ALA A 1 307 ? 56.091  23.683  -32.443  1.00 21.48 ? 296  ALA A O   1 
ATOM   2209  C  CB  . ALA A 1 307 ? 58.890  25.272  -32.775  1.00 23.18 ? 296  ALA A CB  1 
ATOM   2210  N  N   . LYS A 1 308 ? 55.834  25.634  -33.593  1.00 23.54 ? 297  LYS A N   1 
ATOM   2211  C  CA  . LYS A 1 308 ? 54.439  25.813  -33.254  1.00 23.44 ? 297  LYS A CA  1 
ATOM   2212  C  C   . LYS A 1 308 ? 53.631  24.698  -33.895  1.00 23.64 ? 297  LYS A C   1 
ATOM   2213  O  O   . LYS A 1 308 ? 52.877  24.010  -33.219  1.00 24.72 ? 297  LYS A O   1 
ATOM   2214  C  CB  . LYS A 1 308 ? 53.972  27.182  -33.751  1.00 22.95 ? 297  LYS A CB  1 
ATOM   2215  C  CG  . LYS A 1 308 ? 52.553  27.484  -33.459  1.00 24.03 ? 297  LYS A CG  1 
ATOM   2216  C  CD  . LYS A 1 308 ? 52.297  28.971  -33.622  1.00 25.12 ? 297  LYS A CD  1 
ATOM   2217  C  CE  . LYS A 1 308 ? 50.882  29.266  -34.111  1.00 27.27 ? 297  LYS A CE  1 
ATOM   2218  N  NZ  . LYS A 1 308 ? 50.820  30.577  -34.866  1.00 24.18 ? 297  LYS A NZ  1 
ATOM   2219  N  N   . ALA A 1 309 ? 53.829  24.518  -35.204  1.00 22.43 ? 298  ALA A N   1 
ATOM   2220  C  CA  . ALA A 1 309 ? 53.146  23.530  -35.984  1.00 21.34 ? 298  ALA A CA  1 
ATOM   2221  C  C   . ALA A 1 309 ? 53.426  22.113  -35.472  1.00 22.28 ? 298  ALA A C   1 
ATOM   2222  O  O   . ALA A 1 309 ? 52.558  21.230  -35.565  1.00 23.10 ? 298  ALA A O   1 
ATOM   2223  C  CB  . ALA A 1 309 ? 53.569  23.649  -37.435  1.00 18.43 ? 298  ALA A CB  1 
ATOM   2224  N  N   . ALA A 1 310 ? 54.646  21.888  -34.985  1.00 20.70 ? 299  ALA A N   1 
ATOM   2225  C  CA  . ALA A 1 310 ? 55.080  20.568  -34.591  1.00 20.61 ? 299  ALA A CA  1 
ATOM   2226  C  C   . ALA A 1 310 ? 54.544  20.282  -33.198  1.00 20.41 ? 299  ALA A C   1 
ATOM   2227  O  O   . ALA A 1 310 ? 54.469  19.117  -32.802  1.00 20.31 ? 299  ALA A O   1 
ATOM   2228  C  CB  . ALA A 1 310 ? 56.612  20.465  -34.630  1.00 20.73 ? 299  ALA A CB  1 
ATOM   2229  N  N   . ALA A 1 311 ? 54.169  21.343  -32.474  1.00 19.72 ? 300  ALA A N   1 
ATOM   2230  C  CA  . ALA A 1 311 ? 53.518  21.191  -31.173  1.00 20.43 ? 300  ALA A CA  1 
ATOM   2231  C  C   . ALA A 1 311 ? 52.141  20.501  -31.353  1.00 20.43 ? 300  ALA A C   1 
ATOM   2232  O  O   . ALA A 1 311 ? 51.735  19.631  -30.574  1.00 22.42 ? 300  ALA A O   1 
ATOM   2233  C  CB  . ALA A 1 311 ? 53.388  22.541  -30.493  1.00 18.65 ? 300  ALA A CB  1 
ATOM   2234  N  N   . PHE A 1 312 ? 51.457  20.834  -32.440  1.00 21.37 ? 301  PHE A N   1 
ATOM   2235  C  CA  . PHE A 1 312 ? 50.119  20.307  -32.678  1.00 20.33 ? 301  PHE A CA  1 
ATOM   2236  C  C   . PHE A 1 312 ? 50.139  18.833  -33.092  1.00 19.89 ? 301  PHE A C   1 
ATOM   2237  O  O   . PHE A 1 312 ? 49.087  18.196  -33.142  1.00 20.75 ? 301  PHE A O   1 
ATOM   2238  C  CB  . PHE A 1 312 ? 49.396  21.180  -33.713  1.00 22.34 ? 301  PHE A CB  1 
ATOM   2239  C  CG  . PHE A 1 312 ? 48.869  22.461  -33.134  1.00 22.45 ? 301  PHE A CG  1 
ATOM   2240  C  CD1 . PHE A 1 312 ? 49.744  23.469  -32.703  1.00 23.94 ? 301  PHE A CD1 1 
ATOM   2241  C  CD2 . PHE A 1 312 ? 47.509  22.652  -32.967  1.00 23.82 ? 301  PHE A CD2 1 
ATOM   2242  C  CE1 . PHE A 1 312 ? 49.258  24.656  -32.123  1.00 23.88 ? 301  PHE A CE1 1 
ATOM   2243  C  CE2 . PHE A 1 312 ? 47.022  23.827  -32.404  1.00 23.64 ? 301  PHE A CE2 1 
ATOM   2244  C  CZ  . PHE A 1 312 ? 47.895  24.822  -31.971  1.00 24.26 ? 301  PHE A CZ  1 
ATOM   2245  N  N   . VAL A 1 313 ? 51.319  18.283  -33.376  1.00 18.91 ? 302  VAL A N   1 
ATOM   2246  C  CA  . VAL A 1 313 ? 51.419  16.925  -33.931  1.00 17.59 ? 302  VAL A CA  1 
ATOM   2247  C  C   . VAL A 1 313 ? 51.071  15.906  -32.858  1.00 17.00 ? 302  VAL A C   1 
ATOM   2248  O  O   . VAL A 1 313 ? 51.788  15.783  -31.884  1.00 17.08 ? 302  VAL A O   1 
ATOM   2249  C  CB  . VAL A 1 313 ? 52.800  16.637  -34.518  1.00 17.60 ? 302  VAL A CB  1 
ATOM   2250  C  CG1 . VAL A 1 313 ? 53.092  15.103  -34.568  1.00 19.95 ? 302  VAL A CG1 1 
ATOM   2251  C  CG2 . VAL A 1 313 ? 52.923  17.277  -35.926  1.00 15.21 ? 302  VAL A CG2 1 
ATOM   2252  N  N   . THR A 1 314 ? 49.921  15.243  -33.045  1.00 15.62 ? 303  THR A N   1 
ATOM   2253  C  CA  . THR A 1 314 ? 49.481  14.095  -32.272  1.00 14.90 ? 303  THR A CA  1 
ATOM   2254  C  C   . THR A 1 314 ? 48.595  13.275  -33.174  1.00 15.72 ? 303  THR A C   1 
ATOM   2255  O  O   . THR A 1 314 ? 48.282  13.704  -34.313  1.00 15.79 ? 303  THR A O   1 
ATOM   2256  C  CB  . THR A 1 314 ? 48.776  14.517  -30.955  1.00 15.23 ? 303  THR A CB  1 
ATOM   2257  O  OG1 . THR A 1 314 ? 48.529  13.357  -30.160  1.00 17.23 ? 303  THR A OG1 1 
ATOM   2258  C  CG2 . THR A 1 314 ? 47.444  15.278  -31.240  1.00 15.51 ? 303  THR A CG2 1 
ATOM   2259  N  N   . SER A 1 315 ? 48.267  12.064  -32.736  1.00 15.40 ? 304  SER A N   1 
ATOM   2260  C  CA  . SER A 1 315 ? 47.594  11.084  -33.583  1.00 15.10 ? 304  SER A CA  1 
ATOM   2261  C  C   . SER A 1 315 ? 46.388  10.496  -32.837  1.00 15.94 ? 304  SER A C   1 
ATOM   2262  O  O   . SER A 1 315 ? 46.565  9.957   -31.763  1.00 12.69 ? 304  SER A O   1 
ATOM   2263  C  CB  . SER A 1 315 ? 48.546  9.928   -33.895  1.00 14.41 ? 304  SER A CB  1 
ATOM   2264  O  OG  . SER A 1 315 ? 49.637  10.323  -34.729  1.00 19.13 ? 304  SER A OG  1 
ATOM   2265  N  N   . PRO A 1 316 ? 45.167  10.593  -33.397  1.00 16.18 ? 305  PRO A N   1 
ATOM   2266  C  CA  . PRO A 1 316 ? 44.811  11.234  -34.648  1.00 17.23 ? 305  PRO A CA  1 
ATOM   2267  C  C   . PRO A 1 316 ? 44.983  12.763  -34.606  1.00 16.69 ? 305  PRO A C   1 
ATOM   2268  O  O   . PRO A 1 316 ? 44.874  13.360  -33.554  1.00 17.27 ? 305  PRO A O   1 
ATOM   2269  C  CB  . PRO A 1 316 ? 43.313  10.878  -34.808  1.00 16.81 ? 305  PRO A CB  1 
ATOM   2270  C  CG  . PRO A 1 316 ? 43.038  9.834   -33.863  1.00 16.89 ? 305  PRO A CG  1 
ATOM   2271  C  CD  . PRO A 1 316 ? 43.976  10.042  -32.728  1.00 14.53 ? 305  PRO A CD  1 
ATOM   2272  N  N   . PRO A 1 317 ? 45.202  13.398  -35.764  1.00 17.33 ? 306  PRO A N   1 
ATOM   2273  C  CA  . PRO A 1 317 ? 45.454  14.832  -35.655  1.00 17.80 ? 306  PRO A CA  1 
ATOM   2274  C  C   . PRO A 1 317 ? 44.201  15.675  -35.394  1.00 16.84 ? 306  PRO A C   1 
ATOM   2275  O  O   . PRO A 1 317 ? 43.054  15.227  -35.573  1.00 13.27 ? 306  PRO A O   1 
ATOM   2276  C  CB  . PRO A 1 317 ? 46.083  15.208  -37.003  1.00 16.63 ? 306  PRO A CB  1 
ATOM   2277  C  CG  . PRO A 1 317 ? 45.817  14.062  -37.937  1.00 16.86 ? 306  PRO A CG  1 
ATOM   2278  C  CD  . PRO A 1 317 ? 45.153  12.940  -37.156  1.00 16.11 ? 306  PRO A CD  1 
ATOM   2279  N  N   . LEU A 1 318 ? 44.462  16.893  -34.952  1.00 15.85 ? 307  LEU A N   1 
ATOM   2280  C  CA  . LEU A 1 318 ? 43.451  17.923  -34.966  1.00 16.06 ? 307  LEU A CA  1 
ATOM   2281  C  C   . LEU A 1 318 ? 42.925  18.079  -36.389  1.00 15.22 ? 307  LEU A C   1 
ATOM   2282  O  O   . LEU A 1 318 ? 43.712  18.219  -37.332  1.00 14.17 ? 307  LEU A O   1 
ATOM   2283  C  CB  . LEU A 1 318 ? 44.007  19.253  -34.487  1.00 17.02 ? 307  LEU A CB  1 
ATOM   2284  C  CG  . LEU A 1 318 ? 44.433  19.356  -33.032  1.00 17.84 ? 307  LEU A CG  1 
ATOM   2285  C  CD1 . LEU A 1 318 ? 43.341  18.822  -32.158  1.00 17.85 ? 307  LEU A CD1 1 
ATOM   2286  C  CD2 . LEU A 1 318 ? 45.779  18.656  -32.797  1.00 19.04 ? 307  LEU A CD2 1 
ATOM   2287  N  N   . SER A 1 319 ? 41.601  18.029  -36.548  1.00 14.38 ? 308  SER A N   1 
ATOM   2288  C  CA  . SER A 1 319 ? 41.030  18.209  -37.903  1.00 14.72 ? 308  SER A CA  1 
ATOM   2289  C  C   . SER A 1 319 ? 41.321  19.621  -38.334  1.00 14.30 ? 308  SER A C   1 
ATOM   2290  O  O   . SER A 1 319 ? 41.096  20.544  -37.567  1.00 12.24 ? 308  SER A O   1 
ATOM   2291  C  CB  . SER A 1 319 ? 39.505  18.065  -37.908  1.00 14.65 ? 308  SER A CB  1 
ATOM   2292  O  OG  . SER A 1 319 ? 38.984  18.352  -39.228  1.00 14.15 ? 308  SER A OG  1 
ATOM   2293  N  N   . PRO A 1 320 ? 41.796  19.806  -39.578  1.00 15.76 ? 309  PRO A N   1 
ATOM   2294  C  CA  . PRO A 1 320 ? 41.899  21.152  -40.108  1.00 16.30 ? 309  PRO A CA  1 
ATOM   2295  C  C   . PRO A 1 320 ? 40.587  21.891  -40.338  1.00 17.13 ? 309  PRO A C   1 
ATOM   2296  O  O   . PRO A 1 320 ? 40.634  23.074  -40.710  1.00 17.09 ? 309  PRO A O   1 
ATOM   2297  C  CB  . PRO A 1 320 ? 42.584  20.948  -41.441  1.00 15.26 ? 309  PRO A CB  1 
ATOM   2298  C  CG  . PRO A 1 320 ? 43.237  19.579  -41.370  1.00 15.73 ? 309  PRO A CG  1 
ATOM   2299  C  CD  . PRO A 1 320 ? 42.347  18.794  -40.509  1.00 15.91 ? 309  PRO A CD  1 
ATOM   2300  N  N   . ASP A 1 321 ? 39.449  21.214  -40.115  1.00 17.47 ? 310  ASP A N   1 
ATOM   2301  C  CA  . ASP A 1 321 ? 38.125  21.794  -40.309  1.00 16.21 ? 310  ASP A CA  1 
ATOM   2302  C  C   . ASP A 1 321 ? 37.849  22.710  -39.154  1.00 16.32 ? 310  ASP A C   1 
ATOM   2303  O  O   . ASP A 1 321 ? 37.732  22.244  -38.029  1.00 15.85 ? 310  ASP A O   1 
ATOM   2304  C  CB  . ASP A 1 321 ? 37.091  20.665  -40.408  1.00 17.56 ? 310  ASP A CB  1 
ATOM   2305  C  CG  . ASP A 1 321 ? 35.672  21.159  -40.718  1.00 18.11 ? 310  ASP A CG  1 
ATOM   2306  O  OD1 . ASP A 1 321 ? 35.331  22.342  -40.438  1.00 22.96 ? 310  ASP A OD1 1 
ATOM   2307  O  OD2 . ASP A 1 321 ? 34.902  20.320  -41.230  1.00 21.45 ? 310  ASP A OD2 1 
ATOM   2308  N  N   . PRO A 1 322 ? 37.769  24.043  -39.400  1.00 16.63 ? 311  PRO A N   1 
ATOM   2309  C  CA  . PRO A 1 322 ? 37.590  24.975  -38.273  1.00 15.81 ? 311  PRO A CA  1 
ATOM   2310  C  C   . PRO A 1 322 ? 36.272  24.859  -37.478  1.00 16.29 ? 311  PRO A C   1 
ATOM   2311  O  O   . PRO A 1 322 ? 36.222  25.266  -36.306  1.00 14.71 ? 311  PRO A O   1 
ATOM   2312  C  CB  . PRO A 1 322 ? 37.704  26.366  -38.913  1.00 16.50 ? 311  PRO A CB  1 
ATOM   2313  C  CG  . PRO A 1 322 ? 37.759  26.166  -40.388  1.00 17.08 ? 311  PRO A CG  1 
ATOM   2314  C  CD  . PRO A 1 322 ? 37.817  24.728  -40.703  1.00 16.24 ? 311  PRO A CD  1 
ATOM   2315  N  N   . THR A 1 323 ? 35.249  24.257  -38.094  1.00 17.32 ? 312  THR A N   1 
ATOM   2316  C  CA  . THR A 1 323 ? 33.929  24.053  -37.474  1.00 17.59 ? 312  THR A CA  1 
ATOM   2317  C  C   . THR A 1 323 ? 33.901  22.834  -36.504  1.00 16.56 ? 312  THR A C   1 
ATOM   2318  O  O   . THR A 1 323 ? 32.936  22.643  -35.777  1.00 18.75 ? 312  THR A O   1 
ATOM   2319  C  CB  . THR A 1 323 ? 32.834  23.872  -38.553  1.00 16.93 ? 312  THR A CB  1 
ATOM   2320  O  OG1 . THR A 1 323 ? 32.908  22.550  -39.085  1.00 20.39 ? 312  THR A OG1 1 
ATOM   2321  C  CG2 . THR A 1 323 ? 32.996  24.856  -39.715  1.00 19.12 ? 312  THR A CG2 1 
ATOM   2322  N  N   . THR A 1 324 ? 34.973  22.037  -36.490  1.00 16.53 ? 313  THR A N   1 
ATOM   2323  C  CA  . THR A 1 324 ? 35.063  20.812  -35.696  1.00 17.11 ? 313  THR A CA  1 
ATOM   2324  C  C   . THR A 1 324 ? 34.782  21.018  -34.191  1.00 17.60 ? 313  THR A C   1 
ATOM   2325  O  O   . THR A 1 324 ? 33.918  20.357  -33.628  1.00 19.75 ? 313  THR A O   1 
ATOM   2326  C  CB  . THR A 1 324 ? 36.446  20.095  -35.899  1.00 17.50 ? 313  THR A CB  1 
ATOM   2327  O  OG1 . THR A 1 324 ? 36.553  19.602  -37.230  1.00 13.74 ? 313  THR A OG1 1 
ATOM   2328  C  CG2 . THR A 1 324 ? 36.629  18.952  -34.933  1.00 14.88 ? 313  THR A CG2 1 
ATOM   2329  N  N   . PRO A 1 325 ? 35.488  21.931  -33.520  1.00 18.62 ? 314  PRO A N   1 
ATOM   2330  C  CA  . PRO A 1 325 ? 35.200  22.015  -32.084  1.00 18.04 ? 314  PRO A CA  1 
ATOM   2331  C  C   . PRO A 1 325 ? 33.730  22.268  -31.764  1.00 18.64 ? 314  PRO A C   1 
ATOM   2332  O  O   . PRO A 1 325 ? 33.216  21.722  -30.776  1.00 18.73 ? 314  PRO A O   1 
ATOM   2333  C  CB  . PRO A 1 325 ? 36.031  23.209  -31.629  1.00 18.40 ? 314  PRO A CB  1 
ATOM   2334  C  CG  . PRO A 1 325 ? 37.098  23.333  -32.620  1.00 17.21 ? 314  PRO A CG  1 
ATOM   2335  C  CD  . PRO A 1 325 ? 36.518  22.901  -33.927  1.00 20.10 ? 314  PRO A CD  1 
ATOM   2336  N  N   . ASP A 1 326 ? 33.071  23.104  -32.582  1.00 18.97 ? 315  ASP A N   1 
ATOM   2337  C  CA  A ASP A 1 326 ? 31.650  23.453  -32.389  0.50 18.70 ? 315  ASP A CA  1 
ATOM   2338  C  CA  B ASP A 1 326 ? 31.681  23.448  -32.341  0.50 18.11 ? 315  ASP A CA  1 
ATOM   2339  C  C   . ASP A 1 326 ? 30.795  22.218  -32.497  1.00 18.12 ? 315  ASP A C   1 
ATOM   2340  O  O   . ASP A 1 326 ? 29.943  21.987  -31.663  1.00 18.35 ? 315  ASP A O   1 
ATOM   2341  C  CB  A ASP A 1 326 ? 31.147  24.494  -33.405  0.50 19.16 ? 315  ASP A CB  1 
ATOM   2342  C  CB  B ASP A 1 326 ? 31.224  24.589  -33.252  0.50 17.58 ? 315  ASP A CB  1 
ATOM   2343  C  CG  A ASP A 1 326 ? 29.604  24.471  -33.580  0.50 20.30 ? 315  ASP A CG  1 
ATOM   2344  C  CG  B ASP A 1 326 ? 31.846  25.932  -32.879  0.50 16.12 ? 315  ASP A CG  1 
ATOM   2345  O  OD1 A ASP A 1 326 ? 28.874  25.021  -32.725  0.50 21.13 ? 315  ASP A OD1 1 
ATOM   2346  O  OD1 B ASP A 1 326 ? 32.317  26.124  -31.734  0.50 14.28 ? 315  ASP A OD1 1 
ATOM   2347  O  OD2 A ASP A 1 326 ? 29.111  23.915  -34.592  0.50 23.39 ? 315  ASP A OD2 1 
ATOM   2348  O  OD2 B ASP A 1 326 ? 31.851  26.821  -33.750  0.50 17.32 ? 315  ASP A OD2 1 
ATOM   2349  N  N   . PHE A 1 327 ? 31.026  21.437  -33.545  1.00 18.98 ? 316  PHE A N   1 
ATOM   2350  C  CA  . PHE A 1 327 ? 30.330  20.172  -33.736  1.00 18.04 ? 316  PHE A CA  1 
ATOM   2351  C  C   . PHE A 1 327 ? 30.517  19.204  -32.591  1.00 17.87 ? 316  PHE A C   1 
ATOM   2352  O  O   . PHE A 1 327 ? 29.561  18.649  -32.102  1.00 19.62 ? 316  PHE A O   1 
ATOM   2353  C  CB  . PHE A 1 327 ? 30.801  19.486  -34.994  1.00 20.02 ? 316  PHE A CB  1 
ATOM   2354  C  CG  . PHE A 1 327 ? 29.988  18.279  -35.351  1.00 20.91 ? 316  PHE A CG  1 
ATOM   2355  C  CD1 . PHE A 1 327 ? 28.738  18.424  -35.920  1.00 21.96 ? 316  PHE A CD1 1 
ATOM   2356  C  CD2 . PHE A 1 327 ? 30.476  16.992  -35.114  1.00 22.30 ? 316  PHE A CD2 1 
ATOM   2357  C  CE1 . PHE A 1 327 ? 27.991  17.321  -36.248  1.00 22.32 ? 316  PHE A CE1 1 
ATOM   2358  C  CE2 . PHE A 1 327 ? 29.735  15.884  -35.453  1.00 20.22 ? 316  PHE A CE2 1 
ATOM   2359  C  CZ  . PHE A 1 327 ? 28.487  16.050  -36.026  1.00 21.26 ? 316  PHE A CZ  1 
ATOM   2360  N  N   . LEU A 1 328 ? 31.752  19.002  -32.161  1.00 16.09 ? 317  LEU A N   1 
ATOM   2361  C  CA  . LEU A 1 328 ? 32.043  18.050  -31.072  1.00 14.35 ? 317  LEU A CA  1 
ATOM   2362  C  C   . LEU A 1 328 ? 31.484  18.517  -29.741  1.00 12.76 ? 317  LEU A C   1 
ATOM   2363  O  O   . LEU A 1 328 ? 31.088  17.711  -28.929  1.00 12.06 ? 317  LEU A O   1 
ATOM   2364  C  CB  . LEU A 1 328 ? 33.560  17.810  -30.924  1.00 13.19 ? 317  LEU A CB  1 
ATOM   2365  C  CG  . LEU A 1 328 ? 34.297  17.206  -32.104  1.00 13.06 ? 317  LEU A CG  1 
ATOM   2366  C  CD1 . LEU A 1 328 ? 35.800  17.144  -31.731  1.00 8.49  ? 317  LEU A CD1 1 
ATOM   2367  C  CD2 . LEU A 1 328 ? 33.737  15.838  -32.511  1.00 11.85 ? 317  LEU A CD2 1 
ATOM   2368  N  N   . ASN A 1 329 ? 31.459  19.822  -29.520  1.00 14.10 ? 318  ASN A N   1 
ATOM   2369  C  CA  . ASN A 1 329 ? 30.860  20.385  -28.298  1.00 14.31 ? 318  ASN A CA  1 
ATOM   2370  C  C   . ASN A 1 329 ? 29.329  20.259  -28.311  1.00 13.52 ? 318  ASN A C   1 
ATOM   2371  O  O   . ASN A 1 329 ? 28.683  20.204  -27.280  1.00 13.81 ? 318  ASN A O   1 
ATOM   2372  C  CB  . ASN A 1 329 ? 31.275  21.851  -28.107  1.00 14.65 ? 318  ASN A CB  1 
ATOM   2373  C  CG  . ASN A 1 329 ? 32.716  22.007  -27.644  1.00 14.17 ? 318  ASN A CG  1 
ATOM   2374  O  OD1 . ASN A 1 329 ? 33.004  21.993  -26.450  1.00 10.38 ? 318  ASN A OD1 1 
ATOM   2375  N  ND2 . ASN A 1 329 ? 33.624  22.178  -28.596  1.00 11.87 ? 318  ASN A ND2 1 
ATOM   2376  N  N   . SER A 1 330 ? 28.753  20.213  -29.496  1.00 12.30 ? 319  SER A N   1 
ATOM   2377  C  CA  . SER A 1 330 ? 27.319  20.001  -29.639  1.00 13.24 ? 319  SER A CA  1 
ATOM   2378  C  C   . SER A 1 330 ? 26.946  18.548  -29.291  1.00 13.47 ? 319  SER A C   1 
ATOM   2379  O  O   . SER A 1 330 ? 25.935  18.297  -28.632  1.00 14.12 ? 319  SER A O   1 
ATOM   2380  C  CB  . SER A 1 330 ? 26.884  20.354  -31.075  1.00 11.63 ? 319  SER A CB  1 
ATOM   2381  O  OG  . SER A 1 330 ? 26.910  21.761  -31.251  1.00 10.22 ? 319  SER A OG  1 
ATOM   2382  N  N   . LEU A 1 331 ? 27.782  17.608  -29.731  1.00 14.76 ? 320  LEU A N   1 
ATOM   2383  C  CA  . LEU A 1 331 ? 27.558  16.178  -29.547  1.00 14.18 ? 320  LEU A CA  1 
ATOM   2384  C  C   . LEU A 1 331 ? 27.817  15.771  -28.117  1.00 14.19 ? 320  LEU A C   1 
ATOM   2385  O  O   . LEU A 1 331 ? 27.242  14.829  -27.610  1.00 16.23 ? 320  LEU A O   1 
ATOM   2386  C  CB  . LEU A 1 331 ? 28.428  15.358  -30.498  1.00 12.99 ? 320  LEU A CB  1 
ATOM   2387  C  CG  . LEU A 1 331 ? 27.698  14.949  -31.792  1.00 13.58 ? 320  LEU A CG  1 
ATOM   2388  C  CD1 . LEU A 1 331 ? 27.049  16.144  -32.456  1.00 15.86 ? 320  LEU A CD1 1 
ATOM   2389  C  CD2 . LEU A 1 331 ? 28.649  14.224  -32.727  1.00 13.61 ? 320  LEU A CD2 1 
ATOM   2390  N  N   . LEU A 1 332 ? 28.672  16.503  -27.455  1.00 15.77 ? 321  LEU A N   1 
ATOM   2391  C  CA  . LEU A 1 332 ? 28.899  16.285  -26.031  1.00 15.96 ? 321  LEU A CA  1 
ATOM   2392  C  C   . LEU A 1 332 ? 27.667  16.718  -25.262  1.00 16.43 ? 321  LEU A C   1 
ATOM   2393  O  O   . LEU A 1 332 ? 27.211  16.052  -24.342  1.00 17.08 ? 321  LEU A O   1 
ATOM   2394  C  CB  . LEU A 1 332 ? 30.124  17.098  -25.642  1.00 17.77 ? 321  LEU A CB  1 
ATOM   2395  C  CG  . LEU A 1 332 ? 31.050  16.771  -24.480  1.00 17.07 ? 321  LEU A CG  1 
ATOM   2396  C  CD1 . LEU A 1 332 ? 31.502  15.304  -24.468  1.00 16.10 ? 321  LEU A CD1 1 
ATOM   2397  C  CD2 . LEU A 1 332 ? 32.206  17.743  -24.657  1.00 15.91 ? 321  LEU A CD2 1 
ATOM   2398  N  N   . SER A 1 333 ? 27.087  17.826  -25.688  1.00 19.25 ? 322  SER A N   1 
ATOM   2399  C  CA  . SER A 1 333 ? 25.928  18.386  -25.029  1.00 20.08 ? 322  SER A CA  1 
ATOM   2400  C  C   . SER A 1 333 ? 24.609  17.590  -25.241  1.00 21.62 ? 322  SER A C   1 
ATOM   2401  O  O   . SER A 1 333 ? 23.752  17.601  -24.352  1.00 22.59 ? 322  SER A O   1 
ATOM   2402  C  CB  . SER A 1 333 ? 25.743  19.854  -25.453  1.00 20.70 ? 322  SER A CB  1 
ATOM   2403  O  OG  . SER A 1 333 ? 26.952  20.603  -25.372  1.00 18.19 ? 322  SER A OG  1 
ATOM   2404  N  N   . CYS A 1 334 ? 24.438  16.934  -26.403  1.00 21.67 ? 323  CYS A N   1 
ATOM   2405  C  CA  . CYS A 1 334 ? 23.246  16.120  -26.688  1.00 20.93 ? 323  CYS A CA  1 
ATOM   2406  C  C   . CYS A 1 334 ? 23.411  14.664  -26.340  1.00 21.87 ? 323  CYS A C   1 
ATOM   2407  O  O   . CYS A 1 334 ? 22.448  13.935  -26.393  1.00 24.36 ? 323  CYS A O   1 
ATOM   2408  C  CB  . CYS A 1 334 ? 22.814  16.199  -28.148  1.00 21.55 ? 323  CYS A CB  1 
ATOM   2409  S  SG  . CYS A 1 334 ? 23.825  15.282  -29.237  1.00 20.40 ? 323  CYS A SG  1 
ATOM   2410  N  N   . GLY A 1 335 ? 24.612  14.221  -25.989  1.00 21.21 ? 324  GLY A N   1 
ATOM   2411  C  CA  . GLY A 1 335 ? 24.781  12.908  -25.362  1.00 20.07 ? 324  GLY A CA  1 
ATOM   2412  C  C   . GLY A 1 335 ? 25.380  11.834  -26.228  1.00 18.88 ? 324  GLY A C   1 
ATOM   2413  O  O   . GLY A 1 335 ? 25.513  10.701  -25.792  1.00 16.95 ? 324  GLY A O   1 
ATOM   2414  N  N   . ASP A 1 336 ? 25.772  12.194  -27.442  1.00 20.04 ? 325  ASP A N   1 
ATOM   2415  C  CA  . ASP A 1 336 ? 26.390  11.243  -28.357  1.00 19.83 ? 325  ASP A CA  1 
ATOM   2416  C  C   . ASP A 1 336 ? 27.851  10.959  -27.996  1.00 19.72 ? 325  ASP A C   1 
ATOM   2417  O  O   . ASP A 1 336 ? 28.363  9.875   -28.287  1.00 19.60 ? 325  ASP A O   1 
ATOM   2418  C  CB  . ASP A 1 336 ? 26.266  11.737  -29.806  1.00 21.76 ? 325  ASP A CB  1 
ATOM   2419  C  CG  . ASP A 1 336 ? 24.834  11.671  -30.316  1.00 23.44 ? 325  ASP A CG  1 
ATOM   2420  O  OD1 . ASP A 1 336 ? 23.993  10.971  -29.687  1.00 25.60 ? 325  ASP A OD1 1 
ATOM   2421  O  OD2 . ASP A 1 336 ? 24.548  12.315  -31.345  1.00 28.90 ? 325  ASP A OD2 1 
ATOM   2422  N  N   . LEU A 1 337 ? 28.509  11.932  -27.357  1.00 17.83 ? 326  LEU A N   1 
ATOM   2423  C  CA  . LEU A 1 337 ? 29.836  11.741  -26.804  1.00 15.83 ? 326  LEU A CA  1 
ATOM   2424  C  C   . LEU A 1 337 ? 29.633  12.014  -25.308  1.00 15.19 ? 326  LEU A C   1 
ATOM   2425  O  O   . LEU A 1 337 ? 28.884  12.915  -24.930  1.00 15.18 ? 326  LEU A O   1 
ATOM   2426  C  CB  . LEU A 1 337 ? 30.860  12.690  -27.465  1.00 14.07 ? 326  LEU A CB  1 
ATOM   2427  C  CG  . LEU A 1 337 ? 31.028  12.678  -29.010  1.00 12.21 ? 326  LEU A CG  1 
ATOM   2428  C  CD1 . LEU A 1 337 ? 31.680  13.982  -29.489  1.00 7.54  ? 326  LEU A CD1 1 
ATOM   2429  C  CD2 . LEU A 1 337 ? 31.797  11.506  -29.490  1.00 8.02  ? 326  LEU A CD2 1 
ATOM   2430  N  N   . GLN A 1 338 ? 30.250  11.197  -24.470  1.00 16.82 ? 327  GLN A N   1 
ATOM   2431  C  CA  . GLN A 1 338 ? 29.883  11.103  -23.043  1.00 17.29 ? 327  GLN A CA  1 
ATOM   2432  C  C   . GLN A 1 338 ? 30.979  11.454  -22.064  1.00 17.36 ? 327  GLN A C   1 
ATOM   2433  O  O   . GLN A 1 338 ? 30.719  11.944  -20.978  1.00 18.61 ? 327  GLN A O   1 
ATOM   2434  C  CB  . GLN A 1 338 ? 29.414  9.683   -22.720  1.00 18.85 ? 327  GLN A CB  1 
ATOM   2435  C  CG  . GLN A 1 338 ? 28.265  9.174   -23.586  1.00 20.50 ? 327  GLN A CG  1 
ATOM   2436  C  CD  . GLN A 1 338 ? 28.723  8.860   -25.020  1.00 24.33 ? 327  GLN A CD  1 
ATOM   2437  O  OE1 . GLN A 1 338 ? 29.894  8.541   -25.280  1.00 21.85 ? 327  GLN A OE1 1 
ATOM   2438  N  NE2 . GLN A 1 338 ? 27.798  8.990   -25.960  1.00 23.93 ? 327  GLN A NE2 1 
ATOM   2439  N  N   . VAL A 1 339 ? 32.215  11.209  -22.454  1.00 18.41 ? 328  VAL A N   1 
ATOM   2440  C  CA  . VAL A 1 339 ? 33.364  11.455  -21.583  1.00 17.27 ? 328  VAL A CA  1 
ATOM   2441  C  C   . VAL A 1 339 ? 34.342  12.416  -22.234  1.00 17.79 ? 328  VAL A C   1 
ATOM   2442  O  O   . VAL A 1 339 ? 34.375  12.551  -23.458  1.00 18.89 ? 328  VAL A O   1 
ATOM   2443  C  CB  . VAL A 1 339 ? 34.085  10.119  -21.240  1.00 18.07 ? 328  VAL A CB  1 
ATOM   2444  C  CG1 . VAL A 1 339 ? 33.122  9.183   -20.545  1.00 11.38 ? 328  VAL A CG1 1 
ATOM   2445  C  CG2 . VAL A 1 339 ? 34.636  9.454   -22.499  1.00 14.15 ? 328  VAL A CG2 1 
ATOM   2446  N  N   . THR A 1 340 ? 35.139  13.083  -21.412  1.00 17.97 ? 329  THR A N   1 
ATOM   2447  C  CA  . THR A 1 340 ? 36.189  13.954  -21.895  1.00 17.21 ? 329  THR A CA  1 
ATOM   2448  C  C   . THR A 1 340 ? 37.494  13.668  -21.147  1.00 17.03 ? 329  THR A C   1 
ATOM   2449  O  O   . THR A 1 340 ? 37.517  13.470  -19.920  1.00 18.73 ? 329  THR A O   1 
ATOM   2450  C  CB  . THR A 1 340 ? 35.818  15.467  -21.760  1.00 17.65 ? 329  THR A CB  1 
ATOM   2451  O  OG1 . THR A 1 340 ? 35.687  15.838  -20.379  1.00 16.73 ? 329  THR A OG1 1 
ATOM   2452  C  CG2 . THR A 1 340 ? 34.520  15.762  -22.441  1.00 15.93 ? 329  THR A CG2 1 
ATOM   2453  N  N   . GLY A 1 341 ? 38.568  13.657  -21.913  1.00 17.99 ? 330  GLY A N   1 
ATOM   2454  C  CA  . GLY A 1 341 ? 39.926  13.582  -21.385  1.00 16.33 ? 330  GLY A CA  1 
ATOM   2455  C  C   . GLY A 1 341 ? 40.824  14.615  -22.059  1.00 15.89 ? 330  GLY A C   1 
ATOM   2456  O  O   . GLY A 1 341 ? 40.346  15.582  -22.659  1.00 13.41 ? 330  GLY A O   1 
ATOM   2457  N  N   . SER A 1 342 ? 42.131  14.441  -21.901  1.00 15.58 ? 331  SER A N   1 
ATOM   2458  C  CA  . SER A 1 342 ? 43.121  15.359  -22.529  1.00 16.28 ? 331  SER A CA  1 
ATOM   2459  C  C   . SER A 1 342 ? 44.108  14.652  -23.435  1.00 16.07 ? 331  SER A C   1 
ATOM   2460  O  O   . SER A 1 342 ? 44.635  15.276  -24.382  1.00 19.25 ? 331  SER A O   1 
ATOM   2461  C  CB  . SER A 1 342 ? 43.887  16.125  -21.465  1.00 16.74 ? 331  SER A CB  1 
ATOM   2462  O  OG  . SER A 1 342 ? 44.478  15.261  -20.503  1.00 15.31 ? 331  SER A OG  1 
ATOM   2463  N  N   . ALA A 1 343 ? 44.336  13.357  -23.187  1.00 15.19 ? 332  ALA A N   1 
ATOM   2464  C  CA  . ALA A 1 343 ? 45.416  12.614  -23.828  1.00 15.91 ? 332  ALA A CA  1 
ATOM   2465  C  C   . ALA A 1 343 ? 46.703  13.405  -23.677  1.00 17.53 ? 332  ALA A C   1 
ATOM   2466  O  O   . ALA A 1 343 ? 47.471  13.536  -24.626  1.00 17.87 ? 332  ALA A O   1 
ATOM   2467  C  CB  . ALA A 1 343 ? 45.103  12.366  -25.299  1.00 15.35 ? 332  ALA A CB  1 
ATOM   2468  N  N   . HIS A 1 344 ? 46.922  13.953  -22.474  1.00 18.07 ? 333  HIS A N   1 
ATOM   2469  C  CA  . HIS A 1 344 ? 48.024  14.885  -22.211  1.00 18.18 ? 333  HIS A CA  1 
ATOM   2470  C  C   . HIS A 1 344 ? 49.304  14.084  -22.302  1.00 18.91 ? 333  HIS A C   1 
ATOM   2471  O  O   . HIS A 1 344 ? 49.584  13.224  -21.458  1.00 16.93 ? 333  HIS A O   1 
ATOM   2472  C  CB  . HIS A 1 344 ? 47.873  15.516  -20.808  1.00 18.14 ? 333  HIS A CB  1 
ATOM   2473  C  CG  . HIS A 1 344 ? 48.852  16.609  -20.518  1.00 19.19 ? 333  HIS A CG  1 
ATOM   2474  N  ND1 . HIS A 1 344 ? 48.571  17.940  -20.735  1.00 18.93 ? 333  HIS A ND1 1 
ATOM   2475  C  CD2 . HIS A 1 344 ? 50.108  16.570  -20.007  1.00 22.38 ? 333  HIS A CD2 1 
ATOM   2476  C  CE1 . HIS A 1 344 ? 49.610  18.673  -20.378  1.00 19.56 ? 333  HIS A CE1 1 
ATOM   2477  N  NE2 . HIS A 1 344 ? 50.556  17.867  -19.932  1.00 23.21 ? 333  HIS A NE2 1 
ATOM   2478  N  N   . CYS A 1 345 ? 50.058  14.327  -23.364  1.00 19.75 ? 334  CYS A N   1 
ATOM   2479  C  CA  . CYS A 1 345 ? 51.299  13.588  -23.616  1.00 19.82 ? 334  CYS A CA  1 
ATOM   2480  C  C   . CYS A 1 345 ? 52.345  14.532  -24.160  1.00 19.64 ? 334  CYS A C   1 
ATOM   2481  O  O   . CYS A 1 345 ? 52.533  14.600  -25.363  1.00 13.05 ? 334  CYS A O   1 
ATOM   2482  C  CB  . CYS A 1 345 ? 51.052  12.468  -24.626  1.00 19.53 ? 334  CYS A CB  1 
ATOM   2483  S  SG  . CYS A 1 345 ? 52.403  11.303  -24.656  1.00 21.83 ? 334  CYS A SG  1 
ATOM   2484  N  N   . THR A 1 346 ? 53.010  15.290  -23.283  1.00 19.82 ? 335  THR A N   1 
ATOM   2485  C  CA  . THR A 1 346 ? 53.816  16.438  -23.775  1.00 20.82 ? 335  THR A CA  1 
ATOM   2486  C  C   . THR A 1 346 ? 55.273  16.123  -24.130  1.00 21.83 ? 335  THR A C   1 
ATOM   2487  O  O   . THR A 1 346 ? 55.937  15.342  -23.443  1.00 22.88 ? 335  THR A O   1 
ATOM   2488  C  CB  . THR A 1 346 ? 53.787  17.664  -22.847  1.00 20.31 ? 335  THR A CB  1 
ATOM   2489  O  OG1 . THR A 1 346 ? 53.999  17.263  -21.481  1.00 18.28 ? 335  THR A OG1 1 
ATOM   2490  C  CG2 . THR A 1 346 ? 52.454  18.420  -23.021  1.00 18.21 ? 335  THR A CG2 1 
ATOM   2491  N  N   . PHE A 1 347 ? 55.720  16.715  -25.249  1.00 22.18 ? 336  PHE A N   1 
ATOM   2492  C  CA  . PHE A 1 347 ? 57.122  16.694  -25.664  1.00 21.18 ? 336  PHE A CA  1 
ATOM   2493  C  C   . PHE A 1 347 ? 57.582  18.096  -26.025  1.00 21.41 ? 336  PHE A C   1 
ATOM   2494  O  O   . PHE A 1 347 ? 57.000  18.726  -26.925  1.00 22.77 ? 336  PHE A O   1 
ATOM   2495  C  CB  . PHE A 1 347 ? 57.313  15.750  -26.842  1.00 19.59 ? 336  PHE A CB  1 
ATOM   2496  C  CG  . PHE A 1 347 ? 57.014  14.331  -26.500  1.00 21.04 ? 336  PHE A CG  1 
ATOM   2497  C  CD1 . PHE A 1 347 ? 55.692  13.861  -26.533  1.00 17.28 ? 336  PHE A CD1 1 
ATOM   2498  C  CD2 . PHE A 1 347 ? 58.024  13.480  -26.068  1.00 16.32 ? 336  PHE A CD2 1 
ATOM   2499  C  CE1 . PHE A 1 347 ? 55.403  12.599  -26.203  1.00 10.85 ? 336  PHE A CE1 1 
ATOM   2500  C  CE2 . PHE A 1 347 ? 57.726  12.208  -25.743  1.00 15.52 ? 336  PHE A CE2 1 
ATOM   2501  C  CZ  . PHE A 1 347 ? 56.398  11.758  -25.823  1.00 15.31 ? 336  PHE A CZ  1 
ATOM   2502  N  N   . ASN A 1 348 ? 58.628  18.580  -25.344  1.00 20.64 ? 337  ASN A N   1 
ATOM   2503  C  CA  . ASN A 1 348 ? 59.132  19.940  -25.572  1.00 21.11 ? 337  ASN A CA  1 
ATOM   2504  C  C   . ASN A 1 348 ? 59.641  20.093  -26.993  1.00 20.82 ? 337  ASN A C   1 
ATOM   2505  O  O   . ASN A 1 348 ? 59.660  19.125  -27.716  1.00 21.65 ? 337  ASN A O   1 
ATOM   2506  C  CB  . ASN A 1 348 ? 60.196  20.325  -24.557  1.00 21.28 ? 337  ASN A CB  1 
ATOM   2507  C  CG  . ASN A 1 348 ? 61.505  19.569  -24.726  1.00 22.01 ? 337  ASN A CG  1 
ATOM   2508  O  OD1 . ASN A 1 348 ? 61.915  19.186  -25.826  1.00 21.97 ? 337  ASN A OD1 1 
ATOM   2509  N  ND2 . ASN A 1 348 ? 62.188  19.381  -23.614  1.00 21.49 ? 337  ASN A ND2 1 
ATOM   2510  N  N   . THR A 1 349 ? 60.050  21.294  -27.377  1.00 22.64 ? 338  THR A N   1 
ATOM   2511  C  CA  . THR A 1 349 ? 60.448  21.578  -28.769  1.00 23.38 ? 338  THR A CA  1 
ATOM   2512  C  C   . THR A 1 349 ? 61.728  20.897  -29.193  1.00 23.63 ? 338  THR A C   1 
ATOM   2513  O  O   . THR A 1 349 ? 61.942  20.672  -30.392  1.00 25.43 ? 338  THR A O   1 
ATOM   2514  C  CB  . THR A 1 349 ? 60.643  23.080  -28.979  1.00 24.81 ? 338  THR A CB  1 
ATOM   2515  O  OG1 . THR A 1 349 ? 59.598  23.787  -28.294  1.00 27.42 ? 338  THR A OG1 1 
ATOM   2516  C  CG2 . THR A 1 349 ? 60.684  23.442  -30.490  1.00 24.48 ? 338  THR A CG2 1 
ATOM   2517  N  N   . ALA A 1 350 ? 62.598  20.587  -28.233  1.00 23.88 ? 339  ALA A N   1 
ATOM   2518  C  CA  . ALA A 1 350 ? 63.834  19.846  -28.545  1.00 23.64 ? 339  ALA A CA  1 
ATOM   2519  C  C   . ALA A 1 350 ? 63.504  18.403  -28.889  1.00 23.66 ? 339  ALA A C   1 
ATOM   2520  O  O   . ALA A 1 350 ? 64.106  17.821  -29.797  1.00 23.13 ? 339  ALA A O   1 
ATOM   2521  C  CB  . ALA A 1 350 ? 64.798  19.896  -27.381  1.00 24.03 ? 339  ALA A CB  1 
ATOM   2522  N  N   . GLN A 1 351 ? 62.543  17.833  -28.156  1.00 23.04 ? 340  GLN A N   1 
ATOM   2523  C  CA  . GLN A 1 351 ? 62.060  16.477  -28.425  1.00 22.16 ? 340  GLN A CA  1 
ATOM   2524  C  C   . GLN A 1 351 ? 61.301  16.465  -29.733  1.00 22.37 ? 340  GLN A C   1 
ATOM   2525  O  O   . GLN A 1 351 ? 61.569  15.623  -30.597  1.00 22.87 ? 340  GLN A O   1 
ATOM   2526  C  CB  . GLN A 1 351 ? 61.169  15.997  -27.299  1.00 21.80 ? 340  GLN A CB  1 
ATOM   2527  C  CG  . GLN A 1 351 ? 61.915  15.768  -25.976  1.00 21.60 ? 340  GLN A CG  1 
ATOM   2528  C  CD  . GLN A 1 351 ? 60.979  15.615  -24.816  1.00 23.58 ? 340  GLN A CD  1 
ATOM   2529  O  OE1 . GLN A 1 351 ? 60.001  16.346  -24.717  1.00 24.70 ? 340  GLN A OE1 1 
ATOM   2530  N  NE2 . GLN A 1 351 ? 61.274  14.679  -23.915  1.00 22.92 ? 340  GLN A NE2 1 
ATOM   2531  N  N   . LYS A 1 352 ? 60.376  17.416  -29.898  1.00 21.83 ? 341  LYS A N   1 
ATOM   2532  C  CA  . LYS A 1 352 ? 59.664  17.582  -31.189  1.00 21.42 ? 341  LYS A CA  1 
ATOM   2533  C  C   . LYS A 1 352 ? 60.623  17.720  -32.370  1.00 21.79 ? 341  LYS A C   1 
ATOM   2534  O  O   . LYS A 1 352 ? 60.389  17.155  -33.439  1.00 21.45 ? 341  LYS A O   1 
ATOM   2535  C  CB  . LYS A 1 352 ? 58.705  18.787  -31.167  1.00 20.90 ? 341  LYS A CB  1 
ATOM   2536  C  CG  . LYS A 1 352 ? 57.542  18.655  -30.186  1.00 19.98 ? 341  LYS A CG  1 
ATOM   2537  C  CD  . LYS A 1 352 ? 56.526  17.645  -30.692  1.00 20.32 ? 341  LYS A CD  1 
ATOM   2538  C  CE  . LYS A 1 352 ? 55.208  17.708  -29.957  1.00 19.16 ? 341  LYS A CE  1 
ATOM   2539  N  NZ  . LYS A 1 352 ? 54.285  16.588  -30.288  1.00 18.81 ? 341  LYS A NZ  1 
ATOM   2540  N  N   . ALA A 1 353 ? 61.700  18.483  -32.186  1.00 22.32 ? 342  ALA A N   1 
ATOM   2541  C  CA  . ALA A 1 353 ? 62.547  18.888  -33.309  1.00 20.84 ? 342  ALA A CA  1 
ATOM   2542  C  C   . ALA A 1 353 ? 63.417  17.799  -33.893  1.00 21.90 ? 342  ALA A C   1 
ATOM   2543  O  O   . ALA A 1 353 ? 64.115  18.061  -34.877  1.00 22.40 ? 342  ALA A O   1 
ATOM   2544  C  CB  . ALA A 1 353 ? 63.375  20.058  -32.943  1.00 20.84 ? 342  ALA A CB  1 
ATOM   2545  N  N   . VAL A 1 354 ? 63.399  16.588  -33.319  1.00 21.89 ? 343  VAL A N   1 
ATOM   2546  C  CA  . VAL A 1 354 ? 63.943  15.385  -33.995  1.00 21.55 ? 343  VAL A CA  1 
ATOM   2547  C  C   . VAL A 1 354 ? 63.358  15.179  -35.379  1.00 21.71 ? 343  VAL A C   1 
ATOM   2548  O  O   . VAL A 1 354 ? 63.993  14.620  -36.241  1.00 21.60 ? 343  VAL A O   1 
ATOM   2549  C  CB  . VAL A 1 354 ? 63.646  14.105  -33.184  1.00 22.93 ? 343  VAL A CB  1 
ATOM   2550  C  CG1 . VAL A 1 354 ? 64.365  12.868  -33.769  1.00 23.10 ? 343  VAL A CG1 1 
ATOM   2551  C  CG2 . VAL A 1 354 ? 64.032  14.303  -31.737  1.00 23.19 ? 343  VAL A CG2 1 
ATOM   2552  N  N   . GLY A 1 355 ? 62.111  15.587  -35.579  1.00 23.22 ? 344  GLY A N   1 
ATOM   2553  C  CA  . GLY A 1 355 ? 61.446  15.393  -36.870  1.00 24.25 ? 344  GLY A CA  1 
ATOM   2554  C  C   . GLY A 1 355 ? 61.310  16.663  -37.695  1.00 25.36 ? 344  GLY A C   1 
ATOM   2555  O  O   . GLY A 1 355 ? 60.399  16.767  -38.542  1.00 27.35 ? 344  GLY A O   1 
ATOM   2556  N  N   . LYS A 1 356 ? 62.194  17.632  -37.456  1.00 25.83 ? 345  LYS A N   1 
ATOM   2557  C  CA  . LYS A 1 356 ? 62.229  18.859  -38.250  1.00 25.40 ? 345  LYS A CA  1 
ATOM   2558  C  C   . LYS A 1 356 ? 62.325  18.544  -39.743  1.00 26.47 ? 345  LYS A C   1 
ATOM   2559  O  O   . LYS A 1 356 ? 61.723  19.263  -40.554  1.00 27.22 ? 345  LYS A O   1 
ATOM   2560  C  CB  . LYS A 1 356 ? 63.352  19.798  -37.814  1.00 24.68 ? 345  LYS A CB  1 
ATOM   2561  C  CG  . LYS A 1 356 ? 64.763  19.300  -38.097  1.00 24.67 ? 345  LYS A CG  1 
ATOM   2562  C  CD  . LYS A 1 356 ? 65.822  20.330  -37.690  1.00 25.53 ? 345  LYS A CD  1 
ATOM   2563  C  CE  . LYS A 1 356 ? 67.264  19.854  -37.924  1.00 25.29 ? 345  LYS A CE  1 
ATOM   2564  N  NZ  . LYS A 1 356 ? 67.682  18.661  -37.112  1.00 26.21 ? 345  LYS A NZ  1 
ATOM   2565  N  N   . ASP A 1 357 ? 63.053  17.475  -40.091  1.00 26.80 ? 346  ASP A N   1 
ATOM   2566  C  CA  . ASP A 1 357 ? 63.179  17.021  -41.496  1.00 26.22 ? 346  ASP A CA  1 
ATOM   2567  C  C   . ASP A 1 357 ? 62.445  15.700  -41.822  1.00 25.49 ? 346  ASP A C   1 
ATOM   2568  O  O   . ASP A 1 357 ? 62.451  15.285  -42.968  1.00 22.90 ? 346  ASP A O   1 
ATOM   2569  C  CB  . ASP A 1 357 ? 64.660  16.862  -41.886  1.00 28.05 ? 346  ASP A CB  1 
ATOM   2570  C  CG  . ASP A 1 357 ? 65.434  18.175  -41.871  1.00 30.53 ? 346  ASP A CG  1 
ATOM   2571  O  OD1 . ASP A 1 357 ? 64.949  19.218  -42.393  1.00 35.31 ? 346  ASP A OD1 1 
ATOM   2572  O  OD2 . ASP A 1 357 ? 66.557  18.144  -41.348  1.00 33.77 ? 346  ASP A OD2 1 
ATOM   2573  N  N   . ASN A 1 358 ? 61.865  15.023  -40.826  1.00 24.46 ? 347  ASN A N   1 
ATOM   2574  C  CA  . ASN A 1 358 ? 60.938  13.890  -41.081  1.00 24.61 ? 347  ASN A CA  1 
ATOM   2575  C  C   . ASN A 1 358 ? 59.720  13.944  -40.143  1.00 24.65 ? 347  ASN A C   1 
ATOM   2576  O  O   . ASN A 1 358 ? 59.840  13.613  -38.966  1.00 25.89 ? 347  ASN A O   1 
ATOM   2577  C  CB  . ASN A 1 358 ? 61.697  12.561  -40.943  1.00 24.61 ? 347  ASN A CB  1 
ATOM   2578  C  CG  . ASN A 1 358 ? 60.874  11.338  -41.353  1.00 23.61 ? 347  ASN A CG  1 
ATOM   2579  O  OD1 . ASN A 1 358 ? 59.656  11.342  -41.269  1.00 26.30 ? 347  ASN A OD1 1 
ATOM   2580  N  ND2 . ASN A 1 358 ? 61.551  10.271  -41.759  1.00 22.69 ? 347  ASN A ND2 1 
ATOM   2581  N  N   . PHE A 1 359 ? 58.555  14.383  -40.628  1.00 23.87 ? 348  PHE A N   1 
ATOM   2582  C  CA  . PHE A 1 359 ? 57.375  14.532  -39.744  1.00 22.41 ? 348  PHE A CA  1 
ATOM   2583  C  C   . PHE A 1 359 ? 57.013  13.246  -39.030  1.00 21.35 ? 348  PHE A C   1 
ATOM   2584  O  O   . PHE A 1 359 ? 56.615  13.267  -37.873  1.00 21.78 ? 348  PHE A O   1 
ATOM   2585  C  CB  . PHE A 1 359 ? 56.143  15.079  -40.483  1.00 22.43 ? 348  PHE A CB  1 
ATOM   2586  C  CG  . PHE A 1 359 ? 55.609  14.170  -41.543  1.00 20.29 ? 348  PHE A CG  1 
ATOM   2587  C  CD1 . PHE A 1 359 ? 54.619  13.248  -41.251  1.00 21.13 ? 348  PHE A CD1 1 
ATOM   2588  C  CD2 . PHE A 1 359 ? 56.095  14.233  -42.829  1.00 21.54 ? 348  PHE A CD2 1 
ATOM   2589  C  CE1 . PHE A 1 359 ? 54.125  12.392  -42.218  1.00 21.25 ? 348  PHE A CE1 1 
ATOM   2590  C  CE2 . PHE A 1 359 ? 55.602  13.392  -43.807  1.00 22.56 ? 348  PHE A CE2 1 
ATOM   2591  C  CZ  . PHE A 1 359 ? 54.616  12.471  -43.499  1.00 22.20 ? 348  PHE A CZ  1 
ATOM   2592  N  N   . THR A 1 360 ? 57.221  12.109  -39.675  1.00 21.39 ? 349  THR A N   1 
ATOM   2593  C  CA  . THR A 1 360 ? 56.878  10.845  -39.052  1.00 21.28 ? 349  THR A CA  1 
ATOM   2594  C  C   . THR A 1 360 ? 57.761  10.577  -37.832  1.00 21.46 ? 349  THR A C   1 
ATOM   2595  O  O   . THR A 1 360 ? 57.589  9.546   -37.189  1.00 22.12 ? 349  THR A O   1 
ATOM   2596  C  CB  . THR A 1 360 ? 57.021  9.649   -40.001  1.00 21.16 ? 349  THR A CB  1 
ATOM   2597  O  OG1 . THR A 1 360 ? 58.410  9.435   -40.257  1.00 24.44 ? 349  THR A OG1 1 
ATOM   2598  C  CG2 . THR A 1 360 ? 56.267  9.843   -41.341  1.00 18.50 ? 349  THR A CG2 1 
ATOM   2599  N  N   . LEU A 1 361 ? 58.695  11.486  -37.520  1.00 20.29 ? 350  LEU A N   1 
ATOM   2600  C  CA  . LEU A 1 361 ? 59.622  11.313  -36.393  1.00 20.29 ? 350  LEU A CA  1 
ATOM   2601  C  C   . LEU A 1 361 ? 59.390  12.284  -35.265  1.00 20.50 ? 350  LEU A C   1 
ATOM   2602  O  O   . LEU A 1 361 ? 60.111  12.226  -34.268  1.00 19.66 ? 350  LEU A O   1 
ATOM   2603  C  CB  . LEU A 1 361 ? 61.096  11.481  -36.823  1.00 19.83 ? 350  LEU A CB  1 
ATOM   2604  C  CG  . LEU A 1 361 ? 61.787  10.565  -37.853  1.00 17.33 ? 350  LEU A CG  1 
ATOM   2605  C  CD1 . LEU A 1 361 ? 63.304  10.879  -37.833  1.00 14.62 ? 350  LEU A CD1 1 
ATOM   2606  C  CD2 . LEU A 1 361 ? 61.499  9.111   -37.619  1.00 14.01 ? 350  LEU A CD2 1 
ATOM   2607  N  N   . ILE A 1 362 ? 58.444  13.212  -35.437  1.00 21.19 ? 351  ILE A N   1 
ATOM   2608  C  CA  . ILE A 1 362 ? 58.072  14.151  -34.370  1.00 20.89 ? 351  ILE A CA  1 
ATOM   2609  C  C   . ILE A 1 362 ? 57.365  13.348  -33.274  1.00 21.10 ? 351  ILE A C   1 
ATOM   2610  O  O   . ILE A 1 362 ? 56.397  12.663  -33.559  1.00 24.15 ? 351  ILE A O   1 
ATOM   2611  C  CB  . ILE A 1 362 ? 57.080  15.240  -34.918  1.00 21.98 ? 351  ILE A CB  1 
ATOM   2612  C  CG1 . ILE A 1 362 ? 57.652  15.931  -36.168  1.00 21.17 ? 351  ILE A CG1 1 
ATOM   2613  C  CG2 . ILE A 1 362 ? 56.747  16.260  -33.854  1.00 20.35 ? 351  ILE A CG2 1 
ATOM   2614  C  CD1 . ILE A 1 362 ? 56.700  16.852  -36.935  1.00 19.32 ? 351  ILE A CD1 1 
ATOM   2615  N  N   . PRO A 1 363 ? 57.807  13.440  -32.009  1.00 21.32 ? 352  PRO A N   1 
ATOM   2616  C  CA  . PRO A 1 363 ? 57.061  12.688  -30.982  1.00 20.29 ? 352  PRO A CA  1 
ATOM   2617  C  C   . PRO A 1 363 ? 55.652  13.255  -30.748  1.00 20.59 ? 352  PRO A C   1 
ATOM   2618  O  O   . PRO A 1 363 ? 55.484  14.447  -30.446  1.00 22.72 ? 352  PRO A O   1 
ATOM   2619  C  CB  . PRO A 1 363 ? 57.942  12.830  -29.745  1.00 20.40 ? 352  PRO A CB  1 
ATOM   2620  C  CG  . PRO A 1 363 ? 58.653  14.089  -29.920  1.00 20.25 ? 352  PRO A CG  1 
ATOM   2621  C  CD  . PRO A 1 363 ? 58.925  14.192  -31.417  1.00 19.91 ? 352  PRO A CD  1 
ATOM   2622  N  N   . GLU A 1 364 ? 54.648  12.395  -30.866  1.00 20.84 ? 353  GLU A N   1 
ATOM   2623  C  CA  . GLU A 1 364 ? 53.248  12.826  -30.889  1.00 19.57 ? 353  GLU A CA  1 
ATOM   2624  C  C   . GLU A 1 364 ? 52.686  13.040  -29.503  1.00 18.86 ? 353  GLU A C   1 
ATOM   2625  O  O   . GLU A 1 364 ? 52.982  12.281  -28.606  1.00 17.29 ? 353  GLU A O   1 
ATOM   2626  C  CB  . GLU A 1 364 ? 52.418  11.774  -31.584  1.00 21.30 ? 353  GLU A CB  1 
ATOM   2627  C  CG  . GLU A 1 364 ? 52.874  11.449  -32.976  1.00 22.10 ? 353  GLU A CG  1 
ATOM   2628  C  CD  . GLU A 1 364 ? 52.616  9.998   -33.307  1.00 24.72 ? 353  GLU A CD  1 
ATOM   2629  O  OE1 . GLU A 1 364 ? 53.011  9.120   -32.481  1.00 30.32 ? 353  GLU A OE1 1 
ATOM   2630  O  OE2 . GLU A 1 364 ? 52.034  9.727   -34.388  1.00 28.71 ? 353  GLU A OE2 1 
ATOM   2631  N  N   . GLY A 1 365 ? 51.850  14.054  -29.364  1.00 18.00 ? 354  GLY A N   1 
ATOM   2632  C  CA  . GLY A 1 365 ? 51.249  14.419  -28.093  1.00 18.03 ? 354  GLY A CA  1 
ATOM   2633  C  C   . GLY A 1 365 ? 51.095  15.935  -27.962  1.00 17.81 ? 354  GLY A C   1 
ATOM   2634  O  O   . GLY A 1 365 ? 51.762  16.711  -28.668  1.00 19.82 ? 354  GLY A O   1 
ATOM   2635  N  N   . THR A 1 366 ? 50.233  16.359  -27.034  1.00 15.30 ? 355  THR A N   1 
ATOM   2636  C  CA  . THR A 1 366 ? 49.958  17.773  -26.851  1.00 15.24 ? 355  THR A CA  1 
ATOM   2637  C  C   . THR A 1 366 ? 49.581  18.006  -25.427  1.00 13.38 ? 355  THR A C   1 
ATOM   2638  O  O   . THR A 1 366 ? 49.544  17.072  -24.656  1.00 11.24 ? 355  THR A O   1 
ATOM   2639  C  CB  . THR A 1 366 ? 48.846  18.242  -27.790  1.00 15.32 ? 355  THR A CB  1 
ATOM   2640  O  OG1 . THR A 1 366 ? 49.016  19.631  -28.041  1.00 21.62 ? 355  THR A OG1 1 
ATOM   2641  C  CG2 . THR A 1 366 ? 47.443  17.967  -27.229  1.00 15.65 ? 355  THR A CG2 1 
ATOM   2642  N  N   . ASN A 1 367 ? 49.296  19.250  -25.086  1.00 14.01 ? 356  ASN A N   1 
ATOM   2643  C  CA  . ASN A 1 367 ? 48.813  19.564  -23.728  1.00 16.14 ? 356  ASN A CA  1 
ATOM   2644  C  C   . ASN A 1 367 ? 47.275  19.434  -23.661  1.00 15.73 ? 356  ASN A C   1 
ATOM   2645  O  O   . ASN A 1 367 ? 46.612  19.291  -24.697  1.00 14.97 ? 356  ASN A O   1 
ATOM   2646  C  CB  . ASN A 1 367 ? 49.288  20.971  -23.309  1.00 16.48 ? 356  ASN A CB  1 
ATOM   2647  C  CG  . ASN A 1 367 ? 48.844  22.051  -24.275  1.00 16.11 ? 356  ASN A CG  1 
ATOM   2648  O  OD1 . ASN A 1 367 ? 49.383  22.176  -25.362  1.00 20.03 ? 356  ASN A OD1 1 
ATOM   2649  N  ND2 . ASN A 1 367 ? 47.865  22.842  -23.871  1.00 19.17 ? 356  ASN A ND2 1 
ATOM   2650  N  N   . GLY A 1 368 ? 46.701  19.491  -22.450  1.00 17.64 ? 357  GLY A N   1 
ATOM   2651  C  CA  . GLY A 1 368 ? 45.255  19.359  -22.326  1.00 17.57 ? 357  GLY A CA  1 
ATOM   2652  C  C   . GLY A 1 368 ? 44.673  19.094  -20.973  1.00 18.73 ? 357  GLY A C   1 
ATOM   2653  O  O   . GLY A 1 368 ? 43.501  19.341  -20.772  1.00 20.42 ? 357  GLY A O   1 
ATOM   2654  N  N   . THR A 1 369 ? 45.473  18.584  -20.041  1.00 19.89 ? 358  THR A N   1 
ATOM   2655  C  CA  . THR A 1 369 ? 44.982  18.257  -18.697  1.00 19.70 ? 358  THR A CA  1 
ATOM   2656  C  C   . THR A 1 369 ? 44.659  19.491  -17.880  1.00 20.57 ? 358  THR A C   1 
ATOM   2657  O  O   . THR A 1 369 ? 43.738  19.467  -17.085  1.00 22.35 ? 358  THR A O   1 
ATOM   2658  C  CB  . THR A 1 369 ? 45.971  17.311  -17.919  1.00 19.33 ? 358  THR A CB  1 
ATOM   2659  O  OG1 . THR A 1 369 ? 45.256  16.560  -16.941  1.00 19.98 ? 358  THR A OG1 1 
ATOM   2660  C  CG2 . THR A 1 369 ? 47.115  18.092  -17.227  1.00 16.65 ? 358  THR A CG2 1 
ATOM   2661  N  N   . GLU A 1 370 ? 45.392  20.582  -18.082  1.00 21.38 ? 359  GLU A N   1 
ATOM   2662  C  CA  . GLU A 1 370 ? 45.139  21.791  -17.330  1.00 20.96 ? 359  GLU A CA  1 
ATOM   2663  C  C   . GLU A 1 370 ? 43.938  22.545  -17.863  1.00 20.17 ? 359  GLU A C   1 
ATOM   2664  O  O   . GLU A 1 370 ? 43.185  23.113  -17.097  1.00 20.08 ? 359  GLU A O   1 
ATOM   2665  C  CB  . GLU A 1 370 ? 46.369  22.727  -17.356  1.00 22.10 ? 359  GLU A CB  1 
ATOM   2666  C  CG  . GLU A 1 370 ? 46.229  23.931  -16.417  1.00 21.60 ? 359  GLU A CG  1 
ATOM   2667  C  CD  . GLU A 1 370 ? 47.530  24.691  -16.183  1.00 23.39 ? 359  GLU A CD  1 
ATOM   2668  O  OE1 . GLU A 1 370 ? 48.350  24.807  -17.115  1.00 20.03 ? 359  GLU A OE1 1 
ATOM   2669  O  OE2 . GLU A 1 370 ? 47.716  25.202  -15.045  1.00 25.88 ? 359  GLU A OE2 1 
ATOM   2670  N  N   . GLU A 1 371 ? 43.795  22.563  -19.188  1.00 19.65 ? 360  GLU A N   1 
ATOM   2671  C  CA  . GLU A 1 371 ? 42.798  23.377  -19.890  1.00 19.57 ? 360  GLU A CA  1 
ATOM   2672  C  C   . GLU A 1 371 ? 41.393  22.742  -20.008  1.00 18.41 ? 360  GLU A C   1 
ATOM   2673  O  O   . GLU A 1 371 ? 40.425  23.471  -20.150  1.00 17.37 ? 360  GLU A O   1 
ATOM   2674  C  CB  . GLU A 1 371 ? 43.297  23.698  -21.302  1.00 19.75 ? 360  GLU A CB  1 
ATOM   2675  C  CG  . GLU A 1 371 ? 44.610  24.489  -21.397  1.00 22.53 ? 360  GLU A CG  1 
ATOM   2676  C  CD  . GLU A 1 371 ? 45.886  23.637  -21.331  1.00 25.09 ? 360  GLU A CD  1 
ATOM   2677  O  OE1 . GLU A 1 371 ? 45.845  22.411  -21.577  1.00 26.23 ? 360  GLU A OE1 1 
ATOM   2678  O  OE2 . GLU A 1 371 ? 46.954  24.212  -21.025  1.00 29.05 ? 360  GLU A OE2 1 
ATOM   2679  N  N   . ARG A 1 372 ? 41.291  21.409  -19.924  1.00 18.99 ? 361  ARG A N   1 
ATOM   2680  C  CA  . ARG A 1 372 ? 40.044  20.642  -20.223  1.00 19.06 ? 361  ARG A CA  1 
ATOM   2681  C  C   . ARG A 1 372 ? 38.741  21.235  -19.709  1.00 19.65 ? 361  ARG A C   1 
ATOM   2682  O  O   . ARG A 1 372 ? 37.824  21.490  -20.472  1.00 18.67 ? 361  ARG A O   1 
ATOM   2683  C  CB  . ARG A 1 372 ? 40.141  19.195  -19.691  1.00 19.31 ? 361  ARG A CB  1 
ATOM   2684  C  CG  . ARG A 1 372 ? 38.954  18.289  -20.109  1.00 18.90 ? 361  ARG A CG  1 
ATOM   2685  C  CD  . ARG A 1 372 ? 39.202  16.848  -19.803  1.00 18.94 ? 361  ARG A CD  1 
ATOM   2686  N  NE  . ARG A 1 372 ? 39.287  16.694  -18.365  1.00 16.53 ? 361  ARG A NE  1 
ATOM   2687  C  CZ  . ARG A 1 372 ? 38.311  16.294  -17.570  1.00 21.30 ? 361  ARG A CZ  1 
ATOM   2688  N  NH1 . ARG A 1 372 ? 37.135  15.942  -18.060  1.00 24.14 ? 361  ARG A NH1 1 
ATOM   2689  N  NH2 . ARG A 1 372 ? 38.528  16.226  -16.265  1.00 19.95 ? 361  ARG A NH2 1 
ATOM   2690  N  N   . MET A 1 373 ? 38.640  21.406  -18.398  1.00 18.53 ? 362  MET A N   1 
ATOM   2691  C  CA  . MET A 1 373 ? 37.406  21.902  -17.805  1.00 20.37 ? 362  MET A CA  1 
ATOM   2692  C  C   . MET A 1 373 ? 37.039  23.334  -18.264  1.00 20.12 ? 362  MET A C   1 
ATOM   2693  O  O   . MET A 1 373 ? 35.907  23.563  -18.704  1.00 17.28 ? 362  MET A O   1 
ATOM   2694  C  CB  . MET A 1 373 ? 37.473  21.748  -16.295  1.00 18.85 ? 362  MET A CB  1 
ATOM   2695  C  CG  . MET A 1 373 ? 37.408  20.245  -15.926  1.00 20.27 ? 362  MET A CG  1 
ATOM   2696  S  SD  . MET A 1 373 ? 37.482  19.900  -14.163  1.00 26.59 ? 362  MET A SD  1 
ATOM   2697  C  CE  . MET A 1 373 ? 35.784  20.016  -13.554  1.00 20.66 ? 362  MET A CE  1 
ATOM   2698  N  N   . SER A 1 374 ? 38.013  24.255  -18.187  1.00 20.28 ? 363  SER A N   1 
ATOM   2699  C  CA  . SER A 1 374 ? 37.887  25.622  -18.697  1.00 19.51 ? 363  SER A CA  1 
ATOM   2700  C  C   . SER A 1 374 ? 37.498  25.644  -20.144  1.00 19.15 ? 363  SER A C   1 
ATOM   2701  O  O   . SER A 1 374 ? 36.629  26.418  -20.511  1.00 20.68 ? 363  SER A O   1 
ATOM   2702  C  CB  . SER A 1 374 ? 39.198  26.392  -18.556  1.00 19.94 ? 363  SER A CB  1 
ATOM   2703  O  OG  . SER A 1 374 ? 39.474  26.621  -17.178  1.00 22.78 ? 363  SER A OG  1 
ATOM   2704  N  N   . VAL A 1 375 ? 38.107  24.807  -20.968  1.00 18.27 ? 364  VAL A N   1 
ATOM   2705  C  CA  . VAL A 1 375 ? 37.734  24.778  -22.393  1.00 19.18 ? 364  VAL A CA  1 
ATOM   2706  C  C   . VAL A 1 375 ? 36.265  24.292  -22.568  1.00 19.03 ? 364  VAL A C   1 
ATOM   2707  O  O   . VAL A 1 375 ? 35.527  24.886  -23.315  1.00 18.89 ? 364  VAL A O   1 
ATOM   2708  C  CB  . VAL A 1 375 ? 38.749  23.980  -23.274  1.00 18.68 ? 364  VAL A CB  1 
ATOM   2709  C  CG1 . VAL A 1 375 ? 38.176  23.673  -24.682  1.00 18.66 ? 364  VAL A CG1 1 
ATOM   2710  C  CG2 . VAL A 1 375 ? 40.047  24.766  -23.415  1.00 19.92 ? 364  VAL A CG2 1 
ATOM   2711  N  N   . ILE A 1 376 ? 35.821  23.283  -21.828  1.00 20.42 ? 365  ILE A N   1 
ATOM   2712  C  CA  . ILE A 1 376 ? 34.445  22.781  -22.028  1.00 21.05 ? 365  ILE A CA  1 
ATOM   2713  C  C   . ILE A 1 376 ? 33.391  23.823  -21.603  1.00 22.25 ? 365  ILE A C   1 
ATOM   2714  O  O   . ILE A 1 376 ? 32.375  24.024  -22.292  1.00 22.34 ? 365  ILE A O   1 
ATOM   2715  C  CB  . ILE A 1 376 ? 34.182  21.442  -21.269  1.00 21.76 ? 365  ILE A CB  1 
ATOM   2716  C  CG1 . ILE A 1 376 ? 35.038  20.301  -21.835  1.00 21.52 ? 365  ILE A CG1 1 
ATOM   2717  C  CG2 . ILE A 1 376 ? 32.703  21.013  -21.389  1.00 19.94 ? 365  ILE A CG2 1 
ATOM   2718  C  CD1 . ILE A 1 376 ? 35.177  19.155  -20.846  1.00 18.48 ? 365  ILE A CD1 1 
ATOM   2719  N  N   . TRP A 1 377 ? 33.643  24.470  -20.461  1.00 22.59 ? 366  TRP A N   1 
ATOM   2720  C  CA  . TRP A 1 377 ? 32.777  25.510  -19.928  1.00 21.90 ? 366  TRP A CA  1 
ATOM   2721  C  C   . TRP A 1 377 ? 32.608  26.649  -20.944  1.00 22.04 ? 366  TRP A C   1 
ATOM   2722  O  O   . TRP A 1 377 ? 31.496  27.071  -21.271  1.00 21.02 ? 366  TRP A O   1 
ATOM   2723  C  CB  . TRP A 1 377 ? 33.336  26.011  -18.583  1.00 22.12 ? 366  TRP A CB  1 
ATOM   2724  C  CG  . TRP A 1 377 ? 32.416  26.979  -17.948  1.00 22.27 ? 366  TRP A CG  1 
ATOM   2725  C  CD1 . TRP A 1 377 ? 32.419  28.322  -18.116  1.00 22.01 ? 366  TRP A CD1 1 
ATOM   2726  C  CD2 . TRP A 1 377 ? 31.308  26.680  -17.085  1.00 21.58 ? 366  TRP A CD2 1 
ATOM   2727  N  NE1 . TRP A 1 377 ? 31.391  28.890  -17.406  1.00 23.16 ? 366  TRP A NE1 1 
ATOM   2728  C  CE2 . TRP A 1 377 ? 30.682  27.902  -16.778  1.00 22.77 ? 366  TRP A CE2 1 
ATOM   2729  C  CE3 . TRP A 1 377 ? 30.774  25.496  -16.553  1.00 21.83 ? 366  TRP A CE3 1 
ATOM   2730  C  CZ2 . TRP A 1 377 ? 29.562  27.982  -15.936  1.00 23.04 ? 366  TRP A CZ2 1 
ATOM   2731  C  CZ3 . TRP A 1 377 ? 29.646  25.578  -15.732  1.00 22.96 ? 366  TRP A CZ3 1 
ATOM   2732  C  CH2 . TRP A 1 377 ? 29.060  26.811  -15.434  1.00 22.05 ? 366  TRP A CH2 1 
ATOM   2733  N  N   . ASP A 1 378 ? 33.717  27.099  -21.496  1.00 22.36 ? 367  ASP A N   1 
ATOM   2734  C  CA  . ASP A 1 378 ? 33.699  28.172  -22.470  1.00 22.00 ? 367  ASP A CA  1 
ATOM   2735  C  C   . ASP A 1 378 ? 32.885  27.785  -23.731  1.00 21.11 ? 367  ASP A C   1 
ATOM   2736  O  O   . ASP A 1 378 ? 31.997  28.520  -24.142  1.00 22.13 ? 367  ASP A O   1 
ATOM   2737  C  CB  . ASP A 1 378 ? 35.162  28.571  -22.792  1.00 23.39 ? 367  ASP A CB  1 
ATOM   2738  C  CG  . ASP A 1 378 ? 35.284  29.764  -23.725  1.00 22.64 ? 367  ASP A CG  1 
ATOM   2739  O  OD1 . ASP A 1 378 ? 35.280  30.918  -23.234  1.00 24.87 ? 367  ASP A OD1 1 
ATOM   2740  O  OD2 . ASP A 1 378 ? 35.446  29.556  -24.957  1.00 28.27 ? 367  ASP A OD2 1 
ATOM   2741  N  N   . LYS A 1 379 ? 33.164  26.633  -24.325  1.00 20.45 ? 368  LYS A N   1 
ATOM   2742  C  CA  . LYS A 1 379 ? 32.612  26.307  -25.630  1.00 19.77 ? 368  LYS A CA  1 
ATOM   2743  C  C   . LYS A 1 379 ? 31.246  25.596  -25.606  1.00 18.94 ? 368  LYS A C   1 
ATOM   2744  O  O   . LYS A 1 379 ? 30.555  25.560  -26.630  1.00 16.88 ? 368  LYS A O   1 
ATOM   2745  C  CB  . LYS A 1 379 ? 33.621  25.484  -26.416  1.00 20.60 ? 368  LYS A CB  1 
ATOM   2746  C  CG  . LYS A 1 379 ? 35.028  26.145  -26.519  1.00 22.98 ? 368  LYS A CG  1 
ATOM   2747  C  CD  . LYS A 1 379 ? 35.127  27.168  -27.647  1.00 22.57 ? 368  LYS A CD  1 
ATOM   2748  C  CE  . LYS A 1 379 ? 35.367  26.477  -28.964  1.00 24.97 ? 368  LYS A CE  1 
ATOM   2749  N  NZ  . LYS A 1 379 ? 35.173  27.362  -30.149  1.00 25.50 ? 368  LYS A NZ  1 
ATOM   2750  N  N   . ALA A 1 380 ? 30.859  25.038  -24.455  1.00 17.53 ? 369  ALA A N   1 
ATOM   2751  C  CA  . ALA A 1 380 ? 29.633  24.257  -24.340  1.00 18.05 ? 369  ALA A CA  1 
ATOM   2752  C  C   . ALA A 1 380 ? 28.615  24.929  -23.437  1.00 18.54 ? 369  ALA A C   1 
ATOM   2753  O  O   . ALA A 1 380 ? 27.436  24.989  -23.755  1.00 17.84 ? 369  ALA A O   1 
ATOM   2754  C  CB  . ALA A 1 380 ? 29.953  22.885  -23.811  1.00 15.97 ? 369  ALA A CB  1 
ATOM   2755  N  N   . VAL A 1 381 ? 29.085  25.402  -22.285  1.00 18.34 ? 370  VAL A N   1 
ATOM   2756  C  CA  . VAL A 1 381 ? 28.225  26.019  -21.297  1.00 19.19 ? 370  VAL A CA  1 
ATOM   2757  C  C   . VAL A 1 381 ? 27.988  27.530  -21.538  1.00 19.79 ? 370  VAL A C   1 
ATOM   2758  O  O   . VAL A 1 381 ? 26.822  27.951  -21.595  1.00 20.41 ? 370  VAL A O   1 
ATOM   2759  C  CB  . VAL A 1 381 ? 28.763  25.724  -19.889  1.00 18.54 ? 370  VAL A CB  1 
ATOM   2760  C  CG1 . VAL A 1 381 ? 27.818  26.262  -18.818  1.00 22.89 ? 370  VAL A CG1 1 
ATOM   2761  C  CG2 . VAL A 1 381 ? 28.974  24.229  -19.712  1.00 15.53 ? 370  VAL A CG2 1 
ATOM   2762  N  N   . VAL A 1 382 ? 29.044  28.336  -21.718  1.00 19.81 ? 371  VAL A N   1 
ATOM   2763  C  CA  . VAL A 1 382 ? 28.869  29.785  -21.958  1.00 19.87 ? 371  VAL A CA  1 
ATOM   2764  C  C   . VAL A 1 382 ? 28.034  29.981  -23.227  1.00 20.30 ? 371  VAL A C   1 
ATOM   2765  O  O   . VAL A 1 382 ? 27.212  30.922  -23.315  1.00 18.80 ? 371  VAL A O   1 
ATOM   2766  C  CB  . VAL A 1 382 ? 30.232  30.604  -22.112  1.00 21.85 ? 371  VAL A CB  1 
ATOM   2767  C  CG1 . VAL A 1 382 ? 29.964  32.007  -22.582  1.00 21.45 ? 371  VAL A CG1 1 
ATOM   2768  C  CG2 . VAL A 1 382 ? 31.049  30.671  -20.833  1.00 18.68 ? 371  VAL A CG2 1 
ATOM   2769  N  N   . THR A 1 383 ? 28.245  29.077  -24.199  1.00 20.23 ? 372  THR A N   1 
ATOM   2770  C  CA  . THR A 1 383 ? 27.495  29.076  -25.462  1.00 19.24 ? 372  THR A CA  1 
ATOM   2771  C  C   . THR A 1 383 ? 26.026  28.680  -25.357  1.00 18.59 ? 372  THR A C   1 
ATOM   2772  O  O   . THR A 1 383 ? 25.287  28.864  -26.314  1.00 21.49 ? 372  THR A O   1 
ATOM   2773  C  CB  . THR A 1 383 ? 28.127  28.131  -26.509  1.00 18.40 ? 372  THR A CB  1 
ATOM   2774  O  OG1 . THR A 1 383 ? 28.334  26.864  -25.906  1.00 16.19 ? 372  THR A OG1 1 
ATOM   2775  C  CG2 . THR A 1 383 ? 29.453  28.670  -27.005  1.00 17.96 ? 372  THR A CG2 1 
ATOM   2776  N  N   . GLY A 1 384 ? 25.614  28.108  -24.241  1.00 17.19 ? 373  GLY A N   1 
ATOM   2777  C  CA  . GLY A 1 384 ? 24.250  27.634  -24.058  1.00 16.88 ? 373  GLY A CA  1 
ATOM   2778  C  C   . GLY A 1 384 ? 23.961  26.227  -24.582  1.00 15.76 ? 373  GLY A C   1 
ATOM   2779  O  O   . GLY A 1 384 ? 22.831  25.756  -24.480  1.00 14.41 ? 373  GLY A O   1 
ATOM   2780  N  N   . LYS A 1 385 ? 24.981  25.563  -25.140  1.00 14.45 ? 374  LYS A N   1 
ATOM   2781  C  CA  . LYS A 1 385 ? 24.850  24.216  -25.662  1.00 13.27 ? 374  LYS A CA  1 
ATOM   2782  C  C   . LYS A 1 385 ? 24.512  23.203  -24.575  1.00 12.59 ? 374  LYS A C   1 
ATOM   2783  O  O   . LYS A 1 385 ? 23.806  22.218  -24.831  1.00 10.35 ? 374  LYS A O   1 
ATOM   2784  C  CB  . LYS A 1 385 ? 26.134  23.835  -26.380  1.00 13.66 ? 374  LYS A CB  1 
ATOM   2785  C  CG  . LYS A 1 385 ? 26.342  24.622  -27.659  1.00 12.70 ? 374  LYS A CG  1 
ATOM   2786  C  CD  . LYS A 1 385 ? 27.507  24.095  -28.435  1.00 13.47 ? 374  LYS A CD  1 
ATOM   2787  C  CE  . LYS A 1 385 ? 27.544  24.701  -29.810  1.00 14.98 ? 374  LYS A CE  1 
ATOM   2788  N  NZ  . LYS A 1 385 ? 28.744  24.247  -30.491  1.00 17.60 ? 374  LYS A NZ  1 
ATOM   2789  N  N   . MET A 1 386 ? 24.958  23.471  -23.351  1.00 12.63 ? 375  MET A N   1 
ATOM   2790  C  CA  . MET A 1 386 ? 24.710  22.568  -22.233  1.00 13.21 ? 375  MET A CA  1 
ATOM   2791  C  C   . MET A 1 386 ? 24.661  23.367  -20.951  1.00 13.66 ? 375  MET A C   1 
ATOM   2792  O  O   . MET A 1 386 ? 25.042  24.538  -20.940  1.00 13.44 ? 375  MET A O   1 
ATOM   2793  C  CB  . MET A 1 386 ? 25.804  21.480  -22.140  1.00 14.96 ? 375  MET A CB  1 
ATOM   2794  C  CG  . MET A 1 386 ? 27.058  21.785  -21.248  1.00 12.64 ? 375  MET A CG  1 
ATOM   2795  S  SD  . MET A 1 386 ? 28.284  20.461  -21.107  1.00 13.78 ? 375  MET A SD  1 
ATOM   2796  C  CE  . MET A 1 386 ? 28.464  20.071  -22.881  1.00 9.00  ? 375  MET A CE  1 
ATOM   2797  N  N   . ASP A 1 387 ? 24.195  22.747  -19.866  1.00 15.60 ? 376  ASP A N   1 
ATOM   2798  C  CA  . ASP A 1 387 ? 24.098  23.453  -18.589  1.00 16.37 ? 376  ASP A CA  1 
ATOM   2799  C  C   . ASP A 1 387 ? 25.036  22.897  -17.542  1.00 16.76 ? 376  ASP A C   1 
ATOM   2800  O  O   . ASP A 1 387 ? 25.578  21.820  -17.692  1.00 17.12 ? 376  ASP A O   1 
ATOM   2801  C  CB  . ASP A 1 387 ? 22.634  23.549  -18.090  1.00 17.87 ? 376  ASP A CB  1 
ATOM   2802  C  CG  . ASP A 1 387 ? 22.077  22.250  -17.487  1.00 18.66 ? 376  ASP A CG  1 
ATOM   2803  O  OD1 . ASP A 1 387 ? 22.847  21.327  -17.134  1.00 20.63 ? 376  ASP A OD1 1 
ATOM   2804  O  OD2 . ASP A 1 387 ? 20.815  22.164  -17.355  1.00 21.59 ? 376  ASP A OD2 1 
ATOM   2805  N  N   . GLU A 1 388 ? 25.207  23.666  -16.476  1.00 17.53 ? 377  GLU A N   1 
ATOM   2806  C  CA  . GLU A 1 388 ? 26.158  23.336  -15.416  1.00 17.53 ? 377  GLU A CA  1 
ATOM   2807  C  C   . GLU A 1 388 ? 26.034  21.900  -14.914  1.00 16.79 ? 377  GLU A C   1 
ATOM   2808  O  O   . GLU A 1 388 ? 27.021  21.286  -14.527  1.00 20.60 ? 377  GLU A O   1 
ATOM   2809  C  CB  . GLU A 1 388 ? 26.041  24.348  -14.268  1.00 18.02 ? 377  GLU A CB  1 
ATOM   2810  C  CG  . GLU A 1 388 ? 24.641  24.569  -13.677  1.00 19.03 ? 377  GLU A CG  1 
ATOM   2811  C  CD  . GLU A 1 388 ? 24.690  25.193  -12.270  1.00 18.91 ? 377  GLU A CD  1 
ATOM   2812  O  OE1 . GLU A 1 388 ? 25.499  26.110  -12.042  1.00 22.83 ? 377  GLU A OE1 1 
ATOM   2813  O  OE2 . GLU A 1 388 ? 23.931  24.768  -11.395  1.00 20.74 ? 377  GLU A OE2 1 
ATOM   2814  N  N   . ASN A 1 389 ? 24.844  21.336  -14.964  1.00 15.35 ? 378  ASN A N   1 
ATOM   2815  C  CA  . ASN A 1 389 ? 24.652  19.960  -14.526  1.00 15.35 ? 378  ASN A CA  1 
ATOM   2816  C  C   . ASN A 1 389 ? 25.208  18.976  -15.527  1.00 14.20 ? 378  ASN A C   1 
ATOM   2817  O  O   . ASN A 1 389 ? 25.800  17.981  -15.149  1.00 10.86 ? 378  ASN A O   1 
ATOM   2818  C  CB  . ASN A 1 389 ? 23.181  19.699  -14.189  1.00 15.70 ? 378  ASN A CB  1 
ATOM   2819  C  CG  . ASN A 1 389 ? 22.683  20.606  -13.101  1.00 15.73 ? 378  ASN A CG  1 
ATOM   2820  O  OD1 . ASN A 1 389 ? 22.266  21.732  -13.372  1.00 20.46 ? 378  ASN A OD1 1 
ATOM   2821  N  ND2 . ASN A 1 389 ? 22.747  20.144  -11.847  1.00 12.82 ? 378  ASN A ND2 1 
ATOM   2822  N  N   . GLN A 1 390 ? 25.091  19.283  -16.824  1.00 13.99 ? 379  GLN A N   1 
ATOM   2823  C  CA  . GLN A 1 390 ? 25.639  18.385  -17.807  1.00 14.35 ? 379  GLN A CA  1 
ATOM   2824  C  C   . GLN A 1 390 ? 27.147  18.470  -17.866  1.00 14.74 ? 379  GLN A C   1 
ATOM   2825  O  O   . GLN A 1 390 ? 27.809  17.462  -18.149  1.00 10.91 ? 379  GLN A O   1 
ATOM   2826  C  CB  . GLN A 1 390 ? 25.043  18.660  -19.184  1.00 15.84 ? 379  GLN A CB  1 
ATOM   2827  C  CG  . GLN A 1 390 ? 23.813  17.795  -19.455  1.00 21.32 ? 379  GLN A CG  1 
ATOM   2828  C  CD  . GLN A 1 390 ? 24.024  16.337  -19.033  1.00 23.46 ? 379  GLN A CD  1 
ATOM   2829  O  OE1 . GLN A 1 390 ? 23.420  15.860  -18.044  1.00 25.61 ? 379  GLN A OE1 1 
ATOM   2830  N  NE2 . GLN A 1 390 ? 24.927  15.642  -19.745  1.00 20.29 ? 379  GLN A NE2 1 
ATOM   2831  N  N   . PHE A 1 391 ? 27.667  19.685  -17.616  1.00 15.13 ? 380  PHE A N   1 
ATOM   2832  C  CA  . PHE A 1 391 ? 29.084  19.945  -17.520  1.00 14.30 ? 380  PHE A CA  1 
ATOM   2833  C  C   . PHE A 1 391 ? 29.676  19.004  -16.503  1.00 15.28 ? 380  PHE A C   1 
ATOM   2834  O  O   . PHE A 1 391 ? 30.729  18.414  -16.723  1.00 15.99 ? 380  PHE A O   1 
ATOM   2835  C  CB  . PHE A 1 391 ? 29.325  21.399  -17.098  1.00 13.14 ? 380  PHE A CB  1 
ATOM   2836  C  CG  . PHE A 1 391 ? 30.762  21.733  -16.878  1.00 12.83 ? 380  PHE A CG  1 
ATOM   2837  C  CD1 . PHE A 1 391 ? 31.584  21.964  -17.933  1.00 3.72  ? 380  PHE A CD1 1 
ATOM   2838  C  CD2 . PHE A 1 391 ? 31.292  21.816  -15.597  1.00 6.09  ? 380  PHE A CD2 1 
ATOM   2839  C  CE1 . PHE A 1 391 ? 32.893  22.254  -17.770  1.00 8.95  ? 380  PHE A CE1 1 
ATOM   2840  C  CE2 . PHE A 1 391 ? 32.629  22.119  -15.409  1.00 11.22 ? 380  PHE A CE2 1 
ATOM   2841  C  CZ  . PHE A 1 391 ? 33.441  22.336  -16.488  1.00 10.92 ? 380  PHE A CZ  1 
ATOM   2842  N  N   . VAL A 1 392 ? 28.987  18.860  -15.375  1.00 15.21 ? 381  VAL A N   1 
ATOM   2843  C  CA  . VAL A 1 392 ? 29.391  17.869  -14.387  1.00 14.75 ? 381  VAL A CA  1 
ATOM   2844  C  C   . VAL A 1 392 ? 29.426  16.433  -14.934  1.00 16.23 ? 381  VAL A C   1 
ATOM   2845  O  O   . VAL A 1 392 ? 30.309  15.653  -14.572  1.00 16.28 ? 381  VAL A O   1 
ATOM   2846  C  CB  . VAL A 1 392 ? 28.516  17.978  -13.132  1.00 13.75 ? 381  VAL A CB  1 
ATOM   2847  C  CG1 . VAL A 1 392 ? 28.871  16.918  -12.129  1.00 8.89  ? 381  VAL A CG1 1 
ATOM   2848  C  CG2 . VAL A 1 392 ? 28.690  19.327  -12.572  1.00 8.63  ? 381  VAL A CG2 1 
ATOM   2849  N  N   . ALA A 1 393 ? 28.531  16.111  -15.873  1.00 17.56 ? 382  ALA A N   1 
ATOM   2850  C  CA  . ALA A 1 393 ? 28.447  14.734  -16.395  1.00 16.14 ? 382  ALA A CA  1 
ATOM   2851  C  C   . ALA A 1 393 ? 29.599  14.423  -17.363  1.00 16.03 ? 382  ALA A C   1 
ATOM   2852  O  O   . ALA A 1 393 ? 30.122  13.295  -17.400  1.00 15.00 ? 382  ALA A O   1 
ATOM   2853  C  CB  . ALA A 1 393 ? 27.090  14.495  -17.058  1.00 16.72 ? 382  ALA A CB  1 
ATOM   2854  N  N   . VAL A 1 394 ? 29.985  15.428  -18.145  1.00 16.40 ? 383  VAL A N   1 
ATOM   2855  C  CA  . VAL A 1 394 ? 30.990  15.240  -19.189  1.00 15.63 ? 383  VAL A CA  1 
ATOM   2856  C  C   . VAL A 1 394 ? 32.402  15.579  -18.661  1.00 15.79 ? 383  VAL A C   1 
ATOM   2857  O  O   . VAL A 1 394 ? 33.379  15.383  -19.374  1.00 16.63 ? 383  VAL A O   1 
ATOM   2858  C  CB  . VAL A 1 394 ? 30.614  15.976  -20.536  1.00 15.72 ? 383  VAL A CB  1 
ATOM   2859  C  CG1 . VAL A 1 394 ? 29.152  15.657  -20.934  1.00 10.03 ? 383  VAL A CG1 1 
ATOM   2860  C  CG2 . VAL A 1 394 ? 30.892  17.493  -20.492  1.00 15.19 ? 383  VAL A CG2 1 
ATOM   2861  N  N   . THR A 1 395 ? 32.498  15.996  -17.385  1.00 15.35 ? 384  THR A N   1 
ATOM   2862  C  CA  . THR A 1 395 ? 33.781  16.282  -16.748  1.00 15.35 ? 384  THR A CA  1 
ATOM   2863  C  C   . THR A 1 395 ? 34.122  15.269  -15.655  1.00 15.19 ? 384  THR A C   1 
ATOM   2864  O  O   . THR A 1 395 ? 35.315  14.980  -15.465  1.00 13.54 ? 384  THR A O   1 
ATOM   2865  C  CB  . THR A 1 395 ? 33.935  17.741  -16.186  1.00 15.65 ? 384  THR A CB  1 
ATOM   2866  O  OG1 . THR A 1 395 ? 33.067  17.971  -15.050  1.00 17.56 ? 384  THR A OG1 1 
ATOM   2867  C  CG2 . THR A 1 395 ? 33.738  18.796  -17.259  1.00 14.97 ? 384  THR A CG2 1 
ATOM   2868  N  N   . SER A 1 396 ? 33.112  14.724  -14.955  1.00 14.72 ? 385  SER A N   1 
ATOM   2869  C  CA  . SER A 1 396 ? 33.357  13.628  -14.007  1.00 16.40 ? 385  SER A CA  1 
ATOM   2870  C  C   . SER A 1 396 ? 32.348  12.469  -13.994  1.00 16.73 ? 385  SER A C   1 
ATOM   2871  O  O   . SER A 1 396 ? 32.757  11.324  -14.083  1.00 16.67 ? 385  SER A O   1 
ATOM   2872  C  CB  . SER A 1 396 ? 33.499  14.180  -12.583  1.00 16.96 ? 385  SER A CB  1 
ATOM   2873  O  OG  . SER A 1 396 ? 32.369  14.918  -12.238  1.00 16.36 ? 385  SER A OG  1 
ATOM   2874  N  N   . THR A 1 397 ? 31.048  12.728  -13.831  1.00 17.69 ? 386  THR A N   1 
ATOM   2875  C  CA  . THR A 1 397 ? 30.130  11.652  -13.447  1.00 18.68 ? 386  THR A CA  1 
ATOM   2876  C  C   . THR A 1 397 ? 30.053  10.495  -14.423  1.00 20.16 ? 386  THR A C   1 
ATOM   2877  O  O   . THR A 1 397 ? 30.124  9.333   -14.007  1.00 22.16 ? 386  THR A O   1 
ATOM   2878  C  CB  . THR A 1 397 ? 28.696  12.136  -13.182  1.00 19.68 ? 386  THR A CB  1 
ATOM   2879  O  OG1 . THR A 1 397 ? 28.715  13.437  -12.582  1.00 22.20 ? 386  THR A OG1 1 
ATOM   2880  C  CG2 . THR A 1 397 ? 27.984  11.144  -12.244  1.00 17.66 ? 386  THR A CG2 1 
ATOM   2881  N  N   . ASN A 1 398 ? 29.933  10.784  -15.710  1.00 19.72 ? 387  ASN A N   1 
ATOM   2882  C  CA  . ASN A 1 398 ? 29.834  9.713   -16.686  1.00 19.45 ? 387  ASN A CA  1 
ATOM   2883  C  C   . ASN A 1 398 ? 31.088  8.840   -16.727  1.00 19.53 ? 387  ASN A C   1 
ATOM   2884  O  O   . ASN A 1 398 ? 30.970  7.610   -16.807  1.00 19.67 ? 387  ASN A O   1 
ATOM   2885  C  CB  . ASN A 1 398 ? 29.515  10.251  -18.079  1.00 20.53 ? 387  ASN A CB  1 
ATOM   2886  C  CG  . ASN A 1 398 ? 28.107  10.831  -18.185  1.00 21.38 ? 387  ASN A CG  1 
ATOM   2887  O  OD1 . ASN A 1 398 ? 27.268  10.663  -17.286  1.00 26.54 ? 387  ASN A OD1 1 
ATOM   2888  N  ND2 . ASN A 1 398 ? 27.850  11.526  -19.262  1.00 20.90 ? 387  ASN A ND2 1 
ATOM   2889  N  N   . ALA A 1 399 ? 32.272  9.463   -16.646  1.00 18.60 ? 388  ALA A N   1 
ATOM   2890  C  CA  . ALA A 1 399 ? 33.529  8.730   -16.622  1.00 17.09 ? 388  ALA A CA  1 
ATOM   2891  C  C   . ALA A 1 399 ? 33.477  7.867   -15.409  1.00 17.18 ? 388  ALA A C   1 
ATOM   2892  O  O   . ALA A 1 399 ? 33.886  6.710   -15.443  1.00 15.96 ? 388  ALA A O   1 
ATOM   2893  C  CB  . ALA A 1 399 ? 34.730  9.661   -16.554  1.00 17.10 ? 388  ALA A CB  1 
ATOM   2894  N  N   . ALA A 1 400 ? 32.931  8.426   -14.332  1.00 15.81 ? 389  ALA A N   1 
ATOM   2895  C  CA  . ALA A 1 400 ? 32.784  7.667   -13.083  1.00 15.77 ? 389  ALA A CA  1 
ATOM   2896  C  C   . ALA A 1 400 ? 31.941  6.407   -13.355  1.00 15.86 ? 389  ALA A C   1 
ATOM   2897  O  O   . ALA A 1 400 ? 32.325  5.277   -13.042  1.00 15.25 ? 389  ALA A O   1 
ATOM   2898  C  CB  . ALA A 1 400 ? 32.147  8.533   -12.083  1.00 12.14 ? 389  ALA A CB  1 
ATOM   2899  N  N   . LYS A 1 401 ? 30.790  6.609   -13.989  1.00 17.14 ? 390  LYS A N   1 
ATOM   2900  C  CA  . LYS A 1 401 ? 29.883  5.509   -14.252  1.00 17.28 ? 390  LYS A CA  1 
ATOM   2901  C  C   . LYS A 1 401 ? 30.498  4.520   -15.260  1.00 17.74 ? 390  LYS A C   1 
ATOM   2902  O  O   . LYS A 1 401 ? 30.365  3.300   -15.110  1.00 18.81 ? 390  LYS A O   1 
ATOM   2903  C  CB  . LYS A 1 401 ? 28.521  6.060   -14.711  1.00 16.76 ? 390  LYS A CB  1 
ATOM   2904  C  CG  . LYS A 1 401 ? 27.793  6.840   -13.597  1.00 16.06 ? 390  LYS A CG  1 
ATOM   2905  C  CD  . LYS A 1 401 ? 26.525  7.527   -14.061  1.00 16.39 ? 390  LYS A CD  1 
ATOM   2906  C  CE  . LYS A 1 401 ? 25.997  8.457   -13.013  1.00 18.17 ? 390  LYS A CE  1 
ATOM   2907  N  NZ  . LYS A 1 401 ? 24.760  9.248   -13.336  1.00 15.29 ? 390  LYS A NZ  1 
ATOM   2908  N  N   . VAL A 1 402 ? 31.185  5.034   -16.269  1.00 17.64 ? 391  VAL A N   1 
ATOM   2909  C  CA  . VAL A 1 402 ? 31.805  4.140   -17.261  1.00 17.77 ? 391  VAL A CA  1 
ATOM   2910  C  C   . VAL A 1 402 ? 32.866  3.175   -16.689  1.00 18.95 ? 391  VAL A C   1 
ATOM   2911  O  O   . VAL A 1 402 ? 32.941  2.015   -17.111  1.00 18.98 ? 391  VAL A O   1 
ATOM   2912  C  CB  . VAL A 1 402 ? 32.382  4.942   -18.477  1.00 18.71 ? 391  VAL A CB  1 
ATOM   2913  C  CG1 . VAL A 1 402 ? 33.215  4.072   -19.366  1.00 15.99 ? 391  VAL A CG1 1 
ATOM   2914  C  CG2 . VAL A 1 402 ? 31.275  5.518   -19.269  1.00 11.12 ? 391  VAL A CG2 1 
ATOM   2915  N  N   . PHE A 1 403 ? 33.648  3.650   -15.713  1.00 19.46 ? 392  PHE A N   1 
ATOM   2916  C  CA  . PHE A 1 403 ? 34.783  2.892   -15.154  1.00 18.59 ? 392  PHE A CA  1 
ATOM   2917  C  C   . PHE A 1 403 ? 34.583  2.401   -13.715  1.00 19.26 ? 392  PHE A C   1 
ATOM   2918  O  O   . PHE A 1 403 ? 35.528  1.938   -13.069  1.00 19.47 ? 392  PHE A O   1 
ATOM   2919  C  CB  . PHE A 1 403 ? 36.059  3.721   -15.254  1.00 16.55 ? 392  PHE A CB  1 
ATOM   2920  C  CG  . PHE A 1 403 ? 36.422  4.053   -16.671  1.00 14.75 ? 392  PHE A CG  1 
ATOM   2921  C  CD1 . PHE A 1 403 ? 36.862  3.059   -17.533  1.00 12.88 ? 392  PHE A CD1 1 
ATOM   2922  C  CD2 . PHE A 1 403 ? 36.285  5.339   -17.142  1.00 12.51 ? 392  PHE A CD2 1 
ATOM   2923  C  CE1 . PHE A 1 403 ? 37.163  3.353   -18.854  1.00 13.05 ? 392  PHE A CE1 1 
ATOM   2924  C  CE2 . PHE A 1 403 ? 36.593  5.636   -18.466  1.00 10.82 ? 392  PHE A CE2 1 
ATOM   2925  C  CZ  . PHE A 1 403 ? 37.032  4.648   -19.301  1.00 13.46 ? 392  PHE A CZ  1 
ATOM   2926  N  N   . ASN A 1 404 ? 33.346  2.465   -13.242  1.00 20.82 ? 393  ASN A N   1 
ATOM   2927  C  CA  . ASN A 1 404 ? 32.972  1.866   -11.959  1.00 20.59 ? 393  ASN A CA  1 
ATOM   2928  C  C   . ASN A 1 404 ? 33.567  2.588   -10.762  1.00 20.21 ? 393  ASN A C   1 
ATOM   2929  O  O   . ASN A 1 404 ? 33.993  1.959   -9.799   1.00 21.94 ? 393  ASN A O   1 
ATOM   2930  C  CB  . ASN A 1 404 ? 33.335  0.361   -11.949  1.00 21.47 ? 393  ASN A CB  1 
ATOM   2931  C  CG  . ASN A 1 404 ? 32.255  -0.509  -11.322  1.00 22.08 ? 393  ASN A CG  1 
ATOM   2932  O  OD1 . ASN A 1 404 ? 31.323  -0.009  -10.702  1.00 23.15 ? 393  ASN A OD1 1 
ATOM   2933  N  ND2 . ASN A 1 404 ? 32.393  -1.826  -11.469  1.00 21.91 ? 393  ASN A ND2 1 
ATOM   2934  N  N   . LEU A 1 405 ? 33.546  3.918   -10.800  1.00 19.74 ? 394  LEU A N   1 
ATOM   2935  C  CA  . LEU A 1 405 ? 33.987  4.740   -9.645   1.00 18.26 ? 394  LEU A CA  1 
ATOM   2936  C  C   . LEU A 1 405 ? 32.906  5.715   -9.156   1.00 16.74 ? 394  LEU A C   1 
ATOM   2937  O  O   . LEU A 1 405 ? 33.212  6.713   -8.516   1.00 15.69 ? 394  LEU A O   1 
ATOM   2938  C  CB  . LEU A 1 405 ? 35.236  5.530   -10.016  1.00 18.48 ? 394  LEU A CB  1 
ATOM   2939  C  CG  . LEU A 1 405 ? 36.447  4.745   -10.506  1.00 18.07 ? 394  LEU A CG  1 
ATOM   2940  C  CD1 . LEU A 1 405 ? 37.233  5.624   -11.398  1.00 16.40 ? 394  LEU A CD1 1 
ATOM   2941  C  CD2 . LEU A 1 405 ? 37.257  4.266   -9.327   1.00 19.20 ? 394  LEU A CD2 1 
ATOM   2942  N  N   . TYR A 1 406 ? 31.647  5.396   -9.460   1.00 16.56 ? 395  TYR A N   1 
ATOM   2943  C  CA  . TYR A 1 406 ? 30.479  6.171   -9.037   1.00 17.72 ? 395  TYR A CA  1 
ATOM   2944  C  C   . TYR A 1 406 ? 29.750  5.373   -7.976   1.00 18.72 ? 395  TYR A C   1 
ATOM   2945  O  O   . TYR A 1 406 ? 29.532  4.157   -8.152   1.00 19.27 ? 395  TYR A O   1 
ATOM   2946  C  CB  . TYR A 1 406 ? 29.514  6.403   -10.211  1.00 16.88 ? 395  TYR A CB  1 
ATOM   2947  C  CG  . TYR A 1 406 ? 28.238  7.159   -9.893   1.00 15.54 ? 395  TYR A CG  1 
ATOM   2948  C  CD1 . TYR A 1 406 ? 28.241  8.541   -9.777   1.00 16.37 ? 395  TYR A CD1 1 
ATOM   2949  C  CD2 . TYR A 1 406 ? 27.029  6.494   -9.725   1.00 16.58 ? 395  TYR A CD2 1 
ATOM   2950  C  CE1 . TYR A 1 406 ? 27.081  9.237   -9.520   1.00 14.57 ? 395  TYR A CE1 1 
ATOM   2951  C  CE2 . TYR A 1 406 ? 25.853  7.190   -9.439   1.00 14.04 ? 395  TYR A CE2 1 
ATOM   2952  C  CZ  . TYR A 1 406 ? 25.887  8.564   -9.341   1.00 12.68 ? 395  TYR A CZ  1 
ATOM   2953  O  OH  . TYR A 1 406 ? 24.724  9.278   -9.083   1.00 13.14 ? 395  TYR A OH  1 
ATOM   2954  N  N   . PRO A 1 407 ? 29.341  6.039   -6.888   1.00 19.08 ? 396  PRO A N   1 
ATOM   2955  C  CA  . PRO A 1 407 ? 29.410  7.470   -6.585   1.00 19.88 ? 396  PRO A CA  1 
ATOM   2956  C  C   . PRO A 1 407 ? 30.655  7.980   -5.877   1.00 19.84 ? 396  PRO A C   1 
ATOM   2957  O  O   . PRO A 1 407 ? 30.700  9.154   -5.537   1.00 20.15 ? 396  PRO A O   1 
ATOM   2958  C  CB  . PRO A 1 407 ? 28.190  7.685   -5.698   1.00 19.19 ? 396  PRO A CB  1 
ATOM   2959  C  CG  . PRO A 1 407 ? 27.580  6.312   -5.512   1.00 18.01 ? 396  PRO A CG  1 
ATOM   2960  C  CD  . PRO A 1 407 ? 28.616  5.336   -5.827   1.00 19.23 ? 396  PRO A CD  1 
ATOM   2961  N  N   . ARG A 1 408 ? 31.655  7.122   -5.711   1.00 21.78 ? 397  ARG A N   1 
ATOM   2962  C  CA  . ARG A 1 408 ? 32.908  7.474   -5.054   1.00 22.42 ? 397  ARG A CA  1 
ATOM   2963  C  C   . ARG A 1 408 ? 33.455  8.760   -5.628   1.00 22.77 ? 397  ARG A C   1 
ATOM   2964  O  O   . ARG A 1 408 ? 33.745  9.737   -4.889   1.00 22.70 ? 397  ARG A O   1 
ATOM   2965  C  CB  . ARG A 1 408 ? 33.897  6.324   -5.211   1.00 22.49 ? 397  ARG A CB  1 
ATOM   2966  C  CG  . ARG A 1 408 ? 35.310  6.630   -4.770   1.00 24.31 ? 397  ARG A CG  1 
ATOM   2967  C  CD  . ARG A 1 408 ? 36.205  5.404   -4.717   1.00 26.12 ? 397  ARG A CD  1 
ATOM   2968  N  NE  . ARG A 1 408 ? 37.403  5.757   -3.970   1.00 27.90 ? 397  ARG A NE  1 
ATOM   2969  C  CZ  . ARG A 1 408 ? 38.241  4.897   -3.382   1.00 31.49 ? 397  ARG A CZ  1 
ATOM   2970  N  NH1 . ARG A 1 408 ? 38.083  3.578   -3.453   1.00 31.52 ? 397  ARG A NH1 1 
ATOM   2971  N  NH2 . ARG A 1 408 ? 39.281  5.382   -2.726   1.00 32.85 ? 397  ARG A NH2 1 
ATOM   2972  N  N   . LYS A 1 409 ? 33.567  8.765   -6.957   1.00 23.57 ? 398  LYS A N   1 
ATOM   2973  C  CA  . LYS A 1 409 ? 33.947  9.945   -7.713   1.00 22.49 ? 398  LYS A CA  1 
ATOM   2974  C  C   . LYS A 1 409 ? 32.722  10.571  -8.381   1.00 22.35 ? 398  LYS A C   1 
ATOM   2975  O  O   . LYS A 1 409 ? 31.622  10.019  -8.348   1.00 23.29 ? 398  LYS A O   1 
ATOM   2976  C  CB  . LYS A 1 409 ? 35.046  9.591   -8.732   1.00 21.78 ? 398  LYS A CB  1 
ATOM   2977  C  CG  . LYS A 1 409 ? 36.306  8.938   -8.133   1.00 21.87 ? 398  LYS A CG  1 
ATOM   2978  C  CD  . LYS A 1 409 ? 37.016  9.872   -7.122   1.00 22.25 ? 398  LYS A CD  1 
ATOM   2979  C  CE  . LYS A 1 409 ? 38.416  9.362   -6.744   1.00 19.54 ? 398  LYS A CE  1 
ATOM   2980  N  NZ  . LYS A 1 409 ? 38.844  9.873   -5.385   1.00 24.72 ? 398  LYS A NZ  1 
ATOM   2981  N  N   . GLY A 1 410 ? 32.918  11.759  -8.934   1.00 23.20 ? 399  GLY A N   1 
ATOM   2982  C  CA  . GLY A 1 410 ? 31.923  12.434  -9.763   1.00 22.71 ? 399  GLY A CA  1 
ATOM   2983  C  C   . GLY A 1 410 ? 30.596  12.772  -9.114   1.00 23.10 ? 399  GLY A C   1 
ATOM   2984  O  O   . GLY A 1 410 ? 29.599  12.949  -9.803   1.00 25.28 ? 399  GLY A O   1 
ATOM   2985  N  N   . ARG A 1 411 ? 30.556  12.886  -7.790   1.00 23.03 ? 400  ARG A N   1 
ATOM   2986  C  CA  . ARG A 1 411 ? 29.318  13.241  -7.120   1.00 22.55 ? 400  ARG A CA  1 
ATOM   2987  C  C   . ARG A 1 411 ? 29.585  13.724  -5.714   1.00 21.88 ? 400  ARG A C   1 
ATOM   2988  O  O   . ARG A 1 411 ? 30.379  13.114  -4.997   1.00 17.62 ? 400  ARG A O   1 
ATOM   2989  C  CB  . ARG A 1 411 ? 28.370  12.045  -7.049   1.00 23.37 ? 400  ARG A CB  1 
ATOM   2990  C  CG  . ARG A 1 411 ? 27.034  12.387  -6.432   1.00 23.69 ? 400  ARG A CG  1 
ATOM   2991  C  CD  . ARG A 1 411 ? 26.061  11.283  -6.634   1.00 23.41 ? 400  ARG A CD  1 
ATOM   2992  N  NE  . ARG A 1 411 ? 24.705  11.655  -6.235   1.00 24.20 ? 400  ARG A NE  1 
ATOM   2993  C  CZ  . ARG A 1 411 ? 23.795  12.229  -7.013   1.00 23.29 ? 400  ARG A CZ  1 
ATOM   2994  N  NH1 . ARG A 1 411 ? 24.053  12.536  -8.281   1.00 23.61 ? 400  ARG A NH1 1 
ATOM   2995  N  NH2 . ARG A 1 411 ? 22.598  12.475  -6.509   1.00 23.60 ? 400  ARG A NH2 1 
ATOM   2996  N  N   . ILE A 1 412 ? 28.921  14.824  -5.364   1.00 22.23 ? 401  ILE A N   1 
ATOM   2997  C  CA  . ILE A 1 412 ? 28.919  15.350  -4.019   1.00 22.78 ? 401  ILE A CA  1 
ATOM   2998  C  C   . ILE A 1 412 ? 27.771  14.675  -3.293   1.00 24.59 ? 401  ILE A C   1 
ATOM   2999  O  O   . ILE A 1 412 ? 26.609  15.016  -3.480   1.00 26.54 ? 401  ILE A O   1 
ATOM   3000  C  CB  . ILE A 1 412 ? 28.710  16.871  -3.966   1.00 21.84 ? 401  ILE A CB  1 
ATOM   3001  C  CG1 . ILE A 1 412 ? 29.857  17.611  -4.618   1.00 19.35 ? 401  ILE A CG1 1 
ATOM   3002  C  CG2 . ILE A 1 412 ? 28.637  17.311  -2.512   1.00 21.65 ? 401  ILE A CG2 1 
ATOM   3003  C  CD1 . ILE A 1 412 ? 29.718  19.098  -4.536   1.00 19.48 ? 401  ILE A CD1 1 
ATOM   3004  N  N   . ALA A 1 413 ? 28.107  13.695  -2.478   1.00 26.19 ? 402  ALA A N   1 
ATOM   3005  C  CA  . ALA A 1 413 ? 27.130  12.930  -1.727   1.00 26.48 ? 402  ALA A CA  1 
ATOM   3006  C  C   . ALA A 1 413 ? 27.835  12.485  -0.461   1.00 27.18 ? 402  ALA A C   1 
ATOM   3007  O  O   . ALA A 1 413 ? 29.004  12.115  -0.510   1.00 29.50 ? 402  ALA A O   1 
ATOM   3008  C  CB  . ALA A 1 413 ? 26.676  11.722  -2.532   1.00 25.86 ? 402  ALA A CB  1 
ATOM   3009  N  N   . VAL A 1 414 ? 27.160  12.531  0.672    1.00 27.66 ? 403  VAL A N   1 
ATOM   3010  C  CA  . VAL A 1 414 ? 27.726  11.934  1.879    1.00 27.89 ? 403  VAL A CA  1 
ATOM   3011  C  C   . VAL A 1 414 ? 28.291  10.528  1.576    1.00 29.35 ? 403  VAL A C   1 
ATOM   3012  O  O   . VAL A 1 414 ? 27.651  9.717   0.899    1.00 30.06 ? 403  VAL A O   1 
ATOM   3013  C  CB  . VAL A 1 414 ? 26.687  11.877  3.003    1.00 27.92 ? 403  VAL A CB  1 
ATOM   3014  C  CG1 . VAL A 1 414 ? 27.086  10.852  4.055    1.00 27.88 ? 403  VAL A CG1 1 
ATOM   3015  C  CG2 . VAL A 1 414 ? 26.517  13.248  3.604    1.00 24.14 ? 403  VAL A CG2 1 
ATOM   3016  N  N   . GLY A 1 415 ? 29.517  10.264  2.030    1.00 29.80 ? 404  GLY A N   1 
ATOM   3017  C  CA  . GLY A 1 415 ? 30.170  8.972   1.779    1.00 29.47 ? 404  GLY A CA  1 
ATOM   3018  C  C   . GLY A 1 415 ? 31.017  8.936   0.512    1.00 29.65 ? 404  GLY A C   1 
ATOM   3019  O  O   . GLY A 1 415 ? 31.765  7.969   0.267    1.00 29.47 ? 404  GLY A O   1 
ATOM   3020  N  N   . SER A 1 416 ? 30.906  9.992   -0.290   1.00 29.33 ? 405  SER A N   1 
ATOM   3021  C  CA  . SER A 1 416 ? 31.721  10.134  -1.480   1.00 28.50 ? 405  SER A CA  1 
ATOM   3022  C  C   . SER A 1 416 ? 33.060  10.667  -1.040   1.00 28.32 ? 405  SER A C   1 
ATOM   3023  O  O   . SER A 1 416 ? 33.232  11.078  0.119    1.00 28.30 ? 405  SER A O   1 
ATOM   3024  C  CB  . SER A 1 416 ? 31.067  11.061  -2.502   1.00 28.92 ? 405  SER A CB  1 
ATOM   3025  O  OG  . SER A 1 416 ? 30.040  10.371  -3.194   1.00 31.78 ? 405  SER A OG  1 
ATOM   3026  N  N   . ASP A 1 417 ? 34.032  10.598  -1.938   1.00 26.60 ? 406  ASP A N   1 
ATOM   3027  C  CA  . ASP A 1 417 ? 35.357  11.100  -1.629   1.00 25.96 ? 406  ASP A CA  1 
ATOM   3028  C  C   . ASP A 1 417 ? 35.370  12.622  -1.703   1.00 25.29 ? 406  ASP A C   1 
ATOM   3029  O  O   . ASP A 1 417 ? 34.613  13.225  -2.454   1.00 24.11 ? 406  ASP A O   1 
ATOM   3030  C  CB  . ASP A 1 417 ? 36.384  10.468  -2.556   1.00 26.73 ? 406  ASP A CB  1 
ATOM   3031  C  CG  . ASP A 1 417 ? 36.636  9.029   -2.211   1.00 26.99 ? 406  ASP A CG  1 
ATOM   3032  O  OD1 . ASP A 1 417 ? 35.923  8.478   -1.342   1.00 26.56 ? 406  ASP A OD1 1 
ATOM   3033  O  OD2 . ASP A 1 417 ? 37.557  8.438   -2.787   1.00 30.28 ? 406  ASP A OD2 1 
ATOM   3034  N  N   . ALA A 1 418 ? 36.226  13.234  -0.894   1.00 23.63 ? 407  ALA A N   1 
ATOM   3035  C  CA  . ALA A 1 418 ? 36.313  14.672  -0.761   1.00 22.55 ? 407  ALA A CA  1 
ATOM   3036  C  C   . ALA A 1 418 ? 37.126  15.239  -1.909   1.00 23.23 ? 407  ALA A C   1 
ATOM   3037  O  O   . ALA A 1 418 ? 38.199  15.772  -1.690   1.00 23.63 ? 407  ALA A O   1 
ATOM   3038  C  CB  . ALA A 1 418 ? 36.960  15.009  0.570    1.00 22.20 ? 407  ALA A CB  1 
ATOM   3039  N  N   . ASP A 1 419 ? 36.630  15.084  -3.139   1.00 22.80 ? 408  ASP A N   1 
ATOM   3040  C  CA  . ASP A 1 419 ? 37.241  15.702  -4.326   1.00 23.63 ? 408  ASP A CA  1 
ATOM   3041  C  C   . ASP A 1 419 ? 36.272  16.744  -4.937   1.00 24.30 ? 408  ASP A C   1 
ATOM   3042  O  O   . ASP A 1 419 ? 35.363  16.395  -5.712   1.00 24.79 ? 408  ASP A O   1 
ATOM   3043  C  CB  . ASP A 1 419 ? 37.568  14.682  -5.424   1.00 24.44 ? 408  ASP A CB  1 
ATOM   3044  C  CG  . ASP A 1 419 ? 38.521  13.564  -4.987   1.00 27.46 ? 408  ASP A CG  1 
ATOM   3045  O  OD1 . ASP A 1 419 ? 39.269  13.694  -3.984   1.00 27.96 ? 408  ASP A OD1 1 
ATOM   3046  O  OD2 . ASP A 1 419 ? 38.518  12.539  -5.711   1.00 28.61 ? 408  ASP A OD2 1 
ATOM   3047  N  N   . LEU A 1 420 ? 36.520  18.019  -4.639   1.00 23.75 ? 409  LEU A N   1 
ATOM   3048  C  CA  . LEU A 1 420 ? 35.575  19.119  -4.854   1.00 22.94 ? 409  LEU A CA  1 
ATOM   3049  C  C   . LEU A 1 420 ? 36.261  20.281  -5.512   1.00 22.39 ? 409  LEU A C   1 
ATOM   3050  O  O   . LEU A 1 420 ? 37.439  20.519  -5.259   1.00 21.90 ? 409  LEU A O   1 
ATOM   3051  C  CB  . LEU A 1 420 ? 35.095  19.659  -3.493   1.00 24.17 ? 409  LEU A CB  1 
ATOM   3052  C  CG  . LEU A 1 420 ? 34.329  18.766  -2.536   1.00 23.12 ? 409  LEU A CG  1 
ATOM   3053  C  CD1 . LEU A 1 420 ? 34.520  19.274  -1.135   1.00 23.68 ? 409  LEU A CD1 1 
ATOM   3054  C  CD2 . LEU A 1 420 ? 32.851  18.719  -2.915   1.00 26.62 ? 409  LEU A CD2 1 
ATOM   3055  N  N   . VAL A 1 421 ? 35.504  21.031  -6.310   1.00 22.40 ? 410  VAL A N   1 
ATOM   3056  C  CA  . VAL A 1 421 ? 35.961  22.291  -6.857   1.00 22.07 ? 410  VAL A CA  1 
ATOM   3057  C  C   . VAL A 1 421 ? 34.916  23.414  -6.706   1.00 22.03 ? 410  VAL A C   1 
ATOM   3058  O  O   . VAL A 1 421 ? 33.765  23.265  -7.117   1.00 22.67 ? 410  VAL A O   1 
ATOM   3059  C  CB  . VAL A 1 421 ? 36.349  22.127  -8.349   1.00 21.37 ? 410  VAL A CB  1 
ATOM   3060  C  CG1 . VAL A 1 421 ? 36.921  23.399  -8.871   1.00 20.48 ? 410  VAL A CG1 1 
ATOM   3061  C  CG2 . VAL A 1 421 ? 37.342  20.996  -8.505   1.00 22.01 ? 410  VAL A CG2 1 
ATOM   3062  N  N   . ILE A 1 422 ? 35.317  24.537  -6.102   1.00 22.66 ? 411  ILE A N   1 
ATOM   3063  C  CA  . ILE A 1 422 ? 34.502  25.765  -6.119   1.00 22.22 ? 411  ILE A CA  1 
ATOM   3064  C  C   . ILE A 1 422 ? 34.898  26.464  -7.415   1.00 22.96 ? 411  ILE A C   1 
ATOM   3065  O  O   . ILE A 1 422 ? 36.048  26.871  -7.576   1.00 23.60 ? 411  ILE A O   1 
ATOM   3066  C  CB  . ILE A 1 422 ? 34.757  26.687  -4.904   1.00 20.85 ? 411  ILE A CB  1 
ATOM   3067  C  CG1 . ILE A 1 422 ? 34.420  25.949  -3.609   1.00 20.07 ? 411  ILE A CG1 1 
ATOM   3068  C  CG2 . ILE A 1 422 ? 33.908  27.949  -4.997   1.00 21.84 ? 411  ILE A CG2 1 
ATOM   3069  C  CD1 . ILE A 1 422 ? 34.853  26.682  -2.388   1.00 20.90 ? 411  ILE A CD1 1 
ATOM   3070  N  N   . TRP A 1 423 ? 33.953  26.559  -8.341   1.00 23.02 ? 412  TRP A N   1 
ATOM   3071  C  CA  . TRP A 1 423 ? 34.209  26.996  -9.717   1.00 23.23 ? 412  TRP A CA  1 
ATOM   3072  C  C   . TRP A 1 423 ? 33.905  28.480  -9.961   1.00 24.06 ? 412  TRP A C   1 
ATOM   3073  O  O   . TRP A 1 423 ? 32.996  29.029  -9.363   1.00 25.48 ? 412  TRP A O   1 
ATOM   3074  C  CB  . TRP A 1 423 ? 33.313  26.154  -10.606  1.00 23.97 ? 412  TRP A CB  1 
ATOM   3075  C  CG  . TRP A 1 423 ? 33.515  26.323  -12.047  1.00 23.25 ? 412  TRP A CG  1 
ATOM   3076  C  CD1 . TRP A 1 423 ? 32.661  26.917  -12.926  1.00 23.95 ? 412  TRP A CD1 1 
ATOM   3077  C  CD2 . TRP A 1 423 ? 34.626  25.858  -12.806  1.00 22.54 ? 412  TRP A CD2 1 
ATOM   3078  N  NE1 . TRP A 1 423 ? 33.191  26.880  -14.184  1.00 22.83 ? 412  TRP A NE1 1 
ATOM   3079  C  CE2 . TRP A 1 423 ? 34.393  26.226  -14.144  1.00 22.86 ? 412  TRP A CE2 1 
ATOM   3080  C  CE3 . TRP A 1 423 ? 35.795  25.158  -12.485  1.00 23.85 ? 412  TRP A CE3 1 
ATOM   3081  C  CZ2 . TRP A 1 423 ? 35.291  25.933  -15.169  1.00 23.31 ? 412  TRP A CZ2 1 
ATOM   3082  C  CZ3 . TRP A 1 423 ? 36.691  24.863  -13.495  1.00 24.88 ? 412  TRP A CZ3 1 
ATOM   3083  C  CH2 . TRP A 1 423 ? 36.437  25.254  -14.827  1.00 25.01 ? 412  TRP A CH2 1 
ATOM   3084  N  N   . ASP A 1 424 ? 34.651  29.129  -10.847  1.00 25.05 ? 413  ASP A N   1 
ATOM   3085  C  CA  . ASP A 1 424 ? 34.354  30.496  -11.244  1.00 25.47 ? 413  ASP A CA  1 
ATOM   3086  C  C   . ASP A 1 424 ? 33.874  30.464  -12.681  1.00 26.03 ? 413  ASP A C   1 
ATOM   3087  O  O   . ASP A 1 424 ? 34.653  30.103  -13.561  1.00 27.16 ? 413  ASP A O   1 
ATOM   3088  C  CB  . ASP A 1 424 ? 35.583  31.386  -11.139  1.00 26.87 ? 413  ASP A CB  1 
ATOM   3089  C  CG  . ASP A 1 424 ? 35.253  32.879  -11.195  1.00 27.23 ? 413  ASP A CG  1 
ATOM   3090  O  OD1 . ASP A 1 424 ? 34.512  33.334  -12.092  1.00 32.64 ? 413  ASP A OD1 1 
ATOM   3091  O  OD2 . ASP A 1 424 ? 35.788  33.625  -10.350  1.00 32.52 ? 413  ASP A OD2 1 
ATOM   3092  N  N   . PRO A 1 425 ? 32.585  30.820  -12.920  1.00 26.43 ? 414  PRO A N   1 
ATOM   3093  C  CA  . PRO A 1 425 ? 31.953  30.823  -14.249  1.00 26.72 ? 414  PRO A CA  1 
ATOM   3094  C  C   . PRO A 1 425 ? 32.162  32.039  -15.127  1.00 27.85 ? 414  PRO A C   1 
ATOM   3095  O  O   . PRO A 1 425 ? 31.875  31.970  -16.337  1.00 28.45 ? 414  PRO A O   1 
ATOM   3096  C  CB  . PRO A 1 425 ? 30.450  30.743  -13.931  1.00 26.40 ? 414  PRO A CB  1 
ATOM   3097  C  CG  . PRO A 1 425 ? 30.319  30.821  -12.455  1.00 26.71 ? 414  PRO A CG  1 
ATOM   3098  C  CD  . PRO A 1 425 ? 31.619  31.220  -11.882  1.00 26.13 ? 414  PRO A CD  1 
ATOM   3099  N  N   . ASP A 1 426 ? 32.594  33.147  -14.530  1.00 28.54 ? 415  ASP A N   1 
ATOM   3100  C  CA  . ASP A 1 426 ? 32.547  34.463  -15.192  1.00 28.97 ? 415  ASP A CA  1 
ATOM   3101  C  C   . ASP A 1 426 ? 33.903  34.922  -15.711  1.00 29.72 ? 415  ASP A C   1 
ATOM   3102  O  O   . ASP A 1 426 ? 33.978  35.596  -16.754  1.00 29.80 ? 415  ASP A O   1 
ATOM   3103  C  CB  . ASP A 1 426 ? 32.002  35.532  -14.244  1.00 29.10 ? 415  ASP A CB  1 
ATOM   3104  C  CG  . ASP A 1 426 ? 30.604  35.246  -13.778  1.00 29.13 ? 415  ASP A CG  1 
ATOM   3105  O  OD1 . ASP A 1 426 ? 29.900  34.441  -14.409  1.00 34.17 ? 415  ASP A OD1 1 
ATOM   3106  O  OD2 . ASP A 1 426 ? 30.198  35.822  -12.761  1.00 33.14 ? 415  ASP A OD2 1 
ATOM   3107  N  N   . SER A 1 427 ? 34.953  34.545  -14.982  1.00 29.67 ? 416  SER A N   1 
ATOM   3108  C  CA  . SER A 1 427 ? 36.319  35.004  -15.230  1.00 29.30 ? 416  SER A CA  1 
ATOM   3109  C  C   . SER A 1 427 ? 36.834  34.576  -16.578  1.00 28.84 ? 416  SER A C   1 
ATOM   3110  O  O   . SER A 1 427 ? 36.875  33.393  -16.845  1.00 30.09 ? 416  SER A O   1 
ATOM   3111  C  CB  . SER A 1 427 ? 37.235  34.428  -14.169  1.00 29.51 ? 416  SER A CB  1 
ATOM   3112  O  OG  . SER A 1 427 ? 36.714  34.697  -12.880  1.00 31.43 ? 416  SER A OG  1 
ATOM   3113  N  N   . VAL A 1 428 ? 37.197  35.537  -17.423  1.00 28.67 ? 417  VAL A N   1 
ATOM   3114  C  CA  . VAL A 1 428 ? 37.945  35.265  -18.652  1.00 29.11 ? 417  VAL A CA  1 
ATOM   3115  C  C   . VAL A 1 428 ? 39.451  35.305  -18.344  1.00 29.61 ? 417  VAL A C   1 
ATOM   3116  O  O   . VAL A 1 428 ? 39.939  36.276  -17.731  1.00 29.68 ? 417  VAL A O   1 
ATOM   3117  C  CB  . VAL A 1 428 ? 37.661  36.305  -19.762  1.00 29.11 ? 417  VAL A CB  1 
ATOM   3118  C  CG1 . VAL A 1 428 ? 38.184  35.804  -21.084  1.00 30.28 ? 417  VAL A CG1 1 
ATOM   3119  C  CG2 . VAL A 1 428 ? 36.170  36.617  -19.890  1.00 28.57 ? 417  VAL A CG2 1 
ATOM   3120  N  N   . LYS A 1 429 ? 40.173  34.241  -18.713  1.00 28.69 ? 418  LYS A N   1 
ATOM   3121  C  CA  . LYS A 1 429 ? 41.638  34.220  -18.614  1.00 28.77 ? 418  LYS A CA  1 
ATOM   3122  C  C   . LYS A 1 429 ? 42.236  33.839  -19.953  1.00 28.97 ? 418  LYS A C   1 
ATOM   3123  O  O   . LYS A 1 429 ? 41.598  33.150  -20.750  1.00 29.20 ? 418  LYS A O   1 
ATOM   3124  C  CB  . LYS A 1 429 ? 42.132  33.261  -17.532  1.00 28.42 ? 418  LYS A CB  1 
ATOM   3125  C  CG  . LYS A 1 429 ? 41.752  33.681  -16.142  1.00 29.01 ? 418  LYS A CG  1 
ATOM   3126  C  CD  . LYS A 1 429 ? 42.462  32.888  -15.058  1.00 29.40 ? 418  LYS A CD  1 
ATOM   3127  C  CE  . LYS A 1 429 ? 42.041  33.406  -13.697  1.00 31.15 ? 418  LYS A CE  1 
ATOM   3128  N  NZ  . LYS A 1 429 ? 42.542  32.588  -12.546  1.00 31.38 ? 418  LYS A NZ  1 
ATOM   3129  N  N   . THR A 1 430 ? 43.456  34.303  -20.202  1.00 28.69 ? 419  THR A N   1 
ATOM   3130  C  CA  . THR A 1 430 ? 44.186  33.914  -21.386  1.00 29.07 ? 419  THR A CA  1 
ATOM   3131  C  C   . THR A 1 430 ? 45.062  32.709  -21.081  1.00 29.96 ? 419  THR A C   1 
ATOM   3132  O  O   . THR A 1 430 ? 45.882  32.749  -20.152  1.00 31.59 ? 419  THR A O   1 
ATOM   3133  C  CB  . THR A 1 430 ? 45.080  35.034  -21.880  1.00 28.79 ? 419  THR A CB  1 
ATOM   3134  O  OG1 . THR A 1 430 ? 44.265  36.161  -22.208  1.00 31.46 ? 419  THR A OG1 1 
ATOM   3135  C  CG2 . THR A 1 430 ? 45.865  34.611  -23.105  1.00 27.73 ? 419  THR A CG2 1 
ATOM   3136  N  N   . ILE A 1 431 ? 44.875  31.653  -21.872  1.00 29.17 ? 420  ILE A N   1 
ATOM   3137  C  CA  . ILE A 1 431 ? 45.726  30.483  -21.834  1.00 28.39 ? 420  ILE A CA  1 
ATOM   3138  C  C   . ILE A 1 431 ? 46.991  30.816  -22.615  1.00 28.24 ? 420  ILE A C   1 
ATOM   3139  O  O   . ILE A 1 431 ? 46.932  31.309  -23.742  1.00 27.10 ? 420  ILE A O   1 
ATOM   3140  C  CB  . ILE A 1 431 ? 45.023  29.223  -22.443  1.00 28.84 ? 420  ILE A CB  1 
ATOM   3141  C  CG1 . ILE A 1 431 ? 43.662  28.975  -21.763  1.00 26.82 ? 420  ILE A CG1 1 
ATOM   3142  C  CG2 . ILE A 1 431 ? 45.914  27.975  -22.308  1.00 28.38 ? 420  ILE A CG2 1 
ATOM   3143  C  CD1 . ILE A 1 431 ? 42.830  27.898  -22.436  1.00 27.26 ? 420  ILE A CD1 1 
ATOM   3144  N  N   . SER A 1 432 ? 48.131  30.598  -21.976  1.00 28.07 ? 421  SER A N   1 
ATOM   3145  C  CA  A SER A 1 432 ? 49.424  30.780  -22.624  0.50 28.20 ? 421  SER A CA  1 
ATOM   3146  C  CA  B SER A 1 432 ? 49.428  30.806  -22.609  0.50 28.03 ? 421  SER A CA  1 
ATOM   3147  C  C   . SER A 1 432 ? 50.486  29.912  -21.964  1.00 28.12 ? 421  SER A C   1 
ATOM   3148  O  O   . SER A 1 432 ? 50.390  29.553  -20.764  1.00 26.46 ? 421  SER A O   1 
ATOM   3149  C  CB  A SER A 1 432 ? 49.860  32.256  -22.605  0.50 28.39 ? 421  SER A CB  1 
ATOM   3150  C  CB  B SER A 1 432 ? 49.843  32.284  -22.500  0.50 28.11 ? 421  SER A CB  1 
ATOM   3151  O  OG  A SER A 1 432 ? 50.018  32.746  -21.284  0.50 26.82 ? 421  SER A OG  1 
ATOM   3152  O  OG  B SER A 1 432 ? 50.853  32.623  -23.436  0.50 25.11 ? 421  SER A OG  1 
ATOM   3153  N  N   . ALA A 1 433 ? 51.499  29.575  -22.752  1.00 29.30 ? 422  ALA A N   1 
ATOM   3154  C  CA  . ALA A 1 433 ? 52.650  28.834  -22.257  1.00 30.04 ? 422  ALA A CA  1 
ATOM   3155  C  C   . ALA A 1 433 ? 53.536  29.726  -21.397  1.00 31.44 ? 422  ALA A C   1 
ATOM   3156  O  O   . ALA A 1 433 ? 54.410  29.228  -20.680  1.00 32.01 ? 422  ALA A O   1 
ATOM   3157  C  CB  . ALA A 1 433 ? 53.448  28.255  -23.403  1.00 30.45 ? 422  ALA A CB  1 
ATOM   3158  N  N   . LYS A 1 434 ? 53.323  31.042  -21.454  1.00 31.81 ? 423  LYS A N   1 
ATOM   3159  C  CA  . LYS A 1 434 ? 54.012  31.912  -20.531  1.00 32.54 ? 423  LYS A CA  1 
ATOM   3160  C  C   . LYS A 1 434 ? 53.342  31.878  -19.156  1.00 32.57 ? 423  LYS A C   1 
ATOM   3161  O  O   . LYS A 1 434 ? 53.863  32.427  -18.207  1.00 32.71 ? 423  LYS A O   1 
ATOM   3162  C  CB  . LYS A 1 434 ? 54.209  33.321  -21.111  1.00 33.32 ? 423  LYS A CB  1 
ATOM   3163  C  CG  . LYS A 1 434 ? 53.053  34.294  -21.007  1.00 34.81 ? 423  LYS A CG  1 
ATOM   3164  C  CD  . LYS A 1 434 ? 53.497  35.718  -21.452  1.00 34.16 ? 423  LYS A CD  1 
ATOM   3165  C  CE  . LYS A 1 434 ? 52.308  36.697  -21.572  1.00 35.73 ? 423  LYS A CE  1 
ATOM   3166  N  NZ  . LYS A 1 434 ? 51.195  36.219  -22.469  1.00 35.38 ? 423  LYS A NZ  1 
ATOM   3167  N  N   . THR A 1 435 ? 52.217  31.165  -19.046  1.00 33.47 ? 424  THR A N   1 
ATOM   3168  C  CA  . THR A 1 435 ? 51.521  30.991  -17.770  1.00 33.02 ? 424  THR A CA  1 
ATOM   3169  C  C   . THR A 1 435 ? 51.126  29.537  -17.386  1.00 32.46 ? 424  THR A C   1 
ATOM   3170  O  O   . THR A 1 435 ? 50.765  29.298  -16.221  1.00 31.15 ? 424  THR A O   1 
ATOM   3171  C  CB  . THR A 1 435 ? 50.279  31.900  -17.723  1.00 33.90 ? 424  THR A CB  1 
ATOM   3172  O  OG1 . THR A 1 435 ? 50.681  33.272  -17.911  1.00 34.53 ? 424  THR A OG1 1 
ATOM   3173  C  CG2 . THR A 1 435 ? 49.580  31.764  -16.383  1.00 34.80 ? 424  THR A CG2 1 
ATOM   3174  N  N   . HIS A 1 436 ? 51.199  28.565  -18.303  1.00 31.59 ? 425  HIS A N   1 
ATOM   3175  C  CA  . HIS A 1 436 ? 50.761  27.186  -17.948  1.00 31.02 ? 425  HIS A CA  1 
ATOM   3176  C  C   . HIS A 1 436 ? 51.651  26.457  -16.927  1.00 31.03 ? 425  HIS A C   1 
ATOM   3177  O  O   . HIS A 1 436 ? 52.761  26.901  -16.633  1.00 32.05 ? 425  HIS A O   1 
ATOM   3178  C  CB  . HIS A 1 436 ? 50.517  26.305  -19.188  1.00 30.59 ? 425  HIS A CB  1 
ATOM   3179  C  CG  . HIS A 1 436 ? 51.716  26.057  -20.046  1.00 30.08 ? 425  HIS A CG  1 
ATOM   3180  N  ND1 . HIS A 1 436 ? 51.605  25.803  -21.398  1.00 30.59 ? 425  HIS A ND1 1 
ATOM   3181  C  CD2 . HIS A 1 436 ? 53.041  26.020  -19.768  1.00 31.67 ? 425  HIS A CD2 1 
ATOM   3182  C  CE1 . HIS A 1 436 ? 52.805  25.600  -21.909  1.00 30.60 ? 425  HIS A CE1 1 
ATOM   3183  N  NE2 . HIS A 1 436 ? 53.697  25.743  -20.945  1.00 32.13 ? 425  HIS A NE2 1 
ATOM   3184  N  N   . ASN A 1 437 ? 51.151  25.339  -16.397  1.00 30.97 ? 426  ASN A N   1 
ATOM   3185  C  CA  . ASN A 1 437 ? 51.885  24.494  -15.430  1.00 30.52 ? 426  ASN A CA  1 
ATOM   3186  C  C   . ASN A 1 437 ? 52.497  23.308  -16.165  1.00 30.48 ? 426  ASN A C   1 
ATOM   3187  O  O   . ASN A 1 437 ? 52.388  22.162  -15.761  1.00 29.56 ? 426  ASN A O   1 
ATOM   3188  C  CB  . ASN A 1 437 ? 50.980  23.995  -14.310  1.00 29.64 ? 426  ASN A CB  1 
ATOM   3189  C  CG  . ASN A 1 437 ? 50.890  24.960  -13.139  1.00 30.70 ? 426  ASN A CG  1 
ATOM   3190  O  OD1 . ASN A 1 437 ? 51.871  25.199  -12.444  1.00 28.43 ? 426  ASN A OD1 1 
ATOM   3191  N  ND2 . ASN A 1 437 ? 49.687  25.478  -12.885  1.00 27.15 ? 426  ASN A ND2 1 
ATOM   3192  N  N   . SER A 1 438 ? 53.160  23.622  -17.261  1.00 31.62 ? 427  SER A N   1 
ATOM   3193  C  CA  . SER A 1 438 ? 53.749  22.640  -18.124  1.00 31.62 ? 427  SER A CA  1 
ATOM   3194  C  C   . SER A 1 438 ? 55.160  23.070  -18.513  1.00 32.04 ? 427  SER A C   1 
ATOM   3195  O  O   . SER A 1 438 ? 55.492  24.252  -18.586  1.00 32.12 ? 427  SER A O   1 
ATOM   3196  C  CB  . SER A 1 438 ? 52.887  22.475  -19.363  1.00 31.80 ? 427  SER A CB  1 
ATOM   3197  O  OG  . SER A 1 438 ? 53.645  21.933  -20.415  1.00 33.66 ? 427  SER A OG  1 
ATOM   3198  N  N   . SER A 1 439 ? 55.984  22.079  -18.789  1.00 32.48 ? 428  SER A N   1 
ATOM   3199  C  CA  . SER A 1 439 ? 57.376  22.304  -19.104  1.00 31.60 ? 428  SER A CA  1 
ATOM   3200  C  C   . SER A 1 439 ? 57.563  22.860  -20.513  1.00 31.12 ? 428  SER A C   1 
ATOM   3201  O  O   . SER A 1 439 ? 58.627  23.376  -20.831  1.00 31.38 ? 428  SER A O   1 
ATOM   3202  C  CB  . SER A 1 439 ? 58.134  20.980  -18.926  1.00 32.33 ? 428  SER A CB  1 
ATOM   3203  O  OG  . SER A 1 439 ? 57.600  20.258  -17.817  1.00 32.93 ? 428  SER A OG  1 
ATOM   3204  N  N   . LEU A 1 440 ? 56.534  22.767  -21.350  1.00 29.40 ? 429  LEU A N   1 
ATOM   3205  C  CA  . LEU A 1 440 ? 56.676  23.123  -22.754  1.00 28.51 ? 429  LEU A CA  1 
ATOM   3206  C  C   . LEU A 1 440 ? 56.770  24.616  -23.007  1.00 28.14 ? 429  LEU A C   1 
ATOM   3207  O  O   . LEU A 1 440 ? 56.317  25.443  -22.223  1.00 28.54 ? 429  LEU A O   1 
ATOM   3208  C  CB  . LEU A 1 440 ? 55.535  22.538  -23.592  1.00 27.24 ? 429  LEU A CB  1 
ATOM   3209  C  CG  . LEU A 1 440 ? 55.691  21.052  -23.916  1.00 27.87 ? 429  LEU A CG  1 
ATOM   3210  C  CD1 . LEU A 1 440 ? 56.140  20.205  -22.684  1.00 25.43 ? 429  LEU A CD1 1 
ATOM   3211  C  CD2 . LEU A 1 440 ? 54.384  20.526  -24.492  1.00 26.57 ? 429  LEU A CD2 1 
ATOM   3212  N  N   . GLU A 1 441 ? 57.356  24.924  -24.154  1.00 28.78 ? 430  GLU A N   1 
ATOM   3213  C  CA  . GLU A 1 441 ? 57.541  26.279  -24.602  1.00 27.93 ? 430  GLU A CA  1 
ATOM   3214  C  C   . GLU A 1 441 ? 56.273  26.722  -25.298  1.00 27.52 ? 430  GLU A C   1 
ATOM   3215  O  O   . GLU A 1 441 ? 55.942  27.906  -25.293  1.00 28.18 ? 430  GLU A O   1 
ATOM   3216  C  CB  . GLU A 1 441 ? 58.760  26.346  -25.523  1.00 27.95 ? 430  GLU A CB  1 
ATOM   3217  C  CG  . GLU A 1 441 ? 60.046  25.760  -24.875  1.00 28.58 ? 430  GLU A CG  1 
ATOM   3218  C  CD  . GLU A 1 441 ? 60.431  24.360  -25.374  1.00 29.05 ? 430  GLU A CD  1 
ATOM   3219  O  OE1 . GLU A 1 441 ? 59.540  23.507  -25.621  1.00 26.92 ? 430  GLU A OE1 1 
ATOM   3220  O  OE2 . GLU A 1 441 ? 61.655  24.107  -25.507  1.00 29.87 ? 430  GLU A OE2 1 
ATOM   3221  N  N   . TYR A 1 442 ? 55.544  25.759  -25.857  1.00 26.74 ? 431  TYR A N   1 
ATOM   3222  C  CA  . TYR A 1 442 ? 54.314  26.031  -26.603  1.00 25.82 ? 431  TYR A CA  1 
ATOM   3223  C  C   . TYR A 1 442 ? 53.047  25.499  -25.943  1.00 24.31 ? 431  TYR A C   1 
ATOM   3224  O  O   . TYR A 1 442 ? 53.073  24.508  -25.219  1.00 24.80 ? 431  TYR A O   1 
ATOM   3225  C  CB  . TYR A 1 442 ? 54.423  25.450  -28.016  1.00 25.54 ? 431  TYR A CB  1 
ATOM   3226  C  CG  . TYR A 1 442 ? 55.249  26.301  -28.922  1.00 26.35 ? 431  TYR A CG  1 
ATOM   3227  C  CD1 . TYR A 1 442 ? 56.636  26.166  -28.988  1.00 25.65 ? 431  TYR A CD1 1 
ATOM   3228  C  CD2 . TYR A 1 442 ? 54.648  27.254  -29.711  1.00 27.06 ? 431  TYR A CD2 1 
ATOM   3229  C  CE1 . TYR A 1 442 ? 57.380  26.969  -29.809  1.00 25.47 ? 431  TYR A CE1 1 
ATOM   3230  C  CE2 . TYR A 1 442 ? 55.381  28.050  -30.540  1.00 27.78 ? 431  TYR A CE2 1 
ATOM   3231  C  CZ  . TYR A 1 442 ? 56.745  27.909  -30.585  1.00 26.62 ? 431  TYR A CZ  1 
ATOM   3232  O  OH  . TYR A 1 442 ? 57.437  28.739  -31.439  1.00 30.00 ? 431  TYR A OH  1 
ATOM   3233  N  N   . ASN A 1 443 ? 51.942  26.183  -26.233  1.00 24.21 ? 432  ASN A N   1 
ATOM   3234  C  CA  . ASN A 1 443 ? 50.590  25.807  -25.824  1.00 23.86 ? 432  ASN A CA  1 
ATOM   3235  C  C   . ASN A 1 443 ? 49.637  25.874  -27.002  1.00 23.17 ? 432  ASN A C   1 
ATOM   3236  O  O   . ASN A 1 443 ? 49.425  26.925  -27.599  1.00 22.50 ? 432  ASN A O   1 
ATOM   3237  C  CB  . ASN A 1 443 ? 50.084  26.712  -24.717  1.00 23.90 ? 432  ASN A CB  1 
ATOM   3238  C  CG  . ASN A 1 443 ? 48.922  26.109  -23.965  1.00 24.08 ? 432  ASN A CG  1 
ATOM   3239  O  OD1 . ASN A 1 443 ? 48.892  26.098  -22.732  1.00 27.07 ? 432  ASN A OD1 1 
ATOM   3240  N  ND2 . ASN A 1 443 ? 47.959  25.605  -24.698  1.00 23.93 ? 432  ASN A ND2 1 
ATOM   3241  N  N   . ILE A 1 444 ? 49.032  24.736  -27.305  1.00 23.26 ? 433  ILE A N   1 
ATOM   3242  C  CA  . ILE A 1 444 ? 48.162  24.601  -28.477  1.00 22.78 ? 433  ILE A CA  1 
ATOM   3243  C  C   . ILE A 1 444 ? 46.886  25.437  -28.331  1.00 22.31 ? 433  ILE A C   1 
ATOM   3244  O  O   . ILE A 1 444 ? 46.166  25.604  -29.290  1.00 22.30 ? 433  ILE A O   1 
ATOM   3245  C  CB  . ILE A 1 444 ? 47.837  23.092  -28.778  1.00 22.28 ? 433  ILE A CB  1 
ATOM   3246  C  CG1 . ILE A 1 444 ? 46.964  22.457  -27.688  1.00 23.30 ? 433  ILE A CG1 1 
ATOM   3247  C  CG2 . ILE A 1 444 ? 49.095  22.289  -28.865  1.00 17.03 ? 433  ILE A CG2 1 
ATOM   3248  C  CD1 . ILE A 1 444 ? 46.207  21.196  -28.173  1.00 23.57 ? 433  ILE A CD1 1 
ATOM   3249  N  N   . PHE A 1 445 ? 46.627  25.960  -27.133  1.00 23.00 ? 434  PHE A N   1 
ATOM   3250  C  CA  . PHE A 1 445 ? 45.530  26.926  -26.860  1.00 23.80 ? 434  PHE A CA  1 
ATOM   3251  C  C   . PHE A 1 445 ? 45.998  28.369  -26.532  1.00 23.46 ? 434  PHE A C   1 
ATOM   3252  O  O   . PHE A 1 445 ? 45.191  29.201  -26.120  1.00 23.55 ? 434  PHE A O   1 
ATOM   3253  C  CB  . PHE A 1 445 ? 44.654  26.413  -25.692  1.00 24.54 ? 434  PHE A CB  1 
ATOM   3254  C  CG  . PHE A 1 445 ? 44.289  24.955  -25.799  1.00 25.48 ? 434  PHE A CG  1 
ATOM   3255  C  CD1 . PHE A 1 445 ? 43.425  24.514  -26.799  1.00 25.68 ? 434  PHE A CD1 1 
ATOM   3256  C  CD2 . PHE A 1 445 ? 44.837  24.018  -24.927  1.00 25.54 ? 434  PHE A CD2 1 
ATOM   3257  C  CE1 . PHE A 1 445 ? 43.105  23.170  -26.912  1.00 25.05 ? 434  PHE A CE1 1 
ATOM   3258  C  CE2 . PHE A 1 445 ? 44.519  22.667  -25.037  1.00 25.10 ? 434  PHE A CE2 1 
ATOM   3259  C  CZ  . PHE A 1 445 ? 43.652  22.248  -26.021  1.00 25.25 ? 434  PHE A CZ  1 
ATOM   3260  N  N   . GLU A 1 446 ? 47.293  28.635  -26.693  1.00 24.02 ? 435  GLU A N   1 
ATOM   3261  C  CA  . GLU A 1 446 ? 47.916  29.981  -26.594  1.00 23.80 ? 435  GLU A CA  1 
ATOM   3262  C  C   . GLU A 1 446 ? 47.082  31.168  -27.091  1.00 24.82 ? 435  GLU A C   1 
ATOM   3263  O  O   . GLU A 1 446 ? 46.732  31.255  -28.279  1.00 25.23 ? 435  GLU A O   1 
ATOM   3264  C  CB  . GLU A 1 446 ? 49.208  29.970  -27.401  1.00 23.78 ? 435  GLU A CB  1 
ATOM   3265  C  CG  . GLU A 1 446 ? 50.006  31.250  -27.416  1.00 23.65 ? 435  GLU A CG  1 
ATOM   3266  C  CD  . GLU A 1 446 ? 50.517  31.584  -26.076  1.00 26.08 ? 435  GLU A CD  1 
ATOM   3267  O  OE1 . GLU A 1 446 ? 51.147  30.709  -25.453  1.00 27.90 ? 435  GLU A OE1 1 
ATOM   3268  O  OE2 . GLU A 1 446 ? 50.255  32.712  -25.622  1.00 29.80 ? 435  GLU A OE2 1 
ATOM   3269  N  N   . GLY A 1 447 ? 46.795  32.101  -26.189  1.00 25.12 ? 436  GLY A N   1 
ATOM   3270  C  CA  . GLY A 1 447 ? 46.035  33.294  -26.549  1.00 26.31 ? 436  GLY A CA  1 
ATOM   3271  C  C   . GLY A 1 447 ? 44.529  33.118  -26.679  1.00 26.60 ? 436  GLY A C   1 
ATOM   3272  O  O   . GLY A 1 447 ? 43.825  34.072  -26.966  1.00 26.90 ? 436  GLY A O   1 
ATOM   3273  N  N   . MET A 1 448 ? 44.020  31.908  -26.480  1.00 27.85 ? 437  MET A N   1 
ATOM   3274  C  CA  . MET A 1 448 ? 42.582  31.718  -26.301  1.00 29.35 ? 437  MET A CA  1 
ATOM   3275  C  C   . MET A 1 448 ? 42.056  32.447  -25.048  1.00 30.51 ? 437  MET A C   1 
ATOM   3276  O  O   . MET A 1 448 ? 42.438  32.120  -23.925  1.00 31.54 ? 437  MET A O   1 
ATOM   3277  C  CB  . MET A 1 448 ? 42.244  30.228  -26.177  1.00 29.01 ? 437  MET A CB  1 
ATOM   3278  C  CG  . MET A 1 448 ? 40.756  29.922  -26.042  1.00 27.84 ? 437  MET A CG  1 
ATOM   3279  S  SD  . MET A 1 448 ? 40.493  28.180  -25.723  1.00 31.50 ? 437  MET A SD  1 
ATOM   3280  C  CE  . MET A 1 448 ? 41.010  27.524  -27.303  1.00 29.35 ? 437  MET A CE  1 
ATOM   3281  N  N   . GLU A 1 449 ? 41.138  33.399  -25.239  1.00 31.62 ? 438  GLU A N   1 
ATOM   3282  C  CA  . GLU A 1 449 ? 40.442  34.005  -24.096  1.00 31.52 ? 438  GLU A CA  1 
ATOM   3283  C  C   . GLU A 1 449 ? 39.367  33.008  -23.649  1.00 30.53 ? 438  GLU A C   1 
ATOM   3284  O  O   . GLU A 1 449 ? 38.398  32.715  -24.379  1.00 30.16 ? 438  GLU A O   1 
