data_2VQ6
# 
_entry.id   2VQ6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2VQ6         
PDBE  EBI-35651    
WWPDB D_1290035651 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2008-05-13 
_pdbx_database_PDB_obs_spr.pdb_id           2VQ6 
_pdbx_database_PDB_obs_spr.replace_pdb_id   2VB4 
_pdbx_database_PDB_obs_spr.details          ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1ZGB unspecified 
'CRYSTAL STRUCTURE OF TORPEDO CALIFORNICAACETYLCHOLINESTERASE IN COMPLEX WITH AN (R)-TACRINE(10)-HUPYRIDONE INHIBITOR.' 
PDB 1QTI unspecified ACETYLCHOLINESTERASE 
PDB 1AMN unspecified 
'TRANSITION STATE ANALOG: ACETYLCHOLINESTERASE COMPLEXED WITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 1E66 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-HUPRINE X AT 2.1A RESOLUTION' 
PDB 2J3D unspecified 'NATIVE MONOCLINIC FORM OF TORPEDO ACETYLCHOLINESTERASE' 
PDB 2ACK unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, MONOCHROMATIC DATA' 
PDB 1QII unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT F) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2CKM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH ALKYLENE-LINKED BIS-TACRINE DIMER (7 CARBON LINKER)' 
PDB 1DX6 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-GALANTHAMINE AT 2.3A RESOLUTION' 
PDB 1QIJ unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT G) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIE unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT B) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1ACL unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH DECAMETHONIUM' 
PDB 1W4L unspecified 'COMPLEX OF TCACHE WITH BIS-ACTING GALANTHAMINE DERIVATIVE' 
PDB 1ODC unspecified 
;STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH N-4'-QUINOLYL-N'-9 "-(1",2",3",4"-TETRAHYDROACRIDINYL)-1,8- DIAMINOOCTANE AT 2.2A RESOLUTION
;
PDB 2CMF unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH ALKYLENE-LINKED BIS-TACRINE DIMER (5 CARBON LINKER)' 
PDB 2J3Q unspecified 'TORPEDO ACETYLCHOLINESTERASE COMPLEXED WITH FLUOROPHORE THIOFLAVIN T' 
PDB 1GQS unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH NAP' 
PDB 2J4F unspecified 'TORPEDO ACETYLCHOLINESTERASE - HG HEAVY-ATOM DERIVATIVE' 
PDB 1E3Q unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH BW284C51' 
PDB 2DFP unspecified 'X-RAY STRUCTURE OF AGED DI-ISOPROPYL- PHOSPHORO-FLUORIDATE (DFP) BOUND TO ACETYLCHOLINESTERASE' 
PDB 1QIK unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT H) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2C5F unspecified 
'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N-TRIMETHYLAMMONIUM' 
PDB 1EA5 unspecified 'NATIVE ACETYLCHOLINESTERASE (E.C. 3.1.1.7 ) FROM TORPEDO CALIFORNICA AT 1.8A RESOLUTION' 
PDB 2VJC unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET A AT 150K
;
PDB 1EEA unspecified ACETYLCHOLINESTERASE 
PDB 1QIF unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT C) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2VJB unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET D AT 100K
;
PDB 1QIG unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT D) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1ZGC unspecified 
'CRYSTAL STRUCTURE OF TORPEDO CALIFORNICAACETYLCHOLINESTERASE IN COMPLEX WITH AN (RS)-TACRINE(10)-HUPYRIDONE INHIBITOR.' 
PDB 1QID unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT A) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2VJD unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET C AT 150K
;
PDB 1JJB unspecified 
'A NEUTRAL MOLECULE IN CATION-BINDING SITE: SPECIFIC BINDINGOF PEG-SH TO ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 1UT6 unspecified 
;STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH N-9-(1',2',3',4 '-TETRAHYDROACRIDINYL)-1,8- DIAMINOOCTANE AT 2.4 ANGSTROMS RESOLUTION.
;
PDB 2CEK unspecified 
;CONFORMATIONAL FLEXIBILITY IN THE PERIPHERAL SITE OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE REVEALED BY THE COMPLEX STRUCTURE WITH A BIFUNCTIONAL INHIBITOR
;
PDB 1QIM unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT I) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1JGA unspecified 
;THEORETICAL MODEL OF THE DIISOPROPYLPHOSPHORYL- ACETYLCHOLINESTERASE COMPLEXED WITH 1,7- HEPTYLENE-BIS-N,N'-SYN-2-PYRIDINIUMALDOXIME
;
PDB 1GPK unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXE WITH (+)-HUPERZINE A AT 2.1A RESOLUTION' 
PDB 3ACE unspecified 'THEORETICAL MODEL OF (R)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
PDB 1OCE unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH MF268' 
PDB 1W6R unspecified 'COMPLEX OF TCACHE WITH GALANTHAMINE DERIVATIVE' 
PDB 1SOM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE INHIBITED BY NERVE AGENT GD (SOMAN).' 
PDB 1VXO unspecified 
;METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 2VJA unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET A AT 100K
;
PDB 1CFJ unspecified 
'METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O- ISOPROPYLMETHYLPHOSPHONOFLUORIDATE (GB, SARIN)' 
PDB 2V96 unspecified 
'STRUCTURE OF THE UNPHOTOLYSED COMPLEX OF TCACHE WITH 1-(2-NITROPHENYL)-2,2,2- TRIFLUOROETHYL-ARSENOCHOLINE AT 100K' 
PDB 1AX9 unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, LAUE DATA' 
PDB 1U65 unspecified 'ACHE W. CPT-11' 
PDB 1W76 unspecified 
'ORTHORHOMBIC FORM OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE (ACHE) COMPLEXED WITH BIS- ACTING GALANTHAMINE DERIVATIVE' 
PDB 1H22 unspecified 
'STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH (S,S)-(-)-BIS(10)- HUPERZINE A-LIKE INHIBITOR AT 2.15A RESOLUTION' 
PDB 1EVE unspecified 
'THREE DIMENSIONAL STRUCTURE OF THE ANTI- ALZHEIMER DRUG, E2020 (ARICEPT), COMPLEXED WITH ITS TARGET ACETYLCHOLINESTERASE' 
PDB 2C4H unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 500MM ACETYLTHIOCHOLINE' 
PDB 1GQR unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH RIVASTIGMINE' 
PDB 2ACE unspecified 'NATIVE ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 2VA9 unspecified 
;STRUCTURE OF NATIVE TCACHE AFTER A 9 SECONDS ANNEALING TO ROOM TEMPERATURE DURING THE FIRST 5 SECONDS OF WHICH LASER IRRADIATION AT 266NM TOOK PLACE
;
PDB 1VXR unspecified 
;O-ETHYLMETHYLPHOSPHONYLATED ACETYLCHOLINESTERASE OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 4ACE unspecified 'THEORETICAL MODEL OF (S)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
PDB 2C58 unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 20MM ACETYLTHIOCHOLINE' 
PDB 1HBJ unspecified 
;X-RAY CRYSTAL STRUCTURE OF COMPLEX BETWEEN TORPEDO CALIFORNICA ACHE AND A REVERSIBLE INHIBITOR, 4-AMINO-5-FLUORO-2-METHYL-3-( 3-TRIFLUOROACETYLBENZYLTHIOMETHYL)QUINOLINE
;
PDB 1VOT unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE A' 
PDB 1W75 unspecified 'NATIVE ORTHORHOMBIC FORM OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE (ACHE)' 
PDB 2C5G unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 20MM THIOCHOLINE' 
PDB 2V98 unspecified 
;STRUCTURE OF THE COMPLEX OF TCACHE WITH 1 -(2-NITROPHENYL)-2,2,2-TRIFLUOROETHYL- ARSENOCHOLINE AFTER A 9 SECONDS ANNEALING TO ROOM TEMPERATURE, DURING HTE FIRST 5 SECONDS OF WHICH LASER IRRADIATION AT 266NM TOOK PLACE
;
PDB 1JGB unspecified 
;THEORETICAL MODEL OF THE DIISOPROPYLPHOSPHORYL- ACETYLCHOLINESTERASE COMPLEXED WITH 1,3- PROPYLENE-BIS-N,N'-SYN-4-PYRIDINIUMALDOXIME
;
PDB 1GPN unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE B AT 2.35A RESOLUTION' 
PDB 1QIH unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT E) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1H23 unspecified 
'STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH (S,S)-(-)-BIS(12)- HUPERZINE A-LIKE INHIBITOR AT 2.15A RESOLUTION' 
PDB 1FSS unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH FASCICULIN- II' 
PDB 1ACJ unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH TACRINE' 
PDB 2V97 unspecified 
;STRUCTURE OF THE UNPHOTOLYSED COMPLEX OF TCACHE WITH 1-(2-NITROPHENYL)-2,2,2- TRIFLUOROETHYL-ARSENOCHOLINE AFTER A 9 SECONDS ANNEALING TO ROOM TEMPERATURE
;
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2VQ6 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2008-03-11 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Harel, M.'     1 
'Silman, I.'    2 
'Sussman, J.L.' 3 
# 
_citation.id                        primary 
_citation.title                     'The Structure of Torpedo Californica Acetylcholinesterase Complexed with 2-Pam' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Harel, M.'     1 ? 
primary 'Silman, I.'    2 ? 
primary 'Sussman, J.L.' 3 ? 
# 
_cell.entry_id           2VQ6 
_cell.length_a           113.950 
_cell.length_b           113.950 
_cell.length_c           138.050 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2VQ6 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat ACETYLCHOLINESTERASE                                     61325.090 1  3.1.1.7 ? 'RESIDUES 22-464' 
'2-FORMYL-1-METHYL-PYRIDINIUM CHLORIDE (PRALYDOXIME, 2-PAM) IN ACTIVE SITE GORGE' 
2 non-polymer syn 'N-hydroxy-1-(1-methylpyridin-2(1H)-ylidene)methanamine' 138.167   1  ?       ? ?                 ? 
3 non-polymer syn 'SULFATE ION'                                            96.063    1  ?       ? ?                 ? 
4 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                 221.208   2  ?       ? ?                 ? 
5 water       nat water                                                    18.015    93 ?       ? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
1 538 ASP n 
1 539 GLY n 
1 540 GLU n 
1 541 LEU n 
1 542 SER n 
1 543 SER n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'PACIFIC ELECTRIC RAY' 
_entity_src_nat.pdbx_organism_scientific   'TORPEDO CALIFORNICA' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2VQ6 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 543 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  564 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                                 ? 'C3 H7 N O2 S'   121.158 
FP1 non-polymer                  . 'N-hydroxy-1-(1-methylpyridin-2(1H)-ylidene)methanamine' ? 'C7 H10 N2 O'    138.167 
GLN 'L-peptide linking'          y GLUTAMINE                                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                 ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                                   ? 'C3 H7 N O3'     105.093 
SO4 non-polymer                  . 'SULFATE ION'                                            ? 'O4 S -2'        96.063  
THR 'L-peptide linking'          y THREONINE                                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2VQ6 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.2 
_exptl_crystal.density_percent_sol   70 
_exptl_crystal.description           NONE 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU IMAGE PLATE' 
_diffrn_detector.pdbx_collection_date   1991-08-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2VQ6 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             15.66 
_reflns.d_resolution_high            2.80 
_reflns.number_obs                   26435 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.5 
_reflns.pdbx_Rmerge_I_obs            0.15 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.4 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.71 
_reflns_shell.d_res_low              2.78 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2VQ6 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     25095 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             15.66 
_refine.ls_d_res_high                            2.71 
_refine.ls_percent_reflns_obs                    100.0 
_refine.ls_R_factor_obs                          0.174 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.171 
_refine.ls_R_factor_R_free                       0.234 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  1340 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.941 
_refine.correlation_coeff_Fo_to_Fc_free          0.886 
_refine.B_iso_mean                               26.12 
_refine.aniso_B[1][1]                            0.16000 
_refine.aniso_B[2][2]                            0.16000 
_refine.aniso_B[3][3]                            -0.24000 
_refine.aniso_B[1][2]                            0.08000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2ACE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.359 
_refine.pdbx_overall_ESU_R_Free                  0.270 
_refine.overall_SU_ML                            0.197 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             10.334 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4220 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         43 
_refine_hist.number_atoms_solvent             93 
_refine_hist.number_atoms_total               4356 
_refine_hist.d_res_high                       2.71 
_refine_hist.d_res_low                        15.66 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.030  0.022  ? 4413 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          2.651  1.951  ? 5993 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       8.713  5.000  ? 533  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.268 23.886 ? 211  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       23.475 15.000 ? 709  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.850 15.000 ? 25   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.166  0.200  ? 628  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.010  0.020  ? 3415 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.269  0.200  ? 2056 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.348  0.200  ? 3050 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.183  0.200  ? 163  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.288  0.200  ? 16   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.314  0.200  ? 2    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.256  1.500  ? 2681 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.314  2.000  ? 4268 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.417  3.000  ? 1962 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 5.600  4.500  ? 1722 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.71 
_refine_ls_shell.d_res_low                        2.78 
_refine_ls_shell.number_reflns_R_work             708 
_refine_ls_shell.R_factor_R_work                  0.3100 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3190 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             39 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2VQ6 
_struct.title                     'Torpedo californica acetylcholinesterase complexed with 2-PAM' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2VQ6 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;SERINE ESTERASE, ALTERNATIVE SPLICING, NEUROTRANSMITTER DEGRADATION, LIPOPROTEIN, GLYCOPROTEIN, TORPEDO ACHE, CELL JUNCTION, ANTICANCER PRODRUG CPT- 11, SYNAPSE, MEMBRANE, HYDROLASE, GPI-ANCHOR
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PHE A 78  ? MET A 83  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P2  2  LEU A 127 ? ASN A 131 ? LEU A 127 ASN A 131 5 ? 5  
HELX_P HELX_P3  3  GLY A 132 ? GLU A 140 ? GLY A 132 GLU A 140 1 ? 9  
HELX_P HELX_P4  4  VAL A 150 ? LEU A 156 ? VAL A 150 LEU A 156 1 ? 7  
HELX_P HELX_P5  5  ASN A 167 ? ILE A 184 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P6  6  GLN A 185 ? PHE A 187 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P7  7  SER A 200 ? SER A 212 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P8  8  SER A 215 ? PHE A 219 ? SER A 215 PHE A 219 5 ? 5  
HELX_P HELX_P9  9  SER A 237 ? ASN A 251 ? SER A 237 ASN A 251 1 ? 15 
HELX_P HELX_P10 10 SER A 258 ? LYS A 269 ? SER A 258 LYS A 269 1 ? 12 
HELX_P HELX_P11 11 LYS A 270 ? GLU A 278 ? LYS A 270 GLU A 278 1 ? 9  
HELX_P HELX_P12 12 TRP A 279 ? LEU A 282 ? TRP A 279 LEU A 282 5 ? 4  
HELX_P HELX_P13 13 SER A 304 ? SER A 311 ? SER A 304 SER A 311 1 ? 8  
HELX_P HELX_P14 14 GLY A 328 ? ALA A 336 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P15 15 SER A 348 ? VAL A 360 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P16 16 ASN A 364 ? THR A 376 ? ASN A 364 THR A 376 1 ? 13 
HELX_P HELX_P17 17 ASN A 383 ? VAL A 400 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P18 18 VAL A 400 ? GLY A 415 ? VAL A 400 GLY A 415 1 ? 16 
HELX_P HELX_P19 19 PRO A 433 ? GLY A 437 ? PRO A 433 GLY A 437 5 ? 5  
HELX_P HELX_P20 20 GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P21 21 GLY A 449 ? VAL A 453 ? GLY A 449 VAL A 453 5 ? 5  
HELX_P HELX_P22 22 VAL A 453 ? ASN A 457 ? VAL A 453 ASN A 457 5 ? 5  
HELX_P HELX_P23 23 THR A 459 ? GLY A 480 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P24 24 ARG A 517 ? GLN A 526 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P25 25 GLN A 526 ? THR A 535 ? GLN A 526 THR A 535 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67  A CYS 94   1_555 ? ? ? ? ? ? ? 2.075 ? ?               
disulf2 disulf ?   ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254 A CYS 265  1_555 ? ? ? ? ? ? ? 1.998 ? ?               
disulf3 disulf ?   ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402 A CYS 521  1_555 ? ? ? ? ? ? ? 2.136 ? ?               