ATOM   3285  C  CB  . GLU A 1 449 ? 39.817  35.364  -24.445  1.00 32.40 ? 438  GLU A CB  1 
ATOM   3286  C  CG  . GLU A 1 449 ? 40.685  36.292  -25.297  1.00 36.81 ? 438  GLU A CG  1 
ATOM   3287  C  CD  . GLU A 1 449 ? 41.814  36.975  -24.523  1.00 39.64 ? 438  GLU A CD  1 
ATOM   3288  O  OE1 . GLU A 1 449 ? 41.868  36.857  -23.266  1.00 42.75 ? 438  GLU A OE1 1 
ATOM   3289  O  OE2 . GLU A 1 449 ? 42.640  37.650  -25.189  1.00 41.61 ? 438  GLU A OE2 1 
ATOM   3290  N  N   . CYS A 1 450 ? 39.526  32.485  -22.450  1.00 28.89 ? 439  CYS A N   1 
ATOM   3291  C  CA  . CYS A 1 450 ? 38.674  31.430  -22.025  1.00 27.96 ? 439  CYS A CA  1 
ATOM   3292  C  C   . CYS A 1 450 ? 37.948  31.766  -20.746  1.00 28.17 ? 439  CYS A C   1 
ATOM   3293  O  O   . CYS A 1 450 ? 38.561  32.178  -19.757  1.00 27.36 ? 439  CYS A O   1 
ATOM   3294  C  CB  . CYS A 1 450 ? 39.499  30.175  -21.841  1.00 28.77 ? 439  CYS A CB  1 
ATOM   3295  S  SG  . CYS A 1 450 ? 38.491  28.748  -21.575  1.00 30.25 ? 439  CYS A SG  1 
ATOM   3296  N  N   . ARG A 1 451 ? 36.631  31.566  -20.773  1.00 27.54 ? 440  ARG A N   1 
ATOM   3297  C  CA  . ARG A 1 451 ? 35.782  31.797  -19.610  1.00 26.64 ? 440  ARG A CA  1 
ATOM   3298  C  C   . ARG A 1 451 ? 35.573  30.540  -18.762  1.00 25.46 ? 440  ARG A C   1 
ATOM   3299  O  O   . ARG A 1 451 ? 35.468  29.432  -19.281  1.00 23.80 ? 440  ARG A O   1 
ATOM   3300  C  CB  . ARG A 1 451 ? 34.441  32.346  -20.069  1.00 27.36 ? 440  ARG A CB  1 
ATOM   3301  C  CG  . ARG A 1 451 ? 33.806  33.281  -19.069  1.00 27.07 ? 440  ARG A CG  1 
ATOM   3302  C  CD  . ARG A 1 451 ? 32.704  34.065  -19.714  1.00 28.78 ? 440  ARG A CD  1 
ATOM   3303  N  NE  . ARG A 1 451 ? 31.539  34.112  -18.844  1.00 29.95 ? 440  ARG A NE  1 
ATOM   3304  C  CZ  . ARG A 1 451 ? 30.346  34.584  -19.195  1.00 32.28 ? 440  ARG A CZ  1 
ATOM   3305  N  NH1 . ARG A 1 451 ? 30.125  35.086  -20.416  1.00 32.76 ? 440  ARG A NH1 1 
ATOM   3306  N  NH2 . ARG A 1 451 ? 29.368  34.562  -18.300  1.00 34.87 ? 440  ARG A NH2 1 
ATOM   3307  N  N   . GLY A 1 452 ? 35.494  30.723  -17.450  1.00 24.41 ? 441  GLY A N   1 
ATOM   3308  C  CA  . GLY A 1 452 ? 35.358  29.614  -16.535  1.00 24.78 ? 441  GLY A CA  1 
ATOM   3309  C  C   . GLY A 1 452 ? 36.723  29.212  -16.004  1.00 25.01 ? 441  GLY A C   1 
ATOM   3310  O  O   . GLY A 1 452 ? 37.656  28.996  -16.779  1.00 23.16 ? 441  GLY A O   1 
ATOM   3311  N  N   . SER A 1 453 ? 36.832  29.113  -14.674  1.00 24.95 ? 442  SER A N   1 
ATOM   3312  C  CA  . SER A 1 453 ? 38.076  28.721  -14.017  1.00 26.11 ? 442  SER A CA  1 
ATOM   3313  C  C   . SER A 1 453 ? 37.818  28.270  -12.578  1.00 26.15 ? 442  SER A C   1 
ATOM   3314  O  O   . SER A 1 453 ? 36.810  28.677  -11.989  1.00 25.81 ? 442  SER A O   1 
ATOM   3315  C  CB  . SER A 1 453 ? 39.074  29.893  -14.027  1.00 27.15 ? 442  SER A CB  1 
ATOM   3316  O  OG  . SER A 1 453 ? 38.576  31.014  -13.285  1.00 28.51 ? 442  SER A OG  1 
ATOM   3317  N  N   . PRO A 1 454 ? 38.733  27.455  -12.005  1.00 25.92 ? 443  PRO A N   1 
ATOM   3318  C  CA  . PRO A 1 454 ? 38.603  27.012  -10.622  1.00 26.38 ? 443  PRO A CA  1 
ATOM   3319  C  C   . PRO A 1 454 ? 39.083  28.098  -9.707   1.00 27.01 ? 443  PRO A C   1 
ATOM   3320  O  O   . PRO A 1 454 ? 39.964  28.857  -10.084  1.00 26.27 ? 443  PRO A O   1 
ATOM   3321  C  CB  . PRO A 1 454 ? 39.537  25.805  -10.520  1.00 25.74 ? 443  PRO A CB  1 
ATOM   3322  C  CG  . PRO A 1 454 ? 40.438  25.893  -11.702  1.00 25.56 ? 443  PRO A CG  1 
ATOM   3323  C  CD  . PRO A 1 454 ? 39.971  26.954  -12.624  1.00 26.32 ? 443  PRO A CD  1 
ATOM   3324  N  N   . LEU A 1 455 ? 38.454  28.186  -8.538   1.00 28.09 ? 444  LEU A N   1 
ATOM   3325  C  CA  . LEU A 1 455 ? 38.814  29.131  -7.486   1.00 28.36 ? 444  LEU A CA  1 
ATOM   3326  C  C   . LEU A 1 455 ? 39.468  28.373  -6.344   1.00 28.60 ? 444  LEU A C   1 
ATOM   3327  O  O   . LEU A 1 455 ? 40.346  28.900  -5.666   1.00 29.63 ? 444  LEU A O   1 
ATOM   3328  C  CB  . LEU A 1 455 ? 37.566  29.815  -6.902   1.00 28.86 ? 444  LEU A CB  1 
ATOM   3329  C  CG  . LEU A 1 455 ? 36.888  31.026  -7.516   1.00 29.39 ? 444  LEU A CG  1 
ATOM   3330  C  CD1 . LEU A 1 455 ? 35.785  31.433  -6.567   1.00 28.05 ? 444  LEU A CD1 1 
ATOM   3331  C  CD2 . LEU A 1 455 ? 37.857  32.164  -7.750   1.00 30.60 ? 444  LEU A CD2 1 
ATOM   3332  N  N   . VAL A 1 456 ? 38.973  27.172  -6.085   1.00 28.13 ? 445  VAL A N   1 
ATOM   3333  C  CA  . VAL A 1 456 ? 39.468  26.350  -5.008   1.00 27.84 ? 445  VAL A CA  1 
ATOM   3334  C  C   . VAL A 1 456 ? 39.306  24.909  -5.439   1.00 28.09 ? 445  VAL A C   1 
ATOM   3335  O  O   . VAL A 1 456 ? 38.248  24.529  -5.910   1.00 28.51 ? 445  VAL A O   1 
ATOM   3336  C  CB  . VAL A 1 456 ? 38.694  26.594  -3.703   1.00 27.30 ? 445  VAL A CB  1 
ATOM   3337  C  CG1 . VAL A 1 456 ? 38.889  25.439  -2.724   1.00 26.82 ? 445  VAL A CG1 1 
ATOM   3338  C  CG2 . VAL A 1 456 ? 39.095  27.917  -3.068   1.00 26.85 ? 445  VAL A CG2 1 
ATOM   3339  N  N   . VAL A 1 457 ? 40.366  24.120  -5.300   1.00 28.70 ? 446  VAL A N   1 
ATOM   3340  C  CA  . VAL A 1 457 ? 40.339  22.701  -5.625   1.00 28.72 ? 446  VAL A CA  1 
ATOM   3341  C  C   . VAL A 1 457 ? 40.672  21.939  -4.350   1.00 30.46 ? 446  VAL A C   1 
ATOM   3342  O  O   . VAL A 1 457 ? 41.556  22.367  -3.586   1.00 31.69 ? 446  VAL A O   1 
ATOM   3343  C  CB  . VAL A 1 457 ? 41.351  22.371  -6.731   1.00 28.22 ? 446  VAL A CB  1 
ATOM   3344  C  CG1 . VAL A 1 457 ? 41.358  20.858  -7.054   1.00 25.19 ? 446  VAL A CG1 1 
ATOM   3345  C  CG2 . VAL A 1 457 ? 41.048  23.210  -7.963   1.00 26.60 ? 446  VAL A CG2 1 
ATOM   3346  N  N   . ILE A 1 458 ? 39.961  20.833  -4.119   1.00 30.34 ? 447  ILE A N   1 
ATOM   3347  C  CA  . ILE A 1 458 ? 40.157  20.003  -2.937   1.00 30.26 ? 447  ILE A CA  1 
ATOM   3348  C  C   . ILE A 1 458 ? 40.366  18.563  -3.361   1.00 30.91 ? 447  ILE A C   1 
ATOM   3349  O  O   . ILE A 1 458 ? 39.581  18.022  -4.125   1.00 30.34 ? 447  ILE A O   1 
ATOM   3350  C  CB  . ILE A 1 458 ? 38.953  20.090  -2.000   1.00 30.30 ? 447  ILE A CB  1 
ATOM   3351  C  CG1 . ILE A 1 458 ? 38.846  21.509  -1.440   1.00 31.39 ? 447  ILE A CG1 1 
ATOM   3352  C  CG2 . ILE A 1 458 ? 39.052  19.060  -0.878   1.00 29.53 ? 447  ILE A CG2 1 
ATOM   3353  C  CD1 . ILE A 1 458 ? 37.585  21.758  -0.649   1.00 31.53 ? 447  ILE A CD1 1 
ATOM   3354  N  N   . SER A 1 459 ? 41.440  17.949  -2.878   1.00 31.46 ? 448  SER A N   1 
ATOM   3355  C  CA  . SER A 1 459 ? 41.754  16.561  -3.200   1.00 31.79 ? 448  SER A CA  1 
ATOM   3356  C  C   . SER A 1 459 ? 41.889  15.790  -1.899   1.00 31.99 ? 448  SER A C   1 
ATOM   3357  O  O   . SER A 1 459 ? 42.647  16.185  -1.020   1.00 32.56 ? 448  SER A O   1 
ATOM   3358  C  CB  . SER A 1 459 ? 43.050  16.497  -4.007   1.00 31.76 ? 448  SER A CB  1 
ATOM   3359  O  OG  . SER A 1 459 ? 43.331  15.179  -4.433   1.00 33.55 ? 448  SER A OG  1 
ATOM   3360  N  N   . GLN A 1 460 ? 41.137  14.708  -1.766   1.00 32.23 ? 449  GLN A N   1 
ATOM   3361  C  CA  . GLN A 1 460 ? 41.140  13.904  -0.556   1.00 32.73 ? 449  GLN A CA  1 
ATOM   3362  C  C   . GLN A 1 460 ? 40.840  14.741  0.681    1.00 33.24 ? 449  GLN A C   1 
ATOM   3363  O  O   . GLN A 1 460 ? 41.345  14.462  1.772    1.00 33.91 ? 449  GLN A O   1 
ATOM   3364  C  CB  . GLN A 1 460 ? 42.482  13.177  -0.416   1.00 33.45 ? 449  GLN A CB  1 
ATOM   3365  C  CG  . GLN A 1 460 ? 43.023  12.609  -1.750   1.00 32.95 ? 449  GLN A CG  1 
ATOM   3366  C  CD  . GLN A 1 460 ? 44.406  12.000  -1.630   1.00 33.30 ? 449  GLN A CD  1 
ATOM   3367  O  OE1 . GLN A 1 460 ? 45.383  12.536  -2.163   1.00 31.58 ? 449  GLN A OE1 1 
ATOM   3368  N  NE2 . GLN A 1 460 ? 44.493  10.868  -0.940   1.00 30.60 ? 449  GLN A NE2 1 
ATOM   3369  N  N   . GLY A 1 461 ? 39.993  15.756  0.512    1.00 33.71 ? 450  GLY A N   1 
ATOM   3370  C  CA  . GLY A 1 461 ? 39.658  16.689  1.589    1.00 33.73 ? 450  GLY A CA  1 
ATOM   3371  C  C   . GLY A 1 461 ? 40.810  17.587  2.002    1.00 34.30 ? 450  GLY A C   1 
ATOM   3372  O  O   . GLY A 1 461 ? 40.900  17.980  3.159    1.00 34.85 ? 450  GLY A O   1 
ATOM   3373  N  N   . LYS A 1 462 ? 41.695  17.897  1.058    1.00 34.23 ? 451  LYS A N   1 
ATOM   3374  C  CA  . LYS A 1 462 ? 42.831  18.780  1.299    1.00 34.56 ? 451  LYS A CA  1 
ATOM   3375  C  C   . LYS A 1 462 ? 42.810  19.871  0.247    1.00 33.96 ? 451  LYS A C   1 
ATOM   3376  O  O   . LYS A 1 462 ? 42.685  19.572  -0.939   1.00 32.85 ? 451  LYS A O   1 
ATOM   3377  C  CB  . LYS A 1 462 ? 44.166  18.009  1.219    1.00 35.41 ? 451  LYS A CB  1 
ATOM   3378  C  CG  . LYS A 1 462 ? 44.585  17.299  2.516    1.00 36.68 ? 451  LYS A CG  1 
ATOM   3379  C  CD  . LYS A 1 462 ? 46.074  16.907  2.495    1.00 36.74 ? 451  LYS A CD  1 
ATOM   3380  C  CE  . LYS A 1 462 ? 46.462  16.014  3.674    1.00 37.79 ? 451  LYS A CE  1 
ATOM   3381  N  NZ  . LYS A 1 462 ? 47.816  15.396  3.486    1.00 38.87 ? 451  LYS A NZ  1 
ATOM   3382  N  N   . ILE A 1 463 ? 42.937  21.126  0.677    1.00 33.31 ? 452  ILE A N   1 
ATOM   3383  C  CA  . ILE A 1 463 ? 42.941  22.271  -0.242   1.00 33.78 ? 452  ILE A CA  1 
ATOM   3384  C  C   . ILE A 1 463 ? 44.252  22.311  -1.002   1.00 33.64 ? 452  ILE A C   1 
ATOM   3385  O  O   . ILE A 1 463 ? 45.306  22.440  -0.386   1.00 33.53 ? 452  ILE A O   1 
ATOM   3386  C  CB  . ILE A 1 463 ? 42.814  23.625  0.506    1.00 33.32 ? 452  ILE A CB  1 
ATOM   3387  C  CG1 . ILE A 1 463 ? 41.480  23.736  1.236    1.00 34.74 ? 452  ILE A CG1 1 
ATOM   3388  C  CG2 . ILE A 1 463 ? 42.981  24.787  -0.464   1.00 33.02 ? 452  ILE A CG2 1 
ATOM   3389  C  CD1 . ILE A 1 463 ? 41.432  24.916  2.218    1.00 34.32 ? 452  ILE A CD1 1 
ATOM   3390  N  N   . VAL A 1 464 ? 44.196  22.184  -2.328   1.00 33.82 ? 453  VAL A N   1 
ATOM   3391  C  CA  . VAL A 1 464 ? 45.398  22.229  -3.150   1.00 33.76 ? 453  VAL A CA  1 
ATOM   3392  C  C   . VAL A 1 464 ? 45.417  23.456  -4.027   1.00 33.79 ? 453  VAL A C   1 
ATOM   3393  O  O   . VAL A 1 464 ? 46.433  23.753  -4.643   1.00 31.83 ? 453  VAL A O   1 
ATOM   3394  C  CB  . VAL A 1 464 ? 45.584  20.961  -4.044   1.00 33.77 ? 453  VAL A CB  1 
ATOM   3395  C  CG1 . VAL A 1 464 ? 45.614  19.669  -3.193   1.00 33.15 ? 453  VAL A CG1 1 
ATOM   3396  C  CG2 . VAL A 1 464 ? 44.526  20.896  -5.122   1.00 33.16 ? 453  VAL A CG2 1 
ATOM   3397  N  N   . LEU A 1 465 ? 44.291  24.157  -4.101   1.00 35.05 ? 454  LEU A N   1 
ATOM   3398  C  CA  . LEU A 1 465 ? 44.255  25.477  -4.737   1.00 36.04 ? 454  LEU A CA  1 
ATOM   3399  C  C   . LEU A 1 465 ? 43.340  26.384  -3.949   1.00 36.67 ? 454  LEU A C   1 
ATOM   3400  O  O   . LEU A 1 465 ? 42.225  25.996  -3.602   1.00 36.08 ? 454  LEU A O   1 
ATOM   3401  C  CB  . LEU A 1 465 ? 43.758  25.386  -6.185   1.00 36.14 ? 454  LEU A CB  1 
ATOM   3402  C  CG  . LEU A 1 465 ? 43.777  26.697  -6.991   1.00 36.51 ? 454  LEU A CG  1 
ATOM   3403  C  CD1 . LEU A 1 465 ? 45.152  26.918  -7.622   1.00 36.09 ? 454  LEU A CD1 1 
ATOM   3404  C  CD2 . LEU A 1 465 ? 42.683  26.727  -8.053   1.00 35.03 ? 454  LEU A CD2 1 
ATOM   3405  N  N   . GLU A 1 466 ? 43.834  27.576  -3.634   1.00 38.05 ? 455  GLU A N   1 
ATOM   3406  C  CA  . GLU A 1 466 ? 42.989  28.650  -3.122   1.00 39.41 ? 455  GLU A CA  1 
ATOM   3407  C  C   . GLU A 1 466 ? 43.712  29.974  -3.252   1.00 40.49 ? 455  GLU A C   1 
ATOM   3408  O  O   . GLU A 1 466 ? 44.915  30.046  -3.027   1.00 41.71 ? 455  GLU A O   1 
ATOM   3409  C  CB  . GLU A 1 466 ? 42.547  28.400  -1.672   1.00 39.55 ? 455  GLU A CB  1 
ATOM   3410  C  CG  . GLU A 1 466 ? 43.152  29.305  -0.613   1.00 39.76 ? 455  GLU A CG  1 
ATOM   3411  C  CD  . GLU A 1 466 ? 42.512  29.103  0.770    1.00 39.88 ? 455  GLU A CD  1 
ATOM   3412  O  OE1 . GLU A 1 466 ? 41.268  29.144  0.880    1.00 38.16 ? 455  GLU A OE1 1 
ATOM   3413  O  OE2 . GLU A 1 466 ? 43.258  28.904  1.755    1.00 41.10 ? 455  GLU A OE2 1 
ATOM   3414  N  N   . ASP A 1 467 ? 42.967  31.011  -3.634   1.00 41.74 ? 456  ASP A N   1 
ATOM   3415  C  CA  . ASP A 1 467 ? 43.500  32.376  -3.781   1.00 41.96 ? 456  ASP A CA  1 
ATOM   3416  C  C   . ASP A 1 467 ? 44.706  32.479  -4.734   1.00 42.08 ? 456  ASP A C   1 
ATOM   3417  O  O   . ASP A 1 467 ? 45.636  33.256  -4.484   1.00 43.27 ? 456  ASP A O   1 
ATOM   3418  C  CB  . ASP A 1 467 ? 43.851  32.948  -2.396   1.00 42.30 ? 456  ASP A CB  1 
ATOM   3419  C  CG  . ASP A 1 467 ? 42.620  33.362  -1.609   1.00 44.25 ? 456  ASP A CG  1 
ATOM   3420  O  OD1 . ASP A 1 467 ? 42.043  34.427  -1.950   1.00 45.34 ? 456  ASP A OD1 1 
ATOM   3421  O  OD2 . ASP A 1 467 ? 42.236  32.638  -0.651   1.00 44.82 ? 456  ASP A OD2 1 
ATOM   3422  N  N   . GLY A 1 468 ? 44.689  31.699  -5.815   1.00 41.43 ? 457  GLY A N   1 
ATOM   3423  C  CA  . GLY A 1 468 ? 45.789  31.696  -6.793   1.00 41.04 ? 457  GLY A CA  1 
ATOM   3424  C  C   . GLY A 1 468 ? 47.064  31.010  -6.305   1.00 40.62 ? 457  GLY A C   1 
ATOM   3425  O  O   . GLY A 1 468 ? 48.097  31.041  -6.981   1.00 40.10 ? 457  GLY A O   1 
ATOM   3426  N  N   . THR A 1 469 ? 46.981  30.376  -5.138   1.00 40.18 ? 458  THR A N   1 
ATOM   3427  C  CA  . THR A 1 469 ? 48.120  29.717  -4.515   1.00 39.77 ? 458  THR A CA  1 
ATOM   3428  C  C   . THR A 1 469 ? 47.906  28.211  -4.575   1.00 38.98 ? 458  THR A C   1 
ATOM   3429  O  O   . THR A 1 469 ? 47.063  27.670  -3.859   1.00 39.41 ? 458  THR A O   1 
ATOM   3430  C  CB  . THR A 1 469 ? 48.290  30.154  -3.030   1.00 40.06 ? 458  THR A CB  1 
ATOM   3431  O  OG1 . THR A 1 469 ? 48.157  31.575  -2.918   1.00 40.55 ? 458  THR A OG1 1 
ATOM   3432  C  CG2 . THR A 1 469 ? 49.653  29.753  -2.503   1.00 40.29 ? 458  THR A CG2 1 
ATOM   3433  N  N   . LEU A 1 470 ? 48.680  27.539  -5.421   1.00 38.20 ? 459  LEU A N   1 
ATOM   3434  C  CA  . LEU A 1 470 ? 48.649  26.071  -5.529   1.00 38.08 ? 459  LEU A CA  1 
ATOM   3435  C  C   . LEU A 1 470 ? 49.405  25.422  -4.367   1.00 38.30 ? 459  LEU A C   1 
ATOM   3436  O  O   . LEU A 1 470 ? 50.448  25.925  -3.934   1.00 39.28 ? 459  LEU A O   1 
ATOM   3437  C  CB  . LEU A 1 470 ? 49.252  25.625  -6.869   1.00 37.52 ? 459  LEU A CB  1 
ATOM   3438  C  CG  . LEU A 1 470 ? 48.653  24.431  -7.626   1.00 37.53 ? 459  LEU A CG  1 
ATOM   3439  C  CD1 . LEU A 1 470 ? 47.143  24.354  -7.536   1.00 37.20 ? 459  LEU A CD1 1 
ATOM   3440  C  CD2 . LEU A 1 470 ? 49.053  24.534  -9.075   1.00 37.15 ? 459  LEU A CD2 1 
ATOM   3441  N  N   . HIS A 1 471 ? 48.875  24.316  -3.855   1.00 37.64 ? 460  HIS A N   1 
ATOM   3442  C  CA  . HIS A 1 471 ? 49.470  23.627  -2.719   1.00 37.42 ? 460  HIS A CA  1 
ATOM   3443  C  C   . HIS A 1 471 ? 49.477  22.112  -2.949   1.00 36.77 ? 460  HIS A C   1 
ATOM   3444  O  O   . HIS A 1 471 ? 48.804  21.360  -2.237   1.00 36.23 ? 460  HIS A O   1 
ATOM   3445  C  CB  . HIS A 1 471 ? 48.705  23.971  -1.436   1.00 38.47 ? 460  HIS A CB  1 
ATOM   3446  C  CG  . HIS A 1 471 ? 48.618  25.444  -1.152   1.00 42.12 ? 460  HIS A CG  1 
ATOM   3447  N  ND1 . HIS A 1 471 ? 49.716  26.201  -0.798   1.00 44.06 ? 460  HIS A ND1 1 
ATOM   3448  C  CD2 . HIS A 1 471 ? 47.560  26.296  -1.161   1.00 44.08 ? 460  HIS A CD2 1 
ATOM   3449  C  CE1 . HIS A 1 471 ? 49.340  27.455  -0.607   1.00 45.71 ? 460  HIS A CE1 1 
ATOM   3450  N  NE2 . HIS A 1 471 ? 48.038  27.543  -0.832   1.00 44.70 ? 460  HIS A NE2 1 
ATOM   3451  N  N   . VAL A 1 472 ? 50.245  21.670  -3.948   1.00 35.95 ? 461  VAL A N   1 
ATOM   3452  C  CA  . VAL A 1 472 ? 50.285  20.247  -4.336   1.00 35.42 ? 461  VAL A CA  1 
ATOM   3453  C  C   . VAL A 1 472 ? 51.333  19.500  -3.538   1.00 34.96 ? 461  VAL A C   1 
ATOM   3454  O  O   . VAL A 1 472 ? 52.243  20.102  -2.976   1.00 35.42 ? 461  VAL A O   1 
ATOM   3455  C  CB  . VAL A 1 472 ? 50.565  20.057  -5.845   1.00 35.01 ? 461  VAL A CB  1 
ATOM   3456  C  CG1 . VAL A 1 472 ? 49.615  20.921  -6.671   1.00 33.93 ? 461  VAL A CG1 1 
ATOM   3457  C  CG2 . VAL A 1 472 ? 52.000  20.377  -6.173   1.00 35.27 ? 461  VAL A CG2 1 
ATOM   3458  N  N   . THR A 1 473 ? 51.192  18.184  -3.490   1.00 34.30 ? 462  THR A N   1 
ATOM   3459  C  CA  . THR A 1 473 ? 52.076  17.343  -2.702   1.00 34.18 ? 462  THR A CA  1 
ATOM   3460  C  C   . THR A 1 473 ? 52.377  16.072  -3.473   1.00 33.71 ? 462  THR A C   1 
ATOM   3461  O  O   . THR A 1 473 ? 51.495  15.230  -3.649   1.00 32.93 ? 462  THR A O   1 
ATOM   3462  C  CB  . THR A 1 473 ? 51.427  17.044  -1.360   1.00 34.13 ? 462  THR A CB  1 
ATOM   3463  O  OG1 . THR A 1 473 ? 51.373  18.271  -0.621   1.00 37.87 ? 462  THR A OG1 1 
ATOM   3464  C  CG2 . THR A 1 473 ? 52.189  15.995  -0.564   1.00 34.27 ? 462  THR A CG2 1 
ATOM   3465  N  N   . GLU A 1 474 ? 53.629  15.966  -3.933   1.00 32.93 ? 463  GLU A N   1 
ATOM   3466  C  CA  . GLU A 1 474 ? 54.120  14.833  -4.715   1.00 32.03 ? 463  GLU A CA  1 
ATOM   3467  C  C   . GLU A 1 474 ? 53.920  13.550  -3.954   1.00 31.82 ? 463  GLU A C   1 
ATOM   3468  O  O   . GLU A 1 474 ? 54.147  13.491  -2.741   1.00 31.84 ? 463  GLU A O   1 
ATOM   3469  C  CB  . GLU A 1 474 ? 55.606  15.012  -4.984   1.00 32.34 ? 463  GLU A CB  1 
ATOM   3470  C  CG  . GLU A 1 474 ? 56.221  14.058  -5.995   1.00 32.60 ? 463  GLU A CG  1 
ATOM   3471  C  CD  . GLU A 1 474 ? 57.679  14.357  -6.244   1.00 31.55 ? 463  GLU A CD  1 
ATOM   3472  O  OE1 . GLU A 1 474 ? 58.321  14.857  -5.288   1.00 30.55 ? 463  GLU A OE1 1 
ATOM   3473  O  OE2 . GLU A 1 474 ? 58.172  14.099  -7.381   1.00 29.92 ? 463  GLU A OE2 1 
ATOM   3474  N  N   . GLY A 1 475 ? 53.466  12.530  -4.674   1.00 31.43 ? 464  GLY A N   1 
ATOM   3475  C  CA  . GLY A 1 475 ? 53.257  11.199  -4.119   1.00 30.83 ? 464  GLY A CA  1 
ATOM   3476  C  C   . GLY A 1 475 ? 52.005  11.053  -3.280   1.00 30.01 ? 464  GLY A C   1 
ATOM   3477  O  O   . GLY A 1 475 ? 51.724  9.966   -2.790   1.00 30.54 ? 464  GLY A O   1 
ATOM   3478  N  N   . SER A 1 476 ? 51.238  12.130  -3.130   1.00 29.70 ? 465  SER A N   1 
ATOM   3479  C  CA  . SER A 1 476 ? 50.068  12.126  -2.257   1.00 29.83 ? 465  SER A CA  1 
ATOM   3480  C  C   . SER A 1 476 ? 48.931  11.306  -2.839   1.00 29.68 ? 465  SER A C   1 
ATOM   3481  O  O   . SER A 1 476 ? 48.196  10.640  -2.109   1.00 29.34 ? 465  SER A O   1 
ATOM   3482  C  CB  . SER A 1 476 ? 49.578  13.547  -2.029   1.00 29.82 ? 465  SER A CB  1 
ATOM   3483  O  OG  . SER A 1 476 ? 49.133  14.110  -3.239   1.00 30.84 ? 465  SER A OG  1 
ATOM   3484  N  N   . GLY A 1 477 ? 48.793  11.380  -4.160   1.00 29.39 ? 466  GLY A N   1 
ATOM   3485  C  CA  . GLY A 1 477 ? 47.756  10.659  -4.889   1.00 28.74 ? 466  GLY A CA  1 
ATOM   3486  C  C   . GLY A 1 477 ? 47.818  9.157   -4.742   1.00 27.97 ? 466  GLY A C   1 
ATOM   3487  O  O   . GLY A 1 477 ? 48.890  8.554   -4.831   1.00 28.56 ? 466  GLY A O   1 
ATOM   3488  N  N   . ARG A 1 478 ? 46.644  8.565   -4.554   1.00 26.80 ? 467  ARG A N   1 
ATOM   3489  C  CA  . ARG A 1 478 ? 46.495  7.149   -4.316   1.00 26.86 ? 467  ARG A CA  1 
ATOM   3490  C  C   . ARG A 1 478 ? 46.093  6.449   -5.604   1.00 26.51 ? 467  ARG A C   1 
ATOM   3491  O  O   . ARG A 1 478 ? 45.511  7.081   -6.494   1.00 27.99 ? 467  ARG A O   1 
ATOM   3492  C  CB  . ARG A 1 478 ? 45.406  6.922   -3.278   1.00 26.20 ? 467  ARG A CB  1 
ATOM   3493  C  CG  . ARG A 1 478 ? 45.427  7.888   -2.090   1.00 28.96 ? 467  ARG A CG  1 
ATOM   3494  C  CD  . ARG A 1 478 ? 44.215  7.639   -1.167   1.00 29.01 ? 467  ARG A CD  1 
ATOM   3495  N  NE  . ARG A 1 478 ? 42.978  8.259   -1.649   1.00 30.27 ? 467  ARG A NE  1 
ATOM   3496  C  CZ  . ARG A 1 478 ? 41.742  7.807   -1.407   1.00 32.47 ? 467  ARG A CZ  1 
ATOM   3497  N  NH1 . ARG A 1 478 ? 41.536  6.697   -0.706   1.00 33.60 ? 467  ARG A NH1 1 
ATOM   3498  N  NH2 . ARG A 1 478 ? 40.689  8.466   -1.894   1.00 34.84 ? 467  ARG A NH2 1 
ATOM   3499  N  N   . TYR A 1 479 ? 46.400  5.151   -5.703   1.00 24.64 ? 468  TYR A N   1 
ATOM   3500  C  CA  . TYR A 1 479 ? 45.836  4.281   -6.752   1.00 24.25 ? 468  TYR A CA  1 
ATOM   3501  C  C   . TYR A 1 479 ? 44.371  4.004   -6.490   1.00 24.12 ? 468  TYR A C   1 
ATOM   3502  O  O   . TYR A 1 479 ? 44.019  3.566   -5.393   1.00 24.77 ? 468  TYR A O   1 
ATOM   3503  C  CB  . TYR A 1 479 ? 46.526  2.906   -6.823   1.00 22.46 ? 468  TYR A CB  1 
ATOM   3504  C  CG  . TYR A 1 479 ? 45.957  2.047   -7.956   1.00 20.39 ? 468  TYR A CG  1 
ATOM   3505  C  CD1 . TYR A 1 479 ? 46.211  2.371   -9.276   1.00 18.42 ? 468  TYR A CD1 1 
ATOM   3506  C  CD2 . TYR A 1 479 ? 45.150  0.960   -7.702   1.00 17.38 ? 468  TYR A CD2 1 
ATOM   3507  C  CE1 . TYR A 1 479 ? 45.693  1.647   -10.293  1.00 16.48 ? 468  TYR A CE1 1 
ATOM   3508  C  CE2 . TYR A 1 479 ? 44.620  0.207   -8.730   1.00 19.98 ? 468  TYR A CE2 1 
ATOM   3509  C  CZ  . TYR A 1 479 ? 44.909  0.562   -10.043  1.00 18.35 ? 468  TYR A CZ  1 
ATOM   3510  O  OH  . TYR A 1 479 ? 44.409  -0.169  -11.124  1.00 20.78 ? 468  TYR A OH  1 
ATOM   3511  N  N   . ILE A 1 480 ? 43.521  4.215   -7.490   1.00 23.66 ? 469  ILE A N   1 
ATOM   3512  C  CA  . ILE A 1 480 ? 42.099  3.894   -7.337   1.00 23.94 ? 469  ILE A CA  1 
ATOM   3513  C  C   . ILE A 1 480 ? 41.720  2.615   -8.100   1.00 23.36 ? 469  ILE A C   1 
ATOM   3514  O  O   . ILE A 1 480 ? 41.695  2.601   -9.331   1.00 22.46 ? 469  ILE A O   1 
ATOM   3515  C  CB  . ILE A 1 480 ? 41.201  5.078   -7.732   1.00 24.59 ? 469  ILE A CB  1 
ATOM   3516  C  CG1 . ILE A 1 480 ? 41.508  6.278   -6.832   1.00 23.60 ? 469  ILE A CG1 1 
ATOM   3517  C  CG2 . ILE A 1 480 ? 39.721  4.694   -7.601   1.00 24.41 ? 469  ILE A CG2 1 
ATOM   3518  C  CD1 . ILE A 1 480 ? 41.529  5.938   -5.336   1.00 25.18 ? 469  ILE A CD1 1 
ATOM   3519  N  N   . PRO A 1 481 ? 41.413  1.537   -7.361   1.00 23.50 ? 470  PRO A N   1 
ATOM   3520  C  CA  . PRO A 1 481 ? 41.088  0.294   -8.042   1.00 23.78 ? 470  PRO A CA  1 
ATOM   3521  C  C   . PRO A 1 481 ? 39.659  0.322   -8.600   1.00 23.98 ? 470  PRO A C   1 
ATOM   3522  O  O   . PRO A 1 481 ? 38.813  1.056   -8.100   1.00 24.87 ? 470  PRO A O   1 
ATOM   3523  C  CB  . PRO A 1 481 ? 41.238  -0.774  -6.950   1.00 23.09 ? 470  PRO A CB  1 
ATOM   3524  C  CG  . PRO A 1 481 ? 41.276  -0.044  -5.638   1.00 23.21 ? 470  PRO A CG  1 
ATOM   3525  C  CD  . PRO A 1 481 ? 41.248  1.423   -5.895   1.00 22.81 ? 470  PRO A CD  1 
ATOM   3526  N  N   . ARG A 1 482 ? 39.421  -0.448  -9.651   1.00 23.33 ? 471  ARG A N   1 
ATOM   3527  C  CA  . ARG A 1 482 ? 38.137  -0.459  -10.330  1.00 23.48 ? 471  ARG A CA  1 
ATOM   3528  C  C   . ARG A 1 482 ? 37.687  -1.869  -10.623  1.00 23.33 ? 471  ARG A C   1 
ATOM   3529  O  O   . ARG A 1 482 ? 38.425  -2.621  -11.248  1.00 24.76 ? 471  ARG A O   1 
ATOM   3530  C  CB  . ARG A 1 482 ? 38.262  0.264   -11.637  1.00 22.74 ? 471  ARG A CB  1 
ATOM   3531  C  CG  . ARG A 1 482 ? 38.623  1.680   -11.508  1.00 22.02 ? 471  ARG A CG  1 
ATOM   3532  C  CD  . ARG A 1 482 ? 38.931  2.199   -12.878  1.00 23.27 ? 471  ARG A CD  1 
ATOM   3533  N  NE  . ARG A 1 482 ? 40.068  1.488   -13.435  1.00 25.64 ? 471  ARG A NE  1 
ATOM   3534  C  CZ  . ARG A 1 482 ? 40.347  1.393   -14.730  1.00 24.33 ? 471  ARG A CZ  1 
ATOM   3535  N  NH1 . ARG A 1 482 ? 39.554  1.975   -15.616  1.00 27.32 ? 471  ARG A NH1 1 
ATOM   3536  N  NH2 . ARG A 1 482 ? 41.422  0.723   -15.130  1.00 19.83 ? 471  ARG A NH2 1 
ATOM   3537  N  N   . LYS A 1 483 ? 36.479  -2.218  -10.167  1.00 23.15 ? 472  LYS A N   1 
ATOM   3538  C  CA  . LYS A 1 483 ? 35.932  -3.563  -10.309  1.00 22.62 ? 472  LYS A CA  1 
ATOM   3539  C  C   . LYS A 1 483 ? 35.390  -3.761  -11.723  1.00 21.53 ? 472  LYS A C   1 
ATOM   3540  O  O   . LYS A 1 483 ? 34.977  -2.814  -12.373  1.00 20.92 ? 472  LYS A O   1 
ATOM   3541  C  CB  . LYS A 1 483 ? 34.806  -3.832  -9.294   1.00 23.09 ? 472  LYS A CB  1 
ATOM   3542  C  CG  . LYS A 1 483 ? 35.246  -4.135  -7.854   1.00 23.17 ? 472  LYS A CG  1 
ATOM   3543  C  CD  . LYS A 1 483 ? 34.060  -4.003  -6.885   1.00 23.48 ? 472  LYS A CD  1 
ATOM   3544  C  CE  . LYS A 1 483 ? 34.477  -4.065  -5.416   1.00 24.83 ? 472  LYS A CE  1 
ATOM   3545  N  NZ  . LYS A 1 483 ? 33.374  -3.605  -4.516   1.00 24.86 ? 472  LYS A NZ  1 
ATOM   3546  N  N   . PRO A 1 484 ? 35.413  -5.002  -12.209  1.00 21.53 ? 473  PRO A N   1 
ATOM   3547  C  CA  . PRO A 1 484 ? 34.834  -5.270  -13.533  1.00 21.24 ? 473  PRO A CA  1 
ATOM   3548  C  C   . PRO A 1 484 ? 33.277  -5.249  -13.525  1.00 20.49 ? 473  PRO A C   1 
ATOM   3549  O  O   . PRO A 1 484 ? 32.641  -5.164  -12.478  1.00 19.53 ? 473  PRO A O   1 
ATOM   3550  C  CB  . PRO A 1 484 ? 35.384  -6.660  -13.858  1.00 21.06 ? 473  PRO A CB  1 
ATOM   3551  C  CG  . PRO A 1 484 ? 35.496  -7.313  -12.517  1.00 21.24 ? 473  PRO A CG  1 
ATOM   3552  C  CD  . PRO A 1 484 ? 35.986  -6.217  -11.604  1.00 20.13 ? 473  PRO A CD  1 
ATOM   3553  N  N   . PHE A 1 485 ? 32.680  -5.296  -14.703  1.00 19.82 ? 474  PHE A N   1 
ATOM   3554  C  CA  . PHE A 1 485 ? 31.222  -5.287  -14.846  1.00 19.87 ? 474  PHE A CA  1 
ATOM   3555  C  C   . PHE A 1 485 ? 30.550  -4.032  -14.281  1.00 19.43 ? 474  PHE A C   1 
ATOM   3556  O  O   . PHE A 1 485 ? 29.602  -4.128  -13.500  1.00 20.42 ? 474  PHE A O   1 
ATOM   3557  C  CB  . PHE A 1 485 ? 30.590  -6.587  -14.319  1.00 19.93 ? 474  PHE A CB  1 
ATOM   3558  C  CG  . PHE A 1 485 ? 31.108  -7.822  -15.001  1.00 20.17 ? 474  PHE A CG  1 
ATOM   3559  C  CD1 . PHE A 1 485 ? 30.758  -8.100  -16.317  1.00 22.60 ? 474  PHE A CD1 1 
ATOM   3560  C  CD2 . PHE A 1 485 ? 31.971  -8.695  -14.349  1.00 22.09 ? 474  PHE A CD2 1 
ATOM   3561  C  CE1 . PHE A 1 485 ? 31.248  -9.260  -16.983  1.00 20.76 ? 474  PHE A CE1 1 
ATOM   3562  C  CE2 . PHE A 1 485 ? 32.459  -9.849  -15.002  1.00 21.61 ? 474  PHE A CE2 1 
ATOM   3563  C  CZ  . PHE A 1 485 ? 32.103  -10.117 -16.327  1.00 22.00 ? 474  PHE A CZ  1 
ATOM   3564  N  N   . PRO A 1 486 ? 31.035  -2.846  -14.692  1.00 18.04 ? 475  PRO A N   1 
ATOM   3565  C  CA  . PRO A 1 486 ? 30.349  -1.656  -14.281  1.00 19.84 ? 475  PRO A CA  1 
ATOM   3566  C  C   . PRO A 1 486 ? 28.912  -1.637  -14.801  1.00 19.18 ? 475  PRO A C   1 
ATOM   3567  O  O   . PRO A 1 486 ? 28.692  -1.744  -15.988  1.00 21.56 ? 475  PRO A O   1 
ATOM   3568  C  CB  . PRO A 1 486 ? 31.180  -0.544  -14.905  1.00 19.39 ? 475  PRO A CB  1 
ATOM   3569  C  CG  . PRO A 1 486 ? 31.918  -1.189  -16.015  1.00 15.73 ? 475  PRO A CG  1 
ATOM   3570  C  CD  . PRO A 1 486 ? 32.200  -2.526  -15.547  1.00 18.70 ? 475  PRO A CD  1 
ATOM   3571  N  N   . ASP A 1 487 ? 27.960  -1.487  -13.893  1.00 19.37 ? 476  ASP A N   1 
ATOM   3572  C  CA  . ASP A 1 487 ? 26.537  -1.658  -14.219  1.00 19.36 ? 476  ASP A CA  1 
ATOM   3573  C  C   . ASP A 1 487 ? 26.058  -0.789  -15.389  1.00 19.28 ? 476  ASP A C   1 
ATOM   3574  O  O   . ASP A 1 487 ? 25.312  -1.254  -16.257  1.00 20.32 ? 476  ASP A O   1 
ATOM   3575  C  CB  . ASP A 1 487 ? 25.690  -1.364  -12.975  1.00 19.42 ? 476  ASP A CB  1 
ATOM   3576  C  CG  . ASP A 1 487 ? 25.608  -2.527  -12.034  1.00 21.17 ? 476  ASP A CG  1 
ATOM   3577  O  OD1 . ASP A 1 487 ? 25.573  -3.686  -12.489  1.00 21.69 ? 476  ASP A OD1 1 
ATOM   3578  O  OD2 . ASP A 1 487 ? 25.549  -2.285  -10.811  1.00 27.29 ? 476  ASP A OD2 1 
ATOM   3579  N  N   . PHE A 1 488 ? 26.498  0.464   -15.390  1.00 18.81 ? 477  PHE A N   1 
ATOM   3580  C  CA  . PHE A 1 488 ? 26.123  1.476   -16.369  1.00 17.35 ? 477  PHE A CA  1 
ATOM   3581  C  C   . PHE A 1 488 ? 26.328  0.912   -17.777  1.00 16.85 ? 477  PHE A C   1 
ATOM   3582  O  O   . PHE A 1 488 ? 25.529  1.159   -18.706  1.00 16.41 ? 477  PHE A O   1 
ATOM   3583  C  CB  . PHE A 1 488 ? 27.033  2.683   -16.118  1.00 18.78 ? 477  PHE A CB  1 
ATOM   3584  C  CG  . PHE A 1 488 ? 26.745  3.873   -16.962  1.00 20.29 ? 477  PHE A CG  1 
ATOM   3585  C  CD1 . PHE A 1 488 ? 25.627  4.642   -16.734  1.00 22.73 ? 477  PHE A CD1 1 
ATOM   3586  C  CD2 . PHE A 1 488 ? 27.617  4.248   -17.971  1.00 22.82 ? 477  PHE A CD2 1 
ATOM   3587  C  CE1 . PHE A 1 488 ? 25.356  5.749   -17.520  1.00 22.68 ? 477  PHE A CE1 1 
ATOM   3588  C  CE2 . PHE A 1 488 ? 27.358  5.378   -18.743  1.00 22.79 ? 477  PHE A CE2 1 
ATOM   3589  C  CZ  . PHE A 1 488 ? 26.217  6.129   -18.499  1.00 21.21 ? 477  PHE A CZ  1 
ATOM   3590  N  N   . VAL A 1 489 ? 27.397  0.125   -17.911  1.00 16.43 ? 478  VAL A N   1 
ATOM   3591  C  CA  . VAL A 1 489 ? 27.772  -0.514  -19.199  1.00 14.14 ? 478  VAL A CA  1 
ATOM   3592  C  C   . VAL A 1 489 ? 27.246  -1.938  -19.399  1.00 14.71 ? 478  VAL A C   1 
ATOM   3593  O  O   . VAL A 1 489 ? 26.791  -2.286  -20.515  1.00 14.33 ? 478  VAL A O   1 
ATOM   3594  C  CB  . VAL A 1 489 ? 29.300  -0.554  -19.336  1.00 12.05 ? 478  VAL A CB  1 
ATOM   3595  C  CG1 . VAL A 1 489 ? 29.745  -1.251  -20.651  1.00 14.52 ? 478  VAL A CG1 1 
ATOM   3596  C  CG2 . VAL A 1 489 ? 29.847  0.869   -19.289  1.00 11.36 ? 478  VAL A CG2 1 
ATOM   3597  N  N   . TYR A 1 490 ? 27.349  -2.784  -18.373  1.00 13.10 ? 479  TYR A N   1 
ATOM   3598  C  CA  . TYR A 1 490 ? 27.305  -4.235  -18.592  1.00 13.08 ? 479  TYR A CA  1 
ATOM   3599  C  C   . TYR A 1 490 ? 25.931  -4.867  -18.466  1.00 14.13 ? 479  TYR A C   1 
ATOM   3600  O  O   . TYR A 1 490 ? 25.745  -6.003  -18.931  1.00 14.90 ? 479  TYR A O   1 
ATOM   3601  C  CB  . TYR A 1 490 ? 28.322  -5.014  -17.749  1.00 12.08 ? 479  TYR A CB  1 
ATOM   3602  C  CG  . TYR A 1 490 ? 29.587  -5.374  -18.486  1.00 7.60  ? 479  TYR A CG  1 
ATOM   3603  C  CD1 . TYR A 1 490 ? 29.677  -6.547  -19.217  1.00 13.86 ? 479  TYR A CD1 1 
ATOM   3604  C  CD2 . TYR A 1 490 ? 30.659  -4.507  -18.511  1.00 8.39  ? 479  TYR A CD2 1 
ATOM   3605  C  CE1 . TYR A 1 490 ? 30.828  -6.867  -19.952  1.00 13.36 ? 479  TYR A CE1 1 
ATOM   3606  C  CE2 . TYR A 1 490 ? 31.816  -4.809  -19.222  1.00 11.62 ? 479  TYR A CE2 1 
ATOM   3607  C  CZ  . TYR A 1 490 ? 31.907  -5.999  -19.931  1.00 9.51  ? 479  TYR A CZ  1 
ATOM   3608  O  OH  . TYR A 1 490 ? 33.056  -6.295  -20.644  1.00 13.03 ? 479  TYR A OH  1 
ATOM   3609  N  N   . LYS A 1 491 ? 24.973  -4.148  -17.885  1.00 13.15 ? 480  LYS A N   1 
ATOM   3610  C  CA  . LYS A 1 491 ? 23.626  -4.686  -17.773  1.00 13.73 ? 480  LYS A CA  1 
ATOM   3611  C  C   . LYS A 1 491 ? 23.075  -4.974  -19.164  1.00 14.75 ? 480  LYS A C   1 
ATOM   3612  O  O   . LYS A 1 491 ? 22.632  -6.092  -19.477  1.00 14.85 ? 480  LYS A O   1 
ATOM   3613  C  CB  . LYS A 1 491 ? 22.745  -3.703  -17.056  1.00 13.87 ? 480  LYS A CB  1 
ATOM   3614  C  CG  . LYS A 1 491 ? 23.041  -3.702  -15.565  1.00 15.25 ? 480  LYS A CG  1 
ATOM   3615  C  CD  . LYS A 1 491 ? 22.098  -2.770  -14.865  1.00 16.03 ? 480  LYS A CD  1 
ATOM   3616  C  CE  . LYS A 1 491 ? 22.249  -2.861  -13.357  1.00 18.40 ? 480  LYS A CE  1 
ATOM   3617  N  NZ  . LYS A 1 491 ? 21.491  -1.754  -12.747  1.00 18.26 ? 480  LYS A NZ  1 
ATOM   3618  N  N   . ARG A 1 492 ? 23.103  -3.948  -20.002  1.00 13.95 ? 481  ARG A N   1 
ATOM   3619  C  CA  . ARG A 1 492 ? 22.715  -4.157  -21.398  1.00 13.12 ? 481  ARG A CA  1 
ATOM   3620  C  C   . ARG A 1 492 ? 23.450  -5.382  -21.974  1.00 11.67 ? 481  ARG A C   1 
ATOM   3621  O  O   . ARG A 1 492 ? 22.803  -6.268  -22.461  1.00 12.55 ? 481  ARG A O   1 
ATOM   3622  C  CB  . ARG A 1 492 ? 22.959  -2.904  -22.182  1.00 13.03 ? 481  ARG A CB  1 
ATOM   3623  C  CG  . ARG A 1 492 ? 21.855  -1.873  -22.071  1.00 13.87 ? 481  ARG A CG  1 
ATOM   3624  C  CD  . ARG A 1 492 ? 22.286  -0.610  -22.805  1.00 13.05 ? 481  ARG A CD  1 
ATOM   3625  N  NE  . ARG A 1 492 ? 23.336  0.041   -22.055  1.00 14.79 ? 481  ARG A NE  1 
ATOM   3626  C  CZ  . ARG A 1 492 ? 24.273  0.862   -22.521  1.00 16.83 ? 481  ARG A CZ  1 
ATOM   3627  N  NH1 . ARG A 1 492 ? 24.370  1.183   -23.827  1.00 20.45 ? 481  ARG A NH1 1 
ATOM   3628  N  NH2 . ARG A 1 492 ? 25.155  1.346   -21.666  1.00 19.12 ? 481  ARG A NH2 1 
ATOM   3629  N  N   . ILE A 1 493 ? 24.785  -5.430  -21.858  1.00 13.41 ? 482  ILE A N   1 
ATOM   3630  C  CA  . ILE A 1 493 ? 25.652  -6.542  -22.314  1.00 13.65 ? 482  ILE A CA  1 
ATOM   3631  C  C   . ILE A 1 493 ? 25.245  -7.940  -21.825  1.00 15.18 ? 482  ILE A C   1 
ATOM   3632  O  O   . ILE A 1 493 ? 25.199  -8.904  -22.601  1.00 13.34 ? 482  ILE A O   1 
ATOM   3633  C  CB  . ILE A 1 493 ? 27.156  -6.314  -21.908  1.00 12.74 ? 482  ILE A CB  1 
ATOM   3634  C  CG1 . ILE A 1 493 ? 27.716  -4.949  -22.408  1.00 7.99  ? 482  ILE A CG1 1 
ATOM   3635  C  CG2 . ILE A 1 493 ? 28.039  -7.465  -22.420  1.00 13.43 ? 482  ILE A CG2 1 
ATOM   3636  C  CD1 . ILE A 1 493 ? 27.824  -4.736  -24.037  1.00 11.64 ? 482  ILE A CD1 1 
ATOM   3637  N  N   . LYS A 1 494 ? 24.974  -8.070  -20.523  1.00 17.28 ? 483  LYS A N   1 
ATOM   3638  C  CA  . LYS A 1 494 ? 24.495  -9.333  -19.977  1.00 18.34 ? 483  LYS A CA  1 
ATOM   3639  C  C   . LYS A 1 494 ? 23.145  -9.729  -20.578  1.00 18.69 ? 483  LYS A C   1 
ATOM   3640  O  O   . LYS A 1 494 ? 22.954  -10.868 -20.994  1.00 19.84 ? 483  LYS A O   1 
ATOM   3641  C  CB  . LYS A 1 494 ? 24.332  -9.258  -18.456  1.00 18.38 ? 483  LYS A CB  1 
ATOM   3642  C  CG  . LYS A 1 494 ? 25.544  -8.794  -17.684  1.00 20.06 ? 483  LYS A CG  1 
ATOM   3643  C  CD  . LYS A 1 494 ? 25.542  -9.374  -16.249  1.00 22.27 ? 483  LYS A CD  1 
ATOM   3644  C  CE  . LYS A 1 494 ? 25.609  -8.300  -15.145  1.00 27.22 ? 483  LYS A CE  1 
ATOM   3645  N  NZ  . LYS A 1 494 ? 24.256  -7.756  -14.709  1.00 26.32 ? 483  LYS A NZ  1 
ATOM   3646  N  N   . ALA A 1 495 ? 22.219  -8.775  -20.599  1.00 19.50 ? 484  ALA A N   1 
ATOM   3647  C  CA  . ALA A 1 495 ? 20.876  -8.973  -21.147  1.00 19.35 ? 484  ALA A CA  1 
ATOM   3648  C  C   . ALA A 1 495 ? 20.940  -9.425  -22.588  1.00 19.66 ? 484  ALA A C   1 
ATOM   3649  O  O   . ALA A 1 495 ? 20.075  -10.162 -23.066  1.00 19.69 ? 484  ALA A O   1 
ATOM   3650  C  CB  . ALA A 1 495 ? 20.093  -7.706  -21.065  1.00 17.50 ? 484  ALA A CB  1 
ATOM   3651  N  N   . ARG A 1 496 ? 21.951  -8.957  -23.297  1.00 20.06 ? 485  ARG A N   1 
ATOM   3652  C  CA  . ARG A 1 496 ? 22.105  -9.329  -24.685  1.00 19.04 ? 485  ARG A CA  1 
ATOM   3653  C  C   . ARG A 1 496 ? 22.674  -10.756 -24.847  1.00 19.31 ? 485  ARG A C   1 
ATOM   3654  O  O   . ARG A 1 496 ? 22.448  -11.421 -25.881  1.00 11.41 ? 485  ARG A O   1 
ATOM   3655  C  CB  . ARG A 1 496 ? 22.973  -8.300  -25.413  1.00 19.43 ? 485  ARG A CB  1 
ATOM   3656  C  CG  . ARG A 1 496 ? 22.340  -6.912  -25.425  1.00 16.93 ? 485  ARG A CG  1 
ATOM   3657  C  CD  . ARG A 1 496 ? 23.108  -5.968  -26.298  1.00 15.15 ? 485  ARG A CD  1 
ATOM   3658  N  NE  . ARG A 1 496 ? 22.601  -4.623  -26.070  1.00 14.15 ? 485  ARG A NE  1 
ATOM   3659  C  CZ  . ARG A 1 496 ? 23.015  -3.547  -26.708  1.00 12.92 ? 485  ARG A CZ  1 
ATOM   3660  N  NH1 . ARG A 1 496 ? 23.931  -3.660  -27.687  1.00 13.63 ? 485  ARG A NH1 1 
ATOM   3661  N  NH2 . ARG A 1 496 ? 22.436  -2.381  -26.434  1.00 11.93 ? 485  ARG A NH2 1 
ATOM   3662  N  N   . SER A 1 497 ? 23.406  -11.206 -23.837  1.00 20.13 ? 486  SER A N   1 
ATOM   3663  C  CA  . SER A 1 497 ? 23.967  -12.558 -23.846  1.00 24.45 ? 486  SER A CA  1 
ATOM   3664  C  C   . SER A 1 497 ? 22.851  -13.597 -23.746  1.00 26.92 ? 486  SER A C   1 
ATOM   3665  O  O   . SER A 1 497 ? 22.861  -14.605 -24.458  1.00 27.66 ? 486  SER A O   1 
ATOM   3666  C  CB  . SER A 1 497 ? 24.984  -12.749 -22.709  1.00 24.37 ? 486  SER A CB  1 
ATOM   3667  O  OG  . SER A 1 497 ? 26.312  -12.586 -23.188  1.00 26.88 ? 486  SER A OG  1 
ATOM   3668  N  N   . ARG A 1 498 ? 21.880  -13.335 -22.875  1.00 29.67 ? 487  ARG A N   1 
ATOM   3669  C  CA  . ARG A 1 498 ? 20.732  -14.225 -22.693  1.00 31.15 ? 487  ARG A CA  1 
ATOM   3670  C  C   . ARG A 1 498 ? 19.829  -14.309 -23.905  1.00 32.88 ? 487  ARG A C   1 
ATOM   3671  O  O   . ARG A 1 498 ? 19.257  -15.370 -24.163  1.00 34.87 ? 487  ARG A O   1 
ATOM   3672  C  CB  . ARG A 1 498 ? 19.910  -13.801 -21.497  1.00 30.57 ? 487  ARG A CB  1 
ATOM   3673  C  CG  . ARG A 1 498 ? 20.724  -13.841 -20.260  1.00 31.62 ? 487  ARG A CG  1 
ATOM   3674  C  CD  . ARG A 1 498 ? 19.901  -13.862 -18.991  1.00 34.00 ? 487  ARG A CD  1 
ATOM   3675  N  NE  . ARG A 1 498 ? 20.762  -13.453 -17.885  1.00 35.92 ? 487  ARG A NE  1 
ATOM   3676  C  CZ  . ARG A 1 498 ? 21.044  -12.192 -17.568  1.00 37.30 ? 487  ARG A CZ  1 
ATOM   3677  N  NH1 . ARG A 1 498 ? 20.497  -11.170 -18.233  1.00 37.22 ? 487  ARG A NH1 1 
ATOM   3678  N  NH2 . ARG A 1 498 ? 21.867  -11.950 -16.555  1.00 39.93 ? 487  ARG A NH2 1 
ATOM   3679  N  N   . LEU A 1 499 ? 19.682  -13.226 -24.651  1.00 34.05 ? 488  LEU A N   1 
ATOM   3680  C  CA  . LEU A 1 499 ? 18.918  -13.307 -25.898  1.00 35.74 ? 488  LEU A CA  1 
ATOM   3681  C  C   . LEU A 1 499 ? 19.517  -14.341 -26.880  1.00 37.10 ? 488  LEU A C   1 
ATOM   3682  O  O   . LEU A 1 499 ? 20.594  -14.887 -26.655  1.00 36.41 ? 488  LEU A O   1 
ATOM   3683  C  CB  . LEU A 1 499 ? 18.811  -11.930 -26.567  1.00 35.82 ? 488  LEU A CB  1 
ATOM   3684  C  CG  . LEU A 1 499 ? 18.042  -10.845 -25.816  1.00 35.24 ? 488  LEU A CG  1 
ATOM   3685  C  CD1 . LEU A 1 499 ? 18.146  -9.550  -26.575  1.00 36.95 ? 488  LEU A CD1 1 
ATOM   3686  C  CD2 . LEU A 1 499 ? 16.597  -11.213 -25.633  1.00 35.40 ? 488  LEU A CD2 1 
ATOM   3687  N  N   . ALA A 1 500 ? 18.806  -14.581 -27.979  1.00 39.31 ? 489  ALA A N   1 
ATOM   3688  C  CA  . ALA A 1 500 ? 19.193  -15.585 -28.985  1.00 41.23 ? 489  ALA A CA  1 
ATOM   3689  C  C   . ALA A 1 500 ? 19.663  -14.992 -30.331  1.00 42.94 ? 489  ALA A C   1 
ATOM   3690  O  O   . ALA A 1 500 ? 19.509  -13.796 -30.596  1.00 42.81 ? 489  ALA A O   1 
ATOM   3691  C  CB  . ALA A 1 500 ? 18.029  -16.576 -29.223  1.00 41.76 ? 489  ALA A CB  1 
ATOM   3692  N  N   . GLU A 1 501 ? 20.206  -15.879 -31.173  1.00 44.61 ? 490  GLU A N   1 
ATOM   3693  C  CA  . GLU A 1 501 ? 20.897  -15.540 -32.441  1.00 44.58 ? 490  GLU A CA  1 
ATOM   3694  C  C   . GLU A 1 501 ? 20.175  -14.529 -33.354  1.00 45.75 ? 490  GLU A C   1 
ATOM   3695  O  O   . GLU A 1 501 ? 18.940  -14.423 -33.386  1.00 46.70 ? 490  GLU A O   1 
ATOM   3696  C  CB  . GLU A 1 501 ? 21.167  -16.833 -33.240  1.00 44.80 ? 490  GLU A CB  1 
ATOM   3697  C  CG  . GLU A 1 501 ? 22.175  -17.804 -32.617  1.00 43.92 ? 490  GLU A CG  1 
ATOM   3698  C  CD  . GLU A 1 501 ? 23.608  -17.325 -32.746  1.00 44.34 ? 490  GLU A CD  1 
ATOM   3699  O  OE1 . GLU A 1 501 ? 24.032  -16.998 -33.882  1.00 43.42 ? 490  GLU A OE1 1 
ATOM   3700  O  OE2 . GLU A 1 501 ? 24.307  -17.265 -31.708  1.00 42.43 ? 490  GLU A OE2 1 
ATOM   3701  O  OXT . GLU A 1 501 ? 20.834  -13.791 -34.097  1.00 46.40 ? 490  GLU A OXT 1 
ATOM   3702  N  N   . ASP B 1 26  ? 1.142   6.909   6.758    1.00 48.83 ? 15   ASP B N   1 
ATOM   3703  C  CA  . ASP B 1 26  ? 1.323   5.966   7.906    1.00 48.56 ? 15   ASP B CA  1 
ATOM   3704  C  C   . ASP B 1 26  ? 2.521   5.037   7.692    1.00 48.45 ? 15   ASP B C   1 
ATOM   3705  O  O   . ASP B 1 26  ? 2.959   4.832   6.561    1.00 49.12 ? 15   ASP B O   1 
ATOM   3706  C  CB  . ASP B 1 26  ? 0.051   5.141   8.118    1.00 49.23 ? 15   ASP B CB  1 
ATOM   3707  C  CG  . ASP B 1 26  ? -0.066  4.590   9.541    1.00 49.64 ? 15   ASP B CG  1 
ATOM   3708  O  OD1 . ASP B 1 26  ? -1.067  4.911   10.227   1.00 51.98 ? 15   ASP B OD1 1 
ATOM   3709  O  OD2 . ASP B 1 26  ? 0.840   3.842   9.974    1.00 49.87 ? 15   ASP B OD2 1 
ATOM   3710  N  N   . ARG B 1 27  ? 3.026   4.461   8.783    1.00 47.34 ? 16   ARG B N   1 
ATOM   3711  C  CA  . ARG B 1 27  ? 4.301   3.737   8.774    1.00 46.38 ? 16   ARG B CA  1 
ATOM   3712  C  C   . ARG B 1 27  ? 4.298   2.440   7.969    1.00 44.84 ? 16   ARG B C   1 
ATOM   3713  O  O   . ARG B 1 27  ? 3.563   1.509   8.279    1.00 44.74 ? 16   ARG B O   1 
ATOM   3714  C  CB  . ARG B 1 27  ? 4.753   3.445   10.204   1.00 46.84 ? 16   ARG B CB  1 
ATOM   3715  C  CG  . ARG B 1 27  ? 5.201   4.683   10.939   1.00 47.65 ? 16   ARG B CG  1 
ATOM   3716  C  CD  . ARG B 1 27  ? 5.238   4.455   12.421   1.00 49.01 ? 16   ARG B CD  1 
ATOM   3717  N  NE  . ARG B 1 27  ? 5.598   5.669   13.148   1.00 50.98 ? 16   ARG B NE  1 
ATOM   3718  C  CZ  . ARG B 1 27  ? 5.696   5.746   14.475   1.00 52.76 ? 16   ARG B CZ  1 
ATOM   3719  N  NH1 . ARG B 1 27  ? 5.460   4.677   15.231   1.00 53.66 ? 16   ARG B NH1 1 
ATOM   3720  N  NH2 . ARG B 1 27  ? 6.034   6.896   15.051   1.00 53.30 ? 16   ARG B NH2 1 
ATOM   3721  N  N   . LEU B 1 28  ? 5.148   2.396   6.943    1.00 43.44 ? 17   LEU B N   1 
ATOM   3722  C  CA  . LEU B 1 28  ? 5.338   1.209   6.110    1.00 42.04 ? 17   LEU B CA  1 
ATOM   3723  C  C   . LEU B 1 28  ? 6.833   0.938   5.949    1.00 41.59 ? 17   LEU B C   1 
ATOM   3724  O  O   . LEU B 1 28  ? 7.635   1.865   5.774    1.00 41.22 ? 17   LEU B O   1 
ATOM   3725  C  CB  . LEU B 1 28  ? 4.665   1.385   4.737    1.00 41.33 ? 17   LEU B CB  1 
ATOM   3726  C  CG  . LEU B 1 28  ? 4.758   0.226   3.730    1.00 41.04 ? 17   LEU B CG  1 
ATOM   3727  C  CD1 . LEU B 1 28  ? 4.080   -0.999  4.256    1.00 38.71 ? 17   LEU B CD1 1 
ATOM   3728  C  CD2 . LEU B 1 28  ? 4.167   0.604   2.369    1.00 40.33 ? 17   LEU B CD2 1 
ATOM   3729  N  N   . LEU B 1 29  ? 7.194   -0.342  6.025    1.00 41.04 ? 18   LEU B N   1 
ATOM   3730  C  CA  . LEU B 1 29  ? 8.558   -0.805  5.832    1.00 40.52 ? 18   LEU B CA  1 
ATOM   3731  C  C   . LEU B 1 29  ? 8.598   -1.833  4.699    1.00 40.23 ? 18   LEU B C   1 
ATOM   3732  O  O   . LEU B 1 29  ? 7.815   -2.783  4.699    1.00 39.50 ? 18   LEU B O   1 
ATOM   3733  C  CB  . LEU B 1 29  ? 9.063   -1.431  7.131    1.00 40.32 ? 18   LEU B CB  1 
ATOM   3734  C  CG  . LEU B 1 29  ? 10.428  -2.117  7.113    1.00 40.58 ? 18   LEU B CG  1 
ATOM   3735  C  CD1 . LEU B 1 29  ? 11.478  -1.272  6.387    1.00 40.63 ? 18   LEU B CD1 1 
ATOM   3736  C  CD2 . LEU B 1 29  ? 10.867  -2.421  8.529    1.00 40.08 ? 18   LEU B CD2 1 
ATOM   3737  N  N   . ILE B 1 30  ? 9.489   -1.620  3.724    1.00 39.99 ? 19   ILE B N   1 
ATOM   3738  C  CA  . ILE B 1 30  ? 9.782   -2.617  2.681    1.00 39.69 ? 19   ILE B CA  1 
ATOM   3739  C  C   . ILE B 1 30  ? 11.197  -3.105  2.906    1.00 39.81 ? 19   ILE B C   1 
ATOM   3740  O  O   . ILE B 1 30  ? 12.127  -2.302  2.987    1.00 39.98 ? 19   ILE B O   1 
ATOM   3741  C  CB  . ILE B 1 30  ? 9.709   -2.041  1.258    1.00 39.68 ? 19   ILE B CB  1 
ATOM   3742  C  CG1 . ILE B 1 30  ? 8.273   -1.654  0.916    1.00 39.62 ? 19   ILE B CG1 1 
ATOM   3743  C  CG2 . ILE B 1 30  ? 10.243  -3.058  0.242    1.00 38.94 ? 19   ILE B CG2 1 
ATOM   3744  C  CD1 . ILE B 1 30  ? 7.746   -0.508  1.744    1.00 39.49 ? 19   ILE B CD1 1 
ATOM   3745  N  N   . LYS B 1 31  ? 11.358  -4.417  3.019    1.00 39.19 ? 20   LYS B N   1 
ATOM   3746  C  CA  . LYS B 1 31  ? 12.643  -4.978  3.365    1.00 39.21 ? 20   LYS B CA  1 
ATOM   3747  C  C   . LYS B 1 31  ? 13.110  -5.914  2.290    1.00 36.99 ? 20   LYS B C   1 
ATOM   3748  O  O   . LYS B 1 31  ? 12.308  -6.544  1.598    1.00 37.21 ? 20   LYS B O   1 
ATOM   3749  C  CB  . LYS B 1 31  ? 12.560  -5.733  4.688    1.00 40.02 ? 20   LYS B CB  1 
ATOM   3750  C  CG  . LYS B 1 31  ? 12.335  -4.820  5.887    1.00 41.88 ? 20   LYS B CG  1 
ATOM   3751  C  CD  . LYS B 1 31  ? 11.993  -5.596  7.156    1.00 42.32 ? 20   LYS B CD  1 
ATOM   3752  C  CE  . LYS B 1 31  ? 13.112  -6.544  7.557    1.00 44.65 ? 20   LYS B CE  1 
ATOM   3753  N  NZ  . LYS B 1 31  ? 13.069  -7.845  6.813    1.00 45.54 ? 20   LYS B NZ  1 
ATOM   3754  N  N   . GLY B 1 32  ? 14.423  -5.982  2.144    1.00 35.05 ? 21   GLY B N   1 
ATOM   3755  C  CA  . GLY B 1 32  ? 15.040  -6.976  1.292    1.00 33.05 ? 21   GLY B CA  1 
ATOM   3756  C  C   . GLY B 1 32  ? 15.040  -6.643  -0.168   1.00 32.28 ? 21   GLY B C   1 
ATOM   3757  O  O   . GLY B 1 32  ? 15.541  -7.437  -0.952   1.00 32.54 ? 21   GLY B O   1 
ATOM   3758  N  N   . GLY B 1 33  ? 14.516  -5.472  -0.546   1.00 31.08 ? 22   GLY B N   1 
ATOM   3759  C  CA  . GLY B 1 33  ? 14.446  -5.073  -1.967   1.00 29.99 ? 22   GLY B CA  1 
ATOM   3760  C  C   . GLY B 1 33  ? 15.699  -4.453  -2.599   1.00 28.55 ? 22   GLY B C   1 
ATOM   3761  O  O   . GLY B 1 33  ? 16.594  -3.944  -1.926   1.00 28.54 ? 22   GLY B O   1 
ATOM   3762  N  N   . LYS B 1 34  ? 15.761  -4.497  -3.919   1.00 26.75 ? 23   LYS B N   1 
ATOM   3763  C  CA  . LYS B 1 34  ? 16.866  -3.900  -4.633   1.00 25.69 ? 23   LYS B CA  1 
ATOM   3764  C  C   . LYS B 1 34  ? 16.373  -2.585  -5.195   1.00 24.02 ? 23   LYS B C   1 
ATOM   3765  O  O   . LYS B 1 34  ? 15.648  -2.575  -6.182   1.00 23.84 ? 23   LYS B O   1 
ATOM   3766  C  CB  . LYS B 1 34  ? 17.340  -4.822  -5.758   1.00 26.06 ? 23   LYS B CB  1 
ATOM   3767  C  CG  . LYS B 1 34  ? 18.661  -4.409  -6.368   1.00 26.41 ? 23   LYS B CG  1 
ATOM   3768  C  CD  . LYS B 1 34  ? 18.953  -5.192  -7.655   1.00 27.28 ? 23   LYS B CD  1 
ATOM   3769  C  CE  . LYS B 1 34  ? 18.264  -4.572  -8.877   1.00 29.39 ? 23   LYS B CE  1 
ATOM   3770  N  NZ  . LYS B 1 34  ? 18.129  -5.502  -10.054  1.00 26.37 ? 23   LYS B NZ  1 
ATOM   3771  N  N   . ILE B 1 35  ? 16.744  -1.484  -4.551   1.00 21.34 ? 24   ILE B N   1 
ATOM   3772  C  CA  . ILE B 1 35  ? 16.375  -0.157  -5.013   1.00 21.02 ? 24   ILE B CA  1 
ATOM   3773  C  C   . ILE B 1 35  ? 17.059  0.144   -6.338   1.00 19.62 ? 24   ILE B C   1 
ATOM   3774  O  O   . ILE B 1 35  ? 18.256  -0.068  -6.458   1.00 22.10 ? 24   ILE B O   1 
ATOM   3775  C  CB  . ILE B 1 35  ? 16.768  0.927   -4.023   1.00 20.35 ? 24   ILE B CB  1 
ATOM   3776  C  CG1 . ILE B 1 35  ? 15.927  0.791   -2.736   1.00 21.57 ? 24   ILE B CG1 1 
ATOM   3777  C  CG2 . ILE B 1 35  ? 16.564  2.311   -4.687   1.00 20.12 ? 24   ILE B CG2 1 
ATOM   3778  C  CD1 . ILE B 1 35  ? 16.625  1.174   -1.408   1.00 23.06 ? 24   ILE B CD1 1 
ATOM   3779  N  N   . VAL B 1 36  ? 16.283  0.617   -7.311   1.00 17.52 ? 25   VAL B N   1 
ATOM   3780  C  CA  . VAL B 1 36  ? 16.763  1.000   -8.633   1.00 17.09 ? 25   VAL B CA  1 
ATOM   3781  C  C   . VAL B 1 36  ? 16.331  2.447   -8.905   1.00 16.30 ? 25   VAL B C   1 
ATOM   3782  O  O   . VAL B 1 36  ? 15.164  2.712   -9.153   1.00 17.98 ? 25   VAL B O   1 
ATOM   3783  C  CB  . VAL B 1 36  ? 16.183  0.097   -9.740   1.00 16.17 ? 25   VAL B CB  1 
ATOM   3784  C  CG1 . VAL B 1 36  ? 16.604  0.603   -11.134  1.00 14.54 ? 25   VAL B CG1 1 
ATOM   3785  C  CG2 . VAL B 1 36  ? 16.610  -1.354  -9.547   1.00 15.06 ? 25   VAL B CG2 1 
ATOM   3786  N  N   . ASN B 1 37  ? 17.268  3.380   -8.820   1.00 16.00 ? 26   ASN B N   1 
ATOM   3787  C  CA  . ASN B 1 37  ? 17.021  4.759   -9.180   1.00 17.12 ? 26   ASN B CA  1 
ATOM   3788  C  C   . ASN B 1 37  ? 17.510  4.904   -10.585  1.00 17.07 ? 26   ASN B C   1 
ATOM   3789  O  O   . ASN B 1 37  ? 18.000  3.930   -11.127  1.00 16.05 ? 26   ASN B O   1 
ATOM   3790  C  CB  . ASN B 1 37  ? 17.739  5.700   -8.234   1.00 17.34 ? 26   ASN B CB  1 
ATOM   3791  C  CG  . ASN B 1 37  ? 16.942  5.951   -6.993   1.00 18.49 ? 26   ASN B CG  1 
ATOM   3792  O  OD1 . ASN B 1 37  ? 15.724  6.042   -7.054   1.00 22.91 ? 26   ASN B OD1 1 
ATOM   3793  N  ND2 . ASN B 1 37  ? 17.609  6.059   -5.870   1.00 18.42 ? 26   ASN B ND2 1 
ATOM   3794  N  N   . ASP B 1 38  ? 17.375  6.083   -11.179  1.00 18.30 ? 27   ASP B N   1 
ATOM   3795  C  CA  . ASP B 1 38  ? 17.863  6.267   -12.547  1.00 19.67 ? 27   ASP B CA  1 
ATOM   3796  C  C   . ASP B 1 38  ? 19.401  6.315   -12.633  1.00 20.42 ? 27   ASP B C   1 
ATOM   3797  O  O   . ASP B 1 38  ? 19.973  6.077   -13.691  1.00 22.04 ? 27   ASP B O   1 
ATOM   3798  C  CB  . ASP B 1 38  ? 17.199  7.470   -13.238  1.00 20.28 ? 27   ASP B CB  1 
ATOM   3799  C  CG  . ASP B 1 38  ? 17.799  8.837   -12.828  1.00 23.42 ? 27   ASP B CG  1 
ATOM   3800  O  OD1 . ASP B 1 38  ? 18.005  9.105   -11.621  1.00 12.56 ? 27   ASP B OD1 1 
ATOM   3801  O  OD2 . ASP B 1 38  ? 18.012  9.681   -13.739  1.00 22.56 ? 27   ASP B OD2 1 
ATOM   3802  N  N   . ASP B 1 39  ? 20.076  6.607   -11.527  1.00 20.43 ? 28   ASP B N   1 
ATOM   3803  C  CA  . ASP B 1 39  ? 21.534  6.735   -11.571  1.00 21.18 ? 28   ASP B CA  1 
ATOM   3804  C  C   . ASP B 1 39  ? 22.319  5.473   -11.113  1.00 22.48 ? 28   ASP B C   1 
ATOM   3805  O  O   . ASP B 1 39  ? 23.476  5.298   -11.457  1.00 22.41 ? 28   ASP B O   1 
ATOM   3806  C  CB  . ASP B 1 39  ? 21.944  7.966   -10.776  1.00 19.83 ? 28   ASP B CB  1 
ATOM   3807  C  CG  . ASP B 1 39  ? 21.611  7.853   -9.303   1.00 15.31 ? 28   ASP B CG  1 
ATOM   3808  O  OD1 . ASP B 1 39  ? 20.561  7.279   -8.933   1.00 9.16  ? 28   ASP B OD1 1 
ATOM   3809  O  OD2 . ASP B 1 39  ? 22.447  8.356   -8.543   1.00 16.57 ? 28   ASP B OD2 1 
ATOM   3810  N  N   . GLN B 1 40  ? 21.667  4.584   -10.375  1.00 23.18 ? 29   GLN B N   1 
ATOM   3811  C  CA  . GLN B 1 40  ? 22.314  3.425   -9.834   1.00 23.37 ? 29   GLN B CA  1 
ATOM   3812  C  C   . GLN B 1 40  ? 21.317  2.612   -9.020   1.00 23.24 ? 29   GLN B C   1 
ATOM   3813  O  O   . GLN B 1 40  ? 20.331  3.141   -8.516   1.00 19.68 ? 29   GLN B O   1 
ATOM   3814  C  CB  . GLN B 1 40  ? 23.470  3.847   -8.935   1.00 23.64 ? 29   GLN B CB  1 
ATOM   3815  C  CG  . GLN B 1 40  ? 23.042  4.646   -7.704   1.00 26.68 ? 29   GLN B CG  1 
ATOM   3816  C  CD  . GLN B 1 40  ? 24.076  4.687   -6.604   1.00 24.88 ? 29   GLN B CD  1 
ATOM   3817  O  OE1 . GLN B 1 40  ? 25.126  4.076   -6.693   1.00 31.40 ? 29   GLN B OE1 1 
ATOM   3818  N  NE2 . GLN B 1 40  ? 23.771  5.423   -5.548   1.00 29.57 ? 29   GLN B NE2 1 
ATOM   3819  N  N   . SER B 1 41  ? 21.604  1.319   -8.896   1.00 24.31 ? 30   SER B N   1 
ATOM   3820  C  CA  . SER B 1 41  ? 20.830  0.403   -8.061   1.00 25.37 ? 30   SER B CA  1 
ATOM   3821  C  C   . SER B 1 41  ? 21.703  -0.043  -6.900   1.00 26.18 ? 30   SER B C   1 
ATOM   3822  O  O   . SER B 1 41  ? 22.926  0.018   -6.982   1.00 24.76 ? 30   SER B O   1 
ATOM   3823  C  CB  . SER B 1 41  ? 20.392  -0.817  -8.867   1.00 25.57 ? 30   SER B CB  1 
ATOM   3824  O  OG  . SER B 1 41  ? 19.761  -0.415  -10.055  1.00 23.12 ? 30   SER B OG  1 
ATOM   3825  N  N   . PHE B 1 42  ? 21.069  -0.501  -5.823   1.00 28.50 ? 31   PHE B N   1 
ATOM   3826  C  CA  . PHE B 1 42  ? 21.791  -0.909  -4.608   1.00 28.33 ? 31   PHE B CA  1 
ATOM   3827  C  C   . PHE B 1 42  ? 20.826  -1.539  -3.611   1.00 28.69 ? 31   PHE B C   1 
ATOM   3828  O  O   . PHE B 1 42  ? 19.620  -1.264  -3.660   1.00 28.27 ? 31   PHE B O   1 
ATOM   3829  C  CB  . PHE B 1 42  ? 22.463  0.297   -3.968   1.00 28.56 ? 31   PHE B CB  1 
ATOM   3830  C  CG  . PHE B 1 42  ? 21.493  1.334   -3.487   1.00 28.99 ? 31   PHE B CG  1 
ATOM   3831  C  CD1 . PHE B 1 42  ? 21.047  2.336   -4.349   1.00 28.41 ? 31   PHE B CD1 1 
ATOM   3832  C  CD2 . PHE B 1 42  ? 21.009  1.296   -2.179   1.00 28.43 ? 31   PHE B CD2 1 
ATOM   3833  C  CE1 . PHE B 1 42  ? 20.142  3.273   -3.921   1.00 27.04 ? 31   PHE B CE1 1 
ATOM   3834  C  CE2 . PHE B 1 42  ? 20.104  2.239   -1.732   1.00 27.04 ? 31   PHE B CE2 1 
ATOM   3835  C  CZ  . PHE B 1 42  ? 19.669  3.236   -2.604   1.00 28.74 ? 31   PHE B CZ  1 
ATOM   3836  N  N   . TYR B 1 43  ? 21.347  -2.356  -2.693   1.00 29.60 ? 32   TYR B N   1 
ATOM   3837  C  CA  . TYR B 1 43  ? 20.487  -3.093  -1.763   1.00 30.65 ? 32   TYR B CA  1 
ATOM   3838  C  C   . TYR B 1 43  ? 20.259  -2.302  -0.482   1.00 31.47 ? 32   TYR B C   1 
ATOM   3839  O  O   . TYR B 1 43  ? 21.209  -1.821  0.112    1.00 31.63 ? 32   TYR B O   1 
ATOM   3840  C  CB  . TYR B 1 43  ? 21.039  -4.489  -1.478   1.00 31.14 ? 32   TYR B CB  1 
ATOM   3841  C  CG  . TYR B 1 43  ? 20.855  -5.435  -2.656   1.00 32.50 ? 32   TYR B CG  1 
ATOM   3842  C  CD1 . TYR B 1 43  ? 19.735  -6.260  -2.750   1.00 32.59 ? 32   TYR B CD1 1 
ATOM   3843  C  CD2 . TYR B 1 43  ? 21.776  -5.471  -3.695   1.00 33.29 ? 32   TYR B CD2 1 
ATOM   3844  C  CE1 . TYR B 1 43  ? 19.555  -7.111  -3.839   1.00 32.44 ? 32   TYR B CE1 1 
ATOM   3845  C  CE2 . TYR B 1 43  ? 21.606  -6.317  -4.788   1.00 32.89 ? 32   TYR B CE2 1 
ATOM   3846  C  CZ  . TYR B 1 43  ? 20.500  -7.140  -4.854   1.00 33.77 ? 32   TYR B CZ  1 
ATOM   3847  O  OH  . TYR B 1 43  ? 20.341  -7.984  -5.944   1.00 32.47 ? 32   TYR B OH  1 
ATOM   3848  N  N   . ALA B 1 44  ? 18.980  -2.136  -0.111   1.00 32.04 ? 33   ALA B N   1 
ATOM   3849  C  CA  . ALA B 1 44  ? 18.564  -1.374  1.077    1.00 32.24 ? 33   ALA B CA  1 
ATOM   3850  C  C   . ALA B 1 44  ? 17.068  -1.562  1.399    1.00 32.88 ? 33   ALA B C   1 
ATOM   3851  O  O   . ALA B 1 44  ? 16.271  -1.914  0.525    1.00 33.79 ? 33   ALA B O   1 
ATOM   3852  C  CB  . ALA B 1 44  ? 18.874  0.106   0.891    1.00 31.74 ? 33   ALA B CB  1 
ATOM   3853  N  N   . ASP B 1 45  ? 16.720  -1.344  2.667    1.00 33.07 ? 34   ASP B N   1 
ATOM   3854  C  CA  . ASP B 1 45  ? 15.332  -1.233  3.135    1.00 33.33 ? 34   ASP B CA  1 
ATOM   3855  C  C   . ASP B 1 45  ? 14.791  0.192   3.000    1.00 33.60 ? 34   ASP B C   1 
ATOM   3856  O  O   . ASP B 1 45  ? 15.530  1.167   3.183    1.00 33.79 ? 34   ASP B O   1 
ATOM   3857  C  CB  . ASP B 1 45  ? 15.219  -1.588  4.617    1.00 32.99 ? 34   ASP B CB  1 
ATOM   3858  C  CG  . ASP B 1 45  ? 15.606  -2.993  4.912    1.00 33.84 ? 34   ASP B CG  1 
ATOM   3859  O  OD1 . ASP B 1 45  ? 15.869  -3.759  3.959    1.00 34.58 ? 34   ASP B OD1 1 
ATOM   3860  O  OD2 . ASP B 1 45  ? 15.642  -3.327  6.120    1.00 34.57 ? 34   ASP B OD2 1 
ATOM   3861  N  N   . ILE B 1 46  ? 13.485  0.282   2.727    1.00 33.56 ? 35   ILE B N   1 
ATOM   3862  C  CA  . ILE B 1 46  ? 12.755  1.538   2.617    1.00 33.88 ? 35   ILE B CA  1 
ATOM   3863  C  C   . ILE B 1 46  ? 11.706  1.598   3.744    1.00 34.84 ? 35   ILE B C   1 
ATOM   3864  O  O   . ILE B 1 46  ? 10.818  0.741   3.830    1.00 34.74 ? 35   ILE B O   1 
ATOM   3865  C  CB  . ILE B 1 46  ? 12.040  1.683   1.240    1.00 32.63 ? 35   ILE B CB  1 
ATOM   3866  C  CG1 . ILE B 1 46  ? 13.014  1.445   0.079    1.00 32.69 ? 35   ILE B CG1 1 
ATOM   3867  C  CG2 . ILE B 1 46  ? 11.447  3.053   1.105    1.00 32.44 ? 35   ILE B CG2 1 
ATOM   3868  C  CD1 . ILE B 1 46  ? 12.375  1.505   -1.332   1.00 32.63 ? 35   ILE B CD1 1 
ATOM   3869  N  N   . TYR B 1 47  ? 11.833  2.594   4.615    1.00 36.44 ? 36   TYR B N   1 
ATOM   3870  C  CA  . TYR B 1 47  ? 10.818  2.869   5.630    1.00 37.37 ? 36   TYR B CA  1 
ATOM   3871  C  C   . TYR B 1 47  ? 10.184  4.242   5.356    1.00 38.08 ? 36   TYR B C   1 
ATOM   3872  O  O   . TYR B 1 47  ? 10.884  5.250   5.141    1.00 37.21 ? 36   TYR B O   1 
ATOM   3873  C  CB  . TYR B 1 47  ? 11.401  2.751   7.050    1.00 38.82 ? 36   TYR B CB  1 
ATOM   3874  C  CG  . TYR B 1 47  ? 10.583  3.379   8.162    1.00 37.79 ? 36   TYR B CG  1 
ATOM   3875  C  CD1 . TYR B 1 47  ? 9.534   2.695   8.777    1.00 39.79 ? 36   TYR B CD1 1 
ATOM   3876  C  CD2 . TYR B 1 47  ? 10.882  4.661   8.610    1.00 39.84 ? 36   TYR B CD2 1 
ATOM   3877  C  CE1 . TYR B 1 47  ? 8.796   3.291   9.824    1.00 41.45 ? 36   TYR B CE1 1 
ATOM   3878  C  CE2 . TYR B 1 47  ? 10.166  5.266   9.630    1.00 40.56 ? 36   TYR B CE2 1 
ATOM   3879  C  CZ  . TYR B 1 47  ? 9.127   4.591   10.239   1.00 41.62 ? 36   TYR B CZ  1 
ATOM   3880  O  OH  . TYR B 1 47  ? 8.450   5.245   11.249   1.00 41.53 ? 36   TYR B OH  1 
ATOM   3881  N  N   . MET B 1 48  ? 8.845   4.237   5.350    1.00 38.78 ? 37   MET B N   1 
ATOM   3882  C  CA  . MET B 1 48  ? 8.018   5.388   4.991    1.00 39.03 ? 37   MET B CA  1 
ATOM   3883  C  C   . MET B 1 48  ? 7.094   5.769   6.151    1.00 39.06 ? 37   MET B C   1 
ATOM   3884  O  O   . MET B 1 48  ? 6.824   4.954   7.035    1.00 38.71 ? 37   MET B O   1 
ATOM   3885  C  CB  . MET B 1 48  ? 7.197   5.046   3.741    1.00 38.79 ? 37   MET B CB  1 
ATOM   3886  C  CG  . MET B 1 48  ? 8.064   4.726   2.514    1.00 39.59 ? 37   MET B CG  1 
ATOM   3887  S  SD  . MET B 1 48  ? 7.564   3.263   1.585    1.00 40.35 ? 37   MET B SD  1 
ATOM   3888  C  CE  . MET B 1 48  ? 6.063   3.868   0.861    1.00 38.16 ? 37   MET B CE  1 
ATOM   3889  N  N   . GLU B 1 49  ? 6.600   7.005   6.114    1.00 39.72 ? 38   GLU B N   1 
ATOM   3890  C  CA  . GLU B 1 49  ? 5.792   7.575   7.190    1.00 39.61 ? 38   GLU B CA  1 
ATOM   3891  C  C   . GLU B 1 49  ? 5.290   8.957   6.764    1.00 39.07 ? 38   GLU B C   1 
ATOM   3892  O  O   . GLU B 1 49  ? 6.081   9.832   6.427    1.00 39.06 ? 38   GLU B O   1 
ATOM   3893  C  CB  . GLU B 1 49  ? 6.630   7.629   8.485    1.00 40.12 ? 38   GLU B CB  1 
ATOM   3894  C  CG  . GLU B 1 49  ? 6.305   8.729   9.504    1.00 41.12 ? 38   GLU B CG  1 
ATOM   3895  C  CD  . GLU B 1 49  ? 7.473   8.980   10.465   1.00 41.99 ? 38   GLU B CD  1 
ATOM   3896  O  OE1 . GLU B 1 49  ? 7.804   8.065   11.259   1.00 45.85 ? 38   GLU B OE1 1 
ATOM   3897  O  OE2 . GLU B 1 49  ? 8.073   10.083  10.419   1.00 45.39 ? 38   GLU B OE2 1 
ATOM   3898  N  N   . ASP B 1 50  ? 3.971   9.131   6.774    1.00 38.78 ? 39   ASP B N   1 
ATOM   3899  C  CA  . ASP B 1 50  ? 3.307   10.360  6.314    1.00 38.75 ? 39   ASP B CA  1 
ATOM   3900  C  C   . ASP B 1 50  ? 3.476   10.609  4.813    1.00 38.47 ? 39   ASP B C   1 
ATOM   3901  O  O   . ASP B 1 50  ? 3.713   11.732  4.371    1.00 37.51 ? 39   ASP B O   1 
ATOM   3902  C  CB  . ASP B 1 50  ? 3.767   11.581  7.115    1.00 38.78 ? 39   ASP B CB  1 
ATOM   3903  C  CG  . ASP B 1 50  ? 3.371   11.505  8.585    1.00 38.57 ? 39   ASP B CG  1 
ATOM   3904  O  OD1 . ASP B 1 50  ? 2.471   10.717  8.948    1.00 39.80 ? 39   ASP B OD1 1 
ATOM   3905  O  OD2 . ASP B 1 50  ? 3.960   12.260  9.372    1.00 39.39 ? 39   ASP B OD2 1 
ATOM   3906  N  N   . GLY B 1 51  ? 3.345   9.547   4.032    1.00 39.05 ? 40   GLY B N   1 
ATOM   3907  C  CA  . GLY B 1 51  ? 3.436   9.646   2.582    1.00 39.76 ? 40   GLY B CA  1 
ATOM   3908  C  C   . GLY B 1 51  ? 4.829   9.884   2.020    1.00 40.51 ? 40   GLY B C   1 
ATOM   3909  O  O   . GLY B 1 51  ? 5.004   9.902   0.783    1.00 41.14 ? 40   GLY B O   1 
ATOM   3910  N  N   . LEU B 1 52  ? 5.813   10.047  2.915    1.00 40.47 ? 41   LEU B N   1 
ATOM   3911  C  CA  . LEU B 1 52  ? 7.192   10.354  2.542    1.00 39.92 ? 41   LEU B CA  1 
ATOM   3912  C  C   . LEU B 1 52  ? 8.086   9.202   2.924    1.00 39.55 ? 41   LEU B C   1 
ATOM   3913  O  O   . LEU B 1 52  ? 7.714   8.357   3.733    1.00 39.41 ? 41   LEU B O   1 
ATOM   3914  C  CB  . LEU B 1 52  ? 7.679   11.630  3.233    1.00 40.30 ? 41   LEU B CB  1 
ATOM   3915  C  CG  . LEU B 1 52  ? 7.026   12.965  2.830    1.00 40.96 ? 41   LEU B CG  1 
ATOM   3916  C  CD1 . LEU B 1 52  ? 7.715   14.107  3.538    1.00 41.76 ? 41   LEU B CD1 1 
ATOM   3917  C  CD2 . LEU B 1 52  ? 7.020   13.220  1.314    1.00 42.28 ? 41   LEU B CD2 1 
ATOM   3918  N  N   . ILE B 1 53  ? 9.265   9.173   2.316    1.00 39.81 ? 42   ILE B N   1 
ATOM   3919  C  CA  . ILE B 1 53  ? 10.289  8.178   2.628    1.00 39.60 ? 42   ILE B CA  1 
ATOM   3920  C  C   . ILE B 1 53  ? 11.199  8.809   3.672    1.00 39.14 ? 42   ILE B C   1 
ATOM   3921  O  O   . ILE B 1 53  ? 11.733  9.891   3.457    1.00 38.74 ? 42   ILE B O   1 
ATOM   3922  C  CB  . ILE B 1 53  ? 11.073  7.767   1.365    1.00 39.64 ? 42   ILE B CB  1 
ATOM   3923  C  CG1 . ILE B 1 53  ? 10.124  7.094   0.362    1.00 39.90 ? 42   ILE B CG1 1 
ATOM   3924  C  CG2 . ILE B 1 53  ? 12.219  6.822   1.710    1.00 39.90 ? 42   ILE B CG2 1 
ATOM   3925  C  CD1 . ILE B 1 53  ? 10.720  6.825   -0.993   1.00 39.63 ? 42   ILE B CD1 1 
ATOM   3926  N  N   . LYS B 1 54  ? 11.338  8.148   4.818    1.00 39.34 ? 43   LYS B N   1 
ATOM   3927  C  CA  . LYS B 1 54  ? 12.072  8.721   5.947    1.00 39.59 ? 43   LYS B CA  1 
ATOM   3928  C  C   . LYS B 1 54  ? 13.453  8.122   6.153    1.00 39.77 ? 43   LYS B C   1 
ATOM   3929  O  O   . LYS B 1 54  ? 14.365  8.821   6.593    1.00 39.71 ? 43   LYS B O   1 
ATOM   3930  C  CB  . LYS B 1 54  ? 11.245  8.575   7.222    1.00 39.51 ? 43   LYS B CB  1 
ATOM   3931  C  CG  . LYS B 1 54  ? 9.934   9.354   7.188    1.00 39.55 ? 43   LYS B CG  1 
ATOM   3932  C  CD  . LYS B 1 54  ? 10.167  10.862  7.113    1.00 40.68 ? 43   LYS B CD  1 
ATOM   3933  C  CE  . LYS B 1 54  ? 8.868   11.635  7.102    1.00 40.85 ? 43   LYS B CE  1 
ATOM   3934  N  NZ  . LYS B 1 54  ? 7.914   11.121  8.106    1.00 39.98 ? 43   LYS B NZ  1 
ATOM   3935  N  N   . GLN B 1 55  ? 13.591  6.835   5.834    1.00 39.92 ? 44   GLN B N   1 
ATOM   3936  C  CA  . GLN B 1 55  ? 14.808  6.081   6.083    1.00 40.60 ? 44   GLN B CA  1 
ATOM   3937  C  C   . GLN B 1 55  ? 15.069  5.048   4.982    1.00 40.99 ? 44   GLN B C   1 
ATOM   3938  O  O   . GLN B 1 55  ? 14.185  4.253   4.666    1.00 39.90 ? 44   GLN B O   1 
ATOM   3939  C  CB  . GLN B 1 55  ? 14.692  5.355   7.432    1.00 40.49 ? 44   GLN B CB  1 
ATOM   3940  C  CG  . GLN B 1 55  ? 14.592  6.302   8.636    1.00 40.67 ? 44   GLN B CG  1 
ATOM   3941  C  CD  . GLN B 1 55  ? 14.491  5.593   9.983    1.00 40.12 ? 44   GLN B CD  1 
ATOM   3942  O  OE1 . GLN B 1 55  ? 14.683  4.380   10.086   1.00 39.92 ? 44   GLN B OE1 1 
ATOM   3943  N  NE2 . GLN B 1 55  ? 14.198  6.365   11.027   1.00 39.53 ? 44   GLN B NE2 1 
ATOM   3944  N  N   . ILE B 1 56  ? 16.283  5.071   4.417    1.00 42.16 ? 45   ILE B N   1 
ATOM   3945  C  CA  . ILE B 1 56  ? 16.767  4.018   3.508    1.00 43.61 ? 45   ILE B CA  1 
ATOM   3946  C  C   . ILE B 1 56  ? 18.120  3.466   3.972    1.00 44.76 ? 45   ILE B C   1 
ATOM   3947  O  O   . ILE B 1 56  ? 19.108  4.192   4.028    1.00 44.24 ? 45   ILE B O   1 
ATOM   3948  C  CB  . ILE B 1 56  ? 16.947  4.524   2.064    1.00 43.20 ? 45   ILE B CB  1 
ATOM   3949  C  CG1 . ILE B 1 56  ? 15.678  5.202   1.546    1.00 43.12 ? 45   ILE B CG1 1 
ATOM   3950  C  CG2 . ILE B 1 56  ? 17.334  3.368   1.146    1.00 41.85 ? 45   ILE B CG2 1 
ATOM   3951  C  CD1 . ILE B 1 56  ? 15.948  6.133   0.370    1.00 43.39 ? 45   ILE B CD1 1 
ATOM   3952  N  N   . GLY B 1 57  ? 18.162  2.177   4.277    1.00 46.92 ? 46   GLY B N   1 
ATOM   3953  C  CA  . GLY B 1 57  ? 19.364  1.550   4.821    1.00 49.12 ? 46   GLY B CA  1 
ATOM   3954  C  C   . GLY B 1 57  ? 19.214  0.046   4.863    1.00 51.16 ? 46   GLY B C   1 
ATOM   3955  O  O   . GLY B 1 57  ? 18.164  -0.480  4.510    1.00 51.30 ? 46   GLY B O   1 
ATOM   3956  N  N   . GLU B 1 58  ? 20.245  -0.656  5.317    1.00 54.21 ? 47   GLU B N   1 
ATOM   3957  C  CA  . GLU B 1 58  ? 20.297  -2.117  5.159    1.00 55.44 ? 47   GLU B CA  1 
ATOM   3958  C  C   . GLU B 1 58  ? 20.055  -2.888  6.472    1.00 56.80 ? 47   GLU B C   1 
ATOM   3959  O  O   . GLU B 1 58  ? 20.778  -3.834  6.801    1.00 56.86 ? 47   GLU B O   1 
ATOM   3960  C  CB  . GLU B 1 58  ? 21.637  -2.506  4.507    1.00 56.11 ? 47   GLU B CB  1 
ATOM   3961  C  CG  . GLU B 1 58  ? 21.801  -3.975  4.085    1.00 56.22 ? 47   GLU B CG  1 
ATOM   3962  C  CD  . GLU B 1 58  ? 20.708  -4.471  3.153    1.00 58.47 ? 47   GLU B CD  1 
ATOM   3963  O  OE1 . GLU B 1 58  ? 21.039  -4.814  1.997    1.00 59.47 ? 47   GLU B OE1 1 
ATOM   3964  O  OE2 . GLU B 1 58  ? 19.528  -4.535  3.575    1.00 59.90 ? 47   GLU B OE2 1 
ATOM   3965  N  N   . ASN B 1 59  ? 19.012  -2.493  7.195    1.00 58.12 ? 48   ASN B N   1 
ATOM   3966  C  CA  . ASN B 1 59  ? 18.641  -3.125  8.477    1.00 59.06 ? 48   ASN B CA  1 
ATOM   3967  C  C   . ASN B 1 59  ? 17.661  -2.299  9.324    1.00 60.09 ? 48   ASN B C   1 
ATOM   3968  O  O   . ASN B 1 59  ? 17.050  -2.828  10.257   1.00 60.34 ? 48   ASN B O   1 
ATOM   3969  C  CB  . ASN B 1 59  ? 19.887  -3.523  9.308    1.00 59.36 ? 48   ASN B CB  1 
ATOM   3970  C  CG  . ASN B 1 59  ? 19.685  -3.354  10.817   1.00 59.22 ? 48   ASN B CG  1 
ATOM   3971  O  OD1 . ASN B 1 59  ? 19.332  -4.295  11.541   1.00 60.00 ? 48   ASN B OD1 1 
ATOM   3972  N  ND2 . ASN B 1 59  ? 19.912  -2.140  11.289   1.00 60.64 ? 48   ASN B ND2 1 
ATOM   3973  N  N   . LEU B 1 60  ? 17.522  -1.014  9.006    1.00 61.04 ? 49   LEU B N   1 
ATOM   3974  C  CA  . LEU B 1 60  ? 16.571  -0.128  9.678    1.00 61.61 ? 49   LEU B CA  1 
ATOM   3975  C  C   . LEU B 1 60  ? 15.773  -0.829  10.781   1.00 62.58 ? 49   LEU B C   1 
ATOM   3976  O  O   . LEU B 1 60  ? 14.986  -1.741  10.500   1.00 62.92 ? 49   LEU B O   1 
ATOM   3977  C  CB  . LEU B 1 60  ? 15.586  0.471   8.660    1.00 61.20 ? 49   LEU B CB  1 
ATOM   3978  C  CG  . LEU B 1 60  ? 16.126  1.156   7.400    1.00 60.88 ? 49   LEU B CG  1 
ATOM   3979  C  CD1 . LEU B 1 60  ? 14.995  1.428   6.424    1.00 60.65 ? 49   LEU B CD1 1 
ATOM   3980  C  CD2 . LEU B 1 60  ? 16.865  2.446   7.733    1.00 60.81 ? 49   LEU B CD2 1 
ATOM   3981  N  N   . ILE B 1 61  ? 15.986  -0.413  12.028   1.00 63.39 ? 50   ILE B N   1 
ATOM   3982  C  CA  . ILE B 1 61  ? 15.078  -0.762  13.121   1.00 63.78 ? 50   ILE B CA  1 
ATOM   3983  C  C   . ILE B 1 61  ? 14.018  0.343   13.180   1.00 64.85 ? 50   ILE B C   1 
ATOM   3984  O  O   . ILE B 1 61  ? 14.349  1.517   13.375   1.00 65.66 ? 50   ILE B O   1 
ATOM   3985  C  CB  . ILE B 1 61  ? 15.805  -0.874  14.483   1.00 63.79 ? 50   ILE B CB  1 
ATOM   3986  C  CG1 . ILE B 1 61  ? 17.098  -1.677  14.344   1.00 63.32 ? 50   ILE B CG1 1 
ATOM   3987  C  CG2 . ILE B 1 61  ? 14.898  -1.523  15.518   1.00 63.77 ? 50   ILE B CG2 1 
ATOM   3988  C  CD1 . ILE B 1 61  ? 17.655  -2.195  15.644   1.00 63.21 ? 50   ILE B CD1 1 
ATOM   3989  N  N   . VAL B 1 62  ? 12.753  -0.018  12.974   1.00 65.42 ? 51   VAL B N   1 
ATOM   3990  C  CA  . VAL B 1 62  ? 11.665  0.967   12.965   1.00 65.66 ? 51   VAL B CA  1 
ATOM   3991  C  C   . VAL B 1 62  ? 10.692  0.700   14.122   1.00 66.26 ? 51   VAL B C   1 
ATOM   3992  O  O   . VAL B 1 62  ? 10.692  -0.404  14.688   1.00 66.05 ? 51   VAL B O   1 
ATOM   3993  C  CB  . VAL B 1 62  ? 10.929  1.005   11.597   1.00 65.72 ? 51   VAL B CB  1 
ATOM   3994  C  CG1 . VAL B 1 62  ? 11.883  1.451   10.521   1.00 65.38 ? 51   VAL B CG1 1 
ATOM   3995  C  CG2 . VAL B 1 62  ? 10.314  -0.348  11.253   1.00 66.08 ? 51   VAL B CG2 1 
ATOM   3996  N  N   . PRO B 1 63  ? 9.873   1.715   14.489   1.00 66.69 ? 52   PRO B N   1 
ATOM   3997  C  CA  . PRO B 1 63  ? 8.968   1.583   15.627   1.00 66.42 ? 52   PRO B CA  1 
ATOM   3998  C  C   . PRO B 1 63  ? 8.242   0.241   15.687   1.00 66.64 ? 52   PRO B C   1 
ATOM   3999  O  O   . PRO B 1 63  ? 7.741   -0.242  14.663   1.00 67.43 ? 52   PRO B O   1 
ATOM   4000  C  CB  . PRO B 1 63  ? 7.971   2.720   15.399   1.00 66.65 ? 52   PRO B CB  1 
ATOM   4001  C  CG  . PRO B 1 63  ? 8.782   3.782   14.759   1.00 66.86 ? 52   PRO B CG  1 
ATOM   4002  C  CD  . PRO B 1 63  ? 9.756   3.053   13.867   1.00 66.94 ? 52   PRO B CD  1 
ATOM   4003  N  N   . GLY B 1 64  ? 8.216   -0.367  16.873   1.00 66.00 ? 53   GLY B N   1 
ATOM   4004  C  CA  . GLY B 1 64  ? 7.395   -1.548  17.110   1.00 65.13 ? 53   GLY B CA  1 
ATOM   4005  C  C   . GLY B 1 64  ? 5.948   -1.207  16.794   1.00 64.68 ? 53   GLY B C   1 
ATOM   4006  O  O   . GLY B 1 64  ? 5.299   -0.449  17.528   1.00 64.73 ? 53   GLY B O   1 
ATOM   4007  N  N   . GLY B 1 65  ? 5.453   -1.746  15.685   1.00 63.77 ? 54   GLY B N   1 
ATOM   4008  C  CA  . GLY B 1 65  ? 4.128   -1.390  15.177   1.00 62.90 ? 54   GLY B CA  1 
ATOM   4009  C  C   . GLY B 1 65  ? 4.253   -0.729  13.820   1.00 62.17 ? 54   GLY B C   1 
ATOM   4010  O  O   . GLY B 1 65  ? 3.827   0.419   13.611   1.00 62.02 ? 54   GLY B O   1 
ATOM   4011  N  N   . VAL B 1 66  ? 4.854   -1.473  12.900   1.00 60.80 ? 55   VAL B N   1 
ATOM   4012  C  CA  . VAL B 1 66  ? 5.110   -1.007  11.549   1.00 59.68 ? 55   VAL B CA  1 
ATOM   4013  C  C   . VAL B 1 66  ? 4.734   -2.145  10.597   1.00 58.73 ? 55   VAL B C   1 
ATOM   4014  O  O   . VAL B 1 66  ? 5.272   -3.258  10.691   1.00 58.53 ? 55   VAL B O   1 
ATOM   4015  C  CB  . VAL B 1 66  ? 6.603   -0.582  11.390   1.00 59.38 ? 55   VAL B CB  1 
ATOM   4016  C  CG1 . VAL B 1 66  ? 7.070   -0.707  9.953    1.00 59.16 ? 55   VAL B CG1 1 
ATOM   4017  C  CG2 . VAL B 1 66  ? 6.814   0.846   11.893   1.00 58.51 ? 55   VAL B CG2 1 
ATOM   4018  N  N   . LYS B 1 67  ? 3.777   -1.885  9.711    1.00 57.61 ? 56   LYS B N   1 
ATOM   4019  C  CA  . LYS B 1 67  ? 3.458   -2.846  8.664    1.00 56.71 ? 56   LYS B CA  1 
ATOM   4020  C  C   . LYS B 1 67  ? 4.707   -3.023  7.806    1.00 55.22 ? 56   LYS B C   1 
ATOM   4021  O  O   . LYS B 1 67  ? 5.438   -2.059  7.575    1.00 54.88 ? 56   LYS B O   1 
ATOM   4022  C  CB  . LYS B 1 67  ? 2.265   -2.391  7.809    1.00 57.02 ? 56   LYS B CB  1 
ATOM   4023  C  CG  . LYS B 1 67  ? 1.900   -3.399  6.704    1.00 58.00 ? 56   LYS B CG  1 
ATOM   4024  C  CD  . LYS B 1 67  ? 0.575   -3.100  6.012    1.00 57.65 ? 56   LYS B CD  1 
ATOM   4025  C  CE  . LYS B 1 67  ? 0.329   -4.083  4.875    1.00 58.18 ? 56   LYS B CE  1 
ATOM   4026  N  NZ  . LYS B 1 67  ? 0.425   -5.508  5.325    1.00 58.95 ? 56   LYS B NZ  1 
ATOM   4027  N  N   . THR B 1 68  ? 4.953   -4.256  7.361    1.00 53.49 ? 57   THR B N   1 
ATOM   4028  C  CA  . THR B 1 68  ? 6.154   -4.580  6.591    1.00 52.72 ? 57   THR B CA  1 
ATOM   4029  C  C   . THR B 1 68  ? 5.847   -5.426  5.346    1.00 51.86 ? 57   THR B C   1 
ATOM   4030  O  O   . THR B 1 68  ? 4.842   -6.141  5.294    1.00 51.46 ? 57   THR B O   1 
ATOM   4031  C  CB  . THR B 1 68  ? 7.200   -5.295  7.472    1.00 52.48 ? 57   THR B CB  1 
ATOM   4032  O  OG1 . THR B 1 68  ? 7.504   -4.472  8.609    1.00 51.98 ? 57   THR B OG1 1 
ATOM   4033  C  CG2 . THR B 1 68  ? 8.484   -5.579  6.692    1.00 52.42 ? 57   THR B CG2 1 
ATOM   4034  N  N   . ILE B 1 69  ? 6.707   -5.290  4.332    1.00 50.72 ? 58   ILE B N   1 
ATOM   4035  C  CA  . ILE B 1 69  ? 6.673   -6.122  3.136    1.00 49.59 ? 58   ILE B CA  1 
ATOM   4036  C  C   . ILE B 1 69  ? 8.054   -6.702  2.927    1.00 48.54 ? 58   ILE B C   1 
ATOM   4037  O  O   . ILE B 1 69  ? 9.048   -5.969  2.947    1.00 48.55 ? 58   ILE B O   1 
ATOM   4038  C  CB  . ILE B 1 69  ? 6.314   -5.321  1.875    1.00 49.55 ? 58   ILE B CB  1 
ATOM   4039  C  CG1 . ILE B 1 69  ? 4.932   -4.689  2.002    1.00 49.24 ? 58   ILE B CG1 1 
ATOM   4040  C  CG2 . ILE B 1 69  ? 6.325   -6.223  0.653    1.00 49.95 ? 58   ILE B CG2 1 
ATOM   4041  C  CD1 . ILE B 1 69  ? 4.621   -3.720  0.893    1.00 49.32 ? 58   ILE B CD1 1 
ATOM   4042  N  N   . GLU B 1 70  ? 8.103   -8.016  2.739    1.00 47.39 ? 59   GLU B N   1 
ATOM   4043  C  CA  . GLU B 1 70  ? 9.328   -8.717  2.368    1.00 46.77 ? 59   GLU B CA  1 
ATOM   4044  C  C   . GLU B 1 70  ? 9.500   -8.752  0.849    1.00 45.29 ? 59   GLU B C   1 
ATOM   4045  O  O   . GLU B 1 70  ? 8.720   -9.390  0.151    1.00 45.00 ? 59   GLU B O   1 
ATOM   4046  C  CB  . GLU B 1 70  ? 9.299   -10.149 2.903    1.00 47.78 ? 59   GLU B CB  1 
ATOM   4047  C  CG  . GLU B 1 70  ? 9.828   -10.276 4.310    1.00 50.46 ? 59   GLU B CG  1 
ATOM   4048  C  CD  . GLU B 1 70  ? 11.240  -9.743  4.427    1.00 53.20 ? 59   GLU B CD  1 
ATOM   4049  O  OE1 . GLU B 1 70  ? 12.042  -9.943  3.471    1.00 55.52 ? 59   GLU B OE1 1 
ATOM   4050  O  OE2 . GLU B 1 70  ? 11.533  -9.106  5.463    1.00 54.89 ? 59   GLU B OE2 1 
ATOM   4051  N  N   . ALA B 1 71  ? 10.533  -8.080  0.350    1.00 43.80 ? 60   ALA B N   1 
ATOM   4052  C  CA  . ALA B 1 71  ? 10.753  -7.944  -1.091   1.00 42.28 ? 60   ALA B CA  1 
ATOM   4053  C  C   . ALA B 1 71  ? 11.522  -9.132  -1.672   1.00 41.58 ? 60   ALA B C   1 
ATOM   4054  O  O   . ALA B 1 71  ? 11.452  -9.385  -2.883   1.00 41.29 ? 60   ALA B O   1 
ATOM   4055  C  CB  . ALA B 1 71  ? 11.487  -6.648  -1.388   1.00 41.14 ? 60   ALA B CB  1 
ATOM   4056  N  N   . HIS B 1 72  ? 12.249  -9.852  -0.813   1.00 40.23 ? 61   HIS B N   1 
ATOM   4057  C  CA  . HIS B 1 72  ? 13.114  -10.966 -1.229   1.00 39.28 ? 61   HIS B CA  1 
ATOM   4058  C  C   . HIS B 1 72  ? 14.005  -10.566 -2.409   1.00 37.85 ? 61   HIS B C   1 
ATOM   4059  O  O   . HIS B 1 72  ? 13.913  -11.105 -3.513   1.00 37.52 ? 61   HIS B O   1 
ATOM   4060  C  CB  . HIS B 1 72  ? 12.282  -12.205 -1.549   1.00 39.93 ? 61   HIS B CB  1 
ATOM   4061  C  CG  . HIS B 1 72  ? 11.245  -12.524 -0.513   1.00 41.39 ? 61   HIS B CG  1 
ATOM   4062  N  ND1 . HIS B 1 72  ? 9.893   -12.483 -0.781   1.00 42.53 ? 61   HIS B ND1 1 
ATOM   4063  C  CD2 . HIS B 1 72  ? 11.359  -12.885 0.787    1.00 42.93 ? 61   HIS B CD2 1 
ATOM   4064  C  CE1 . HIS B 1 72  ? 9.220   -12.810 0.307    1.00 43.26 ? 61   HIS B CE1 1 
ATOM   4065  N  NE2 . HIS B 1 72  ? 10.085  -13.058 1.274    1.00 43.32 ? 61   HIS B NE2 1 
ATOM   4066  N  N   . SER B 1 73  ? 14.831  -9.559  -2.156   1.00 36.82 ? 62   SER B N   1 
ATOM   4067  C  CA  . SER B 1 73  ? 15.811  -9.055  -3.118   1.00 35.86 ? 62   SER B CA  1 
ATOM   4068  C  C   . SER B 1 73  ? 15.204  -8.508  -4.414   1.00 34.84 ? 62   SER B C   1 
ATOM   4069  O  O   . SER B 1 73  ? 15.941  -8.216  -5.346   1.00 34.64 ? 62   SER B O   1 
ATOM   4070  C  CB  . SER B 1 73  ? 16.866  -10.132 -3.398   1.00 36.02 ? 62   SER B CB  1 
ATOM   4071  O  OG  . SER B 1 73  ? 17.573  -10.434 -2.203   1.00 35.83 ? 62   SER B OG  1 
ATOM   4072  N  N   . ARG B 1 74  ? 13.880  -8.330  -4.455   1.00 34.30 ? 63   ARG B N   1 
ATOM   4073  C  CA  . ARG B 1 74  ? 13.193  -7.904  -5.677   1.00 32.27 ? 63   ARG B CA  1 
ATOM   4074  C  C   . ARG B 1 74  ? 13.341  -6.389  -5.925   1.00 30.70 ? 63   ARG B C   1 
ATOM   4075  O  O   . ARG B 1 74  ? 13.496  -5.615  -4.968   1.00 29.75 ? 63   ARG B O   1 
ATOM   4076  C  CB  . ARG B 1 74  ? 11.717  -8.277  -5.625   1.00 33.60 ? 63   ARG B CB  1 
ATOM   4077  C  CG  . ARG B 1 74  ? 11.098  -8.576  -6.994   1.00 36.88 ? 63   ARG B CG  1 
ATOM   4078  C  CD  . ARG B 1 74  ? 11.107  -10.087 -7.326   1.00 42.28 ? 63   ARG B CD  1 
ATOM   4079  N  NE  . ARG B 1 74  ? 9.900   -10.813 -6.879   1.00 44.65 ? 63   ARG B NE  1 
ATOM   4080  C  CZ  . ARG B 1 74  ? 9.747   -11.460 -5.714   1.00 45.08 ? 63   ARG B CZ  1 
ATOM   4081  N  NH1 . ARG B 1 74  ? 10.710  -11.509 -4.793   1.00 45.48 ? 63   ARG B NH1 1 
ATOM   4082  N  NH2 . ARG B 1 74  ? 8.596   -12.075 -5.462   1.00 44.97 ? 63   ARG B NH2 1 
ATOM   4083  N  N   . MET B 1 75  ? 13.306  -5.999  -7.214   1.00 27.33 ? 64   MET B N   1 
ATOM   4084  C  CA  . MET B 1 75  ? 13.392  -4.602  -7.672   1.00 24.95 ? 64   MET B CA  1 
ATOM   4085  C  C   . MET B 1 75  ? 12.419  -3.722  -6.934   1.00 25.02 ? 64   MET B C   1 
ATOM   4086  O  O   . MET B 1 75  ? 11.290  -4.138  -6.676   1.00 26.14 ? 64   MET B O   1 
ATOM   4087  C  CB  . MET B 1 75  ? 13.019  -4.466  -9.164   1.00 23.55 ? 64   MET B CB  1 
ATOM   4088  C  CG  . MET B 1 75  ? 14.023  -4.945  -10.155  1.00 21.32 ? 64   MET B CG  1 
ATOM   4089  S  SD  . MET B 1 75  ? 13.538  -4.633  -11.878  1.00 21.25 ? 64   MET B SD  1 
ATOM   4090  C  CE  . MET B 1 75  ? 13.328  -2.858  -11.915  1.00 16.57 ? 64   MET B CE  1 
ATOM   4091  N  N   . VAL B 1 76  ? 12.843  -2.495  -6.632   1.00 24.17 ? 65   VAL B N   1 
ATOM   4092  C  CA  . VAL B 1 76  ? 11.962  -1.480  -6.091   1.00 22.38 ? 65   VAL B CA  1 
ATOM   4093  C  C   . VAL B 1 76  ? 12.285  -0.194  -6.822   1.00 22.31 ? 65   VAL B C   1 
ATOM   4094  O  O   . VAL B 1 76  ? 13.409  0.264   -6.781   1.00 23.97 ? 65   VAL B O   1 
ATOM   4095  C  CB  . VAL B 1 76  ? 12.158  -1.316  -4.568   1.00 23.01 ? 65   VAL B CB  1 
ATOM   4096  C  CG1 . VAL B 1 76  ? 11.146  -0.331  -3.999   1.00 20.42 ? 65   VAL B CG1 1 
ATOM   4097  C  CG2 . VAL B 1 76  ? 12.049  -2.681  -3.879   1.00 19.19 ? 65   VAL B CG2 1 
ATOM   4098  N  N   . ILE B 1 77  ? 11.314  0.373   -7.524   1.00 21.96 ? 66   ILE B N   1 
ATOM   4099  C  CA  . ILE B 1 77  ? 11.582  1.478   -8.442   1.00 21.74 ? 66   ILE B CA  1 
ATOM   4100  C  C   . ILE B 1 77  ? 10.640  2.616   -8.101   1.00 21.39 ? 66   ILE B C   1 
ATOM   4101  O  O   . ILE B 1 77  ? 9.576   2.367   -7.572   1.00 22.34 ? 66   ILE B O   1 
ATOM   4102  C  CB  . ILE B 1 77  ? 11.384  1.059   -9.965   1.00 21.25 ? 66   ILE B CB  1 
ATOM   4103  C  CG1 . ILE B 1 77  ? 9.898   0.806   -10.256  1.00 21.58 ? 66   ILE B CG1 1 
ATOM   4104  C  CG2 . ILE B 1 77  ? 12.273  -0.128  -10.298  1.00 22.65 ? 66   ILE B CG2 1 
ATOM   4105  C  CD1 . ILE B 1 77  ? 9.529   -0.001  -11.525  1.00 20.26 ? 66   ILE B CD1 1 
ATOM   4106  N  N   . PRO B 1 78  ? 11.005  3.857   -8.446   1.00 20.17 ? 67   PRO B N   1 
ATOM   4107  C  CA  . PRO B 1 78  ? 10.027  4.915   -8.261   1.00 20.41 ? 67   PRO B CA  1 
ATOM   4108  C  C   . PRO B 1 78  ? 8.760   4.647   -9.077   1.00 21.02 ? 67   PRO B C   1 
ATOM   4109  O  O   . PRO B 1 78  ? 8.838   4.174   -10.214  1.00 22.62 ? 67   PRO B O   1 
ATOM   4110  C  CB  . PRO B 1 78  ? 10.747  6.186   -8.756   1.00 18.88 ? 67   PRO B CB  1 
ATOM   4111  C  CG  . PRO B 1 78  ? 12.176  5.810   -8.982   1.00 19.33 ? 67   PRO B CG  1 
ATOM   4112  C  CD  . PRO B 1 78  ? 12.275  4.331   -9.029   1.00 20.41 ? 67   PRO B CD  1 
ATOM   4113  N  N   . GLY B 1 79  ? 7.607   4.941   -8.497   1.00 21.09 ? 68   GLY B N   1 
ATOM   4114  C  CA  . GLY B 1 79  ? 6.347   4.885   -9.223   1.00 20.91 ? 68   GLY B CA  1 
ATOM   4115  C  C   . GLY B 1 79  ? 6.452   5.722   -10.482  1.00 20.84 ? 68   GLY B C   1 
ATOM   4116  O  O   . GLY B 1 79  ? 7.096   6.770   -10.478  1.00 23.63 ? 68   GLY B O   1 
ATOM   4117  N  N   . GLY B 1 80  ? 5.859   5.235   -11.559  1.00 19.04 ? 69   GLY B N   1 
ATOM   4118  C  CA  . GLY B 1 80  ? 5.931   5.878   -12.851  1.00 17.71 ? 69   GLY B CA  1 
ATOM   4119  C  C   . GLY B 1 80  ? 5.104   7.144   -12.878  1.00 17.57 ? 69   GLY B C   1 
ATOM   4120  O  O   . GLY B 1 80  ? 4.190   7.318   -12.057  1.00 16.48 ? 69   GLY B O   1 
ATOM   4121  N  N   . ILE B 1 81  ? 5.459   8.034   -13.812  1.00 14.86 ? 70   ILE B N   1 
ATOM   4122  C  CA  . ILE B 1 81  ? 4.742   9.261   -14.083  1.00 13.68 ? 70   ILE B CA  1 
ATOM   4123  C  C   . ILE B 1 81  ? 4.267   9.218   -15.517  1.00 14.20 ? 70   ILE B C   1 
ATOM   4124  O  O   . ILE B 1 81  ? 5.096   9.141   -16.423  1.00 12.41 ? 70   ILE B O   1 
ATOM   4125  C  CB  . ILE B 1 81  ? 5.609   10.511  -13.845  1.00 13.12 ? 70   ILE B CB  1 
ATOM   4126  C  CG1 . ILE B 1 81  ? 6.267   10.440  -12.431  1.00 13.40 ? 70   ILE B CG1 1 
ATOM   4127  C  CG2 . ILE B 1 81  ? 4.728   11.778  -13.971  1.00 11.50 ? 70   ILE B CG2 1 
ATOM   4128  C  CD1 . ILE B 1 81  ? 7.311   11.562  -12.110  1.00 15.05 ? 70   ILE B CD1 1 
ATOM   4129  N  N   . ASP B 1 82  ? 2.939   9.242   -15.713  1.00 15.05 ? 71   ASP B N   1 
ATOM   4130  C  CA  . ASP B 1 82  ? 2.347   9.259   -17.052  1.00 14.70 ? 71   ASP B CA  1 
ATOM   4131  C  C   . ASP B 1 82  ? 2.193   10.712  -17.358  1.00 15.43 ? 71   ASP B C   1 
ATOM   4132  O  O   . ASP B 1 82  ? 1.296   11.364  -16.837  1.00 17.00 ? 71   ASP B O   1 
ATOM   4133  C  CB  . ASP B 1 82  ? 1.007   8.525   -17.088  1.00 16.12 ? 71   ASP B CB  1 
ATOM   4134  C  CG  . ASP B 1 82  ? 0.540   8.200   -18.486  1.00 16.39 ? 71   ASP B CG  1 
ATOM   4135  O  OD1 . ASP B 1 82  ? 0.988   8.852   -19.455  1.00 18.76 ? 71   ASP B OD1 1 
ATOM   4136  O  OD2 . ASP B 1 82  ? -0.285  7.271   -18.627  1.00 25.18 ? 71   ASP B OD2 1 
ATOM   4137  N  N   . VAL B 1 83  ? 3.091   11.234  -18.187  1.00 13.36 ? 72   VAL B N   1 
ATOM   4138  C  CA  . VAL B 1 83  ? 3.107   12.651  -18.522  1.00 12.38 ? 72   VAL B CA  1 
ATOM   4139  C  C   . VAL B 1 83  ? 1.971   13.095  -19.461  1.00 11.83 ? 72   VAL B C   1 
ATOM   4140  O  O   . VAL B 1 83  ? 1.850   14.311  -19.814  1.00 7.55  ? 72   VAL B O   1 
ATOM   4141  C  CB  . VAL B 1 83  ? 4.486   13.040  -19.087  1.00 11.72 ? 72   VAL B CB  1 
ATOM   4142  C  CG1 . VAL B 1 83  ? 5.526   12.778  -18.044  1.00 7.68  ? 72   VAL B CG1 1 
ATOM   4143  C  CG2 . VAL B 1 83  ? 4.846   12.249  -20.334  1.00 12.92 ? 72   VAL B CG2 1 
ATOM   4144  N  N   . HIS B 1 84  ? 1.139   12.120  -19.861  1.00 14.16 ? 73   HIS B N   1 
ATOM   4145  C  CA  . HIS B 1 84  ? 0.053   12.334  -20.841  1.00 14.25 ? 73   HIS B CA  1 
ATOM   4146  C  C   . HIS B 1 84  ? -1.108  11.382  -20.626  1.00 15.86 ? 73   HIS B C   1 
ATOM   4147  O  O   . HIS B 1 84  ? -1.131  10.269  -21.159  1.00 15.34 ? 73   HIS B O   1 
ATOM   4148  C  CB  . HIS B 1 84  ? 0.562   12.135  -22.258  1.00 14.86 ? 73   HIS B CB  1 
ATOM   4149  C  CG  . HIS B 1 84  ? -0.306  12.745  -23.327  1.00 12.23 ? 73   HIS B CG  1 
ATOM   4150  N  ND1 . HIS B 1 84  ? 0.161   12.998  -24.598  1.00 14.01 ? 73   HIS B ND1 1 
ATOM   4151  C  CD2 . HIS B 1 84  ? -1.601  13.140  -23.327  1.00 14.58 ? 73   HIS B CD2 1 
ATOM   4152  C  CE1 . HIS B 1 84  ? -0.805  13.516  -25.335  1.00 10.59 ? 73   HIS B CE1 1 
ATOM   4153  N  NE2 . HIS B 1 84  ? -1.889  13.606  -24.593  1.00 14.41 ? 73   HIS B NE2 1 
ATOM   4154  N  N   . THR B 1 85  ? -2.085  11.838  -19.845  1.00 16.99 ? 74   THR B N   1 
ATOM   4155  C  CA  . THR B 1 85  ? -3.373  11.170  -19.725  1.00 16.55 ? 74   THR B CA  1 
ATOM   4156  C  C   . THR B 1 85  ? -4.501  12.094  -20.155  1.00 16.39 ? 74   THR B C   1 
ATOM   4157  O  O   . THR B 1 85  ? -4.313  13.300  -20.278  1.00 15.52 ? 74   THR B O   1 
ATOM   4158  C  CB  . THR B 1 85  ? -3.603  10.704  -18.271  1.00 17.67 ? 74   THR B CB  1 
ATOM   4159  O  OG1 . THR B 1 85  ? -3.879  11.851  -17.479  1.00 20.06 ? 74   THR B OG1 1 
ATOM   4160  C  CG2 . THR B 1 85  ? -2.367  9.966   -17.742  1.00 18.20 ? 74   THR B CG2 1 
ATOM   4161  N  N   . ARG B 1 86  ? -5.679  11.528  -20.425  1.00 17.88 ? 75   ARG B N   1 
ATOM   4162  C  CA  . ARG B 1 86  ? -6.869  12.336  -20.817  1.00 17.03 ? 75   ARG B CA  1 
ATOM   4163  C  C   . ARG B 1 86  ? -8.168  11.658  -20.341  1.00 17.20 ? 75   ARG B C   1 
ATOM   4164  O  O   . ARG B 1 86  ? -9.051  11.314  -21.114  1.00 14.33 ? 75   ARG B O   1 
ATOM   4165  C  CB  . ARG B 1 86  ? -6.901  12.605  -22.324  1.00 16.51 ? 75   ARG B CB  1 
ATOM   4166  C  CG  . ARG B 1 86  ? -5.679  13.352  -22.817  1.00 16.90 ? 75   ARG B CG  1 
ATOM   4167  C  CD  . ARG B 1 86  ? -5.735  13.676  -24.315  1.00 16.74 ? 75   ARG B CD  1 
ATOM   4168  N  NE  . ARG B 1 86  ? -4.658  14.586  -24.641  1.00 16.71 ? 75   ARG B NE  1 
ATOM   4169  C  CZ  . ARG B 1 86  ? -4.733  15.917  -24.597  1.00 19.78 ? 75   ARG B CZ  1 
ATOM   4170  N  NH1 . ARG B 1 86  ? -5.856  16.547  -24.308  1.00 21.41 ? 75   ARG B NH1 1 
ATOM   4171  N  NH2 . ARG B 1 86  ? -3.668  16.636  -24.902  1.00 24.33 ? 75   ARG B NH2 1 
ATOM   4172  N  N   . PHE B 1 87  ? -8.255  11.493  -19.021  1.00 16.59 ? 76   PHE B N   1 
ATOM   4173  C  CA  . PHE B 1 87  ? -9.377  10.867  -18.375  1.00 17.39 ? 76   PHE B CA  1 
ATOM   4174  C  C   . PHE B 1 87  ? -10.581 11.793  -18.329  1.00 17.60 ? 76   PHE B C   1 
ATOM   4175  O  O   . PHE B 1 87  ? -10.433 12.998  -18.203  1.00 20.04 ? 76   PHE B O   1 
ATOM   4176  C  CB  . PHE B 1 87  ? -8.993  10.469  -16.950  1.00 15.92 ? 76   PHE B CB  1 
ATOM   4177  C  CG  . PHE B 1 87  ? -7.796  9.571   -16.855  1.00 17.78 ? 76   PHE B CG  1 
ATOM   4178  C  CD1 . PHE B 1 87  ? -7.577  8.561   -17.778  1.00 13.56 ? 76   PHE B CD1 1 
ATOM   4179  C  CD2 . PHE B 1 87  ? -6.909  9.692   -15.774  1.00 13.34 ? 76   PHE B CD2 1 
ATOM   4180  C  CE1 . PHE B 1 87  ? -6.510  7.728   -17.646  1.00 16.60 ? 76   PHE B CE1 1 
ATOM   4181  C  CE2 . PHE B 1 87  ? -5.833  8.866   -15.662  1.00 14.89 ? 76   PHE B CE2 1 
ATOM   4182  C  CZ  . PHE B 1 87  ? -5.636  7.863   -16.572  1.00 13.96 ? 76   PHE B CZ  1 
ATOM   4183  N  N   . GLN B 1 88  ? -11.766 11.190  -18.418  1.00 19.09 ? 77   GLN B N   1 
ATOM   4184  C  CA  . GLN B 1 88  ? -13.069 11.831  -18.686  1.00 19.91 ? 77   GLN B CA  1 
ATOM   4185  C  C   . GLN B 1 88  ? -13.052 13.094  -19.564  1.00 21.11 ? 77   GLN B C   1 
ATOM   4186  O  O   . GLN B 1 88  ? -13.824 14.010  -19.357  1.00 23.17 ? 77   GLN B O   1 
ATOM   4187  C  CB  . GLN B 1 88  ? -13.883 12.022  -17.395  1.00 21.38 ? 77   GLN B CB  1 
ATOM   4188  C  CG  . GLN B 1 88  ? -13.505 13.172  -16.524  1.00 20.29 ? 77   GLN B CG  1 
ATOM   4189  C  CD  . GLN B 1 88  ? -14.128 13.061  -15.135  1.00 20.97 ? 77   GLN B CD  1 
ATOM   4190  O  OE1 . GLN B 1 88  ? -13.778 12.187  -14.358  1.00 22.90 ? 77   GLN B OE1 1 
ATOM   4191  N  NE2 . GLN B 1 88  ? -15.051 13.960  -14.824  1.00 24.09 ? 77   GLN B NE2 1 
ATOM   4192  N  N   . MET B 1 89  ? -12.188 13.123  -20.572  1.00 21.48 ? 78   MET B N   1 
ATOM   4193  C  CA  . MET B 1 89  ? -12.088 14.285  -21.437  1.00 20.99 ? 78   MET B CA  1 
ATOM   4194  C  C   . MET B 1 89  ? -13.368 14.387  -22.236  1.00 20.65 ? 78   MET B C   1 
ATOM   4195  O  O   . MET B 1 89  ? -13.838 13.372  -22.734  1.00 19.91 ? 78   MET B O   1 
ATOM   4196  C  CB  . MET B 1 89  ? -10.940 14.151  -22.419  1.00 20.76 ? 78   MET B CB  1 
ATOM   4197  C  CG  . MET B 1 89  ? -10.770 15.366  -23.315  1.00 20.63 ? 78   MET B CG  1 
ATOM   4198  S  SD  . MET B 1 89  ? -9.562  15.080  -24.575  1.00 22.68 ? 78   MET B SD  1 
ATOM   4199  C  CE  . MET B 1 89  ? -10.543 14.765  -26.060  1.00 18.44 ? 78   MET B CE  1 
ATOM   4200  N  N   . PRO B 1 90  ? -13.937 15.608  -22.353  1.00 21.10 ? 79   PRO B N   1 
ATOM   4201  C  CA  . PRO B 1 90  ? -15.074 15.782  -23.241  1.00 20.22 ? 79   PRO B CA  1 
ATOM   4202  C  C   . PRO B 1 90  ? -14.609 15.793  -24.666  1.00 19.94 ? 79   PRO B C   1 
ATOM   4203  O  O   . PRO B 1 90  ? -13.542 16.339  -24.951  1.00 19.71 ? 79   PRO B O   1 
ATOM   4204  C  CB  . PRO B 1 90  ? -15.570 17.206  -22.912  1.00 21.78 ? 79   PRO B CB  1 
ATOM   4205  C  CG  . PRO B 1 90  ? -14.932 17.561  -21.636  1.00 20.11 ? 79   PRO B CG  1 
ATOM   4206  C  CD  . PRO B 1 90  ? -13.624 16.874  -21.668  1.00 20.54 ? 79   PRO B CD  1 
ATOM   4207  N  N   . ASP B 1 91  ? -15.441 15.272  -25.548  1.00 18.49 ? 80   ASP B N   1 
ATOM   4208  C  CA  . ASP B 1 91  ? -15.186 15.373  -26.977  1.00 19.33 ? 80   ASP B CA  1 
ATOM   4209  C  C   . ASP B 1 91  ? -16.505 15.290  -27.759  1.00 20.14 ? 80   ASP B C   1 
ATOM   4210  O  O   . ASP B 1 91  ? -17.132 14.231  -27.806  1.00 20.60 ? 80   ASP B O   1 
ATOM   4211  C  CB  . ASP B 1 91  ? -14.255 14.263  -27.414  1.00 17.67 ? 80   ASP B CB  1 
ATOM   4212  C  CG  . ASP B 1 91  ? -13.915 14.346  -28.902  1.00 19.70 ? 80   ASP B CG  1 
ATOM   4213  O  OD1 . ASP B 1 91  ? -14.280 15.387  -29.472  1.00 10.80 ? 80   ASP B OD1 1 
ATOM   4214  O  OD2 . ASP B 1 91  ? -13.268 13.424  -29.450  1.00 21.30 ? 80   ASP B OD2 1 
ATOM   4215  N  N   . GLN B 1 92  ? -16.914 16.401  -28.368  1.00 23.46 ? 81   GLN B N   1 
ATOM   4216  C  CA  . GLN B 1 92  ? -18.088 16.441  -29.270  1.00 24.09 ? 81   GLN B CA  1 
ATOM   4217  C  C   . GLN B 1 92  ? -19.279 15.790  -28.605  1.00 24.60 ? 81   GLN B C   1 
ATOM   4218  O  O   . GLN B 1 92  ? -19.706 14.691  -28.992  1.00 25.84 ? 81   GLN B O   1 
ATOM   4219  C  CB  . GLN B 1 92  ? -17.792 15.745  -30.611  1.00 25.41 ? 81   GLN B CB  1 
ATOM   4220  C  CG  . GLN B 1 92  ? -18.878 16.013  -31.713  1.00 26.01 ? 81   GLN B CG  1 
ATOM   4221  C  CD  . GLN B 1 92  ? -18.523 15.487  -33.113  1.00 26.33 ? 81   GLN B CD  1 
ATOM   4222  O  OE1 . GLN B 1 92  ? -18.755 16.164  -34.119  1.00 31.80 ? 81   GLN B OE1 1 
ATOM   4223  N  NE2 . GLN B 1 92  ? -17.981 14.277  -33.181  1.00 30.46 ? 81   GLN B NE2 1 
ATOM   4224  N  N   . GLY B 1 93  ? -19.768 16.419  -27.542  1.00 25.08 ? 82   GLY B N   1 
ATOM   4225  C  CA  . GLY B 1 93  ? -20.929 15.889  -26.799  1.00 25.16 ? 82   GLY B CA  1 
ATOM   4226  C  C   . GLY B 1 93  ? -20.747 14.631  -25.950  1.00 25.78 ? 82   GLY B C   1 
ATOM   4227  O  O   . GLY B 1 93  ? -21.632 14.287  -25.146  1.00 25.88 ? 82   GLY B O   1 
ATOM   4228  N  N   . MET B 1 94  ? -19.623 13.934  -26.120  1.00 25.28 ? 83   MET B N   1 
ATOM   4229  C  CA  . MET B 1 94  ? -19.355 12.695  -25.387  1.00 24.78 ? 83   MET B CA  1 
ATOM   4230  C  C   . MET B 1 94  ? -18.262 12.921  -24.344  1.00 23.66 ? 83   MET B C   1 
ATOM   4231  O  O   . MET B 1 94  ? -17.484 13.860  -24.464  1.00 24.93 ? 83   MET B O   1 
ATOM   4232  C  CB  . MET B 1 94  ? -18.916 11.602  -26.365  1.00 25.10 ? 83   MET B CB  1 
ATOM   4233  C  CG  . MET B 1 94  ? -20.061 10.933  -27.107  1.00 27.68 ? 83   MET B CG  1 
ATOM   4234  S  SD  . MET B 1 94  ? -19.563 9.820   -28.451  1.00 27.20 ? 83   MET B SD  1 
ATOM   4235  C  CE  . MET B 1 94  ? -19.253 10.967  -29.812  1.00 34.89 ? 83   MET B CE  1 
ATOM   4236  N  N   . THR B 1 95  ? -18.217 12.052  -23.333  1.00 22.30 ? 84   THR B N   1 
ATOM   4237  C  CA  . THR B 1 95  ? -17.146 12.008  -22.320  1.00 21.30 ? 84   THR B CA  1 
ATOM   4238  C  C   . THR B 1 95  ? -16.448 10.617  -22.349  1.00 20.51 ? 84   THR B C   1 
ATOM   4239  O  O   . THR B 1 95  ? -17.104 9.568   -22.395  1.00 18.14 ? 84   THR B O   1 
ATOM   4240  C  CB  . THR B 1 95  ? -17.729 12.239  -20.907  1.00 22.36 ? 84   THR B CB  1 
ATOM   4241  O  OG1 . THR B 1 95  ? -18.674 13.311  -20.958  1.00 24.30 ? 84   THR B OG1 1 
ATOM   4242  C  CG2 . THR B 1 95  ? -16.651 12.547  -19.878  1.00 19.52 ? 84   THR B CG2 1 
ATOM   4243  N  N   . SER B 1 96  ? -15.112 10.627  -22.313  1.00 20.50 ? 85   SER B N   1 
ATOM   4244  C  CA  . SER B 1 96  ? -14.304 9.414   -22.264  1.00 19.87 ? 85   SER B CA  1 
ATOM   4245  C  C   . SER B 1 96  ? -14.862 8.364   -21.289  1.00 19.39 ? 85   SER B C   1 
ATOM   4246  O  O   . SER B 1 96  ? -15.280 8.687   -20.165  1.00 19.64 ? 85   SER B O   1 
ATOM   4247  C  CB  . SER B 1 96  ? -12.832 9.771   -21.926  1.00 20.37 ? 85   SER B CB  1 
ATOM   4248  O  OG  . SER B 1 96  ? -12.028 8.601   -21.723  1.00 22.54 ? 85   SER B OG  1 
ATOM   4249  N  N   . ALA B 1 97  ? -14.857 7.115   -21.756  1.00 18.27 ? 86   ALA B N   1 
ATOM   4250  C  CA  . ALA B 1 97  ? -15.306 5.916   -21.041  1.00 19.00 ? 86   ALA B CA  1 
ATOM   4251  C  C   . ALA B 1 97  ? -14.642 5.654   -19.685  1.00 20.59 ? 86   ALA B C   1 
ATOM   4252  O  O   . ALA B 1 97  ? -15.265 5.072   -18.779  1.00 20.74 ? 86   ALA B O   1 
ATOM   4253  C  CB  . ALA B 1 97  ? -15.077 4.743   -21.917  1.00 17.71 ? 86   ALA B CB  1 
ATOM   4254  N  N   . ASP B 1 98  ? -13.365 6.007   -19.557  1.00 22.56 ? 87   ASP B N   1 
ATOM   4255  C  CA  . ASP B 1 98  ? -12.670 5.900   -18.259  1.00 22.89 ? 87   ASP B CA  1 
ATOM   4256  C  C   . ASP B 1 98  ? -12.491 7.304   -17.684  1.00 23.73 ? 87   ASP B C   1 
ATOM   4257  O  O   . ASP B 1 98  ? -11.959 8.195   -18.363  1.00 24.84 ? 87   ASP B O   1 
ATOM   4258  C  CB  . ASP B 1 98  ? -11.309 5.201   -18.393  1.00 24.03 ? 87   ASP B CB  1 
ATOM   4259  C  CG  . ASP B 1 98  ? -11.411 3.795   -18.957  1.00 24.65 ? 87   ASP B CG  1 
ATOM   4260  O  OD1 . ASP B 1 98  ? -11.987 2.923   -18.290  1.00 25.42 ? 87   ASP B OD1 1 
ATOM   4261  O  OD2 . ASP B 1 98  ? -10.873 3.550   -20.062  1.00 29.39 ? 87   ASP B OD2 1 
ATOM   4262  N  N   . ASP B 1 99  ? -12.951 7.505   -16.447  1.00 23.22 ? 88   ASP B N   1 
ATOM   4263  C  CA  . ASP B 1 99  ? -12.908 8.817   -15.829  1.00 23.22 ? 88   ASP B CA  1 
ATOM   4264  C  C   . ASP B 1 99  ? -11.705 8.930   -14.904  1.00 22.21 ? 88   ASP B C   1 
ATOM   4265  O  O   . ASP B 1 99  ? -10.915 8.021   -14.827  1.00 21.81 ? 88   ASP B O   1 
ATOM   4266  C  CB  . ASP B 1 99  ? -14.263 9.173   -15.140  1.00 23.54 ? 88   ASP B CB  1 
ATOM   4267  C  CG  . ASP B 1 99  ? -14.588 8.307   -13.945  1.00 25.04 ? 88   ASP B CG  1 
ATOM   4268  O  OD1 . ASP B 1 99  ? -13.777 7.419   -13.605  1.00 22.39 ? 88   ASP B OD1 1 
ATOM   4269  O  OD2 . ASP B 1 99  ? -15.682 8.518   -13.365  1.00 22.94 ? 88   ASP B OD2 1 
ATOM   4270  N  N   . PHE B 1 100 ? -11.544 10.050  -14.214  1.00 22.74 ? 89   PHE B N   1 
ATOM   4271  C  CA  . PHE B 1 100 ? -10.396 10.184  -13.322  1.00 23.21 ? 89   PHE B CA  1 
ATOM   4272  C  C   . PHE B 1 100 ? -10.301 9.057   -12.308  1.00 23.21 ? 89   PHE B C   1 
ATOM   4273  O  O   . PHE B 1 100 ? -9.197  8.691   -11.883  1.00 23.86 ? 89   PHE B O   1 
ATOM   4274  C  CB  . PHE B 1 100 ? -10.335 11.565  -12.645  1.00 23.88 ? 89   PHE B CB  1 
ATOM   4275  C  CG  . PHE B 1 100 ? -9.648  12.615  -13.486  1.00 24.16 ? 89   PHE B CG  1 
ATOM   4276  C  CD1 . PHE B 1 100 ? -8.258  12.636  -13.583  1.00 24.35 ? 89   PHE B CD1 1 
ATOM   4277  C  CD2 . PHE B 1 100 ? -10.385 13.562  -14.186  1.00 21.13 ? 89   PHE B CD2 1 
ATOM   4278  C  CE1 . PHE B 1 100 ? -7.620  13.579  -14.352  1.00 23.46 ? 89   PHE B CE1 1 
ATOM   4279  C  CE2 . PHE B 1 100 ? -9.766  14.507  -14.953  1.00 22.09 ? 89   PHE B CE2 1 
ATOM   4280  C  CZ  . PHE B 1 100 ? -8.379  14.521  -15.055  1.00 24.41 ? 89   PHE B CZ  1 
ATOM   4281  N  N   . PHE B 1 101 ? -11.423 8.476   -11.918  1.00 22.76 ? 90   PHE B N   1 
ATOM   4282  C  CA  . PHE B 1 101 ? -11.346 7.376   -10.972  1.00 23.37 ? 90   PHE B CA  1 
ATOM   4283  C  C   . PHE B 1 101 ? -10.850 6.085   -11.649  1.00 25.22 ? 90   PHE B C   1 
ATOM   4284  O  O   . PHE B 1 101 ? -9.806  5.524   -11.285  1.00 25.98 ? 90   PHE B O   1 
ATOM   4285  C  CB  . PHE B 1 101 ? -12.688 7.094   -10.316  1.00 22.32 ? 90   PHE B CB  1 
ATOM   4286  C  CG  . PHE B 1 101 ? -12.654 5.870   -9.475   1.00 20.19 ? 90   PHE B CG  1 
ATOM   4287  C  CD1 . PHE B 1 101 ? -11.954 5.866   -8.280   1.00 20.30 ? 90   PHE B CD1 1 
ATOM   4288  C  CD2 . PHE B 1 101 ? -13.248 4.715   -9.886   1.00 19.67 ? 90   PHE B CD2 1 
ATOM   4289  C  CE1 . PHE B 1 101 ? -11.874 4.749   -7.516   1.00 15.46 ? 90   PHE B CE1 1 
ATOM   4290  C  CE2 . PHE B 1 101 ? -13.175 3.579   -9.096   1.00 19.22 ? 90   PHE B CE2 1 
ATOM   4291  C  CZ  . PHE B 1 101 ? -12.476 3.609   -7.914   1.00 18.72 ? 90   PHE B CZ  1 
ATOM   4292  N  N   . GLN B 1 102 ? -11.619 5.603   -12.624  1.00 26.75 ? 91   GLN B N   1 
ATOM   4293  C  CA  . GLN B 1 102 ? -11.256 4.396   -13.358  1.00 26.48 ? 91   GLN B CA  1 
ATOM   4294  C  C   . GLN B 1 102 ? -9.874  4.508   -14.010  1.00 26.82 ? 91   GLN B C   1 
ATOM   4295  O  O   . GLN B 1 102 ? -9.100  3.547   -13.987  1.00 26.84 ? 91   GLN B O   1 
ATOM   4296  C  CB  . GLN B 1 102 ? -12.320 4.050   -14.407  1.00 27.32 ? 91   GLN B CB  1 
ATOM   4297  C  CG  . GLN B 1 102 ? -13.332 3.005   -13.935  1.00 31.54 ? 91   GLN B CG  1 
ATOM   4298  C  CD  . GLN B 1 102 ? -12.678 1.711   -13.487  1.00 33.34 ? 91   GLN B CD  1 
ATOM   4299  O  OE1 . GLN B 1 102 ? -11.699 1.267   -14.080  1.00 37.30 ? 91   GLN B OE1 1 
ATOM   4300  N  NE2 . GLN B 1 102 ? -13.202 1.112   -12.418  1.00 35.66 ? 91   GLN B NE2 1 
ATOM   4301  N  N   . GLY B 1 103 ? -9.572  5.678   -14.575  1.00 26.31 ? 92   GLY B N   1 
ATOM   4302  C  CA  . GLY B 1 103 ? -8.283  5.922   -15.242  1.00 25.58 ? 92   GLY B CA  1 
ATOM   4303  C  C   . GLY B 1 103 ? -7.063  5.885   -14.337  1.00 24.63 ? 92   GLY B C   1 
ATOM   4304  O  O   . GLY B 1 103 ? -6.013  5.350   -14.713  1.00 24.78 ? 92   GLY B O   1 
ATOM   4305  N  N   . THR B 1 104 ? -7.204  6.453   -13.137  1.00 25.06 ? 93   THR B N   1 
ATOM   4306  C  CA  . THR B 1 104 ? -6.112  6.485   -12.171  1.00 23.05 ? 93   THR B CA  1 
ATOM   4307  C  C   . THR B 1 104 ? -6.083  5.185   -11.380  1.00 22.31 ? 93   THR B C   1 
ATOM   4308  O  O   . THR B 1 104 ? -5.066  4.812   -10.822  1.00 20.68 ? 93   THR B O   1 
ATOM   4309  C  CB  . THR B 1 104 ? -6.158  7.757   -11.290  1.00 23.49 ? 93   THR B CB  1 
ATOM   4310  O  OG1 . THR B 1 104 ? -7.213  7.680   -10.336  1.00 25.10 ? 93   THR B OG1 1 
ATOM   4311  C  CG2 . THR B 1 104 ? -6.344  8.984   -12.139  1.00 22.62 ? 93   THR B CG2 1 
ATOM   4312  N  N   . LYS B 1 105 ? -7.208  4.476   -11.356  1.00 22.43 ? 94   LYS B N   1 
ATOM   4313  C  CA  . LYS B 1 105 ? -7.202  3.072   -11.009  1.00 21.61 ? 94   LYS B CA  1 
ATOM   4314  C  C   . LYS B 1 105 ? -6.455  2.218   -12.063  1.00 20.24 ? 94   LYS B C   1 
ATOM   4315  O  O   . LYS B 1 105 ? -5.635  1.396   -11.712  1.00 20.31 ? 94   LYS B O   1 
ATOM   4316  C  CB  . LYS B 1 105 ? -8.631  2.567   -10.832  1.00 22.74 ? 94   LYS B CB  1 
ATOM   4317  C  CG  . LYS B 1 105 ? -8.660  1.159   -10.269  1.00 24.10 ? 94   LYS B CG  1 
ATOM   4318  C  CD  . LYS B 1 105 ? -10.015 0.539   -10.343  1.00 24.40 ? 94   LYS B CD  1 
ATOM   4319  C  CE  . LYS B 1 105 ? -10.096 -0.659  -9.419   1.00 26.89 ? 94   LYS B CE  1 
ATOM   4320  N  NZ  . LYS B 1 105 ? -11.514 -1.109  -9.322   1.00 27.96 ? 94   LYS B NZ  1 
ATOM   4321  N  N   . ALA B 1 106 ? -6.725  2.406   -13.360  1.00 19.18 ? 95   ALA B N   1 
ATOM   4322  C  CA  . ALA B 1 106 ? -6.045  1.608   -14.366  1.00 17.84 ? 95   ALA B CA  1 
ATOM   4323  C  C   . ALA B 1 106 ? -4.543  1.788   -14.177  1.00 17.49 ? 95   ALA B C   1 
ATOM   4324  O  O   . ALA B 1 106 ? -3.771  0.818   -14.118  1.00 19.01 ? 95   ALA B O   1 
ATOM   4325  C  CB  . ALA B 1 106 ? -6.485  2.036   -15.803  1.00 16.52 ? 95   ALA B CB  1 
ATOM   4326  N  N   . ALA B 1 107 ? -4.153  3.045   -14.000  1.00 17.09 ? 96   ALA B N   1 
ATOM   4327  C  CA  . ALA B 1 107 ? -2.766  3.435   -13.865  1.00 15.84 ? 96   ALA B CA  1 
ATOM   4328  C  C   . ALA B 1 107 ? -2.034  2.883   -12.619  1.00 14.56 ? 96   ALA B C   1 
ATOM   4329  O  O   . ALA B 1 107 ? -0.875  2.463   -12.726  1.00 11.86 ? 96   ALA B O   1 
ATOM   4330  C  CB  . ALA B 1 107 ? -2.666  4.956   -13.938  1.00 14.36 ? 96   ALA B CB  1 
ATOM   4331  N  N   . LEU B 1 108 ? -2.647  2.886   -11.441  1.00 15.23 ? 97   LEU B N   1 
ATOM   4332  C  CA  . LEU B 1 108 ? -1.964  2.293   -10.289  1.00 17.78 ? 97   LEU B CA  1 
ATOM   4333  C  C   . LEU B 1 108 ? -1.811  0.780   -10.497  1.00 19.67 ? 97   LEU B C   1 
ATOM   4334  O  O   . LEU B 1 108 ? -0.832  0.170   -10.053  1.00 21.78 ? 97   LEU B O   1 
ATOM   4335  C  CB  . LEU B 1 108 ? -2.685  2.587   -8.977   1.00 18.26 ? 97   LEU B CB  1 
ATOM   4336  C  CG  . LEU B 1 108 ? -2.792  4.065   -8.615   1.00 19.85 ? 97   LEU B CG  1 
ATOM   4337  C  CD1 . LEU B 1 108 ? -3.860  4.303   -7.513   1.00 17.90 ? 97   LEU B CD1 1 
ATOM   4338  C  CD2 . LEU B 1 108 ? -1.437  4.607   -8.187   1.00 23.99 ? 97   LEU B CD2 1 
ATOM   4339  N  N   . ALA B 1 109 ? -2.785  0.191   -11.196  1.00 22.50 ? 98   ALA B N   1 
ATOM   4340  C  CA  . ALA B 1 109 ? -2.747  -1.214  -11.632  1.00 21.78 ? 98   ALA B CA  1 
ATOM   4341  C  C   . ALA B 1 109 ? -1.442  -1.559  -12.311  1.00 22.92 ? 98   ALA B C   1 
ATOM   4342  O  O   . ALA B 1 109 ? -0.887  -2.629  -12.070  1.00 23.79 ? 98   ALA B O   1 
ATOM   4343  C  CB  . ALA B 1 109 ? -3.915  -1.515  -12.560  1.00 22.97 ? 98   ALA B CB  1 
ATOM   4344  N  N   . GLY B 1 110 ? -0.945  -0.644  -13.140  1.00 22.67 ? 99   GLY B N   1 
ATOM   4345  C  CA  . GLY B 1 110 ? 0.240   -0.900  -13.965  1.00 22.50 ? 99   GLY B CA  1 
ATOM   4346  C  C   . GLY B 1 110 ? 1.590   -0.408  -13.443  1.00 21.75 ? 99   GLY B C   1 
ATOM   4347  O  O   . GLY B 1 110 ? 2.608   -0.584  -14.124  1.00 20.65 ? 99   GLY B O   1 
ATOM   4348  N  N   . GLY B 1 111 ? 1.612   0.209   -12.260  1.00 21.89 ? 100  GLY B N   1 
ATOM   4349  C  CA  . GLY B 1 111 ? 2.852   0.734   -11.677  1.00 21.27 ? 100  GLY B CA  1 
ATOM   4350  C  C   . GLY B 1 111 ? 3.092   2.232   -11.844  1.00 20.48 ? 100  GLY B C   1 
ATOM   4351  O  O   . GLY B 1 111 ? 4.229   2.691   -11.723  1.00 19.94 ? 100  GLY B O   1 
ATOM   4352  N  N   . THR B 1 112 ? 2.027   2.988   -12.111  1.00 19.90 ? 101  THR B N   1 
ATOM   4353  C  CA  . THR B 1 112 ? 2.078   4.464   -12.231  1.00 20.26 ? 101  THR B CA  1 
ATOM   4354  C  C   . THR B 1 112 ? 1.317   5.128   -11.076  1.00 19.62 ? 101  THR B C   1 
ATOM   4355  O  O   . THR B 1 112 ? 0.183   4.756   -10.765  1.00 18.20 ? 101  THR B O   1 
ATOM   4356  C  CB  . THR B 1 112 ? 1.494   4.933   -13.592  1.00 20.74 ? 101  THR B CB  1 
ATOM   4357  O  OG1 . THR B 1 112 ? 2.337   4.446   -14.663  1.00 23.87 ? 101  THR B OG1 1 
ATOM   4358  C  CG2 . THR B 1 112 ? 1.397   6.458   -13.674  1.00 18.59 ? 101  THR B CG2 1 
ATOM   4359  N  N   . THR B 1 113 ? 1.969   6.080   -10.422  1.00 20.30 ? 102  THR B N   1 
ATOM   4360  C  CA  . THR B 1 113 ? 1.499   6.664   -9.148   1.00 19.99 ? 102  THR B CA  1 
ATOM   4361  C  C   . THR B 1 113 ? 1.361   8.199   -9.213   1.00 18.69 ? 102  THR B C   1 