covale1 covale one ? A ASN 59  ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 59  A NAG 1539 1_555 ? ? ? ? ? ? ? 1.478 ? N-Glycosylation 
covale2 covale one ? A ASN 416 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 416 A NAG 1538 1_555 ? ? ? ? ? ? ? 1.462 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       4.06 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 7   ? THR A 10  ? LEU A 7   THR A 10  
AA 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
AA 3  VAL A 57  ? ASN A 59  ? VAL A 57  ASN A 59  
AB 1  THR A 18  ? PRO A 21  ? THR A 18  PRO A 21  
AB 2  HIS A 26  ? PRO A 34  ? HIS A 26  PRO A 34  
AB 3  TYR A 96  ? VAL A 101 ? TYR A 96  VAL A 101 
AB 4  VAL A 142 ? SER A 145 ? VAL A 142 SER A 145 
AB 5  THR A 109 ? ILE A 115 ? THR A 109 ILE A 115 
AB 6  GLY A 189 ? GLU A 199 ? GLY A 189 GLU A 199 
AB 7  ARG A 221 ? GLN A 225 ? ARG A 221 GLN A 225 
AB 8  ILE A 319 ? ASN A 324 ? ILE A 319 ASN A 324 
AB 9  THR A 418 ? PHE A 423 ? THR A 418 PHE A 423 
AB 10 LYS A 501 ? LEU A 505 ? LYS A 501 LEU A 505 
AB 11 VAL A 512 ? GLN A 514 ? VAL A 512 GLN A 514 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N THR A 10  ? N THR A 10  O GLY A 13  ? O GLY A 13  
AA 2  3  N MET A 16  ? N MET A 16  O TRP A 58  ? O TRP A 58  
AB 1  2  N VAL A 20  ? N VAL A 20  O ILE A 27  ? O ILE A 27  
AB 2  3  N ILE A 33  ? N ILE A 33  O LEU A 97  ? O LEU A 97  
AB 3  4  N TRP A 100 ? N TRP A 100 O LEU A 143 ? O LEU A 143 
AB 4  5  N VAL A 142 ? N VAL A 142 O THR A 110 ? O THR A 110 
AB 5  6  O THR A 109 ? O THR A 109 N ASP A 190 ? N ASP A 190 
AB 6  7  N ILE A 196 ? N ILE A 196 O ARG A 221 ? O ARG A 221 
AB 7  8  N LEU A 224 ? N LEU A 224 O LEU A 320 ? O LEU A 320 
AB 8  9  N LEU A 321 ? N LEU A 321 O TYR A 419 ? O TYR A 419 
AB 9  10 N PHE A 422 ? N PHE A 422 O ILE A 503 ? O ILE A 503 
AB 10 11 N PHE A 502 ? N PHE A 502 O HIS A 513 ? O HIS A 513 
# 
_database_PDB_matrix.entry_id          2VQ6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2VQ6 
_atom_sites.fract_transf_matrix[1][1]   0.008776 
_atom_sites.fract_transf_matrix[1][2]   0.005067 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010133 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007244 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 4   ? -13.163 89.524 35.610 1.00 51.22  ? 4    SER A N   1 
ATOM   2    C CA  . SER A 1 4   ? -12.278 89.944 36.762 1.00 50.81  ? 4    SER A CA  1 
ATOM   3    C C   . SER A 1 4   ? -11.080 88.923 36.880 1.00 50.89  ? 4    SER A C   1 
ATOM   4    O O   . SER A 1 4   ? -11.196 87.768 36.409 1.00 51.08  ? 4    SER A O   1 
ATOM   5    C CB  . SER A 1 4   ? -13.114 90.100 38.087 1.00 50.77  ? 4    SER A CB  1 
ATOM   6    O OG  . SER A 1 4   ? -12.429 90.856 39.099 1.00 49.59  ? 4    SER A OG  1 
ATOM   7    N N   . GLU A 1 5   ? -9.954  89.345 37.485 1.00 49.71  ? 5    GLU A N   1 
ATOM   8    C CA  . GLU A 1 5   ? -8.830  88.431 37.791 1.00 48.37  ? 5    GLU A CA  1 
ATOM   9    C C   . GLU A 1 5   ? -9.284  87.286 38.712 1.00 45.95  ? 5    GLU A C   1 
ATOM   10   O O   . GLU A 1 5   ? -8.739  86.182 38.674 1.00 46.46  ? 5    GLU A O   1 
ATOM   11   C CB  . GLU A 1 5   ? -7.638  89.182 38.389 1.00 47.66  ? 5    GLU A CB  1 
ATOM   12   C CG  . GLU A 1 5   ? -6.308  88.705 37.800 1.00 52.28  ? 5    GLU A CG  1 
ATOM   13   C CD  . GLU A 1 5   ? -5.096  89.073 38.695 1.00 61.19  ? 5    GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 5   ? -4.351  88.145 39.173 1.00 64.12  ? 5    GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 5   ? -4.901  90.293 38.955 1.00 62.68  ? 5    GLU A OE2 1 
ATOM   16   N N   . LEU A 1 6   ? -10.332 87.553 39.472 1.00 42.84  ? 6    LEU A N   1 
ATOM   17   C CA  . LEU A 1 6   ? -10.777 86.747 40.560 1.00 40.44  ? 6    LEU A CA  1 
ATOM   18   C C   . LEU A 1 6   ? -11.890 85.740 40.255 1.00 39.99  ? 6    LEU A C   1 
ATOM   19   O O   . LEU A 1 6   ? -12.424 85.109 41.168 1.00 39.09  ? 6    LEU A O   1 
ATOM   20   C CB  . LEU A 1 6   ? -11.306 87.725 41.574 1.00 40.34  ? 6    LEU A CB  1 
ATOM   21   C CG  . LEU A 1 6   ? -10.428 88.158 42.749 1.00 40.28  ? 6    LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 6   ? -8.865  88.152 42.461 1.00 39.91  ? 6    LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 6   ? -10.956 89.487 43.268 1.00 35.69  ? 6    LEU A CD2 1 
ATOM   24   N N   . LEU A 1 7   ? -12.276 85.611 38.987 1.00 39.67  ? 7    LEU A N   1 
ATOM   25   C CA  . LEU A 1 7   ? -13.342 84.670 38.609 1.00 39.08  ? 7    LEU A CA  1 
ATOM   26   C C   . LEU A 1 7   ? -12.780 83.685 37.635 1.00 38.19  ? 7    LEU A C   1 
ATOM   27   O O   . LEU A 1 7   ? -12.179 84.064 36.627 1.00 38.84  ? 7    LEU A O   1 
ATOM   28   C CB  . LEU A 1 7   ? -14.458 85.375 37.907 1.00 39.45  ? 7    LEU A CB  1 
ATOM   29   C CG  . LEU A 1 7   ? -15.894 84.890 38.126 1.00 40.99  ? 7    LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 7   ? -16.741 85.353 36.908 1.00 43.86  ? 7    LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 7   ? -16.130 83.420 38.385 1.00 42.26  ? 7    LEU A CD2 1 
ATOM   32   N N   . VAL A 1 8   ? -12.923 82.412 37.956 1.00 36.85  ? 8    VAL A N   1 
ATOM   33   C CA  . VAL A 1 8   ? -12.205 81.390 37.223 1.00 35.12  ? 8    VAL A CA  1 
ATOM   34   C C   . VAL A 1 8   ? -13.130 80.246 36.963 1.00 34.78  ? 8    VAL A C   1 
ATOM   35   O O   . VAL A 1 8   ? -13.937 79.795 37.820 1.00 33.75  ? 8    VAL A O   1 
ATOM   36   C CB  . VAL A 1 8   ? -10.932 80.933 37.918 1.00 34.96  ? 8    VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 8   ? -10.134 80.067 37.017 1.00 34.83  ? 8    VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 8   ? -10.097 82.114 38.230 1.00 35.13  ? 8    VAL A CG2 1 
ATOM   39   N N   . ASN A 1 9   ? -13.019 79.820 35.712 1.00 34.32  ? 9    ASN A N   1 
ATOM   40   C CA  . ASN A 1 9   ? -13.760 78.708 35.188 1.00 33.55  ? 9    ASN A CA  1 
ATOM   41   C C   . ASN A 1 9   ? -13.027 77.393 35.245 1.00 32.64  ? 9    ASN A C   1 
ATOM   42   O O   . ASN A 1 9   ? -11.895 77.284 34.741 1.00 33.73  ? 9    ASN A O   1 
ATOM   43   C CB  . ASN A 1 9   ? -13.978 79.021 33.768 1.00 34.22  ? 9    ASN A CB  1 
ATOM   44   C CG  . ASN A 1 9   ? -15.329 79.344 33.548 1.00 35.73  ? 9    ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 9   ? -16.212 78.700 34.146 1.00 37.22  ? 9    ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 9   ? -15.570 80.363 32.727 1.00 37.66  ? 9    ASN A ND2 1 
ATOM   47   N N   . THR A 1 10  ? -13.626 76.398 35.867 1.00 30.33  ? 10   THR A N   1 
ATOM   48   C CA  . THR A 1 10  ? -12.897 75.177 36.047 1.00 28.19  ? 10   THR A CA  1 
ATOM   49   C C   . THR A 1 10  ? -13.844 74.088 35.690 1.00 28.85  ? 10   THR A C   1 
ATOM   50   O O   . THR A 1 10  ? -15.081 74.186 35.941 1.00 29.43  ? 10   THR A O   1 
ATOM   51   C CB  . THR A 1 10  ? -12.452 74.899 37.531 1.00 27.50  ? 10   THR A CB  1 
ATOM   52   O OG1 . THR A 1 10  ? -13.526 74.279 38.242 1.00 27.16  ? 10   THR A OG1 1 
ATOM   53   C CG2 . THR A 1 10  ? -11.986 76.113 38.284 1.00 23.87  ? 10   THR A CG2 1 
ATOM   54   N N   . LYS A 1 11  ? -13.261 73.001 35.198 1.00 28.08  ? 11   LYS A N   1 
ATOM   55   C CA  . LYS A 1 11  ? -13.996 71.780 34.942 1.00 26.04  ? 11   LYS A CA  1 
ATOM   56   C C   . LYS A 1 11  ? -15.078 71.454 35.969 1.00 26.51  ? 11   LYS A C   1 
ATOM   57   O O   . LYS A 1 11  ? -16.054 70.851 35.621 1.00 25.95  ? 11   LYS A O   1 
ATOM   58   C CB  . LYS A 1 11  ? -12.997 70.657 34.737 1.00 24.90  ? 11   LYS A CB  1 
ATOM   59   C CG  . LYS A 1 11  ? -12.137 70.963 33.520 1.00 22.12  ? 11   LYS A CG  1 
ATOM   60   C CD  . LYS A 1 11  ? -11.044 69.986 33.270 1.00 21.21  ? 11   LYS A CD  1 
ATOM   61   C CE  . LYS A 1 11  ? -10.176 70.393 32.079 1.00 18.47  ? 11   LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 11  ? -9.053  69.377 32.054 1.00 21.24  ? 11   LYS A NZ  1 
ATOM   63   N N   . SER A 1 12  ? -14.956 71.874 37.219 1.00 27.97  ? 12   SER A N   1 
ATOM   64   C CA  . SER A 1 12  ? -16.005 71.492 38.172 1.00 30.38  ? 12   SER A CA  1 
ATOM   65   C C   . SER A 1 12  ? -17.065 72.598 38.327 1.00 31.00  ? 12   SER A C   1 
ATOM   66   O O   . SER A 1 12  ? -18.114 72.373 38.941 1.00 30.52  ? 12   SER A O   1 
ATOM   67   C CB  . SER A 1 12  ? -15.417 71.101 39.567 1.00 31.03  ? 12   SER A CB  1 
ATOM   68   O OG  . SER A 1 12  ? -14.474 70.016 39.569 1.00 33.35  ? 12   SER A OG  1 
ATOM   69   N N   . GLY A 1 13  ? -16.789 73.783 37.787 1.00 31.48  ? 13   GLY A N   1 
ATOM   70   C CA  . GLY A 1 13  ? -17.626 74.933 38.070 1.00 33.27  ? 13   GLY A CA  1 
ATOM   71   C C   . GLY A 1 13  ? -16.847 76.249 38.100 1.00 34.91  ? 13   GLY A C   1 
ATOM   72   O O   . GLY A 1 13  ? -15.601 76.282 38.029 1.00 34.90  ? 13   GLY A O   1 
ATOM   73   N N   . LYS A 1 14  ? -17.587 77.358 38.150 1.00 35.94  ? 14   LYS A N   1 
ATOM   74   C CA  . LYS A 1 14  ? -16.977 78.692 38.294 1.00 37.03  ? 14   LYS A CA  1 
ATOM   75   C C   . LYS A 1 14  ? -16.643 78.957 39.735 1.00 36.45  ? 14   LYS A C   1 
ATOM   76   O O   . LYS A 1 14  ? -17.452 78.716 40.666 1.00 35.76  ? 14   LYS A O   1 
ATOM   77   C CB  . LYS A 1 14  ? -17.881 79.815 37.803 1.00 37.07  ? 14   LYS A CB  1 
ATOM   78   C CG  . LYS A 1 14  ? -17.345 80.430 36.586 1.00 42.43  ? 14   LYS A CG  1 
ATOM   79   C CD  . LYS A 1 14  ? -18.449 80.772 35.553 1.00 49.36  ? 14   LYS A CD  1 
ATOM   80   C CE  . LYS A 1 14  ? -19.892 80.205 35.884 1.00 51.86  ? 14   LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 14  ? -20.941 80.695 34.875 1.00 50.23  ? 14   LYS A NZ  1 
ATOM   82   N N   . VAL A 1 15  ? -15.440 79.457 39.929 1.00 36.19  ? 15   VAL A N   1 
ATOM   83   C CA  . VAL A 1 15  ? -15.051 79.730 41.281 1.00 36.10  ? 15   VAL A CA  1 
ATOM   84   C C   . VAL A 1 15  ? -14.640 81.173 41.409 1.00 36.25  ? 15   VAL A C   1 
ATOM   85   O O   . VAL A 1 15  ? -13.866 81.704 40.592 1.00 34.80  ? 15   VAL A O   1 
ATOM   86   C CB  . VAL A 1 15  ? -14.047 78.650 41.848 1.00 35.57  ? 15   VAL A CB  1 
ATOM   87   C CG1 . VAL A 1 15  ? -12.588 78.959 41.563 1.00 34.61  ? 15   VAL A CG1 1 
ATOM   88   C CG2 . VAL A 1 15  ? -14.242 78.562 43.283 1.00 36.26  ? 15   VAL A CG2 1 
ATOM   89   N N   . MET A 1 16  ? -15.216 81.836 42.404 1.00 37.46  ? 16   MET A N   1 
ATOM   90   C CA  . MET A 1 16  ? -14.733 83.190 42.677 1.00 39.49  ? 16   MET A CA  1 
ATOM   91   C C   . MET A 1 16  ? -13.986 83.451 43.956 1.00 36.87  ? 16   MET A C   1 
ATOM   92   O O   . MET A 1 16  ? -14.539 83.341 45.034 1.00 36.20  ? 16   MET A O   1 
ATOM   93   C CB  . MET A 1 16  ? -15.830 84.205 42.541 1.00 40.15  ? 16   MET A CB  1 
ATOM   94   C CG  . MET A 1 16  ? -15.242 85.565 42.118 1.00 43.79  ? 16   MET A CG  1 
ATOM   95   S SD  . MET A 1 16  ? -16.175 86.808 42.980 1.00 45.66  ? 16   MET A SD  1 
ATOM   96   C CE  . MET A 1 16  ? -17.413 85.954 44.078 1.00 43.48  ? 16   MET A CE  1 
ATOM   97   N N   . GLY A 1 17  ? -12.737 83.833 43.780 1.00 35.79  ? 17   GLY A N   1 
ATOM   98   C CA  . GLY A 1 17  ? -11.852 84.030 44.872 1.00 36.14  ? 17   GLY A CA  1 
ATOM   99   C C   . GLY A 1 17  ? -11.898 85.408 45.476 1.00 36.09  ? 17   GLY A C   1 
ATOM   100  O O   . GLY A 1 17  ? -12.910 86.095 45.477 1.00 35.71  ? 17   GLY A O   1 
ATOM   101  N N   . THR A 1 18  ? -10.756 85.806 45.978 1.00 36.47  ? 18   THR A N   1 
ATOM   102  C CA  . THR A 1 18  ? -10.637 87.015 46.734 1.00 37.41  ? 18   THR A CA  1 
ATOM   103  C C   . THR A 1 18  ? -9.235  87.509 46.709 1.00 38.14  ? 18   THR A C   1 
ATOM   104  O O   . THR A 1 18  ? -8.259  86.812 46.469 1.00 37.55  ? 18   THR A O   1 
ATOM   105  C CB  . THR A 1 18  ? -10.998 86.834 48.230 1.00 37.54  ? 18   THR A CB  1 
ATOM   106  O OG1 . THR A 1 18  ? -11.140 88.126 48.781 1.00 38.71  ? 18   THR A OG1 1 
ATOM   107  C CG2 . THR A 1 18  ? -9.879  86.167 49.035 1.00 36.66  ? 18   THR A CG2 1 
ATOM   108  N N   . ARG A 1 19  ? -9.084  88.756 47.006 1.00 40.29  ? 19   ARG A N   1 
ATOM   109  C CA  . ARG A 1 19  ? -7.768  89.253 46.691 1.00 42.12  ? 19   ARG A CA  1 
ATOM   110  C C   . ARG A 1 19  ? -7.091  89.745 47.973 1.00 41.16  ? 19   ARG A C   1 
ATOM   111  O O   . ARG A 1 19  ? -7.652  90.599 48.672 1.00 40.82  ? 19   ARG A O   1 
ATOM   112  C CB  . ARG A 1 19  ? -7.872  90.237 45.487 1.00 43.03  ? 19   ARG A CB  1 
ATOM   113  C CG  . ARG A 1 19  ? -8.237  91.603 45.803 1.00 47.51  ? 19   ARG A CG  1 
ATOM   114  C CD  . ARG A 1 19  ? -6.936  92.234 46.257 1.00 56.95  ? 19   ARG A CD  1 
ATOM   115  N NE  . ARG A 1 19  ? -6.061  92.418 45.110 1.00 64.16  ? 19   ARG A NE  1 
ATOM   116  C CZ  . ARG A 1 19  ? -6.051  93.527 44.368 1.00 68.12  ? 19   ARG A CZ  1 
ATOM   117  N NH1 . ARG A 1 19  ? -6.854  94.567 44.683 1.00 68.14  ? 19   ARG A NH1 1 
ATOM   118  N NH2 . ARG A 1 19  ? -5.202  93.603 43.338 1.00 71.16  ? 19   ARG A NH2 1 
ATOM   119  N N   . VAL A 1 20  ? -5.950  89.129 48.322 1.00 40.46  ? 20   VAL A N   1 
ATOM   120  C CA  . VAL A 1 20  ? -5.265  89.423 49.610 1.00 39.37  ? 20   VAL A CA  1 
ATOM   121  C C   . VAL A 1 20  ? -4.026  90.368 49.548 1.00 39.01  ? 20   VAL A C   1 
ATOM   122  O O   . VAL A 1 20  ? -3.401  90.548 48.488 1.00 39.34  ? 20   VAL A O   1 
ATOM   123  C CB  . VAL A 1 20  ? -4.924  88.149 50.400 1.00 39.08  ? 20   VAL A CB  1 
ATOM   124  C CG1 . VAL A 1 20  ? -6.147  87.277 50.556 1.00 37.07  ? 20   VAL A CG1 1 
ATOM   125  C CG2 . VAL A 1 20  ? -3.796  87.445 49.737 1.00 38.74  ? 20   VAL A CG2 1 
ATOM   126  N N   . PRO A 1 21  ? -3.709  91.027 50.675 1.00 38.28  ? 21   PRO A N   1 
ATOM   127  C CA  . PRO A 1 21  ? -2.517  91.904 50.622 1.00 37.85  ? 21   PRO A CA  1 
ATOM   128  C C   . PRO A 1 21  ? -1.302  91.128 51.000 1.00 37.29  ? 21   PRO A C   1 
ATOM   129  O O   . PRO A 1 21  ? -1.394  90.211 51.817 1.00 36.57  ? 21   PRO A O   1 
ATOM   130  C CB  . PRO A 1 21  ? -2.800  92.959 51.706 1.00 37.74  ? 21   PRO A CB  1 
ATOM   131  C CG  . PRO A 1 21  ? -3.803  92.219 52.722 1.00 38.19  ? 21   PRO A CG  1 
ATOM   132  C CD  . PRO A 1 21  ? -4.406  91.035 51.987 1.00 38.32  ? 21   PRO A CD  1 
ATOM   133  N N   . VAL A 1 22  ? -0.167  91.499 50.438 1.00 37.83  ? 22   VAL A N   1 
ATOM   134  C CA  . VAL A 1 22  ? 1.093   90.840 50.795 1.00 39.30  ? 22   VAL A CA  1 
ATOM   135  C C   . VAL A 1 22  ? 2.260   91.825 50.694 1.00 40.75  ? 22   VAL A C   1 