ATOM   4362  O  O   . THR B 1 113 ? 0.973   8.867   -8.246   1.00 14.75 ? 102  THR B O   1 
ATOM   4363  C  CB  . THR B 1 113 ? 2.457   6.271   -7.992   1.00 20.87 ? 102  THR B CB  1 
ATOM   4364  O  OG1 . THR B 1 113 ? 3.788   6.709   -8.317   1.00 25.91 ? 102  THR B OG1 1 
ATOM   4365  C  CG2 . THR B 1 113 ? 2.461   4.738   -7.775   1.00 20.26 ? 102  THR B CG2 1 
ATOM   4366  N  N   . MET B 1 114 ? 1.691   8.760   -10.367  1.00 18.52 ? 103  MET B N   1 
ATOM   4367  C  CA  . MET B 1 114 ? 1.366   10.130  -10.674  1.00 18.69 ? 103  MET B CA  1 
ATOM   4368  C  C   . MET B 1 114 ? 0.968   10.202  -12.155  1.00 17.33 ? 103  MET B C   1 
ATOM   4369  O  O   . MET B 1 114 ? 1.608   9.574   -12.995  1.00 19.69 ? 103  MET B O   1 
ATOM   4370  C  CB  . MET B 1 114 ? 2.538   11.056  -10.409  1.00 18.37 ? 103  MET B CB  1 
ATOM   4371  C  CG  . MET B 1 114 ? 2.223   12.476  -10.879  1.00 20.49 ? 103  MET B CG  1 
ATOM   4372  S  SD  . MET B 1 114 ? 3.112   13.812  -10.110  1.00 24.70 ? 103  MET B SD  1 
ATOM   4373  C  CE  . MET B 1 114 ? 2.448   15.217  -11.025  1.00 15.59 ? 103  MET B CE  1 
ATOM   4374  N  N   . ILE B 1 115 ? -0.090  10.949  -12.444  1.00 16.93 ? 104  ILE B N   1 
ATOM   4375  C  CA  . ILE B 1 115 ? -0.537  11.198  -13.837  1.00 14.57 ? 104  ILE B CA  1 
ATOM   4376  C  C   . ILE B 1 115 ? -0.541  12.703  -14.049  1.00 15.00 ? 104  ILE B C   1 
ATOM   4377  O  O   . ILE B 1 115 ? -0.733  13.474  -13.102  1.00 13.92 ? 104  ILE B O   1 
ATOM   4378  C  CB  . ILE B 1 115 ? -1.941  10.557  -14.187  1.00 14.61 ? 104  ILE B CB  1 
ATOM   4379  C  CG1 . ILE B 1 115 ? -3.094  11.094  -13.311  1.00 14.32 ? 104  ILE B CG1 1 
ATOM   4380  C  CG2 . ILE B 1 115 ? -1.891  9.023   -14.140  1.00 10.37 ? 104  ILE B CG2 1 
ATOM   4381  C  CD1 . ILE B 1 115 ? -3.693  12.457  -13.773  1.00 14.05 ? 104  ILE B CD1 1 
ATOM   4382  N  N   . ILE B 1 116 ? -0.278  13.137  -15.280  1.00 12.88 ? 105  ILE B N   1 
ATOM   4383  C  CA  . ILE B 1 116 ? -0.397  14.546  -15.602  1.00 13.25 ? 105  ILE B CA  1 
ATOM   4384  C  C   . ILE B 1 116 ? -1.405  14.584  -16.729  1.00 14.50 ? 105  ILE B C   1 
ATOM   4385  O  O   . ILE B 1 116 ? -1.157  14.024  -17.800  1.00 16.90 ? 105  ILE B O   1 
ATOM   4386  C  CB  . ILE B 1 116 ? 0.943   15.219  -16.035  1.00 12.40 ? 105  ILE B CB  1 
ATOM   4387  C  CG1 . ILE B 1 116 ? 2.140   14.664  -15.260  1.00 7.62  ? 105  ILE B CG1 1 
ATOM   4388  C  CG2 . ILE B 1 116 ? 0.828   16.769  -16.020  1.00 11.38 ? 105  ILE B CG2 1 
ATOM   4389  C  CD1 . ILE B 1 116 ? 3.474   15.310  -15.626  1.00 10.30 ? 105  ILE B CD1 1 
ATOM   4390  N  N   . ASP B 1 117 ? -2.534  15.239  -16.469  1.00 14.35 ? 106  ASP B N   1 
ATOM   4391  C  CA  . ASP B 1 117 ? -3.673  15.267  -17.373  1.00 15.12 ? 106  ASP B CA  1 
ATOM   4392  C  C   . ASP B 1 117 ? -3.724  16.578  -18.172  1.00 13.61 ? 106  ASP B C   1 
ATOM   4393  O  O   . ASP B 1 117 ? -2.856  17.406  -18.032  1.00 10.57 ? 106  ASP B O   1 
ATOM   4394  C  CB  . ASP B 1 117 ? -4.969  15.032  -16.555  1.00 15.24 ? 106  ASP B CB  1 
ATOM   4395  C  CG  . ASP B 1 117 ? -6.015  14.232  -17.308  1.00 17.63 ? 106  ASP B CG  1 
ATOM   4396  O  OD1 . ASP B 1 117 ? -6.119  13.016  -17.078  1.00 22.79 ? 106  ASP B OD1 1 
ATOM   4397  O  OD2 . ASP B 1 117 ? -6.745  14.826  -18.122  1.00 21.31 ? 106  ASP B OD2 1 
ATOM   4398  N  N   . HIS B 1 118 ? -4.725  16.726  -19.043  1.00 15.73 ? 107  HIS B N   1 
ATOM   4399  C  CA  . HIS B 1 118 ? -4.797  17.817  -20.023  1.00 15.87 ? 107  HIS B CA  1 
ATOM   4400  C  C   . HIS B 1 118 ? -6.139  18.577  -19.964  1.00 17.28 ? 107  HIS B C   1 
ATOM   4401  O  O   . HIS B 1 118 ? -7.190  18.111  -20.491  1.00 16.85 ? 107  HIS B O   1 
ATOM   4402  C  CB  . HIS B 1 118 ? -4.607  17.272  -21.471  1.00 17.26 ? 107  HIS B CB  1 
ATOM   4403  C  CG  . HIS B 1 118 ? -3.171  17.153  -21.913  1.00 17.20 ? 107  HIS B CG  1 
ATOM   4404  N  ND1 . HIS B 1 118 ? -2.408  18.240  -22.288  1.00 14.27 ? 107  HIS B ND1 1 
ATOM   4405  C  CD2 . HIS B 1 118 ? -2.380  16.061  -22.083  1.00 16.07 ? 107  HIS B CD2 1 
ATOM   4406  C  CE1 . HIS B 1 118 ? -1.205  17.824  -22.651  1.00 17.04 ? 107  HIS B CE1 1 
ATOM   4407  N  NE2 . HIS B 1 118 ? -1.164  16.507  -22.542  1.00 15.81 ? 107  HIS B NE2 1 
ATOM   4408  N  N   . VAL B 1 119 ? -6.088  19.767  -19.347  1.00 17.12 ? 108  VAL B N   1 
ATOM   4409  C  CA  . VAL B 1 119 ? -7.232  20.707  -19.302  1.00 16.12 ? 108  VAL B CA  1 
ATOM   4410  C  C   . VAL B 1 119 ? -7.574  21.207  -20.717  1.00 16.46 ? 108  VAL B C   1 
ATOM   4411  O  O   . VAL B 1 119 ? -6.732  21.770  -21.398  1.00 16.94 ? 108  VAL B O   1 
ATOM   4412  C  CB  . VAL B 1 119 ? -6.955  21.912  -18.359  1.00 14.85 ? 108  VAL B CB  1 
ATOM   4413  C  CG1 . VAL B 1 119 ? -7.974  22.979  -18.555  1.00 11.97 ? 108  VAL B CG1 1 
ATOM   4414  C  CG2 . VAL B 1 119 ? -6.945  21.438  -16.910  1.00 8.90  ? 108  VAL B CG2 1 
ATOM   4415  N  N   . VAL B 1 120 ? -8.824  21.013  -21.129  1.00 17.17 ? 109  VAL B N   1 
ATOM   4416  C  CA  . VAL B 1 120 ? -9.263  21.376  -22.488  1.00 18.08 ? 109  VAL B CA  1 
ATOM   4417  C  C   . VAL B 1 120 ? -10.464 22.320  -22.350  1.00 18.59 ? 109  VAL B C   1 
ATOM   4418  O  O   . VAL B 1 120 ? -11.583 21.882  -22.094  1.00 18.52 ? 109  VAL B O   1 
ATOM   4419  C  CB  . VAL B 1 120 ? -9.638  20.146  -23.307  1.00 16.58 ? 109  VAL B CB  1 
ATOM   4420  C  CG1 . VAL B 1 120 ? -9.790  20.510  -24.821  1.00 17.63 ? 109  VAL B CG1 1 
ATOM   4421  C  CG2 . VAL B 1 120 ? -8.616  19.055  -23.107  1.00 18.07 ? 109  VAL B CG2 1 
ATOM   4422  N  N   . PRO B 1 121 ? -10.227 23.630  -22.495  1.00 21.04 ? 110  PRO B N   1 
ATOM   4423  C  CA  . PRO B 1 121 ? -11.311 24.609  -22.586  1.00 22.08 ? 110  PRO B CA  1 
ATOM   4424  C  C   . PRO B 1 121 ? -11.973 24.685  -23.963  1.00 24.51 ? 110  PRO B C   1 
ATOM   4425  O  O   . PRO B 1 121 ? -11.299 24.843  -24.989  1.00 24.70 ? 110  PRO B O   1 
ATOM   4426  C  CB  . PRO B 1 121 ? -10.623 25.933  -22.278  1.00 21.79 ? 110  PRO B CB  1 
ATOM   4427  C  CG  . PRO B 1 121 ? -9.166  25.618  -22.092  1.00 22.02 ? 110  PRO B CG  1 
ATOM   4428  C  CD  . PRO B 1 121 ? -8.909  24.268  -22.599  1.00 20.61 ? 110  PRO B CD  1 
ATOM   4429  N  N   . GLU B 1 122 ? -13.297 24.596  -23.982  1.00 27.47 ? 111  GLU B N   1 
ATOM   4430  C  CA  . GLU B 1 122 ? -14.038 24.831  -25.201  1.00 28.05 ? 111  GLU B CA  1 
ATOM   4431  C  C   . GLU B 1 122 ? -13.620 26.206  -25.715  1.00 29.46 ? 111  GLU B C   1 
ATOM   4432  O  O   . GLU B 1 122 ? -13.541 27.157  -24.935  1.00 29.82 ? 111  GLU B O   1 
ATOM   4433  C  CB  . GLU B 1 122 ? -15.537 24.774  -24.915  1.00 29.22 ? 111  GLU B CB  1 
ATOM   4434  C  CG  . GLU B 1 122 ? -16.435 25.069  -26.093  1.00 30.61 ? 111  GLU B CG  1 
ATOM   4435  C  CD  . GLU B 1 122 ? -16.338 24.023  -27.202  1.00 35.22 ? 111  GLU B CD  1 
ATOM   4436  O  OE1 . GLU B 1 122 ? -16.060 22.838  -26.905  1.00 41.63 ? 111  GLU B OE1 1 
ATOM   4437  O  OE2 . GLU B 1 122 ? -16.537 24.382  -28.379  1.00 37.59 ? 111  GLU B OE2 1 
ATOM   4438  N  N   . PRO B 1 123 ? -13.299 26.308  -27.022  1.00 30.03 ? 112  PRO B N   1 
ATOM   4439  C  CA  . PRO B 1 123 ? -12.944 27.585  -27.639  1.00 30.85 ? 112  PRO B CA  1 
ATOM   4440  C  C   . PRO B 1 123 ? -13.905 28.702  -27.283  1.00 31.84 ? 112  PRO B C   1 
ATOM   4441  O  O   . PRO B 1 123 ? -15.108 28.552  -27.425  1.00 33.21 ? 112  PRO B O   1 
ATOM   4442  C  CB  . PRO B 1 123 ? -13.023 27.288  -29.139  1.00 29.97 ? 112  PRO B CB  1 
ATOM   4443  C  CG  . PRO B 1 123 ? -12.787 25.858  -29.256  1.00 29.47 ? 112  PRO B CG  1 
ATOM   4444  C  CD  . PRO B 1 123 ? -13.216 25.202  -27.990  1.00 30.59 ? 112  PRO B CD  1 
ATOM   4445  N  N   . GLY B 1 124 ? -13.362 29.810  -26.813  1.00 32.74 ? 113  GLY B N   1 
ATOM   4446  C  CA  . GLY B 1 124 ? -14.161 30.935  -26.426  1.00 32.48 ? 113  GLY B CA  1 
ATOM   4447  C  C   . GLY B 1 124 ? -14.295 31.038  -24.926  1.00 33.39 ? 113  GLY B C   1 
ATOM   4448  O  O   . GLY B 1 124 ? -14.789 32.059  -24.445  1.00 35.37 ? 113  GLY B O   1 
ATOM   4449  N  N   . THR B 1 125 ? -13.865 30.015  -24.174  1.00 32.54 ? 114  THR B N   1 
ATOM   4450  C  CA  . THR B 1 125 ? -13.967 30.064  -22.708  1.00 31.45 ? 114  THR B CA  1 
ATOM   4451  C  C   . THR B 1 125 ? -12.623 30.207  -21.984  1.00 30.22 ? 114  THR B C   1 
ATOM   4452  O  O   . THR B 1 125 ? -11.543 29.981  -22.537  1.00 29.59 ? 114  THR B O   1 
ATOM   4453  C  CB  . THR B 1 125 ? -14.705 28.836  -22.102  1.00 33.03 ? 114  THR B CB  1 
ATOM   4454  O  OG1 . THR B 1 125 ? -13.833 27.697  -22.081  1.00 34.89 ? 114  THR B OG1 1 
ATOM   4455  C  CG2 . THR B 1 125 ? -15.996 28.536  -22.860  1.00 32.71 ? 114  THR B CG2 1 
ATOM   4456  N  N   . SER B 1 126 ? -12.703 30.553  -20.708  1.00 28.64 ? 115  SER B N   1 
ATOM   4457  C  CA  . SER B 1 126 ? -11.519 30.929  -19.983  1.00 27.33 ? 115  SER B CA  1 
ATOM   4458  C  C   . SER B 1 126 ? -10.723 29.699  -19.557  1.00 26.07 ? 115  SER B C   1 
ATOM   4459  O  O   . SER B 1 126 ? -11.281 28.750  -19.013  1.00 26.18 ? 115  SER B O   1 
ATOM   4460  C  CB  . SER B 1 126 ? -11.898 31.822  -18.792  1.00 27.05 ? 115  SER B CB  1 
ATOM   4461  O  OG  . SER B 1 126 ? -11.841 31.137  -17.575  1.00 26.86 ? 115  SER B OG  1 
ATOM   4462  N  N   . LEU B 1 127 ? -9.414  29.735  -19.797  1.00 25.02 ? 116  LEU B N   1 
ATOM   4463  C  CA  . LEU B 1 127 ? -8.498  28.715  -19.287  1.00 25.10 ? 116  LEU B CA  1 
ATOM   4464  C  C   . LEU B 1 127 ? -8.662  28.506  -17.795  1.00 23.99 ? 116  LEU B C   1 
ATOM   4465  O  O   . LEU B 1 127 ? -8.569  27.380  -17.307  1.00 24.75 ? 116  LEU B O   1 
ATOM   4466  C  CB  . LEU B 1 127 ? -7.034  29.097  -19.539  1.00 25.20 ? 116  LEU B CB  1 
ATOM   4467  C  CG  . LEU B 1 127 ? -6.573  29.222  -20.992  1.00 25.84 ? 116  LEU B CG  1 
ATOM   4468  C  CD1 . LEU B 1 127 ? -5.062  29.326  -21.047  1.00 24.70 ? 116  LEU B CD1 1 
ATOM   4469  C  CD2 . LEU B 1 127 ? -7.052  28.052  -21.807  1.00 24.82 ? 116  LEU B CD2 1 
ATOM   4470  N  N   . LEU B 1 128 ? -8.896  29.591  -17.070  1.00 23.85 ? 117  LEU B N   1 
ATOM   4471  C  CA  . LEU B 1 128 ? -9.028  29.530  -15.601  1.00 23.03 ? 117  LEU B CA  1 
ATOM   4472  C  C   . LEU B 1 128 ? -10.260 28.731  -15.185  1.00 22.53 ? 117  LEU B C   1 
ATOM   4473  O  O   . LEU B 1 128 ? -10.219 27.903  -14.271  1.00 20.25 ? 117  LEU B O   1 
ATOM   4474  C  CB  . LEU B 1 128 ? -9.151  30.945  -15.053  1.00 23.04 ? 117  LEU B CB  1 
ATOM   4475  C  CG  . LEU B 1 128 ? -7.879  31.739  -14.790  1.00 23.93 ? 117  LEU B CG  1 
ATOM   4476  C  CD1 . LEU B 1 128 ? -6.999  31.879  -16.058  1.00 23.96 ? 117  LEU B CD1 1 
ATOM   4477  C  CD2 . LEU B 1 128 ? -8.298  33.118  -14.242  1.00 24.17 ? 117  LEU B CD2 1 
ATOM   4478  N  N   . ALA B 1 129 ? -11.373 29.001  -15.851  1.00 22.12 ? 118  ALA B N   1 
ATOM   4479  C  CA  . ALA B 1 129 ? -12.600 28.294  -15.548  1.00 23.25 ? 118  ALA B CA  1 
ATOM   4480  C  C   . ALA B 1 129 ? -12.396 26.831  -15.927  1.00 23.68 ? 118  ALA B C   1 
ATOM   4481  O  O   . ALA B 1 129 ? -12.669 25.940  -15.126  1.00 23.69 ? 118  ALA B O   1 
ATOM   4482  C  CB  . ALA B 1 129 ? -13.771 28.903  -16.275  1.00 22.73 ? 118  ALA B CB  1 
ATOM   4483  N  N   . ALA B 1 130 ? -11.889 26.590  -17.136  1.00 23.39 ? 119  ALA B N   1 
ATOM   4484  C  CA  . ALA B 1 130 ? -11.460 25.262  -17.540  1.00 22.89 ? 119  ALA B CA  1 
ATOM   4485  C  C   . ALA B 1 130 ? -10.654 24.579  -16.440  1.00 23.43 ? 119  ALA B C   1 
ATOM   4486  O  O   . ALA B 1 130 ? -10.999 23.485  -15.978  1.00 25.20 ? 119  ALA B O   1 
ATOM   4487  C  CB  . ALA B 1 130 ? -10.619 25.372  -18.774  1.00 22.94 ? 119  ALA B CB  1 
ATOM   4488  N  N   . PHE B 1 131 ? -9.550  25.199  -16.051  1.00 22.77 ? 120  PHE B N   1 
ATOM   4489  C  CA  . PHE B 1 131 ? -8.663  24.604  -15.046  1.00 23.19 ? 120  PHE B CA  1 
ATOM   4490  C  C   . PHE B 1 131 ? -9.446  24.305  -13.774  1.00 23.17 ? 120  PHE B C   1 
ATOM   4491  O  O   . PHE B 1 131 ? -9.186  23.306  -13.095  1.00 24.98 ? 120  PHE B O   1 
ATOM   4492  C  CB  . PHE B 1 131 ? -7.477  25.533  -14.726  1.00 21.46 ? 120  PHE B CB  1 
ATOM   4493  C  CG  . PHE B 1 131 ? -6.540  24.988  -13.682  1.00 21.45 ? 120  PHE B CG  1 
ATOM   4494  C  CD1 . PHE B 1 131 ? -5.450  24.203  -14.046  1.00 18.07 ? 120  PHE B CD1 1 
ATOM   4495  C  CD2 . PHE B 1 131 ? -6.753  25.255  -12.325  1.00 21.97 ? 120  PHE B CD2 1 
ATOM   4496  C  CE1 . PHE B 1 131 ? -4.584  23.701  -13.083  1.00 20.06 ? 120  PHE B CE1 1 
ATOM   4497  C  CE2 . PHE B 1 131 ? -5.876  24.751  -11.335  1.00 20.38 ? 120  PHE B CE2 1 
ATOM   4498  C  CZ  . PHE B 1 131 ? -4.810  23.972  -11.709  1.00 20.13 ? 120  PHE B CZ  1 
ATOM   4499  N  N   . ASP B 1 132 ? -10.394 25.174  -13.435  1.00 23.40 ? 121  ASP B N   1 
ATOM   4500  C  CA  . ASP B 1 132 ? -11.146 24.991  -12.192  1.00 23.26 ? 121  ASP B CA  1 
ATOM   4501  C  C   . ASP B 1 132 ? -11.998 23.741  -12.299  1.00 21.20 ? 121  ASP B C   1 
ATOM   4502  O  O   . ASP B 1 132 ? -12.212 23.066  -11.319  1.00 18.42 ? 121  ASP B O   1 
ATOM   4503  C  CB  . ASP B 1 132 ? -12.042 26.199  -11.882  1.00 24.46 ? 121  ASP B CB  1 
ATOM   4504  C  CG  . ASP B 1 132 ? -11.259 27.480  -11.659  1.00 27.88 ? 121  ASP B CG  1 
ATOM   4505  O  OD1 . ASP B 1 132 ? -10.013 27.418  -11.562  1.00 30.87 ? 121  ASP B OD1 1 
ATOM   4506  O  OD2 . ASP B 1 132 ? -11.899 28.569  -11.599  1.00 33.73 ? 121  ASP B OD2 1 
ATOM   4507  N  N   . GLN B 1 133 ? -12.486 23.445  -13.496  1.00 20.28 ? 122  GLN B N   1 
ATOM   4508  C  CA  . GLN B 1 133 ? -13.301 22.244  -13.705  1.00 21.97 ? 122  GLN B CA  1 
ATOM   4509  C  C   . GLN B 1 133 ? -12.494 20.943  -13.557  1.00 22.28 ? 122  GLN B C   1 
ATOM   4510  O  O   . GLN B 1 133 ? -12.813 20.064  -12.731  1.00 22.51 ? 122  GLN B O   1 
ATOM   4511  C  CB  . GLN B 1 133 ? -13.991 22.271  -15.089  1.00 22.04 ? 122  GLN B CB  1 
ATOM   4512  C  CG  . GLN B 1 133 ? -15.061 21.189  -15.266  1.00 22.03 ? 122  GLN B CG  1 
ATOM   4513  C  CD  . GLN B 1 133 ? -15.932 21.001  -14.010  1.00 23.62 ? 122  GLN B CD  1 
ATOM   4514  O  OE1 . GLN B 1 133 ? -15.506 20.397  -13.026  1.00 24.21 ? 122  GLN B OE1 1 
ATOM   4515  N  NE2 . GLN B 1 133 ? -17.154 21.514  -14.054  1.00 27.50 ? 122  GLN B NE2 1 
ATOM   4516  N  N   . TRP B 1 134 ? -11.441 20.819  -14.357  1.00 22.40 ? 123  TRP B N   1 
ATOM   4517  C  CA  . TRP B 1 134 ? -10.544 19.677  -14.248  1.00 22.38 ? 123  TRP B CA  1 
ATOM   4518  C  C   . TRP B 1 134 ? -10.084 19.468  -12.819  1.00 22.67 ? 123  TRP B C   1 
ATOM   4519  O  O   . TRP B 1 134 ? -10.075 18.350  -12.321  1.00 24.90 ? 123  TRP B O   1 
ATOM   4520  C  CB  . TRP B 1 134 ? -9.356  19.857  -15.169  1.00 21.83 ? 123  TRP B CB  1 
ATOM   4521  C  CG  . TRP B 1 134 ? -9.505  19.111  -16.445  1.00 20.07 ? 123  TRP B CG  1 
ATOM   4522  C  CD1 . TRP B 1 134 ? -8.912  17.929  -16.760  1.00 20.85 ? 123  TRP B CD1 1 
ATOM   4523  C  CD2 . TRP B 1 134 ? -10.324 19.466  -17.560  1.00 18.89 ? 123  TRP B CD2 1 
ATOM   4524  N  NE1 . TRP B 1 134 ? -9.289  17.528  -18.031  1.00 20.74 ? 123  TRP B NE1 1 
ATOM   4525  C  CE2 . TRP B 1 134 ? -10.155 18.455  -18.543  1.00 19.08 ? 123  TRP B CE2 1 
ATOM   4526  C  CE3 . TRP B 1 134 ? -11.175 20.551  -17.837  1.00 19.67 ? 123  TRP B CE3 1 
ATOM   4527  C  CZ2 . TRP B 1 134 ? -10.798 18.493  -19.781  1.00 18.80 ? 123  TRP B CZ2 1 
ATOM   4528  C  CZ3 . TRP B 1 134 ? -11.818 20.591  -19.086  1.00 20.84 ? 123  TRP B CZ3 1 
ATOM   4529  C  CH2 . TRP B 1 134 ? -11.630 19.549  -20.031  1.00 20.08 ? 123  TRP B CH2 1 
ATOM   4530  N  N   . ARG B 1 135 ? -9.715  20.539  -12.141  1.00 24.23 ? 124  ARG B N   1 
ATOM   4531  C  CA  . ARG B 1 135 ? -9.404  20.442  -10.708  1.00 24.56 ? 124  ARG B CA  1 
ATOM   4532  C  C   . ARG B 1 135 ? -10.516 19.782  -9.937   1.00 25.07 ? 124  ARG B C   1 
ATOM   4533  O  O   . ARG B 1 135 ? -10.268 18.864  -9.167   1.00 24.89 ? 124  ARG B O   1 
ATOM   4534  C  CB  . ARG B 1 135 ? -9.143  21.819  -10.094  1.00 25.20 ? 124  ARG B CB  1 
ATOM   4535  C  CG  . ARG B 1 135 ? -7.755  22.382  -10.351  1.00 25.96 ? 124  ARG B CG  1 
ATOM   4536  C  CD  . ARG B 1 135 ? -6.645  21.524  -9.765   1.00 26.79 ? 124  ARG B CD  1 
ATOM   4537  N  NE  . ARG B 1 135 ? -6.750  21.374  -8.316   1.00 26.79 ? 124  ARG B NE  1 
ATOM   4538  C  CZ  . ARG B 1 135 ? -6.119  22.125  -7.421   1.00 27.45 ? 124  ARG B CZ  1 
ATOM   4539  N  NH1 . ARG B 1 135 ? -5.310  23.107  -7.795   1.00 29.25 ? 124  ARG B NH1 1 
ATOM   4540  N  NH2 . ARG B 1 135 ? -6.297  21.884  -6.127   1.00 28.44 ? 124  ARG B NH2 1 
ATOM   4541  N  N   . GLU B 1 136 ? -11.737 20.260  -10.162  1.00 25.58 ? 125  GLU B N   1 
ATOM   4542  C  CA  . GLU B 1 136 ? -12.932 19.768  -9.473   1.00 25.74 ? 125  GLU B CA  1 
ATOM   4543  C  C   . GLU B 1 136 ? -13.118 18.280  -9.716   1.00 24.26 ? 125  GLU B C   1 
ATOM   4544  O  O   . GLU B 1 136 ? -13.303 17.492  -8.788   1.00 21.96 ? 125  GLU B O   1 
ATOM   4545  C  CB  . GLU B 1 136 ? -14.160 20.568  -9.938   1.00 27.02 ? 125  GLU B CB  1 
ATOM   4546  C  CG  . GLU B 1 136 ? -15.379 20.554  -8.992   1.00 28.27 ? 125  GLU B CG  1 
ATOM   4547  C  CD  . GLU B 1 136 ? -16.399 21.634  -9.336   1.00 29.99 ? 125  GLU B CD  1 
ATOM   4548  O  OE1 . GLU B 1 136 ? -15.992 22.715  -9.823   1.00 36.61 ? 125  GLU B OE1 1 
ATOM   4549  O  OE2 . GLU B 1 136 ? -17.612 21.416  -9.115   1.00 35.41 ? 125  GLU B OE2 1 
ATOM   4550  N  N   . TRP B 1 137 ? -13.025 17.897  -10.981  1.00 24.52 ? 126  TRP B N   1 
ATOM   4551  C  CA  . TRP B 1 137 ? -13.098 16.493  -11.379  1.00 24.48 ? 126  TRP B CA  1 
ATOM   4552  C  C   . TRP B 1 137 ? -12.007 15.586  -10.815  1.00 25.42 ? 126  TRP B C   1 
ATOM   4553  O  O   . TRP B 1 137 ? -12.289 14.492  -10.328  1.00 25.66 ? 126  TRP B O   1 
ATOM   4554  C  CB  . TRP B 1 137 ? -13.026 16.423  -12.903  1.00 23.74 ? 126  TRP B CB  1 
ATOM   4555  C  CG  . TRP B 1 137 ? -14.243 16.898  -13.588  1.00 21.69 ? 126  TRP B CG  1 
ATOM   4556  C  CD1 . TRP B 1 137 ? -15.491 17.091  -13.047  1.00 21.99 ? 126  TRP B CD1 1 
ATOM   4557  C  CD2 . TRP B 1 137 ? -14.364 17.191  -14.987  1.00 22.08 ? 126  TRP B CD2 1 
ATOM   4558  N  NE1 . TRP B 1 137 ? -16.366 17.486  -14.025  1.00 20.99 ? 126  TRP B NE1 1 
ATOM   4559  C  CE2 . TRP B 1 137 ? -15.700 17.558  -15.221  1.00 19.79 ? 126  TRP B CE2 1 
ATOM   4560  C  CE3 . TRP B 1 137 ? -13.465 17.180  -16.060  1.00 21.34 ? 126  TRP B CE3 1 
ATOM   4561  C  CZ2 . TRP B 1 137 ? -16.157 17.911  -16.477  1.00 22.28 ? 126  TRP B CZ2 1 
ATOM   4562  C  CZ3 . TRP B 1 137 ? -13.923 17.530  -17.300  1.00 21.22 ? 126  TRP B CZ3 1 
ATOM   4563  C  CH2 . TRP B 1 137 ? -15.253 17.892  -17.502  1.00 21.06 ? 126  TRP B CH2 1 
ATOM   4564  N  N   . ALA B 1 138 ? -10.757 16.027  -10.922  1.00 26.46 ? 127  ALA B N   1 
ATOM   4565  C  CA  . ALA B 1 138 ? -9.636  15.219  -10.513  1.00 26.38 ? 127  ALA B CA  1 
ATOM   4566  C  C   . ALA B 1 138 ? -9.609  15.068  -9.012   1.00 27.38 ? 127  ALA B C   1 
ATOM   4567  O  O   . ALA B 1 138 ? -9.483  13.952  -8.515   1.00 28.18 ? 127  ALA B O   1 
ATOM   4568  C  CB  . ALA B 1 138 ? -8.338  15.808  -11.015  1.00 26.40 ? 127  ALA B CB  1 
ATOM   4569  N  N   . ASP B 1 139 ? -9.734  16.178  -8.288   1.00 28.32 ? 128  ASP B N   1 
ATOM   4570  C  CA  . ASP B 1 139 ? -9.645  16.165  -6.811   1.00 28.51 ? 128  ASP B CA  1 
ATOM   4571  C  C   . ASP B 1 139 ? -10.604 15.187  -6.157   1.00 29.65 ? 128  ASP B C   1 
ATOM   4572  O  O   . ASP B 1 139 ? -10.277 14.538  -5.143   1.00 32.38 ? 128  ASP B O   1 
ATOM   4573  C  CB  . ASP B 1 139 ? -9.960  17.541  -6.246   1.00 28.35 ? 128  ASP B CB  1 
ATOM   4574  C  CG  . ASP B 1 139 ? -8.876  18.543  -6.500   1.00 28.12 ? 128  ASP B CG  1 
ATOM   4575  O  OD1 . ASP B 1 139 ? -7.681  18.167  -6.515   1.00 28.32 ? 128  ASP B OD1 1 
ATOM   4576  O  OD2 . ASP B 1 139 ? -9.230  19.727  -6.663   1.00 27.65 ? 128  ASP B OD2 1 
ATOM   4577  N  N   . SER B 1 140 ? -11.810 15.112  -6.710   1.00 29.39 ? 129  SER B N   1 
ATOM   4578  C  CA  . SER B 1 140 ? -12.853 14.303  -6.118   1.00 28.73 ? 129  SER B CA  1 
ATOM   4579  C  C   . SER B 1 140 ? -12.754 12.835  -6.539   1.00 28.92 ? 129  SER B C   1 
ATOM   4580  O  O   . SER B 1 140 ? -13.374 11.981  -5.915   1.00 28.16 ? 129  SER B O   1 
ATOM   4581  C  CB  . SER B 1 140 ? -14.231 14.874  -6.454   1.00 29.02 ? 129  SER B CB  1 
ATOM   4582  O  OG  . SER B 1 140 ? -14.506 14.812  -7.844   1.00 30.70 ? 129  SER B OG  1 
ATOM   4583  N  N   . LYS B 1 141 ? -11.973 12.535  -7.579   1.00 28.40 ? 130  LYS B N   1 
ATOM   4584  C  CA  . LYS B 1 141 ? -11.960 11.179  -8.144   1.00 28.06 ? 130  LYS B CA  1 
ATOM   4585  C  C   . LYS B 1 141 ? -10.598 10.488  -8.232   1.00 26.87 ? 130  LYS B C   1 
ATOM   4586  O  O   . LYS B 1 141 ? -10.536 9.250   -8.199   1.00 25.64 ? 130  LYS B O   1 
ATOM   4587  C  CB  . LYS B 1 141 ? -12.596 11.204  -9.523   1.00 28.52 ? 130  LYS B CB  1 
ATOM   4588  C  CG  . LYS B 1 141 ? -14.116 11.169  -9.532   1.00 29.97 ? 130  LYS B CG  1 
ATOM   4589  C  CD  . LYS B 1 141 ? -14.580 10.968  -10.970  1.00 29.78 ? 130  LYS B CD  1 
ATOM   4590  C  CE  . LYS B 1 141 ? -16.024 11.370  -11.216  1.00 32.43 ? 130  LYS B CE  1 
ATOM   4591  N  NZ  . LYS B 1 141 ? -16.151 11.878  -12.629  1.00 34.15 ? 130  LYS B NZ  1 
ATOM   4592  N  N   . SER B 1 142 ? -9.515  11.260  -8.333   1.00 26.74 ? 131  SER B N   1 
ATOM   4593  C  CA  . SER B 1 142 ? -8.182  10.670  -8.496   1.00 26.84 ? 131  SER B CA  1 
ATOM   4594  C  C   . SER B 1 142 ? -7.756  9.775   -7.333   1.00 27.23 ? 131  SER B C   1 
ATOM   4595  O  O   . SER B 1 142 ? -7.761  10.196  -6.162   1.00 27.60 ? 131  SER B O   1 
ATOM   4596  C  CB  . SER B 1 142 ? -7.107  11.742  -8.717   1.00 26.56 ? 131  SER B CB  1 
ATOM   4597  O  OG  . SER B 1 142 ? -5.918  11.144  -9.234   1.00 25.10 ? 131  SER B OG  1 
ATOM   4598  N  N   . CYS B 1 143 ? -7.371  8.545   -7.691   1.00 27.12 ? 132  CYS B N   1 
ATOM   4599  C  CA  . CYS B 1 143 ? -6.720  7.611   -6.789   1.00 27.15 ? 132  CYS B CA  1 
ATOM   4600  C  C   . CYS B 1 143 ? -5.259  7.972   -6.517   1.00 27.27 ? 132  CYS B C   1 
ATOM   4601  O  O   . CYS B 1 143 ? -4.658  7.491   -5.542   1.00 26.47 ? 132  CYS B O   1 
ATOM   4602  C  CB  . CYS B 1 143 ? -6.788  6.197   -7.373   1.00 28.08 ? 132  CYS B CB  1 
ATOM   4603  S  SG  . CYS B 1 143 ? -8.454  5.597   -7.601   1.00 26.16 ? 132  CYS B SG  1 
ATOM   4604  N  N   . CYS B 1 144 ? -4.672  8.805   -7.378   1.00 26.50 ? 133  CYS B N   1 
ATOM   4605  C  CA  . CYS B 1 144 ? -3.250  9.117   -7.264   1.00 24.77 ? 133  CYS B CA  1 
ATOM   4606  C  C   . CYS B 1 144 ? -2.960  10.611  -7.401   1.00 24.06 ? 133  CYS B C   1 
ATOM   4607  O  O   . CYS B 1 144 ? -3.817  11.379  -7.849   1.00 25.10 ? 133  CYS B O   1 
ATOM   4608  C  CB  . CYS B 1 144 ? -2.463  8.296   -8.285   1.00 24.60 ? 133  CYS B CB  1 
ATOM   4609  S  SG  . CYS B 1 144 ? -2.791  8.701   -10.007  1.00 22.76 ? 133  CYS B SG  1 
ATOM   4610  N  N   . ASP B 1 145 ? -1.758  11.016  -6.963   1.00 23.04 ? 134  ASP B N   1 
ATOM   4611  C  CA  . ASP B 1 145 ? -1.273  12.390  -7.119   1.00 21.21 ? 134  ASP B CA  1 
ATOM   4612  C  C   . ASP B 1 145 ? -1.306  12.671  -8.582   1.00 19.33 ? 134  ASP B C   1 
ATOM   4613  O  O   . ASP B 1 145 ? -1.102  11.787  -9.365   1.00 20.00 ? 134  ASP B O   1 
ATOM   4614  C  CB  . ASP B 1 145 ? 0.157   12.562  -6.619   1.00 20.82 ? 134  ASP B CB  1 
ATOM   4615  C  CG  . ASP B 1 145 ? 0.254   12.572  -5.112   1.00 22.90 ? 134  ASP B CG  1 
ATOM   4616  O  OD1 . ASP B 1 145 ? -0.786  12.644  -4.447   1.00 22.18 ? 134  ASP B OD1 1 
ATOM   4617  O  OD2 . ASP B 1 145 ? 1.376   12.517  -4.581   1.00 28.02 ? 134  ASP B OD2 1 
ATOM   4618  N  N   . TYR B 1 146 ? -1.573  13.903  -8.939   1.00 19.41 ? 135  TYR B N   1 
ATOM   4619  C  CA  . TYR B 1 146 ? -1.786  14.263  -10.344  1.00 18.74 ? 135  TYR B CA  1 
ATOM   4620  C  C   . TYR B 1 146 ? -1.406  15.722  -10.508  1.00 17.36 ? 135  TYR B C   1 
ATOM   4621  O  O   . TYR B 1 146 ? -1.331  16.450  -9.535   1.00 16.64 ? 135  TYR B O   1 
ATOM   4622  C  CB  . TYR B 1 146 ? -3.276  14.025  -10.742  1.00 19.18 ? 135  TYR B CB  1 
ATOM   4623  C  CG  . TYR B 1 146 ? -4.257  15.056  -10.197  1.00 17.98 ? 135  TYR B CG  1 
ATOM   4624  C  CD1 . TYR B 1 146 ? -4.838  14.933  -8.928   1.00 19.45 ? 135  TYR B CD1 1 
ATOM   4625  C  CD2 . TYR B 1 146 ? -4.575  16.164  -10.944  1.00 18.32 ? 135  TYR B CD2 1 
ATOM   4626  C  CE1 . TYR B 1 146 ? -5.732  15.912  -8.442   1.00 17.44 ? 135  TYR B CE1 1 
ATOM   4627  C  CE2 . TYR B 1 146 ? -5.442  17.125  -10.479  1.00 20.44 ? 135  TYR B CE2 1 
ATOM   4628  C  CZ  . TYR B 1 146 ? -6.012  17.012  -9.223   1.00 20.55 ? 135  TYR B CZ  1 
ATOM   4629  O  OH  . TYR B 1 146 ? -6.851  18.037  -8.838   1.00 19.50 ? 135  TYR B OH  1 
ATOM   4630  N  N   . SER B 1 147 ? -1.152  16.136  -11.739  1.00 15.26 ? 136  SER B N   1 
ATOM   4631  C  CA  . SER B 1 147 ? -0.976  17.555  -12.065  1.00 16.47 ? 136  SER B CA  1 
ATOM   4632  C  C   . SER B 1 147 ? -1.639  17.724  -13.427  1.00 14.62 ? 136  SER B C   1 
ATOM   4633  O  O   . SER B 1 147 ? -2.133  16.756  -13.951  1.00 12.65 ? 136  SER B O   1 
ATOM   4634  C  CB  . SER B 1 147 ? 0.502   17.987  -12.115  1.00 15.15 ? 136  SER B CB  1 
ATOM   4635  O  OG  . SER B 1 147 ? 0.641   19.418  -12.018  1.00 17.33 ? 136  SER B OG  1 
ATOM   4636  N  N   . LEU B 1 148 ? -1.675  18.952  -13.935  1.00 16.51 ? 137  LEU B N   1 
ATOM   4637  C  CA  . LEU B 1 148 ? -2.423  19.291  -15.153  1.00 17.59 ? 137  LEU B CA  1 
ATOM   4638  C  C   . LEU B 1 148 ? -1.640  20.160  -16.113  1.00 17.64 ? 137  LEU B C   1 
ATOM   4639  O  O   . LEU B 1 148 ? -1.146  21.209  -15.730  1.00 18.54 ? 137  LEU B O   1 
ATOM   4640  C  CB  . LEU B 1 148 ? -3.710  20.063  -14.789  1.00 17.63 ? 137  LEU B CB  1 
ATOM   4641  C  CG  . LEU B 1 148 ? -4.774  19.359  -13.965  1.00 17.28 ? 137  LEU B CG  1 
ATOM   4642  C  CD1 . LEU B 1 148 ? -5.788  20.348  -13.378  1.00 15.13 ? 137  LEU B CD1 1 
ATOM   4643  C  CD2 . LEU B 1 148 ? -5.457  18.321  -14.808  1.00 16.32 ? 137  LEU B CD2 1 
ATOM   4644  N  N   . HIS B 1 149 ? -1.567  19.752  -17.382  1.00 19.21 ? 138  HIS B N   1 
ATOM   4645  C  CA  . HIS B 1 149 ? -1.189  20.661  -18.455  1.00 17.22 ? 138  HIS B CA  1 
ATOM   4646  C  C   . HIS B 1 149 ? -2.439  21.412  -18.808  1.00 17.73 ? 138  HIS B C   1 
ATOM   4647  O  O   . HIS B 1 149 ? -3.555  20.982  -18.452  1.00 17.60 ? 138  HIS B O   1 
ATOM   4648  C  CB  . HIS B 1 149 ? -0.749  19.914  -19.704  1.00 17.84 ? 138  HIS B CB  1 
ATOM   4649  C  CG  . HIS B 1 149 ? 0.279   18.866  -19.457  1.00 18.60 ? 138  HIS B CG  1 
ATOM   4650  N  ND1 . HIS B 1 149 ? 1.626   19.145  -19.414  1.00 19.95 ? 138  HIS B ND1 1 
ATOM   4651  C  CD2 . HIS B 1 149 ? 0.159   17.536  -19.262  1.00 20.59 ? 138  HIS B CD2 1 
ATOM   4652  C  CE1 . HIS B 1 149 ? 2.289   18.031  -19.174  1.00 21.81 ? 138  HIS B CE1 1 
ATOM   4653  N  NE2 . HIS B 1 149 ? 1.421   17.038  -19.087  1.00 23.46 ? 138  HIS B NE2 1 
ATOM   4654  N  N   . VAL B 1 150 ? -2.263  22.495  -19.564  1.00 16.19 ? 139  VAL B N   1 
ATOM   4655  C  CA  . VAL B 1 150 ? -3.364  23.368  -19.916  1.00 14.94 ? 139  VAL B CA  1 
ATOM   4656  C  C   . VAL B 1 150 ? -3.289  23.503  -21.433  1.00 14.83 ? 139  VAL B C   1 
ATOM   4657  O  O   . VAL B 1 150 ? -2.291  23.993  -21.969  1.00 13.36 ? 139  VAL B O   1 
ATOM   4658  C  CB  . VAL B 1 150 ? -3.297  24.747  -19.163  1.00 14.32 ? 139  VAL B CB  1 
ATOM   4659  C  CG1 . VAL B 1 150 ? -4.525  25.564  -19.361  1.00 14.07 ? 139  VAL B CG1 1 
ATOM   4660  C  CG2 . VAL B 1 150 ? -3.151  24.520  -17.645  1.00 13.47 ? 139  VAL B CG2 1 
ATOM   4661  N  N   . ASP B 1 151 ? -4.320  23.005  -22.110  1.00 15.02 ? 140  ASP B N   1 
ATOM   4662  C  CA  . ASP B 1 151 ? -4.355  23.052  -23.580  1.00 15.02 ? 140  ASP B CA  1 
ATOM   4663  C  C   . ASP B 1 151 ? -4.934  24.380  -23.973  1.00 15.12 ? 140  ASP B C   1 
ATOM   4664  O  O   . ASP B 1 151 ? -5.700  24.947  -23.225  1.00 14.75 ? 140  ASP B O   1 
ATOM   4665  C  CB  . ASP B 1 151 ? -5.189  21.905  -24.157  1.00 15.17 ? 140  ASP B CB  1 
ATOM   4666  C  CG  . ASP B 1 151 ? -4.591  20.540  -23.895  1.00 17.15 ? 140  ASP B CG  1 
ATOM   4667  O  OD1 . ASP B 1 151 ? -3.599  20.428  -23.130  1.00 20.61 ? 140  ASP B OD1 1 
ATOM   4668  O  OD2 . ASP B 1 151 ? -5.136  19.557  -24.445  1.00 18.62 ? 140  ASP B OD2 1 
ATOM   4669  N  N   . ILE B 1 152 ? -4.597  24.853  -25.181  1.00 15.06 ? 141  ILE B N   1 
ATOM   4670  C  CA  . ILE B 1 152 ? -4.988  26.164  -25.664  1.00 15.33 ? 141  ILE B CA  1 
ATOM   4671  C  C   . ILE B 1 152 ? -5.681  25.852  -26.952  1.00 15.90 ? 141  ILE B C   1 
ATOM   4672  O  O   . ILE B 1 152 ? -5.066  25.236  -27.829  1.00 8.60  ? 141  ILE B O   1 
ATOM   4673  C  CB  . ILE B 1 152 ? -3.769  27.081  -25.906  1.00 15.10 ? 141  ILE B CB  1 
ATOM   4674  C  CG1 . ILE B 1 152 ? -3.091  27.432  -24.563  1.00 18.25 ? 141  ILE B CG1 1 
ATOM   4675  C  CG2 . ILE B 1 152 ? -4.157  28.359  -26.520  1.00 12.70 ? 141  ILE B CG2 1 
ATOM   4676  C  CD1 . ILE B 1 152 ? -1.693  27.879  -24.749  1.00 18.13 ? 141  ILE B CD1 1 
ATOM   4677  N  N   . SER B 1 153 ? -6.979  26.189  -26.996  1.00 17.34 ? 142  SER B N   1 
ATOM   4678  C  CA  . SER B 1 153 ? -7.846  25.954  -28.146  1.00 20.83 ? 142  SER B CA  1 
ATOM   4679  C  C   . SER B 1 153 ? -7.994  27.200  -29.012  1.00 20.53 ? 142  SER B C   1 
ATOM   4680  O  O   . SER B 1 153 ? -8.573  27.152  -30.093  1.00 21.88 ? 142  SER B O   1 
ATOM   4681  C  CB  . SER B 1 153 ? -9.219  25.498  -27.647  1.00 22.27 ? 142  SER B CB  1 
ATOM   4682  O  OG  . SER B 1 153 ? -9.660  26.322  -26.582  1.00 27.69 ? 142  SER B OG  1 
ATOM   4683  N  N   . GLU B 1 154 ? -7.463  28.314  -28.531  1.00 22.27 ? 143  GLU B N   1 
ATOM   4684  C  CA  . GLU B 1 154 ? -7.525  29.575  -29.227  1.00 23.60 ? 143  GLU B CA  1 
ATOM   4685  C  C   . GLU B 1 154 ? -6.538  30.589  -28.689  1.00 24.13 ? 143  GLU B C   1 
ATOM   4686  O  O   . GLU B 1 154 ? -6.247  30.643  -27.493  1.00 23.75 ? 143  GLU B O   1 
ATOM   4687  C  CB  . GLU B 1 154 ? -8.927  30.194  -29.175  1.00 24.29 ? 143  GLU B CB  1 
ATOM   4688  C  CG  . GLU B 1 154 ? -9.574  30.238  -27.806  1.00 26.78 ? 143  GLU B CG  1 
ATOM   4689  C  CD  . GLU B 1 154 ? -10.691 31.272  -27.727  1.00 28.82 ? 143  GLU B CD  1 
ATOM   4690  O  OE1 . GLU B 1 154 ? -11.147 31.746  -28.802  1.00 34.01 ? 143  GLU B OE1 1 
ATOM   4691  O  OE2 . GLU B 1 154 ? -11.124 31.597  -26.597  1.00 30.43 ? 143  GLU B OE2 1 
ATOM   4692  N  N   . TRP B 1 155 ? -6.065  31.420  -29.606  1.00 24.69 ? 144  TRP B N   1 
ATOM   4693  C  CA  . TRP B 1 155 ? -5.121  32.446  -29.292  1.00 25.31 ? 144  TRP B CA  1 
ATOM   4694  C  C   . TRP B 1 155 ? -5.735  33.826  -29.387  1.00 27.02 ? 144  TRP B C   1 
ATOM   4695  O  O   . TRP B 1 155 ? -6.163  34.251  -30.451  1.00 26.47 ? 144  TRP B O   1 
ATOM   4696  C  CB  . TRP B 1 155 ? -3.935  32.352  -30.245  1.00 23.68 ? 144  TRP B CB  1 
ATOM   4697  C  CG  . TRP B 1 155 ? -2.840  33.250  -29.890  1.00 20.36 ? 144  TRP B CG  1 
ATOM   4698  C  CD1 . TRP B 1 155 ? -2.200  34.135  -30.704  1.00 18.61 ? 144  TRP B CD1 1 
ATOM   4699  C  CD2 . TRP B 1 155 ? -2.241  33.366  -28.603  1.00 16.54 ? 144  TRP B CD2 1 
ATOM   4700  N  NE1 . TRP B 1 155 ? -1.230  34.798  -29.995  1.00 19.56 ? 144  TRP B NE1 1 
ATOM   4701  C  CE2 . TRP B 1 155 ? -1.243  34.342  -28.699  1.00 16.26 ? 144  TRP B CE2 1 
ATOM   4702  C  CE3 . TRP B 1 155 ? -2.462  32.736  -27.367  1.00 18.57 ? 144  TRP B CE3 1 
ATOM   4703  C  CZ2 . TRP B 1 155 ? -0.454  34.699  -27.616  1.00 20.73 ? 144  TRP B CZ2 1 
ATOM   4704  C  CZ3 . TRP B 1 155 ? -1.685  33.089  -26.303  1.00 19.49 ? 144  TRP B CZ3 1 
ATOM   4705  C  CH2 . TRP B 1 155 ? -0.686  34.059  -26.428  1.00 18.84 ? 144  TRP B CH2 1 
ATOM   4706  N  N   . HIS B 1 156 ? -5.760  34.531  -28.266  1.00 29.66 ? 145  HIS B N   1 
ATOM   4707  C  CA  . HIS B 1 156 ? -6.045  35.948  -28.314  1.00 32.64 ? 145  HIS B CA  1 
ATOM   4708  C  C   . HIS B 1 156 ? -5.419  36.702  -27.154  1.00 33.84 ? 145  HIS B C   1 
ATOM   4709  O  O   . HIS B 1 156 ? -5.001  36.103  -26.151  1.00 34.18 ? 145  HIS B O   1 
ATOM   4710  C  CB  . HIS B 1 156 ? -7.551  36.202  -28.418  1.00 32.89 ? 145  HIS B CB  1 
ATOM   4711  C  CG  . HIS B 1 156 ? -8.326  35.818  -27.198  1.00 34.88 ? 145  HIS B CG  1 
ATOM   4712  N  ND1 . HIS B 1 156 ? -8.070  36.359  -25.958  1.00 35.90 ? 145  HIS B ND1 1 
ATOM   4713  C  CD2 . HIS B 1 156 ? -9.384  34.986  -27.036  1.00 34.92 ? 145  HIS B CD2 1 
ATOM   4714  C  CE1 . HIS B 1 156 ? -8.922  35.861  -25.079  1.00 37.02 ? 145  HIS B CE1 1 
ATOM   4715  N  NE2 . HIS B 1 156 ? -9.734  35.030  -25.710  1.00 36.61 ? 145  HIS B NE2 1 
ATOM   4716  N  N   . LYS B 1 157 ? -5.373  38.026  -27.318  1.00 35.09 ? 146  LYS B N   1 
ATOM   4717  C  CA  . LYS B 1 157 ? -4.661  38.973  -26.420  1.00 35.61 ? 146  LYS B CA  1 
ATOM   4718  C  C   . LYS B 1 157 ? -5.069  38.831  -24.952  1.00 35.25 ? 146  LYS B C   1 
ATOM   4719  O  O   . LYS B 1 157 ? -4.314  39.207  -24.046  1.00 35.83 ? 146  LYS B O   1 
ATOM   4720  C  CB  . LYS B 1 157 ? -4.885  40.438  -26.866  1.00 37.57 ? 146  LYS B CB  1 
ATOM   4721  C  CG  . LYS B 1 157 ? -4.979  40.671  -28.405  1.00 38.92 ? 146  LYS B CG  1 
ATOM   4722  C  CD  . LYS B 1 157 ? -6.397  40.379  -28.962  1.00 39.79 ? 146  LYS B CD  1 
ATOM   4723  C  CE  . LYS B 1 157 ? -6.348  39.644  -30.308  1.00 40.17 ? 146  LYS B CE  1 
ATOM   4724  N  NZ  . LYS B 1 157 ? -5.378  38.503  -30.361  1.00 42.52 ? 146  LYS B NZ  1 
ATOM   4725  N  N   . GLY B 1 158 ? -6.271  38.306  -24.728  1.00 34.69 ? 147  GLY B N   1 
ATOM   4726  C  CA  . GLY B 1 158 ? -6.725  37.928  -23.390  1.00 34.23 ? 147  GLY B CA  1 
ATOM   4727  C  C   . GLY B 1 158 ? -6.156  36.642  -22.810  1.00 34.20 ? 147  GLY B C   1 
ATOM   4728  O  O   . GLY B 1 158 ? -6.048  36.535  -21.602  1.00 33.75 ? 147  GLY B O   1 
ATOM   4729  N  N   . ILE B 1 159 ? -5.796  35.660  -23.645  1.00 33.83 ? 148  ILE B N   1 
ATOM   4730  C  CA  . ILE B 1 159 ? -5.370  34.351  -23.122  1.00 33.86 ? 148  ILE B CA  1 
ATOM   4731  C  C   . ILE B 1 159 ? -3.998  34.426  -22.443  1.00 33.09 ? 148  ILE B C   1 
ATOM   4732  O  O   . ILE B 1 159 ? -3.721  33.650  -21.527  1.00 33.05 ? 148  ILE B O   1 
ATOM   4733  C  CB  . ILE B 1 159 ? -5.379  33.195  -24.208  1.00 34.73 ? 148  ILE B CB  1 
ATOM   4734  C  CG1 . ILE B 1 159 ? -6.804  32.864  -24.708  1.00 33.84 ? 148  ILE B CG1 1 
ATOM   4735  C  CG2 . ILE B 1 159 ? -4.716  31.912  -23.657  1.00 33.87 ? 148  ILE B CG2 1 
ATOM   4736  C  CD1 . ILE B 1 159 ? -7.730  32.253  -23.656  1.00 33.34 ? 148  ILE B CD1 1 
ATOM   4737  N  N   . GLN B 1 160 ? -3.152  35.350  -22.890  1.00 32.90 ? 149  GLN B N   1 
ATOM   4738  C  CA  . GLN B 1 160 ? -1.857  35.591  -22.246  1.00 33.20 ? 149  GLN B CA  1 
ATOM   4739  C  C   . GLN B 1 160 ? -1.984  35.727  -20.746  1.00 32.88 ? 149  GLN B C   1 
ATOM   4740  O  O   . GLN B 1 160 ? -1.376  34.984  -19.975  1.00 32.81 ? 149  GLN B O   1 
ATOM   4741  C  CB  . GLN B 1 160 ? -1.235  36.884  -22.745  1.00 33.32 ? 149  GLN B CB  1 
ATOM   4742  C  CG  . GLN B 1 160 ? -0.236  36.721  -23.844  1.00 34.14 ? 149  GLN B CG  1 
ATOM   4743  C  CD  . GLN B 1 160 ? 0.865   37.762  -23.796  1.00 34.51 ? 149  GLN B CD  1 
ATOM   4744  O  OE1 . GLN B 1 160 ? 1.391   38.165  -24.840  1.00 39.11 ? 149  GLN B OE1 1 
ATOM   4745  N  NE2 . GLN B 1 160 ? 1.237   38.185  -22.594  1.00 32.37 ? 149  GLN B NE2 1 
ATOM   4746  N  N   . GLU B 1 161 ? -2.786  36.709  -20.352  1.00 33.08 ? 150  GLU B N   1 
ATOM   4747  C  CA  . GLU B 1 161 ? -3.047  37.002  -18.944  1.00 32.26 ? 150  GLU B CA  1 
ATOM   4748  C  C   . GLU B 1 161 ? -3.352  35.745  -18.176  1.00 30.19 ? 150  GLU B C   1 
ATOM   4749  O  O   . GLU B 1 161 ? -2.795  35.527  -17.107  1.00 30.09 ? 150  GLU B O   1 
ATOM   4750  C  CB  . GLU B 1 161 ? -4.231  37.962  -18.784  1.00 32.63 ? 150  GLU B CB  1 
ATOM   4751  C  CG  . GLU B 1 161 ? -3.879  39.398  -18.981  1.00 35.45 ? 150  GLU B CG  1 
ATOM   4752  C  CD  . GLU B 1 161 ? -4.024  39.827  -20.417  1.00 39.57 ? 150  GLU B CD  1 
ATOM   4753  O  OE1 . GLU B 1 161 ? -4.583  40.919  -20.637  1.00 45.38 ? 150  GLU B OE1 1 
ATOM   4754  O  OE2 . GLU B 1 161 ? -3.591  39.082  -21.325  1.00 40.84 ? 150  GLU B OE2 1 
ATOM   4755  N  N   . GLU B 1 162 ? -4.242  34.930  -18.722  1.00 27.66 ? 151  GLU B N   1 
ATOM   4756  C  CA  . GLU B 1 162 ? -4.675  33.741  -18.027  1.00 26.96 ? 151  GLU B CA  1 
ATOM   4757  C  C   . GLU B 1 162 ? -3.526  32.757  -17.884  1.00 26.06 ? 151  GLU B C   1 
ATOM   4758  O  O   . GLU B 1 162 ? -3.305  32.199  -16.806  1.00 24.74 ? 151  GLU B O   1 
ATOM   4759  C  CB  . GLU B 1 162 ? -5.851  33.106  -18.754  1.00 26.79 ? 151  GLU B CB  1 
ATOM   4760  C  CG  . GLU B 1 162 ? -7.133  33.892  -18.587  1.00 27.44 ? 151  GLU B CG  1 
ATOM   4761  C  CD  . GLU B 1 162 ? -8.337  33.066  -18.919  1.00 28.05 ? 151  GLU B CD  1 
ATOM   4762  O  OE1 . GLU B 1 162 ? -9.059  32.695  -17.960  1.00 29.12 ? 151  GLU B OE1 1 
ATOM   4763  O  OE2 . GLU B 1 162 ? -8.529  32.767  -20.133  1.00 26.86 ? 151  GLU B OE2 1 
ATOM   4764  N  N   . MET B 1 163 ? -2.789  32.557  -18.973  1.00 25.32 ? 152  MET B N   1 
ATOM   4765  C  CA  . MET B 1 163 ? -1.599  31.721  -18.936  1.00 24.95 ? 152  MET B CA  1 
ATOM   4766  C  C   . MET B 1 163 ? -0.720  32.208  -17.804  1.00 26.14 ? 152  MET B C   1 
ATOM   4767  O  O   . MET B 1 163 ? -0.405  31.442  -16.884  1.00 26.03 ? 152  MET B O   1 
ATOM   4768  C  CB  . MET B 1 163 ? -0.866  31.784  -20.281  1.00 25.64 ? 152  MET B CB  1 
ATOM   4769  C  CG  . MET B 1 163 ? -1.470  30.891  -21.364  1.00 21.86 ? 152  MET B CG  1 
ATOM   4770  S  SD  . MET B 1 163 ? -0.807  31.210  -23.021  1.00 23.94 ? 152  MET B SD  1 
ATOM   4771  C  CE  . MET B 1 163 ? 0.804   30.426  -22.936  1.00 13.85 ? 152  MET B CE  1 
ATOM   4772  N  N   . GLU B 1 164 ? -0.395  33.504  -17.825  1.00 26.55 ? 153  GLU B N   1 
ATOM   4773  C  CA  . GLU B 1 164 ? 0.463   34.116  -16.787  1.00 25.90 ? 153  GLU B CA  1 
ATOM   4774  C  C   . GLU B 1 164 ? -0.055  33.936  -15.365  1.00 24.84 ? 153  GLU B C   1 
ATOM   4775  O  O   . GLU B 1 164 ? 0.738   33.718  -14.465  1.00 25.49 ? 153  GLU B O   1 
ATOM   4776  C  CB  . GLU B 1 164 ? 0.670   35.617  -17.041  1.00 27.22 ? 153  GLU B CB  1 
ATOM   4777  C  CG  . GLU B 1 164 ? 1.216   35.984  -18.431  1.00 29.76 ? 153  GLU B CG  1 
ATOM   4778  C  CD  . GLU B 1 164 ? 1.104   37.462  -18.724  1.00 28.55 ? 153  GLU B CD  1 
ATOM   4779  O  OE1 . GLU B 1 164 ? 1.202   38.237  -17.756  1.00 33.19 ? 153  GLU B OE1 1 
ATOM   4780  O  OE2 . GLU B 1 164 ? 0.929   37.844  -19.909  1.00 32.12 ? 153  GLU B OE2 1 
ATOM   4781  N  N   . ALA B 1 165 ? -1.367  34.051  -15.169  1.00 23.20 ? 154  ALA B N   1 
ATOM   4782  C  CA  . ALA B 1 165 ? -1.997  33.771  -13.875  1.00 23.25 ? 154  ALA B CA  1 
ATOM   4783  C  C   . ALA B 1 165 ? -1.918  32.279  -13.533  1.00 22.24 ? 154  ALA B C   1 
ATOM   4784  O  O   . ALA B 1 165 ? -1.653  31.903  -12.381  1.00 20.88 ? 154  ALA B O   1 
ATOM   4785  C  CB  . ALA B 1 165 ? -3.469  34.245  -13.862  1.00 22.75 ? 154  ALA B CB  1 
ATOM   4786  N  N   . LEU B 1 166 ? -2.172  31.426  -14.526  1.00 20.23 ? 155  LEU B N   1 
ATOM   4787  C  CA  . LEU B 1 166 ? -2.111  29.975  -14.307  1.00 21.03 ? 155  LEU B CA  1 
ATOM   4788  C  C   . LEU B 1 166 ? -0.702  29.564  -13.832  1.00 22.06 ? 155  LEU B C   1 
ATOM   4789  O  O   . LEU B 1 166 ? -0.570  28.890  -12.802  1.00 20.72 ? 155  LEU B O   1 
ATOM   4790  C  CB  . LEU B 1 166 ? -2.542  29.192  -15.574  1.00 20.62 ? 155  LEU B CB  1 
ATOM   4791  C  CG  . LEU B 1 166 ? -4.041  29.081  -15.923  1.00 15.88 ? 155  LEU B CG  1 
ATOM   4792  C  CD1 . LEU B 1 166 ? -4.284  28.976  -17.494  1.00 14.25 ? 155  LEU B CD1 1 
ATOM   4793  C  CD2 . LEU B 1 166 ? -4.617  27.903  -15.206  1.00 20.43 ? 155  LEU B CD2 1 
ATOM   4794  N  N   . VAL B 1 167 ? 0.339   29.986  -14.562  1.00 21.34 ? 156  VAL B N   1 
ATOM   4795  C  CA  . VAL B 1 167 ? 1.723   29.654  -14.176  1.00 22.29 ? 156  VAL B CA  1 
ATOM   4796  C  C   . VAL B 1 167 ? 2.085   30.207  -12.788  1.00 22.74 ? 156  VAL B C   1 
ATOM   4797  O  O   . VAL B 1 167 ? 2.645   29.482  -11.967  1.00 23.24 ? 156  VAL B O   1 
ATOM   4798  C  CB  . VAL B 1 167 ? 2.758   30.156  -15.191  1.00 20.74 ? 156  VAL B CB  1 
ATOM   4799  C  CG1 . VAL B 1 167 ? 4.153   29.996  -14.649  1.00 20.14 ? 156  VAL B CG1 1 
ATOM   4800  C  CG2 . VAL B 1 167 ? 2.633   29.390  -16.500  1.00 18.92 ? 156  VAL B CG2 1 
ATOM   4801  N  N   . LYS B 1 168 ? 1.769   31.477  -12.547  1.00 24.22 ? 157  LYS B N   1 
ATOM   4802  C  CA  . LYS B 1 168 ? 2.091   32.135  -11.253  1.00 25.51 ? 157  LYS B CA  1 
ATOM   4803  C  C   . LYS B 1 168 ? 1.266   31.691  -10.058  1.00 25.67 ? 157  LYS B C   1 
ATOM   4804  O  O   . LYS B 1 168 ? 1.792   31.553  -8.949   1.00 24.75 ? 157  LYS B O   1 
ATOM   4805  C  CB  . LYS B 1 168 ? 1.944   33.649  -11.362  1.00 26.50 ? 157  LYS B CB  1 
ATOM   4806  C  CG  . LYS B 1 168 ? 3.222   34.368  -11.758  1.00 29.89 ? 157  LYS B CG  1 
ATOM   4807  C  CD  . LYS B 1 168 ? 2.927   35.716  -12.401  1.00 29.39 ? 157  LYS B CD  1 
ATOM   4808  C  CE  . LYS B 1 168 ? 4.190   36.496  -12.758  1.00 31.61 ? 157  LYS B CE  1 
ATOM   4809  N  NZ  . LYS B 1 168 ? 3.894   37.620  -13.724  1.00 32.86 ? 157  LYS B NZ  1 
ATOM   4810  N  N   . ASP B 1 169 ? -0.035  31.510  -10.265  1.00 25.41 ? 158  ASP B N   1 
ATOM   4811  C  CA  . ASP B 1 169 ? -0.944  31.302  -9.140   1.00 25.08 ? 158  ASP B CA  1 
ATOM   4812  C  C   . ASP B 1 169 ? -1.412  29.860  -8.982   1.00 24.29 ? 158  ASP B C   1 
ATOM   4813  O  O   . ASP B 1 169 ? -1.790  29.471  -7.873   1.00 22.09 ? 158  ASP B O   1 
ATOM   4814  C  CB  . ASP B 1 169 ? -2.157  32.252  -9.243   1.00 26.06 ? 158  ASP B CB  1 
ATOM   4815  C  CG  . ASP B 1 169 ? -1.763  33.729  -9.130   1.00 27.72 ? 158  ASP B CG  1 
ATOM   4816  O  OD1 . ASP B 1 169 ? -1.151  34.087  -8.111   1.00 30.56 ? 158  ASP B OD1 1 
ATOM   4817  O  OD2 . ASP B 1 169 ? -2.040  34.531  -10.058  1.00 27.45 ? 158  ASP B OD2 1 
ATOM   4818  N  N   . HIS B 1 170 ? -1.364  29.061  -10.060  1.00 22.78 ? 159  HIS B N   1 
ATOM   4819  C  CA  . HIS B 1 170 ? -2.061  27.756  -10.050  1.00 23.07 ? 159  HIS B CA  1 
ATOM   4820  C  C   . HIS B 1 170 ? -1.235  26.447  -10.220  1.00 21.80 ? 159  HIS B C   1 
ATOM   4821  O  O   . HIS B 1 170 ? -1.814  25.372  -10.371  1.00 22.70 ? 159  HIS B O   1 
ATOM   4822  C  CB  . HIS B 1 170 ? -3.269  27.823  -11.013  1.00 23.28 ? 159  HIS B CB  1 
ATOM   4823  C  CG  . HIS B 1 170 ? -4.269  28.859  -10.614  1.00 23.42 ? 159  HIS B CG  1 
ATOM   4824  N  ND1 . HIS B 1 170 ? -5.136  28.678  -9.564   1.00 24.48 ? 159  HIS B ND1 1 
ATOM   4825  C  CD2 . HIS B 1 170 ? -4.487  30.117  -11.065  1.00 24.62 ? 159  HIS B CD2 1 
ATOM   4826  C  CE1 . HIS B 1 170 ? -5.873  29.764  -9.405   1.00 24.16 ? 159  HIS B CE1 1 
ATOM   4827  N  NE2 . HIS B 1 170 ? -5.493  30.657  -10.299  1.00 24.70 ? 159  HIS B NE2 1 
ATOM   4828  N  N   . GLY B 1 171 ? 0.088   26.501  -10.129  1.00 20.88 ? 160  GLY B N   1 
ATOM   4829  C  CA  . GLY B 1 171 ? 0.887   25.253  -10.200  1.00 21.00 ? 160  GLY B CA  1 
ATOM   4830  C  C   . GLY B 1 171 ? 1.054   24.647  -11.601  1.00 20.38 ? 160  GLY B C   1 
ATOM   4831  O  O   . GLY B 1 171 ? 1.367   23.473  -11.754  1.00 19.95 ? 160  GLY B O   1 
ATOM   4832  N  N   . VAL B 1 172 ? 0.889   25.466  -12.625  1.00 20.27 ? 161  VAL B N   1 
ATOM   4833  C  CA  . VAL B 1 172 ? 0.958   25.006  -14.010  1.00 19.82 ? 161  VAL B CA  1 
ATOM   4834  C  C   . VAL B 1 172 ? 2.250   25.474  -14.718  1.00 19.86 ? 161  VAL B C   1 
ATOM   4835  O  O   . VAL B 1 172 ? 2.547   26.670  -14.703  1.00 20.48 ? 161  VAL B O   1 
ATOM   4836  C  CB  . VAL B 1 172 ? -0.248  25.588  -14.743  1.00 20.45 ? 161  VAL B CB  1 
ATOM   4837  C  CG1 . VAL B 1 172 ? -0.145  25.373  -16.254  1.00 18.58 ? 161  VAL B CG1 1 
ATOM   4838  C  CG2 . VAL B 1 172 ? -1.573  25.013  -14.133  1.00 19.88 ? 161  VAL B CG2 1 
ATOM   4839  N  N   . ASN B 1 173 ? 3.017   24.558  -15.332  1.00 17.72 ? 162  ASN B N   1 
ATOM   4840  C  CA  . ASN B 1 173 ? 4.249   24.986  -16.023  1.00 15.92 ? 162  ASN B CA  1 
ATOM   4841  C  C   . ASN B 1 173 ? 4.399   24.535  -17.465  1.00 15.75 ? 162  ASN B C   1 
ATOM   4842  O  O   . ASN B 1 173 ? 5.509   24.551  -17.997  1.00 15.18 ? 162  ASN B O   1 
ATOM   4843  C  CB  . ASN B 1 173 ? 5.526   24.713  -15.212  1.00 14.85 ? 162  ASN B CB  1 
ATOM   4844  C  CG  . ASN B 1 173 ? 5.823   23.231  -14.972  1.00 14.21 ? 162  ASN B CG  1 
ATOM   4845  O  OD1 . ASN B 1 173 ? 5.036   22.327  -15.284  1.00 14.85 ? 162  ASN B OD1 1 
ATOM   4846  N  ND2 . ASN B 1 173 ? 6.980   22.984  -14.378  1.00 11.64 ? 162  ASN B ND2 1 
ATOM   4847  N  N   . SER B 1 174 ? 3.265   24.199  -18.078  1.00 16.42 ? 163  SER B N   1 
ATOM   4848  C  CA  . SER B 1 174 ? 3.216   23.670  -19.451  1.00 16.18 ? 163  SER B CA  1 
ATOM   4849  C  C   . SER B 1 174 ? 1.839   23.875  -20.057  1.00 16.43 ? 163  SER B C   1 
ATOM   4850  O  O   . SER B 1 174 ? 0.815   23.853  -19.347  1.00 17.17 ? 163  SER B O   1 
ATOM   4851  C  CB  . SER B 1 174 ? 3.566   22.190  -19.473  1.00 16.00 ? 163  SER B CB  1 
ATOM   4852  O  OG  . SER B 1 174 ? 2.838   21.483  -18.494  1.00 19.08 ? 163  SER B OG  1 
ATOM   4853  N  N   . PHE B 1 175 ? 1.839   24.101  -21.377  1.00 14.19 ? 164  PHE B N   1 
ATOM   4854  C  CA  . PHE B 1 175 ? 0.660   24.435  -22.114  1.00 14.05 ? 164  PHE B CA  1 
ATOM   4855  C  C   . PHE B 1 175 ? 0.762   23.694  -23.430  1.00 13.52 ? 164  PHE B C   1 
ATOM   4856  O  O   . PHE B 1 175 ? 1.865   23.463  -23.888  1.00 14.98 ? 164  PHE B O   1 
ATOM   4857  C  CB  . PHE B 1 175 ? 0.607   25.939  -22.398  1.00 14.65 ? 164  PHE B CB  1 
ATOM   4858  C  CG  . PHE B 1 175 ? 0.427   26.783  -21.171  1.00 13.54 ? 164  PHE B CG  1 
ATOM   4859  C  CD1 . PHE B 1 175 ? 1.524   27.194  -20.423  1.00 14.77 ? 164  PHE B CD1 1 
ATOM   4860  C  CD2 . PHE B 1 175 ? -0.842  27.188  -20.775  1.00 14.57 ? 164  PHE B CD2 1 
ATOM   4861  C  CE1 . PHE B 1 175 ? 1.347   27.971  -19.257  1.00 14.80 ? 164  PHE B CE1 1 
ATOM   4862  C  CE2 . PHE B 1 175 ? -1.032  27.970  -19.625  1.00 14.94 ? 164  PHE B CE2 1 
ATOM   4863  C  CZ  . PHE B 1 175 ? 0.059   28.365  -18.880  1.00 13.67 ? 164  PHE B CZ  1 
ATOM   4864  N  N   . LEU B 1 176 ? -0.367  23.337  -24.041  1.00 13.72 ? 165  LEU B N   1 
ATOM   4865  C  CA  . LEU B 1 176 ? -0.338  22.709  -25.390  1.00 11.33 ? 165  LEU B CA  1 
ATOM   4866  C  C   . LEU B 1 176 ? -1.037  23.527  -26.422  1.00 10.80 ? 165  LEU B C   1 
ATOM   4867  O  O   . LEU B 1 176 ? -2.092  24.096  -26.159  1.00 9.15  ? 165  LEU B O   1 
ATOM   4868  C  CB  . LEU B 1 176 ? -0.951  21.299  -25.337  1.00 11.65 ? 165  LEU B CB  1 
ATOM   4869  C  CG  . LEU B 1 176 ? -0.899  20.292  -26.485  1.00 13.26 ? 165  LEU B CG  1 
ATOM   4870  C  CD1 . LEU B 1 176 ? -0.666  18.907  -25.965  1.00 9.67  ? 165  LEU B CD1 1 
ATOM   4871  C  CD2 . LEU B 1 176 ? -2.232  20.369  -27.320  1.00 12.53 ? 165  LEU B CD2 1 
ATOM   4872  N  N   . VAL B 1 177 ? -0.464  23.510  -27.637  1.00 10.10 ? 166  VAL B N   1 
ATOM   4873  C  CA  . VAL B 1 177 ? -1.045  24.140  -28.826  1.00 9.59  ? 166  VAL B CA  1 
ATOM   4874  C  C   . VAL B 1 177 ? -1.129  23.122  -29.933  1.00 9.50  ? 166  VAL B C   1 
ATOM   4875  O  O   . VAL B 1 177 ? -0.415  22.135  -29.895  1.00 7.73  ? 166  VAL B O   1 
ATOM   4876  C  CB  . VAL B 1 177 ? -0.197  25.312  -29.314  1.00 11.71 ? 166  VAL B CB  1 
ATOM   4877  C  CG1 . VAL B 1 177 ? -0.204  26.435  -28.246  1.00 11.46 ? 166  VAL B CG1 1 
ATOM   4878  C  CG2 . VAL B 1 177 ? 1.260   24.872  -29.621  1.00 7.15  ? 166  VAL B CG2 1 
ATOM   4879  N  N   . TYR B 1 178 ? -1.995  23.385  -30.935  1.00 9.60  ? 167  TYR B N   1 
ATOM   4880  C  CA  . TYR B 1 178 ? -2.404  22.379  -31.912  1.00 9.26  ? 167  TYR B CA  1 
ATOM   4881  C  C   . TYR B 1 178 ? -2.093  22.960  -33.272  1.00 6.31  ? 167  TYR B C   1 
ATOM   4882  O  O   . TYR B 1 178 ? -2.420  24.088  -33.509  1.00 4.00  ? 167  TYR B O   1 
ATOM   4883  C  CB  . TYR B 1 178 ? -3.931  22.138  -31.858  1.00 9.34  ? 167  TYR B CB  1 
ATOM   4884  C  CG  . TYR B 1 178 ? -4.430  21.371  -30.677  1.00 11.08 ? 167  TYR B CG  1 
ATOM   4885  C  CD1 . TYR B 1 178 ? -4.579  21.991  -29.445  1.00 13.04 ? 167  TYR B CD1 1 
ATOM   4886  C  CD2 . TYR B 1 178 ? -4.767  20.020  -30.778  1.00 10.75 ? 167  TYR B CD2 1 
ATOM   4887  C  CE1 . TYR B 1 178 ? -5.035  21.284  -28.330  1.00 11.92 ? 167  TYR B CE1 1 
ATOM   4888  C  CE2 . TYR B 1 178 ? -5.219  19.293  -29.643  1.00 11.74 ? 167  TYR B CE2 1 
ATOM   4889  C  CZ  . TYR B 1 178 ? -5.336  19.932  -28.435  1.00 9.93  ? 167  TYR B CZ  1 
ATOM   4890  O  OH  . TYR B 1 178 ? -5.797  19.223  -27.317  1.00 15.72 ? 167  TYR B OH  1 
ATOM   4891  N  N   . MET B 1 179 ? -1.368  22.218  -34.083  1.00 9.34  ? 168  MET B N   1 
ATOM   4892  C  CA  A MET B 1 179 ? -1.172  22.566  -35.501  0.50 9.65  ? 168  MET B CA  1 
ATOM   4893  C  CA  B MET B 1 179 ? -1.162  22.582  -35.494  0.50 12.51 ? 168  MET B CA  1 
ATOM   4894  C  C   . MET B 1 179 ? -2.156  21.781  -36.328  1.00 12.64 ? 168  MET B C   1 
ATOM   4895  O  O   . MET B 1 179 ? -2.224  21.943  -37.583  1.00 14.64 ? 168  MET B O   1 
ATOM   4896  C  CB  A MET B 1 179 ? 0.239   22.194  -35.922  0.50 9.11  ? 168  MET B CB  1 
ATOM   4897  C  CB  B MET B 1 179 ? 0.300   22.310  -35.907  0.50 12.88 ? 168  MET B CB  1 
ATOM   4898  C  CG  A MET B 1 179 ? 1.287   23.040  -35.266  0.50 5.18  ? 168  MET B CG  1 
ATOM   4899  C  CG  B MET B 1 179 ? 1.268   23.429  -35.466  0.50 13.27 ? 168  MET B CG  1 
ATOM   4900  S  SD  A MET B 1 179 ? 2.916   22.383  -35.454  0.50 2.00  ? 168  MET B SD  1 
ATOM   4901  S  SD  B MET B 1 179 ? 3.001   23.409  -36.022  0.50 17.30 ? 168  MET B SD  1 
ATOM   4902  C  CE  A MET B 1 179 ? 3.048   22.443  -37.267  0.50 2.00  ? 168  MET B CE  1 
ATOM   4903  C  CE  B MET B 1 179 ? 3.629   22.102  -35.012  0.50 12.63 ? 168  MET B CE  1 
ATOM   4904  N  N   . ALA B 1 180 ? -2.920  20.925  -35.637  1.00 14.01 ? 169  ALA B N   1 
ATOM   4905  C  CA  . ALA B 1 180 ? -3.964  20.090  -36.217  1.00 15.23 ? 169  ALA B CA  1 
ATOM   4906  C  C   . ALA B 1 180 ? -5.364  20.508  -35.721  1.00 15.81 ? 169  ALA B C   1 
ATOM   4907  O  O   . ALA B 1 180 ? -5.487  21.324  -34.797  1.00 17.88 ? 169  ALA B O   1 
ATOM   4908  C  CB  . ALA B 1 180 ? -3.671  18.574  -35.928  1.00 14.66 ? 169  ALA B CB  1 
ATOM   4909  N  N   . PHE B 1 181 ? -6.409  19.983  -36.371  1.00 17.04 ? 170  PHE B N   1 
ATOM   4910  C  CA  . PHE B 1 181 ? -7.828  20.290  -36.044  1.00 16.88 ? 170  PHE B CA  1 
ATOM   4911  C  C   . PHE B 1 181 ? -8.205  21.656  -36.554  1.00 15.59 ? 170  PHE B C   1 
ATOM   4912  O  O   . PHE B 1 181 ? -8.509  22.568  -35.806  1.00 13.84 ? 170  PHE B O   1 
ATOM   4913  C  CB  . PHE B 1 181 ? -8.128  20.133  -34.542  1.00 19.31 ? 170  PHE B CB  1 
ATOM   4914  C  CG  . PHE B 1 181 ? -7.768  18.776  -34.012  1.00 21.30 ? 170  PHE B CG  1 
ATOM   4915  C  CD1 . PHE B 1 181 ? -8.312  17.637  -34.571  1.00 24.73 ? 170  PHE B CD1 1 
ATOM   4916  C  CD2 . PHE B 1 181 ? -6.839  18.632  -33.006  1.00 24.73 ? 170  PHE B CD2 1 
ATOM   4917  C  CE1 . PHE B 1 181 ? -7.938  16.392  -34.126  1.00 24.99 ? 170  PHE B CE1 1 
ATOM   4918  C  CE2 . PHE B 1 181 ? -6.473  17.387  -32.555  1.00 23.33 ? 170  PHE B CE2 1 
ATOM   4919  C  CZ  . PHE B 1 181 ? -7.023  16.271  -33.109  1.00 24.26 ? 170  PHE B CZ  1 
ATOM   4920  N  N   . LYS B 1 182 ? -8.162  21.769  -37.876  1.00 16.57 ? 171  LYS B N   1 
ATOM   4921  C  CA  . LYS B 1 182 ? -8.555  22.958  -38.559  1.00 16.63 ? 171  LYS B CA  1 
ATOM   4922  C  C   . LYS B 1 182 ? -10.007 23.303  -38.202  1.00 19.33 ? 171  LYS B C   1 
ATOM   4923  O  O   . LYS B 1 182 ? -10.890 22.412  -38.148  1.00 20.67 ? 171  LYS B O   1 
ATOM   4924  C  CB  . LYS B 1 182 ? -8.433  22.739  -40.074  1.00 15.73 ? 171  LYS B CB  1 
ATOM   4925  C  CG  . LYS B 1 182 ? -8.415  24.023  -40.831  1.00 15.14 ? 171  LYS B CG  1 
ATOM   4926  C  CD  . LYS B 1 182 ? -8.531  23.813  -42.345  1.00 13.95 ? 171  LYS B CD  1 
ATOM   4927  C  CE  . LYS B 1 182 ? -8.488  25.132  -43.052  1.00 14.67 ? 171  LYS B CE  1 
ATOM   4928  N  NZ  . LYS B 1 182 ? -8.751  25.031  -44.538  1.00 14.89 ? 171  LYS B NZ  1 
ATOM   4929  N  N   . ASP B 1 183 ? -10.255 24.597  -37.994  1.00 20.51 ? 172  ASP B N   1 
ATOM   4930  C  CA  . ASP B 1 183 ? -11.594 25.104  -37.677  1.00 20.32 ? 172  ASP B CA  1 
ATOM   4931  C  C   . ASP B 1 183 ? -12.051 24.475  -36.373  1.00 21.23 ? 172  ASP B C   1 
ATOM   4932  O  O   . ASP B 1 183 ? -13.109 23.859  -36.355  1.00 24.67 ? 172  ASP B O   1 
ATOM   4933  C  CB  . ASP B 1 183 ? -12.603 24.775  -38.795  1.00 18.93 ? 172  ASP B CB  1 
ATOM   4934  C  CG  . ASP B 1 183 ? -12.137 25.251  -40.167  1.00 20.26 ? 172  ASP B CG  1 
ATOM   4935  O  OD1 . ASP B 1 183 ? -11.258 26.137  -40.250  1.00 19.00 ? 172  ASP B OD1 1 
ATOM   4936  O  OD2 . ASP B 1 183 ? -12.679 24.742  -41.179  1.00 23.69 ? 172  ASP B OD2 1 
ATOM   4937  N  N   . ARG B 1 184 ? -11.228 24.587  -35.330  1.00 21.44 ? 173  ARG B N   1 
ATOM   4938  C  CA  A ARG B 1 184 ? -11.518 24.024  -34.003  0.50 21.55 ? 173  ARG B CA  1 
ATOM   4939  C  CA  B ARG B 1 184 ? -11.522 24.027  -33.997  0.50 21.58 ? 173  ARG B CA  1 
ATOM   4940  C  C   . ARG B 1 184 ? -10.423 24.449  -33.013  1.00 21.76 ? 173  ARG B C   1 
ATOM   4941  O  O   . ARG B 1 184 ? -10.663 25.292  -32.150  1.00 21.48 ? 173  ARG B O   1 
ATOM   4942  C  CB  A ARG B 1 184 ? -11.641 22.496  -34.072  0.50 21.65 ? 173  ARG B CB  1 
ATOM   4943  C  CB  B ARG B 1 184 ? -11.674 22.496  -34.043  0.50 21.72 ? 173  ARG B CB  1 
ATOM   4944  C  CG  A ARG B 1 184 ? -11.873 21.779  -32.723  0.50 22.14 ? 173  ARG B CG  1 
ATOM   4945  C  CG  B ARG B 1 184 ? -11.776 21.773  -32.660  0.50 22.12 ? 173  ARG B CG  1 
ATOM   4946  C  CD  A ARG B 1 184 ? -12.345 20.312  -32.959  0.50 22.96 ? 173  ARG B CD  1 
ATOM   4947  C  CD  B ARG B 1 184 ? -12.515 20.388  -32.770  0.50 23.20 ? 173  ARG B CD  1 
ATOM   4948  N  NE  A ARG B 1 184 ? -12.106 19.424  -31.813  0.50 22.20 ? 173  ARG B NE  1 
ATOM   4949  N  NE  B ARG B 1 184 ? -11.925 19.317  -31.939  0.50 22.25 ? 173  ARG B NE  1 
ATOM   4950  C  CZ  A ARG B 1 184 ? -12.798 19.437  -30.671  0.50 23.59 ? 173  ARG B CZ  1 
ATOM   4951  C  CZ  B ARG B 1 184 ? -11.582 18.095  -32.366  0.50 23.72 ? 173  ARG B CZ  1 
ATOM   4952  N  NH1 A ARG B 1 184 ? -13.798 20.291  -30.480  0.50 24.51 ? 173  ARG B NH1 1 
ATOM   4953  N  NH1 B ARG B 1 184 ? -11.047 17.215  -31.519  0.50 23.96 ? 173  ARG B NH1 1 
ATOM   4954  N  NH2 A ARG B 1 184 ? -12.488 18.579  -29.707  0.50 23.37 ? 173  ARG B NH2 1 
ATOM   4955  N  NH2 B ARG B 1 184 ? -11.770 17.732  -33.636  0.50 26.19 ? 173  ARG B NH2 1 
ATOM   4956  N  N   . PHE B 1 185 ? -9.206  23.884  -33.158  1.00 22.05 ? 174  PHE B N   1 
ATOM   4957  C  CA  . PHE B 1 185 ? -8.036  24.245  -32.309  1.00 21.03 ? 174  PHE B CA  1 
ATOM   4958  C  C   . PHE B 1 185 ? -6.774  24.749  -33.042  1.00 20.16 ? 174  PHE B C   1 
ATOM   4959  O  O   . PHE B 1 185 ? -5.832  25.262  -32.422  1.00 22.22 ? 174  PHE B O   1 
ATOM   4960  C  CB  . PHE B 1 185 ? -7.591  23.055  -31.491  1.00 20.69 ? 174  PHE B CB  1 
ATOM   4961  C  CG  . PHE B 1 185 ? -8.630  22.474  -30.624  1.00 20.76 ? 174  PHE B CG  1 
ATOM   4962  C  CD1 . PHE B 1 185 ? -9.519  23.268  -29.944  1.00 22.95 ? 174  PHE B CD1 1 
ATOM   4963  C  CD2 . PHE B 1 185 ? -8.660  21.107  -30.419  1.00 19.92 ? 174  PHE B CD2 1 
ATOM   4964  C  CE1 . PHE B 1 185 ? -10.458 22.706  -29.108  1.00 22.03 ? 174  PHE B CE1 1 
ATOM   4965  C  CE2 . PHE B 1 185 ? -9.597  20.540  -29.588  1.00 22.26 ? 174  PHE B CE2 1 
ATOM   4966  C  CZ  . PHE B 1 185 ? -10.494 21.336  -28.930  1.00 22.33 ? 174  PHE B CZ  1 
ATOM   4967  N  N   . GLN B 1 186 ? -6.727  24.594  -34.352  1.00 19.53 ? 175  GLN B N   1 
ATOM   4968  C  CA  . GLN B 1 186 ? -5.538  24.938  -35.074  1.00 18.35 ? 175  GLN B CA  1 
ATOM   4969  C  C   . GLN B 1 186 ? -5.187  26.384  -34.865  1.00 18.21 ? 175  GLN B C   1 
ATOM   4970  O  O   . GLN B 1 186 ? -6.037  27.267  -35.015  1.00 18.19 ? 175  GLN B O   1 
ATOM   4971  C  CB  . GLN B 1 186 ? -5.705  24.678  -36.569  1.00 19.24 ? 175  GLN B CB  1 
ATOM   4972  C  CG  . GLN B 1 186 ? -4.374  24.598  -37.330  1.00 17.53 ? 175  GLN B CG  1 
ATOM   4973  C  CD  . GLN B 1 186 ? -4.560  23.908  -38.655  1.00 17.61 ? 175  GLN B CD  1 
ATOM   4974  O  OE1 . GLN B 1 186 ? -5.334  22.941  -38.761  1.00 14.47 ? 175  GLN B OE1 1 
ATOM   4975  N  NE2 . GLN B 1 186 ? -3.884  24.392  -39.672  1.00 20.47 ? 175  GLN B NE2 1 
ATOM   4976  N  N   . LEU B 1 187 ? -3.936  26.589  -34.446  1.00 17.58 ? 176  LEU B N   1 
ATOM   4977  C  CA  . LEU B 1 187 ? -3.283  27.883  -34.396  1.00 17.40 ? 176  LEU B CA  1 
ATOM   4978  C  C   . LEU B 1 187 ? -2.450  28.068  -35.672  1.00 15.53 ? 176  LEU B C   1 
ATOM   4979  O  O   . LEU B 1 187 ? -1.887  27.095  -36.174  1.00 13.42 ? 176  LEU B O   1 
ATOM   4980  C  CB  . LEU B 1 187 ? -2.361  27.925  -33.181  1.00 18.37 ? 176  LEU B CB  1 
ATOM   4981  C  CG  . LEU B 1 187 ? -2.883  28.442  -31.840  1.00 20.37 ? 176  LEU B CG  1 
ATOM   4982  C  CD1 . LEU B 1 187 ? -4.287  28.017  -31.549  1.00 21.89 ? 176  LEU B CD1 1 
ATOM   4983  C  CD2 . LEU B 1 187 ? -1.951  28.027  -30.709  1.00 17.68 ? 176  LEU B CD2 1 
ATOM   4984  N  N   . THR B 1 188 ? -2.349  29.298  -36.188  1.00 15.57 ? 177  THR B N   1 
ATOM   4985  C  CA  . THR B 1 188 ? -1.378  29.590  -37.277  1.00 15.51 ? 177  THR B CA  1 
ATOM   4986  C  C   . THR B 1 188 ? 0.038   29.670  -36.738  1.00 13.89 ? 177  THR B C   1 
ATOM   4987  O  O   . THR B 1 188 ? 0.269   29.677  -35.517  1.00 12.39 ? 177  THR B O   1 
ATOM   4988  C  CB  . THR B 1 188 ? -1.648  30.902  -38.097  1.00 15.12 ? 177  THR B CB  1 
ATOM   4989  O  OG1 . THR B 1 188 ? -1.340  32.056  -37.309  1.00 20.53 ? 177  THR B OG1 1 
ATOM   4990  C  CG2 . THR B 1 188 ? -3.071  30.975  -38.602  1.00 14.70 ? 177  THR B CG2 1 
ATOM   4991  N  N   . ASP B 1 189 ? 0.969   29.720  -37.670  1.00 12.91 ? 178  ASP B N   1 
ATOM   4992  C  CA  . ASP B 1 189 ? 2.420   29.815  -37.410  1.00 14.40 ? 178  ASP B CA  1 
ATOM   4993  C  C   . ASP B 1 189 ? 2.779   31.094  -36.718  1.00 13.92 ? 178  ASP B C   1 
ATOM   4994  O  O   . ASP B 1 189 ? 3.562   31.074  -35.794  1.00 15.70 ? 178  ASP B O   1 
ATOM   4995  C  CB  . ASP B 1 189 ? 3.208   29.780  -38.735  1.00 13.99 ? 178  ASP B CB  1 
ATOM   4996  C  CG  . ASP B 1 189 ? 3.342   28.385  -39.312  1.00 16.07 ? 178  ASP B CG  1 
ATOM   4997  O  OD1 . ASP B 1 189 ? 3.025   27.440  -38.560  1.00 11.27 ? 178  ASP B OD1 1 
ATOM   4998  O  OD2 . ASP B 1 189 ? 3.738   28.237  -40.535  1.00 12.48 ? 178  ASP B OD2 1 
ATOM   4999  N  N   . CYS B 1 190 ? 2.182   32.203  -37.158  1.00 16.64 ? 179  CYS B N   1 
ATOM   5000  C  CA  . CYS B 1 190 ? 2.311   33.496  -36.478  1.00 15.88 ? 179  CYS B CA  1 
ATOM   5001  C  C   . CYS B 1 190 ? 1.806   33.351  -35.026  1.00 15.12 ? 179  CYS B C   1 
ATOM   5002  O  O   . CYS B 1 190 ? 2.506   33.639  -34.066  1.00 15.82 ? 179  CYS B O   1 
ATOM   5003  C  CB  . CYS B 1 190 ? 1.509   34.547  -37.260  1.00 17.82 ? 179  CYS B CB  1 
ATOM   5004  S  SG  . CYS B 1 190 ? 1.421   36.250  -36.550  1.00 25.44 ? 179  CYS B SG  1 
ATOM   5005  N  N   . GLN B 1 191 ? 0.587   32.857  -34.869  1.00 15.48 ? 180  GLN B N   1 
ATOM   5006  C  CA  . GLN B 1 191 ? 0.035   32.627  -33.552  1.00 16.21 ? 180  GLN B CA  1 
ATOM   5007  C  C   . GLN B 1 191 ? 0.902   31.695  -32.675  1.00 16.75 ? 180  GLN B C   1 
ATOM   5008  O  O   . GLN B 1 191 ? 0.912   31.828  -31.443  1.00 17.88 ? 180  GLN B O   1 
ATOM   5009  C  CB  . GLN B 1 191 ? -1.380  32.063  -33.658  1.00 15.83 ? 180  GLN B CB  1 
ATOM   5010  C  CG  . GLN B 1 191 ? -2.431  33.014  -34.220  1.00 18.12 ? 180  GLN B CG  1 
ATOM   5011  C  CD  . GLN B 1 191 ? -3.828  32.410  -34.177  1.00 18.02 ? 180  GLN B CD  1 
ATOM   5012  O  OE1 . GLN B 1 191 ? -3.989  31.194  -34.313  1.00 16.67 ? 180  GLN B OE1 1 
ATOM   5013  N  NE2 . GLN B 1 191 ? -4.846  33.250  -33.975  1.00 18.64 ? 180  GLN B NE2 1 
ATOM   5014  N  N   . ILE B 1 192 ? 1.591   30.734  -33.286  1.00 16.09 ? 181  ILE B N   1 
ATOM   5015  C  CA  . ILE B 1 192 ? 2.410   29.779  -32.540  1.00 15.78 ? 181  ILE B CA  1 
ATOM   5016  C  C   . ILE B 1 192 ? 3.674   30.467  -32.083  1.00 15.45 ? 181  ILE B C   1 
ATOM   5017  O  O   . ILE B 1 192 ? 4.089   30.316  -30.917  1.00 11.30 ? 181  ILE B O   1 
ATOM   5018  C  CB  . ILE B 1 192 ? 2.738   28.487  -33.341  1.00 16.06 ? 181  ILE B CB  1 
ATOM   5019  C  CG1 . ILE B 1 192 ? 1.490   27.596  -33.422  1.00 17.15 ? 181  ILE B CG1 1 
ATOM   5020  C  CG2 . ILE B 1 192 ? 3.881   27.717  -32.665  1.00 14.40 ? 181  ILE B CG2 1 
ATOM   5021  C  CD1 . ILE B 1 192 ? 1.523   26.587  -34.483  1.00 14.59 ? 181  ILE B CD1 1 
ATOM   5022  N  N   . TYR B 1 193 ? 4.244   31.264  -32.976  1.00 16.94 ? 182  TYR B N   1 
ATOM   5023  C  CA  . TYR B 1 193 ? 5.354   32.164  -32.630  1.00 18.55 ? 182  TYR B CA  1 
ATOM   5024  C  C   . TYR B 1 193 ? 4.988   33.093  -31.476  1.00 19.20 ? 182  TYR B C   1 
ATOM   5025  O  O   . TYR B 1 193 ? 5.816   33.343  -30.598  1.00 19.66 ? 182  TYR B O   1 
ATOM   5026  C  CB  . TYR B 1 193 ? 5.755   32.993  -33.854  1.00 19.64 ? 182  TYR B CB  1 
ATOM   5027  C  CG  . TYR B 1 193 ? 6.920   33.956  -33.661  1.00 19.90 ? 182  TYR B CG  1 
ATOM   5028  C  CD1 . TYR B 1 193 ? 6.763   35.129  -32.924  1.00 23.01 ? 182  TYR B CD1 1 
ATOM   5029  C  CD2 . TYR B 1 193 ? 8.168   33.720  -34.260  1.00 20.30 ? 182  TYR B CD2 1 
ATOM   5030  C  CE1 . TYR B 1 193 ? 7.805   36.033  -32.766  1.00 21.73 ? 182  TYR B CE1 1 
ATOM   5031  C  CE2 . TYR B 1 193 ? 9.231   34.624  -34.090  1.00 21.97 ? 182  TYR B CE2 1 
ATOM   5032  C  CZ  . TYR B 1 193 ? 9.035   35.784  -33.340  1.00 20.83 ? 182  TYR B CZ  1 
ATOM   5033  O  OH  . TYR B 1 193 ? 10.045  36.710  -33.143  1.00 22.47 ? 182  TYR B OH  1 
ATOM   5034  N  N   . GLU B 1 194 ? 3.756   33.595  -31.446  1.00 19.69 ? 183  GLU B N   1 
ATOM   5035  C  CA  . GLU B 1 194 ? 3.361   34.470  -30.349  1.00 20.49 ? 183  GLU B CA  1 
ATOM   5036  C  C   . GLU B 1 194 ? 3.224   33.731  -29.016  1.00 20.94 ? 183  GLU B C   1 
ATOM   5037  O  O   . GLU B 1 194 ? 3.769   34.184  -27.991  1.00 24.01 ? 183  GLU B O   1 
ATOM   5038  C  CB  . GLU B 1 194 ? 2.083   35.211  -30.675  1.00 21.18 ? 183  GLU B CB  1 
ATOM   5039  C  CG  . GLU B 1 194 ? 2.281   36.232  -31.761  1.00 21.85 ? 183  GLU B CG  1 
ATOM   5040  C  CD  . GLU B 1 194 ? 1.007   36.920  -32.127  1.00 21.84 ? 183  GLU B CD  1 
ATOM   5041  O  OE1 . GLU B 1 194 ? 0.088   36.922  -31.295  1.00 21.75 ? 183  GLU B OE1 1 
ATOM   5042  O  OE2 . GLU B 1 194 ? 0.930   37.448  -33.245  1.00 24.99 ? 183  GLU B OE2 1 
ATOM   5043  N  N   . VAL B 1 195 ? 2.527   32.596  -29.039  1.00 19.05 ? 184  VAL B N   1 
ATOM   5044  C  CA  . VAL B 1 195 ? 2.393   31.708  -27.878  1.00 19.07 ? 184  VAL B CA  1 
ATOM   5045  C  C   . VAL B 1 195 ? 3.717   31.243  -27.236  1.00 19.90 ? 184  VAL B C   1 
ATOM   5046  O  O   . VAL B 1 195 ? 3.875   31.318  -25.998  1.00 19.76 ? 184  VAL B O   1 
ATOM   5047  C  CB  . VAL B 1 195 ? 1.592   30.433  -28.235  1.00 17.92 ? 184  VAL B CB  1 
ATOM   5048  C  CG1 . VAL B 1 195 ? 1.417   29.569  -27.007  1.00 13.39 ? 184  VAL B CG1 1 
ATOM   5049  C  CG2 . VAL B 1 195 ? 0.245   30.802  -28.864  1.00 20.53 ? 184  VAL B CG2 1 
ATOM   5050  N  N   . LEU B 1 196 ? 4.632   30.724  -28.061  1.00 19.58 ? 185  LEU B N   1 
ATOM   5051  C  CA  . LEU B 1 196 ? 5.920   30.213  -27.575  1.00 20.86 ? 185  LEU B CA  1 
ATOM   5052  C  C   . LEU B 1 196 ? 6.780   31.289  -26.916  1.00 20.86 ? 185  LEU B C   1 
ATOM   5053  O  O   . LEU B 1 196 ? 7.477   31.027  -25.948  1.00 21.55 ? 185  LEU B O   1 
ATOM   5054  C  CB  . LEU B 1 196 ? 6.686   29.516  -28.714  1.00 21.31 ? 185  LEU B CB  1 
ATOM   5055  C  CG  . LEU B 1 196 ? 6.470   28.006  -28.864  1.00 22.42 ? 185  LEU B CG  1 
ATOM   5056  C  CD1 . LEU B 1 196 ? 5.045   27.548  -28.534  1.00 23.54 ? 185  LEU B CD1 1 
ATOM   5057  C  CD2 . LEU B 1 196 ? 6.843   27.566  -30.251  1.00 21.60 ? 185  LEU B CD2 1 
ATOM   5058  N  N   . SER B 1 197 ? 6.683   32.513  -27.406  1.00 21.96 ? 186  SER B N   1 
ATOM   5059  C  CA  . SER B 1 197 ? 7.408   33.617  -26.811  1.00 22.42 ? 186  SER B CA  1 
ATOM   5060  C  C   . SER B 1 197 ? 6.885   33.890  -25.412  1.00 23.54 ? 186  SER B C   1 
ATOM   5061  O  O   . SER B 1 197 ? 7.679   34.180  -24.513  1.00 24.58 ? 186  SER B O   1 
ATOM   5062  C  CB  . SER B 1 197 ? 7.295   34.863  -27.679  1.00 23.30 ? 186  SER B CB  1 
ATOM   5063  O  OG  . SER B 1 197 ? 7.666   34.599  -29.022  1.00 20.51 ? 186  SER B OG  1 
ATOM   5064  N  N   . VAL B 1 198 ? 5.563   33.773  -25.223  1.00 23.41 ? 187  VAL B N   1 
ATOM   5065  C  CA  . VAL B 1 198 ? 4.938   34.016  -23.918  1.00 22.85 ? 187  VAL B CA  1 
ATOM   5066  C  C   . VAL B 1 198 ? 5.372   32.908  -22.963  1.00 22.97 ? 187  VAL B C   1 
ATOM   5067  O  O   . VAL B 1 198 ? 5.874   33.181  -21.879  1.00 23.91 ? 187  VAL B O   1 
ATOM   5068  C  CB  . VAL B 1 198 ? 3.363   34.095  -23.992  1.00 23.64 ? 187  VAL B CB  1 
ATOM   5069  C  CG1 . VAL B 1 198 ? 2.746   34.199  -22.567  1.00 22.79 ? 187  VAL B CG1 1 
ATOM   5070  C  CG2 . VAL B 1 198 ? 2.886   35.260  -24.859  1.00 20.59 ? 187  VAL B CG2 1 
ATOM   5071  N  N   . ILE B 1 199 ? 5.207   31.653  -23.392  1.00 22.86 ? 188  ILE B N   1 
ATOM   5072  C  CA  . ILE B 1 199 ? 5.638   30.466  -22.619  1.00 21.25 ? 188  ILE B CA  1 
ATOM   5073  C  C   . ILE B 1 199 ? 7.088   30.622  -22.127  1.00 19.74 ? 188  ILE B C   1 
ATOM   5074  O  O   . ILE B 1 199 ? 7.374   30.479  -20.934  1.00 20.31 ? 188  ILE B O   1 
ATOM   5075  C  CB  . ILE B 1 199 ? 5.434   29.153  -23.456  1.00 20.16 ? 188  ILE B CB  1 
ATOM   5076  C  CG1 . ILE B 1 199 ? 3.964   28.809  -23.562  1.00 19.84 ? 188  ILE B CG1 1 
ATOM   5077  C  CG2 . ILE B 1 199 ? 6.138   27.938  -22.851  1.00 21.95 ? 188  ILE B CG2 1 
ATOM   5078  C  CD1 . ILE B 1 199 ? 3.668   27.967  -24.751  1.00 17.45 ? 188  ILE B CD1 1 
ATOM   5079  N  N   . ARG B 1 200 ? 7.977   30.980  -23.033  1.00 18.99 ? 189  ARG B N   1 
ATOM   5080  C  CA  . ARG B 1 200 ? 9.376   31.306  -22.669  1.00 21.06 ? 189  ARG B CA  1 
ATOM   5081  C  C   . ARG B 1 200 ? 9.545   32.351  -21.553  1.00 21.40 ? 189  ARG B C   1 
ATOM   5082  O  O   . ARG B 1 200 ? 10.359  32.164  -20.661  1.00 23.09 ? 189  ARG B O   1 
ATOM   5083  C  CB  . ARG B 1 200 ? 10.138  31.838  -23.875  1.00 19.46 ? 189  ARG B CB  1 
ATOM   5084  C  CG  . ARG B 1 200 ? 11.604  32.102  -23.628  1.00 18.32 ? 189  ARG B CG  1 
ATOM   5085  C  CD  . ARG B 1 200 ? 12.147  33.017  -24.692  1.00 19.53 ? 189  ARG B CD  1 
ATOM   5086  N  NE  . ARG B 1 200 ? 11.440  34.292  -24.645  1.00 16.53 ? 189  ARG B NE  1 
ATOM   5087  C  CZ  . ARG B 1 200 ? 11.054  34.994  -25.695  1.00 19.64 ? 189  ARG B CZ  1 
ATOM   5088  N  NH1 . ARG B 1 200 ? 11.317  34.578  -26.933  1.00 18.56 ? 189  ARG B NH1 1 
ATOM   5089  N  NH2 . ARG B 1 200 ? 10.403  36.149  -25.519  1.00 18.73 ? 189  ARG B NH2 1 
ATOM   5090  N  N   . ASP B 1 201 ? 8.818   33.466  -21.667  1.00 22.80 ? 190  ASP B N   1 
ATOM   5091  C  CA  . ASP B 1 201 ? 8.911   34.589  -20.720  1.00 23.24 ? 190  ASP B CA  1 
ATOM   5092  C  C   . ASP B 1 201 ? 8.301   34.209  -19.376  1.00 24.03 ? 190  ASP B C   1 
ATOM   5093  O  O   . ASP B 1 201 ? 8.610   34.813  -18.336  1.00 22.80 ? 190  ASP B O   1 
ATOM   5094  C  CB  . ASP B 1 201 ? 8.163   35.817  -21.258  1.00 24.44 ? 190  ASP B CB  1 
ATOM   5095  C  CG  . ASP B 1 201 ? 8.798   36.432  -22.521  1.00 26.05 ? 190  ASP B CG  1 
ATOM   5096  O  OD1 . ASP B 1 201 ? 9.982   36.154  -22.840  1.00 26.20 ? 190  ASP B OD1 1 
ATOM   5097  O  OD2 . ASP B 1 201 ? 8.087   37.235  -23.182  1.00 25.34 ? 190  ASP B OD2 1 
ATOM   5098  N  N   . ILE B 1 202 ? 7.412   33.215  -19.428  1.00 24.90 ? 191  ILE B N   1 
ATOM   5099  C  CA  . ILE B 1 202 ? 6.645   32.706  -18.293  1.00 24.38 ? 191  ILE B CA  1 
ATOM   5100  C  C   . ILE B 1 202 ? 7.419   31.576  -17.629  1.00 23.25 ? 191  ILE B C   1 
ATOM   5101  O  O   . ILE B 1 202 ? 7.140   31.222  -16.493  1.00 23.68 ? 191  ILE B O   1 
ATOM   5102  C  CB  . ILE B 1 202 ? 5.227   32.215  -18.786  1.00 25.26 ? 191  ILE B CB  1 
ATOM   5103  C  CG1 . ILE B 1 202 ? 4.079   32.954  -18.109  1.00 26.66 ? 191  ILE B CG1 1 
ATOM   5104  C  CG2 . ILE B 1 202 ? 5.036   30.714  -18.623  1.00 28.35 ? 191  ILE B CG2 1 
ATOM   5105  C  CD1 . ILE B 1 202 ? 2.714   32.640  -18.791  1.00 26.18 ? 191  ILE B CD1 1 
ATOM   5106  N  N   . GLY B 1 203 ? 8.413   31.032  -18.332  1.00 22.05 ? 192  GLY B N   1 
ATOM   5107  C  CA  . GLY B 1 203 ? 9.164   29.856  -17.854  1.00 21.42 ? 192  GLY B CA  1 
ATOM   5108  C  C   . GLY B 1 203 ? 8.351   28.566  -17.838  1.00 20.39 ? 192  GLY B C   1 
ATOM   5109  O  O   . GLY B 1 203 ? 8.397   27.778  -16.860  1.00 20.48 ? 192  GLY B O   1 
ATOM   5110  N  N   . ALA B 1 204 ? 7.584   28.372  -18.912  1.00 19.22 ? 193  ALA B N   1 
ATOM   5111  C  CA  . ALA B 1 204 ? 6.743   27.189  -19.093  1.00 18.10 ? 193  ALA B CA  1 
ATOM   5112  C  C   . ALA B 1 204 ? 7.283   26.317  -20.214  1.00 17.25 ? 193  ALA B C   1 
ATOM   5113  O  O   . ALA B 1 204 ? 8.205   26.708  -20.939  1.00 17.32 ? 193  ALA B O   1 
ATOM   5114  C  CB  . ALA B 1 204 ? 5.325   27.592  -19.412  1.00 17.86 ? 193  ALA B CB  1 
ATOM   5115  N  N   . ILE B 1 205 ? 6.716   25.128  -20.349  1.00 16.83 ? 194  ILE B N   1 
ATOM   5116  C  CA  . ILE B 1 205 ? 7.109   24.235  -21.431  1.00 16.08 ? 194  ILE B CA  1 
ATOM   5117  C  C   . ILE B 1 205 ? 6.025   24.263  -22.477  1.00 14.68 ? 194  ILE B C   1 
ATOM   5118  O  O   . ILE B 1 205 ? 4.852   24.150  -22.149  1.00 14.06 ? 194  ILE B O   1 
ATOM   5119  C  CB  . ILE B 1 205 ? 7.295   22.804  -20.983  1.00 15.04 ? 194  ILE B CB  1 
ATOM   5120  C  CG1 . ILE B 1 205 ? 8.378   22.707  -19.925  1.00 18.16 ? 194  ILE B CG1 1 
ATOM   5121  C  CG2 . ILE B 1 205 ? 7.659   21.921  -22.222  1.00 16.90 ? 194  ILE B CG2 1 
ATOM   5122  C  CD1 . ILE B 1 205 ? 7.881   23.092  -18.563  1.00 18.87 ? 194  ILE B CD1 1 
ATOM   5123  N  N   . ALA B 1 206 ? 6.424   24.396  -23.744  1.00 15.81 ? 195  ALA B N   1 
ATOM   5124  C  CA  . ALA B 1 206 ? 5.485   24.422  -24.852  1.00 14.21 ? 195  ALA B CA  1 
ATOM   5125  C  C   . ALA B 1 206 ? 5.296   23.027  -25.371  1.00 14.37 ? 195  ALA B C   1 
ATOM   5126  O  O   . ALA B 1 206 ? 6.236   22.436  -25.853  1.00 16.77 ? 195  ALA B O   1 
ATOM   5127  C  CB  . ALA B 1 206 ? 5.985   25.340  -25.998  1.00 13.19 ? 195  ALA B CB  1 
ATOM   5128  N  N   . GLN B 1 207 ? 4.079   22.511  -25.286  1.00 14.15 ? 196  GLN B N   1 
ATOM   5129  C  CA  . GLN B 1 207 ? 3.729   21.219  -25.835  1.00 14.15 ? 196  GLN B CA  1 
ATOM   5130  C  C   . GLN B 1 207 ? 3.016   21.542  -27.128  1.00 13.09 ? 196  GLN B C   1 
ATOM   5131  O  O   . GLN B 1 207 ? 2.374   22.565  -27.246  1.00 11.73 ? 196  GLN B O   1 
ATOM   5132  C  CB  . GLN B 1 207 ? 2.823   20.427  -24.892  1.00 13.06 ? 196  GLN B CB  1 
ATOM   5133  C  CG  . GLN B 1 207 ? 3.471   19.955  -23.624  1.00 15.33 ? 196  GLN B CG  1 
ATOM   5134  C  CD  . GLN B 1 207 ? 2.495   19.287  -22.657  1.00 14.79 ? 196  GLN B CD  1 
ATOM   5135  O  OE1 . GLN B 1 207 ? 1.477   19.865  -22.308  1.00 17.85 ? 196  GLN B OE1 1 
ATOM   5136  N  NE2 . GLN B 1 207 ? 2.802   18.058  -22.241  1.00 13.63 ? 196  GLN B NE2 1 
ATOM   5137  N  N   . VAL B 1 208 ? 3.220   20.705  -28.128  1.00 16.02 ? 197  VAL B N   1 
ATOM   5138  C  CA  . VAL B 1 208 ? 2.481   20.800  -29.354  1.00 16.33 ? 197  VAL B CA  1 
ATOM   5139  C  C   . VAL B 1 208 ? 1.787   19.444  -29.672  1.00 17.09 ? 197  VAL B C   1 
ATOM   5140  O  O   . VAL B 1 208 ? 2.322   18.380  -29.323  1.00 18.39 ? 197  VAL B O   1 
ATOM   5141  C  CB  . VAL B 1 208 ? 3.433   21.278  -30.479  1.00 17.08 ? 197  VAL B CB  1 
ATOM   5142  C  CG1 . VAL B 1 208 ? 4.438   20.206  -30.820  1.00 18.37 ? 197  VAL B CG1 1 
ATOM   5143  C  CG2 . VAL B 1 208 ? 2.679   21.692  -31.664  1.00 19.05 ? 197  VAL B CG2 1 
ATOM   5144  N  N   . HIS B 1 209 ? 0.573   19.503  -30.256  1.00 16.96 ? 198  HIS B N   1 
ATOM   5145  C  CA  . HIS B 1 209 ? 0.020   18.414  -31.094  1.00 16.43 ? 198  HIS B CA  1 
ATOM   5146  C  C   . HIS B 1 209 ? 0.424   18.672  -32.540  1.00 17.60 ? 198  HIS B C   1 
ATOM   5147  O  O   . HIS B 1 209 ? -0.090  19.593  -33.203  1.00 16.41 ? 198  HIS B O   1 
ATOM   5148  C  CB  . HIS B 1 209 ? -1.517  18.309  -31.005  1.00 16.36 ? 198  HIS B CB  1 
ATOM   5149  C  CG  . HIS B 1 209 ? -2.100  17.289  -31.934  1.00 14.55 ? 198  HIS B CG  1 
ATOM   5150  N  ND1 . HIS B 1 209 ? -2.730  16.134  -31.503  1.00 9.53  ? 198  HIS B ND1 1 
ATOM   5151  C  CD2 . HIS B 1 209 ? -2.108  17.233  -33.291  1.00 16.14 ? 198  HIS B CD2 1 
ATOM   5152  C  CE1 . HIS B 1 209 ? -3.094  15.421  -32.551  1.00 18.15 ? 198  HIS B CE1 1 
ATOM   5153  N  NE2 . HIS B 1 209 ? -2.731  16.066  -33.646  1.00 8.37  ? 198  HIS B NE2 1 
ATOM   5154  N  N   . ALA B 1 210 ? 1.343   17.841  -33.032  1.00 18.42 ? 199  ALA B N   1 
ATOM   5155  C  CA  . ALA B 1 210 ? 2.106   18.163  -34.236  1.00 16.81 ? 199  ALA B CA  1 
ATOM   5156  C  C   . ALA B 1 210 ? 1.692   17.306  -35.451  1.00 16.02 ? 199  ALA B C   1 
ATOM   5157  O  O   . ALA B 1 210 ? 2.285   16.289  -35.762  1.00 15.24 ? 199  ALA B O   1 
ATOM   5158  C  CB  . ALA B 1 210 ? 3.611   18.063  -33.954  1.00 17.65 ? 199  ALA B CB  1 
ATOM   5159  N  N   . GLU B 1 211 ? 0.617   17.731  -36.088  1.00 14.44 ? 200  GLU B N   1 
ATOM   5160  C  CA  . GLU B 1 211 ? 0.282   17.283  -37.452  1.00 13.66 ? 200  GLU B CA  1 
ATOM   5161  C  C   . GLU B 1 211 ? -0.150  18.480  -38.185  1.00 12.26 ? 200  GLU B C   1 
ATOM   5162  O  O   . GLU B 1 211 ? -0.638  19.417  -37.578  1.00 7.65  ? 200  GLU B O   1 
ATOM   5163  C  CB  . GLU B 1 211 ? -0.863  16.309  -37.453  1.00 13.73 ? 200  GLU B CB  1 
ATOM   5164  C  CG  . GLU B 1 211 ? -0.587  14.994  -36.813  1.00 12.71 ? 200  GLU B CG  1 
ATOM   5165  C  CD  . GLU B 1 211 ? -1.875  14.234  -36.620  1.00 16.71 ? 200  GLU B CD  1 
ATOM   5166  O  OE1 . GLU B 1 211 ? -2.603  14.515  -35.607  1.00 12.70 ? 200  GLU B OE1 1 
ATOM   5167  O  OE2 . GLU B 1 211 ? -2.165  13.361  -37.468  1.00 10.42 ? 200  GLU B OE2 1 
ATOM   5168  N  N   . ASN B 1 212 ? 0.002   18.448  -39.511  1.00 9.87  ? 201  ASN B N   1 
ATOM   5169  C  CA  . ASN B 1 212 ? -0.428  19.539  -40.349  1.00 11.61 ? 201  ASN B CA  1 
ATOM   5170  C  C   . ASN B 1 212 ? -1.942  19.420  -40.588  1.00 12.68 ? 201  ASN B C   1 
ATOM   5171  O  O   . ASN B 1 212 ? -2.357  18.585  -41.405  1.00 7.72  ? 201  ASN B O   1 
ATOM   5172  C  CB  . ASN B 1 212 ? 0.333   19.525  -41.695  1.00 10.56 ? 201  ASN B CB  1 
ATOM   5173  C  CG  . ASN B 1 212 ? 0.092   20.796  -42.536  1.00 10.74 ? 201  ASN B CG  1 
ATOM   5174  O  OD1 . ASN B 1 212 ? -1.043  21.137  -42.864  1.00 10.85 ? 201  ASN B OD1 1 
ATOM   5175  N  ND2 . ASN B 1 212 ? 1.170   21.507  -42.866  1.00 14.87 ? 201  ASN B ND2 1 
ATOM   5176  N  N   . GLY B 1 213 ? -2.729  20.255  -39.870  1.00 9.88  ? 202  GLY B N   1 
ATOM   5177  C  CA  . GLY B 1 213 ? -4.199  20.258  -39.954  1.00 10.76 ? 202  GLY B CA  1 
ATOM   5178  C  C   . GLY B 1 213 ? -4.796  20.533  -41.324  1.00 11.84 ? 202  GLY B C   1 
ATOM   5179  O  O   . GLY B 1 213 ? -5.867  19.998  -41.666  1.00 10.87 ? 202  GLY B O   1 
ATOM   5180  N  N   . ASP B 1 214 ? -4.096  21.373  -42.088  1.00 11.91 ? 203  ASP B N   1 
ATOM   5181  C  CA  . ASP B 1 214 ? -4.602  21.884  -43.374  1.00 12.30 ? 203  ASP B CA  1 
ATOM   5182  C  C   . ASP B 1 214 ? -4.543  20.821  -44.471  1.00 11.93 ? 203  ASP B C   1 
ATOM   5183  O  O   . ASP B 1 214 ? -5.457  20.694  -45.256  1.00 14.38 ? 203  ASP B O   1 
ATOM   5184  C  CB  . ASP B 1 214 ? -3.812  23.109  -43.834  1.00 12.27 ? 203  ASP B CB  1 
ATOM   5185  C  CG  . ASP B 1 214 ? -4.202  24.413  -43.121  1.00 17.52 ? 203  ASP B CG  1 
ATOM   5186  O  OD1 . ASP B 1 214 ? -4.433  24.425  -41.877  1.00 25.72 ? 203  ASP B OD1 1 
ATOM   5187  O  OD2 . ASP B 1 214 ? -4.201  25.469  -43.801  1.00 24.45 ? 203  ASP B OD2 1 
ATOM   5188  N  N   . ILE B 1 215 ? -3.439  20.106  -44.565  1.00 11.50 ? 204  ILE B N   1 
ATOM   5189  C  CA  . ILE B 1 215 ? -3.331  18.935  -45.481  1.00 9.54  ? 204  ILE B CA  1 
ATOM   5190  C  C   . ILE B 1 215 ? -4.352  17.857  -45.071  1.00 8.05  ? 204  ILE B C   1 
ATOM   5191  O  O   . ILE B 1 215 ? -5.078  17.340  -45.861  1.00 7.18  ? 204  ILE B O   1 
ATOM   5192  C  CB  . ILE B 1 215 ? -1.891  18.353  -45.454  1.00 8.11  ? 204  ILE B CB  1 
ATOM   5193  C  CG1 . ILE B 1 215 ? -0.889  19.347  -46.031  1.00 10.38 ? 204  ILE B CG1 1 
ATOM   5194  C  CG2 . ILE B 1 215 ? -1.835  16.994  -46.132  1.00 12.70 ? 204  ILE B CG2 1 
ATOM   5195  C  CD1 . ILE B 1 215 ? 0.601   18.906  -45.965  1.00 5.97  ? 204  ILE B CD1 1 
ATOM   5196  N  N   . ILE B 1 216 ? -4.477  17.584  -43.763  1.00 8.71  ? 205  ILE B N   1 
ATOM   5197  C  CA  . ILE B 1 216 ? -5.391  16.581  -43.321  1.00 9.88  ? 205  ILE B CA  1 
ATOM   5198  C  C   . ILE B 1 216 ? -6.834  16.923  -43.637  1.00 12.16 ? 205  ILE B C   1 
ATOM   5199  O  O   . ILE B 1 216 ? -7.610  16.058  -43.998  1.00 14.59 ? 205  ILE B O   1 
ATOM   5200  C  CB  . ILE B 1 216 ? -5.258  16.330  -41.777  1.00 6.71  ? 205  ILE B CB  1 
ATOM   5201  C  CG1 . ILE B 1 216 ? -3.926  15.669  -41.464  1.00 10.24 ? 205  ILE B CG1 1 
ATOM   5202  C  CG2 . ILE B 1 216 ? -6.331  15.390  -41.318  1.00 10.98 ? 205  ILE B CG2 1 
ATOM   5203  C  CD1 . ILE B 1 216 ? -3.660  15.536  -39.892  1.00 2.46  ? 205  ILE B CD1 1 
ATOM   5204  N  N   . ALA B 1 217 ? -7.210  18.188  -43.504  1.00 13.61 ? 206  ALA B N   1 
ATOM   5205  C  CA  . ALA B 1 217 ? -8.567  18.580  -43.800  1.00 13.18 ? 206  ALA B CA  1 
ATOM   5206  C  C   . ALA B 1 217 ? -8.880  18.155  -45.237  1.00 16.05 ? 206  ALA B C   1 
ATOM   5207  O  O   . ALA B 1 217 ? -9.938  17.599  -45.558  1.00 18.52 ? 206  ALA B O   1 
ATOM   5208  C  CB  . ALA B 1 217 ? -8.703  20.090  -43.635  1.00 12.60 ? 206  ALA B CB  1 
ATOM   5209  N  N   . GLU B 1 218 ? -7.919  18.404  -46.097  1.00 15.08 ? 207  GLU B N   1 
ATOM   5210  C  CA  . GLU B 1 218 ? -8.083  18.146  -47.530  1.00 14.84 ? 207  GLU B CA  1 
ATOM   5211  C  C   . GLU B 1 218 ? -8.118  16.672  -47.873  1.00 16.35 ? 207  GLU B C   1 
ATOM   5212  O  O   . GLU B 1 218 ? -8.808  16.276  -48.815  1.00 18.32 ? 207  GLU B O   1 
ATOM   5213  C  CB  . GLU B 1 218 ? -6.962  18.823  -48.276  1.00 12.64 ? 207  GLU B CB  1 
ATOM   5214  C  CG  . GLU B 1 218 ? -6.970  20.329  -48.148  1.00 12.35 ? 207  GLU B CG  1 
ATOM   5215  C  CD  . GLU B 1 218 ? -8.236  20.973  -48.677  1.00 17.79 ? 207  GLU B CD  1 
ATOM   5216  O  OE1 . GLU B 1 218 ? -8.718  20.629  -49.802  1.00 13.59 ? 207  GLU B OE1 1 
ATOM   5217  O  OE2 . GLU B 1 218 ? -8.735  21.871  -47.985  1.00 18.60 ? 207  GLU B OE2 1 
ATOM   5218  N  N   . GLU B 1 219 ? -7.373  15.862  -47.128  1.00 14.81 ? 208  GLU B N   1 
ATOM   5219  C  CA  . GLU B 1 219 ? -7.293  14.448  -47.399  1.00 15.18 ? 208  GLU B CA  1 
ATOM   5220  C  C   . GLU B 1 219 ? -8.455  13.685  -46.742  1.00 16.90 ? 208  GLU B C   1 
ATOM   5221  O  O   . GLU B 1 219 ? -8.812  12.600  -47.163  1.00 18.64 ? 208  GLU B O   1 
ATOM   5222  C  CB  . GLU B 1 219 ? -5.916  13.909  -47.000  1.00 15.02 ? 208  GLU B CB  1 
ATOM   5223  C  CG  . GLU B 1 219 ? -4.784  14.377  -47.956  1.00 11.74 ? 208  GLU B CG  1 
ATOM   5224  C  CD  . GLU B 1 219 ? -4.824  13.723  -49.323  1.00 15.75 ? 208  GLU B CD  1 
ATOM   5225  O  OE1 . GLU B 1 219 ? -4.733  12.474  -49.329  1.00 12.83 ? 208  GLU B OE1 1 
ATOM   5226  O  OE2 . GLU B 1 219 ? -4.891  14.432  -50.385  1.00 10.23 ? 208  GLU B OE2 1 
ATOM   5227  N  N   . GLN B 1 220 ? -9.068  14.248  -45.716  1.00 17.58 ? 209  GLN B N   1 
ATOM   5228  C  CA  . GLN B 1 220 ? -10.298 13.683  -45.179  1.00 18.05 ? 209  GLN B CA  1 
ATOM   5229  C  C   . GLN B 1 220 ? -11.392 13.763  -46.203  1.00 20.26 ? 209  GLN B C   1 
ATOM   5230  O  O   . GLN B 1 220 ? -12.082 12.782  -46.451  1.00 22.39 ? 209  GLN B O   1 
ATOM   5231  C  CB  . GLN B 1 220 ? -10.728 14.429  -43.933  1.00 17.52 ? 209  GLN B CB  1 
ATOM   5232  C  CG  . GLN B 1 220 ? -9.949  13.979  -42.788  1.00 13.81 ? 209  GLN B CG  1 
ATOM   5233  C  CD  . GLN B 1 220 ? -10.209 14.739  -41.553  1.00 14.46 ? 209  GLN B CD  1 
ATOM   5234  O  OE1 . GLN B 1 220 ? -10.056 14.203  -40.472  1.00 13.26 ? 209  GLN B OE1 1 
ATOM   5235  N  NE2 . GLN B 1 220 ? -10.574 15.995  -41.678  1.00 8.78  ? 209  GLN B NE2 1 
ATOM   5236  N  N   . GLN B 1 221 ? -11.558 14.924  -46.809  1.00 21.83 ? 210  GLN B N   1 
ATOM   5237  C  CA  . GLN B 1 221 ? -12.613 15.061  -47.803  1.00 22.99 ? 210  GLN B CA  1 
ATOM   5238  C  C   . GLN B 1 221 ? -12.364 14.133  -48.960  1.00 23.93 ? 210  GLN B C   1 
ATOM   5239  O  O   . GLN B 1 221 ? -13.209 13.312  -49.299  1.00 23.95 ? 210  GLN B O   1 
ATOM   5240  C  CB  . GLN B 1 221 ? -12.739 16.504  -48.281  1.00 23.85 ? 210  GLN B CB  1 
ATOM   5241  C  CG  . GLN B 1 221 ? -13.755 17.315  -47.467  1.00 26.31 ? 210  GLN B CG  1 
ATOM   5242  C  CD  . GLN B 1 221 ? -15.175 16.714  -47.465  1.00 25.37 ? 210  GLN B CD  1 
ATOM   5243  O  OE1 . GLN B 1 221 ? -15.819 16.618  -46.414  1.00 24.79 ? 210  GLN B OE1 1 
ATOM   5244  N  NE2 . GLN B 1 221 ? -15.659 16.305  -48.647  1.00 26.94 ? 210  GLN B NE2 1 
ATOM   5245  N  N   . ARG B 1 222 ? -11.182 14.257  -49.541  1.00 24.91 ? 211  ARG B N   1 
ATOM   5246  C  CA  . ARG B 1 222 ? -10.772 13.438  -50.671  1.00 25.68 ? 211  ARG B CA  1 
ATOM   5247  C  C   . ARG B 1 222 ? -10.876 11.929  -50.445  1.00 26.40 ? 211  ARG B C   1 
ATOM   5248  O  O   . ARG B 1 222 ? -11.145 11.212  -51.385  1.00 27.86 ? 211  ARG B O   1 
ATOM   5249  C  CB  . ARG B 1 222 ? -9.349  13.791  -51.078  1.00 26.32 ? 211  ARG B CB  1 
ATOM   5250  C  CG  . ARG B 1 222 ? -8.994  13.372  -52.503  1.00 26.31 ? 211  ARG B CG  1 
ATOM   5251  C  CD  . ARG B 1 222 ? -7.506  13.562  -52.793  1.00 26.83 ? 211  ARG B CD  1 
ATOM   5252  N  NE  . ARG B 1 222 ? -6.664  12.776  -51.900  1.00 26.51 ? 211  ARG B NE  1 
ATOM   5253  C  CZ  . ARG B 1 222 ? -6.501  11.463  -51.998  1.00 28.10 ? 211  ARG B CZ  1 
ATOM   5254  N  NH1 . ARG B 1 222 ? -7.149  10.781  -52.926  1.00 28.74 ? 211  ARG B NH1 1 
ATOM   5255  N  NH2 . ARG B 1 222 ? -5.711  10.819  -51.143  1.00 29.22 ? 211  ARG B NH2 1 
ATOM   5256  N  N   . ILE B 1 223 ? -10.653 11.447  -49.220  1.00 26.41 ? 212  ILE B N   1 
ATOM   5257  C  CA  . ILE B 1 223 ? -10.872 10.031  -48.903  1.00 26.73 ? 212  ILE B CA  1 
ATOM   5258  C  C   . ILE B 1 223 ? -12.371 9.757   -48.683  1.00 27.79 ? 212  ILE B C   1 
ATOM   5259  O  O   . ILE B 1 223 ? -12.872 8.686   -49.057  1.00 28.66 ? 212  ILE B O   1 
ATOM   5260  C  CB  . ILE B 1 223 ? -10.078 9.570   -47.662  1.00 26.87 ? 212  ILE B CB  1 
ATOM   5261  C  CG1 . ILE B 1 223 ? -8.567  9.774   -47.849  1.00 29.25 ? 212  ILE B CG1 1 
ATOM   5262  C  CG2 . ILE B 1 223 ? -10.328 8.120   -47.357  1.00 26.05 ? 212  ILE B CG2 1 
ATOM   5263  C  CD1 . ILE B 1 223 ? -8.008  9.137   -49.073  1.00 31.35 ? 212  ILE B CD1 1 
ATOM   5264  N  N   . LEU B 1 224 ? -13.095 10.697  -48.071  1.00 27.74 ? 213  LEU B N   1 
ATOM   5265  C  CA  . LEU B 1 224 ? -14.553 10.544  -47.923  1.00 26.65 ? 213  LEU B CA  1 
ATOM   5266  C  C   . LEU B 1 224 ? -15.314 10.608  -49.269  1.00 27.34 ? 213  LEU B C   1 
ATOM   5267  O  O   . LEU B 1 224 ? -16.257 9.855   -49.465  1.00 27.41 ? 213  LEU B O   1 
ATOM   5268  C  CB  . LEU B 1 224 ? -15.116 11.526  -46.900  1.00 26.41 ? 213  LEU B CB  1 
ATOM   5269  C  CG  . LEU B 1 224 ? -14.939 11.064  -45.444  1.00 22.46 ? 213  LEU B CG  1 
ATOM   5270  C  CD1 . LEU B 1 224 ? -15.682 11.906  -44.472  1.00 24.12 ? 213  LEU B CD1 1 
ATOM   5271  C  CD2 . LEU B 1 224 ? -15.393 9.624   -45.264  1.00 18.96 ? 213  LEU B CD2 1 
ATOM   5272  N  N   . ASP B 1 225 ? -14.896 11.473  -50.186  1.00 27.57 ? 214  ASP B N   1 
ATOM   5273  C  CA  . ASP B 1 225 ? -15.487 11.537  -51.537  1.00 28.59 ? 214  ASP B CA  1 
ATOM   5274  C  C   . ASP B 1 225 ? -15.229 10.322  -52.431  1.00 29.18 ? 214  ASP B C   1 
ATOM   5275  O  O   . ASP B 1 225 ? -15.999 10.036  -53.350  1.00 29.58 ? 214  ASP B O   1 
ATOM   5276  C  CB  . ASP B 1 225 ? -14.998 12.787  -52.265  1.00 29.11 ? 214  ASP B CB  1 
ATOM   5277  C  CG  . ASP B 1 225 ? -15.430 14.041  -51.592  1.00 29.83 ? 214  ASP B CG  1 
ATOM   5278  O  OD1 . ASP B 1 225 ? -16.193 13.945  -50.607  1.00 33.85 ? 214  ASP B OD1 1 
ATOM   5279  O  OD2 . ASP B 1 225 ? -14.996 15.132  -52.025  1.00 35.62 ? 214  ASP B OD2 1 
ATOM   5280  N  N   . LEU B 1 226 ? -14.127 9.626   -52.197  1.00 30.48 ? 215  LEU B N   1 
ATOM   5281  C  CA  . LEU B 1 226 ? -13.838 8.365   -52.903  1.00 30.61 ? 215  LEU B CA  1 
ATOM   5282  C  C   . LEU B 1 226 ? -14.784 7.260   -52.468  1.00 30.66 ? 215  LEU B C   1 
ATOM   5283  O  O   . LEU B 1 226 ? -14.851 6.221   -53.102  1.00 32.30 ? 215  LEU B O   1 
ATOM   5284  C  CB  . LEU B 1 226 ? -12.386 7.909   -52.645  1.00 31.48 ? 215  LEU B CB  1 
ATOM   5285  C  CG  . LEU B 1 226 ? -11.302 8.318   -53.638  1.00 32.15 ? 215  LEU B CG  1 
ATOM   5286  C  CD1 . LEU B 1 226 ? -11.640 9.627   -54.306  1.00 32.07 ? 215  LEU B CD1 1 
ATOM   5287  C  CD2 . LEU B 1 226 ? -9.947  8.363   -52.956  1.00 31.43 ? 215  LEU B CD2 1 
ATOM   5288  N  N   . GLY B 1 227 ? -15.496 7.498   -51.374  1.00 30.06 ? 216  GLY B N   1 
ATOM   5289  C  CA  . GLY B 1 227 ? -16.365 6.516   -50.760  1.00 29.30 ? 216  GLY B CA  1 
ATOM   5290  C  C   . GLY B 1 227 ? -15.624 5.785   -49.663  1.00 28.80 ? 216  GLY B C   1 
ATOM   5291  O  O   . GLY B 1 227 ? -16.129 4.804   -49.128  1.00 29.00 ? 216  GLY B O   1 
ATOM   5292  N  N   . ILE B 1 228 ? -14.422 6.242   -49.321  1.00 26.95 ? 217  ILE B N   1 
ATOM   5293  C  CA  . ILE B 1 228 ? -13.641 5.529   -48.329  1.00 26.50 ? 217  ILE B CA  1 
ATOM   5294  C  C   . ILE B 1 228 ? -14.022 6.092   -46.971  1.00 25.44 ? 217  ILE B C   1 
ATOM   5295  O  O   . ILE B 1 228 ? -13.428 7.050   -46.492  1.00 26.52 ? 217  ILE B O   1 
ATOM   5296  C  CB  . ILE B 1 228 ? -12.124 5.615   -48.621  1.00 26.89 ? 217  ILE B CB  1 
ATOM   5297  C  CG1 . ILE B 1 228 ? -11.844 5.076   -50.035  1.00 28.35 ? 217  ILE B CG1 1 
ATOM   5298  C  CG2 . ILE B 1 228 ? -11.309 4.865   -47.551  1.00 26.50 ? 217  ILE B CG2 1 
ATOM   5299  C  CD1 . ILE B 1 228 ? -10.527 5.521   -50.626  1.00 26.07 ? 217  ILE B CD1 1 
ATOM   5300  N  N   . THR B 1 229 ? -15.043 5.499   -46.364  1.00 23.35 ? 218  THR B N   1 
ATOM   5301  C  CA  . THR B 1 229 ? -15.573 5.975   -45.077  1.00 21.76 ? 218  THR B CA  1 
ATOM   5302  C  C   . THR B 1 229 ? -15.101 5.160   -43.868  1.00 20.52 ? 218  THR B C   1 
ATOM   5303  O  O   . THR B 1 229 ? -15.465 5.468   -42.728  1.00 17.68 ? 218  THR B O   1 
ATOM   5304  C  CB  . THR B 1 229 ? -17.110 5.939   -45.068  1.00 21.38 ? 218  THR B CB  1 
ATOM   5305  O  OG1 . THR B 1 229 ? -17.574 4.609   -45.378  1.00 19.78 ? 218  THR B OG1 1 
ATOM   5306  C  CG2 . THR B 1 229 ? -17.695 6.956   -46.038  1.00 21.43 ? 218  THR B CG2 1 
ATOM   5307  N  N   . GLY B 1 230 ? -14.307 4.118   -44.103  1.00 20.05 ? 219  GLY B N   1 
ATOM   5308  C  CA  . GLY B 1 230 ? -13.955 3.173   -43.040  1.00 19.16 ? 219  GLY B CA  1 
ATOM   5309  C  C   . GLY B 1 230 ? -12.725 3.656   -42.316  1.00 18.51 ? 219  GLY B C   1 
ATOM   5310  O  O   . GLY B 1 230 ? -12.052 4.566   -42.810  1.00 16.68 ? 219  GLY B O   1 
ATOM   5311  N  N   . PRO B 1 231 ? -12.399 3.034   -41.165  1.00 16.81 ? 220  PRO B N   1 
ATOM   5312  C  CA  . PRO B 1 231 ? -11.419 3.555   -40.213  1.00 17.53 ? 220  PRO B CA  1 
ATOM   5313  C  C   . PRO B 1 231 ? -9.993  3.596   -40.735  1.00 17.41 ? 220  PRO B C   1 
ATOM   5314  O  O   . PRO B 1 231 ? -9.176  4.359   -40.239  1.00 18.90 ? 220  PRO B O   1 
ATOM   5315  C  CB  . PRO B 1 231 ? -11.518 2.574   -39.020  1.00 17.53 ? 220  PRO B CB  1 
ATOM   5316  C  CG  . PRO B 1 231 ? -12.795 1.815   -39.217  1.00 15.22 ? 220  PRO B CG  1 
ATOM   5317  C  CD  . PRO B 1 231 ? -12.918 1.734   -40.724  1.00 18.52 ? 220  PRO B CD  1 
ATOM   5318  N  N   . GLU B 1 232 ? -9.693  2.768   -41.728  1.00 18.47 ? 221  GLU B N   1 
ATOM   5319  C  CA  . GLU B 1 232 ? -8.435  2.881   -42.471  1.00 18.10 ? 221  GLU B CA  1 
ATOM   5320  C  C   . GLU B 1 232 ? -8.340  4.221   -43.163  1.00 17.22 ? 221  GLU B C   1 
ATOM   5321  O  O   . GLU B 1 232 ? -7.253  4.703   -43.425  1.00 16.55 ? 221  GLU B O   1 
ATOM   5322  C  CB  . GLU B 1 232 ? -8.295  1.757   -43.501  1.00 18.10 ? 221  GLU B CB  1 
ATOM   5323  C  CG  . GLU B 1 232 ? -9.209  1.860   -44.730  1.00 17.47 ? 221  GLU B CG  1 
ATOM   5324  C  CD  . GLU B 1 232 ? -10.589 1.260   -44.528  1.00 16.95 ? 221  GLU B CD  1 
ATOM   5325  O  OE1 . GLU B 1 232 ? -11.045 1.013   -43.375  1.00 11.03 ? 221  GLU B OE1 1 
ATOM   5326  O  OE2 . GLU B 1 232 ? -11.226 1.033   -45.551  1.00 15.85 ? 221  GLU B OE2 1 
ATOM   5327  N  N   . GLY B 1 233 ? -9.489  4.809   -43.491  1.00 17.81 ? 222  GLY B N   1 
ATOM   5328  C  CA  . GLY B 1 233 ? -9.538  6.181   -44.024  1.00 17.64 ? 222  GLY B CA  1 
ATOM   5329  C  C   . GLY B 1 233 ? -8.885  7.204   -43.106  1.00 18.05 ? 222  GLY B C   1 
ATOM   5330  O  O   . GLY B 1 233 ? -8.337  8.200   -43.566  1.00 21.11 ? 222  GLY B O   1 
ATOM   5331  N  N   . HIS B 1 234 ? -8.917  6.946   -41.805  1.00 17.11 ? 223  HIS B N   1 
ATOM   5332  C  CA  . HIS B 1 234 ? -8.348  7.844   -40.826  1.00 15.32 ? 223  HIS B CA  1 
ATOM   5333  C  C   . HIS B 1 234 ? -6.833  7.881   -40.902  1.00 14.92 ? 223  HIS B C   1 
ATOM   5334  O  O   . HIS B 1 234 ? -6.245  8.954   -40.834  1.00 13.43 ? 223  HIS B O   1 
ATOM   5335  C  CB  . HIS B 1 234 ? -8.812  7.492   -39.419  1.00 16.18 ? 223  HIS B CB  1 
ATOM   5336  C  CG  . HIS B 1 234 ? -8.174  8.343   -38.361  1.00 16.41 ? 223  HIS B CG  1 
ATOM   5337  N  ND1 . HIS B 1 234 ? -8.625  9.611   -38.057  1.00 18.78 ? 223  HIS B ND1 1 
ATOM   5338  C  CD2 . HIS B 1 234 ? -7.087  8.125   -37.571  1.00 18.53 ? 223  HIS B CD2 1 
ATOM   5339  C  CE1 . HIS B 1 234 ? -7.864  10.121  -37.098  1.00 20.67 ? 223  HIS B CE1 1 
ATOM   5340  N  NE2 . HIS B 1 234 ? -6.915  9.247   -36.799  1.00 16.74 ? 223  HIS B NE2 1 
ATOM   5341  N  N   . VAL B 1 235 ? -6.215  6.717   -41.093  1.00 15.18 ? 224  VAL B N   1 
ATOM   5342  C  CA  . VAL B 1 235 ? -4.766  6.595   -41.233  1.00 15.02 ? 224  VAL B CA  1 
ATOM   5343  C  C   . VAL B 1 235 ? -4.293  7.068   -42.618  1.00 16.12 ? 224  VAL B C   1 
ATOM   5344  O  O   . VAL B 1 235 ? -3.301  7.788   -42.722  1.00 15.78 ? 224  VAL B O   1 
ATOM   5345  C  CB  . VAL B 1 235 ? -4.252  5.138   -40.915  1.00 14.52 ? 224  VAL B CB  1 
ATOM   5346  C  CG1 . VAL B 1 235 ? -4.632  4.106   -42.042  1.00 12.66 ? 224  VAL B CG1 1 
ATOM   5347  C  CG2 . VAL B 1 235 ? -2.759  5.164   -40.659  1.00 14.95 ? 224  VAL B CG2 1 
ATOM   5348  N  N   . LEU B 1 236 ? -5.020  6.698   -43.670  1.00 15.86 ? 225  LEU B N   1 
ATOM   5349  C  CA  . LEU B 1 236 ? -4.705  7.204   -45.020  1.00 15.97 ? 225  LEU B CA  1 
ATOM   5350  C  C   . LEU B 1 236 ? -4.772  8.756   -45.082  1.00 16.54 ? 225  LEU B C   1 
ATOM   5351  O  O   . LEU B 1 236 ? -4.035  9.380   -45.837  1.00 19.92 ? 225  LEU B O   1 
ATOM   5352  C  CB  . LEU B 1 236 ? -5.617  6.543   -46.086  1.00 16.56 ? 225  LEU B CB  1 
ATOM   5353  C  CG  . LEU B 1 236 ? -5.671  4.997   -46.227  1.00 15.69 ? 225  LEU B CG  1 
ATOM   5354  C  CD1 . LEU B 1 236 ? -6.887  4.579   -47.060  1.00 13.82 ? 225  LEU B CD1 1 
ATOM   5355  C  CD2 . LEU B 1 236 ? -4.375  4.374   -46.752  1.00 7.09  ? 225  LEU B CD2 1 
ATOM   5356  N  N   . SER B 1 237 ? -5.663  9.369   -44.313  1.00 16.64 ? 226  SER B N   1 
ATOM   5357  C  CA  . SER B 1 237 ? -5.815  10.843  -44.269  1.00 17.50 ? 226  SER B CA  1 
ATOM   5358  C  C   . SER B 1 237 ? -4.731  11.593  -43.448  1.00 18.31 ? 226  SER B C   1 
ATOM   5359  O  O   . SER B 1 237 ? -4.686  12.835  -43.432  1.00 19.91 ? 226  SER B O   1 
ATOM   5360  C  CB  . SER B 1 237 ? -7.221  11.223  -43.734  1.00 17.73 ? 226  SER B CB  1 
ATOM   5361  O  OG  . SER B 1 237 ? -7.317  11.300  -42.291  1.00 22.67 ? 226  SER B OG  1 
ATOM   5362  N  N   . ARG B 1 238 ? -3.870  10.834  -42.781  1.00 15.49 ? 227  ARG B N   1 
ATOM   5363  C  CA  . ARG B 1 238 ? -2.841  11.372  -41.943  1.00 15.41 ? 227  ARG B CA  1 
ATOM   5364  C  C   . ARG B 1 238 ? -1.576  10.560  -42.062  1.00 13.42 ? 227  ARG B C   1 
ATOM   5365  O  O   . ARG B 1 238 ? -1.165  9.936   -41.113  1.00 13.75 ? 227  ARG B O   1 
ATOM   5366  C  CB  . ARG B 1 238 ? -3.319  11.262  -40.501  1.00 13.15 ? 227  ARG B CB  1 
ATOM   5367  C  CG  . ARG B 1 238 ? -4.556  12.021  -40.272  1.00 17.39 ? 227  ARG B CG  1 
ATOM   5368  C  CD  . ARG B 1 238 ? -5.168  11.682  -38.953  1.00 16.86 ? 227  ARG B CD  1 
ATOM   5369  N  NE  . ARG B 1 238 ? -5.031  12.768  -38.010  1.00 16.55 ? 227  ARG B NE  1 
ATOM   5370  C  CZ  . ARG B 1 238 ? -5.889  13.768  -37.842  1.00 17.86 ? 227  ARG B CZ  1 
ATOM   5371  N  NH1 . ARG B 1 238 ? -5.639  14.695  -36.931  1.00 21.31 ? 227  ARG B NH1 1 
ATOM   5372  N  NH2 . ARG B 1 238 ? -6.997  13.862  -38.533  1.00 21.01 ? 227  ARG B NH2 1 
ATOM   5373  N  N   . PRO B 1 239 ? -0.912  10.565  -43.223  1.00 11.17 ? 228  PRO B N   1 
ATOM   5374  C  CA  . PRO B 1 239 ? 0.241   9.692   -43.243  1.00 9.40  ? 228  PRO B CA  1 
ATOM   5375  C  C   . PRO B 1 239 ? 1.327   10.298  -42.409  1.00 8.89  ? 228  PRO B C   1 
ATOM   5376  O  O   . PRO B 1 239 ? 1.307   11.530  -42.170  1.00 10.44 ? 228  PRO B O   1 
ATOM   5377  C  CB  . PRO B 1 239 ? 0.618   9.688   -44.741  1.00 10.71 ? 228  PRO B CB  1 
ATOM   5378  C  CG  . PRO B 1 239 ? 0.281   11.032  -45.125  1.00 8.57  ? 228  PRO B CG  1 
ATOM   5379  C  CD  . PRO B 1 239 ? -1.044  11.291  -44.495  1.00 10.74 ? 228  PRO B CD  1 
ATOM   5380  N  N   . GLU B 1 240 ? 2.292   9.487   -41.991  1.00 8.11  ? 229  GLU B N   1 
ATOM   5381  C  CA  . GLU B 1 240 ? 3.355   9.937   -41.031  1.00 6.60  ? 229  GLU B CA  1 
ATOM   5382  C  C   . GLU B 1 240 ? 4.133   11.101  -41.494  1.00 6.79  ? 229  GLU B C   1 
ATOM   5383  O  O   . GLU B 1 240 ? 4.666   11.809  -40.741  1.00 2.09  ? 229  GLU B O   1 
ATOM   5384  C  CB  . GLU B 1 240 ? 4.280   8.787   -40.636  1.00 6.61  ? 229  GLU B CB  1 
ATOM   5385  C  CG  . GLU B 1 240 ? 5.583   8.575   -41.422  1.00 9.50  ? 229  GLU B CG  1 
ATOM   5386  C  CD  . GLU B 1 240 ? 6.464   7.477   -40.804  1.00 7.41  ? 229  GLU B CD  1 
ATOM   5387  O  OE1 . GLU B 1 240 ? 6.066   6.289   -40.711  1.00 11.85 ? 229  GLU B OE1 1 
ATOM   5388  O  OE2 . GLU B 1 240 ? 7.592   7.760   -40.465  1.00 7.03  ? 229  GLU B OE2 1 
ATOM   5389  N  N   . GLU B 1 241 ? 4.205   11.341  -42.819  1.00 5.25  ? 230  GLU B N   1 
ATOM   5390  C  CA  . GLU B 1 241 ? 4.813   12.589  -43.269  1.00 7.30  ? 230  GLU B CA  1 
ATOM   5391  C  C   . GLU B 1 241 ? 4.204   13.903  -42.726  1.00 7.91  ? 230  GLU B C   1 
ATOM   5392  O  O   . GLU B 1 241 ? 4.933   14.889  -42.526  1.00 10.53 ? 230  GLU B O   1 
ATOM   5393  C  CB  . GLU B 1 241 ? 4.794   12.616  -44.810  1.00 7.44  ? 230  GLU B CB  1 
ATOM   5394  C  CG  . GLU B 1 241 ? 5.697   11.596  -45.350  1.00 10.14 ? 230  GLU B CG  1 
ATOM   5395  C  CD  . GLU B 1 241 ? 5.228   10.188  -45.110  1.00 9.75  ? 230  GLU B CD  1 
ATOM   5396  O  OE1 . GLU B 1 241 ? 4.014   9.948   -45.156  1.00 14.50 ? 230  GLU B OE1 1 
ATOM   5397  O  OE2 . GLU B 1 241 ? 6.066   9.312   -44.815  1.00 15.74 ? 230  GLU B OE2 1 
ATOM   5398  N  N   . VAL B 1 242 ? 2.888   13.932  -42.506  1.00 7.63  ? 231  VAL B N   1 
ATOM   5399  C  CA  . VAL B 1 242 ? 2.203   15.141  -42.117  1.00 8.58  ? 231  VAL B CA  1 
ATOM   5400  C  C   . VAL B 1 242 ? 2.460   15.386  -40.635  1.00 8.33  ? 231  VAL B C   1 
ATOM   5401  O  O   . VAL B 1 242 ? 2.322   16.502  -40.187  1.00 10.74 ? 231  VAL B O   1 
ATOM   5402  C  CB  . VAL B 1 242 ? 0.647   15.105  -42.265  1.00 10.69 ? 231  VAL B CB  1 
ATOM   5403  C  CG1 . VAL B 1 242 ? 0.200   14.797  -43.761  1.00 8.10  ? 231  VAL B CG1 1 
ATOM   5404  C  CG2 . VAL B 1 242 ? 0.002   14.184  -41.234  1.00 6.36  ? 231  VAL B CG2 1 
ATOM   5405  N  N   . GLU B 1 243 ? 2.810   14.348  -39.908  1.00 9.36  ? 232  GLU B N   1 
ATOM   5406  C  CA  . GLU B 1 243 ? 3.176   14.489  -38.488  1.00 10.37 ? 232  GLU B CA  1 
ATOM   5407  C  C   . GLU B 1 243 ? 4.623   15.007  -38.371  1.00 12.22 ? 232  GLU B C   1 
ATOM   5408  O  O   . GLU B 1 243 ? 4.949   15.919  -37.581  1.00 14.41 ? 232  GLU B O   1 
ATOM   5409  C  CB  . GLU B 1 243 ? 3.032   13.137  -37.811  1.00 11.13 ? 232  GLU B CB  1 
ATOM   5410  C  CG  . GLU B 1 243 ? 3.438   13.125  -36.257  1.00 9.32  ? 232  GLU B CG  1 
ATOM   5411  C  CD  . GLU B 1 243 ? 4.086   11.836  -35.813  1.00 13.60 ? 232  GLU B CD  1 
ATOM   5412  O  OE1 . GLU B 1 243 ? 4.287   10.983  -36.674  1.00 7.67  ? 232  GLU B OE1 1 
ATOM   5413  O  OE2 . GLU B 1 243 ? 4.424   11.633  -34.593  1.00 10.54 ? 232  GLU B OE2 1 
ATOM   5414  N  N   . ALA B 1 244 ? 5.488   14.444  -39.201  1.00 13.06 ? 233  ALA B N   1 
ATOM   5415  C  CA  . ALA B 1 244 ? 6.903   14.762  -39.198  1.00 13.02 ? 233  ALA B CA  1 
ATOM   5416  C  C   . ALA B 1 244 ? 7.107   16.166  -39.687  1.00 14.37 ? 233  ALA B C   1 
ATOM   5417  O  O   . ALA B 1 244 ? 8.016   16.844  -39.206  1.00 14.92 ? 233  ALA B O   1 
ATOM   5418  C  CB  . ALA B 1 244 ? 7.687   13.782  -40.063  1.00 12.43 ? 233  ALA B CB  1 
ATOM   5419  N  N   . GLU B 1 245 ? 6.303   16.597  -40.662  1.00 14.61 ? 234  GLU B N   1 
ATOM   5420  C  CA  . GLU B 1 245 ? 6.354   17.969  -41.122  1.00 15.26 ? 234  GLU B CA  1 
ATOM   5421  C  C   . GLU B 1 245 ? 6.091   18.971  -40.008  1.00 14.73 ? 234  GLU B C   1 
ATOM   5422  O  O   . GLU B 1 245 ? 6.829   19.928  -39.809  1.00 18.16 ? 234  GLU B O   1 
ATOM   5423  C  CB  . GLU B 1 245 ? 5.325   18.201  -42.223  1.00 16.52 ? 234  GLU B CB  1 
ATOM   5424  C  CG  . GLU B 1 245 ? 5.531   19.515  -43.005  1.00 17.91 ? 234  GLU B CG  1 
ATOM   5425  C  CD  . GLU B 1 245 ? 4.810   20.690  -42.391  1.00 21.32 ? 234  GLU B CD  1 
ATOM   5426  O  OE1 . GLU B 1 245 ? 3.574   20.589  -42.208  1.00 21.64 ? 234  GLU B OE1 1 
ATOM   5427  O  OE2 . GLU B 1 245 ? 5.479   21.726  -42.134  1.00 24.54 ? 234  GLU B OE2 1 
ATOM   5428  N  N   . ALA B 1 246 ? 4.999   18.769  -39.316  1.00 13.03 ? 235  ALA B N   1 
ATOM   5429  C  CA  . ALA B 1 246 ? 4.555   19.723  -38.336  1.00 11.57 ? 235  ALA B CA  1 
ATOM   5430  C  C   . ALA B 1 246 ? 5.556   19.773  -37.174  1.00 9.86  ? 235  ALA B C   1 
ATOM   5431  O  O   . ALA B 1 246 ? 5.792   20.815  -36.611  1.00 10.72 ? 235  ALA B O   1 
ATOM   5432  C  CB  . ALA B 1 246 ? 3.160   19.368  -37.871  1.00 8.23  ? 235  ALA B CB  1 
ATOM   5433  N  N   . VAL B 1 247 ? 6.179   18.650  -36.860  1.00 10.73 ? 236  VAL B N   1 
ATOM   5434  C  CA  . VAL B 1 247 ? 7.179   18.601  -35.755  1.00 9.86  ? 236  VAL B CA  1 
ATOM   5435  C  C   . VAL B 1 247 ? 8.414   19.464  -36.118  1.00 11.48 ? 236  VAL B C   1 
ATOM   5436  O  O   . VAL B 1 247 ? 9.033   20.094  -35.270  1.00 10.68 ? 236  VAL B O   1 
ATOM   5437  C  CB  . VAL B 1 247 ? 7.635   17.146  -35.514  1.00 10.95 ? 236  VAL B CB  1 
ATOM   5438  C  CG1 . VAL B 1 247 ? 8.837   17.082  -34.565  1.00 7.89  ? 236  VAL B CG1 1 