ATOM   136  O O   . VAL A 1 22  ? 2.505   92.387 49.624 1.00 40.71  ? 22   VAL A O   1 
ATOM   137  C CB  . VAL A 1 22  ? 1.324   89.460 49.993 1.00 39.02  ? 22   VAL A CB  1 
ATOM   138  C CG1 . VAL A 1 22  ? 0.978   89.565 48.517 1.00 37.81  ? 22   VAL A CG1 1 
ATOM   139  C CG2 . VAL A 1 22  ? 2.724   88.926 50.144 1.00 39.24  ? 22   VAL A CG2 1 
ATOM   140  N N   . LEU A 1 23  ? 2.978   92.038 51.805 1.00 42.72  ? 23   LEU A N   1 
ATOM   141  C CA  . LEU A 1 23  ? 4.048   93.052 51.847 1.00 44.52  ? 23   LEU A CA  1 
ATOM   142  C C   . LEU A 1 23  ? 3.498   94.399 51.375 1.00 46.51  ? 23   LEU A C   1 
ATOM   143  O O   . LEU A 1 23  ? 2.509   94.919 51.970 1.00 47.18  ? 23   LEU A O   1 
ATOM   144  C CB  . LEU A 1 23  ? 5.266   92.633 51.031 1.00 43.91  ? 23   LEU A CB  1 
ATOM   145  C CG  . LEU A 1 23  ? 6.135   91.620 51.799 1.00 44.68  ? 23   LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 23  ? 5.957   91.806 53.328 1.00 46.17  ? 23   LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 23  ? 5.916   90.163 51.419 1.00 42.14  ? 23   LEU A CD2 1 
ATOM   148  N N   . SER A 1 24  ? 4.095   94.952 50.318 1.00 47.78  ? 24   SER A N   1 
ATOM   149  C CA  . SER A 1 24  ? 3.565   96.188 49.701 1.00 49.25  ? 24   SER A CA  1 
ATOM   150  C C   . SER A 1 24  ? 2.427   95.926 48.682 1.00 49.16  ? 24   SER A C   1 
ATOM   151  O O   . SER A 1 24  ? 1.421   96.573 48.789 1.00 50.12  ? 24   SER A O   1 
ATOM   152  C CB  . SER A 1 24  ? 4.684   96.969 49.019 1.00 50.14  ? 24   SER A CB  1 
ATOM   153  O OG  . SER A 1 24  ? 5.310   96.101 48.061 1.00 55.32  ? 24   SER A OG  1 
ATOM   154  N N   . SER A 1 25  ? 2.592   95.000 47.719 1.00 48.47  ? 25   SER A N   1 
ATOM   155  C CA  . SER A 1 25  ? 1.560   94.600 46.718 1.00 47.58  ? 25   SER A CA  1 
ATOM   156  C C   . SER A 1 25  ? 0.231   93.926 47.167 1.00 46.58  ? 25   SER A C   1 
ATOM   157  O O   . SER A 1 25  ? -0.317  94.180 48.274 1.00 45.14  ? 25   SER A O   1 
ATOM   158  C CB  . SER A 1 25  ? 2.222   93.656 45.708 1.00 47.40  ? 25   SER A CB  1 
ATOM   159  O OG  . SER A 1 25  ? 2.430   94.218 44.427 1.00 49.29  ? 25   SER A OG  1 
ATOM   160  N N   . HIS A 1 26  ? -0.258  93.063 46.250 1.00 46.70  ? 26   HIS A N   1 
ATOM   161  C CA  . HIS A 1 26  ? -1.505  92.204 46.362 1.00 47.66  ? 26   HIS A CA  1 
ATOM   162  C C   . HIS A 1 26  ? -1.423  90.834 45.683 1.00 44.86  ? 26   HIS A C   1 
ATOM   163  O O   . HIS A 1 26  ? -0.449  90.526 45.017 1.00 45.68  ? 26   HIS A O   1 
ATOM   164  C CB  . HIS A 1 26  ? -2.695  92.920 45.774 1.00 49.26  ? 26   HIS A CB  1 
ATOM   165  C CG  . HIS A 1 26  ? -2.859  94.310 46.322 1.00 60.28  ? 26   HIS A CG  1 
ATOM   166  N ND1 . HIS A 1 26  ? -3.345  94.557 47.605 1.00 66.19  ? 26   HIS A ND1 1 
ATOM   167  C CD2 . HIS A 1 26  ? -2.563  95.532 45.779 1.00 66.31  ? 26   HIS A CD2 1 
ATOM   168  C CE1 . HIS A 1 26  ? -3.386  95.870 47.806 1.00 69.54  ? 26   HIS A CE1 1 
ATOM   169  N NE2 . HIS A 1 26  ? -2.911  96.483 46.721 1.00 70.50  ? 26   HIS A NE2 1 
ATOM   170  N N   . ILE A 1 27  ? -2.430  89.994 45.865 1.00 41.79  ? 27   ILE A N   1 
ATOM   171  C CA  . ILE A 1 27  ? -2.435  88.665 45.239 1.00 38.71  ? 27   ILE A CA  1 
ATOM   172  C C   . ILE A 1 27  ? -3.840  88.153 45.188 1.00 37.06  ? 27   ILE A C   1 
ATOM   173  O O   . ILE A 1 27  ? -4.734  88.681 45.866 1.00 36.77  ? 27   ILE A O   1 
ATOM   174  C CB  . ILE A 1 27  ? -1.584  87.667 46.018 1.00 38.76  ? 27   ILE A CB  1 
ATOM   175  C CG1 . ILE A 1 27  ? -0.684  86.942 45.104 1.00 37.51  ? 27   ILE A CG1 1 
ATOM   176  C CG2 . ILE A 1 27  ? -2.363  86.700 46.780 1.00 38.75  ? 27   ILE A CG2 1 
ATOM   177  C CD1 . ILE A 1 27  ? 0.659   87.623 45.161 1.00 41.96  ? 27   ILE A CD1 1 
ATOM   178  N N   . SER A 1 28  ? -4.080  87.121 44.411 1.00 34.50  ? 28   SER A N   1 
ATOM   179  C CA  . SER A 1 28  ? -5.413  86.612 44.505 1.00 33.02  ? 28   SER A CA  1 
ATOM   180  C C   . SER A 1 28  ? -5.383  85.295 45.244 1.00 31.37  ? 28   SER A C   1 
ATOM   181  O O   . SER A 1 28  ? -4.426  84.511 45.088 1.00 32.46  ? 28   SER A O   1 
ATOM   182  C CB  . SER A 1 28  ? -6.076  86.570 43.141 1.00 33.49  ? 28   SER A CB  1 
ATOM   183  O OG  . SER A 1 28  ? -5.127  86.678 42.083 1.00 38.85  ? 28   SER A OG  1 
ATOM   184  N N   . ALA A 1 29  ? -6.374  85.082 46.115 1.00 28.55  ? 29   ALA A N   1 
ATOM   185  C CA  . ALA A 1 29  ? -6.490  83.837 46.901 1.00 26.28  ? 29   ALA A CA  1 
ATOM   186  C C   . ALA A 1 29  ? -7.778  83.039 46.610 1.00 25.10  ? 29   ALA A C   1 
ATOM   187  O O   . ALA A 1 29  ? -8.845  83.624 46.575 1.00 24.74  ? 29   ALA A O   1 
ATOM   188  C CB  . ALA A 1 29  ? -6.384  84.142 48.389 1.00 25.40  ? 29   ALA A CB  1 
ATOM   189  N N   . PHE A 1 30  ? -7.699  81.729 46.367 1.00 24.15  ? 30   PHE A N   1 
ATOM   190  C CA  . PHE A 1 30  ? -8.938  80.938 46.237 1.00 23.63  ? 30   PHE A CA  1 
ATOM   191  C C   . PHE A 1 30  ? -8.971  79.939 47.383 1.00 23.84  ? 30   PHE A C   1 
ATOM   192  O O   . PHE A 1 30  ? -8.142  78.998 47.431 1.00 25.67  ? 30   PHE A O   1 
ATOM   193  C CB  . PHE A 1 30  ? -9.058  80.286 44.859 1.00 22.22  ? 30   PHE A CB  1 
ATOM   194  C CG  . PHE A 1 30  ? -9.011  81.281 43.705 1.00 24.03  ? 30   PHE A CG  1 
ATOM   195  C CD1 . PHE A 1 30  ? -10.195 81.689 43.053 1.00 20.34  ? 30   PHE A CD1 1 
ATOM   196  C CD2 . PHE A 1 30  ? -7.757  81.860 43.280 1.00 27.46  ? 30   PHE A CD2 1 
ATOM   197  C CE1 . PHE A 1 30  ? -10.157 82.564 42.013 1.00 17.05  ? 30   PHE A CE1 1 
ATOM   198  C CE2 . PHE A 1 30  ? -7.698  82.806 42.202 1.00 20.16  ? 30   PHE A CE2 1 
ATOM   199  C CZ  . PHE A 1 30  ? -8.929  83.128 41.590 1.00 21.40  ? 30   PHE A CZ  1 
ATOM   200  N N   . LEU A 1 31  ? -9.880  80.155 48.325 1.00 22.36  ? 31   LEU A N   1 
ATOM   201  C CA  . LEU A 1 31  ? -9.800  79.492 49.609 1.00 21.05  ? 31   LEU A CA  1 
ATOM   202  C C   . LEU A 1 31  ? -10.917 78.505 49.739 1.00 21.88  ? 31   LEU A C   1 
ATOM   203  O O   . LEU A 1 31  ? -12.097 78.829 49.656 1.00 23.34  ? 31   LEU A O   1 
ATOM   204  C CB  . LEU A 1 31  ? -9.845  80.500 50.753 1.00 19.66  ? 31   LEU A CB  1 
ATOM   205  C CG  . LEU A 1 31  ? -8.533  81.198 51.241 1.00 20.26  ? 31   LEU A CG  1 
ATOM   206  C CD1 . LEU A 1 31  ? -7.156  81.095 50.450 1.00 13.39  ? 31   LEU A CD1 1 
ATOM   207  C CD2 . LEU A 1 31  ? -8.867  82.609 51.501 1.00 17.95  ? 31   LEU A CD2 1 
ATOM   208  N N   . GLY A 1 32  ? -10.582 77.249 49.906 1.00 22.09  ? 32   GLY A N   1 
ATOM   209  C CA  . GLY A 1 32  ? -11.659 76.358 50.249 1.00 22.15  ? 32   GLY A CA  1 
ATOM   210  C C   . GLY A 1 32  ? -12.462 75.804 49.105 1.00 21.98  ? 32   GLY A C   1 
ATOM   211  O O   . GLY A 1 32  ? -13.695 75.613 49.281 1.00 22.31  ? 32   GLY A O   1 
ATOM   212  N N   . ILE A 1 33  ? -11.761 75.517 47.985 1.00 20.32  ? 33   ILE A N   1 
ATOM   213  C CA  . ILE A 1 33  ? -12.349 74.850 46.820 1.00 19.37  ? 33   ILE A CA  1 
ATOM   214  C C   . ILE A 1 33  ? -12.571 73.372 47.153 1.00 19.24  ? 33   ILE A C   1 
ATOM   215  O O   . ILE A 1 33  ? -11.640 72.706 47.543 1.00 19.42  ? 33   ILE A O   1 
ATOM   216  C CB  . ILE A 1 33  ? -11.436 75.047 45.625 1.00 18.89  ? 33   ILE A CB  1 
ATOM   217  C CG1 . ILE A 1 33  ? -11.216 76.544 45.463 1.00 17.87  ? 33   ILE A CG1 1 
ATOM   218  C CG2 . ILE A 1 33  ? -12.062 74.506 44.349 1.00 17.01  ? 33   ILE A CG2 1 
ATOM   219  C CD1 . ILE A 1 33  ? -10.260 76.920 44.330 1.00 17.51  ? 33   ILE A CD1 1 
ATOM   220  N N   . PRO A 1 34  ? -13.817 72.856 47.054 1.00 19.15  ? 34   PRO A N   1 
ATOM   221  C CA  . PRO A 1 34  ? -14.011 71.412 47.466 1.00 18.12  ? 34   PRO A CA  1 
ATOM   222  C C   . PRO A 1 34  ? -13.467 70.571 46.337 1.00 17.29  ? 34   PRO A C   1 
ATOM   223  O O   . PRO A 1 34  ? -13.614 71.011 45.235 1.00 17.80  ? 34   PRO A O   1 
ATOM   224  C CB  . PRO A 1 34  ? -15.539 71.225 47.491 1.00 17.16  ? 34   PRO A CB  1 
ATOM   225  C CG  . PRO A 1 34  ? -16.044 72.216 46.458 1.00 18.54  ? 34   PRO A CG  1 
ATOM   226  C CD  . PRO A 1 34  ? -15.055 73.459 46.507 1.00 19.26  ? 34   PRO A CD  1 
ATOM   227  N N   . PHE A 1 35  ? -12.859 69.414 46.570 1.00 16.25  ? 35   PHE A N   1 
ATOM   228  C CA  . PHE A 1 35  ? -12.436 68.569 45.493 1.00 15.59  ? 35   PHE A CA  1 
ATOM   229  C C   . PHE A 1 35  ? -12.853 67.155 45.608 1.00 17.33  ? 35   PHE A C   1 
ATOM   230  O O   . PHE A 1 35  ? -12.332 66.331 44.860 1.00 18.71  ? 35   PHE A O   1 
ATOM   231  C CB  . PHE A 1 35  ? -10.989 68.528 45.468 1.00 15.78  ? 35   PHE A CB  1 
ATOM   232  C CG  . PHE A 1 35  ? -10.321 67.958 46.750 1.00 18.31  ? 35   PHE A CG  1 
ATOM   233  C CD1 . PHE A 1 35  ? -10.041 66.605 46.884 1.00 20.05  ? 35   PHE A CD1 1 
ATOM   234  C CD2 . PHE A 1 35  ? -9.796  68.802 47.720 1.00 22.29  ? 35   PHE A CD2 1 
ATOM   235  C CE1 . PHE A 1 35  ? -9.337  66.096 47.969 1.00 18.84  ? 35   PHE A CE1 1 
ATOM   236  C CE2 . PHE A 1 35  ? -9.079  68.296 48.824 1.00 22.41  ? 35   PHE A CE2 1 
ATOM   237  C CZ  . PHE A 1 35  ? -8.893  66.922 48.950 1.00 19.97  ? 35   PHE A CZ  1 
ATOM   238  N N   . ALA A 1 36  ? -13.805 66.857 46.508 1.00 17.97  ? 36   ALA A N   1 
ATOM   239  C CA  . ALA A 1 36  ? -14.352 65.532 46.784 1.00 18.24  ? 36   ALA A CA  1 
ATOM   240  C C   . ALA A 1 36  ? -15.726 65.667 47.452 1.00 19.82  ? 36   ALA A C   1 
ATOM   241  O O   . ALA A 1 36  ? -16.036 66.673 48.081 1.00 19.58  ? 36   ALA A O   1 
ATOM   242  C CB  . ALA A 1 36  ? -13.458 64.814 47.706 1.00 17.55  ? 36   ALA A CB  1 
ATOM   243  N N   . GLU A 1 37  ? -16.542 64.629 47.383 1.00 21.35  ? 37   GLU A N   1 
ATOM   244  C CA  . GLU A 1 37  ? -17.824 64.687 48.047 1.00 23.02  ? 37   GLU A CA  1 
ATOM   245  C C   . GLU A 1 37  ? -17.496 64.606 49.515 1.00 23.76  ? 37   GLU A C   1 
ATOM   246  O O   . GLU A 1 37  ? -16.577 63.827 49.850 1.00 24.01  ? 37   GLU A O   1 
ATOM   247  C CB  . GLU A 1 37  ? -18.697 63.514 47.614 1.00 23.30  ? 37   GLU A CB  1 
ATOM   248  C CG  . GLU A 1 37  ? -19.436 63.719 46.286 1.00 27.44  ? 37   GLU A CG  1 
ATOM   249  C CD  . GLU A 1 37  ? -20.123 65.134 46.119 1.00 33.76  ? 37   GLU A CD  1 
ATOM   250  O OE1 . GLU A 1 37  ? -20.825 65.594 47.090 1.00 34.63  ? 37   GLU A OE1 1 
ATOM   251  O OE2 . GLU A 1 37  ? -19.952 65.767 44.993 1.00 33.83  ? 37   GLU A OE2 1 
ATOM   252  N N   . PRO A 1 38  ? -18.157 65.449 50.379 1.00 23.77  ? 38   PRO A N   1 
ATOM   253  C CA  . PRO A 1 38  ? -17.848 65.381 51.804 1.00 23.48  ? 38   PRO A CA  1 
ATOM   254  C C   . PRO A 1 38  ? -18.047 63.995 52.380 1.00 23.55  ? 38   PRO A C   1 
ATOM   255  O O   . PRO A 1 38  ? -19.105 63.418 52.228 1.00 23.79  ? 38   PRO A O   1 
ATOM   256  C CB  . PRO A 1 38  ? -18.750 66.457 52.454 1.00 22.16  ? 38   PRO A CB  1 
ATOM   257  C CG  . PRO A 1 38  ? -19.670 66.884 51.485 1.00 22.20  ? 38   PRO A CG  1 
ATOM   258  C CD  . PRO A 1 38  ? -19.086 66.567 50.104 1.00 24.51  ? 38   PRO A CD  1 
ATOM   259  N N   . PRO A 1 39  ? -17.005 63.466 53.045 1.00 24.58  ? 39   PRO A N   1 
ATOM   260  C CA  . PRO A 1 39  ? -16.975 62.103 53.526 1.00 25.15  ? 39   PRO A CA  1 
ATOM   261  C C   . PRO A 1 39  ? -17.676 62.025 54.850 1.00 26.01  ? 39   PRO A C   1 
ATOM   262  O O   . PRO A 1 39  ? -17.133 61.486 55.835 1.00 26.63  ? 39   PRO A O   1 
ATOM   263  C CB  . PRO A 1 39  ? -15.474 61.801 53.680 1.00 24.74  ? 39   PRO A CB  1 
ATOM   264  C CG  . PRO A 1 39  ? -14.789 63.119 53.655 1.00 24.86  ? 39   PRO A CG  1 
ATOM   265  C CD  . PRO A 1 39  ? -15.770 64.192 53.408 1.00 24.88  ? 39   PRO A CD  1 
ATOM   266  N N   . VAL A 1 40  ? -18.890 62.564 54.880 1.00 26.79  ? 40   VAL A N   1 
ATOM   267  C CA  . VAL A 1 40  ? -19.690 62.500 56.113 1.00 26.95  ? 40   VAL A CA  1 
ATOM   268  C C   . VAL A 1 40  ? -20.600 61.337 56.025 1.00 27.80  ? 40   VAL A C   1 
ATOM   269  O O   . VAL A 1 40  ? -20.561 60.566 55.089 1.00 26.14  ? 40   VAL A O   1 
ATOM   270  C CB  . VAL A 1 40  ? -20.532 63.724 56.332 1.00 25.70  ? 40   VAL A CB  1 
ATOM   271  C CG1 . VAL A 1 40  ? -19.605 64.872 56.506 1.00 25.72  ? 40   VAL A CG1 1 
ATOM   272  C CG2 . VAL A 1 40  ? -21.473 63.917 55.139 1.00 22.61  ? 40   VAL A CG2 1 
ATOM   273  N N   . GLY A 1 41  ? -21.432 61.224 57.033 1.00 30.13  ? 41   GLY A N   1 
ATOM   274  C CA  . GLY A 1 41  ? -22.480 60.211 56.984 1.00 33.41  ? 41   GLY A CA  1 
ATOM   275  C C   . GLY A 1 41  ? -21.784 58.912 57.149 1.00 34.58  ? 41   GLY A C   1 
ATOM   276  O O   . GLY A 1 41  ? -20.982 58.715 58.095 1.00 35.77  ? 41   GLY A O   1 
ATOM   277  N N   . ASN A 1 42  ? -22.020 58.065 56.175 1.00 35.82  ? 42   ASN A N   1 
ATOM   278  C CA  . ASN A 1 42  ? -21.289 56.823 56.128 1.00 37.04  ? 42   ASN A CA  1 
ATOM   279  C C   . ASN A 1 42  ? -20.618 56.595 54.755 1.00 35.69  ? 42   ASN A C   1 
ATOM   280  O O   . ASN A 1 42  ? -20.556 55.522 54.162 1.00 35.03  ? 42   ASN A O   1 
ATOM   281  C CB  . ASN A 1 42  ? -22.256 55.741 56.516 1.00 38.99  ? 42   ASN A CB  1 
ATOM   282  C CG  . ASN A 1 42  ? -23.365 55.639 55.543 1.00 42.48  ? 42   ASN A CG  1 
ATOM   283  O OD1 . ASN A 1 42  ? -23.455 56.459 54.614 1.00 47.02  ? 42   ASN A OD1 1 
ATOM   284  N ND2 . ASN A 1 42  ? -24.198 54.613 55.700 1.00 47.10  ? 42   ASN A ND2 1 
ATOM   285  N N   . MET A 1 43  ? -20.143 57.695 54.259 1.00 35.26  ? 43   MET A N   1 
ATOM   286  C CA  . MET A 1 43  ? -18.900 57.681 53.582 1.00 35.49  ? 43   MET A CA  1 
ATOM   287  C C   . MET A 1 43  ? -17.789 57.657 54.607 1.00 33.84  ? 43   MET A C   1 
ATOM   288  O O   . MET A 1 43  ? -16.639 57.552 54.214 1.00 34.36  ? 43   MET A O   1 
ATOM   289  C CB  . MET A 1 43  ? -18.770 58.948 52.832 1.00 35.99  ? 43   MET A CB  1 
ATOM   290  C CG  . MET A 1 43  ? -20.070 59.260 52.278 1.00 40.93  ? 43   MET A CG  1 
ATOM   291  S SD  . MET A 1 43  ? -19.891 59.004 50.566 1.00 51.29  ? 43   MET A SD  1 
ATOM   292  C CE  . MET A 1 43  ? -19.933 60.781 50.073 1.00 45.69  ? 43   MET A CE  1 
ATOM   293  N N   . ARG A 1 44  ? -18.082 57.735 55.903 1.00 31.81  ? 44   ARG A N   1 
ATOM   294  C CA  . ARG A 1 44  ? -16.982 57.605 56.852 1.00 29.64  ? 44   ARG A CA  1 
ATOM   295  C C   . ARG A 1 44  ? -16.051 56.381 56.605 1.00 27.83  ? 44   ARG A C   1 
ATOM   296  O O   . ARG A 1 44  ? -16.510 55.288 56.443 1.00 25.88  ? 44   ARG A O   1 
ATOM   297  C CB  . ARG A 1 44  ? -17.468 57.644 58.287 1.00 29.85  ? 44   ARG A CB  1 