ATOM   5439  C  CG2 . VAL B 1 247 ? 6.485   16.269  -35.045  1.00 4.70  ? 236  VAL B CG2 1 
ATOM   5440  N  N   . ASN B 1 248 ? 8.777   19.407  -37.403  1.00 10.98 ? 237  ASN B N   1 
ATOM   5441  C  CA  . ASN B 1 248 ? 9.844   20.174  -38.033  1.00 10.10 ? 237  ASN B CA  1 
ATOM   5442  C  C   . ASN B 1 248 ? 9.580   21.698  -38.136  1.00 10.37 ? 237  ASN B C   1 
ATOM   5443  O  O   . ASN B 1 248 ? 10.527  22.482  -37.998  1.00 12.94 ? 237  ASN B O   1 
ATOM   5444  C  CB  . ASN B 1 248 ? 10.079  19.591  -39.432  1.00 10.72 ? 237  ASN B CB  1 
ATOM   5445  C  CG  . ASN B 1 248 ? 11.219  20.211  -40.114  1.00 6.65  ? 237  ASN B CG  1 
ATOM   5446  O  OD1 . ASN B 1 248 ? 11.052  21.031  -41.022  1.00 17.19 ? 237  ASN B OD1 1 
ATOM   5447  N  ND2 . ASN B 1 248 ? 12.405  19.817  -39.718  1.00 3.62  ? 237  ASN B ND2 1 
ATOM   5448  N  N   . ARG B 1 249 ? 8.310   22.100  -38.349  1.00 9.21  ? 238  ARG B N   1 
ATOM   5449  C  CA  . ARG B 1 249 ? 7.878   23.497  -38.278  1.00 8.65  ? 238  ARG B CA  1 
ATOM   5450  C  C   . ARG B 1 249 ? 7.949   23.931  -36.828  1.00 8.73  ? 238  ARG B C   1 
ATOM   5451  O  O   . ARG B 1 249 ? 8.470   24.974  -36.509  1.00 11.99 ? 238  ARG B O   1 
ATOM   5452  C  CB  . ARG B 1 249 ? 6.463   23.660  -38.789  1.00 8.92  ? 238  ARG B CB  1 
ATOM   5453  C  CG  . ARG B 1 249 ? 5.899   25.108  -38.924  1.00 10.22 ? 238  ARG B CG  1 
ATOM   5454  C  CD  . ARG B 1 249 ? 5.097   25.302  -40.300  1.00 8.92  ? 238  ARG B CD  1 
ATOM   5455  N  NE  . ARG B 1 249 ? 4.305   24.076  -40.495  1.00 16.30 ? 238  ARG B NE  1 
ATOM   5456  C  CZ  . ARG B 1 249 ? 3.155   23.774  -39.880  1.00 15.06 ? 238  ARG B CZ  1 
ATOM   5457  N  NH1 . ARG B 1 249 ? 2.540   24.644  -39.112  1.00 17.61 ? 238  ARG B NH1 1 
ATOM   5458  N  NH2 . ARG B 1 249 ? 2.591   22.599  -40.066  1.00 14.99 ? 238  ARG B NH2 1 
ATOM   5459  N  N   . ALA B 1 250 ? 7.420   23.120  -35.941  1.00 9.80  ? 239  ALA B N   1 
ATOM   5460  C  CA  . ALA B 1 250 ? 7.360   23.511  -34.541  1.00 7.18  ? 239  ALA B CA  1 
ATOM   5461  C  C   . ALA B 1 250 ? 8.748   23.779  -34.046  1.00 8.10  ? 239  ALA B C   1 
ATOM   5462  O  O   . ALA B 1 250 ? 9.008   24.795  -33.388  1.00 10.93 ? 239  ALA B O   1 
ATOM   5463  C  CB  . ALA B 1 250 ? 6.690   22.447  -33.756  1.00 7.44  ? 239  ALA B CB  1 
ATOM   5464  N  N   . ILE B 1 251 ? 9.645   22.845  -34.333  1.00 8.96  ? 240  ILE B N   1 
ATOM   5465  C  CA  . ILE B 1 251 ? 11.063  22.978  -33.971  1.00 8.59  ? 240  ILE B CA  1 
ATOM   5466  C  C   . ILE B 1 251 ? 11.649  24.253  -34.549  1.00 9.89  ? 240  ILE B C   1 
ATOM   5467  O  O   . ILE B 1 251 ? 12.315  24.990  -33.868  1.00 10.99 ? 240  ILE B O   1 
ATOM   5468  C  CB  . ILE B 1 251 ? 11.880  21.727  -34.346  1.00 6.29  ? 240  ILE B CB  1 
ATOM   5469  C  CG1 . ILE B 1 251 ? 11.367  20.518  -33.609  1.00 7.13  ? 240  ILE B CG1 1 
ATOM   5470  C  CG2 . ILE B 1 251 ? 13.332  21.933  -34.014  1.00 12.72 ? 240  ILE B CG2 1 
ATOM   5471  C  CD1 . ILE B 1 251 ? 12.012  19.246  -33.910  1.00 2.70  ? 240  ILE B CD1 1 
ATOM   5472  N  N   . THR B 1 252 ? 11.371  24.539  -35.814  1.00 9.32  ? 241  THR B N   1 
ATOM   5473  C  CA  . THR B 1 252 ? 11.791  25.781  -36.386  1.00 8.45  ? 241  THR B CA  1 
ATOM   5474  C  C   . THR B 1 252 ? 11.276  26.992  -35.629  1.00 9.54  ? 241  THR B C   1 
ATOM   5475  O  O   . THR B 1 252 ? 12.042  27.889  -35.253  1.00 13.44 ? 241  THR B O   1 
ATOM   5476  C  CB  . THR B 1 252 ? 11.280  25.868  -37.802  1.00 8.00  ? 241  THR B CB  1 
ATOM   5477  O  OG1 . THR B 1 252 ? 11.649  24.652  -38.444  1.00 11.57 ? 241  THR B OG1 1 
ATOM   5478  C  CG2 . THR B 1 252 ? 11.907  27.027  -38.490  1.00 6.40  ? 241  THR B CG2 1 
ATOM   5479  N  N   . ILE B 1 253 ? 9.980   27.027  -35.368  1.00 7.36  ? 242  ILE B N   1 
ATOM   5480  C  CA  . ILE B 1 253 ? 9.418   28.172  -34.676  1.00 8.26  ? 242  ILE B CA  1 
ATOM   5481  C  C   . ILE B 1 253 ? 10.082  28.242  -33.274  1.00 11.04 ? 242  ILE B C   1 
ATOM   5482  O  O   . ILE B 1 253 ? 10.436  29.312  -32.795  1.00 13.18 ? 242  ILE B O   1 
ATOM   5483  C  CB  . ILE B 1 253 ? 7.845   28.125  -34.606  1.00 6.58  ? 242  ILE B CB  1 
ATOM   5484  C  CG1 . ILE B 1 253 ? 7.256   28.276  -36.047  1.00 4.40  ? 242  ILE B CG1 1 
ATOM   5485  C  CG2 . ILE B 1 253 ? 7.282   29.253  -33.705  1.00 4.64  ? 242  ILE B CG2 1 
ATOM   5486  C  CD1 . ILE B 1 253 ? 5.778   27.737  -36.186  1.00 2.84  ? 242  ILE B CD1 1 
ATOM   5487  N  N   . ALA B 1 254 ? 10.306  27.083  -32.687  1.00 11.96 ? 243  ALA B N   1 
ATOM   5488  C  CA  . ALA B 1 254 ? 10.825  26.988  -31.317  1.00 12.05 ? 243  ALA B CA  1 
ATOM   5489  C  C   . ALA B 1 254 ? 12.275  27.495  -31.196  1.00 13.77 ? 243  ALA B C   1 
ATOM   5490  O  O   . ALA B 1 254 ? 12.625  28.277  -30.297  1.00 13.56 ? 243  ALA B O   1 
ATOM   5491  C  CB  . ALA B 1 254 ? 10.723  25.588  -30.883  1.00 13.24 ? 243  ALA B CB  1 
ATOM   5492  N  N   . ASN B 1 255 ? 13.136  27.065  -32.101  1.00 14.64 ? 244  ASN B N   1 
ATOM   5493  C  CA  . ASN B 1 255 ? 14.506  27.583  -32.133  1.00 14.77 ? 244  ASN B CA  1 
ATOM   5494  C  C   . ASN B 1 255 ? 14.623  29.089  -32.386  1.00 15.52 ? 244  ASN B C   1 
ATOM   5495  O  O   . ASN B 1 255 ? 15.401  29.769  -31.711  1.00 15.33 ? 244  ASN B O   1 
ATOM   5496  C  CB  . ASN B 1 255 ? 15.326  26.905  -33.209  1.00 14.47 ? 244  ASN B CB  1 
ATOM   5497  C  CG  . ASN B 1 255 ? 15.635  25.447  -32.924  1.00 16.11 ? 244  ASN B CG  1 
ATOM   5498  O  OD1 . ASN B 1 255 ? 15.964  25.064  -31.798  1.00 12.96 ? 244  ASN B OD1 1 
ATOM   5499  N  ND2 . ASN B 1 255 ? 15.637  24.625  -34.010  1.00 5.84  ? 244  ASN B ND2 1 
ATOM   5500  N  N   . GLN B 1 256 ? 13.901  29.593  -33.377  1.00 15.44 ? 245  GLN B N   1 
ATOM   5501  C  CA  . GLN B 1 256 ? 13.856  31.046  -33.673  1.00 16.38 ? 245  GLN B CA  1 
ATOM   5502  C  C   . GLN B 1 256 ? 13.280  31.914  -32.546  1.00 16.18 ? 245  GLN B C   1 
ATOM   5503  O  O   . GLN B 1 256 ? 13.440  33.118  -32.549  1.00 16.41 ? 245  GLN B O   1 
ATOM   5504  C  CB  . GLN B 1 256 ? 13.053  31.328  -34.918  1.00 16.58 ? 245  GLN B CB  1 
ATOM   5505  C  CG  . GLN B 1 256 ? 13.752  30.888  -36.215  1.00 20.58 ? 245  GLN B CG  1 
ATOM   5506  C  CD  . GLN B 1 256 ? 15.215  31.246  -36.193  1.00 24.61 ? 245  GLN B CD  1 
ATOM   5507  O  OE1 . GLN B 1 256 ? 15.587  32.439  -36.190  1.00 26.96 ? 245  GLN B OE1 1 
ATOM   5508  N  NE2 . GLN B 1 256 ? 16.069  30.221  -36.124  1.00 30.44 ? 245  GLN B NE2 1 
ATOM   5509  N  N   . THR B 1 257 ? 12.651  31.274  -31.577  1.00 17.63 ? 246  THR B N   1 
ATOM   5510  C  CA  . THR B 1 257 ? 11.954  31.930  -30.486  1.00 17.42 ? 246  THR B CA  1 
ATOM   5511  C  C   . THR B 1 257 ? 12.647  31.628  -29.152  1.00 18.04 ? 246  THR B C   1 
ATOM   5512  O  O   . THR B 1 257 ? 12.419  32.305  -28.153  1.00 19.29 ? 246  THR B O   1 
ATOM   5513  C  CB  . THR B 1 257 ? 10.495  31.386  -30.442  1.00 18.83 ? 246  THR B CB  1 
ATOM   5514  O  OG1 . THR B 1 257 ? 9.592   32.340  -31.020  1.00 20.89 ? 246  THR B OG1 1 
ATOM   5515  C  CG2 . THR B 1 257 ? 10.082  31.069  -29.051  1.00 16.78 ? 246  THR B CG2 1 
ATOM   5516  N  N   . ASN B 1 258 ? 13.500  30.608  -29.142  1.00 17.05 ? 247  ASN B N   1 
ATOM   5517  C  CA  . ASN B 1 258 ? 14.186  30.160  -27.935  1.00 16.06 ? 247  ASN B CA  1 
ATOM   5518  C  C   . ASN B 1 258 ? 13.219  29.814  -26.827  1.00 14.84 ? 247  ASN B C   1 
ATOM   5519  O  O   . ASN B 1 258 ? 13.379  30.218  -25.667  1.00 13.15 ? 247  ASN B O   1 
ATOM   5520  C  CB  . ASN B 1 258 ? 15.244  31.178  -27.474  1.00 16.91 ? 247  ASN B CB  1 
ATOM   5521  C  CG  . ASN B 1 258 ? 16.109  30.650  -26.378  1.00 16.34 ? 247  ASN B CG  1 
ATOM   5522  O  OD1 . ASN B 1 258 ? 16.684  29.581  -26.502  1.00 18.08 ? 247  ASN B OD1 1 
ATOM   5523  N  ND2 . ASN B 1 258 ? 16.191  31.383  -25.275  1.00 18.00 ? 247  ASN B ND2 1 
ATOM   5524  N  N   . CYS B 1 259 ? 12.225  29.026  -27.199  1.00 13.43 ? 248  CYS B N   1 
ATOM   5525  C  CA  . CYS B 1 259 ? 11.280  28.470  -26.245  1.00 12.00 ? 248  CYS B CA  1 
ATOM   5526  C  C   . CYS B 1 259 ? 11.438  26.946  -26.174  1.00 10.03 ? 248  CYS B C   1 
ATOM   5527  O  O   . CYS B 1 259 ? 11.516  26.243  -27.197  1.00 7.63  ? 248  CYS B O   1 
ATOM   5528  C  CB  . CYS B 1 259 ? 9.839   28.855  -26.644  1.00 12.84 ? 248  CYS B CB  1 
ATOM   5529  S  SG  . CYS B 1 259 ? 8.484   28.123  -25.677  1.00 15.25 ? 248  CYS B SG  1 
ATOM   5530  N  N   . PRO B 1 260 ? 11.484  26.398  -24.964  1.00 8.43  ? 249  PRO B N   1 
ATOM   5531  C  CA  . PRO B 1 260 ? 11.599  24.952  -24.815  1.00 10.12 ? 249  PRO B CA  1 
ATOM   5532  C  C   . PRO B 1 260 ? 10.343  24.263  -25.297  1.00 11.53 ? 249  PRO B C   1 
ATOM   5533  O  O   . PRO B 1 260 ? 9.224   24.688  -24.946  1.00 11.54 ? 249  PRO B O   1 
ATOM   5534  C  CB  . PRO B 1 260 ? 11.752  24.771  -23.291  1.00 9.44  ? 249  PRO B CB  1 
ATOM   5535  C  CG  . PRO B 1 260 ? 11.056  25.983  -22.759  1.00 8.26  ? 249  PRO B CG  1 
ATOM   5536  C  CD  . PRO B 1 260 ? 11.453  27.081  -23.660  1.00 9.00  ? 249  PRO B CD  1 
ATOM   5537  N  N   . LEU B 1 261 ? 10.541  23.195  -26.079  1.00 12.21 ? 250  LEU B N   1 
ATOM   5538  C  CA  . LEU B 1 261 ? 9.472   22.508  -26.777  1.00 12.00 ? 250  LEU B CA  1 
ATOM   5539  C  C   . LEU B 1 261 ? 9.382   21.046  -26.447  1.00 12.13 ? 250  LEU B C   1 
ATOM   5540  O  O   . LEU B 1 261 ? 10.335  20.434  -25.983  1.00 10.46 ? 250  LEU B O   1 
ATOM   5541  C  CB  . LEU B 1 261 ? 9.721   22.652  -28.280  1.00 11.45 ? 250  LEU B CB  1 
ATOM   5542  C  CG  . LEU B 1 261 ? 8.703   22.160  -29.326  1.00 13.82 ? 250  LEU B CG  1 
ATOM   5543  C  CD1 . LEU B 1 261 ? 7.485   23.052  -29.549  1.00 10.35 ? 250  LEU B CD1 1 
ATOM   5544  C  CD2 . LEU B 1 261 ? 9.478   22.048  -30.580  1.00 10.87 ? 250  LEU B CD2 1 
ATOM   5545  N  N   . TYR B 1 262 ? 8.209   20.491  -26.708  1.00 11.80 ? 251  TYR B N   1 
ATOM   5546  C  CA  . TYR B 1 262 ? 7.833   19.180  -26.212  1.00 13.25 ? 251  TYR B CA  1 
ATOM   5547  C  C   . TYR B 1 262 ? 6.806   18.582  -27.158  1.00 11.84 ? 251  TYR B C   1 
ATOM   5548  O  O   . TYR B 1 262 ? 5.689   19.078  -27.281  1.00 9.17  ? 251  TYR B O   1 
ATOM   5549  C  CB  . TYR B 1 262 ? 7.233   19.327  -24.783  1.00 14.54 ? 251  TYR B CB  1 
ATOM   5550  C  CG  . TYR B 1 262 ? 6.777   18.045  -24.098  1.00 13.13 ? 251  TYR B CG  1 
ATOM   5551  C  CD1 . TYR B 1 262 ? 5.638   17.381  -24.500  1.00 13.44 ? 251  TYR B CD1 1 
ATOM   5552  C  CD2 . TYR B 1 262 ? 7.472   17.535  -23.038  1.00 13.40 ? 251  TYR B CD2 1 
ATOM   5553  C  CE1 . TYR B 1 262 ? 5.228   16.213  -23.874  1.00 12.97 ? 251  TYR B CE1 1 
ATOM   5554  C  CE2 . TYR B 1 262 ? 7.058   16.377  -22.388  1.00 16.16 ? 251  TYR B CE2 1 
ATOM   5555  C  CZ  . TYR B 1 262 ? 5.927   15.724  -22.825  1.00 14.69 ? 251  TYR B CZ  1 
ATOM   5556  O  OH  . TYR B 1 262 ? 5.506   14.564  -22.199  1.00 14.17 ? 251  TYR B OH  1 
ATOM   5557  N  N   . ILE B 1 263 ? 7.179   17.503  -27.820  1.00 12.35 ? 252  ILE B N   1 
ATOM   5558  C  CA  . ILE B 1 263 ? 6.309   16.965  -28.861  1.00 12.40 ? 252  ILE B CA  1 
ATOM   5559  C  C   . ILE B 1 263 ? 5.522   15.829  -28.270  1.00 13.12 ? 252  ILE B C   1 
ATOM   5560  O  O   . ILE B 1 263 ? 6.102   14.802  -27.900  1.00 15.64 ? 252  ILE B O   1 
ATOM   5561  C  CB  . ILE B 1 263 ? 7.085   16.440  -30.076  1.00 12.21 ? 252  ILE B CB  1 
ATOM   5562  C  CG1 . ILE B 1 263 ? 8.045   17.507  -30.621  1.00 10.27 ? 252  ILE B CG1 1 
ATOM   5563  C  CG2 . ILE B 1 263 ? 6.082   15.981  -31.129  1.00 10.27 ? 252  ILE B CG2 1 
ATOM   5564  C  CD1 . ILE B 1 263 ? 7.372   18.793  -31.120  1.00 4.68  ? 252  ILE B CD1 1 
ATOM   5565  N  N   . THR B 1 264 ? 4.211   16.026  -28.143  1.00 12.94 ? 253  THR B N   1 
ATOM   5566  C  CA  . THR B 1 264 ? 3.329   14.989  -27.639  1.00 12.85 ? 253  THR B CA  1 
ATOM   5567  C  C   . THR B 1 264 ? 3.035   13.938  -28.688  1.00 12.64 ? 253  THR B C   1 
ATOM   5568  O  O   . THR B 1 264 ? 3.070   14.214  -29.904  1.00 10.98 ? 253  THR B O   1 
ATOM   5569  C  CB  . THR B 1 264 ? 1.983   15.557  -27.171  1.00 13.68 ? 253  THR B CB  1 
ATOM   5570  O  OG1 . THR B 1 264 ? 1.460   16.410  -28.180  1.00 11.87 ? 253  THR B OG1 1 
ATOM   5571  C  CG2 . THR B 1 264 ? 2.142   16.374  -25.883  1.00 8.77  ? 253  THR B CG2 1 
ATOM   5572  N  N   . LYS B 1 265 ? 2.708   12.752  -28.194  1.00 11.76 ? 254  LYS B N   1 
ATOM   5573  C  CA  . LYS B 1 265 ? 2.257   11.636  -29.020  1.00 13.37 ? 254  LYS B CA  1 
ATOM   5574  C  C   . LYS B 1 265 ? 3.186   11.313  -30.156  1.00 13.66 ? 254  LYS B C   1 
ATOM   5575  O  O   . LYS B 1 265 ? 2.767   11.343  -31.320  1.00 15.20 ? 254  LYS B O   1 
ATOM   5576  C  CB  . LYS B 1 265 ? 0.859   11.910  -29.565  1.00 13.08 ? 254  LYS B CB  1 
ATOM   5577  C  CG  . LYS B 1 265 ? -0.131  12.173  -28.492  1.00 14.18 ? 254  LYS B CG  1 
ATOM   5578  C  CD  . LYS B 1 265 ? -1.422  12.576  -29.099  1.00 13.37 ? 254  LYS B CD  1 
ATOM   5579  C  CE  . LYS B 1 265 ? -2.601  12.193  -28.247  1.00 10.35 ? 254  LYS B CE  1 
ATOM   5580  N  NZ  . LYS B 1 265 ? -3.878  12.461  -28.973  1.00 2.00  ? 254  LYS B NZ  1 
ATOM   5581  N  N   . VAL B 1 266 ? 4.452   11.008  -29.842  1.00 13.70 ? 255  VAL B N   1 
ATOM   5582  C  CA  . VAL B 1 266 ? 5.404   10.624  -30.883  1.00 11.68 ? 255  VAL B CA  1 
ATOM   5583  C  C   . VAL B 1 266 ? 5.018   9.247   -31.394  1.00 12.75 ? 255  VAL B C   1 
ATOM   5584  O  O   . VAL B 1 266 ? 5.072   8.271   -30.656  1.00 11.19 ? 255  VAL B O   1 
ATOM   5585  C  CB  . VAL B 1 266 ? 6.874   10.731  -30.455  1.00 10.77 ? 255  VAL B CB  1 
ATOM   5586  C  CG1 . VAL B 1 266 ? 7.793   10.198  -31.513  1.00 4.40  ? 255  VAL B CG1 1 
ATOM   5587  C  CG2 . VAL B 1 266 ? 7.241   12.222  -30.212  1.00 10.19 ? 255  VAL B CG2 1 
ATOM   5588  N  N   . MET B 1 267 ? 4.598   9.195   -32.669  1.00 11.33 ? 256  MET B N   1 
ATOM   5589  C  CA  . MET B 1 267 ? 3.974   7.996   -33.194  1.00 11.46 ? 256  MET B CA  1 
ATOM   5590  C  C   . MET B 1 267 ? 4.768   7.305   -34.245  1.00 11.14 ? 256  MET B C   1 
ATOM   5591  O  O   . MET B 1 267 ? 4.442   6.182   -34.605  1.00 13.04 ? 256  MET B O   1 
ATOM   5592  C  CB  . MET B 1 267 ? 2.607   8.303   -33.819  1.00 10.63 ? 256  MET B CB  1 
ATOM   5593  C  CG  . MET B 1 267 ? 1.562   8.815   -32.907  1.00 8.66  ? 256  MET B CG  1 
ATOM   5594  S  SD  . MET B 1 267 ? 1.504   7.913   -31.375  1.00 12.30 ? 256  MET B SD  1 
ATOM   5595  C  CE  . MET B 1 267 ? 0.811   6.316   -31.886  1.00 2.00  ? 256  MET B CE  1 
ATOM   5596  N  N   . SER B 1 268 ? 5.793   7.965   -34.773  1.00 12.23 ? 257  SER B N   1 
ATOM   5597  C  CA  . SER B 1 268 ? 6.370   7.504   -36.039  1.00 11.10 ? 257  SER B CA  1 
ATOM   5598  C  C   . SER B 1 268 ? 7.875   7.640   -36.064  1.00 11.83 ? 257  SER B C   1 
ATOM   5599  O  O   . SER B 1 268 ? 8.423   8.517   -35.410  1.00 9.57  ? 257  SER B O   1 
ATOM   5600  C  CB  . SER B 1 268 ? 5.754   8.286   -37.201  1.00 12.42 ? 257  SER B CB  1 
ATOM   5601  O  OG  . SER B 1 268 ? 6.119   9.667   -37.233  1.00 9.41  ? 257  SER B OG  1 
ATOM   5602  N  N   . LYS B 1 269 ? 8.521   6.799   -36.891  1.00 11.97 ? 258  LYS B N   1 
ATOM   5603  C  CA  . LYS B 1 269 ? 9.966   6.859   -37.159  1.00 11.98 ? 258  LYS B CA  1 
ATOM   5604  C  C   . LYS B 1 269 ? 10.409  8.230   -37.677  1.00 13.19 ? 258  LYS B C   1 
ATOM   5605  O  O   . LYS B 1 269 ? 11.350  8.816   -37.159  1.00 12.64 ? 258  LYS B O   1 
ATOM   5606  C  CB  . LYS B 1 269 ? 10.350  5.749   -38.170  1.00 10.73 ? 258  LYS B CB  1 
ATOM   5607  C  CG  . LYS B 1 269 ? 10.037  4.345   -37.659  1.00 9.22  ? 258  LYS B CG  1 
ATOM   5608  C  CD  . LYS B 1 269 ? 10.181  3.259   -38.704  1.00 12.48 ? 258  LYS B CD  1 
ATOM   5609  C  CE  . LYS B 1 269 ? 11.599  3.018   -39.095  1.00 13.33 ? 258  LYS B CE  1 
ATOM   5610  N  NZ  . LYS B 1 269 ? 11.678  1.908   -40.154  1.00 12.17 ? 258  LYS B NZ  1 
ATOM   5611  N  N   . SER B 1 270 ? 9.786   8.676   -38.771  1.00 14.73 ? 259  SER B N   1 
ATOM   5612  C  CA  . SER B 1 270 ? 9.920   10.039  -39.321  1.00 14.86 ? 259  SER B CA  1 
ATOM   5613  C  C   . SER B 1 270 ? 9.949   11.154  -38.294  1.00 15.76 ? 259  SER B C   1 
ATOM   5614  O  O   . SER B 1 270 ? 10.842  12.005  -38.309  1.00 14.62 ? 259  SER B O   1 
ATOM   5615  C  CB  . SER B 1 270 ? 8.725   10.358  -40.231  1.00 15.53 ? 259  SER B CB  1 
ATOM   5616  O  OG  . SER B 1 270 ? 8.904   9.845   -41.542  1.00 22.64 ? 259  SER B OG  1 
ATOM   5617  N  N   . SER B 1 271 ? 8.930   11.169  -37.443  1.00 15.47 ? 260  SER B N   1 
ATOM   5618  C  CA  . SER B 1 271 ? 8.784   12.244  -36.488  1.00 16.34 ? 260  SER B CA  1 
ATOM   5619  C  C   . SER B 1 271 ? 9.914   12.198  -35.481  1.00 15.93 ? 260  SER B C   1 
ATOM   5620  O  O   . SER B 1 271 ? 10.579  13.215  -35.269  1.00 17.10 ? 260  SER B O   1 
ATOM   5621  C  CB  . SER B 1 271 ? 7.408   12.273  -35.825  1.00 16.36 ? 260  SER B CB  1 
ATOM   5622  O  OG  . SER B 1 271 ? 7.372   11.569  -34.604  1.00 23.92 ? 260  SER B OG  1 
ATOM   5623  N  N   . ALA B 1 272 ? 10.133  11.017  -34.900  1.00 15.82 ? 261  ALA B N   1 
ATOM   5624  C  CA  . ALA B 1 272 ? 11.188  10.746  -33.908  1.00 14.36 ? 261  ALA B CA  1 
ATOM   5625  C  C   . ALA B 1 272 ? 12.584  11.140  -34.372  1.00 14.54 ? 261  ALA B C   1 
ATOM   5626  O  O   . ALA B 1 272 ? 13.413  11.647  -33.601  1.00 15.20 ? 261  ALA B O   1 
ATOM   5627  C  CB  . ALA B 1 272 ? 11.168  9.269   -33.575  1.00 14.15 ? 261  ALA B CB  1 
ATOM   5628  N  N   . GLU B 1 273 ? 12.862  10.883  -35.641  1.00 12.40 ? 262  GLU B N   1 
ATOM   5629  C  CA  . GLU B 1 273 ? 14.161  11.200  -36.187  1.00 13.49 ? 262  GLU B CA  1 
ATOM   5630  C  C   . GLU B 1 273 ? 14.311  12.716  -36.303  1.00 11.67 ? 262  GLU B C   1 
ATOM   5631  O  O   . GLU B 1 273 ? 15.404  13.222  -36.104  1.00 9.79  ? 262  GLU B O   1 
ATOM   5632  C  CB  . GLU B 1 273 ? 14.367  10.461  -37.529  1.00 13.82 ? 262  GLU B CB  1 
ATOM   5633  C  CG  . GLU B 1 273 ? 15.634  10.795  -38.305  1.00 16.76 ? 262  GLU B CG  1 
ATOM   5634  C  CD  . GLU B 1 273 ? 16.951  10.323  -37.682  1.00 22.38 ? 262  GLU B CD  1 
ATOM   5635  O  OE1 . GLU B 1 273 ? 16.991  9.373   -36.847  1.00 21.88 ? 262  GLU B OE1 1 
ATOM   5636  O  OE2 . GLU B 1 273 ? 17.986  10.913  -38.085  1.00 25.84 ? 262  GLU B OE2 1 
ATOM   5637  N  N   . VAL B 1 274 ? 13.221  13.428  -36.628  1.00 11.81 ? 263  VAL B N   1 
ATOM   5638  C  CA  . VAL B 1 274 ? 13.272  14.886  -36.721  1.00 11.22 ? 263  VAL B CA  1 
ATOM   5639  C  C   . VAL B 1 274 ? 13.678  15.433  -35.377  1.00 11.54 ? 263  VAL B C   1 
ATOM   5640  O  O   . VAL B 1 274 ? 14.508  16.325  -35.311  1.00 15.07 ? 263  VAL B O   1 
ATOM   5641  C  CB  . VAL B 1 274 ? 11.963  15.530  -37.111  1.00 11.61 ? 263  VAL B CB  1 
ATOM   5642  C  CG1 . VAL B 1 274 ? 11.960  16.993  -36.694  1.00 10.43 ? 263  VAL B CG1 1 
ATOM   5643  C  CG2 . VAL B 1 274 ? 11.737  15.424  -38.659  1.00 9.27  ? 263  VAL B CG2 1 
ATOM   5644  N  N   . ILE B 1 275 ? 13.106  14.892  -34.309  1.00 10.60 ? 264  ILE B N   1 
ATOM   5645  C  CA  . ILE B 1 275 ? 13.518  15.287  -32.942  1.00 10.94 ? 264  ILE B CA  1 
ATOM   5646  C  C   . ILE B 1 275 ? 15.012  14.940  -32.691  1.00 14.07 ? 264  ILE B C   1 
ATOM   5647  O  O   . ILE B 1 275 ? 15.757  15.695  -32.033  1.00 15.84 ? 264  ILE B O   1 
ATOM   5648  C  CB  . ILE B 1 275 ? 12.666  14.571  -31.890  1.00 10.76 ? 264  ILE B CB  1 
ATOM   5649  C  CG1 . ILE B 1 275 ? 11.160  14.758  -32.147  1.00 12.71 ? 264  ILE B CG1 1 
ATOM   5650  C  CG2 . ILE B 1 275 ? 13.038  15.064  -30.438  1.00 8.98  ? 264  ILE B CG2 1 
ATOM   5651  C  CD1 . ILE B 1 275 ? 10.264  13.907  -31.298  1.00 9.89  ? 264  ILE B CD1 1 
ATOM   5652  N  N   . ALA B 1 276 ? 15.444  13.775  -33.185  1.00 13.28 ? 265  ALA B N   1 
ATOM   5653  C  CA  . ALA B 1 276 ? 16.820  13.339  -33.017  1.00 14.16 ? 265  ALA B CA  1 
ATOM   5654  C  C   . ALA B 1 276 ? 17.782  14.313  -33.647  1.00 14.52 ? 265  ALA B C   1 
ATOM   5655  O  O   . ALA B 1 276 ? 18.642  14.840  -32.980  1.00 11.61 ? 265  ALA B O   1 
ATOM   5656  C  CB  . ALA B 1 276 ? 17.027  11.923  -33.610  1.00 15.60 ? 265  ALA B CB  1 
ATOM   5657  N  N   . GLN B 1 277 ? 17.650  14.527  -34.957  1.00 12.97 ? 266  GLN B N   1 
ATOM   5658  C  CA  . GLN B 1 277 ? 18.514  15.440  -35.664  1.00 14.97 ? 266  GLN B CA  1 
ATOM   5659  C  C   . GLN B 1 277 ? 18.532  16.848  -35.048  1.00 16.41 ? 266  GLN B C   1 
ATOM   5660  O  O   . GLN B 1 277 ? 19.598  17.470  -34.899  1.00 16.89 ? 266  GLN B O   1 
ATOM   5661  C  CB  . GLN B 1 277 ? 18.071  15.496  -37.137  1.00 15.11 ? 266  GLN B CB  1 
ATOM   5662  C  CG  . GLN B 1 277 ? 18.277  14.187  -37.834  1.00 19.45 ? 266  GLN B CG  1 
ATOM   5663  C  CD  . GLN B 1 277 ? 19.747  13.781  -37.856  1.00 27.35 ? 266  GLN B CD  1 
ATOM   5664  O  OE1 . GLN B 1 277 ? 20.183  12.907  -37.068  1.00 35.20 ? 266  GLN B OE1 1 
ATOM   5665  N  NE2 . GLN B 1 277 ? 20.540  14.453  -38.713  1.00 26.95 ? 266  GLN B NE2 1 
ATOM   5666  N  N   . ALA B 1 278 ? 17.345  17.318  -34.679  1.00 16.97 ? 267  ALA B N   1 
ATOM   5667  C  CA  . ALA B 1 278 ? 17.153  18.571  -33.969  1.00 16.36 ? 267  ALA B CA  1 
ATOM   5668  C  C   . ALA B 1 278 ? 17.904  18.719  -32.592  1.00 16.29 ? 267  ALA B C   1 
ATOM   5669  O  O   . ALA B 1 278 ? 18.528  19.751  -32.361  1.00 16.00 ? 267  ALA B O   1 
ATOM   5670  C  CB  . ALA B 1 278 ? 15.671  18.811  -33.804  1.00 16.41 ? 267  ALA B CB  1 
ATOM   5671  N  N   . ARG B 1 279 ? 17.872  17.719  -31.708  1.00 17.04 ? 268  ARG B N   1 
ATOM   5672  C  CA  . ARG B 1 279 ? 18.674  17.769  -30.475  1.00 16.27 ? 268  ARG B CA  1 
ATOM   5673  C  C   . ARG B 1 279 ? 20.161  17.766  -30.757  1.00 17.21 ? 268  ARG B C   1 
ATOM   5674  O  O   . ARG B 1 279 ? 20.916  18.224  -29.931  1.00 15.99 ? 268  ARG B O   1 
ATOM   5675  C  CB  . ARG B 1 279 ? 18.426  16.588  -29.543  1.00 17.08 ? 268  ARG B CB  1 
ATOM   5676  C  CG  . ARG B 1 279 ? 17.022  16.302  -29.126  1.00 14.71 ? 268  ARG B CG  1 
ATOM   5677  C  CD  . ARG B 1 279 ? 16.950  14.955  -28.400  1.00 17.96 ? 268  ARG B CD  1 
ATOM   5678  N  NE  . ARG B 1 279 ? 17.634  14.978  -27.087  1.00 16.99 ? 268  ARG B NE  1 
ATOM   5679  C  CZ  . ARG B 1 279 ? 18.858  14.477  -26.849  1.00 20.78 ? 268  ARG B CZ  1 
ATOM   5680  N  NH1 . ARG B 1 279 ? 19.553  13.850  -27.793  1.00 24.15 ? 268  ARG B NH1 1 
ATOM   5681  N  NH2 . ARG B 1 279 ? 19.396  14.573  -25.640  1.00 21.19 ? 268  ARG B NH2 1 
ATOM   5682  N  N   . LYS B 1 280 ? 20.602  17.248  -31.917  1.00 17.51 ? 269  LYS B N   1 
ATOM   5683  C  CA  . LYS B 1 280 ? 22.042  17.246  -32.243  1.00 16.78 ? 269  LYS B CA  1 
ATOM   5684  C  C   . LYS B 1 280 ? 22.518  18.633  -32.618  1.00 15.11 ? 269  LYS B C   1 
ATOM   5685  O  O   . LYS B 1 280 ? 23.720  18.920  -32.606  1.00 12.44 ? 269  LYS B O   1 
ATOM   5686  C  CB  . LYS B 1 280 ? 22.363  16.293  -33.391  1.00 17.96 ? 269  LYS B CB  1 
ATOM   5687  C  CG  . LYS B 1 280 ? 22.830  14.944  -32.968  1.00 20.03 ? 269  LYS B CG  1 
ATOM   5688  C  CD  . LYS B 1 280 ? 23.760  14.346  -33.959  1.00 20.06 ? 269  LYS B CD  1 
ATOM   5689  C  CE  . LYS B 1 280 ? 23.102  14.134  -35.311  1.00 24.09 ? 269  LYS B CE  1 
ATOM   5690  N  NZ  . LYS B 1 280 ? 23.909  13.144  -36.112  1.00 26.10 ? 269  LYS B NZ  1 
ATOM   5691  N  N   . LYS B 1 281 ? 21.568  19.481  -32.993  1.00 15.60 ? 270  LYS B N   1 
ATOM   5692  C  CA  . LYS B 1 281 ? 21.857  20.850  -33.363  1.00 16.65 ? 270  LYS B CA  1 
ATOM   5693  C  C   . LYS B 1 281 ? 21.718  21.707  -32.121  1.00 16.29 ? 270  LYS B C   1 
ATOM   5694  O  O   . LYS B 1 281 ? 21.969  22.912  -32.178  1.00 18.48 ? 270  LYS B O   1 
ATOM   5695  C  CB  . LYS B 1 281 ? 20.909  21.330  -34.464  1.00 18.16 ? 270  LYS B CB  1 
ATOM   5696  C  CG  . LYS B 1 281 ? 21.306  20.897  -35.860  1.00 18.78 ? 270  LYS B CG  1 
ATOM   5697  C  CD  . LYS B 1 281 ? 20.322  21.391  -36.908  1.00 20.73 ? 270  LYS B CD  1 
ATOM   5698  C  CE  . LYS B 1 281 ? 21.009  21.502  -38.297  1.00 22.47 ? 270  LYS B CE  1 
ATOM   5699  N  NZ  . LYS B 1 281 ? 20.137  21.943  -39.478  1.00 25.01 ? 270  LYS B NZ  1 
ATOM   5700  N  N   . GLY B 1 282 ? 21.336  21.082  -31.010  1.00 15.00 ? 271  GLY B N   1 
ATOM   5701  C  CA  . GLY B 1 282 ? 21.161  21.771  -29.730  1.00 14.55 ? 271  GLY B CA  1 
ATOM   5702  C  C   . GLY B 1 282 ? 19.753  22.299  -29.445  1.00 13.59 ? 271  GLY B C   1 
ATOM   5703  O  O   . GLY B 1 282 ? 19.578  23.097  -28.522  1.00 15.64 ? 271  GLY B O   1 
ATOM   5704  N  N   . THR B 1 283 ? 18.758  21.916  -30.237  1.00 12.35 ? 272  THR B N   1 
ATOM   5705  C  CA  . THR B 1 283 ? 17.350  22.308  -29.989  1.00 11.40 ? 272  THR B CA  1 
ATOM   5706  C  C   . THR B 1 283 ? 16.952  21.820  -28.591  1.00 8.65  ? 272  THR B C   1 
ATOM   5707  O  O   . THR B 1 283 ? 17.189  20.693  -28.252  1.00 10.45 ? 272  THR B O   1 
ATOM   5708  C  CB  . THR B 1 283 ? 16.452  21.674  -31.023  1.00 9.59  ? 272  THR B CB  1 
ATOM   5709  O  OG1 . THR B 1 283 ? 16.861  22.152  -32.303  1.00 15.53 ? 272  THR B OG1 1 
ATOM   5710  C  CG2 . THR B 1 283 ? 15.005  22.035  -30.862  1.00 9.79  ? 272  THR B CG2 1 
ATOM   5711  N  N   . VAL B 1 284 ? 16.367  22.675  -27.778  1.00 11.60 ? 273  VAL B N   1 
ATOM   5712  C  CA  . VAL B 1 284 ? 15.823  22.201  -26.512  1.00 11.50 ? 273  VAL B CA  1 
ATOM   5713  C  C   . VAL B 1 284 ? 14.422  21.646  -26.828  1.00 11.46 ? 273  VAL B C   1 
ATOM   5714  O  O   . VAL B 1 284 ? 13.412  22.356  -26.755  1.00 12.58 ? 273  VAL B O   1 
ATOM   5715  C  CB  . VAL B 1 284 ? 15.849  23.340  -25.431  1.00 12.40 ? 273  VAL B CB  1 
ATOM   5716  C  CG1 . VAL B 1 284 ? 15.253  22.889  -24.124  1.00 13.48 ? 273  VAL B CG1 1 
ATOM   5717  C  CG2 . VAL B 1 284 ? 17.287  23.877  -25.260  1.00 11.01 ? 273  VAL B CG2 1 
ATOM   5718  N  N   . VAL B 1 285 ? 14.376  20.376  -27.245  1.00 11.97 ? 274  VAL B N   1 
ATOM   5719  C  CA  . VAL B 1 285 ? 13.130  19.709  -27.602  1.00 12.16 ? 274  VAL B CA  1 
ATOM   5720  C  C   . VAL B 1 285 ? 13.056  18.350  -26.930  1.00 13.36 ? 274  VAL B C   1 
ATOM   5721  O  O   . VAL B 1 285 ? 14.076  17.649  -26.822  1.00 16.83 ? 274  VAL B O   1 
ATOM   5722  C  CB  . VAL B 1 285 ? 12.934  19.601  -29.188  1.00 11.83 ? 274  VAL B CB  1 
ATOM   5723  C  CG1 . VAL B 1 285 ? 14.160  19.001  -29.854  1.00 8.22  ? 274  VAL B CG1 1 
ATOM   5724  C  CG2 . VAL B 1 285 ? 11.722  18.816  -29.527  1.00 9.80  ? 274  VAL B CG2 1 
ATOM   5725  N  N   . TYR B 1 286 ? 11.857  17.988  -26.470  1.00 14.08 ? 275  TYR B N   1 
ATOM   5726  C  CA  . TYR B 1 286 ? 11.575  16.682  -25.878  1.00 15.24 ? 275  TYR B CA  1 
ATOM   5727  C  C   . TYR B 1 286 ? 10.458  15.939  -26.588  1.00 15.81 ? 275  TYR B C   1 
ATOM   5728  O  O   . TYR B 1 286 ? 9.450   16.516  -26.963  1.00 18.44 ? 275  TYR B O   1 
ATOM   5729  C  CB  . TYR B 1 286 ? 11.162  16.812  -24.410  1.00 17.12 ? 275  TYR B CB  1 
ATOM   5730  C  CG  . TYR B 1 286 ? 12.133  17.585  -23.635  1.00 16.76 ? 275  TYR B CG  1 
ATOM   5731  C  CD1 . TYR B 1 286 ? 13.103  16.957  -22.883  1.00 18.17 ? 275  TYR B CD1 1 
ATOM   5732  C  CD2 . TYR B 1 286 ? 12.128  18.963  -23.682  1.00 16.88 ? 275  TYR B CD2 1 
ATOM   5733  C  CE1 . TYR B 1 286 ? 14.033  17.695  -22.212  1.00 17.72 ? 275  TYR B CE1 1 
ATOM   5734  C  CE2 . TYR B 1 286 ? 13.055  19.705  -23.005  1.00 15.58 ? 275  TYR B CE2 1 
ATOM   5735  C  CZ  . TYR B 1 286 ? 13.987  19.073  -22.267  1.00 18.45 ? 275  TYR B CZ  1 
ATOM   5736  O  OH  . TYR B 1 286 ? 14.893  19.831  -21.574  1.00 22.36 ? 275  TYR B OH  1 
ATOM   5737  N  N   . GLY B 1 287 ? 10.653  14.637  -26.745  1.00 16.87 ? 276  GLY B N   1 
ATOM   5738  C  CA  . GLY B 1 287 ? 9.712   13.759  -27.429  1.00 16.12 ? 276  GLY B CA  1 
ATOM   5739  C  C   . GLY B 1 287 ? 9.044   12.761  -26.522  1.00 15.87 ? 276  GLY B C   1 
ATOM   5740  O  O   . GLY B 1 287 ? 9.694   12.119  -25.727  1.00 13.94 ? 276  GLY B O   1 
ATOM   5741  N  N   . GLU B 1 288 ? 7.733   12.635  -26.696  1.00 16.60 ? 277  GLU B N   1 
ATOM   5742  C  CA  . GLU B 1 288 ? 6.859   11.799  -25.889  1.00 15.86 ? 277  GLU B CA  1 
ATOM   5743  C  C   . GLU B 1 288 ? 6.247   10.708  -26.732  1.00 16.92 ? 277  GLU B C   1 
ATOM   5744  O  O   . GLU B 1 288 ? 5.114   10.876  -27.198  1.00 17.51 ? 277  GLU B O   1 
ATOM   5745  C  CB  . GLU B 1 288 ? 5.727   12.650  -25.362  1.00 16.72 ? 277  GLU B CB  1 
ATOM   5746  C  CG  . GLU B 1 288 ? 4.724   11.968  -24.459  1.00 15.99 ? 277  GLU B CG  1 
ATOM   5747  C  CD  . GLU B 1 288 ? 3.384   12.705  -24.458  1.00 16.57 ? 277  GLU B CD  1 
ATOM   5748  O  OE1 . GLU B 1 288 ? 2.554   12.534  -25.380  1.00 13.49 ? 277  GLU B OE1 1 
ATOM   5749  O  OE2 . GLU B 1 288 ? 3.195   13.529  -23.583  1.00 10.78 ? 277  GLU B OE2 1 
ATOM   5750  N  N   . PRO B 1 289 ? 6.992   9.605   -26.956  1.00 15.52 ? 278  PRO B N   1 
ATOM   5751  C  CA  . PRO B 1 289 ? 6.355   8.419   -27.499  1.00 14.90 ? 278  PRO B CA  1 
ATOM   5752  C  C   . PRO B 1 289 ? 5.284   8.004   -26.493  1.00 14.60 ? 278  PRO B C   1 
ATOM   5753  O  O   . PRO B 1 289 ? 5.360   8.420   -25.334  1.00 16.18 ? 278  PRO B O   1 
ATOM   5754  C  CB  . PRO B 1 289 ? 7.491   7.396   -27.531  1.00 14.46 ? 278  PRO B CB  1 
ATOM   5755  C  CG  . PRO B 1 289 ? 8.480   7.890   -26.480  1.00 17.67 ? 278  PRO B CG  1 
ATOM   5756  C  CD  . PRO B 1 289 ? 8.413   9.376   -26.641  1.00 15.96 ? 278  PRO B CD  1 
ATOM   5757  N  N   . ILE B 1 290 ? 4.281   7.239   -26.925  1.00 14.10 ? 279  ILE B N   1 
ATOM   5758  C  CA  . ILE B 1 290 ? 3.279   6.720   -25.970  1.00 10.05 ? 279  ILE B CA  1 
ATOM   5759  C  C   . ILE B 1 290 ? 3.184   5.214   -26.018  1.00 11.58 ? 279  ILE B C   1 
ATOM   5760  O  O   . ILE B 1 290 ? 3.630   4.570   -26.990  1.00 12.33 ? 279  ILE B O   1 
ATOM   5761  C  CB  . ILE B 1 290 ? 1.905   7.392   -26.159  1.00 7.73  ? 279  ILE B CB  1 
ATOM   5762  C  CG1 . ILE B 1 290 ? 1.309   7.136   -27.561  1.00 5.56  ? 279  ILE B CG1 1 
ATOM   5763  C  CG2 . ILE B 1 290 ? 2.024   8.934   -26.034  1.00 2.21  ? 279  ILE B CG2 1 
ATOM   5764  C  CD1 . ILE B 1 290 ? -0.140  7.387   -27.617  1.00 4.67  ? 279  ILE B CD1 1 
ATOM   5765  N  N   . THR B 1 291 ? 2.559   4.642   -24.988  1.00 12.22 ? 280  THR B N   1 
ATOM   5766  C  CA  . THR B 1 291 ? 2.309   3.211   -24.969  1.00 11.12 ? 280  THR B CA  1 
ATOM   5767  C  C   . THR B 1 291 ? 1.882   2.584   -26.322  1.00 12.10 ? 280  THR B C   1 
ATOM   5768  O  O   . THR B 1 291 ? 2.497   1.597   -26.776  1.00 13.74 ? 280  THR B O   1 
ATOM   5769  C  CB  . THR B 1 291 ? 1.300   2.826   -23.922  1.00 9.98  ? 280  THR B CB  1 
ATOM   5770  O  OG1 . THR B 1 291 ? 1.521   3.556   -22.714  1.00 7.15  ? 280  THR B OG1 1 
ATOM   5771  C  CG2 . THR B 1 291 ? 1.429   1.354   -23.650  1.00 13.68 ? 280  THR B CG2 1 
ATOM   5772  N  N   . ALA B 1 292 ? 0.835   3.137   -26.942  1.00 10.54 ? 281  ALA B N   1 
ATOM   5773  C  CA  . ALA B 1 292 ? 0.457   2.758   -28.304  1.00 11.33 ? 281  ALA B CA  1 
ATOM   5774  C  C   . ALA B 1 292 ? 1.645   2.583   -29.269  1.00 13.59 ? 281  ALA B C   1 
ATOM   5775  O  O   . ALA B 1 292 ? 1.842   1.495   -29.839  1.00 16.22 ? 281  ALA B O   1 
ATOM   5776  C  CB  . ALA B 1 292 ? -0.507  3.735   -28.844  1.00 8.66  ? 281  ALA B CB  1 
ATOM   5777  N  N   . SER B 1 293 ? 2.425   3.639   -29.480  1.00 14.33 ? 282  SER B N   1 
ATOM   5778  C  CA  . SER B 1 293 ? 3.408   3.617   -30.555  1.00 12.84 ? 282  SER B CA  1 
ATOM   5779  C  C   . SER B 1 293 ? 4.631   2.773   -30.203  1.00 12.76 ? 282  SER B C   1 
ATOM   5780  O  O   . SER B 1 293 ? 5.345   2.311   -31.079  1.00 7.44  ? 282  SER B O   1 
ATOM   5781  C  CB  . SER B 1 293 ? 3.804   5.032   -30.977  1.00 13.95 ? 282  SER B CB  1 
ATOM   5782  O  OG  . SER B 1 293 ? 4.434   5.784   -29.976  1.00 10.79 ? 282  SER B OG  1 
ATOM   5783  N  N   . LEU B 1 294 ? 4.870   2.609   -28.904  1.00 8.38  ? 283  LEU B N   1 
ATOM   5784  C  CA  . LEU B 1 294 ? 5.943   1.805   -28.363  1.00 8.76  ? 283  LEU B CA  1 
ATOM   5785  C  C   . LEU B 1 294 ? 5.609   0.349   -28.291  1.00 6.84  ? 283  LEU B C   1 
ATOM   5786  O  O   . LEU B 1 294 ? 6.483   -0.472  -28.183  1.00 3.82  ? 283  LEU B O   1 
ATOM   5787  C  CB  . LEU B 1 294 ? 6.216   2.265   -26.893  1.00 8.02  ? 283  LEU B CB  1 
ATOM   5788  C  CG  . LEU B 1 294 ? 6.945   3.587   -26.747  1.00 6.48  ? 283  LEU B CG  1 
ATOM   5789  C  CD1 . LEU B 1 294 ? 6.958   3.991   -25.229  1.00 2.91  ? 283  LEU B CD1 1 
ATOM   5790  C  CD2 . LEU B 1 294 ? 8.344   3.474   -27.204  1.00 7.57  ? 283  LEU B CD2 1 
ATOM   5791  N  N   . GLY B 1 295 ? 4.331   0.011   -28.338  1.00 10.06 ? 284  GLY B N   1 
ATOM   5792  C  CA  . GLY B 1 295 ? 3.926   -1.370  -28.161  1.00 12.90 ? 284  GLY B CA  1 
ATOM   5793  C  C   . GLY B 1 295 ? 3.194   -2.085  -29.280  1.00 14.20 ? 284  GLY B C   1 
ATOM   5794  O  O   . GLY B 1 295 ? 3.062   -3.288  -29.214  1.00 17.27 ? 284  GLY B O   1 
ATOM   5795  N  N   . THR B 1 296 ? 2.686   -1.386  -30.290  1.00 16.71 ? 285  THR B N   1 
ATOM   5796  C  CA  . THR B 1 296 ? 2.077   -2.070  -31.419  1.00 16.57 ? 285  THR B CA  1 
ATOM   5797  C  C   . THR B 1 296 ? 2.047   -1.206  -32.686  1.00 17.29 ? 285  THR B C   1 
ATOM   5798  O  O   . THR B 1 296 ? 2.828   -0.260  -32.816  1.00 17.67 ? 285  THR B O   1 
ATOM   5799  C  CB  . THR B 1 296 ? 0.648   -2.635  -31.097  1.00 17.25 ? 285  THR B CB  1 
ATOM   5800  O  OG1 . THR B 1 296 ? 0.222   -3.455  -32.201  1.00 19.86 ? 285  THR B OG1 1 
ATOM   5801  C  CG2 . THR B 1 296 ? -0.401  -1.557  -30.872  1.00 13.29 ? 285  THR B CG2 1 
ATOM   5802  N  N   . ASP B 1 297 ? 1.145   -1.502  -33.615  1.00 17.92 ? 286  ASP B N   1 
ATOM   5803  C  CA  . ASP B 1 297 ? 1.183   -0.800  -34.897  1.00 17.03 ? 286  ASP B CA  1 
ATOM   5804  C  C   . ASP B 1 297 ? -0.168  -0.618  -35.580  1.00 15.03 ? 286  ASP B C   1 
ATOM   5805  O  O   . ASP B 1 297 ? -1.146  -1.226  -35.191  1.00 16.46 ? 286  ASP B O   1 
ATOM   5806  C  CB  . ASP B 1 297 ? 2.203   -1.451  -35.816  1.00 17.31 ? 286  ASP B CB  1 
ATOM   5807  C  CG  . ASP B 1 297 ? 1.839   -2.843  -36.187  1.00 21.16 ? 286  ASP B CG  1 
ATOM   5808  O  OD1 . ASP B 1 297 ? 1.169   -3.036  -37.230  1.00 19.92 ? 286  ASP B OD1 1 
ATOM   5809  O  OD2 . ASP B 1 297 ? 2.234   -3.742  -35.432  1.00 22.92 ? 286  ASP B OD2 1 
ATOM   5810  N  N   . GLY B 1 298 ? -0.197  0.222   -36.613  1.00 15.64 ? 287  GLY B N   1 
ATOM   5811  C  CA  . GLY B 1 298 ? -1.435  0.618   -37.275  1.00 16.13 ? 287  GLY B CA  1 
ATOM   5812  C  C   . GLY B 1 298 ? -1.941  -0.345  -38.331  1.00 17.58 ? 287  GLY B C   1 
ATOM   5813  O  O   . GLY B 1 298 ? -2.754  0.018   -39.189  1.00 18.80 ? 287  GLY B O   1 
ATOM   5814  N  N   . SER B 1 299 ? -1.441  -1.572  -38.298  1.00 17.07 ? 288  SER B N   1 
ATOM   5815  C  CA  . SER B 1 299 ? -1.962  -2.621  -39.157  1.00 15.59 ? 288  SER B CA  1 
ATOM   5816  C  C   . SER B 1 299 ? -3.454  -2.775  -38.881  1.00 15.61 ? 288  SER B C   1 
ATOM   5817  O  O   . SER B 1 299 ? -4.225  -2.979  -39.769  1.00 16.37 ? 288  SER B O   1 
ATOM   5818  C  CB  . SER B 1 299 ? -1.237  -3.957  -38.894  1.00 12.51 ? 288  SER B CB  1 
ATOM   5819  O  OG  . SER B 1 299 ? -1.465  -4.408  -37.558  1.00 18.41 ? 288  SER B OG  1 
ATOM   5820  N  N   . HIS B 1 300 ? -3.850  -2.645  -37.618  1.00 16.42 ? 289  HIS B N   1 
ATOM   5821  C  CA  . HIS B 1 300 ? -5.183  -3.012  -37.191  1.00 14.93 ? 289  HIS B CA  1 
ATOM   5822  C  C   . HIS B 1 300 ? -6.266  -2.091  -37.696  1.00 15.89 ? 289  HIS B C   1 
ATOM   5823  O  O   . HIS B 1 300 ? -7.430  -2.427  -37.559  1.00 14.74 ? 289  HIS B O   1 
ATOM   5824  C  CB  . HIS B 1 300 ? -5.206  -3.167  -35.655  1.00 16.16 ? 289  HIS B CB  1 
ATOM   5825  C  CG  . HIS B 1 300 ? -4.075  -3.999  -35.166  1.00 16.27 ? 289  HIS B CG  1 
ATOM   5826  N  ND1 . HIS B 1 300 ? -4.111  -5.378  -35.179  1.00 17.43 ? 289  HIS B ND1 1 
ATOM   5827  C  CD2 . HIS B 1 300 ? -2.822  -3.654  -34.794  1.00 18.38 ? 289  HIS B CD2 1 
ATOM   5828  C  CE1 . HIS B 1 300 ? -2.937  -5.840  -34.785  1.00 23.07 ? 289  HIS B CE1 1 
ATOM   5829  N  NE2 . HIS B 1 300 ? -2.143  -4.814  -34.532  1.00 21.58 ? 289  HIS B NE2 1 
ATOM   5830  N  N   . TYR B 1 301 ? -5.895  -0.952  -38.286  1.00 15.64 ? 290  TYR B N   1 
ATOM   5831  C  CA  . TYR B 1 301 ? -6.870  -0.077  -38.947  1.00 16.82 ? 290  TYR B CA  1 
ATOM   5832  C  C   . TYR B 1 301 ? -7.553  -0.816  -40.112  1.00 17.42 ? 290  TYR B C   1 
ATOM   5833  O  O   . TYR B 1 301 ? -8.637  -0.440  -40.523  1.00 18.13 ? 290  TYR B O   1 
ATOM   5834  C  CB  . TYR B 1 301 ? -6.234  1.243   -39.477  1.00 15.90 ? 290  TYR B CB  1 
ATOM   5835  C  CG  . TYR B 1 301 ? -5.751  2.192   -38.387  1.00 15.61 ? 290  TYR B CG  1 
ATOM   5836  C  CD1 . TYR B 1 301 ? -6.649  2.810   -37.518  1.00 15.91 ? 290  TYR B CD1 1 
ATOM   5837  C  CD2 . TYR B 1 301 ? -4.402  2.491   -38.240  1.00 11.42 ? 290  TYR B CD2 1 
ATOM   5838  C  CE1 . TYR B 1 301 ? -6.205  3.668   -36.488  1.00 12.61 ? 290  TYR B CE1 1 
ATOM   5839  C  CE2 . TYR B 1 301 ? -3.963  3.373   -37.229  1.00 15.33 ? 290  TYR B CE2 1 
ATOM   5840  C  CZ  . TYR B 1 301 ? -4.871  3.925   -36.361  1.00 11.30 ? 290  TYR B CZ  1 
ATOM   5841  O  OH  . TYR B 1 301 ? -4.418  4.755   -35.414  1.00 13.87 ? 290  TYR B OH  1 
ATOM   5842  N  N   . TRP B 1 302 ? -6.885  -1.819  -40.683  1.00 18.92 ? 291  TRP B N   1 
ATOM   5843  C  CA  . TRP B 1 302 ? -7.501  -2.623  -41.750  1.00 18.02 ? 291  TRP B CA  1 
ATOM   5844  C  C   . TRP B 1 302 ? -8.159  -3.877  -41.244  1.00 18.82 ? 291  TRP B C   1 
ATOM   5845  O  O   . TRP B 1 302 ? -8.528  -4.739  -42.040  1.00 19.52 ? 291  TRP B O   1 
ATOM   5846  C  CB  . TRP B 1 302 ? -6.483  -2.992  -42.829  1.00 17.83 ? 291  TRP B CB  1 
ATOM   5847  C  CG  . TRP B 1 302 ? -6.187  -1.895  -43.729  1.00 15.19 ? 291  TRP B CG  1 
ATOM   5848  C  CD1 . TRP B 1 302 ? -6.718  -1.677  -44.964  1.00 14.60 ? 291  TRP B CD1 1 
ATOM   5849  C  CD2 . TRP B 1 302 ? -5.254  -0.843  -43.498  1.00 18.02 ? 291  TRP B CD2 1 
ATOM   5850  N  NE1 . TRP B 1 302 ? -6.180  -0.555  -45.505  1.00 14.66 ? 291  TRP B NE1 1 
ATOM   5851  C  CE2 . TRP B 1 302 ? -5.264  -0.030  -44.638  1.00 16.36 ? 291  TRP B CE2 1 
ATOM   5852  C  CE3 . TRP B 1 302 ? -4.384  -0.526  -42.440  1.00 17.14 ? 291  TRP B CE3 1 
ATOM   5853  C  CZ2 . TRP B 1 302 ? -4.475  1.097   -44.745  1.00 17.65 ? 291  TRP B CZ2 1 
ATOM   5854  C  CZ3 . TRP B 1 302 ? -3.595  0.576   -42.546  1.00 15.49 ? 291  TRP B CZ3 1 
ATOM   5855  C  CH2 . TRP B 1 302 ? -3.636  1.386   -43.690  1.00 17.33 ? 291  TRP B CH2 1 
ATOM   5856  N  N   . SER B 1 303 ? -8.336  -4.016  -39.933  1.00 18.28 ? 292  SER B N   1 
ATOM   5857  C  CA  . SER B 1 303 ? -9.097  -5.171  -39.452  1.00 19.10 ? 292  SER B CA  1 
ATOM   5858  C  C   . SER B 1 303 ? -10.519 -5.181  -40.031  1.00 20.18 ? 292  SER B C   1 
ATOM   5859  O  O   . SER B 1 303 ? -11.191 -4.140  -40.022  1.00 22.68 ? 292  SER B O   1 
ATOM   5860  C  CB  . SER B 1 303 ? -9.188  -5.139  -37.941  1.00 17.25 ? 292  SER B CB  1 
ATOM   5861  O  OG  . SER B 1 303 ? -10.194 -6.035  -37.569  1.00 18.30 ? 292  SER B OG  1 
ATOM   5862  N  N   . LYS B 1 304 ? -10.993 -6.341  -40.517  1.00 21.44 ? 293  LYS B N   1 
ATOM   5863  C  CA  . LYS B 1 304 ? -12.334 -6.441  -41.148  1.00 20.66 ? 293  LYS B CA  1 
ATOM   5864  C  C   . LYS B 1 304 ? -13.479 -6.322  -40.124  1.00 20.50 ? 293  LYS B C   1 
ATOM   5865  O  O   . LYS B 1 304 ? -14.586 -5.975  -40.477  1.00 22.60 ? 293  LYS B O   1 
ATOM   5866  C  CB  . LYS B 1 304 ? -12.497 -7.733  -41.960  1.00 22.81 ? 293  LYS B CB  1 
ATOM   5867  C  CG  . LYS B 1 304 ? -11.384 -8.018  -42.947  1.00 22.47 ? 293  LYS B CG  1 
ATOM   5868  C  CD  . LYS B 1 304 ? -11.452 -7.143  -44.149  1.00 24.36 ? 293  LYS B CD  1 
ATOM   5869  C  CE  . LYS B 1 304 ? -10.135 -7.172  -44.887  1.00 24.87 ? 293  LYS B CE  1 
ATOM   5870  N  NZ  . LYS B 1 304 ? -10.334 -6.921  -46.352  1.00 30.12 ? 293  LYS B NZ  1 
ATOM   5871  N  N   . ASN B 1 305 ? -13.192 -6.613  -38.859  1.00 20.04 ? 294  ASN B N   1 
ATOM   5872  C  CA  . ASN B 1 305 ? -13.994 -6.135  -37.736  1.00 18.38 ? 294  ASN B CA  1 
ATOM   5873  C  C   . ASN B 1 305 ? -13.838 -4.620  -37.535  1.00 19.10 ? 294  ASN B C   1 
ATOM   5874  O  O   . ASN B 1 305 ? -12.723 -4.124  -37.323  1.00 20.05 ? 294  ASN B O   1 
ATOM   5875  C  CB  . ASN B 1 305 ? -13.520 -6.802  -36.466  1.00 16.29 ? 294  ASN B CB  1 
ATOM   5876  C  CG  . ASN B 1 305 ? -14.262 -6.335  -35.279  1.00 17.43 ? 294  ASN B CG  1 
ATOM   5877  O  OD1 . ASN B 1 305 ? -15.116 -5.467  -35.393  1.00 17.60 ? 294  ASN B OD1 1 
ATOM   5878  N  ND2 . ASN B 1 305 ? -13.941 -6.894  -34.103  1.00 15.69 ? 294  ASN B ND2 1 
ATOM   5879  N  N   . TRP B 1 306 ? -14.953 -3.896  -37.582  1.00 18.61 ? 295  TRP B N   1 
ATOM   5880  C  CA  . TRP B 1 306 ? -14.972 -2.436  -37.407  1.00 17.05 ? 295  TRP B CA  1 
ATOM   5881  C  C   . TRP B 1 306 ? -14.613 -2.053  -35.976  1.00 17.79 ? 295  TRP B C   1 
ATOM   5882  O  O   . TRP B 1 306 ? -13.796 -1.173  -35.747  1.00 18.41 ? 295  TRP B O   1 
ATOM   5883  C  CB  . TRP B 1 306 ? -16.359 -1.874  -37.780  1.00 17.41 ? 295  TRP B CB  1 
ATOM   5884  C  CG  . TRP B 1 306 ? -16.450 -0.360  -37.824  1.00 15.08 ? 295  TRP B CG  1 
ATOM   5885  C  CD1 . TRP B 1 306 ? -16.377 0.428   -38.916  1.00 13.13 ? 295  TRP B CD1 1 
ATOM   5886  C  CD2 . TRP B 1 306 ? -16.660 0.506   -36.718  1.00 15.16 ? 295  TRP B CD2 1 
ATOM   5887  N  NE1 . TRP B 1 306 ? -16.500 1.745   -38.567  1.00 12.18 ? 295  TRP B NE1 1 
ATOM   5888  C  CE2 . TRP B 1 306 ? -16.676 1.818   -37.211  1.00 14.78 ? 295  TRP B CE2 1 
ATOM   5889  C  CE3 . TRP B 1 306 ? -16.831 0.299   -35.351  1.00 14.45 ? 295  TRP B CE3 1 
ATOM   5890  C  CZ2 . TRP B 1 306 ? -16.836 2.917   -36.389  1.00 13.60 ? 295  TRP B CZ2 1 
ATOM   5891  C  CZ3 . TRP B 1 306 ? -16.980 1.393   -34.538  1.00 14.45 ? 295  TRP B CZ3 1 
ATOM   5892  C  CH2 . TRP B 1 306 ? -16.964 2.675   -35.050  1.00 13.47 ? 295  TRP B CH2 1 
ATOM   5893  N  N   . ALA B 1 307 ? -15.199 -2.733  -34.999  1.00 16.38 ? 296  ALA B N   1 
ATOM   5894  C  CA  . ALA B 1 307 ? -15.058 -2.291  -33.612  1.00 16.43 ? 296  ALA B CA  1 
ATOM   5895  C  C   . ALA B 1 307 ? -13.617 -2.311  -33.150  1.00 18.30 ? 296  ALA B C   1 
ATOM   5896  O  O   . ALA B 1 307 ? -13.289 -1.738  -32.076  1.00 19.85 ? 296  ALA B O   1 
ATOM   5897  C  CB  . ALA B 1 307 ? -15.901 -3.131  -32.715  1.00 12.76 ? 296  ALA B CB  1 
ATOM   5898  N  N   . LYS B 1 308 ? -12.762 -3.001  -33.912  1.00 18.44 ? 297  LYS B N   1 
ATOM   5899  C  CA  . LYS B 1 308 ? -11.366 -3.176  -33.555  1.00 17.22 ? 297  LYS B CA  1 
ATOM   5900  C  C   . LYS B 1 308 ? -10.596 -2.180  -34.343  1.00 18.36 ? 297  LYS B C   1 
ATOM   5901  O  O   . LYS B 1 308 ? -9.781  -1.470  -33.774  1.00 18.51 ? 297  LYS B O   1 
ATOM   5902  C  CB  . LYS B 1 308 ? -10.905 -4.599  -33.836  1.00 17.79 ? 297  LYS B CB  1 
ATOM   5903  C  CG  . LYS B 1 308 ? -9.466  -4.897  -33.471  1.00 17.43 ? 297  LYS B CG  1 
ATOM   5904  C  CD  . LYS B 1 308 ? -8.779  -5.838  -34.463  1.00 17.48 ? 297  LYS B CD  1 
ATOM   5905  C  CE  . LYS B 1 308 ? -7.545  -6.404  -33.831  1.00 17.23 ? 297  LYS B CE  1 
ATOM   5906  N  NZ  . LYS B 1 308 ? -6.596  -7.122  -34.729  1.00 19.05 ? 297  LYS B NZ  1 
ATOM   5907  N  N   . ALA B 1 309 ? -10.845 -2.089  -35.660  1.00 18.49 ? 298  ALA B N   1 
ATOM   5908  C  CA  . ALA B 1 309 ? -10.212 -1.023  -36.436  1.00 18.48 ? 298  ALA B CA  1 
ATOM   5909  C  C   . ALA B 1 309 ? -10.422 0.296   -35.689  1.00 19.96 ? 298  ALA B C   1 
ATOM   5910  O  O   . ALA B 1 309 ? -9.454  0.989   -35.329  1.00 21.45 ? 298  ALA B O   1 
ATOM   5911  C  CB  . ALA B 1 309 ? -10.794 -0.932  -37.853  1.00 19.71 ? 298  ALA B CB  1 
ATOM   5912  N  N   . ALA B 1 310 ? -11.691 0.595   -35.413  1.00 17.90 ? 299  ALA B N   1 
ATOM   5913  C  CA  . ALA B 1 310 ? -12.099 1.827   -34.773  1.00 17.12 ? 299  ALA B CA  1 
ATOM   5914  C  C   . ALA B 1 310 ? -11.405 2.048   -33.431  1.00 16.68 ? 299  ALA B C   1 
ATOM   5915  O  O   . ALA B 1 310 ? -11.119 3.172   -33.081  1.00 19.03 ? 299  ALA B O   1 
ATOM   5916  C  CB  . ALA B 1 310 ? -13.608 1.848   -34.589  1.00 15.54 ? 299  ALA B CB  1 
ATOM   5917  N  N   . ALA B 1 311 ? -11.082 0.984   -32.720  1.00 15.69 ? 300  ALA B N   1 
ATOM   5918  C  CA  . ALA B 1 311 ? -10.506 1.130   -31.387  1.00 16.97 ? 300  ALA B CA  1 
ATOM   5919  C  C   . ALA B 1 311 ? -9.062  1.650   -31.405  1.00 16.66 ? 300  ALA B C   1 
ATOM   5920  O  O   . ALA B 1 311 ? -8.504  1.974   -30.349  1.00 13.87 ? 300  ALA B O   1 
ATOM   5921  C  CB  . ALA B 1 311 ? -10.574 -0.205  -30.644  1.00 18.63 ? 300  ALA B CB  1 
ATOM   5922  N  N   . PHE B 1 312 ? -8.458  1.686   -32.603  1.00 17.29 ? 301  PHE B N   1 
ATOM   5923  C  CA  . PHE B 1 312 ? -7.076  2.166   -32.799  1.00 17.89 ? 301  PHE B CA  1 
ATOM   5924  C  C   . PHE B 1 312 ? -7.042  3.589   -33.350  1.00 16.61 ? 301  PHE B C   1 
ATOM   5925  O  O   . PHE B 1 312 ? -5.962  4.113   -33.662  1.00 11.96 ? 301  PHE B O   1 
ATOM   5926  C  CB  . PHE B 1 312 ? -6.322  1.249   -33.782  1.00 19.71 ? 301  PHE B CB  1 
ATOM   5927  C  CG  . PHE B 1 312 ? -6.028  -0.117  -33.234  1.00 20.77 ? 301  PHE B CG  1 
ATOM   5928  C  CD1 . PHE B 1 312 ? -6.936  -1.131  -33.367  1.00 18.42 ? 301  PHE B CD1 1 
ATOM   5929  C  CD2 . PHE B 1 312 ? -4.833  -0.378  -32.580  1.00 25.23 ? 301  PHE B CD2 1 
ATOM   5930  C  CE1 . PHE B 1 312 ? -6.679  -2.367  -32.880  1.00 19.45 ? 301  PHE B CE1 1 
ATOM   5931  C  CE2 . PHE B 1 312 ? -4.560  -1.653  -32.071  1.00 25.49 ? 301  PHE B CE2 1 
ATOM   5932  C  CZ  . PHE B 1 312 ? -5.491  -2.641  -32.228  1.00 23.35 ? 301  PHE B CZ  1 
ATOM   5933  N  N   . VAL B 1 313 ? -8.229  4.181   -33.493  1.00 16.67 ? 302  VAL B N   1 
ATOM   5934  C  CA  . VAL B 1 313 ? -8.355  5.513   -34.077  1.00 18.20 ? 302  VAL B CA  1 
ATOM   5935  C  C   . VAL B 1 313 ? -8.032  6.520   -33.006  1.00 17.83 ? 302  VAL B C   1 
ATOM   5936  O  O   . VAL B 1 313 ? -8.645  6.548   -31.950  1.00 19.47 ? 302  VAL B O   1 
ATOM   5937  C  CB  . VAL B 1 313 ? -9.734  5.767   -34.729  1.00 18.67 ? 302  VAL B CB  1 
ATOM   5938  C  CG1 . VAL B 1 313 ? -9.846  7.201   -35.161  1.00 15.83 ? 302  VAL B CG1 1 
ATOM   5939  C  CG2 . VAL B 1 313 ? -9.943  4.804   -35.908  1.00 14.59 ? 302  VAL B CG2 1 
ATOM   5940  N  N   . THR B 1 314 ? -6.972  7.260   -33.281  1.00 17.56 ? 303  THR B N   1 
ATOM   5941  C  CA  . THR B 1 314 ? -6.421  8.264   -32.399  1.00 17.62 ? 303  THR B CA  1 
ATOM   5942  C  C   . THR B 1 314 ? -5.532  9.158   -33.206  1.00 16.08 ? 303  THR B C   1 
ATOM   5943  O  O   . THR B 1 314 ? -5.137  8.818   -34.339  1.00 14.64 ? 303  THR B O   1 
ATOM   5944  C  CB  . THR B 1 314 ? -5.627  7.676   -31.224  1.00 18.03 ? 303  THR B CB  1 
ATOM   5945  O  OG1 . THR B 1 314 ? -5.298  8.746   -30.326  1.00 20.49 ? 303  THR B OG1 1 
ATOM   5946  C  CG2 . THR B 1 314 ? -4.351  6.942   -31.683  1.00 15.27 ? 303  THR B CG2 1 
ATOM   5947  N  N   . SER B 1 315 ? -5.272  10.347  -32.678  1.00 13.56 ? 304  SER B N   1 
ATOM   5948  C  CA  . SER B 1 315 ? -4.549  11.334  -33.464  1.00 12.60 ? 304  SER B CA  1 
ATOM   5949  C  C   . SER B 1 315 ? -3.373  11.899  -32.655  1.00 11.26 ? 304  SER B C   1 
ATOM   5950  O  O   . SER B 1 315 ? -3.535  12.303  -31.450  1.00 13.16 ? 304  SER B O   1 
ATOM   5951  C  CB  . SER B 1 315 ? -5.522  12.372  -33.985  1.00 13.85 ? 304  SER B CB  1 
ATOM   5952  O  OG  . SER B 1 315 ? -6.348  11.794  -35.002  1.00 11.64 ? 304  SER B OG  1 
ATOM   5953  N  N   . PRO B 1 316 ? -2.151  11.818  -33.218  1.00 8.65  ? 305  PRO B N   1 
ATOM   5954  C  CA  . PRO B 1 316 ? -1.728  11.122  -34.459  1.00 5.94  ? 305  PRO B CA  1 
ATOM   5955  C  C   . PRO B 1 316 ? -1.958  9.591   -34.425  1.00 6.25  ? 305  PRO B C   1 
ATOM   5956  O  O   . PRO B 1 316 ? -1.953  8.950   -33.338  1.00 2.00  ? 305  PRO B O   1 
ATOM   5957  C  CB  . PRO B 1 316 ? -0.235  11.391  -34.501  1.00 4.59  ? 305  PRO B CB  1 
ATOM   5958  C  CG  . PRO B 1 316 ? -0.015  12.531  -33.706  1.00 6.71  ? 305  PRO B CG  1 
ATOM   5959  C  CD  . PRO B 1 316 ? -1.002  12.460  -32.584  1.00 9.05  ? 305  PRO B CD  1 
ATOM   5960  N  N   . PRO B 1 317 ? -2.115  8.967   -35.601  1.00 3.60  ? 306  PRO B N   1 
ATOM   5961  C  CA  . PRO B 1 317 ? -2.414  7.583   -35.664  1.00 6.04  ? 306  PRO B CA  1 
ATOM   5962  C  C   . PRO B 1 317 ? -1.234  6.707   -35.444  1.00 10.31 ? 306  PRO B C   1 
ATOM   5963  O  O   . PRO B 1 317 ? -0.099  7.075   -35.827  1.00 13.59 ? 306  PRO B O   1 
ATOM   5964  C  CB  . PRO B 1 317 ? -2.803  7.371   -37.164  1.00 4.83  ? 306  PRO B CB  1 
ATOM   5965  C  CG  . PRO B 1 317 ? -2.682  8.585   -37.768  1.00 2.27  ? 306  PRO B CG  1 
ATOM   5966  C  CD  . PRO B 1 317 ? -1.938  9.520   -36.959  1.00 5.51  ? 306  PRO B CD  1 
ATOM   5967  N  N   . LEU B 1 318 ? -1.516  5.515   -34.902  1.00 14.38 ? 307  LEU B N   1 
ATOM   5968  C  CA  . LEU B 1 318 ? -0.580  4.391   -34.915  1.00 15.49 ? 307  LEU B CA  1 
ATOM   5969  C  C   . LEU B 1 318 ? -0.011  4.234   -36.324  1.00 15.90 ? 307  LEU B C   1 
ATOM   5970  O  O   . LEU B 1 318 ? -0.779  4.220   -37.285  1.00 15.26 ? 307  LEU B O   1 
ATOM   5971  C  CB  . LEU B 1 318 ? -1.284  3.076   -34.596  1.00 14.71 ? 307  LEU B CB  1 
ATOM   5972  C  CG  . LEU B 1 318 ? -1.543  2.638   -33.143  1.00 13.77 ? 307  LEU B CG  1 
ATOM   5973  C  CD1 . LEU B 1 318 ? -0.311  2.006   -32.633  1.00 8.69  ? 307  LEU B CD1 1 
ATOM   5974  C  CD2 . LEU B 1 318 ? -1.992  3.772   -32.357  1.00 16.64 ? 307  LEU B CD2 1 
ATOM   5975  N  N   . SER B 1 319 ? 1.302   4.021   -36.426  1.00 16.68 ? 308  SER B N   1 
ATOM   5976  C  CA  . SER B 1 319 ? 1.936   3.821   -37.731  1.00 16.49 ? 308  SER B CA  1 
ATOM   5977  C  C   . SER B 1 319 ? 1.716   2.413   -38.285  1.00 17.54 ? 308  SER B C   1 
ATOM   5978  O  O   . SER B 1 319 ? 1.980   1.432   -37.582  1.00 19.94 ? 308  SER B O   1 
ATOM   5979  C  CB  . SER B 1 319 ? 3.439   4.035   -37.652  1.00 16.89 ? 308  SER B CB  1 
ATOM   5980  O  OG  . SER B 1 319 ? 4.024   3.745   -38.928  1.00 20.40 ? 308  SER B OG  1 
ATOM   5981  N  N   . PRO B 1 320 ? 1.280   2.287   -39.552  1.00 16.55 ? 309  PRO B N   1 
ATOM   5982  C  CA  . PRO B 1 320 ? 1.154   0.937   -40.084  1.00 17.63 ? 309  PRO B CA  1 
ATOM   5983  C  C   . PRO B 1 320 ? 2.486   0.168   -40.223  1.00 18.79 ? 309  PRO B C   1 
ATOM   5984  O  O   . PRO B 1 320 ? 2.471   -1.055  -40.193  1.00 22.03 ? 309  PRO B O   1 
ATOM   5985  C  CB  . PRO B 1 320 ? 0.533   1.169   -41.469  1.00 15.95 ? 309  PRO B CB  1 
ATOM   5986  C  CG  . PRO B 1 320 ? -0.035  2.464   -41.404  1.00 15.86 ? 309  PRO B CG  1 
ATOM   5987  C  CD  . PRO B 1 320 ? 0.873   3.267   -40.563  1.00 16.39 ? 309  PRO B CD  1 
ATOM   5988  N  N   . ASP B 1 321 ? 3.610   0.878   -40.392  1.00 19.42 ? 310  ASP B N   1 
ATOM   5989  C  CA  . ASP B 1 321 ? 4.948   0.267   -40.466  1.00 18.07 ? 310  ASP B CA  1 
ATOM   5990  C  C   . ASP B 1 321 ? 5.268   -0.561  -39.226  1.00 18.08 ? 310  ASP B C   1 
ATOM   5991  O  O   . ASP B 1 321 ? 5.524   0.016   -38.168  1.00 18.88 ? 310  ASP B O   1 
ATOM   5992  C  CB  . ASP B 1 321 ? 5.995   1.356   -40.587  1.00 19.94 ? 310  ASP B CB  1 
ATOM   5993  C  CG  . ASP B 1 321 ? 7.417   0.813   -40.803  1.00 18.95 ? 310  ASP B CG  1 
ATOM   5994  O  OD1 . ASP B 1 321 ? 7.784   -0.280  -40.337  1.00 23.60 ? 310  ASP B OD1 1 
ATOM   5995  O  OD2 . ASP B 1 321 ? 8.168   1.523   -41.474  1.00 23.04 ? 310  ASP B OD2 1 
ATOM   5996  N  N   . PRO B 1 322 ? 5.311   -1.908  -39.355  1.00 16.11 ? 311  PRO B N   1 
ATOM   5997  C  CA  . PRO B 1 322 ? 5.519   -2.734  -38.175  1.00 15.44 ? 311  PRO B CA  1 
ATOM   5998  C  C   . PRO B 1 322 ? 6.908   -2.628  -37.520  1.00 14.63 ? 311  PRO B C   1 
ATOM   5999  O  O   . PRO B 1 322 ? 7.139   -3.212  -36.440  1.00 16.23 ? 311  PRO B O   1 
ATOM   6000  C  CB  . PRO B 1 322 ? 5.281   -4.169  -38.702  1.00 14.57 ? 311  PRO B CB  1 
ATOM   6001  C  CG  . PRO B 1 322 ? 4.702   -4.022  -40.022  1.00 15.43 ? 311  PRO B CG  1 
ATOM   6002  C  CD  . PRO B 1 322 ? 5.185   -2.746  -40.562  1.00 16.30 ? 311  PRO B CD  1 
ATOM   6003  N  N   . THR B 1 323 ? 7.806   -1.865  -38.120  1.00 13.60 ? 312  THR B N   1 
ATOM   6004  C  CA  . THR B 1 323 ? 9.106   -1.686  -37.543  1.00 12.99 ? 312  THR B CA  1 
ATOM   6005  C  C   . THR B 1 323 ? 9.105   -0.544  -36.514  1.00 12.70 ? 312  THR B C   1 
ATOM   6006  O  O   . THR B 1 323 ? 10.113  -0.298  -35.900  1.00 11.54 ? 312  THR B O   1 
ATOM   6007  C  CB  . THR B 1 323 ? 10.194  -1.492  -38.647  1.00 15.41 ? 312  THR B CB  1 
ATOM   6008  O  OG1 . THR B 1 323 ? 10.132  -0.197  -39.227  1.00 17.88 ? 312  THR B OG1 1 
ATOM   6009  C  CG2 . THR B 1 323 ? 10.045  -2.539  -39.728  1.00 15.71 ? 312  THR B CG2 1 
ATOM   6010  N  N   . THR B 1 324 ? 7.960   0.133   -36.316  1.00 7.39  ? 313  THR B N   1 
ATOM   6011  C  CA  . THR B 1 324 ? 8.010   1.461   -35.755  1.00 6.92  ? 313  THR B CA  1 
ATOM   6012  C  C   . THR B 1 324 ? 8.266   1.306   -34.275  1.00 3.94  ? 313  THR B C   1 
ATOM   6013  O  O   . THR B 1 324 ? 9.078   2.014   -33.717  1.00 2.00  ? 313  THR B O   1 
ATOM   6014  C  CB  . THR B 1 324 ? 6.708   2.256   -35.947  1.00 7.63  ? 313  THR B CB  1 
ATOM   6015  O  OG1 . THR B 1 324 ? 6.544   2.566   -37.360  1.00 3.66  ? 313  THR B OG1 1 
ATOM   6016  C  CG2 . THR B 1 324 ? 6.796   3.546   -35.184  1.00 2.00  ? 313  THR B CG2 1 
ATOM   6017  N  N   . PRO B 1 325 ? 7.627   0.337   -33.686  1.00 5.00  ? 314  PRO B N   1 
ATOM   6018  C  CA  . PRO B 1 325 ? 7.917   0.191   -32.173  1.00 6.24  ? 314  PRO B CA  1 
ATOM   6019  C  C   . PRO B 1 325 ? 9.344   -0.193  -31.788  1.00 8.36  ? 314  PRO B C   1 
ATOM   6020  O  O   . PRO B 1 325 ? 9.799   0.012   -30.627  1.00 9.55  ? 314  PRO B O   1 
ATOM   6021  C  CB  . PRO B 1 325 ? 7.022   -0.947  -31.807  1.00 4.70  ? 314  PRO B CB  1 
ATOM   6022  C  CG  . PRO B 1 325 ? 5.956   -0.923  -32.701  1.00 3.71  ? 314  PRO B CG  1 
ATOM   6023  C  CD  . PRO B 1 325 ? 6.571   -0.606  -34.089  1.00 4.82  ? 314  PRO B CD  1 
ATOM   6024  N  N   . ASP B 1 326 ? 10.074  -0.800  -32.722  1.00 11.83 ? 315  ASP B N   1 
ATOM   6025  C  CA  . ASP B 1 326 ? 11.460  -1.187  -32.454  1.00 12.50 ? 315  ASP B CA  1 
ATOM   6026  C  C   . ASP B 1 326 ? 12.340  0.055   -32.562  1.00 12.46 ? 315  ASP B C   1 
ATOM   6027  O  O   . ASP B 1 326 ? 13.309  0.221   -31.827  1.00 15.66 ? 315  ASP B O   1 
ATOM   6028  C  CB  . ASP B 1 326 ? 11.902  -2.292  -33.448  1.00 15.84 ? 315  ASP B CB  1 
ATOM   6029  C  CG  . ASP B 1 326 ? 13.335  -2.810  -33.195  1.00 17.68 ? 315  ASP B CG  1 
ATOM   6030  O  OD1 . ASP B 1 326 ? 14.087  -2.966  -34.182  1.00 27.90 ? 315  ASP B OD1 1 
ATOM   6031  O  OD2 . ASP B 1 326 ? 13.738  -3.039  -32.022  1.00 27.88 ? 315  ASP B OD2 1 
ATOM   6032  N  N   . PHE B 1 327 ? 12.004  0.924   -33.513  1.00 13.17 ? 316  PHE B N   1 
ATOM   6033  C  CA  . PHE B 1 327 ? 12.684  2.190   -33.655  1.00 13.03 ? 316  PHE B CA  1 
ATOM   6034  C  C   . PHE B 1 327 ? 12.464  3.064   -32.429  1.00 12.09 ? 316  PHE B C   1 
ATOM   6035  O  O   . PHE B 1 327 ? 13.414  3.633   -31.906  1.00 15.01 ? 316  PHE B O   1 
ATOM   6036  C  CB  . PHE B 1 327 ? 12.228  2.946   -34.904  1.00 13.99 ? 316  PHE B CB  1 
ATOM   6037  C  CG  . PHE B 1 327 ? 13.157  4.086   -35.310  1.00 14.72 ? 316  PHE B CG  1 
ATOM   6038  C  CD1 . PHE B 1 327 ? 14.288  3.846   -36.072  1.00 13.98 ? 316  PHE B CD1 1 
ATOM   6039  C  CD2 . PHE B 1 327 ? 12.868  5.391   -34.966  1.00 9.79  ? 316  PHE B CD2 1 
ATOM   6040  C  CE1 . PHE B 1 327 ? 15.122  4.875   -36.425  1.00 12.49 ? 316  PHE B CE1 1 
ATOM   6041  C  CE2 . PHE B 1 327 ? 13.685  6.408   -35.331  1.00 12.23 ? 316  PHE B CE2 1 
ATOM   6042  C  CZ  . PHE B 1 327 ? 14.815  6.153   -36.071  1.00 14.62 ? 316  PHE B CZ  1 
ATOM   6043  N  N   . LEU B 1 328 ? 11.231  3.194   -31.999  1.00 8.33  ? 317  LEU B N   1 
ATOM   6044  C  CA  . LEU B 1 328 ? 10.925  4.195   -30.976  1.00 10.48 ? 317  LEU B CA  1 
ATOM   6045  C  C   . LEU B 1 328 ? 11.467  3.737   -29.635  1.00 9.81  ? 317  LEU B C   1 
ATOM   6046  O  O   . LEU B 1 328 ? 11.850  4.540   -28.785  1.00 11.81 ? 317  LEU B O   1 
ATOM   6047  C  CB  . LEU B 1 328 ? 9.429   4.507   -30.900  1.00 8.44  ? 317  LEU B CB  1 
ATOM   6048  C  CG  . LEU B 1 328 ? 8.718   5.175   -32.082  1.00 11.68 ? 317  LEU B CG  1 
ATOM   6049  C  CD1 . LEU B 1 328 ? 7.298   5.519   -31.629  1.00 7.55  ? 317  LEU B CD1 1 
ATOM   6050  C  CD2 . LEU B 1 328 ? 9.451   6.417   -32.569  1.00 8.73  ? 317  LEU B CD2 1 
ATOM   6051  N  N   . ASN B 1 329 ? 11.560  2.440   -29.452  1.00 10.08 ? 318  ASN B N   1 
ATOM   6052  C  CA  . ASN B 1 329 ? 12.188  1.903   -28.237  1.00 9.48  ? 318  ASN B CA  1 
ATOM   6053  C  C   . ASN B 1 329 ? 13.703  2.046   -28.281  1.00 10.16 ? 318  ASN B C   1 
ATOM   6054  O  O   . ASN B 1 329 ? 14.347  2.357   -27.284  1.00 8.65  ? 318  ASN B O   1 
ATOM   6055  C  CB  . ASN B 1 329 ? 11.789  0.443   -28.039  1.00 9.47  ? 318  ASN B CB  1 
ATOM   6056  C  CG  . ASN B 1 329 ? 10.454  0.295   -27.326  1.00 12.48 ? 318  ASN B CG  1 
ATOM   6057  O  OD1 . ASN B 1 329 ? 10.317  0.499   -26.100  1.00 10.54 ? 318  ASN B OD1 1 
ATOM   6058  N  ND2 . ASN B 1 329 ? 9.487   -0.128  -28.057  1.00 2.38  ? 318  ASN B ND2 1 
ATOM   6059  N  N   . SER B 1 330 ? 14.309  1.843   -29.446  1.00 9.15  ? 319  SER B N   1 
ATOM   6060  C  CA  . SER B 1 330 ? 15.703  2.175   -29.637  1.00 10.34 ? 319  SER B CA  1 
ATOM   6061  C  C   . SER B 1 330 ? 16.061  3.611   -29.323  1.00 12.04 ? 319  SER B C   1 
ATOM   6062  O  O   . SER B 1 330 ? 16.982  3.887   -28.542  1.00 12.72 ? 319  SER B O   1 
ATOM   6063  C  CB  . SER B 1 330 ? 16.052  1.894   -31.103  1.00 11.35 ? 319  SER B CB  1 
ATOM   6064  O  OG  . SER B 1 330 ? 15.848  0.522   -31.357  1.00 12.03 ? 319  SER B OG  1 
ATOM   6065  N  N   . LEU B 1 331 ? 15.364  4.544   -29.959  1.00 13.86 ? 320  LEU B N   1 
ATOM   6066  C  CA  . LEU B 1 331 ? 15.679  5.959   -29.778  1.00 15.23 ? 320  LEU B CA  1 
ATOM   6067  C  C   . LEU B 1 331 ? 15.368  6.371   -28.348  1.00 15.03 ? 320  LEU B C   1 
ATOM   6068  O  O   . LEU B 1 331 ? 15.921  7.329   -27.850  1.00 18.43 ? 320  LEU B O   1 
ATOM   6069  C  CB  . LEU B 1 331 ? 14.928  6.841   -30.759  1.00 14.88 ? 320  LEU B CB  1 
ATOM   6070  C  CG  . LEU B 1 331 ? 15.713  7.294   -31.971  1.00 16.89 ? 320  LEU B CG  1 
ATOM   6071  C  CD1 . LEU B 1 331 ? 16.253  6.097   -32.679  1.00 14.53 ? 320  LEU B CD1 1 
ATOM   6072  C  CD2 . LEU B 1 331 ? 14.785  8.128   -32.849  1.00 16.26 ? 320  LEU B CD2 1 
ATOM   6073  N  N   . LEU B 1 332 ? 14.478  5.632   -27.703  1.00 17.79 ? 321  LEU B N   1 
ATOM   6074  C  CA  . LEU B 1 332 ? 14.215  5.758   -26.266  1.00 17.03 ? 321  LEU B CA  1 
ATOM   6075  C  C   . LEU B 1 332 ? 15.426  5.326   -25.414  1.00 18.06 ? 321  LEU B C   1 
ATOM   6076  O  O   . LEU B 1 332 ? 15.722  5.913   -24.383  1.00 17.71 ? 321  LEU B O   1 
ATOM   6077  C  CB  . LEU B 1 332 ? 12.979  4.901   -25.924  1.00 19.20 ? 321  LEU B CB  1 
ATOM   6078  C  CG  . LEU B 1 332 ? 12.384  4.847   -24.512  1.00 18.84 ? 321  LEU B CG  1 
ATOM   6079  C  CD1 . LEU B 1 332 ? 11.892  6.245   -24.120  1.00 23.52 ? 321  LEU B CD1 1 
ATOM   6080  C  CD2 . LEU B 1 332 ? 11.225  3.828   -24.421  1.00 15.07 ? 321  LEU B CD2 1 
ATOM   6081  N  N   . SER B 1 333 ? 16.154  4.306   -25.863  1.00 18.10 ? 322  SER B N   1 
ATOM   6082  C  CA  . SER B 1 333 ? 17.246  3.761   -25.101  1.00 18.02 ? 322  SER B CA  1 
ATOM   6083  C  C   . SER B 1 333 ? 18.480  4.633   -25.250  1.00 19.15 ? 322  SER B C   1 
ATOM   6084  O  O   . SER B 1 333 ? 19.246  4.737   -24.319  1.00 21.49 ? 322  SER B O   1 
ATOM   6085  C  CB  . SER B 1 333 ? 17.527  2.317   -25.520  1.00 17.47 ? 322  SER B CB  1 
ATOM   6086  O  OG  . SER B 1 333 ? 16.385  1.510   -25.333  1.00 14.32 ? 322  SER B OG  1 
ATOM   6087  N  N   . CYS B 1 334 ? 18.685  5.270   -26.400  1.00 17.45 ? 323  CYS B N   1 
ATOM   6088  C  CA  . CYS B 1 334 ? 19.872  6.128   -26.595  1.00 18.32 ? 323  CYS B CA  1 
ATOM   6089  C  C   . CYS B 1 334 ? 19.654  7.603   -26.199  1.00 18.53 ? 323  CYS B C   1 
ATOM   6090  O  O   . CYS B 1 334 ? 20.543  8.451   -26.402  1.00 19.52 ? 323  CYS B O   1 
ATOM   6091  C  CB  . CYS B 1 334 ? 20.346  6.058   -28.055  1.00 16.71 ? 323  CYS B CB  1 
ATOM   6092  S  SG  . CYS B 1 334 ? 19.244  6.835   -29.187  1.00 22.53 ? 323  CYS B SG  1 
ATOM   6093  N  N   . GLY B 1 335 ? 18.481  7.905   -25.646  1.00 17.31 ? 324  GLY B N   1 
ATOM   6094  C  CA  . GLY B 1 335 ? 18.147  9.237   -25.148  1.00 17.13 ? 324  GLY B CA  1 
ATOM   6095  C  C   . GLY B 1 335 ? 17.557  10.278  -26.091  1.00 16.08 ? 324  GLY B C   1 
ATOM   6096  O  O   . GLY B 1 335 ? 17.356  11.431  -25.689  1.00 14.08 ? 324  GLY B O   1 
ATOM   6097  N  N   . ASP B 1 336 ? 17.305  9.923   -27.356  1.00 16.25 ? 325  ASP B N   1 
ATOM   6098  C  CA  . ASP B 1 336 ? 16.686  10.871  -28.271  1.00 15.56 ? 325  ASP B CA  1 
ATOM   6099  C  C   . ASP B 1 336 ? 15.191  11.118  -27.938  1.00 15.56 ? 325  ASP B C   1 
ATOM   6100  O  O   . ASP B 1 336 ? 14.618  12.171  -28.278  1.00 14.64 ? 325  ASP B O   1 
ATOM   6101  C  CB  . ASP B 1 336 ? 16.803  10.396  -29.730  1.00 16.62 ? 325  ASP B CB  1 
ATOM   6102  C  CG  . ASP B 1 336 ? 18.165  10.656  -30.328  1.00 18.53 ? 325  ASP B CG  1 
ATOM   6103  O  OD1 . ASP B 1 336 ? 18.720  11.779  -30.140  1.00 17.89 ? 325  ASP B OD1 1 
ATOM   6104  O  OD2 . ASP B 1 336 ? 18.662  9.730   -31.016  1.00 22.54 ? 325  ASP B OD2 1 
ATOM   6105  N  N   . LEU B 1 337 ? 14.552  10.141  -27.300  1.00 15.16 ? 326  LEU B N   1 
ATOM   6106  C  CA  . LEU B 1 337 ? 13.184  10.279  -26.799  1.00 12.20 ? 326  LEU B CA  1 
ATOM   6107  C  C   . LEU B 1 337 ? 13.205  9.978   -25.314  1.00 12.36 ? 326  LEU B C   1 
ATOM   6108  O  O   . LEU B 1 337 ? 13.511  8.874   -24.944  1.00 15.33 ? 326  LEU B O   1 
ATOM   6109  C  CB  . LEU B 1 337 ? 12.282  9.255   -27.429  1.00 9.16  ? 326  LEU B CB  1 
ATOM   6110  C  CG  . LEU B 1 337 ? 12.176  9.394   -28.948  1.00 2.00  ? 326  LEU B CG  1 
ATOM   6111  C  CD1 . LEU B 1 337 ? 11.204  8.369   -29.362  1.00 2.63  ? 326  LEU B CD1 1 
ATOM   6112  C  CD2 . LEU B 1 337 ? 11.727  10.797  -29.235  1.00 2.79  ? 326  LEU B CD2 1 
ATOM   6113  N  N   . GLN B 1 338 ? 12.783  10.915  -24.493  1.00 13.02 ? 327  GLN B N   1 
ATOM   6114  C  CA  . GLN B 1 338 ? 13.183  10.924  -23.049  1.00 12.57 ? 327  GLN B CA  1 
ATOM   6115  C  C   . GLN B 1 338 ? 12.136  10.564  -22.028  1.00 12.29 ? 327  GLN B C   1 
ATOM   6116  O  O   . GLN B 1 338 ? 12.452  10.271  -20.832  1.00 9.94  ? 327  GLN B O   1 
ATOM   6117  C  CB  . GLN B 1 338 ? 13.641  12.343  -22.691  1.00 14.14 ? 327  GLN B CB  1 
ATOM   6118  C  CG  . GLN B 1 338 ? 14.399  13.104  -23.777  1.00 18.64 ? 327  GLN B CG  1 
ATOM   6119  C  CD  . GLN B 1 338 ? 13.545  13.432  -25.024  1.00 20.98 ? 327  GLN B CD  1 
ATOM   6120  O  OE1 . GLN B 1 338 ? 12.388  13.794  -24.915  1.00 24.03 ? 327  GLN B OE1 1 
ATOM   6121  N  NE2 . GLN B 1 338 ? 14.129  13.280  -26.202  1.00 19.77 ? 327  GLN B NE2 1 
ATOM   6122  N  N   . VAL B 1 339 ? 10.890  10.722  -22.432  1.00 14.30 ? 328  VAL B N   1 
ATOM   6123  C  CA  . VAL B 1 339 ? 9.761   10.579  -21.532  1.00 14.71 ? 328  VAL B CA  1 
ATOM   6124  C  C   . VAL B 1 339 ? 8.727   9.685   -22.180  1.00 15.06 ? 328  VAL B C   1 
ATOM   6125  O  O   . VAL B 1 339 ? 8.737   9.498   -23.405  1.00 14.41 ? 328  VAL B O   1 
ATOM   6126  C  CB  . VAL B 1 339 ? 9.225   11.961  -21.036  1.00 15.13 ? 328  VAL B CB  1 
ATOM   6127  C  CG1 . VAL B 1 339 ? 10.385  12.846  -20.614  1.00 14.22 ? 328  VAL B CG1 1 
ATOM   6128  C  CG2 . VAL B 1 339 ? 8.338   12.683  -22.072  1.00 14.99 ? 328  VAL B CG2 1 
ATOM   6129  N  N   . THR B 1 340 ? 7.914   9.030   -21.359  1.00 15.32 ? 329  THR B N   1 
ATOM   6130  C  CA  . THR B 1 340 ? 6.863   8.164   -21.861  1.00 15.51 ? 329  THR B CA  1 
ATOM   6131  C  C   . THR B 1 340 ? 5.498   8.474   -21.221  1.00 15.90 ? 329  THR B C   1 
ATOM   6132  O  O   . THR B 1 340 ? 5.383   8.700   -19.992  1.00 15.89 ? 329  THR B O   1 
ATOM   6133  C  CB  . THR B 1 340 ? 7.226   6.661   -21.714  1.00 14.84 ? 329  THR B CB  1 
ATOM   6134  O  OG1 . THR B 1 340 ? 7.429   6.314   -20.336  1.00 18.81 ? 329  THR B OG1 1 
ATOM   6135  C  CG2 . THR B 1 340 ? 8.478   6.315   -22.521  1.00 17.67 ? 329  THR B CG2 1 
ATOM   6136  N  N   . GLY B 1 341 ? 4.464   8.457   -22.063  1.00 15.87 ? 330  GLY B N   1 
ATOM   6137  C  CA  . GLY B 1 341 ? 3.080   8.586   -21.614  1.00 16.39 ? 330  GLY B CA  1 
ATOM   6138  C  C   . GLY B 1 341 ? 2.127   7.662   -22.348  1.00 18.21 ? 330  GLY B C   1 
ATOM   6139  O  O   . GLY B 1 341 ? 2.535   6.948   -23.293  1.00 20.27 ? 330  GLY B O   1 
ATOM   6140  N  N   . SER B 1 342 ? 0.850   7.694   -21.969  1.00 16.09 ? 331  SER B N   1 
ATOM   6141  C  CA  . SER B 1 342 ? -0.168  6.870   -22.660  1.00 15.06 ? 331  SER B CA  1 
ATOM   6142  C  C   . SER B 1 342 ? -1.072  7.604   -23.628  1.00 13.94 ? 331  SER B C   1 
ATOM   6143  O  O   . SER B 1 342 ? -1.629  6.987   -24.533  1.00 16.44 ? 331  SER B O   1 
ATOM   6144  C  CB  . SER B 1 342 ? -1.057  6.228   -21.623  1.00 13.13 ? 331  SER B CB  1 
ATOM   6145  O  OG  . SER B 1 342 ? -1.853  7.219   -21.058  1.00 16.94 ? 331  SER B OG  1 
ATOM   6146  N  N   . ALA B 1 343 ? -1.242  8.915   -23.460  1.00 14.45 ? 332  ALA B N   1 
ATOM   6147  C  CA  . ALA B 1 343 ? -2.351  9.651   -24.086  1.00 14.26 ? 332  ALA B CA  1 
ATOM   6148  C  C   . ALA B 1 343 ? -3.682  8.880   -23.956  1.00 14.96 ? 332  ALA B C   1 
ATOM   6149  O  O   . ALA B 1 343 ? -4.453  8.720   -24.924  1.00 13.07 ? 332  ALA B O   1 
ATOM   6150  C  CB  . ALA B 1 343 ? -2.029  9.972   -25.565  1.00 13.86 ? 332  ALA B CB  1 
ATOM   6151  N  N   . HIS B 1 344 ? -3.936  8.388   -22.744  1.00 14.46 ? 333  HIS B N   1 
ATOM   6152  C  CA  . HIS B 1 344 ? -5.041  7.476   -22.482  1.00 16.23 ? 333  HIS B CA  1 
ATOM   6153  C  C   . HIS B 1 344 ? -6.328  8.271   -22.592  1.00 16.59 ? 333  HIS B C   1 
ATOM   6154  O  O   . HIS B 1 344 ? -6.588  9.141   -21.800  1.00 17.17 ? 333  HIS B O   1 
ATOM   6155  C  CB  . HIS B 1 344 ? -4.907  6.841   -21.091  1.00 13.39 ? 333  HIS B CB  1 
ATOM   6156  C  CG  . HIS B 1 344 ? -5.954  5.807   -20.788  1.00 14.67 ? 333  HIS B CG  1 
ATOM   6157  N  ND1 . HIS B 1 344 ? -5.651  4.496   -20.505  1.00 17.29 ? 333  HIS B ND1 1 
ATOM   6158  C  CD2 . HIS B 1 344 ? -7.300  5.900   -20.699  1.00 13.86 ? 333  HIS B CD2 1 
ATOM   6159  C  CE1 . HIS B 1 344 ? -6.761  3.822   -20.278  1.00 15.58 ? 333  HIS B CE1 1 
ATOM   6160  N  NE2 . HIS B 1 344 ? -7.778  4.650   -20.406  1.00 17.73 ? 333  HIS B NE2 1 
ATOM   6161  N  N   . CYS B 1 345 ? -7.083  8.003   -23.643  1.00 19.70 ? 334  CYS B N   1 
ATOM   6162  C  CA  . CYS B 1 345 ? -8.273  8.757   -23.975  1.00 19.13 ? 334  CYS B CA  1 
ATOM   6163  C  C   . CYS B 1 345 ? -9.293  7.781   -24.534  1.00 19.29 ? 334  CYS B C   1 
ATOM   6164  O  O   . CYS B 1 345 ? -9.522  7.724   -25.726  1.00 21.01 ? 334  CYS B O   1 
ATOM   6165  C  CB  . CYS B 1 345 ? -7.909  9.823   -25.002  1.00 19.58 ? 334  CYS B CB  1 
ATOM   6166  S  SG  . CYS B 1 345 ? -9.143  11.093  -25.194  1.00 22.94 ? 334  CYS B SG  1 
ATOM   6167  N  N   . THR B 1 346 ? -9.901  6.996   -23.667  1.00 18.68 ? 335  THR B N   1 
ATOM   6168  C  CA  . THR B 1 346 ? -10.673 5.842   -24.097  1.00 18.79 ? 335  THR B CA  1 
ATOM   6169  C  C   . THR B 1 346 ? -12.127 6.146   -24.364  1.00 20.26 ? 335  THR B C   1 
ATOM   6170  O  O   . THR B 1 346 ? -12.775 6.874   -23.598  1.00 21.45 ? 335  THR B O   1 
ATOM   6171  C  CB  . THR B 1 346 ? -10.657 4.740   -23.040  1.00 17.98 ? 335  THR B CB  1 
ATOM   6172  O  OG1 . THR B 1 346 ? -10.972 5.309   -21.756  1.00 16.37 ? 335  THR B OG1 1 
ATOM   6173  C  CG2 . THR B 1 346 ? -9.300  4.066   -23.019  1.00 10.76 ? 335  THR B CG2 1 
ATOM   6174  N  N   . PHE B 1 347 ? -12.619 5.578   -25.462  1.00 21.18 ? 336  PHE B N   1 
ATOM   6175  C  CA  . PHE B 1 347 ? -14.039 5.527   -25.773  1.00 21.61 ? 336  PHE B CA  1 
ATOM   6176  C  C   . PHE B 1 347 ? -14.458 4.095   -26.126  1.00 22.59 ? 336  PHE B C   1 
ATOM   6177  O  O   . PHE B 1 347 ? -13.707 3.308   -26.737  1.00 24.31 ? 336  PHE B O   1 
ATOM   6178  C  CB  . PHE B 1 347 ? -14.378 6.449   -26.936  1.00 22.05 ? 336  PHE B CB  1 
ATOM   6179  C  CG  . PHE B 1 347 ? -14.044 7.897   -26.698  1.00 23.35 ? 336  PHE B CG  1 
ATOM   6180  C  CD1 . PHE B 1 347 ? -12.770 8.391   -26.982  1.00 21.82 ? 336  PHE B CD1 1 
ATOM   6181  C  CD2 . PHE B 1 347 ? -15.020 8.784   -26.236  1.00 23.51 ? 336  PHE B CD2 1 
ATOM   6182  C  CE1 . PHE B 1 347 ? -12.467 9.730   -26.774  1.00 21.22 ? 336  PHE B CE1 1 
ATOM   6183  C  CE2 . PHE B 1 347 ? -14.727 10.144  -26.045  1.00 22.87 ? 336  PHE B CE2 1 
ATOM   6184  C  CZ  . PHE B 1 347 ? -13.448 10.614  -26.316  1.00 21.85 ? 336  PHE B CZ  1 
ATOM   6185  N  N   . ASN B 1 348 ? -15.677 3.744   -25.745  1.00 22.56 ? 337  ASN B N   1 
ATOM   6186  C  CA  . ASN B 1 348 ? -16.151 2.389   -25.914  1.00 20.55 ? 337  ASN B CA  1 
ATOM   6187  C  C   . ASN B 1 348 ? -16.681 2.208   -27.322  1.00 20.57 ? 337  ASN B C   1 
ATOM   6188  O  O   . ASN B 1 348 ? -16.767 3.166   -28.121  1.00 18.29 ? 337  ASN B O   1 
ATOM   6189  C  CB  . ASN B 1 348 ? -17.180 2.026   -24.836  1.00 19.65 ? 337  ASN B CB  1 
ATOM   6190  C  CG  . ASN B 1 348 ? -18.357 2.924   -24.831  1.00 19.20 ? 337  ASN B CG  1 
ATOM   6191  O  OD1 . ASN B 1 348 ? -18.939 3.228   -25.878  1.00 11.28 ? 337  ASN B OD1 1 
ATOM   6192  N  ND2 . ASN B 1 348 ? -18.739 3.369   -23.653  1.00 7.19  ? 337  ASN B ND2 1 
ATOM   6193  N  N   . THR B 1 349 ? -16.986 0.959   -27.643  1.00 21.31 ? 338  THR B N   1 
ATOM   6194  C  CA  . THR B 1 349 ? -17.439 0.608   -28.993  1.00 21.39 ? 338  THR B CA  1 
ATOM   6195  C  C   . THR B 1 349 ? -18.656 1.420   -29.362  1.00 20.92 ? 338  THR B C   1 
ATOM   6196  O  O   . THR B 1 349 ? -18.725 1.996   -30.450  1.00 21.18 ? 338  THR B O   1 
ATOM   6197  C  CB  . THR B 1 349 ? -17.774 -0.894  -29.095  1.00 21.24 ? 338  THR B CB  1 
ATOM   6198  O  OG1 . THR B 1 349 ? -16.611 -1.667  -28.755  1.00 25.20 ? 338  THR B OG1 1 
ATOM   6199  C  CG2 . THR B 1 349 ? -18.250 -1.239  -30.486  1.00 20.70 ? 338  THR B CG2 1 
ATOM   6200  N  N   . ALA B 1 350 ? -19.616 1.485   -28.441  1.00 21.68 ? 339  ALA B N   1 
ATOM   6201  C  CA  . ALA B 1 350 ? -20.826 2.269   -28.688  1.00 21.60 ? 339  ALA B CA  1 
ATOM   6202  C  C   . ALA B 1 350 ? -20.476 3.735   -28.947  1.00 21.74 ? 339  ALA B C   1 
ATOM   6203  O  O   . ALA B 1 350 ? -20.973 4.319   -29.896  1.00 20.97 ? 339  ALA B O   1 
ATOM   6204  C  CB  . ALA B 1 350 ? -21.835 2.112   -27.542  1.00 20.93 ? 339  ALA B CB  1 
ATOM   6205  N  N   . GLN B 1 351 ? -19.614 4.331   -28.124  1.00 21.62 ? 340  GLN B N   1 
ATOM   6206  C  CA  . GLN B 1 351 ? -19.121 5.696   -28.406  1.00 21.79 ? 340  GLN B CA  1 
ATOM   6207  C  C   . GLN B 1 351 ? -18.394 5.785   -29.752  1.00 22.74 ? 340  GLN B C   1 
ATOM   6208  O  O   . GLN B 1 351 ? -18.677 6.668   -30.572  1.00 26.31 ? 340  GLN B O   1 
ATOM   6209  C  CB  . GLN B 1 351 ? -18.210 6.197   -27.285  1.00 20.92 ? 340  GLN B CB  1 
ATOM   6210  C  CG  . GLN B 1 351 ? -18.966 6.806   -26.128  1.00 19.59 ? 340  GLN B CG  1 
ATOM   6211  C  CD  . GLN B 1 351 ? -18.068 7.072   -24.928  1.00 19.56 ? 340  GLN B CD  1 
ATOM   6212  O  OE1 . GLN B 1 351 ? -17.325 6.200   -24.510  1.00 17.36 ? 340  GLN B OE1 1 
ATOM   6213  N  NE2 . GLN B 1 351 ? -18.104 8.284   -24.413  1.00 15.42 ? 340  GLN B NE2 1 
ATOM   6214  N  N   . LYS B 1 352 ? -17.493 4.857   -30.017  1.00 22.89 ? 341  LYS B N   1 
ATOM   6215  C  CA  . LYS B 1 352 ? -16.791 4.842   -31.316  1.00 22.73 ? 341  LYS B CA  1 
ATOM   6216  C  C   . LYS B 1 352 ? -17.758 4.796   -32.502  1.00 22.81 ? 341  LYS B C   1 
ATOM   6217  O  O   . LYS B 1 352 ? -17.474 5.340   -33.600  1.00 21.12 ? 341  LYS B O   1 
ATOM   6218  C  CB  . LYS B 1 352 ? -15.843 3.618   -31.398  1.00 23.17 ? 341  LYS B CB  1 
ATOM   6219  C  CG  . LYS B 1 352 ? -14.575 3.674   -30.509  1.00 22.31 ? 341  LYS B CG  1 
ATOM   6220  C  CD  . LYS B 1 352 ? -13.618 4.753   -30.972  1.00 20.54 ? 341  LYS B CD  1 
ATOM   6221  C  CE  . LYS B 1 352 ? -12.286 4.702   -30.286  1.00 22.41 ? 341  LYS B CE  1 
ATOM   6222  N  NZ  . LYS B 1 352 ? -11.227 5.217   -31.220  1.00 24.09 ? 341  LYS B NZ  1 
ATOM   6223  N  N   . ALA B 1 353 ? -18.891 4.121   -32.302  1.00 24.44 ? 342  ALA B N   1 
ATOM   6224  C  CA  . ALA B 1 353 ? -19.769 3.699   -33.424  1.00 23.90 ? 342  ALA B CA  1 
ATOM   6225  C  C   . ALA B 1 353 ? -20.439 4.832   -34.178  1.00 24.03 ? 342  ALA B C   1 
ATOM   6226  O  O   . ALA B 1 353 ? -20.947 4.612   -35.299  1.00 24.57 ? 342  ALA B O   1 
ATOM   6227  C  CB  . ALA B 1 353 ? -20.788 2.680   -32.955  1.00 25.17 ? 342  ALA B CB  1 
ATOM   6228  N  N   . VAL B 1 354 ? -20.371 6.042   -33.607  1.00 24.05 ? 343  VAL B N   1 
ATOM   6229  C  CA  . VAL B 1 354 ? -20.995 7.235   -34.170  1.00 23.37 ? 343  VAL B CA  1 
ATOM   6230  C  C   . VAL B 1 354 ? -20.340 7.609   -35.486  1.00 23.44 ? 343  VAL B C   1 
ATOM   6231  O  O   . VAL B 1 354 ? -21.003 8.148   -36.393  1.00 21.71 ? 343  VAL B O   1 
ATOM   6232  C  CB  . VAL B 1 354 ? -20.958 8.402   -33.185  1.00 24.72 ? 343  VAL B CB  1 
ATOM   6233  C  CG1 . VAL B 1 354 ? -22.003 9.463   -33.581  1.00 28.18 ? 343  VAL B CG1 1 
ATOM   6234  C  CG2 . VAL B 1 354 ? -21.229 7.898   -31.774  1.00 25.48 ? 343  VAL B CG2 1 
ATOM   6235  N  N   . GLY B 1 355 ? -19.044 7.301   -35.606  1.00 22.60 ? 344  GLY B N   1 
ATOM   6236  C  CA  . GLY B 1 355 ? -18.365 7.350   -36.901  1.00 22.52 ? 344  GLY B CA  1 
ATOM   6237  C  C   . GLY B 1 355 ? -18.457 6.065   -37.717  1.00 21.93 ? 344  GLY B C   1 
ATOM   6238  O  O   . GLY B 1 355 ? -17.542 5.770   -38.471  1.00 22.09 ? 344  GLY B O   1 
ATOM   6239  N  N   . LYS B 1 356 ? -19.551 5.307   -37.582  1.00 21.66 ? 345  LYS B N   1 
ATOM   6240  C  CA  . LYS B 1 356 ? -19.739 4.054   -38.314  1.00 22.31 ? 345  LYS B CA  1 
ATOM   6241  C  C   . LYS B 1 356 ? -19.725 4.220   -39.854  1.00 20.60 ? 345  LYS B C   1 
ATOM   6242  O  O   . LYS B 1 356 ? -19.329 3.303   -40.553  1.00 19.72 ? 345  LYS B O   1 
ATOM   6243  C  CB  . LYS B 1 356 ? -21.057 3.398   -37.901  1.00 23.91 ? 345  LYS B CB  1 
ATOM   6244  C  CG  . LYS B 1 356 ? -22.294 4.224   -38.288  1.00 26.22 ? 345  LYS B CG  1 
ATOM   6245  C  CD  . LYS B 1 356 ? -23.475 4.147   -37.287  1.00 27.26 ? 345  LYS B CD  1 
ATOM   6246  C  CE  . LYS B 1 356 ? -24.787 4.663   -37.931  1.00 29.02 ? 345  LYS B CE  1 
ATOM   6247  N  NZ  . LYS B 1 356 ? -24.615 5.914   -38.734  1.00 31.88 ? 345  LYS B NZ  1 
ATOM   6248  N  N   . ASP B 1 357 ? -20.144 5.386   -40.356  1.00 20.79 ? 346  ASP B N   1 
ATOM   6249  C  CA  . ASP B 1 357 ? -20.210 5.656   -41.818  1.00 20.84 ? 346  ASP B CA  1 
ATOM   6250  C  C   . ASP B 1 357 ? -19.344 6.830   -42.256  1.00 20.26 ? 346  ASP B C   1 
ATOM   6251  O  O   . ASP B 1 357 ? -19.489 7.343   -43.364  1.00 22.81 ? 346  ASP B O   1 
ATOM   6252  C  CB  . ASP B 1 357 ? -21.659 5.916   -42.241  1.00 21.51 ? 346  ASP B CB  1 
ATOM   6253  C  CG  . ASP B 1 357 ? -22.516 4.671   -42.183  1.00 24.64 ? 346  ASP B CG  1 
ATOM   6254  O  OD1 . ASP B 1 357 ? -22.223 3.706   -42.938  1.00 25.74 ? 346  ASP B OD1 1 
ATOM   6255  O  OD2 . ASP B 1 357 ? -23.488 4.664   -41.379  1.00 29.21 ? 346  ASP B OD2 1 
ATOM   6256  N  N   . ASN B 1 358 ? -18.402 7.222   -41.417  1.00 19.50 ? 347  ASN B N   1 
ATOM   6257  C  CA  . ASN B 1 358 ? -17.583 8.402   -41.649  1.00 17.93 ? 347  ASN B CA  1 
ATOM   6258  C  C   . ASN B 1 358 ? -16.515 8.388   -40.554  1.00 16.78 ? 347  ASN B C   1 
ATOM   6259  O  O   . ASN B 1 358 ? -16.816 8.717   -39.418  1.00 16.28 ? 347  ASN B O   1 
ATOM   6260  C  CB  . ASN B 1 358 ? -18.464 9.667   -41.593  1.00 16.78 ? 347  ASN B CB  1 
ATOM   6261  C  CG  . ASN B 1 358 ? -17.686 10.960  -41.837  1.00 18.90 ? 347  ASN B CG  1 
ATOM   6262  O  OD1 . ASN B 1 358 ? -16.456 10.977  -41.786  1.00 19.60 ? 347  ASN B OD1 1 
ATOM   6263  N  ND2 . ASN B 1 358 ? -18.410 12.063  -42.077  1.00 17.19 ? 347  ASN B ND2 1 
ATOM   6264  N  N   . PHE B 1 359 ? -15.296 7.957   -40.892  1.00 15.57 ? 348  PHE B N   1 
ATOM   6265  C  CA  . PHE B 1 359 ? -14.160 7.865   -39.908  1.00 15.61 ? 348  PHE B CA  1 
ATOM   6266  C  C   . PHE B 1 359 ? -13.794 9.171   -39.205  1.00 14.18 ? 348  PHE B C   1 
ATOM   6267  O  O   . PHE B 1 359 ? -13.326 9.147   -38.047  1.00 13.42 ? 348  PHE B O   1 
ATOM   6268  C  CB  . PHE B 1 359 ? -12.877 7.277   -40.542  1.00 14.43 ? 348  PHE B CB  1 
ATOM   6269  C  CG  . PHE B 1 359 ? -12.297 8.128   -41.623  1.00 16.70 ? 348  PHE B CG  1 
ATOM   6270  C  CD1 . PHE B 1 359 ? -11.468 9.199   -41.324  1.00 12.90 ? 348  PHE B CD1 1 
ATOM   6271  C  CD2 . PHE B 1 359 ? -12.595 7.880   -42.943  1.00 15.84 ? 348  PHE B CD2 1 
ATOM   6272  C  CE1 . PHE B 1 359 ? -10.966 9.977   -42.302  1.00 16.17 ? 348  PHE B CE1 1 
ATOM   6273  C  CE2 . PHE B 1 359 ? -12.082 8.696   -43.933  1.00 15.23 ? 348  PHE B CE2 1 
ATOM   6274  C  CZ  . PHE B 1 359 ? -11.273 9.727   -43.623  1.00 12.00 ? 348  PHE B CZ  1 
ATOM   6275  N  N   . THR B 1 360 ? -13.981 10.301  -39.890  1.00 12.58 ? 349  THR B N   1 
ATOM   6276  C  CA  . THR B 1 360 ? -13.761 11.641  -39.264  1.00 12.91 ? 349  THR B CA  1 
ATOM   6277  C  C   . THR B 1 360 ? -14.543 11.802  -37.947  1.00 13.33 ? 349  THR B C   1 
ATOM   6278  O  O   . THR B 1 360 ? -14.030 12.427  -37.007  1.00 13.05 ? 349  THR B O   1 
ATOM   6279  C  CB  . THR B 1 360 ? -14.123 12.823  -40.141  1.00 12.82 ? 349  THR B CB  1 
ATOM   6280  O  OG1 . THR B 1 360 ? -15.541 12.865  -40.399  1.00 16.69 ? 349  THR B OG1 1 
ATOM   6281  C  CG2 . THR B 1 360 ? -13.359 12.790  -41.445  1.00 5.41  ? 349  THR B CG2 1 
ATOM   6282  N  N   . LEU B 1 361 ? -15.740 11.202  -37.868  1.00 13.45 ? 350  LEU B N   1 
ATOM   6283  C  CA  . LEU B 1 361 ? -16.568 11.340  -36.675  1.00 12.98 ? 350  LEU B CA  1 
ATOM   6284  C  C   . LEU B 1 361 ? -16.240 10.385  -35.559  1.00 14.00 ? 350  LEU B C   1 
ATOM   6285  O  O   . LEU B 1 361 ? -16.726 10.603  -34.422  1.00 15.15 ? 350  LEU B O   1 
ATOM   6286  C  CB  . LEU B 1 361 ? -18.058 11.269  -36.998  1.00 13.46 ? 350  LEU B CB  1 
ATOM   6287  C  CG  . LEU B 1 361 ? -18.667 12.258  -37.984  1.00 13.17 ? 350  LEU B CG  1 
ATOM   6288  C  CD1 . LEU B 1 361 ? -20.083 12.373  -37.616  1.00 16.64 ? 350  LEU B CD1 1 
ATOM   6289  C  CD2 . LEU B 1 361 ? -18.022 13.657  -38.006  1.00 16.47 ? 350  LEU B CD2 1 
ATOM   6290  N  N   . ILE B 1 362 ? -15.413 9.366   -35.823  1.00 13.65 ? 351  ILE B N   1 
ATOM   6291  C  CA  . ILE B 1 362 ? -14.977 8.435   -34.758  1.00 12.92 ? 351  ILE B CA  1 
ATOM   6292  C  C   . ILE B 1 362 ? -14.192 9.207   -33.675  1.00 12.49 ? 351  ILE B C   1 
ATOM   6293  O  O   . ILE B 1 362 ? -13.082 9.758   -33.894  1.00 12.30 ? 351  ILE B O   1 
ATOM   6294  C  CB  . ILE B 1 362 ? -14.077 7.211   -35.231  1.00 12.58 ? 351  ILE B CB  1 
ATOM   6295  C  CG1 . ILE B 1 362 ? -14.645 6.510   -36.459  1.00 11.31 ? 351  ILE B CG1 1 
ATOM   6296  C  CG2 . ILE B 1 362 ? -13.978 6.163   -34.169  1.00 12.81 ? 351  ILE B CG2 1 
ATOM   6297  C  CD1 . ILE B 1 362 ? -13.799 5.374   -36.992  1.00 10.21 ? 351  ILE B CD1 1 
ATOM   6298  N  N   . PRO B 1 363 ? -14.741 9.205   -32.467  1.00 11.69 ? 352  PRO B N   1 
ATOM   6299  C  CA  . PRO B 1 363 ? -13.956 9.844   -31.450  1.00 10.41 ? 352  PRO B CA  1 
ATOM   6300  C  C   . PRO B 1 363 ? -12.515 9.357   -31.439  1.00 10.94 ? 352  PRO B C   1 
ATOM   6301  O  O   . PRO B 1 363 ? -12.266 8.141   -31.519  1.00 15.67 ? 352  PRO B O   1 
ATOM   6302  C  CB  . PRO B 1 363 ? -14.662 9.454   -30.146  1.00 9.61  ? 352  PRO B CB  1 
ATOM   6303  C  CG  . PRO B 1 363 ? -15.845 8.713   -30.476  1.00 10.49 ? 352  PRO B CG  1 
ATOM   6304  C  CD  . PRO B 1 363 ? -16.009 8.647   -31.978  1.00 11.19 ? 352  PRO B CD  1 
ATOM   6305  N  N   . GLU B 1 364 ? -11.574 10.276  -31.252  1.00 12.86 ? 353  GLU B N   1 
ATOM   6306  C  CA  . GLU B 1 364 ? -10.117 9.970   -31.242  1.00 12.88 ? 353  GLU B CA  1 
ATOM   6307  C  C   . GLU B 1 364 ? -9.591  9.644   -29.859  1.00 14.53 ? 353  GLU B C   1 
ATOM   6308  O  O   . GLU B 1 364 ? -9.642  10.471  -28.939  1.00 17.92 ? 353  GLU B O   1 
ATOM   6309  C  CB  . GLU B 1 364 ? -9.315  11.127  -31.798  1.00 11.45 ? 353  GLU B CB  1 
ATOM   6310  C  CG  . GLU B 1 364 ? -9.445  11.240  -33.296  1.00 12.00 ? 353  GLU B CG  1 
ATOM   6311  C  CD  . GLU B 1 364 ? -9.394  12.662  -33.791  1.00 14.02 ? 353  GLU B CD  1 
ATOM   6312  O  OE1 . GLU B 1 364 ? -10.090 13.535  -33.238  1.00 20.64 ? 353  GLU B OE1 1 
ATOM   6313  O  OE2 . GLU B 1 364 ? -8.674  12.912  -34.776  1.00 23.84 ? 353  GLU B OE2 1 
ATOM   6314  N  N   . GLY B 1 365 ? -9.077  8.432   -29.736  1.00 15.03 ? 354  GLY B N   1 
ATOM   6315  C  CA  . GLY B 1 365 ? -8.350  8.027   -28.540  1.00 14.71 ? 354  GLY B CA  1 
ATOM   6316  C  C   . GLY B 1 365 ? -8.241  6.539   -28.321  1.00 14.39 ? 354  GLY B C   1 
ATOM   6317  O  O   . GLY B 1 365 ? -9.023  5.755   -28.883  1.00 16.94 ? 354  GLY B O   1 
ATOM   6318  N  N   . THR B 1 366 ? -7.287  6.155   -27.465  1.00 11.59 ? 355  THR B N   1 
ATOM   6319  C  CA  . THR B 1 366 ? -6.828  4.779   -27.329  1.00 12.21 ? 355  THR B CA  1 
ATOM   6320  C  C   . THR B 1 366 ? -6.513  4.527   -25.856  1.00 11.50 ? 355  THR B C   1 
ATOM   6321  O  O   . THR B 1 366 ? -6.419  5.477   -25.109  1.00 10.54 ? 355  THR B O   1 
ATOM   6322  C  CB  . THR B 1 366 ? -5.568  4.546   -28.238  1.00 14.75 ? 355  THR B CB  1 
ATOM   6323  O  OG1 . THR B 1 366 ? -5.956  3.882   -29.466  1.00 16.64 ? 355  THR B OG1 1 
ATOM   6324  C  CG2 . THR B 1 366 ? -4.458  3.780   -27.532  1.00 15.35 ? 355  THR B CG2 1 
ATOM   6325  N  N   . ASN B 1 367 ? -6.417  3.270   -25.451  1.00 12.33 ? 356  ASN B N   1 
ATOM   6326  C  CA  . ASN B 1 367 ? -6.030  2.909   -24.056  1.00 10.82 ? 356  ASN B CA  1 
ATOM   6327  C  C   . ASN B 1 367 ? -4.501  3.000   -23.906  1.00 11.53 ? 356  ASN B C   1 
ATOM   6328  O  O   . ASN B 1 367 ? -3.800  3.092   -24.906  1.00 10.28 ? 356  ASN B O   1 
ATOM   6329  C  CB  . ASN B 1 367 ? -6.560  1.504   -23.672  1.00 10.81 ? 356  ASN B CB  1 
ATOM   6330  C  CG  . ASN B 1 367 ? -6.032  0.393   -24.545  1.00 10.15 ? 356  ASN B CG  1 
ATOM   6331  O  OD1 . ASN B 1 367 ? -6.465  0.258   -25.690  1.00 21.13 ? 356  ASN B OD1 1 
ATOM   6332  N  ND2 . ASN B 1 367 ? -5.091  -0.407  -24.035  1.00 9.01  ? 356  ASN B ND2 1 
ATOM   6333  N  N   . GLY B 1 368 ? -3.967  2.973   -22.682  1.00 11.33 ? 357  GLY B N   1 
ATOM   6334  C  CA  . GLY B 1 368 ? -2.509  2.888   -22.530  1.00 13.30 ? 357  GLY B CA  1 
ATOM   6335  C  C   . GLY B 1 368 ? -1.886  3.066   -21.147  1.00 13.26 ? 357  GLY B C   1 
ATOM   6336  O  O   . GLY B 1 368 ? -0.805  2.598   -20.892  1.00 14.99 ? 357  GLY B O   1 
ATOM   6337  N  N   . THR B 1 369 ? -2.541  3.799   -20.290  1.00 14.81 ? 358  THR B N   1 
ATOM   6338  C  CA  . THR B 1 369 ? -1.996  4.132   -18.957  1.00 16.21 ? 358  THR B CA  1 
ATOM   6339  C  C   . THR B 1 369 ? -1.652  2.899   -18.094  1.00 17.41 ? 358  THR B C   1 
ATOM   6340  O  O   . THR B 1 369 ? -0.701  2.893   -17.266  1.00 16.96 ? 358  THR B O   1 
ATOM   6341  C  CB  . THR B 1 369 ? -3.002  5.083   -18.235  1.00 17.41 ? 358  THR B CB  1 
ATOM   6342  O  OG1 . THR B 1 369 ? -2.363  5.802   -17.162  1.00 16.34 ? 358  THR B OG1 1 
ATOM   6343  C  CG2 . THR B 1 369 ? -4.283  4.306   -17.770  1.00 17.59 ? 358  THR B CG2 1 
ATOM   6344  N  N   . GLU B 1 370 ? -2.416  1.839   -18.272  1.00 18.30 ? 359  GLU B N   1 
ATOM   6345  C  CA  . GLU B 1 370 ? -2.187  0.619   -17.481  1.00 18.50 ? 359  GLU B CA  1 
ATOM   6346  C  C   . GLU B 1 370 ? -1.009  -0.214  -17.990  1.00 18.17 ? 359  GLU B C   1 
ATOM   6347  O  O   . GLU B 1 370 ? -0.324  -0.858  -17.209  1.00 18.37 ? 359  GLU B O   1 
ATOM   6348  C  CB  . GLU B 1 370 ? -3.459  -0.233  -17.486  1.00 19.32 ? 359  GLU B CB  1 
ATOM   6349  C  CG  . GLU B 1 370 ? -3.506  -1.286  -16.406  1.00 17.59 ? 359  GLU B CG  1 
ATOM   6350  C  CD  . GLU B 1 370 ? -4.866  -1.960  -16.304  1.00 19.30 ? 359  GLU B CD  1 
ATOM   6351  O  OE1 . GLU B 1 370 ? -5.673  -1.848  -17.255  1.00 12.17 ? 359  GLU B OE1 1 
ATOM   6352  O  OE2 . GLU B 1 370 ? -5.141  -2.593  -15.248  1.00 18.93 ? 359  GLU B OE2 1 
ATOM   6353  N  N   . GLU B 1 371 ? -0.775  -0.201  -19.303  1.00 18.45 ? 360  GLU B N   1 
ATOM   6354  C  CA  . GLU B 1 371 ? 0.250   -1.072  -19.935  1.00 16.91 ? 360  GLU B CA  1 
ATOM   6355  C  C   . GLU B 1 371 ? 1.617   -0.434  -20.212  1.00 15.89 ? 360  GLU B C   1 
ATOM   6356  O  O   . GLU B 1 371 ? 2.480   -1.105  -20.802  1.00 14.98 ? 360  GLU B O   1 
ATOM   6357  C  CB  . GLU B 1 371 ? -0.297  -1.624  -21.253  1.00 16.99 ? 360  GLU B CB  1 
ATOM   6358  C  CG  . GLU B 1 371 ? -1.473  -2.586  -21.043  1.00 16.12 ? 360  GLU B CG  1 
ATOM   6359  C  CD  . GLU B 1 371 ? -2.810  -1.919  -20.863  1.00 13.90 ? 360  GLU B CD  1 
ATOM   6360  O  OE1 . GLU B 1 371 ? -2.883  -0.677  -20.868  1.00 20.19 ? 360  GLU B OE1 1 
ATOM   6361  O  OE2 . GLU B 1 371 ? -3.811  -2.657  -20.749  1.00 18.12 ? 360  GLU B OE2 1 
ATOM   6362  N  N   . ARG B 1 372 ? 1.827   0.815   -19.769  1.00 14.03 ? 361  ARG B N   1 
ATOM   6363  C  CA  . ARG B 1 372 ? 2.980   1.633   -20.185  1.00 13.36 ? 361  ARG B CA  1 
ATOM   6364  C  C   . ARG B 1 372 ? 4.273   1.009   -19.760  1.00 15.88 ? 361  ARG B C   1 
ATOM   6365  O  O   . ARG B 1 372 ? 5.090   0.620   -20.571  1.00 14.41 ? 361  ARG B O   1 
ATOM   6366  C  CB  . ARG B 1 372 ? 2.860   3.073   -19.624  1.00 14.70 ? 361  ARG B CB  1 
ATOM   6367  C  CG  . ARG B 1 372 ? 4.005   4.039   -19.950  1.00 12.59 ? 361  ARG B CG  1 
ATOM   6368  C  CD  . ARG B 1 372 ? 3.711   5.464   -19.539  1.00 8.51  ? 361  ARG B CD  1 
ATOM   6369  N  NE  . ARG B 1 372 ? 3.563   5.596   -18.064  1.00 8.20  ? 361  ARG B NE  1 
ATOM   6370  C  CZ  . ARG B 1 372 ? 4.505   6.001   -17.244  1.00 5.88  ? 361  ARG B CZ  1 
ATOM   6371  N  NH1 . ARG B 1 372 ? 5.717   6.342   -17.675  1.00 6.09  ? 361  ARG B NH1 1 
ATOM   6372  N  NH2 . ARG B 1 372 ? 4.240   6.071   -15.936  1.00 8.39  ? 361  ARG B NH2 1 
ATOM   6373  N  N   . MET B 1 373 ? 4.458   0.885   -18.448  1.00 15.08 ? 362  MET B N   1 
ATOM   6374  C  CA  . MET B 1 373 ? 5.696   0.434   -17.932  1.00 16.74 ? 362  MET B CA  1 
ATOM   6375  C  C   . MET B 1 373 ? 5.938   -1.044  -18.153  1.00 17.33 ? 362  MET B C   1 
ATOM   6376  O  O   . MET B 1 373 ? 7.075   -1.495  -18.025  1.00 20.00 ? 362  MET B O   1 
ATOM   6377  C  CB  . MET B 1 373 ? 5.719   0.779   -16.457  1.00 17.01 ? 362  MET B CB  1 
ATOM   6378  C  CG  . MET B 1 373 ? 5.682   2.288   -16.246  1.00 13.68 ? 362  MET B CG  1 
ATOM   6379  S  SD  . MET B 1 373 ? 5.642   2.557   -14.496  1.00 24.47 ? 362  MET B SD  1 
ATOM   6380  C  CE  . MET B 1 373 ? 7.293   1.992   -14.089  1.00 24.10 ? 362  MET B CE  1 
ATOM   6381  N  N   . SER B 1 374 ? 4.899   -1.820  -18.462  1.00 16.37 ? 363  SER B N   1 
ATOM   6382  C  CA  . SER B 1 374 ? 5.083   -3.242  -18.754  1.00 17.12 ? 363  SER B CA  1 
ATOM   6383  C  C   . SER B 1 374 ? 5.649   -3.386  -20.142  1.00 17.35 ? 363  SER B C   1 
ATOM   6384  O  O   . SER B 1 374 ? 6.661   -4.066  -20.351  1.00 18.98 ? 363  SER B O   1 
ATOM   6385  C  CB  . SER B 1 374 ? 3.752   -4.027  -18.662  1.00 17.29 ? 363  SER B CB  1 
ATOM   6386  O  OG  . SER B 1 374 ? 3.404   -4.253  -17.290  1.00 17.53 ? 363  SER B OG  1 
ATOM   6387  N  N   . VAL B 1 375 ? 4.951   -2.743  -21.073  1.00 16.99 ? 364  VAL B N   1 
ATOM   6388  C  CA  . VAL B 1 375 ? 5.286   -2.715  -22.499  1.00 16.50 ? 364  VAL B CA  1 
ATOM   6389  C  C   . VAL B 1 375 ? 6.735   -2.275  -22.773  1.00 16.91 ? 364  VAL B C   1 
ATOM   6390  O  O   . VAL B 1 375 ? 7.440   -2.876  -23.605  1.00 17.58 ? 364  VAL B O   1 
ATOM   6391  C  CB  . VAL B 1 375 ? 4.302   -1.771  -23.252  1.00 16.85 ? 364  VAL B CB  1 
ATOM   6392  C  CG1 . VAL B 1 375 ? 4.753   -1.536  -24.698  1.00 14.98 ? 364  VAL B CG1 1 
ATOM   6393  C  CG2 . VAL B 1 375 ? 2.894   -2.344  -23.225  1.00 15.56 ? 364  VAL B CG2 1 
ATOM   6394  N  N   . ILE B 1 376 ? 7.154   -1.214  -22.102  1.00 15.04 ? 365  ILE B N   1 
ATOM   6395  C  CA  . ILE B 1 376 ? 8.503   -0.683  -22.245  1.00 15.92 ? 365  ILE B CA  1 
ATOM   6396  C  C   . ILE B 1 376 ? 9.515   -1.696  -21.713  1.00 17.13 ? 365  ILE B C   1 
ATOM   6397  O  O   . ILE B 1 376 ? 10.575  -1.911  -22.314  1.00 18.89 ? 365  ILE B O   1 
ATOM   6398  C  CB  . ILE B 1 376 ? 8.708   0.649   -21.482  1.00 14.02 ? 365  ILE B CB  1 
ATOM   6399  C  CG1 . ILE B 1 376 ? 7.811   1.777   -22.009  1.00 15.57 ? 365  ILE B CG1 1 
ATOM   6400  C  CG2 . ILE B 1 376 ? 10.193  1.063   -21.569  1.00 12.74 ? 365  ILE B CG2 1 
ATOM   6401  C  CD1 . ILE B 1 376 ? 7.497   2.899   -20.966  1.00 14.59 ? 365  ILE B CD1 1 
ATOM   6402  N  N   . TRP B 1 377 ? 9.194   -2.313  -20.568  1.00 18.59 ? 366  TRP B N   1 
ATOM   6403  C  CA  . TRP B 1 377 ? 10.029  -3.376  -20.020  1.00 18.31 ? 366  TRP B CA  1 
ATOM   6404  C  C   . TRP B 1 377 ? 10.187  -4.534  -20.998  1.00 18.30 ? 366  TRP B C   1 
ATOM   6405  O  O   . TRP B 1 377 ? 11.294  -4.992  -21.224  1.00 20.93 ? 366  TRP B O   1 
ATOM   6406  C  CB  . TRP B 1 377 ? 9.487   -3.916  -18.690  1.00 18.18 ? 366  TRP B CB  1 
ATOM   6407  C  CG  . TRP B 1 377 ? 10.502  -4.783  -17.991  1.00 18.87 ? 366  TRP B CG  1 
ATOM   6408  C  CD1 . TRP B 1 377 ? 10.619  -6.150  -18.080  1.00 18.65 ? 366  TRP B CD1 1 
ATOM   6409  C  CD2 . TRP B 1 377 ? 11.577  -4.351  -17.135  1.00 17.68 ? 366  TRP B CD2 1 
ATOM   6410  N  NE1 . TRP B 1 377 ? 11.676  -6.575  -17.337  1.00 17.62 ? 366  TRP B NE1 1 
ATOM   6411  C  CE2 . TRP B 1 377 ? 12.284  -5.497  -16.753  1.00 17.16 ? 366  TRP B CE2 1 
ATOM   6412  C  CE3 . TRP B 1 377 ? 12.002  -3.108  -16.657  1.00 16.36 ? 366  TRP B CE3 1 
ATOM   6413  C  CZ2 . TRP B 1 377 ? 13.392  -5.441  -15.920  1.00 17.68 ? 366  TRP B CZ2 1 
ATOM   6414  C  CZ3 . TRP B 1 377 ? 13.107  -3.052  -15.847  1.00 16.94 ? 366  TRP B CZ3 1 
ATOM   6415  C  CH2 . TRP B 1 377 ? 13.784  -4.216  -15.478  1.00 18.69 ? 366  TRP B CH2 1 
ATOM   6416  N  N   . ASP B 1 378 ? 9.084   -5.020  -21.548  1.00 18.03 ? 367  ASP B N   1 
ATOM   6417  C  CA  . ASP B 1 378 ? 9.144   -6.141  -22.470  1.00 17.13 ? 367  ASP B CA  1 
ATOM   6418  C  C   . ASP B 1 378 ? 9.926   -5.745  -23.702  1.00 16.59 ? 367  ASP B C   1 
ATOM   6419  O  O   . ASP B 1 378 ? 10.751  -6.489  -24.188  1.00 16.84 ? 367  ASP B O   1 
ATOM   6420  C  CB  . ASP B 1 378 ? 7.743   -6.573  -22.890  1.00 17.77 ? 367  ASP B CB  1 
ATOM   6421  C  CG  . ASP B 1 378 ? 7.751   -7.774  -23.845  1.00 19.12 ? 367  ASP B CG  1 
ATOM   6422  O  OD1 . ASP B 1 378 ? 7.700   -7.571  -25.100  1.00 20.55 ? 367  ASP B OD1 1 
ATOM   6423  O  OD2 . ASP B 1 378 ? 7.836   -8.915  -23.338  1.00 15.52 ? 367  ASP B OD2 1 
ATOM   6424  N  N   . LYS B 1 379 ? 9.678   -4.532  -24.167  1.00 16.70 ? 368  LYS B N   1 
ATOM   6425  C  CA  . LYS B 1 379 ? 10.150  -4.052  -25.480  1.00 13.97 ? 368  LYS B CA  1 
ATOM   6426  C  C   . LYS B 1 379 ? 11.541  -3.440  -25.508  1.00 12.30 ? 368  LYS B C   1 
ATOM   6427  O  O   . LYS B 1 379 ? 12.153  -3.386  -26.545  1.00 9.14  ? 368  LYS B O   1 
ATOM   6428  C  CB  . LYS B 1 379 ? 9.188   -2.989  -25.994  1.00 15.23 ? 368  LYS B CB  1 
ATOM   6429  C  CG  . LYS B 1 379 ? 7.816   -3.492  -26.288  1.00 14.35 ? 368  LYS B CG  1 
ATOM   6430  C  CD  . LYS B 1 379 ? 7.775   -4.197  -27.644  1.00 16.39 ? 368  LYS B CD  1 
ATOM   6431  C  CE  . LYS B 1 379 ? 8.009   -3.250  -28.794  1.00 19.15 ? 368  LYS B CE  1 
ATOM   6432  N  NZ  . LYS B 1 379 ? 7.261   -3.616  -30.057  1.00 19.68 ? 368  LYS B NZ  1 
ATOM   6433  N  N   . ALA B 1 380 ? 12.048  -2.947  -24.387  1.00 12.37 ? 369  ALA B N   1 
ATOM   6434  C  CA  . ALA B 1 380 ? 13.334  -2.236  -24.401  1.00 12.68 ? 369  ALA B CA  1 
ATOM   6435  C  C   . ALA B 1 380 ? 14.381  -2.811  -23.440  1.00 11.68 ? 369  ALA B C   1 
ATOM   6436  O  O   . ALA B 1 380 ? 15.579  -2.709  -23.681  1.00 10.07 ? 369  ALA B O   1 
ATOM   6437  C  CB  . ALA B 1 380 ? 13.110  -0.716  -24.151  1.00 12.18 ? 369  ALA B CB  1 
ATOM   6438  N  N   . VAL B 1 381 ? 13.936  -3.387  -22.330  1.00 11.98 ? 370  VAL B N   1 
ATOM   6439  C  CA  . VAL B 1 381 ? 14.860  -3.996  -21.373  1.00 13.22 ? 370  VAL B CA  1 
ATOM   6440  C  C   . VAL B 1 381 ? 15.100  -5.497  -21.641  1.00 13.23 ? 370  VAL B C   1 
ATOM   6441  O  O   . VAL B 1 381 ? 16.241  -5.967  -21.796  1.00 14.39 ? 370  VAL B O   1 
ATOM   6442  C  CB  . VAL B 1 381 ? 14.349  -3.765  -19.923  1.00 11.53 ? 370  VAL B CB  1 
ATOM   6443  C  CG1 . VAL B 1 381 ? 15.168  -4.557  -18.940  1.00 14.78 ? 370  VAL B CG1 1 
ATOM   6444  C  CG2 . VAL B 1 381 ? 14.399  -2.285  -19.611  1.00 14.81 ? 370  VAL B CG2 1 
ATOM   6445  N  N   . VAL B 1 382 ? 14.017  -6.237  -21.735  1.00 12.91 ? 371  VAL B N   1 
ATOM   6446  C  CA  . VAL B 1 382 ? 14.102  -7.658  -21.951  1.00 13.78 ? 371  VAL B CA  1 
ATOM   6447  C  C   . VAL B 1 382 ? 14.797  -7.903  -23.298  1.00 15.44 ? 371  VAL B C   1 
ATOM   6448  O  O   . VAL B 1 382 ? 15.448  -8.930  -23.514  1.00 16.57 ? 371  VAL B O   1 
ATOM   6449  C  CB  . VAL B 1 382 ? 12.684  -8.283  -21.871  1.00 11.29 ? 371  VAL B CB  1 
ATOM   6450  C  CG1 . VAL B 1 382 ? 12.702  -9.677  -22.235  1.00 9.78  ? 371  VAL B CG1 1 
ATOM   6451  C  CG2 . VAL B 1 382 ? 12.162  -8.164  -20.433  1.00 11.24 ? 371  VAL B CG2 1 
ATOM   6452  N  N   . THR B 1 383 ? 14.655  -6.949  -24.203  1.00 15.90 ? 372  THR B N   1 
ATOM   6453  C  CA  . THR B 1 383 ? 15.296  -7.061  -25.528  1.00 14.72 ? 372  THR B CA  1 
ATOM   6454  C  C   . THR B 1 383 ? 16.735  -6.556  -25.540  1.00 14.83 ? 372  THR B C   1 
ATOM   6455  O  O   . THR B 1 383 ? 17.381  -6.530  -26.589  1.00 15.17 ? 372  THR B O   1 
ATOM   6456  C  CB  . THR B 1 383 ? 14.551  -6.232  -26.487  1.00 15.30 ? 372  THR B CB  1 
ATOM   6457  O  OG1 . THR B 1 383 ? 14.547  -4.883  -25.993  1.00 16.59 ? 372  THR B OG1 1 
ATOM   6458  C  CG2 . THR B 1 383 ? 13.141  -6.753  -26.600  1.00 15.37 ? 372  THR B CG2 1 
ATOM   6459  N  N   . GLY B 1 384 ? 17.219  -6.106  -24.386  1.00 12.98 ? 373  GLY B N   1 
ATOM   6460  C  CA  . GLY B 1 384 ? 18.584  -5.680  -24.219  1.00 13.78 ? 373  GLY B CA  1 
ATOM   6461  C  C   . GLY B 1 384 ? 18.899  -4.320  -24.782  1.00 14.59 ? 373  GLY B C   1 
ATOM   6462  O  O   . GLY B 1 384 ? 20.026  -4.075  -25.146  1.00 16.38 ? 373  GLY B O   1 
ATOM   6463  N  N   . LYS B 1 385 ? 17.915  -3.441  -24.873  1.00 15.59 ? 374  LYS B N   1 
ATOM   6464  C  CA  . LYS B 1 385 ? 18.139  -2.100  -25.419  1.00 14.38 ? 374  LYS B CA  1 
ATOM   6465  C  C   . LYS B 1 385 ? 18.534  -1.154  -24.317  1.00 14.16 ? 374  LYS B C   1 
ATOM   6466  O  O   . LYS B 1 385 ? 19.415  -0.347  -24.495  1.00 12.49 ? 374  LYS B O   1 
ATOM   6467  C  CB  . LYS B 1 385 ? 16.902  -1.576  -26.148  1.00 15.47 ? 374  LYS B CB  1 
ATOM   6468  C  CG  . LYS B 1 385 ? 16.737  -2.109  -27.608  1.00 12.01 ? 374  LYS B CG  1 
ATOM   6469  C  CD  . LYS B 1 385 ? 15.283  -2.053  -28.028  1.00 15.16 ? 374  LYS B CD  1 
ATOM   6470  C  CE  . LYS B 1 385 ? 15.008  -2.736  -29.379  1.00 18.11 ? 374  LYS B CE  1 
ATOM   6471  N  NZ  . LYS B 1 385 ? 15.122  -1.825  -30.531  1.00 22.04 ? 374  LYS B NZ  1 
ATOM   6472  N  N   . MET B 1 386 ? 17.881  -1.253  -23.163  1.00 15.55 ? 375  MET B N   1 
ATOM   6473  C  CA  . MET B 1 386 ? 18.278  -0.448  -22.006  1.00 14.48 ? 375  MET B CA  1 
ATOM   6474  C  C   . MET B 1 386 ? 18.307  -1.338  -20.782  1.00 15.04 ? 375  MET B C   1 
ATOM   6475  O  O   . MET B 1 386 ? 17.780  -2.453  -20.786  1.00 15.20 ? 375  MET B O   1 
ATOM   6476  C  CB  . MET B 1 386 ? 17.339  0.757   -21.794  1.00 14.69 ? 375  MET B CB  1 
ATOM   6477  C  CG  . MET B 1 386 ? 15.930  0.415   -21.334  1.00 16.78 ? 375  MET B CG  1 
ATOM   6478  S  SD  . MET B 1 386 ? 14.782  1.782   -20.974  1.00 17.51 ? 375  MET B SD  1 
ATOM   6479  C  CE  . MET B 1 386 ? 14.503  2.422   -22.642  1.00 16.51 ? 375  MET B CE  1 
ATOM   6480  N  N   . ASP B 1 387 ? 19.000  -0.863  -19.762  1.00 14.62 ? 376  ASP B N   1 
ATOM   6481  C  CA  . ASP B 1 387 ? 18.909  -1.461  -18.445  1.00 15.65 ? 376  ASP B CA  1 
ATOM   6482  C  C   . ASP B 1 387 ? 17.755  -0.893  -17.620  1.00 16.21 ? 376  ASP B C   1 
ATOM   6483  O  O   . ASP B 1 387 ? 17.053  0.041   -18.013  1.00 15.14 ? 376  ASP B O   1 
ATOM   6484  C  CB  . ASP B 1 387 ? 20.253  -1.364  -17.706  1.00 15.53 ? 376  ASP B CB  1 
ATOM   6485  C  CG  . ASP B 1 387 ? 20.836  0.012   -17.688  1.00 14.04 ? 376  ASP B CG  1 
ATOM   6486  O  OD1 . ASP B 1 387 ? 20.139  0.958   -17.326  1.00 22.30 ? 376  ASP B OD1 1 
ATOM   6487  O  OD2 . ASP B 1 387 ? 22.039  0.162   -17.959  1.00 14.32 ? 376  ASP B OD2 1 
ATOM   6488  N  N   . GLU B 1 388 ? 17.591  -1.464  -16.435  1.00 15.97 ? 377  GLU B N   1 
ATOM   6489  C  CA  . GLU B 1 388 ? 16.561  -1.031  -15.508  1.00 16.48 ? 377  GLU B CA  1 
ATOM   6490  C  C   . GLU B 1 388 ? 16.693  0.413   -15.002  1.00 16.82 ? 377  GLU B C   1 
ATOM   6491  O  O   . GLU B 1 388 ? 15.708  0.988   -14.552  1.00 16.66 ? 377  GLU B O   1 
ATOM   6492  C  CB  . GLU B 1 388 ? 16.557  -1.993  -14.312  1.00 15.44 ? 377  GLU B CB  1 
ATOM   6493  C  CG  . GLU B 1 388 ? 17.891  -2.105  -13.670  1.00 15.26 ? 377  GLU B CG  1 
ATOM   6494  C  CD  . GLU B 1 388 ? 17.847  -2.888  -12.393  1.00 17.65 ? 377  GLU B CD  1 
ATOM   6495  O  OE1 . GLU B 1 388 ? 16.831  -3.546  -12.154  1.00 21.26 ? 377  GLU B OE1 1 
ATOM   6496  O  OE2 . GLU B 1 388 ? 18.856  -2.894  -11.673  1.00 21.37 ? 377  GLU B OE2 1 
ATOM   6497  N  N   . ASN B 1 389 ? 17.906  0.975   -15.024  1.00 17.82 ? 378  ASN B N   1 
ATOM   6498  C  CA  . ASN B 1 389 ? 18.148  2.341   -14.541  1.00 17.09 ? 378  ASN B CA  1 
ATOM   6499  C  C   . ASN B 1 389 ? 17.695  3.335   -15.591  1.00 16.78 ? 378  ASN B C   1 
ATOM   6500  O  O   . ASN B 1 389 ? 17.097  4.348   -15.267  1.00 16.04 ? 378  ASN B O   1 
ATOM   6501  C  CB  . ASN B 1 389 ? 19.626  2.569   -14.140  1.00 16.37 ? 378  ASN B CB  1 
ATOM   6502  C  CG  . ASN B 1 389 ? 20.131  1.531   -13.155  1.00 18.59 ? 378  ASN B CG  1 
ATOM   6503  O  OD1 . ASN B 1 389 ? 20.883  0.635   -13.515  1.00 14.40 ? 378  ASN B OD1 1 
ATOM   6504  N  ND2 . ASN B 1 389 ? 19.708  1.645   -11.890  1.00 18.44 ? 378  ASN B ND2 1 
ATOM   6505  N  N   . GLN B 1 390 ? 17.970  3.044   -16.871  1.00 18.99 ? 379  GLN B N   1 
ATOM   6506  C  CA  . GLN B 1 390 ? 17.413  3.835   -17.930  1.00 18.12 ? 379  GLN B CA  1 
ATOM   6507  C  C   . GLN B 1 390 ? 15.909  3.678   -17.932  1.00 19.38 ? 379  GLN B C   1 
ATOM   6508  O  O   . GLN B 1 390 ? 15.209  4.650   -18.209  1.00 21.53 ? 379  GLN B O   1 
ATOM   6509  C  CB  . GLN B 1 390 ? 17.996  3.460   -19.292  1.00 19.14 ? 379  GLN B CB  1 
ATOM   6510  C  CG  . GLN B 1 390 ? 17.318  4.168   -20.499  1.00 21.62 ? 379  GLN B CG  1 
ATOM   6511  C  CD  . GLN B 1 390 ? 17.843  5.579   -20.812  1.00 27.19 ? 379  GLN B CD  1 
ATOM   6512  O  OE1 . GLN B 1 390 ? 18.029  5.945   -21.991  1.00 25.57 ? 379  GLN B OE1 1 
ATOM   6513  N  NE2 . GLN B 1 390 ? 18.083  6.370   -19.773  1.00 27.83 ? 379  GLN B NE2 1 
ATOM   6514  N  N   . PHE B 1 391 ? 15.405  2.479   -17.607  1.00 19.18 ? 380  PHE B N   1 
ATOM   6515  C  CA  . PHE B 1 391 ? 13.958  2.226   -17.496  1.00 18.00 ? 380  PHE B CA  1 