ATOM   298  C CG  . ARG A 1 44  ? -16.278 57.823 59.236 1.00 27.96  ? 44   ARG A CG  1 
ATOM   299  C CD  . ARG A 1 44  ? -16.656 57.577 60.679 1.00 22.68  ? 44   ARG A CD  1 
ATOM   300  N NE  . ARG A 1 44  ? -17.254 58.779 61.138 1.00 19.49  ? 44   ARG A NE  1 
ATOM   301  C CZ  . ARG A 1 44  ? -17.901 58.932 62.272 1.00 19.31  ? 44   ARG A CZ  1 
ATOM   302  N NH1 . ARG A 1 44  ? -18.043 57.930 63.160 1.00 12.50  ? 44   ARG A NH1 1 
ATOM   303  N NH2 . ARG A 1 44  ? -18.381 60.150 62.507 1.00 17.41  ? 44   ARG A NH2 1 
ATOM   304  N N   . PHE A 1 45  ? -14.749 56.617 56.564 1.00 27.00  ? 45   PHE A N   1 
ATOM   305  C CA  . PHE A 1 45  ? -13.755 55.582 56.350 1.00 27.09  ? 45   PHE A CA  1 
ATOM   306  C C   . PHE A 1 45  ? -13.677 55.067 54.926 1.00 28.13  ? 45   PHE A C   1 
ATOM   307  O O   . PHE A 1 45  ? -12.838 54.197 54.654 1.00 27.55  ? 45   PHE A O   1 
ATOM   308  C CB  . PHE A 1 45  ? -13.973 54.365 57.253 1.00 26.14  ? 45   PHE A CB  1 
ATOM   309  C CG  . PHE A 1 45  ? -14.250 54.697 58.688 1.00 26.45  ? 45   PHE A CG  1 
ATOM   310  C CD1 . PHE A 1 45  ? -13.377 55.486 59.422 1.00 25.21  ? 45   PHE A CD1 1 
ATOM   311  C CD2 . PHE A 1 45  ? -15.371 54.172 59.329 1.00 26.36  ? 45   PHE A CD2 1 
ATOM   312  C CE1 . PHE A 1 45  ? -13.629 55.774 60.740 1.00 24.25  ? 45   PHE A CE1 1 
ATOM   313  C CE2 . PHE A 1 45  ? -15.634 54.466 60.658 1.00 25.09  ? 45   PHE A CE2 1 
ATOM   314  C CZ  . PHE A 1 45  ? -14.759 55.274 61.363 1.00 24.30  ? 45   PHE A CZ  1 
ATOM   315  N N   . ARG A 1 46  ? -14.553 55.552 54.040 1.00 29.29  ? 46   ARG A N   1 
ATOM   316  C CA  . ARG A 1 46  ? -14.679 54.986 52.688 1.00 31.28  ? 46   ARG A CA  1 
ATOM   317  C C   . ARG A 1 46  ? -13.691 55.728 51.811 1.00 31.12  ? 46   ARG A C   1 
ATOM   318  O O   . ARG A 1 46  ? -13.134 56.750 52.236 1.00 30.39  ? 46   ARG A O   1 
ATOM   319  C CB  . ARG A 1 46  ? -16.098 55.122 52.116 1.00 32.60  ? 46   ARG A CB  1 
ATOM   320  C CG  . ARG A 1 46  ? -17.255 54.348 52.892 1.00 40.10  ? 46   ARG A CG  1 
ATOM   321  C CD  . ARG A 1 46  ? -18.209 53.563 51.983 1.00 51.01  ? 46   ARG A CD  1 
ATOM   322  N NE  . ARG A 1 46  ? -17.341 52.990 50.956 1.00 62.67  ? 46   ARG A NE  1 
ATOM   323  C CZ  . ARG A 1 46  ? -17.338 53.370 49.673 1.00 69.12  ? 46   ARG A CZ  1 
ATOM   324  N NH1 . ARG A 1 46  ? -18.217 54.287 49.243 1.00 73.04  ? 46   ARG A NH1 1 
ATOM   325  N NH2 . ARG A 1 46  ? -16.455 52.844 48.811 1.00 70.75  ? 46   ARG A NH2 1 
ATOM   326  N N   . ARG A 1 47  ? -13.407 55.207 50.615 1.00 30.97  ? 47   ARG A N   1 
ATOM   327  C CA  . ARG A 1 47  ? -12.513 55.954 49.756 1.00 32.28  ? 47   ARG A CA  1 
ATOM   328  C C   . ARG A 1 47  ? -13.232 57.220 49.288 1.00 30.35  ? 47   ARG A C   1 
ATOM   329  O O   . ARG A 1 47  ? -14.452 57.223 49.197 1.00 31.01  ? 47   ARG A O   1 
ATOM   330  C CB  . ARG A 1 47  ? -11.911 55.120 48.614 1.00 31.48  ? 47   ARG A CB  1 
ATOM   331  C CG  . ARG A 1 47  ? -12.708 53.900 48.172 1.00 36.98  ? 47   ARG A CG  1 
ATOM   332  C CD  . ARG A 1 47  ? -11.956 53.165 46.948 1.00 38.88  ? 47   ARG A CD  1 
ATOM   333  N NE  . ARG A 1 47  ? -10.698 52.431 47.336 1.00 46.22  ? 47   ARG A NE  1 
ATOM   334  C CZ  . ARG A 1 47  ? -10.596 51.141 47.741 1.00 44.96  ? 47   ARG A CZ  1 
ATOM   335  N NH1 . ARG A 1 47  ? -11.670 50.325 47.835 1.00 42.98  ? 47   ARG A NH1 1 
ATOM   336  N NH2 . ARG A 1 47  ? -9.392  50.660 48.056 1.00 44.81  ? 47   ARG A NH2 1 
ATOM   337  N N   . PRO A 1 48  ? -12.497 58.305 49.008 1.00 29.63  ? 48   PRO A N   1 
ATOM   338  C CA  . PRO A 1 48  ? -13.214 59.544 48.615 1.00 29.14  ? 48   PRO A CA  1 
ATOM   339  C C   . PRO A 1 48  ? -13.881 59.495 47.224 1.00 29.29  ? 48   PRO A C   1 
ATOM   340  O O   . PRO A 1 48  ? -13.440 58.781 46.364 1.00 29.80  ? 48   PRO A O   1 
ATOM   341  C CB  . PRO A 1 48  ? -12.106 60.577 48.610 1.00 28.34  ? 48   PRO A CB  1 
ATOM   342  C CG  . PRO A 1 48  ? -10.775 59.746 48.418 1.00 28.39  ? 48   PRO A CG  1 
ATOM   343  C CD  . PRO A 1 48  ? -11.015 58.457 49.038 1.00 29.27  ? 48   PRO A CD  1 
ATOM   344  N N   . GLU A 1 49  ? -14.910 60.273 46.988 1.00 29.60  ? 49   GLU A N   1 
ATOM   345  C CA  . GLU A 1 49  ? -15.421 60.427 45.635 1.00 30.68  ? 49   GLU A CA  1 
ATOM   346  C C   . GLU A 1 49  ? -15.235 61.814 45.117 1.00 30.01  ? 49   GLU A C   1 
ATOM   347  O O   . GLU A 1 49  ? -15.143 62.738 45.896 1.00 31.04  ? 49   GLU A O   1 
ATOM   348  C CB  . GLU A 1 49  ? -16.885 60.232 45.632 1.00 31.76  ? 49   GLU A CB  1 
ATOM   349  C CG  . GLU A 1 49  ? -17.297 58.806 45.720 1.00 37.17  ? 49   GLU A CG  1 
ATOM   350  C CD  . GLU A 1 49  ? -18.798 58.736 45.982 1.00 42.60  ? 49   GLU A CD  1 
ATOM   351  O OE1 . GLU A 1 49  ? -19.537 59.820 46.068 1.00 39.08  ? 49   GLU A OE1 1 
ATOM   352  O OE2 . GLU A 1 49  ? -19.174 57.543 46.119 1.00 46.79  ? 49   GLU A OE2 1 
ATOM   353  N N   . PRO A 1 50  ? -15.203 61.986 43.799 1.00 29.15  ? 50   PRO A N   1 
ATOM   354  C CA  . PRO A 1 50  ? -14.876 63.266 43.170 1.00 29.79  ? 50   PRO A CA  1 
ATOM   355  C C   . PRO A 1 50  ? -15.903 64.359 43.484 1.00 30.03  ? 50   PRO A C   1 
ATOM   356  O O   . PRO A 1 50  ? -16.989 63.987 43.873 1.00 30.86  ? 50   PRO A O   1 
ATOM   357  C CB  . PRO A 1 50  ? -14.882 62.889 41.709 1.00 29.24  ? 50   PRO A CB  1 
ATOM   358  C CG  . PRO A 1 50  ? -14.556 61.494 41.766 1.00 28.25  ? 50   PRO A CG  1 
ATOM   359  C CD  . PRO A 1 50  ? -15.390 60.972 42.785 1.00 28.09  ? 50   PRO A CD  1 
ATOM   360  N N   . LYS A 1 51  ? -15.596 65.659 43.384 1.00 30.22  ? 51   LYS A N   1 
ATOM   361  C CA  . LYS A 1 51  ? -16.667 66.632 43.655 1.00 31.85  ? 51   LYS A CA  1 
ATOM   362  C C   . LYS A 1 51  ? -17.674 66.421 42.526 1.00 33.62  ? 51   LYS A C   1 
ATOM   363  O O   . LYS A 1 51  ? -17.419 65.627 41.664 1.00 34.96  ? 51   LYS A O   1 
ATOM   364  C CB  . LYS A 1 51  ? -16.236 68.102 43.778 1.00 31.24  ? 51   LYS A CB  1 
ATOM   365  C CG  . LYS A 1 51  ? -17.316 68.965 44.502 1.00 29.10  ? 51   LYS A CG  1 
ATOM   366  C CD  . LYS A 1 51  ? -18.050 68.046 45.452 1.00 29.82  ? 51   LYS A CD  1 
ATOM   367  C CE  . LYS A 1 51  ? -19.174 68.641 46.375 1.00 33.25  ? 51   LYS A CE  1 
ATOM   368  N NZ  . LYS A 1 51  ? -19.351 70.038 46.115 1.00 36.92  ? 51   LYS A NZ  1 
ATOM   369  N N   . LYS A 1 52  ? -18.837 67.038 42.533 1.00 34.45  ? 52   LYS A N   1 
ATOM   370  C CA  . LYS A 1 52  ? -19.765 66.745 41.498 1.00 35.05  ? 52   LYS A CA  1 
ATOM   371  C C   . LYS A 1 52  ? -19.991 68.106 41.058 1.00 34.54  ? 52   LYS A C   1 
ATOM   372  O O   . LYS A 1 52  ? -20.244 68.936 41.903 1.00 35.32  ? 52   LYS A O   1 
ATOM   373  C CB  . LYS A 1 52  ? -21.016 66.201 42.111 1.00 35.36  ? 52   LYS A CB  1 
ATOM   374  C CG  . LYS A 1 52  ? -22.033 65.783 41.058 1.00 41.36  ? 52   LYS A CG  1 
ATOM   375  C CD  . LYS A 1 52  ? -23.344 65.282 41.697 1.00 47.78  ? 52   LYS A CD  1 
ATOM   376  C CE  . LYS A 1 52  ? -23.069 64.775 43.154 1.00 52.84  ? 52   LYS A CE  1 
ATOM   377  N NZ  . LYS A 1 52  ? -22.260 63.500 43.141 1.00 55.94  ? 52   LYS A NZ  1 
ATOM   378  N N   . PRO A 1 53  ? -19.887 68.381 39.755 1.00 34.64  ? 53   PRO A N   1 
ATOM   379  C CA  . PRO A 1 53  ? -19.763 69.832 39.435 1.00 34.73  ? 53   PRO A CA  1 
ATOM   380  C C   . PRO A 1 53  ? -20.867 70.691 40.081 1.00 35.37  ? 53   PRO A C   1 
ATOM   381  O O   . PRO A 1 53  ? -21.959 70.213 40.298 1.00 37.04  ? 53   PRO A O   1 
ATOM   382  C CB  . PRO A 1 53  ? -19.783 69.845 37.933 1.00 33.44  ? 53   PRO A CB  1 
ATOM   383  C CG  . PRO A 1 53  ? -19.189 68.455 37.576 1.00 33.77  ? 53   PRO A CG  1 
ATOM   384  C CD  . PRO A 1 53  ? -19.852 67.537 38.547 1.00 34.00  ? 53   PRO A CD  1 
ATOM   385  N N   . TRP A 1 54  ? -20.571 71.882 40.547 1.00 35.87  ? 54   TRP A N   1 
ATOM   386  C CA  . TRP A 1 54  ? -21.640 72.729 41.086 1.00 36.75  ? 54   TRP A CA  1 
ATOM   387  C C   . TRP A 1 54  ? -22.090 73.657 39.938 1.00 40.08  ? 54   TRP A C   1 
ATOM   388  O O   . TRP A 1 54  ? -21.371 73.934 38.897 1.00 40.56  ? 54   TRP A O   1 
ATOM   389  C CB  . TRP A 1 54  ? -21.206 73.602 42.297 1.00 34.09  ? 54   TRP A CB  1 
ATOM   390  C CG  . TRP A 1 54  ? -19.957 74.324 42.015 1.00 31.05  ? 54   TRP A CG  1 
ATOM   391  C CD1 . TRP A 1 54  ? -19.827 75.554 41.489 1.00 29.19  ? 54   TRP A CD1 1 
ATOM   392  C CD2 . TRP A 1 54  ? -18.629 73.796 42.120 1.00 31.46  ? 54   TRP A CD2 1 
ATOM   393  N NE1 . TRP A 1 54  ? -18.484 75.876 41.290 1.00 26.73  ? 54   TRP A NE1 1 
ATOM   394  C CE2 . TRP A 1 54  ? -17.737 74.795 41.645 1.00 30.38  ? 54   TRP A CE2 1 
ATOM   395  C CE3 . TRP A 1 54  ? -18.100 72.567 42.572 1.00 30.31  ? 54   TRP A CE3 1 
ATOM   396  C CZ2 . TRP A 1 54  ? -16.359 74.615 41.628 1.00 31.86  ? 54   TRP A CZ2 1 
ATOM   397  C CZ3 . TRP A 1 54  ? -16.734 72.380 42.537 1.00 29.71  ? 54   TRP A CZ3 1 
ATOM   398  C CH2 . TRP A 1 54  ? -15.878 73.402 42.079 1.00 31.17  ? 54   TRP A CH2 1 
ATOM   399  N N   . SER A 1 55  ? -23.302 74.157 40.143 1.00 43.14  ? 55   SER A N   1 
ATOM   400  C CA  . SER A 1 55  ? -23.789 75.294 39.366 1.00 44.86  ? 55   SER A CA  1 
ATOM   401  C C   . SER A 1 55  ? -23.568 76.622 40.092 1.00 44.12  ? 55   SER A C   1 
ATOM   402  O O   . SER A 1 55  ? -23.473 76.680 41.321 1.00 45.01  ? 55   SER A O   1 
ATOM   403  C CB  . SER A 1 55  ? -25.281 75.113 39.101 1.00 45.74  ? 55   SER A CB  1 
ATOM   404  O OG  . SER A 1 55  ? -25.605 75.916 37.990 1.00 49.53  ? 55   SER A OG  1 
ATOM   405  N N   . GLY A 1 56  ? -23.539 77.714 39.367 1.00 42.95  ? 56   GLY A N   1 
ATOM   406  C CA  . GLY A 1 56  ? -23.451 78.956 40.101 1.00 41.14  ? 56   GLY A CA  1 
ATOM   407  C C   . GLY A 1 56  ? -22.005 79.114 40.470 1.00 39.62  ? 56   GLY A C   1 
ATOM   408  O O   . GLY A 1 56  ? -21.159 78.413 39.948 1.00 40.52  ? 56   GLY A O   1 
ATOM   409  N N   . VAL A 1 57  ? -21.729 80.043 41.359 1.00 37.91  ? 57   VAL A N   1 
ATOM   410  C CA  . VAL A 1 57  ? -20.377 80.482 41.608 1.00 35.18  ? 57   VAL A CA  1 
ATOM   411  C C   . VAL A 1 57  ? -20.056 80.087 43.021 1.00 35.02  ? 57   VAL A C   1 
ATOM   412  O O   . VAL A 1 57  ? -20.643 80.583 43.976 1.00 34.83  ? 57   VAL A O   1 
ATOM   413  C CB  . VAL A 1 57  ? -20.235 81.992 41.314 1.00 33.69  ? 57   VAL A CB  1 
ATOM   414  C CG1 . VAL A 1 57  ? -19.074 82.567 41.980 1.00 32.12  ? 57   VAL A CG1 1 
ATOM   415  C CG2 . VAL A 1 57  ? -20.065 82.151 39.879 1.00 31.66  ? 57   VAL A CG2 1 
ATOM   416  N N   . TRP A 1 58  ? -19.157 79.134 43.143 1.00 34.82  ? 58   TRP A N   1 
ATOM   417  C CA  . TRP A 1 58  ? -18.597 78.827 44.432 1.00 34.93  ? 58   TRP A CA  1 
ATOM   418  C C   . TRP A 1 58  ? -17.818 79.987 45.076 1.00 34.82  ? 58   TRP A C   1 
ATOM   419  O O   . TRP A 1 58  ? -16.875 80.580 44.443 1.00 33.01  ? 58   TRP A O   1 
ATOM   420  C CB  . TRP A 1 58  ? -17.614 77.684 44.306 1.00 35.03  ? 58   TRP A CB  1 
ATOM   421  C CG  . TRP A 1 58  ? -17.278 77.204 45.646 1.00 35.17  ? 58   TRP A CG  1 
ATOM   422  C CD1 . TRP A 1 58  ? -16.271 77.643 46.489 1.00 33.74  ? 58   TRP A CD1 1 
ATOM   423  C CD2 . TRP A 1 58  ? -18.014 76.242 46.359 1.00 33.69  ? 58   TRP A CD2 1 
ATOM   424  N NE1 . TRP A 1 58  ? -16.341 76.958 47.675 1.00 32.72  ? 58   TRP A NE1 1 
ATOM   425  C CE2 . TRP A 1 58  ? -17.390 76.082 47.614 1.00 32.42  ? 58   TRP A CE2 1 
ATOM   426  C CE3 . TRP A 1 58  ? -19.116 75.458 46.041 1.00 31.98  ? 58   TRP A CE3 1 
ATOM   427  C CZ2 . TRP A 1 58  ? -17.825 75.163 48.537 1.00 34.07  ? 58   TRP A CZ2 1 
ATOM   428  C CZ3 . TRP A 1 58  ? -19.547 74.538 46.967 1.00 34.34  ? 58   TRP A CZ3 1 
ATOM   429  C CH2 . TRP A 1 58  ? -18.907 74.398 48.204 1.00 33.96  ? 58   TRP A CH2 1 
ATOM   430  N N   . ASN A 1 59  ? -18.168 80.245 46.348 1.00 35.11  ? 59   ASN A N   1 
ATOM   431  C CA  . ASN A 1 59  ? -17.433 81.235 47.135 1.00 36.48  ? 59   ASN A CA  1 
ATOM   432  C C   . ASN A 1 59  ? -16.002 80.922 47.669 1.00 35.59  ? 59   ASN A C   1 
ATOM   433  O O   . ASN A 1 59  ? -15.867 80.298 48.718 1.00 36.19  ? 59   ASN A O   1 
ATOM   434  C CB  . ASN A 1 59  ? -18.268 81.767 48.286 1.00 37.26  ? 59   ASN A CB  1 
ATOM   435  C CG  . ASN A 1 59  ? -18.015 83.277 48.487 1.00 42.28  ? 59   ASN A CG  1 
ATOM   436  O OD1 . ASN A 1 59  ? -17.056 83.872 47.958 1.00 46.53  ? 59   ASN A OD1 1 
ATOM   437  N ND2 . ASN A 1 59  ? -18.893 83.903 49.300 1.00 44.63  ? 59   ASN A ND2 1 
ATOM   438  N N   . ALA A 1 60  ? -14.954 81.394 47.000 1.00 33.59  ? 60   ALA A N   1 
ATOM   439  C CA  . ALA A 1 60  ? -13.619 81.003 47.418 1.00 33.03  ? 60   ALA A CA  1 
ATOM   440  C C   . ALA A 1 60  ? -12.896 82.023 48.294 1.00 32.65  ? 60   ALA A C   1 
ATOM   441  O O   . ALA A 1 60  ? -11.739 82.350 48.029 1.00 32.05  ? 60   ALA A O   1 
ATOM   442  C CB  . ALA A 1 60  ? -12.773 80.685 46.226 1.00 32.91  ? 60   ALA A CB  1 
ATOM   443  N N   . SER A 1 61  ? -13.536 82.512 49.348 1.00 32.57  ? 61   SER A N   1 
ATOM   444  C CA  . SER A 1 61  ? -12.985 83.713 50.023 1.00 32.94  ? 61   SER A CA  1 
ATOM   445  C C   . SER A 1 61  ? -12.679 83.610 51.524 1.00 32.99  ? 61   SER A C   1 
ATOM   446  O O   . SER A 1 61  ? -11.903 84.413 52.042 1.00 33.54  ? 61   SER A O   1 
ATOM   447  C CB  . SER A 1 61  ? -13.842 84.940 49.724 1.00 32.41  ? 61   SER A CB  1 
ATOM   448  O OG  . SER A 1 61  ? -15.210 84.599 49.879 1.00 32.10  ? 61   SER A OG  1 
ATOM   449  N N   . THR A 1 62  ? -13.284 82.625 52.187 1.00 32.47  ? 62   THR A N   1 
ATOM   450  C CA  . THR A 1 62  ? -12.873 82.167 53.503 1.00 31.99  ? 62   THR A CA  1 
ATOM   451  C C   . THR A 1 62  ? -12.253 80.774 53.507 1.00 30.43  ? 62   THR A C   1 
ATOM   452  O O   . THR A 1 62  ? -12.667 79.930 52.741 1.00 29.74  ? 62   THR A O   1 
ATOM   453  C CB  . THR A 1 62  ? -14.076 81.887 54.330 1.00 32.69  ? 62   THR A CB  1 
ATOM   454  O OG1 . THR A 1 62  ? -15.256 82.215 53.592 1.00 31.26  ? 62   THR A OG1 1 
ATOM   455  C CG2 . THR A 1 62  ? -13.950 82.588 55.683 1.00 35.74  ? 62   THR A CG2 1 
ATOM   456  N N   . TYR A 1 63  ? -11.354 80.534 54.469 1.00 29.58  ? 63   TYR A N   1 
ATOM   457  C CA  . TYR A 1 63  ? -10.794 79.190 54.783 1.00 27.22  ? 63   TYR A CA  1 
ATOM   458  C C   . TYR A 1 63  ? -11.800 78.168 55.129 1.00 24.92  ? 63   TYR A C   1 
ATOM   459  O O   . TYR A 1 63  ? -12.720 78.396 55.858 1.00 25.13  ? 63   TYR A O   1 
ATOM   460  C CB  . TYR A 1 63  ? -9.919  79.257 56.003 1.00 27.78  ? 63   TYR A CB  1 
ATOM   461  C CG  . TYR A 1 63  ? -8.572  79.766 55.727 1.00 27.96  ? 63   TYR A CG  1 
ATOM   462  C CD1 . TYR A 1 63  ? -8.105  80.923 56.369 1.00 28.02  ? 63   TYR A CD1 1 
ATOM   463  C CD2 . TYR A 1 63  ? -7.758  79.116 54.808 1.00 27.51  ? 63   TYR A CD2 1 
ATOM   464  C CE1 . TYR A 1 63  ? -6.800  81.427 56.152 1.00 30.04  ? 63   TYR A CE1 1 
ATOM   465  C CE2 . TYR A 1 63  ? -6.478  79.575 54.559 1.00 30.60  ? 63   TYR A CE2 1 
ATOM   466  C CZ  . TYR A 1 63  ? -5.973  80.733 55.234 1.00 31.60  ? 63   TYR A CZ  1 
ATOM   467  O OH  . TYR A 1 63  ? -4.663  81.174 54.957 1.00 30.11  ? 63   TYR A OH  1 
ATOM   468  N N   . PRO A 1 64  ? -11.560 76.992 54.688 1.00 23.56  ? 64   PRO A N   1 
ATOM   469  C CA  . PRO A 1 64  ? -12.471 75.894 54.926 1.00 23.85  ? 64   PRO A CA  1 
ATOM   470  C C   . PRO A 1 64  ? -12.338 75.315 56.343 1.00 24.67  ? 64   PRO A C   1 
ATOM   471  O O   . PRO A 1 64  ? -11.489 75.753 57.196 1.00 25.73  ? 64   PRO A O   1 
ATOM   472  C CB  . PRO A 1 64  ? -12.002 74.852 53.941 1.00 23.66  ? 64   PRO A CB  1 
ATOM   473  C CG  . PRO A 1 64  ? -10.488 75.168 53.758 1.00 23.90  ? 64   PRO A CG  1 
ATOM   474  C CD  . PRO A 1 64  ? -10.344 76.631 53.957 1.00 23.31  ? 64   PRO A CD  1 
ATOM   475  N N   . ASN A 1 65  ? -13.129 74.299 56.625 1.00 23.79  ? 65   ASN A N   1 
ATOM   476  C CA  . ASN A 1 65  ? -12.964 73.734 57.944 1.00 23.57  ? 65   ASN A CA  1 
ATOM   477  C C   . ASN A 1 65  ? -11.753 72.908 58.023 1.00 22.52  ? 65   ASN A C   1 
ATOM   478  O O   . ASN A 1 65  ? -11.260 72.512 56.980 1.00 23.98  ? 65   ASN A O   1 
ATOM   479  C CB  . ASN A 1 65  ? -14.120 72.848 58.308 1.00 24.36  ? 65   ASN A CB  1 
ATOM   480  C CG  . ASN A 1 65  ? -15.413 73.581 58.317 1.00 25.55  ? 65   ASN A CG  1 
ATOM   481  O OD1 . ASN A 1 65  ? -16.430 72.970 57.963 1.00 29.05  ? 65   ASN A OD1 1 
ATOM   482  N ND2 . ASN A 1 65  ? -15.414 74.898 58.725 1.00 25.20  ? 65   ASN A ND2 1 
ATOM   483  N N   . ASN A 1 66  ? -11.301 72.605 59.242 1.00 20.80  ? 66   ASN A N   1 
ATOM   484  C CA  . ASN A 1 66  ? -10.290 71.572 59.483 1.00 18.86  ? 66   ASN A CA  1 
ATOM   485  C C   . ASN A 1 66  ? -10.894 70.180 59.756 1.00 18.51  ? 66   ASN A C   1 
ATOM   486  O O   . ASN A 1 66  ? -11.997 70.044 60.340 1.00 17.71  ? 66   ASN A O   1 
ATOM   487  C CB  . ASN A 1 66  ? -9.434  72.032 60.637 1.00 18.17  ? 66   ASN A CB  1 
ATOM   488  C CG  . ASN A 1 66  ? -8.852  73.422 60.417 1.00 15.67  ? 66   ASN A CG  1 
ATOM   489  O OD1 . ASN A 1 66  ? -8.654  73.845 59.298 1.00 17.94  ? 66   ASN A OD1 1 
ATOM   490  N ND2 . ASN A 1 66  ? -8.521  74.114 61.500 1.00 16.15  ? 66   ASN A ND2 1 
ATOM   491  N N   . CYS A 1 67  ? -10.218 69.144 59.308 1.00 17.98  ? 67   CYS A N   1 
ATOM   492  C CA  . CYS A 1 67  ? -10.730 67.797 59.659 1.00 19.70  ? 67   CYS A CA  1 
ATOM   493  C C   . CYS A 1 67  ? -10.684 67.474 61.150 1.00 19.55  ? 67   CYS A C   1 
ATOM   494  O O   . CYS A 1 67  ? -9.772  67.936 61.848 1.00 19.75  ? 67   CYS A O   1 
ATOM   495  C CB  . CYS A 1 67  ? -9.983  66.667 58.930 1.00 19.36  ? 67   CYS A CB  1 
ATOM   496  S SG  . CYS A 1 67  ? -9.959  66.915 57.194 1.00 20.60  ? 67   CYS A SG  1 
ATOM   497  N N   . GLN A 1 68  ? -11.607 66.611 61.597 1.00 19.01  ? 68   GLN A N   1 
ATOM   498  C CA  . GLN A 1 68  ? -11.612 66.140 62.974 1.00 19.05  ? 68   GLN A CA  1 
ATOM   499  C C   . GLN A 1 68  ? -10.282 65.640 63.392 1.00 18.18  ? 68   GLN A C   1 
ATOM   500  O O   . GLN A 1 68  ? -9.714  64.752 62.740 1.00 19.03  ? 68   GLN A O   1 
ATOM   501  C CB  . GLN A 1 68  ? -12.586 65.005 63.144 1.00 19.68  ? 68   GLN A CB  1 
ATOM   502  C CG  . GLN A 1 68  ? -14.042 65.419 62.963 1.00 22.87  ? 68   GLN A CG  1 
ATOM   503  C CD  . GLN A 1 68  ? -14.548 66.544 63.881 1.00 24.10  ? 68   GLN A CD  1 
ATOM   504  O OE1 . GLN A 1 68  ? -13.853 67.080 64.714 1.00 26.25  ? 68   GLN A OE1 1 
ATOM   505  N NE2 . GLN A 1 68  ? -15.777 66.900 63.691 1.00 29.46  ? 68   GLN A NE2 1 
ATOM   506  N N   . GLN A 1 69  ? -9.757  66.199 64.473 1.00 17.52  ? 69   GLN A N   1 
ATOM   507  C CA  . GLN A 1 69  ? -8.416  65.756 64.973 1.00 16.24  ? 69   GLN A CA  1 
ATOM   508  C C   . GLN A 1 69  ? -8.238  65.958 66.487 1.00 16.63  ? 69   GLN A C   1 
ATOM   509  O O   . GLN A 1 69  ? -8.911  66.777 67.111 1.00 16.44  ? 69   GLN A O   1 
ATOM   510  C CB  . GLN A 1 69  ? -7.299  66.405 64.161 1.00 13.21  ? 69   GLN A CB  1 
ATOM   511  C CG  . GLN A 1 69  ? -7.224  67.798 64.443 1.00 11.54  ? 69   GLN A CG  1 
ATOM   512  C CD  . GLN A 1 69  ? -6.471  68.585 63.404 1.00 11.72  ? 69   GLN A CD  1 
ATOM   513  O OE1 . GLN A 1 69  ? -5.401  69.190 63.663 1.00 11.63  ? 69   GLN A OE1 1 
ATOM   514  N NE2 . GLN A 1 69  ? -7.039  68.639 62.235 1.00 7.70   ? 69   GLN A NE2 1 
ATOM   515  N N   . TYR A 1 70  ? -7.348  65.166 67.079 1.00 18.47  ? 70   TYR A N   1 
ATOM   516  C CA  . TYR A 1 70  ? -6.855  65.426 68.442 1.00 18.67  ? 70   TYR A CA  1 
ATOM   517  C C   . TYR A 1 70  ? -6.280  66.851 68.582 1.00 18.03  ? 70   TYR A C   1 
ATOM   518  O O   . TYR A 1 70  ? -5.518  67.276 67.752 1.00 18.24  ? 70   TYR A O   1 
ATOM   519  C CB  . TYR A 1 70  ? -5.837  64.369 68.794 1.00 20.55  ? 70   TYR A CB  1 
ATOM   520  C CG  . TYR A 1 70  ? -5.222  64.585 70.151 1.00 25.27  ? 70   TYR A CG  1 
ATOM   521  C CD1 . TYR A 1 70  ? -5.724  63.902 71.290 1.00 27.24  ? 70   TYR A CD1 1 
ATOM   522  C CD2 . TYR A 1 70  ? -4.123  65.485 70.322 1.00 26.13  ? 70   TYR A CD2 1 
ATOM   523  C CE1 . TYR A 1 70  ? -5.171  64.149 72.553 1.00 27.73  ? 70   TYR A CE1 1 
ATOM   524  C CE2 . TYR A 1 70  ? -3.564  65.720 71.577 1.00 25.31  ? 70   TYR A CE2 1 
ATOM   525  C CZ  . TYR A 1 70  ? -4.096  65.064 72.679 1.00 26.60  ? 70   TYR A CZ  1 
ATOM   526  O OH  . TYR A 1 70  ? -3.564  65.305 73.924 1.00 28.75  ? 70   TYR A OH  1 
ATOM   527  N N   . VAL A 1 71  ? -6.695  67.616 69.593 1.00 18.09  ? 71   VAL A N   1 
ATOM   528  C CA  . VAL A 1 71  ? -6.300  69.035 69.764 1.00 18.12  ? 71   VAL A CA  1 
ATOM   529  C C   . VAL A 1 71  ? -5.391  69.042 70.957 1.00 19.17  ? 71   VAL A C   1 
ATOM   530  O O   . VAL A 1 71  ? -5.674  68.310 71.913 1.00 20.48  ? 71   VAL A O   1 
ATOM   531  C CB  . VAL A 1 71  ? -7.501  69.927 70.073 1.00 17.78  ? 71   VAL A CB  1 
ATOM   532  C CG1 . VAL A 1 71  ? -7.058  71.293 70.432 1.00 15.02  ? 71   VAL A CG1 1 
ATOM   533  C CG2 . VAL A 1 71  ? -8.398  69.973 68.923 1.00 16.01  ? 71   VAL A CG2 1 
ATOM   534  N N   . ASP A 1 72  ? -4.299  69.817 70.917 1.00 20.76  ? 72   ASP A N   1 
ATOM   535  C CA  . ASP A 1 72  ? -3.148  69.576 71.825 1.00 22.02  ? 72   ASP A CA  1 
ATOM   536  C C   . ASP A 1 72  ? -3.323  70.513 72.970 1.00 23.58  ? 72   ASP A C   1 
ATOM   537  O O   . ASP A 1 72  ? -3.290  71.700 72.790 1.00 24.01  ? 72   ASP A O   1 
ATOM   538  C CB  . ASP A 1 72  ? -1.802  69.765 71.153 1.00 20.88  ? 72   ASP A CB  1 
ATOM   539  C CG  . ASP A 1 72  ? -0.608  69.915 72.154 1.00 22.95  ? 72   ASP A CG  1 
ATOM   540  O OD1 . ASP A 1 72  ? 0.429   70.529 71.759 1.00 23.49  ? 72   ASP A OD1 1 
ATOM   541  O OD2 . ASP A 1 72  ? -0.649  69.442 73.314 1.00 24.79  ? 72   ASP A OD2 1 
ATOM   542  N N   . GLU A 1 73  ? -3.533  70.001 74.177 1.00 25.39  ? 73   GLU A N   1 
ATOM   543  C CA  . GLU A 1 73  ? -3.717  70.981 75.248 1.00 26.27  ? 73   GLU A CA  1 
ATOM   544  C C   . GLU A 1 73  ? -2.614  71.068 76.273 1.00 24.80  ? 73   GLU A C   1 
ATOM   545  O O   . GLU A 1 73  ? -2.545  72.049 76.989 1.00 23.74  ? 73   GLU A O   1 
ATOM   546  C CB  . GLU A 1 73  ? -5.102  70.894 75.879 1.00 26.87  ? 73   GLU A CB  1 
ATOM   547  C CG  . GLU A 1 73  ? -6.189  71.421 74.974 1.00 30.11  ? 73   GLU A CG  1 
ATOM   548  C CD  . GLU A 1 73  ? -7.546  71.034 75.518 1.00 35.33  ? 73   GLU A CD  1 
ATOM   549  O OE1 . GLU A 1 73  ? -7.698  69.896 76.034 1.00 37.38  ? 73   GLU A OE1 1 
ATOM   550  O OE2 . GLU A 1 73  ? -8.450  71.874 75.442 1.00 35.79  ? 73   GLU A OE2 1 
ATOM   551  N N   . GLN A 1 74  ? -1.768  70.042 76.314 1.00 23.79  ? 74   GLN A N   1 
ATOM   552  C CA  . GLN A 1 74  ? -0.516  70.113 77.040 1.00 22.92  ? 74   GLN A CA  1 
ATOM   553  C C   . GLN A 1 74  ? 0.064   71.530 77.493 1.00 22.77  ? 74   GLN A C   1 
ATOM   554  O O   . GLN A 1 74  ? 0.279   71.692 78.647 1.00 22.69  ? 74   GLN A O   1 
ATOM   555  C CB  . GLN A 1 74  ? 0.499   69.268 76.324 1.00 22.42  ? 74   GLN A CB  1 
ATOM   556  C CG  . GLN A 1 74  ? 1.742   69.181 77.128 1.00 23.20  ? 74   GLN A CG  1 
ATOM   557  C CD  . GLN A 1 74  ? 1.516   68.395 78.378 1.00 23.74  ? 74   GLN A CD  1 
ATOM   558  O OE1 . GLN A 1 74  ? 1.461   68.916 79.488 1.00 24.94  ? 74   GLN A OE1 1 
ATOM   559  N NE2 . GLN A 1 74  ? 1.346   67.126 78.202 1.00 25.42  ? 74   GLN A NE2 1 
ATOM   560  N N   . PHE A 1 75  ? 0.299   72.545 76.633 1.00 23.42  ? 75   PHE A N   1 
ATOM   561  C CA  . PHE A 1 75  ? 0.561   73.960 77.088 1.00 23.16  ? 75   PHE A CA  1 
ATOM   562  C C   . PHE A 1 75  ? -0.503  75.017 76.666 1.00 23.32  ? 75   PHE A C   1 
ATOM   563  O O   . PHE A 1 75  ? -0.284  75.769 75.731 1.00 23.25  ? 75   PHE A O   1 
ATOM   564  C CB  . PHE A 1 75  ? 1.985   74.399 76.725 1.00 22.82  ? 75   PHE A CB  1 
ATOM   565  C CG  . PHE A 1 75  ? 2.995   73.326 76.981 1.00 23.95  ? 75   PHE A CG  1 
ATOM   566  C CD1 . PHE A 1 75  ? 3.347   72.429 75.997 1.00 24.24  ? 75   PHE A CD1 1 
ATOM   567  C CD2 . PHE A 1 75  ? 3.540   73.149 78.233 1.00 22.38  ? 75   PHE A CD2 1 
ATOM   568  C CE1 . PHE A 1 75  ? 4.264   71.377 76.261 1.00 24.97  ? 75   PHE A CE1 1 
ATOM   569  C CE2 . PHE A 1 75  ? 4.420   72.111 78.464 1.00 23.35  ? 75   PHE A CE2 1 
ATOM   570  C CZ  . PHE A 1 75  ? 4.772   71.209 77.492 1.00 20.31  ? 75   PHE A CZ  1 
ATOM   571  N N   . PRO A 1 76  ? -1.666  75.076 77.376 1.00 22.99  ? 76   PRO A N   1 
ATOM   572  C CA  . PRO A 1 76  ? -2.749  75.931 76.844 1.00 22.78  ? 76   PRO A CA  1 
ATOM   573  C C   . PRO A 1 76  ? -2.310  77.345 76.907 1.00 23.14  ? 76   PRO A C   1 
ATOM   574  O O   . PRO A 1 76  ? -1.647  77.706 77.894 1.00 22.64  ? 76   PRO A O   1 
ATOM   575  C CB  . PRO A 1 76  ? -3.938  75.697 77.810 1.00 22.95  ? 76   PRO A CB  1 
ATOM   576  C CG  . PRO A 1 76  ? -3.577  74.506 78.609 1.00 22.34  ? 76   PRO A CG  1 
ATOM   577  C CD  . PRO A 1 76  ? -2.055  74.398 78.627 1.00 21.87  ? 76   PRO A CD  1 
ATOM   578  N N   . GLY A 1 77  ? -2.646  78.116 75.850 1.00 23.88  ? 77   GLY A N   1 
ATOM   579  C CA  . GLY A 1 77  ? -2.156  79.506 75.630 1.00 23.14  ? 77   GLY A CA  1 
ATOM   580  C C   . GLY A 1 77  ? -0.724  79.707 75.069 1.00 23.39  ? 77   GLY A C   1 
ATOM   581  O O   . GLY A 1 77  ? -0.465  80.698 74.350 1.00 23.28  ? 77   GLY A O   1 
ATOM   582  N N   . PHE A 1 78  ? 0.231   78.797 75.395 1.00 22.51  ? 78   PHE A N   1 
ATOM   583  C CA  . PHE A 1 78  ? 1.557   78.765 74.727 1.00 20.25  ? 78   PHE A CA  1 
ATOM   584  C C   . PHE A 1 78  ? 1.489   78.806 73.194 1.00 20.35  ? 78   PHE A C   1 
ATOM   585  O O   . PHE A 1 78  ? 1.048   77.852 72.539 1.00 20.03  ? 78   PHE A O   1 
ATOM   586  C CB  . PHE A 1 78  ? 2.266   77.518 75.107 1.00 19.51  ? 78   PHE A CB  1 
ATOM   587  C CG  . PHE A 1 78  ? 3.707   77.519 74.761 1.00 19.05  ? 78   PHE A CG  1 
ATOM   588  C CD1 . PHE A 1 78  ? 4.512   78.575 75.127 1.00 14.10  ? 78   PHE A CD1 1 
ATOM   589  C CD2 . PHE A 1 78  ? 4.284   76.407 74.135 1.00 21.84  ? 78   PHE A CD2 1 
ATOM   590  C CE1 . PHE A 1 78  ? 5.864   78.565 74.868 1.00 17.01  ? 78   PHE A CE1 1 
ATOM   591  C CE2 . PHE A 1 78  ? 5.685   76.367 73.841 1.00 21.74  ? 78   PHE A CE2 1 
ATOM   592  C CZ  . PHE A 1 78  ? 6.476   77.461 74.212 1.00 20.47  ? 78   PHE A CZ  1 
ATOM   593  N N   . SER A 1 79  ? 1.928   79.900 72.592 1.00 19.97  ? 79   SER A N   1 
ATOM   594  C CA  . SER A 1 79  ? 1.939   79.906 71.119 1.00 19.60  ? 79   SER A CA  1 
ATOM   595  C C   . SER A 1 79  ? 2.772   78.795 70.471 1.00 18.57  ? 79   SER A C   1 
ATOM   596  O O   . SER A 1 79  ? 2.438   78.391 69.370 1.00 17.80  ? 79   SER A O   1 
ATOM   597  C CB  . SER A 1 79  ? 2.425   81.240 70.575 1.00 20.02  ? 79   SER A CB  1 
ATOM   598  O OG  . SER A 1 79  ? 3.809   81.310 70.791 1.00 21.26  ? 79   SER A OG  1 
ATOM   599  N N   . GLY A 1 80  ? 3.825   78.309 71.160 1.00 18.23  ? 80   GLY A N   1 
ATOM   600  C CA  . GLY A 1 80  ? 4.833   77.433 70.561 1.00 17.48  ? 80   GLY A CA  1 
ATOM   601  C C   . GLY A 1 80  ? 4.135   76.164 70.167 1.00 18.78  ? 80   GLY A C   1 
ATOM   602  O O   . GLY A 1 80  ? 4.498   75.485 69.191 1.00 16.42  ? 80   GLY A O   1 
ATOM   603  N N   . SER A 1 81  ? 3.083   75.869 70.935 1.00 19.99  ? 81   SER A N   1 
ATOM   604  C CA  . SER A 1 81  ? 2.352   74.653 70.723 1.00 21.52  ? 81   SER A CA  1 
ATOM   605  C C   . SER A 1 81  ? 1.028   74.874 70.000 1.00 22.55  ? 81   SER A C   1 
ATOM   606  O O   . SER A 1 81  ? 0.585   73.976 69.244 1.00 23.18  ? 81   SER A O   1 
ATOM   607  C CB  . SER A 1 81  ? 2.157   73.936 72.045 1.00 20.83  ? 81   SER A CB  1 
ATOM   608  O OG  . SER A 1 81  ? 0.993   74.420 72.632 1.00 22.63  ? 81   SER A OG  1 
ATOM   609  N N   . GLU A 1 82  ? 0.422   76.053 70.225 1.00 23.73  ? 82   GLU A N   1 
ATOM   610  C CA  . GLU A 1 82  ? -0.901  76.426 69.659 1.00 24.62  ? 82   GLU A CA  1 
ATOM   611  C C   . GLU A 1 82  ? -0.771  76.618 68.179 1.00 23.96  ? 82   GLU A C   1 
ATOM   612  O O   . GLU A 1 82  ? -1.741  76.385 67.438 1.00 22.94  ? 82   GLU A O   1 
ATOM   613  C CB  . GLU A 1 82  ? -1.427  77.792 70.166 1.00 26.18  ? 82   GLU A CB  1 
ATOM   614  C CG  . GLU A 1 82  ? -1.762  78.019 71.702 1.00 30.49  ? 82   GLU A CG  1 
ATOM   615  C CD  . GLU A 1 82  ? -2.943  77.151 72.244 1.00 35.87  ? 82   GLU A CD  1 
ATOM   616  O OE1 . GLU A 1 82  ? -3.492  76.308 71.408 1.00 34.35  ? 82   GLU A OE1 1 
ATOM   617  O OE2 . GLU A 1 82  ? -3.270  77.314 73.500 1.00 34.79  ? 82   GLU A OE2 1 
ATOM   618  N N   . MET A 1 83  ? 0.424   77.051 67.731 1.00 23.00  ? 83   MET A N   1 
ATOM   619  C CA  . MET A 1 83  ? 0.578   77.332 66.300 1.00 22.07  ? 83   MET A CA  1 
ATOM   620  C C   . MET A 1 83  ? 0.231   76.117 65.441 1.00 21.51  ? 83   MET A C   1 
ATOM   621  O O   . MET A 1 83  ? 0.102   76.261 64.258 1.00 22.07  ? 83   MET A O   1 
ATOM   622  C CB  . MET A 1 83  ? 1.966   77.771 65.947 1.00 21.50  ? 83   MET A CB  1 