ATOM   6516  C  C   . PHE B 1 391 ? 13.278  3.189   -16.523  1.00 17.53 ? 380  PHE B C   1 
ATOM   6517  O  O   . PHE B 1 391 ? 12.286  3.816   -16.855  1.00 17.13 ? 380  PHE B O   1 
ATOM   6518  C  CB  . PHE B 1 391 ? 13.711  0.748   -17.102  1.00 18.67 ? 380  PHE B CB  1 
ATOM   6519  C  CG  . PHE B 1 391 ? 12.263  0.397   -16.752  1.00 19.30 ? 380  PHE B CG  1 
ATOM   6520  C  CD1 . PHE B 1 391 ? 11.284  0.290   -17.741  1.00 19.65 ? 380  PHE B CD1 1 
ATOM   6521  C  CD2 . PHE B 1 391 ? 11.898  0.124   -15.418  1.00 20.93 ? 380  PHE B CD2 1 
ATOM   6522  C  CE1 . PHE B 1 391 ? 9.950   -0.068  -17.411  1.00 19.01 ? 380  PHE B CE1 1 
ATOM   6523  C  CE2 . PHE B 1 391 ? 10.583  -0.233  -15.077  1.00 19.11 ? 380  PHE B CE2 1 
ATOM   6524  C  CZ  . PHE B 1 391 ? 9.613   -0.335  -16.070  1.00 17.28 ? 380  PHE B CZ  1 
ATOM   6525  N  N   . VAL B 1 392 ? 13.805  3.309   -15.308  1.00 16.50 ? 381  VAL B N   1 
ATOM   6526  C  CA  . VAL B 1 392 ? 13.279  4.312   -14.380  1.00 15.53 ? 381  VAL B CA  1 
ATOM   6527  C  C   . VAL B 1 392 ? 13.348  5.701   -14.972  1.00 15.11 ? 381  VAL B C   1 
ATOM   6528  O  O   . VAL B 1 392 ? 12.415  6.495   -14.845  1.00 16.30 ? 381  VAL B O   1 
ATOM   6529  C  CB  . VAL B 1 392 ? 14.036  4.306   -13.050  1.00 15.35 ? 381  VAL B CB  1 
ATOM   6530  C  CG1 . VAL B 1 392 ? 13.631  5.512   -12.226  1.00 14.01 ? 381  VAL B CG1 1 
ATOM   6531  C  CG2 . VAL B 1 392 ? 13.738  3.020   -12.325  1.00 12.46 ? 381  VAL B CG2 1 
ATOM   6532  N  N   . ALA B 1 393 ? 14.457  5.981   -15.648  1.00 13.91 ? 382  ALA B N   1 
ATOM   6533  C  CA  . ALA B 1 393 ? 14.671  7.266   -16.246  1.00 12.42 ? 382  ALA B CA  1 
ATOM   6534  C  C   . ALA B 1 393 ? 13.486  7.643   -17.115  1.00 12.45 ? 382  ALA B C   1 
ATOM   6535  O  O   . ALA B 1 393 ? 12.920  8.706   -16.937  1.00 9.76  ? 382  ALA B O   1 
ATOM   6536  C  CB  . ALA B 1 393 ? 15.945  7.274   -17.051  1.00 13.82 ? 382  ALA B CB  1 
ATOM   6537  N  N   . VAL B 1 394 ? 13.113  6.750   -18.035  1.00 12.20 ? 383  VAL B N   1 
ATOM   6538  C  CA  . VAL B 1 394 ? 12.154  7.071   -19.110  1.00 10.90 ? 383  VAL B CA  1 
ATOM   6539  C  C   . VAL B 1 394 ? 10.691  6.866   -18.711  1.00 11.45 ? 383  VAL B C   1 
ATOM   6540  O  O   . VAL B 1 394 ? 9.780   7.244   -19.439  1.00 8.50  ? 383  VAL B O   1 
ATOM   6541  C  CB  . VAL B 1 394 ? 12.452  6.218   -20.326  1.00 9.93  ? 383  VAL B CB  1 
ATOM   6542  C  CG1 . VAL B 1 394 ? 13.829  6.579   -20.885  1.00 8.18  ? 383  VAL B CG1 1 
ATOM   6543  C  CG2 . VAL B 1 394 ? 12.332  4.725   -19.962  1.00 8.52  ? 383  VAL B CG2 1 
ATOM   6544  N  N   . THR B 1 395 ? 10.486  6.260   -17.530  1.00 14.22 ? 384  THR B N   1 
ATOM   6545  C  CA  . THR B 1 395 ? 9.157   6.008   -16.973  1.00 13.10 ? 384  THR B CA  1 
ATOM   6546  C  C   . THR B 1 395 ? 8.799   7.020   -15.844  1.00 14.44 ? 384  THR B C   1 
ATOM   6547  O  O   . THR B 1 395 ? 7.616   7.317   -15.646  1.00 13.53 ? 384  THR B O   1 
ATOM   6548  C  CB  . THR B 1 395 ? 8.968   4.537   -16.449  1.00 11.65 ? 384  THR B CB  1 
ATOM   6549  O  OG1 . THR B 1 395 ? 9.854   4.277   -15.346  1.00 16.39 ? 384  THR B OG1 1 
ATOM   6550  C  CG2 . THR B 1 395 ? 9.180   3.475   -17.544  1.00 13.45 ? 384  THR B CG2 1 
ATOM   6551  N  N   . SER B 1 396 ? 9.787   7.553   -15.129  1.00 12.34 ? 385  SER B N   1 
ATOM   6552  C  CA  . SER B 1 396 ? 9.480   8.565   -14.104  1.00 14.00 ? 385  SER B CA  1 
ATOM   6553  C  C   . SER B 1 396 ? 10.475  9.712   -14.007  1.00 14.01 ? 385  SER B C   1 
ATOM   6554  O  O   . SER B 1 396 ? 10.053  10.851  -13.961  1.00 16.61 ? 385  SER B O   1 
ATOM   6555  C  CB  . SER B 1 396 ? 9.320   7.927   -12.718  1.00 14.02 ? 385  SER B CB  1 
ATOM   6556  O  OG  . SER B 1 396 ? 10.489  7.248   -12.374  1.00 14.23 ? 385  SER B OG  1 
ATOM   6557  N  N   . THR B 1 397 ? 11.781  9.440   -13.964  1.00 14.75 ? 386  THR B N   1 
ATOM   6558  C  CA  . THR B 1 397 ? 12.758  10.488  -13.598  1.00 12.90 ? 386  THR B CA  1 
ATOM   6559  C  C   . THR B 1 397 ? 12.961  11.573  -14.623  1.00 12.82 ? 386  THR B C   1 
ATOM   6560  O  O   . THR B 1 397 ? 13.126  12.729  -14.288  1.00 12.09 ? 386  THR B O   1 
ATOM   6561  C  CB  . THR B 1 397 ? 14.089  9.875   -13.264  1.00 12.93 ? 386  THR B CB  1 
ATOM   6562  O  OG1 . THR B 1 397 ? 13.863  8.820   -12.329  1.00 7.77  ? 386  THR B OG1 1 
ATOM   6563  C  CG2 . THR B 1 397 ? 15.037  10.939  -12.655  1.00 14.70 ? 386  THR B CG2 1 
ATOM   6564  N  N   . ASN B 1 398 ? 12.935  11.222  -15.899  1.00 13.57 ? 387  ASN B N   1 
ATOM   6565  C  CA  . ASN B 1 398 ? 13.115  12.233  -16.934  1.00 13.95 ? 387  ASN B CA  1 
ATOM   6566  C  C   . ASN B 1 398 ? 11.996  13.276  -16.901  1.00 15.80 ? 387  ASN B C   1 
ATOM   6567  O  O   . ASN B 1 398 ? 12.266  14.503  -16.965  1.00 15.76 ? 387  ASN B O   1 
ATOM   6568  C  CB  . ASN B 1 398 ? 13.253  11.536  -18.313  1.00 13.69 ? 387  ASN B CB  1 
ATOM   6569  C  CG  . ASN B 1 398 ? 14.645  10.960  -18.518  1.00 13.58 ? 387  ASN B CG  1 
ATOM   6570  O  OD1 . ASN B 1 398 ? 15.546  11.193  -17.697  1.00 17.96 ? 387  ASN B OD1 1 
ATOM   6571  N  ND2 . ASN B 1 398 ? 14.839  10.202  -19.590  1.00 14.54 ? 387  ASN B ND2 1 
ATOM   6572  N  N   . ALA B 1 399 ? 10.749  12.778  -16.793  1.00 16.40 ? 388  ALA B N   1 
ATOM   6573  C  CA  . ALA B 1 399 ? 9.524   13.600  -16.725  1.00 14.99 ? 388  ALA B CA  1 
ATOM   6574  C  C   . ALA B 1 399 ? 9.543   14.464  -15.472  1.00 15.67 ? 388  ALA B C   1 
ATOM   6575  O  O   . ALA B 1 399 ? 9.226   15.656  -15.506  1.00 14.43 ? 388  ALA B O   1 
ATOM   6576  C  CB  . ALA B 1 399 ? 8.291   12.708  -16.741  1.00 14.53 ? 388  ALA B CB  1 
ATOM   6577  N  N   . ALA B 1 400 ? 9.942   13.850  -14.367  1.00 16.27 ? 389  ALA B N   1 
ATOM   6578  C  CA  . ALA B 1 400 ? 10.105  14.569  -13.108  1.00 16.14 ? 389  ALA B CA  1 
ATOM   6579  C  C   . ALA B 1 400 ? 11.027  15.769  -13.296  1.00 17.86 ? 389  ALA B C   1 
ATOM   6580  O  O   . ALA B 1 400 ? 10.733  16.863  -12.792  1.00 19.15 ? 389  ALA B O   1 
ATOM   6581  C  CB  . ALA B 1 400 ? 10.623  13.625  -12.026  1.00 16.72 ? 389  ALA B CB  1 
ATOM   6582  N  N   . LYS B 1 401 ? 12.102  15.592  -14.076  1.00 18.06 ? 390  LYS B N   1 
ATOM   6583  C  CA  . LYS B 1 401 ? 13.078  16.647  -14.309  1.00 17.45 ? 390  LYS B CA  1 
ATOM   6584  C  C   . LYS B 1 401 ? 12.569  17.741  -15.245  1.00 17.29 ? 390  LYS B C   1 
ATOM   6585  O  O   . LYS B 1 401 ? 12.767  18.936  -14.961  1.00 14.37 ? 390  LYS B O   1 
ATOM   6586  C  CB  . LYS B 1 401 ? 14.405  16.073  -14.851  1.00 18.12 ? 390  LYS B CB  1 
ATOM   6587  C  CG  . LYS B 1 401 ? 15.337  15.557  -13.768  1.00 17.67 ? 390  LYS B CG  1 
ATOM   6588  C  CD  . LYS B 1 401 ? 16.472  14.725  -14.320  1.00 18.50 ? 390  LYS B CD  1 
ATOM   6589  C  CE  . LYS B 1 401 ? 17.387  14.329  -13.198  1.00 18.84 ? 390  LYS B CE  1 
ATOM   6590  N  NZ  . LYS B 1 401 ? 18.213  13.111  -13.418  1.00 18.10 ? 390  LYS B NZ  1 
ATOM   6591  N  N   . VAL B 1 402 ? 11.939  17.364  -16.367  1.00 17.26 ? 391  VAL B N   1 
ATOM   6592  C  CA  . VAL B 1 402 ? 11.410  18.414  -17.274  1.00 17.81 ? 391  VAL B CA  1 
ATOM   6593  C  C   . VAL B 1 402 ? 10.215  19.238  -16.719  1.00 17.89 ? 391  VAL B C   1 
ATOM   6594  O  O   . VAL B 1 402 ? 10.167  20.444  -16.961  1.00 18.20 ? 391  VAL B O   1 
ATOM   6595  C  CB  . VAL B 1 402 ? 11.186  17.964  -18.803  1.00 18.17 ? 391  VAL B CB  1 
ATOM   6596  C  CG1 . VAL B 1 402 ? 11.863  16.698  -19.097  1.00 14.83 ? 391  VAL B CG1 1 
ATOM   6597  C  CG2 . VAL B 1 402 ? 9.743   17.921  -19.183  1.00 17.79 ? 391  VAL B CG2 1 
ATOM   6598  N  N   . PHE B 1 403 ? 9.304   18.618  -15.958  1.00 17.97 ? 392  PHE B N   1 
ATOM   6599  C  CA  . PHE B 1 403 ? 8.150   19.340  -15.376  1.00 17.94 ? 392  PHE B CA  1 
ATOM   6600  C  C   . PHE B 1 403 ? 8.372   19.848  -13.941  1.00 18.49 ? 392  PHE B C   1 
ATOM   6601  O  O   . PHE B 1 403 ? 7.425   20.290  -13.293  1.00 18.46 ? 392  PHE B O   1 
ATOM   6602  C  CB  . PHE B 1 403 ? 6.866   18.506  -15.480  1.00 17.13 ? 392  PHE B CB  1 
ATOM   6603  C  CG  . PHE B 1 403 ? 6.504   18.169  -16.914  1.00 16.97 ? 392  PHE B CG  1 
ATOM   6604  C  CD1 . PHE B 1 403 ? 6.119   19.171  -17.781  1.00 17.53 ? 392  PHE B CD1 1 
ATOM   6605  C  CD2 . PHE B 1 403 ? 6.601   16.878  -17.392  1.00 17.03 ? 392  PHE B CD2 1 
ATOM   6606  C  CE1 . PHE B 1 403 ? 5.839   18.887  -19.097  1.00 17.99 ? 392  PHE B CE1 1 
ATOM   6607  C  CE2 . PHE B 1 403 ? 6.312   16.596  -18.715  1.00 16.92 ? 392  PHE B CE2 1 
ATOM   6608  C  CZ  . PHE B 1 403 ? 5.935   17.596  -19.548  1.00 16.77 ? 392  PHE B CZ  1 
ATOM   6609  N  N   . ASN B 1 404 ? 9.623   19.843  -13.491  1.00 19.37 ? 393  ASN B N   1 
ATOM   6610  C  CA  . ASN B 1 404 ? 10.021  20.426  -12.208  1.00 18.72 ? 393  ASN B CA  1 
ATOM   6611  C  C   . ASN B 1 404 ? 9.490   19.686  -10.989  1.00 20.29 ? 393  ASN B C   1 
ATOM   6612  O  O   . ASN B 1 404 ? 9.250   20.307  -9.959   1.00 22.23 ? 393  ASN B O   1 
ATOM   6613  C  CB  . ASN B 1 404 ? 9.636   21.922  -12.132  1.00 18.88 ? 393  ASN B CB  1 
ATOM   6614  C  CG  . ASN B 1 404 ? 10.717  22.796  -11.451  1.00 18.12 ? 393  ASN B CG  1 
ATOM   6615  O  OD1 . ASN B 1 404 ? 11.785  22.314  -11.105  1.00 20.29 ? 393  ASN B OD1 1 
ATOM   6616  N  ND2 . ASN B 1 404 ? 10.440  24.082  -11.292  1.00 15.72 ? 393  ASN B ND2 1 
ATOM   6617  N  N   . LEU B 1 405 ? 9.334   18.371  -11.096  1.00 20.83 ? 394  LEU B N   1 
ATOM   6618  C  CA  . LEU B 1 405 ? 8.909   17.511  -9.987   1.00 20.99 ? 394  LEU B CA  1 
ATOM   6619  C  C   . LEU B 1 405 ? 10.034  16.673  -9.341   1.00 21.20 ? 394  LEU B C   1 
ATOM   6620  O  O   . LEU B 1 405 ? 9.761   15.852  -8.463   1.00 20.23 ? 394  LEU B O   1 
ATOM   6621  C  CB  . LEU B 1 405 ? 7.831   16.542  -10.492  1.00 22.29 ? 394  LEU B CB  1 
ATOM   6622  C  CG  . LEU B 1 405 ? 6.594   17.093  -11.220  1.00 21.02 ? 394  LEU B CG  1 
ATOM   6623  C  CD1 . LEU B 1 405 ? 5.811   15.943  -11.701  1.00 23.01 ? 394  LEU B CD1 1 
ATOM   6624  C  CD2 . LEU B 1 405 ? 5.707   17.981  -10.343  1.00 23.36 ? 394  LEU B CD2 1 
ATOM   6625  N  N   . TYR B 1 406 ? 11.281  16.863  -9.785   1.00 20.99 ? 395  TYR B N   1 
ATOM   6626  C  CA  . TYR B 1 406 ? 12.435  16.087  -9.292   1.00 21.67 ? 395  TYR B CA  1 
ATOM   6627  C  C   . TYR B 1 406 ? 13.141  16.854  -8.178   1.00 22.37 ? 395  TYR B C   1 
ATOM   6628  O  O   . TYR B 1 406 ? 13.340  18.072  -8.336   1.00 23.52 ? 395  TYR B O   1 
ATOM   6629  C  CB  . TYR B 1 406 ? 13.446  15.875  -10.427  1.00 20.03 ? 395  TYR B CB  1 
ATOM   6630  C  CG  . TYR B 1 406 ? 14.638  15.035  -10.055  1.00 19.49 ? 395  TYR B CG  1 
ATOM   6631  C  CD1 . TYR B 1 406 ? 14.560  13.651  -10.056  1.00 19.18 ? 395  TYR B CD1 1 
ATOM   6632  C  CD2 . TYR B 1 406 ? 15.847  15.619  -9.716   1.00 18.85 ? 395  TYR B CD2 1 
ATOM   6633  C  CE1 . TYR B 1 406 ? 15.638  12.878  -9.728   1.00 18.02 ? 395  TYR B CE1 1 
ATOM   6634  C  CE2 . TYR B 1 406 ? 16.924  14.856  -9.382   1.00 18.17 ? 395  TYR B CE2 1 
ATOM   6635  C  CZ  . TYR B 1 406 ? 16.808  13.482  -9.384   1.00 18.82 ? 395  TYR B CZ  1 
ATOM   6636  O  OH  . TYR B 1 406 ? 17.876  12.702  -9.056   1.00 20.01 ? 395  TYR B OH  1 
ATOM   6637  N  N   . PRO B 1 407 ? 13.564  16.162  -7.088   1.00 21.74 ? 396  PRO B N   1 
ATOM   6638  C  CA  . PRO B 1 407 ? 13.514  14.710  -6.699   1.00 22.39 ? 396  PRO B CA  1 
ATOM   6639  C  C   . PRO B 1 407 ? 12.327  14.200  -5.844   1.00 22.44 ? 396  PRO B C   1 
ATOM   6640  O  O   . PRO B 1 407 ? 12.349  13.059  -5.344   1.00 22.59 ? 396  PRO B O   1 
ATOM   6641  C  CB  . PRO B 1 407 ? 14.813  14.532  -5.921   1.00 20.86 ? 396  PRO B CB  1 
ATOM   6642  C  CG  . PRO B 1 407 ? 15.063  15.858  -5.327   1.00 21.11 ? 396  PRO B CG  1 
ATOM   6643  C  CD  . PRO B 1 407 ? 14.300  16.929  -6.077   1.00 21.17 ? 396  PRO B CD  1 
ATOM   6644  N  N   . ARG B 1 408 ? 11.320  15.045  -5.669   1.00 23.01 ? 397  ARG B N   1 
ATOM   6645  C  CA  . ARG B 1 408 ? 10.068  14.665  -5.009   1.00 22.81 ? 397  ARG B CA  1 
ATOM   6646  C  C   . ARG B 1 408 ? 9.510   13.362  -5.595   1.00 21.75 ? 397  ARG B C   1 
ATOM   6647  O  O   . ARG B 1 408 ? 9.143   12.429  -4.881   1.00 19.29 ? 397  ARG B O   1 
ATOM   6648  C  CB  . ARG B 1 408 ? 9.048   15.814  -5.183   1.00 23.25 ? 397  ARG B CB  1 
ATOM   6649  C  CG  . ARG B 1 408 ? 7.774   15.649  -4.360   1.00 22.99 ? 397  ARG B CG  1 
ATOM   6650  C  CD  . ARG B 1 408 ? 6.775   16.776  -4.592   1.00 24.56 ? 397  ARG B CD  1 
ATOM   6651  N  NE  . ARG B 1 408 ? 5.585   16.578  -3.764   1.00 25.39 ? 397  ARG B NE  1 
ATOM   6652  C  CZ  . ARG B 1 408 ? 4.711   17.524  -3.427   1.00 26.02 ? 397  ARG B CZ  1 
ATOM   6653  N  NH1 . ARG B 1 408 ? 4.860   18.777  -3.843   1.00 26.51 ? 397  ARG B NH1 1 
ATOM   6654  N  NH2 . ARG B 1 408 ? 3.678   17.209  -2.653   1.00 23.70 ? 397  ARG B NH2 1 
ATOM   6655  N  N   . LYS B 1 409 ? 9.465   13.354  -6.926   1.00 22.10 ? 398  LYS B N   1 
ATOM   6656  C  CA  . LYS B 1 409 ? 9.077   12.228  -7.750   1.00 22.13 ? 398  LYS B CA  1 
ATOM   6657  C  C   . LYS B 1 409 ? 10.266  11.756  -8.593   1.00 22.32 ? 398  LYS B C   1 
ATOM   6658  O  O   . LYS B 1 409 ? 11.190  12.524  -8.890   1.00 22.93 ? 398  LYS B O   1 
ATOM   6659  C  CB  . LYS B 1 409 ? 7.936   12.651  -8.694   1.00 22.39 ? 398  LYS B CB  1 
ATOM   6660  C  CG  . LYS B 1 409 ? 6.720   13.343  -8.029   1.00 21.72 ? 398  LYS B CG  1 
ATOM   6661  C  CD  . LYS B 1 409 ? 5.817   12.327  -7.360   1.00 22.37 ? 398  LYS B CD  1 
ATOM   6662  C  CE  . LYS B 1 409 ? 4.779   13.003  -6.465   1.00 21.70 ? 398  LYS B CE  1 
ATOM   6663  N  NZ  . LYS B 1 409 ? 3.904   12.006  -5.825   1.00 18.83 ? 398  LYS B NZ  1 
ATOM   6664  N  N   . GLY B 1 410 ? 10.223  10.491  -9.005   1.00 22.76 ? 399  GLY B N   1 
ATOM   6665  C  CA  . GLY B 1 410 ? 11.264  9.903   -9.867   1.00 22.66 ? 399  GLY B CA  1 
ATOM   6666  C  C   . GLY B 1 410 ? 12.531  9.436   -9.157   1.00 22.55 ? 399  GLY B C   1 
ATOM   6667  O  O   . GLY B 1 410 ? 13.545  9.076   -9.804   1.00 18.65 ? 399  GLY B O   1 
ATOM   6668  N  N   . ARG B 1 411 ? 12.482  9.423   -7.825   1.00 22.82 ? 400  ARG B N   1 
ATOM   6669  C  CA  . ARG B 1 411 ? 13.652  9.055   -7.052   1.00 23.27 ? 400  ARG B CA  1 
ATOM   6670  C  C   . ARG B 1 411 ? 13.335  8.484   -5.697   1.00 23.31 ? 400  ARG B C   1 
ATOM   6671  O  O   . ARG B 1 411 ? 12.678  9.131   -4.910   1.00 24.26 ? 400  ARG B O   1 
ATOM   6672  C  CB  . ARG B 1 411 ? 14.528  10.282  -6.851   1.00 24.17 ? 400  ARG B CB  1 
ATOM   6673  C  CG  . ARG B 1 411 ? 15.890  9.954   -6.243   1.00 24.89 ? 400  ARG B CG  1 
ATOM   6674  C  CD  . ARG B 1 411 ? 16.952  10.811  -6.889   1.00 29.14 ? 400  ARG B CD  1 
ATOM   6675  N  NE  . ARG B 1 411 ? 18.297  10.429  -6.495   1.00 28.71 ? 400  ARG B NE  1 
ATOM   6676  C  CZ  . ARG B 1 411 ? 19.120  9.662   -7.200   1.00 30.71 ? 400  ARG B CZ  1 
ATOM   6677  N  NH1 . ARG B 1 411 ? 18.747  9.142   -8.362   1.00 32.61 ? 400  ARG B NH1 1 
ATOM   6678  N  NH2 . ARG B 1 411 ? 20.326  9.414   -6.714   1.00 33.63 ? 400  ARG B NH2 1 
ATOM   6679  N  N   . ILE B 1 412 ? 13.829  7.281   -5.427   1.00 23.85 ? 401  ILE B N   1 
ATOM   6680  C  CA  . ILE B 1 412 ? 13.720  6.680   -4.093   1.00 24.04 ? 401  ILE B CA  1 
ATOM   6681  C  C   . ILE B 1 412 ? 14.865  7.202   -3.210   1.00 23.96 ? 401  ILE B C   1 
ATOM   6682  O  O   . ILE B 1 412 ? 15.976  6.648   -3.191   1.00 22.88 ? 401  ILE B O   1 
ATOM   6683  C  CB  . ILE B 1 412 ? 13.731  5.154   -4.137   1.00 23.78 ? 401  ILE B CB  1 
ATOM   6684  C  CG1 . ILE B 1 412 ? 12.598  4.630   -4.997   1.00 23.51 ? 401  ILE B CG1 1 
ATOM   6685  C  CG2 . ILE B 1 412 ? 13.600  4.582   -2.727   1.00 23.59 ? 401  ILE B CG2 1 
ATOM   6686  C  CD1 . ILE B 1 412 ? 11.199  4.936   -4.453   1.00 23.65 ? 401  ILE B CD1 1 
ATOM   6687  N  N   . ALA B 1 413 ? 14.566  8.294   -2.507   1.00 24.88 ? 402  ALA B N   1 
ATOM   6688  C  CA  . ALA B 1 413 ? 15.518  8.987   -1.643   1.00 25.61 ? 402  ALA B CA  1 
ATOM   6689  C  C   . ALA B 1 413 ? 14.765  9.443   -0.395   1.00 26.57 ? 402  ALA B C   1 
ATOM   6690  O  O   . ALA B 1 413 ? 13.536  9.448   -0.386   1.00 26.62 ? 402  ALA B O   1 
ATOM   6691  C  CB  . ALA B 1 413 ? 16.150  10.165  -2.386   1.00 25.23 ? 402  ALA B CB  1 
ATOM   6692  N  N   . VAL B 1 414 ? 15.491  9.787   0.670    1.00 27.96 ? 403  VAL B N   1 
ATOM   6693  C  CA  . VAL B 1 414 ? 14.856  10.293  1.880    1.00 27.11 ? 403  VAL B CA  1 
ATOM   6694  C  C   . VAL B 1 414 ? 14.361  11.713  1.685    1.00 26.70 ? 403  VAL B C   1 
ATOM   6695  O  O   . VAL B 1 414 ? 15.119  12.578  1.263    1.00 27.65 ? 403  VAL B O   1 
ATOM   6696  C  CB  . VAL B 1 414 ? 15.830  10.341  3.062    1.00 28.39 ? 403  VAL B CB  1 
ATOM   6697  C  CG1 . VAL B 1 414 ? 15.228  11.221  4.145    1.00 26.36 ? 403  VAL B CG1 1 
ATOM   6698  C  CG2 . VAL B 1 414 ? 16.143  8.931   3.555    1.00 27.93 ? 403  VAL B CG2 1 
ATOM   6699  N  N   . GLY B 1 415 ? 13.101  11.956  2.015    1.00 25.88 ? 404  GLY B N   1 
ATOM   6700  C  CA  . GLY B 1 415 ? 12.495  13.261  1.798    1.00 26.67 ? 404  GLY B CA  1 
ATOM   6701  C  C   . GLY B 1 415 ? 11.581  13.297  0.585    1.00 26.13 ? 404  GLY B C   1 
ATOM   6702  O  O   . GLY B 1 415 ? 10.588  14.018  0.573    1.00 25.79 ? 404  GLY B O   1 
ATOM   6703  N  N   . SER B 1 416 ? 11.913  12.507  -0.427   1.00 26.40 ? 405  SER B N   1 
ATOM   6704  C  CA  . SER B 1 416 ? 11.065  12.322  -1.594   1.00 26.86 ? 405  SER B CA  1 
ATOM   6705  C  C   . SER B 1 416 ? 9.768   11.558  -1.251   1.00 27.46 ? 405  SER B C   1 
ATOM   6706  O  O   . SER B 1 416 ? 9.638   10.975  -0.156   1.00 26.53 ? 405  SER B O   1 
ATOM   6707  C  CB  . SER B 1 416 ? 11.847  11.584  -2.682   1.00 27.09 ? 405  SER B CB  1 
ATOM   6708  O  OG  . SER B 1 416 ? 13.128  12.172  -2.901   1.00 27.03 ? 405  SER B OG  1 
ATOM   6709  N  N   . ASP B 1 417 ? 8.808   11.598  -2.183   1.00 27.55 ? 406  ASP B N   1 
ATOM   6710  C  CA  . ASP B 1 417 ? 7.460   11.000  -2.002   1.00 27.21 ? 406  ASP B CA  1 
ATOM   6711  C  C   . ASP B 1 417 ? 7.481   9.486   -2.099   1.00 27.53 ? 406  ASP B C   1 
ATOM   6712  O  O   . ASP B 1 417 ? 8.133   8.917   -2.975   1.00 27.67 ? 406  ASP B O   1 
ATOM   6713  C  CB  . ASP B 1 417 ? 6.468   11.523  -3.061   1.00 26.46 ? 406  ASP B CB  1 
ATOM   6714  C  CG  . ASP B 1 417 ? 5.894   12.901  -2.723   1.00 26.04 ? 406  ASP B CG  1 
ATOM   6715  O  OD1 . ASP B 1 417 ? 6.120   13.384  -1.586   1.00 18.77 ? 406  ASP B OD1 1 
ATOM   6716  O  OD2 . ASP B 1 417 ? 5.191   13.480  -3.598   1.00 15.05 ? 406  ASP B OD2 1 
ATOM   6717  N  N   . ALA B 1 418 ? 6.716   8.837   -1.229   1.00 28.07 ? 407  ALA B N   1 
ATOM   6718  C  CA  . ALA B 1 418 ? 6.700   7.381   -1.130   1.00 27.98 ? 407  ALA B CA  1 
ATOM   6719  C  C   . ALA B 1 418 ? 5.807   6.757   -2.185   1.00 28.14 ? 407  ALA B C   1 
ATOM   6720  O  O   . ALA B 1 418 ? 4.873   6.014   -1.846   1.00 27.86 ? 407  ALA B O   1 
ATOM   6721  C  CB  . ALA B 1 418 ? 6.235   6.943   0.271    1.00 28.73 ? 407  ALA B CB  1 
ATOM   6722  N  N   . ASP B 1 419 ? 6.085   7.062   -3.460   1.00 28.08 ? 408  ASP B N   1 
ATOM   6723  C  CA  . ASP B 1 419 ? 5.453   6.358   -4.571   1.00 27.80 ? 408  ASP B CA  1 
ATOM   6724  C  C   . ASP B 1 419 ? 6.434   5.300   -5.090   1.00 27.91 ? 408  ASP B C   1 
ATOM   6725  O  O   . ASP B 1 419 ? 7.526   5.632   -5.556   1.00 29.01 ? 408  ASP B O   1 
ATOM   6726  C  CB  . ASP B 1 419 ? 5.047   7.323   -5.691   1.00 27.52 ? 408  ASP B CB  1 
ATOM   6727  C  CG  . ASP B 1 419 ? 4.085   8.433   -5.233   1.00 26.41 ? 408  ASP B CG  1 
ATOM   6728  O  OD1 . ASP B 1 419 ? 3.493   8.380   -4.125   1.00 23.10 ? 408  ASP B OD1 1 
ATOM   6729  O  OD2 . ASP B 1 419 ? 3.922   9.381   -6.025   1.00 22.80 ? 408  ASP B OD2 1 
ATOM   6730  N  N   . LEU B 1 420 ? 6.064   4.027   -4.988   1.00 27.84 ? 409  LEU B N   1 
ATOM   6731  C  CA  . LEU B 1 420 ? 7.013   2.941   -5.245   1.00 27.04 ? 409  LEU B CA  1 
ATOM   6732  C  C   . LEU B 1 420 ? 6.358   1.696   -5.807   1.00 26.17 ? 409  LEU B C   1 
ATOM   6733  O  O   . LEU B 1 420 ? 5.207   1.406   -5.494   1.00 25.92 ? 409  LEU B O   1 
ATOM   6734  C  CB  . LEU B 1 420 ? 7.743   2.540   -3.963   1.00 28.08 ? 409  LEU B CB  1 
ATOM   6735  C  CG  . LEU B 1 420 ? 8.223   3.605   -2.970   1.00 28.56 ? 409  LEU B CG  1 
ATOM   6736  C  CD1 . LEU B 1 420 ? 7.227   3.756   -1.853   1.00 32.04 ? 409  LEU B CD1 1 
ATOM   6737  C  CD2 . LEU B 1 420 ? 9.555   3.239   -2.389   1.00 29.00 ? 409  LEU B CD2 1 
ATOM   6738  N  N   . VAL B 1 421 ? 7.120   0.953   -6.609   1.00 24.74 ? 410  VAL B N   1 
ATOM   6739  C  CA  . VAL B 1 421 ? 6.685   -0.320  -7.176   1.00 24.58 ? 410  VAL B CA  1 
ATOM   6740  C  C   . VAL B 1 421 ? 7.719   -1.376  -6.864   1.00 24.64 ? 410  VAL B C   1 
ATOM   6741  O  O   . VAL B 1 421 ? 8.914   -1.123  -6.978   1.00 25.56 ? 410  VAL B O   1 
ATOM   6742  C  CB  . VAL B 1 421 ? 6.506   -0.221  -8.722   1.00 24.72 ? 410  VAL B CB  1 
ATOM   6743  C  CG1 . VAL B 1 421 ? 5.855   -1.477  -9.295   1.00 20.26 ? 410  VAL B CG1 1 
ATOM   6744  C  CG2 . VAL B 1 421 ? 5.709   1.001   -9.058   1.00 23.81 ? 410  VAL B CG2 1 
ATOM   6745  N  N   . ILE B 1 422 ? 7.266   -2.542  -6.416   1.00 24.54 ? 411  ILE B N   1 
ATOM   6746  C  CA  . ILE B 1 422 ? 8.097   -3.729  -6.384   1.00 23.68 ? 411  ILE B CA  1 
ATOM   6747  C  C   . ILE B 1 422 ? 7.720   -4.394  -7.684   1.00 23.13 ? 411  ILE B C   1 
ATOM   6748  O  O   . ILE B 1 422 ? 6.582   -4.794  -7.862   1.00 24.80 ? 411  ILE B O   1 
ATOM   6749  C  CB  . ILE B 1 422 ? 7.776   -4.666  -5.186   1.00 24.15 ? 411  ILE B CB  1 
ATOM   6750  C  CG1 . ILE B 1 422 ? 7.896   -3.913  -3.855   1.00 25.77 ? 411  ILE B CG1 1 
ATOM   6751  C  CG2 . ILE B 1 422 ? 8.703   -5.880  -5.168   1.00 24.10 ? 411  ILE B CG2 1 
ATOM   6752  C  CD1 . ILE B 1 422 ? 7.609   -4.797  -2.624   1.00 23.49 ? 411  ILE B CD1 1 
ATOM   6753  N  N   . TRP B 1 423 ? 8.660   -4.471  -8.611   1.00 21.24 ? 412  TRP B N   1 
ATOM   6754  C  CA  . TRP B 1 423 ? 8.372   -4.891  -9.967   1.00 21.57 ? 412  TRP B CA  1 
ATOM   6755  C  C   . TRP B 1 423 ? 8.919   -6.292  -10.149  1.00 22.47 ? 412  TRP B C   1 
ATOM   6756  O  O   . TRP B 1 423 ? 9.989   -6.618  -9.630   1.00 22.93 ? 412  TRP B O   1 
ATOM   6757  C  CB  . TRP B 1 423 ? 9.038   -3.895  -10.891  1.00 18.33 ? 412  TRP B CB  1 
ATOM   6758  C  CG  . TRP B 1 423 ? 8.952   -4.101  -12.348  1.00 16.69 ? 412  TRP B CG  1 
ATOM   6759  C  CD1 . TRP B 1 423 ? 9.889   -4.666  -13.140  1.00 15.14 ? 412  TRP B CD1 1 
ATOM   6760  C  CD2 . TRP B 1 423 ? 7.917   -3.652  -13.201  1.00 11.27 ? 412  TRP B CD2 1 
ATOM   6761  N  NE1 . TRP B 1 423 ? 9.488   -4.624  -14.451  1.00 13.87 ? 412  TRP B NE1 1 
ATOM   6762  C  CE2 . TRP B 1 423 ? 8.272   -4.002  -14.509  1.00 12.36 ? 412  TRP B CE2 1 
ATOM   6763  C  CE3 . TRP B 1 423 ? 6.711   -2.988  -12.987  1.00 13.15 ? 412  TRP B CE3 1 
ATOM   6764  C  CZ2 . TRP B 1 423 ? 7.459   -3.722  -15.596  1.00 13.38 ? 412  TRP B CZ2 1 
ATOM   6765  C  CZ3 . TRP B 1 423 ? 5.917   -2.703  -14.042  1.00 15.14 ? 412  TRP B CZ3 1 
ATOM   6766  C  CH2 . TRP B 1 423 ? 6.298   -3.065  -15.363  1.00 12.75 ? 412  TRP B CH2 1 
ATOM   6767  N  N   . ASP B 1 424 ? 8.159   -7.129  -10.856  1.00 24.52 ? 413  ASP B N   1 
ATOM   6768  C  CA  . ASP B 1 424 ? 8.582   -8.477  -11.186  1.00 25.43 ? 413  ASP B CA  1 
ATOM   6769  C  C   . ASP B 1 424 ? 9.120   -8.446  -12.608  1.00 26.56 ? 413  ASP B C   1 
ATOM   6770  O  O   . ASP B 1 424 ? 8.335   -8.285  -13.548  1.00 26.87 ? 413  ASP B O   1 
ATOM   6771  C  CB  . ASP B 1 424 ? 7.399   -9.423  -11.095  1.00 25.93 ? 413  ASP B CB  1 
ATOM   6772  C  CG  . ASP B 1 424 ? 7.760   -10.854 -11.422  1.00 25.86 ? 413  ASP B CG  1 
ATOM   6773  O  OD1 . ASP B 1 424 ? 8.948   -11.143 -11.724  1.00 28.40 ? 413  ASP B OD1 1 
ATOM   6774  O  OD2 . ASP B 1 424 ? 6.827   -11.690 -11.382  1.00 27.06 ? 413  ASP B OD2 1 
ATOM   6775  N  N   . PRO B 1 425 ? 10.456  -8.602  -12.772  1.00 27.84 ? 414  PRO B N   1 
ATOM   6776  C  CA  . PRO B 1 425 ? 11.080  -8.494  -14.095  1.00 28.11 ? 414  PRO B CA  1 
ATOM   6777  C  C   . PRO B 1 425 ? 10.901  -9.730  -14.963  1.00 28.68 ? 414  PRO B C   1 
ATOM   6778  O  O   . PRO B 1 425 ? 11.279  -9.715  -16.138  1.00 27.64 ? 414  PRO B O   1 
ATOM   6779  C  CB  . PRO B 1 425 ? 12.568  -8.313  -13.779  1.00 27.99 ? 414  PRO B CB  1 
ATOM   6780  C  CG  . PRO B 1 425 ? 12.701  -8.390  -12.286  1.00 29.63 ? 414  PRO B CG  1 
ATOM   6781  C  CD  . PRO B 1 425 ? 11.446  -8.909  -11.726  1.00 27.78 ? 414  PRO B CD  1 
ATOM   6782  N  N   . ASP B 1 426 ? 10.302  -10.769 -14.386  1.00 30.30 ? 415  ASP B N   1 
ATOM   6783  C  CA  . ASP B 1 426 ? 10.412  -12.120 -14.896  1.00 31.57 ? 415  ASP B CA  1 
ATOM   6784  C  C   . ASP B 1 426 ? 9.085   -12.673 -15.381  1.00 32.97 ? 415  ASP B C   1 
ATOM   6785  O  O   . ASP B 1 426 ? 8.982   -13.072 -16.545  1.00 35.16 ? 415  ASP B O   1 
ATOM   6786  C  CB  . ASP B 1 426 ? 11.004  -13.030 -13.819  1.00 31.53 ? 415  ASP B CB  1 
ATOM   6787  C  CG  . ASP B 1 426 ? 12.437  -12.684 -13.490  1.00 31.71 ? 415  ASP B CG  1 
ATOM   6788  O  OD1 . ASP B 1 426 ? 13.181  -12.267 -14.403  1.00 27.59 ? 415  ASP B OD1 1 
ATOM   6789  O  OD2 . ASP B 1 426 ? 12.817  -12.826 -12.302  1.00 34.27 ? 415  ASP B OD2 1 
ATOM   6790  N  N   . SER B 1 427 ? 8.074   -12.715 -14.515  1.00 34.09 ? 416  SER B N   1 
ATOM   6791  C  CA  . SER B 1 427 ? 6.809   -13.352 -14.907  1.00 33.50 ? 416  SER B CA  1 
ATOM   6792  C  C   . SER B 1 427 ? 6.195   -12.648 -16.128  1.00 33.52 ? 416  SER B C   1 
ATOM   6793  O  O   . SER B 1 427 ? 6.381   -11.433 -16.313  1.00 33.32 ? 416  SER B O   1 
ATOM   6794  C  CB  . SER B 1 427 ? 5.833   -13.396 -13.740  1.00 34.67 ? 416  SER B CB  1 
ATOM   6795  O  OG  . SER B 1 427 ? 6.375   -14.117 -12.637  1.00 34.78 ? 416  SER B OG  1 
ATOM   6796  N  N   . VAL B 1 428 ? 5.512   -13.436 -16.964  1.00 32.01 ? 417  VAL B N   1 
ATOM   6797  C  CA  . VAL B 1 428 ? 4.953   -12.968 -18.230  1.00 31.62 ? 417  VAL B CA  1 
ATOM   6798  C  C   . VAL B 1 428 ? 3.421   -12.915 -18.165  1.00 31.66 ? 417  VAL B C   1 
ATOM   6799  O  O   . VAL B 1 428 ? 2.806   -13.692 -17.434  1.00 33.28 ? 417  VAL B O   1 
ATOM   6800  C  CB  . VAL B 1 428 ? 5.440   -13.830 -19.423  1.00 30.90 ? 417  VAL B CB  1 
ATOM   6801  C  CG1 . VAL B 1 428 ? 4.849   -13.312 -20.768  1.00 30.61 ? 417  VAL B CG1 1 
ATOM   6802  C  CG2 . VAL B 1 428 ? 6.970   -13.822 -19.480  1.00 28.82 ? 417  VAL B CG2 1 
ATOM   6803  N  N   . LYS B 1 429 ? 2.821   -11.971 -18.900  1.00 30.25 ? 418  LYS B N   1 
ATOM   6804  C  CA  . LYS B 1 429 ? 1.369   -11.766 -18.873  1.00 28.18 ? 418  LYS B CA  1 
ATOM   6805  C  C   . LYS B 1 429 ? 0.823   -11.459 -20.242  1.00 27.52 ? 418  LYS B C   1 
ATOM   6806  O  O   . LYS B 1 429 ? 1.387   -10.667 -20.981  1.00 27.65 ? 418  LYS B O   1 
ATOM   6807  C  CB  . LYS B 1 429 ? 0.976   -10.609 -17.964  1.00 28.26 ? 418  LYS B CB  1 
ATOM   6808  C  CG  . LYS B 1 429 ? 1.326   -10.778 -16.483  1.00 27.16 ? 418  LYS B CG  1 
ATOM   6809  C  CD  . LYS B 1 429 ? 0.697   -9.662  -15.644  1.00 27.65 ? 418  LYS B CD  1 
ATOM   6810  C  CE  . LYS B 1 429 ? 0.918   -9.856  -14.137  1.00 27.43 ? 418  LYS B CE  1 
ATOM   6811  N  NZ  . LYS B 1 429 ? 0.355   -8.715  -13.340  1.00 30.05 ? 418  LYS B NZ  1 
ATOM   6812  N  N   . THR B 1 430 ? -0.307  -12.077 -20.563  1.00 26.52 ? 419  THR B N   1 
ATOM   6813  C  CA  . THR B 1 430 ? -1.124  -11.636 -21.685  1.00 24.68 ? 419  THR B CA  1 
ATOM   6814  C  C   . THR B 1 430 ? -1.776  -10.343 -21.253  1.00 23.07 ? 419  THR B C   1 
ATOM   6815  O  O   . THR B 1 430 ? -2.207  -10.223 -20.100  1.00 21.62 ? 419  THR B O   1 
ATOM   6816  C  CB  . THR B 1 430 ? -2.233  -12.629 -22.031  1.00 24.54 ? 419  THR B CB  1 
ATOM   6817  O  OG1 . THR B 1 430 ? -1.656  -13.868 -22.433  1.00 26.66 ? 419  THR B OG1 1 
ATOM   6818  C  CG2 . THR B 1 430 ? -3.119  -12.090 -23.153  1.00 25.88 ? 419  THR B CG2 1 
ATOM   6819  N  N   . ILE B 1 431 ? -1.771  -9.366  -22.157  1.00 20.80 ? 420  ILE B N   1 
ATOM   6820  C  CA  . ILE B 1 431 ? -2.604  -8.183  -22.041  1.00 20.19 ? 420  ILE B CA  1 
ATOM   6821  C  C   . ILE B 1 431 ? -3.947  -8.497  -22.701  1.00 19.09 ? 420  ILE B C   1 
ATOM   6822  O  O   . ILE B 1 431 ? -3.980  -9.123  -23.774  1.00 13.39 ? 420  ILE B O   1 
ATOM   6823  C  CB  . ILE B 1 431 ? -1.967  -6.968  -22.726  1.00 18.05 ? 420  ILE B CB  1 
ATOM   6824  C  CG1 . ILE B 1 431 ? -0.555  -6.769  -22.197  1.00 20.23 ? 420  ILE B CG1 1 
ATOM   6825  C  CG2 . ILE B 1 431 ? -2.836  -5.725  -22.529  1.00 19.51 ? 420  ILE B CG2 1 
ATOM   6826  C  CD1 . ILE B 1 431 ? 0.050   -5.415  -22.480  1.00 17.96 ? 420  ILE B CD1 1 
ATOM   6827  N  N   . SER B 1 432 ? -5.042  -8.063  -22.071  1.00 20.11 ? 421  SER B N   1 
ATOM   6828  C  CA  . SER B 1 432 ? -6.379  -8.287  -22.626  1.00 21.08 ? 421  SER B CA  1 
ATOM   6829  C  C   . SER B 1 432 ? -7.487  -7.452  -22.033  1.00 20.95 ? 421  SER B C   1 
ATOM   6830  O  O   . SER B 1 432 ? -7.497  -7.144  -20.824  1.00 20.86 ? 421  SER B O   1 
ATOM   6831  C  CB  . SER B 1 432 ? -6.807  -9.740  -22.436  1.00 20.73 ? 421  SER B CB  1 
ATOM   6832  O  OG  . SER B 1 432 ? -7.494  -9.863  -21.210  1.00 23.31 ? 421  SER B OG  1 
ATOM   6833  N  N   . ALA B 1 433 ? -8.480  -7.191  -22.875  1.00 22.50 ? 422  ALA B N   1 
ATOM   6834  C  CA  . ALA B 1 433 ? -9.756  -6.555  -22.455  1.00 24.08 ? 422  ALA B CA  1 
ATOM   6835  C  C   . ALA B 1 433 ? -10.458 -7.237  -21.278  1.00 25.02 ? 422  ALA B C   1 
ATOM   6836  O  O   . ALA B 1 433 ? -11.152 -6.585  -20.509  1.00 27.11 ? 422  ALA B O   1 
ATOM   6837  C  CB  . ALA B 1 433 ? -10.726 -6.448  -23.643  1.00 22.86 ? 422  ALA B CB  1 
ATOM   6838  N  N   . LYS B 1 434 ? -10.293 -8.542  -21.120  1.00 25.94 ? 423  LYS B N   1 
ATOM   6839  C  CA  . LYS B 1 434 ? -11.030 -9.236  -20.048  1.00 26.76 ? 423  LYS B CA  1 
ATOM   6840  C  C   . LYS B 1 434 ? -10.326 -9.237  -18.708  1.00 26.73 ? 423  LYS B C   1 
ATOM   6841  O  O   . LYS B 1 434 ? -10.886 -9.718  -17.735  1.00 27.56 ? 423  LYS B O   1 
ATOM   6842  C  CB  . LYS B 1 434 ? -11.442 -10.655 -20.460  1.00 27.15 ? 423  LYS B CB  1 
ATOM   6843  C  CG  . LYS B 1 434 ? -10.355 -11.561 -20.944  1.00 28.28 ? 423  LYS B CG  1 
ATOM   6844  C  CD  . LYS B 1 434 ? -10.853 -12.361 -22.173  1.00 29.90 ? 423  LYS B CD  1 
ATOM   6845  C  CE  . LYS B 1 434 ? -9.783  -13.307 -22.707  1.00 31.02 ? 423  LYS B CE  1 
ATOM   6846  N  NZ  . LYS B 1 434 ? -8.433  -12.653 -22.833  1.00 33.65 ? 423  LYS B NZ  1 
ATOM   6847  N  N   . THR B 1 435 ? -9.117  -8.687  -18.661  1.00 26.41 ? 424  THR B N   1 
ATOM   6848  C  CA  . THR B 1 435 ? -8.366  -8.527  -17.419  1.00 26.75 ? 424  THR B CA  1 
ATOM   6849  C  C   . THR B 1 435 ? -7.930  -7.080  -17.139  1.00 26.64 ? 424  THR B C   1 
ATOM   6850  O  O   . THR B 1 435 ? -7.505  -6.783  -16.013  1.00 25.94 ? 424  THR B O   1 
ATOM   6851  C  CB  . THR B 1 435 ? -7.121  -9.431  -17.409  1.00 27.12 ? 424  THR B CB  1 
ATOM   6852  O  OG1 . THR B 1 435 ? -6.545  -9.469  -18.720  1.00 28.56 ? 424  THR B OG1 1 
ATOM   6853  C  CG2 . THR B 1 435 ? -7.496  -10.854 -17.005  1.00 27.60 ? 424  THR B CG2 1 
ATOM   6854  N  N   . HIS B 1 436 ? -8.052  -6.183  -18.125  1.00 25.57 ? 425  HIS B N   1 
ATOM   6855  C  CA  . HIS B 1 436 ? -7.728  -4.768  -17.918  1.00 25.77 ? 425  HIS B CA  1 
ATOM   6856  C  C   . HIS B 1 436 ? -8.787  -3.993  -17.144  1.00 26.48 ? 425  HIS B C   1 
ATOM   6857  O  O   . HIS B 1 436 ? -9.968  -4.328  -17.155  1.00 25.47 ? 425  HIS B O   1 
ATOM   6858  C  CB  . HIS B 1 436 ? -7.389  -4.060  -19.235  1.00 25.90 ? 425  HIS B CB  1 
ATOM   6859  C  CG  . HIS B 1 436 ? -8.558  -3.745  -20.116  1.00 24.97 ? 425  HIS B CG  1 
ATOM   6860  N  ND1 . HIS B 1 436 ? -8.387  -3.295  -21.410  1.00 23.80 ? 425  HIS B ND1 1 
ATOM   6861  C  CD2 . HIS B 1 436 ? -9.898  -3.786  -19.910  1.00 23.99 ? 425  HIS B CD2 1 
ATOM   6862  C  CE1 . HIS B 1 436 ? -9.566  -3.068  -21.955  1.00 22.82 ? 425  HIS B CE1 1 
ATOM   6863  N  NE2 . HIS B 1 436 ? -10.501 -3.358  -21.070  1.00 22.36 ? 425  HIS B NE2 1 
ATOM   6864  N  N   . ASN B 1 437 ? -8.350  -2.930  -16.483  1.00 27.58 ? 426  ASN B N   1 
ATOM   6865  C  CA  . ASN B 1 437 ? -9.224  -2.158  -15.602  1.00 28.38 ? 426  ASN B CA  1 
ATOM   6866  C  C   . ASN B 1 437 ? -10.007 -1.044  -16.314  1.00 29.10 ? 426  ASN B C   1 
ATOM   6867  O  O   . ASN B 1 437 ? -10.635 -0.216  -15.685  1.00 29.93 ? 426  ASN B O   1 
ATOM   6868  C  CB  . ASN B 1 437 ? -8.405  -1.628  -14.419  1.00 27.84 ? 426  ASN B CB  1 
ATOM   6869  C  CG  . ASN B 1 437 ? -8.093  -2.708  -13.418  1.00 28.39 ? 426  ASN B CG  1 
ATOM   6870  O  OD1 . ASN B 1 437 ? -8.943  -3.052  -12.583  1.00 32.08 ? 426  ASN B OD1 1 
ATOM   6871  N  ND2 . ASN B 1 437 ? -6.886  -3.275  -13.494  1.00 22.94 ? 426  ASN B ND2 1 
ATOM   6872  N  N   . SER B 1 438 ? -9.968  -1.042  -17.640  1.00 30.49 ? 427  SER B N   1 
ATOM   6873  C  CA  . SER B 1 438 ? -10.833 -0.205  -18.429  1.00 30.38 ? 427  SER B CA  1 
ATOM   6874  C  C   . SER B 1 438 ? -12.172 -0.923  -18.626  1.00 31.84 ? 427  SER B C   1 
ATOM   6875  O  O   . SER B 1 438 ? -12.243 -2.157  -18.770  1.00 31.62 ? 427  SER B O   1 
ATOM   6876  C  CB  . SER B 1 438 ? -10.171 0.106   -19.776  1.00 30.51 ? 427  SER B CB  1 
ATOM   6877  O  OG  . SER B 1 438 ? -11.011 0.889   -20.594  1.00 30.16 ? 427  SER B OG  1 
ATOM   6878  N  N   . SER B 1 439 ? -13.242 -0.137  -18.622  1.00 32.29 ? 428  SER B N   1 
ATOM   6879  C  CA  . SER B 1 439 ? -14.567 -0.640  -18.955  1.00 32.02 ? 428  SER B CA  1 
ATOM   6880  C  C   . SER B 1 439 ? -14.671 -1.049  -20.431  1.00 32.38 ? 428  SER B C   1 
ATOM   6881  O  O   . SER B 1 439 ? -15.641 -1.706  -20.841  1.00 31.89 ? 428  SER B O   1 
ATOM   6882  C  CB  . SER B 1 439 ? -15.597 0.442   -18.657  1.00 32.84 ? 428  SER B CB  1 
ATOM   6883  O  OG  . SER B 1 439 ? -15.119 1.730   -19.012  1.00 33.44 ? 428  SER B OG  1 
ATOM   6884  N  N   . LEU B 1 440 ? -13.674 -0.643  -21.222  1.00 32.33 ? 429  LEU B N   1 
ATOM   6885  C  CA  . LEU B 1 440 ? -13.671 -0.896  -22.644  1.00 31.75 ? 429  LEU B CA  1 
ATOM   6886  C  C   . LEU B 1 440 ? -13.788 -2.371  -22.974  1.00 31.34 ? 429  LEU B C   1 
ATOM   6887  O  O   . LEU B 1 440 ? -13.388 -3.239  -22.202  1.00 30.84 ? 429  LEU B O   1 
ATOM   6888  C  CB  . LEU B 1 440 ? -12.424 -0.291  -23.318  1.00 32.41 ? 429  LEU B CB  1 
ATOM   6889  C  CG  . LEU B 1 440 ? -12.519 1.155   -23.844  1.00 32.46 ? 429  LEU B CG  1 
ATOM   6890  C  CD1 . LEU B 1 440 ? -13.193 2.085   -22.824  1.00 32.41 ? 429  LEU B CD1 1 
ATOM   6891  C  CD2 . LEU B 1 440 ? -11.114 1.682   -24.270  1.00 32.37 ? 429  LEU B CD2 1 
ATOM   6892  N  N   . GLU B 1 441 ? -14.343 -2.613  -24.159  1.00 31.46 ? 430  GLU B N   1 
ATOM   6893  C  CA  . GLU B 1 441 ? -14.549 -3.946  -24.720  1.00 31.18 ? 430  GLU B CA  1 
ATOM   6894  C  C   . GLU B 1 441 ? -13.288 -4.434  -25.426  1.00 31.12 ? 430  GLU B C   1 
ATOM   6895  O  O   . GLU B 1 441 ? -13.002 -5.641  -25.477  1.00 32.52 ? 430  GLU B O   1 
ATOM   6896  C  CB  . GLU B 1 441 ? -15.690 -3.911  -25.749  1.00 31.65 ? 430  GLU B CB  1 
ATOM   6897  C  CG  . GLU B 1 441 ? -17.045 -3.420  -25.194  1.00 33.08 ? 430  GLU B CG  1 
ATOM   6898  C  CD  . GLU B 1 441 ? -17.204 -1.876  -25.063  1.00 31.47 ? 430  GLU B CD  1 
ATOM   6899  O  OE1 . GLU B 1 441 ? -16.396 -1.099  -25.627  1.00 27.89 ? 430  GLU B OE1 1 
ATOM   6900  O  OE2 . GLU B 1 441 ? -18.176 -1.468  -24.385  1.00 32.35 ? 430  GLU B OE2 1 
ATOM   6901  N  N   . TYR B 1 442 ? -12.563 -3.481  -26.002  1.00 29.13 ? 431  TYR B N   1 
ATOM   6902  C  CA  . TYR B 1 442 ? -11.360 -3.759  -26.717  1.00 27.06 ? 431  TYR B CA  1 
ATOM   6903  C  C   . TYR B 1 442 ? -10.159 -3.157  -26.027  1.00 24.06 ? 431  TYR B C   1 
ATOM   6904  O  O   . TYR B 1 442 ? -10.252 -2.117  -25.432  1.00 21.46 ? 431  TYR B O   1 
ATOM   6905  C  CB  . TYR B 1 442 ? -11.458 -3.169  -28.110  1.00 27.62 ? 431  TYR B CB  1 
ATOM   6906  C  CG  . TYR B 1 442 ? -12.390 -3.941  -29.001  1.00 29.03 ? 431  TYR B CG  1 
ATOM   6907  C  CD1 . TYR B 1 442 ? -13.767 -3.668  -29.029  1.00 29.86 ? 431  TYR B CD1 1 
ATOM   6908  C  CD2 . TYR B 1 442 ? -11.907 -4.957  -29.806  1.00 29.16 ? 431  TYR B CD2 1 
ATOM   6909  C  CE1 . TYR B 1 442 ? -14.632 -4.385  -29.868  1.00 29.70 ? 431  TYR B CE1 1 
ATOM   6910  C  CE2 . TYR B 1 442 ? -12.757 -5.683  -30.637  1.00 29.54 ? 431  TYR B CE2 1 
ATOM   6911  C  CZ  . TYR B 1 442 ? -14.116 -5.393  -30.670  1.00 29.32 ? 431  TYR B CZ  1 
ATOM   6912  O  OH  . TYR B 1 442 ? -14.941 -6.129  -31.487  1.00 29.81 ? 431  TYR B OH  1 
ATOM   6913  N  N   . ASN B 1 443 ? -9.016  -3.817  -26.195  1.00 22.96 ? 432  ASN B N   1 
ATOM   6914  C  CA  . ASN B 1 443 ? -7.724  -3.288  -25.817  1.00 22.42 ? 432  ASN B CA  1 
ATOM   6915  C  C   . ASN B 1 443 ? -6.825  -3.359  -27.033  1.00 21.30 ? 432  ASN B C   1 
ATOM   6916  O  O   . ASN B 1 443 ? -6.886  -4.338  -27.770  1.00 23.28 ? 432  ASN B O   1 
ATOM   6917  C  CB  . ASN B 1 443 ? -7.174  -4.115  -24.665  1.00 21.65 ? 432  ASN B CB  1 
ATOM   6918  C  CG  . ASN B 1 443 ? -5.884  -3.578  -24.115  1.00 21.75 ? 432  ASN B CG  1 
ATOM   6919  O  OD1 . ASN B 1 443 ? -5.677  -3.561  -22.914  1.00 16.69 ? 432  ASN B OD1 1 
ATOM   6920  N  ND2 . ASN B 1 443 ? -4.984  -3.210  -24.980  1.00 15.20 ? 432  ASN B ND2 1 
ATOM   6921  N  N   . ILE B 1 444 ? -6.030  -2.313  -27.271  1.00 19.80 ? 433  ILE B N   1 
ATOM   6922  C  CA  . ILE B 1 444 ? -5.155  -2.241  -28.477  1.00 18.30 ? 433  ILE B CA  1 
ATOM   6923  C  C   . ILE B 1 444 ? -3.920  -3.156  -28.361  1.00 16.82 ? 433  ILE B C   1 
ATOM   6924  O  O   . ILE B 1 444 ? -3.252  -3.451  -29.341  1.00 13.10 ? 433  ILE B O   1 
ATOM   6925  C  CB  . ILE B 1 444 ? -4.704  -0.786  -28.806  1.00 17.37 ? 433  ILE B CB  1 
ATOM   6926  C  CG1 . ILE B 1 444 ? -3.846  -0.176  -27.685  1.00 18.19 ? 433  ILE B CG1 1 
ATOM   6927  C  CG2 . ILE B 1 444 ? -5.907  0.071   -29.099  1.00 17.03 ? 433  ILE B CG2 1 
ATOM   6928  C  CD1 . ILE B 1 444 ? -3.257  1.167   -28.014  1.00 19.05 ? 433  ILE B CD1 1 
ATOM   6929  N  N   . PHE B 1 445 ? -3.613  -3.590  -27.143  1.00 14.48 ? 434  PHE B N   1 
ATOM   6930  C  CA  . PHE B 1 445 ? -2.508  -4.530  -26.880  1.00 16.33 ? 434  PHE B CA  1 
ATOM   6931  C  C   . PHE B 1 445 ? -2.979  -5.974  -26.767  1.00 15.94 ? 434  PHE B C   1 
ATOM   6932  O  O   . PHE B 1 445 ? -2.177  -6.854  -26.505  1.00 17.41 ? 434  PHE B O   1 
ATOM   6933  C  CB  . PHE B 1 445 ? -1.748  -4.092  -25.610  1.00 17.28 ? 434  PHE B CB  1 
ATOM   6934  C  CG  . PHE B 1 445 ? -1.340  -2.675  -25.671  1.00 16.81 ? 434  PHE B CG  1 
ATOM   6935  C  CD1 . PHE B 1 445 ? -0.386  -2.264  -26.590  1.00 19.36 ? 434  PHE B CD1 1 
ATOM   6936  C  CD2 . PHE B 1 445 ? -2.002  -1.726  -24.946  1.00 16.05 ? 434  PHE B CD2 1 
ATOM   6937  C  CE1 . PHE B 1 445 ? -0.050  -0.930  -26.702  1.00 18.15 ? 434  PHE B CE1 1 
ATOM   6938  C  CE2 . PHE B 1 445 ? -1.656  -0.404  -25.027  1.00 17.99 ? 434  PHE B CE2 1 
ATOM   6939  C  CZ  . PHE B 1 445 ? -0.690  0.002   -25.919  1.00 19.65 ? 434  PHE B CZ  1 
ATOM   6940  N  N   . GLU B 1 446 ? -4.263  -6.214  -27.030  1.00 17.16 ? 435  GLU B N   1 
ATOM   6941  C  CA  . GLU B 1 446 ? -4.933  -7.498  -26.770  1.00 18.25 ? 435  GLU B CA  1 
ATOM   6942  C  C   . GLU B 1 446 ? -4.098  -8.719  -27.120  1.00 19.43 ? 435  GLU B C   1 
ATOM   6943  O  O   . GLU B 1 446 ? -3.720  -8.925  -28.291  1.00 18.49 ? 435  GLU B O   1 
ATOM   6944  C  CB  . GLU B 1 446 ? -6.232  -7.577  -27.564  1.00 19.81 ? 435  GLU B CB  1 
ATOM   6945  C  CG  . GLU B 1 446 ? -7.084  -8.835  -27.309  1.00 17.97 ? 435  GLU B CG  1 
ATOM   6946  C  CD  . GLU B 1 446 ? -7.649  -8.847  -25.935  1.00 20.87 ? 435  GLU B CD  1 
ATOM   6947  O  OE1 . GLU B 1 446 ? -8.154  -7.798  -25.487  1.00 20.22 ? 435  GLU B OE1 1 
ATOM   6948  O  OE2 . GLU B 1 446 ? -7.569  -9.901  -25.284  1.00 22.65 ? 435  GLU B OE2 1 
ATOM   6949  N  N   . GLY B 1 447 ? -3.821  -9.532  -26.114  1.00 18.21 ? 436  GLY B N   1 
ATOM   6950  C  CA  . GLY B 1 447 ? -3.121  -10.794 -26.315  1.00 21.27 ? 436  GLY B CA  1 
ATOM   6951  C  C   . GLY B 1 447 ? -1.611  -10.706 -26.396  1.00 23.06 ? 436  GLY B C   1 
ATOM   6952  O  O   . GLY B 1 447 ? -0.930  -11.709 -26.704  1.00 24.13 ? 436  GLY B O   1 
ATOM   6953  N  N   . MET B 1 448 ? -1.063  -9.523  -26.133  1.00 24.23 ? 437  MET B N   1 
ATOM   6954  C  CA  . MET B 1 448 ? 0.377   -9.383  -26.144  1.00 24.07 ? 437  MET B CA  1 
ATOM   6955  C  C   . MET B 1 448 ? 0.904   -10.147 -24.942  1.00 26.57 ? 437  MET B C   1 
ATOM   6956  O  O   . MET B 1 448 ? 0.462   -9.926  -23.804  1.00 26.05 ? 437  MET B O   1 
ATOM   6957  C  CB  . MET B 1 448 ? 0.781   -7.919  -26.094  1.00 24.13 ? 437  MET B CB  1 
ATOM   6958  C  CG  . MET B 1 448 ? 2.101   -7.671  -25.381  1.00 23.00 ? 437  MET B CG  1 
ATOM   6959  S  SD  . MET B 1 448 ? 2.748   -5.999  -25.531  1.00 20.97 ? 437  MET B SD  1 
ATOM   6960  C  CE  . MET B 1 448 ? 2.678   -5.863  -27.365  1.00 3.38  ? 437  MET B CE  1 
ATOM   6961  N  N   . GLU B 1 449 ? 1.831   -11.061 -25.214  1.00 28.09 ? 438  GLU B N   1 
ATOM   6962  C  CA  . GLU B 1 449 ? 2.520   -11.824 -24.182  1.00 28.57 ? 438  GLU B CA  1 
ATOM   6963  C  C   . GLU B 1 449 ? 3.656   -10.966 -23.646  1.00 29.52 ? 438  GLU B C   1 
ATOM   6964  O  O   . GLU B 1 449 ? 4.759   -10.962 -24.205  1.00 30.49 ? 438  GLU B O   1 
ATOM   6965  C  CB  . GLU B 1 449 ? 3.076   -13.112 -24.786  1.00 31.07 ? 438  GLU B CB  1 
ATOM   6966  C  CG  . GLU B 1 449 ? 2.008   -14.147 -25.157  1.00 34.13 ? 438  GLU B CG  1 
ATOM   6967  C  CD  . GLU B 1 449 ? 1.552   -14.951 -23.948  1.00 39.58 ? 438  GLU B CD  1 
ATOM   6968  O  OE1 . GLU B 1 449 ? 2.414   -15.609 -23.294  1.00 41.20 ? 438  GLU B OE1 1 
ATOM   6969  O  OE2 . GLU B 1 449 ? 0.332   -14.911 -23.655  1.00 42.86 ? 438  GLU B OE2 1 
ATOM   6970  N  N   . CYS B 1 450 ? 3.378   -10.244 -22.560  1.00 28.70 ? 439  CYS B N   1 
ATOM   6971  C  CA  . CYS B 1 450 ? 4.184   -9.114  -22.136  1.00 27.29 ? 439  CYS B CA  1 
ATOM   6972  C  C   . CYS B 1 450 ? 4.986   -9.435  -20.902  1.00 26.69 ? 439  CYS B C   1 
ATOM   6973  O  O   . CYS B 1 450 ? 4.441   -9.563  -19.814  1.00 25.45 ? 439  CYS B O   1 
ATOM   6974  C  CB  . CYS B 1 450 ? 3.265   -7.941  -21.860  1.00 27.32 ? 439  CYS B CB  1 
ATOM   6975  S  SG  . CYS B 1 450 ? 4.067   -6.386  -21.998  1.00 30.23 ? 439  CYS B SG  1 
ATOM   6976  N  N   . ARG B 1 451 ? 6.296   -9.564  -21.057  1.00 27.06 ? 440  ARG B N   1 
ATOM   6977  C  CA  . ARG B 1 451 ? 7.141   -9.823  -19.906  1.00 27.01 ? 440  ARG B CA  1 
ATOM   6978  C  C   . ARG B 1 451 ? 7.341   -8.557  -19.013  1.00 26.68 ? 440  ARG B C   1 
ATOM   6979  O  O   . ARG B 1 451 ? 7.699   -7.487  -19.502  1.00 25.50 ? 440  ARG B O   1 
ATOM   6980  C  CB  . ARG B 1 451 ? 8.459   -10.410 -20.400  1.00 28.38 ? 440  ARG B CB  1 
ATOM   6981  C  CG  . ARG B 1 451 ? 9.373   -10.830 -19.284  1.00 29.09 ? 440  ARG B CG  1 
ATOM   6982  C  CD  . ARG B 1 451 ? 10.635  -11.523 -19.739  1.00 28.65 ? 440  ARG B CD  1 
ATOM   6983  N  NE  . ARG B 1 451 ? 11.590  -11.513 -18.633  1.00 31.09 ? 440  ARG B NE  1 
ATOM   6984  C  CZ  . ARG B 1 451 ? 12.810  -12.049 -18.666  1.00 32.30 ? 440  ARG B CZ  1 
ATOM   6985  N  NH1 . ARG B 1 451 ? 13.252  -12.674 -19.758  1.00 33.40 ? 440  ARG B NH1 1 
ATOM   6986  N  NH2 . ARG B 1 451 ? 13.585  -11.966 -17.588  1.00 33.30 ? 440  ARG B NH2 1 
ATOM   6987  N  N   . GLY B 1 452 ? 7.073   -8.671  -17.705  1.00 26.64 ? 441  GLY B N   1 
ATOM   6988  C  CA  . GLY B 1 452 ? 7.216   -7.530  -16.768  1.00 25.70 ? 441  GLY B CA  1 
ATOM   6989  C  C   . GLY B 1 452 ? 5.921   -6.898  -16.241  1.00 24.99 ? 441  GLY B C   1 
ATOM   6990  O  O   . GLY B 1 452 ? 5.024   -6.511  -17.022  1.00 23.41 ? 441  GLY B O   1 
ATOM   6991  N  N   . SER B 1 453 ? 5.821   -6.791  -14.910  1.00 24.66 ? 442  SER B N   1 
ATOM   6992  C  CA  . SER B 1 453 ? 4.582   -6.353  -14.256  1.00 25.07 ? 442  SER B CA  1 
ATOM   6993  C  C   . SER B 1 453 ? 4.782   -6.002  -12.790  1.00 24.79 ? 442  SER B C   1 
ATOM   6994  O  O   . SER B 1 453 ? 5.669   -6.535  -12.141  1.00 26.81 ? 442  SER B O   1 
ATOM   6995  C  CB  . SER B 1 453 ? 3.522   -7.458  -14.325  1.00 25.35 ? 442  SER B CB  1 
ATOM   6996  O  OG  . SER B 1 453 ? 3.862   -8.550  -13.482  1.00 23.45 ? 442  SER B OG  1 
ATOM   6997  N  N   . PRO B 1 454 ? 3.936   -5.123  -12.251  1.00 24.19 ? 443  PRO B N   1 
ATOM   6998  C  CA  . PRO B 1 454 ? 4.000   -4.790  -10.830  1.00 24.33 ? 443  PRO B CA  1 
ATOM   6999  C  C   . PRO B 1 454 ? 3.602   -5.949  -9.971   1.00 23.83 ? 443  PRO B C   1 
ATOM   7000  O  O   . PRO B 1 454 ? 3.025   -6.901  -10.478  1.00 24.91 ? 443  PRO B O   1 
ATOM   7001  C  CB  . PRO B 1 454 ? 2.964   -3.676  -10.675  1.00 23.78 ? 443  PRO B CB  1 
ATOM   7002  C  CG  . PRO B 1 454 ? 2.631   -3.250  -12.038  1.00 25.24 ? 443  PRO B CG  1 
ATOM   7003  C  CD  . PRO B 1 454 ? 2.867   -4.386  -12.934  1.00 23.39 ? 443  PRO B CD  1 
ATOM   7004  N  N   . LEU B 1 455 ? 3.940   -5.879  -8.691   1.00 24.11 ? 444  LEU B N   1 
ATOM   7005  C  CA  . LEU B 1 455 ? 3.548   -6.894  -7.707   1.00 25.23 ? 444  LEU B CA  1 
ATOM   7006  C  C   . LEU B 1 455 ? 2.930   -6.173  -6.521   1.00 25.69 ? 444  LEU B C   1 
ATOM   7007  O  O   . LEU B 1 455 ? 1.818   -6.498  -6.127   1.00 27.06 ? 444  LEU B O   1 
ATOM   7008  C  CB  . LEU B 1 455 ? 4.734   -7.747  -7.211   1.00 24.76 ? 444  LEU B CB  1 
ATOM   7009  C  CG  . LEU B 1 455 ? 5.346   -8.879  -8.049   1.00 24.84 ? 444  LEU B CG  1 
ATOM   7010  C  CD1 . LEU B 1 455 ? 6.742   -9.153  -7.560   1.00 22.28 ? 444  LEU B CD1 1 
ATOM   7011  C  CD2 . LEU B 1 455 ? 4.512   -10.171 -8.055   1.00 24.97 ? 444  LEU B CD2 1 
ATOM   7012  N  N   . VAL B 1 456 ? 3.674   -5.227  -5.946   1.00 26.30 ? 445  VAL B N   1 
ATOM   7013  C  CA  . VAL B 1 456 ? 3.138   -4.276  -4.963   1.00 26.69 ? 445  VAL B CA  1 
ATOM   7014  C  C   . VAL B 1 456 ? 3.329   -2.854  -5.474   1.00 27.05 ? 445  VAL B C   1 
ATOM   7015  O  O   . VAL B 1 456 ? 4.382   -2.518  -5.985   1.00 28.07 ? 445  VAL B O   1 
ATOM   7016  C  CB  . VAL B 1 456 ? 3.826   -4.376  -3.569   1.00 26.76 ? 445  VAL B CB  1 
ATOM   7017  C  CG1 . VAL B 1 456 ? 3.167   -3.408  -2.568   1.00 23.68 ? 445  VAL B CG1 1 
ATOM   7018  C  CG2 . VAL B 1 456 ? 3.785   -5.774  -3.051   1.00 26.34 ? 445  VAL B CG2 1 
ATOM   7019  N  N   . VAL B 1 457 ? 2.293   -2.032  -5.355   1.00 28.43 ? 446  VAL B N   1 
ATOM   7020  C  CA  . VAL B 1 457 ? 2.373   -0.607  -5.659   1.00 28.40 ? 446  VAL B CA  1 
ATOM   7021  C  C   . VAL B 1 457 ? 2.018   0.166   -4.385   1.00 29.56 ? 446  VAL B C   1 
ATOM   7022  O  O   . VAL B 1 457 ? 0.959   -0.056  -3.784   1.00 28.95 ? 446  VAL B O   1 
ATOM   7023  C  CB  . VAL B 1 457 ? 1.406   -0.177  -6.811   1.00 28.19 ? 446  VAL B CB  1 
ATOM   7024  C  CG1 . VAL B 1 457 ? 1.439   1.330   -7.010   1.00 26.09 ? 446  VAL B CG1 1 
ATOM   7025  C  CG2 . VAL B 1 457 ? 1.751   -0.883  -8.124   1.00 26.78 ? 446  VAL B CG2 1 
ATOM   7026  N  N   . ILE B 1 458 ? 2.907   1.069   -3.978   1.00 30.33 ? 447  ILE B N   1 
ATOM   7027  C  CA  . ILE B 1 458 ? 2.638   1.941   -2.843   1.00 30.18 ? 447  ILE B CA  1 
ATOM   7028  C  C   . ILE B 1 458 ? 2.458   3.349   -3.346   1.00 29.87 ? 447  ILE B C   1 
ATOM   7029  O  O   . ILE B 1 458 ? 3.332   3.872   -4.025   1.00 31.93 ? 447  ILE B O   1 
ATOM   7030  C  CB  . ILE B 1 458 ? 3.793   1.945   -1.814   1.00 31.04 ? 447  ILE B CB  1 
ATOM   7031  C  CG1 . ILE B 1 458 ? 3.942   0.575   -1.136   1.00 31.18 ? 447  ILE B CG1 1 
ATOM   7032  C  CG2 . ILE B 1 458 ? 3.552   3.017   -0.764   1.00 30.61 ? 447  ILE B CG2 1 
ATOM   7033  C  CD1 . ILE B 1 458 ? 5.329   0.324   -0.660   1.00 30.87 ? 447  ILE B CD1 1 
ATOM   7034  N  N   . SER B 1 459 ? 1.321   3.956   -3.015   1.00 29.86 ? 448  SER B N   1 
ATOM   7035  C  CA  . SER B 1 459 ? 0.991   5.318   -3.427   1.00 29.82 ? 448  SER B CA  1 
ATOM   7036  C  C   . SER B 1 459 ? 0.666   6.183   -2.215   1.00 30.44 ? 448  SER B C   1 
ATOM   7037  O  O   . SER B 1 459 ? -0.240  5.869   -1.459   1.00 30.92 ? 448  SER B O   1 
ATOM   7038  C  CB  . SER B 1 459 ? -0.200  5.294   -4.373   1.00 28.67 ? 448  SER B CB  1 
ATOM   7039  O  OG  . SER B 1 459 ? -0.562  6.599   -4.750   1.00 23.48 ? 448  SER B OG  1 
ATOM   7040  N  N   . GLN B 1 460 ? 1.413   7.274   -2.053   1.00 31.39 ? 449  GLN B N   1 
ATOM   7041  C  CA  . GLN B 1 460 ? 1.316   8.160   -0.892   1.00 32.12 ? 449  GLN B CA  1 
ATOM   7042  C  C   . GLN B 1 460 ? 1.523   7.437   0.448    1.00 33.19 ? 449  GLN B C   1 
ATOM   7043  O  O   . GLN B 1 460 ? 0.845   7.720   1.440    1.00 32.78 ? 449  GLN B O   1 
ATOM   7044  C  CB  . GLN B 1 460 ? -0.005  8.925   -0.882   1.00 31.71 ? 449  GLN B CB  1 
ATOM   7045  C  CG  . GLN B 1 460 ? -0.147  9.950   -1.983   1.00 31.92 ? 449  GLN B CG  1 
ATOM   7046  C  CD  . GLN B 1 460 ? -1.402  10.783  -1.804   1.00 32.46 ? 449  GLN B CD  1 
ATOM   7047  O  OE1 . GLN B 1 460 ? -2.381  10.628  -2.538   1.00 31.17 ? 449  GLN B OE1 1 
ATOM   7048  N  NE2 . GLN B 1 460 ? -1.387  11.660  -0.802   1.00 33.28 ? 449  GLN B NE2 1 
ATOM   7049  N  N   . GLY B 1 461 ? 2.479   6.514   0.476    1.00 34.19 ? 450  GLY B N   1 
ATOM   7050  C  CA  . GLY B 1 461 ? 2.763   5.738   1.682    1.00 34.77 ? 450  GLY B CA  1 
ATOM   7051  C  C   . GLY B 1 461 ? 1.873   4.521   1.881    1.00 35.17 ? 450  GLY B C   1 
ATOM   7052  O  O   . GLY B 1 461 ? 2.243   3.611   2.626    1.00 34.51 ? 450  GLY B O   1 
ATOM   7053  N  N   . LYS B 1 462 ? 0.714   4.513   1.216    1.00 36.29 ? 451  LYS B N   1 
ATOM   7054  C  CA  . LYS B 1 462 ? -0.317  3.477   1.371    1.00 36.81 ? 451  LYS B CA  1 
ATOM   7055  C  C   . LYS B 1 462 ? -0.208  2.459   0.253    1.00 36.49 ? 451  LYS B C   1 
ATOM   7056  O  O   . LYS B 1 462 ? 0.042   2.828   -0.886   1.00 36.50 ? 451  LYS B O   1 
ATOM   7057  C  CB  . LYS B 1 462 ? -1.713  4.121   1.357    1.00 37.30 ? 451  LYS B CB  1 
ATOM   7058  C  CG  . LYS B 1 462 ? -1.967  5.045   2.566    1.00 38.74 ? 451  LYS B CG  1 
ATOM   7059  C  CD  . LYS B 1 462 ? -3.338  5.724   2.520    1.00 38.70 ? 451  LYS B CD  1 
ATOM   7060  C  CE  . LYS B 1 462 ? -3.652  6.446   3.842    1.00 40.48 ? 451  LYS B CE  1 
ATOM   7061  N  NZ  . LYS B 1 462 ? -3.880  5.514   5.018    1.00 40.97 ? 451  LYS B NZ  1 
ATOM   7062  N  N   . ILE B 1 463 ? -0.388  1.181   0.585    1.00 36.32 ? 452  ILE B N   1 
ATOM   7063  C  CA  . ILE B 1 463 ? -0.336  0.105   -0.406   1.00 35.78 ? 452  ILE B CA  1 
ATOM   7064  C  C   . ILE B 1 463 ? -1.626  0.161   -1.183   1.00 35.84 ? 452  ILE B C   1 
ATOM   7065  O  O   . ILE B 1 463 ? -2.704  0.038   -0.599   1.00 35.67 ? 452  ILE B O   1 
ATOM   7066  C  CB  . ILE B 1 463 ? -0.188  -1.295  0.248    1.00 35.20 ? 452  ILE B CB  1 
ATOM   7067  C  CG1 . ILE B 1 463 ? 1.193   -1.445  0.890    1.00 36.18 ? 452  ILE B CG1 1 
ATOM   7068  C  CG2 . ILE B 1 463 ? -0.388  -2.416  -0.771   1.00 36.13 ? 452  ILE B CG2 1 
ATOM   7069  C  CD1 . ILE B 1 463 ? 1.382   -2.733  1.708    1.00 35.80 ? 452  ILE B CD1 1 
ATOM   7070  N  N   . VAL B 1 464 ? -1.520  0.387   -2.490   1.00 35.63 ? 453  VAL B N   1 
ATOM   7071  C  CA  . VAL B 1 464 ? -2.688  0.424   -3.359   1.00 35.62 ? 453  VAL B CA  1 
ATOM   7072  C  C   . VAL B 1 464 ? -2.770  -0.815  -4.246   1.00 35.51 ? 453  VAL B C   1 
ATOM   7073  O  O   . VAL B 1 464 ? -3.765  -1.007  -4.950   1.00 34.51 ? 453  VAL B O   1 
ATOM   7074  C  CB  . VAL B 1 464 ? -2.718  1.696   -4.217   1.00 35.25 ? 453  VAL B CB  1 
ATOM   7075  C  CG1 . VAL B 1 464 ? -2.843  2.920   -3.320   1.00 35.72 ? 453  VAL B CG1 1 
ATOM   7076  C  CG2 . VAL B 1 464 ? -1.478  1.792   -5.078   1.00 35.75 ? 453  VAL B CG2 1 
ATOM   7077  N  N   . LEU B 1 465 ? -1.741  -1.663  -4.194   1.00 36.17 ? 454  LEU B N   1 
ATOM   7078  C  CA  . LEU B 1 465 ? -1.757  -2.940  -4.911   1.00 37.00 ? 454  LEU B CA  1 
ATOM   7079  C  C   . LEU B 1 465 ? -0.936  -3.966  -4.173   1.00 37.19 ? 454  LEU B C   1 
ATOM   7080  O  O   . LEU B 1 465 ? 0.181   -3.676  -3.774   1.00 38.05 ? 454  LEU B O   1 
ATOM   7081  C  CB  . LEU B 1 465 ? -1.216  -2.780  -6.339   1.00 36.87 ? 454  LEU B CB  1 
ATOM   7082  C  CG  . LEU B 1 465 ? -1.261  -3.991  -7.286   1.00 36.54 ? 454  LEU B CG  1 
ATOM   7083  C  CD1 . LEU B 1 465 ? -2.650  -4.626  -7.376   1.00 36.36 ? 454  LEU B CD1 1 
ATOM   7084  C  CD2 . LEU B 1 465 ? -0.805  -3.567  -8.642   1.00 35.82 ? 454  LEU B CD2 1 
ATOM   7085  N  N   . GLU B 1 466 ? -1.505  -5.153  -3.980   1.00 37.44 ? 455  GLU B N   1 
ATOM   7086  C  CA  . GLU B 1 466 ? -0.768  -6.292  -3.448   1.00 38.36 ? 455  GLU B CA  1 
ATOM   7087  C  C   . GLU B 1 466 ? -1.506  -7.620  -3.700   1.00 37.80 ? 455  GLU B C   1 
ATOM   7088  O  O   . GLU B 1 466 ? -2.731  -7.656  -3.819   1.00 37.35 ? 455  GLU B O   1 
ATOM   7089  C  CB  . GLU B 1 466 ? -0.422  -6.103  -1.962   1.00 38.56 ? 455  GLU B CB  1 
ATOM   7090  C  CG  . GLU B 1 466 ? -1.584  -6.157  -1.001   1.00 41.42 ? 455  GLU B CG  1 
ATOM   7091  C  CD  . GLU B 1 466 ? -1.158  -6.670  0.370    1.00 42.24 ? 455  GLU B CD  1 
ATOM   7092  O  OE1 . GLU B 1 466 ? -1.811  -7.615  0.877    1.00 46.69 ? 455  GLU B OE1 1 
ATOM   7093  O  OE2 . GLU B 1 466 ? -0.160  -6.143  0.931    1.00 46.58 ? 455  GLU B OE2 1 
ATOM   7094  N  N   . ASP B 1 467 ? -0.739  -8.701  -3.802   1.00 37.87 ? 456  ASP B N   1 
ATOM   7095  C  CA  . ASP B 1 467 ? -1.280  -10.011 -4.173   1.00 38.56 ? 456  ASP B CA  1 
ATOM   7096  C  C   . ASP B 1 467 ? -2.373  -9.917  -5.246   1.00 38.20 ? 456  ASP B C   1 
ATOM   7097  O  O   . ASP B 1 467 ? -3.465  -10.443 -5.078   1.00 38.36 ? 456  ASP B O   1 
ATOM   7098  C  CB  . ASP B 1 467 ? -1.811  -10.735 -2.928   1.00 39.32 ? 456  ASP B CB  1 
ATOM   7099  C  CG  . ASP B 1 467 ? -0.700  -11.271 -2.056   1.00 40.55 ? 456  ASP B CG  1 
ATOM   7100  O  OD1 . ASP B 1 467 ? 0.071   -12.137 -2.540   1.00 42.85 ? 456  ASP B OD1 1 
ATOM   7101  O  OD2 . ASP B 1 467 ? -0.603  -10.829 -0.889   1.00 43.73 ? 456  ASP B OD2 1 
ATOM   7102  N  N   . GLY B 1 468 ? -2.081  -9.216  -6.335   1.00 38.23 ? 457  GLY B N   1 
ATOM   7103  C  CA  . GLY B 1 468 ? -3.018  -9.106  -7.458   1.00 37.58 ? 457  GLY B CA  1 
ATOM   7104  C  C   . GLY B 1 468 ? -4.252  -8.234  -7.274   1.00 37.66 ? 457  GLY B C   1 
ATOM   7105  O  O   . GLY B 1 468 ? -4.989  -8.019  -8.240   1.00 37.45 ? 457  GLY B O   1 
ATOM   7106  N  N   . THR B 1 469 ? -4.457  -7.693  -6.067   1.00 37.17 ? 458  THR B N   1 
ATOM   7107  C  CA  . THR B 1 469 ? -5.703  -7.001  -5.686   1.00 36.58 ? 458  THR B CA  1 
ATOM   7108  C  C   . THR B 1 469 ? -5.543  -5.480  -5.480   1.00 35.62 ? 458  THR B C   1 
ATOM   7109  O  O   . THR B 1 469 ? -4.619  -5.026  -4.804   1.00 34.94 ? 458  THR B O   1 
ATOM   7110  C  CB  . THR B 1 469 ? -6.272  -7.638  -4.374   1.00 37.22 ? 458  THR B CB  1 
ATOM   7111  O  OG1 . THR B 1 469 ? -6.855  -8.920  -4.670   1.00 37.81 ? 458  THR B OG1 1 
ATOM   7112  C  CG2 . THR B 1 469 ? -7.321  -6.742  -3.703   1.00 37.37 ? 458  THR B CG2 1 
ATOM   7113  N  N   . LEU B 1 470 ? -6.475  -4.705  -6.033   1.00 35.10 ? 459  LEU B N   1 
ATOM   7114  C  CA  . LEU B 1 470 ? -6.464  -3.234  -5.888   1.00 35.04 ? 459  LEU B CA  1 
ATOM   7115  C  C   . LEU B 1 470 ? -7.093  -2.745  -4.563   1.00 34.80 ? 459  LEU B C   1 
ATOM   7116  O  O   . LEU B 1 470 ? -8.230  -3.102  -4.206   1.00 33.41 ? 459  LEU B O   1 
ATOM   7117  C  CB  . LEU B 1 470 ? -7.174  -2.540  -7.066   1.00 34.42 ? 459  LEU B CB  1 
ATOM   7118  C  CG  . LEU B 1 470 ? -6.415  -2.078  -8.312   1.00 33.85 ? 459  LEU B CG  1 
ATOM   7119  C  CD1 . LEU B 1 470 ? -5.060  -1.471  -7.961   1.00 33.04 ? 459  LEU B CD1 1 
ATOM   7120  C  CD2 . LEU B 1 470 ? -6.255  -3.202  -9.306   1.00 33.77 ? 459  LEU B CD2 1 
ATOM   7121  N  N   . HIS B 1 471 ? -6.334  -1.915  -3.858   1.00 34.43 ? 460  HIS B N   1 
ATOM   7122  C  CA  . HIS B 1 471 ? -6.809  -1.207  -2.686   1.00 34.88 ? 460  HIS B CA  1 
ATOM   7123  C  C   . HIS B 1 471 ? -6.658  0.311   -2.881   1.00 34.11 ? 460  HIS B C   1 
ATOM   7124  O  O   . HIS B 1 471 ? -5.859  0.969   -2.201   1.00 34.34 ? 460  HIS B O   1 
ATOM   7125  C  CB  . HIS B 1 471 ? -6.031  -1.673  -1.458   1.00 36.27 ? 460  HIS B CB  1 
ATOM   7126  C  CG  . HIS B 1 471 ? -6.011  -3.159  -1.294   1.00 39.51 ? 460  HIS B CG  1 
ATOM   7127  N  ND1 . HIS B 1 471 ? -4.858  -3.908  -1.421   1.00 41.71 ? 460  HIS B ND1 1 
ATOM   7128  C  CD2 . HIS B 1 471 ? -7.009  -4.041  -1.039   1.00 42.13 ? 460  HIS B CD2 1 
ATOM   7129  C  CE1 . HIS B 1 471 ? -5.143  -5.186  -1.236   1.00 42.13 ? 460  HIS B CE1 1 
ATOM   7130  N  NE2 . HIS B 1 471 ? -6.441  -5.295  -1.005   1.00 43.47 ? 460  HIS B NE2 1 
ATOM   7131  N  N   . VAL B 1 472 ? -7.448  0.861   -3.796   1.00 32.88 ? 461  VAL B N   1 
ATOM   7132  C  CA  . VAL B 1 472 ? -7.397  2.291   -4.115   1.00 32.54 ? 461  VAL B CA  1 
ATOM   7133  C  C   . VAL B 1 472 ? -8.530  3.040   -3.423   1.00 31.55 ? 461  VAL B C   1 
ATOM   7134  O  O   . VAL B 1 472 ? -9.605  2.477   -3.215   1.00 31.61 ? 461  VAL B O   1 
ATOM   7135  C  CB  . VAL B 1 472 ? -7.430  2.527   -5.659   1.00 32.26 ? 461  VAL B CB  1 
ATOM   7136  C  CG1 . VAL B 1 472 ? -6.438  1.612   -6.357   1.00 33.03 ? 461  VAL B CG1 1 
ATOM   7137  C  CG2 . VAL B 1 472 ? -8.817  2.335   -6.239   1.00 32.78 ? 461  VAL B CG2 1 
ATOM   7138  N  N   . THR B 1 473 ? -8.280  4.295   -3.047   1.00 31.12 ? 462  THR B N   1 
ATOM   7139  C  CA  . THR B 1 473 ? -9.303  5.159   -2.426   1.00 31.23 ? 462  THR B CA  1 
ATOM   7140  C  C   . THR B 1 473 ? -9.697  6.256   -3.406   1.00 30.59 ? 462  THR B C   1 
ATOM   7141  O  O   . THR B 1 473 ? -8.834  7.018   -3.843   1.00 29.98 ? 462  THR B O   1 
ATOM   7142  C  CB  . THR B 1 473 ? -8.801  5.868   -1.124   1.00 31.69 ? 462  THR B CB  1 
ATOM   7143  O  OG1 . THR B 1 473 ? -8.014  4.976   -0.320   1.00 31.89 ? 462  THR B OG1 1 
ATOM   7144  C  CG2 . THR B 1 473 ? -9.971  6.399   -0.317   1.00 31.00 ? 462  THR B CG2 1 
ATOM   7145  N  N   . GLU B 1 474 ? -10.985 6.358   -3.734   1.00 30.35 ? 463  GLU B N   1 
ATOM   7146  C  CA  . GLU B 1 474 ? -11.433 7.388   -4.657   1.00 31.29 ? 463  GLU B CA  1 
ATOM   7147  C  C   . GLU B 1 474 ? -11.172 8.782   -4.076   1.00 31.20 ? 463  GLU B C   1 
ATOM   7148  O  O   . GLU B 1 474 ? -11.241 8.992   -2.868   1.00 32.72 ? 463  GLU B O   1 
ATOM   7149  C  CB  . GLU B 1 474 ? -12.901 7.215   -5.045   1.00 31.48 ? 463  GLU B CB  1 
ATOM   7150  C  CG  . GLU B 1 474 ? -13.334 8.082   -6.254   1.00 32.48 ? 463  GLU B CG  1 
ATOM   7151  C  CD  . GLU B 1 474 ? -14.831 8.033   -6.534   1.00 34.37 ? 463  GLU B CD  1 
ATOM   7152  O  OE1 . GLU B 1 474 ? -15.488 7.054   -6.104   1.00 38.82 ? 463  GLU B OE1 1 
ATOM   7153  O  OE2 . GLU B 1 474 ? -15.351 8.980   -7.180   1.00 39.41 ? 463  GLU B OE2 1 
ATOM   7154  N  N   . GLY B 1 475 ? -10.808 9.710   -4.955   1.00 31.12 ? 464  GLY B N   1 
ATOM   7155  C  CA  . GLY B 1 475 ? -10.515 11.090  -4.582   1.00 30.54 ? 464  GLY B CA  1 
ATOM   7156  C  C   . GLY B 1 475 ? -9.358  11.295  -3.632   1.00 30.59 ? 464  GLY B C   1 
ATOM   7157  O  O   . GLY B 1 475 ? -9.300  12.348  -3.001   1.00 32.95 ? 464  GLY B O   1 
ATOM   7158  N  N   . SER B 1 476 ? -8.441  10.317  -3.512   1.00 29.56 ? 465  SER B N   1 
ATOM   7159  C  CA  . SER B 1 476 ? -7.339  10.411  -2.534   1.00 28.54 ? 465  SER B CA  1 
ATOM   7160  C  C   . SER B 1 476 ? -6.109  11.168  -3.048   1.00 27.81 ? 465  SER B C   1 
ATOM   7161  O  O   . SER B 1 476 ? -5.274  11.604  -2.263   1.00 26.16 ? 465  SER B O   1 
ATOM   7162  C  CB  . SER B 1 476 ? -6.936  9.033   -2.006   1.00 29.69 ? 465  SER B CB  1 
ATOM   7163  O  OG  . SER B 1 476 ? -6.581  8.121   -3.029   1.00 28.56 ? 465  SER B OG  1 
ATOM   7164  N  N   . GLY B 1 477 ? -6.025  11.363  -4.360   1.00 26.59 ? 466  GLY B N   1 
ATOM   7165  C  CA  . GLY B 1 477 ? -4.892  12.053  -4.951   1.00 26.17 ? 466  GLY B CA  1 
ATOM   7166  C  C   . GLY B 1 477 ? -4.805  13.546  -4.674   1.00 25.27 ? 466  GLY B C   1 
ATOM   7167  O  O   . GLY B 1 477 ? -5.827  14.242  -4.575   1.00 25.60 ? 466  GLY B O   1 
ATOM   7168  N  N   . ARG B 1 478 ? -3.570  14.033  -4.570   1.00 24.21 ? 467  ARG B N   1 
ATOM   7169  C  CA  . ARG B 1 478 ? -3.284  15.464  -4.488   1.00 24.04 ? 467  ARG B CA  1 
ATOM   7170  C  C   . ARG B 1 478 ? -2.894  16.063  -5.841   1.00 23.59 ? 467  ARG B C   1 
ATOM   7171  O  O   . ARG B 1 478 ? -2.150  15.452  -6.591   1.00 22.33 ? 467  ARG B O   1 
ATOM   7172  C  CB  . ARG B 1 478 ? -2.145  15.700  -3.507   1.00 23.39 ? 467  ARG B CB  1 
ATOM   7173  C  CG  . ARG B 1 478 ? -2.416  15.167  -2.078   1.00 23.88 ? 467  ARG B CG  1 
ATOM   7174  C  CD  . ARG B 1 478 ? -1.143  15.060  -1.245   1.00 24.86 ? 467  ARG B CD  1 
ATOM   7175  N  NE  . ARG B 1 478 ? 0.035   14.699  -2.057   1.00 26.83 ? 467  ARG B NE  1 
ATOM   7176  C  CZ  . ARG B 1 478 ? 1.267   14.521  -1.586   1.00 27.32 ? 467  ARG B CZ  1 
ATOM   7177  N  NH1 . ARG B 1 478 ? 1.518   14.666  -0.294   1.00 28.69 ? 467  ARG B NH1 1 
ATOM   7178  N  NH2 . ARG B 1 478 ? 2.257   14.182  -2.415   1.00 26.11 ? 467  ARG B NH2 1 
ATOM   7179  N  N   . TYR B 1 479 ? -3.391  17.268  -6.127   1.00 23.30 ? 468  TYR B N   1 
ATOM   7180  C  CA  . TYR B 1 479 ? -2.851  18.084  -7.213   1.00 23.76 ? 468  TYR B CA  1 
ATOM   7181  C  C   . TYR B 1 479 ? -1.468  18.583  -6.817   1.00 24.61 ? 468  TYR B C   1 
ATOM   7182  O  O   . TYR B 1 479 ? -1.322  19.188  -5.760   1.00 25.53 ? 468  TYR B O   1 
ATOM   7183  C  CB  . TYR B 1 479 ? -3.736  19.296  -7.534   1.00 23.21 ? 468  TYR B CB  1 
ATOM   7184  C  CG  . TYR B 1 479 ? -3.189  20.121  -8.688   1.00 23.37 ? 468  TYR B CG  1 
ATOM   7185  C  CD1 . TYR B 1 479 ? -3.370  19.717  -9.998   1.00 21.80 ? 468  TYR B CD1 1 
ATOM   7186  C  CD2 . TYR B 1 479 ? -2.479  21.295  -8.469   1.00 23.65 ? 468  TYR B CD2 1 
ATOM   7187  C  CE1 . TYR B 1 479 ? -2.850  20.455  -11.061  1.00 23.45 ? 468  TYR B CE1 1 
ATOM   7188  C  CE2 . TYR B 1 479 ? -1.963  22.029  -9.532   1.00 20.65 ? 468  TYR B CE2 1 
ATOM   7189  C  CZ  . TYR B 1 479 ? -2.158  21.600  -10.812  1.00 23.03 ? 468  TYR B CZ  1 
ATOM   7190  O  OH  . TYR B 1 479 ? -1.647  22.324  -11.865  1.00 23.95 ? 468  TYR B OH  1 
ATOM   7191  N  N   . ILE B 1 480 ? -0.457  18.320  -7.651   1.00 23.82 ? 469  ILE B N   1 
ATOM   7192  C  CA  . ILE B 1 480 ? 0.929   18.710  -7.351   1.00 22.75 ? 469  ILE B CA  1 
ATOM   7193  C  C   . ILE B 1 480 ? 1.272   19.927  -8.214   1.00 22.09 ? 469  ILE B C   1 
ATOM   7194  O  O   . ILE B 1 480 ? 1.255   19.836  -9.460   1.00 20.92 ? 469  ILE B O   1 
ATOM   7195  C  CB  . ILE B 1 480 ? 1.941   17.567  -7.637   1.00 23.32 ? 469  ILE B CB  1 
ATOM   7196  C  CG1 . ILE B 1 480 ? 1.534   16.245  -6.956   1.00 21.30 ? 469  ILE B CG1 1 
ATOM   7197  C  CG2 . ILE B 1 480 ? 3.354   17.986  -7.213   1.00 23.33 ? 469  ILE B CG2 1 
ATOM   7198  C  CD1 . ILE B 1 480 ? 1.541   16.272  -5.460   1.00 25.63 ? 469  ILE B CD1 1 
ATOM   7199  N  N   . PRO B 1 481 ? 1.524   21.085  -7.576   1.00 21.56 ? 470  PRO B N   1 
ATOM   7200  C  CA  . PRO B 1 481 ? 1.879   22.293  -8.320   1.00 21.41 ? 470  PRO B CA  1 
ATOM   7201  C  C   . PRO B 1 481 ? 3.298   22.196  -8.859   1.00 22.26 ? 470  PRO B C   1 
ATOM   7202  O  O   . PRO B 1 481 ? 4.185   21.698  -8.165   1.00 23.15 ? 470  PRO B O   1 
ATOM   7203  C  CB  . PRO B 1 481 ? 1.822   23.411  -7.278   1.00 21.51 ? 470  PRO B CB  1 
ATOM   7204  C  CG  . PRO B 1 481 ? 1.370   22.785  -6.020   1.00 21.14 ? 470  PRO B CG  1 
ATOM   7205  C  CD  . PRO B 1 481 ? 1.499   21.317  -6.123   1.00 21.62 ? 470  PRO B CD  1 
ATOM   7206  N  N   . ARG B 1 482 ? 3.496   22.663  -10.090  1.00 20.56 ? 471  ARG B N   1 
ATOM   7207  C  CA  . ARG B 1 482 ? 4.773   22.608  -10.763  1.00 20.33 ? 471  ARG B CA  1 
ATOM   7208  C  C   . ARG B 1 482 ? 5.268   24.036  -10.957  1.00 19.47 ? 471  ARG B C   1 
ATOM   7209  O  O   . ARG B 1 482 ? 4.598   24.842  -11.586  1.00 18.61 ? 471  ARG B O   1 
ATOM   7210  C  CB  . ARG B 1 482 ? 4.617   21.881  -12.107  1.00 19.59 ? 471  ARG B CB  1 
ATOM   7211  C  CG  . ARG B 1 482 ? 4.020   20.476  -11.978  1.00 20.26 ? 471  ARG B CG  1 
ATOM   7212  C  CD  . ARG B 1 482 ? 3.528   19.925  -13.363  1.00 23.65 ? 471  ARG B CD  1 
ATOM   7213  N  NE  . ARG B 1 482 ? 2.576   20.848  -13.979  1.00 26.20 ? 471  ARG B NE  1 
ATOM   7214  C  CZ  . ARG B 1 482 ? 2.229   20.841  -15.257  1.00 27.65 ? 471  ARG B CZ  1 
ATOM   7215  N  NH1 . ARG B 1 482 ? 2.730   19.936  -16.087  1.00 30.32 ? 471  ARG B NH1 1 
ATOM   7216  N  NH2 . ARG B 1 482 ? 1.376   21.747  -15.703  1.00 26.38 ? 471  ARG B NH2 1 
ATOM   7217  N  N   . LYS B 1 483 ? 6.408   24.369  -10.344  1.00 19.61 ? 472  LYS B N   1 
ATOM   7218  C  CA  . LYS B 1 483 ? 6.974   25.728  -10.441  1.00 18.65 ? 472  LYS B CA  1 
ATOM   7219  C  C   . LYS B 1 483 ? 7.621   25.907  -11.824  1.00 17.69 ? 472  LYS B C   1 
ATOM   7220  O  O   . LYS B 1 483 ? 8.056   24.927  -12.432  1.00 18.63 ? 472  LYS B O   1 
ATOM   7221  C  CB  . LYS B 1 483 ? 7.980   26.002  -9.293   1.00 18.87 ? 472  LYS B CB  1 
ATOM   7222  C  CG  . LYS B 1 483 ? 7.329   26.111  -7.892   1.00 18.75 ? 472  LYS B CG  1 
ATOM   7223  C  CD  . LYS B 1 483 ? 8.326   26.510  -6.800   1.00 20.03 ? 472  LYS B CD  1 
ATOM   7224  C  CE  . LYS B 1 483 ? 7.687   26.419  -5.401   1.00 22.12 ? 472  LYS B CE  1 
ATOM   7225  N  NZ  . LYS B 1 483 ? 8.429   27.200  -4.318   1.00 25.31 ? 472  LYS B NZ  1 
ATOM   7226  N  N   . PRO B 1 484 ? 7.668   27.148  -12.334  1.00 17.58 ? 473  PRO B N   1 
ATOM   7227  C  CA  . PRO B 1 484 ? 8.210   27.356  -13.675  1.00 17.40 ? 473  PRO B CA  1 
ATOM   7228  C  C   . PRO B 1 484 ? 9.724   27.364  -13.667  1.00 17.80 ? 473  PRO B C   1 
ATOM   7229  O  O   . PRO B 1 484 ? 10.342  27.237  -12.609  1.00 17.23 ? 473  PRO B O   1 
ATOM   7230  C  CB  . PRO B 1 484 ? 7.651   28.713  -14.084  1.00 15.87 ? 473  PRO B CB  1 
ATOM   7231  C  CG  . PRO B 1 484 ? 7.164   29.368  -12.812  1.00 17.81 ? 473  PRO B CG  1 
ATOM   7232  C  CD  . PRO B 1 484 ? 7.278   28.423  -11.697  1.00 18.14 ? 473  PRO B CD  1 
ATOM   7233  N  N   . PHE B 1 485 ? 10.299  27.531  -14.852  1.00 17.82 ? 474  PHE B N   1 
ATOM   7234  C  CA  . PHE B 1 485 ? 11.733  27.562  -15.052  1.00 18.33 ? 474  PHE B CA  1 
ATOM   7235  C  C   . PHE B 1 485 ? 12.418  26.303  -14.519  1.00 18.29 ? 474  PHE B C   1 
ATOM   7236  O  O   . PHE B 1 485 ? 13.327  26.406  -13.693  1.00 16.27 ? 474  PHE B O   1 
ATOM   7237  C  CB  . PHE B 1 485 ? 12.345  28.814  -14.404  1.00 19.10 ? 474  PHE B CB  1 
ATOM   7238  C  CG  . PHE B 1 485 ? 11.761  30.099  -14.901  1.00 18.76 ? 474  PHE B CG  1 
ATOM   7239  C  CD1 . PHE B 1 485 ? 12.131  30.598  -16.142  1.00 20.00 ? 474  PHE B CD1 1 
ATOM   7240  C  CD2 . PHE B 1 485 ? 10.865  30.817  -14.124  1.00 18.54 ? 474  PHE B CD2 1 
ATOM   7241  C  CE1 . PHE B 1 485 ? 11.622  31.777  -16.614  1.00 18.84 ? 474  PHE B CE1 1 
ATOM   7242  C  CE2 . PHE B 1 485 ? 10.331  31.995  -14.582  1.00 20.36 ? 474  PHE B CE2 1 
ATOM   7243  C  CZ  . PHE B 1 485 ? 10.714  32.490  -15.845  1.00 20.13 ? 474  PHE B CZ  1 
ATOM   7244  N  N   . PRO B 1 486 ? 11.977  25.115  -14.973  1.00 18.74 ? 475  PRO B N   1 
ATOM   7245  C  CA  . PRO B 1 486 ? 12.716  23.890  -14.643  1.00 19.28 ? 475  PRO B CA  1 
ATOM   7246  C  C   . PRO B 1 486 ? 14.200  23.963  -15.039  1.00 19.10 ? 475  PRO B C   1 
ATOM   7247  O  O   . PRO B 1 486 ? 14.533  24.109  -16.217  1.00 19.35 ? 475  PRO B O   1 
ATOM   7248  C  CB  . PRO B 1 486 ? 11.986  22.803  -15.444  1.00 19.06 ? 475  PRO B CB  1 
ATOM   7249  C  CG  . PRO B 1 486 ? 10.681  23.343  -15.746  1.00 19.24 ? 475  PRO B CG  1 
ATOM   7250  C  CD  . PRO B 1 486 ? 10.780  24.823  -15.782  1.00 19.23 ? 475  PRO B CD  1 
ATOM   7251  N  N   . ASP B 1 487 ? 15.082  23.879  -14.057  1.00 19.20 ? 476  ASP B N   1 
ATOM   7252  C  CA  . ASP B 1 487 ? 16.522  23.847  -14.310  1.00 19.86 ? 476  ASP B CA  1 
ATOM   7253  C  C   . ASP B 1 487 ? 16.916  23.049  -15.538  1.00 19.47 ? 476  ASP B C   1 
ATOM   7254  O  O   . ASP B 1 487 ? 17.622  23.536  -16.390  1.00 22.14 ? 476  ASP B O   1 
ATOM   7255  C  CB  . ASP B 1 487 ? 17.237  23.270  -13.088  1.00 20.56 ? 476  ASP B CB  1 
ATOM   7256  C  CG  . ASP B 1 487 ? 17.546  24.329  -12.028  1.00 23.00 ? 476  ASP B CG  1 
ATOM   7257  O  OD1 . ASP B 1 487 ? 16.757  25.319  -11.860  1.00 19.64 ? 476  ASP B OD1 1 
ATOM   7258  O  OD2 . ASP B 1 487 ? 18.607  24.154  -11.371  1.00 29.98 ? 476  ASP B OD2 1 
ATOM   7259  N  N   . PHE B 1 488 ? 16.447  21.814  -15.609  1.00 20.20 ? 477  PHE B N   1 
ATOM   7260  C  CA  . PHE B 1 488 ? 16.797  20.850  -16.653  1.00 19.73 ? 477  PHE B CA  1 
ATOM   7261  C  C   . PHE B 1 488 ? 16.537  21.421  -18.041  1.00 18.73 ? 477  PHE B C   1 
ATOM   7262  O  O   . PHE B 1 488 ? 17.275  21.170  -18.983  1.00 18.48 ? 477  PHE B O   1 
ATOM   7263  C  CB  . PHE B 1 488 ? 15.980  19.583  -16.410  1.00 20.62 ? 477  PHE B CB  1 
ATOM   7264  C  CG  . PHE B 1 488 ? 16.415  18.389  -17.205  1.00 20.67 ? 477  PHE B CG  1 
ATOM   7265  C  CD1 . PHE B 1 488 ? 17.661  17.812  -17.008  1.00 22.20 ? 477  PHE B CD1 1 
ATOM   7266  C  CD2 . PHE B 1 488 ? 15.543  17.794  -18.108  1.00 22.88 ? 477  PHE B CD2 1 
ATOM   7267  C  CE1 . PHE B 1 488 ? 18.070  16.690  -17.748  1.00 20.31 ? 477  PHE B CE1 1 
ATOM   7268  C  CE2 . PHE B 1 488 ? 15.928  16.668  -18.850  1.00 21.71 ? 477  PHE B CE2 1 
ATOM   7269  C  CZ  . PHE B 1 488 ? 17.199  16.106  -18.654  1.00 21.48 ? 477  PHE B CZ  1 
ATOM   7270  N  N   . VAL B 1 489 ? 15.519  22.248  -18.136  1.00 18.13 ? 478  VAL B N   1 
ATOM   7271  C  CA  . VAL B 1 489 ? 15.096  22.840  -19.399  1.00 19.26 ? 478  VAL B CA  1 
ATOM   7272  C  C   . VAL B 1 489 ? 15.612  24.266  -19.569  1.00 18.28 ? 478  VAL B C   1 
ATOM   7273  O  O   . VAL B 1 489 ? 16.118  24.632  -20.634  1.00 17.88 ? 478  VAL B O   1 
ATOM   7274  C  CB  . VAL B 1 489 ? 13.563  22.853  -19.459  1.00 19.48 ? 478  VAL B CB  1 
ATOM   7275  C  CG1 . VAL B 1 489 ? 13.087  23.307  -20.817  1.00 19.24 ? 478  VAL B CG1 1 
ATOM   7276  C  CG2 . VAL B 1 489 ? 13.015  21.471  -19.105  1.00 19.20 ? 478  VAL B CG2 1 
ATOM   7277  N  N   . TYR B 1 490 ? 15.488  25.061  -18.514  1.00 18.43 ? 479  TYR B N   1 
ATOM   7278  C  CA  . TYR B 1 490 ? 15.697  26.513  -18.617  1.00 17.95 ? 479  TYR B CA  1 
ATOM   7279  C  C   . TYR B 1 490 ? 17.119  27.042  -18.396  1.00 18.08 ? 479  TYR B C   1 
ATOM   7280  O  O   . TYR B 1 490 ? 17.459  28.089  -18.932  1.00 21.46 ? 479  TYR B O   1 
ATOM   7281  C  CB  . TYR B 1 490 ? 14.673  27.255  -17.761  1.00 16.73 ? 479  TYR B CB  1 
ATOM   7282  C  CG  . TYR B 1 490 ? 13.434  27.573  -18.536  1.00 15.73 ? 479  TYR B CG  1 
ATOM   7283  C  CD1 . TYR B 1 490 ? 13.329  28.757  -19.230  1.00 16.37 ? 479  TYR B CD1 1 
ATOM   7284  C  CD2 . TYR B 1 490 ? 12.382  26.683  -18.610  1.00 15.04 ? 479  TYR B CD2 1 
ATOM   7285  C  CE1 . TYR B 1 490 ? 12.215  29.066  -19.943  1.00 14.41 ? 479  TYR B CE1 1 
ATOM   7286  C  CE2 . TYR B 1 490 ? 11.253  26.985  -19.330  1.00 14.03 ? 479  TYR B CE2 1 
ATOM   7287  C  CZ  . TYR B 1 490 ? 11.182  28.179  -19.987  1.00 13.04 ? 479  TYR B CZ  1 
ATOM   7288  O  OH  . TYR B 1 490 ? 10.097  28.524  -20.737  1.00 19.33 ? 479  TYR B OH  1 
ATOM   7289  N  N   . LYS B 1 491 ? 17.982  26.337  -17.671  1.00 18.38 ? 480  LYS B N   1 
ATOM   7290  C  CA  . LYS B 1 491 ? 19.378  26.789  -17.597  1.00 17.27 ? 480  LYS B CA  1 
ATOM   7291  C  C   . LYS B 1 491 ? 19.987  27.071  -18.987  1.00 17.62 ? 480  LYS B C   1 
ATOM   7292  O  O   . LYS B 1 491 ? 20.696  28.051  -19.112  1.00 20.41 ? 480  LYS B O   1 
ATOM   7293  C  CB  . LYS B 1 491 ? 20.237  25.829  -16.779  1.00 17.76 ? 480  LYS B CB  1 
ATOM   7294  C  CG  . LYS B 1 491 ? 20.118  26.074  -15.262  1.00 17.09 ? 480  LYS B CG  1 
ATOM   7295  C  CD  . LYS B 1 491 ? 20.904  25.045  -14.501  1.00 17.16 ? 480  LYS B CD  1 
ATOM   7296  C  CE  . LYS B 1 491 ? 20.929  25.327  -13.023  1.00 19.80 ? 480  LYS B CE  1 
ATOM   7297  N  NZ  . LYS B 1 491 ? 21.105  24.023  -12.330  1.00 21.68 ? 480  LYS B NZ  1 
ATOM   7298  N  N   . ARG B 1 492 ? 19.689  26.262  -20.018  1.00 16.62 ? 481  ARG B N   1 
ATOM   7299  C  CA  . ARG B 1 492 ? 20.235  26.468  -21.390  1.00 16.13 ? 481  ARG B CA  1 
ATOM   7300  C  C   . ARG B 1 492 ? 19.553  27.593  -22.127  1.00 15.91 ? 481  ARG B C   1 
ATOM   7301  O  O   . ARG B 1 492 ? 20.205  28.432  -22.781  1.00 16.87 ? 481  ARG B O   1 
ATOM   7302  C  CB  . ARG B 1 492 ? 20.098  25.210  -22.269  1.00 16.90 ? 481  ARG B CB  1 
ATOM   7303  C  CG  . ARG B 1 492 ? 21.206  24.146  -22.127  1.00 16.92 ? 481  ARG B CG  1 
ATOM   7304  C  CD  . ARG B 1 492 ? 20.768  22.849  -22.781  1.00 18.30 ? 481  ARG B CD  1 
ATOM   7305  N  NE  . ARG B 1 492 ? 19.550  22.333  -22.147  1.00 21.57 ? 481  ARG B NE  1 
ATOM   7306  C  CZ  . ARG B 1 492 ? 18.740  21.412  -22.673  1.00 23.25 ? 481  ARG B CZ  1 
ATOM   7307  N  NH1 . ARG B 1 492 ? 19.003  20.888  -23.876  1.00 25.36 ? 481  ARG B NH1 1 
ATOM   7308  N  NH2 . ARG B 1 492 ? 17.650  21.017  -22.007  1.00 20.82 ? 481  ARG B NH2 1 
ATOM   7309  N  N   . ILE B 1 493 ? 18.230  27.605  -22.032  1.00 15.07 ? 482  ILE B N   1 
ATOM   7310  C  CA  . ILE B 1 493 ? 17.423  28.678  -22.565  1.00 14.56 ? 482  ILE B CA  1 
ATOM   7311  C  C   . ILE B 1 493 ? 17.926  29.999  -21.964  1.00 14.84 ? 482  ILE B C   1 
ATOM   7312  O  O   . ILE B 1 493 ? 18.214  30.912  -22.690  1.00 12.74 ? 482  ILE B O   1 
ATOM   7313  C  CB  . ILE B 1 493 ? 15.901  28.463  -22.292  1.00 13.85 ? 482  ILE B CB  1 
ATOM   7314  C  CG1 . ILE B 1 493 ? 15.395  27.159  -22.904  1.00 13.23 ? 482  ILE B CG1 1 
ATOM   7315  C  CG2 . ILE B 1 493 ? 15.065  29.632  -22.791  1.00 13.11 ? 482  ILE B CG2 1 
ATOM   7316  C  CD1 . ILE B 1 493 ? 15.149  27.231  -24.459  1.00 6.88  ? 482  ILE B CD1 1 
ATOM   7317  N  N   . LYS B 1 494 ? 18.058  30.083  -20.629  1.00 17.10 ? 483  LYS B N   1 
ATOM   7318  C  CA  . LYS B 1 494 ? 18.578  31.284  -19.989  1.00 18.83 ? 483  LYS B CA  1 
ATOM   7319  C  C   . LYS B 1 494 ? 19.977  31.685  -20.465  1.00 19.41 ? 483  LYS B C   1 
ATOM   7320  O  O   . LYS B 1 494 ? 20.226  32.844  -20.732  1.00 21.79 ? 483  LYS B O   1 
ATOM   7321  C  CB  . LYS B 1 494 ? 18.602  31.086  -18.481  1.00 20.64 ? 483  LYS B CB  1 
ATOM   7322  C  CG  . LYS B 1 494 ? 17.242  31.164  -17.868  1.00 23.07 ? 483  LYS B CG  1 
ATOM   7323  C  CD  . LYS B 1 494 ? 17.293  31.087  -16.334  1.00 23.08 ? 483  LYS B CD  1 
ATOM   7324  C  CE  . LYS B 1 494 ? 16.591  29.868  -15.789  1.00 24.55 ? 483  LYS B CE  1 
ATOM   7325  N  NZ  . LYS B 1 494 ? 15.985  30.181  -14.448  1.00 26.91 ? 483  LYS B NZ  1 
ATOM   7326  N  N   . ALA B 1 495 ? 20.884  30.725  -20.598  1.00 20.00 ? 484  ALA B N   1 
ATOM   7327  C  CA  . ALA B 1 495 ? 22.210  31.016  -21.166  1.00 20.39 ? 484  ALA B CA  1 
ATOM   7328  C  C   . ALA B 1 495 ? 22.072  31.642  -22.523  1.00 20.53 ? 484  ALA B C   1 
ATOM   7329  O  O   . ALA B 1 495 ? 22.797  32.559  -22.858  1.00 21.05 ? 484  ALA B O   1 
ATOM   7330  C  CB  . ALA B 1 495 ? 23.085  29.749  -21.254  1.00 18.94 ? 484  ALA B CB  1 
ATOM   7331  N  N   . ARG B 1 496 ? 21.126  31.139  -23.303  1.00 21.57 ? 485  ARG B N   1 
ATOM   7332  C  CA  . ARG B 1 496 ? 21.023  31.493  -24.711  1.00 21.75 ? 485  ARG B CA  1 
ATOM   7333  C  C   . ARG B 1 496 ? 20.479  32.891  -24.906  1.00 23.50 ? 485  ARG B C   1 
ATOM   7334  O  O   . ARG B 1 496 ? 20.915  33.630  -25.798  1.00 25.21 ? 485  ARG B O   1 
ATOM   7335  C  CB  . ARG B 1 496 ? 20.115  30.490  -25.407  1.00 21.40 ? 485  ARG B CB  1 
ATOM   7336  C  CG  . ARG B 1 496 ? 20.751  29.150  -25.593  1.00 17.83 ? 485  ARG B CG  1 
ATOM   7337  C  CD  . ARG B 1 496 ? 19.866  28.144  -26.318  1.00 20.51 ? 485  ARG B CD  1 
ATOM   7338  N  NE  . ARG B 1 496 ? 20.419  26.797  -26.125  1.00 20.43 ? 485  ARG B NE  1 
ATOM   7339  C  CZ  . ARG B 1 496 ? 19.995  25.679  -26.708  1.00 21.16 ? 485  ARG B CZ  1 
ATOM   7340  N  NH1 . ARG B 1 496 ? 18.997  25.684  -27.568  1.00 24.64 ? 485  ARG B NH1 1 
ATOM   7341  N  NH2 . ARG B 1 496 ? 20.615  24.552  -26.452  1.00 22.40 ? 485  ARG B NH2 1 
ATOM   7342  N  N   . SER B 1 497 ? 19.487  33.229  -24.101  1.00 23.82 ? 486  SER B N   1 
ATOM   7343  C  CA  . SER B 1 497 ? 18.972  34.586  -24.026  1.00 26.36 ? 486  SER B CA  1 
ATOM   7344  C  C   . SER B 1 497 ? 20.063  35.615  -23.663  1.00 28.01 ? 486  SER B C   1 
ATOM   7345  O  O   . SER B 1 497 ? 20.028  36.746  -24.132  1.00 28.96 ? 486  SER B O   1 
ATOM   7346  C  CB  . SER B 1 497 ? 17.813  34.643  -23.034  1.00 26.42 ? 486  SER B CB  1 
ATOM   7347  O  OG  . SER B 1 497 ? 16.704  33.916  -23.539  1.00 28.03 ? 486  SER B OG  1 
ATOM   7348  N  N   . ARG B 1 498 ? 21.039  35.212  -22.858  1.00 29.88 ? 487  ARG B N   1 
ATOM   7349  C  CA  . ARG B 1 498 ? 22.211  36.051  -22.596  1.00 31.93 ? 487  ARG B CA  1 
ATOM   7350  C  C   . ARG B 1 498 ? 23.054  36.425  -23.832  1.00 33.58 ? 487  ARG B C   1 
ATOM   7351  O  O   . ARG B 1 498 ? 23.735  37.452  -23.801  1.00 34.22 ? 487  ARG B O   1 
ATOM   7352  C  CB  . ARG B 1 498 ? 23.112  35.412  -21.535  1.00 32.11 ? 487  ARG B CB  1 
ATOM   7353  C  CG  . ARG B 1 498 ? 22.371  35.106  -20.256  1.00 32.31 ? 487  ARG B CG  1 
ATOM   7354  C  CD  . ARG B 1 498 ? 23.279  34.975  -19.034  1.00 33.65 ? 487  ARG B CD  1 
ATOM   7355  N  NE  . ARG B 1 498 ? 22.510  34.537  -17.857  1.00 34.72 ? 487  ARG B NE  1 
ATOM   7356  C  CZ  . ARG B 1 498 ? 22.296  33.261  -17.497  1.00 36.27 ? 487  ARG B CZ  1 
ATOM   7357  N  NH1 . ARG B 1 498 ? 22.801  32.250  -18.193  1.00 34.18 ? 487  ARG B NH1 1 
ATOM   7358  N  NH2 . ARG B 1 498 ? 21.577  32.993  -16.405  1.00 38.28 ? 487  ARG B NH2 1 
ATOM   7359  N  N   . LEU B 1 499 ? 22.999  35.637  -24.912  1.00 34.44 ? 488  LEU B N   1 
ATOM   7360  C  CA  . LEU B 1 499 ? 23.799  35.922  -26.116  1.00 35.56 ? 488  LEU B CA  1 
ATOM   7361  C  C   . LEU B 1 499 ? 23.155  36.973  -27.049  1.00 37.22 ? 488  LEU B C   1 
ATOM   7362  O  O   . LEU B 1 499 ? 21.939  37.195  -27.001  1.00 37.74 ? 488  LEU B O   1 
ATOM   7363  C  CB  . LEU B 1 499 ? 24.056  34.622  -26.896  1.00 35.29 ? 488  LEU B CB  1 
ATOM   7364  C  CG  . LEU B 1 499 ? 24.686  33.477  -26.090  1.00 34.51 ? 488  LEU B CG  1 
ATOM   7365  C  CD1 . LEU B 1 499 ? 24.940  32.271  -26.982  1.00 31.04 ? 488  LEU B CD1 1 
ATOM   7366  C  CD2 . LEU B 1 499 ? 25.966  33.942  -25.390  1.00 31.96 ? 488  LEU B CD2 1 
ATOM   7367  N  N   . ALA B 1 500 ? 23.956  37.590  -27.925  1.00 38.64 ? 489  ALA B N   1 
ATOM   7368  C  CA  . ALA B 1 500 ? 23.480  38.750  -28.725  1.00 39.63 ? 489  ALA B CA  1 
ATOM   7369  C  C   . ALA B 1 500 ? 23.593  38.637  -30.259  1.00 40.97 ? 489  ALA B C   1 
ATOM   7370  O  O   . ALA B 1 500 ? 24.304  39.425  -30.889  1.00 42.44 ? 489  ALA B O   1 
ATOM   7371  C  CB  . ALA B 1 500 ? 24.165  40.035  -28.249  1.00 40.03 ? 489  ALA B CB  1 
ATOM   7372  N  N   . GLU B 1 501 ? 22.847  37.686  -30.832  1.00 41.95 ? 490  GLU B N   1 
ATOM   7373  C  CA  . GLU B 1 501 ? 22.680  37.469  -32.299  1.00 41.27 ? 490  GLU B CA  1 
ATOM   7374  C  C   . GLU B 1 501 ? 23.897  37.689  -33.193  1.00 41.73 ? 490  GLU B C   1 
ATOM   7375  O  O   . GLU B 1 501 ? 23.826  38.304  -34.259  1.00 41.77 ? 490  GLU B O   1 
ATOM   7376  C  CB  . GLU B 1 501 ? 21.503  38.275  -32.844  1.00 41.40 ? 490  GLU B CB  1 
ATOM   7377  C  CG  . GLU B 1 501 ? 20.269  38.167  -32.000  1.00 40.47 ? 490  GLU B CG  1 
ATOM   7378  C  CD  . GLU B 1 501 ? 19.009  38.612  -32.726  1.00 39.86 ? 490  GLU B CD  1 
ATOM   7379  O  OE1 . GLU B 1 501 ? 18.820  38.297  -33.945  1.00 36.82 ? 490  GLU B OE1 1 
ATOM   7380  O  OE2 . GLU B 1 501 ? 18.207  39.273  -32.038  1.00 29.93 ? 490  GLU B OE2 1 
ATOM   7381  O  OXT . GLU B 1 501 ? 24.992  37.237  -32.876  1.00 43.14 ? 490  GLU B OXT 1 
ATOM   7382  N  N   . ASP C 1 26  ? 21.344  -10.261 -90.091  1.00 52.34 ? 15   ASP C N   1 
ATOM   7383  C  CA  . ASP C 1 26  ? 20.870  -10.026 -91.481  1.00 51.32 ? 15   ASP C CA  1 
ATOM   7384  C  C   . ASP C 1 26  ? 19.915  -8.836  -91.492  1.00 50.79 ? 15   ASP C C   1 
ATOM   7385  O  O   . ASP C 1 26  ? 19.776  -8.141  -90.486  1.00 51.32 ? 15   ASP C O   1 
ATOM   7386  C  CB  . ASP C 1 26  ? 20.172  -11.287 -91.992  1.00 52.56 ? 15   ASP C CB  1 
ATOM   7387  C  CG  . ASP C 1 26  ? 20.220  -11.419 -93.501  1.00 53.31 ? 15   ASP C CG  1 
ATOM   7388  O  OD1 . ASP C 1 26  ? 20.734  -10.501 -94.178  1.00 57.12 ? 15   ASP C OD1 1 
ATOM   7389  O  OD2 . ASP C 1 26  ? 19.742  -12.453 -94.011  1.00 56.21 ? 15   ASP C OD2 1 
ATOM   7390  N  N   . ARG C 1 27  ? 19.272  -8.590  -92.629  1.00 49.60 ? 16   ARG C N   1 
ATOM   7391  C  CA  . ARG C 1 27  ? 18.262  -7.533  -92.740  1.00 48.20 ? 16   ARG C CA  1 
ATOM   7392  C  C   . ARG C 1 27  ? 17.042  -7.834  -91.870  1.00 46.58 ? 16   ARG C C   1 
ATOM   7393  O  O   . ARG C 1 27  ? 16.563  -8.977  -91.816  1.00 46.71 ? 16   ARG C O   1 
ATOM   7394  C  CB  . ARG C 1 27  ? 17.829  -7.352  -94.196  1.00 48.19 ? 16   ARG C CB  1 
ATOM   7395  C  CG  . ARG C 1 27  ? 18.930  -6.807  -95.086  1.00 48.88 ? 16   ARG C CG  1 
ATOM   7396  C  CD  . ARG C 1 27  ? 18.594  -7.030  -96.545  1.00 50.51 ? 16   ARG C CD  1 
ATOM   7397  N  NE  . ARG C 1 27  ? 19.193  -6.038  -97.437  1.00 51.83 ? 16   ARG C NE  1 
ATOM   7398  C  CZ  . ARG C 1 27  ? 19.040  -6.046  -98.761  1.00 53.91 ? 16   ARG C CZ  1 
ATOM   7399  N  NH1 . ARG C 1 27  ? 18.308  -6.993  -99.343  1.00 54.95 ? 16   ARG C NH1 1 
ATOM   7400  N  NH2 . ARG C 1 27  ? 19.604  -5.101  -99.505  1.00 53.91 ? 16   ARG C NH2 1 
ATOM   7401  N  N   . LEU C 1 28  ? 16.561  -6.790  -91.192  1.00 44.72 ? 17   LEU C N   1 
ATOM   7402  C  CA  . LEU C 1 28  ? 15.430  -6.875  -90.262  1.00 42.96 ? 17   LEU C CA  1 
ATOM   7403  C  C   . LEU C 1 28  ? 14.848  -5.490  -90.039  1.00 40.77 ? 17   LEU C C   1 
ATOM   7404  O  O   . LEU C 1 28  ? 15.580  -4.512  -90.005  1.00 39.86 ? 17   LEU C O   1 
ATOM   7405  C  CB  . LEU C 1 28  ? 15.885  -7.460  -88.924  1.00 43.08 ? 17   LEU C CB  1 
ATOM   7406  C  CG  . LEU C 1 28  ? 14.813  -7.677  -87.856  1.00 43.40 ? 17   LEU C CG  1 
ATOM   7407  C  CD1 . LEU C 1 28  ? 13.790  -8.709  -88.303  1.00 41.61 ? 17   LEU C CD1 1 
ATOM   7408  C  CD2 . LEU C 1 28  ? 15.481  -8.108  -86.557  1.00 43.08 ? 17   LEU C CD2 1 
ATOM   7409  N  N   . LEU C 1 29  ? 13.526  -5.426  -89.891  1.00 39.00 ? 18   LEU C N   1 
ATOM   7410  C  CA  . LEU C 1 29  ? 12.785  -4.158  -89.760  1.00 37.81 ? 18   LEU C CA  1 
ATOM   7411  C  C   . LEU C 1 29  ? 11.763  -4.267  -88.653  1.00 36.13 ? 18   LEU C C   1 
ATOM   7412  O  O   . LEU C 1 29  ? 10.969  -5.200  -88.652  1.00 36.16 ? 18   LEU C O   1 
ATOM   7413  C  CB  . LEU C 1 29  ? 12.039  -3.833  -91.059  1.00 37.15 ? 18   LEU C CB  1 
ATOM   7414  C  CG  . LEU C 1 29  ? 11.243  -2.528  -91.203  1.00 37.28 ? 18   LEU C CG  1 
ATOM   7415  C  CD1 . LEU C 1 29  ? 12.094  -1.245  -91.118  1.00 32.38 ? 18   LEU C CD1 1 
ATOM   7416  C  CD2 . LEU C 1 29  ? 10.535  -2.596  -92.542  1.00 37.50 ? 18   LEU C CD2 1 
ATOM   7417  N  N   . ILE C 1 30  ? 11.782  -3.323  -87.717  1.00 34.02 ? 19   ILE C N   1 
ATOM   7418  C  CA  . ILE C 1 30  ? 10.693  -3.194  -86.760  1.00 33.64 ? 19   ILE C CA  1 
ATOM   7419  C  C   . ILE C 1 30  ? 9.871   -1.942  -87.096  1.00 33.76 ? 19   ILE C C   1 
ATOM   7420  O  O   . ILE C 1 30  ? 10.402  -0.815  -87.139  1.00 33.45 ? 19   ILE C O   1 
ATOM   7421  C  CB  . ILE C 1 30  ? 11.189  -3.156  -85.289  1.00 32.45 ? 19   ILE C CB  1 
ATOM   7422  C  CG1 . ILE C 1 30  ? 12.221  -4.246  -85.042  1.00 31.70 ? 19   ILE C CG1 1 
ATOM   7423  C  CG2 . ILE C 1 30  ? 10.039  -3.374  -84.350  1.00 32.27 ? 19   ILE C CG2 1 
ATOM   7424  C  CD1 . ILE C 1 30  ? 12.568  -4.403  -83.594  1.00 32.03 ? 19   ILE C CD1 1 
ATOM   7425  N  N   . LYS C 1 31  ? 8.578   -2.159  -87.348  1.00 34.02 ? 20   LYS C N   1 
ATOM   7426  C  CA  . LYS C 1 31  ? 7.626   -1.092  -87.670  1.00 34.09 ? 20   LYS C CA  1 
ATOM   7427  C  C   . LYS C 1 31  ? 6.624   -0.802  -86.545  1.00 33.79 ? 20   LYS C C   1 
ATOM   7428  O  O   . LYS C 1 31  ? 6.133   -1.717  -85.865  1.00 34.44 ? 20   LYS C O   1 
ATOM   7429  C  CB  . LYS C 1 31  ? 6.823   -1.462  -88.916  1.00 34.39 ? 20   LYS C CB  1 
ATOM   7430  C  CG  . LYS C 1 31  ? 7.642   -1.597  -90.150  1.00 34.71 ? 20   LYS C CG  1 
ATOM   7431  C  CD  . LYS C 1 31  ? 6.778   -2.033  -91.320  1.00 36.07 ? 20   LYS C CD  1 
ATOM   7432  C  CE  . LYS C 1 31  ? 5.737   -0.983  -91.716  1.00 37.78 ? 20   LYS C CE  1 
ATOM   7433  N  NZ  . LYS C 1 31  ? 5.237   -1.226  -93.127  1.00 38.46 ? 20   LYS C NZ  1 
ATOM   7434  N  N   . GLY C 1 32  ? 6.315   0.485   -86.388  1.00 32.72 ? 21   GLY C N   1 
ATOM   7435  C  CA  . GLY C 1 32  ? 5.273   0.954   -85.487  1.00 31.87 ? 21   GLY C CA  1 
ATOM   7436  C  C   . GLY C 1 32  ? 5.626   0.938   -84.012  1.00 31.58 ? 21   GLY C C   1 
ATOM   7437  O  O   . GLY C 1 32  ? 4.741   1.093   -83.176  1.00 32.35 ? 21   GLY C O   1 
ATOM   7438  N  N   . GLY C 1 33  ? 6.905   0.768   -83.674  1.00 30.81 ? 22   GLY C N   1 
ATOM   7439  C  CA  . GLY C 1 33  ? 7.321   0.654   -82.264  1.00 29.11 ? 22   GLY C CA  1 
ATOM   7440  C  C   . GLY C 1 33  ? 7.672   1.979   -81.609  1.00 27.81 ? 22   GLY C C   1 
ATOM   7441  O  O   . GLY C 1 33  ? 8.019   2.943   -82.281  1.00 26.57 ? 22   GLY C O   1 
ATOM   7442  N  N   . LYS C 1 34  ? 7.580   2.006   -80.281  1.00 25.73 ? 23   LYS C N   1 
ATOM   7443  C  CA  . LYS C 1 34  ? 8.045   3.133   -79.490  1.00 25.27 ? 23   LYS C CA  1 
ATOM   7444  C  C   . LYS C 1 34  ? 9.520   2.919   -79.026  1.00 24.96 ? 23   LYS C C   1 
ATOM   7445  O  O   . LYS C 1 34  ? 9.826   2.015   -78.221  1.00 23.29 ? 23   LYS C O   1 
ATOM   7446  C  CB  . LYS C 1 34  ? 7.118   3.371   -78.297  1.00 23.31 ? 23   LYS C CB  1 
ATOM   7447  C  CG  . LYS C 1 34  ? 7.319   4.748   -77.646  1.00 24.33 ? 23   LYS C CG  1 
ATOM   7448  C  CD  . LYS C 1 34  ? 6.569   4.930   -76.325  1.00 24.08 ? 23   LYS C CD  1 
ATOM   7449  C  CE  . LYS C 1 34  ? 6.872   3.830   -75.314  1.00 23.05 ? 23   LYS C CE  1 
ATOM   7450  N  NZ  . LYS C 1 34  ? 6.325   4.150   -73.947  1.00 22.55 ? 23   LYS C NZ  1 
ATOM   7451  N  N   . ILE C 1 35  ? 10.410  3.763   -79.566  1.00 25.24 ? 24   ILE C N   1 
ATOM   7452  C  CA  . ILE C 1 35  ? 11.842  3.759   -79.257  1.00 24.84 ? 24   ILE C CA  1 
ATOM   7453  C  C   . ILE C 1 35  ? 12.056  4.409   -77.910  1.00 23.54 ? 24   ILE C C   1 
ATOM   7454  O  O   . ILE C 1 35  ? 11.831  5.593   -77.775  1.00 25.54 ? 24   ILE C O   1 
ATOM   7455  C  CB  . ILE C 1 35  ? 12.669  4.587   -80.275  1.00 25.21 ? 24   ILE C CB  1 
ATOM   7456  C  CG1 . ILE C 1 35  ? 12.691  3.902   -81.656  1.00 28.26 ? 24   ILE C CG1 1 
ATOM   7457  C  CG2 . ILE C 1 35  ? 14.098  4.800   -79.741  1.00 25.18 ? 24   ILE C CG2 1 
ATOM   7458  C  CD1 . ILE C 1 35  ? 13.485  4.676   -82.738  1.00 25.15 ? 24   ILE C CD1 1 
ATOM   7459  N  N   . VAL C 1 36  ? 12.488  3.619   -76.937  1.00 21.90 ? 25   VAL C N   1 
ATOM   7460  C  CA  . VAL C 1 36  ? 12.745  4.054   -75.573  1.00 20.49 ? 25   VAL C CA  1 
ATOM   7461  C  C   . VAL C 1 36  ? 14.239  3.988   -75.324  1.00 19.50 ? 25   VAL C C   1 
ATOM   7462  O  O   . VAL C 1 36  ? 14.795  2.882   -75.274  1.00 21.52 ? 25   VAL C O   1 
ATOM   7463  C  CB  . VAL C 1 36  ? 12.045  3.108   -74.566  1.00 20.58 ? 25   VAL C CB  1 
ATOM   7464  C  CG1 . VAL C 1 36  ? 12.263  3.575   -73.091  1.00 19.27 ? 25   VAL C CG1 1 
ATOM   7465  C  CG2 . VAL C 1 36  ? 10.557  2.942   -74.906  1.00 19.75 ? 25   VAL C CG2 1 
ATOM   7466  N  N   . ASN C 1 37  ? 14.898  5.146   -75.210  1.00 16.99 ? 26   ASN C N   1 
ATOM   7467  C  CA  . ASN C 1 37  ? 16.298  5.209   -74.775  1.00 17.58 ? 26   ASN C CA  1 
ATOM   7468  C  C   . ASN C 1 37  ? 16.347  5.748   -73.357  1.00 15.62 ? 26   ASN C C   1 
ATOM   7469  O  O   . ASN C 1 37  ? 15.321  5.894   -72.726  1.00 13.26 ? 26   ASN C O   1 
ATOM   7470  C  CB  . ASN C 1 37  ? 17.156  6.065   -75.702  1.00 17.34 ? 26   ASN C CB  1 
ATOM   7471  C  CG  . ASN C 1 37  ? 17.591  5.320   -76.933  1.00 18.94 ? 26   ASN C CG  1 
ATOM   7472  O  OD1 . ASN C 1 37  ? 17.993  4.161   -76.852  1.00 19.72 ? 26   ASN C OD1 1 
ATOM   7473  N  ND2 . ASN C 1 37  ? 17.562  5.985   -78.061  1.00 15.22 ? 26   ASN C ND2 1 
ATOM   7474  N  N   . ASP C 1 38  ? 17.527  6.022   -72.857  1.00 15.80 ? 27   ASP C N   1 
ATOM   7475  C  CA  . ASP C 1 38  ? 17.617  6.467   -71.463  1.00 18.50 ? 27   ASP C CA  1 
ATOM   7476  C  C   . ASP C 1 38  ? 17.388  7.978   -71.325  1.00 18.03 ? 27   ASP C C   1 
ATOM   7477  O  O   . ASP C 1 38  ? 17.178  8.478   -70.209  1.00 17.98 ? 27   ASP C O   1 
ATOM   7478  C  CB  . ASP C 1 38  ? 18.943  5.978   -70.822  1.00 18.77 ? 27   ASP C CB  1 
ATOM   7479  C  CG  . ASP C 1 38  ? 20.109  6.929   -71.006  1.00 20.88 ? 27   ASP C CG  1 
ATOM   7480  O  OD1 . ASP C 1 38  ? 20.453  7.285   -72.156  1.00 12.39 ? 27   ASP C OD1 1 
ATOM   7481  O  OD2 . ASP C 1 38  ? 20.723  7.295   -69.973  1.00 17.92 ? 27   ASP C OD2 1 
ATOM   7482  N  N   . ASP C 1 39  ? 17.398  8.685   -72.460  1.00 19.46 ? 28   ASP C N   1 
ATOM   7483  C  CA  . ASP C 1 39  ? 17.224  10.144  -72.525  1.00 20.94 ? 28   ASP C CA  1 
ATOM   7484  C  C   . ASP C 1 39  ? 15.847  10.609  -73.028  1.00 22.25 ? 28   ASP C C   1 
ATOM   7485  O  O   . ASP C 1 39  ? 15.393  11.704  -72.666  1.00 21.49 ? 28   ASP C O   1 
ATOM   7486  C  CB  . ASP C 1 39  ? 18.323  10.767  -73.394  1.00 21.10 ? 28   ASP C CB  1 
ATOM   7487  C  CG  . ASP C 1 39  ? 18.116  10.541  -74.904  1.00 22.78 ? 28   ASP C CG  1 
ATOM   7488  O  OD1 . ASP C 1 39  ? 17.928  9.381   -75.331  1.00 25.96 ? 28   ASP C OD1 1 
ATOM   7489  O  OD2 . ASP C 1 39  ? 18.165  11.542  -75.645  1.00 21.42 ? 28   ASP C OD2 1 
ATOM   7490  N  N   . GLN C 1 40  ? 15.196  9.793   -73.863  1.00 23.25 ? 29   GLN C N   1 
ATOM   7491  C  CA  . GLN C 1 40  ? 13.860  10.111  -74.392  1.00 23.49 ? 29   GLN C CA  1 
ATOM   7492  C  C   . GLN C 1 40  ? 13.230  8.923   -75.120  1.00 23.45 ? 29   GLN C C   1 
ATOM   7493  O  O   . GLN C 1 40  ? 13.941  8.015   -75.574  1.00 24.39 ? 29   GLN C O   1 
ATOM   7494  C  CB  . GLN C 1 40  ? 13.895  11.327  -75.337  1.00 24.36 ? 29   GLN C CB  1 
ATOM   7495  C  CG  . GLN C 1 40  ? 14.524  11.047  -76.703  1.00 25.97 ? 29   GLN C CG  1 
ATOM   7496  C  CD  . GLN C 1 40  ? 14.404  12.200  -77.689  1.00 25.30 ? 29   GLN C CD  1 
ATOM   7497  O  OE1 . GLN C 1 40  ? 15.356  12.525  -78.379  1.00 27.04 ? 29   GLN C OE1 1 
ATOM   7498  N  NE2 . GLN C 1 40  ? 13.232  12.798  -77.772  1.00 29.64 ? 29   GLN C NE2 1 
ATOM   7499  N  N   . SER C 1 41  ? 11.897  8.956   -75.222  1.00 22.76 ? 30   SER C N   1 
ATOM   7500  C  CA  . SER C 1 41  ? 11.143  7.999   -75.988  1.00 22.93 ? 30   SER C CA  1 
ATOM   7501  C  C   . SER C 1 41  ? 10.562  8.726   -77.187  1.00 23.95 ? 30   SER C C   1 
ATOM   7502  O  O   . SER C 1 41  ? 10.258  9.911   -77.119  1.00 25.45 ? 30   SER C O   1 
ATOM   7503  C  CB  . SER C 1 41  ? 10.022  7.376   -75.168  1.00 22.73 ? 30   SER C CB  1 
ATOM   7504  O  OG  . SER C 1 41  ? 10.464  6.963   -73.883  1.00 23.62 ? 30   SER C OG  1 
ATOM   7505  N  N   . PHE C 1 42  ? 10.423  8.019   -78.297  1.00 24.43 ? 31   PHE C N   1 
ATOM   7506  C  CA  . PHE C 1 42  ? 9.788   8.577   -79.493  1.00 24.62 ? 31   PHE C CA  1 
ATOM   7507  C  C   . PHE C 1 42  ? 9.293   7.424   -80.354  1.00 25.14 ? 31   PHE C C   1 
ATOM   7508  O  O   . PHE C 1 42  ? 9.714   6.283   -80.170  1.00 25.48 ? 31   PHE C O   1 
ATOM   7509  C  CB  . PHE C 1 42  ? 10.742  9.500   -80.246  1.00 23.65 ? 31   PHE C CB  1 
ATOM   7510  C  CG  . PHE C 1 42  ? 12.038  8.870   -80.589  1.00 24.21 ? 31   PHE C CG  1 
ATOM   7511  C  CD1 . PHE C 1 42  ? 12.947  8.547   -79.593  1.00 25.92 ? 31   PHE C CD1 1 
ATOM   7512  C  CD2 . PHE C 1 42  ? 12.372  8.593   -81.918  1.00 25.40 ? 31   PHE C CD2 1 
ATOM   7513  C  CE1 . PHE C 1 42  ? 14.145  7.940   -79.885  1.00 25.27 ? 31   PHE C CE1 1 
ATOM   7514  C  CE2 . PHE C 1 42  ? 13.598  7.982   -82.229  1.00 24.64 ? 31   PHE C CE2 1 
ATOM   7515  C  CZ  . PHE C 1 42  ? 14.481  7.648   -81.200  1.00 25.86 ? 31   PHE C CZ  1 
ATOM   7516  N  N   . TYR C 1 43  ? 8.356   7.696   -81.252  1.00 26.66 ? 32   TYR C N   1 
ATOM   7517  C  CA  . TYR C 1 43  ? 7.888   6.680   -82.187  1.00 26.58 ? 32   TYR C CA  1 
ATOM   7518  C  C   . TYR C 1 43  ? 8.680   6.757   -83.472  1.00 26.87 ? 32   TYR C C   1 
ATOM   7519  O  O   . TYR C 1 43  ? 8.717   7.798   -84.124  1.00 26.34 ? 32   TYR C O   1 
ATOM   7520  C  CB  . TYR C 1 43  ? 6.396   6.842   -82.479  1.00 27.73 ? 32   TYR C CB  1 
ATOM   7521  C  CG  . TYR C 1 43  ? 5.547   6.417   -81.322  1.00 27.73 ? 32   TYR C CG  1 
ATOM   7522  C  CD1 . TYR C 1 43  ? 5.145   5.093   -81.185  1.00 28.53 ? 32   TYR C CD1 1 
ATOM   7523  C  CD2 . TYR C 1 43  ? 5.177   7.324   -80.330  1.00 29.66 ? 32   TYR C CD2 1 
ATOM   7524  C  CE1 . TYR C 1 43  ? 4.367   4.686   -80.107  1.00 28.47 ? 32   TYR C CE1 1 
ATOM   7525  C  CE2 . TYR C 1 43  ? 4.404   6.927   -79.245  1.00 28.13 ? 32   TYR C CE2 1 
ATOM   7526  C  CZ  . TYR C 1 43  ? 3.996   5.601   -79.142  1.00 29.07 ? 32   TYR C CZ  1 
ATOM   7527  O  OH  . TYR C 1 43  ? 3.230   5.179   -78.057  1.00 30.27 ? 32   TYR C OH  1 
ATOM   7528  N  N   . ALA C 1 44  ? 9.328   5.646   -83.817  1.00 27.92 ? 33   ALA C N   1 
ATOM   7529  C  CA  . ALA C 1 44  ? 9.984   5.485   -85.110  1.00 28.03 ? 33   ALA C CA  1 
ATOM   7530  C  C   . ALA C 1 44  ? 10.189  3.995   -85.408  1.00 29.21 ? 33   ALA C C   1 
ATOM   7531  O  O   . ALA C 1 44  ? 10.136  3.129   -84.497  1.00 29.92 ? 33   ALA C O   1 
ATOM   7532  C  CB  . ALA C 1 44  ? 11.302  6.226   -85.126  1.00 28.66 ? 33   ALA C CB  1 
ATOM   7533  N  N   . ASP C 1 45  ? 10.386  3.705   -86.687  1.00 28.92 ? 34   ASP C N   1 
ATOM   7534  C  CA  . ASP C 1 45  ? 10.698  2.366   -87.148  1.00 28.43 ? 34   ASP C CA  1 
ATOM   7535  C  C   . ASP C 1 45  ? 12.224  2.196   -87.075  1.00 28.62 ? 34   ASP C C   1 
ATOM   7536  O  O   . ASP C 1 45  ? 12.970  3.183   -87.076  1.00 27.57 ? 34   ASP C O   1 
ATOM   7537  C  CB  . ASP C 1 45  ? 10.223  2.153   -88.596  1.00 27.60 ? 34   ASP C CB  1 
ATOM   7538  C  CG  . ASP C 1 45  ? 8.746   2.452   -88.804  1.00 26.76 ? 34   ASP C CG  1 
ATOM   7539  O  OD1 . ASP C 1 45  ? 7.964   2.530   -87.834  1.00 21.55 ? 34   ASP C OD1 1 
ATOM   7540  O  OD2 . ASP C 1 45  ? 8.362   2.613   -89.976  1.00 23.17 ? 34   ASP C OD2 1 
ATOM   7541  N  N   . ILE C 1 46  ? 12.679  0.941   -87.043  1.00 29.41 ? 35   ILE C N   1 
ATOM   7542  C  CA  . ILE C 1 46  ? 14.093  0.609   -86.849  1.00 29.67 ? 35   ILE C CA  1 
ATOM   7543  C  C   . ILE C 1 46  ? 14.545  -0.468  -87.825  1.00 30.39 ? 35   ILE C C   1 
ATOM   7544  O  O   . ILE C 1 46  ? 14.097  -1.615  -87.772  1.00 30.48 ? 35   ILE C O   1 
ATOM   7545  C  CB  . ILE C 1 46  ? 14.384  0.057   -85.433  1.00 29.70 ? 35   ILE C CB  1 
ATOM   7546  C  CG1 . ILE C 1 46  ? 13.674  0.862   -84.349  1.00 30.19 ? 35   ILE C CG1 1 
ATOM   7547  C  CG2 . ILE C 1 46  ? 15.889  0.036   -85.184  1.00 29.78 ? 35   ILE C CG2 1 
ATOM   7548  C  CD1 . ILE C 1 46  ? 13.831  0.262   -82.972  1.00 28.70 ? 35   ILE C CD1 1 
ATOM   7549  N  N   . TYR C 1 47  ? 15.450  -0.078  -88.703  1.00 31.37 ? 36   TYR C N   1 
ATOM   7550  C  CA  . TYR C 1 47  ? 16.007  -0.962  -89.694  1.00 31.81 ? 36   TYR C CA  1 
ATOM   7551  C  C   . TYR C 1 47  ? 17.459  -1.264  -89.368  1.00 32.09 ? 36   TYR C C   1 
ATOM   7552  O  O   . TYR C 1 47  ? 18.302  -0.364  -89.236  1.00 30.88 ? 36   TYR C O   1 
ATOM   7553  C  CB  . TYR C 1 47  ? 15.916  -0.343  -91.084  1.00 32.25 ? 36   TYR C CB  1 
ATOM   7554  C  CG  . TYR C 1 47  ? 16.542  -1.224  -92.100  1.00 32.04 ? 36   TYR C CG  1 
ATOM   7555  C  CD1 . TYR C 1 47  ? 15.973  -2.455  -92.406  1.00 33.87 ? 36   TYR C CD1 1 
ATOM   7556  C  CD2 . TYR C 1 47  ? 17.732  -0.872  -92.715  1.00 32.22 ? 36   TYR C CD2 1 
ATOM   7557  C  CE1 . TYR C 1 47  ? 16.563  -3.311  -93.325  1.00 34.62 ? 36   TYR C CE1 1 
ATOM   7558  C  CE2 . TYR C 1 47  ? 18.327  -1.718  -93.641  1.00 32.87 ? 36   TYR C CE2 1 
ATOM   7559  C  CZ  . TYR C 1 47  ? 17.734  -2.933  -93.940  1.00 32.35 ? 36   TYR C CZ  1 
ATOM   7560  O  OH  . TYR C 1 47  ? 18.300  -3.788  -94.845  1.00 32.61 ? 36   TYR C OH  1 
ATOM   7561  N  N   . MET C 1 48  ? 17.728  -2.555  -89.252  1.00 33.32 ? 37   MET C N   1 
ATOM   7562  C  CA  . MET C 1 48  ? 19.035  -3.062  -88.939  1.00 34.89 ? 37   MET C CA  1 
ATOM   7563  C  C   . MET C 1 48  ? 19.492  -3.948  -90.092  1.00 35.39 ? 37   MET C C   1 
ATOM   7564  O  O   . MET C 1 48  ? 18.677  -4.408  -90.908  1.00 34.58 ? 37   MET C O   1 
ATOM   7565  C  CB  . MET C 1 48  ? 18.978  -3.866  -87.648  1.00 34.82 ? 37   MET C CB  1 
ATOM   7566  C  CG  . MET C 1 48  ? 18.279  -3.170  -86.479  1.00 34.57 ? 37   MET C CG  1 
ATOM   7567  S  SD  . MET C 1 48  ? 17.488  -4.366  -85.371  1.00 38.39 ? 37   MET C SD  1 
ATOM   7568  C  CE  . MET C 1 48  ? 15.812  -4.365  -86.004  1.00 31.70 ? 37   MET C CE  1 
ATOM   7569  N  N   . GLU C 1 49  ? 20.797  -4.179  -90.148  1.00 37.07 ? 38   GLU C N   1 
ATOM   7570  C  CA  . GLU C 1 49  ? 21.410  -4.895  -91.252  1.00 37.94 ? 38   GLU C CA  1 
ATOM   7571  C  C   . GLU C 1 49  ? 22.842  -5.272  -90.903  1.00 38.60 ? 38   GLU C C   1 
ATOM   7572  O  O   . GLU C 1 49  ? 23.707  -4.411  -90.703  1.00 39.33 ? 38   GLU C O   1 
ATOM   7573  C  CB  . GLU C 1 49  ? 21.367  -4.032  -92.510  1.00 38.79 ? 38   GLU C CB  1 
ATOM   7574  C  CG  . GLU C 1 49  ? 22.265  -4.483  -93.674  1.00 39.15 ? 38   GLU C CG  1 
ATOM   7575  C  CD  . GLU C 1 49  ? 21.917  -3.766  -94.987  1.00 40.57 ? 38   GLU C CD  1 
ATOM   7576  O  OE1 . GLU C 1 49  ? 22.827  -3.156  -95.614  1.00 43.00 ? 38   GLU C OE1 1 
ATOM   7577  O  OE2 . GLU C 1 49  ? 20.727  -3.815  -95.381  1.00 42.30 ? 38   GLU C OE2 1 
ATOM   7578  N  N   . ASP C 1 50  ? 23.080  -6.577  -90.824  1.00 39.07 ? 39   ASP C N   1 
ATOM   7579  C  CA  . ASP C 1 50  ? 24.405  -7.118  -90.556  1.00 38.84 ? 39   ASP C CA  1 
ATOM   7580  C  C   . ASP C 1 50  ? 24.959  -6.545  -89.242  1.00 38.73 ? 39   ASP C C   1 
ATOM   7581  O  O   . ASP C 1 50  ? 26.032  -5.931  -89.187  1.00 39.69 ? 39   ASP C O   1 
ATOM   7582  C  CB  . ASP C 1 50  ? 25.310  -6.917  -91.779  1.00 39.80 ? 39   ASP C CB  1 
ATOM   7583  C  CG  . ASP C 1 50  ? 24.723  -7.576  -93.051  1.00 40.80 ? 39   ASP C CG  1 
ATOM   7584  O  OD1 . ASP C 1 50  ? 23.678  -8.257  -92.948  1.00 41.18 ? 39   ASP C OD1 1 
ATOM   7585  O  OD2 . ASP C 1 50  ? 25.288  -7.408  -94.155  1.00 43.93 ? 39   ASP C OD2 1 
ATOM   7586  N  N   . GLY C 1 51  ? 24.170  -6.751  -88.191  1.00 37.70 ? 40   GLY C N   1 
ATOM   7587  C  CA  . GLY C 1 51  ? 24.579  -6.484  -86.828  1.00 37.41 ? 40   GLY C CA  1 
ATOM   7588  C  C   . GLY C 1 51  ? 24.286  -5.107  -86.275  1.00 36.90 ? 40   GLY C C   1 
ATOM   7589  O  O   . GLY C 1 51  ? 24.332  -4.924  -85.055  1.00 36.67 ? 40   GLY C O   1 
ATOM   7590  N  N   . LEU C 1 52  ? 23.983  -4.143  -87.141  1.00 36.22 ? 41   LEU C N   1 
ATOM   7591  C  CA  . LEU C 1 52  ? 23.883  -2.741  -86.720  1.00 36.46 ? 41   LEU C CA  1 
ATOM   7592  C  C   . LEU C 1 52  ? 22.566  -2.083  -87.130  1.00 36.18 ? 41   LEU C C   1 