ATOM   623  C CG  . MET A 1 83  ? 2.985   76.800 66.352 1.00 20.52  ? 83   MET A CG  1 
ATOM   624  S SD  . MET A 1 83  ? 4.623   77.500 65.962 1.00 23.25  ? 83   MET A SD  1 
ATOM   625  C CE  . MET A 1 83  ? 5.036   76.874 64.323 1.00 25.77  ? 83   MET A CE  1 
ATOM   626  N N   . TRP A 1 84  ? 0.115   74.922 66.031 1.00 20.47  ? 84   TRP A N   1 
ATOM   627  C CA  . TRP A 1 84  ? -0.154  73.733 65.255 1.00 18.12  ? 84   TRP A CA  1 
ATOM   628  C C   . TRP A 1 84  ? -1.605  73.319 65.388 1.00 16.85  ? 84   TRP A C   1 
ATOM   629  O O   . TRP A 1 84  ? -2.024  72.430 64.667 1.00 15.82  ? 84   TRP A O   1 
ATOM   630  C CB  . TRP A 1 84  ? 0.815   72.558 65.582 1.00 17.41  ? 84   TRP A CB  1 
ATOM   631  C CG  . TRP A 1 84  ? 2.239   72.969 65.633 1.00 16.97  ? 84   TRP A CG  1 
ATOM   632  C CD1 . TRP A 1 84  ? 2.944   73.327 66.742 1.00 18.14  ? 84   TRP A CD1 1 
ATOM   633  C CD2 . TRP A 1 84  ? 3.153   73.085 64.549 1.00 16.11  ? 84   TRP A CD2 1 
ATOM   634  N NE1 . TRP A 1 84  ? 4.245   73.622 66.417 1.00 13.06  ? 84   TRP A NE1 1 
ATOM   635  C CE2 . TRP A 1 84  ? 4.389   73.507 65.082 1.00 12.91  ? 84   TRP A CE2 1 
ATOM   636  C CE3 . TRP A 1 84  ? 3.053   72.861 63.177 1.00 17.27  ? 84   TRP A CE3 1 
ATOM   637  C CZ2 . TRP A 1 84  ? 5.468   73.755 64.315 1.00 16.85  ? 84   TRP A CZ2 1 
ATOM   638  C CZ3 . TRP A 1 84  ? 4.131   73.106 62.392 1.00 15.69  ? 84   TRP A CZ3 1 
ATOM   639  C CH2 . TRP A 1 84  ? 5.333   73.551 62.965 1.00 18.95  ? 84   TRP A CH2 1 
ATOM   640  N N   . ASN A 1 85  ? -2.374  73.935 66.276 1.00 15.60  ? 85   ASN A N   1 
ATOM   641  C CA  . ASN A 1 85  ? -3.716  73.437 66.482 1.00 15.87  ? 85   ASN A CA  1 
ATOM   642  C C   . ASN A 1 85  ? -4.788  73.839 65.449 1.00 16.49  ? 85   ASN A C   1 
ATOM   643  O O   . ASN A 1 85  ? -4.710  74.921 64.829 1.00 16.70  ? 85   ASN A O   1 
ATOM   644  C CB  . ASN A 1 85  ? -4.144  73.784 67.862 1.00 15.83  ? 85   ASN A CB  1 
ATOM   645  C CG  . ASN A 1 85  ? -3.756  72.747 68.849 1.00 19.51  ? 85   ASN A CG  1 
ATOM   646  O OD1 . ASN A 1 85  ? -3.995  71.587 68.664 1.00 25.55  ? 85   ASN A OD1 1 
ATOM   647  N ND2 . ASN A 1 85  ? -3.142  73.161 69.905 1.00 24.71  ? 85   ASN A ND2 1 
ATOM   648  N N   . PRO A 1 86  ? -5.824  73.010 65.270 1.00 16.90  ? 86   PRO A N   1 
ATOM   649  C CA  . PRO A 1 86  ? -6.816  73.505 64.291 1.00 18.42  ? 86   PRO A CA  1 
ATOM   650  C C   . PRO A 1 86  ? -7.177  74.936 64.677 1.00 20.26  ? 86   PRO A C   1 
ATOM   651  O O   . PRO A 1 86  ? -7.367  75.242 65.875 1.00 20.34  ? 86   PRO A O   1 
ATOM   652  C CB  . PRO A 1 86  ? -8.046  72.606 64.492 1.00 17.08  ? 86   PRO A CB  1 
ATOM   653  C CG  . PRO A 1 86  ? -7.569  71.430 65.105 1.00 17.15  ? 86   PRO A CG  1 
ATOM   654  C CD  . PRO A 1 86  ? -6.233  71.751 65.881 1.00 16.90  ? 86   PRO A CD  1 
ATOM   655  N N   . ASN A 1 87  ? -7.248  75.824 63.696 1.00 21.55  ? 87   ASN A N   1 
ATOM   656  C CA  . ASN A 1 87  ? -7.552  77.219 64.008 1.00 22.69  ? 87   ASN A CA  1 
ATOM   657  C C   . ASN A 1 87  ? -8.781  77.590 63.257 1.00 24.10  ? 87   ASN A C   1 
ATOM   658  O O   . ASN A 1 87  ? -8.996  78.720 63.030 1.00 25.22  ? 87   ASN A O   1 
ATOM   659  C CB  . ASN A 1 87  ? -6.438  78.132 63.530 1.00 20.76  ? 87   ASN A CB  1 
ATOM   660  C CG  . ASN A 1 87  ? -6.263  78.050 62.045 1.00 21.32  ? 87   ASN A CG  1 
ATOM   661  O OD1 . ASN A 1 87  ? -5.659  78.879 61.490 1.00 20.61  ? 87   ASN A OD1 1 
ATOM   662  N ND2 . ASN A 1 87  ? -6.821  77.040 61.392 1.00 21.88  ? 87   ASN A ND2 1 
ATOM   663  N N   . ARG A 1 88  ? -9.526  76.639 62.765 1.00 25.97  ? 88   ARG A N   1 
ATOM   664  C CA  . ARG A 1 88  ? -10.797 76.919 62.162 1.00 27.90  ? 88   ARG A CA  1 
ATOM   665  C C   . ARG A 1 88  ? -11.708 75.910 62.792 1.00 29.08  ? 88   ARG A C   1 
ATOM   666  O O   . ARG A 1 88  ? -11.231 75.071 63.559 1.00 30.65  ? 88   ARG A O   1 
ATOM   667  C CB  . ARG A 1 88  ? -10.710 76.563 60.728 1.00 28.64  ? 88   ARG A CB  1 
ATOM   668  C CG  . ARG A 1 88  ? -10.322 77.603 59.925 1.00 30.71  ? 88   ARG A CG  1 
ATOM   669  C CD  . ARG A 1 88  ? -11.523 78.299 59.557 1.00 34.23  ? 88   ARG A CD  1 
ATOM   670  N NE  . ARG A 1 88  ? -11.011 79.622 59.454 1.00 39.05  ? 88   ARG A NE  1 
ATOM   671  C CZ  . ARG A 1 88  ? -11.645 80.624 58.905 1.00 45.59  ? 88   ARG A CZ  1 
ATOM   672  N NH1 . ARG A 1 88  ? -10.995 81.794 58.875 1.00 49.35  ? 88   ARG A NH1 1 
ATOM   673  N NH2 . ARG A 1 88  ? -12.875 80.453 58.364 1.00 44.76  ? 88   ARG A NH2 1 
ATOM   674  N N   . GLU A 1 89  ? -12.996 75.912 62.475 1.00 29.87  ? 89   GLU A N   1 
ATOM   675  C CA  . GLU A 1 89  ? -13.889 74.923 63.133 1.00 31.19  ? 89   GLU A CA  1 
ATOM   676  C C   . GLU A 1 89  ? -13.629 73.523 62.644 1.00 28.12  ? 89   GLU A C   1 
ATOM   677  O O   . GLU A 1 89  ? -13.244 73.359 61.521 1.00 27.89  ? 89   GLU A O   1 
ATOM   678  C CB  . GLU A 1 89  ? -15.326 75.298 62.863 1.00 33.55  ? 89   GLU A CB  1 
ATOM   679  C CG  . GLU A 1 89  ? -16.178 75.197 64.103 1.00 43.73  ? 89   GLU A CG  1 
ATOM   680  C CD  . GLU A 1 89  ? -17.545 74.540 63.786 1.00 58.02  ? 89   GLU A CD  1 
ATOM   681  O OE1 . GLU A 1 89  ? -17.785 74.180 62.579 1.00 61.42  ? 89   GLU A OE1 1 
ATOM   682  O OE2 . GLU A 1 89  ? -18.369 74.367 64.749 1.00 62.42  ? 89   GLU A OE2 1 
ATOM   683  N N   . MET A 1 90  ? -13.809 72.501 63.457 1.00 25.64  ? 90   MET A N   1 
ATOM   684  C CA  . MET A 1 90  ? -13.508 71.108 62.963 1.00 22.97  ? 90   MET A CA  1 
ATOM   685  C C   . MET A 1 90  ? -14.777 70.427 62.436 1.00 22.33  ? 90   MET A C   1 
ATOM   686  O O   . MET A 1 90  ? -15.846 70.638 63.013 1.00 22.34  ? 90   MET A O   1 
ATOM   687  C CB  . MET A 1 90  ? -12.900 70.222 64.031 1.00 21.17  ? 90   MET A CB  1 
ATOM   688  C CG  . MET A 1 90  ? -11.503 70.443 64.272 1.00 20.04  ? 90   MET A CG  1 
ATOM   689  S SD  . MET A 1 90  ? -10.723 69.375 65.543 1.00 22.38  ? 90   MET A SD  1 
ATOM   690  C CE  . MET A 1 90  ? -11.911 69.441 66.891 1.00 26.01  ? 90   MET A CE  1 
ATOM   691  N N   . SER A 1 91  ? -14.675 69.611 61.373 1.00 20.87  ? 91   SER A N   1 
ATOM   692  C CA  . SER A 1 91  ? -15.858 68.955 60.755 1.00 18.34  ? 91   SER A CA  1 
ATOM   693  C C   . SER A 1 91  ? -15.421 67.773 59.937 1.00 18.22  ? 91   SER A C   1 
ATOM   694  O O   . SER A 1 91  ? -14.343 67.818 59.301 1.00 16.77  ? 91   SER A O   1 
ATOM   695  C CB  . SER A 1 91  ? -16.596 69.959 59.855 1.00 17.97  ? 91   SER A CB  1 
ATOM   696  O OG  . SER A 1 91  ? -17.405 69.347 58.897 1.00 15.60  ? 91   SER A OG  1 
ATOM   697  N N   . GLU A 1 92  ? -16.224 66.704 59.946 1.00 18.80  ? 92   GLU A N   1 
ATOM   698  C CA  . GLU A 1 92  ? -15.901 65.559 59.102 1.00 19.09  ? 92   GLU A CA  1 
ATOM   699  C C   . GLU A 1 92  ? -15.883 65.992 57.625 1.00 20.09  ? 92   GLU A C   1 
ATOM   700  O O   . GLU A 1 92  ? -15.035 65.472 56.816 1.00 21.03  ? 92   GLU A O   1 
ATOM   701  C CB  . GLU A 1 92  ? -16.864 64.479 59.315 1.00 17.81  ? 92   GLU A CB  1 
ATOM   702  C CG  . GLU A 1 92  ? -16.416 63.636 60.366 1.00 21.53  ? 92   GLU A CG  1 
ATOM   703  C CD  . GLU A 1 92  ? -17.228 62.354 60.347 1.00 29.27  ? 92   GLU A CD  1 
ATOM   704  O OE1 . GLU A 1 92  ? -18.460 62.494 60.413 1.00 31.46  ? 92   GLU A OE1 1 
ATOM   705  O OE2 . GLU A 1 92  ? -16.698 61.213 60.201 1.00 30.16  ? 92   GLU A OE2 1 
ATOM   706  N N   . ASP A 1 93  ? -16.772 66.951 57.290 1.00 18.84  ? 93   ASP A N   1 
ATOM   707  C CA  . ASP A 1 93  ? -16.674 67.714 56.045 1.00 18.62  ? 93   ASP A CA  1 
ATOM   708  C C   . ASP A 1 93  ? -15.509 68.726 55.932 1.00 18.37  ? 93   ASP A C   1 
ATOM   709  O O   . ASP A 1 93  ? -15.643 69.965 56.260 1.00 16.81  ? 93   ASP A O   1 
ATOM   710  C CB  . ASP A 1 93  ? -17.957 68.499 55.732 1.00 19.30  ? 93   ASP A CB  1 
ATOM   711  C CG  . ASP A 1 93  ? -17.801 69.333 54.442 1.00 20.77  ? 93   ASP A CG  1 
ATOM   712  O OD1 . ASP A 1 93  ? -16.722 69.166 53.761 1.00 25.93  ? 93   ASP A OD1 1 
ATOM   713  O OD2 . ASP A 1 93  ? -18.733 70.085 54.097 1.00 16.25  ? 93   ASP A OD2 1 
ATOM   714  N N   . CYS A 1 94  ? -14.403 68.234 55.366 1.00 17.93  ? 94   CYS A N   1 
ATOM   715  C CA  . CYS A 1 94  ? -13.194 69.074 55.260 1.00 16.58  ? 94   CYS A CA  1 
ATOM   716  C C   . CYS A 1 94  ? -12.330 68.759 54.087 1.00 15.87  ? 94   CYS A C   1 
ATOM   717  O O   . CYS A 1 94  ? -11.174 69.044 54.155 1.00 15.23  ? 94   CYS A O   1 
ATOM   718  C CB  . CYS A 1 94  ? -12.320 68.862 56.460 1.00 16.89  ? 94   CYS A CB  1 
ATOM   719  S SG  . CYS A 1 94  ? -11.948 67.095 56.630 1.00 16.00  ? 94   CYS A SG  1 
ATOM   720  N N   . LEU A 1 95  ? -12.833 68.163 53.010 1.00 15.78  ? 95   LEU A N   1 
ATOM   721  C CA  . LEU A 1 95  ? -11.917 67.999 51.894 1.00 14.55  ? 95   LEU A CA  1 
ATOM   722  C C   . LEU A 1 95  ? -11.895 69.270 50.976 1.00 16.44  ? 95   LEU A C   1 
ATOM   723  O O   . LEU A 1 95  ? -12.690 69.405 50.012 1.00 16.40  ? 95   LEU A O   1 
ATOM   724  C CB  . LEU A 1 95  ? -12.152 66.710 51.160 1.00 12.28  ? 95   LEU A CB  1 
ATOM   725  C CG  . LEU A 1 95  ? -11.998 65.599 52.143 1.00 10.55  ? 95   LEU A CG  1 
ATOM   726  C CD1 . LEU A 1 95  ? -12.166 64.206 51.550 1.00 10.77  ? 95   LEU A CD1 1 
ATOM   727  C CD2 . LEU A 1 95  ? -10.651 65.727 52.761 1.00 11.68  ? 95   LEU A CD2 1 
ATOM   728  N N   . TYR A 1 96  ? -10.980 70.207 51.260 1.00 16.83  ? 96   TYR A N   1 
ATOM   729  C CA  . TYR A 1 96  ? -10.884 71.409 50.406 1.00 18.04  ? 96   TYR A CA  1 
ATOM   730  C C   . TYR A 1 96  ? -9.490  71.690 50.084 1.00 17.31  ? 96   TYR A C   1 
ATOM   731  O O   . TYR A 1 96  ? -8.613  71.100 50.681 1.00 19.98  ? 96   TYR A O   1 
ATOM   732  C CB  . TYR A 1 96  ? -11.476 72.637 51.112 1.00 18.65  ? 96   TYR A CB  1 
ATOM   733  C CG  . TYR A 1 96  ? -12.908 72.406 51.384 1.00 18.82  ? 96   TYR A CG  1 
ATOM   734  C CD1 . TYR A 1 96  ? -13.276 71.648 52.504 1.00 17.79  ? 96   TYR A CD1 1 
ATOM   735  C CD2 . TYR A 1 96  ? -13.897 72.856 50.485 1.00 16.97  ? 96   TYR A CD2 1 
ATOM   736  C CE1 . TYR A 1 96  ? -14.575 71.387 52.770 1.00 20.60  ? 96   TYR A CE1 1 
ATOM   737  C CE2 . TYR A 1 96  ? -15.203 72.589 50.736 1.00 18.76  ? 96   TYR A CE2 1 
ATOM   738  C CZ  . TYR A 1 96  ? -15.532 71.837 51.883 1.00 20.00  ? 96   TYR A CZ  1 
ATOM   739  O OH  . TYR A 1 96  ? -16.808 71.506 52.200 1.00 20.70  ? 96   TYR A OH  1 
ATOM   740  N N   . LEU A 1 97  ? -9.256  72.593 49.161 1.00 15.75  ? 97   LEU A N   1 
ATOM   741  C CA  . LEU A 1 97  ? -7.902  72.972 48.932 1.00 14.93  ? 97   LEU A CA  1 
ATOM   742  C C   . LEU A 1 97  ? -7.808  74.427 48.680 1.00 14.83  ? 97   LEU A C   1 
ATOM   743  O O   . LEU A 1 97  ? -8.828  75.066 48.371 1.00 15.68  ? 97   LEU A O   1 
ATOM   744  C CB  . LEU A 1 97  ? -7.334  72.155 47.796 1.00 14.45  ? 97   LEU A CB  1 
ATOM   745  C CG  . LEU A 1 97  ? -8.036  72.321 46.482 1.00 12.75  ? 97   LEU A CG  1 
ATOM   746  C CD1 . LEU A 1 97  ? -7.281  73.282 45.630 1.00 15.69  ? 97   LEU A CD1 1 
ATOM   747  C CD2 . LEU A 1 97  ? -8.020  71.052 45.790 1.00 11.05  ? 97   LEU A CD2 1 
ATOM   748  N N   . ASN A 1 98  ? -6.606  74.963 48.815 1.00 15.23  ? 98   ASN A N   1 
ATOM   749  C CA  . ASN A 1 98  ? -6.387  76.401 48.611 1.00 18.21  ? 98   ASN A CA  1 
ATOM   750  C C   . ASN A 1 98  ? -5.295  76.701 47.612 1.00 19.45  ? 98   ASN A C   1 
ATOM   751  O O   . ASN A 1 98  ? -4.288  75.960 47.527 1.00 18.81  ? 98   ASN A O   1 
ATOM   752  C CB  . ASN A 1 98  ? -6.155  77.193 49.927 1.00 18.54  ? 98   ASN A CB  1 
ATOM   753  C CG  . ASN A 1 98  ? -6.910  76.564 51.155 1.00 22.01  ? 98   ASN A CG  1 
ATOM   754  O OD1 . ASN A 1 98  ? -8.133  76.780 51.350 1.00 22.95  ? 98   ASN A OD1 1 
ATOM   755  N ND2 . ASN A 1 98  ? -6.166  75.745 51.970 1.00 21.64  ? 98   ASN A ND2 1 
ATOM   756  N N   . ILE A 1 99  ? -5.535  77.790 46.841 1.00 21.98  ? 99   ILE A N   1 
ATOM   757  C CA  . ILE A 1 99  ? -4.571  78.323 45.828 1.00 23.28  ? 99   ILE A CA  1 
ATOM   758  C C   . ILE A 1 99  ? -4.145  79.777 45.993 1.00 23.35  ? 99   ILE A C   1 
ATOM   759  O O   . ILE A 1 99  ? -4.953  80.603 46.327 1.00 23.25  ? 99   ILE A O   1 
ATOM   760  C CB  . ILE A 1 99  ? -5.131  78.179 44.426 1.00 23.00  ? 99   ILE A CB  1 
ATOM   761  C CG1 . ILE A 1 99  ? -6.220  77.076 44.466 1.00 25.03  ? 99   ILE A CG1 1 
ATOM   762  C CG2 . ILE A 1 99  ? -3.938  78.086 43.456 1.00 21.30  ? 99   ILE A CG2 1 
ATOM   763  C CD1 . ILE A 1 99  ? -6.181  76.032 43.351 1.00 30.16  ? 99   ILE A CD1 1 
ATOM   764  N N   . TRP A 1 100 ? -2.897  80.085 45.720 1.00 23.75  ? 100  TRP A N   1 
ATOM   765  C CA  . TRP A 1 100 ? -2.488  81.464 45.786 1.00 25.62  ? 100  TRP A CA  1 
ATOM   766  C C   . TRP A 1 100 ? -1.865  81.679 44.438 1.00 27.32  ? 100  TRP A C   1 
ATOM   767  O O   . TRP A 1 100 ? -0.859  81.000 44.048 1.00 29.25  ? 100  TRP A O   1 
ATOM   768  C CB  . TRP A 1 100 ? -1.441  81.751 46.913 1.00 25.32  ? 100  TRP A CB  1 
ATOM   769  C CG  . TRP A 1 100 ? -2.065  81.919 48.285 1.00 25.18  ? 100  TRP A CG  1 
ATOM   770  C CD1 . TRP A 1 100 ? -2.577  83.048 48.833 1.00 24.66  ? 100  TRP A CD1 1 
ATOM   771  C CD2 . TRP A 1 100 ? -2.287  80.901 49.239 1.00 24.15  ? 100  TRP A CD2 1 
ATOM   772  N NE1 . TRP A 1 100 ? -3.102  82.799 50.075 1.00 20.08  ? 100  TRP A NE1 1 
ATOM   773  C CE2 . TRP A 1 100 ? -2.933  81.477 50.333 1.00 20.33  ? 100  TRP A CE2 1 
ATOM   774  C CE3 . TRP A 1 100 ? -2.000  79.542 49.272 1.00 27.36  ? 100  TRP A CE3 1 
ATOM   775  C CZ2 . TRP A 1 100 ? -3.268  80.765 51.432 1.00 23.95  ? 100  TRP A CZ2 1 
ATOM   776  C CZ3 . TRP A 1 100 ? -2.365  78.819 50.390 1.00 25.30  ? 100  TRP A CZ3 1 
ATOM   777  C CH2 . TRP A 1 100 ? -2.965  79.434 51.450 1.00 25.45  ? 100  TRP A CH2 1 
ATOM   778  N N   . VAL A 1 101 ? -2.439  82.636 43.714 1.00 27.42  ? 101  VAL A N   1 
ATOM   779  C CA  . VAL A 1 101 ? -1.993  82.968 42.354 1.00 25.94  ? 101  VAL A CA  1 
ATOM   780  C C   . VAL A 1 101 ? -1.403  84.368 42.350 1.00 26.45  ? 101  VAL A C   1 
ATOM   781  O O   . VAL A 1 101 ? -1.989  85.315 42.957 1.00 25.06  ? 101  VAL A O   1 
ATOM   782  C CB  . VAL A 1 101 ? -3.178  82.922 41.318 1.00 26.13  ? 101  VAL A CB  1 
ATOM   783  C CG1 . VAL A 1 101 ? -2.632  83.091 39.891 1.00 26.73  ? 101  VAL A CG1 1 
ATOM   784  C CG2 . VAL A 1 101 ? -4.115  81.659 41.475 1.00 21.12  ? 101  VAL A CG2 1 
ATOM   785  N N   . PRO A 1 102 ? -0.220  84.507 41.711 1.00 27.36  ? 102  PRO A N   1 