ATOM   7593  O  O   . LEU C 1 52  ? 21.905  -2.521  -88.059  1.00 36.92 ? 41   LEU C O   1 
ATOM   7594  C  CB  . LEU C 1 52  ? 25.076  -1.951  -87.271  1.00 36.27 ? 41   LEU C CB  1 
ATOM   7595  C  CG  . LEU C 1 52  ? 26.441  -2.640  -87.067  1.00 35.72 ? 41   LEU C CG  1 
ATOM   7596  C  CD1 . LEU C 1 52  ? 27.583  -1.789  -87.588  1.00 33.13 ? 41   LEU C CD1 1 
ATOM   7597  C  CD2 . LEU C 1 52  ? 26.686  -2.978  -85.590  1.00 36.91 ? 41   LEU C CD2 1 
ATOM   7598  N  N   . ILE C 1 53  ? 22.196  -1.030  -86.414  1.00 35.82 ? 42   ILE C N   1 
ATOM   7599  C  CA  . ILE C 1 53  ? 21.004  -0.246  -86.720  1.00 36.14 ? 42   ILE C CA  1 
ATOM   7600  C  C   . ILE C 1 53  ? 21.413  0.751   -87.777  1.00 36.55 ? 42   ILE C C   1 
ATOM   7601  O  O   . ILE C 1 53  ? 22.334  1.520   -87.549  1.00 37.94 ? 42   ILE C O   1 
ATOM   7602  C  CB  . ILE C 1 53  ? 20.509  0.552   -85.484  1.00 35.91 ? 42   ILE C CB  1 
ATOM   7603  C  CG1 . ILE C 1 53  ? 20.198  -0.379  -84.301  1.00 34.62 ? 42   ILE C CG1 1 
ATOM   7604  C  CG2 . ILE C 1 53  ? 19.288  1.361   -85.843  1.00 35.78 ? 42   ILE C CG2 1 
ATOM   7605  C  CD1 . ILE C 1 53  ? 20.277  0.308   -82.940  1.00 34.63 ? 42   ILE C CD1 1 
ATOM   7606  N  N   . LYS C 1 54  ? 20.760  0.730   -88.931  1.00 37.22 ? 43   LYS C N   1 
ATOM   7607  C  CA  . LYS C 1 54  ? 21.161  1.579   -90.058  1.00 37.34 ? 43   LYS C CA  1 
ATOM   7608  C  C   . LYS C 1 54  ? 20.294  2.819   -90.142  1.00 37.52 ? 43   LYS C C   1 
ATOM   7609  O  O   . LYS C 1 54  ? 20.797  3.924   -90.397  1.00 37.46 ? 43   LYS C O   1 
ATOM   7610  C  CB  . LYS C 1 54  ? 21.029  0.828   -91.390  1.00 38.54 ? 43   LYS C CB  1 
ATOM   7611  C  CG  . LYS C 1 54  ? 21.838  -0.444  -91.519  1.00 39.66 ? 43   LYS C CG  1 
ATOM   7612  C  CD  . LYS C 1 54  ? 23.328  -0.186  -91.361  1.00 41.71 ? 43   LYS C CD  1 
ATOM   7613  C  CE  . LYS C 1 54  ? 24.171  -1.417  -91.661  1.00 42.44 ? 43   LYS C CE  1 
ATOM   7614  N  NZ  . LYS C 1 54  ? 24.318  -1.663  -93.142  1.00 44.95 ? 43   LYS C NZ  1 
ATOM   7615  N  N   . GLN C 1 55  ? 18.988  2.620   -89.951  1.00 37.46 ? 44   GLN C N   1 
ATOM   7616  C  CA  A GLN C 1 55  ? 18.002  3.685   -90.115  0.50 36.94 ? 44   GLN C CA  1 
ATOM   7617  C  CA  B GLN C 1 55  ? 18.032  3.693   -90.097  0.50 37.10 ? 44   GLN C CA  1 
ATOM   7618  C  C   . GLN C 1 55  ? 17.028  3.737   -88.952  1.00 36.87 ? 44   GLN C C   1 
ATOM   7619  O  O   . GLN C 1 55  ? 16.623  2.712   -88.430  1.00 36.44 ? 44   GLN C O   1 
ATOM   7620  C  CB  A GLN C 1 55  ? 17.207  3.503   -91.412  0.50 36.71 ? 44   GLN C CB  1 
ATOM   7621  C  CB  B GLN C 1 55  ? 17.301  3.555   -91.429  0.50 36.97 ? 44   GLN C CB  1 
ATOM   7622  C  CG  A GLN C 1 55  ? 18.071  3.345   -92.649  0.50 36.42 ? 44   GLN C CG  1 
ATOM   7623  C  CG  B GLN C 1 55  ? 16.421  4.744   -91.745  0.50 37.10 ? 44   GLN C CG  1 
ATOM   7624  C  CD  A GLN C 1 55  ? 17.341  3.661   -93.945  0.50 36.51 ? 44   GLN C CD  1 
ATOM   7625  C  CD  B GLN C 1 55  ? 16.479  5.164   -93.198  0.50 37.71 ? 44   GLN C CD  1 
ATOM   7626  O  OE1 A GLN C 1 55  ? 16.567  4.611   -94.027  0.50 38.90 ? 44   GLN C OE1 1 
ATOM   7627  O  OE1 B GLN C 1 55  ? 16.760  4.355   -94.094  0.50 38.51 ? 44   GLN C OE1 1 
ATOM   7628  N  NE2 A GLN C 1 55  ? 17.609  2.875   -94.972  0.50 35.20 ? 44   GLN C NE2 1 
ATOM   7629  N  NE2 B GLN C 1 55  ? 16.210  6.440   -93.441  0.50 36.54 ? 44   GLN C NE2 1 
ATOM   7630  N  N   . ILE C 1 56  ? 16.666  4.953   -88.565  1.00 36.70 ? 45   ILE C N   1 
ATOM   7631  C  CA  . ILE C 1 56  ? 15.608  5.194   -87.613  1.00 36.66 ? 45   ILE C CA  1 
ATOM   7632  C  C   . ILE C 1 56  ? 14.827  6.351   -88.205  1.00 37.36 ? 45   ILE C C   1 
ATOM   7633  O  O   . ILE C 1 56  ? 15.413  7.259   -88.788  1.00 37.31 ? 45   ILE C O   1 
ATOM   7634  C  CB  . ILE C 1 56  ? 16.131  5.559   -86.204  1.00 35.57 ? 45   ILE C CB  1 
ATOM   7635  C  CG1 . ILE C 1 56  ? 16.938  4.409   -85.614  1.00 33.24 ? 45   ILE C CG1 1 
ATOM   7636  C  CG2 . ILE C 1 56  ? 14.978  5.858   -85.281  1.00 35.78 ? 45   ILE C CG2 1 
ATOM   7637  C  CD1 . ILE C 1 56  ? 17.700  4.781   -84.421  1.00 34.13 ? 45   ILE C CD1 1 
ATOM   7638  N  N   . GLY C 1 57  ? 13.510  6.293   -88.065  1.00 39.07 ? 46   GLY C N   1 
ATOM   7639  C  CA  . GLY C 1 57  ? 12.599  7.273   -88.642  1.00 40.81 ? 46   GLY C CA  1 
ATOM   7640  C  C   . GLY C 1 57  ? 11.302  6.609   -89.070  1.00 42.19 ? 46   GLY C C   1 
ATOM   7641  O  O   . GLY C 1 57  ? 11.131  5.392   -88.920  1.00 41.54 ? 46   GLY C O   1 
ATOM   7642  N  N   . GLU C 1 58  ? 10.394  7.414   -89.607  1.00 44.29 ? 47   GLU C N   1 
ATOM   7643  C  CA  . GLU C 1 58  ? 9.114   6.918   -90.118  1.00 46.25 ? 47   GLU C CA  1 
ATOM   7644  C  C   . GLU C 1 58  ? 9.141   6.853   -91.646  1.00 46.88 ? 47   GLU C C   1 
ATOM   7645  O  O   . GLU C 1 58  ? 9.803   7.668   -92.294  1.00 46.64 ? 47   GLU C O   1 
ATOM   7646  C  CB  . GLU C 1 58  ? 7.970   7.801   -89.626  1.00 47.29 ? 47   GLU C CB  1 
ATOM   7647  C  CG  . GLU C 1 58  ? 8.125   9.297   -89.973  1.00 49.33 ? 47   GLU C CG  1 
ATOM   7648  C  CD  . GLU C 1 58  ? 7.823   10.199  -88.787  1.00 49.46 ? 47   GLU C CD  1 
ATOM   7649  O  OE1 . GLU C 1 58  ? 8.536   10.077  -87.756  1.00 55.10 ? 47   GLU C OE1 1 
ATOM   7650  O  OE2 . GLU C 1 58  ? 6.885   11.026  -88.886  1.00 52.63 ? 47   GLU C OE2 1 
ATOM   7651  N  N   . ASN C 1 59  ? 8.415   5.879   -92.204  1.00 47.69 ? 48   ASN C N   1 
ATOM   7652  C  CA  . ASN C 1 59  ? 8.460   5.548   -93.642  1.00 48.39 ? 48   ASN C CA  1 
ATOM   7653  C  C   . ASN C 1 59  ? 9.889   5.476   -94.189  1.00 48.78 ? 48   ASN C C   1 
ATOM   7654  O  O   . ASN C 1 59  ? 10.319  6.347   -94.950  1.00 48.67 ? 48   ASN C O   1 
ATOM   7655  C  CB  . ASN C 1 59  ? 7.618   6.534   -94.468  1.00 49.23 ? 48   ASN C CB  1 
ATOM   7656  C  CG  . ASN C 1 59  ? 6.112   6.400   -94.208  1.00 50.12 ? 48   ASN C CG  1 
ATOM   7657  O  OD1 . ASN C 1 59  ? 5.649   6.514   -93.067  1.00 52.51 ? 48   ASN C OD1 1 
ATOM   7658  N  ND2 . ASN C 1 59  ? 5.344   6.169   -95.275  1.00 50.95 ? 48   ASN C ND2 1 
ATOM   7659  N  N   . LEU C 1 60  ? 10.619  4.434   -93.787  1.00 49.36 ? 49   LEU C N   1 
ATOM   7660  C  CA  . LEU C 1 60  ? 12.036  4.277   -94.156  1.00 49.59 ? 49   LEU C CA  1 
ATOM   7661  C  C   . LEU C 1 60  ? 12.189  3.619   -95.528  1.00 50.54 ? 49   LEU C C   1 
ATOM   7662  O  O   . LEU C 1 60  ? 11.369  2.786   -95.928  1.00 50.52 ? 49   LEU C O   1 
ATOM   7663  C  CB  . LEU C 1 60  ? 12.779  3.432   -93.115  1.00 48.38 ? 49   LEU C CB  1 
ATOM   7664  C  CG  . LEU C 1 60  ? 12.622  3.826   -91.651  1.00 46.08 ? 49   LEU C CG  1 
ATOM   7665  C  CD1 . LEU C 1 60  ? 13.369  2.848   -90.763  1.00 44.72 ? 49   LEU C CD1 1 
ATOM   7666  C  CD2 . LEU C 1 60  ? 13.103  5.240   -91.433  1.00 45.46 ? 49   LEU C CD2 1 
ATOM   7667  N  N   . ILE C 1 61  ? 13.235  3.989   -96.254  1.00 51.50 ? 50   ILE C N   1 
ATOM   7668  C  CA  . ILE C 1 61  ? 13.586  3.235   -97.440  1.00 52.34 ? 50   ILE C CA  1 
ATOM   7669  C  C   . ILE C 1 61  ? 14.324  1.999   -96.953  1.00 53.34 ? 50   ILE C C   1 
ATOM   7670  O  O   . ILE C 1 61  ? 15.241  2.087   -96.128  1.00 53.38 ? 50   ILE C O   1 
ATOM   7671  C  CB  . ILE C 1 61  ? 14.432  4.042   -98.444  1.00 52.57 ? 50   ILE C CB  1 
ATOM   7672  C  CG1 . ILE C 1 61  ? 13.627  5.241   -98.938  1.00 52.75 ? 50   ILE C CG1 1 
ATOM   7673  C  CG2 . ILE C 1 61  ? 14.859  3.168   -99.625  1.00 51.77 ? 50   ILE C CG2 1 
ATOM   7674  C  CD1 . ILE C 1 61  ? 12.221  4.886   -99.348  1.00 52.72 ? 50   ILE C CD1 1 
ATOM   7675  N  N   . VAL C 1 62  ? 13.866  0.853   -97.450  1.00 54.03 ? 51   VAL C N   1 
ATOM   7676  C  CA  . VAL C 1 62  ? 14.370  -0.457  -97.073  1.00 53.79 ? 51   VAL C CA  1 
ATOM   7677  C  C   . VAL C 1 62  ? 14.232  -1.361  -98.304  1.00 54.59 ? 51   VAL C C   1 
ATOM   7678  O  O   . VAL C 1 62  ? 13.315  -1.163  -99.114  1.00 54.98 ? 51   VAL C O   1 
ATOM   7679  C  CB  . VAL C 1 62  ? 13.571  -1.013  -95.872  1.00 53.60 ? 51   VAL C CB  1 
ATOM   7680  C  CG1 . VAL C 1 62  ? 13.419  -2.523  -95.950  1.00 53.46 ? 51   VAL C CG1 1 
ATOM   7681  C  CG2 . VAL C 1 62  ? 14.226  -0.602  -94.579  1.00 52.72 ? 51   VAL C CG2 1 
ATOM   7682  N  N   . PRO C 1 63  ? 15.152  -2.337  -98.465  1.00 54.95 ? 52   PRO C N   1 
ATOM   7683  C  CA  . PRO C 1 63  ? 15.141  -3.306  -99.573  1.00 54.45 ? 52   PRO C CA  1 
ATOM   7684  C  C   . PRO C 1 63  ? 13.818  -4.065  -99.771  1.00 54.62 ? 52   PRO C C   1 
ATOM   7685  O  O   . PRO C 1 63  ? 12.783  -3.688  -99.208  1.00 54.73 ? 52   PRO C O   1 
ATOM   7686  C  CB  . PRO C 1 63  ? 16.255  -4.285  -99.188  1.00 54.70 ? 52   PRO C CB  1 
ATOM   7687  C  CG  . PRO C 1 63  ? 17.151  -3.515  -98.300  1.00 54.76 ? 52   PRO C CG  1 
ATOM   7688  C  CD  . PRO C 1 63  ? 16.312  -2.539  -97.574  1.00 54.73 ? 52   PRO C CD  1 
ATOM   7689  N  N   . GLY C 1 64  ? 13.868  -5.126  -100.581 1.00 54.28 ? 53   GLY C N   1 
ATOM   7690  C  CA  . GLY C 1 64  ? 12.685  -5.946  -100.885 1.00 53.49 ? 53   GLY C CA  1 
ATOM   7691  C  C   . GLY C 1 64  ? 12.587  -7.201  -100.036 1.00 52.76 ? 53   GLY C C   1 
ATOM   7692  O  O   . GLY C 1 64  ? 11.485  -7.630  -99.670  1.00 51.72 ? 53   GLY C O   1 
ATOM   7693  N  N   . GLY C 1 65  ? 13.744  -7.802  -99.754  1.00 52.24 ? 54   GLY C N   1 
ATOM   7694  C  CA  . GLY C 1 65  ? 13.818  -9.003  -98.928  1.00 51.74 ? 54   GLY C CA  1 
ATOM   7695  C  C   . GLY C 1 65  ? 14.221  -8.680  -97.503  1.00 51.22 ? 54   GLY C C   1 
ATOM   7696  O  O   . GLY C 1 65  ? 15.282  -9.104  -97.036  1.00 51.43 ? 54   GLY C O   1 
ATOM   7697  N  N   . VAL C 1 66  ? 13.373  -7.914  -96.819  1.00 50.23 ? 55   VAL C N   1 
ATOM   7698  C  CA  . VAL C 1 66  ? 13.605  -7.542  -95.424  1.00 49.16 ? 55   VAL C CA  1 
ATOM   7699  C  C   . VAL C 1 66  ? 12.546  -8.176  -94.531  1.00 47.95 ? 55   VAL C C   1 
ATOM   7700  O  O   . VAL C 1 66  ? 11.350  -7.935  -94.711  1.00 46.86 ? 55   VAL C O   1 
ATOM   7701  C  CB  . VAL C 1 66  ? 13.594  -6.005  -95.237  1.00 49.22 ? 55   VAL C CB  1 
ATOM   7702  C  CG1 . VAL C 1 66  ? 13.777  -5.638  -93.772  1.00 49.26 ? 55   VAL C CG1 1 
ATOM   7703  C  CG2 . VAL C 1 66  ? 14.682  -5.362  -96.083  1.00 49.76 ? 55   VAL C CG2 1 
ATOM   7704  N  N   . LYS C 1 67  ? 12.988  -8.997  -93.579  1.00 47.33 ? 56   LYS C N   1 
ATOM   7705  C  CA  . LYS C 1 67  ? 12.092  -9.505  -92.556  1.00 47.10 ? 56   LYS C CA  1 
ATOM   7706  C  C   . LYS C 1 67  ? 11.502  -8.285  -91.892  1.00 46.53 ? 56   LYS C C   1 
ATOM   7707  O  O   . LYS C 1 67  ? 12.228  -7.339  -91.580  1.00 46.58 ? 56   LYS C O   1 
ATOM   7708  C  CB  . LYS C 1 67  ? 12.833  -10.353 -91.520  1.00 47.54 ? 56   LYS C CB  1 
ATOM   7709  C  CG  . LYS C 1 67  ? 11.981  -10.781 -90.311  1.00 48.10 ? 56   LYS C CG  1 
ATOM   7710  C  CD  . LYS C 1 67  ? 10.925  -11.827 -90.683  1.00 49.80 ? 56   LYS C CD  1 
ATOM   7711  C  CE  . LYS C 1 67  ? 10.539  -12.707 -89.480  1.00 49.90 ? 56   LYS C CE  1 
ATOM   7712  N  NZ  . LYS C 1 67  ? 9.475   -13.734 -89.795  1.00 50.78 ? 56   LYS C NZ  1 
ATOM   7713  N  N   . THR C 1 68  ? 10.188  -8.300  -91.699  1.00 45.73 ? 57   THR C N   1 
ATOM   7714  C  CA  . THR C 1 68  ? 9.491   -7.172  -91.094  1.00 45.08 ? 57   THR C CA  1 
ATOM   7715  C  C   . THR C 1 68  ? 8.677   -7.610  -89.899  1.00 43.86 ? 57   THR C C   1 
ATOM   7716  O  O   . THR C 1 68  ? 7.776   -8.431  -90.037  1.00 44.32 ? 57   THR C O   1 
ATOM   7717  C  CB  . THR C 1 68  ? 8.567   -6.470  -92.102  1.00 45.33 ? 57   THR C CB  1 
ATOM   7718  O  OG1 . THR C 1 68  ? 9.347   -5.551  -92.877  1.00 47.22 ? 57   THR C OG1 1 
ATOM   7719  C  CG2 . THR C 1 68  ? 7.432   -5.707  -91.381  1.00 45.50 ? 57   THR C CG2 1 
ATOM   7720  N  N   . ILE C 1 69  ? 9.020   -7.050  -88.737  1.00 42.77 ? 58   ILE C N   1 
ATOM   7721  C  CA  . ILE C 1 69  ? 8.304   -7.255  -87.482  1.00 41.60 ? 58   ILE C CA  1 
ATOM   7722  C  C   . ILE C 1 69  ? 7.409   -6.052  -87.223  1.00 40.22 ? 58   ILE C C   1 
ATOM   7723  O  O   . ILE C 1 69  ? 7.829   -4.931  -87.413  1.00 39.46 ? 58   ILE C O   1 
ATOM   7724  C  CB  . ILE C 1 69  ? 9.287   -7.405  -86.295  1.00 41.86 ? 58   ILE C CB  1 
ATOM   7725  C  CG1 . ILE C 1 69  ? 10.027  -8.742  -86.371  1.00 40.72 ? 58   ILE C CG1 1 
ATOM   7726  C  CG2 . ILE C 1 69  ? 8.549   -7.280  -84.948  1.00 42.40 ? 58   ILE C CG2 1 
ATOM   7727  C  CD1 . ILE C 1 69  ? 10.762  -9.089  -85.111  1.00 40.86 ? 58   ILE C CD1 1 
ATOM   7728  N  N   . GLU C 1 70  ? 6.175   -6.305  -86.798  1.00 40.15 ? 59   GLU C N   1 
ATOM   7729  C  CA  . GLU C 1 70  ? 5.228   -5.255  -86.436  1.00 40.06 ? 59   GLU C CA  1 
ATOM   7730  C  C   . GLU C 1 70  ? 5.178   -5.036  -84.923  1.00 39.77 ? 59   GLU C C   1 
ATOM   7731  O  O   . GLU C 1 70  ? 4.712   -5.897  -84.176  1.00 40.35 ? 59   GLU C O   1 
ATOM   7732  C  CB  . GLU C 1 70  ? 3.834   -5.600  -86.937  1.00 40.45 ? 59   GLU C CB  1 
ATOM   7733  C  CG  . GLU C 1 70  ? 3.588   -5.145  -88.360  1.00 41.54 ? 59   GLU C CG  1 
ATOM   7734  C  CD  . GLU C 1 70  ? 3.391   -3.642  -88.492  1.00 42.65 ? 59   GLU C CD  1 
ATOM   7735  O  OE1 . GLU C 1 70  ? 3.180   -2.952  -87.460  1.00 40.94 ? 59   GLU C OE1 1 
ATOM   7736  O  OE2 . GLU C 1 70  ? 3.440   -3.160  -89.656  1.00 45.28 ? 59   GLU C OE2 1 
ATOM   7737  N  N   . ALA C 1 71  ? 5.643   -3.869  -84.486  1.00 38.97 ? 60   ALA C N   1 
ATOM   7738  C  CA  . ALA C 1 71  ? 5.757   -3.573  -83.063  1.00 38.55 ? 60   ALA C CA  1 
ATOM   7739  C  C   . ALA C 1 71  ? 4.405   -3.204  -82.474  1.00 37.96 ? 60   ALA C C   1 
ATOM   7740  O  O   . ALA C 1 71  ? 4.167   -3.439  -81.293  1.00 37.35 ? 60   ALA C O   1 
ATOM   7741  C  CB  . ALA C 1 71  ? 6.776   -2.456  -82.832  1.00 38.46 ? 60   ALA C CB  1 
ATOM   7742  N  N   . HIS C 1 72  ? 3.519   -2.649  -83.304  1.00 37.75 ? 61   HIS C N   1 
ATOM   7743  C  CA  . HIS C 1 72  ? 2.192   -2.184  -82.859  1.00 37.70 ? 61   HIS C CA  1 
ATOM   7744  C  C   . HIS C 1 72  ? 2.311   -1.176  -81.710  1.00 36.83 ? 61   HIS C C   1 
ATOM   7745  O  O   . HIS C 1 72  ? 1.766   -1.392  -80.627  1.00 35.43 ? 61   HIS C O   1 
ATOM   7746  C  CB  . HIS C 1 72  ? 1.297   -3.361  -82.432  1.00 38.46 ? 61   HIS C CB  1 
ATOM   7747  C  CG  . HIS C 1 72  ? 1.022   -4.355  -83.521  1.00 40.22 ? 61   HIS C CG  1 
ATOM   7748  N  ND1 . HIS C 1 72  ? 1.653   -5.581  -83.586  1.00 40.52 ? 61   HIS C ND1 1 
ATOM   7749  C  CD2 . HIS C 1 72  ? 0.164   -4.317  -84.570  1.00 39.95 ? 61   HIS C CD2 1 
ATOM   7750  C  CE1 . HIS C 1 72  ? 1.206   -6.247  -84.636  1.00 39.96 ? 61   HIS C CE1 1 
ATOM   7751  N  NE2 . HIS C 1 72  ? 0.303   -5.503  -85.250  1.00 39.80 ? 61   HIS C NE2 1 
ATOM   7752  N  N   . SER C 1 73  ? 3.053   -0.097  -81.968  1.00 36.86 ? 62   SER C N   1 
ATOM   7753  C  CA  . SER C 1 73  ? 3.326   0.995   -80.999  1.00 36.39 ? 62   SER C CA  1 
ATOM   7754  C  C   . SER C 1 73  ? 3.893   0.542   -79.658  1.00 36.15 ? 62   SER C C   1 
ATOM   7755  O  O   . SER C 1 73  ? 3.734   1.223   -78.644  1.00 36.70 ? 62   SER C O   1 
ATOM   7756  C  CB  . SER C 1 73  ? 2.076   1.856   -80.805  1.00 36.62 ? 62   SER C CB  1 
ATOM   7757  O  OG  . SER C 1 73  ? 1.736   2.514   -82.012  1.00 38.47 ? 62   SER C OG  1 
ATOM   7758  N  N   . ARG C 1 74  ? 4.590   -0.591  -79.659  1.00 35.50 ? 63   ARG C N   1 
ATOM   7759  C  CA  . ARG C 1 74  ? 5.148   -1.141  -78.429  1.00 33.90 ? 63   ARG C CA  1 
ATOM   7760  C  C   . ARG C 1 74  ? 6.505   -0.568  -78.106  1.00 32.63 ? 63   ARG C C   1 
ATOM   7761  O  O   . ARG C 1 74  ? 7.145   0.066   -78.938  1.00 31.93 ? 63   ARG C O   1 
ATOM   7762  C  CB  . ARG C 1 74  ? 5.314   -2.649  -78.520  1.00 34.88 ? 63   ARG C CB  1 
ATOM   7763  C  CG  . ARG C 1 74  ? 4.438   -3.426  -77.614  1.00 35.88 ? 63   ARG C CG  1 
ATOM   7764  C  CD  . ARG C 1 74  ? 3.452   -4.242  -78.394  1.00 38.77 ? 63   ARG C CD  1 
ATOM   7765  N  NE  . ARG C 1 74  ? 2.802   -5.203  -77.518  1.00 39.95 ? 63   ARG C NE  1 
ATOM   7766  C  CZ  . ARG C 1 74  ? 1.832   -6.024  -77.893  1.00 41.33 ? 63   ARG C CZ  1 
ATOM   7767  N  NH1 . ARG C 1 74  ? 1.376   -6.006  -79.144  1.00 40.97 ? 63   ARG C NH1 1 
ATOM   7768  N  NH2 . ARG C 1 74  ? 1.315   -6.867  -77.005  1.00 41.66 ? 63   ARG C NH2 1 
ATOM   7769  N  N   . MET C 1 75  ? 6.926   -0.853  -76.880  1.00 30.65 ? 64   MET C N   1 
ATOM   7770  C  CA  . MET C 1 75  ? 8.242   -0.544  -76.368  1.00 29.45 ? 64   MET C CA  1 
ATOM   7771  C  C   . MET C 1 75  ? 9.326   -1.293  -77.112  1.00 28.03 ? 64   MET C C   1 
ATOM   7772  O  O   . MET C 1 75  ? 9.287   -2.515  -77.156  1.00 27.56 ? 64   MET C O   1 
ATOM   7773  C  CB  . MET C 1 75  ? 8.298   -0.992  -74.908  1.00 28.90 ? 64   MET C CB  1 
ATOM   7774  C  CG  . MET C 1 75  ? 7.455   -0.165  -73.989  1.00 29.94 ? 64   MET C CG  1 
ATOM   7775  S  SD  . MET C 1 75  ? 7.771   -0.487  -72.244  1.00 30.11 ? 64   MET C SD  1 
ATOM   7776  C  CE  . MET C 1 75  ? 9.343   0.322   -72.019  1.00 28.31 ? 64   MET C CE  1 
ATOM   7777  N  N   . VAL C 1 76  ? 10.286  -0.576  -77.696  1.00 26.65 ? 65   VAL C N   1 
ATOM   7778  C  CA  . VAL C 1 76  ? 11.538  -1.190  -78.150  1.00 25.64 ? 65   VAL C CA  1 
ATOM   7779  C  C   . VAL C 1 76  ? 12.662  -0.586  -77.304  1.00 25.95 ? 65   VAL C C   1 
ATOM   7780  O  O   . VAL C 1 76  ? 12.819  0.640   -77.247  1.00 26.81 ? 65   VAL C O   1 
ATOM   7781  C  CB  . VAL C 1 76  ? 11.814  -0.955  -79.648  1.00 26.11 ? 65   VAL C CB  1 
ATOM   7782  C  CG1 . VAL C 1 76  ? 13.098  -1.675  -80.094  1.00 25.28 ? 65   VAL C CG1 1 
ATOM   7783  C  CG2 . VAL C 1 76  ? 10.647  -1.429  -80.472  1.00 25.36 ? 65   VAL C CG2 1 
ATOM   7784  N  N   . ILE C 1 77  ? 13.417  -1.428  -76.602  1.00 23.89 ? 66   ILE C N   1 
ATOM   7785  C  CA  . ILE C 1 77  ? 14.475  -0.926  -75.715  1.00 21.64 ? 66   ILE C CA  1 
ATOM   7786  C  C   . ILE C 1 77  ? 15.831  -1.498  -76.116  1.00 20.33 ? 66   ILE C C   1 
ATOM   7787  O  O   . ILE C 1 77  ? 15.895  -2.552  -76.714  1.00 21.61 ? 66   ILE C O   1 
ATOM   7788  C  CB  . ILE C 1 77  ? 14.166  -1.244  -74.195  1.00 21.59 ? 66   ILE C CB  1 
ATOM   7789  C  CG1 . ILE C 1 77  ? 14.052  -2.755  -73.932  1.00 20.76 ? 66   ILE C CG1 1 
ATOM   7790  C  CG2 . ILE C 1 77  ? 12.873  -0.552  -73.741  1.00 20.87 ? 66   ILE C CG2 1 
ATOM   7791  C  CD1 . ILE C 1 77  ? 14.194  -3.135  -72.455  1.00 17.57 ? 66   ILE C CD1 1 
ATOM   7792  N  N   . PRO C 1 78  ? 16.922  -0.812  -75.773  1.00 18.66 ? 67   PRO C N   1 
ATOM   7793  C  CA  . PRO C 1 78  ? 18.200  -1.485  -75.873  1.00 18.64 ? 67   PRO C CA  1 
ATOM   7794  C  C   . PRO C 1 78  ? 18.221  -2.767  -75.028  1.00 20.22 ? 67   PRO C C   1 
ATOM   7795  O  O   . PRO C 1 78  ? 17.720  -2.787  -73.882  1.00 20.02 ? 67   PRO C O   1 
ATOM   7796  C  CB  . PRO C 1 78  ? 19.180  -0.458  -75.333  1.00 17.75 ? 67   PRO C CB  1 
ATOM   7797  C  CG  . PRO C 1 78  ? 18.446  0.898   -75.400  1.00 17.30 ? 67   PRO C CG  1 
ATOM   7798  C  CD  . PRO C 1 78  ? 17.026  0.572   -75.273  1.00 18.71 ? 67   PRO C CD  1 
ATOM   7799  N  N   . GLY C 1 79  ? 18.790  -3.834  -75.573  1.00 20.45 ? 68   GLY C N   1 
ATOM   7800  C  CA  . GLY C 1 79  ? 18.997  -5.057  -74.815  1.00 19.96 ? 68   GLY C CA  1 
ATOM   7801  C  C   . GLY C 1 79  ? 19.803  -4.818  -73.550  1.00 21.29 ? 68   GLY C C   1 
ATOM   7802  O  O   . GLY C 1 79  ? 20.690  -3.941  -73.499  1.00 21.69 ? 68   GLY C O   1 
ATOM   7803  N  N   . GLY C 1 80  ? 19.502  -5.599  -72.517  1.00 21.07 ? 69   GLY C N   1 
ATOM   7804  C  CA  . GLY C 1 80  ? 20.205  -5.466  -71.235  1.00 21.45 ? 69   GLY C CA  1 
ATOM   7805  C  C   . GLY C 1 80  ? 21.653  -5.931  -71.227  1.00 21.32 ? 69   GLY C C   1 
ATOM   7806  O  O   . GLY C 1 80  ? 21.987  -6.917  -71.860  1.00 18.81 ? 69   GLY C O   1 
ATOM   7807  N  N   . ILE C 1 81  ? 22.483  -5.210  -70.462  1.00 21.86 ? 70   ILE C N   1 
ATOM   7808  C  CA  . ILE C 1 81  ? 23.843  -5.622  -70.063  1.00 20.52 ? 70   ILE C CA  1 
ATOM   7809  C  C   . ILE C 1 81  ? 23.875  -6.088  -68.569  1.00 20.83 ? 70   ILE C C   1 
ATOM   7810  O  O   . ILE C 1 81  ? 23.884  -5.251  -67.649  1.00 21.32 ? 70   ILE C O   1 
ATOM   7811  C  CB  . ILE C 1 81  ? 24.858  -4.454  -70.258  1.00 20.53 ? 70   ILE C CB  1 
ATOM   7812  C  CG1 . ILE C 1 81  ? 24.920  -4.023  -71.740  1.00 21.71 ? 70   ILE C CG1 1 
ATOM   7813  C  CG2 . ILE C 1 81  ? 26.246  -4.855  -69.769  1.00 20.08 ? 70   ILE C CG2 1 
ATOM   7814  C  CD1 . ILE C 1 81  ? 25.588  -2.681  -71.982  1.00 20.09 ? 70   ILE C CD1 1 
ATOM   7815  N  N   . ASP C 1 82  ? 23.886  -7.418  -68.361  1.00 18.71 ? 71   ASP C N   1 
ATOM   7816  C  CA  . ASP C 1 82  ? 24.026  -8.038  -67.040  1.00 17.88 ? 71   ASP C CA  1 
ATOM   7817  C  C   . ASP C 1 82  ? 25.486  -7.959  -66.614  1.00 16.60 ? 71   ASP C C   1 
ATOM   7818  O  O   . ASP C 1 82  ? 26.290  -8.822  -66.954  1.00 16.14 ? 71   ASP C O   1 
ATOM   7819  C  CB  . ASP C 1 82  ? 23.547  -9.491  -67.110  1.00 17.44 ? 71   ASP C CB  1 
ATOM   7820  C  CG  . ASP C 1 82  ? 23.433  -10.148 -65.776  1.00 18.15 ? 71   ASP C CG  1 
ATOM   7821  O  OD1 . ASP C 1 82  ? 23.926  -9.642  -64.743  1.00 19.13 ? 71   ASP C OD1 1 
ATOM   7822  O  OD2 . ASP C 1 82  ? 22.826  -11.212 -65.747  1.00 18.26 ? 71   ASP C OD2 1 
ATOM   7823  N  N   . VAL C 1 83  ? 25.822  -6.913  -65.856  1.00 16.34 ? 72   VAL C N   1 
ATOM   7824  C  CA  . VAL C 1 83  ? 27.222  -6.614  -65.463  1.00 16.13 ? 72   VAL C CA  1 
ATOM   7825  C  C   . VAL C 1 83  ? 27.959  -7.658  -64.618  1.00 16.46 ? 72   VAL C C   1 
ATOM   7826  O  O   . VAL C 1 83  ? 29.198  -7.546  -64.371  1.00 14.92 ? 72   VAL C O   1 
ATOM   7827  C  CB  . VAL C 1 83  ? 27.299  -5.265  -64.710  1.00 16.75 ? 72   VAL C CB  1 
ATOM   7828  C  CG1 . VAL C 1 83  ? 26.946  -4.146  -65.662  1.00 14.09 ? 72   VAL C CG1 1 
ATOM   7829  C  CG2 . VAL C 1 83  ? 26.399  -5.289  -63.465  1.00 14.33 ? 72   VAL C CG2 1 
ATOM   7830  N  N   . HIS C 1 84  ? 27.201  -8.666  -64.189  1.00 15.16 ? 73   HIS C N   1 
ATOM   7831  C  CA  . HIS C 1 84  ? 27.733  -9.698  -63.352  1.00 16.22 ? 73   HIS C CA  1 
ATOM   7832  C  C   . HIS C 1 84  ? 27.074  -11.040 -63.638  1.00 14.98 ? 73   HIS C C   1 
ATOM   7833  O  O   . HIS C 1 84  ? 25.917  -11.277 -63.274  1.00 16.97 ? 73   HIS C O   1 
ATOM   7834  C  CB  . HIS C 1 84  ? 27.498  -9.302  -61.900  1.00 16.62 ? 73   HIS C CB  1 
ATOM   7835  C  CG  . HIS C 1 84  ? 28.293  -10.104 -60.935  1.00 17.01 ? 73   HIS C CG  1 
ATOM   7836  N  ND1 . HIS C 1 84  ? 28.817  -9.572  -59.782  1.00 16.38 ? 73   HIS C ND1 1 
ATOM   7837  C  CD2 . HIS C 1 84  ? 28.653  -11.402 -60.953  1.00 17.98 ? 73   HIS C CD2 1 
ATOM   7838  C  CE1 . HIS C 1 84  ? 29.457  -10.515 -59.126  1.00 17.75 ? 73   HIS C CE1 1 
ATOM   7839  N  NE2 . HIS C 1 84  ? 29.387  -11.629 -59.826  1.00 14.47 ? 73   HIS C NE2 1 
ATOM   7840  N  N   . THR C 1 85  ? 27.812  -11.894 -64.326  1.00 13.96 ? 74   THR C N   1 
ATOM   7841  C  CA  . THR C 1 85  ? 27.440  -13.283 -64.525  1.00 13.95 ? 74   THR C CA  1 
ATOM   7842  C  C   . THR C 1 85  ? 28.652  -14.128 -64.153  1.00 14.94 ? 74   THR C C   1 
ATOM   7843  O  O   . THR C 1 85  ? 29.782  -13.678 -64.273  1.00 17.88 ? 74   THR C O   1 
ATOM   7844  C  CB  . THR C 1 85  ? 27.005  -13.538 -65.991  1.00 13.75 ? 74   THR C CB  1 
ATOM   7845  O  OG1 . THR C 1 85  ? 28.086  -13.222 -66.873  1.00 12.18 ? 74   THR C OG1 1 
ATOM   7846  C  CG2 . THR C 1 85  ? 25.827  -12.674 -66.343  1.00 9.19  ? 74   THR C CG2 1 
ATOM   7847  N  N   . ARG C 1 86  ? 28.425  -15.333 -63.645  1.00 14.20 ? 75   ARG C N   1 
ATOM   7848  C  CA  . ARG C 1 86  ? 29.509  -16.266 -63.350  1.00 11.53 ? 75   ARG C CA  1 
ATOM   7849  C  C   . ARG C 1 86  ? 29.204  -17.679 -63.902  1.00 10.15 ? 75   ARG C C   1 
ATOM   7850  O  O   . ARG C 1 86  ? 29.101  -18.655 -63.200  1.00 2.14  ? 75   ARG C O   1 
ATOM   7851  C  CB  . ARG C 1 86  ? 29.792  -16.250 -61.835  1.00 12.22 ? 75   ARG C CB  1 
ATOM   7852  C  CG  . ARG C 1 86  ? 30.393  -14.910 -61.321  1.00 11.45 ? 75   ARG C CG  1 
ATOM   7853  C  CD  . ARG C 1 86  ? 30.488  -14.886 -59.738  1.00 12.00 ? 75   ARG C CD  1 
ATOM   7854  N  NE  . ARG C 1 86  ? 31.183  -13.690 -59.239  1.00 11.73 ? 75   ARG C NE  1 
ATOM   7855  C  CZ  . ARG C 1 86  ? 32.513  -13.560 -59.155  1.00 15.01 ? 75   ARG C CZ  1 
ATOM   7856  N  NH1 . ARG C 1 86  ? 33.328  -14.559 -59.481  1.00 17.93 ? 75   ARG C NH1 1 
ATOM   7857  N  NH2 . ARG C 1 86  ? 33.043  -12.428 -58.716  1.00 16.94 ? 75   ARG C NH2 1 
ATOM   7858  N  N   . PHE C 1 87  ? 29.129  -17.825 -65.228  1.00 8.03  ? 76   PHE C N   1 
ATOM   7859  C  CA  . PHE C 1 87  ? 28.727  -19.096 -65.752  1.00 10.60 ? 76   PHE C CA  1 
ATOM   7860  C  C   . PHE C 1 87  ? 29.882  -20.124 -65.709  1.00 10.27 ? 76   PHE C C   1 
ATOM   7861  O  O   . PHE C 1 87  ? 31.077  -19.774 -65.679  1.00 10.89 ? 76   PHE C O   1 
ATOM   7862  C  CB  . PHE C 1 87  ? 28.208  -18.935 -67.209  1.00 11.62 ? 76   PHE C CB  1 
ATOM   7863  C  CG  . PHE C 1 87  ? 27.089  -17.959 -67.361  1.00 13.15 ? 76   PHE C CG  1 
ATOM   7864  C  CD1 . PHE C 1 87  ? 25.964  -18.036 -66.554  1.00 15.30 ? 76   PHE C CD1 1 
ATOM   7865  C  CD2 . PHE C 1 87  ? 27.140  -16.965 -68.334  1.00 11.32 ? 76   PHE C CD2 1 
ATOM   7866  C  CE1 . PHE C 1 87  ? 24.924  -17.167 -66.706  1.00 15.44 ? 76   PHE C CE1 1 
ATOM   7867  C  CE2 . PHE C 1 87  ? 26.100  -16.073 -68.481  1.00 15.22 ? 76   PHE C CE2 1 
ATOM   7868  C  CZ  . PHE C 1 87  ? 24.988  -16.159 -67.664  1.00 13.08 ? 76   PHE C CZ  1 
ATOM   7869  N  N   . GLN C 1 88  ? 29.522  -21.412 -65.729  1.00 13.59 ? 77   GLN C N   1 
ATOM   7870  C  CA  . GLN C 1 88  ? 30.491  -22.523 -65.609  1.00 13.16 ? 77   GLN C CA  1 
ATOM   7871  C  C   . GLN C 1 88  ? 31.563  -22.237 -64.586  1.00 15.59 ? 77   GLN C C   1 
ATOM   7872  O  O   . GLN C 1 88  ? 32.719  -22.618 -64.775  1.00 16.34 ? 77   GLN C O   1 
ATOM   7873  C  CB  . GLN C 1 88  ? 31.251  -22.784 -66.898  1.00 12.06 ? 77   GLN C CB  1 
ATOM   7874  C  CG  . GLN C 1 88  ? 30.525  -22.439 -68.101  1.00 13.84 ? 77   GLN C CG  1 
ATOM   7875  C  CD  . GLN C 1 88  ? 31.117  -23.013 -69.309  1.00 9.93  ? 77   GLN C CD  1 
ATOM   7876  O  OE1 . GLN C 1 88  ? 30.455  -23.032 -70.344  1.00 19.47 ? 77   GLN C OE1 1 
ATOM   7877  N  NE2 . GLN C 1 88  ? 32.335  -23.494 -69.221  1.00 13.39 ? 77   GLN C NE2 1 
ATOM   7878  N  N   . MET C 1 89  ? 31.219  -21.494 -63.546  1.00 18.82 ? 78   MET C N   1 
ATOM   7879  C  CA  . MET C 1 89  ? 32.220  -21.062 -62.605  1.00 17.76 ? 78   MET C CA  1 
ATOM   7880  C  C   . MET C 1 89  ? 32.688  -22.230 -61.795  1.00 20.84 ? 78   MET C C   1 
ATOM   7881  O  O   . MET C 1 89  ? 31.874  -22.915 -61.156  1.00 22.43 ? 78   MET C O   1 
ATOM   7882  C  CB  . MET C 1 89  ? 31.708  -19.972 -61.699  1.00 15.40 ? 78   MET C CB  1 
ATOM   7883  C  CG  . MET C 1 89  ? 32.359  -20.030 -60.309  1.00 15.30 ? 78   MET C CG  1 
ATOM   7884  S  SD  . MET C 1 89  ? 32.563  -18.463 -59.598  1.00 12.87 ? 78   MET C SD  1 
ATOM   7885  C  CE  . MET C 1 89  ? 32.410  -18.990 -57.824  1.00 2.00  ? 78   MET C CE  1 
ATOM   7886  N  N   . PRO C 1 90  ? 34.022  -22.455 -61.795  1.00 23.19 ? 79   PRO C N   1 
ATOM   7887  C  CA  . PRO C 1 90  ? 34.584  -23.506 -60.958  1.00 24.43 ? 79   PRO C CA  1 
ATOM   7888  C  C   . PRO C 1 90  ? 34.562  -23.186 -59.459  1.00 26.70 ? 79   PRO C C   1 
ATOM   7889  O  O   . PRO C 1 90  ? 34.964  -22.095 -59.057  1.00 27.81 ? 79   PRO C O   1 
ATOM   7890  C  CB  . PRO C 1 90  ? 36.034  -23.621 -61.464  1.00 23.94 ? 79   PRO C CB  1 
ATOM   7891  C  CG  . PRO C 1 90  ? 36.089  -22.862 -62.712  1.00 22.50 ? 79   PRO C CG  1 
ATOM   7892  C  CD  . PRO C 1 90  ? 35.067  -21.800 -62.594  1.00 21.35 ? 79   PRO C CD  1 
ATOM   7893  N  N   . ASP C 1 91  ? 34.105  -24.138 -58.656  1.00 28.10 ? 80   ASP C N   1 
ATOM   7894  C  CA  . ASP C 1 91  ? 34.148  -24.017 -57.198  1.00 29.63 ? 80   ASP C CA  1 
ATOM   7895  C  C   . ASP C 1 91  ? 34.194  -25.427 -56.616  1.00 30.86 ? 80   ASP C C   1 
ATOM   7896  O  O   . ASP C 1 91  ? 33.448  -26.288 -57.072  1.00 30.75 ? 80   ASP C O   1 
ATOM   7897  C  CB  . ASP C 1 91  ? 32.908  -23.266 -56.703  1.00 30.01 ? 80   ASP C CB  1 
ATOM   7898  C  CG  . ASP C 1 91  ? 32.790  -23.242 -55.195  1.00 29.97 ? 80   ASP C CG  1 
ATOM   7899  O  OD1 . ASP C 1 91  ? 33.780  -22.866 -54.526  1.00 32.58 ? 80   ASP C OD1 1 
ATOM   7900  O  OD2 . ASP C 1 91  ? 31.693  -23.566 -54.676  1.00 32.24 ? 80   ASP C OD2 1 
ATOM   7901  N  N   . GLN C 1 92  ? 35.085  -25.664 -55.652  1.00 32.52 ? 81   GLN C N   1 
ATOM   7902  C  CA  . GLN C 1 92  ? 35.124  -26.929 -54.876  1.00 34.45 ? 81   GLN C CA  1 
ATOM   7903  C  C   . GLN C 1 92  ? 35.124  -28.251 -55.692  1.00 35.41 ? 81   GLN C C   1 
ATOM   7904  O  O   . GLN C 1 92  ? 34.462  -29.226 -55.313  1.00 35.87 ? 81   GLN C O   1 
ATOM   7905  C  CB  . GLN C 1 92  ? 33.950  -26.963 -53.882  1.00 35.09 ? 81   GLN C CB  1 
ATOM   7906  C  CG  . GLN C 1 92  ? 33.974  -25.868 -52.854  1.00 35.96 ? 81   GLN C CG  1 
ATOM   7907  C  CD  . GLN C 1 92  ? 32.815  -25.963 -51.876  1.00 36.24 ? 81   GLN C CD  1 
ATOM   7908  O  OE1 . GLN C 1 92  ? 31.718  -25.481 -52.143  1.00 37.01 ? 81   GLN C OE1 1 
ATOM   7909  N  NE2 . GLN C 1 92  ? 33.064  -26.586 -50.728  1.00 40.43 ? 81   GLN C NE2 1 
ATOM   7910  N  N   . GLY C 1 93  ? 35.865  -28.274 -56.801  1.00 35.87 ? 82   GLY C N   1 
ATOM   7911  C  CA  . GLY C 1 93  ? 35.855  -29.405 -57.727  1.00 35.13 ? 82   GLY C CA  1 
ATOM   7912  C  C   . GLY C 1 93  ? 34.557  -29.549 -58.508  1.00 35.30 ? 82   GLY C C   1 
ATOM   7913  O  O   . GLY C 1 93  ? 34.350  -30.550 -59.188  1.00 35.57 ? 82   GLY C O   1 
ATOM   7914  N  N   . MET C 1 94  ? 33.673  -28.556 -58.401  1.00 34.83 ? 83   MET C N   1 
ATOM   7915  C  CA  . MET C 1 94  ? 32.419  -28.538 -59.159  1.00 33.90 ? 83   MET C CA  1 
ATOM   7916  C  C   . MET C 1 94  ? 32.444  -27.396 -60.122  1.00 32.52 ? 83   MET C C   1 
ATOM   7917  O  O   . MET C 1 94  ? 33.315  -26.545 -60.071  1.00 32.16 ? 83   MET C O   1 
ATOM   7918  C  CB  . MET C 1 94  ? 31.213  -28.330 -58.250  1.00 33.59 ? 83   MET C CB  1 
ATOM   7919  C  CG  . MET C 1 94  ? 31.072  -29.368 -57.187  1.00 33.07 ? 83   MET C CG  1 
ATOM   7920  S  SD  . MET C 1 94  ? 29.654  -28.992 -56.176  1.00 32.71 ? 83   MET C SD  1 
ATOM   7921  C  CE  . MET C 1 94  ? 30.476  -28.327 -54.744  1.00 21.75 ? 83   MET C CE  1 
ATOM   7922  N  N   . THR C 1 95  ? 31.442  -27.381 -60.979  1.00 32.21 ? 84   THR C N   1 
ATOM   7923  C  CA  . THR C 1 95  ? 31.226  -26.306 -61.929  1.00 31.18 ? 84   THR C CA  1 
ATOM   7924  C  C   . THR C 1 95  ? 29.750  -25.911 -61.915  1.00 31.13 ? 84   THR C C   1 
ATOM   7925  O  O   . THR C 1 95  ? 28.860  -26.774 -61.914  1.00 31.45 ? 84   THR C O   1 
ATOM   7926  C  CB  . THR C 1 95  ? 31.709  -26.723 -63.316  1.00 30.64 ? 84   THR C CB  1 
ATOM   7927  O  OG1 . THR C 1 95  ? 33.024  -26.195 -63.508  1.00 31.46 ? 84   THR C OG1 1 
ATOM   7928  C  CG2 . THR C 1 95  ? 30.794  -26.232 -64.417  1.00 30.26 ? 84   THR C CG2 1 
ATOM   7929  N  N   . SER C 1 96  ? 29.502  -24.598 -61.877  1.00 30.90 ? 85   SER C N   1 
ATOM   7930  C  CA  . SER C 1 96  ? 28.139  -24.072 -61.890  1.00 29.39 ? 85   SER C CA  1 
ATOM   7931  C  C   . SER C 1 96  ? 27.286  -24.727 -62.965  1.00 27.73 ? 85   SER C C   1 
ATOM   7932  O  O   . SER C 1 96  ? 27.671  -24.736 -64.124  1.00 28.94 ? 85   SER C O   1 
ATOM   7933  C  CB  . SER C 1 96  ? 28.143  -22.576 -62.138  1.00 28.80 ? 85   SER C CB  1 
ATOM   7934  O  OG  . SER C 1 96  ? 26.826  -22.155 -62.438  1.00 30.78 ? 85   SER C OG  1 
ATOM   7935  N  N   . ALA C 1 97  ? 26.120  -25.223 -62.568  1.00 25.96 ? 86   ALA C N   1 
ATOM   7936  C  CA  . ALA C 1 97  ? 25.173  -25.902 -63.454  1.00 25.71 ? 86   ALA C CA  1 
ATOM   7937  C  C   . ALA C 1 97  ? 24.991  -25.253 -64.832  1.00 25.40 ? 86   ALA C C   1 
ATOM   7938  O  O   . ALA C 1 97  ? 25.032  -25.933 -65.887  1.00 23.06 ? 86   ALA C O   1 
ATOM   7939  C  CB  . ALA C 1 97  ? 23.831  -25.976 -62.770  1.00 25.92 ? 86   ALA C CB  1 
ATOM   7940  N  N   . ASP C 1 98  ? 24.724  -23.946 -64.823  1.00 25.23 ? 87   ASP C N   1 
ATOM   7941  C  CA  . ASP C 1 98  ? 24.470  -23.232 -66.081  1.00 25.00 ? 87   ASP C CA  1 
ATOM   7942  C  C   . ASP C 1 98  ? 25.782  -22.777 -66.639  1.00 24.99 ? 87   ASP C C   1 
ATOM   7943  O  O   . ASP C 1 98  ? 26.474  -21.930 -66.072  1.00 25.25 ? 87   ASP C O   1 
ATOM   7944  C  CB  . ASP C 1 98  ? 23.538  -22.056 -65.900  1.00 24.25 ? 87   ASP C CB  1 
ATOM   7945  C  CG  . ASP C 1 98  ? 22.199  -22.463 -65.398  1.00 23.93 ? 87   ASP C CG  1 
ATOM   7946  O  OD1 . ASP C 1 98  ? 21.647  -23.472 -65.895  1.00 14.81 ? 87   ASP C OD1 1 
ATOM   7947  O  OD2 . ASP C 1 98  ? 21.697  -21.759 -64.486  1.00 29.30 ? 87   ASP C OD2 1 
ATOM   7948  N  N   . ASP C 1 99  ? 26.128  -23.373 -67.768  1.00 25.06 ? 88   ASP C N   1 
ATOM   7949  C  CA  . ASP C 1 99  ? 27.401  -23.138 -68.393  1.00 24.01 ? 88   ASP C CA  1 
ATOM   7950  C  C   . ASP C 1 99  ? 27.232  -21.920 -69.318  1.00 23.40 ? 88   ASP C C   1 
ATOM   7951  O  O   . ASP C 1 99  ? 26.199  -21.285 -69.257  1.00 24.29 ? 88   ASP C O   1 
ATOM   7952  C  CB  . ASP C 1 99  ? 27.876  -24.437 -69.102  1.00 24.19 ? 88   ASP C CB  1 
ATOM   7953  C  CG  . ASP C 1 99  ? 27.045  -24.788 -70.291  1.00 24.24 ? 88   ASP C CG  1 
ATOM   7954  O  OD1 . ASP C 1 99  ? 26.013  -24.124 -70.487  1.00 30.06 ? 88   ASP C OD1 1 
ATOM   7955  O  OD2 . ASP C 1 99  ? 27.407  -25.729 -71.026  1.00 21.92 ? 88   ASP C OD2 1 
ATOM   7956  N  N   . PHE C 1 100 ? 28.200  -21.588 -70.168  1.00 21.69 ? 89   PHE C N   1 
ATOM   7957  C  CA  . PHE C 1 100 ? 28.059  -20.359 -71.002  1.00 21.42 ? 89   PHE C CA  1 
ATOM   7958  C  C   . PHE C 1 100 ? 26.934  -20.402 -72.038  1.00 20.43 ? 89   PHE C C   1 
ATOM   7959  O  O   . PHE C 1 100 ? 26.463  -19.357 -72.452  1.00 18.51 ? 89   PHE C O   1 
ATOM   7960  C  CB  . PHE C 1 100 ? 29.376  -19.945 -71.685  1.00 20.06 ? 89   PHE C CB  1 
ATOM   7961  C  CG  . PHE C 1 100 ? 30.295  -19.125 -70.804  1.00 20.89 ? 89   PHE C CG  1 
ATOM   7962  C  CD1 . PHE C 1 100 ? 30.098  -17.754 -70.659  1.00 21.76 ? 89   PHE C CD1 1 
ATOM   7963  C  CD2 . PHE C 1 100 ? 31.348  -19.720 -70.113  1.00 17.65 ? 89   PHE C CD2 1 
ATOM   7964  C  CE1 . PHE C 1 100 ? 30.938  -16.999 -69.810  1.00 20.46 ? 89   PHE C CE1 1 
ATOM   7965  C  CE2 . PHE C 1 100 ? 32.195  -18.974 -69.294  1.00 16.03 ? 89   PHE C CE2 1 
ATOM   7966  C  CZ  . PHE C 1 100 ? 31.982  -17.615 -69.145  1.00 16.18 ? 89   PHE C CZ  1 
ATOM   7967  N  N   . PHE C 1 101 ? 26.496  -21.593 -72.439  1.00 21.14 ? 90   PHE C N   1 
ATOM   7968  C  CA  . PHE C 1 101 ? 25.456  -21.695 -73.459  1.00 22.77 ? 90   PHE C CA  1 
ATOM   7969  C  C   . PHE C 1 101 ? 24.116  -21.521 -72.799  1.00 23.13 ? 90   PHE C C   1 
ATOM   7970  O  O   . PHE C 1 101 ? 23.302  -20.716 -73.243  1.00 23.50 ? 90   PHE C O   1 
ATOM   7971  C  CB  . PHE C 1 101 ? 25.490  -23.050 -74.182  1.00 23.07 ? 90   PHE C CB  1 
ATOM   7972  C  CG  . PHE C 1 101 ? 24.165  -23.413 -74.849  1.00 22.85 ? 90   PHE C CG  1 
ATOM   7973  C  CD1 . PHE C 1 101 ? 23.825  -22.860 -76.073  1.00 21.98 ? 90   PHE C CD1 1 
ATOM   7974  C  CD2 . PHE C 1 101 ? 23.267  -24.259 -74.229  1.00 22.74 ? 90   PHE C CD2 1 
ATOM   7975  C  CE1 . PHE C 1 101 ? 22.646  -23.149 -76.667  1.00 20.18 ? 90   PHE C CE1 1 
ATOM   7976  C  CE2 . PHE C 1 101 ? 22.075  -24.542 -74.814  1.00 23.49 ? 90   PHE C CE2 1 
ATOM   7977  C  CZ  . PHE C 1 101 ? 21.769  -23.987 -76.063  1.00 22.90 ? 90   PHE C CZ  1 
ATOM   7978  N  N   . GLN C 1 102 ? 23.926  -22.265 -71.708  1.00 24.42 ? 91   GLN C N   1 
ATOM   7979  C  CA  . GLN C 1 102 ? 22.675  -22.263 -70.973  1.00 24.44 ? 91   GLN C CA  1 
ATOM   7980  C  C   . GLN C 1 102 ? 22.478  -20.964 -70.161  1.00 24.12 ? 91   GLN C C   1 
ATOM   7981  O  O   . GLN C 1 102 ? 21.356  -20.470 -70.015  1.00 23.75 ? 91   GLN C O   1 
ATOM   7982  C  CB  . GLN C 1 102 ? 22.586  -23.506 -70.081  1.00 24.46 ? 91   GLN C CB  1 
ATOM   7983  C  CG  . GLN C 1 102 ? 21.169  -23.754 -69.537  1.00 26.14 ? 91   GLN C CG  1 
ATOM   7984  C  CD  . GLN C 1 102 ? 20.162  -24.137 -70.609  1.00 28.00 ? 91   GLN C CD  1 
ATOM   7985  O  OE1 . GLN C 1 102 ? 20.514  -24.750 -71.611  1.00 31.97 ? 91   GLN C OE1 1 
ATOM   7986  N  NE2 . GLN C 1 102 ? 18.900  -23.764 -70.404  1.00 29.78 ? 91   GLN C NE2 1 
ATOM   7987  N  N   . GLY C 1 103 ? 23.565  -20.404 -69.658  1.00 23.61 ? 92   GLY C N   1 
ATOM   7988  C  CA  . GLY C 1 103 ? 23.524  -19.051 -69.063  1.00 24.04 ? 92   GLY C CA  1 
ATOM   7989  C  C   . GLY C 1 103 ? 23.098  -17.918 -69.987  1.00 23.05 ? 92   GLY C C   1 
ATOM   7990  O  O   . GLY C 1 103 ? 22.267  -17.107 -69.634  1.00 23.11 ? 92   GLY C O   1 
ATOM   7991  N  N   . THR C 1 104 ? 23.681  -17.860 -71.173  1.00 24.37 ? 93   THR C N   1 
ATOM   7992  C  CA  . THR C 1 104 ? 23.459  -16.742 -72.087  1.00 23.80 ? 93   THR C CA  1 
ATOM   7993  C  C   . THR C 1 104 ? 22.164  -16.909 -72.881  1.00 23.28 ? 93   THR C C   1 
ATOM   7994  O  O   . THR C 1 104 ? 21.649  -15.962 -73.448  1.00 24.47 ? 93   THR C O   1 
ATOM   7995  C  CB  . THR C 1 104 ? 24.666  -16.575 -73.004  1.00 24.14 ? 93   THR C CB  1 
ATOM   7996  O  OG1 . THR C 1 104 ? 24.927  -17.832 -73.644  1.00 26.67 ? 93   THR C OG1 1 
ATOM   7997  C  CG2 . THR C 1 104 ? 25.876  -16.203 -72.202  1.00 22.89 ? 93   THR C CG2 1 
ATOM   7998  N  N   . LYS C 1 105 ? 21.637  -18.122 -72.896  1.00 23.01 ? 94   LYS C N   1 
ATOM   7999  C  CA  . LYS C 1 105 ? 20.303  -18.403 -73.412  1.00 21.84 ? 94   LYS C CA  1 
ATOM   8000  C  C   . LYS C 1 105 ? 19.213  -17.930 -72.461  1.00 20.11 ? 94   LYS C C   1 
ATOM   8001  O  O   . LYS C 1 105 ? 18.234  -17.331 -72.876  1.00 18.66 ? 94   LYS C O   1 
ATOM   8002  C  CB  . LYS C 1 105 ? 20.137  -19.913 -73.598  1.00 22.43 ? 94   LYS C CB  1 
ATOM   8003  C  CG  . LYS C 1 105 ? 18.840  -20.295 -74.285  1.00 23.65 ? 94   LYS C CG  1 
ATOM   8004  C  CD  . LYS C 1 105 ? 18.600  -21.781 -74.218  1.00 22.71 ? 94   LYS C CD  1 
ATOM   8005  C  CE  . LYS C 1 105 ? 17.328  -22.122 -74.967  1.00 23.48 ? 94   LYS C CE  1 
ATOM   8006  N  NZ  . LYS C 1 105 ? 17.422  -23.455 -75.558  1.00 25.34 ? 94   LYS C NZ  1 
ATOM   8007  N  N   . ALA C 1 106 ? 19.378  -18.233 -71.176  1.00 19.06 ? 95   ALA C N   1 
ATOM   8008  C  CA  . ALA C 1 106 ? 18.471  -17.741 -70.164  1.00 18.42 ? 95   ALA C CA  1 
ATOM   8009  C  C   . ALA C 1 106 ? 18.442  -16.206 -70.179  1.00 18.33 ? 95   ALA C C   1 
ATOM   8010  O  O   . ALA C 1 106 ? 17.398  -15.573 -69.972  1.00 19.40 ? 95   ALA C O   1 
ATOM   8011  C  CB  . ALA C 1 106 ? 18.939  -18.223 -68.811  1.00 18.49 ? 95   ALA C CB  1 
ATOM   8012  N  N   . ALA C 1 107 ? 19.618  -15.615 -70.369  1.00 16.90 ? 96   ALA C N   1 
ATOM   8013  C  CA  . ALA C 1 107 ? 19.764  -14.175 -70.366  1.00 16.14 ? 96   ALA C CA  1 
ATOM   8014  C  C   . ALA C 1 107 ? 18.865  -13.671 -71.455  1.00 16.02 ? 96   ALA C C   1 
ATOM   8015  O  O   . ALA C 1 107 ? 17.887  -12.940 -71.208  1.00 14.42 ? 96   ALA C O   1 
ATOM   8016  C  CB  . ALA C 1 107 ? 21.217  -13.794 -70.638  1.00 16.03 ? 96   ALA C CB  1 
ATOM   8017  N  N   . LEU C 1 108 ? 19.161  -14.124 -72.668  1.00 15.24 ? 97   LEU C N   1 
ATOM   8018  C  CA  . LEU C 1 108 ? 18.435  -13.655 -73.835  1.00 15.76 ? 97   LEU C CA  1 
ATOM   8019  C  C   . LEU C 1 108 ? 16.938  -13.772 -73.629  1.00 16.86 ? 97   LEU C C   1 
ATOM   8020  O  O   . LEU C 1 108 ? 16.212  -12.875 -74.036  1.00 20.67 ? 97   LEU C O   1 
ATOM   8021  C  CB  . LEU C 1 108 ? 18.888  -14.391 -75.116  1.00 15.39 ? 97   LEU C CB  1 
ATOM   8022  C  CG  . LEU C 1 108 ? 20.283  -14.184 -75.710  1.00 17.43 ? 97   LEU C CG  1 
ATOM   8023  C  CD1 . LEU C 1 108 ? 20.632  -15.300 -76.712  1.00 12.15 ? 97   LEU C CD1 1 
ATOM   8024  C  CD2 . LEU C 1 108 ? 20.478  -12.830 -76.405  1.00 16.75 ? 97   LEU C CD2 1 
ATOM   8025  N  N   . ALA C 1 109 ? 16.472  -14.860 -72.997  1.00 17.33 ? 98   ALA C N   1 
ATOM   8026  C  CA  . ALA C 1 109 ? 15.034  -15.053 -72.730  1.00 16.89 ? 98   ALA C CA  1 
ATOM   8027  C  C   . ALA C 1 109 ? 14.483  -14.008 -71.739  1.00 17.38 ? 98   ALA C C   1 
ATOM   8028  O  O   . ALA C 1 109 ? 13.284  -13.692 -71.747  1.00 17.73 ? 98   ALA C O   1 
ATOM   8029  C  CB  . ALA C 1 109 ? 14.748  -16.476 -72.239  1.00 16.86 ? 98   ALA C CB  1 
ATOM   8030  N  N   . GLY C 1 110 ? 15.370  -13.472 -70.903  1.00 16.35 ? 99   GLY C N   1 
ATOM   8031  C  CA  . GLY C 1 110 ? 15.036  -12.316 -70.088  1.00 14.73 ? 99   GLY C CA  1 
ATOM   8032  C  C   . GLY C 1 110 ? 15.148  -10.927 -70.697  1.00 12.83 ? 99   GLY C C   1 
ATOM   8033  O  O   . GLY C 1 110 ? 14.870  -9.971  -70.041  1.00 10.09 ? 99   GLY C O   1 
ATOM   8034  N  N   . GLY C 1 111 ? 15.517  -10.802 -71.969  1.00 12.77 ? 100  GLY C N   1 
ATOM   8035  C  CA  . GLY C 1 111 ? 15.728  -9.510  -72.576  1.00 13.07 ? 100  GLY C CA  1 
ATOM   8036  C  C   . GLY C 1 111 ? 17.137  -8.953  -72.421  1.00 11.56 ? 100  GLY C C   1 
ATOM   8037  O  O   . GLY C 1 111 ? 17.343  -7.767  -72.637  1.00 11.24 ? 100  GLY C O   1 
ATOM   8038  N  N   . THR C 1 112 ? 18.090  -9.805  -72.038  1.00 11.15 ? 101  THR C N   1 
ATOM   8039  C  CA  . THR C 1 112 ? 19.496  -9.421  -71.826  1.00 10.87 ? 101  THR C CA  1 
ATOM   8040  C  C   . THR C 1 112 ? 20.341  -9.942  -72.979  1.00 12.11 ? 101  THR C C   1 
ATOM   8041  O  O   . THR C 1 112 ? 20.424  -11.131 -73.188  1.00 15.85 ? 101  THR C O   1 
ATOM   8042  C  CB  . THR C 1 112 ? 19.972  -9.936  -70.435  1.00 10.63 ? 101  THR C CB  1 
ATOM   8043  O  OG1 . THR C 1 112 ? 19.350  -9.126  -69.450  1.00 10.92 ? 101  THR C OG1 1 
ATOM   8044  C  CG2 . THR C 1 112 ? 21.466  -9.834  -70.219  1.00 10.70 ? 101  THR C CG2 1 
ATOM   8045  N  N   . THR C 1 113 ? 20.911  -9.034  -73.775  1.00 12.74 ? 102  THR C N   1 
ATOM   8046  C  CA  . THR C 1 113 ? 21.620  -9.414  -74.998  1.00 12.30 ? 102  THR C CA  1 
ATOM   8047  C  C   . THR C 1 113 ? 23.183  -9.379  -74.859  1.00 11.98 ? 102  THR C C   1 
ATOM   8048  O  O   . THR C 1 113 ? 23.936  -9.670  -75.802  1.00 9.37  ? 102  THR C O   1 
ATOM   8049  C  CB  . THR C 1 113 ? 21.064  -8.532  -76.147  1.00 11.00 ? 102  THR C CB  1 
ATOM   8050  O  OG1 . THR C 1 113 ? 21.234  -7.141  -75.810  1.00 17.65 ? 102  THR C OG1 1 
ATOM   8051  C  CG2 . THR C 1 113 ? 19.586  -8.795  -76.341  1.00 9.27  ? 102  THR C CG2 1 
ATOM   8052  N  N   . MET C 1 114 ? 23.672  -9.036  -73.665  1.00 11.33 ? 103  MET C N   1 
ATOM   8053  C  CA  . MET C 1 114 ? 25.111  -8.937  -73.397  1.00 13.46 ? 103  MET C CA  1 
ATOM   8054  C  C   . MET C 1 114 ? 25.318  -9.283  -71.927  1.00 13.34 ? 103  MET C C   1 
ATOM   8055  O  O   . MET C 1 114 ? 24.429  -9.025  -71.110  1.00 13.33 ? 103  MET C O   1 
ATOM   8056  C  CB  . MET C 1 114 ? 25.718  -7.527  -73.713  1.00 14.64 ? 103  MET C CB  1 
ATOM   8057  C  CG  . MET C 1 114 ? 27.251  -7.536  -73.797  1.00 13.95 ? 103  MET C CG  1 
ATOM   8058  S  SD  . MET C 1 114 ? 28.107  -5.966  -73.932  1.00 20.29 ? 103  MET C SD  1 
ATOM   8059  C  CE  . MET C 1 114 ? 29.820  -6.511  -73.856  1.00 10.65 ? 103  MET C CE  1 
ATOM   8060  N  N   . ILE C 1 115 ? 26.442  -9.932  -71.646  1.00 12.40 ? 104  ILE C N   1 
ATOM   8061  C  CA  . ILE C 1 115 ? 26.797  -10.350 -70.291  1.00 9.92  ? 104  ILE C CA  1 
ATOM   8062  C  C   . ILE C 1 115 ? 28.265  -9.982  -70.076  1.00 10.11 ? 104  ILE C C   1 
ATOM   8063  O  O   . ILE C 1 115 ? 29.025  -9.870  -71.030  1.00 8.48  ? 104  ILE C O   1 
ATOM   8064  C  CB  . ILE C 1 115 ? 26.490  -11.884 -70.048  1.00 9.27  ? 104  ILE C CB  1 
ATOM   8065  C  CG1 . ILE C 1 115 ? 27.328  -12.821 -70.906  1.00 9.06  ? 104  ILE C CG1 1 
ATOM   8066  C  CG2 . ILE C 1 115 ? 25.013  -12.224 -70.267  1.00 8.68  ? 104  ILE C CG2 1 
ATOM   8067  C  CD1 . ILE C 1 115 ? 28.576  -13.436 -70.180  1.00 12.70 ? 104  ILE C CD1 1 
ATOM   8068  N  N   . ILE C 1 116 ? 28.675  -9.740  -68.822  1.00 9.55  ? 105  ILE C N   1 
ATOM   8069  C  CA  . ILE C 1 116 ? 30.074  -9.541  -68.509  1.00 10.57 ? 105  ILE C CA  1 
ATOM   8070  C  C   . ILE C 1 116 ? 30.336  -10.478 -67.377  1.00 12.92 ? 105  ILE C C   1 
ATOM   8071  O  O   . ILE C 1 116 ? 29.719  -10.331 -66.341  1.00 11.74 ? 105  ILE C O   1 
ATOM   8072  C  CB  . ILE C 1 116 ? 30.423  -8.106  -68.065  1.00 8.72  ? 105  ILE C CB  1 
ATOM   8073  C  CG1 . ILE C 1 116 ? 29.741  -7.075  -68.983  1.00 11.36 ? 105  ILE C CG1 1 
ATOM   8074  C  CG2 . ILE C 1 116 ? 31.945  -7.945  -67.984  1.00 8.24  ? 105  ILE C CG2 1 
ATOM   8075  C  CD1 . ILE C 1 116 ? 29.925  -5.620  -68.577  1.00 9.96  ? 105  ILE C CD1 1 
ATOM   8076  N  N   . ASP C 1 117 ? 31.214  -11.456 -67.610  1.00 14.35 ? 106  ASP C N   1 
ATOM   8077  C  CA  . ASP C 1 117 ? 31.472  -12.545 -66.656  1.00 14.51 ? 106  ASP C CA  1 
ATOM   8078  C  C   . ASP C 1 117 ? 32.770  -12.305 -65.900  1.00 13.99 ? 106  ASP C C   1 
ATOM   8079  O  O   . ASP C 1 117 ? 33.372  -11.275 -66.057  1.00 14.63 ? 106  ASP C O   1 
ATOM   8080  C  CB  . ASP C 1 117 ? 31.506  -13.888 -67.403  1.00 16.01 ? 106  ASP C CB  1 
ATOM   8081  C  CG  . ASP C 1 117 ? 31.073  -15.069 -66.528  1.00 15.27 ? 106  ASP C CG  1 
ATOM   8082  O  OD1 . ASP C 1 117 ? 29.885  -15.417 -66.554  1.00 19.03 ? 106  ASP C OD1 1 
ATOM   8083  O  OD2 . ASP C 1 117 ? 31.912  -15.650 -65.821  1.00 18.85 ? 106  ASP C OD2 1 
ATOM   8084  N  N   . HIS C 1 118 ? 33.203  -13.279 -65.104  1.00 14.77 ? 107  HIS C N   1 
ATOM   8085  C  CA  . HIS C 1 118 ? 34.270  -13.092 -64.126  1.00 15.61 ? 107  HIS C CA  1 
ATOM   8086  C  C   . HIS C 1 118 ? 35.369  -14.137 -64.150  1.00 16.05 ? 107  HIS C C   1 
ATOM   8087  O  O   . HIS C 1 118 ? 35.089  -15.319 -63.939  1.00 19.04 ? 107  HIS C O   1 
ATOM   8088  C  CB  . HIS C 1 118 ? 33.632  -13.067 -62.745  1.00 14.26 ? 107  HIS C CB  1 
ATOM   8089  C  CG  . HIS C 1 118 ? 33.141  -11.709 -62.378  1.00 14.42 ? 107  HIS C CG  1 
ATOM   8090  N  ND1 . HIS C 1 118 ? 33.963  -10.767 -61.804  1.00 10.53 ? 107  HIS C ND1 1 
ATOM   8091  C  CD2 . HIS C 1 118 ? 31.943  -11.105 -62.571  1.00 12.37 ? 107  HIS C CD2 1 
ATOM   8092  C  CE1 . HIS C 1 118 ? 33.289  -9.644  -61.643  1.00 14.07 ? 107  HIS C CE1 1 
ATOM   8093  N  NE2 . HIS C 1 118 ? 32.057  -9.825  -62.088  1.00 14.81 ? 107  HIS C NE2 1 
ATOM   8094  N  N   . VAL C 1 119 ? 36.609  -13.704 -64.403  1.00 16.43 ? 108  VAL C N   1 
ATOM   8095  C  CA  . VAL C 1 119 ? 37.756  -14.625 -64.519  1.00 16.12 ? 108  VAL C CA  1 
ATOM   8096  C  C   . VAL C 1 119 ? 38.264  -14.874 -63.136  1.00 16.72 ? 108  VAL C C   1 
ATOM   8097  O  O   . VAL C 1 119 ? 38.600  -13.934 -62.428  1.00 18.15 ? 108  VAL C O   1 
ATOM   8098  C  CB  . VAL C 1 119 ? 38.915  -14.111 -65.413  1.00 15.59 ? 108  VAL C CB  1 
ATOM   8099  C  CG1 . VAL C 1 119 ? 40.127  -15.099 -65.406  1.00 12.95 ? 108  VAL C CG1 1 
ATOM   8100  C  CG2 . VAL C 1 119 ? 38.442  -13.916 -66.828  1.00 8.02  ? 108  VAL C CG2 1 
ATOM   8101  N  N   . VAL C 1 120 ? 38.256  -16.142 -62.741  1.00 16.94 ? 109  VAL C N   1 
ATOM   8102  C  CA  . VAL C 1 120 ? 38.749  -16.537 -61.427  1.00 17.40 ? 109  VAL C CA  1 
ATOM   8103  C  C   . VAL C 1 120 ? 39.961  -17.454 -61.687  1.00 17.84 ? 109  VAL C C   1 
ATOM   8104  O  O   . VAL C 1 120 ? 39.825  -18.651 -61.949  1.00 17.06 ? 109  VAL C O   1 
ATOM   8105  C  CB  . VAL C 1 120 ? 37.659  -17.215 -60.535  1.00 16.62 ? 109  VAL C CB  1 
ATOM   8106  C  CG1 . VAL C 1 120 ? 38.106  -17.240 -59.040  1.00 16.24 ? 109  VAL C CG1 1 
ATOM   8107  C  CG2 . VAL C 1 120 ? 36.328  -16.507 -60.631  1.00 14.98 ? 109  VAL C CG2 1 
ATOM   8108  N  N   . PRO C 1 121 ? 41.159  -16.858 -61.674  1.00 18.57 ? 110  PRO C N   1 
ATOM   8109  C  CA  . PRO C 1 121 ? 42.384  -17.612 -61.633  1.00 18.42 ? 110  PRO C CA  1 
ATOM   8110  C  C   . PRO C 1 121 ? 42.505  -18.293 -60.315  1.00 20.48 ? 110  PRO C C   1 
ATOM   8111  O  O   . PRO C 1 121 ? 42.383  -17.638 -59.275  1.00 18.69 ? 110  PRO C O   1 
ATOM   8112  C  CB  . PRO C 1 121 ? 43.480  -16.540 -61.746  1.00 18.68 ? 110  PRO C CB  1 
ATOM   8113  C  CG  . PRO C 1 121 ? 42.815  -15.265 -62.062  1.00 16.39 ? 110  PRO C CG  1 
ATOM   8114  C  CD  . PRO C 1 121 ? 41.395  -15.402 -61.728  1.00 18.91 ? 110  PRO C CD  1 
ATOM   8115  N  N   . GLU C 1 122 ? 42.794  -19.588 -60.322  1.00 23.10 ? 111  GLU C N   1 
ATOM   8116  C  CA  . GLU C 1 122 ? 43.120  -20.215 -59.057  1.00 23.87 ? 111  GLU C CA  1 
ATOM   8117  C  C   . GLU C 1 122 ? 44.394  -19.508 -58.569  1.00 23.52 ? 111  GLU C C   1 
ATOM   8118  O  O   . GLU C 1 122 ? 45.246  -19.074 -59.380  1.00 21.60 ? 111  GLU C O   1 
ATOM   8119  C  CB  . GLU C 1 122 ? 43.292  -21.730 -59.228  1.00 24.59 ? 111  GLU C CB  1 
ATOM   8120  C  CG  . GLU C 1 122 ? 43.102  -22.521 -57.953  1.00 25.76 ? 111  GLU C CG  1 
ATOM   8121  C  CD  . GLU C 1 122 ? 41.785  -22.238 -57.260  1.00 29.24 ? 111  GLU C CD  1 
ATOM   8122  O  OE1 . GLU C 1 122 ? 40.764  -22.084 -57.963  1.00 33.37 ? 111  GLU C OE1 1 
ATOM   8123  O  OE2 . GLU C 1 122 ? 41.770  -22.177 -56.005  1.00 31.37 ? 111  GLU C OE2 1 
ATOM   8124  N  N   . PRO C 1 123 ? 44.512  -19.308 -57.257  1.00 23.10 ? 112  PRO C N   1 
ATOM   8125  C  CA  . PRO C 1 123 ? 45.765  -18.769 -56.801  1.00 24.48 ? 112  PRO C CA  1 
ATOM   8126  C  C   . PRO C 1 123 ? 46.961  -19.592 -57.277  1.00 26.08 ? 112  PRO C C   1 
ATOM   8127  O  O   . PRO C 1 123 ? 46.945  -20.843 -57.218  1.00 27.09 ? 112  PRO C O   1 
ATOM   8128  C  CB  . PRO C 1 123 ? 45.640  -18.843 -55.285  1.00 23.91 ? 112  PRO C CB  1 
ATOM   8129  C  CG  . PRO C 1 123 ? 44.218  -18.790 -55.026  1.00 23.52 ? 112  PRO C CG  1 
ATOM   8130  C  CD  . PRO C 1 123 ? 43.570  -19.513 -56.145  1.00 23.65 ? 112  PRO C CD  1 
ATOM   8131  N  N   . GLY C 1 124 ? 47.981  -18.885 -57.761  1.00 26.73 ? 113  GLY C N   1 
ATOM   8132  C  CA  . GLY C 1 124 ? 49.204  -19.504 -58.237  1.00 26.69 ? 113  GLY C CA  1 
ATOM   8133  C  C   . GLY C 1 124 ? 49.237  -19.467 -59.739  1.00 27.27 ? 113  GLY C C   1 
ATOM   8134  O  O   . GLY C 1 124 ? 50.309  -19.473 -60.340  1.00 28.01 ? 113  GLY C O   1 
ATOM   8135  N  N   . THR C 1 125 ? 48.058  -19.422 -60.353  1.00 27.36 ? 114  THR C N   1 
ATOM   8136  C  CA  . THR C 1 125 ? 47.947  -19.505 -61.807  1.00 26.75 ? 114  THR C CA  1 
ATOM   8137  C  C   . THR C 1 125 ? 47.970  -18.089 -62.376  1.00 26.47 ? 114  THR C C   1 
ATOM   8138  O  O   . THR C 1 125 ? 47.864  -17.117 -61.632  1.00 26.61 ? 114  THR C O   1 
ATOM   8139  C  CB  . THR C 1 125 ? 46.689  -20.322 -62.204  1.00 27.70 ? 114  THR C CB  1 
ATOM   8140  O  OG1 . THR C 1 125 ? 45.504  -19.642 -61.791  1.00 30.23 ? 114  THR C OG1 1 
ATOM   8141  C  CG2 . THR C 1 125 ? 46.696  -21.689 -61.505  1.00 25.40 ? 114  THR C CG2 1 
ATOM   8142  N  N   . SER C 1 126 ? 48.157  -17.939 -63.679  1.00 26.09 ? 115  SER C N   1 
ATOM   8143  C  CA  . SER C 1 126 ? 48.329  -16.586 -64.224  1.00 25.91 ? 115  SER C CA  1 
ATOM   8144  C  C   . SER C 1 126 ? 47.017  -16.010 -64.772  1.00 25.73 ? 115  SER C C   1 
ATOM   8145  O  O   . SER C 1 126 ? 46.134  -16.752 -65.245  1.00 25.56 ? 115  SER C O   1 
ATOM   8146  C  CB  . SER C 1 126 ? 49.396  -16.577 -65.307  1.00 25.90 ? 115  SER C CB  1 
ATOM   8147  O  OG  . SER C 1 126 ? 48.823  -16.879 -66.553  1.00 28.72 ? 115  SER C OG  1 
ATOM   8148  N  N   . LEU C 1 127 ? 46.901  -14.682 -64.731  1.00 24.96 ? 116  LEU C N   1 
ATOM   8149  C  CA  . LEU C 1 127 ? 45.701  -13.984 -65.213  1.00 23.46 ? 116  LEU C CA  1 
ATOM   8150  C  C   . LEU C 1 127 ? 45.459  -14.283 -66.684  1.00 24.14 ? 116  LEU C C   1 
ATOM   8151  O  O   . LEU C 1 127 ? 44.312  -14.467 -67.126  1.00 24.19 ? 116  LEU C O   1 
ATOM   8152  C  CB  . LEU C 1 127 ? 45.855  -12.468 -65.042  1.00 22.53 ? 116  LEU C CB  1 
ATOM   8153  C  CG  . LEU C 1 127 ? 46.146  -11.987 -63.625  1.00 20.23 ? 116  LEU C CG  1 
ATOM   8154  C  CD1 . LEU C 1 127 ? 46.313  -10.484 -63.580  1.00 22.22 ? 116  LEU C CD1 1 
ATOM   8155  C  CD2 . LEU C 1 127 ? 45.042  -12.400 -62.739  1.00 19.45 ? 116  LEU C CD2 1 
ATOM   8156  N  N   . LEU C 1 128 ? 46.552  -14.334 -67.435  1.00 23.17 ? 117  LEU C N   1 
ATOM   8157  C  CA  . LEU C 1 128 ? 46.477  -14.456 -68.893  1.00 23.99 ? 117  LEU C CA  1 
ATOM   8158  C  C   . LEU C 1 128 ? 46.027  -15.846 -69.269  1.00 23.50 ? 117  LEU C C   1 
ATOM   8159  O  O   . LEU C 1 128 ? 45.212  -16.009 -70.168  1.00 24.94 ? 117  LEU C O   1 
ATOM   8160  C  CB  . LEU C 1 128 ? 47.826  -14.102 -69.522  1.00 24.59 ? 117  LEU C CB  1 
ATOM   8161  C  CG  . LEU C 1 128 ? 48.059  -12.594 -69.781  1.00 25.39 ? 117  LEU C CG  1 
ATOM   8162  C  CD1 . LEU C 1 128 ? 48.473  -11.837 -68.514  1.00 24.37 ? 117  LEU C CD1 1 
ATOM   8163  C  CD2 . LEU C 1 128 ? 49.094  -12.417 -70.925  1.00 24.86 ? 117  LEU C CD2 1 
ATOM   8164  N  N   . ALA C 1 129 ? 46.530  -16.834 -68.535  1.00 23.69 ? 118  ALA C N   1 
ATOM   8165  C  CA  . ALA C 1 129 ? 46.204  -18.233 -68.764  1.00 22.26 ? 118  ALA C CA  1 
ATOM   8166  C  C   . ALA C 1 129 ? 44.714  -18.420 -68.565  1.00 21.61 ? 118  ALA C C   1 
ATOM   8167  O  O   . ALA C 1 129 ? 44.006  -18.794 -69.472  1.00 18.32 ? 118  ALA C O   1 
ATOM   8168  C  CB  . ALA C 1 129 ? 46.986  -19.106 -67.786  1.00 21.40 ? 118  ALA C CB  1 
ATOM   8169  N  N   . ALA C 1 130 ? 44.266  -18.111 -67.349  1.00 21.10 ? 119  ALA C N   1 
ATOM   8170  C  CA  . ALA C 1 130 ? 42.860  -18.100 -66.946  1.00 21.61 ? 119  ALA C CA  1 
ATOM   8171  C  C   . ALA C 1 130 ? 41.997  -17.346 -67.898  1.00 20.82 ? 119  ALA C C   1 
ATOM   8172  O  O   . ALA C 1 130 ? 41.012  -17.879 -68.386  1.00 23.20 ? 119  ALA C O   1 
ATOM   8173  C  CB  . ALA C 1 130 ? 42.719  -17.457 -65.552  1.00 20.68 ? 119  ALA C CB  1 
ATOM   8174  N  N   . PHE C 1 131 ? 42.347  -16.098 -68.165  1.00 21.81 ? 120  PHE C N   1 
ATOM   8175  C  CA  . PHE C 1 131 ? 41.605  -15.312 -69.157  1.00 22.32 ? 120  PHE C CA  1 
ATOM   8176  C  C   . PHE C 1 131 ? 41.418  -16.102 -70.449  1.00 22.51 ? 120  PHE C C   1 
ATOM   8177  O  O   . PHE C 1 131 ? 40.353  -16.068 -71.097  1.00 22.52 ? 120  PHE C O   1 
ATOM   8178  C  CB  . PHE C 1 131 ? 42.326  -13.993 -69.468  1.00 19.96 ? 120  PHE C CB  1 
ATOM   8179  C  CG  . PHE C 1 131 ? 41.601  -13.151 -70.473  1.00 21.41 ? 120  PHE C CG  1 
ATOM   8180  C  CD1 . PHE C 1 131 ? 40.656  -12.217 -70.069  1.00 19.22 ? 120  PHE C CD1 1 
ATOM   8181  C  CD2 . PHE C 1 131 ? 41.829  -13.322 -71.837  1.00 19.94 ? 120  PHE C CD2 1 
ATOM   8182  C  CE1 . PHE C 1 131 ? 39.969  -11.465 -70.972  1.00 18.50 ? 120  PHE C CE1 1 
ATOM   8183  C  CE2 . PHE C 1 131 ? 41.157  -12.558 -72.757  1.00 19.01 ? 120  PHE C CE2 1 
ATOM   8184  C  CZ  . PHE C 1 131 ? 40.216  -11.627 -72.348  1.00 18.59 ? 120  PHE C CZ  1 
ATOM   8185  N  N   . ASP C 1 132 ? 42.484  -16.790 -70.838  1.00 24.44 ? 121  ASP C N   1 
ATOM   8186  C  CA  . ASP C 1 132 ? 42.496  -17.511 -72.104  1.00 24.21 ? 121  ASP C CA  1 
ATOM   8187  C  C   . ASP C 1 132 ? 41.530  -18.660 -72.047  1.00 23.89 ? 121  ASP C C   1 
ATOM   8188  O  O   . ASP C 1 132 ? 41.012  -19.064 -73.073  1.00 22.91 ? 121  ASP C O   1 
ATOM   8189  C  CB  . ASP C 1 132 ? 43.904  -18.002 -72.428  1.00 25.58 ? 121  ASP C CB  1 
ATOM   8190  C  CG  . ASP C 1 132 ? 44.673  -17.032 -73.296  1.00 29.50 ? 121  ASP C CG  1 
ATOM   8191  O  OD1 . ASP C 1 132 ? 44.322  -15.822 -73.366  1.00 30.88 ? 121  ASP C OD1 1 
ATOM   8192  O  OD2 . ASP C 1 132 ? 45.653  -17.493 -73.928  1.00 36.17 ? 121  ASP C OD2 1 
ATOM   8193  N  N   . GLN C 1 133 ? 41.289  -19.167 -70.837  1.00 23.51 ? 122  GLN C N   1 
ATOM   8194  C  CA  . GLN C 1 133 ? 40.390  -20.295 -70.624  1.00 24.58 ? 122  GLN C CA  1 
ATOM   8195  C  C   . GLN C 1 133 ? 38.923  -19.892 -70.708  1.00 24.33 ? 122  GLN C C   1 
ATOM   8196  O  O   . GLN C 1 133 ? 38.123  -20.516 -71.419  1.00 22.07 ? 122  GLN C O   1 
ATOM   8197  C  CB  . GLN C 1 133 ? 40.645  -20.924 -69.247  1.00 24.83 ? 122  GLN C CB  1 
ATOM   8198  C  CG  . GLN C 1 133 ? 39.919  -22.211 -69.027  1.00 25.11 ? 122  GLN C CG  1 
ATOM   8199  C  CD  . GLN C 1 133 ? 40.108  -23.172 -70.179  1.00 29.16 ? 122  GLN C CD  1 
ATOM   8200  O  OE1 . GLN C 1 133 ? 39.656  -22.909 -71.290  1.00 29.78 ? 122  GLN C OE1 1 
ATOM   8201  N  NE2 . GLN C 1 133 ? 40.763  -24.299 -69.917  1.00 31.92 ? 122  GLN C NE2 1 
ATOM   8202  N  N   . TRP C 1 134 ? 38.594  -18.845 -69.952  1.00 25.44 ? 123  TRP C N   1 
ATOM   8203  C  CA  . TRP C 1 134 ? 37.291  -18.180 -70.020  1.00 25.89 ? 123  TRP C CA  1 
ATOM   8204  C  C   . TRP C 1 134 ? 36.942  -17.823 -71.440  1.00 26.61 ? 123  TRP C C   1 
ATOM   8205  O  O   . TRP C 1 134 ? 35.868  -18.187 -71.915  1.00 26.83 ? 123  TRP C O   1 
ATOM   8206  C  CB  . TRP C 1 134 ? 37.261  -16.928 -69.125  1.00 25.77 ? 123  TRP C CB  1 
ATOM   8207  C  CG  . TRP C 1 134 ? 36.515  -17.183 -67.826  1.00 25.25 ? 123  TRP C CG  1 
ATOM   8208  C  CD1 . TRP C 1 134 ? 35.241  -16.815 -67.545  1.00 24.48 ? 123  TRP C CD1 1 
ATOM   8209  C  CD2 . TRP C 1 134 ? 36.987  -17.905 -66.682  1.00 24.23 ? 123  TRP C CD2 1 
ATOM   8210  N  NE1 . TRP C 1 134 ? 34.888  -17.247 -66.294  1.00 26.40 ? 123  TRP C NE1 1 
ATOM   8211  C  CE2 . TRP C 1 134 ? 35.939  -17.919 -65.739  1.00 24.35 ? 123  TRP C CE2 1 
ATOM   8212  C  CE3 . TRP C 1 134 ? 38.192  -18.538 -66.363  1.00 25.13 ? 123  TRP C CE3 1 
ATOM   8213  C  CZ2 . TRP C 1 134 ? 36.057  -18.535 -64.491  1.00 24.71 ? 123  TRP C CZ2 1 
ATOM   8214  C  CZ3 . TRP C 1 134 ? 38.314  -19.155 -65.129  1.00 24.81 ? 123  TRP C CZ3 1 
ATOM   8215  C  CH2 . TRP C 1 134 ? 37.245  -19.155 -64.209  1.00 25.43 ? 123  TRP C CH2 1 
ATOM   8216  N  N   . ARG C 1 135 ? 37.856  -17.135 -72.123  1.00 27.80 ? 124  ARG C N   1 
ATOM   8217  C  CA  . ARG C 1 135 ? 37.692  -16.856 -73.560  1.00 27.98 ? 124  ARG C CA  1 
ATOM   8218  C  C   . ARG C 1 135 ? 37.345  -18.135 -74.305  1.00 28.75 ? 124  ARG C C   1 
ATOM   8219  O  O   . ARG C 1 135 ? 36.380  -18.181 -75.053  1.00 30.43 ? 124  ARG C O   1 
ATOM   8220  C  CB  . ARG C 1 135 ? 38.965  -16.271 -74.164  1.00 28.67 ? 124  ARG C CB  1 
ATOM   8221  C  CG  . ARG C 1 135 ? 39.200  -14.787 -73.942  1.00 29.66 ? 124  ARG C CG  1 
ATOM   8222  C  CD  . ARG C 1 135 ? 38.134  -13.906 -74.581  1.00 30.67 ? 124  ARG C CD  1 
ATOM   8223  N  NE  . ARG C 1 135 ? 37.894  -14.193 -75.996  1.00 31.48 ? 124  ARG C NE  1 
ATOM   8224  C  CZ  . ARG C 1 135 ? 38.530  -13.629 -77.031  1.00 31.43 ? 124  ARG C CZ  1 
ATOM   8225  N  NH1 . ARG C 1 135 ? 39.479  -12.724 -76.860  1.00 31.75 ? 124  ARG C NH1 1 
ATOM   8226  N  NH2 . ARG C 1 135 ? 38.212  -13.977 -78.267  1.00 32.89 ? 124  ARG C NH2 1 
ATOM   8227  N  N   . GLU C 1 136 ? 38.119  -19.187 -74.082  1.00 28.78 ? 125  GLU C N   1 
ATOM   8228  C  CA  . GLU C 1 136 ? 37.871  -20.457 -74.761  1.00 28.94 ? 125  GLU C CA  1 
ATOM   8229  C  C   . GLU C 1 136 ? 36.473  -21.020 -74.509  1.00 29.56 ? 125  GLU C C   1 
ATOM   8230  O  O   . GLU C 1 136 ? 35.801  -21.515 -75.428  1.00 29.11 ? 125  GLU C O   1 
ATOM   8231  C  CB  . GLU C 1 136 ? 38.905  -21.489 -74.332  1.00 29.22 ? 125  GLU C CB  1 
ATOM   8232  C  CG  . GLU C 1 136 ? 39.104  -22.581 -75.336  1.00 30.73 ? 125  GLU C CG  1 
ATOM   8233  C  CD  . GLU C 1 136 ? 40.556  -22.798 -75.654  1.00 32.33 ? 125  GLU C CD  1 
ATOM   8234  O  OE1 . GLU C 1 136 ? 41.314  -23.098 -74.702  1.00 33.18 ? 125  GLU C OE1 1 
ATOM   8235  O  OE2 . GLU C 1 136 ? 40.930  -22.666 -76.856  1.00 31.68 ? 125  GLU C OE2 1 
ATOM   8236  N  N   . TRP C 1 137 ? 36.055  -20.977 -73.249  1.00 29.55 ? 126  TRP C N   1 
ATOM   8237  C  CA  . TRP C 1 137 ? 34.716  -21.453 -72.843  1.00 28.12 ? 126  TRP C CA  1 
ATOM   8238  C  C   . TRP C 1 137 ? 33.586  -20.639 -73.420  1.00 26.83 ? 126  TRP C C   1 
ATOM   8239  O  O   . TRP C 1 137 ? 32.635  -21.195 -73.950  1.00 27.02 ? 126  TRP C O   1 
ATOM   8240  C  CB  . TRP C 1 137 ? 34.581  -21.402 -71.337  1.00 28.53 ? 126  TRP C CB  1 
ATOM   8241  C  CG  . TRP C 1 137 ? 35.303  -22.465 -70.609  1.00 29.67 ? 126  TRP C CG  1 
ATOM   8242  C  CD1 . TRP C 1 137 ? 35.487  -23.750 -70.998  1.00 29.63 ? 126  TRP C CD1 1 
ATOM   8243  C  CD2 . TRP C 1 137 ? 35.865  -22.354 -69.297  1.00 29.41 ? 126  TRP C CD2 1 
ATOM   8244  N  NE1 . TRP C 1 137 ? 36.166  -24.444 -70.025  1.00 29.52 ? 126  TRP C NE1 1 
ATOM   8245  C  CE2 . TRP C 1 137 ? 36.418  -23.603 -68.974  1.00 31.00 ? 126  TRP C CE2 1 
ATOM   8246  C  CE3 . TRP C 1 137 ? 35.992  -21.303 -68.385  1.00 29.21 ? 126  TRP C CE3 1 
ATOM   8247  C  CZ2 . TRP C 1 137 ? 37.080  -23.837 -67.764  1.00 29.29 ? 126  TRP C CZ2 1 
ATOM   8248  C  CZ3 . TRP C 1 137 ? 36.637  -21.540 -67.183  1.00 29.10 ? 126  TRP C CZ3 1 
ATOM   8249  C  CH2 . TRP C 1 137 ? 37.176  -22.797 -66.887  1.00 29.51 ? 126  TRP C CH2 1 
ATOM   8250  N  N   . ALA C 1 138 ? 33.700  -19.319 -73.334  1.00 26.45 ? 127  ALA C N   1 
ATOM   8251  C  CA  . ALA C 1 138 ? 32.610  -18.433 -73.732  1.00 25.76 ? 127  ALA C CA  1 
ATOM   8252  C  C   . ALA C 1 138 ? 32.520  -18.289 -75.249  1.00 25.13 ? 127  ALA C C   1 
ATOM   8253  O  O   . ALA C 1 138 ? 31.425  -18.138 -75.792  1.00 24.19 ? 127  ALA C O   1 
ATOM   8254  C  CB  . ALA C 1 138 ? 32.774  -17.098 -73.098  1.00 24.82 ? 127  ALA C CB  1 
ATOM   8255  N  N   . ASP C 1 139 ? 33.670  -18.317 -75.920  1.00 25.60 ? 128  ASP C N   1 
ATOM   8256  C  CA  . ASP C 1 139 ? 33.709  -18.186 -77.385  1.00 25.60 ? 128  ASP C CA  1 
ATOM   8257  C  C   . ASP C 1 139 ? 33.071  -19.374 -78.094  1.00 24.69 ? 128  ASP C C   1 
ATOM   8258  O  O   . ASP C 1 139 ? 32.600  -19.243 -79.219  1.00 26.67 ? 128  ASP C O   1 
ATOM   8259  C  CB  . ASP C 1 139 ? 35.152  -18.016 -77.871  1.00 25.83 ? 128  ASP C CB  1 
ATOM   8260  C  CG  . ASP C 1 139 ? 35.707  -16.629 -77.608  1.00 29.24 ? 128  ASP C CG  1 
ATOM   8261  O  OD1 . ASP C 1 139 ? 34.918  -15.682 -77.347  1.00 29.90 ? 128  ASP C OD1 1 
ATOM   8262  O  OD2 . ASP C 1 139 ? 36.952  -16.476 -77.682  1.00 32.53 ? 128  ASP C OD2 1 
ATOM   8263  N  N   . SER C 1 140 ? 33.054  -20.525 -77.430  1.00 24.96 ? 129  SER C N   1 
ATOM   8264  C  CA  . SER C 1 140 ? 32.533  -21.799 -77.982  1.00 24.57 ? 129  SER C CA  1 
ATOM   8265  C  C   . SER C 1 140 ? 31.051  -22.060 -77.668  1.00 25.34 ? 129  SER C C   1 
ATOM   8266  O  O   . SER C 1 140 ? 30.367  -22.804 -78.386  1.00 26.36 ? 129  SER C O   1 
ATOM   8267  C  CB  . SER C 1 140 ? 33.355  -22.947 -77.416  1.00 24.07 ? 129  SER C CB  1 
ATOM   8268  O  OG  . SER C 1 140 ? 33.156  -23.009 -76.007  1.00 22.37 ? 129  SER C OG  1 
ATOM   8269  N  N   . LYS C 1 141 ? 30.563  -21.409 -76.617  1.00 23.90 ? 130  LYS C N   1 
ATOM   8270  C  CA  . LYS C 1 141 ? 29.234  -21.659 -76.071  1.00 23.78 ? 130  LYS C CA  1 
ATOM   8271  C  C   . LYS C 1 141 ? 28.286  -20.447 -76.061  1.00 23.60 ? 130  LYS C C   1 
ATOM   8272  O  O   . LYS C 1 141 ? 27.080  -20.640 -76.122  1.00 24.87 ? 130  LYS C O   1 
ATOM   8273  C  CB  . LYS C 1 141 ? 29.376  -22.188 -74.635  1.00 22.87 ? 130  LYS C CB  1 
ATOM   8274  C  CG  . LYS C 1 141 ? 29.683  -23.660 -74.535  1.00 22.06 ? 130  LYS C CG  1 
ATOM   8275  C  CD  . LYS C 1 141 ? 29.971  -24.034 -73.100  1.00 22.26 ? 130  LYS C CD  1 
ATOM   8276  C  CE  . LYS C 1 141 ? 29.877  -25.521 -72.916  1.00 24.26 ? 130  LYS C CE  1 
ATOM   8277  N  NZ  . LYS C 1 141 ? 30.616  -25.966 -71.692  1.00 27.11 ? 130  LYS C NZ  1 
ATOM   8278  N  N   . SER C 1 142 ? 28.811  -19.221 -75.988  1.00 23.80 ? 131  SER C N   1 
ATOM   8279  C  CA  . SER C 1 142 ? 27.971  -18.054 -75.705  1.00 23.60 ? 131  SER C CA  1 
ATOM   8280  C  C   . SER C 1 142 ? 27.017  -17.745 -76.841  1.00 24.31 ? 131  SER C C   1 
ATOM   8281  O  O   . SER C 1 142 ? 27.425  -17.741 -78.030  1.00 24.22 ? 131  SER C O   1 
ATOM   8282  C  CB  . SER C 1 142 ? 28.792  -16.804 -75.404  1.00 23.64 ? 131  SER C CB  1 
ATOM   8283  O  OG  . SER C 1 142 ? 27.925  -15.688 -75.173  1.00 25.39 ? 131  SER C OG  1 
ATOM   8284  N  N   . CYS C 1 143 ? 25.758  -17.482 -76.450  1.00 23.23 ? 132  CYS C N   1 
ATOM   8285  C  CA  . CYS C 1 143 ? 24.686  -17.148 -77.368  1.00 23.99 ? 132  CYS C CA  1 
ATOM   8286  C  C   . CYS C 1 143 ? 24.603  -15.665 -77.638  1.00 23.95 ? 132  CYS C C   1 
ATOM   8287  O  O   . CYS C 1 143 ? 23.905  -15.252 -78.563  1.00 25.07 ? 132  CYS C O   1 
ATOM   8288  C  CB  . CYS C 1 143 ? 23.354  -17.647 -76.832  1.00 23.00 ? 132  CYS C CB  1 
ATOM   8289  S  SG  . CYS C 1 143 ? 23.357  -19.423 -76.560  1.00 25.48 ? 132  CYS C SG  1 
ATOM   8290  N  N   . CYS C 1 144 ? 25.316  -14.864 -76.846  1.00 24.93 ? 133  CYS C N   1 
ATOM   8291  C  CA  . CYS C 1 144 ? 25.313  -13.387 -77.005  1.00 23.84 ? 133  CYS C CA  1 
ATOM   8292  C  C   . CYS C 1 144 ? 26.702  -12.760 -76.795  1.00 23.85 ? 133  CYS C C   1 
ATOM   8293  O  O   . CYS C 1 144 ? 27.623  -13.405 -76.259  1.00 22.65 ? 133  CYS C O   1 
ATOM   8294  C  CB  . CYS C 1 144 ? 24.323  -12.747 -76.025  1.00 23.09 ? 133  CYS C CB  1 
ATOM   8295  S  SG  . CYS C 1 144 ? 24.758  -12.938 -74.266  1.00 19.77 ? 133  CYS C SG  1 
ATOM   8296  N  N   . ASP C 1 145 ? 26.826  -11.487 -77.179  1.00 23.09 ? 134  ASP C N   1 
ATOM   8297  C  CA  . ASP C 1 145 ? 28.054  -10.728 -76.944  1.00 23.29 ? 134  ASP C CA  1 
ATOM   8298  C  C   . ASP C 1 145 ? 28.346  -10.717 -75.462  1.00 22.17 ? 134  ASP C C   1 
ATOM   8299  O  O   . ASP C 1 145 ? 27.428  -10.681 -74.643  1.00 20.95 ? 134  ASP C O   1 
ATOM   8300  C  CB  . ASP C 1 145 ? 27.956  -9.298  -77.451  1.00 24.75 ? 134  ASP C CB  1 
ATOM   8301  C  CG  . ASP C 1 145 ? 27.691  -9.234  -78.933  1.00 26.81 ? 134  ASP C CG  1 
ATOM   8302  O  OD1 . ASP C 1 145 ? 27.299  -10.271 -79.496  1.00 33.01 ? 134  ASP C OD1 1 
ATOM   8303  O  OD2 . ASP C 1 145 ? 27.848  -8.158  -79.529  1.00 29.73 ? 134  ASP C OD2 1 
ATOM   8304  N  N   . TYR C 1 146 ? 29.622  -10.791 -75.128  1.00 20.59 ? 135  TYR C N   1 
ATOM   8305  C  CA  . TYR C 1 146 ? 30.012  -10.915 -73.748  1.00 18.78 ? 135  TYR C CA  1 
ATOM   8306  C  C   . TYR C 1 146 ? 31.353  -10.265 -73.589  1.00 18.32 ? 135  TYR C C   1 
ATOM   8307  O  O   . TYR C 1 146 ? 32.036  -10.007 -74.577  1.00 15.85 ? 135  TYR C O   1 
ATOM   8308  C  CB  . TYR C 1 146 ? 30.090  -12.394 -73.365  1.00 20.89 ? 135  TYR C CB  1 
ATOM   8309  C  CG  . TYR C 1 146 ? 31.329  -13.129 -73.900  1.00 23.01 ? 135  TYR C CG  1 
ATOM   8310  C  CD1 . TYR C 1 146 ? 31.419  -13.577 -75.230  1.00 20.36 ? 135  TYR C CD1 1 
ATOM   8311  C  CD2 . TYR C 1 146 ? 32.408  -13.377 -73.056  1.00 23.96 ? 135  TYR C CD2 1 
ATOM   8312  C  CE1 . TYR C 1 146 ? 32.580  -14.237 -75.694  1.00 19.95 ? 135  TYR C CE1 1 
ATOM   8313  C  CE2 . TYR C 1 146 ? 33.545  -14.014 -73.503  1.00 22.29 ? 135  TYR C CE2 1 
ATOM   8314  C  CZ  . TYR C 1 146 ? 33.635  -14.438 -74.808  1.00 21.97 ? 135  TYR C CZ  1 
ATOM   8315  O  OH  . TYR C 1 146 ? 34.813  -15.066 -75.134  1.00 22.60 ? 135  TYR C OH  1 
ATOM   8316  N  N   . SER C 1 147 ? 31.754  -10.041 -72.343  1.00 14.16 ? 136  SER C N   1 
ATOM   8317  C  CA  . SER C 1 147 ? 33.052  -9.484  -72.050  1.00 15.88 ? 136  SER C CA  1 
ATOM   8318  C  C   . SER C 1 147 ? 33.393  -10.073 -70.722  1.00 15.16 ? 136  SER C C   1 
ATOM   8319  O  O   . SER C 1 147 ? 32.552  -10.787 -70.177  1.00 15.31 ? 136  SER C O   1 
ATOM   8320  C  CB  . SER C 1 147 ? 32.997  -7.956  -71.965  1.00 14.45 ? 136  SER C CB  1 
ATOM   8321  O  OG  . SER C 1 147 ? 34.296  -7.405  -72.131  1.00 21.33 ? 136  SER C OG  1 
ATOM   8322  N  N   . LEU C 1 148 ? 34.582  -9.751  -70.206  1.00 16.82 ? 137  LEU C N   1 
ATOM   8323  C  CA  . LEU C 1 148 ? 35.075  -10.297 -68.937  1.00 16.24 ? 137  LEU C CA  1 
ATOM   8324  C  C   . LEU C 1 148 ? 35.798  -9.363  -67.988  1.00 16.59 ? 137  LEU C C   1 
ATOM   8325  O  O   . LEU C 1 148 ? 36.777  -8.703  -68.352  1.00 19.36 ? 137  LEU C O   1 
ATOM   8326  C  CB  . LEU C 1 148 ? 36.021  -11.477 -69.230  1.00 16.05 ? 137  LEU C CB  1 
ATOM   8327  C  CG  . LEU C 1 148 ? 35.377  -12.741 -69.809  1.00 16.29 ? 137  LEU C CG  1 
ATOM   8328  C  CD1 . LEU C 1 148 ? 36.380  -13.408 -70.716  1.00 12.71 ? 137  LEU C CD1 1 
ATOM   8329  C  CD2 . LEU C 1 148 ? 34.872  -13.695 -68.735  1.00 14.98 ? 137  LEU C CD2 1 
ATOM   8330  N  N   . HIS C 1 149 ? 35.333  -9.375  -66.739  1.00 16.64 ? 138  HIS C N   1 
ATOM   8331  C  CA  . HIS C 1 149 ? 36.071  -8.874  -65.580  1.00 14.62 ? 138  HIS C CA  1 
ATOM   8332  C  C   . HIS C 1 149 ? 37.095  -9.914  -65.193  1.00 13.25 ? 138  HIS C C   1 
ATOM   8333  O  O   . HIS C 1 149 ? 36.831  -11.089 -65.338  1.00 15.73 ? 138  HIS C O   1 
ATOM   8334  C  CB  . HIS C 1 149 ? 35.123  -8.720  -64.387  1.00 15.34 ? 138  HIS C CB  1 
ATOM   8335  C  CG  . HIS C 1 149 ? 33.878  -7.939  -64.671  1.00 14.75 ? 138  HIS C CG  1 
ATOM   8336  N  ND1 . HIS C 1 149 ? 33.890  -6.597  -64.989  1.00 16.51 ? 138  HIS C ND1 1 
ATOM   8337  C  CD2 . HIS C 1 149 ? 32.578  -8.298  -64.615  1.00 18.26 ? 138  HIS C CD2 1 
ATOM   8338  C  CE1 . HIS C 1 149 ? 32.650  -6.174  -65.144  1.00 18.80 ? 138  HIS C CE1 1 
ATOM   8339  N  NE2 . HIS C 1 149 ? 31.833  -7.190  -64.929  1.00 19.82 ? 138  HIS C NE2 1 
ATOM   8340  N  N   . VAL C 1 150 ? 38.245  -9.509  -64.679  1.00 12.35 ? 139  VAL C N   1 
ATOM   8341  C  CA  . VAL C 1 150 ? 39.278  -10.453 -64.250  1.00 12.05 ? 139  VAL C CA  1 
ATOM   8342  C  C   . VAL C 1 150 ? 39.482  -10.224 -62.753  1.00 11.17 ? 139  VAL C C   1 
ATOM   8343  O  O   . VAL C 1 150 ? 39.793  -9.113  -62.344  1.00 8.85  ? 139  VAL C O   1 
ATOM   8344  C  CB  . VAL C 1 150 ? 40.602  -10.201 -64.954  1.00 10.77 ? 139  VAL C CB  1 
ATOM   8345  C  CG1 . VAL C 1 150 ? 41.657  -11.152 -64.486  1.00 11.43 ? 139  VAL C CG1 1 
ATOM   8346  C  CG2 . VAL C 1 150 ? 40.425  -10.359 -66.497  1.00 9.83  ? 139  VAL C CG2 1 
ATOM   8347  N  N   . ASP C 1 151 ? 39.281  -11.282 -61.992  1.00 13.06 ? 140  ASP C N   1 
ATOM   8348  C  CA  . ASP C 1 151 ? 39.322  -11.256 -60.536  1.00 15.43 ? 140  ASP C CA  1 
ATOM   8349  C  C   . ASP C 1 151 ? 40.719  -11.577 -60.047  1.00 16.90 ? 140  ASP C C   1 
ATOM   8350  O  O   . ASP C 1 151 ? 41.308  -12.562 -60.475  1.00 17.61 ? 140  ASP C O   1 
ATOM   8351  C  CB  . ASP C 1 151 ? 38.447  -12.364 -59.977  1.00 14.93 ? 140  ASP C CB  1 
ATOM   8352  C  CG  . ASP C 1 151 ? 36.981  -12.127 -60.155  1.00 14.22 ? 140  ASP C CG  1 
ATOM   8353  O  OD1 . ASP C 1 151 ? 36.588  -11.181 -60.837  1.00 12.82 ? 140  ASP C OD1 1 
ATOM   8354  O  OD2 . ASP C 1 151 ? 36.228  -12.952 -59.616  1.00 5.01  ? 140  ASP C OD2 1 
ATOM   8355  N  N   . ILE C 1 152 ? 41.202  -10.807 -59.072  1.00 19.46 ? 141  ILE C N   1 
ATOM   8356  C  CA  . ILE C 1 152 ? 42.522  -11.000 -58.520  1.00 18.97 ? 141  ILE C CA  1 
ATOM   8357  C  C   . ILE C 1 152 ? 42.421  -11.807 -57.244  1.00 21.12 ? 141  ILE C C   1 
ATOM   8358  O  O   . ILE C 1 152 ? 41.852  -11.352 -56.241  1.00 20.51 ? 141  ILE C O   1 
ATOM   8359  C  CB  . ILE C 1 152 ? 43.196  -9.666  -58.294  1.00 18.99 ? 141  ILE C CB  1 
ATOM   8360  C  CG1 . ILE C 1 152 ? 43.691  -9.113  -59.617  1.00 17.99 ? 141  ILE C CG1 1 
ATOM   8361  C  CG2 . ILE C 1 152 ? 44.408  -9.807  -57.447  1.00 17.10 ? 141  ILE C CG2 1 
ATOM   8362  C  CD1 . ILE C 1 152 ? 43.205  -9.821  -60.855  1.00 19.12 ? 141  ILE C CD1 1 
ATOM   8363  N  N   . SER C 1 153 ? 42.994  -13.009 -57.301  1.00 21.43 ? 142  SER C N   1 
ATOM   8364  C  CA  . SER C 1 153 ? 42.904  -14.002 -56.231  1.00 21.47 ? 142  SER C CA  1 
ATOM   8365  C  C   . SER C 1 153 ? 44.075  -14.003 -55.233  1.00 22.57 ? 142  SER C C   1 
ATOM   8366  O  O   . SER C 1 153 ? 43.999  -14.686 -54.180  1.00 25.10 ? 142  SER C O   1 
ATOM   8367  C  CB  . SER C 1 153 ? 42.780  -15.381 -56.891  1.00 22.59 ? 142  SER C CB  1 
ATOM   8368  O  OG  . SER C 1 153 ? 43.891  -15.661 -57.725  1.00 17.87 ? 142  SER C OG  1 
ATOM   8369  N  N   . GLU C 1 154 ? 45.131  -13.228 -55.543  1.00 22.23 ? 143  GLU C N   1 
ATOM   8370  C  CA  . GLU C 1 154 ? 46.332  -13.065 -54.683  1.00 20.86 ? 143  GLU C CA  1 
ATOM   8371  C  C   . GLU C 1 154 ? 47.156  -11.894 -55.173  1.00 18.93 ? 143  GLU C C   1 
ATOM   8372  O  O   . GLU C 1 154 ? 47.179  -11.641 -56.355  1.00 17.89 ? 143  GLU C O   1 
ATOM   8373  C  CB  . GLU C 1 154 ? 47.203  -14.313 -54.727  1.00 20.78 ? 143  GLU C CB  1 
ATOM   8374  C  CG  . GLU C 1 154 ? 47.849  -14.577 -56.077  1.00 20.66 ? 143  GLU C CG  1 
ATOM   8375  C  CD  . GLU C 1 154 ? 48.346  -16.020 -56.213  1.00 22.39 ? 143  GLU C CD  1 
ATOM   8376  O  OE1 . GLU C 1 154 ? 48.380  -16.748 -55.194  1.00 13.30 ? 143  GLU C OE1 1 
ATOM   8377  O  OE2 . GLU C 1 154 ? 48.648  -16.441 -57.354  1.00 15.59 ? 143  GLU C OE2 1 
ATOM   8378  N  N   . TRP C 1 155 ? 47.820  -11.177 -54.267  1.00 18.16 ? 144  TRP C N   1 
ATOM   8379  C  CA  . TRP C 1 155 ? 48.607  -9.977  -54.661  1.00 17.29 ? 144  TRP C CA  1 
ATOM   8380  C  C   . TRP C 1 155 ? 50.120  -10.099 -54.372  1.00 16.65 ? 144  TRP C C   1 
ATOM   8381  O  O   . TRP C 1 155 ? 50.542  -10.377 -53.256  1.00 14.00 ? 144  TRP C O   1 
ATOM   8382  C  CB  . TRP C 1 155 ? 48.019  -8.715  -54.020  1.00 15.84 ? 144  TRP C CB  1 
ATOM   8383  C  CG  . TRP C 1 155 ? 48.705  -7.433  -54.401  1.00 15.09 ? 144  TRP C CG  1 
ATOM   8384  C  CD1 . TRP C 1 155 ? 49.488  -6.659  -53.610  1.00 15.25 ? 144  TRP C CD1 1 
ATOM   8385  C  CD2 . TRP C 1 155 ? 48.690  -6.798  -55.684  1.00 10.49 ? 144  TRP C CD2 1 
ATOM   8386  N  NE1 . TRP C 1 155 ? 49.946  -5.566  -54.311  1.00 13.55 ? 144  TRP C NE1 1 
ATOM   8387  C  CE2 . TRP C 1 155 ? 49.465  -5.632  -55.586  1.00 13.34 ? 144  TRP C CE2 1 
ATOM   8388  C  CE3 . TRP C 1 155 ? 48.072  -7.092  -56.895  1.00 13.58 ? 144  TRP C CE3 1 
ATOM   8389  C  CZ2 . TRP C 1 155 ? 49.659  -4.760  -56.670  1.00 15.26 ? 144  TRP C CZ2 1 
ATOM   8390  C  CZ3 . TRP C 1 155 ? 48.251  -6.247  -57.953  1.00 14.47 ? 144  TRP C CZ3 1 
ATOM   8391  C  CH2 . TRP C 1 155 ? 49.039  -5.081  -57.842  1.00 15.50 ? 144  TRP C CH2 1 
ATOM   8392  N  N   . HIS C 1 156 ? 50.935  -9.893  -55.388  1.00 14.79 ? 145  HIS C N   1 
ATOM   8393  C  CA  . HIS C 1 156 ? 52.383  -9.840  -55.195  1.00 18.59 ? 145  HIS C CA  1 
ATOM   8394  C  C   . HIS C 1 156 ? 52.915  -8.860  -56.241  1.00 20.31 ? 145  HIS C C   1 
ATOM   8395  O  O   . HIS C 1 156 ? 52.148  -8.401  -57.105  1.00 21.92 ? 145  HIS C O   1 
ATOM   8396  C  CB  . HIS C 1 156 ? 53.020  -11.250 -55.358  1.00 18.38 ? 145  HIS C CB  1 
ATOM   8397  C  CG  . HIS C 1 156 ? 52.712  -11.906 -56.676  1.00 14.96 ? 145  HIS C CG  1 
ATOM   8398  N  ND1 . HIS C 1 156 ? 53.326  -11.533 -57.848  1.00 17.54 ? 145  HIS C ND1 1 
ATOM   8399  C  CD2 . HIS C 1 156 ? 51.866  -12.907 -57.001  1.00 13.57 ? 145  HIS C CD2 1 
ATOM   8400  C  CE1 . HIS C 1 156 ? 52.846  -12.244 -58.852  1.00 14.96 ? 145  HIS C CE1 1 
ATOM   8401  N  NE2 . HIS C 1 156 ? 51.966  -13.096 -58.364  1.00 17.98 ? 145  HIS C NE2 1 
ATOM   8402  N  N   . LYS C 1 157 ? 54.216  -8.581  -56.211  1.00 22.20 ? 146  LYS C N   1 
ATOM   8403  C  CA  . LYS C 1 157 ? 54.780  -7.520  -57.062  1.00 22.88 ? 146  LYS C CA  1 
ATOM   8404  C  C   . LYS C 1 157 ? 54.915  -7.852  -58.564  1.00 23.67 ? 146  LYS C C   1 
ATOM   8405  O  O   . LYS C 1 157 ? 55.435  -7.038  -59.349  1.00 21.36 ? 146  LYS C O   1 
ATOM   8406  C  CB  . LYS C 1 157 ? 56.106  -7.046  -56.490  1.00 24.39 ? 146  LYS C CB  1 
ATOM   8407  C  CG  . LYS C 1 157 ? 55.913  -6.180  -55.220  1.00 26.41 ? 146  LYS C CG  1 
ATOM   8408  C  CD  . LYS C 1 157 ? 57.140  -6.155  -54.326  1.00 26.51 ? 146  LYS C CD  1 
ATOM   8409  C  CE  . LYS C 1 157 ? 58.430  -5.916  -55.060  1.00 28.00 ? 146  LYS C CE  1 
ATOM   8410  N  NZ  . LYS C 1 157 ? 59.514  -5.749  -54.041  1.00 30.11 ? 146  LYS C NZ  1 
ATOM   8411  N  N   . GLY C 1 158 ? 54.420  -9.020  -58.953  1.00 23.38 ? 147  GLY C N   1 
ATOM   8412  C  CA  . GLY C 1 158 ? 54.404  -9.420  -60.352  1.00 23.57 ? 147  GLY C CA  1 
ATOM   8413  C  C   . GLY C 1 158 ? 53.036  -9.488  -60.989  1.00 24.15 ? 147  GLY C C   1 
ATOM   8414  O  O   . GLY C 1 158 ? 52.943  -9.783  -62.181  1.00 24.94 ? 147  GLY C O   1 
ATOM   8415  N  N   . ILE C 1 159 ? 51.967  -9.238  -60.219  1.00 23.73 ? 148  ILE C N   1 
ATOM   8416  C  CA  . ILE C 1 159 ? 50.619  -9.280  -60.795  1.00 24.09 ? 148  ILE C CA  1 
ATOM   8417  C  C   . ILE C 1 159 ? 50.336  -8.068  -61.704  1.00 23.91 ? 148  ILE C C   1 
ATOM   8418  O  O   . ILE C 1 159 ? 49.760  -8.209  -62.773  1.00 25.05 ? 148  ILE C O   1 
ATOM   8419  C  CB  . ILE C 1 159 ? 49.519  -9.366  -59.724  1.00 22.44 ? 148  ILE C CB  1 
ATOM   8420  C  CG1 . ILE C 1 159 ? 49.652  -10.640 -58.902  1.00 20.77 ? 148  ILE C CG1 1 
ATOM   8421  C  CG2 . ILE C 1 159 ? 48.127  -9.334  -60.389  1.00 22.91 ? 148  ILE C CG2 1 
ATOM   8422  C  CD1 . ILE C 1 159 ? 49.082  -11.864 -59.580  1.00 19.45 ? 148  ILE C CD1 1 
ATOM   8423  N  N   . GLN C 1 160 ? 50.731  -6.883  -61.267  1.00 24.86 ? 149  GLN C N   1 
ATOM   8424  C  CA  . GLN C 1 160 ? 50.559  -5.676  -62.063  1.00 25.43 ? 149  GLN C CA  1 
ATOM   8425  C  C   . GLN C 1 160 ? 50.926  -5.864  -63.544  1.00 26.97 ? 149  GLN C C   1 
ATOM   8426  O  O   . GLN C 1 160 ? 50.199  -5.420  -64.451  1.00 27.32 ? 149  GLN C O   1 
ATOM   8427  C  CB  . GLN C 1 160 ? 51.401  -4.538  -61.472  1.00 25.59 ? 149  GLN C CB  1 
ATOM   8428  C  CG  . GLN C 1 160 ? 51.491  -3.355  -62.390  1.00 25.03 ? 149  GLN C CG  1 
ATOM   8429  C  CD  . GLN C 1 160 ? 52.425  -2.327  -61.918  1.00 24.21 ? 149  GLN C CD  1 
ATOM   8430  O  OE1 . GLN C 1 160 ? 52.716  -2.205  -60.735  1.00 15.58 ? 149  GLN C OE1 1 
ATOM   8431  N  NE2 . GLN C 1 160 ? 52.929  -1.564  -62.853  1.00 19.71 ? 149  GLN C NE2 1 
ATOM   8432  N  N   . GLU C 1 161 ? 52.076  -6.495  -63.777  1.00 27.88 ? 150  GLU C N   1 
ATOM   8433  C  CA  . GLU C 1 161 ? 52.591  -6.715  -65.115  1.00 27.51 ? 150  GLU C CA  1 
ATOM   8434  C  C   . GLU C 1 161 ? 51.580  -7.422  -65.987  1.00 26.73 ? 150  GLU C C   1 
ATOM   8435  O  O   . GLU C 1 161 ? 51.466  -7.141  -67.182  1.00 27.57 ? 150  GLU C O   1 
ATOM   8436  C  CB  . GLU C 1 161 ? 53.874  -7.533  -65.040  1.00 28.13 ? 150  GLU C CB  1 
ATOM   8437  C  CG  . GLU C 1 161 ? 54.651  -7.513  -66.316  1.00 32.48 ? 150  GLU C CG  1 
ATOM   8438  C  CD  . GLU C 1 161 ? 56.057  -8.033  -66.182  1.00 31.93 ? 150  GLU C CD  1 
ATOM   8439  O  OE1 . GLU C 1 161 ? 56.672  -8.256  -67.240  1.00 36.94 ? 150  GLU C OE1 1 
ATOM   8440  O  OE2 . GLU C 1 161 ? 56.547  -8.205  -65.046  1.00 35.65 ? 150  GLU C OE2 1 
ATOM   8441  N  N   . GLU C 1 162 ? 50.848  -8.356  -65.397  1.00 26.59 ? 151  GLU C N   1 
ATOM   8442  C  CA  . GLU C 1 162 ? 49.788  -9.064  -66.101  1.00 26.01 ? 151  GLU C CA  1 
ATOM   8443  C  C   . GLU C 1 162 ? 48.583  -8.172  -66.340  1.00 24.85 ? 151  GLU C C   1 
ATOM   8444  O  O   . GLU C 1 162 ? 48.018  -8.165  -67.422  1.00 25.86 ? 151  GLU C O   1 
ATOM   8445  C  CB  . GLU C 1 162 ? 49.366  -10.310 -65.319  1.00 26.46 ? 151  GLU C CB  1 
ATOM   8446  C  CG  . GLU C 1 162 ? 50.393  -11.416 -65.347  1.00 27.06 ? 151  GLU C CG  1 
ATOM   8447  C  CD  . GLU C 1 162 ? 50.009  -12.593 -64.504  1.00 27.86 ? 151  GLU C CD  1 
ATOM   8448  O  OE1 . GLU C 1 162 ? 49.460  -13.551 -65.080  1.00 30.82 ? 151  GLU C OE1 1 
ATOM   8449  O  OE2 . GLU C 1 162 ? 50.261  -12.570 -63.267  1.00 29.94 ? 151  GLU C OE2 1 
ATOM   8450  N  N   . MET C 1 163 ? 48.171  -7.443  -65.313  1.00 24.71 ? 152  MET C N   1 
ATOM   8451  C  CA  . MET C 1 163 ? 47.054  -6.493  -65.430  1.00 24.62 ? 152  MET C CA  1 
ATOM   8452  C  C   . MET C 1 163 ? 47.285  -5.501  -66.563  1.00 24.25 ? 152  MET C C   1 
ATOM   8453  O  O   . MET C 1 163 ? 46.416  -5.281  -67.412  1.00 23.21 ? 152  MET C O   1 
ATOM   8454  C  CB  . MET C 1 163 ? 46.872  -5.731  -64.118  1.00 23.83 ? 152  MET C CB  1 
ATOM   8455  C  CG  . MET C 1 163 ? 46.436  -6.596  -62.972  1.00 24.88 ? 152  MET C CG  1 
ATOM   8456  S  SD  . MET C 1 163 ? 46.188  -5.722  -61.423  1.00 25.76 ? 152  MET C SD  1 
ATOM   8457  C  CE  . MET C 1 163 ? 47.765  -5.006  -61.080  1.00 32.85 ? 152  MET C CE  1 
ATOM   8458  N  N   . GLU C 1 164 ? 48.483  -4.921  -66.568  1.00 24.18 ? 153  GLU C N   1 
ATOM   8459  C  CA  . GLU C 1 164 ? 48.865  -3.958  -67.568  1.00 24.17 ? 153  GLU C CA  1 
ATOM   8460  C  C   . GLU C 1 164 ? 48.707  -4.549  -68.961  1.00 23.03 ? 153  GLU C C   1 
ATOM   8461  O  O   . GLU C 1 164 ? 48.100  -3.936  -69.814  1.00 22.68 ? 153  GLU C O   1 
ATOM   8462  C  CB  . GLU C 1 164 ? 50.308  -3.507  -67.344  1.00 24.89 ? 153  GLU C CB  1 
ATOM   8463  C  CG  . GLU C 1 164 ? 50.544  -2.762  -66.001  1.00 25.49 ? 153  GLU C CG  1 
ATOM   8464  C  CD  . GLU C 1 164 ? 52.014  -2.456  -65.755  1.00 26.45 ? 153  GLU C CD  1 
ATOM   8465  O  OE1 . GLU C 1 164 ? 52.859  -3.300  -66.126  1.00 25.95 ? 153  GLU C OE1 1 
ATOM   8466  O  OE2 . GLU C 1 164 ? 52.324  -1.357  -65.212  1.00 25.66 ? 153  GLU C OE2 1 
ATOM   8467  N  N   . ALA C 1 165 ? 49.222  -5.760  -69.149  1.00 23.55 ? 154  ALA C N   1 
ATOM   8468  C  CA  . ALA C 1 165 ? 49.139  -6.499  -70.417  1.00 23.59 ? 154  ALA C CA  1 
ATOM   8469  C  C   . ALA C 1 165 ? 47.710  -6.820  -70.848  1.00 23.43 ? 154  ALA C C   1 
ATOM   8470  O  O   . ALA C 1 165 ? 47.364  -6.705  -72.037  1.00 24.61 ? 154  ALA C O   1 
ATOM   8471  C  CB  . ALA C 1 165 ? 49.956  -7.788  -70.307  1.00 24.04 ? 154  ALA C CB  1 
ATOM   8472  N  N   . LEU C 1 166 ? 46.879  -7.225  -69.889  1.00 23.09 ? 155  LEU C N   1 
ATOM   8473  C  CA  . LEU C 1 166 ? 45.469  -7.539  -70.167  1.00 22.65 ? 155  LEU C CA  1 
ATOM   8474  C  C   . LEU C 1 166 ? 44.760  -6.314  -70.689  1.00 22.50 ? 155  LEU C C   1 
ATOM   8475  O  O   . LEU C 1 166 ? 43.932  -6.425  -71.567  1.00 24.15 ? 155  LEU C O   1 
ATOM   8476  C  CB  . LEU C 1 166 ? 44.737  -8.077  -68.921  1.00 22.31 ? 155  LEU C CB  1 
ATOM   8477  C  CG  . LEU C 1 166 ? 44.975  -9.546  -68.508  1.00 22.26 ? 155  LEU C CG  1 
ATOM   8478  C  CD1 . LEU C 1 166 ? 44.335  -9.845  -67.176  1.00 20.69 ? 155  LEU C CD1 1 
ATOM   8479  C  CD2 . LEU C 1 166 ? 44.461  -10.529 -69.542  1.00 19.88 ? 155  LEU C CD2 1 
ATOM   8480  N  N   . VAL C 1 167 ? 45.101  -5.139  -70.172  1.00 23.10 ? 156  VAL C N   1 
ATOM   8481  C  CA  . VAL C 1 167 ? 44.402  -3.901  -70.536  1.00 22.90 ? 156  VAL C CA  1 
ATOM   8482  C  C   . VAL C 1 167 ? 44.817  -3.422  -71.916  1.00 24.08 ? 156  VAL C C   1 
ATOM   8483  O  O   . VAL C 1 167 ? 43.956  -3.110  -72.735  1.00 23.21 ? 156  VAL C O   1 
ATOM   8484  C  CB  . VAL C 1 167 ? 44.624  -2.806  -69.489  1.00 22.96 ? 156  VAL C CB  1 
ATOM   8485  C  CG1 . VAL C 1 167 ? 44.122  -1.463  -69.994  1.00 22.50 ? 156  VAL C CG1 1 
ATOM   8486  C  CG2 . VAL C 1 167 ? 43.924  -3.186  -68.176  1.00 15.85 ? 156  VAL C CG2 1 
ATOM   8487  N  N   . LYS C 1 168 ? 46.128  -3.401  -72.156  1.00 25.31 ? 157  LYS C N   1 
ATOM   8488  C  CA  . LYS C 1 168 ? 46.718  -3.061  -73.468  1.00 27.10 ? 157  LYS C CA  1 
ATOM   8489  C  C   . LYS C 1 168 ? 46.273  -3.998  -74.577  1.00 27.88 ? 157  LYS C C   1 
ATOM   8490  O  O   . LYS C 1 168 ? 45.763  -3.540  -75.591  1.00 29.15 ? 157  LYS C O   1 
ATOM   8491  C  CB  . LYS C 1 168 ? 48.255  -3.151  -73.430  1.00 27.55 ? 157  LYS C CB  1 
ATOM   8492  C  CG  . LYS C 1 168 ? 49.021  -1.866  -73.287  1.00 28.48 ? 157  LYS C CG  1 
ATOM   8493  C  CD  . LYS C 1 168 ? 50.459  -2.048  -73.815  1.00 28.52 ? 157  LYS C CD  1 
ATOM   8494  C  CE  . LYS C 1 168 ? 51.419  -0.971  -73.310  1.00 29.08 ? 157  LYS C CE  1 
ATOM   8495  N  NZ  . LYS C 1 168 ? 52.745  -0.894  -74.038  1.00 25.38 ? 157  LYS C NZ  1 
ATOM   8496  N  N   . ASP C 1 169 ? 46.469  -5.308  -74.381  1.00 29.26 ? 158  ASP C N   1 
ATOM   8497  C  CA  . ASP C 1 169 ? 46.404  -6.287  -75.485  1.00 29.63 ? 158  ASP C CA  1 
ATOM   8498  C  C   . ASP C 1 169 ? 45.155  -7.187  -75.558  1.00 30.23 ? 158  ASP C C   1 
ATOM   8499  O  O   . ASP C 1 169 ? 44.878  -7.754  -76.630  1.00 30.98 ? 158  ASP C O   1 
ATOM   8500  C  CB  . ASP C 1 169 ? 47.654  -7.184  -75.484  1.00 30.22 ? 158  ASP C CB  1 
ATOM   8501  C  CG  . ASP C 1 169 ? 48.982  -6.399  -75.565  1.00 29.84 ? 158  ASP C CG  1 
ATOM   8502  O  OD1 . ASP C 1 169 ? 49.053  -5.246  -76.081  1.00 26.36 ? 158  ASP C OD1 1 
ATOM   8503  O  OD2 . ASP C 1 169 ? 49.979  -6.980  -75.087  1.00 30.40 ? 158  ASP C OD2 1 
ATOM   8504  N  N   . HIS C 1 170 ? 44.396  -7.303  -74.466  1.00 30.01 ? 159  HIS C N   1 
ATOM   8505  C  CA  . HIS C 1 170 ? 43.262  -8.254  -74.383  1.00 29.60 ? 159  HIS C CA  1 
ATOM   8506  C  C   . HIS C 1 170 ? 41.875  -7.661  -73.996  1.00 29.43 ? 159  HIS C C   1 
ATOM   8507  O  O   . HIS C 1 170 ? 40.974  -8.391  -73.574  1.00 30.07 ? 159  HIS C O   1 
ATOM   8508  C  CB  . HIS C 1 170 ? 43.639  -9.394  -73.433  1.00 30.73 ? 159  HIS C CB  1 
ATOM   8509  C  CG  . HIS C 1 170 ? 44.940  -10.049 -73.788  1.00 33.54 ? 159  HIS C CG  1 
ATOM   8510  N  ND1 . HIS C 1 170 ? 45.069  -10.912 -74.857  1.00 34.31 ? 159  HIS C ND1 1 
ATOM   8511  C  CD2 . HIS C 1 170 ? 46.175  -9.943  -73.237  1.00 35.25 ? 159  HIS C CD2 1 
ATOM   8512  C  CE1 . HIS C 1 170 ? 46.324  -11.318 -74.939  1.00 34.57 ? 159  HIS C CE1 1 
ATOM   8513  N  NE2 . HIS C 1 170 ? 47.015  -10.746 -73.968  1.00 34.33 ? 159  HIS C NE2 1 
ATOM   8514  N  N   . GLY C 1 171 ? 41.693  -6.351  -74.156  1.00 27.14 ? 160  GLY C N   1 
ATOM   8515  C  CA  . GLY C 1 171 ? 40.357  -5.761  -74.055  1.00 25.34 ? 160  GLY C CA  1 
ATOM   8516  C  C   . GLY C 1 171 ? 39.664  -5.862  -72.714  1.00 23.03 ? 160  GLY C C   1 
ATOM   8517  O  O   . GLY C 1 171 ? 38.447  -5.976  -72.672  1.00 22.70 ? 160  GLY C O   1 
ATOM   8518  N  N   . VAL C 1 172 ? 40.462  -5.814  -71.642  1.00 21.42 ? 161  VAL C N   1 
ATOM   8519  C  CA  . VAL C 1 172 ? 40.017  -5.747  -70.236  1.00 20.26 ? 161  VAL C CA  1 
ATOM   8520  C  C   . VAL C 1 172 ? 40.051  -4.297  -69.701  1.00 20.42 ? 161  VAL C C   1 
ATOM   8521  O  O   . VAL C 1 172 ? 41.016  -3.562  -69.954  1.00 23.11 ? 161  VAL C O   1 
ATOM   8522  C  CB  . VAL C 1 172 ? 40.969  -6.583  -69.358  1.00 18.54 ? 161  VAL C CB  1 
ATOM   8523  C  CG1 . VAL C 1 172 ? 40.728  -6.351  -67.908  1.00 18.00 ? 161  VAL C CG1 1 
ATOM   8524  C  CG2 . VAL C 1 172 ? 40.836  -8.058  -69.696  1.00 19.79 ? 161  VAL C CG2 1 
ATOM   8525  N  N   . ASN C 1 173 ? 39.028  -3.866  -68.958  1.00 18.74 ? 162  ASN C N   1 
ATOM   8526  C  CA  . ASN C 1 173 ? 39.171  -2.612  -68.171  1.00 17.11 ? 162  ASN C CA  1 
ATOM   8527  C  C   . ASN C 1 173 ? 38.606  -2.662  -66.758  1.00 16.12 ? 162  ASN C C   1 
ATOM   8528  O  O   . ASN C 1 173 ? 38.333  -1.624  -66.170  1.00 17.03 ? 162  ASN C O   1 
ATOM   8529  C  CB  . ASN C 1 173 ? 38.636  -1.375  -68.910  1.00 16.17 ? 162  ASN C CB  1 
ATOM   8530  C  CG  . ASN C 1 173 ? 37.150  -1.433  -69.152  1.00 13.97 ? 162  ASN C CG  1 
ATOM   8531  O  OD1 . ASN C 1 173 ? 36.494  -2.396  -68.787  1.00 12.86 ? 162  ASN C OD1 1 
ATOM   8532  N  ND2 . ASN C 1 173 ? 36.616  -0.418  -69.784  1.00 4.52  ? 162  ASN C ND2 1 
ATOM   8533  N  N   . SER C 1 174 ? 38.479  -3.853  -66.203  1.00 15.50 ? 163  SER C N   1 
ATOM   8534  C  CA  . SER C 1 174 ? 37.920  -3.978  -64.849  1.00 15.04 ? 163  SER C CA  1 
ATOM   8535  C  C   . SER C 1 174 ? 38.510  -5.172  -64.128  1.00 14.00 ? 163  SER C C   1 
ATOM   8536  O  O   . SER C 1 174 ? 38.731  -6.180  -64.719  1.00 12.52 ? 163  SER C O   1 
ATOM   8537  C  CB  . SER C 1 174 ? 36.351  -3.988  -64.896  1.00 15.13 ? 163  SER C CB  1 
ATOM   8538  O  OG  . SER C 1 174 ? 35.739  -5.172  -65.416  1.00 13.05 ? 163  SER C OG  1 
ATOM   8539  N  N   . PHE C 1 175 ? 38.726  -5.058  -62.811  1.00 14.28 ? 164  PHE C N   1 
ATOM   8540  C  CA  . PHE C 1 175 ? 39.418  -6.079  -62.039  1.00 14.09 ? 164  PHE C CA  1 
ATOM   8541  C  C   . PHE C 1 175 ? 38.763  -6.188  -60.665  1.00 14.13 ? 164  PHE C C   1 
ATOM   8542  O  O   . PHE C 1 175 ? 38.277  -5.186  -60.180  1.00 13.29 ? 164  PHE C O   1 
ATOM   8543  C  CB  . PHE C 1 175 ? 40.870  -5.654  -61.827  1.00 14.75 ? 164  PHE C CB  1 
ATOM   8544  C  CG  . PHE C 1 175 ? 41.728  -5.807  -63.045  1.00 12.91 ? 164  PHE C CG  1 
ATOM   8545  C  CD1 . PHE C 1 175 ? 42.034  -4.711  -63.841  1.00 13.48 ? 164  PHE C CD1 1 
ATOM   8546  C  CD2 . PHE C 1 175 ? 42.262  -7.057  -63.372  1.00 12.11 ? 164  PHE C CD2 1 
ATOM   8547  C  CE1 . PHE C 1 175 ? 42.826  -4.873  -64.970  1.00 14.72 ? 164  PHE C CE1 1 
ATOM   8548  C  CE2 . PHE C 1 175 ? 43.045  -7.213  -64.500  1.00 14.01 ? 164  PHE C CE2 1 
ATOM   8549  C  CZ  . PHE C 1 175 ? 43.333  -6.104  -65.285  1.00 12.53 ? 164  PHE C CZ  1 
ATOM   8550  N  N   . LEU C 1 176 ? 38.728  -7.383  -60.074  1.00 14.12 ? 165  LEU C N   1 
ATOM   8551  C  CA  . LEU C 1 176 ? 38.086  -7.573  -58.751  1.00 13.69 ? 165  LEU C CA  1 
ATOM   8552  C  C   . LEU C 1 176 ? 39.083  -8.011  -57.720  1.00 13.70 ? 165  LEU C C   1 
ATOM   8553  O  O   . LEU C 1 176 ? 39.975  -8.779  -58.013  1.00 14.49 ? 165  LEU C O   1 
ATOM   8554  C  CB  . LEU C 1 176 ? 36.928  -8.603  -58.814  1.00 13.21 ? 165  LEU C CB  1 
ATOM   8555  C  CG  . LEU C 1 176 ? 35.994  -8.693  -57.579  1.00 14.65 ? 165  LEU C CG  1 
ATOM   8556  C  CD1 . LEU C 1 176 ? 34.548  -9.085  -57.896  1.00 17.29 ? 165  LEU C CD1 1 
ATOM   8557  C  CD2 . LEU C 1 176 ? 36.543  -9.622  -56.558  1.00 15.29 ? 165  LEU C CD2 1 
ATOM   8558  N  N   . VAL C 1 177 ? 38.866  -7.572  -56.480  1.00 13.94 ? 166  VAL C N   1 
ATOM   8559  C  CA  . VAL C 1 177 ? 39.671  -7.981  -55.321  1.00 13.61 ? 166  VAL C CA  1 
ATOM   8560  C  C   . VAL C 1 177 ? 38.696  -8.289  -54.174  1.00 13.24 ? 166  VAL C C   1 
ATOM   8561  O  O   . VAL C 1 177 ? 37.628  -7.701  -54.082  1.00 11.32 ? 166  VAL C O   1 
ATOM   8562  C  CB  . VAL C 1 177 ? 40.728  -6.896  -54.947  1.00 15.63 ? 166  VAL C CB  1 
ATOM   8563  C  CG1 . VAL C 1 177 ? 41.439  -6.368  -56.241  1.00 12.45 ? 166  VAL C CG1 1 
ATOM   8564  C  CG2 . VAL C 1 177 ? 40.119  -5.717  -54.110  1.00 15.84 ? 166  VAL C CG2 1 
ATOM   8565  N  N   . TYR C 1 178 ? 39.059  -9.254  -53.342  1.00 12.79 ? 167  TYR C N   1 
ATOM   8566  C  CA  . TYR C 1 178 ? 38.155  -9.862  -52.407  1.00 12.15 ? 167  TYR C CA  1 
ATOM   8567  C  C   . TYR C 1 178 ? 38.555  -9.312  -51.044  1.00 11.38 ? 167  TYR C C   1 
ATOM   8568  O  O   . TYR C 1 178 ? 39.748  -9.297  -50.720  1.00 7.07  ? 167  TYR C O   1 
ATOM   8569  C  CB  . TYR C 1 178 ? 38.281  -11.399 -52.442  1.00 9.10  ? 167  TYR C CB  1 
ATOM   8570  C  CG  . TYR C 1 178 ? 37.730  -12.013 -53.711  1.00 8.27  ? 167  TYR C CG  1 
ATOM   8571  C  CD1 . TYR C 1 178 ? 38.428  -11.873 -54.905  1.00 10.76 ? 167  TYR C CD1 1 
ATOM   8572  C  CD2 . TYR C 1 178 ? 36.493  -12.650 -53.750  1.00 4.11  ? 167  TYR C CD2 1 
ATOM   8573  C  CE1 . TYR C 1 178 ? 37.951  -12.394 -56.076  1.00 7.17  ? 167  TYR C CE1 1 
ATOM   8574  C  CE2 . TYR C 1 178 ? 35.982  -13.181 -54.998  1.00 6.48  ? 167  TYR C CE2 1 
ATOM   8575  C  CZ  . TYR C 1 178 ? 36.732  -13.028 -56.138  1.00 7.71  ? 167  TYR C CZ  1 
ATOM   8576  O  OH  . TYR C 1 178 ? 36.279  -13.534 -57.405  1.00 5.93  ? 167  TYR C OH  1 
ATOM   8577  N  N   . MET C 1 179 ? 37.568  -8.874  -50.256  1.00 14.77 ? 168  MET C N   1 
ATOM   8578  C  CA  . MET C 1 179 ? 37.828  -8.483  -48.878  1.00 15.05 ? 168  MET C CA  1 
ATOM   8579  C  C   . MET C 1 179 ? 37.442  -9.604  -47.923  1.00 15.83 ? 168  MET C C   1 
ATOM   8580  O  O   . MET C 1 179 ? 37.695  -9.533  -46.709  1.00 12.41 ? 168  MET C O   1 
ATOM   8581  C  CB  . MET C 1 179 ? 37.067  -7.200  -48.517  1.00 17.76 ? 168  MET C CB  1 
ATOM   8582  C  CG  . MET C 1 179 ? 37.640  -5.927  -49.157  1.00 18.14 ? 168  MET C CG  1 
ATOM   8583  S  SD  . MET C 1 179 ? 36.707  -4.396  -48.807  1.00 20.61 ? 168  MET C SD  1 
ATOM   8584  C  CE  . MET C 1 179 ? 36.849  -4.249  -47.030  1.00 25.99 ? 168  MET C CE  1 
ATOM   8585  N  N   . ALA C 1 180 ? 36.841  -10.636 -48.501  1.00 16.75 ? 169  ALA C N   1 
ATOM   8586  C  CA  . ALA C 1 180 ? 36.316  -11.806 -47.814  1.00 16.39 ? 169  ALA C CA  1 
ATOM   8587  C  C   . ALA C 1 180 ? 37.057  -13.046 -48.388  1.00 16.75 ? 169  ALA C C   1 
ATOM   8588  O  O   . ALA C 1 180 ? 37.933  -12.886 -49.236  1.00 16.27 ? 169  ALA C O   1 
ATOM   8589  C  CB  . ALA C 1 180 ? 34.795  -11.896 -48.023  1.00 14.90 ? 169  ALA C CB  1 
ATOM   8590  N  N   . PHE C 1 181 ? 36.710  -14.249 -47.909  1.00 17.16 ? 170  PHE C N   1 
ATOM   8591  C  CA  . PHE C 1 181 ? 37.370  -15.526 -48.293  1.00 14.72 ? 170  PHE C CA  1 
ATOM   8592  C  C   . PHE C 1 181 ? 38.772  -15.550 -47.703  1.00 13.88 ? 170  PHE C C   1 
ATOM   8593  O  O   . PHE C 1 181 ? 39.764  -15.652 -48.394  1.00 10.86 ? 170  PHE C O   1 
ATOM   8594  C  CB  . PHE C 1 181 ? 37.295  -15.752 -49.828  1.00 16.34 ? 170  PHE C CB  1 
ATOM   8595  C  CG  . PHE C 1 181 ? 35.881  -15.706 -50.355  1.00 16.41 ? 170  PHE C CG  1 
ATOM   8596  C  CD1 . PHE C 1 181 ? 35.043  -16.796 -50.227  1.00 21.30 ? 170  PHE C CD1 1 
ATOM   8597  C  CD2 . PHE C 1 181 ? 35.350  -14.543 -50.874  1.00 19.35 ? 170  PHE C CD2 1 
ATOM   8598  C  CE1 . PHE C 1 181 ? 33.708  -16.734 -50.643  1.00 19.75 ? 170  PHE C CE1 1 
ATOM   8599  C  CE2 . PHE C 1 181 ? 34.035  -14.473 -51.292  1.00 16.02 ? 170  PHE C CE2 1 
ATOM   8600  C  CZ  . PHE C 1 181 ? 33.214  -15.569 -51.185  1.00 18.74 ? 170  PHE C CZ  1 
ATOM   8601  N  N   . LYS C 1 182 ? 38.849  -15.435 -46.372  1.00 13.37 ? 171  LYS C N   1 
ATOM   8602  C  CA  . LYS C 1 182 ? 40.113  -15.461 -45.672  1.00 13.40 ? 171  LYS C CA  1 
ATOM   8603  C  C   . LYS C 1 182 ? 40.873  -16.719 -46.117  1.00 16.47 ? 171  LYS C C   1 
ATOM   8604  O  O   . LYS C 1 182 ? 40.279  -17.789 -46.389  1.00 16.16 ? 171  LYS C O   1 
ATOM   8605  C  CB  . LYS C 1 182 ? 39.866  -15.450 -44.153  1.00 13.54 ? 171  LYS C CB  1 
ATOM   8606  C  CG  . LYS C 1 182 ? 41.067  -15.195 -43.298  1.00 11.45 ? 171  LYS C CG  1 
ATOM   8607  C  CD  . LYS C 1 182 ? 40.659  -15.148 -41.797  1.00 13.48 ? 171  LYS C CD  1 
ATOM   8608  C  CE  . LYS C 1 182 ? 41.854  -15.170 -40.896  1.00 15.36 ? 171  LYS C CE  1 
ATOM   8609  N  NZ  . LYS C 1 182 ? 41.562  -15.633 -39.423  1.00 16.42 ? 171  LYS C NZ  1 
ATOM   8610  N  N   . ASP C 1 183 ? 42.188  -16.583 -46.248  1.00 18.92 ? 172  ASP C N   1 
ATOM   8611  C  CA  . ASP C 1 183 ? 43.050  -17.685 -46.714  1.00 20.01 ? 172  ASP C CA  1 
ATOM   8612  C  C   . ASP C 1 183 ? 42.732  -18.221 -48.113  1.00 21.15 ? 172  ASP C C   1 
ATOM   8613  O  O   . ASP C 1 183 ? 43.386  -19.171 -48.553  1.00 23.20 ? 172  ASP C O   1 
ATOM   8614  C  CB  . ASP C 1 183 ? 43.053  -18.869 -45.734  1.00 20.72 ? 172  ASP C CB  1 
ATOM   8615  C  CG  . ASP C 1 183 ? 43.361  -18.456 -44.258  1.00 22.00 ? 172  ASP C CG  1 
ATOM   8616  O  OD1 . ASP C 1 183 ? 44.288  -17.641 -43.997  1.00 20.91 ? 172  ASP C OD1 1 
ATOM   8617  O  OD2 . ASP C 1 183 ? 42.670  -18.996 -43.362  1.00 26.34 ? 172  ASP C OD2 1 
ATOM   8618  N  N   . ARG C 1 184 ? 41.728  -17.687 -48.805  1.00 22.48 ? 173  ARG C N   1 
ATOM   8619  C  CA  . ARG C 1 184 ? 41.549  -18.011 -50.240  1.00 21.93 ? 173  ARG C CA  1 
ATOM   8620  C  C   . ARG C 1 184 ? 41.876  -16.834 -51.093  1.00 22.44 ? 173  ARG C C   1 
ATOM   8621  O  O   . ARG C 1 184 ? 42.848  -16.865 -51.867  1.00 23.86 ? 173  ARG C O   1 
ATOM   8622  C  CB  . ARG C 1 184 ? 40.114  -18.396 -50.582  1.00 21.88 ? 173  ARG C CB  1 
ATOM   8623  C  CG  . ARG C 1 184 ? 39.820  -19.844 -50.424  1.00 25.21 ? 173  ARG C CG  1 
ATOM   8624  C  CD  . ARG C 1 184 ? 38.785  -20.283 -51.411  1.00 24.95 ? 173  ARG C CD  1 
ATOM   8625  N  NE  . ARG C 1 184 ? 39.339  -20.383 -52.756  1.00 27.04 ? 173  ARG C NE  1 
ATOM   8626  C  CZ  . ARG C 1 184 ? 38.609  -20.665 -53.823  1.00 25.35 ? 173  ARG C CZ  1 
ATOM   8627  N  NH1 . ARG C 1 184 ? 37.312  -20.889 -53.692  1.00 25.66 ? 173  ARG C NH1 1 
ATOM   8628  N  NH2 . ARG C 1 184 ? 39.177  -20.740 -55.012  1.00 25.63 ? 173  ARG C NH2 1 
ATOM   8629  N  N   . PHE C 1 185 ? 41.013  -15.816 -51.017  1.00 21.06 ? 174  PHE C N   1 
ATOM   8630  C  CA  . PHE C 1 185 ? 41.116  -14.667 -51.925  1.00 19.67 ? 174  PHE C CA  1 
ATOM   8631  C  C   . PHE C 1 185 ? 41.445  -13.367 -51.188  1.00 18.79 ? 174  PHE C C   1 
ATOM   8632  O  O   . PHE C 1 185 ? 41.901  -12.389 -51.786  1.00 18.66 ? 174  PHE C O   1 
ATOM   8633  C  CB  . PHE C 1 185 ? 39.803  -14.438 -52.648  1.00 21.02 ? 174  PHE C CB  1 
ATOM   8634  C  CG  . PHE C 1 185 ? 39.411  -15.516 -53.605  1.00 21.99 ? 174  PHE C CG  1 
ATOM   8635  C  CD1 . PHE C 1 185 ? 40.343  -16.151 -54.410  1.00 24.45 ? 174  PHE C CD1 1 
ATOM   8636  C  CD2 . PHE C 1 185 ? 38.073  -15.845 -53.745  1.00 22.90 ? 174  PHE C CD2 1 
ATOM   8637  C  CE1 . PHE C 1 185 ? 39.956  -17.151 -55.298  1.00 21.42 ? 174  PHE C CE1 1 
ATOM   8638  C  CE2 . PHE C 1 185 ? 37.678  -16.802 -54.612  1.00 19.02 ? 174  PHE C CE2 1 
ATOM   8639  C  CZ  . PHE C 1 185 ? 38.630  -17.469 -55.408  1.00 22.03 ? 174  PHE C CZ  1 
ATOM   8640  N  N   . GLN C 1 186 ? 41.210  -13.356 -49.881  1.00 15.79 ? 175  GLN C N   1 
ATOM   8641  C  CA  . GLN C 1 186 ? 41.279  -12.118 -49.108  1.00 16.58 ? 175  GLN C CA  1 
ATOM   8642  C  C   . GLN C 1 186 ? 42.555  -11.309 -49.294  1.00 16.45 ? 175  GLN C C   1 
ATOM   8643  O  O   . GLN C 1 186 ? 43.655  -11.858 -49.315  1.00 17.19 ? 175  GLN C O   1 
ATOM   8644  C  CB  . GLN C 1 186 ? 41.114  -12.439 -47.632  1.00 16.16 ? 175  GLN C CB  1 
ATOM   8645  C  CG  . GLN C 1 186 ? 40.970  -11.232 -46.784  1.00 13.13 ? 175  GLN C CG  1 
ATOM   8646  C  CD  . GLN C 1 186 ? 40.174  -11.524 -45.561  1.00 15.95 ? 175  GLN C CD  1 
ATOM   8647  O  OE1 . GLN C 1 186 ? 39.127  -12.143 -45.649  1.00 15.97 ? 175  GLN C OE1 1 
ATOM   8648  N  NE2 . GLN C 1 186 ? 40.673  -11.117 -44.403  1.00 10.26 ? 175  GLN C NE2 1 
ATOM   8649  N  N   . LEU C 1 187 ? 42.401  -9.994  -49.423  1.00 16.42 ? 176  LEU C N   1 
ATOM   8650  C  CA  . LEU C 1 187 ? 43.533  -9.080  -49.588  1.00 15.97 ? 176  LEU C CA  1 
ATOM   8651  C  C   . LEU C 1 187 ? 43.440  -8.119  -48.429  1.00 16.88 ? 176  LEU C C   1 
ATOM   8652  O  O   . LEU C 1 187 ? 42.335  -7.704  -48.089  1.00 18.53 ? 176  LEU C O   1 
ATOM   8653  C  CB  . LEU C 1 187 ? 43.449  -8.305  -50.905  1.00 16.13 ? 176  LEU C CB  1 
ATOM   8654  C  CG  . LEU C 1 187 ? 44.211  -8.795  -52.167  1.00 17.21 ? 176  LEU C CG  1 
ATOM   8655  C  CD1 . LEU C 1 187 ? 44.584  -10.273 -52.232  1.00 14.93 ? 176  LEU C CD1 1 
ATOM   8656  C  CD2 . LEU C 1 187 ? 43.485  -8.389  -53.411  1.00 15.71 ? 176  LEU C CD2 1 
ATOM   8657  N  N   . THR C 1 188 ? 44.594  -7.749  -47.869  1.00 16.66 ? 177  THR C N   1 
ATOM   8658  C  CA  . THR C 1 188 ? 44.687  -6.856  -46.719  1.00 16.06 ? 177  THR C CA  1 
ATOM   8659  C  C   . THR C 1 188 ? 44.535  -5.412  -47.149  1.00 14.57 ? 177  THR C C   1 
ATOM   8660  O  O   . THR C 1 188 ? 44.665  -5.070  -48.343  1.00 12.14 ? 177  THR C O   1 
ATOM   8661  C  CB  . THR C 1 188 ? 46.043  -7.018  -45.949  1.00 17.71 ? 177  THR C CB  1 
ATOM   8662  O  OG1 . THR C 1 188 ? 47.092  -6.211  -46.544  1.00 14.69 ? 177  THR C OG1 1 
ATOM   8663  C  CG2 . THR C 1 188 ? 46.466  -8.503  -45.878  1.00 19.00 ? 177  THR C CG2 1 
ATOM   8664  N  N   . ASP C 1 189 ? 44.266  -4.542  -46.196  1.00 12.95 ? 178  ASP C N   1 
ATOM   8665  C  CA  . ASP C 1 189 ? 44.134  -3.098  -46.514  1.00 16.01 ? 178  ASP C CA  1 
ATOM   8666  C  C   . ASP C 1 189 ? 45.345  -2.545  -47.273  1.00 16.45 ? 178  ASP C C   1 
ATOM   8667  O  O   . ASP C 1 189 ? 45.180  -1.721  -48.185  1.00 15.11 ? 178  ASP C O   1 
ATOM   8668  C  CB  . ASP C 1 189 ? 43.922  -2.243  -45.263  1.00 16.56 ? 178  ASP C CB  1 
ATOM   8669  C  CG  . ASP C 1 189 ? 42.501  -2.297  -44.736  1.00 18.49 ? 178  ASP C CG  1 