ATOM   786  C CA  . PRO A 1 102 ? 0.334   85.825 41.503 1.00 28.35  ? 102  PRO A CA  1 
ATOM   787  C C   . PRO A 1 102 ? -0.647  86.761 40.763 1.00 30.78  ? 102  PRO A C   1 
ATOM   788  O O   . PRO A 1 102 ? -1.590  86.291 40.094 1.00 31.66  ? 102  PRO A O   1 
ATOM   789  C CB  . PRO A 1 102 ? 1.629   85.554 40.733 1.00 27.37  ? 102  PRO A CB  1 
ATOM   790  C CG  . PRO A 1 102 ? 2.038   84.240 41.078 1.00 26.79  ? 102  PRO A CG  1 
ATOM   791  C CD  . PRO A 1 102 ? 0.710   83.456 41.254 1.00 27.92  ? 102  PRO A CD  1 
ATOM   792  N N   . SER A 1 103 ? -0.495  88.076 40.988 1.00 33.38  ? 103  SER A N   1 
ATOM   793  C CA  . SER A 1 103 ? -1.166  89.118 40.152 1.00 35.16  ? 103  SER A CA  1 
ATOM   794  C C   . SER A 1 103 ? -0.125  89.959 39.406 1.00 35.59  ? 103  SER A C   1 
ATOM   795  O O   . SER A 1 103 ? 0.844   90.366 40.008 1.00 37.38  ? 103  SER A O   1 
ATOM   796  C CB  . SER A 1 103 ? -2.065  90.062 40.930 1.00 34.94  ? 103  SER A CB  1 
ATOM   797  O OG  . SER A 1 103 ? -2.416  91.059 39.992 1.00 36.01  ? 103  SER A OG  1 
ATOM   798  N N   . PRO A 1 104 ? -0.276  90.145 38.082 1.00 35.59  ? 104  PRO A N   1 
ATOM   799  C CA  . PRO A 1 104 ? -1.465  89.624 37.398 1.00 34.31  ? 104  PRO A CA  1 
ATOM   800  C C   . PRO A 1 104 ? -1.227  88.106 37.141 1.00 32.50  ? 104  PRO A C   1 
ATOM   801  O O   . PRO A 1 104 ? -0.042  87.635 37.177 1.00 30.62  ? 104  PRO A O   1 
ATOM   802  C CB  . PRO A 1 104 ? -1.530  90.496 36.115 1.00 35.25  ? 104  PRO A CB  1 
ATOM   803  C CG  . PRO A 1 104 ? 0.051   90.812 35.778 1.00 35.76  ? 104  PRO A CG  1 
ATOM   804  C CD  . PRO A 1 104 ? 0.758   90.711 37.151 1.00 35.62  ? 104  PRO A CD  1 
ATOM   805  N N   . ARG A 1 105 ? -2.329  87.373 36.910 1.00 31.31  ? 105  ARG A N   1 
ATOM   806  C CA  . ARG A 1 105 ? -2.305  85.910 36.682 1.00 31.27  ? 105  ARG A CA  1 
ATOM   807  C C   . ARG A 1 105 ? -1.240  85.438 35.727 1.00 31.81  ? 105  ARG A C   1 
ATOM   808  O O   . ARG A 1 105 ? -1.176  85.862 34.598 1.00 31.53  ? 105  ARG A O   1 
ATOM   809  C CB  . ARG A 1 105 ? -3.598  85.418 36.109 1.00 30.57  ? 105  ARG A CB  1 
ATOM   810  C CG  . ARG A 1 105 ? -3.697  83.924 36.140 1.00 32.45  ? 105  ARG A CG  1 
ATOM   811  C CD  . ARG A 1 105 ? -4.977  83.448 35.537 1.00 33.52  ? 105  ARG A CD  1 
ATOM   812  N NE  . ARG A 1 105 ? -6.078  84.066 36.271 1.00 36.10  ? 105  ARG A NE  1 
ATOM   813  C CZ  . ARG A 1 105 ? -7.341  83.995 35.871 1.00 36.13  ? 105  ARG A CZ  1 
ATOM   814  N NH1 . ARG A 1 105 ? -7.601  83.301 34.786 1.00 38.18  ? 105  ARG A NH1 1 
ATOM   815  N NH2 . ARG A 1 105 ? -8.334  84.564 36.556 1.00 34.75  ? 105  ARG A NH2 1 
ATOM   816  N N   . PRO A 1 106 ? -0.400  84.505 36.145 1.00 32.92  ? 106  PRO A N   1 
ATOM   817  C CA  . PRO A 1 106 ? 0.433   84.065 34.996 1.00 33.91  ? 106  PRO A CA  1 
ATOM   818  C C   . PRO A 1 106 ? -0.379  83.214 33.987 1.00 34.79  ? 106  PRO A C   1 
ATOM   819  O O   . PRO A 1 106 ? -1.620  82.989 34.140 1.00 33.47  ? 106  PRO A O   1 
ATOM   820  C CB  . PRO A 1 106 ? 1.561   83.251 35.639 1.00 33.92  ? 106  PRO A CB  1 
ATOM   821  C CG  . PRO A 1 106 ? 1.230   83.245 37.150 1.00 32.80  ? 106  PRO A CG  1 
ATOM   822  C CD  . PRO A 1 106 ? -0.115  83.802 37.403 1.00 31.72  ? 106  PRO A CD  1 
ATOM   823  N N   . LYS A 1 107 ? 0.313   82.776 32.942 1.00 35.82  ? 107  LYS A N   1 
ATOM   824  C CA  . LYS A 1 107 ? -0.377  82.058 31.878 1.00 36.72  ? 107  LYS A CA  1 
ATOM   825  C C   . LYS A 1 107 ? -0.111  80.592 32.063 1.00 35.42  ? 107  LYS A C   1 
ATOM   826  O O   . LYS A 1 107 ? -1.050  79.781 32.056 1.00 35.42  ? 107  LYS A O   1 
ATOM   827  C CB  . LYS A 1 107 ? 0.128   82.520 30.527 1.00 37.85  ? 107  LYS A CB  1 
ATOM   828  C CG  . LYS A 1 107 ? -0.141  83.979 30.225 1.00 43.92  ? 107  LYS A CG  1 
ATOM   829  C CD  . LYS A 1 107 ? 0.665   84.305 28.945 1.00 55.12  ? 107  LYS A CD  1 
ATOM   830  C CE  . LYS A 1 107 ? 0.380   85.730 28.432 1.00 61.21  ? 107  LYS A CE  1 
ATOM   831  N NZ  . LYS A 1 107 ? 0.837   86.805 29.382 1.00 64.04  ? 107  LYS A NZ  1 
ATOM   832  N N   . SER A 1 108 ? 1.168   80.266 32.248 1.00 33.94  ? 108  SER A N   1 
ATOM   833  C CA  . SER A 1 108 ? 1.567   78.925 32.571 1.00 33.35  ? 108  SER A CA  1 
ATOM   834  C C   . SER A 1 108 ? 2.865   78.956 33.347 1.00 32.24  ? 108  SER A C   1 
ATOM   835  O O   . SER A 1 108 ? 3.906   78.967 32.744 1.00 32.74  ? 108  SER A O   1 
ATOM   836  C CB  . SER A 1 108 ? 1.819   78.160 31.287 1.00 33.74  ? 108  SER A CB  1 
ATOM   837  O OG  . SER A 1 108 ? 1.282   76.866 31.422 1.00 35.93  ? 108  SER A OG  1 
ATOM   838  N N   . THR A 1 109 ? 2.800   78.984 34.675 1.00 30.48  ? 109  THR A N   1 
ATOM   839  C CA  . THR A 1 109 ? 3.975   79.009 35.552 1.00 28.03  ? 109  THR A CA  1 
ATOM   840  C C   . THR A 1 109 ? 4.094   77.747 36.450 1.00 27.96  ? 109  THR A C   1 
ATOM   841  O O   . THR A 1 109 ? 3.172   76.847 36.428 1.00 28.33  ? 109  THR A O   1 
ATOM   842  C CB  . THR A 1 109 ? 3.958   80.266 36.412 1.00 27.14  ? 109  THR A CB  1 
ATOM   843  O OG1 . THR A 1 109 ? 5.193   80.349 37.071 1.00 26.65  ? 109  THR A OG1 1 
ATOM   844  C CG2 . THR A 1 109 ? 2.882   80.205 37.462 1.00 28.04  ? 109  THR A CG2 1 
ATOM   845  N N   . THR A 1 110 ? 5.202   77.672 37.223 1.00 26.30  ? 110  THR A N   1 
ATOM   846  C CA  . THR A 1 110 ? 5.396   76.581 38.203 1.00 25.21  ? 110  THR A CA  1 
ATOM   847  C C   . THR A 1 110 ? 4.279   76.443 39.298 1.00 24.07  ? 110  THR A C   1 
ATOM   848  O O   . THR A 1 110 ? 3.785   77.454 39.868 1.00 24.74  ? 110  THR A O   1 
ATOM   849  C CB  . THR A 1 110 ? 6.734   76.644 38.919 1.00 25.28  ? 110  THR A CB  1 
ATOM   850  O OG1 . THR A 1 110 ? 7.814   76.841 37.976 1.00 27.56  ? 110  THR A OG1 1 
ATOM   851  C CG2 . THR A 1 110 ? 6.930   75.350 39.620 1.00 25.04  ? 110  THR A CG2 1 
ATOM   852  N N   . VAL A 1 111 ? 3.861   75.198 39.550 1.00 21.04  ? 111  VAL A N   1 
ATOM   853  C CA  . VAL A 1 111 ? 2.960   74.867 40.668 1.00 18.13  ? 111  VAL A CA  1 
ATOM   854  C C   . VAL A 1 111 ? 3.687   74.057 41.851 1.00 17.84  ? 111  VAL A C   1 
ATOM   855  O O   . VAL A 1 111 ? 4.468   73.070 41.641 1.00 16.73  ? 111  VAL A O   1 
ATOM   856  C CB  . VAL A 1 111 ? 1.694   74.112 40.162 1.00 16.51  ? 111  VAL A CB  1 
ATOM   857  C CG1 . VAL A 1 111 ? 0.827   73.715 41.296 1.00 16.12  ? 111  VAL A CG1 1 
ATOM   858  C CG2 . VAL A 1 111 ? 0.938   74.935 39.258 1.00 15.25  ? 111  VAL A CG2 1 
ATOM   859  N N   . MET A 1 112 ? 3.355   74.461 43.082 1.00 16.23  ? 112  MET A N   1 
ATOM   860  C CA  . MET A 1 112 ? 3.816   73.854 44.289 1.00 14.81  ? 112  MET A CA  1 
ATOM   861  C C   . MET A 1 112 ? 2.634   73.451 45.125 1.00 12.98  ? 112  MET A C   1 
ATOM   862  O O   . MET A 1 112 ? 1.793   74.307 45.508 1.00 13.48  ? 112  MET A O   1 
ATOM   863  C CB  . MET A 1 112 ? 4.682   74.889 44.983 1.00 13.64  ? 112  MET A CB  1 
ATOM   864  C CG  . MET A 1 112 ? 6.102   74.692 44.562 1.00 15.69  ? 112  MET A CG  1 
ATOM   865  S SD  . MET A 1 112 ? 7.354   75.851 45.149 1.00 19.74  ? 112  MET A SD  1 
ATOM   866  C CE  . MET A 1 112 ? 8.331   74.882 46.323 1.00 26.55  ? 112  MET A CE  1 
ATOM   867  N N   . VAL A 1 113 ? 2.536   72.158 45.417 1.00 12.01  ? 113  VAL A N   1 
ATOM   868  C CA  . VAL A 1 113 ? 1.425   71.667 46.282 1.00 10.99  ? 113  VAL A CA  1 
ATOM   869  C C   . VAL A 1 113 ? 1.939   71.312 47.695 1.00 11.07  ? 113  VAL A C   1 
ATOM   870  O O   . VAL A 1 113 ? 2.756   70.407 47.832 1.00 12.00  ? 113  VAL A O   1 
ATOM   871  C CB  . VAL A 1 113 ? 0.694   70.386 45.737 1.00 10.30  ? 113  VAL A CB  1 
ATOM   872  C CG1 . VAL A 1 113 ? -0.661  70.201 46.399 1.00 10.98  ? 113  VAL A CG1 1 
ATOM   873  C CG2 . VAL A 1 113 ? 0.504   70.461 44.351 1.00 10.29  ? 113  VAL A CG2 1 
ATOM   874  N N   . TRP A 1 114 ? 1.405   71.951 48.730 1.00 9.37   ? 114  TRP A N   1 
ATOM   875  C CA  . TRP A 1 114 ? 1.878   71.670 50.031 1.00 9.32   ? 114  TRP A CA  1 
ATOM   876  C C   . TRP A 1 114 ? 1.047   70.609 50.721 1.00 9.57   ? 114  TRP A C   1 
ATOM   877  O O   . TRP A 1 114 ? -0.167  70.766 50.917 1.00 10.21  ? 114  TRP A O   1 
ATOM   878  C CB  . TRP A 1 114 ? 1.833   72.964 50.878 1.00 10.23  ? 114  TRP A CB  1 
ATOM   879  C CG  . TRP A 1 114 ? 2.103   72.720 52.388 1.00 10.57  ? 114  TRP A CG  1 
ATOM   880  C CD1 . TRP A 1 114 ? 1.176   72.716 53.428 1.00 10.19  ? 114  TRP A CD1 1 
ATOM   881  C CD2 . TRP A 1 114 ? 3.360   72.367 52.976 1.00 10.97  ? 114  TRP A CD2 1 
ATOM   882  N NE1 . TRP A 1 114 ? 1.802   72.391 54.610 1.00 12.27  ? 114  TRP A NE1 1 
ATOM   883  C CE2 . TRP A 1 114 ? 3.137   72.170 54.357 1.00 11.64  ? 114  TRP A CE2 1 
ATOM   884  C CE3 . TRP A 1 114 ? 4.662   72.244 52.475 1.00 9.00   ? 114  TRP A CE3 1 
ATOM   885  C CZ2 . TRP A 1 114 ? 4.166   71.902 55.217 1.00 9.97   ? 114  TRP A CZ2 1 
ATOM   886  C CZ3 . TRP A 1 114 ? 5.662   71.948 53.321 1.00 8.35   ? 114  TRP A CZ3 1 
ATOM   887  C CH2 . TRP A 1 114 ? 5.432   71.792 54.663 1.00 9.64   ? 114  TRP A CH2 1 
ATOM   888  N N   . ILE A 1 115 ? 1.648   69.695 51.175 1.00 20.00  ? 115  ILE A N   1 
ATOM   889  C CA  . ILE A 1 115 ? 0.980   68.675 51.973 1.00 20.00  ? 115  ILE A CA  1 
ATOM   890  C C   . ILE A 1 115 ? 1.430   68.730 53.430 1.00 20.00  ? 115  ILE A C   1 
ATOM   891  O O   . ILE A 1 115 ? 2.677   68.547 53.763 1.00 11.68  ? 115  ILE A O   1 
ATOM   892  C CB  . ILE A 1 115 ? 1.244   67.274 51.391 1.00 20.00  ? 115  ILE A CB  1 
ATOM   893  C CG1 . ILE A 1 115 ? 0.638   67.154 49.991 1.00 20.00  ? 115  ILE A CG1 1 
ATOM   894  C CG2 . ILE A 1 115 ? 0.685   66.200 52.312 1.00 20.00  ? 115  ILE A CG2 1 
ATOM   895  C CD1 . ILE A 1 115 ? 1.051   65.901 49.252 1.00 20.00  ? 115  ILE A CD1 1 
ATOM   896  N N   . TYR A 1 116 ? 0.492   68.762 54.442 1.00 9.97   ? 116  TYR A N   1 
ATOM   897  C CA  . TYR A 1 116 ? 0.895   69.047 55.795 1.00 9.12   ? 116  TYR A CA  1 
ATOM   898  C C   . TYR A 1 116 ? 1.272   67.817 56.621 1.00 9.41   ? 116  TYR A C   1 
ATOM   899  O O   . TYR A 1 116 ? 0.747   66.720 56.388 1.00 9.00   ? 116  TYR A O   1 
ATOM   900  C CB  . TYR A 1 116 ? -0.141  69.931 56.478 1.00 9.67   ? 116  TYR A CB  1 
ATOM   901  C CG  . TYR A 1 116 ? -1.488  69.341 56.547 1.00 7.88   ? 116  TYR A CG  1 
ATOM   902  C CD1 . TYR A 1 116 ? -1.702  68.217 57.282 1.00 6.76   ? 116  TYR A CD1 1 
ATOM   903  C CD2 . TYR A 1 116 ? -2.554  69.921 55.880 1.00 7.72   ? 116  TYR A CD2 1 
ATOM   904  C CE1 . TYR A 1 116 ? -2.947  67.648 57.374 1.00 10.20  ? 116  TYR A CE1 1 
ATOM   905  C CE2 . TYR A 1 116 ? -3.866  69.346 55.920 1.00 8.18   ? 116  TYR A CE2 1 
ATOM   906  C CZ  . TYR A 1 116 ? -4.047  68.198 56.678 1.00 11.91  ? 116  TYR A CZ  1 
ATOM   907  O OH  . TYR A 1 116 ? -5.278  67.547 56.768 1.00 11.52  ? 116  TYR A OH  1 
ATOM   908  N N   . GLY A 1 117 ? 2.175   68.014 57.597 1.00 9.12   ? 117  GLY A N   1 
ATOM   909  C CA  . GLY A 1 117 ? 2.598   66.965 58.600 1.00 10.14  ? 117  GLY A CA  1 
ATOM   910  C C   . GLY A 1 117 ? 1.625   66.777 59.772 1.00 10.26  ? 117  GLY A C   1 
ATOM   911  O O   . GLY A 1 117 ? 0.462   67.275 59.715 1.00 11.19  ? 117  GLY A O   1 
ATOM   912  N N   . GLY A 1 118 ? 2.032   66.087 60.835 1.00 8.66   ? 118  GLY A N   1 
ATOM   913  C CA  . GLY A 1 118 ? 1.115   65.999 61.971 1.00 7.72   ? 118  GLY A CA  1 
ATOM   914  C C   . GLY A 1 118 ? 0.869   64.608 62.466 1.00 8.26   ? 118  GLY A C   1 
ATOM   915  O O   . GLY A 1 118 ? -0.160  64.318 63.084 1.00 7.74   ? 118  GLY A O   1 
ATOM   916  N N   . GLY A 1 119 ? 1.824   63.742 62.150 1.00 9.89   ? 119  GLY A N   1 
ATOM   917  C CA  . GLY A 1 119 ? 1.908   62.367 62.657 1.00 12.15  ? 119  GLY A CA  1 
ATOM   918  C C   . GLY A 1 119 ? 0.813   61.467 62.161 1.00 14.43  ? 119  GLY A C   1 
ATOM   919  O O   . GLY A 1 119 ? 0.613   60.398 62.743 1.00 16.53  ? 119  GLY A O   1 
ATOM   920  N N   . PHE A 1 120 ? 0.104   61.863 61.100 1.00 15.04  ? 120  PHE A N   1 
ATOM   921  C CA  . PHE A 1 120 ? -1.096  61.144 60.581 1.00 17.28  ? 120  PHE A CA  1 
ATOM   922  C C   . PHE A 1 120 ? -2.345  61.208 61.474 1.00 17.41  ? 120  PHE A C   1 
ATOM   923  O O   . PHE A 1 120 ? -3.444  60.943 61.015 1.00 18.95  ? 120  PHE A O   1 
ATOM   924  C CB  . PHE A 1 120 ? -0.856  59.673 60.073 1.00 18.44  ? 120  PHE A CB  1 
ATOM   925  C CG  . PHE A 1 120 ? 0.135   59.554 58.916 1.00 20.81  ? 120  PHE A CG  1 
ATOM   926  C CD1 . PHE A 1 120 ? -0.226  59.884 57.616 1.00 23.07  ? 120  PHE A CD1 1 
ATOM   927  C CD2 . PHE A 1 120 ? 1.430   59.100 59.122 1.00 22.47  ? 120  PHE A CD2 1 
ATOM   928  C CE1 . PHE A 1 120 ? 0.698   59.814 56.569 1.00 19.87  ? 120  PHE A CE1 1 
ATOM   929  C CE2 . PHE A 1 120 ? 2.359   59.050 58.049 1.00 22.10  ? 120  PHE A CE2 1 
ATOM   930  C CZ  . PHE A 1 120 ? 1.982   59.407 56.796 1.00 20.49  ? 120  PHE A CZ  1 
ATOM   931  N N   . TYR A 1 121 ? -2.210  61.583 62.716 1.00 17.09  ? 121  TYR A N   1 
ATOM   932  C CA  . TYR A 1 121 ? -3.378  61.904 63.528 1.00 16.85  ? 121  TYR A CA  1 
ATOM   933  C C   . TYR A 1 121 ? -3.768  63.423 63.553 1.00 17.09  ? 121  TYR A C   1 
ATOM   934  O O   . TYR A 1 121 ? -4.759  63.770 64.226 1.00 17.87  ? 121  TYR A O   1 
ATOM   935  C CB  . TYR A 1 121 ? -3.110  61.478 64.992 1.00 17.67  ? 121  TYR A CB  1 
ATOM   936  C CG  . TYR A 1 121 ? -2.049  62.401 65.671 1.00 18.17  ? 121  TYR A CG  1 
ATOM   937  C CD1 . TYR A 1 121 ? -2.451  63.517 66.457 1.00 15.23  ? 121  TYR A CD1 1 
ATOM   938  C CD2 . TYR A 1 121 ? -0.685  62.203 65.456 1.00 15.41  ? 121  TYR A CD2 1 
ATOM   939  C CE1 . TYR A 1 121 ? -1.596  64.327 67.045 1.00 12.58  ? 121  TYR A CE1 1 
ATOM   940  C CE2 . TYR A 1 121 ? 0.187   62.984 66.049 1.00 18.41  ? 121  TYR A CE2 1 
ATOM   941  C CZ  . TYR A 1 121 ? -0.266  64.075 66.856 1.00 19.24  ? 121  TYR A CZ  1 
ATOM   942  O OH  . TYR A 1 121 ? 0.672   64.925 67.467 1.00 21.45  ? 121  TYR A OH  1 
ATOM   943  N N   . SER A 1 122 ? -3.009  64.357 62.952 1.00 16.42  ? 122  SER A N   1 
ATOM   944  C CA  . SER A 1 122 ? -3.449  65.784 63.082 1.00 15.83  ? 122  SER A CA  1 
ATOM   945  C C   . SER A 1 122 ? -3.015  66.634 61.890 1.00 15.80  ? 122  SER A C   1 
ATOM   946  O O   . SER A 1 122 ? -2.309  66.072 61.043 1.00 15.28  ? 122  SER A O   1 
ATOM   947  C CB  . SER A 1 122 ? -2.919  66.382 64.354 1.00 14.74  ? 122  SER A CB  1 