ATOM   8670  O  OD1 . ASP C 1 189 ? 41.615  -2.721  -45.510  1.00 20.73 ? 178  ASP C OD1 1 
ATOM   8671  O  OD2 . ASP C 1 189 ? 42.293  -1.929  -43.531  1.00 18.68 ? 178  ASP C OD2 1 
ATOM   8672  N  N   . CYS C 1 190 ? 46.555  -2.977  -46.888  1.00 16.65 ? 179  CYS C N   1 
ATOM   8673  C  CA  . CYS C 1 190 ? 47.757  -2.527  -47.590  1.00 17.10 ? 179  CYS C CA  1 
ATOM   8674  C  C   . CYS C 1 190 ? 47.789  -3.084  -49.001  1.00 13.74 ? 179  CYS C C   1 
ATOM   8675  O  O   . CYS C 1 190 ? 48.168  -2.400  -49.911  1.00 13.75 ? 179  CYS C O   1 
ATOM   8676  C  CB  . CYS C 1 190 ? 49.054  -2.858  -46.841  1.00 18.52 ? 179  CYS C CB  1 
ATOM   8677  S  SG  . CYS C 1 190 ? 49.106  -4.467  -46.029  1.00 36.72 ? 179  CYS C SG  1 
ATOM   8678  N  N   . GLN C 1 191 ? 47.379  -4.320  -49.189  1.00 12.93 ? 180  GLN C N   1 
ATOM   8679  C  CA  . GLN C 1 191 ? 47.406  -4.865  -50.533  1.00 12.58 ? 180  GLN C CA  1 
ATOM   8680  C  C   . GLN C 1 191 ? 46.338  -4.213  -51.392  1.00 13.42 ? 180  GLN C C   1 
ATOM   8681  O  O   . GLN C 1 191 ? 46.541  -3.994  -52.583  1.00 14.28 ? 180  GLN C O   1 
ATOM   8682  C  CB  . GLN C 1 191 ? 47.177  -6.371  -50.528  1.00 12.22 ? 180  GLN C CB  1 
ATOM   8683  C  CG  . GLN C 1 191 ? 48.382  -7.188  -50.261  1.00 14.24 ? 180  GLN C CG  1 
ATOM   8684  C  CD  . GLN C 1 191 ? 48.016  -8.574  -49.872  1.00 12.08 ? 180  GLN C CD  1 
ATOM   8685  O  OE1 . GLN C 1 191 ? 47.038  -8.795  -49.167  1.00 20.98 ? 180  GLN C OE1 1 
ATOM   8686  N  NE2 . GLN C 1 191 ? 48.805  -9.535  -50.314  1.00 22.06 ? 180  GLN C NE2 1 
ATOM   8687  N  N   . ILE C 1 192 ? 45.168  -3.944  -50.820  1.00 12.84 ? 181  ILE C N   1 
ATOM   8688  C  CA  . ILE C 1 192 ? 44.086  -3.255  -51.596  1.00 13.78 ? 181  ILE C CA  1 
ATOM   8689  C  C   . ILE C 1 192 ? 44.512  -1.854  -52.171  1.00 13.85 ? 181  ILE C C   1 
ATOM   8690  O  O   . ILE C 1 192 ? 44.303  -1.534  -53.357  1.00 13.88 ? 181  ILE C O   1 
ATOM   8691  C  CB  . ILE C 1 192 ? 42.753  -3.158  -50.752  1.00 11.92 ? 181  ILE C CB  1 
ATOM   8692  C  CG1 . ILE C 1 192 ? 42.229  -4.579  -50.428  1.00 12.51 ? 181  ILE C CG1 1 
ATOM   8693  C  CG2 . ILE C 1 192 ? 41.701  -2.315  -51.498  1.00 10.71 ? 181  ILE C CG2 1 
ATOM   8694  C  CD1 . ILE C 1 192 ? 40.890  -4.629  -49.756  1.00 11.88 ? 181  ILE C CD1 1 
ATOM   8695  N  N   . TYR C 1 193 ? 45.135  -1.049  -51.318  1.00 15.30 ? 182  TYR C N   1 
ATOM   8696  C  CA  . TYR C 1 193 ? 45.723  0.248   -51.709  1.00 14.94 ? 182  TYR C CA  1 
ATOM   8697  C  C   . TYR C 1 193 ? 46.654  0.108   -52.917  1.00 15.83 ? 182  TYR C C   1 
ATOM   8698  O  O   . TYR C 1 193 ? 46.467  0.777   -53.943  1.00 15.46 ? 182  TYR C O   1 
ATOM   8699  C  CB  . TYR C 1 193 ? 46.462  0.834   -50.508  1.00 14.44 ? 182  TYR C CB  1 
ATOM   8700  C  CG  . TYR C 1 193 ? 47.169  2.171   -50.730  1.00 15.40 ? 182  TYR C CG  1 
ATOM   8701  C  CD1 . TYR C 1 193 ? 48.428  2.229   -51.343  1.00 17.00 ? 182  TYR C CD1 1 
ATOM   8702  C  CD2 . TYR C 1 193 ? 46.600  3.361   -50.308  1.00 14.79 ? 182  TYR C CD2 1 
ATOM   8703  C  CE1 . TYR C 1 193 ? 49.073  3.413   -51.529  1.00 14.59 ? 182  TYR C CE1 1 
ATOM   8704  C  CE2 . TYR C 1 193 ? 47.255  4.559   -50.494  1.00 17.08 ? 182  TYR C CE2 1 
ATOM   8705  C  CZ  . TYR C 1 193 ? 48.490  4.570   -51.117  1.00 15.63 ? 182  TYR C CZ  1 
ATOM   8706  O  OH  . TYR C 1 193 ? 49.148  5.744   -51.302  1.00 13.15 ? 182  TYR C OH  1 
ATOM   8707  N  N   . GLU C 1 194 ? 47.611  -0.814  -52.835  1.00 16.20 ? 183  GLU C N   1 
ATOM   8708  C  CA  . GLU C 1 194 ? 48.504  -1.048  -53.982  1.00 16.80 ? 183  GLU C CA  1 
ATOM   8709  C  C   . GLU C 1 194 ? 47.739  -1.352  -55.239  1.00 15.86 ? 183  GLU C C   1 
ATOM   8710  O  O   . GLU C 1 194 ? 48.064  -0.809  -56.281  1.00 16.50 ? 183  GLU C O   1 
ATOM   8711  C  CB  . GLU C 1 194 ? 49.473  -2.210  -53.745  1.00 17.99 ? 183  GLU C CB  1 
ATOM   8712  C  CG  . GLU C 1 194 ? 50.274  -2.126  -52.459  1.00 18.85 ? 183  GLU C CG  1 
ATOM   8713  C  CD  . GLU C 1 194 ? 51.361  -3.161  -52.419  1.00 21.51 ? 183  GLU C CD  1 
ATOM   8714  O  OE1 . GLU C 1 194 ? 51.351  -4.004  -51.496  1.00 28.34 ? 183  GLU C OE1 1 
ATOM   8715  O  OE2 . GLU C 1 194 ? 52.223  -3.132  -53.317  1.00 26.75 ? 183  GLU C OE2 1 
ATOM   8716  N  N   . VAL C 1 195 ? 46.774  -2.272  -55.171  1.00 16.86 ? 184  VAL C N   1 
ATOM   8717  C  CA  . VAL C 1 195 ? 46.008  -2.682  -56.398  1.00 16.12 ? 184  VAL C CA  1 
ATOM   8718  C  C   . VAL C 1 195 ? 45.251  -1.520  -57.033  1.00 16.10 ? 184  VAL C C   1 
ATOM   8719  O  O   . VAL C 1 195 ? 45.330  -1.280  -58.262  1.00 13.29 ? 184  VAL C O   1 
ATOM   8720  C  CB  . VAL C 1 195 ? 44.974  -3.807  -56.121  1.00 17.53 ? 184  VAL C CB  1 
ATOM   8721  C  CG1 . VAL C 1 195 ? 44.305  -4.175  -57.370  1.00 15.92 ? 184  VAL C CG1 1 
ATOM   8722  C  CG2 . VAL C 1 195 ? 45.641  -5.046  -55.545  1.00 17.00 ? 184  VAL C CG2 1 
ATOM   8723  N  N   . LEU C 1 196 ? 44.497  -0.802  -56.209  1.00 14.27 ? 185  LEU C N   1 
ATOM   8724  C  CA  . LEU C 1 196 ? 43.712  0.343   -56.711  1.00 14.25 ? 185  LEU C CA  1 
ATOM   8725  C  C   . LEU C 1 196 ? 44.603  1.420   -57.349  1.00 16.00 ? 185  LEU C C   1 
ATOM   8726  O  O   . LEU C 1 196 ? 44.216  2.058   -58.335  1.00 14.70 ? 185  LEU C O   1 
ATOM   8727  C  CB  . LEU C 1 196 ? 42.857  0.946   -55.592  1.00 14.07 ? 185  LEU C CB  1 
ATOM   8728  C  CG  . LEU C 1 196 ? 41.394  0.450   -55.490  1.00 15.06 ? 185  LEU C CG  1 
ATOM   8729  C  CD1 . LEU C 1 196 ? 41.206  -1.084  -55.807  1.00 15.89 ? 185  LEU C CD1 1 
ATOM   8730  C  CD2 . LEU C 1 196 ? 40.785  0.848   -54.129  1.00 13.11 ? 185  LEU C CD2 1 
ATOM   8731  N  N   . SER C 1 197 ? 45.793  1.614   -56.775  1.00 15.38 ? 186  SER C N   1 
ATOM   8732  C  CA  . SER C 1 197 ? 46.788  2.514   -57.334  1.00 15.04 ? 186  SER C CA  1 
ATOM   8733  C  C   . SER C 1 197 ? 47.261  2.055   -58.688  1.00 16.82 ? 186  SER C C   1 
ATOM   8734  O  O   . SER C 1 197 ? 47.426  2.888   -59.566  1.00 17.41 ? 186  SER C O   1 
ATOM   8735  C  CB  . SER C 1 197 ? 47.959  2.625   -56.395  1.00 15.53 ? 186  SER C CB  1 
ATOM   8736  O  OG  . SER C 1 197 ? 47.501  3.059   -55.119  1.00 12.22 ? 186  SER C OG  1 
ATOM   8737  N  N   . VAL C 1 198 ? 47.451  0.745   -58.874  1.00 17.14 ? 187  VAL C N   1 
ATOM   8738  C  CA  . VAL C 1 198 ? 47.799  0.231   -60.193  1.00 17.06 ? 187  VAL C CA  1 
ATOM   8739  C  C   . VAL C 1 198 ? 46.629  0.387   -61.146  1.00 17.48 ? 187  VAL C C   1 
ATOM   8740  O  O   . VAL C 1 198 ? 46.800  0.785   -62.311  1.00 20.10 ? 187  VAL C O   1 
ATOM   8741  C  CB  . VAL C 1 198 ? 48.270  -1.260  -60.123  1.00 18.37 ? 187  VAL C CB  1 
ATOM   8742  C  CG1 . VAL C 1 198 ? 48.469  -1.840  -61.529  1.00 15.73 ? 187  VAL C CG1 1 
ATOM   8743  C  CG2 . VAL C 1 198 ? 49.566  -1.364  -59.321  1.00 17.73 ? 187  VAL C CG2 1 
ATOM   8744  N  N   . ILE C 1 199 ? 45.434  0.054   -60.666  1.00 17.62 ? 188  ILE C N   1 
ATOM   8745  C  CA  . ILE C 1 199 ? 44.212  0.114   -61.472  1.00 16.37 ? 188  ILE C CA  1 
ATOM   8746  C  C   . ILE C 1 199 ? 43.942  1.548   -61.943  1.00 15.63 ? 188  ILE C C   1 
ATOM   8747  O  O   . ILE C 1 199 ? 43.605  1.771   -63.108  1.00 16.75 ? 188  ILE C O   1 
ATOM   8748  C  CB  . ILE C 1 199 ? 42.998  -0.498  -60.692  1.00 16.22 ? 188  ILE C CB  1 
ATOM   8749  C  CG1 . ILE C 1 199 ? 43.169  -2.021  -60.492  1.00 17.73 ? 188  ILE C CG1 1 
ATOM   8750  C  CG2 . ILE C 1 199 ? 41.689  -0.250  -61.395  1.00 15.85 ? 188  ILE C CG2 1 
ATOM   8751  C  CD1 . ILE C 1 199 ? 41.924  -2.779  -60.089  1.00 13.79 ? 188  ILE C CD1 1 
ATOM   8752  N  N   . ARG C 1 200 ? 44.130  2.534   -61.072  1.00 14.40 ? 189  ARG C N   1 
ATOM   8753  C  CA  . ARG C 1 200 ? 43.961  3.923   -61.505  1.00 14.86 ? 189  ARG C CA  1 
ATOM   8754  C  C   . ARG C 1 200 ? 44.928  4.318   -62.628  1.00 16.32 ? 189  ARG C C   1 
ATOM   8755  O  O   . ARG C 1 200 ? 44.550  5.017   -63.591  1.00 17.82 ? 189  ARG C O   1 
ATOM   8756  C  CB  . ARG C 1 200 ? 44.210  4.863   -60.340  1.00 14.24 ? 189  ARG C CB  1 
ATOM   8757  C  CG  . ARG C 1 200 ? 44.208  6.330   -60.683  1.00 13.66 ? 189  ARG C CG  1 
ATOM   8758  C  CD  . ARG C 1 200 ? 45.062  7.116   -59.701  1.00 14.88 ? 189  ARG C CD  1 
ATOM   8759  N  NE  . ARG C 1 200 ? 46.468  6.702   -59.804  1.00 10.71 ? 189  ARG C NE  1 
ATOM   8760  C  CZ  . ARG C 1 200 ? 47.253  6.371   -58.780  1.00 17.76 ? 189  ARG C CZ  1 
ATOM   8761  N  NH1 . ARG C 1 200 ? 46.842  6.450   -57.507  1.00 6.75  ? 189  ARG C NH1 1 
ATOM   8762  N  NH2 . ARG C 1 200 ? 48.486  5.966   -59.022  1.00 13.98 ? 189  ARG C NH2 1 
ATOM   8763  N  N   . ASP C 1 201 ? 46.187  3.911   -62.480  1.00 16.64 ? 190  ASP C N   1 
ATOM   8764  C  CA  . ASP C 1 201 ? 47.223  4.300   -63.444  1.00 17.02 ? 190  ASP C CA  1 
ATOM   8765  C  C   . ASP C 1 201 ? 46.965  3.722   -64.833  1.00 17.10 ? 190  ASP C C   1 
ATOM   8766  O  O   . ASP C 1 201 ? 47.228  4.389   -65.816  1.00 19.16 ? 190  ASP C O   1 
ATOM   8767  C  CB  . ASP C 1 201 ? 48.609  3.902   -62.922  1.00 17.20 ? 190  ASP C CB  1 
ATOM   8768  C  CG  . ASP C 1 201 ? 49.012  4.702   -61.718  1.00 18.41 ? 190  ASP C CG  1 
ATOM   8769  O  OD1 . ASP C 1 201 ? 48.545  5.847   -61.582  1.00 18.30 ? 190  ASP C OD1 1 
ATOM   8770  O  OD2 . ASP C 1 201 ? 49.797  4.219   -60.899  1.00 22.48 ? 190  ASP C OD2 1 
ATOM   8771  N  N   . ILE C 1 202 ? 46.427  2.504   -64.890  1.00 16.90 ? 191  ILE C N   1 
ATOM   8772  C  CA  . ILE C 1 202 ? 46.196  1.764   -66.130  1.00 17.22 ? 191  ILE C CA  1 
ATOM   8773  C  C   . ILE C 1 202 ? 44.793  2.004   -66.689  1.00 16.57 ? 191  ILE C C   1 
ATOM   8774  O  O   . ILE C 1 202 ? 44.436  1.525   -67.795  1.00 17.07 ? 191  ILE C O   1 
ATOM   8775  C  CB  . ILE C 1 202 ? 46.477  0.259   -65.922  1.00 17.74 ? 191  ILE C CB  1 
ATOM   8776  C  CG1 . ILE C 1 202 ? 45.307  -0.477  -65.267  1.00 16.81 ? 191  ILE C CG1 1 
ATOM   8777  C  CG2 . ILE C 1 202 ? 47.729  0.084   -65.087  1.00 19.00 ? 191  ILE C CG2 1 
ATOM   8778  C  CD1 . ILE C 1 202 ? 45.511  -1.957  -65.255  1.00 18.58 ? 191  ILE C CD1 1 
ATOM   8779  N  N   . GLY C 1 203 ? 44.011  2.769   -65.937  1.00 15.32 ? 192  GLY C N   1 
ATOM   8780  C  CA  . GLY C 1 203 ? 42.777  3.382   -66.429  1.00 15.24 ? 192  GLY C CA  1 
ATOM   8781  C  C   . GLY C 1 203 ? 41.641  2.389   -66.428  1.00 15.19 ? 192  GLY C C   1 
ATOM   8782  O  O   . GLY C 1 203 ? 40.835  2.359   -67.363  1.00 16.78 ? 192  GLY C O   1 
ATOM   8783  N  N   . ALA C 1 204 ? 41.580  1.557   -65.388  1.00 13.52 ? 193  ALA C N   1 
ATOM   8784  C  CA  . ALA C 1 204 ? 40.558  0.513   -65.310  1.00 13.58 ? 193  ALA C CA  1 
ATOM   8785  C  C   . ALA C 1 204 ? 39.683  0.697   -64.077  1.00 12.64 ? 193  ALA C C   1 
ATOM   8786  O  O   . ALA C 1 204 ? 39.971  1.565   -63.214  1.00 16.19 ? 193  ALA C O   1 
ATOM   8787  C  CB  . ALA C 1 204 ? 41.208  -0.918  -65.325  1.00 11.84 ? 193  ALA C CB  1 
ATOM   8788  N  N   . ILE C 1 205 ? 38.620  -0.106  -64.002  1.00 12.27 ? 194  ILE C N   1 
ATOM   8789  C  CA  A ILE C 1 205 ? 37.686  -0.057  -62.867  0.50 12.75 ? 194  ILE C CA  1 
ATOM   8790  C  CA  B ILE C 1 205 ? 37.694  -0.043  -62.872  0.50 12.61 ? 194  ILE C CA  1 
ATOM   8791  C  C   . ILE C 1 205 ? 38.048  -1.077  -61.815  1.00 12.03 ? 194  ILE C C   1 
ATOM   8792  O  O   . ILE C 1 205 ? 38.270  -2.245  -62.131  1.00 12.81 ? 194  ILE C O   1 
ATOM   8793  C  CB  A ILE C 1 205 ? 36.220  -0.322  -63.286  0.50 12.42 ? 194  ILE C CB  1 
ATOM   8794  C  CB  B ILE C 1 205 ? 36.230  -0.214  -63.342  0.50 12.04 ? 194  ILE C CB  1 
ATOM   8795  C  CG1 A ILE C 1 205 ? 35.746  0.751   -64.269  0.50 14.61 ? 194  ILE C CG1 1 
ATOM   8796  C  CG1 B ILE C 1 205 ? 35.913  0.820   -64.433  0.50 13.66 ? 194  ILE C CG1 1 
ATOM   8797  C  CG2 A ILE C 1 205 ? 35.295  -0.381  -62.050  0.50 12.44 ? 194  ILE C CG2 1 
ATOM   8798  C  CG2 B ILE C 1 205 ? 35.251  -0.063  -62.168  0.50 11.96 ? 194  ILE C CG2 1 
ATOM   8799  C  CD1 A ILE C 1 205 ? 36.009  0.391   -65.702  0.50 11.85 ? 194  ILE C CD1 1 
ATOM   8800  C  CD1 B ILE C 1 205 ? 36.006  2.257   -63.957  0.50 9.16  ? 194  ILE C CD1 1 
ATOM   8801  N  N   . ALA C 1 206 ? 38.103  -0.638  -60.553  1.00 13.08 ? 195  ALA C N   1 
ATOM   8802  C  CA  . ALA C 1 206 ? 38.328  -1.543  -59.458  1.00 12.96 ? 195  ALA C CA  1 
ATOM   8803  C  C   . ALA C 1 206 ? 37.025  -2.013  -58.902  1.00 13.46 ? 195  ALA C C   1 
ATOM   8804  O  O   . ALA C 1 206 ? 36.225  -1.208  -58.516  1.00 13.09 ? 195  ALA C O   1 
ATOM   8805  C  CB  . ALA C 1 206 ? 39.084  -0.880  -58.353  1.00 14.09 ? 195  ALA C CB  1 
ATOM   8806  N  N   . GLN C 1 207 ? 36.827  -3.331  -58.862  1.00 14.57 ? 196  GLN C N   1 
ATOM   8807  C  CA  . GLN C 1 207 ? 35.695  -3.933  -58.193  1.00 14.61 ? 196  GLN C CA  1 
ATOM   8808  C  C   . GLN C 1 207 ? 36.176  -4.589  -56.908  1.00 15.29 ? 196  GLN C C   1 
ATOM   8809  O  O   . GLN C 1 207 ? 37.343  -4.966  -56.806  1.00 18.03 ? 196  GLN C O   1 
ATOM   8810  C  CB  . GLN C 1 207 ? 35.039  -4.964  -59.064  1.00 14.34 ? 196  GLN C CB  1 
ATOM   8811  C  CG  . GLN C 1 207 ? 34.940  -4.579  -60.539  1.00 13.52 ? 196  GLN C CG  1 
ATOM   8812  C  CD  . GLN C 1 207 ? 34.146  -5.611  -61.282  1.00 16.24 ? 196  GLN C CD  1 
ATOM   8813  O  OE1 . GLN C 1 207 ? 34.476  -6.802  -61.211  1.00 16.70 ? 196  GLN C OE1 1 
ATOM   8814  N  NE2 . GLN C 1 207 ? 33.086  -5.186  -61.992  1.00 12.46 ? 196  GLN C NE2 1 
ATOM   8815  N  N   . VAL C 1 208 ? 35.278  -4.674  -55.938  1.00 14.07 ? 197  VAL C N   1 
ATOM   8816  C  CA  . VAL C 1 208 ? 35.493  -5.398  -54.697  1.00 14.62 ? 197  VAL C CA  1 
ATOM   8817  C  C   . VAL C 1 208 ? 34.309  -6.299  -54.373  1.00 13.40 ? 197  VAL C C   1 
ATOM   8818  O  O   . VAL C 1 208 ? 33.163  -5.904  -54.550  1.00 16.68 ? 197  VAL C O   1 
ATOM   8819  C  CB  . VAL C 1 208 ? 35.697  -4.442  -53.537  1.00 14.11 ? 197  VAL C CB  1 
ATOM   8820  C  CG1 . VAL C 1 208 ? 35.783  -5.192  -52.218  1.00 14.47 ? 197  VAL C CG1 1 
ATOM   8821  C  CG2 . VAL C 1 208 ? 36.954  -3.669  -53.771  1.00 19.26 ? 197  VAL C CG2 1 
ATOM   8822  N  N   . HIS C 1 209 ? 34.595  -7.531  -53.971  1.00 12.20 ? 198  HIS C N   1 
ATOM   8823  C  CA  . HIS C 1 209 ? 33.661  -8.299  -53.204  1.00 12.07 ? 198  HIS C CA  1 
ATOM   8824  C  C   . HIS C 1 209 ? 33.849  -7.817  -51.749  1.00 11.80 ? 198  HIS C C   1 
ATOM   8825  O  O   . HIS C 1 209 ? 34.894  -8.092  -51.130  1.00 14.91 ? 198  HIS C O   1 
ATOM   8826  C  CB  . HIS C 1 209 ? 33.876  -9.821  -53.253  1.00 11.39 ? 198  HIS C CB  1 
ATOM   8827  C  CG  . HIS C 1 209 ? 33.017  -10.542 -52.254  1.00 9.48  ? 198  HIS C CG  1 
ATOM   8828  N  ND1 . HIS C 1 209 ? 31.923  -11.295 -52.603  1.00 8.15  ? 198  HIS C ND1 1 
ATOM   8829  C  CD2 . HIS C 1 209 ? 33.040  -10.535 -50.893  1.00 10.30 ? 198  HIS C CD2 1 
ATOM   8830  C  CE1 . HIS C 1 209 ? 31.317  -11.730 -51.512  1.00 12.86 ? 198  HIS C CE1 1 
ATOM   8831  N  NE2 . HIS C 1 209 ? 31.974  -11.280 -50.463  1.00 6.74  ? 198  HIS C NE2 1 
ATOM   8832  N  N   . ALA C 1 210 ? 32.818  -7.164  -51.194  1.00 12.06 ? 199  ALA C N   1 
ATOM   8833  C  CA  . ALA C 1 210 ? 32.941  -6.394  -49.956  1.00 9.61  ? 199  ALA C CA  1 
ATOM   8834  C  C   . ALA C 1 210 ? 32.249  -6.997  -48.711  1.00 9.05  ? 199  ALA C C   1 
ATOM   8835  O  O   . ALA C 1 210 ? 31.079  -6.739  -48.426  1.00 8.00  ? 199  ALA C O   1 
ATOM   8836  C  CB  . ALA C 1 210 ? 32.443  -4.952  -50.182  1.00 7.49  ? 199  ALA C CB  1 
ATOM   8837  N  N   . GLU C 1 211 ? 32.987  -7.781  -47.969  1.00 11.26 ? 200  GLU C N   1 
ATOM   8838  C  CA  . GLU C 1 211 ? 32.553  -8.253  -46.668  1.00 9.75  ? 200  GLU C CA  1 
ATOM   8839  C  C   . GLU C 1 211 ? 33.778  -8.465  -45.873  1.00 9.92  ? 200  GLU C C   1 
ATOM   8840  O  O   . GLU C 1 211 ? 34.801  -8.700  -46.430  1.00 6.46  ? 200  GLU C O   1 
ATOM   8841  C  CB  . GLU C 1 211 ? 31.869  -9.603  -46.770  1.00 10.97 ? 200  GLU C CB  1 
ATOM   8842  C  CG  . GLU C 1 211 ? 30.525  -9.670  -47.438  1.00 12.79 ? 200  GLU C CG  1 
ATOM   8843  C  CD  . GLU C 1 211 ? 30.086  -11.120 -47.640  1.00 14.11 ? 200  GLU C CD  1 
ATOM   8844  O  OE1 . GLU C 1 211 ? 30.569  -11.780 -48.610  1.00 6.92  ? 200  GLU C OE1 1 
ATOM   8845  O  OE2 . GLU C 1 211 ? 29.251  -11.616 -46.856  1.00 5.08  ? 200  GLU C OE2 1 
ATOM   8846  N  N   . ASN C 1 212 ? 33.668  -8.423  -44.540  1.00 7.32  ? 201  ASN C N   1 
ATOM   8847  C  CA  . ASN C 1 212 ? 34.814  -8.528  -43.698  1.00 9.73  ? 201  ASN C CA  1 
ATOM   8848  C  C   . ASN C 1 212 ? 35.119  -9.988  -43.401  1.00 12.21 ? 201  ASN C C   1 
ATOM   8849  O  O   . ASN C 1 212 ? 34.540  -10.570 -42.456  1.00 14.88 ? 201  ASN C O   1 
ATOM   8850  C  CB  . ASN C 1 212 ? 34.574  -7.804  -42.358  1.00 7.82  ? 201  ASN C CB  1 
ATOM   8851  C  CG  . ASN C 1 212 ? 35.865  -7.681  -41.525  1.00 9.82  ? 201  ASN C CG  1 
ATOM   8852  O  OD1 . ASN C 1 212 ? 36.480  -8.696  -41.144  1.00 14.45 ? 201  ASN C OD1 1 
ATOM   8853  N  ND2 . ASN C 1 212 ? 36.298  -6.444  -41.264  1.00 12.85 ? 201  ASN C ND2 1 
ATOM   8854  N  N   . GLY C 1 213 ? 36.058  -10.544 -44.159  1.00 12.59 ? 202  GLY C N   1 
ATOM   8855  C  CA  . GLY C 1 213 ? 36.356  -11.961 -44.151  1.00 13.42 ? 202  GLY C CA  1 
ATOM   8856  C  C   . GLY C 1 213 ? 36.904  -12.476 -42.866  1.00 13.80 ? 202  GLY C C   1 
ATOM   8857  O  O   . GLY C 1 213 ? 36.813  -13.662 -42.580  1.00 16.03 ? 202  GLY C O   1 
ATOM   8858  N  N   . ASP C 1 214 ? 37.452  -11.570 -42.082  1.00 13.93 ? 203  ASP C N   1 
ATOM   8859  C  CA  . ASP C 1 214 ? 38.112  -11.919 -40.837  1.00 13.39 ? 203  ASP C CA  1 
ATOM   8860  C  C   . ASP C 1 214 ? 37.074  -12.190 -39.760  1.00 13.69 ? 203  ASP C C   1 
ATOM   8861  O  O   . ASP C 1 214 ? 37.141  -13.194 -39.052  1.00 14.97 ? 203  ASP C O   1 
ATOM   8862  C  CB  . ASP C 1 214 ? 39.016  -10.774 -40.397  1.00 13.18 ? 203  ASP C CB  1 
ATOM   8863  C  CG  . ASP C 1 214 ? 40.454  -10.945 -40.809  1.00 13.67 ? 203  ASP C CG  1 
ATOM   8864  O  OD1 . ASP C 1 214 ? 40.765  -11.478 -41.897  1.00 15.33 ? 203  ASP C OD1 1 
ATOM   8865  O  OD2 . ASP C 1 214 ? 41.294  -10.461 -40.030  1.00 20.22 ? 203  ASP C OD2 1 
ATOM   8866  N  N   . ILE C 1 215 ? 36.098  -11.292 -39.670  1.00 14.29 ? 204  ILE C N   1 
ATOM   8867  C  CA  . ILE C 1 215 ? 34.989  -11.433 -38.746  1.00 11.70 ? 204  ILE C CA  1 
ATOM   8868  C  C   . ILE C 1 215 ? 34.146  -12.595 -39.183  1.00 9.29  ? 204  ILE C C   1 
ATOM   8869  O  O   . ILE C 1 215 ? 33.680  -13.374 -38.389  1.00 7.65  ? 204  ILE C O   1 
ATOM   8870  C  CB  . ILE C 1 215 ? 34.102  -10.152 -38.692  1.00 13.31 ? 204  ILE C CB  1 
ATOM   8871  C  CG1 . ILE C 1 215 ? 34.876  -8.944  -38.130  1.00 12.07 ? 204  ILE C CG1 1 
ATOM   8872  C  CG2 . ILE C 1 215 ? 32.887  -10.388 -37.846  1.00 14.67 ? 204  ILE C CG2 1 
ATOM   8873  C  CD1 . ILE C 1 215 ? 34.058  -7.657  -38.129  1.00 7.46  ? 204  ILE C CD1 1 
ATOM   8874  N  N   . ILE C 1 216 ? 33.909  -12.737 -40.479  1.00 6.30  ? 205  ILE C N   1 
ATOM   8875  C  CA  . ILE C 1 216 ? 33.168  -13.856 -40.913  1.00 4.72  ? 205  ILE C CA  1 
ATOM   8876  C  C   . ILE C 1 216 ? 33.827  -15.184 -40.586  1.00 5.97  ? 205  ILE C C   1 
ATOM   8877  O  O   . ILE C 1 216 ? 33.123  -16.156 -40.337  1.00 9.23  ? 205  ILE C O   1 
ATOM   8878  C  CB  . ILE C 1 216 ? 32.941  -13.771 -42.506  1.00 2.00  ? 205  ILE C CB  1 
ATOM   8879  C  CG1 . ILE C 1 216 ? 32.062  -12.574 -42.855  1.00 2.00  ? 205  ILE C CG1 1 
ATOM   8880  C  CG2 . ILE C 1 216 ? 32.241  -14.981 -42.951  1.00 6.24  ? 205  ILE C CG2 1 
ATOM   8881  C  CD1 . ILE C 1 216 ? 31.959  -12.363 -44.468  1.00 2.63  ? 205  ILE C CD1 1 
ATOM   8882  N  N   . ALA C 1 217 ? 35.162  -15.271 -40.661  1.00 7.60  ? 206  ALA C N   1 
ATOM   8883  C  CA  . ALA C 1 217 ? 35.901  -16.494 -40.420  1.00 8.10  ? 206  ALA C CA  1 
ATOM   8884  C  C   . ALA C 1 217 ? 35.702  -16.925 -38.963  1.00 11.42 ? 206  ALA C C   1 
ATOM   8885  O  O   . ALA C 1 217 ? 35.409  -18.085 -38.661  1.00 12.12 ? 206  ALA C O   1 
ATOM   8886  C  CB  . ALA C 1 217 ? 37.368  -16.278 -40.691  1.00 8.43  ? 206  ALA C CB  1 
ATOM   8887  N  N   . GLU C 1 218 ? 35.773  -15.967 -38.077  1.00 14.95 ? 207  GLU C N   1 
ATOM   8888  C  CA  . GLU C 1 218 ? 35.518  -16.241 -36.646  1.00 16.41 ? 207  GLU C CA  1 
ATOM   8889  C  C   . GLU C 1 218 ? 34.065  -16.609 -36.345  1.00 18.02 ? 207  GLU C C   1 
ATOM   8890  O  O   . GLU C 1 218 ? 33.797  -17.570 -35.657  1.00 19.36 ? 207  GLU C O   1 
ATOM   8891  C  CB  . GLU C 1 218 ? 35.873  -15.008 -35.829  1.00 18.77 ? 207  GLU C CB  1 
ATOM   8892  C  CG  . GLU C 1 218 ? 37.310  -14.572 -35.952  1.00 22.84 ? 207  GLU C CG  1 
ATOM   8893  C  CD  . GLU C 1 218 ? 38.303  -15.539 -35.318  1.00 27.71 ? 207  GLU C CD  1 
ATOM   8894  O  OE1 . GLU C 1 218 ? 37.883  -16.440 -34.559  1.00 31.16 ? 207  GLU C OE1 1 
ATOM   8895  O  OE2 . GLU C 1 218 ? 39.518  -15.377 -35.579  1.00 32.44 ? 207  GLU C OE2 1 
ATOM   8896  N  N   . GLU C 1 219 ? 33.116  -15.836 -36.860  1.00 19.26 ? 208  GLU C N   1 
ATOM   8897  C  CA  . GLU C 1 219 ? 31.678  -16.131 -36.647  1.00 19.03 ? 208  GLU C CA  1 
ATOM   8898  C  C   . GLU C 1 219 ? 31.208  -17.473 -37.272  1.00 20.43 ? 208  GLU C C   1 
ATOM   8899  O  O   . GLU C 1 219 ? 30.418  -18.184 -36.686  1.00 22.01 ? 208  GLU C O   1 
ATOM   8900  C  CB  . GLU C 1 219 ? 30.820  -15.013 -37.210  1.00 17.61 ? 208  GLU C CB  1 
ATOM   8901  C  CG  . GLU C 1 219 ? 30.918  -13.728 -36.515  1.00 16.78 ? 208  GLU C CG  1 
ATOM   8902  C  CD  . GLU C 1 219 ? 30.239  -13.795 -35.165  1.00 19.87 ? 208  GLU C CD  1 
ATOM   8903  O  OE1 . GLU C 1 219 ? 29.216  -13.127 -34.969  1.00 23.56 ? 208  GLU C OE1 1 
ATOM   8904  O  OE2 . GLU C 1 219 ? 30.716  -14.558 -34.310  1.00 24.70 ? 208  GLU C OE2 1 
ATOM   8905  N  N   . GLN C 1 220 ? 31.690  -17.784 -38.464  1.00 20.69 ? 209  GLN C N   1 
ATOM   8906  C  CA  . GLN C 1 220 ? 31.447  -19.058 -39.094  1.00 20.58 ? 209  GLN C CA  1 
ATOM   8907  C  C   . GLN C 1 220 ? 31.648  -20.273 -38.147  1.00 23.00 ? 209  GLN C C   1 
ATOM   8908  O  O   . GLN C 1 220 ? 30.787  -21.154 -38.039  1.00 22.98 ? 209  GLN C O   1 
ATOM   8909  C  CB  . GLN C 1 220 ? 32.391  -19.195 -40.267  1.00 19.91 ? 209  GLN C CB  1 
ATOM   8910  C  CG  . GLN C 1 220 ? 31.790  -18.754 -41.523  1.00 14.46 ? 209  GLN C CG  1 
ATOM   8911  C  CD  . GLN C 1 220 ? 32.649  -19.040 -42.686  1.00 19.11 ? 209  GLN C CD  1 
ATOM   8912  O  OE1 . GLN C 1 220 ? 33.836  -19.334 -42.546  1.00 18.14 ? 209  GLN C OE1 1 
ATOM   8913  N  NE2 . GLN C 1 220 ? 32.063  -18.942 -43.874  1.00 15.29 ? 209  GLN C NE2 1 
ATOM   8914  N  N   . GLN C 1 221 ? 32.803  -20.326 -37.505  1.00 24.57 ? 210  GLN C N   1 
ATOM   8915  C  CA  . GLN C 1 221 ? 33.145  -21.453 -36.636  1.00 25.98 ? 210  GLN C CA  1 
ATOM   8916  C  C   . GLN C 1 221 ? 32.453  -21.371 -35.301  1.00 25.69 ? 210  GLN C C   1 
ATOM   8917  O  O   . GLN C 1 221 ? 32.251  -22.403 -34.649  1.00 27.86 ? 210  GLN C O   1 
ATOM   8918  C  CB  . GLN C 1 221 ? 34.667  -21.560 -36.417  1.00 28.77 ? 210  GLN C CB  1 
ATOM   8919  C  CG  . GLN C 1 221 ? 35.352  -22.597 -37.327  1.00 32.23 ? 210  GLN C CG  1 
ATOM   8920  C  CD  . GLN C 1 221 ? 34.877  -24.050 -37.106  1.00 35.05 ? 210  GLN C CD  1 
ATOM   8921  O  OE1 . GLN C 1 221 ? 35.021  -24.888 -38.002  1.00 39.05 ? 210  GLN C OE1 1 
ATOM   8922  N  NE2 . GLN C 1 221 ? 34.293  -24.338 -35.933  1.00 37.77 ? 210  GLN C NE2 1 
ATOM   8923  N  N   . ARG C 1 222 ? 32.116  -20.159 -34.880  1.00 23.81 ? 211  ARG C N   1 
ATOM   8924  C  CA  . ARG C 1 222 ? 31.370  -19.963 -33.632  1.00 23.75 ? 211  ARG C CA  1 
ATOM   8925  C  C   . ARG C 1 222 ? 29.931  -20.494 -33.738  1.00 23.90 ? 211  ARG C C   1 
ATOM   8926  O  O   . ARG C 1 222 ? 29.400  -21.075 -32.790  1.00 25.96 ? 211  ARG C O   1 
ATOM   8927  C  CB  . ARG C 1 222 ? 31.341  -18.485 -33.259  1.00 22.55 ? 211  ARG C CB  1 
ATOM   8928  C  CG  . ARG C 1 222 ? 30.970  -18.230 -31.795  1.00 22.73 ? 211  ARG C CG  1 
ATOM   8929  C  CD  . ARG C 1 222 ? 30.643  -16.793 -31.603  1.00 23.55 ? 211  ARG C CD  1 
ATOM   8930  N  NE  . ARG C 1 222 ? 29.525  -16.342 -32.430  1.00 27.11 ? 211  ARG C NE  1 
ATOM   8931  C  CZ  . ARG C 1 222 ? 28.252  -16.262 -32.044  1.00 28.60 ? 211  ARG C CZ  1 
ATOM   8932  N  NH1 . ARG C 1 222 ? 27.879  -16.636 -30.831  1.00 33.75 ? 211  ARG C NH1 1 
ATOM   8933  N  NH2 . ARG C 1 222 ? 27.334  -15.801 -32.880  1.00 26.21 ? 211  ARG C NH2 1 
ATOM   8934  N  N   . ILE C 1 223 ? 29.308  -20.243 -34.885  1.00 23.47 ? 212  ILE C N   1 
ATOM   8935  C  CA  . ILE C 1 223 ? 27.959  -20.684 -35.191  1.00 22.88 ? 212  ILE C CA  1 
ATOM   8936  C  C   . ILE C 1 223 ? 27.970  -22.233 -35.337  1.00 22.85 ? 212  ILE C C   1 
ATOM   8937  O  O   . ILE C 1 223 ? 27.116  -22.915 -34.805  1.00 20.62 ? 212  ILE C O   1 
ATOM   8938  C  CB  . ILE C 1 223 ? 27.440  -19.991 -36.514  1.00 22.09 ? 212  ILE C CB  1 
ATOM   8939  C  CG1 . ILE C 1 223 ? 27.433  -18.454 -36.429  1.00 22.31 ? 212  ILE C CG1 1 
ATOM   8940  C  CG2 . ILE C 1 223 ? 26.045  -20.429 -36.893  1.00 21.83 ? 212  ILE C CG2 1 
ATOM   8941  C  CD1 . ILE C 1 223 ? 26.519  -17.845 -35.399  1.00 23.99 ? 212  ILE C CD1 1 
ATOM   8942  N  N   . LEU C 1 224 ? 28.936  -22.790 -36.066  1.00 23.95 ? 213  LEU C N   1 
ATOM   8943  C  CA  . LEU C 1 224 ? 29.076  -24.255 -36.151  1.00 23.96 ? 213  LEU C CA  1 
ATOM   8944  C  C   . LEU C 1 224 ? 29.426  -24.881 -34.797  1.00 25.08 ? 213  LEU C C   1 
ATOM   8945  O  O   . LEU C 1 224 ? 28.981  -25.994 -34.469  1.00 26.43 ? 213  LEU C O   1 
ATOM   8946  C  CB  . LEU C 1 224 ? 30.140  -24.652 -37.172  1.00 24.79 ? 213  LEU C CB  1 
ATOM   8947  C  CG  . LEU C 1 224 ? 30.013  -24.201 -38.629  1.00 24.54 ? 213  LEU C CG  1 
ATOM   8948  C  CD1 . LEU C 1 224 ? 31.426  -23.912 -39.153  1.00 26.60 ? 213  LEU C CD1 1 
ATOM   8949  C  CD2 . LEU C 1 224 ? 29.320  -25.210 -39.527  1.00 25.70 ? 213  LEU C CD2 1 
ATOM   8950  N  N   . ASP C 1 225 ? 30.214  -24.176 -33.998  1.00 24.77 ? 214  ASP C N   1 
ATOM   8951  C  CA  . ASP C 1 225 ? 30.527  -24.658 -32.641  1.00 24.76 ? 214  ASP C CA  1 
ATOM   8952  C  C   . ASP C 1 225 ? 29.270  -24.887 -31.844  1.00 24.34 ? 214  ASP C C   1 
ATOM   8953  O  O   . ASP C 1 225 ? 29.232  -25.777 -31.000  1.00 23.68 ? 214  ASP C O   1 
ATOM   8954  C  CB  . ASP C 1 225 ? 31.425  -23.675 -31.880  1.00 24.35 ? 214  ASP C CB  1 
ATOM   8955  C  CG  . ASP C 1 225 ? 32.893  -23.901 -32.140  1.00 25.48 ? 214  ASP C CG  1 
ATOM   8956  O  OD1 . ASP C 1 225 ? 33.262  -24.451 -33.205  1.00 22.65 ? 214  ASP C OD1 1 
ATOM   8957  O  OD2 . ASP C 1 225 ? 33.682  -23.512 -31.264  1.00 22.42 ? 214  ASP C OD2 1 
ATOM   8958  N  N   . LEU C 1 226 ? 28.250  -24.082 -32.129  1.00 24.73 ? 215  LEU C N   1 
ATOM   8959  C  CA  . LEU C 1 226 ? 26.977  -24.128 -31.396  1.00 24.04 ? 215  LEU C CA  1 
ATOM   8960  C  C   . LEU C 1 226 ? 26.059  -25.256 -31.854  1.00 24.39 ? 215  LEU C C   1 
ATOM   8961  O  O   . LEU C 1 226 ? 25.067  -25.560 -31.189  1.00 24.20 ? 215  LEU C O   1 
ATOM   8962  C  CB  . LEU C 1 226 ? 26.245  -22.789 -31.528  1.00 24.75 ? 215  LEU C CB  1 
ATOM   8963  C  CG  . LEU C 1 226 ? 26.526  -21.712 -30.479  1.00 21.14 ? 215  LEU C CG  1 
ATOM   8964  C  CD1 . LEU C 1 226 ? 27.951  -21.753 -30.044  1.00 18.81 ? 215  LEU C CD1 1 
ATOM   8965  C  CD2 . LEU C 1 226 ? 26.112  -20.347 -31.024  1.00 21.12 ? 215  LEU C CD2 1 
ATOM   8966  N  N   . GLY C 1 227 ? 26.412  -25.866 -32.980  1.00 23.85 ? 216  GLY C N   1 
ATOM   8967  C  CA  . GLY C 1 227 ? 25.612  -26.892 -33.617  1.00 23.03 ? 216  GLY C CA  1 
ATOM   8968  C  C   . GLY C 1 227 ? 24.679  -26.370 -34.678  1.00 22.36 ? 216  GLY C C   1 
ATOM   8969  O  O   . GLY C 1 227 ? 23.874  -27.122 -35.199  1.00 22.52 ? 216  GLY C O   1 
ATOM   8970  N  N   . ILE C 1 228 ? 24.725  -25.085 -34.989  1.00 21.76 ? 217  ILE C N   1 
ATOM   8971  C  CA  . ILE C 1 228 ? 23.850  -24.590 -36.046  1.00 21.43 ? 217  ILE C CA  1 
ATOM   8972  C  C   . ILE C 1 228 ? 24.582  -24.926 -37.318  1.00 20.77 ? 217  ILE C C   1 
ATOM   8973  O  O   . ILE C 1 228 ? 25.575  -24.290 -37.596  1.00 22.45 ? 217  ILE C O   1 
ATOM   8974  C  CB  . ILE C 1 228 ? 23.626  -23.063 -36.027  1.00 21.03 ? 217  ILE C CB  1 
ATOM   8975  C  CG1 . ILE C 1 228 ? 22.747  -22.633 -34.854  1.00 20.56 ? 217  ILE C CG1 1 
ATOM   8976  C  CG2 . ILE C 1 228 ? 22.986  -22.597 -37.381  1.00 20.83 ? 217  ILE C CG2 1 
ATOM   8977  C  CD1 . ILE C 1 228 ? 23.489  -22.490 -33.579  1.00 19.61 ? 217  ILE C CD1 1 
ATOM   8978  N  N   . THR C 1 229 ? 24.112  -25.931 -38.066  1.00 19.80 ? 218  THR C N   1 
ATOM   8979  C  CA  . THR C 1 229 ? 24.781  -26.374 -39.318  1.00 17.72 ? 218  THR C CA  1 
ATOM   8980  C  C   . THR C 1 229 ? 23.984  -26.172 -40.605  1.00 16.35 ? 218  THR C C   1 
ATOM   8981  O  O   . THR C 1 229 ? 24.500  -26.317 -41.738  1.00 11.83 ? 218  THR C O   1 
ATOM   8982  C  CB  . THR C 1 229 ? 25.118  -27.872 -39.203  1.00 19.07 ? 218  THR C CB  1 
ATOM   8983  O  OG1 . THR C 1 229 ? 24.008  -28.565 -38.587  1.00 22.47 ? 218  THR C OG1 1 
ATOM   8984  C  CG2 . THR C 1 229 ? 26.392  -28.068 -38.374  1.00 19.05 ? 218  THR C CG2 1 
ATOM   8985  N  N   . GLY C 1 230 ? 22.706  -25.879 -40.448  1.00 16.40 ? 219  GLY C N   1 
ATOM   8986  C  CA  . GLY C 1 230 ? 21.851  -25.614 -41.581  1.00 16.44 ? 219  GLY C CA  1 
ATOM   8987  C  C   . GLY C 1 230 ? 22.068  -24.233 -42.179  1.00 16.67 ? 219  GLY C C   1 
ATOM   8988  O  O   . GLY C 1 230 ? 22.793  -23.386 -41.612  1.00 15.20 ? 219  GLY C O   1 
ATOM   8989  N  N   . PRO C 1 231 ? 21.448  -23.991 -43.342  1.00 16.36 ? 220  PRO C N   1 
ATOM   8990  C  CA  . PRO C 1 231 ? 21.727  -22.798 -44.111  1.00 16.87 ? 220  PRO C CA  1 
ATOM   8991  C  C   . PRO C 1 231 ? 21.585  -21.489 -43.354  1.00 17.12 ? 220  PRO C C   1 
ATOM   8992  O  O   . PRO C 1 231 ? 22.277  -20.539 -43.683  1.00 18.01 ? 220  PRO C O   1 
ATOM   8993  C  CB  . PRO C 1 231 ? 20.691  -22.875 -45.245  1.00 16.74 ? 220  PRO C CB  1 
ATOM   8994  C  CG  . PRO C 1 231 ? 20.486  -24.331 -45.421  1.00 15.37 ? 220  PRO C CG  1 
ATOM   8995  C  CD  . PRO C 1 231 ? 20.398  -24.800 -43.997  1.00 16.20 ? 220  PRO C CD  1 
ATOM   8996  N  N   . GLU C 1 232 ? 20.752  -21.444 -42.313  1.00 18.47 ? 221  GLU C N   1 
ATOM   8997  C  CA  . GLU C 1 232 ? 20.604  -20.191 -41.558  1.00 18.03 ? 221  GLU C CA  1 
ATOM   8998  C  C   . GLU C 1 232 ? 21.936  -19.659 -40.939  1.00 18.61 ? 221  GLU C C   1 
ATOM   8999  O  O   . GLU C 1 232 ? 22.087  -18.457 -40.675  1.00 19.56 ? 221  GLU C O   1 
ATOM   9000  C  CB  . GLU C 1 232 ? 19.464  -20.281 -40.527  1.00 17.07 ? 221  GLU C CB  1 
ATOM   9001  C  CG  . GLU C 1 232 ? 19.773  -20.984 -39.248  1.00 15.53 ? 221  GLU C CG  1 
ATOM   9002  C  CD  . GLU C 1 232 ? 19.581  -22.474 -39.305  1.00 17.03 ? 221  GLU C CD  1 
ATOM   9003  O  OE1 . GLU C 1 232 ? 19.462  -23.036 -40.437  1.00 2.00  ? 221  GLU C OE1 1 
ATOM   9004  O  OE2 . GLU C 1 232 ? 19.533  -23.105 -38.203  1.00 2.00  ? 221  GLU C OE2 1 
ATOM   9005  N  N   . GLY C 1 233 ? 22.888  -20.550 -40.710  1.00 17.99 ? 222  GLY C N   1 
ATOM   9006  C  CA  . GLY C 1 233 ? 24.206  -20.152 -40.208  1.00 18.15 ? 222  GLY C CA  1 
ATOM   9007  C  C   . GLY C 1 233 ? 24.973  -19.333 -41.226  1.00 16.73 ? 222  GLY C C   1 
ATOM   9008  O  O   . GLY C 1 233 ? 25.852  -18.568 -40.893  1.00 17.01 ? 222  GLY C O   1 
ATOM   9009  N  N   . HIS C 1 234 ? 24.638  -19.487 -42.491  1.00 14.77 ? 223  HIS C N   1 
ATOM   9010  C  CA  . HIS C 1 234 ? 25.300  -18.704 -43.468  1.00 11.97 ? 223  HIS C CA  1 
ATOM   9011  C  C   . HIS C 1 234 ? 24.977  -17.244 -43.152  1.00 13.17 ? 223  HIS C C   1 
ATOM   9012  O  O   . HIS C 1 234 ? 25.863  -16.430 -42.935  1.00 16.89 ? 223  HIS C O   1 
ATOM   9013  C  CB  . HIS C 1 234 ? 24.787  -19.074 -44.847  1.00 11.87 ? 223  HIS C CB  1 
ATOM   9014  C  CG  . HIS C 1 234 ? 25.573  -18.451 -45.942  1.00 9.20  ? 223  HIS C CG  1 
ATOM   9015  N  ND1 . HIS C 1 234 ? 26.923  -18.637 -46.074  1.00 7.91  ? 223  HIS C ND1 1 
ATOM   9016  C  CD2 . HIS C 1 234 ? 25.204  -17.645 -46.964  1.00 14.52 ? 223  HIS C CD2 1 
ATOM   9017  C  CE1 . HIS C 1 234 ? 27.358  -17.988 -47.134  1.00 14.35 ? 223  HIS C CE1 1 
ATOM   9018  N  NE2 . HIS C 1 234 ? 26.335  -17.375 -47.689  1.00 15.95 ? 223  HIS C NE2 1 
ATOM   9019  N  N   . VAL C 1 235 ? 23.695  -16.913 -43.104  1.00 12.96 ? 224  VAL C N   1 
ATOM   9020  C  CA  . VAL C 1 235 ? 23.256  -15.533 -43.068  1.00 11.74 ? 224  VAL C CA  1 
ATOM   9021  C  C   . VAL C 1 235 ? 23.601  -14.939 -41.708  1.00 12.85 ? 224  VAL C C   1 
ATOM   9022  O  O   . VAL C 1 235 ? 23.853  -13.731 -41.598  1.00 13.06 ? 224  VAL C O   1 
ATOM   9023  C  CB  . VAL C 1 235 ? 21.726  -15.410 -43.330  1.00 11.27 ? 224  VAL C CB  1 
ATOM   9024  C  CG1 . VAL C 1 235 ? 20.923  -16.135 -42.244  1.00 9.75  ? 224  VAL C CG1 1 
ATOM   9025  C  CG2 . VAL C 1 235 ? 21.308  -13.946 -43.369  1.00 9.47  ? 224  VAL C CG2 1 
ATOM   9026  N  N   . LEU C 1 236 ? 23.620  -15.810 -40.690  1.00 12.99 ? 225  LEU C N   1 
ATOM   9027  C  CA  . LEU C 1 236 ? 23.843  -15.416 -39.296  1.00 13.75 ? 225  LEU C CA  1 
ATOM   9028  C  C   . LEU C 1 236 ? 25.331  -15.166 -39.041  1.00 15.41 ? 225  LEU C C   1 
ATOM   9029  O  O   . LEU C 1 236 ? 25.686  -14.458 -38.094  1.00 18.23 ? 225  LEU C O   1 
ATOM   9030  C  CB  . LEU C 1 236 ? 23.319  -16.515 -38.349  1.00 13.54 ? 225  LEU C CB  1 
ATOM   9031  C  CG  . LEU C 1 236 ? 21.800  -16.707 -38.069  1.00 13.35 ? 225  LEU C CG  1 
ATOM   9032  C  CD1 . LEU C 1 236 ? 21.486  -17.979 -37.226  1.00 11.22 ? 225  LEU C CD1 1 
ATOM   9033  C  CD2 . LEU C 1 236 ? 21.144  -15.460 -37.411  1.00 6.66  ? 225  LEU C CD2 1 
ATOM   9034  N  N   . SER C 1 237 ? 26.205  -15.763 -39.865  1.00 14.38 ? 226  SER C N   1 
ATOM   9035  C  CA  . SER C 1 237 ? 27.656  -15.575 -39.774  1.00 13.67 ? 226  SER C CA  1 
ATOM   9036  C  C   . SER C 1 237 ? 28.134  -14.356 -40.597  1.00 14.52 ? 226  SER C C   1 
ATOM   9037  O  O   . SER C 1 237 ? 29.283  -13.898 -40.486  1.00 13.13 ? 226  SER C O   1 
ATOM   9038  C  CB  . SER C 1 237 ? 28.373  -16.871 -40.183  1.00 13.46 ? 226  SER C CB  1 
ATOM   9039  O  OG  . SER C 1 237 ? 28.307  -17.124 -41.609  1.00 17.31 ? 226  SER C OG  1 
ATOM   9040  N  N   . ARG C 1 238 ? 27.208  -13.810 -41.384  1.00 14.43 ? 227  ARG C N   1 
ATOM   9041  C  CA  . ARG C 1 238 ? 27.467  -12.695 -42.263  1.00 15.38 ? 227  ARG C CA  1 
ATOM   9042  C  C   . ARG C 1 238 ? 26.387  -11.651 -42.117  1.00 14.55 ? 227  ARG C C   1 
ATOM   9043  O  O   . ARG C 1 238 ? 25.722  -11.361 -43.060  1.00 14.19 ? 227  ARG C O   1 
ATOM   9044  C  CB  . ARG C 1 238 ? 27.501  -13.196 -43.721  1.00 14.86 ? 227  ARG C CB  1 
ATOM   9045  C  CG  . ARG C 1 238 ? 27.623  -14.662 -43.860  1.00 17.78 ? 227  ARG C CG  1 
ATOM   9046  C  CD  . ARG C 1 238 ? 27.943  -15.063 -45.286  1.00 19.23 ? 227  ARG C CD  1 
ATOM   9047  N  NE  . ARG C 1 238 ? 29.360  -14.932 -45.551  1.00 20.04 ? 227  ARG C NE  1 
ATOM   9048  C  CZ  . ARG C 1 238 ? 29.865  -14.447 -46.677  1.00 25.10 ? 227  ARG C CZ  1 
ATOM   9049  N  NH1 . ARG C 1 238 ? 29.046  -14.041 -47.629  1.00 29.61 ? 227  ARG C NH1 1 
ATOM   9050  N  NH2 . ARG C 1 238 ? 31.178  -14.353 -46.861  1.00 24.47 ? 227  ARG C NH2 1 
ATOM   9051  N  N   . PRO C 1 239 ? 26.191  -11.080 -40.918  1.00 13.32 ? 228  PRO C N   1 
ATOM   9052  C  CA  . PRO C 1 239 ? 25.234  -9.977  -40.802  1.00 13.30 ? 228  PRO C CA  1 
ATOM   9053  C  C   . PRO C 1 239 ? 25.563  -8.810  -41.748  1.00 13.71 ? 228  PRO C C   1 
ATOM   9054  O  O   . PRO C 1 239 ? 26.711  -8.604  -42.078  1.00 18.12 ? 228  PRO C O   1 
ATOM   9055  C  CB  . PRO C 1 239 ? 25.405  -9.535  -39.331  1.00 14.68 ? 228  PRO C CB  1 
ATOM   9056  C  CG  . PRO C 1 239 ? 26.749  -10.035 -38.964  1.00 13.79 ? 228  PRO C CG  1 
ATOM   9057  C  CD  . PRO C 1 239 ? 26.808  -11.376 -39.617  1.00 14.28 ? 228  PRO C CD  1 
ATOM   9058  N  N   . GLU C 1 240 ? 24.565  -8.038  -42.141  1.00 12.92 ? 229  GLU C N   1 
ATOM   9059  C  CA  . GLU C 1 240 ? 24.688  -7.020  -43.175  1.00 10.94 ? 229  GLU C CA  1 
ATOM   9060  C  C   . GLU C 1 240 ? 25.717  -5.976  -42.773  1.00 10.77 ? 229  GLU C C   1 
ATOM   9061  O  O   . GLU C 1 240 ? 26.424  -5.395  -43.580  1.00 8.45  ? 229  GLU C O   1 
ATOM   9062  C  CB  . GLU C 1 240 ? 23.298  -6.419  -43.492  1.00 11.65 ? 229  GLU C CB  1 
ATOM   9063  C  CG  . GLU C 1 240 ? 22.839  -5.228  -42.633  1.00 10.32 ? 229  GLU C CG  1 
ATOM   9064  C  CD  . GLU C 1 240 ? 21.583  -4.503  -43.108  1.00 11.11 ? 229  GLU C CD  1 
ATOM   9065  O  OE1 . GLU C 1 240 ? 21.711  -3.276  -43.319  1.00 15.67 ? 229  GLU C OE1 1 
ATOM   9066  O  OE2 . GLU C 1 240 ? 20.480  -5.112  -43.234  1.00 12.36 ? 229  GLU C OE2 1 
ATOM   9067  N  N   . GLU C 1 241 ? 25.900  -5.835  -41.463  1.00 11.72 ? 230  GLU C N   1 
ATOM   9068  C  CA  . GLU C 1 241 ? 26.900  -4.959  -40.961  1.00 11.90 ? 230  GLU C CA  1 
ATOM   9069  C  C   . GLU C 1 241 ? 28.302  -5.267  -41.408  1.00 10.04 ? 230  GLU C C   1 
ATOM   9070  O  O   . GLU C 1 241 ? 29.143  -4.369  -41.368  1.00 11.19 ? 230  GLU C O   1 
ATOM   9071  C  CB  . GLU C 1 241 ? 26.876  -4.980  -39.431  1.00 11.19 ? 230  GLU C CB  1 
ATOM   9072  C  CG  . GLU C 1 241 ? 25.599  -4.370  -38.808  1.00 16.85 ? 230  GLU C CG  1 
ATOM   9073  C  CD  . GLU C 1 241 ? 24.333  -5.250  -38.820  1.00 15.67 ? 230  GLU C CD  1 
ATOM   9074  O  OE1 . GLU C 1 241 ? 24.406  -6.488  -38.918  1.00 18.46 ? 230  GLU C OE1 1 
ATOM   9075  O  OE2 . GLU C 1 241 ? 23.246  -4.671  -38.700  1.00 20.56 ? 230  GLU C OE2 1 
ATOM   9076  N  N   . VAL C 1 242 ? 28.607  -6.523  -41.727  1.00 10.02 ? 231  VAL C N   1 
ATOM   9077  C  CA  . VAL C 1 242 ? 29.975  -6.862  -42.149  1.00 11.03 ? 231  VAL C CA  1 
ATOM   9078  C  C   . VAL C 1 242 ? 30.147  -6.542  -43.645  1.00 10.68 ? 231  VAL C C   1 
ATOM   9079  O  O   . VAL C 1 242 ? 31.245  -6.283  -44.080  1.00 7.35  ? 231  VAL C O   1 
ATOM   9080  C  CB  . VAL C 1 242 ? 30.432  -8.327  -41.760  1.00 13.17 ? 231  VAL C CB  1 
ATOM   9081  C  CG1 . VAL C 1 242 ? 30.397  -8.477  -40.239  1.00 11.24 ? 231  VAL C CG1 1 
ATOM   9082  C  CG2 . VAL C 1 242 ? 29.614  -9.453  -42.452  1.00 11.20 ? 231  VAL C CG2 1 
ATOM   9083  N  N   . GLU C 1 243 ? 29.045  -6.449  -44.377  1.00 11.57 ? 232  GLU C N   1 
ATOM   9084  C  CA  . GLU C 1 243 ? 29.110  -5.965  -45.785  1.00 11.95 ? 232  GLU C CA  1 
ATOM   9085  C  C   . GLU C 1 243 ? 29.347  -4.453  -45.823  1.00 11.81 ? 232  GLU C C   1 
ATOM   9086  O  O   . GLU C 1 243 ? 30.237  -3.960  -46.504  1.00 13.68 ? 232  GLU C O   1 
ATOM   9087  C  CB  . GLU C 1 243 ? 27.807  -6.270  -46.478  1.00 11.99 ? 232  GLU C CB  1 
ATOM   9088  C  CG  . GLU C 1 243 ? 27.756  -5.964  -47.980  1.00 12.83 ? 232  GLU C CG  1 
ATOM   9089  C  CD  . GLU C 1 243 ? 26.327  -5.974  -48.481  1.00 14.27 ? 232  GLU C CD  1 
ATOM   9090  O  OE1 . GLU C 1 243 ? 25.445  -6.396  -47.707  1.00 12.74 ? 232  GLU C OE1 1 
ATOM   9091  O  OE2 . GLU C 1 243 ? 26.074  -5.551  -49.638  1.00 20.70 ? 232  GLU C OE2 1 
ATOM   9092  N  N   . ALA C 1 244 ? 28.530  -3.707  -45.091  1.00 11.68 ? 233  ALA C N   1 
ATOM   9093  C  CA  . ALA C 1 244 ? 28.663  -2.251  -45.032  1.00 11.91 ? 233  ALA C CA  1 
ATOM   9094  C  C   . ALA C 1 244 ? 30.008  -1.778  -44.480  1.00 10.09 ? 233  ALA C C   1 
ATOM   9095  O  O   . ALA C 1 244 ? 30.486  -0.741  -44.827  1.00 9.26  ? 233  ALA C O   1 
ATOM   9096  C  CB  . ALA C 1 244 ? 27.511  -1.655  -44.262  1.00 11.02 ? 233  ALA C CB  1 
ATOM   9097  N  N   . GLU C 1 245 ? 30.607  -2.531  -43.579  1.00 14.41 ? 234  GLU C N   1 
ATOM   9098  C  CA  . GLU C 1 245 ? 31.898  -2.167  -43.019  1.00 13.22 ? 234  GLU C CA  1 
ATOM   9099  C  C   . GLU C 1 245 ? 32.944  -2.200  -44.112  1.00 12.68 ? 234  GLU C C   1 
ATOM   9100  O  O   . GLU C 1 245 ? 33.804  -1.321  -44.244  1.00 13.75 ? 234  GLU C O   1 
ATOM   9101  C  CB  . GLU C 1 245 ? 32.255  -3.156  -41.908  1.00 14.89 ? 234  GLU C CB  1 
ATOM   9102  C  CG  . GLU C 1 245 ? 33.469  -2.792  -41.103  1.00 16.59 ? 234  GLU C CG  1 
ATOM   9103  C  CD  . GLU C 1 245 ? 34.761  -3.133  -41.796  1.00 19.95 ? 234  GLU C CD  1 
ATOM   9104  O  OE1 . GLU C 1 245 ? 34.998  -4.319  -42.097  1.00 24.10 ? 234  GLU C OE1 1 
ATOM   9105  O  OE2 . GLU C 1 245 ? 35.537  -2.201  -42.059  1.00 21.51 ? 234  GLU C OE2 1 
ATOM   9106  N  N   . ALA C 1 246 ? 32.847  -3.227  -44.927  1.00 11.87 ? 235  ALA C N   1 
ATOM   9107  C  CA  . ALA C 1 246 ? 33.871  -3.534  -45.862  1.00 9.47  ? 235  ALA C CA  1 
ATOM   9108  C  C   . ALA C 1 246 ? 33.658  -2.666  -47.094  1.00 8.51  ? 235  ALA C C   1 
ATOM   9109  O  O   . ALA C 1 246 ? 34.600  -2.304  -47.785  1.00 13.30 ? 235  ALA C O   1 
ATOM   9110  C  CB  . ALA C 1 246 ? 33.826  -5.034  -46.186  1.00 11.18 ? 235  ALA C CB  1 
ATOM   9111  N  N   . VAL C 1 247 ? 32.426  -2.279  -47.347  1.00 7.64  ? 236  VAL C N   1 
ATOM   9112  C  CA  . VAL C 1 247 ? 32.118  -1.258  -48.386  1.00 5.29  ? 236  VAL C CA  1 
ATOM   9113  C  C   . VAL C 1 247 ? 32.674  0.122   -48.007  1.00 4.83  ? 236  VAL C C   1 
ATOM   9114  O  O   . VAL C 1 247 ? 33.241  0.821   -48.802  1.00 2.66  ? 236  VAL C O   1 
ATOM   9115  C  CB  . VAL C 1 247 ? 30.574  -1.165  -48.671  1.00 4.29  ? 236  VAL C CB  1 
ATOM   9116  C  CG1 . VAL C 1 247 ? 30.317  -0.155  -49.747  1.00 7.24  ? 236  VAL C CG1 1 
ATOM   9117  C  CG2 . VAL C 1 247 ? 29.983  -2.539  -49.000  1.00 4.30  ? 236  VAL C CG2 1 
ATOM   9118  N  N   . ASN C 1 248 ? 32.598  0.497   -46.721  1.00 2.70  ? 237  ASN C N   1 
ATOM   9119  C  CA  . ASN C 1 248 ? 33.119  1.727   -46.248  1.00 2.67  ? 237  ASN C CA  1 
ATOM   9120  C  C   . ASN C 1 248 ? 34.653  1.794   -46.222  1.00 2.87  ? 237  ASN C C   1 
ATOM   9121  O  O   . ASN C 1 248 ? 35.193  2.854   -46.397  1.00 7.15  ? 237  ASN C O   1 
ATOM   9122  C  CB  . ASN C 1 248 ? 32.541  1.910   -44.805  1.00 3.51  ? 237  ASN C CB  1 
ATOM   9123  C  CG  . ASN C 1 248 ? 32.976  3.174   -44.147  1.00 4.35  ? 237  ASN C CG  1 
ATOM   9124  O  OD1 . ASN C 1 248 ? 33.908  3.164   -43.315  1.00 13.46 ? 237  ASN C OD1 1 
ATOM   9125  N  ND2 . ASN C 1 248 ? 32.323  4.287   -44.483  1.00 2.00  ? 237  ASN C ND2 1 
ATOM   9126  N  N   . ARG C 1 249 ? 35.340  0.667   -46.013  1.00 2.00  ? 238  ARG C N   1 
ATOM   9127  C  CA  . ARG C 1 249 ? 36.787  0.575   -46.058  1.00 2.11  ? 238  ARG C CA  1 
ATOM   9128  C  C   . ARG C 1 249 ? 37.173  0.673   -47.562  1.00 3.73  ? 238  ARG C C   1 
ATOM   9129  O  O   . ARG C 1 249 ? 37.962  1.523   -47.986  1.00 2.27  ? 238  ARG C O   1 
ATOM   9130  C  CB  . ARG C 1 249 ? 37.156  -0.782  -45.462  1.00 4.40  ? 238  ARG C CB  1 
ATOM   9131  C  CG  . ARG C 1 249 ? 38.633  -1.101  -45.378  1.00 6.17  ? 238  ARG C CG  1 
ATOM   9132  C  CD  . ARG C 1 249 ? 39.010  -1.626  -43.972  1.00 8.45  ? 238  ARG C CD  1 
ATOM   9133  N  NE  . ARG C 1 249 ? 38.073  -2.664  -43.585  1.00 14.16 ? 238  ARG C NE  1 
ATOM   9134  C  CZ  . ARG C 1 249 ? 38.052  -3.891  -44.109  1.00 18.02 ? 238  ARG C CZ  1 
ATOM   9135  N  NH1 . ARG C 1 249 ? 38.954  -4.270  -45.008  1.00 20.72 ? 238  ARG C NH1 1 
ATOM   9136  N  NH2 . ARG C 1 249 ? 37.122  -4.750  -43.734  1.00 19.74 ? 238  ARG C NH2 1 
ATOM   9137  N  N   . ALA C 1 250 ? 36.530  -0.150  -48.340  1.00 3.71  ? 239  ALA C N   1 
ATOM   9138  C  CA  . ALA C 1 250 ? 36.771  -0.084  -49.803  1.00 2.00  ? 239  ALA C CA  1 
ATOM   9139  C  C   . ALA C 1 250 ? 36.841  1.377   -50.163  1.00 2.00  ? 239  ALA C C   1 
ATOM   9140  O  O   . ALA C 1 250 ? 37.931  1.861   -50.450  1.00 2.00  ? 239  ALA C O   1 
ATOM   9141  C  CB  . ALA C 1 250 ? 35.723  -0.804  -50.485  1.00 2.00  ? 239  ALA C CB  1 
ATOM   9142  N  N   . ILE C 1 251 ? 35.693  2.082   -50.116  1.00 4.07  ? 240  ILE C N   1 
ATOM   9143  C  CA  . ILE C 1 251 ? 35.534  3.568   -50.363  1.00 4.09  ? 240  ILE C CA  1 
ATOM   9144  C  C   . ILE C 1 251 ? 36.592  4.527   -49.874  1.00 8.70  ? 240  ILE C C   1 
ATOM   9145  O  O   . ILE C 1 251 ? 37.163  5.295   -50.645  1.00 8.50  ? 240  ILE C O   1 
ATOM   9146  C  CB  . ILE C 1 251 ? 34.155  4.081   -49.947  1.00 3.45  ? 240  ILE C CB  1 
ATOM   9147  C  CG1 . ILE C 1 251 ? 33.086  3.407   -50.817  1.00 4.07  ? 240  ILE C CG1 1 
ATOM   9148  C  CG2 . ILE C 1 251 ? 34.090  5.591   -50.037  1.00 2.00  ? 240  ILE C CG2 1 
ATOM   9149  C  CD1 . ILE C 1 251 ? 31.618  3.719   -50.589  1.00 2.00  ? 240  ILE C CD1 1 
ATOM   9150  N  N   . THR C 1 252 ? 36.863  4.451   -48.596  1.00 6.02  ? 241  THR C N   1 
ATOM   9151  C  CA  . THR C 1 252 ? 37.926  5.144   -47.982  1.00 9.51  ? 241  THR C CA  1 
ATOM   9152  C  C   . THR C 1 252 ? 39.274  4.919   -48.647  1.00 10.48 ? 241  THR C C   1 
ATOM   9153  O  O   . THR C 1 252 ? 40.007  5.855   -48.758  1.00 13.34 ? 241  THR C O   1 
ATOM   9154  C  CB  . THR C 1 252 ? 38.064  4.629   -46.556  1.00 7.07  ? 241  THR C CB  1 
ATOM   9155  O  OG1 . THR C 1 252 ? 36.792  4.723   -45.925  1.00 7.71  ? 241  THR C OG1 1 
ATOM   9156  C  CG2 . THR C 1 252 ? 39.181  5.439   -45.748  1.00 5.97  ? 241  THR C CG2 1 
ATOM   9157  N  N   . ILE C 1 253 ? 39.616  3.669   -49.011  1.00 10.77 ? 242  ILE C N   1 
ATOM   9158  C  CA  . ILE C 1 253 ? 40.918  3.390   -49.597  1.00 10.36 ? 242  ILE C CA  1 
ATOM   9159  C  C   . ILE C 1 253 ? 40.867  3.898   -51.020  1.00 11.84 ? 242  ILE C C   1 
ATOM   9160  O  O   . ILE C 1 253 ? 41.852  4.377   -51.562  1.00 17.44 ? 242  ILE C O   1 
ATOM   9161  C  CB  . ILE C 1 253 ? 41.244  1.885   -49.635  1.00 10.62 ? 242  ILE C CB  1 
ATOM   9162  C  CG1 . ILE C 1 253 ? 41.457  1.338   -48.201  1.00 10.61 ? 242  ILE C CG1 1 
ATOM   9163  C  CG2 . ILE C 1 253 ? 42.486  1.628   -50.553  1.00 12.34 ? 242  ILE C CG2 1 
ATOM   9164  C  CD1 . ILE C 1 253 ? 41.206  -0.160  -48.059  1.00 11.76 ? 242  ILE C CD1 1 
ATOM   9165  N  N   . ALA C 1 254 ? 39.699  3.781   -51.615  1.00 9.96  ? 243  ALA C N   1 
ATOM   9166  C  CA  . ALA C 1 254 ? 39.433  4.337   -52.942  1.00 8.42  ? 243  ALA C CA  1 
ATOM   9167  C  C   . ALA C 1 254 ? 39.603  5.886   -52.978  1.00 10.44 ? 243  ALA C C   1 
ATOM   9168  O  O   . ALA C 1 254 ? 40.246  6.462   -53.862  1.00 12.13 ? 243  ALA C O   1 
ATOM   9169  C  CB  . ALA C 1 254 ? 38.045  3.952   -53.322  1.00 7.21  ? 243  ALA C CB  1 
ATOM   9170  N  N   . ASN C 1 255 ? 39.052  6.579   -51.998  1.00 10.71 ? 244  ASN C N   1 
ATOM   9171  C  CA  . ASN C 1 255 ? 39.219  7.994   -51.988  1.00 10.22 ? 244  ASN C CA  1 
ATOM   9172  C  C   . ASN C 1 255 ? 40.677  8.444   -51.793  1.00 10.78 ? 244  ASN C C   1 
ATOM   9173  O  O   . ASN C 1 255 ? 41.063  9.467   -52.351  1.00 10.84 ? 244  ASN C O   1 
ATOM   9174  C  CB  . ASN C 1 255 ? 38.270  8.653   -50.999  1.00 9.31  ? 244  ASN C CB  1 
ATOM   9175  C  CG  . ASN C 1 255 ? 36.886  8.830   -51.550  1.00 10.61 ? 244  ASN C CG  1 
ATOM   9176  O  OD1 . ASN C 1 255 ? 36.625  9.011   -52.818  1.00 2.00  ? 244  ASN C OD1 1 
ATOM   9177  N  ND2 . ASN C 1 255 ? 35.967  8.762   -50.665  1.00 2.00  ? 244  ASN C ND2 1 
ATOM   9178  N  N   . GLN C 1 256 ? 41.447  7.723   -50.972  1.00 10.46 ? 245  GLN C N   1 
ATOM   9179  C  CA  . GLN C 1 256 ? 42.862  8.004   -50.760  1.00 10.64 ? 245  GLN C CA  1 
ATOM   9180  C  C   . GLN C 1 256 ? 43.747  7.761   -51.987  1.00 11.03 ? 245  GLN C C   1 
ATOM   9181  O  O   . GLN C 1 256 ? 44.838  8.313   -52.097  1.00 12.99 ? 245  GLN C O   1 
ATOM   9182  C  CB  . GLN C 1 256 ? 43.416  7.209   -49.610  1.00 10.78 ? 245  GLN C CB  1 
ATOM   9183  C  CG  . GLN C 1 256 ? 43.047  7.758   -48.275  1.00 13.15 ? 245  GLN C CG  1 
ATOM   9184  C  CD  . GLN C 1 256 ? 43.564  9.158   -48.042  1.00 11.42 ? 245  GLN C CD  1 
ATOM   9185  O  OE1 . GLN C 1 256 ? 42.794  10.079  -48.029  1.00 14.57 ? 245  GLN C OE1 1 
ATOM   9186  N  NE2 . GLN C 1 256 ? 44.879  9.318   -47.850  1.00 17.51 ? 245  GLN C NE2 1 
ATOM   9187  N  N   . THR C 1 257 ? 43.243  6.997   -52.931  1.00 12.47 ? 246  THR C N   1 
ATOM   9188  C  CA  . THR C 1 257 ? 44.011  6.482   -54.031  1.00 9.97  ? 246  THR C CA  1 
ATOM   9189  C  C   . THR C 1 257 ? 43.477  7.000   -55.374  1.00 11.62 ? 246  THR C C   1 
ATOM   9190  O  O   . THR C 1 257 ? 44.097  6.774   -56.420  1.00 8.77  ? 246  THR C O   1 
ATOM   9191  C  CB  . THR C 1 257 ? 43.921  4.918   -53.935  1.00 11.28 ? 246  THR C CB  1 
ATOM   9192  O  OG1 . THR C 1 257 ? 45.185  4.309   -54.203  1.00 18.98 ? 246  THR C OG1 1 
ATOM   9193  C  CG2 . THR C 1 257 ? 42.806  4.310   -54.779  1.00 8.19  ? 246  THR C CG2 1 
ATOM   9194  N  N   . ASN C 1 258 ? 42.338  7.699   -55.337  1.00 11.90 ? 247  ASN C N   1 
ATOM   9195  C  CA  . ASN C 1 258 ? 41.752  8.344   -56.499  1.00 10.99 ? 247  ASN C CA  1 
ATOM   9196  C  C   . ASN C 1 258 ? 41.595  7.326   -57.583  1.00 10.76 ? 247  ASN C C   1 
ATOM   9197  O  O   . ASN C 1 258 ? 41.886  7.585   -58.743  1.00 12.04 ? 247  ASN C O   1 
ATOM   9198  C  CB  . ASN C 1 258 ? 42.600  9.534   -56.960  1.00 12.89 ? 247  ASN C CB  1 
ATOM   9199  C  CG  . ASN C 1 258 ? 41.940  10.332  -58.059  1.00 14.73 ? 247  ASN C CG  1 
ATOM   9200  O  OD1 . ASN C 1 258 ? 40.703  10.375  -58.147  1.00 18.90 ? 247  ASN C OD1 1 
ATOM   9201  N  ND2 . ASN C 1 258 ? 42.752  10.985  -58.905  1.00 20.45 ? 247  ASN C ND2 1 
ATOM   9202  N  N   . CYS C 1 259 ? 41.084  6.168   -57.180  1.00 11.05 ? 248  CYS C N   1 
ATOM   9203  C  CA  . CYS C 1 259 ? 40.753  5.085   -58.067  1.00 9.75  ? 248  CYS C CA  1 
ATOM   9204  C  C   . CYS C 1 259 ? 39.233  4.960   -58.208  1.00 8.17  ? 248  CYS C C   1 
ATOM   9205  O  O   . CYS C 1 259 ? 38.500  4.920   -57.219  1.00 2.43  ? 248  CYS C O   1 
ATOM   9206  C  CB  . CYS C 1 259 ? 41.432  3.789   -57.555  1.00 10.48 ? 248  CYS C CB  1 
ATOM   9207  S  SG  . CYS C 1 259 ? 41.047  2.289   -58.532  1.00 15.30 ? 248  CYS C SG  1 
ATOM   9208  N  N   . PRO C 1 260 ? 38.692  4.888   -59.450  1.00 2.00  ? 249  PRO C N   1 
ATOM   9209  C  CA  . PRO C 1 260 ? 37.283  4.634   -59.499  1.00 3.37  ? 249  PRO C CA  1 
ATOM   9210  C  C   . PRO C 1 260 ? 36.916  3.290   -58.819  1.00 7.45  ? 249  PRO C C   1 
ATOM   9211  O  O   . PRO C 1 260 ? 37.612  2.307   -59.019  1.00 9.53  ? 249  PRO C O   1 
ATOM   9212  C  CB  . PRO C 1 260 ? 36.980  4.578   -61.043  1.00 4.23  ? 249  PRO C CB  1 
ATOM   9213  C  CG  . PRO C 1 260 ? 38.190  4.776   -61.688  1.00 2.00  ? 249  PRO C CG  1 
ATOM   9214  C  CD  . PRO C 1 260 ? 39.313  4.930   -60.796  1.00 4.65  ? 249  PRO C CD  1 
ATOM   9215  N  N   . LEU C 1 261 ? 35.842  3.257   -58.012  1.00 9.16  ? 250  LEU C N   1 
ATOM   9216  C  CA  . LEU C 1 261 ? 35.419  2.064   -57.279  1.00 8.83  ? 250  LEU C CA  1 
ATOM   9217  C  C   . LEU C 1 261 ? 34.061  1.553   -57.774  1.00 9.18  ? 250  LEU C C   1 
ATOM   9218  O  O   . LEU C 1 261 ? 33.202  2.306   -58.135  1.00 9.05  ? 250  LEU C O   1 
ATOM   9219  C  CB  . LEU C 1 261 ? 35.388  2.350   -55.746  1.00 9.42  ? 250  LEU C CB  1 
ATOM   9220  C  CG  . LEU C 1 261 ? 35.230  1.149   -54.753  1.00 8.82  ? 250  LEU C CG  1 
ATOM   9221  C  CD1 . LEU C 1 261 ? 36.470  0.312   -54.585  1.00 2.00  ? 250  LEU C CD1 1 
ATOM   9222  C  CD2 . LEU C 1 261 ? 34.735  1.520   -53.331  1.00 7.22  ? 250  LEU C CD2 1 
ATOM   9223  N  N   . TYR C 1 262 ? 33.880  0.242   -57.728  1.00 10.29 ? 251  TYR C N   1 
ATOM   9224  C  CA  . TYR C 1 262 ? 32.663  -0.434  -58.136  1.00 11.61 ? 251  TYR C CA  1 
ATOM   9225  C  C   . TYR C 1 262 ? 32.350  -1.510  -57.108  1.00 11.79 ? 251  TYR C C   1 
ATOM   9226  O  O   . TYR C 1 262 ? 33.178  -2.387  -56.865  1.00 11.84 ? 251  TYR C O   1 
ATOM   9227  C  CB  . TYR C 1 262 ? 32.927  -1.074  -59.506  1.00 12.67 ? 251  TYR C CB  1 
ATOM   9228  C  CG  . TYR C 1 262 ? 31.767  -1.789  -60.156  1.00 12.31 ? 251  TYR C CG  1 
ATOM   9229  C  CD1 . TYR C 1 262 ? 31.501  -3.113  -59.840  1.00 15.51 ? 251  TYR C CD1 1 
ATOM   9230  C  CD2 . TYR C 1 262 ? 30.963  -1.164  -61.060  1.00 13.53 ? 251  TYR C CD2 1 
ATOM   9231  C  CE1 . TYR C 1 262 ? 30.503  -3.791  -60.400  1.00 14.05 ? 251  TYR C CE1 1 
ATOM   9232  C  CE2 . TYR C 1 262 ? 29.920  -1.846  -61.657  1.00 17.83 ? 251  TYR C CE2 1 
ATOM   9233  C  CZ  . TYR C 1 262 ? 29.707  -3.180  -61.324  1.00 15.05 ? 251  TYR C CZ  1 
ATOM   9234  O  OH  . TYR C 1 262 ? 28.706  -3.935  -61.869  1.00 12.14 ? 251  TYR C OH  1 
ATOM   9235  N  N   . ILE C 1 263 ? 31.168  -1.449  -56.506  1.00 12.60 ? 252  ILE C N   1 
ATOM   9236  C  CA  . ILE C 1 263 ? 30.814  -2.405  -55.433  1.00 13.25 ? 252  ILE C CA  1 
ATOM   9237  C  C   . ILE C 1 263 ? 29.922  -3.498  -56.019  1.00 13.67 ? 252  ILE C C   1 
ATOM   9238  O  O   . ILE C 1 263 ? 28.811  -3.205  -56.470  1.00 14.45 ? 252  ILE C O   1 
ATOM   9239  C  CB  . ILE C 1 263 ? 30.152  -1.716  -54.165  1.00 13.90 ? 252  ILE C CB  1 
ATOM   9240  C  CG1 . ILE C 1 263 ? 31.113  -0.694  -53.494  1.00 14.34 ? 252  ILE C CG1 1 
ATOM   9241  C  CG2 . ILE C 1 263 ? 29.653  -2.762  -53.138  1.00 7.56  ? 252  ILE C CG2 1 
ATOM   9242  C  CD1 . ILE C 1 263 ? 32.236  -1.250  -52.628  1.00 2.00  ? 252  ILE C CD1 1 
ATOM   9243  N  N   . THR C 1 264 ? 30.435  -4.740  -56.079  1.00 12.19 ? 253  THR C N   1 
ATOM   9244  C  CA  . THR C 1 264 ? 29.597  -5.882  -56.468  1.00 11.65 ? 253  THR C CA  1 
ATOM   9245  C  C   . THR C 1 264 ? 28.551  -6.301  -55.470  1.00 11.91 ? 253  THR C C   1 
ATOM   9246  O  O   . THR C 1 264 ? 28.711  -6.165  -54.206  1.00 11.16 ? 253  THR C O   1 
ATOM   9247  C  CB  . THR C 1 264 ? 30.399  -7.161  -56.821  1.00 12.71 ? 253  THR C CB  1 
ATOM   9248  O  OG1 . THR C 1 264 ? 31.083  -7.654  -55.655  1.00 10.06 ? 253  THR C OG1 1 
ATOM   9249  C  CG2 . THR C 1 264 ? 31.386  -6.935  -57.957  1.00 6.14  ? 253  THR C CG2 1 
ATOM   9250  N  N   . LYS C 1 265 ? 27.485  -6.876  -56.016  1.00 11.76 ? 254  LYS C N   1 
ATOM   9251  C  CA  . LYS C 1 265 ? 26.436  -7.522  -55.207  1.00 10.14 ? 254  LYS C CA  1 
ATOM   9252  C  C   . LYS C 1 265 ? 26.051  -6.678  -54.047  1.00 10.60 ? 254  LYS C C   1 
ATOM   9253  O  O   . LYS C 1 265 ? 26.257  -7.068  -52.852  1.00 4.16  ? 254  LYS C O   1 
ATOM   9254  C  CB  . LYS C 1 265 ? 26.918  -8.869  -54.677  1.00 11.99 ? 254  LYS C CB  1 
ATOM   9255  C  CG  . LYS C 1 265 ? 27.300  -9.910  -55.721  1.00 14.30 ? 254  LYS C CG  1 
ATOM   9256  C  CD  . LYS C 1 265 ? 28.278  -10.820 -55.089  1.00 10.80 ? 254  LYS C CD  1 
ATOM   9257  C  CE  . LYS C 1 265 ? 28.406  -12.061 -55.858  1.00 12.74 ? 254  LYS C CE  1 
ATOM   9258  N  NZ  . LYS C 1 265 ? 28.991  -13.112 -55.025  1.00 7.78  ? 254  LYS C NZ  1 
ATOM   9259  N  N   . VAL C 1 266 ? 25.479  -5.514  -54.337  1.00 8.06  ? 255  VAL C N   1 
ATOM   9260  C  CA  . VAL C 1 266 ? 24.885  -4.796  -53.215  1.00 9.65  ? 255  VAL C CA  1 
ATOM   9261  C  C   . VAL C 1 266 ? 23.572  -5.518  -52.768  1.00 9.76  ? 255  VAL C C   1 
ATOM   9262  O  O   . VAL C 1 266 ? 22.618  -5.657  -53.539  1.00 5.86  ? 255  VAL C O   1 
ATOM   9263  C  CB  . VAL C 1 266 ? 24.673  -3.365  -53.567  1.00 9.02  ? 255  VAL C CB  1 
ATOM   9264  C  CG1 . VAL C 1 266 ? 23.708  -2.739  -52.638  1.00 10.53 ? 255  VAL C CG1 1 
ATOM   9265  C  CG2 . VAL C 1 266 ? 26.014  -2.665  -53.585  1.00 11.53 ? 255  VAL C CG2 1 
ATOM   9266  N  N   . MET C 1 267 ? 23.532  -5.950  -51.494  1.00 8.97  ? 256  MET C N   1 
ATOM   9267  C  CA  . MET C 1 267 ? 22.467  -6.748  -50.957  1.00 9.17  ? 256  MET C CA  1 
ATOM   9268  C  C   . MET C 1 267 ? 21.702  -6.152  -49.820  1.00 9.70  ? 256  MET C C   1 
ATOM   9269  O  O   . MET C 1 267 ? 20.685  -6.712  -49.466  1.00 12.42 ? 256  MET C O   1 
ATOM   9270  C  CB  . MET C 1 267 ? 22.940  -8.071  -50.320  1.00 7.21  ? 256  MET C CB  1 
ATOM   9271  C  CG  . MET C 1 267 ? 23.839  -8.933  -51.005  1.00 2.22  ? 256  MET C CG  1 
ATOM   9272  S  SD  . MET C 1 267 ? 23.249  -9.342  -52.702  1.00 5.61  ? 256  MET C SD  1 
ATOM   9273  C  CE  . MET C 1 267 ? 21.807  -10.291 -52.413  1.00 2.00  ? 256  MET C CE  1 
ATOM   9274  N  N   . SER C 1 268 ? 22.174  -5.064  -49.232  1.00 8.40  ? 257  SER C N   1 
ATOM   9275  C  CA  . SER C 1 268 ? 21.533  -4.557  -48.040  1.00 9.69  ? 257  SER C CA  1 
ATOM   9276  C  C   . SER C 1 268 ? 21.339  -3.065  -48.041  1.00 10.56 ? 257  SER C C   1 
ATOM   9277  O  O   . SER C 1 268 ? 21.867  -2.369  -48.875  1.00 10.02 ? 257  SER C O   1 
ATOM   9278  C  CB  . SER C 1 268 ? 22.398  -4.964  -46.877  1.00 7.40  ? 257  SER C CB  1 
ATOM   9279  O  OG  . SER C 1 268 ? 23.692  -4.419  -47.003  1.00 9.54  ? 257  SER C OG  1 
ATOM   9280  N  N   . LYS C 1 269 ? 20.566  -2.583  -47.084  1.00 11.52 ? 258  LYS C N   1 
ATOM   9281  C  CA  . LYS C 1 269 ? 20.284  -1.175  -46.966  1.00 11.75 ? 258  LYS C CA  1 
ATOM   9282  C  C   . LYS C 1 269 ? 21.491  -0.424  -46.438  1.00 12.45 ? 258  LYS C C   1 
ATOM   9283  O  O   . LYS C 1 269 ? 21.812  0.623   -46.957  1.00 14.88 ? 258  LYS C O   1 
ATOM   9284  C  CB  . LYS C 1 269 ? 19.081  -0.983  -46.048  1.00 13.50 ? 258  LYS C CB  1 
ATOM   9285  C  CG  . LYS C 1 269 ? 17.791  -1.640  -46.521  1.00 11.57 ? 258  LYS C CG  1 
ATOM   9286  C  CD  . LYS C 1 269 ? 16.884  -1.880  -45.322  1.00 13.01 ? 258  LYS C CD  1 
ATOM   9287  C  CE  . LYS C 1 269 ? 15.992  -0.748  -45.030  1.00 14.94 ? 258  LYS C CE  1 
ATOM   9288  N  NZ  . LYS C 1 269 ? 15.100  -1.125  -43.855  1.00 19.28 ? 258  LYS C NZ  1 
ATOM   9289  N  N   . SER C 1 270 ? 22.107  -0.959  -45.370  1.00 13.36 ? 259  SER C N   1 
ATOM   9290  C  CA  . SER C 1 270 ? 23.449  -0.572  -44.834  1.00 13.15 ? 259  SER C CA  1 
ATOM   9291  C  C   . SER C 1 270 ? 24.493  -0.101  -45.798  1.00 13.97 ? 259  SER C C   1 
ATOM   9292  O  O   . SER C 1 270 ? 24.983  1.019   -45.665  1.00 12.89 ? 259  SER C O   1 
ATOM   9293  C  CB  . SER C 1 270 ? 24.092  -1.755  -44.097  1.00 14.82 ? 259  SER C CB  1 
ATOM   9294  O  OG  . SER C 1 270 ? 23.399  -2.002  -42.885  1.00 16.17 ? 259  SER C OG  1 
ATOM   9295  N  N   . SER C 1 271 ? 24.849  -1.005  -46.726  1.00 12.86 ? 260  SER C N   1 
ATOM   9296  C  CA  . SER C 1 271 ? 25.912  -0.807  -47.723  1.00 11.04 ? 260  SER C CA  1 
ATOM   9297  C  C   . SER C 1 271 ? 25.468  0.001   -48.905  1.00 10.29 ? 260  SER C C   1 
ATOM   9298  O  O   . SER C 1 271 ? 26.312  0.664   -49.513  1.00 11.78 ? 260  SER C O   1 
ATOM   9299  C  CB  . SER C 1 271 ? 26.454  -2.138  -48.220  1.00 8.91  ? 260  SER C CB  1 
ATOM   9300  O  OG  . SER C 1 271 ? 25.425  -2.971  -48.606  1.00 10.40 ? 260  SER C OG  1 
ATOM   9301  N  N   . ALA C 1 272 ? 24.183  -0.053  -49.227  1.00 6.06  ? 261  ALA C N   1 
ATOM   9302  C  CA  . ALA C 1 272 ? 23.580  0.878   -50.168  1.00 9.85  ? 261  ALA C CA  1 
ATOM   9303  C  C   . ALA C 1 272 ? 23.605  2.338   -49.657  1.00 10.58 ? 261  ALA C C   1 
ATOM   9304  O  O   . ALA C 1 272 ? 23.796  3.236   -50.432  1.00 12.13 ? 261  ALA C O   1 
ATOM   9305  C  CB  . ALA C 1 272 ? 22.153  0.419   -50.529  1.00 7.69  ? 261  ALA C CB  1 
ATOM   9306  N  N   . GLU C 1 273 ? 23.444  2.530   -48.337  1.00 9.89  ? 262  GLU C N   1 
ATOM   9307  C  CA  . GLU C 1 273 ? 23.463  3.831   -47.673  1.00 8.57  ? 262  GLU C CA  1 
ATOM   9308  C  C   . GLU C 1 273 ? 24.867  4.430   -47.542  1.00 5.88  ? 262  GLU C C   1 
ATOM   9309  O  O   . GLU C 1 273 ? 25.026  5.629   -47.634  1.00 8.51  ? 262  GLU C O   1 
ATOM   9310  C  CB  . GLU C 1 273 ? 22.830  3.669   -46.293  1.00 11.59 ? 262  GLU C CB  1 
ATOM   9311  C  CG  . GLU C 1 273 ? 22.734  4.951   -45.502  1.00 15.31 ? 262  GLU C CG  1 
ATOM   9312  C  CD  . GLU C 1 273 ? 21.642  5.903   -45.988  1.00 25.61 ? 262  GLU C CD  1 
ATOM   9313  O  OE1 . GLU C 1 273 ? 20.569  5.423   -46.459  1.00 31.84 ? 262  GLU C OE1 1 
ATOM   9314  O  OE2 . GLU C 1 273 ? 21.857  7.143   -45.863  1.00 29.39 ? 262  GLU C OE2 1 
ATOM   9315  N  N   . VAL C 1 274 ? 25.877  3.587   -47.365  1.00 4.09  ? 263  VAL C N   1 
ATOM   9316  C  CA  . VAL C 1 274 ? 27.251  3.959   -47.410  1.00 3.10  ? 263  VAL C CA  1 
ATOM   9317  C  C   . VAL C 1 274 ? 27.537  4.424   -48.845  1.00 5.47  ? 263  VAL C C   1 
ATOM   9318  O  O   . VAL C 1 274 ? 28.085  5.506   -49.126  1.00 6.21  ? 263  VAL C O   1 
ATOM   9319  C  CB  . VAL C 1 274 ? 28.112  2.736   -47.083  1.00 5.81  ? 263  VAL C CB  1 
ATOM   9320  C  CG1 . VAL C 1 274 ? 29.633  2.953   -47.325  1.00 2.00  ? 263  VAL C CG1 1 
ATOM   9321  C  CG2 . VAL C 1 274 ? 27.943  2.425   -45.573  1.00 2.00  ? 263  VAL C CG2 1 
ATOM   9322  N  N   . ILE C 1 275 ? 27.139  3.589   -49.743  1.00 3.45  ? 264  ILE C N   1 
ATOM   9323  C  CA  . ILE C 1 275 ? 27.453  3.951   -51.177  1.00 4.60  ? 264  ILE C CA  1 
ATOM   9324  C  C   . ILE C 1 275 ? 26.885  5.328   -51.447  1.00 6.46  ? 264  ILE C C   1 
ATOM   9325  O  O   . ILE C 1 275 ? 27.644  6.249   -51.717  1.00 10.95 ? 264  ILE C O   1 
ATOM   9326  C  CB  . ILE C 1 275 ? 26.970  2.938   -52.095  1.00 6.15  ? 264  ILE C CB  1 
ATOM   9327  C  CG1 . ILE C 1 275 ? 27.735  1.610   -51.845  1.00 7.21  ? 264  ILE C CG1 1 
ATOM   9328  C  CG2 . ILE C 1 275 ? 27.191  3.483   -53.546  1.00 2.00  ? 264  ILE C CG2 1 
ATOM   9329  C  CD1 . ILE C 1 275 ? 27.087  0.378   -52.457  1.00 3.28  ? 264  ILE C CD1 1 
ATOM   9330  N  N   . ALA C 1 276 ? 25.557  5.477   -51.382  1.00 9.35  ? 265  ALA C N   1 
ATOM   9331  C  CA  . ALA C 1 276 ? 24.888  6.797   -51.450  1.00 11.21 ? 265  ALA C CA  1 
ATOM   9332  C  C   . ALA C 1 276 ? 25.542  7.936   -50.631  1.00 12.85 ? 265  ALA C C   1 
ATOM   9333  O  O   . ALA C 1 276 ? 25.746  9.005   -51.137  1.00 11.75 ? 265  ALA C O   1 
ATOM   9334  C  CB  . ALA C 1 276 ? 23.424  6.664   -51.067  1.00 12.21 ? 265  ALA C CB  1 
ATOM   9335  N  N   . GLN C 1 277 ? 25.862  7.753   -49.359  1.00 15.88 ? 266  GLN C N   1 
ATOM   9336  C  CA  . GLN C 1 277 ? 26.516  8.859   -48.671  1.00 15.59 ? 266  GLN C CA  1 
ATOM   9337  C  C   . GLN C 1 277 ? 27.827  9.238   -49.426  1.00 17.70 ? 266  GLN C C   1 
ATOM   9338  O  O   . GLN C 1 277 ? 28.069  10.413  -49.772  1.00 17.61 ? 266  GLN C O   1 
ATOM   9339  C  CB  . GLN C 1 277 ? 26.744  8.510   -47.194  1.00 18.46 ? 266  GLN C CB  1 
ATOM   9340  C  CG  . GLN C 1 277 ? 25.448  8.274   -46.392  1.00 19.69 ? 266  GLN C CG  1 
ATOM   9341  C  CD  . GLN C 1 277 ? 24.546  9.484   -46.290  1.00 25.43 ? 266  GLN C CD  1 
ATOM   9342  O  OE1 . GLN C 1 277 ? 25.017  10.630  -46.358  1.00 28.50 ? 266  GLN C OE1 1 
ATOM   9343  N  NE2 . GLN C 1 277 ? 23.223  9.247   -46.135  1.00 28.08 ? 266  GLN C NE2 1 
ATOM   9344  N  N   . ALA C 1 278 ? 28.631  8.231   -49.761  1.00 16.07 ? 267  ALA C N   1 
ATOM   9345  C  CA  . ALA C 1 278 ? 29.930  8.476   -50.359  1.00 14.70 ? 267  ALA C CA  1 
ATOM   9346  C  C   . ALA C 1 278 ? 29.831  9.220   -51.700  1.00 13.25 ? 267  ALA C C   1 
ATOM   9347  O  O   . ALA C 1 278 ? 30.687  10.054  -52.006  1.00 15.42 ? 267  ALA C O   1 
ATOM   9348  C  CB  . ALA C 1 278 ? 30.732  7.138   -50.516  1.00 12.20 ? 267  ALA C CB  1 
ATOM   9349  N  N   . ARG C 1 279 ? 28.799  8.960   -52.484  1.00 13.86 ? 268  ARG C N   1 
ATOM   9350  C  CA  . ARG C 1 279 ? 28.695  9.617   -53.803  1.00 14.76 ? 268  ARG C CA  1 
ATOM   9351  C  C   . ARG C 1 279 ? 28.421  11.101  -53.577  1.00 15.38 ? 268  ARG C C   1 
ATOM   9352  O  O   . ARG C 1 279 ? 28.842  11.917  -54.361  1.00 10.35 ? 268  ARG C O   1 
ATOM   9353  C  CB  . ARG C 1 279 ? 27.580  9.019   -54.648  1.00 14.87 ? 268  ARG C CB  1 
ATOM   9354  C  CG  . ARG C 1 279 ? 27.788  7.585   -55.030  1.00 14.13 ? 268  ARG C CG  1 
ATOM   9355  C  CD  . ARG C 1 279 ? 26.630  7.074   -55.854  1.00 17.94 ? 268  ARG C CD  1 
ATOM   9356  N  NE  . ARG C 1 279 ? 26.385  7.904   -57.044  1.00 17.22 ? 268  ARG C NE  1 
ATOM   9357  C  CZ  . ARG C 1 279 ? 25.474  8.886   -57.130  1.00 20.23 ? 268  ARG C CZ  1 
ATOM   9358  N  NH1 . ARG C 1 279 ? 24.691  9.209   -56.096  1.00 18.64 ? 268  ARG C NH1 1 
ATOM   9359  N  NH2 . ARG C 1 279 ? 25.356  9.572   -58.268  1.00 20.31 ? 268  ARG C NH2 1 
ATOM   9360  N  N   . LYS C 1 280 ? 27.774  11.439  -52.444  1.00 14.07 ? 269  LYS C N   1 
ATOM   9361  C  CA  . LYS C 1 280 ? 27.354  12.826  -52.131  1.00 14.25 ? 269  LYS C CA  1 
ATOM   9362  C  C   . LYS C 1 280 ? 28.501  13.691  -51.606  1.00 14.20 ? 269  LYS C C   1 
ATOM   9363  O  O   . LYS C 1 280 ? 28.449  14.920  -51.692  1.00 14.71 ? 269  LYS C O   1 
ATOM   9364  C  CB  . LYS C 1 280 ? 26.117  12.830  -51.191  1.00 14.68 ? 269  LYS C CB  1 
ATOM   9365  C  CG  . LYS C 1 280 ? 25.684  14.193  -50.599  1.00 14.76 ? 269  LYS C CG  1 
ATOM   9366  C  CD  . LYS C 1 280 ? 24.483  14.026  -49.661  1.00 17.11 ? 269  LYS C CD  1 
ATOM   9367  C  CE  . LYS C 1 280 ? 24.617  14.887  -48.372  1.00 19.20 ? 269  LYS C CE  1 
ATOM   9368  N  NZ  . LYS C 1 280 ? 25.899  14.584  -47.662  1.00 19.45 ? 269  LYS C NZ  1 
ATOM   9369  N  N   . LYS C 1 281 ? 29.524  13.030  -51.061  1.00 13.69 ? 270  LYS C N   1 
ATOM   9370  C  CA  . LYS C 1 281 ? 30.799  13.631  -50.734  1.00 10.54 ? 270  LYS C CA  1 
ATOM   9371  C  C   . LYS C 1 281 ? 31.730  13.710  -51.912  1.00 11.21 ? 270  LYS C C   1 
ATOM   9372  O  O   . LYS C 1 281 ? 32.810  14.267  -51.788  1.00 13.66 ? 270  LYS C O   1 
ATOM   9373  C  CB  . LYS C 1 281 ? 31.516  12.820  -49.686  1.00 8.38  ? 270  LYS C CB  1 
ATOM   9374  C  CG  . LYS C 1 281 ? 30.836  12.974  -48.310  1.00 5.11  ? 270  LYS C CG  1 
ATOM   9375  C  CD  . LYS C 1 281 ? 31.766  12.670  -47.176  1.00 11.74 ? 270  LYS C CD  1 
ATOM   9376  C  CE  . LYS C 1 281 ? 31.104  13.057  -45.868  1.00 9.00  ? 270  LYS C CE  1 
ATOM   9377  N  NZ  . LYS C 1 281 ? 31.958  12.798  -44.608  1.00 14.70 ? 270  LYS C NZ  1 
ATOM   9378  N  N   . GLY C 1 282 ? 31.331  13.142  -53.032  1.00 10.47 ? 271  GLY C N   1 
ATOM   9379  C  CA  . GLY C 1 282 ? 32.157  13.161  -54.226  1.00 9.66  ? 271  GLY C CA  1 
ATOM   9380  C  C   . GLY C 1 282 ? 32.903  11.876  -54.615  1.00 9.64  ? 271  GLY C C   1 
ATOM   9381  O  O   . GLY C 1 282 ? 33.815  11.945  -55.428  1.00 9.94  ? 271  GLY C O   1 
ATOM   9382  N  N   . THR C 1 283 ? 32.545  10.713  -54.093  1.00 9.70  ? 272  THR C N   1 
ATOM   9383  C  CA  . THR C 1 283 ? 33.293  9.490   -54.367  1.00 9.64  ? 272  THR C CA  1 
ATOM   9384  C  C   . THR C 1 283 ? 32.950  9.009   -55.788  1.00 11.09 ? 272  THR C C   1 
ATOM   9385  O  O   . THR C 1 283 ? 31.787  8.972   -56.148  1.00 11.26 ? 272  THR C O   1 
ATOM   9386  C  CB  . THR C 1 283 ? 33.017  8.459   -53.270  1.00 11.55 ? 272  THR C CB  1 
ATOM   9387  O  OG1 . THR C 1 283 ? 33.432  9.023   -51.984  1.00 8.78  ? 272  THR C OG1 1 
ATOM   9388  C  CG2 . THR C 1 283 ? 33.761  7.104   -53.515  1.00 9.48  ? 272  THR C CG2 1 
ATOM   9389  N  N   . VAL C 1 284 ? 33.950  8.730   -56.609  1.00 13.16 ? 273  VAL C N   1 
ATOM   9390  C  CA  . VAL C 1 284 ? 33.687  8.090   -57.912  1.00 13.56 ? 273  VAL C CA  1 
ATOM   9391  C  C   . VAL C 1 284 ? 33.423  6.591   -57.656  1.00 16.80 ? 273  VAL C C   1 
ATOM   9392  O  O   . VAL C 1 284 ? 34.343  5.757   -57.738  1.00 20.81 ? 273  VAL C O   1 
ATOM   9393  C  CB  . VAL C 1 284 ? 34.813  8.305   -58.951  1.00 12.94 ? 273  VAL C CB  1 
ATOM   9394  C  CG1 . VAL C 1 284 ? 34.389  7.692   -60.292  1.00 11.97 ? 273  VAL C CG1 1 
ATOM   9395  C  CG2 . VAL C 1 284 ? 35.138  9.818   -59.129  1.00 6.21  ? 273  VAL C CG2 1 
ATOM   9396  N  N   . VAL C 1 285 ? 32.163  6.268   -57.331  1.00 16.56 ? 274  VAL C N   1 
ATOM   9397  C  CA  . VAL C 1 285 ? 31.774  4.932   -56.853  1.00 15.84 ? 274  VAL C CA  1 
ATOM   9398  C  C   . VAL C 1 285 ? 30.414  4.522   -57.395  1.00 15.96 ? 274  VAL C C   1 
ATOM   9399  O  O   . VAL C 1 285 ? 29.473  5.330   -57.478  1.00 15.92 ? 274  VAL C O   1 
ATOM   9400  C  CB  . VAL C 1 285 ? 31.782  4.804   -55.266  1.00 16.11 ? 274  VAL C CB  1 
ATOM   9401  C  CG1 . VAL C 1 285 ? 30.779  5.759   -54.615  1.00 16.89 ? 274  VAL C CG1 1 
ATOM   9402  C  CG2 . VAL C 1 285 ? 31.517  3.349   -54.829  1.00 15.18 ? 274  VAL C CG2 1 
ATOM   9403  N  N   . TYR C 1 286 ? 30.350  3.266   -57.823  1.00 15.82 ? 275  TYR C N   1 
ATOM   9404  C  CA  . TYR C 1 286 ? 29.151  2.677   -58.359  1.00 15.09 ? 275  TYR C CA  1 
ATOM   9405  C  C   . TYR C 1 286 ? 28.765  1.497   -57.471  1.00 14.16 ? 275  TYR C C   1 
ATOM   9406  O  O   . TYR C 1 286 ? 29.634  0.838   -56.864  1.00 13.61 ? 275  TYR C O   1 
ATOM   9407  C  CB  . TYR C 1 286 ? 29.375  2.240   -59.822  1.00 16.93 ? 275  TYR C CB  1 
ATOM   9408  C  CG  . TYR C 1 286 ? 29.887  3.349   -60.635  1.00 18.93 ? 275  TYR C CG  1 
ATOM   9409  C  CD1 . TYR C 1 286 ? 29.027  4.144   -61.372  1.00 21.88 ? 275  TYR C CD1 1 
ATOM   9410  C  CD2 . TYR C 1 286 ? 31.231  3.676   -60.624  1.00 21.91 ? 275  TYR C CD2 1 
ATOM   9411  C  CE1 . TYR C 1 286 ? 29.504  5.236   -62.067  1.00 22.93 ? 275  TYR C CE1 1 
ATOM   9412  C  CE2 . TYR C 1 286 ? 31.709  4.753   -61.319  1.00 21.75 ? 275  TYR C CE2 1 
ATOM   9413  C  CZ  . TYR C 1 286 ? 30.852  5.515   -62.048  1.00 21.68 ? 275  TYR C CZ  1 
ATOM   9414  O  OH  . TYR C 1 286 ? 31.344  6.575   -62.775  1.00 26.02 ? 275  TYR C OH  1 
ATOM   9415  N  N   . GLY C 1 287 ? 27.450  1.287   -57.350  1.00 12.97 ? 276  GLY C N   1 
ATOM   9416  C  CA  . GLY C 1 287 ? 26.890  0.127   -56.694  1.00 12.05 ? 276  GLY C CA  1 
ATOM   9417  C  C   . GLY C 1 287 ? 26.116  -0.737  -57.669  1.00 12.64 ? 276  GLY C C   1 
ATOM   9418  O  O   . GLY C 1 287 ? 25.392  -0.238  -58.541  1.00 9.99  ? 276  GLY C O   1 
ATOM   9419  N  N   . GLU C 1 288 ? 26.282  -2.041  -57.503  1.00 13.36 ? 277  GLU C N   1 
ATOM   9420  C  CA  . GLU C 1 288 ? 25.598  -3.059  -58.276  1.00 12.81 ? 277  GLU C CA  1 
ATOM   9421  C  C   . GLU C 1 288 ? 24.719  -3.956  -57.399  1.00 11.46 ? 277  GLU C C   1 
ATOM   9422  O  O   . GLU C 1 288 ? 25.164  -5.026  -56.965  1.00 5.82  ? 277  GLU C O   1 
ATOM   9423  C  CB  . GLU C 1 288 ? 26.624  -3.961  -58.935  1.00 14.31 ? 277  GLU C CB  1 
ATOM   9424  C  CG  . GLU C 1 288 ? 26.066  -5.249  -59.559  1.00 13.85 ? 277  GLU C CG  1 
ATOM   9425  C  CD  . GLU C 1 288 ? 27.145  -6.291  -59.695  1.00 14.70 ? 277  GLU C CD  1 
ATOM   9426  O  OE1 . GLU C 1 288 ? 27.256  -7.193  -58.833  1.00 11.33 ? 277  GLU C OE1 1 
ATOM   9427  O  OE2 . GLU C 1 288 ? 27.943  -6.144  -60.622  1.00 12.75 ? 277  GLU C OE2 1 
ATOM   9428  N  N   . PRO C 1 289 ? 23.461  -3.552  -57.202  1.00 11.19 ? 278  PRO C N   1 
ATOM   9429  C  CA  . PRO C 1 289 ? 22.535  -4.516  -56.708  1.00 14.06 ? 278  PRO C CA  1 
ATOM   9430  C  C   . PRO C 1 289 ? 22.293  -5.517  -57.803  1.00 12.31 ? 278  PRO C C   1 
ATOM   9431  O  O   . PRO C 1 289 ? 22.537  -5.258  -58.993  1.00 17.16 ? 278  PRO C O   1 
ATOM   9432  C  CB  . PRO C 1 289 ? 21.283  -3.673  -56.390  1.00 12.90 ? 278  PRO C CB  1 
ATOM   9433  C  CG  . PRO C 1 289 ? 21.358  -2.576  -57.359  1.00 13.54 ? 278  PRO C CG  1 
ATOM   9434  C  CD  . PRO C 1 289 ? 22.814  -2.253  -57.445  1.00 12.10 ? 278  PRO C CD  1 
ATOM   9435  N  N   . ILE C 1 290 ? 21.801  -6.662  -57.377  1.00 14.22 ? 279  ILE C N   1 
ATOM   9436  C  CA  . ILE C 1 290 ? 21.416  -7.719  -58.278  1.00 9.98  ? 279  ILE C CA  1 
ATOM   9437  C  C   . ILE C 1 290 ? 19.961  -8.168  -58.084  1.00 11.72 ? 279  ILE C C   1 
ATOM   9438  O  O   . ILE C 1 290 ? 19.340  -7.858  -57.081  1.00 11.52 ? 279  ILE C O   1 
ATOM   9439  C  CB  . ILE C 1 290 ? 22.396  -8.836  -58.147  1.00 9.38  ? 279  ILE C CB  1 
ATOM   9440  C  CG1 . ILE C 1 290 ? 22.346  -9.491  -56.746  1.00 2.00  ? 279  ILE C CG1 1 
ATOM   9441  C  CG2 . ILE C 1 290 ? 23.786  -8.291  -58.331  1.00 5.99  ? 279  ILE C CG2 1 
ATOM   9442  C  CD1 . ILE C 1 290 ? 22.737  -10.940 -56.748  1.00 2.00  ? 279  ILE C CD1 1 
ATOM   9443  N  N   . THR C 1 291 ? 19.463  -8.947  -59.042  1.00 13.55 ? 280  THR C N   1 
ATOM   9444  C  CA  . THR C 1 291 ? 18.115  -9.604  -58.991  1.00 12.68 ? 280  THR C CA  1 
ATOM   9445  C  C   . THR C 1 291 ? 17.763  -10.210 -57.611  1.00 14.20 ? 280  THR C C   1 
ATOM   9446  O  O   . THR C 1 291 ? 16.745  -9.892  -56.989  1.00 13.65 ? 280  THR C O   1 
ATOM   9447  C  CB  . THR C 1 291 ? 17.956  -10.671 -60.137  1.00 14.04 ? 280  THR C CB  1 
ATOM   9448  O  OG1 . THR C 1 291 ? 18.659  -10.251 -61.318  1.00 9.17  ? 280  THR C OG1 1 
ATOM   9449  C  CG2 . THR C 1 291 ? 16.511  -10.814 -60.531  1.00 12.36 ? 280  THR C CG2 1 
ATOM   9450  N  N   . ALA C 1 292 ? 18.645  -11.025 -57.102  1.00 12.49 ? 281  ALA C N   1 
ATOM   9451  C  CA  . ALA C 1 292 ? 18.468  -11.524 -55.777  1.00 12.08 ? 281  ALA C CA  1 
ATOM   9452  C  C   . ALA C 1 292 ? 18.093  -10.391 -54.788  1.00 11.67 ? 281  ALA C C   1 
ATOM   9453  O  O   . ALA C 1 292 ? 16.979  -10.359 -54.294  1.00 10.35 ? 281  ALA C O   1 
ATOM   9454  C  CB  . ALA C 1 292 ? 19.699  -12.242 -55.384  1.00 11.87 ? 281  ALA C CB  1 
ATOM   9455  N  N   . SER C 1 293 ? 18.993  -9.424  -54.594  1.00 12.36 ? 282  SER C N   1 
ATOM   9456  C  CA  . SER C 1 293 ? 18.777  -8.290  -53.698  1.00 10.67 ? 282  SER C CA  1 
ATOM   9457  C  C   . SER C 1 293 ? 17.502  -7.471  -53.940  1.00 10.38 ? 282  SER C C   1 
ATOM   9458  O  O   . SER C 1 293 ? 16.840  -7.078  -52.990  1.00 4.46  ? 282  SER C O   1 
ATOM   9459  C  CB  . SER C 1 293 ? 20.020  -7.418  -53.579  1.00 9.96  ? 282  SER C CB  1 
ATOM   9460  O  OG  . SER C 1 293 ? 20.452  -6.824  -54.761  1.00 14.41 ? 282  SER C OG  1 
ATOM   9461  N  N   . LEU C 1 294 ? 17.128  -7.262  -55.202  1.00 5.26  ? 283  LEU C N   1 
ATOM   9462  C  CA  . LEU C 1 294 ? 16.044  -6.401  -55.538  1.00 10.92 ? 283  LEU C CA  1 
ATOM   9463  C  C   . LEU C 1 294 ? 14.704  -7.076  -55.576  1.00 11.07 ? 283  LEU C C   1 
ATOM   9464  O  O   . LEU C 1 294 ? 13.704  -6.411  -55.788  1.00 11.99 ? 283  LEU C O   1 
ATOM   9465  C  CB  . LEU C 1 294 ? 16.286  -5.800  -56.941  1.00 9.71  ? 283  LEU C CB  1 
ATOM   9466  C  CG  . LEU C 1 294 ? 17.510  -4.888  -57.162  1.00 12.81 ? 283  LEU C CG  1 
ATOM   9467  C  CD1 . LEU C 1 294 ? 18.071  -4.984  -58.628  1.00 10.06 ? 283  LEU C CD1 1 
ATOM   9468  C  CD2 . LEU C 1 294 ? 17.196  -3.451  -56.865  1.00 15.77 ? 283  LEU C CD2 1 
ATOM   9469  N  N   . GLY C 1 295 ? 14.672  -8.394  -55.436  1.00 12.85 ? 284  GLY C N   1 
ATOM   9470  C  CA  . GLY C 1 295 ? 13.447  -9.157  -55.719  1.00 13.51 ? 284  GLY C CA  1 
ATOM   9471  C  C   . GLY C 1 295 ? 12.838  -9.988  -54.632  1.00 13.92 ? 284  GLY C C   1 
ATOM   9472  O  O   . GLY C 1 295 ? 11.619  -10.116 -54.576  1.00 12.74 ? 284  GLY C O   1 
ATOM   9473  N  N   . THR C 1 296 ? 13.695  -10.584 -53.795  1.00 15.02 ? 285  THR C N   1 
ATOM   9474  C  CA  . THR C 1 296 ? 13.262  -11.319 -52.606  1.00 15.56 ? 285  THR C CA  1 
ATOM   9475  C  C   . THR C 1 296 ? 14.147  -10.955 -51.414  1.00 15.21 ? 285  THR C C   1 
ATOM   9476  O  O   . THR C 1 296 ? 14.864  -9.973  -51.470  1.00 17.77 ? 285  THR C O   1 
ATOM   9477  C  CB  . THR C 1 296 ? 13.243  -12.849 -52.881  1.00 15.52 ? 285  THR C CB  1 
ATOM   9478  O  OG1 . THR C 1 296 ? 12.553  -13.516 -51.820  1.00 18.67 ? 285  THR C OG1 1 
ATOM   9479  C  CG2 . THR C 1 296 ? 14.630  -13.407 -53.027  1.00 15.45 ? 285  THR C CG2 1 
ATOM   9480  N  N   . ASP C 1 297 ? 14.061  -11.726 -50.334  1.00 17.16 ? 286  ASP C N   1 
ATOM   9481  C  CA  . ASP C 1 297 ? 14.866  -11.536 -49.097  1.00 15.43 ? 286  ASP C CA  1 
ATOM   9482  C  C   . ASP C 1 297 ? 15.348  -12.876 -48.536  1.00 14.91 ? 286  ASP C C   1 
ATOM   9483  O  O   . ASP C 1 297 ? 15.050  -13.915 -49.075  1.00 15.36 ? 286  ASP C O   1 
ATOM   9484  C  CB  . ASP C 1 297 ? 14.046  -10.812 -48.030  1.00 16.30 ? 286  ASP C CB  1 
ATOM   9485  C  CG  . ASP C 1 297 ? 12.810  -11.565 -47.653  1.00 14.44 ? 286  ASP C CG  1 
ATOM   9486  O  OD1 . ASP C 1 297 ? 12.937  -12.652 -47.080  1.00 18.45 ? 286  ASP C OD1 1 
ATOM   9487  O  OD2 . ASP C 1 297 ? 11.698  -11.062 -47.917  1.00 17.79 ? 286  ASP C OD2 1 
ATOM   9488  N  N   . GLY C 1 298 ? 16.056  -12.866 -47.410  1.00 14.68 ? 287  GLY C N   1 
ATOM   9489  C  CA  . GLY C 1 298 ? 16.566  -14.118 -46.848  1.00 14.24 ? 287  GLY C CA  1 
ATOM   9490  C  C   . GLY C 1 298 ? 15.787  -14.653 -45.651  1.00 15.63 ? 287  GLY C C   1 
ATOM   9491  O  O   . GLY C 1 298 ? 16.343  -15.381 -44.830  1.00 13.60 ? 287  GLY C O   1 
ATOM   9492  N  N   . SER C 1 299 ? 14.490  -14.311 -45.572  1.00 15.01 ? 288  SER C N   1 
ATOM   9493  C  CA  . SER C 1 299 ? 13.526  -15.059 -44.782  1.00 13.92 ? 288  SER C CA  1 
ATOM   9494  C  C   . SER C 1 299 ? 13.662  -16.567 -45.079  1.00 14.23 ? 288  SER C C   1 
ATOM   9495  O  O   . SER C 1 299 ? 13.608  -17.413 -44.201  1.00 11.30 ? 288  SER C O   1 
ATOM   9496  C  CB  . SER C 1 299 ? 12.084  -14.572 -45.062  1.00 11.79 ? 288  SER C CB  1 
ATOM   9497  O  OG  . SER C 1 299 ? 11.812  -14.506 -46.454  1.00 18.57 ? 288  SER C OG  1 
ATOM   9498  N  N   . HIS C 1 300 ? 13.896  -16.868 -46.352  1.00 14.22 ? 289  HIS C N   1 
ATOM   9499  C  CA  . HIS C 1 300 ? 13.948  -18.196 -46.870  1.00 14.27 ? 289  HIS C CA  1 
ATOM   9500  C  C   . HIS C 1 300 ? 15.155  -19.013 -46.496  1.00 16.35 ? 289  HIS C C   1 
ATOM   9501  O  O   . HIS C 1 300 ? 15.279  -20.125 -46.980  1.00 17.43 ? 289  HIS C O   1 
ATOM   9502  C  CB  . HIS C 1 300 ? 13.873  -18.050 -48.380  1.00 14.41 ? 289  HIS C CB  1 
ATOM   9503  C  CG  . HIS C 1 300 ? 12.707  -17.225 -48.809  1.00 12.09 ? 289  HIS C CG  1 
ATOM   9504  N  ND1 . HIS C 1 300 ? 11.406  -17.592 -48.536  1.00 15.05 ? 289  HIS C ND1 1 
ATOM   9505  C  CD2 . HIS C 1 300 ? 12.638  -16.057 -49.476  1.00 11.49 ? 289  HIS C CD2 1 
ATOM   9506  C  CE1 . HIS C 1 300 ? 10.586  -16.681 -49.026  1.00 11.37 ? 289  HIS C CE1 1 
ATOM   9507  N  NE2 . HIS C 1 300 ? 11.312  -15.740 -49.597  1.00 15.73 ? 289  HIS C NE2 1 
ATOM   9508  N  N   . TYR C 1 301 ? 16.018  -18.491 -45.620  1.00 16.43 ? 290  TYR C N   1 
ATOM   9509  C  CA  . TYR C 1 301 ? 17.128  -19.233 -45.056  1.00 15.38 ? 290  TYR C CA  1 
ATOM   9510  C  C   . TYR C 1 301 ? 16.702  -20.160 -43.908  1.00 15.97 ? 290  TYR C C   1 
ATOM   9511  O  O   . TYR C 1 301 ? 17.272  -21.246 -43.761  1.00 10.83 ? 290  TYR C O   1 
ATOM   9512  C  CB  . TYR C 1 301 ? 18.234  -18.297 -44.565  1.00 16.65 ? 290  TYR C CB  1 
ATOM   9513  C  CG  . TYR C 1 301 ? 19.071  -17.686 -45.655  1.00 14.20 ? 290  TYR C CG  1 
ATOM   9514  C  CD1 . TYR C 1 301 ? 19.873  -18.471 -46.453  1.00 18.13 ? 290  TYR C CD1 1 
ATOM   9515  C  CD2 . TYR C 1 301 ? 19.104  -16.303 -45.840  1.00 14.47 ? 290  TYR C CD2 1 
ATOM   9516  C  CE1 . TYR C 1 301 ? 20.657  -17.893 -47.472  1.00 17.65 ? 290  TYR C CE1 1 
ATOM   9517  C  CE2 . TYR C 1 301 ? 19.872  -15.713 -46.855  1.00 14.73 ? 290  TYR C CE2 1 
ATOM   9518  C  CZ  . TYR C 1 301 ? 20.649  -16.503 -47.645  1.00 16.99 ? 290  TYR C CZ  1 
ATOM   9519  O  OH  . TYR C 1 301 ? 21.416  -15.916 -48.626  1.00 16.83 ? 290  TYR C OH  1 
ATOM   9520  N  N   . TRP C 1 302 ? 15.702  -19.715 -43.129  1.00 14.88 ? 291  TRP C N   1 
ATOM   9521  C  CA  . TRP C 1 302 ? 15.052  -20.535 -42.130  1.00 15.98 ? 291  TRP C CA  1 
ATOM   9522  C  C   . TRP C 1 302 ? 13.911  -21.425 -42.637  1.00 16.30 ? 291  TRP C C   1 
ATOM   9523  O  O   . TRP C 1 302 ? 13.091  -21.900 -41.855  1.00 15.58 ? 291  TRP C O   1 
ATOM   9524  C  CB  . TRP C 1 302 ? 14.556  -19.636 -40.975  1.00 15.62 ? 291  TRP C CB  1 
ATOM   9525  C  CG  . TRP C 1 302 ? 15.648  -18.965 -40.237  1.00 14.71 ? 291  TRP C CG  1 
ATOM   9526  C  CD1 . TRP C 1 302 ? 16.210  -19.374 -39.046  1.00 15.75 ? 291  TRP C CD1 1 
ATOM   9527  C  CD2 . TRP C 1 302 ? 16.300  -17.733 -40.580  1.00 17.07 ? 291  TRP C CD2 1 
ATOM   9528  N  NE1 . TRP C 1 302 ? 17.189  -18.502 -38.675  1.00 14.41 ? 291  TRP C NE1 1 
ATOM   9529  C  CE2 . TRP C 1 302 ? 17.256  -17.477 -39.588  1.00 16.87 ? 291  TRP C CE2 1 
ATOM   9530  C  CE3 . TRP C 1 302 ? 16.168  -16.812 -41.641  1.00 19.46 ? 291  TRP C CE3 1 
ATOM   9531  C  CZ2 . TRP C 1 302 ? 18.086  -16.324 -39.624  1.00 16.64 ? 291  TRP C CZ2 1 
ATOM   9532  C  CZ3 . TRP C 1 302 ? 16.975  -15.663 -41.657  1.00 17.15 ? 291  TRP C CZ3 1 
ATOM   9533  C  CH2 . TRP C 1 302 ? 17.928  -15.445 -40.673  1.00 15.89 ? 291  TRP C CH2 1 
ATOM   9534  N  N   . SER C 1 303 ? 13.870  -21.705 -43.934  1.00 16.01 ? 292  SER C N   1 
ATOM   9535  C  CA  . SER C 1 303 ? 12.916  -22.652 -44.454  1.00 15.36 ? 292  SER C CA  1 
ATOM   9536  C  C   . SER C 1 303 ? 13.164  -24.037 -43.935  1.00 15.20 ? 292  SER C C   1 
ATOM   9537  O  O   . SER C 1 303 ? 14.309  -24.438 -43.706  1.00 16.90 ? 292  SER C O   1 
ATOM   9538  C  CB  . SER C 1 303 ? 12.982  -22.729 -45.973  1.00 15.08 ? 292  SER C CB  1 
ATOM   9539  O  OG  . SER C 1 303 ? 11.993  -23.649 -46.390  1.00 16.50 ? 292  SER C OG  1 
ATOM   9540  N  N   . LYS C 1 304 ? 12.068  -24.768 -43.776  1.00 15.07 ? 293  LYS C N   1 
ATOM   9541  C  CA  . LYS C 1 304 ? 12.060  -26.158 -43.305  1.00 14.10 ? 293  LYS C CA  1 
ATOM   9542  C  C   . LYS C 1 304 ? 12.441  -27.122 -44.384  1.00 14.28 ? 293  LYS C C   1 
ATOM   9543  O  O   . LYS C 1 304 ? 12.738  -28.286 -44.128  1.00 16.23 ? 293  LYS C O   1 
ATOM   9544  C  CB  . LYS C 1 304 ? 10.666  -26.520 -42.826  1.00 16.99 ? 293  LYS C CB  1 
ATOM   9545  C  CG  . LYS C 1 304 ? 10.420  -26.210 -41.312  1.00 16.15 ? 293  LYS C CG  1 
ATOM   9546  C  CD  . LYS C 1 304 ? 11.477  -26.838 -40.456  1.00 20.71 ? 293  LYS C CD  1 
ATOM   9547  C  CE  . LYS C 1 304 ? 10.947  -27.195 -39.104  1.00 20.48 ? 293  LYS C CE  1 
ATOM   9548  N  NZ  . LYS C 1 304 ? 10.146  -26.086 -38.629  1.00 22.39 ? 293  LYS C NZ  1 
ATOM   9549  N  N   . ASN C 1 305 ? 12.371  -26.633 -45.609  1.00 9.36  ? 294  ASN C N   1 
ATOM   9550  C  CA  . ASN C 1 305 ? 12.911  -27.329 -46.760  1.00 9.99  ? 294  ASN C CA  1 
ATOM   9551  C  C   . ASN C 1 305 ? 14.417  -26.996 -46.983  1.00 11.60 ? 294  ASN C C   1 
ATOM   9552  O  O   . ASN C 1 305 ? 14.763  -25.997 -47.644  1.00 13.44 ? 294  ASN C O   1 
ATOM   9553  C  CB  . ASN C 1 305 ? 12.061  -26.893 -47.921  1.00 5.74  ? 294  ASN C CB  1 
ATOM   9554  C  CG  . ASN C 1 305 ? 12.468  -27.553 -49.234  1.00 6.28  ? 294  ASN C CG  1 
ATOM   9555  O  OD1 . ASN C 1 305 ? 13.404  -28.327 -49.285  1.00 8.23  ? 294  ASN C OD1 1 
ATOM   9556  N  ND2 . ASN C 1 305 ? 11.731  -27.269 -50.265  1.00 10.57 ? 294  ASN C ND2 1 
ATOM   9557  N  N   . TRP C 1 306 ? 15.307  -27.845 -46.445  1.00 11.08 ? 295  TRP C N   1 
ATOM   9558  C  CA  . TRP C 1 306 ? 16.759  -27.625 -46.513  1.00 9.97  ? 295  TRP C CA  1 
ATOM   9559  C  C   . TRP C 1 306 ? 17.138  -27.215 -47.928  1.00 10.96 ? 295  TRP C C   1 
ATOM   9560  O  O   . TRP C 1 306 ? 17.885  -26.264 -48.116  1.00 12.13 ? 295  TRP C O   1 
ATOM   9561  C  CB  . TRP C 1 306 ? 17.550  -28.876 -46.088  1.00 9.20  ? 295  TRP C CB  1 
ATOM   9562  C  CG  . TRP C 1 306 ? 19.032  -28.608 -46.046  1.00 7.22  ? 295  TRP C CG  1 
ATOM   9563  C  CD1 . TRP C 1 306 ? 19.819  -28.273 -44.941  1.00 5.28  ? 295  TRP C CD1 1 
ATOM   9564  C  CD2 . TRP C 1 306 ? 19.889  -28.561 -47.176  1.00 2.56  ? 295  TRP C CD2 1 
ATOM   9565  N  NE1 . TRP C 1 306 ? 21.114  -28.029 -45.353  1.00 6.78  ? 295  TRP C NE1 1 
ATOM   9566  C  CE2 . TRP C 1 306 ? 21.165  -28.191 -46.734  1.00 2.94  ? 295  TRP C CE2 1 
ATOM   9567  C  CE3 . TRP C 1 306 ? 19.678  -28.750 -48.550  1.00 6.15  ? 295  TRP C CE3 1 
ATOM   9568  C  CZ2 . TRP C 1 306 ? 22.230  -28.052 -47.610  1.00 2.49  ? 295  TRP C CZ2 1 
ATOM   9569  C  CZ3 . TRP C 1 306 ? 20.720  -28.598 -49.401  1.00 5.03  ? 295  TRP C CZ3 1 
ATOM   9570  C  CH2 . TRP C 1 306 ? 21.985  -28.246 -48.942  1.00 4.73  ? 295  TRP C CH2 1 
ATOM   9571  N  N   . ALA C 1 307 ? 16.652  -27.951 -48.928  1.00 12.39 ? 296  ALA C N   1 
ATOM   9572  C  CA  . ALA C 1 307 ? 17.027  -27.657 -50.345  1.00 11.64 ? 296  ALA C CA  1 
ATOM   9573  C  C   . ALA C 1 307 ? 16.646  -26.260 -50.820  1.00 13.01 ? 296  ALA C C   1 
ATOM   9574  O  O   . ALA C 1 307 ? 17.412  -25.633 -51.591  1.00 12.44 ? 296  ALA C O   1 
ATOM   9575  C  CB  . ALA C 1 307 ? 16.476  -28.726 -51.294  1.00 10.85 ? 296  ALA C CB  1 
ATOM   9576  N  N   . LYS C 1 308 ? 15.451  -25.780 -50.440  1.00 10.85 ? 297  LYS C N   1 
ATOM   9577  C  CA  . LYS C 1 308 ? 15.101  -24.396 -50.737  1.00 11.93 ? 297  LYS C CA  1 
ATOM   9578  C  C   . LYS C 1 308 ? 16.012  -23.428 -49.989  1.00 13.11 ? 297  LYS C C   1 
ATOM   9579  O  O   . LYS C 1 308 ? 16.561  -22.534 -50.585  1.00 15.15 ? 297  LYS C O   1 
ATOM   9580  C  CB  . LYS C 1 308 ? 13.632  -24.110 -50.408  1.00 11.58 ? 297  LYS C CB  1 
ATOM   9581  C  CG  . LYS C 1 308 ? 13.209  -22.663 -50.490  1.00 10.29 ? 297  LYS C CG  1 
ATOM   9582  C  CD  . LYS C 1 308 ? 11.721  -22.501 -50.142  1.00 14.55 ? 297  LYS C CD  1 
ATOM   9583  C  CE  . LYS C 1 308 ? 11.272  -21.032 -50.125  1.00 15.13 ? 297  LYS C CE  1 
ATOM   9584  N  NZ  . LYS C 1 308 ? 9.766   -20.896 -50.199  1.00 16.77 ? 297  LYS C NZ  1 
ATOM   9585  N  N   . ALA C 1 309 ? 16.181  -23.591 -48.665  1.00 13.04 ? 298  ALA C N   1 
ATOM   9586  C  CA  . ALA C 1 309 ? 17.044  -22.696 -47.931  1.00 11.41 ? 298  ALA C CA  1 
ATOM   9587  C  C   . ALA C 1 309 ? 18.510  -22.617 -48.450  1.00 13.05 ? 298  ALA C C   1 
ATOM   9588  O  O   . ALA C 1 309 ? 19.154  -21.571 -48.263  1.00 12.60 ? 298  ALA C O   1 
ATOM   9589  C  CB  . ALA C 1 309 ? 16.992  -23.022 -46.390  1.00 9.61  ? 298  ALA C CB  1 
ATOM   9590  N  N   . ALA C 1 310 ? 18.999  -23.662 -49.168  1.00 13.34 ? 299  ALA C N   1 
ATOM   9591  C  CA  . ALA C 1 310 ? 20.363  -23.676 -49.762  1.00 12.43 ? 299  ALA C CA  1 
ATOM   9592  C  C   . ALA C 1 310 ? 20.359  -23.133 -51.192  1.00 13.62 ? 299  ALA C C   1 
ATOM   9593  O  O   . ALA C 1 310 ? 21.397  -22.724 -51.710  1.00 15.37 ? 299  ALA C O   1 
ATOM   9594  C  CB  . ALA C 1 310 ? 20.980  -25.088 -49.716  1.00 12.53 ? 299  ALA C CB  1 
ATOM   9595  N  N   . ALA C 1 311 ? 19.185  -23.089 -51.804  1.00 12.08 ? 300  ALA C N   1 
ATOM   9596  C  CA  . ALA C 1 311 ? 18.999  -22.382 -53.074  1.00 11.68 ? 300  ALA C CA  1 
ATOM   9597  C  C   . ALA C 1 311 ? 19.381  -20.888 -52.991  1.00 11.55 ? 300  ALA C C   1 
ATOM   9598  O  O   . ALA C 1 311 ? 19.844  -20.270 -53.966  1.00 6.08  ? 300  ALA C O   1 
ATOM   9599  C  CB  . ALA C 1 311 ? 17.560  -22.539 -53.509  1.00 13.38 ? 300  ALA C CB  1 
ATOM   9600  N  N   . PHE C 1 312 ? 19.250  -20.346 -51.778  1.00 9.49  ? 301  PHE C N   1 
ATOM   9601  C  CA  . PHE C 1 312 ? 19.465  -18.936 -51.426  1.00 11.29 ? 301  PHE C CA  1 
ATOM   9602  C  C   . PHE C 1 312 ? 20.883  -18.672 -50.891  1.00 11.34 ? 301  PHE C C   1 
ATOM   9603  O  O   . PHE C 1 312 ? 21.253  -17.510 -50.713  1.00 13.40 ? 301  PHE C O   1 
ATOM   9604  C  CB  . PHE C 1 312 ? 18.396  -18.490 -50.360  1.00 10.13 ? 301  PHE C CB  1 
ATOM   9605  C  CG  . PHE C 1 312 ? 16.965  -18.448 -50.900  1.00 11.26 ? 301  PHE C CG  1 
ATOM   9606  C  CD1 . PHE C 1 312 ? 16.285  -19.604 -51.187  1.00 10.54 ? 301  PHE C CD1 1 
ATOM   9607  C  CD2 . PHE C 1 312 ? 16.328  -17.244 -51.169  1.00 12.34 ? 301  PHE C CD2 1 
ATOM   9608  C  CE1 . PHE C 1 312 ? 15.016  -19.583 -51.662  1.00 10.75 ? 301  PHE C CE1 1 
ATOM   9609  C  CE2 . PHE C 1 312 ? 15.068  -17.207 -51.703  1.00 15.39 ? 301  PHE C CE2 1 
ATOM   9610  C  CZ  . PHE C 1 312 ? 14.399  -18.372 -51.947  1.00 15.41 ? 301  PHE C CZ  1 
ATOM   9611  N  N   . VAL C 1 313 ? 21.683  -19.712 -50.659  1.00 9.87  ? 302  VAL C N   1 
ATOM   9612  C  CA  . VAL C 1 313 ? 23.070  -19.538 -50.205  1.00 12.59 ? 302  VAL C CA  1 
ATOM   9613  C  C   . VAL C 1 313 ? 23.917  -18.942 -51.316  1.00 13.81 ? 302  VAL C C   1 
ATOM   9614  O  O   . VAL C 1 313 ? 24.038  -19.512 -52.439  1.00 14.27 ? 302  VAL C O   1 
ATOM   9615  C  CB  . VAL C 1 313 ? 23.688  -20.819 -49.538  1.00 14.79 ? 302  VAL C CB  1 
ATOM   9616  C  CG1 . VAL C 1 313 ? 25.148  -20.639 -49.152  1.00 12.90 ? 302  VAL C CG1 1 
ATOM   9617  C  CG2 . VAL C 1 313 ? 22.925  -21.130 -48.261  1.00 13.10 ? 302  VAL C CG2 1 
ATOM   9618  N  N   . THR C 1 314 ? 24.374  -17.710 -51.016  1.00 13.64 ? 303  THR C N   1 
ATOM   9619  C  CA  . THR C 1 314 ? 25.244  -16.882 -51.850  1.00 12.68 ? 303  THR C CA  1 
ATOM   9620  C  C   . THR C 1 314 ? 25.905  -15.871 -50.961  1.00 12.61 ? 303  THR C C   1 
ATOM   9621  O  O   . THR C 1 314 ? 25.414  -15.637 -49.819  1.00 10.85 ? 303  THR C O   1 
ATOM   9622  C  CB  . THR C 1 314 ? 24.472  -16.180 -52.942  1.00 12.94 ? 303  THR C CB  1 
ATOM   9623  O  OG1 . THR C 1 314 ? 25.397  -15.659 -53.905  1.00 14.48 ? 303  THR C OG1 1 
ATOM   9624  C  CG2 . THR C 1 314 ? 23.612  -15.055 -52.380  1.00 15.66 ? 303  THR C CG2 1 
ATOM   9625  N  N   . SER C 1 315 ? 27.026  -15.306 -51.432  1.00 10.67 ? 304  SER C N   1 
ATOM   9626  C  CA  . SER C 1 315 ? 27.776  -14.258 -50.710  1.00 10.62 ? 304  SER C CA  1 
ATOM   9627  C  C   . SER C 1 315 ? 28.012  -12.949 -51.509  1.00 8.31  ? 304  SER C C   1 
ATOM   9628  O  O   . SER C 1 315 ? 28.482  -12.971 -52.695  1.00 8.50  ? 304  SER C O   1 
ATOM   9629  C  CB  . SER C 1 315 ? 29.081  -14.849 -50.299  1.00 9.73  ? 304  SER C CB  1 
ATOM   9630  O  OG  . SER C 1 315 ? 28.804  -15.826 -49.327  1.00 15.71 ? 304  SER C OG  1 
ATOM   9631  N  N   . PRO C 1 316 ? 27.684  -11.802 -50.914  1.00 4.53  ? 305  PRO C N   1 
ATOM   9632  C  CA  . PRO C 1 316 ? 27.001  -11.680 -49.560  1.00 2.75  ? 305  PRO C CA  1 
ATOM   9633  C  C   . PRO C 1 316 ? 25.617  -12.317 -49.629  1.00 3.29  ? 305  PRO C C   1 
ATOM   9634  O  O   . PRO C 1 316 ? 25.021  -12.440 -50.770  1.00 2.20  ? 305  PRO C O   1 
ATOM   9635  C  CB  . PRO C 1 316 ? 26.883  -10.179 -49.388  1.00 2.00  ? 305  PRO C CB  1 
ATOM   9636  C  CG  . PRO C 1 316 ? 27.964  -9.614  -50.192  1.00 4.06  ? 305  PRO C CG  1 
ATOM   9637  C  CD  . PRO C 1 316 ? 28.006  -10.482 -51.443  1.00 3.86  ? 305  PRO C CD  1 
ATOM   9638  N  N   . PRO C 1 317 ? 25.014  -12.659 -48.471  1.00 2.00  ? 306  PRO C N   1 
ATOM   9639  C  CA  . PRO C 1 317 ? 23.645  -13.186 -48.395  1.00 3.36  ? 306  PRO C CA  1 
ATOM   9640  C  C   . PRO C 1 317 ? 22.537  -12.189 -48.670  1.00 4.12  ? 306  PRO C C   1 
ATOM   9641  O  O   . PRO C 1 317 ? 22.707  -10.960 -48.458  1.00 2.00  ? 306  PRO C O   1 
ATOM   9642  C  CB  . PRO C 1 317 ? 23.535  -13.679 -46.902  1.00 2.00  ? 306  PRO C CB  1 
ATOM   9643  C  CG  . PRO C 1 317 ? 24.488  -12.836 -46.228  1.00 2.00  ? 306  PRO C CG  1 
ATOM   9644  C  CD  . PRO C 1 317 ? 25.628  -12.552 -47.146  1.00 2.00  ? 306  PRO C CD  1 
ATOM   9645  N  N   . LEU C 1 318 ? 21.422  -12.722 -49.218  1.00 7.38  ? 307  LEU C N   1 
ATOM   9646  C  CA  . LEU C 1 318 ? 20.077  -12.107 -49.184  1.00 6.45  ? 307  LEU C CA  1 
ATOM   9647  C  C   . LEU C 1 318 ? 19.709  -11.621 -47.796  1.00 10.07 ? 307  LEU C C   1 
ATOM   9648  O  O   . LEU C 1 318 ? 19.578  -12.472 -46.915  1.00 6.56  ? 307  LEU C O   1 
ATOM   9649  C  CB  . LEU C 1 318 ? 18.993  -13.101 -49.521  1.00 6.81  ? 307  LEU C CB  1 
ATOM   9650  C  CG  . LEU C 1 318 ? 18.493  -13.184 -51.018  1.00 6.07  ? 307  LEU C CG  1 
ATOM   9651  C  CD1 . LEU C 1 318 ? 17.964  -11.891 -51.521  1.00 13.36 ? 307  LEU C CD1 1 
ATOM   9652  C  CD2 . LEU C 1 318 ? 19.625  -13.672 -51.886  1.00 13.63 ? 307  LEU C CD2 1 
ATOM   9653  N  N   . SER C 1 319 ? 19.407  -10.319 -47.644  1.00 9.31  ? 308  SER C N   1 
ATOM   9654  C  CA  . SER C 1 319 ? 19.095  -9.783  -46.289  1.00 11.97 ? 308  SER C CA  1 
ATOM   9655  C  C   . SER C 1 319 ? 17.824  -10.418 -45.714  1.00 12.58 ? 308  SER C C   1 
ATOM   9656  O  O   . SER C 1 319 ? 16.800  -10.489 -46.379  1.00 16.73 ? 308  SER C O   1 
ATOM   9657  C  CB  . SER C 1 319 ? 18.925  -8.236  -46.329  1.00 12.46 ? 308  SER C CB  1 
ATOM   9658  O  OG  . SER C 1 319 ? 18.474  -7.748  -45.051  1.00 12.40 ? 308  SER C OG  1 
ATOM   9659  N  N   . PRO C 1 320 ? 17.847  -10.844 -44.452  1.00 13.30 ? 309  PRO C N   1 
ATOM   9660  C  CA  . PRO C 1 320 ? 16.562  -11.243 -43.885  1.00 13.30 ? 309  PRO C CA  1 
ATOM   9661  C  C   . PRO C 1 320 ? 15.527  -10.134 -43.693  1.00 13.50 ? 309  PRO C C   1 
ATOM   9662  O  O   . PRO C 1 320 ? 14.359  -10.430 -43.430  1.00 14.79 ? 309  PRO C O   1 
ATOM   9663  C  CB  . PRO C 1 320 ? 16.956  -11.821 -42.518  1.00 11.09 ? 309  PRO C CB  1 
ATOM   9664  C  CG  . PRO C 1 320 ? 18.390  -12.192 -42.683  1.00 14.30 ? 309  PRO C CG  1 
ATOM   9665  C  CD  . PRO C 1 320 ? 18.948  -11.071 -43.513  1.00 13.31 ? 309  PRO C CD  1 
ATOM   9666  N  N   . ASP C 1 321 ? 15.928  -8.869  -43.806  1.00 14.74 ? 310  ASP C N   1 
ATOM   9667  C  CA  . ASP C 1 321 ? 14.971  -7.764  -43.706  1.00 14.74 ? 310  ASP C CA  1 
ATOM   9668  C  C   . ASP C 1 321 ? 14.082  -7.688  -44.967  1.00 14.97 ? 310  ASP C C   1 
ATOM   9669  O  O   . ASP C 1 321 ? 14.567  -7.375  -46.077  1.00 17.49 ? 310  ASP C O   1 
ATOM   9670  C  CB  . ASP C 1 321 ? 15.716  -6.443  -43.455  1.00 15.29 ? 310  ASP C CB  1 
ATOM   9671  C  CG  . ASP C 1 321 ? 14.810  -5.264  -43.492  1.00 14.86 ? 310  ASP C CG  1 
ATOM   9672  O  OD1 . ASP C 1 321 ? 13.594  -5.472  -43.370  1.00 21.63 ? 310  ASP C OD1 1 
ATOM   9673  O  OD2 . ASP C 1 321 ? 15.297  -4.124  -43.666  1.00 20.07 ? 310  ASP C OD2 1 
ATOM   9674  N  N   . PRO C 1 322 ? 12.764  -7.938  -44.816  1.00 14.37 ? 311  PRO C N   1 
ATOM   9675  C  CA  . PRO C 1 322 ? 11.958  -7.985  -46.055  1.00 13.49 ? 311  PRO C CA  1 
ATOM   9676  C  C   . PRO C 1 322 ? 11.726  -6.642  -46.760  1.00 15.65 ? 311  PRO C C   1 
ATOM   9677  O  O   . PRO C 1 322 ? 11.158  -6.612  -47.849  1.00 15.96 ? 311  PRO C O   1 
ATOM   9678  C  CB  . PRO C 1 322 ? 10.606  -8.523  -45.599  1.00 13.58 ? 311  PRO C CB  1 
ATOM   9679  C  CG  . PRO C 1 322 ? 10.640  -8.510  -44.031  1.00 13.53 ? 311  PRO C CG  1 
ATOM   9680  C  CD  . PRO C 1 322 ? 11.987  -8.153  -43.588  1.00 11.32 ? 311  PRO C CD  1 
ATOM   9681  N  N   . THR C 1 323 ? 12.109  -5.537  -46.130  1.00 16.04 ? 312  THR C N   1 
ATOM   9682  C  CA  . THR C 1 323 ? 11.929  -4.201  -46.728  1.00 14.21 ? 312  THR C CA  1 
ATOM   9683  C  C   . THR C 1 323 ? 13.174  -3.796  -47.502  1.00 12.28 ? 312  THR C C   1 
ATOM   9684  O  O   . THR C 1 323 ? 13.340  -2.640  -47.853  1.00 12.72 ? 312  THR C O   1 
ATOM   9685  C  CB  . THR C 1 323 ? 11.749  -3.175  -45.612  1.00 16.20 ? 312  THR C CB  1 
ATOM   9686  O  OG1 . THR C 1 323 ? 13.035  -2.916  -45.034  1.00 16.60 ? 312  THR C OG1 1 
ATOM   9687  C  CG2 . THR C 1 323 ? 10.791  -3.711  -44.560  1.00 14.66 ? 312  THR C CG2 1 
ATOM   9688  N  N   . THR C 1 324 ? 14.084  -4.749  -47.679  1.00 9.93  ? 313  THR C N   1 
ATOM   9689  C  CA  . THR C 1 324 ? 15.385  -4.494  -48.259  1.00 9.85  ? 313  THR C CA  1 
ATOM   9690  C  C   . THR C 1 324 ? 15.215  -4.289  -49.776  1.00 8.88  ? 313  THR C C   1 
ATOM   9691  O  O   . THR C 1 324 ? 15.840  -3.460  -50.391  1.00 11.60 ? 313  THR C O   1 
ATOM   9692  C  CB  . THR C 1 324 ? 16.329  -5.697  -48.039  1.00 9.10  ? 313  THR C CB  1 
ATOM   9693  O  OG1 . THR C 1 324 ? 16.784  -5.765  -46.674  1.00 6.68  ? 313  THR C OG1 1 
ATOM   9694  C  CG2 . THR C 1 324 ? 17.507  -5.592  -48.891  1.00 4.06  ? 313  THR C CG2 1 
ATOM   9695  N  N   . PRO C 1 325 ? 14.383  -5.063  -50.386  1.00 9.57  ? 314  PRO C N   1 
ATOM   9696  C  CA  . PRO C 1 325 ? 14.300  -4.814  -51.886  1.00 9.09  ? 314  PRO C CA  1 
ATOM   9697  C  C   . PRO C 1 325 ? 13.605  -3.532  -52.401  1.00 10.36 ? 314  PRO C C   1 
ATOM   9698  O  O   . PRO C 1 325 ? 13.887  -3.048  -53.534  1.00 11.00 ? 314  PRO C O   1 
ATOM   9699  C  CB  . PRO C 1 325 ? 13.493  -5.999  -52.371  1.00 8.62  ? 314  PRO C CB  1 
ATOM   9700  C  CG  . PRO C 1 325 ? 13.391  -6.943  -51.277  1.00 10.52 ? 314  PRO C CG  1 
ATOM   9701  C  CD  . PRO C 1 325 ? 13.608  -6.230  -49.973  1.00 8.24  ? 314  PRO C CD  1 
ATOM   9702  N  N   . ASP C 1 326 ? 12.588  -3.085  -51.684  1.00 12.65 ? 315  ASP C N   1 
ATOM   9703  C  CA  . ASP C 1 326 ? 11.968  -1.776  -51.894  1.00 11.20 ? 315  ASP C CA  1 
ATOM   9704  C  C   . ASP C 1 326 ? 12.964  -0.644  -51.792  1.00 10.36 ? 315  ASP C C   1 
ATOM   9705  O  O   . ASP C 1 326 ? 12.966  0.261   -52.633  1.00 8.24  ? 315  ASP C O   1 
ATOM   9706  C  CB  . ASP C 1 326 ? 10.917  -1.525  -50.799  1.00 14.07 ? 315  ASP C CB  1 
ATOM   9707  C  CG  . ASP C 1 326 ? 9.626   -2.278  -51.017  1.00 20.41 ? 315  ASP C CG  1 
ATOM   9708  O  OD1 . ASP C 1 326 ? 9.315   -2.706  -52.167  1.00 25.65 ? 315  ASP C OD1 1 
ATOM   9709  O  OD2 . ASP C 1 326 ? 8.894   -2.422  -50.025  1.00 21.02 ? 315  ASP C OD2 1 
ATOM   9710  N  N   . PHE C 1 327 ? 13.751  -0.629  -50.709  1.00 8.38  ? 316  PHE C N   1 
ATOM   9711  C  CA  . PHE C 1 327 ? 14.874  0.317   -50.546  1.00 9.31  ? 316  PHE C CA  1 
ATOM   9712  C  C   . PHE C 1 327 ? 15.847  0.377   -51.725  1.00 9.80  ? 316  PHE C C   1 
ATOM   9713  O  O   . PHE C 1 327 ? 16.230  1.485   -52.174  1.00 8.33  ? 316  PHE C O   1 
ATOM   9714  C  CB  . PHE C 1 327 ? 15.693  -0.017  -49.303  1.00 9.96  ? 316  PHE C CB  1 
ATOM   9715  C  CG  . PHE C 1 327 ? 16.682  1.065   -48.900  1.00 10.48 ? 316  PHE C CG  1 
ATOM   9716  C  CD1 . PHE C 1 327 ? 16.247  2.273   -48.398  1.00 12.28 ? 316  PHE C CD1 1 
ATOM   9717  C  CD2 . PHE C 1 327 ? 18.062  0.849   -48.991  1.00 7.20  ? 316  PHE C CD2 1 
ATOM   9718  C  CE1 . PHE C 1 327 ? 17.145  3.272   -48.034  1.00 9.07  ? 316  PHE C CE1 1 
ATOM   9719  C  CE2 . PHE C 1 327 ? 18.943  1.821   -48.628  1.00 10.28 ? 316  PHE C CE2 1 
ATOM   9720  C  CZ  . PHE C 1 327 ? 18.484  3.046   -48.136  1.00 9.93  ? 316  PHE C CZ  1 
ATOM   9721  N  N   . LEU C 1 328 ? 16.280  -0.792  -52.178  1.00 7.67  ? 317  LEU C N   1 
ATOM   9722  C  CA  . LEU C 1 328 ? 17.354  -0.851  -53.194  1.00 9.21  ? 317  LEU C CA  1 
ATOM   9723  C  C   . LEU C 1 328 ? 16.783  -0.454  -54.527  1.00 9.98  ? 317  LEU C C   1 
ATOM   9724  O  O   . LEU C 1 328 ? 17.488  0.164   -55.355  1.00 11.97 ? 317  LEU C O   1 
ATOM   9725  C  CB  . LEU C 1 328 ? 18.035  -2.238  -53.276  1.00 9.55  ? 317  LEU C CB  1 
ATOM   9726  C  CG  . LEU C 1 328 ? 18.686  -2.816  -52.005  1.00 10.74 ? 317  LEU C CG  1 
ATOM   9727  C  CD1 . LEU C 1 328 ? 19.352  -4.210  -52.239  1.00 2.00  ? 317  LEU C CD1 1 
ATOM   9728  C  CD2 . LEU C 1 328 ? 19.665  -1.787  -51.432  1.00 6.85  ? 317  LEU C CD2 1 
ATOM   9729  N  N   . ASN C 1 329 ? 15.515  -0.777  -54.737  1.00 9.87  ? 318  ASN C N   1 
ATOM   9730  C  CA  . ASN C 1 329 ? 14.800  -0.267  -55.937  1.00 10.64 ? 318  ASN C CA  1 
ATOM   9731  C  C   . ASN C 1 329 ? 14.551  1.247   -55.858  1.00 10.39 ? 318  ASN C C   1 
ATOM   9732  O  O   . ASN C 1 329 ? 14.477  1.904   -56.853  1.00 3.79  ? 318  ASN C O   1 
ATOM   9733  C  CB  . ASN C 1 329 ? 13.481  -1.003  -56.194  1.00 11.81 ? 318  ASN C CB  1 
ATOM   9734  C  CG  . ASN C 1 329 ? 13.667  -2.353  -56.817  1.00 12.67 ? 318  ASN C CG  1 
ATOM   9735  O  OD1 . ASN C 1 329 ? 13.850  -2.503  -58.044  1.00 4.94  ? 318  ASN C OD1 1 
ATOM   9736  N  ND2 . ASN C 1 329 ? 13.580  -3.369  -55.996  1.00 3.24  ? 318  ASN C ND2 1 
ATOM   9737  N  N   . SER C 1 330 ? 14.413  1.808   -54.661  1.00 8.16  ? 319  SER C N   1 
ATOM   9738  C  CA  . SER C 1 330 ? 14.329  3.255   -54.495  1.00 11.29 ? 319  SER C CA  1 
ATOM   9739  C  C   . SER C 1 330 ? 15.671  3.903   -54.824  1.00 13.10 ? 319  SER C C   1 
ATOM   9740  O  O   . SER C 1 330 ? 15.716  4.892   -55.600  1.00 13.29 ? 319  SER C O   1 
ATOM   9741  C  CB  . SER C 1 330 ? 13.935  3.643   -53.045  1.00 11.77 ? 319  SER C CB  1 
ATOM   9742  O  OG  . SER C 1 330 ? 12.706  3.035   -52.636  1.00 17.00 ? 319  SER C OG  1 
ATOM   9743  N  N   . LEU C 1 331 ? 16.762  3.377   -54.242  1.00 11.55 ? 320  LEU C N   1 
ATOM   9744  C  CA  . LEU C 1 331 ? 18.055  3.993   -54.480  1.00 12.10 ? 320  LEU C CA  1 
ATOM   9745  C  C   . LEU C 1 331 ? 18.436  3.846   -55.942  1.00 11.95 ? 320  LEU C C   1 
ATOM   9746  O  O   . LEU C 1 331 ? 19.085  4.710   -56.462  1.00 10.36 ? 320  LEU C O   1 
ATOM   9747  C  CB  . LEU C 1 331 ? 19.149  3.413   -53.638  1.00 13.02 ? 320  LEU C CB  1 
ATOM   9748  C  CG  . LEU C 1 331 ? 19.379  4.220   -52.368  1.00 10.23 ? 320  LEU C CG  1 
ATOM   9749  C  CD1 . LEU C 1 331 ? 18.073  4.418   -51.827  1.00 2.00  ? 320  LEU C CD1 1 
ATOM   9750  C  CD2 . LEU C 1 331 ? 20.334  3.535   -51.434  1.00 13.07 ? 320  LEU C CD2 1 
ATOM   9751  N  N   . LEU C 1 332 ? 18.064  2.727   -56.549  1.00 12.70 ? 321  LEU C N   1 
ATOM   9752  C  CA  . LEU C 1 332 ? 18.186  2.574   -58.024  1.00 13.13 ? 321  LEU C CA  1 
ATOM   9753  C  C   . LEU C 1 332 ? 17.427  3.659   -58.753  1.00 13.70 ? 321  LEU C C   1 
ATOM   9754  O  O   . LEU C 1 332 ? 17.835  4.126   -59.831  1.00 15.97 ? 321  LEU C O   1 
ATOM   9755  C  CB  . LEU C 1 332 ? 17.676  1.186   -58.444  1.00 13.71 ? 321  LEU C CB  1 
ATOM   9756  C  CG  . LEU C 1 332 ? 18.126  0.484   -59.727  1.00 14.72 ? 321  LEU C CG  1 
ATOM   9757  C  CD1 . LEU C 1 332 ? 19.614  0.237   -59.747  1.00 10.72 ? 321  LEU C CD1 1 
ATOM   9758  C  CD2 . LEU C 1 332 ? 17.346  -0.820  -59.821  1.00 13.21 ? 321  LEU C CD2 1 
ATOM   9759  N  N   . SER C 1 333 ? 16.309  4.096   -58.174  1.00 14.61 ? 322  SER C N   1 
ATOM   9760  C  CA  . SER C 1 333 ? 15.438  5.083   -58.792  1.00 14.35 ? 322  SER C CA  1 
ATOM   9761  C  C   . SER C 1 333 ? 15.849  6.538   -58.577  1.00 15.55 ? 322  SER C C   1 
ATOM   9762  O  O   . SER C 1 333 ? 15.437  7.361   -59.345  1.00 13.57 ? 322  SER C O   1 
ATOM   9763  C  CB  . SER C 1 333 ? 13.989  4.874   -58.311  1.00 14.71 ? 322  SER C CB  1 
ATOM   9764  O  OG  . SER C 1 333 ? 13.540  3.582   -58.692  1.00 16.99 ? 322  SER C OG  1 
ATOM   9765  N  N   . CYS C 1 334 ? 16.621  6.860   -57.525  1.00 14.86 ? 323  CYS C N   1 
ATOM   9766  C  CA  . CYS C 1 334 ? 17.195  8.223   -57.322  1.00 15.05 ? 323  CYS C CA  1 
ATOM   9767  C  C   . CYS C 1 334 ? 18.676  8.411   -57.790  1.00 15.30 ? 323  CYS C C   1 
ATOM   9768  O  O   . CYS C 1 334 ? 19.273  9.501   -57.629  1.00 15.65 ? 323  CYS C O   1 
ATOM   9769  C  CB  . CYS C 1 334 ? 17.060  8.653   -55.854  1.00 14.54 ? 323  CYS C CB  1 
ATOM   9770  S  SG  . CYS C 1 334 ? 18.023  7.703   -54.673  1.00 21.44 ? 323  CYS C SG  1 
ATOM   9771  N  N   . GLY C 1 335 ? 19.271  7.360   -58.354  1.00 14.87 ? 324  GLY C N   1 
ATOM   9772  C  CA  . GLY C 1 335 ? 20.633  7.421   -58.902  1.00 14.03 ? 324  GLY C CA  1 
ATOM   9773  C  C   . GLY C 1 335 ? 21.769  7.024   -57.987  1.00 12.92 ? 324  GLY C C   1 
ATOM   9774  O  O   . GLY C 1 335 ? 22.907  6.987   -58.394  1.00 10.86 ? 324  GLY C O   1 
ATOM   9775  N  N   . ASP C 1 336 ? 21.473  6.743   -56.732  1.00 13.95 ? 325  ASP C N   1 
ATOM   9776  C  CA  . ASP C 1 336 ? 22.509  6.323   -55.784  1.00 13.21 ? 325  ASP C CA  1 
ATOM   9777  C  C   . ASP C 1 336 ? 23.111  4.960   -56.105  1.00 12.43 ? 325  ASP C C   1 
ATOM   9778  O  O   . ASP C 1 336 ? 24.302  4.729   -55.861  1.00 13.75 ? 325  ASP C O   1 
ATOM   9779  C  CB  . ASP C 1 336 ? 21.924  6.272   -54.391  1.00 15.96 ? 325  ASP C CB  1 
ATOM   9780  C  CG  . ASP C 1 336 ? 21.795  7.652   -53.761  1.00 21.83 ? 325  ASP C CG  1 
ATOM   9781  O  OD1 . ASP C 1 336 ? 22.582  8.556   -54.140  1.00 26.40 ? 325  ASP C OD1 1 
ATOM   9782  O  OD2 . ASP C 1 336 ? 20.920  7.828   -52.864  1.00 28.41 ? 325  ASP C OD2 1 
ATOM   9783  N  N   . LEU C 1 337 ? 22.291  4.055   -56.646  1.00 9.76  ? 326  LEU C N   1 
ATOM   9784  C  CA  . LEU C 1 337 ? 22.746  2.787   -57.132  1.00 7.43  ? 326  LEU C CA  1 
ATOM   9785  C  C   . LEU C 1 337 ? 22.453  2.867   -58.603  1.00 8.86  ? 326  LEU C C   1 
ATOM   9786  O  O   . LEU C 1 337 ? 21.349  3.228   -58.948  1.00 11.21 ? 326  LEU C O   1 
ATOM   9787  C  CB  . LEU C 1 337 ? 21.925  1.700   -56.571  1.00 3.40  ? 326  LEU C CB  1 
ATOM   9788  C  CG  . LEU C 1 337 ? 22.171  1.565   -55.034  1.00 2.00  ? 326  LEU C CG  1 
ATOM   9789  C  CD1 . LEU C 1 337 ? 21.330  0.441   -54.703  1.00 2.00  ? 326  LEU C CD1 1 
ATOM   9790  C  CD2 . LEU C 1 337 ? 23.586  1.360   -54.785  1.00 2.00  ? 326  LEU C CD2 1 
ATOM   9791  N  N   . GLN C 1 338 ? 23.408  2.502   -59.427  1.00 11.15 ? 327  GLN C N   1 
ATOM   9792  C  CA  . GLN C 1 338 ? 23.384  2.905   -60.880  1.00 12.65 ? 327  GLN C CA  1 
ATOM   9793  C  C   . GLN C 1 338 ? 23.249  1.801   -61.915  1.00 14.79 ? 327  GLN C C   1 
ATOM   9794  O  O   . GLN C 1 338 ? 22.722  2.015   -63.028  1.00 15.54 ? 327  GLN C O   1 
ATOM   9795  C  CB  . GLN C 1 338 ? 24.679  3.657   -61.207  1.00 14.22 ? 327  GLN C CB  1 
ATOM   9796  C  CG  . GLN C 1 338 ? 25.082  4.808   -60.259  1.00 19.84 ? 327  GLN C CG  1 
ATOM   9797  C  CD  . GLN C 1 338 ? 25.618  4.372   -58.866  1.00 22.09 ? 327  GLN C CD  1 
ATOM   9798  O  OE1 . GLN C 1 338 ? 26.095  3.280   -58.666  1.00 23.60 ? 327  GLN C OE1 1 
ATOM   9799  N  NE2 . GLN C 1 338 ? 25.512  5.259   -57.918  1.00 24.55 ? 327  GLN C NE2 1 
ATOM   9800  N  N   . VAL C 1 339 ? 23.762  0.624   -61.579  1.00 16.93 ? 328  VAL C N   1 
ATOM   9801  C  CA  . VAL C 1 339 ? 23.939  -0.489  -62.535  1.00 15.75 ? 328  VAL C CA  1 
ATOM   9802  C  C   . VAL C 1 339 ? 23.280  -1.699  -61.944  1.00 15.39 ? 328  VAL C C   1 
ATOM   9803  O  O   . VAL C 1 339 ? 23.139  -1.781  -60.704  1.00 16.45 ? 328  VAL C O   1 
ATOM   9804  C  CB  . VAL C 1 339 ? 25.459  -0.826  -62.756  1.00 16.70 ? 328  VAL C CB  1 
ATOM   9805  C  CG1 . VAL C 1 339 ? 26.076  0.121   -63.748  1.00 18.73 ? 328  VAL C CG1 1 
ATOM   9806  C  CG2 . VAL C 1 339 ? 26.222  -0.806  -61.411  1.00 17.23 ? 328  VAL C CG2 1 
ATOM   9807  N  N   . THR C 1 340 ? 22.900  -2.666  -62.771  1.00 15.05 ? 329  THR C N   1 
ATOM   9808  C  CA  . THR C 1 340 ? 22.218  -3.845  -62.228  1.00 14.00 ? 329  THR C CA  1 
ATOM   9809  C  C   . THR C 1 340 ? 22.749  -5.102  -62.864  1.00 14.27 ? 329  THR C C   1 
ATOM   9810  O  O   . THR C 1 340 ? 22.984  -5.128  -64.065  1.00 14.65 ? 329  THR C O   1 
ATOM   9811  C  CB  . THR C 1 340 ? 20.645  -3.772  -62.402  1.00 16.31 ? 329  THR C CB  1 
ATOM   9812  O  OG1 . THR C 1 340 ? 20.247  -4.199  -63.719  1.00 15.40 ? 329  THR C OG1 1 
ATOM   9813  C  CG2 . THR C 1 340 ? 20.078  -2.311  -62.137  1.00 14.73 ? 329  THR C CG2 1 
ATOM   9814  N  N   . GLY C 1 341 ? 22.892  -6.147  -62.070  1.00 12.78 ? 330  GLY C N   1 
ATOM   9815  C  CA  . GLY C 1 341 ? 23.304  -7.480  -62.557  1.00 12.84 ? 330  GLY C CA  1 
ATOM   9816  C  C   . GLY C 1 341 ? 22.662  -8.657  -61.826  1.00 13.53 ? 330  GLY C C   1 
ATOM   9817  O  O   . GLY C 1 341 ? 21.709  -8.486  -61.058  1.00 13.80 ? 330  GLY C O   1 
ATOM   9818  N  N   . SER C 1 342 ? 23.207  -9.856  -62.046  1.00 12.87 ? 331  SER C N   1 
ATOM   9819  C  CA  . SER C 1 342 ? 22.617  -11.089 -61.512  1.00 11.67 ? 331  SER C CA  1 
ATOM   9820  C  C   . SER C 1 342 ? 23.471  -11.777 -60.453  1.00 11.34 ? 331  SER C C   1 
ATOM   9821  O  O   . SER C 1 342 ? 22.947  -12.163 -59.413  1.00 12.86 ? 331  SER C O   1 
ATOM   9822  C  CB  . SER C 1 342 ? 22.230  -12.026 -62.676  1.00 12.21 ? 331  SER C CB  1 
ATOM   9823  O  OG  . SER C 1 342 ? 23.255  -12.102 -63.634  1.00 14.29 ? 331  SER C OG  1 
ATOM   9824  N  N   . ALA C 1 343 ? 24.792  -11.805 -60.643  1.00 12.68 ? 332  ALA C N   1 
ATOM   9825  C  CA  . ALA C 1 343 ? 25.717  -12.651 -59.888  1.00 9.47  ? 332  ALA C CA  1 
ATOM   9826  C  C   . ALA C 1 343 ? 25.383  -14.076 -60.184  1.00 11.56 ? 332  ALA C C   1 
ATOM   9827  O  O   . ALA C 1 343 ? 25.499  -14.939 -59.321  1.00 12.13 ? 332  ALA C O   1 
ATOM   9828  C  CB  . ALA C 1 343 ? 25.687  -12.368 -58.326  1.00 12.74 ? 332  ALA C CB  1 
ATOM   9829  N  N   . HIS C 1 344 ? 24.969  -14.357 -61.421  1.00 11.09 ? 333  HIS C N   1 
ATOM   9830  C  CA  . HIS C 1 344 ? 24.331  -15.616 -61.705  1.00 12.14 ? 333  HIS C CA  1 
ATOM   9831  C  C   . HIS C 1 344 ? 25.365  -16.704 -61.593  1.00 11.91 ? 333  HIS C C   1 
ATOM   9832  O  O   . HIS C 1 344 ? 26.244  -16.784 -62.417  1.00 13.24 ? 333  HIS C O   1 
ATOM   9833  C  CB  . HIS C 1 344 ? 23.688  -15.625 -63.104  1.00 10.22 ? 333  HIS C CB  1 
ATOM   9834  C  CG  . HIS C 1 344 ? 22.905  -16.875 -63.395  1.00 14.06 ? 333  HIS C CG  1 
ATOM   9835  N  ND1 . HIS C 1 344 ? 21.548  -16.875 -63.634  1.00 21.11 ? 333  HIS C ND1 1 
ATOM   9836  C  CD2 . HIS C 1 344 ? 23.299  -18.171 -63.507  1.00 18.31 ? 333  HIS C CD2 1 
ATOM   9837  C  CE1 . HIS C 1 344 ? 21.141  -18.113 -63.872  1.00 20.75 ? 333  HIS C CE1 1 
ATOM   9838  N  NE2 . HIS C 1 344 ? 22.185  -18.919 -63.794  1.00 18.76 ? 333  HIS C NE2 1 
ATOM   9839  N  N   . CYS C 1 345 ? 25.239  -17.514 -60.545  1.00 13.87 ? 334  CYS C N   1 
ATOM   9840  C  CA  . CYS C 1 345 ? 26.159  -18.596 -60.264  1.00 13.77 ? 334  CYS C CA  1 
ATOM   9841  C  C   . CYS C 1 345 ? 25.420  -19.819 -59.743  1.00 13.85 ? 334  CYS C C   1 
ATOM   9842  O  O   . CYS C 1 345 ? 25.398  -20.081 -58.547  1.00 7.71  ? 334  CYS C O   1 
ATOM   9843  C  CB  . CYS C 1 345 ? 27.177  -18.118 -59.250  1.00 13.83 ? 334  CYS C CB  1 
ATOM   9844  S  SG  . CYS C 1 345 ? 28.575  -19.110 -59.275  1.00 16.98 ? 334  CYS C SG  1 
ATOM   9845  N  N   . THR C 1 346 ? 24.804  -20.586 -60.626  1.00 13.94 ? 335  THR C N   1 
ATOM   9846  C  CA  . THR C 1 346 ? 23.876  -21.656 -60.176  1.00 16.47 ? 335  THR C CA  1 
ATOM   9847  C  C   . THR C 1 346 ? 24.500  -23.017 -59.846  1.00 16.94 ? 335  THR C C   1 
ATOM   9848  O  O   . THR C 1 346 ? 25.368  -23.471 -60.541  1.00 17.27 ? 335  THR C O   1 
ATOM   9849  C  CB  . THR C 1 346 ? 22.770  -21.896 -61.204  1.00 15.91 ? 335  THR C CB  1 
ATOM   9850  O  OG1 . THR C 1 346 ? 23.331  -21.886 -62.522  1.00 19.89 ? 335  THR C OG1 1 
ATOM   9851  C  CG2 . THR C 1 346 ? 21.721  -20.804 -61.104  1.00 19.08 ? 335  THR C CG2 1 
ATOM   9852  N  N   . PHE C 1 347 ? 24.064  -23.625 -58.737  1.00 17.72 ? 336  PHE C N   1 
ATOM   9853  C  CA  . PHE C 1 347 ? 24.381  -25.022 -58.400  1.00 18.64 ? 336  PHE C CA  1 
ATOM   9854  C  C   . PHE C 1 347 ? 23.091  -25.723 -57.981  1.00 18.51 ? 336  PHE C C   1 
ATOM   9855  O  O   . PHE C 1 347 ? 22.263  -25.165 -57.281  1.00 19.91 ? 336  PHE C O   1 
ATOM   9856  C  CB  . PHE C 1 347 ? 25.456  -25.154 -57.291  1.00 20.08 ? 336  PHE C CB  1 
ATOM   9857  C  CG  . PHE C 1 347 ? 26.730  -24.377 -57.568  1.00 19.88 ? 336  PHE C CG  1 
ATOM   9858  C  CD1 . PHE C 1 347 ? 26.861  -23.060 -57.131  1.00 17.95 ? 336  PHE C CD1 1 
ATOM   9859  C  CD2 . PHE C 1 347 ? 27.781  -24.969 -58.261  1.00 15.86 ? 336  PHE C CD2 1 
ATOM   9860  C  CE1 . PHE C 1 347 ? 28.018  -22.332 -57.400  1.00 18.82 ? 336  PHE C CE1 1 
ATOM   9861  C  CE2 . PHE C 1 347 ? 28.949  -24.254 -58.530  1.00 18.82 ? 336  PHE C CE2 1 
ATOM   9862  C  CZ  . PHE C 1 347 ? 29.067  -22.930 -58.116  1.00 17.99 ? 336  PHE C CZ  1 
ATOM   9863  N  N   . ASN C 1 348 ? 22.898  -26.944 -58.437  1.00 19.64 ? 337  ASN C N   1 
ATOM   9864  C  CA  . ASN C 1 348 ? 21.646  -27.622 -58.214  1.00 19.45 ? 337  ASN C CA  1 
ATOM   9865  C  C   . ASN C 1 348 ? 21.625  -28.135 -56.783  1.00 19.55 ? 337  ASN C C   1 
ATOM   9866  O  O   . ASN C 1 348 ? 22.549  -27.864 -56.023  1.00 20.42 ? 337  ASN C O   1 
ATOM   9867  C  CB  . ASN C 1 348 ? 21.410  -28.731 -59.242  1.00 20.78 ? 337  ASN C CB  1 
ATOM   9868  C  CG  . ASN C 1 348 ? 22.571  -29.713 -59.336  1.00 22.61 ? 337  ASN C CG  1 
ATOM   9869  O  OD1 . ASN C 1 348 ? 23.193  -30.076 -58.337  1.00 20.10 ? 337  ASN C OD1 1 
ATOM   9870  N  ND2 . ASN C 1 348 ? 22.862  -30.142 -60.554  1.00 25.44 ? 337  ASN C ND2 1 
ATOM   9871  N  N   . THR C 1 349 ? 20.564  -28.851 -56.430  1.00 18.45 ? 338  THR C N   1 
ATOM   9872  C  CA  . THR C 1 349 ? 20.385  -29.441 -55.081  1.00 18.26 ? 338  THR C CA  1 
ATOM   9873  C  C   . THR C 1 349 ? 21.406  -30.526 -54.729  1.00 18.90 ? 338  THR C C   1 
ATOM   9874  O  O   . THR C 1 349 ? 21.827  -30.652 -53.554  1.00 20.39 ? 338  THR C O   1 
ATOM   9875  C  CB  . THR C 1 349 ? 18.942  -29.942 -54.951  1.00 17.22 ? 338  THR C CB  1 
ATOM   9876  O  OG1 . THR C 1 349 ? 18.094  -28.974 -55.585  1.00 12.11 ? 338  THR C OG1 1 
ATOM   9877  C  CG2 . THR C 1 349 ? 18.510  -30.151 -53.473  1.00 16.24 ? 338  THR C CG2 1 
ATOM   9878  N  N   . ALA C 1 350 ? 21.827  -31.306 -55.716  1.00 19.98 ? 339  ALA C N   1 
ATOM   9879  C  CA  . ALA C 1 350 ? 22.896  -32.273 -55.495  1.00 19.92 ? 339  ALA C CA  1 
ATOM   9880  C  C   . ALA C 1 350 ? 24.172  -31.529 -55.061  1.00 20.44 ? 339  ALA C C   1 
ATOM   9881  O  O   . ALA C 1 350 ? 24.617  -31.620 -53.906  1.00 22.24 ? 339  ALA C O   1 
ATOM   9882  C  CB  . ALA C 1 350 ? 23.136  -33.103 -56.769  1.00 20.08 ? 339  ALA C CB  1 
ATOM   9883  N  N   . GLN C 1 351 ? 24.692  -30.729 -55.977  1.00 20.66 ? 340  GLN C N   1 
ATOM   9884  C  CA  . GLN C 1 351 ? 25.838  -29.814 -55.743  1.00 20.12 ? 340  GLN C CA  1 
ATOM   9885  C  C   . GLN C 1 351 ? 25.719  -29.018 -54.450  1.00 18.47 ? 340  GLN C C   1 
ATOM   9886  O  O   . GLN C 1 351 ? 26.637  -28.964 -53.644  1.00 16.47 ? 340  GLN C O   1 
ATOM   9887  C  CB  . GLN C 1 351 ? 25.917  -28.846 -56.911  1.00 20.42 ? 340  GLN C CB  1 
ATOM   9888  C  CG  . GLN C 1 351 ? 26.271  -29.525 -58.198  1.00 21.84 ? 340  GLN C CG  1 
ATOM   9889  C  CD  . GLN C 1 351 ? 25.901  -28.710 -59.397  1.00 23.24 ? 340  GLN C CD  1 
ATOM   9890  O  OE1 . GLN C 1 351 ? 25.311  -27.648 -59.274  1.00 21.14 ? 340  GLN C OE1 1 
ATOM   9891  N  NE2 . GLN C 1 351 ? 26.237  -29.214 -60.590  1.00 32.08 ? 340  GLN C NE2 1 
ATOM   9892  N  N   . LYS C 1 352 ? 24.552  -28.433 -54.255  1.00 18.11 ? 341  LYS C N   1 
ATOM   9893  C  CA  . LYS C 1 352 ? 24.264  -27.747 -53.010  1.00 17.79 ? 341  LYS C CA  1 
ATOM   9894  C  C   . LYS C 1 352 ? 24.461  -28.657 -51.778  1.00 17.54 ? 341  LYS C C   1 
ATOM   9895  O  O   . LYS C 1 352 ? 25.020  -28.202 -50.770  1.00 18.14 ? 341  LYS C O   1 
ATOM   9896  C  CB  . LYS C 1 352 ? 22.864  -27.109 -53.044  1.00 16.35 ? 341  LYS C CB  1 
ATOM   9897  C  CG  . LYS C 1 352 ? 22.669  -25.929 -53.999  1.00 15.59 ? 341  LYS C CG  1 
ATOM   9898  C  CD  . LYS C 1 352 ? 23.338  -24.591 -53.587  1.00 15.36 ? 341  LYS C CD  1 
ATOM   9899  C  CE  . LYS C 1 352 ? 22.773  -23.445 -54.422  1.00 16.06 ? 341  LYS C CE  1 
ATOM   9900  N  NZ  . LYS C 1 352 ? 23.323  -22.094 -54.204  1.00 15.25 ? 341  LYS C NZ  1 
ATOM   9901  N  N   . ALA C 1 353 ? 24.019  -29.920 -51.884  1.00 17.18 ? 342  ALA C N   1 
ATOM   9902  C  CA  . ALA C 1 353 ? 23.959  -30.906 -50.775  1.00 18.21 ? 342  ALA C CA  1 
ATOM   9903  C  C   . ALA C 1 353 ? 25.294  -31.430 -50.214  1.00 19.82 ? 342  ALA C C   1 
ATOM   9904  O  O   . ALA C 1 353 ? 25.336  -32.014 -49.101  1.00 17.82 ? 342  ALA C O   1 
ATOM   9905  C  CB  . ALA C 1 353 ? 23.065  -32.051 -51.140  1.00 16.95 ? 342  ALA C CB  1 
ATOM   9906  N  N   . VAL C 1 354 ? 26.375  -31.212 -50.968  1.00 19.75 ? 343  VAL C N   1 
ATOM   9907  C  CA  . VAL C 1 354 ? 27.744  -31.199 -50.417  1.00 19.41 ? 343  VAL C CA  1 
ATOM   9908  C  C   . VAL C 1 354 ? 27.821  -30.485 -49.070  1.00 18.85 ? 343  VAL C C   1 
ATOM   9909  O  O   . VAL C 1 354 ? 28.403  -30.989 -48.095  1.00 17.08 ? 343  VAL C O   1 
ATOM   9910  C  CB  . VAL C 1 354 ? 28.712  -30.536 -51.407  1.00 19.89 ? 343  VAL C CB  1 
ATOM   9911  C  CG1 . VAL C 1 354 ? 29.877  -29.815 -50.695  1.00 18.72 ? 343  VAL C CG1 1 
ATOM   9912  C  CG2 . VAL C 1 354 ? 29.232  -31.578 -52.365  1.00 18.75 ? 343  VAL C CG2 1 
ATOM   9913  N  N   . GLY C 1 355 ? 27.194  -29.318 -49.002  1.00 19.59 ? 344  GLY C N   1 
ATOM   9914  C  CA  . GLY C 1 355 ? 27.121  -28.613 -47.743  1.00 20.09 ? 344  GLY C CA  1 
ATOM   9915  C  C   . GLY C 1 355 ? 25.933  -28.963 -46.901  1.00 19.89 ? 344  GLY C C   1 
ATOM   9916  O  O   . GLY C 1 355 ? 25.539  -28.140 -46.091  1.00 21.57 ? 344  GLY C O   1 
ATOM   9917  N  N   . LYS C 1 356 ? 25.352  -30.157 -47.051  1.00 19.89 ? 345  LYS C N   1 
ATOM   9918  C  CA  . LYS C 1 356 ? 24.125  -30.466 -46.311  1.00 21.90 ? 345  LYS C CA  1 
ATOM   9919  C  C   . LYS C 1 356 ? 24.400  -30.599 -44.831  1.00 22.46 ? 345  LYS C C   1 
ATOM   9920  O  O   . LYS C 1 356 ? 23.511  -30.319 -44.032  1.00 25.53 ? 345  LYS C O   1 
ATOM   9921  C  CB  . LYS C 1 356 ? 23.393  -31.714 -46.815  1.00 21.96 ? 345  LYS C CB  1 
ATOM   9922  C  CG  . LYS C 1 356 ? 23.851  -33.011 -46.214  1.00 22.55 ? 345  LYS C CG  1 
ATOM   9923  C  CD  . LYS C 1 356 ? 23.394  -34.217 -47.010  1.00 23.69 ? 345  LYS C CD  1 
ATOM   9924  C  CE  . LYS C 1 356 ? 23.260  -35.411 -46.137  1.00 23.05 ? 345  LYS C CE  1 
ATOM   9925  N  NZ  . LYS C 1 356 ? 24.580  -35.796 -45.582  1.00 25.89 ? 345  LYS C NZ  1 
ATOM   9926  N  N   . ASP C 1 357 ? 25.617  -31.003 -44.460  1.00 22.76 ? 346  ASP C N   1 
ATOM   9927  C  CA  . ASP C 1 357 ? 26.002  -31.108 -43.036  1.00 22.98 ? 346  ASP C CA  1 
ATOM   9928  C  C   . ASP C 1 357 ? 26.897  -29.970 -42.480  1.00 22.87 ? 346  ASP C C   1 
ATOM   9929  O  O   . ASP C 1 357 ? 27.387  -30.044 -41.341  1.00 22.73 ? 346  ASP C O   1 
ATOM   9930  C  CB  . ASP C 1 357 ? 26.706  -32.440 -42.805  1.00 24.49 ? 346  ASP C CB  1 
ATOM   9931  C  CG  . ASP C 1 357 ? 25.788  -33.634 -42.980  1.00 28.64 ? 346  ASP C CG  1 
ATOM   9932  O  OD1 . ASP C 1 357 ? 24.554  -33.457 -43.156  1.00 34.42 ? 346  ASP C OD1 1 
ATOM   9933  O  OD2 . ASP C 1 357 ? 26.309  -34.771 -42.929  1.00 33.76 ? 346  ASP C OD2 1 
ATOM   9934  N  N   . ASN C 1 358 ? 27.091  -28.908 -43.242  1.00 21.60 ? 347  ASN C N   1 
ATOM   9935  C  CA  . ASN C 1 358 ? 28.011  -27.833 -42.849  1.00 21.54 ? 347  ASN C CA  1 
ATOM   9936  C  C   . ASN C 1 358 ? 27.738  -26.685 -43.785  1.00 21.00 ? 347  ASN C C   1 
ATOM   9937  O  O   . ASN C 1 358 ? 28.137  -26.738 -44.935  1.00 20.47 ? 347  ASN C O   1 
ATOM   9938  C  CB  . ASN C 1 358 ? 29.467  -28.310 -43.005  1.00 21.24 ? 347  ASN C CB  1 
ATOM   9939  C  CG  . ASN C 1 358 ? 30.519  -27.309 -42.507  1.00 20.37 ? 347  ASN C CG  1 
ATOM   9940  O  OD1 . ASN C 1 358 ? 31.599  -27.734 -42.109  1.00 24.54 ? 347  ASN C OD1 1 
ATOM   9941  N  ND2 . ASN C 1 358 ? 30.245  -26.010 -42.563  1.00 10.35 ? 347  ASN C ND2 1 
ATOM   9942  N  N   . PHE C 1 359 ? 27.048  -25.656 -43.315  1.00 20.20 ? 348  PHE C N   1 
ATOM   9943  C  CA  . PHE C 1 359 ? 26.697  -24.560 -44.204  1.00 21.02 ? 348  PHE C CA  1 
ATOM   9944  C  C   . PHE C 1 359 ? 27.917  -23.965 -44.930  1.00 20.43 ? 348  PHE C C   1 
ATOM   9945  O  O   . PHE C 1 359 ? 27.805  -23.500 -46.070  1.00 20.40 ? 348  PHE C O   1 
ATOM   9946  C  CB  . PHE C 1 359 ? 25.905  -23.476 -43.465  1.00 20.37 ? 348  PHE C CB  1 
ATOM   9947  C  CG  . PHE C 1 359 ? 26.715  -22.668 -42.500  1.00 21.09 ? 348  PHE C CG  1 
ATOM   9948  C  CD1 . PHE C 1 359 ? 27.425  -21.576 -42.937  1.00 18.06 ? 348  PHE C CD1 1 
ATOM   9949  C  CD2 . PHE C 1 359 ? 26.729  -22.969 -41.150  1.00 20.36 ? 348  PHE C CD2 1 
ATOM   9950  C  CE1 . PHE C 1 359 ? 28.156  -20.826 -42.096  1.00 20.45 ? 348  PHE C CE1 1 
ATOM   9951  C  CE2 . PHE C 1 359 ? 27.465  -22.208 -40.276  1.00 20.34 ? 348  PHE C CE2 1 
ATOM   9952  C  CZ  . PHE C 1 359 ? 28.175  -21.129 -40.733  1.00 16.76 ? 348  PHE C CZ  1 
ATOM   9953  N  N   . THR C 1 360 ? 29.077  -23.997 -44.278  1.00 19.34 ? 349  THR C N   1 
ATOM   9954  C  CA  . THR C 1 360 ? 30.300  -23.387 -44.846  1.00 20.35 ? 349  THR C CA  1 
ATOM   9955  C  C   . THR C 1 360 ? 30.804  -24.110 -46.106  1.00 18.88 ? 349  THR C C   1 
ATOM   9956  O  O   . THR C 1 360 ? 31.741  -23.646 -46.745  1.00 23.38 ? 349  THR C O   1 
ATOM   9957  C  CB  . THR C 1 360 ? 31.480  -23.286 -43.826  1.00 18.89 ? 349  THR C CB  1 
ATOM   9958  O  OG1 . THR C 1 360 ? 31.937  -24.603 -43.497  1.00 23.54 ? 349  THR C OG1 1 
ATOM   9959  C  CG2 . THR C 1 360 ? 31.075  -22.536 -42.549  1.00 18.19 ? 349  THR C CG2 1 
ATOM   9960  N  N   . LEU C 1 361 ? 30.199  -25.244 -46.448  1.00 17.42 ? 350  LEU C N   1 
ATOM   9961  C  CA  . LEU C 1 361 ? 30.613  -25.999 -47.616  1.00 14.96 ? 350  LEU C CA  1 
ATOM   9962  C  C   . LEU C 1 361 ? 29.630  -25.929 -48.747  1.00 15.14 ? 350  LEU C C   1 
ATOM   9963  O  O   . LEU C 1 361 ? 29.933  -26.474 -49.827  1.00 17.51 ? 350  LEU C O   1 
ATOM   9964  C  CB  . LEU C 1 361 ? 30.732  -27.484 -47.284  1.00 14.22 ? 350  LEU C CB  1 
ATOM   9965  C  CG  . LEU C 1 361 ? 31.698  -28.025 -46.255  1.00 8.28  ? 350  LEU C CG  1 
ATOM   9966  C  CD1 . LEU C 1 361 ? 31.629  -29.537 -46.354  1.00 3.42  ? 350  LEU C CD1 1 
ATOM   9967  C  CD2 . LEU C 1 361 ? 33.061  -27.524 -46.498  1.00 11.88 ? 350  LEU C CD2 1 
ATOM   9968  N  N   . ILE C 1 362 ? 28.452  -25.343 -48.504  1.00 14.06 ? 351  ILE C N   1 
ATOM   9969  C  CA  . ILE C 1 362 ? 27.397  -25.262 -49.478  1.00 14.17 ? 351  ILE C CA  1 
ATOM   9970  C  C   . ILE C 1 362 ? 27.915  -24.385 -50.593  1.00 12.73 ? 351  ILE C C   1 
ATOM   9971  O  O   . ILE C 1 362 ? 28.387  -23.284 -50.345  1.00 10.11 ? 351  ILE C O   1 
ATOM   9972  C  CB  . ILE C 1 362 ? 26.121  -24.610 -48.892  1.00 14.42 ? 351  ILE C CB  1 
ATOM   9973  C  CG1 . ILE C 1 362 ? 25.529  -25.485 -47.779  1.00 18.18 ? 351  ILE C CG1 1 
ATOM   9974  C  CG2 . ILE C 1 362 ? 25.074  -24.393 -49.980  1.00 13.36 ? 351  ILE C CG2 1 
ATOM   9975  C  CD1 . ILE C 1 362 ? 24.299  -24.909 -47.060  1.00 16.28 ? 351  ILE C CD1 1 
ATOM   9976  N  N   . PRO C 1 363 ? 27.854  -24.861 -51.852  1.00 13.12 ? 352  PRO C N   1 
ATOM   9977  C  CA  . PRO C 1 363 ? 28.358  -23.951 -52.849  1.00 11.83 ? 352  PRO C CA  1 
ATOM   9978  C  C   . PRO C 1 363 ? 27.573  -22.637 -52.881  1.00 12.90 ? 352  PRO C C   1 
ATOM   9979  O  O   . PRO C 1 363 ? 26.326  -22.648 -52.908  1.00 13.60 ? 352  PRO C O   1 
ATOM   9980  C  CB  . PRO C 1 363 ? 28.164  -24.726 -54.174  1.00 13.24 ? 352  PRO C CB  1 
ATOM   9981  C  CG  . PRO C 1 363 ? 28.035  -26.110 -53.801  1.00 12.81 ? 352  PRO C CG  1 
ATOM   9982  C  CD  . PRO C 1 363 ? 27.380  -26.114 -52.436  1.00 13.98 ? 352  PRO C CD  1 
ATOM   9983  N  N   . GLU C 1 364 ? 28.282  -21.505 -52.924  1.00 15.27 ? 353  GLU C N   1 
ATOM   9984  C  CA  . GLU C 1 364 ? 27.623  -20.180 -52.957  1.00 13.11 ? 353  GLU C CA  1 
ATOM   9985  C  C   . GLU C 1 364 ? 27.206  -19.697 -54.367  1.00 13.37 ? 353  GLU C C   1 
ATOM   9986  O  O   . GLU C 1 364 ? 28.015  -19.656 -55.259  1.00 13.69 ? 353  GLU C O   1 
ATOM   9987  C  CB  . GLU C 1 364 ? 28.532  -19.176 -52.340  1.00 14.54 ? 353  GLU C CB  1 
ATOM   9988  C  CG  . GLU C 1 364 ? 28.704  -19.359 -50.832  1.00 12.55 ? 353  GLU C CG  1 
ATOM   9989  C  CD  . GLU C 1 364 ? 30.053  -18.866 -50.339  1.00 15.44 ? 353  GLU C CD  1 
ATOM   9990  O  OE1 . GLU C 1 364 ? 31.046  -18.867 -51.127  1.00 15.33 ? 353  GLU C OE1 1 
ATOM   9991  O  OE2 . GLU C 1 364 ? 30.153  -18.543 -49.129  1.00 17.93 ? 353  GLU C OE2 1 
ATOM   9992  N  N   . GLY C 1 365 ? 25.941  -19.312 -54.518  1.00 12.18 ? 354  GLY C N   1 
ATOM   9993  C  CA  . GLY C 1 365 ? 25.440  -18.728 -55.753  1.00 10.90 ? 354  GLY C CA  1 
ATOM   9994  C  C   . GLY C 1 365 ? 23.936  -18.873 -55.861  1.00 11.02 ? 354  GLY C C   1 
ATOM   9995  O  O   . GLY C 1 365 ? 23.336  -19.706 -55.143  1.00 12.75 ? 354  GLY C O   1 
ATOM   9996  N  N   . THR C 1 366 ? 23.316  -18.068 -56.747  1.00 9.23  ? 355  THR C N   1 
ATOM   9997  C  CA  A THR C 1 366 ? 21.914  -18.277 -57.100  0.50 9.41  ? 355  THR C CA  1 
ATOM   9998  C  CA  B THR C 1 366 ? 21.885  -18.150 -57.052  0.50 8.22  ? 355  THR C CA  1 
ATOM   9999  C  C   . THR C 1 366 ? 21.655  -17.917 -58.543  1.00 8.72  ? 355  THR C C   1 
ATOM   10000 O  O   . THR C 1 366 ? 22.596  -17.647 -59.275  1.00 7.37  ? 355  THR C O   1 
ATOM   10001 C  CB  A THR C 1 366 ? 20.939  -17.495 -56.221  0.50 10.19 ? 355  THR C CB  1 
ATOM   10002 C  CB  B THR C 1 366 ? 21.026  -17.091 -56.280  0.50 8.32  ? 355  THR C CB  1 
ATOM   10003 O  OG1 A THR C 1 366 ? 19.697  -18.207 -56.186  0.50 11.65 ? 355  THR C OG1 1 
ATOM   10004 O  OG1 B THR C 1 366 ? 21.113  -15.807 -56.930  0.50 10.34 ? 355  THR C OG1 1 
ATOM   10005 C  CG2 A THR C 1 366 ? 20.710  -16.068 -56.746  0.50 12.07 ? 355  THR C CG2 1 
ATOM   10006 C  CG2 B THR C 1 366 ? 21.419  -16.993 -54.750  0.50 2.00  ? 355  THR C CG2 1 
ATOM   10007 N  N   . ASN C 1 367 ? 20.386  -17.965 -58.920  1.00 9.69  ? 356  ASN C N   1 
ATOM   10008 C  CA  . ASN C 1 367 ? 19.923  -17.527 -60.261  1.00 9.11  ? 356  ASN C CA  1 
ATOM   10009 C  C   . ASN C 1 367 ? 19.572  -16.030 -60.287  1.00 8.86  ? 356  ASN C C   1 
ATOM   10010 O  O   . ASN C 1 367 ? 19.443  -15.403 -59.255  1.00 5.45  ? 356  ASN C O   1 
ATOM   10011 C  CB  . ASN C 1 367 ? 18.725  -18.378 -60.702  1.00 11.11 ? 356  ASN C CB  1 
ATOM   10012 C  CG  . ASN C 1 367 ? 17.445  -18.129 -59.875  1.00 12.76 ? 356  ASN C CG  1 
ATOM   10013 O  OD1 . ASN C 1 367 ? 17.272  -18.734 -58.836  1.00 11.45 ? 356  ASN C OD1 1 
ATOM   10014 N  ND2 . ASN C 1 367 ? 16.523  -17.314 -60.395  1.00 10.34 ? 356  ASN C ND2 1 
ATOM   10015 N  N   . GLY C 1 368 ? 19.395  -15.454 -61.478  1.00 5.46  ? 357  GLY C N   1 
ATOM   10016 C  CA  . GLY C 1 368 ? 18.930  -14.066 -61.574  1.00 7.62  ? 357  GLY C CA  1 
ATOM   10017 C  C   . GLY C 1 368 ? 18.986  -13.478 -62.989  1.00 8.23  ? 357  GLY C C   1 
ATOM   10018 O  O   . GLY C 1 368 ? 18.369  -12.462 -63.234  1.00 11.30 ? 357  GLY C O   1 
ATOM   10019 N  N   . THR C 1 369 ? 19.689  -14.128 -63.895  1.00 11.42 ? 358  THR C N   1 
ATOM   10020 C  CA  . THR C 1 369 ? 19.972  -13.523 -65.230  1.00 11.66 ? 358  THR C CA  1 
ATOM   10021 C  C   . THR C 1 369 ? 18.719  -13.422 -66.119  1.00 13.17 ? 358  THR C C   1 
ATOM   10022 O  O   . THR C 1 369 ? 18.534  -12.469 -66.943  1.00 11.10 ? 358  THR C O   1 
ATOM   10023 C  CB  . THR C 1 369 ? 21.197  -14.213 -65.945  1.00 13.11 ? 358  THR C CB  1 
ATOM   10024 O  OG1 . THR C 1 369 ? 21.690  -13.365 -66.999  1.00 9.82  ? 358  THR C OG1 1 
ATOM   10025 C  CG2 . THR C 1 369 ? 20.895  -15.640 -66.494  1.00 9.20  ? 358  THR C CG2 1 
ATOM   10026 N  N   . GLU C 1 370 ? 17.870  -14.428 -65.986  1.00 16.06 ? 359  GLU C N   1 
ATOM   10027 C  CA  . GLU C 1 370 ? 16.614  -14.496 -66.746  1.00 15.57 ? 359  GLU C CA  1 
ATOM   10028 C  C   . GLU C 1 370 ? 15.546  -13.521 -66.229  1.00 15.61 ? 359  GLU C C   1 
ATOM   10029 O  O   . GLU C 1 370 ? 14.789  -12.942 -67.016  1.00 14.38 ? 359  GLU C O   1 
ATOM   10030 C  CB  . GLU C 1 370 ? 16.084  -15.941 -66.752  1.00 16.82 ? 359  GLU C CB  1 
ATOM   10031 C  CG  . GLU C 1 370 ? 14.763  -16.123 -67.513  1.00 18.94 ? 359  GLU C CG  1 
ATOM   10032 C  CD  . GLU C 1 370 ? 14.516  -17.560 -67.944  1.00 19.76 ? 359  GLU C CD  1 
ATOM   10033 O  OE1 . GLU C 1 370 ? 15.089  -18.461 -67.312  1.00 20.37 ? 359  GLU C OE1 1 
ATOM   10034 O  OE2 . GLU C 1 370 ? 13.768  -17.779 -68.934  1.00 23.80 ? 359  GLU C OE2 1 
ATOM   10035 N  N   . GLU C 1 371 ? 15.504  -13.369 -64.896  1.00 15.65 ? 360  GLU C N   1 
ATOM   10036 C  CA  . GLU C 1 371 ? 14.501  -12.582 -64.151  1.00 13.62 ? 360  GLU C CA  1 
ATOM   10037 C  C   . GLU C 1 371 ? 14.860  -11.111 -63.989  1.00 12.48 ? 360  GLU C C   1 
ATOM   10038 O  O   . GLU C 1 371 ? 13.987  -10.294 -63.782  1.00 8.15  ? 360  GLU C O   1 
ATOM   10039 C  CB  . GLU C 1 371 ? 14.353  -13.162 -62.729  1.00 13.87 ? 360  GLU C CB  1 
ATOM   10040 C  CG  . GLU C 1 371 ? 13.796  -14.556 -62.694  1.00 14.01 ? 360  GLU C CG  1 
ATOM   10041 C  CD  . GLU C 1 371 ? 14.839  -15.645 -62.800  1.00 15.73 ? 360  GLU C CD  1 
ATOM   10042 O  OE1 . GLU C 1 371 ? 16.053  -15.397 -62.526  1.00 15.17 ? 360  GLU C OE1 1 
ATOM   10043 O  OE2 . GLU C 1 371 ? 14.431  -16.773 -63.176  1.00 15.69 ? 360  GLU C OE2 1 
ATOM   10044 N  N   . ARG C 1 372 ? 16.147  -10.777 -64.094  1.00 13.91 ? 361  ARG C N   1 
ATOM   10045 C  CA  . ARG C 1 372 ? 16.644  -9.419  -63.785  1.00 14.41 ? 361  ARG C CA  1 
ATOM   10046 C  C   . ARG C 1 372 ? 15.831  -8.253  -64.369  1.00 16.16 ? 361  ARG C C   1 
ATOM   10047 O  O   . ARG C 1 372 ? 15.372  -7.375  -63.639  1.00 12.67 ? 361  ARG C O   1 
ATOM   10048 C  CB  . ARG C 1 372 ? 18.132  -9.275  -64.189  1.00 15.50 ? 361  ARG C CB  1 
ATOM   10049 C  CG  . ARG C 1 372 ? 18.687  -7.845  -63.989  1.00 12.75 ? 361  ARG C CG  1 
ATOM   10050 C  CD  . ARG C 1 372 ? 20.145  -7.712  -64.302  1.00 12.23 ? 361  ARG C CD  1 
ATOM   10051 N  NE  . ARG C 1 372 ? 20.349  -7.749  -65.763  1.00 4.47  ? 361  ARG C NE  1 
ATOM   10052 C  CZ  . ARG C 1 372 ? 20.516  -6.694  -66.541  1.00 10.75 ? 361  ARG C CZ  1 
ATOM   10053 N  NH1 . ARG C 1 372 ? 20.559  -5.476  -66.063  1.00 5.64  ? 361  ARG C NH1 1 
ATOM   10054 N  NH2 . ARG C 1 372 ? 20.644  -6.865  -67.854  1.00 9.86  ? 361  ARG C NH2 1 
ATOM   10055 N  N   . MET C 1 373 ? 15.695  -8.191  -65.696  1.00 16.53 ? 362  MET C N   1 
ATOM   10056 C  CA  . MET C 1 373 ? 14.999  -7.069  -66.276  1.00 17.73 ? 362  MET C CA  1 
ATOM   10057 C  C   . MET C 1 373 ? 13.528  -6.985  -65.840  1.00 17.46 ? 362  MET C C   1 
ATOM   10058 O  O   . MET C 1 373 ? 13.041  -5.909  -65.532  1.00 15.03 ? 362  MET C O   1 
ATOM   10059 C  CB  . MET C 1 373 ? 15.136  -7.076  -67.789  1.00 18.14 ? 362  MET C CB  1 
ATOM   10060 C  CG  . MET C 1 373 ? 16.572  -6.809  -68.226  1.00 17.34 ? 362  MET C CG  1 
ATOM   10061 S  SD  . MET C 1 373 ? 16.829  -6.559  -69.981  1.00 24.15 ? 362  MET C SD  1 
ATOM   10062 C  CE  . MET C 1 373 ? 16.392  -4.824  -70.139  1.00 17.75 ? 362  MET C CE  1 
ATOM   10063 N  N   . SER C 1 374 ? 12.840  -8.118  -65.810  1.00 18.02 ? 363  SER C N   1 
ATOM   10064 C  CA  . SER C 1 374 ? 11.418  -8.169  -65.501  1.00 19.25 ? 363  SER C CA  1 
ATOM   10065 C  C   . SER C 1 374 ? 11.185  -7.896  -64.019  1.00 19.43 ? 363  SER C C   1 
ATOM   10066 O  O   . SER C 1 374 ? 10.194  -7.269  -63.640  1.00 19.05 ? 363  SER C O   1 
ATOM   10067 C  CB  . SER C 1 374 ? 10.860  -9.538  -65.860  1.00 20.84 ? 363  SER C CB  1 
ATOM   10068 O  OG  . SER C 1 374 ? 10.892  -9.714  -67.285  1.00 25.69 ? 363  SER C OG  1 
ATOM   10069 N  N   . VAL C 1 375 ? 12.104  -8.373  -63.190  1.00 18.21 ? 364  VAL C N   1 
ATOM   10070 C  CA  . VAL C 1 375 ? 12.018  -8.079  -61.761  1.00 18.39 ? 364  VAL C CA  1 
ATOM   10071 C  C   . VAL C 1 375 ? 12.104  -6.535  -61.506  1.00 18.37 ? 364  VAL C C   1 
ATOM   10072 O  O   . VAL C 1 375 ? 11.378  -5.993  -60.664  1.00 18.17 ? 364  VAL C O   1 
ATOM   10073 C  CB  . VAL C 1 375 ? 13.063  -8.899  -60.968  1.00 18.72 ? 364  VAL C CB  1 
ATOM   10074 C  CG1 . VAL C 1 375 ? 13.391  -8.257  -59.631  1.00 15.47 ? 364  VAL C CG1 1 
ATOM   10075 C  CG2 . VAL C 1 375 ? 12.551  -10.322 -60.751  1.00 19.88 ? 364  VAL C CG2 1 
ATOM   10076 N  N   . ILE C 1 376 ? 12.945  -5.825  -62.264  1.00 17.76 ? 365  ILE C N   1 
ATOM   10077 C  CA  . ILE C 1 376 ? 13.177  -4.414  -61.976  1.00 15.85 ? 365  ILE C CA  1 
ATOM   10078 C  C   . ILE C 1 376 ? 11.962  -3.646  -62.436  1.00 16.69 ? 365  ILE C C   1 
ATOM   10079 O  O   . ILE C 1 376 ? 11.466  -2.766  -61.740  1.00 16.72 ? 365  ILE C O   1 
ATOM   10080 C  CB  . ILE C 1 376 ? 14.446  -3.878  -62.635  1.00 15.40 ? 365  ILE C CB  1 
ATOM   10081 C  CG1 . ILE C 1 376 ? 15.705  -4.584  -62.116  1.00 14.43 ? 365  ILE C CG1 1 
ATOM   10082 C  CG2 . ILE C 1 376 ? 14.579  -2.336  -62.452  1.00 16.68 ? 365  ILE C CG2 1 
ATOM   10083 C  CD1 . ILE C 1 376 ? 16.914  -4.437  -63.103  1.00 14.40 ? 365  ILE C CD1 1 
ATOM   10084 N  N   . TRP C 1 377 ? 11.465  -3.996  -63.621  1.00 16.57 ? 366  TRP C N   1 
ATOM   10085 C  CA  . TRP C 1 377 ? 10.257  -3.398  -64.132  1.00 15.49 ? 366  TRP C CA  1 
ATOM   10086 C  C   . TRP C 1 377 ? 9.169   -3.508  -63.081  1.00 12.55 ? 366  TRP C C   1 
ATOM   10087 O  O   . TRP C 1 377 ? 8.583   -2.518  -62.711  1.00 9.01  ? 366  TRP C O   1 
ATOM   10088 C  CB  . TRP C 1 377 ? 9.827   -4.053  -65.471  1.00 16.07 ? 366  TRP C CB  1 
ATOM   10089 C  CG  . TRP C 1 377 ? 8.728   -3.298  -66.168  1.00 17.19 ? 366  TRP C CG  1 
ATOM   10090 C  CD1 . TRP C 1 377 ? 7.372   -3.549  -66.103  1.00 18.01 ? 366  TRP C CD1 1 
ATOM   10091 C  CD2 . TRP C 1 377 ? 8.871   -2.137  -66.977  1.00 17.35 ? 366  TRP C CD2 1 
ATOM   10092 N  NE1 . TRP C 1 377 ? 6.681   -2.613  -66.819  1.00 18.16 ? 366  TRP C NE1 1 
ATOM   10093 C  CE2 . TRP C 1 377 ? 7.576   -1.729  -67.362  1.00 19.36 ? 366  TRP C CE2 1 
ATOM   10094 C  CE3 . TRP C 1 377 ? 9.968   -1.374  -67.394  1.00 18.26 ? 366  TRP C CE3 1 
ATOM   10095 C  CZ2 . TRP C 1 377 ? 7.361   -0.608  -68.157  1.00 15.36 ? 366  TRP C CZ2 1 
ATOM   10096 C  CZ3 . TRP C 1 377 ? 9.753   -0.287  -68.177  1.00 15.46 ? 366  TRP C CZ3 1 
ATOM   10097 C  CH2 . TRP C 1 377 ? 8.455   0.096   -68.546  1.00 17.81 ? 366  TRP C CH2 1 
ATOM   10098 N  N   . ASP C 1 378 ? 8.892   -4.720  -62.629  1.00 13.67 ? 367  ASP C N   1 
ATOM   10099 C  CA  . ASP C 1 378 ? 7.823   -4.954  -61.679  1.00 15.39 ? 367  ASP C CA  1 
ATOM   10100 C  C   . ASP C 1 378 ? 8.007   -4.027  -60.498  1.00 16.23 ? 367  ASP C C   1 
ATOM   10101 O  O   . ASP C 1 378 ? 7.103   -3.279  -60.102  1.00 18.78 ? 367  ASP C O   1 
ATOM   10102 C  CB  . ASP C 1 378 ? 7.845   -6.425  -61.185  1.00 15.74 ? 367  ASP C CB  1 
ATOM   10103 C  CG  . ASP C 1 378 ? 6.654   -6.773  -60.363  1.00 15.62 ? 367  ASP C CG  1 
ATOM   10104 O  OD1 . ASP C 1 378 ? 5.561   -6.870  -60.964  1.00 20.30 ? 367  ASP C OD1 1 
ATOM   10105 O  OD2 . ASP C 1 378 ? 6.788   -6.941  -59.105  1.00 17.72 ? 367  ASP C OD2 1 
ATOM   10106 N  N   . LYS C 1 379 ? 9.210   -4.069  -59.965  1.00 16.88 ? 368  LYS C N   1 
ATOM   10107 C  CA  . LYS C 1 379 ? 9.501   -3.579  -58.604  1.00 15.89 ? 368  LYS C CA  1 
ATOM   10108 C  C   . LYS C 1 379 ? 9.746   -2.038  -58.488  1.00 15.43 ? 368  LYS C C   1 
ATOM   10109 O  O   . LYS C 1 379 ? 9.611   -1.454  -57.405  1.00 13.56 ? 368  LYS C O   1 
ATOM   10110 C  CB  . LYS C 1 379 ? 10.762  -4.321  -58.091  1.00 17.67 ? 368  LYS C CB  1 
ATOM   10111 C  CG  . LYS C 1 379 ? 10.656  -5.819  -57.899  1.00 18.43 ? 368  LYS C CG  1 
ATOM   10112 C  CD  . LYS C 1 379 ? 9.775   -6.135  -56.710  1.00 20.83 ? 368  LYS C CD  1 
ATOM   10113 C  CE  . LYS C 1 379 ? 10.451  -5.752  -55.409  1.00 22.25 ? 368  LYS C CE  1 
ATOM   10114 N  NZ  . LYS C 1 379 ? 9.763   -6.341  -54.236  1.00 25.06 ? 368  LYS C NZ  1 
ATOM   10115 N  N   . ALA C 1 380 ? 10.115  -1.404  -59.595  1.00 15.68 ? 369  ALA C N   1 
ATOM   10116 C  CA  . ALA C 1 380 ? 10.585  -0.009  -59.618  1.00 16.88 ? 369  ALA C CA  1 
ATOM   10117 C  C   . ALA C 1 380 ? 9.715   0.911   -60.482  1.00 18.21 ? 369  ALA C C   1 
ATOM   10118 O  O   . ALA C 1 380 ? 9.508   2.104   -60.163  1.00 17.48 ? 369  ALA C O   1 
ATOM   10119 C  CB  . ALA C 1 380 ? 12.056  0.055   -60.146  1.00 17.16 ? 369  ALA C CB  1 
ATOM   10120 N  N   . VAL C 1 381 ? 9.270   0.373   -61.621  1.00 18.37 ? 370  VAL C N   1 
ATOM   10121 C  CA  . VAL C 1 381 ? 8.549   1.141   -62.623  1.00 17.51 ? 370  VAL C CA  1 
ATOM   10122 C  C   . VAL C 1 381 ? 7.061   0.958   -62.466  1.00 18.54 ? 370  VAL C C   1 
ATOM   10123 O  O   . VAL C 1 381 ? 6.320   1.942   -62.517  1.00 22.06 ? 370  VAL C O   1 
ATOM   10124 C  CB  . VAL C 1 381 ? 8.960   0.717   -64.046  1.00 15.79 ? 370  VAL C CB  1 
ATOM   10125 C  CG1 . VAL C 1 381 ? 8.133   1.447   -65.100  1.00 19.33 ? 370  VAL C CG1 1 
ATOM   10126 C  CG2 . VAL C 1 381 ? 10.414  0.997   -64.241  1.00 11.88 ? 370  VAL C CG2 1 
ATOM   10127 N  N   . VAL C 1 382 ? 6.600   -0.278  -62.264  1.00 17.62 ? 371  VAL C N   1 
ATOM   10128 C  CA  . VAL C 1 382 ? 5.161   -0.488  -62.066  1.00 15.90 ? 371  VAL C CA  1 
ATOM   10129 C  C   . VAL C 1 382 ? 4.724   0.374   -60.889  1.00 16.43 ? 371  VAL C C   1 
ATOM   10130 O  O   . VAL C 1 382 ? 3.690   1.053   -60.922  1.00 14.90 ? 371  VAL C O   1 
ATOM   10131 C  CB  . VAL C 1 382 ? 4.794   -1.973  -61.849  1.00 13.54 ? 371  VAL C CB  1 
ATOM   10132 C  CG1 . VAL C 1 382 ? 3.293   -2.121  -61.661  1.00 12.13 ? 371  VAL C CG1 1 
ATOM   10133 C  CG2 . VAL C 1 382 ? 5.227   -2.773  -63.074  1.00 16.00 ? 371  VAL C CG2 1 
ATOM   10134 N  N   . THR C 1 383 ? 5.579   0.360   -59.867  1.00 16.16 ? 372  THR C N   1 
ATOM   10135 C  CA  . THR C 1 383 ? 5.330   1.013   -58.601  1.00 14.58 ? 372  THR C CA  1 
ATOM   10136 C  C   . THR C 1 383 ? 5.507   2.536   -58.641  1.00 14.52 ? 372  THR C C   1 
ATOM   10137 O  O   . THR C 1 383 ? 5.374   3.227   -57.613  1.00 14.71 ? 372  THR C O   1 
ATOM   10138 C  CB  . THR C 1 383 ? 6.293   0.421   -57.579  1.00 12.72 ? 372  THR C CB  1 
ATOM   10139 O  OG1 . THR C 1 383 ? 7.639   0.629   -58.028  1.00 15.32 ? 372  THR C OG1 1 
ATOM   10140 C  CG2 . THR C 1 383 ? 6.066   -1.074  -57.451  1.00 9.55  ? 372  THR C CG2 1 
ATOM   10141 N  N   . GLY C 1 384 ? 5.804   3.087   -59.805  1.00 13.97 ? 373  GLY C N   1 
ATOM   10142 C  CA  . GLY C 1 384 ? 6.039   4.511   -59.917  1.00 13.54 ? 373  GLY C CA  1 
ATOM   10143 C  C   . GLY C 1 384 ? 7.370   5.044   -59.433  1.00 14.79 ? 373  GLY C C   1 
ATOM   10144 O  O   . GLY C 1 384 ? 7.616   6.243   -59.519  1.00 16.94 ? 373  GLY C O   1 
ATOM   10145 N  N   . LYS C 1 385 ? 8.247   4.172   -58.958  1.00 13.64 ? 374  LYS C N   1 
ATOM   10146 C  CA  . LYS C 1 385 ? 9.572   4.589   -58.509  1.00 14.34 ? 374  LYS C CA  1 
ATOM   10147 C  C   . LYS C 1 385 ? 10.497  5.177   -59.598  1.00 14.70 ? 374  LYS C C   1 
ATOM   10148 O  O   . LYS C 1 385 ? 11.183  6.166   -59.371  1.00 11.83 ? 374  LYS C O   1 
ATOM   10149 C  CB  . LYS C 1 385 ? 10.232  3.421   -57.786  1.00 13.50 ? 374  LYS C CB  1 
ATOM   10150 C  CG  . LYS C 1 385 ? 9.496   3.100   -56.515  1.00 15.18 ? 374  LYS C CG  1 
ATOM   10151 C  CD  . LYS C 1 385 ? 10.233  2.152   -55.643  1.00 10.33 ? 374  LYS C CD  1 
ATOM   10152 C  CE  . LYS C 1 385 ? 9.387   1.811   -54.464  1.00 14.16 ? 374  LYS C CE  1 
ATOM   10153 N  NZ  . LYS C 1 385 ? 10.160  2.006   -53.241  1.00 7.85  ? 374  LYS C NZ  1 
ATOM   10154 N  N   . MET C 1 386 ? 10.479  4.615   -60.807  1.00 17.97 ? 375  MET C N   1 
ATOM   10155 C  CA  . MET C 1 386 ? 11.259  5.188   -61.918  1.00 16.96 ? 375  MET C CA  1 
ATOM   10156 C  C   . MET C 1 386 ? 10.457  5.165   -63.196  1.00 17.38 ? 375  MET C C   1 
ATOM   10157 O  O   . MET C 1 386 ? 9.446   4.481   -63.253  1.00 18.41 ? 375  MET C O   1 
ATOM   10158 C  CB  . MET C 1 386 ? 12.568  4.406   -62.125  1.00 18.02 ? 375  MET C CB  1 
ATOM   10159 C  CG  . MET C 1 386 ? 12.470  3.114   -62.888  1.00 16.38 ? 375  MET C CG  1 
ATOM   10160 S  SD  . MET C 1 386 ? 14.108  2.389   -63.236  1.00 17.50 ? 375  MET C SD  1 
ATOM   10161 C  CE  . MET C 1 386 ? 14.676  2.163   -61.496  1.00 4.41  ? 375  MET C CE  1 
ATOM   10162 N  N   . ASP C 1 387 ? 10.916  5.864   -64.227  1.00 18.66 ? 376  ASP C N   1 
ATOM   10163 C  CA  . ASP C 1 387 ? 10.270  5.761   -65.557  1.00 19.51 ? 376  ASP C CA  1 
ATOM   10164 C  C   . ASP C 1 387 ? 10.993  4.812   -66.561  1.00 20.99 ? 376  ASP C C   1 
ATOM   10165 O  O   . ASP C 1 387 ? 12.120  4.373   -66.325  1.00 22.30 ? 376  ASP C O   1 
ATOM   10166 C  CB  . ASP C 1 387 ? 9.896   7.156   -66.138  1.00 19.58 ? 376  ASP C CB  1 
ATOM   10167 C  CG  . ASP C 1 387 ? 11.047  7.904   -66.749  1.00 19.20 ? 376  ASP C CG  1 
ATOM   10168 O  OD1 . ASP C 1 387 ? 12.052  7.296   -67.142  1.00 18.64 ? 376  ASP C OD1 1 
ATOM   10169 O  OD2 . ASP C 1 387 ? 10.939  9.151   -66.853  1.00 18.98 ? 376  ASP C OD2 1 
ATOM   10170 N  N   . GLU C 1 388 ? 10.327  4.495   -67.679  1.00 22.10 ? 377  GLU C N   1 
ATOM   10171 C  CA  . GLU C 1 388 ? 10.848  3.531   -68.658  1.00 21.01 ? 377  GLU C CA  1 
ATOM   10172 C  C   . GLU C 1 388 ? 12.254  3.891   -69.083  1.00 20.51 ? 377  GLU C C   1 
ATOM   10173 O  O   . GLU C 1 388 ? 13.097  3.020   -69.263  1.00 21.53 ? 377  GLU C O   1 
ATOM   10174 C  CB  . GLU C 1 388 ? 9.923   3.432   -69.878  1.00 21.95 ? 377  GLU C CB  1 
ATOM   10175 C  CG  . GLU C 1 388 ? 9.754   4.718   -70.683  1.00 23.42 ? 377  GLU C CG  1 
ATOM   10176 C  CD  . GLU C 1 388 ? 8.804   4.536   -71.845  1.00 25.21 ? 377  GLU C CD  1 
ATOM   10177 O  OE1 . GLU C 1 388 ? 7.998   3.587   -71.789  1.00 32.79 ? 377  GLU C OE1 1 
ATOM   10178 O  OE2 . GLU C 1 388 ? 8.869   5.316   -72.818  1.00 31.34 ? 377  GLU C OE2 1 
ATOM   10179 N  N   . ASN C 1 389 ? 12.511  5.186   -69.208  1.00 20.03 ? 378  ASN C N   1 
ATOM   10180 C  CA  . ASN C 1 389 ? 13.829  5.690   -69.635  1.00 19.33 ? 378  ASN C CA  1 
ATOM   10181 C  C   . ASN C 1 389 ? 14.910  5.554   -68.556  1.00 17.35 ? 378  ASN C C   1 
ATOM   10182 O  O   . ASN C 1 389 ? 16.075  5.331   -68.879  1.00 17.39 ? 378  ASN C O   1 
ATOM   10183 C  CB  . ASN C 1 389 ? 13.714  7.151   -70.114  1.00 20.88 ? 378  ASN C CB  1 
ATOM   10184 C  CG  . ASN C 1 389 ? 12.614  7.350   -71.173  1.00 20.65 ? 378  ASN C CG  1 
ATOM   10185 O  OD1 . ASN C 1 389 ? 11.528  7.829   -70.863  1.00 22.12 ? 378  ASN C OD1 1 
ATOM   10186 N  ND2 . ASN C 1 389 ? 12.908  6.984   -72.426  1.00 19.92 ? 378  ASN C ND2 1 
ATOM   10187 N  N   . GLN C 1 390 ? 14.529  5.682   -67.280  1.00 16.24 ? 379  GLN C N   1 
ATOM   10188 C  CA  . GLN C 1 390 ? 15.415  5.337   -66.195  1.00 15.25 ? 379  GLN C CA  1 
ATOM   10189 C  C   . GLN C 1 390 ? 15.597  3.792   -66.064  1.00 14.89 ? 379  GLN C C   1 
ATOM   10190 O  O   . GLN C 1 390 ? 16.696  3.327   -65.760  1.00 13.64 ? 379  GLN C O   1 
ATOM   10191 C  CB  . GLN C 1 390 ? 14.914  5.999   -64.908  1.00 15.82 ? 379  GLN C CB  1 
ATOM   10192 C  CG  . GLN C 1 390 ? 15.692  5.676   -63.620  1.00 17.84 ? 379  GLN C CG  1 
ATOM   10193 C  CD  . GLN C 1 390 ? 17.136  6.165   -63.548  1.00 20.28 ? 379  GLN C CD  1 
ATOM   10194 O  OE1 . GLN C 1 390 ? 17.695  6.678   -64.513  1.00 20.22 ? 379  GLN C OE1 1 
ATOM   10195 N  NE2 . GLN C 1 390 ? 17.751  5.998   -62.359  1.00 12.81 ? 379  GLN C NE2 1 
ATOM   10196 N  N   . PHE C 1 391 ? 14.542  3.005   -66.301  1.00 14.27 ? 380  PHE C N   1 
ATOM   10197 C  CA  . PHE C 1 391 ? 14.639  1.533   -66.425  1.00 15.30 ? 380  PHE C CA  1 
ATOM   10198 C  C   . PHE C 1 391 ? 15.748  1.114   -67.403  1.00 15.71 ? 380  PHE C C   1 
ATOM   10199 O  O   . PHE C 1 391 ? 16.632  0.346   -67.067  1.00 15.46 ? 380  PHE C O   1 
ATOM   10200 C  CB  . PHE C 1 391 ? 13.314  0.962   -66.924  1.00 13.16 ? 380  PHE C CB  1 
ATOM   10201 C  CG  . PHE C 1 391 ? 13.329  -0.516  -67.196  1.00 12.90 ? 380  PHE C CG  1 
ATOM   10202 C  CD1 . PHE C 1 391 ? 13.334  -1.430  -66.164  1.00 7.74  ? 380  PHE C CD1 1 
ATOM   10203 C  CD2 . PHE C 1 391 ? 13.299  -1.000  -68.503  1.00 9.66  ? 380  PHE C CD2 1 
ATOM   10204 C  CE1 . PHE C 1 391 ? 13.327  -2.783  -66.412  1.00 7.72  ? 380  PHE C CE1 1 
ATOM   10205 C  CE2 . PHE C 1 391 ? 13.301  -2.372  -68.761  1.00 12.30 ? 380  PHE C CE2 1 
ATOM   10206 C  CZ  . PHE C 1 391 ? 13.302  -3.256  -67.751  1.00 10.68 ? 380  PHE C CZ  1 
ATOM   10207 N  N   . VAL C 1 392 ? 15.700  1.621   -68.623  1.00 16.90 ? 381  VAL C N   1 
ATOM   10208 C  CA  . VAL C 1 392 ? 16.765  1.343   -69.569  1.00 16.58 ? 381  VAL C CA  1 
ATOM   10209 C  C   . VAL C 1 392 ? 18.157  1.749   -69.070  1.00 18.70 ? 381  VAL C C   1 
ATOM   10210 O  O   . VAL C 1 392 ? 19.136  1.036   -69.265  1.00 21.70 ? 381  VAL C O   1 
ATOM   10211 C  CB  . VAL C 1 392 ? 16.465  2.043   -70.923  1.00 17.65 ? 381  VAL C CB  1 
ATOM   10212 C  CG1 . VAL C 1 392 ? 17.624  1.921   -71.872  1.00 14.00 ? 381  VAL C CG1 1 
ATOM   10213 C  CG2 . VAL C 1 392 ? 15.211  1.510   -71.502  1.00 11.04 ? 381  VAL C CG2 1 
ATOM   10214 N  N   . ALA C 1 393 ? 18.270  2.901   -68.437  1.00 18.95 ? 382  ALA C N   1 
ATOM   10215 C  CA  . ALA C 1 393 ? 19.575  3.363   -68.010  1.00 18.05 ? 382  ALA C CA  1 
ATOM   10216 C  C   . ALA C 1 393 ? 20.201  2.431   -66.986  1.00 17.41 ? 382  ALA C C   1 
ATOM   10217 O  O   . ALA C 1 393 ? 21.375  2.138   -67.071  1.00 18.70 ? 382  ALA C O   1 
ATOM   10218 C  CB  . ALA C 1 393 ? 19.486  4.796   -67.472  1.00 19.37 ? 382  ALA C CB  1 
ATOM   10219 N  N   . VAL C 1 394 ? 19.402  1.949   -66.039  1.00 17.71 ? 383  VAL C N   1 
ATOM   10220 C  CA  . VAL C 1 394 ? 19.866  0.983   -64.997  1.00 16.27 ? 383  VAL C CA  1 
ATOM   10221 C  C   . VAL C 1 394 ? 19.943  -0.492  -65.455  1.00 14.64 ? 383  VAL C C   1 
ATOM   10222 O  O   . VAL C 1 394 ? 20.303  -1.367  -64.680  1.00 9.57  ? 383  VAL C O   1 
ATOM   10223 C  CB  . VAL C 1 394 ? 18.966  1.050   -63.743  1.00 16.47 ? 383  VAL C CB  1 
ATOM   10224 C  CG1 . VAL C 1 394 ? 19.033  2.452   -63.139  1.00 18.55 ? 383  VAL C CG1 1 
ATOM   10225 C  CG2 . VAL C 1 394 ? 17.520  0.666   -64.086  1.00 15.65 ? 383  VAL C CG2 1 
ATOM   10226 N  N   . THR C 1 395 ? 19.625  -0.747  -66.723  1.00 13.87 ? 384  THR C N   1 
ATOM   10227 C  CA  . THR C 1 395 ? 19.629  -2.094  -67.243  1.00 13.99 ? 384  THR C CA  1 
ATOM   10228 C  C   . THR C 1 395 ? 20.516  -2.266  -68.487  1.00 14.76 ? 384  THR C C   1 
ATOM   10229 O  O   . THR C 1 395 ? 20.847  -3.407  -68.818  1.00 14.24 ? 384  THR C O   1 
ATOM   10230 C  CB  . THR C 1 395 ? 18.198  -2.652  -67.499  1.00 13.64 ? 384  THR C CB  1 
ATOM   10231 O  OG1 . THR C 1 395 ? 17.591  -1.996  -68.606  1.00 13.68 ? 384  THR C OG1 1 
ATOM   10232 C  CG2 . THR C 1 395 ? 17.285  -2.482  -66.281  1.00 10.44 ? 384  THR C CG2 1 
ATOM   10233 N  N   . SER C 1 396 ? 20.905  -1.159  -69.132  1.00 14.53 ? 385  SER C N   1 
ATOM   10234 C  CA  . SER C 1 396 ? 21.879  -1.188  -70.236  1.00 14.88 ? 385  SER C CA  1 
ATOM   10235 C  C   . SER C 1 396 ? 22.811  0.013   -70.335  1.00 13.94 ? 385  SER C C   1 
ATOM   10236 O  O   . SER C 1 396 ? 24.008  -0.162  -70.502  1.00 12.91 ? 385  SER C O   1 
ATOM   10237 C  CB  . SER C 1 396 ? 21.153  -1.374  -71.568  1.00 15.51 ? 385  SER C CB  1 
ATOM   10238 O  OG  . SER C 1 396 ? 20.493  -0.206  -71.958  1.00 17.09 ? 385  SER C OG  1 
ATOM   10239 N  N   . THR C 1 397 ? 22.270  1.224   -70.212  1.00 16.14 ? 386  THR C N   1 
ATOM   10240 C  CA  . THR C 1 397 ? 23.047  2.471   -70.448  1.00 15.92 ? 386  THR C CA  1 
ATOM   10241 C  C   . THR C 1 397 ? 24.094  2.843   -69.405  1.00 15.62 ? 386  THR C C   1 
ATOM   10242 O  O   . THR C 1 397 ? 25.217  3.089   -69.747  1.00 17.94 ? 386  THR C O   1 
ATOM   10243 C  CB  . THR C 1 397 ? 22.101  3.665   -70.688  1.00 17.28 ? 386  THR C CB  1 
ATOM   10244 O  OG1 . THR C 1 397 ? 21.050  3.241   -71.556  1.00 14.54 ? 386  THR C OG1 1 
ATOM   10245 C  CG2 . THR C 1 397 ? 22.831  4.838   -71.326  1.00 19.57 ? 386  THR C CG2 1 
ATOM   10246 N  N   . ASN C 1 398 ? 23.767  2.874   -68.121  1.00 15.28 ? 387  ASN C N   1 
ATOM   10247 C  CA  . ASN C 1 398 ? 24.780  3.279   -67.158  1.00 14.54 ? 387  ASN C CA  1 
ATOM   10248 C  C   . ASN C 1 398 ? 26.004  2.373   -67.191  1.00 13.75 ? 387  ASN C C   1 
ATOM   10249 O  O   . ASN C 1 398 ? 27.137  2.843   -67.154  1.00 15.37 ? 387  ASN C O   1 
ATOM   10250 C  CB  . ASN C 1 398 ? 24.169  3.375   -65.749  1.00 15.08 ? 387  ASN C CB  1 
ATOM   10251 C  CG  . ASN C 1 398 ? 23.180  4.557   -65.613  1.00 17.60 ? 387  ASN C CG  1 
ATOM   10252 O  OD1 . ASN C 1 398 ? 23.203  5.521   -66.401  1.00 19.28 ? 387  ASN C OD1 1 
ATOM   10253 N  ND2 . ASN C 1 398 ? 22.317  4.484   -64.608  1.00 17.37 ? 387  ASN C ND2 1 
ATOM   10254 N  N   . ALA C 1 399 ? 25.759  1.075   -67.295  1.00 13.80 ? 388  ALA C N   1 
ATOM   10255 C  CA  . ALA C 1 399 ? 26.786  0.047   -67.331  1.00 15.34 ? 388  ALA C CA  1 
ATOM   10256 C  C   . ALA C 1 399 ? 27.640  0.234   -68.573  1.00 16.68 ? 388  ALA C C   1 
ATOM   10257 O  O   . ALA C 1 399 ? 28.871  0.216   -68.532  1.00 17.70 ? 388  ALA C O   1 
ATOM   10258 C  CB  . ALA C 1 399 ? 26.121  -1.335  -67.344  1.00 16.14 ? 388  ALA C CB  1 
ATOM   10259 N  N   . ALA C 1 400 ? 26.977  0.429   -69.691  1.00 16.98 ? 389  ALA C N   1 
ATOM   10260 C  CA  . ALA C 1 400 ? 27.681  0.756   -70.912  1.00 17.59 ? 389  ALA C CA  1 
ATOM   10261 C  C   . ALA C 1 400 ? 28.711  1.870   -70.659  1.00 18.17 ? 389  ALA C C   1 
ATOM   10262 O  O   . ALA C 1 400 ? 29.905  1.679   -70.896  1.00 21.49 ? 389  ALA C O   1 
ATOM   10263 C  CB  . ALA C 1 400 ? 26.665  1.157   -71.974  1.00 17.62 ? 389  ALA C CB  1 
ATOM   10264 N  N   . LYS C 1 401 ? 28.272  3.017   -70.144  1.00 18.70 ? 390  LYS C N   1 
ATOM   10265 C  CA  . LYS C 1 401 ? 29.170  4.157   -69.930  1.00 18.09 ? 390  LYS C CA  1 
ATOM   10266 C  C   . LYS C 1 401 ? 30.287  3.870   -68.909  1.00 18.34 ? 390  LYS C C   1 
ATOM   10267 O  O   . LYS C 1 401 ? 31.428  4.337   -69.067  1.00 19.66 ? 390  LYS C O   1 
ATOM   10268 C  CB  . LYS C 1 401 ? 28.397  5.396   -69.481  1.00 18.42 ? 390  LYS C CB  1 
ATOM   10269 C  CG  . LYS C 1 401 ? 27.378  5.904   -70.436  1.00 16.64 ? 390  LYS C CG  1 
ATOM   10270 C  CD  . LYS C 1 401 ? 26.396  6.841   -69.737  1.00 17.76 ? 390  LYS C CD  1 
ATOM   10271 C  CE  . LYS C 1 401 ? 25.272  7.258   -70.677  1.00 21.02 ? 390  LYS C CE  1 
ATOM   10272 N  NZ  . LYS C 1 401 ? 24.361  8.264   -70.085  1.00 23.33 ? 390  LYS C NZ  1 
ATOM   10273 N  N   . VAL C 1 402 ? 29.951  3.104   -67.873  1.00 18.80 ? 391  VAL C N   1 
ATOM   10274 C  CA  . VAL C 1 402 ? 30.917  2.663   -66.846  1.00 16.87 ? 391  VAL C CA  1 
ATOM   10275 C  C   . VAL C 1 402 ? 32.046  1.855   -67.457  1.00 18.78 ? 391  VAL C C   1 
ATOM   10276 O  O   . VAL C 1 402 ? 33.190  2.005   -67.022  1.00 20.75 ? 391  VAL C O   1 
ATOM   10277 C  CB  . VAL C 1 402 ? 30.219  1.803   -65.719  1.00 17.68 ? 391  VAL C CB  1 
ATOM   10278 C  CG1 . VAL C 1 402 ? 31.203  1.235   -64.691  1.00 7.92  ? 391  VAL C CG1 1 
ATOM   10279 C  CG2 . VAL C 1 402 ? 29.169  2.632   -64.986  1.00 17.10 ? 391  VAL C CG2 1 
ATOM   10280 N  N   . PHE C 1 403 ? 31.733  0.993   -68.443  1.00 16.39 ? 392  PHE C N   1 
ATOM   10281 C  CA  . PHE C 1 403 ? 32.708  0.013   -68.934  1.00 15.30 ? 392  PHE C CA  1 
ATOM   10282 C  C   . PHE C 1 403 ? 33.136  0.325   -70.352  1.00 16.74 ? 392  PHE C C   1 
ATOM   10283 O  O   . PHE C 1 403 ? 33.709  -0.523  -71.020  1.00 18.13 ? 392  PHE C O   1 
ATOM   10284 C  CB  . PHE C 1 403 ? 32.168  -1.415  -68.839  1.00 12.32 ? 392  PHE C CB  1 
ATOM   10285 C  CG  . PHE C 1 403 ? 31.896  -1.858  -67.419  1.00 7.22  ? 392  PHE C CG  1 
ATOM   10286 C  CD1 . PHE C 1 403 ? 32.907  -1.869  -66.476  1.00 12.42 ? 392  PHE C CD1 1 
ATOM   10287 C  CD2 . PHE C 1 403 ? 30.638  -2.236  -67.048  1.00 7.85  ? 392  PHE C CD2 1 
ATOM   10288 C  CE1 . PHE C 1 403 ? 32.629  -2.236  -65.116  1.00 8.97  ? 392  PHE C CE1 1 
ATOM   10289 C  CE2 . PHE C 1 403 ? 30.363  -2.610  -65.716  1.00 11.91 ? 392  PHE C CE2 1 
ATOM   10290 C  CZ  . PHE C 1 403 ? 31.366  -2.613  -64.786  1.00 8.39  ? 392  PHE C CZ  1 
ATOM   10291 N  N   . ASN C 1 404 ? 32.850  1.542   -70.791  1.00 16.97 ? 393  ASN C N   1 
ATOM   10292 C  CA  . ASN C 1 404 ? 33.345  2.065   -72.067  1.00 18.34 ? 393  ASN C CA  1 
ATOM   10293 C  C   . ASN C 1 404 ? 32.717  1.461   -73.318  1.00 19.91 ? 393  ASN C C   1 
ATOM   10294 O  O   . ASN C 1 404 ? 33.362  1.396   -74.378  1.00 20.78 ? 393  ASN C O   1 
ATOM   10295 C  CB  . ASN C 1 404 ? 34.872  1.991   -72.137  1.00 16.98 ? 393  ASN C CB  1 
ATOM   10296 C  CG  . ASN C 1 404 ? 35.475  3.238   -72.767  1.00 20.52 ? 393  ASN C CG  1 
ATOM   10297 O  OD1 . ASN C 1 404 ? 34.743  4.055   -73.361  1.00 15.96 ? 393  ASN C OD1 1 
ATOM   10298 N  ND2 . ASN C 1 404 ? 36.802  3.409   -72.628  1.00 18.29 ? 393  ASN C ND2 1 
ATOM   10299 N  N   . LEU C 1 405 ? 31.442  1.081   -73.204  1.00 20.24 ? 394  LEU C N   1 
ATOM   10300 C  CA  . LEU C 1 405 ? 30.709  0.438   -74.289  1.00 19.67 ? 394  LEU C CA  1 
ATOM   10301 C  C   . LEU C 1 405 ? 29.522  1.280   -74.805  1.00 19.44 ? 394  LEU C C   1 
ATOM   10302 O  O   . LEU C 1 405 ? 28.599  0.723   -75.403  1.00 18.90 ? 394  LEU C O   1 
ATOM   10303 C  CB  . LEU C 1 405 ? 30.215  -0.933  -73.809  1.00 19.97 ? 394  LEU C CB  1 
ATOM   10304 C  CG  . LEU C 1 405 ? 31.278  -1.926  -73.325  1.00 21.07 ? 394  LEU C CG  1 
ATOM   10305 C  CD1 . LEU C 1 405 ? 30.702  -2.965  -72.316  1.00 20.30 ? 394  LEU C CD1 1 
ATOM   10306 C  CD2 . LEU C 1 405 ? 31.890  -2.583  -74.513  1.00 23.10 ? 394  LEU C CD2 1 
ATOM   10307 N  N   . TYR C 1 406 ? 29.537  2.604   -74.570  1.00 18.77 ? 395  TYR C N   1 
ATOM   10308 C  CA  . TYR C 1 406 ? 28.439  3.489   -74.984  1.00 18.76 ? 395  TYR C CA  1 
ATOM   10309 C  C   . TYR C 1 406 ? 28.935  4.306   -76.154  1.00 20.14 ? 395  TYR C C   1 
ATOM   10310 O  O   . TYR C 1 406 ? 30.036  4.836   -76.092  1.00 19.57 ? 395  TYR C O   1 
ATOM   10311 C  CB  . TYR C 1 406 ? 27.996  4.428   -73.862  1.00 18.93 ? 395  TYR C CB  1 
ATOM   10312 C  CG  . TYR C 1 406 ? 26.924  5.458   -74.228  1.00 18.34 ? 395  TYR C CG  1 
ATOM   10313 C  CD1 . TYR C 1 406 ? 25.580  5.112   -74.265  1.00 19.53 ? 395  TYR C CD1 1 
ATOM   10314 C  CD2 . TYR C 1 406 ? 27.258  6.785   -74.513  1.00 18.18 ? 395  TYR C CD2 1 
ATOM   10315 C  CE1 . TYR C 1 406 ? 24.598  6.038   -74.596  1.00 18.99 ? 395  TYR C CE1 1 
ATOM   10316 C  CE2 . TYR C 1 406 ? 26.268  7.726   -74.857  1.00 17.59 ? 395  TYR C CE2 1 
ATOM   10317 C  CZ  . TYR C 1 406 ? 24.949  7.338   -74.892  1.00 17.90 ? 395  TYR C CZ  1 
ATOM   10318 O  OH  . TYR C 1 406 ? 23.967  8.239   -75.198  1.00 19.12 ? 395  TYR C OH  1 
ATOM   10319 N  N   . PRO C 1 407 ? 28.104  4.473   -77.192  1.00 21.25 ? 396  PRO C N   1 
ATOM   10320 C  CA  . PRO C 1 407 ? 26.740  3.987   -77.409  1.00 23.57 ? 396  PRO C CA  1 
ATOM   10321 C  C   . PRO C 1 407 ? 26.572  2.704   -78.226  1.00 23.98 ? 396  PRO C C   1 
ATOM   10322 O  O   . PRO C 1 407 ? 25.454  2.364   -78.568  1.00 24.83 ? 396  PRO C O   1 
ATOM   10323 C  CB  . PRO C 1 407 ? 26.080  5.163   -78.139  1.00 23.06 ? 396  PRO C CB  1 
ATOM   10324 C  CG  . PRO C 1 407 ? 27.232  5.937   -78.756  1.00 22.70 ? 396  PRO C CG  1 
ATOM   10325 C  CD  . PRO C 1 407 ? 28.524  5.355   -78.285  1.00 22.30 ? 396  PRO C CD  1 
ATOM   10326 N  N   . ARG C 1 408 ? 27.666  2.007   -78.531  1.00 25.91 ? 397  ARG C N   1 
ATOM   10327 C  CA  . ARG C 1 408 ? 27.619  0.713   -79.222  1.00 25.42 ? 397  ARG C CA  1 
ATOM   10328 C  C   . ARG C 1 408 ? 26.540  -0.168  -78.609  1.00 25.56 ? 397  ARG C C   1 
ATOM   10329 O  O   . ARG C 1 408 ? 25.815  -0.879  -79.304  1.00 25.39 ? 397  ARG C O   1 
ATOM   10330 C  CB  . ARG C 1 408 ? 28.992  0.012   -79.123  1.00 25.62 ? 397  ARG C CB  1 
ATOM   10331 C  CG  . ARG C 1 408 ? 28.966  -1.485  -79.454  1.00 26.16 ? 397  ARG C CG  1 
ATOM   10332 C  CD  . ARG C 1 408 ? 30.356  -2.122  -79.617  1.00 26.10 ? 397  ARG C CD  1 
ATOM   10333 N  NE  . ARG C 1 408 ? 30.310  -3.251  -80.541  1.00 25.49 ? 397  ARG C NE  1 
ATOM   10334 C  CZ  . ARG C 1 408 ? 31.304  -4.095  -80.776  1.00 27.78 ? 397  ARG C CZ  1 
ATOM   10335 N  NH1 . ARG C 1 408 ? 32.460  -3.975  -80.168  1.00 27.85 ? 397  ARG C NH1 1 
ATOM   10336 N  NH2 . ARG C 1 408 ? 31.134  -5.072  -81.651  1.00 29.32 ? 397  ARG C NH2 1 
ATOM   10337 N  N   . LYS C 1 409 ? 26.476  -0.106  -77.285  1.00 26.31 ? 398  LYS C N   1 
ATOM   10338 C  CA  . LYS C 1 409 ? 25.483  -0.781  -76.470  1.00 26.25 ? 398  LYS C CA  1 
ATOM   10339 C  C   . LYS C 1 409 ? 24.635  0.259   -75.699  1.00 27.57 ? 398  LYS C C   1 
ATOM   10340 O  O   . LYS C 1 409 ? 24.997  1.458   -75.608  1.00 28.06 ? 398  LYS C O   1 
ATOM   10341 C  CB  . LYS C 1 409 ? 26.185  -1.689  -75.458  1.00 25.70 ? 398  LYS C CB  1 
ATOM   10342 C  CG  . LYS C 1 409 ? 27.246  -2.579  -76.030  1.00 25.43 ? 398  LYS C CG  1 
ATOM   10343 C  CD  . LYS C 1 409 ? 26.671  -3.519  -77.060  1.00 24.94 ? 398  LYS C CD  1 
ATOM   10344 C  CE  . LYS C 1 409 ? 27.604  -4.631  -77.418  1.00 23.50 ? 398  LYS C CE  1 
ATOM   10345 N  NZ  . LYS C 1 409 ? 27.039  -5.412  -78.568  1.00 25.24 ? 398  LYS C NZ  1 
ATOM   10346 N  N   . GLY C 1 410 ? 23.522  -0.226  -75.138  1.00 28.17 ? 399  GLY C N   1 
ATOM   10347 C  CA  . GLY C 1 410 ? 22.631  0.566   -74.278  1.00 26.96 ? 399  GLY C CA  1 
ATOM   10348 C  C   . GLY C 1 410 ? 22.023  1.759   -74.976  1.00 27.08 ? 399  GLY C C   1 
ATOM   10349 O  O   . GLY C 1 410 ? 21.707  2.762   -74.326  1.00 25.86 ? 399  GLY C O   1 
ATOM   10350 N  N   . ARG C 1 411 ? 21.854  1.654   -76.302  1.00 26.78 ? 400  ARG C N   1 
ATOM   10351 C  CA  . ARG C 1 411 ? 21.267  2.724   -77.090  1.00 26.67 ? 400  ARG C CA  1 
ATOM   10352 C  C   . ARG C 1 411 ? 20.737  2.316   -78.482  1.00 26.86 ? 400  ARG C C   1 
ATOM   10353 O  O   . ARG C 1 411 ? 21.444  1.722   -79.309  1.00 25.32 ? 400  ARG C O   1 
ATOM   10354 C  CB  . ARG C 1 411 ? 22.256  3.889   -77.247  1.00 27.40 ? 400  ARG C CB  1 
ATOM   10355 C  CG  . ARG C 1 411 ? 21.637  5.110   -77.920  1.00 26.32 ? 400  ARG C CG  1 
ATOM   10356 C  CD  . ARG C 1 411 ? 22.437  6.364   -77.662  1.00 27.16 ? 400  ARG C CD  1 
ATOM   10357 N  NE  . ARG C 1 411 ? 21.693  7.577   -78.032  1.00 29.47 ? 400  ARG C NE  1 
ATOM   10358 C  CZ  . ARG C 1 411 ? 20.844  8.246   -77.241  1.00 27.56 ? 400  ARG C CZ  1 
ATOM   10359 N  NH1 . ARG C 1 411 ? 20.563  7.831   -76.014  1.00 28.61 ? 400  ARG C NH1 1 
ATOM   10360 N  NH2 . ARG C 1 411 ? 20.246  9.334   -77.702  1.00 29.02 ? 400  ARG C NH2 1 
ATOM   10361 N  N   . ILE C 1 412 ? 19.480  2.680   -78.726  1.00 26.81 ? 401  ILE C N   1 
ATOM   10362 C  CA  . ILE C 1 412 ? 18.872  2.590   -80.052  1.00 26.67 ? 401  ILE C CA  1 
ATOM   10363 C  C   . ILE C 1 412 ? 19.315  3.821   -80.834  1.00 27.41 ? 401  ILE C C   1 
ATOM   10364 O  O   . ILE C 1 412 ? 18.746  4.905   -80.697  1.00 28.10 ? 401  ILE C O   1 
ATOM   10365 C  CB  . ILE C 1 412 ? 17.313  2.562   -80.005  1.00 26.86 ? 401  ILE C CB  1 
ATOM   10366 C  CG1 . ILE C 1 412 ? 16.789  1.587   -78.944  1.00 24.57 ? 401  ILE C CG1 1 
ATOM   10367 C  CG2 . ILE C 1 412 ? 16.726  2.268   -81.406  1.00 23.82 ? 401  ILE C CG2 1 
ATOM   10368 C  CD1 . ILE C 1 412 ? 16.040  0.436   -79.449  1.00 23.00 ? 401  ILE C CD1 1 
ATOM   10369 N  N   . ALA C 1 413 ? 20.344  3.648   -81.651  1.00 28.30 ? 402  ALA C N   1 
ATOM   10370 C  CA  . ALA C 1 413 ? 20.848  4.714   -82.490  1.00 28.32 ? 402  ALA C CA  1 
ATOM   10371 C  C   . ALA C 1 413 ? 21.455  4.115   -83.762  1.00 28.85 ? 402  ALA C C   1 
ATOM   10372 O  O   . ALA C 1 413 ? 21.739  2.906   -83.819  1.00 28.65 ? 402  ALA C O   1 
ATOM   10373 C  CB  . ALA C 1 413 ? 21.891  5.531   -81.719  1.00 28.88 ? 402  ALA C CB  1 
ATOM   10374 N  N   . VAL C 1 414 ? 21.642  4.954   -84.778  1.00 29.04 ? 403  VAL C N   1 
ATOM   10375 C  CA  . VAL C 1 414 ? 22.347  4.534   -85.992  1.00 29.05 ? 403  VAL C CA  1 
ATOM   10376 C  C   . VAL C 1 414 ? 23.831  4.437   -85.679  1.00 29.96 ? 403  VAL C C   1 
ATOM   10377 O  O   . VAL C 1 414 ? 24.388  5.354   -85.076  1.00 32.11 ? 403  VAL C O   1 
ATOM   10378 C  CB  . VAL C 1 414 ? 22.114  5.502   -87.162  1.00 28.79 ? 403  VAL C CB  1 
ATOM   10379 C  CG1 . VAL C 1 414 ? 22.979  5.133   -88.377  1.00 27.06 ? 403  VAL C CG1 1 
ATOM   10380 C  CG2 . VAL C 1 414 ? 20.664  5.476   -87.554  1.00 28.64 ? 403  VAL C CG2 1 
ATOM   10381 N  N   . GLY C 1 415 ? 24.456  3.328   -86.084  1.00 29.64 ? 404  GLY C N   1 
ATOM   10382 C  CA  . GLY C 1 415 ? 25.859  3.036   -85.779  1.00 29.06 ? 404  GLY C CA  1 
ATOM   10383 C  C   . GLY C 1 415 ? 26.015  2.060   -84.609  1.00 29.77 ? 404  GLY C C   1 
ATOM   10384 O  O   . GLY C 1 415 ? 27.052  1.393   -84.470  1.00 30.07 ? 404  GLY C O   1 
ATOM   10385 N  N   . SER C 1 416 ? 24.980  1.974   -83.774  1.00 28.33 ? 405  SER C N   1 
ATOM   10386 C  CA  . SER C 1 416 ? 24.996  1.139   -82.574  1.00 27.68 ? 405  SER C CA  1 
ATOM   10387 C  C   . SER C 1 416 ? 24.629  -0.316  -82.891  1.00 27.14 ? 405  SER C C   1 
ATOM   10388 O  O   . SER C 1 416 ? 24.079  -0.609  -83.966  1.00 27.20 ? 405  SER C O   1 
ATOM   10389 C  CB  . SER C 1 416 ? 24.039  1.735   -81.535  1.00 27.81 ? 405  SER C CB  1 
ATOM   10390 O  OG  . SER C 1 416 ? 24.486  3.011   -81.114  1.00 24.90 ? 405  SER C OG  1 
ATOM   10391 N  N   . ASP C 1 417 ? 24.937  -1.224  -81.975  1.00 26.25 ? 406  ASP C N   1 
ATOM   10392 C  CA  . ASP C 1 417 ? 24.712  -2.659  -82.213  1.00 27.48 ? 406  ASP C CA  1 
ATOM   10393 C  C   . ASP C 1 417 ? 23.236  -3.028  -82.291  1.00 27.82 ? 406  ASP C C   1 
ATOM   10394 O  O   . ASP C 1 417 ? 22.429  -2.484  -81.549  1.00 27.87 ? 406  ASP C O   1 
ATOM   10395 C  CB  . ASP C 1 417 ? 25.370  -3.517  -81.123  1.00 27.83 ? 406  ASP C CB  1 
ATOM   10396 C  CG  . ASP C 1 417 ? 26.837  -3.777  -81.380  1.00 28.31 ? 406  ASP C CG  1 
ATOM   10397 O  OD1 . ASP C 1 417 ? 27.316  -3.425  -82.489  1.00 27.02 ? 406  ASP C OD1 1 
ATOM   10398 O  OD2 . ASP C 1 417 ? 27.497  -4.339  -80.458  1.00 26.32 ? 406  ASP C OD2 1 
ATOM   10399 N  N   . ALA C 1 418 ? 22.884  -3.955  -83.191  1.00 28.02 ? 407  ALA C N   1 
ATOM   10400 C  CA  . ALA C 1 418 ? 21.493  -4.407  -83.331  1.00 27.09 ? 407  ALA C CA  1 
ATOM   10401 C  C   . ALA C 1 418 ? 21.167  -5.363  -82.191  1.00 27.54 ? 407  ALA C C   1 
ATOM   10402 O  O   . ALA C 1 418 ? 20.985  -6.567  -82.398  1.00 27.02 ? 407  ALA C O   1 
ATOM   10403 C  CB  . ALA C 1 418 ? 21.260  -5.066  -84.683  1.00 28.29 ? 407  ALA C CB  1 
ATOM   10404 N  N   . ASP C 1 419 ? 21.086  -4.790  -80.986  1.00 26.90 ? 408  ASP C N   1 
ATOM   10405 C  CA  . ASP C 1 419 ? 20.749  -5.503  -79.749  1.00 26.15 ? 408  ASP C CA  1 
ATOM   10406 C  C   . ASP C 1 419 ? 19.496  -4.855  -79.166  1.00 26.08 ? 408  ASP C C   1 
ATOM   10407 O  O   . ASP C 1 419 ? 19.599  -3.792  -78.583  1.00 27.28 ? 408  ASP C O   1 
ATOM   10408 C  CB  . ASP C 1 419 ? 21.886  -5.353  -78.735  1.00 25.66 ? 408  ASP C CB  1 
ATOM   10409 C  CG  . ASP C 1 419 ? 23.111  -6.206  -79.055  1.00 23.82 ? 408  ASP C CG  1 
ATOM   10410 O  OD1 . ASP C 1 419 ? 23.220  -6.774  -80.153  1.00 19.76 ? 408  ASP C OD1 1 
ATOM   10411 O  OD2 . ASP C 1 419 ? 23.993  -6.287  -78.184  1.00 19.49 ? 408  ASP C OD2 1 
ATOM   10412 N  N   . LEU C 1 420 ? 18.330  -5.484  -79.314  1.00 26.65 ? 409  LEU C N   1 
ATOM   10413 C  CA  . LEU C 1 420 ? 17.023  -4.817  -79.072  1.00 26.86 ? 409  LEU C CA  1 
ATOM   10414 C  C   . LEU C 1 420 ? 15.983  -5.753  -78.467  1.00 26.73 ? 409  LEU C C   1 
ATOM   10415 O  O   . LEU C 1 420 ? 15.985  -6.947  -78.752  1.00 27.55 ? 409  LEU C O   1 
ATOM   10416 C  CB  . LEU C 1 420 ? 16.430  -4.294  -80.393  1.00 28.28 ? 409  LEU C CB  1 
ATOM   10417 C  CG  . LEU C 1 420 ? 16.557  -2.836  -80.832  1.00 28.65 ? 409  LEU C CG  1 
ATOM   10418 C  CD1 . LEU C 1 420 ? 18.014  -2.425  -81.010  1.00 32.33 ? 409  LEU C CD1 1 
ATOM   10419 C  CD2 . LEU C 1 420 ? 15.766  -2.635  -82.142  1.00 28.02 ? 409  LEU C CD2 1 
ATOM   10420 N  N   . VAL C 1 421 ? 15.071  -5.195  -77.667  1.00 25.63 ? 410  VAL C N   1 
ATOM   10421 C  CA  . VAL C 1 421 ? 13.944  -5.935  -77.097  1.00 24.63 ? 410  VAL C CA  1 
ATOM   10422 C  C   . VAL C 1 421 ? 12.650  -5.149  -77.285  1.00 24.58 ? 410  VAL C C   1 
ATOM   10423 O  O   . VAL C 1 421 ? 12.590  -3.966  -76.964  1.00 25.72 ? 410  VAL C O   1 
ATOM   10424 C  CB  . VAL C 1 421 ? 14.089  -6.171  -75.561  1.00 23.95 ? 410  VAL C CB  1 
ATOM   10425 C  CG1 . VAL C 1 421 ? 12.951  -7.041  -75.048  1.00 21.22 ? 410  VAL C CG1 1 
ATOM   10426 C  CG2 . VAL C 1 421 ? 15.460  -6.775  -75.211  1.00 23.81 ? 410  VAL C CG2 1 
ATOM   10427 N  N   . ILE C 1 422 ? 11.624  -5.812  -77.803  1.00 25.34 ? 411  ILE C N   1 
ATOM   10428 C  CA  . ILE C 1 422 ? 10.242  -5.314  -77.767  1.00 24.88 ? 411  ILE C CA  1 
ATOM   10429 C  C   . ILE C 1 422 ? 9.668   -5.831  -76.450  1.00 23.77 ? 411  ILE C C   1 
ATOM   10430 O  O   . ILE C 1 422 ? 9.521   -7.033  -76.254  1.00 23.19 ? 411  ILE C O   1 
ATOM   10431 C  CB  . ILE C 1 422 ? 9.412   -5.785  -78.986  1.00 25.37 ? 411  ILE C CB  1 
ATOM   10432 C  CG1 . ILE C 1 422 ? 9.858   -5.064  -80.261  1.00 25.69 ? 411  ILE C CG1 1 
ATOM   10433 C  CG2 . ILE C 1 422 ? 7.924   -5.498  -78.824  1.00 25.59 ? 411  ILE C CG2 1 
ATOM   10434 C  CD1 . ILE C 1 422 ? 9.247   -5.671  -81.521  1.00 26.12 ? 411  ILE C CD1 1 
ATOM   10435 N  N   . TRP C 1 423 ? 9.396   -4.903  -75.540  1.00 23.41 ? 412  TRP C N   1 
ATOM   10436 C  CA  . TRP C 1 423 ? 9.045   -5.208  -74.170  1.00 23.91 ? 412  TRP C CA  1 
ATOM   10437 C  C   . TRP C 1 423 ? 7.531   -5.200  -73.976  1.00 24.80 ? 412  TRP C C   1 
ATOM   10438 O  O   . TRP C 1 423 ? 6.807   -4.463  -74.649  1.00 23.28 ? 412  TRP C O   1 
ATOM   10439 C  CB  . TRP C 1 423 ? 9.703   -4.159  -73.264  1.00 21.82 ? 412  TRP C CB  1 
ATOM   10440 C  CG  . TRP C 1 423 ? 9.734   -4.511  -71.803  1.00 20.47 ? 412  TRP C CG  1 
ATOM   10441 C  CD1 . TRP C 1 423 ? 9.044   -3.912  -70.808  1.00 17.77 ? 412  TRP C CD1 1 
ATOM   10442 C  CD2 . TRP C 1 423 ? 10.517  -5.519  -71.194  1.00 17.66 ? 412  TRP C CD2 1 
ATOM   10443 N  NE1 . TRP C 1 423 ? 9.337   -4.496  -69.597  1.00 18.15 ? 412  TRP C NE1 1 
ATOM   10444 C  CE2 . TRP C 1 423 ? 10.251  -5.482  -69.812  1.00 15.36 ? 412  TRP C CE2 1 
ATOM   10445 C  CE3 . TRP C 1 423 ? 11.441  -6.441  -71.673  1.00 17.08 ? 412  TRP C CE3 1 
ATOM   10446 C  CZ2 . TRP C 1 423 ? 10.848  -6.337  -68.928  1.00 15.60 ? 412  TRP C CZ2 1 
ATOM   10447 C  CZ3 . TRP C 1 423 ? 12.054  -7.280  -70.780  1.00 18.90 ? 412  TRP C CZ3 1 
ATOM   10448 C  CH2 . TRP C 1 423 ? 11.732  -7.243  -69.424  1.00 15.59 ? 412  TRP C CH2 1 
ATOM   10449 N  N   . ASP C 1 424 ? 7.057   -6.023  -73.037  1.00 26.67 ? 413  ASP C N   1 
ATOM   10450 C  CA  . ASP C 1 424 ? 5.648   -6.086  -72.705  1.00 26.91 ? 413  ASP C CA  1 
ATOM   10451 C  C   . ASP C 1 424 ? 5.491   -5.647  -71.260  1.00 27.93 ? 413  ASP C C   1 
ATOM   10452 O  O   . ASP C 1 424 ? 5.764   -6.446  -70.352  1.00 29.52 ? 413  ASP C O   1 
ATOM   10453 C  CB  . ASP C 1 424 ? 5.106   -7.501  -72.884  1.00 28.00 ? 413  ASP C CB  1 
ATOM   10454 C  CG  . ASP C 1 424 ? 3.584   -7.570  -72.756  1.00 28.67 ? 413  ASP C CG  1 
ATOM   10455 O  OD1 . ASP C 1 424 ? 2.941   -6.576  -72.364  1.00 33.16 ? 413  ASP C OD1 1 
ATOM   10456 O  OD2 . ASP C 1 424 ? 3.011   -8.628  -73.078  1.00 34.67 ? 413  ASP C OD2 1 
ATOM   10457 N  N   . PRO C 1 425 ? 5.020   -4.391  -71.037  1.00 28.39 ? 414  PRO C N   1 
ATOM   10458 C  CA  . PRO C 1 425 ? 4.979   -3.772  -69.710  1.00 27.95 ? 414  PRO C CA  1 
ATOM   10459 C  C   . PRO C 1 425 ? 3.694   -4.054  -68.931  1.00 27.39 ? 414  PRO C C   1 
ATOM   10460 O  O   . PRO C 1 425 ? 3.568   -3.688  -67.757  1.00 27.83 ? 414  PRO C O   1 
ATOM   10461 C  CB  . PRO C 1 425 ? 5.096   -2.289  -70.044  1.00 27.80 ? 414  PRO C CB  1 
ATOM   10462 C  CG  . PRO C 1 425 ? 4.347   -2.156  -71.332  1.00 28.91 ? 414  PRO C CG  1 
ATOM   10463 C  CD  . PRO C 1 425 ? 4.448   -3.482  -72.046  1.00 28.28 ? 414  PRO C CD  1 
ATOM   10464 N  N   . ASP C 1 426 ? 2.766   -4.746  -69.565  1.00 27.73 ? 415  ASP C N   1 
ATOM   10465 C  CA  . ASP C 1 426 ? 1.443   -4.956  -69.007  1.00 28.80 ? 415  ASP C CA  1 
ATOM   10466 C  C   . ASP C 1 426 ? 1.166   -6.412  -68.568  1.00 29.70 ? 415  ASP C C   1 
ATOM   10467 O  O   . ASP C 1 426 ? 0.579   -6.623  -67.486  1.00 30.09 ? 415  ASP C O   1 
ATOM   10468 C  CB  . ASP C 1 426 ? 0.412   -4.453  -70.014  1.00 29.18 ? 415  ASP C CB  1 
ATOM   10469 C  CG  . ASP C 1 426 ? 0.390   -2.923  -70.107  1.00 29.42 ? 415  ASP C CG  1 
ATOM   10470 O  OD1 . ASP C 1 426 ? 0.548   -2.266  -69.058  1.00 29.37 ? 415  ASP C OD1 1 
ATOM   10471 O  OD2 . ASP C 1 426 ? 0.204   -2.376  -71.221  1.00 29.88 ? 415  ASP C OD2 1 
ATOM   10472 N  N   . SER C 1 427 ? 1.615   -7.401  -69.352  1.00 29.83 ? 416  SER C N   1 
ATOM   10473 C  CA  . SER C 1 427 ? 1.404   -8.816  -68.990  1.00 30.23 ? 416  SER C CA  1 
ATOM   10474 C  C   . SER C 1 427 ? 2.043   -9.217  -67.658  1.00 31.05 ? 416  SER C C   1 
ATOM   10475 O  O   . SER C 1 427 ? 3.081   -8.691  -67.273  1.00 31.55 ? 416  SER C O   1 
ATOM   10476 C  CB  . SER C 1 427 ? 1.904   -9.750  -70.083  1.00 30.83 ? 416  SER C CB  1 
ATOM   10477 O  OG  . SER C 1 427 ? 0.862   -10.037 -71.002  1.00 30.81 ? 416  SER C OG  1 
ATOM   10478 N  N   . VAL C 1 428 ? 1.394   -10.134 -66.948  1.00 30.98 ? 417  VAL C N   1 
ATOM   10479 C  CA  . VAL C 1 428 ? 1.945   -10.708 -65.725  1.00 31.11 ? 417  VAL C CA  1 
ATOM   10480 C  C   . VAL C 1 428 ? 2.185   -12.216 -65.906  1.00 31.01 ? 417  VAL C C   1 
ATOM   10481 O  O   . VAL C 1 428 ? 1.383   -12.917 -66.523  1.00 30.84 ? 417  VAL C O   1 
ATOM   10482 C  CB  . VAL C 1 428 ? 1.029   -10.489 -64.486  1.00 31.34 ? 417  VAL C CB  1 
ATOM   10483 C  CG1 . VAL C 1 428 ? 1.506   -11.335 -63.310  1.00 32.24 ? 417  VAL C CG1 1 
ATOM   10484 C  CG2 . VAL C 1 428 ? 0.989   -9.021  -64.079  1.00 32.33 ? 417  VAL C CG2 1 
ATOM   10485 N  N   . LYS C 1 429 ? 3.314   -12.680 -65.374  1.00 29.88 ? 418  LYS C N   1 
ATOM   10486 C  CA  . LYS C 1 429 ? 3.637   -14.085 -65.274  1.00 29.78 ? 418  LYS C CA  1 
ATOM   10487 C  C   . LYS C 1 429 ? 4.117   -14.382 -63.870  1.00 29.52 ? 418  LYS C C   1 
ATOM   10488 O  O   . LYS C 1 429 ? 4.535   -13.508 -63.127  1.00 31.09 ? 418  LYS C O   1 
ATOM   10489 C  CB  . LYS C 1 429 ? 4.750   -14.450 -66.236  1.00 28.87 ? 418  LYS C CB  1 
ATOM   10490 C  CG  . LYS C 1 429 ? 4.397   -14.313 -67.683  1.00 29.55 ? 418  LYS C CG  1 
ATOM   10491 C  CD  . LYS C 1 429 ? 5.633   -14.535 -68.486  1.00 30.10 ? 418  LYS C CD  1 
ATOM   10492 C  CE  . LYS C 1 429 ? 5.374   -14.485 -69.957  1.00 31.75 ? 418  LYS C CE  1 
ATOM   10493 N  NZ  . LYS C 1 429 ? 6.690   -14.397 -70.666  1.00 31.90 ? 418  LYS C NZ  1 
ATOM   10494 N  N   . THR C 1 430 ? 4.036   -15.640 -63.501  1.00 29.69 ? 419  THR C N   1 
ATOM   10495 C  CA  . THR C 1 430 ? 4.656   -16.110 -62.287  1.00 28.07 ? 419  THR C CA  1 
ATOM   10496 C  C   . THR C 1 430 ? 6.068   -16.474 -62.697  1.00 27.74 ? 419  THR C C   1 
ATOM   10497 O  O   . THR C 1 430 ? 6.293   -16.770 -63.876  1.00 26.90 ? 419  THR C O   1 
ATOM   10498 C  CB  . THR C 1 430 ? 3.888   -17.295 -61.770  1.00 28.50 ? 419  THR C CB  1 
ATOM   10499 O  OG1 . THR C 1 430 ? 2.499   -17.025 -61.981  1.00 30.40 ? 419  THR C OG1 1 
ATOM   10500 C  CG2 . THR C 1 430 ? 4.147   -17.541 -60.277  1.00 27.88 ? 419  THR C CG2 1 
ATOM   10501 N  N   . ILE C 1 431 ? 7.027   -16.381 -61.772  1.00 26.10 ? 420  ILE C N   1 
ATOM   10502 C  CA  . ILE C 1 431 ? 8.392   -16.891 -62.015  1.00 25.03 ? 420  ILE C CA  1 
ATOM   10503 C  C   . ILE C 1 431 ? 8.461   -18.246 -61.362  1.00 24.62 ? 420  ILE C C   1 
ATOM   10504 O  O   . ILE C 1 431 ? 8.049   -18.381 -60.205  1.00 24.79 ? 420  ILE C O   1 
ATOM   10505 C  CB  . ILE C 1 431 ? 9.512   -15.999 -61.421  1.00 24.46 ? 420  ILE C CB  1 
ATOM   10506 C  CG1 . ILE C 1 431 ? 9.512   -14.630 -62.069  1.00 24.30 ? 420  ILE C CG1 1 
ATOM   10507 C  CG2 . ILE C 1 431 ? 10.888  -16.636 -61.640  1.00 25.52 ? 420  ILE C CG2 1 
ATOM   10508 C  CD1 . ILE C 1 431 ? 10.454  -13.684 -61.443  1.00 22.48 ? 420  ILE C CD1 1 
ATOM   10509 N  N   . SER C 1 432 ? 8.976   -19.237 -62.098  1.00 24.79 ? 421  SER C N   1 
ATOM   10510 C  CA  . SER C 1 432 ? 8.961   -20.630 -61.654  1.00 23.97 ? 421  SER C CA  1 
ATOM   10511 C  C   . SER C 1 432 ? 10.065  -21.511 -62.234  1.00 22.56 ? 421  SER C C   1 
ATOM   10512 O  O   . SER C 1 432 ? 10.422  -21.408 -63.425  1.00 22.07 ? 421  SER C O   1 
ATOM   10513 C  CB  . SER C 1 432 ? 7.590   -21.277 -61.958  1.00 24.78 ? 421  SER C CB  1 
ATOM   10514 O  OG  . SER C 1 432 ? 7.424   -22.484 -61.206  1.00 25.08 ? 421  SER C OG  1 
ATOM   10515 N  N   . ALA C 1 433 ? 10.574  -22.404 -61.396  1.00 21.02 ? 422  ALA C N   1 
ATOM   10516 C  CA  . ALA C 1 433 ? 11.495  -23.463 -61.842  1.00 22.71 ? 422  ALA C CA  1 
ATOM   10517 C  C   . ALA C 1 433 ? 10.931  -24.340 -62.967  1.00 23.89 ? 422  ALA C C   1 
ATOM   10518 O  O   . ALA C 1 433 ? 11.646  -24.681 -63.901  1.00 25.96 ? 422  ALA C O   1 
ATOM   10519 C  CB  . ALA C 1 433 ? 11.924  -24.317 -60.699  1.00 20.51 ? 422  ALA C CB  1 
ATOM   10520 N  N   . LYS C 1 434 ? 9.652   -24.690 -62.909  1.00 24.32 ? 423  LYS C N   1 
ATOM   10521 C  CA  . LYS C 1 434 ? 9.068   -25.501 -63.972  1.00 24.21 ? 423  LYS C CA  1 
ATOM   10522 C  C   . LYS C 1 434 ? 9.106   -24.760 -65.313  1.00 23.63 ? 423  LYS C C   1 
ATOM   10523 O  O   . LYS C 1 434 ? 9.005   -25.378 -66.359  1.00 23.81 ? 423  LYS C O   1 
ATOM   10524 C  CB  . LYS C 1 434 ? 7.636   -25.941 -63.644  1.00 24.83 ? 423  LYS C CB  1 
ATOM   10525 C  CG  . LYS C 1 434 ? 6.842   -24.952 -62.837  1.00 26.07 ? 423  LYS C CG  1 
ATOM   10526 C  CD  . LYS C 1 434 ? 5.363   -25.171 -62.919  1.00 26.87 ? 423  LYS C CD  1 
ATOM   10527 C  CE  . LYS C 1 434 ? 4.660   -24.499 -61.760  1.00 28.02 ? 423  LYS C CE  1 
ATOM   10528 N  NZ  . LYS C 1 434 ? 4.887   -25.197 -60.448  1.00 30.77 ? 423  LYS C NZ  1 
ATOM   10529 N  N   . THR C 1 435 ? 9.307   -23.441 -65.246  1.00 23.45 ? 424  THR C N   1 
ATOM   10530 C  CA  . THR C 1 435 ? 9.294   -22.537 -66.387  1.00 22.27 ? 424  THR C CA  1 
ATOM   10531 C  C   . THR C 1 435 ? 10.670  -21.934 -66.764  1.00 21.15 ? 424  THR C C   1 
ATOM   10532 O  O   . THR C 1 435 ? 10.920  -21.639 -67.935  1.00 20.24 ? 424  THR C O   1 
ATOM   10533 C  CB  . THR C 1 435 ? 8.286   -21.436 -66.059  1.00 23.47 ? 424  THR C CB  1 
ATOM   10534 O  OG1 . THR C 1 435 ? 6.970   -22.007 -66.117  1.00 28.86 ? 424  THR C OG1 1 
ATOM   10535 C  CG2 . THR C 1 435 ? 8.381   -20.273 -67.000  1.00 25.33 ? 424  THR C CG2 1 
ATOM   10536 N  N   . HIS C 1 436 ? 11.580  -21.767 -65.810  1.00 19.11 ? 425  HIS C N   1 
ATOM   10537 C  CA  . HIS C 1 436 ? 12.858  -21.091 -66.101  1.00 19.32 ? 425  HIS C CA  1 
ATOM   10538 C  C   . HIS C 1 436 ? 13.853  -21.815 -67.042  1.00 20.65 ? 425  HIS C C   1 
ATOM   10539 O  O   . HIS C 1 436 ? 13.941  -23.051 -67.054  1.00 20.29 ? 425  HIS C O   1 
ATOM   10540 C  CB  . HIS C 1 436 ? 13.548  -20.671 -64.795  1.00 17.97 ? 425  HIS C CB  1 
ATOM   10541 C  CG  . HIS C 1 436 ? 14.171  -21.782 -64.026  1.00 14.54 ? 425  HIS C CG  1 
ATOM   10542 N  ND1 . HIS C 1 436 ? 14.540  -21.629 -62.704  1.00 15.57 ? 425  HIS C ND1 1 
ATOM   10543 C  CD2 . HIS C 1 436 ? 14.451  -23.068 -64.343  1.00 13.06 ? 425  HIS C CD2 1 
ATOM   10544 C  CE1 . HIS C 1 436 ? 15.063  -22.757 -62.264  1.00 13.53 ? 425  HIS C CE1 1 
ATOM   10545 N  NE2 . HIS C 1 436 ? 15.016  -23.648 -63.230  1.00 12.81 ? 425  HIS C NE2 1 
ATOM   10546 N  N   . ASN C 1 437 ? 14.609  -21.036 -67.826  1.00 22.56 ? 426  ASN C N   1 
ATOM   10547 C  CA  . ASN C 1 437 ? 15.665  -21.574 -68.690  1.00 23.23 ? 426  ASN C CA  1 
ATOM   10548 C  C   . ASN C 1 437 ? 16.999  -21.902 -68.016  1.00 25.01 ? 426  ASN C C   1 
ATOM   10549 O  O   . ASN C 1 437 ? 18.073  -21.597 -68.544  1.00 26.17 ? 426  ASN C O   1 
ATOM   10550 C  CB  . ASN C 1 437 ? 15.924  -20.643 -69.846  1.00 23.79 ? 426  ASN C CB  1 
ATOM   10551 C  CG  . ASN C 1 437 ? 14.826  -20.656 -70.813  1.00 21.06 ? 426  ASN C CG  1 
ATOM   10552 O  OD1 . ASN C 1 437 ? 14.702  -21.582 -71.595  1.00 24.58 ? 426  ASN C OD1 1 
ATOM   10553 N  ND2 . ASN C 1 437 ? 13.984  -19.645 -70.755  1.00 22.05 ? 426  ASN C ND2 1 
ATOM   10554 N  N   . SER C 1 438 ? 16.912  -22.548 -66.866  1.00 26.03 ? 427  SER C N   1 
ATOM   10555 C  CA  . SER C 1 438 ? 18.051  -23.096 -66.166  1.00 26.04 ? 427  SER C CA  1 
ATOM   10556 C  C   . SER C 1 438 ? 17.787  -24.565 -65.897  1.00 27.13 ? 427  SER C C   1 
ATOM   10557 O  O   . SER C 1 438 ? 16.664  -25.049 -66.039  1.00 27.98 ? 427  SER C O   1 
ATOM   10558 C  CB  . SER C 1 438 ? 18.226  -22.354 -64.848  1.00 27.14 ? 427  SER C CB  1 
ATOM   10559 O  OG  . SER C 1 438 ? 18.608  -23.227 -63.817  1.00 28.30 ? 427  SER C OG  1 
ATOM   10560 N  N   . SER C 1 439 ? 18.828  -25.283 -65.492  1.00 27.78 ? 428  SER C N   1 
ATOM   10561 C  CA  . SER C 1 439 ? 18.729  -26.723 -65.205  1.00 26.23 ? 428  SER C CA  1 
ATOM   10562 C  C   . SER C 1 439 ? 18.308  -26.976 -63.767  1.00 26.96 ? 428  SER C C   1 
ATOM   10563 O  O   . SER C 1 439 ? 18.088  -28.124 -63.331  1.00 28.71 ? 428  SER C O   1 
ATOM   10564 C  CB  . SER C 1 439 ? 20.083  -27.400 -65.477  1.00 26.76 ? 428  SER C CB  1 
ATOM   10565 O  OG  . SER C 1 439 ? 21.136  -26.440 -65.612  1.00 22.96 ? 428  SER C OG  1 
ATOM   10566 N  N   . LEU C 1 440 ? 18.203  -25.899 -63.006  1.00 26.39 ? 429  LEU C N   1 
ATOM   10567 C  CA  . LEU C 1 440 ? 17.960  -26.035 -61.580  1.00 23.92 ? 429  LEU C CA  1 
ATOM   10568 C  C   . LEU C 1 440 ? 16.508  -26.411 -61.242  1.00 21.96 ? 429  LEU C C   1 
ATOM   10569 O  O   . LEU C 1 440 ? 15.581  -26.131 -61.990  1.00 21.39 ? 429  LEU C O   1 
ATOM   10570 C  CB  . LEU C 1 440 ? 18.416  -24.758 -60.831  1.00 24.34 ? 429  LEU C CB  1 
ATOM   10571 C  CG  . LEU C 1 440 ? 19.815  -24.868 -60.191  1.00 25.35 ? 429  LEU C CG  1 
ATOM   10572 C  CD1 . LEU C 1 440 ? 20.894  -25.218 -61.260  1.00 19.27 ? 429  LEU C CD1 1 
ATOM   10573 C  CD2 . LEU C 1 440 ? 20.150  -23.572 -59.412  1.00 23.45 ? 429  LEU C CD2 1 
ATOM   10574 N  N   . GLU C 1 441 ? 16.363  -27.026 -60.071  1.00 21.01 ? 430  GLU C N   1 
ATOM   10575 C  CA  . GLU C 1 441 ? 15.091  -27.480 -59.522  1.00 20.98 ? 430  GLU C CA  1 
ATOM   10576 C  C   . GLU C 1 441 ? 14.424  -26.334 -58.771  1.00 20.15 ? 430  GLU C C   1 
ATOM   10577 O  O   . GLU C 1 441 ? 13.186  -26.236 -58.762  1.00 18.04 ? 430  GLU C O   1 
ATOM   10578 C  CB  . GLU C 1 441 ? 15.281  -28.654 -58.527  1.00 20.31 ? 430  GLU C CB  1 
ATOM   10579 C  CG  . GLU C 1 441 ? 16.208  -29.824 -58.938  1.00 22.11 ? 430  GLU C CG  1 
ATOM   10580 C  CD  . GLU C 1 441 ? 17.710  -29.483 -58.894  1.00 21.28 ? 430  GLU C CD  1 
ATOM   10581 O  OE1 . GLU C 1 441 ? 18.201  -29.028 -57.856  1.00 15.50 ? 430  GLU C OE1 1 
ATOM   10582 O  OE2 . GLU C 1 441 ? 18.402  -29.646 -59.919  1.00 20.98 ? 430  GLU C OE2 1 
ATOM   10583 N  N   . TYR C 1 442 ? 15.251  -25.549 -58.062  1.00 19.14 ? 431  TYR C N   1 
ATOM   10584 C  CA  . TYR C 1 442 ? 14.809  -24.317 -57.392  1.00 18.78 ? 431  TYR C CA  1 
ATOM   10585 C  C   . TYR C 1 442 ? 15.104  -23.037 -58.164  1.00 17.94 ? 431  TYR C C   1 
ATOM   10586 O  O   . TYR C 1 442 ? 16.026  -22.975 -58.975  1.00 18.96 ? 431  TYR C O   1 
ATOM   10587 C  CB  . TYR C 1 442 ? 15.351  -24.199 -55.937  1.00 16.74 ? 431  TYR C CB  1 
ATOM   10588 C  CG  . TYR C 1 442 ? 14.818  -25.334 -55.153  1.00 13.61 ? 431  TYR C CG  1 
ATOM   10589 C  CD1 . TYR C 1 442 ? 15.501  -26.508 -55.139  1.00 10.91 ? 431  TYR C CD1 1 
ATOM   10590 C  CD2 . TYR C 1 442 ? 13.562  -25.288 -54.573  1.00 10.62 ? 431  TYR C CD2 1 
ATOM   10591 C  CE1 . TYR C 1 442 ? 15.020  -27.590 -54.566  1.00 12.62 ? 431  TYR C CE1 1 
ATOM   10592 C  CE2 . TYR C 1 442 ? 13.062  -26.387 -53.974  1.00 10.32 ? 431  TYR C CE2 1 
ATOM   10593 C  CZ  . TYR C 1 442 ? 13.817  -27.539 -53.966  1.00 11.56 ? 431  TYR C CZ  1 
ATOM   10594 O  OH  . TYR C 1 442 ? 13.430  -28.704 -53.370  1.00 19.11 ? 431  TYR C OH  1 
ATOM   10595 N  N   . ASN C 1 443 ? 14.270  -22.045 -57.853  1.00 16.88 ? 432  ASN C N   1 
ATOM   10596 C  CA  . ASN C 1 443 ? 14.373  -20.682 -58.295  1.00 17.42 ? 432  ASN C CA  1 
ATOM   10597 C  C   . ASN C 1 443 ? 13.977  -19.743 -57.139  1.00 17.83 ? 432  ASN C C   1 
ATOM   10598 O  O   . ASN C 1 443 ? 12.846  -19.792 -56.638  1.00 17.68 ? 432  ASN C O   1 
ATOM   10599 C  CB  . ASN C 1 443 ? 13.449  -20.433 -59.486  1.00 17.56 ? 432  ASN C CB  1 
ATOM   10600 C  CG  . ASN C 1 443 ? 13.561  -19.039 -60.009  1.00 17.42 ? 432  ASN C CG  1 
ATOM   10601 O  OD1 . ASN C 1 443 ? 13.468  -18.804 -61.217  1.00 13.58 ? 432  ASN C OD1 1 
ATOM   10602 N  ND2 . ASN C 1 443 ? 13.794  -18.093 -59.116  1.00 10.72 ? 432  ASN C ND2 1 
ATOM   10603 N  N   . ILE C 1 444 ? 14.912  -18.875 -56.749  1.00 17.12 ? 433  ILE C N   1 
ATOM   10604 C  CA  . ILE C 1 444 ? 14.751  -18.053 -55.556  1.00 16.74 ? 433  ILE C CA  1 
ATOM   10605 C  C   . ILE C 1 444 ? 13.634  -17.056 -55.708  1.00 18.13 ? 433  ILE C C   1 
ATOM   10606 O  O   . ILE C 1 444 ? 13.208  -16.491 -54.701  1.00 16.29 ? 433  ILE C O   1 
ATOM   10607 C  CB  . ILE C 1 444 ? 16.065  -17.375 -55.121  1.00 14.22 ? 433  ILE C CB  1 
ATOM   10608 C  CG1 . ILE C 1 444 ? 16.619  -16.462 -56.219  1.00 13.75 ? 433  ILE C CG1 1 
ATOM   10609 C  CG2 . ILE C 1 444 ? 17.066  -18.431 -54.800  1.00 5.90  ? 433  ILE C CG2 1 
ATOM   10610 C  CD1 . ILE C 1 444 ? 17.729  -15.526 -55.744  1.00 15.76 ? 433  ILE C CD1 1 
ATOM   10611 N  N   . PHE C 1 445 ? 13.170  -16.836 -56.945  1.00 17.62 ? 434  PHE C N   1 
ATOM   10612 C  CA  . PHE C 1 445 ? 11.941  -16.042 -57.237  1.00 19.75 ? 434  PHE C CA  1 
ATOM   10613 C  C   . PHE C 1 445 ? 10.652  -16.852 -57.463  1.00 20.62 ? 434  PHE C C   1 
ATOM   10614 O  O   . PHE C 1 445 ? 9.629   -16.292 -57.847  1.00 22.49 ? 434  PHE C O   1 
ATOM   10615 C  CB  . PHE C 1 445 ? 12.148  -15.152 -58.469  1.00 19.58 ? 434  PHE C CB  1 
ATOM   10616 C  CG  . PHE C 1 445 ? 13.426  -14.385 -58.446  1.00 19.57 ? 434  PHE C CG  1 
ATOM   10617 C  CD1 . PHE C 1 445 ? 13.745  -13.580 -57.357  1.00 18.57 ? 434  PHE C CD1 1 
ATOM   10618 C  CD2 . PHE C 1 445 ? 14.289  -14.445 -59.517  1.00 18.43 ? 434  PHE C CD2 1 
ATOM   10619 C  CE1 . PHE C 1 445 ? 14.902  -12.878 -57.344  1.00 17.09 ? 434  PHE C CE1 1 
ATOM   10620 C  CE2 . PHE C 1 445 ? 15.466  -13.752 -59.512  1.00 19.98 ? 434  PHE C CE2 1 
ATOM   10621 C  CZ  . PHE C 1 445 ? 15.782  -12.965 -58.429  1.00 17.51 ? 434  PHE C CZ  1 
ATOM   10622 N  N   . GLU C 1 446 ? 10.697  -18.153 -57.211  1.00 21.80 ? 435  GLU C N   1 
ATOM   10623 C  CA  . GLU C 1 446 ? 9.529   -19.017 -57.373  1.00 23.47 ? 435  GLU C CA  1 
ATOM   10624 C  C   . GLU C 1 446 ? 8.272   -18.436 -56.753  1.00 25.14 ? 435  GLU C C   1 
ATOM   10625 O  O   . GLU C 1 446 ? 8.253   -18.073 -55.545  1.00 25.26 ? 435  GLU C O   1 
ATOM   10626 C  CB  . GLU C 1 446 ? 9.785   -20.387 -56.743  1.00 23.68 ? 435  GLU C CB  1 
ATOM   10627 C  CG  . GLU C 1 446 ? 8.672   -21.377 -56.916  1.00 21.87 ? 435  GLU C CG  1 
ATOM   10628 C  CD  . GLU C 1 446 ? 8.596   -21.914 -58.302  1.00 23.13 ? 435  GLU C CD  1 
ATOM   10629 O  OE1 . GLU C 1 446 ? 9.675   -22.083 -58.915  1.00 22.45 ? 435  GLU C OE1 1 
ATOM   10630 O  OE2 . GLU C 1 446 ? 7.464   -22.196 -58.770  1.00 21.77 ? 435  GLU C OE2 1 
ATOM   10631 N  N   . GLY C 1 447 ? 7.225   -18.379 -57.582  1.00 26.24 ? 436  GLY C N   1 
ATOM   10632 C  CA  . GLY C 1 447 ? 5.890   -17.966 -57.156  1.00 27.06 ? 436  GLY C CA  1 
ATOM   10633 C  C   . GLY C 1 447 ? 5.677   -16.467 -57.163  1.00 28.10 ? 436  GLY C C   1 
ATOM   10634 O  O   . GLY C 1 447 ? 4.624   -15.998 -56.714  1.00 28.80 ? 436  GLY C O   1 
ATOM   10635 N  N   . MET C 1 448 ? 6.664   -15.718 -57.663  1.00 28.08 ? 437  MET C N   1 
ATOM   10636 C  CA  . MET C 1 448 ? 6.554   -14.277 -57.795  1.00 28.01 ? 437  MET C CA  1 
ATOM   10637 C  C   . MET C 1 448 ? 5.718   -13.953 -58.995  1.00 29.08 ? 437  MET C C   1 
ATOM   10638 O  O   . MET C 1 448 ? 6.032   -14.401 -60.099  1.00 28.14 ? 437  MET C O   1 
ATOM   10639 C  CB  . MET C 1 448 ? 7.931   -13.616 -57.979  1.00 28.82 ? 437  MET C CB  1 
ATOM   10640 C  CG  . MET C 1 448 ? 7.857   -12.164 -58.570  1.00 28.14 ? 437  MET C CG  1 
ATOM   10641 S  SD  . MET C 1 448 ? 9.357   -11.177 -58.442  1.00 26.50 ? 437  MET C SD  1 
ATOM   10642 C  CE  . MET C 1 448 ? 9.795   -11.567 -56.717  1.00 20.72 ? 437  MET C CE  1 
ATOM   10643 N  N   . GLU C 1 449 ? 4.691   -13.132 -58.781  1.00 29.71 ? 438  GLU C N   1 
ATOM   10644 C  CA  . GLU C 1 449 ? 3.839   -12.653 -59.863  1.00 30.17 ? 438  GLU C CA  1 
ATOM   10645 C  C   . GLU C 1 449 ? 4.443   -11.368 -60.402  1.00 29.83 ? 438  GLU C C   1 
ATOM   10646 O  O   . GLU C 1 449 ? 4.407   -10.329 -59.751  1.00 30.43 ? 438  GLU C O   1 
ATOM   10647 C  CB  . GLU C 1 449 ? 2.419   -12.404 -59.353  1.00 31.47 ? 438  GLU C CB  1 
ATOM   10648 C  CG  . GLU C 1 449 ? 1.576   -13.654 -59.157  1.00 33.32 ? 438  GLU C CG  1 
ATOM   10649 C  CD  . GLU C 1 449 ? 0.634   -13.924 -60.323  1.00 36.02 ? 438  GLU C CD  1 
ATOM   10650 O  OE1 . GLU C 1 449 ? 0.924   -13.494 -61.463  1.00 37.23 ? 438  GLU C OE1 1 
ATOM   10651 O  OE2 . GLU C 1 449 ? -0.407  -14.582 -60.095  1.00 40.88 ? 438  GLU C OE2 1 
ATOM   10652 N  N   . CYS C 1 450 ? 4.994   -11.441 -61.599  1.00 28.68 ? 439  CYS C N   1 
ATOM   10653 C  CA  . CYS C 1 450 ? 5.943   -10.438 -62.040  1.00 28.34 ? 439  CYS C CA  1 
ATOM   10654 C  C   . CYS C 1 450 ? 5.462   -9.753  -63.293  1.00 28.40 ? 439  CYS C C   1 
ATOM   10655 O  O   . CYS C 1 450 ? 5.046   -10.413 -64.228  1.00 27.95 ? 439  CYS C O   1 
ATOM   10656 C  CB  . CYS C 1 450 ? 7.289   -11.098 -62.296  1.00 27.34 ? 439  CYS C CB  1 
ATOM   10657 S  SG  . CYS C 1 450 ? 8.593   -9.924  -62.446  1.00 28.47 ? 439  CYS C SG  1 
ATOM   10658 N  N   . ARG C 1 451 ? 5.529   -8.424  -63.318  1.00 28.67 ? 440  ARG C N   1 
ATOM   10659 C  CA  . ARG C 1 451 ? 4.990   -7.682  -64.433  1.00 27.96 ? 440  ARG C CA  1 
ATOM   10660 C  C   . ARG C 1 451 ? 6.053   -7.141  -65.351  1.00 27.29 ? 440  ARG C C   1 
ATOM   10661 O  O   . ARG C 1 451 ? 6.985   -6.513  -64.898  1.00 29.14 ? 440  ARG C O   1 
ATOM   10662 C  CB  . ARG C 1 451 ? 4.139   -6.553  -63.930  1.00 28.65 ? 440  ARG C CB  1 
ATOM   10663 C  CG  . ARG C 1 451 ? 3.333   -5.970  -65.015  1.00 29.51 ? 440  ARG C CG  1 
ATOM   10664 C  CD  . ARG C 1 451 ? 2.157   -5.315  -64.456  1.00 33.30 ? 440  ARG C CD  1 
ATOM   10665 N  NE  . ARG C 1 451 ? 1.821   -4.124  -65.216  1.00 36.39 ? 440  ARG C NE  1 
ATOM   10666 C  CZ  . ARG C 1 451 ? 0.921   -3.222  -64.837  1.00 35.44 ? 440  ARG C CZ  1 
ATOM   10667 N  NH1 . ARG C 1 451 ? 0.264   -3.366  -63.688  1.00 34.28 ? 440  ARG C NH1 1 
ATOM   10668 N  NH2 . ARG C 1 451 ? 0.690   -2.169  -65.619  1.00 37.27 ? 440  ARG C NH2 1 
ATOM   10669 N  N   . GLY C 1 452 ? 5.887   -7.358  -66.650  1.00 26.63 ? 441  GLY C N   1 
ATOM   10670 C  CA  . GLY C 1 452 ? 6.905   -7.011  -67.624  1.00 25.84 ? 441  GLY C CA  1 
ATOM   10671 C  C   . GLY C 1 452 ? 7.646   -8.234  -68.134  1.00 25.47 ? 441  GLY C C   1 
ATOM   10672 O  O   . GLY C 1 452 ? 8.124   -9.072  -67.344  1.00 22.94 ? 441  GLY C O   1 
ATOM   10673 N  N   . SER C 1 453 ? 7.743   -8.338  -69.464  1.00 24.73 ? 442  SER C N   1 
ATOM   10674 C  CA  . SER C 1 453 ? 8.426   -9.466  -70.100  1.00 25.20 ? 442  SER C CA  1 
ATOM   10675 C  C   . SER C 1 453 ? 8.802   -9.125  -71.531  1.00 25.71 ? 442  SER C C   1 
ATOM   10676 O  O   . SER C 1 453 ? 8.143   -8.303  -72.177  1.00 25.58 ? 442  SER C O   1 
ATOM   10677 C  CB  . SER C 1 453 ? 7.551   -10.724 -70.087  1.00 24.39 ? 442  SER C CB  1 
ATOM   10678 O  OG  . SER C 1 453 ? 6.416   -10.598 -70.930  1.00 28.43 ? 442  SER C OG  1 
ATOM   10679 N  N   . PRO C 1 454 ? 9.893   -9.709  -72.019  1.00 25.92 ? 443  PRO C N   1 
ATOM   10680 C  CA  . PRO C 1 454 ? 10.229  -9.561  -73.425  1.00 26.47 ? 443  PRO C CA  1 
ATOM   10681 C  C   . PRO C 1 454 ? 9.197   -10.193 -74.365  1.00 27.34 ? 443  PRO C C   1 
ATOM   10682 O  O   . PRO C 1 454 ? 8.700   -11.291 -74.106  1.00 28.01 ? 443  PRO C O   1 
ATOM   10683 C  CB  . PRO C 1 454 ? 11.566  -10.281 -73.548  1.00 25.66 ? 443  PRO C CB  1 
ATOM   10684 C  CG  . PRO C 1 454 ? 12.049  -10.453 -72.186  1.00 25.61 ? 443  PRO C CG  1 
ATOM   10685 C  CD  . PRO C 1 454 ? 10.913  -10.464 -71.280  1.00 25.56 ? 443  PRO C CD  1 
ATOM   10686 N  N   . LEU C 1 455 ? 8.902   -9.486  -75.447  1.00 28.21 ? 444  LEU C N   1 
ATOM   10687 C  CA  . LEU C 1 455 ? 7.994   -9.953  -76.473  1.00 28.45 ? 444  LEU C CA  1 
ATOM   10688 C  C   . LEU C 1 455 ? 8.835   -10.502 -77.610  1.00 29.11 ? 444  LEU C C   1 
ATOM   10689 O  O   . LEU C 1 455 ? 8.623   -11.637 -78.074  1.00 30.00 ? 444  LEU C O   1 
ATOM   10690 C  CB  . LEU C 1 455 ? 7.106   -8.797  -76.973  1.00 28.66 ? 444  LEU C CB  1 
ATOM   10691 C  CG  . LEU C 1 455 ? 5.621   -8.828  -76.626  1.00 28.27 ? 444  LEU C CG  1 
ATOM   10692 C  CD1 . LEU C 1 455 ? 4.942   -7.572  -77.119  1.00 24.36 ? 444  LEU C CD1 1 
ATOM   10693 C  CD2 . LEU C 1 455 ? 4.993   -10.049 -77.246  1.00 28.45 ? 444  LEU C CD2 1 
ATOM   10694 N  N   . VAL C 1 456 ? 9.795   -9.685  -78.033  1.00 28.77 ? 445  VAL C N   1 
ATOM   10695 C  CA  . VAL C 1 456 ? 10.748  -10.039 -79.078  1.00 28.92 ? 445  VAL C CA  1 
ATOM   10696 C  C   . VAL C 1 456 ? 12.133  -9.598  -78.627  1.00 29.62 ? 445  VAL C C   1 
ATOM   10697 O  O   . VAL C 1 456 ? 12.286  -8.487  -78.114  1.00 30.39 ? 445  VAL C O   1 
ATOM   10698 C  CB  . VAL C 1 456 ? 10.393  -9.331  -80.407  1.00 28.70 ? 445  VAL C CB  1 
ATOM   10699 C  CG1 . VAL C 1 456 ? 11.381  -9.719  -81.532  1.00 27.50 ? 445  VAL C CG1 1 
ATOM   10700 C  CG2 . VAL C 1 456 ? 8.955   -9.643  -80.794  1.00 28.38 ? 445  VAL C CG2 1 
ATOM   10701 N  N   . VAL C 1 457 ? 13.139  -10.465 -78.771  1.00 29.29 ? 446  VAL C N   1 
ATOM   10702 C  CA  . VAL C 1 457 ? 14.515  -10.062 -78.471  1.00 28.78 ? 446  VAL C CA  1 
ATOM   10703 C  C   . VAL C 1 457 ? 15.317  -10.258 -79.723  1.00 28.55 ? 446  VAL C C   1 
ATOM   10704 O  O   . VAL C 1 457 ? 15.175  -11.261 -80.426  1.00 28.01 ? 446  VAL C O   1 
ATOM   10705 C  CB  . VAL C 1 457 ? 15.183  -10.847 -77.315  1.00 29.45 ? 446  VAL C CB  1 
ATOM   10706 C  CG1 . VAL C 1 457 ? 16.664  -10.454 -77.176  1.00 29.37 ? 446  VAL C CG1 1 
ATOM   10707 C  CG2 . VAL C 1 457 ? 14.469  -10.596 -76.008  1.00 29.52 ? 446  VAL C CG2 1 
ATOM   10708 N  N   . ILE C 1 458 ? 16.156  -9.278  -80.003  1.00 27.51 ? 447  ILE C N   1 
ATOM   10709 C  CA  . ILE C 1 458 ? 17.054  -9.367  -81.107  1.00 27.41 ? 447  ILE C CA  1 
ATOM   10710 C  C   . ILE C 1 458 ? 18.451  -9.205  -80.563  1.00 28.16 ? 447  ILE C C   1 
ATOM   10711 O  O   . ILE C 1 458 ? 18.714  -8.345  -79.722  1.00 31.04 ? 447  ILE C O   1 
ATOM   10712 C  CB  . ILE C 1 458 ? 16.674  -8.343  -82.160  1.00 27.35 ? 447  ILE C CB  1 
ATOM   10713 C  CG1 . ILE C 1 458 ? 15.348  -8.784  -82.796  1.00 26.96 ? 447  ILE C CG1 1 
ATOM   10714 C  CG2 . ILE C 1 458 ? 17.766  -8.206  -83.170  1.00 25.77 ? 447  ILE C CG2 1 
ATOM   10715 C  CD1 . ILE C 1 458 ? 14.515  -7.686  -83.320  1.00 26.96 ? 447  ILE C CD1 1 
ATOM   10716 N  N   . SER C 1 459 ? 19.329  -10.100 -80.981  1.00 27.93 ? 448  SER C N   1 
ATOM   10717 C  CA  . SER C 1 459 ? 20.714  -10.083 -80.588  1.00 27.60 ? 448  SER C CA  1 
ATOM   10718 C  C   . SER C 1 459 ? 21.460  -10.048 -81.894  1.00 27.60 ? 448  SER C C   1 
ATOM   10719 O  O   . SER C 1 459 ? 21.137  -10.801 -82.795  1.00 26.79 ? 448  SER C O   1 
ATOM   10720 C  CB  . SER C 1 459 ? 21.029  -11.347 -79.804  1.00 26.76 ? 448  SER C CB  1 
ATOM   10721 O  OG  . SER C 1 459 ? 22.342  -11.338 -79.290  1.00 27.99 ? 448  SER C OG  1 
ATOM   10722 N  N   . GLN C 1 460 ? 22.421  -9.144  -82.017  1.00 28.95 ? 449  GLN C N   1 
ATOM   10723 C  CA  . GLN C 1 460 ? 23.280  -9.049  -83.225  1.00 29.81 ? 449  GLN C CA  1 
ATOM   10724 C  C   . GLN C 1 460 ? 22.496  -8.922  -84.539  1.00 30.43 ? 449  GLN C C   1 
ATOM   10725 O  O   . GLN C 1 460 ? 22.940  -9.384  -85.593  1.00 30.89 ? 449  GLN C O   1 
ATOM   10726 C  CB  . GLN C 1 460 ? 24.286  -10.225 -83.297  1.00 29.97 ? 449  GLN C CB  1 
ATOM   10727 C  CG  . GLN C 1 460 ? 25.424  -10.128 -82.273  1.00 30.18 ? 449  GLN C CG  1 
ATOM   10728 C  CD  . GLN C 1 460 ? 26.562  -11.098 -82.531  1.00 29.67 ? 449  GLN C CD  1 
ATOM   10729 O  OE1 . GLN C 1 460 ? 27.504  -10.775 -83.235  1.00 28.77 ? 449  GLN C OE1 1 
ATOM   10730 N  NE2 . GLN C 1 460 ? 26.492  -12.281 -81.930  1.00 31.05 ? 449  GLN C NE2 1 
ATOM   10731 N  N   . GLY C 1 461 ? 21.345  -8.268  -84.485  1.00 30.03 ? 450  GLY C N   1 
ATOM   10732 C  CA  . GLY C 1 461 ? 20.495  -8.151  -85.669  1.00 30.22 ? 450  GLY C CA  1 
ATOM   10733 C  C   . GLY C 1 461 ? 19.852  -9.466  -86.092  1.00 30.18 ? 450  GLY C C   1 
ATOM   10734 O  O   . GLY C 1 461 ? 19.444  -9.601  -87.243  1.00 30.36 ? 450  GLY C O   1 
ATOM   10735 N  N   . LYS C 1 462 ? 19.762  -10.432 -85.172  1.00 29.72 ? 451  LYS C N   1 
ATOM   10736 C  CA  . LYS C 1 462 ? 19.050  -11.700 -85.435  1.00 30.20 ? 451  LYS C CA  1 
ATOM   10737 C  C   . LYS C 1 462 ? 17.982  -11.988 -84.381  1.00 30.01 ? 451  LYS C C   1 
ATOM   10738 O  O   . LYS C 1 462 ? 18.283  -12.002 -83.202  1.00 30.07 ? 451  LYS C O   1 
ATOM   10739 C  CB  . LYS C 1 462 ? 20.044  -12.866 -85.553  1.00 29.77 ? 451  LYS C CB  1 
ATOM   10740 C  CG  . LYS C 1 462 ? 20.639  -12.936 -86.937  1.00 29.56 ? 451  LYS C CG  1 
ATOM   10741 C  CD  . LYS C 1 462 ? 21.641  -14.032 -87.116  1.00 31.33 ? 451  LYS C CD  1 
ATOM   10742 C  CE  . LYS C 1 462 ? 21.839  -14.320 -88.592  1.00 32.87 ? 451  LYS C CE  1 
ATOM   10743 N  NZ  . LYS C 1 462 ? 21.896  -13.074 -89.414  1.00 36.40 ? 451  LYS C NZ  1 
ATOM   10744 N  N   . ILE C 1 463 ? 16.740  -12.214 -84.822  1.00 29.76 ? 452  ILE C N   1 
ATOM   10745 C  CA  . ILE C 1 463 ? 15.635  -12.500 -83.922  1.00 29.81 ? 452  ILE C CA  1 
ATOM   10746 C  C   . ILE C 1 463 ? 16.017  -13.720 -83.131  1.00 31.15 ? 452  ILE C C   1 
ATOM   10747 O  O   . ILE C 1 463 ? 16.159  -14.813 -83.688  1.00 31.86 ? 452  ILE C O   1 
ATOM   10748 C  CB  . ILE C 1 463 ? 14.306  -12.835 -84.634  1.00 29.02 ? 452  ILE C CB  1 
ATOM   10749 C  CG1 . ILE C 1 463 ? 13.923  -11.781 -85.664  1.00 28.88 ? 452  ILE C CG1 1 
ATOM   10750 C  CG2 . ILE C 1 463 ? 13.180  -12.966 -83.627  1.00 28.57 ? 452  ILE C CG2 1 
ATOM   10751 C  CD1 . ILE C 1 463 ? 13.584  -12.380 -87.012  1.00 27.46 ? 452  ILE C CD1 1 
ATOM   10752 N  N   . VAL C 1 464 ? 16.183  -13.550 -81.827  1.00 31.62 ? 453  VAL C N   1 
ATOM   10753 C  CA  . VAL C 1 464 ? 16.531  -14.680 -80.989  1.00 31.74 ? 453  VAL C CA  1 
ATOM   10754 C  C   . VAL C 1 464 ? 15.352  -15.135 -80.147  1.00 32.55 ? 453  VAL C C   1 
ATOM   10755 O  O   . VAL C 1 464 ? 15.248  -16.316 -79.829  1.00 32.23 ? 453  VAL C O   1 
ATOM   10756 C  CB  . VAL C 1 464 ? 17.797  -14.406 -80.163  1.00 31.49 ? 453  VAL C CB  1 
ATOM   10757 C  CG1 . VAL C 1 464 ? 19.013  -14.523 -81.075  1.00 32.51 ? 453  VAL C CG1 1 
ATOM   10758 C  CG2 . VAL C 1 464 ? 17.757  -13.025 -79.509  1.00 29.03 ? 453  VAL C CG2 1 
ATOM   10759 N  N   . LEU C 1 465 ? 14.443  -14.221 -79.818  1.00 33.77 ? 454  LEU C N   1 
ATOM   10760 C  CA  . LEU C 1 465 ? 13.233  -14.590 -79.097  1.00 35.24 ? 454  LEU C CA  1 
ATOM   10761 C  C   . LEU C 1 465 ? 12.035  -13.986 -79.790  1.00 36.85 ? 454  LEU C C   1 
ATOM   10762 O  O   . LEU C 1 465 ? 12.051  -12.813 -80.184  1.00 37.64 ? 454  LEU C O   1 
ATOM   10763 C  CB  . LEU C 1 465 ? 13.286  -14.132 -77.634  1.00 34.77 ? 454  LEU C CB  1 
ATOM   10764 C  CG  . LEU C 1 465 ? 12.116  -14.529 -76.736  1.00 34.19 ? 454  LEU C CG  1 
ATOM   10765 C  CD1 . LEU C 1 465 ? 12.199  -16.008 -76.401  1.00 35.00 ? 454  LEU C CD1 1 
ATOM   10766 C  CD2 . LEU C 1 465 ? 12.095  -13.690 -75.448  1.00 34.76 ? 454  LEU C CD2 1 
ATOM   10767 N  N   . GLU C 1 466 ? 11.008  -14.809 -79.953  1.00 38.97 ? 455  GLU C N   1 
ATOM   10768 C  CA  . GLU C 1 466 ? 9.735   -14.381 -80.496  1.00 40.17 ? 455  GLU C CA  1 
ATOM   10769 C  C   . GLU C 1 466 ? 8.676   -15.394 -80.098  1.00 40.66 ? 455  GLU C C   1 
ATOM   10770 O  O   . GLU C 1 466 ? 8.996   -16.561 -79.901  1.00 40.79 ? 455  GLU C O   1 
ATOM   10771 C  CB  . GLU C 1 466 ? 9.810   -14.289 -82.011  1.00 40.33 ? 455  GLU C CB  1 
ATOM   10772 C  CG  . GLU C 1 466 ? 8.602   -13.586 -82.621  1.00 41.57 ? 455  GLU C CG  1 
ATOM   10773 C  CD  . GLU C 1 466 ? 8.319   -14.020 -84.051  1.00 43.15 ? 455  GLU C CD  1 
ATOM   10774 O  OE1 . GLU C 1 466 ? 8.828   -15.095 -84.474  1.00 47.44 ? 455  GLU C OE1 1 
ATOM   10775 O  OE2 . GLU C 1 466 ? 7.583   -13.272 -84.744  1.00 47.54 ? 455  GLU C OE2 1 
ATOM   10776 N  N   . ASP C 1 467 ? 7.430   -14.935 -79.954  1.00 42.04 ? 456  ASP C N   1 
ATOM   10777 C  CA  . ASP C 1 467 ? 6.272   -15.790 -79.640  1.00 42.28 ? 456  ASP C CA  1 
ATOM   10778 C  C   . ASP C 1 467 ? 6.594   -16.923 -78.663  1.00 42.69 ? 456  ASP C C   1 
ATOM   10779 O  O   . ASP C 1 467 ? 6.118   -18.060 -78.828  1.00 43.06 ? 456  ASP C O   1 
ATOM   10780 C  CB  . ASP C 1 467 ? 5.668   -16.379 -80.920  1.00 43.59 ? 456  ASP C CB  1 
ATOM   10781 C  CG  . ASP C 1 467 ? 5.101   -15.316 -81.852  1.00 46.47 ? 456  ASP C CG  1 
ATOM   10782 O  OD1 . ASP C 1 467 ? 4.280   -14.468 -81.406  1.00 48.92 ? 456  ASP C OD1 1 
ATOM   10783 O  OD2 . ASP C 1 467 ? 5.462   -15.353 -83.054  1.00 50.53 ? 456  ASP C OD2 1 
ATOM   10784 N  N   . GLY C 1 468 ? 7.410   -16.604 -77.654  1.00 42.05 ? 457  GLY C N   1 
ATOM   10785 C  CA  . GLY C 1 468 ? 7.808   -17.563 -76.623  1.00 41.40 ? 457  GLY C CA  1 
ATOM   10786 C  C   . GLY C 1 468 ? 8.902   -18.536 -77.018  1.00 40.95 ? 457  GLY C C   1 
ATOM   10787 O  O   . GLY C 1 468 ? 9.412   -19.265 -76.172  1.00 41.95 ? 457  GLY C O   1 
ATOM   10788 N  N   . THR C 1 469 ? 9.267   -18.553 -78.296  1.00 39.78 ? 458  THR C N   1 
ATOM   10789 C  CA  . THR C 1 469 ? 10.233  -19.508 -78.803  1.00 38.70 ? 458  THR C CA  1 
ATOM   10790 C  C   . THR C 1 469 ? 11.634  -18.920 -78.718  1.00 37.54 ? 458  THR C C   1 
ATOM   10791 O  O   . THR C 1 469 ? 11.845  -17.775 -79.121  1.00 37.43 ? 458  THR C O   1 
ATOM   10792 C  CB  . THR C 1 469 ? 9.955   -19.860 -80.290  1.00 38.07 ? 458  THR C CB  1 
ATOM   10793 O  OG1 . THR C 1 469 ? 8.539   -19.918 -80.532  1.00 38.76 ? 458  THR C OG1 1 
ATOM   10794 C  CG2 . THR C 1 469 ? 10.586  -21.178 -80.621  1.00 37.61 ? 458  THR C CG2 1 
ATOM   10795 N  N   . LEU C 1 470 ? 12.587  -19.705 -78.214  1.00 36.46 ? 459  LEU C N   1 
ATOM   10796 C  CA  . LEU C 1 470 ? 13.999  -19.310 -78.213  1.00 35.82 ? 459  LEU C CA  1 
ATOM   10797 C  C   . LEU C 1 470 ? 14.727  -19.931 -79.420  1.00 34.42 ? 459  LEU C C   1 
ATOM   10798 O  O   . LEU C 1 470 ? 14.624  -21.124 -79.650  1.00 34.34 ? 459  LEU C O   1 
ATOM   10799 C  CB  . LEU C 1 470 ? 14.676  -19.741 -76.909  1.00 36.06 ? 459  LEU C CB  1 
ATOM   10800 C  CG  . LEU C 1 470 ? 14.110  -19.190 -75.583  1.00 36.50 ? 459  LEU C CG  1 
ATOM   10801 C  CD1 . LEU C 1 470 ? 12.821  -19.899 -75.194  1.00 38.65 ? 459  LEU C CD1 1 
ATOM   10802 C  CD2 . LEU C 1 470 ? 15.091  -19.314 -74.441  1.00 36.40 ? 459  LEU C CD2 1 
ATOM   10803 N  N   . HIS C 1 471 ? 15.440  -19.111 -80.190  1.00 33.25 ? 460  HIS C N   1 
ATOM   10804 C  CA  . HIS C 1 471 ? 16.262  -19.569 -81.315  1.00 32.58 ? 460  HIS C CA  1 
ATOM   10805 C  C   . HIS C 1 471 ? 17.681  -19.026 -81.186  1.00 30.83 ? 460  HIS C C   1 
ATOM   10806 O  O   . HIS C 1 471 ? 18.059  -18.058 -81.849  1.00 29.03 ? 460  HIS C O   1 
ATOM   10807 C  CB  . HIS C 1 471 ? 15.719  -19.060 -82.648  1.00 33.83 ? 460  HIS C CB  1 
ATOM   10808 C  CG  . HIS C 1 471 ? 14.253  -19.269 -82.852  1.00 35.93 ? 460  HIS C CG  1 
ATOM   10809 N  ND1 . HIS C 1 471 ? 13.342  -18.235 -82.779  1.00 37.68 ? 460  HIS C ND1 1 
ATOM   10810 C  CD2 . HIS C 1 471 ? 13.546  -20.372 -83.195  1.00 37.64 ? 460  HIS C CD2 1 
ATOM   10811 C  CE1 . HIS C 1 471 ? 12.130  -18.703 -83.025  1.00 37.53 ? 460  HIS C CE1 1 
ATOM   10812 N  NE2 . HIS C 1 471 ? 12.225  -19.997 -83.274  1.00 36.68 ? 460  HIS C NE2 1 
ATOM   10813 N  N   . VAL C 1 472 ? 18.458  -19.647 -80.312  1.00 30.41 ? 461  VAL C N   1 
ATOM   10814 C  CA  . VAL C 1 472 ? 19.821  -19.210 -80.029  1.00 28.55 ? 461  VAL C CA  1 
ATOM   10815 C  C   . VAL C 1 472 ? 20.819  -20.091 -80.758  1.00 27.09 ? 461  VAL C C   1 
ATOM   10816 O  O   . VAL C 1 472 ? 20.564  -21.270 -80.993  1.00 25.20 ? 461  VAL C O   1 
ATOM   10817 C  CB  . VAL C 1 472 ? 20.114  -19.241 -78.507  1.00 28.42 ? 461  VAL C CB  1 
ATOM   10818 C  CG1 . VAL C 1 472 ? 19.199  -18.278 -77.772  1.00 27.43 ? 461  VAL C CG1 1 
ATOM   10819 C  CG2 . VAL C 1 472 ? 19.953  -20.629 -77.970  1.00 27.85 ? 461  VAL C CG2 1 
ATOM   10820 N  N   . THR C 1 473 ? 21.953  -19.496 -81.127  1.00 26.35 ? 462  THR C N   1 
ATOM   10821 C  CA  . THR C 1 473 ? 23.030  -20.215 -81.731  1.00 25.95 ? 462  THR C CA  1 
ATOM   10822 C  C   . THR C 1 473 ? 24.218  -20.220 -80.763  1.00 25.74 ? 462  THR C C   1 
ATOM   10823 O  O   . THR C 1 473 ? 24.867  -19.204 -80.519  1.00 24.39 ? 462  THR C O   1 
ATOM   1