ATOM   948  O OG  . SER A 1 122 ? -1.491  66.310 64.340 1.00 15.27  ? 122  SER A OG  1 
ATOM   949  N N   . GLY A 1 123 ? -3.434  67.919 61.836 1.00 14.49  ? 123  GLY A N   1 
ATOM   950  C CA  . GLY A 1 123 ? -2.869  68.921 60.928 1.00 16.15  ? 123  GLY A CA  1 
ATOM   951  C C   . GLY A 1 123 ? -3.926  69.726 60.145 1.00 17.40  ? 123  GLY A C   1 
ATOM   952  O O   . GLY A 1 123 ? -5.049  69.303 60.091 1.00 19.33  ? 123  GLY A O   1 
ATOM   953  N N   . SER A 1 124 ? -3.604  70.865 59.524 1.00 16.57  ? 124  SER A N   1 
ATOM   954  C CA  . SER A 1 124 ? -4.602  71.685 58.826 1.00 16.00  ? 124  SER A CA  1 
ATOM   955  C C   . SER A 1 124 ? -3.927  72.380 57.692 1.00 16.67  ? 124  SER A C   1 
ATOM   956  O O   . SER A 1 124 ? -2.754  72.733 57.807 1.00 16.00  ? 124  SER A O   1 
ATOM   957  C CB  . SER A 1 124 ? -5.065  72.857 59.717 1.00 16.06  ? 124  SER A CB  1 
ATOM   958  O OG  . SER A 1 124 ? -6.086  72.460 60.592 1.00 13.07  ? 124  SER A OG  1 
ATOM   959  N N   . SER A 1 125 ? -4.668  72.654 56.618 1.00 17.80  ? 125  SER A N   1 
ATOM   960  C CA  . SER A 1 125 ? -4.162  73.546 55.550 1.00 18.66  ? 125  SER A CA  1 
ATOM   961  C C   . SER A 1 125 ? -4.065  74.981 56.010 1.00 19.59  ? 125  SER A C   1 
ATOM   962  O O   . SER A 1 125 ? -3.199  75.699 55.492 1.00 20.72  ? 125  SER A O   1 
ATOM   963  C CB  . SER A 1 125 ? -5.008  73.526 54.296 1.00 18.23  ? 125  SER A CB  1 
ATOM   964  O OG  . SER A 1 125 ? -6.304  72.961 54.498 1.00 20.59  ? 125  SER A OG  1 
ATOM   965  N N   . THR A 1 126 ? -4.887  75.359 57.003 1.00 19.08  ? 126  THR A N   1 
ATOM   966  C CA  . THR A 1 126 ? -5.215  76.728 57.305 1.00 18.96  ? 126  THR A CA  1 
ATOM   967  C C   . THR A 1 126 ? -4.327  77.366 58.343 1.00 18.79  ? 126  THR A C   1 
ATOM   968  O O   . THR A 1 126 ? -4.517  78.482 58.683 1.00 19.13  ? 126  THR A O   1 
ATOM   969  C CB  . THR A 1 126 ? -6.704  76.824 57.826 1.00 20.34  ? 126  THR A CB  1 
ATOM   970  O OG1 . THR A 1 126 ? -6.903  75.965 58.960 1.00 20.93  ? 126  THR A OG1 1 
ATOM   971  C CG2 . THR A 1 126 ? -7.790  76.423 56.710 1.00 21.35  ? 126  THR A CG2 1 
ATOM   972  N N   . LEU A 1 127 ? -3.356  76.683 58.899 1.00 18.98  ? 127  LEU A N   1 
ATOM   973  C CA  . LEU A 1 127 ? -2.542  77.327 59.936 1.00 19.02  ? 127  LEU A CA  1 
ATOM   974  C C   . LEU A 1 127 ? -1.774  78.494 59.394 1.00 20.30  ? 127  LEU A C   1 
ATOM   975  O O   . LEU A 1 127 ? -1.298  78.449 58.271 1.00 20.57  ? 127  LEU A O   1 
ATOM   976  C CB  . LEU A 1 127 ? -1.493  76.376 60.461 1.00 17.34  ? 127  LEU A CB  1 
ATOM   977  C CG  . LEU A 1 127 ? -1.915  75.017 60.936 1.00 18.24  ? 127  LEU A CG  1 
ATOM   978  C CD1 . LEU A 1 127 ? -0.656  74.270 61.322 1.00 16.46  ? 127  LEU A CD1 1 
ATOM   979  C CD2 . LEU A 1 127 ? -2.989  75.007 62.110 1.00 19.65  ? 127  LEU A CD2 1 
ATOM   980  N N   . ASP A 1 128 ? -1.547  79.510 60.214 1.00 21.85  ? 128  ASP A N   1 
ATOM   981  C CA  . ASP A 1 128 ? -0.780  80.658 59.725 1.00 22.53  ? 128  ASP A CA  1 
ATOM   982  C C   . ASP A 1 128 ? 0.549   80.252 59.203 1.00 21.65  ? 128  ASP A C   1 
ATOM   983  O O   . ASP A 1 128 ? 0.982   80.932 58.311 1.00 22.16  ? 128  ASP A O   1 
ATOM   984  C CB  . ASP A 1 128 ? -0.527  81.805 60.723 1.00 23.56  ? 128  ASP A CB  1 
ATOM   985  C CG  . ASP A 1 128 ? -1.738  82.171 61.542 1.00 29.43  ? 128  ASP A CG  1 
ATOM   986  O OD1 . ASP A 1 128 ? -1.988  83.347 61.644 1.00 38.31  ? 128  ASP A OD1 1 
ATOM   987  O OD2 . ASP A 1 128 ? -2.437  81.334 62.153 1.00 38.06  ? 128  ASP A OD2 1 
ATOM   988  N N   . VAL A 1 129 ? 1.256   79.255 59.750 1.00 20.73  ? 129  VAL A N   1 
ATOM   989  C CA  . VAL A 1 129 ? 2.632   79.097 59.219 1.00 19.31  ? 129  VAL A CA  1 
ATOM   990  C C   . VAL A 1 129 ? 2.559   78.526 57.825 1.00 19.85  ? 129  VAL A C   1 
ATOM   991  O O   . VAL A 1 129 ? 3.606   78.479 57.122 1.00 21.24  ? 129  VAL A O   1 
ATOM   992  C CB  . VAL A 1 129 ? 3.507   78.051 59.881 1.00 18.99  ? 129  VAL A CB  1 
ATOM   993  C CG1 . VAL A 1 129 ? 4.667   78.652 60.587 1.00 18.05  ? 129  VAL A CG1 1 
ATOM   994  C CG2 . VAL A 1 129 ? 2.676   77.012 60.655 1.00 17.48  ? 129  VAL A CG2 1 
ATOM   995  N N   . TYR A 1 130 ? 1.404   77.987 57.414 1.00 18.81  ? 130  TYR A N   1 
ATOM   996  C CA  . TYR A 1 130 ? 1.369   77.492 56.027 1.00 18.55  ? 130  TYR A CA  1 
ATOM   997  C C   . TYR A 1 130 ? 0.754   78.488 55.076 1.00 20.09  ? 130  TYR A C   1 
ATOM   998  O O   . TYR A 1 130 ? 0.356   78.115 54.051 1.00 22.04  ? 130  TYR A O   1 
ATOM   999  C CB  . TYR A 1 130 ? 0.615   76.186 55.883 1.00 16.27  ? 130  TYR A CB  1 
ATOM   1000 C CG  . TYR A 1 130 ? 1.008   75.054 56.819 1.00 14.83  ? 130  TYR A CG  1 
ATOM   1001 C CD1 . TYR A 1 130 ? 2.323   74.796 57.162 1.00 11.75  ? 130  TYR A CD1 1 
ATOM   1002 C CD2 . TYR A 1 130 ? 0.034   74.215 57.299 1.00 12.88  ? 130  TYR A CD2 1 
ATOM   1003 C CE1 . TYR A 1 130 ? 2.614   73.768 57.994 1.00 13.08  ? 130  TYR A CE1 1 
ATOM   1004 C CE2 . TYR A 1 130 ? 0.298   73.207 58.136 1.00 11.89  ? 130  TYR A CE2 1 
ATOM   1005 C CZ  . TYR A 1 130 ? 1.592   72.938 58.507 1.00 12.91  ? 130  TYR A CZ  1 
ATOM   1006 O OH  . TYR A 1 130 ? 1.808   71.830 59.383 1.00 6.42   ? 130  TYR A OH  1 
ATOM   1007 N N   . ASN A 1 131 ? 0.557   79.744 55.442 1.00 22.09  ? 131  ASN A N   1 
ATOM   1008 C CA  . ASN A 1 131 ? 0.120   80.756 54.489 1.00 22.20  ? 131  ASN A CA  1 
ATOM   1009 C C   . ASN A 1 131 ? 1.042   80.907 53.292 1.00 22.36  ? 131  ASN A C   1 
ATOM   1010 O O   . ASN A 1 131 ? 2.180   81.424 53.388 1.00 21.70  ? 131  ASN A O   1 
ATOM   1011 C CB  . ASN A 1 131 ? -0.027  82.144 55.126 1.00 22.34  ? 131  ASN A CB  1 
ATOM   1012 C CG  . ASN A 1 131 ? -0.834  83.073 54.236 1.00 22.72  ? 131  ASN A CG  1 
ATOM   1013 O OD1 . ASN A 1 131 ? -1.063  82.799 53.048 1.00 24.74  ? 131  ASN A OD1 1 
ATOM   1014 N ND2 . ASN A 1 131 ? -1.314  84.130 54.802 1.00 20.16  ? 131  ASN A ND2 1 
ATOM   1015 N N   . GLY A 1 132 ? 0.465   80.554 52.142 1.00 22.99  ? 132  GLY A N   1 
ATOM   1016 C CA  . GLY A 1 132 ? 1.197   80.550 50.879 1.00 22.64  ? 132  GLY A CA  1 
ATOM   1017 C C   . GLY A 1 132 ? 1.375   81.859 50.149 1.00 21.90  ? 132  GLY A C   1 
ATOM   1018 O O   . GLY A 1 132 ? 2.123   81.881 49.194 1.00 21.19  ? 132  GLY A O   1 
ATOM   1019 N N   . LYS A 1 133 ? 0.770   82.942 50.617 1.00 21.89  ? 133  LYS A N   1 
ATOM   1020 C CA  . LYS A 1 133 ? 0.909   84.201 49.928 1.00 23.95  ? 133  LYS A CA  1 
ATOM   1021 C C   . LYS A 1 133 ? 2.370   84.721 49.787 1.00 24.33  ? 133  LYS A C   1 
ATOM   1022 O O   . LYS A 1 133 ? 2.673   85.409 48.833 1.00 24.29  ? 133  LYS A O   1 
ATOM   1023 C CB  . LYS A 1 133 ? 0.017   85.269 50.552 1.00 24.99  ? 133  LYS A CB  1 
ATOM   1024 C CG  . LYS A 1 133 ? 0.657   86.004 51.789 1.00 27.14  ? 133  LYS A CG  1 
ATOM   1025 C CD  . LYS A 1 133 ? -0.442  86.471 52.757 1.00 29.29  ? 133  LYS A CD  1 
ATOM   1026 C CE  . LYS A 1 133 ? -0.115  87.760 53.535 1.00 30.84  ? 133  LYS A CE  1 
ATOM   1027 N NZ  . LYS A 1 133 ? -1.452  88.379 53.873 1.00 31.86  ? 133  LYS A NZ  1 
ATOM   1028 N N   . TYR A 1 134 ? 3.287   84.374 50.681 1.00 24.84  ? 134  TYR A N   1 
ATOM   1029 C CA  . TYR A 1 134 ? 4.629   84.921 50.554 1.00 25.08  ? 134  TYR A CA  1 
ATOM   1030 C C   . TYR A 1 134 ? 5.369   84.240 49.489 1.00 24.23  ? 134  TYR A C   1 
ATOM   1031 O O   . TYR A 1 134 ? 5.955   84.849 48.630 1.00 24.06  ? 134  TYR A O   1 
ATOM   1032 C CB  . TYR A 1 134 ? 5.382   84.847 51.871 1.00 27.27  ? 134  TYR A CB  1 
ATOM   1033 C CG  . TYR A 1 134 ? 4.643   85.609 52.954 1.00 29.84  ? 134  TYR A CG  1 
ATOM   1034 C CD1 . TYR A 1 134 ? 4.727   87.000 53.049 1.00 29.83  ? 134  TYR A CD1 1 
ATOM   1035 C CD2 . TYR A 1 134 ? 3.803   84.936 53.830 1.00 31.15  ? 134  TYR A CD2 1 
ATOM   1036 C CE1 . TYR A 1 134 ? 4.030   87.697 54.035 1.00 33.89  ? 134  TYR A CE1 1 
ATOM   1037 C CE2 . TYR A 1 134 ? 3.071   85.613 54.788 1.00 33.45  ? 134  TYR A CE2 1 
ATOM   1038 C CZ  . TYR A 1 134 ? 3.178   86.993 54.915 1.00 34.36  ? 134  TYR A CZ  1 
ATOM   1039 O OH  . TYR A 1 134 ? 2.384   87.642 55.896 1.00 34.83  ? 134  TYR A OH  1 
ATOM   1040 N N   . LEU A 1 135 ? 5.332   82.945 49.542 1.00 24.56  ? 135  LEU A N   1 
ATOM   1041 C CA  . LEU A 1 135 ? 5.940   82.156 48.490 1.00 25.19  ? 135  LEU A CA  1 
ATOM   1042 C C   . LEU A 1 135 ? 5.399   82.550 47.123 1.00 25.51  ? 135  LEU A C   1 
ATOM   1043 O O   . LEU A 1 135 ? 6.211   82.873 46.230 1.00 24.63  ? 135  LEU A O   1 
ATOM   1044 C CB  . LEU A 1 135 ? 5.712   80.666 48.744 1.00 25.24  ? 135  LEU A CB  1 
ATOM   1045 C CG  . LEU A 1 135 ? 6.824   79.767 48.232 1.00 24.66  ? 135  LEU A CG  1 
ATOM   1046 C CD1 . LEU A 1 135 ? 8.213   80.334 48.479 1.00 21.24  ? 135  LEU A CD1 1 
ATOM   1047 C CD2 . LEU A 1 135 ? 6.672   78.401 48.878 1.00 23.82  ? 135  LEU A CD2 1 
ATOM   1048 N N   . ALA A 1 136 ? 4.062   82.523 46.968 1.00 25.43  ? 136  ALA A N   1 
ATOM   1049 C CA  . ALA A 1 136 ? 3.448   82.796 45.685 1.00 27.13  ? 136  ALA A CA  1 
ATOM   1050 C C   . ALA A 1 136 ? 4.000   84.130 45.184 1.00 29.13  ? 136  ALA A C   1 
ATOM   1051 O O   . ALA A 1 136 ? 4.432   84.287 44.007 1.00 29.44  ? 136  ALA A O   1 
ATOM   1052 C CB  . ALA A 1 136 ? 1.933   82.900 45.795 1.00 27.17  ? 136  ALA A CB  1 
ATOM   1053 N N   . TYR A 1 137 ? 4.001   85.100 46.095 1.00 30.02  ? 137  TYR A N   1 
ATOM   1054 C CA  . TYR A 1 137 ? 4.293   86.445 45.726 1.00 29.81  ? 137  TYR A CA  1 
ATOM   1055 C C   . TYR A 1 137 ? 5.754   86.518 45.372 1.00 28.81  ? 137  TYR A C   1 
ATOM   1056 O O   . TYR A 1 137 ? 6.127   86.909 44.317 1.00 28.73  ? 137  TYR A O   1 
ATOM   1057 C CB  . TYR A 1 137 ? 4.027   87.332 46.907 1.00 31.84  ? 137  TYR A CB  1 
ATOM   1058 C CG  . TYR A 1 137 ? 4.479   88.715 46.634 1.00 35.88  ? 137  TYR A CG  1 
ATOM   1059 C CD1 . TYR A 1 137 ? 5.816   89.095 46.801 1.00 40.57  ? 137  TYR A CD1 1 
ATOM   1060 C CD2 . TYR A 1 137 ? 3.596   89.645 46.167 1.00 38.48  ? 137  TYR A CD2 1 
ATOM   1061 C CE1 . TYR A 1 137 ? 6.238   90.385 46.511 1.00 40.32  ? 137  TYR A CE1 1 
ATOM   1062 C CE2 . TYR A 1 137 ? 3.997   90.911 45.879 1.00 39.41  ? 137  TYR A CE2 1 
ATOM   1063 C CZ  . TYR A 1 137 ? 5.305   91.277 46.045 1.00 39.33  ? 137  TYR A CZ  1 
ATOM   1064 O OH  . TYR A 1 137 ? 5.639   92.569 45.729 1.00 41.82  ? 137  TYR A OH  1 
ATOM   1065 N N   . THR A 1 138 ? 6.592   86.121 46.295 1.00 28.30  ? 138  THR A N   1 
ATOM   1066 C CA  . THR A 1 138 ? 7.986   86.404 46.206 1.00 26.76  ? 138  THR A CA  1 
ATOM   1067 C C   . THR A 1 138 ? 8.524   85.625 45.037 1.00 26.17  ? 138  THR A C   1 
ATOM   1068 O O   . THR A 1 138 ? 9.337   86.138 44.347 1.00 26.63  ? 138  THR A O   1 
ATOM   1069 C CB  . THR A 1 138 ? 8.667   86.087 47.579 1.00 26.88  ? 138  THR A CB  1 
ATOM   1070 O OG1 . THR A 1 138 ? 8.244   87.069 48.527 1.00 26.19  ? 138  THR A OG1 1 
ATOM   1071 C CG2 . THR A 1 138 ? 10.188  86.065 47.512 1.00 26.00  ? 138  THR A CG2 1 
ATOM   1072 N N   . GLU A 1 139 ? 8.067   84.406 44.779 1.00 26.56  ? 139  GLU A N   1 
ATOM   1073 C CA  . GLU A 1 139 ? 8.735   83.589 43.734 1.00 26.95  ? 139  GLU A CA  1 
ATOM   1074 C C   . GLU A 1 139 ? 7.877   83.413 42.478 1.00 27.70  ? 139  GLU A C   1 
ATOM   1075 O O   . GLU A 1 139 ? 8.331   82.676 41.572 1.00 29.22  ? 139  GLU A O   1 
ATOM   1076 C CB  . GLU A 1 139 ? 9.147   82.177 44.201 1.00 26.75  ? 139  GLU A CB  1 
ATOM   1077 C CG  . GLU A 1 139 ? 10.257  81.997 45.244 1.00 24.44  ? 139  GLU A CG  1 
ATOM   1078 C CD  . GLU A 1 139 ? 11.556  82.558 44.798 1.00 22.10  ? 139  GLU A CD  1 
ATOM   1079 O OE1 . GLU A 1 139 ? 12.210  82.075 43.899 1.00 18.60  ? 139  GLU A OE1 1 
ATOM   1080 O OE2 . GLU A 1 139 ? 11.940  83.541 45.376 1.00 25.32  ? 139  GLU A OE2 1 
ATOM   1081 N N   . GLU A 1 140 ? 6.707   84.086 42.387 1.00 26.77  ? 140  GLU A N   1 
ATOM   1082 C CA  . GLU A 1 140 ? 5.810   83.934 41.250 1.00 27.28  ? 140  GLU A CA  1 
ATOM   1083 C C   . GLU A 1 140 ? 5.629   82.443 40.936 1.00 25.28  ? 140  GLU A C   1 
ATOM   1084 O O   . GLU A 1 140 ? 6.171   81.929 39.928 1.00 24.68  ? 140  GLU A O   1 
ATOM   1085 C CB  . GLU A 1 140 ? 6.383   84.571 39.979 1.00 29.78  ? 140  GLU A CB  1 
ATOM   1086 C CG  . GLU A 1 140 ? 5.924   86.009 39.510 1.00 36.99  ? 140  GLU A CG  1 
ATOM   1087 C CD  . GLU A 1 140 ? 7.124   87.025 39.637 1.00 45.94  ? 140  GLU A CD  1 
ATOM   1088 O OE1 . GLU A 1 140 ? 6.911   88.063 40.327 1.00 50.11  ? 140  GLU A OE1 1 
ATOM   1089 O OE2 . GLU A 1 140 ? 8.278   86.773 39.109 1.00 46.91  ? 140  GLU A OE2 1 
ATOM   1090 N N   . VAL A 1 141 ? 4.933   81.742 41.827 1.00 22.70  ? 141  VAL A N   1 
ATOM   1091 C CA  . VAL A 1 141 ? 4.615   80.358 41.631 1.00 19.81  ? 141  VAL A CA  1 
ATOM   1092 C C   . VAL A 1 141 ? 3.196   80.246 42.033 1.00 19.02  ? 141  VAL A C   1 
ATOM   1093 O O   . VAL A 1 141 ? 2.717   81.087 42.786 1.00 18.63  ? 141  VAL A O   1 
ATOM   1094 C CB  . VAL A 1 141 ? 5.447   79.398 42.507 1.00 19.84  ? 141  VAL A CB  1 
ATOM   1095 C CG1 . VAL A 1 141 ? 6.855   79.327 42.038 1.00 18.30  ? 141  VAL A CG1 1 
ATOM   1096 C CG2 . VAL A 1 141 ? 5.383   79.763 43.924 1.00 17.77  ? 141  VAL A CG2 1 
ATOM   1097 N N   . VAL A 1 142 ? 2.502   79.226 41.522 1.00 18.15  ? 142  VAL A N   1 
ATOM   1098 C CA  . VAL A 1 142 ? 1.148   78.941 42.037 1.00 17.26  ? 142  VAL A CA  1 
ATOM   1099 C C   . VAL A 1 142 ? 1.317   78.015 43.258 1.00 17.71  ? 142  VAL A C   1 
ATOM   1100 O O   . VAL A 1 142 ? 2.046   77.013 43.202 1.00 18.65  ? 142  VAL A O   1 
ATOM   1101 C CB  . VAL A 1 142 ? 0.189   78.410 40.921 1.00 16.09  ? 142  VAL A CB  1 
ATOM   1102 C CG1 . VAL A 1 142 ? -1.144  77.927 41.454 1.00 13.05  ? 142  VAL A CG1 1 
ATOM   1103 C CG2 . VAL A 1 142 ? -0.034  79.502 39.946 1.00 15.91  ? 142  VAL A CG2 1 
ATOM   1104 N N   . LEU A 1 143 ? 0.673   78.360 44.364 1.00 16.85  ? 143  LEU A N   1 
ATOM   1105 C CA  . LEU A 1 143 ? 0.866   77.599 45.579 1.00 16.14  ? 143  LEU A CA  1 
ATOM   1106 C C   . LEU A 1 143 ? -0.472  76.984 45.989 1.00 15.58  ? 143  LEU A C   1 
ATOM   1107 O O   . LEU A 1 143 ? -1.472  77.729 46.255 1.00 14.95  ? 143  LEU A O   1 
ATOM   1108 C CB  . LEU A 1 143 ? 1.457   78.532 46.676 1.00 16.13  ? 143  LEU A CB  1 
ATOM   1109 C CG  . LEU A 1 143 ? 2.136   77.979 47.939 1.00 15.79  ? 143  LEU A CG  1 
ATOM   1110 C CD1 . LEU A 1 143 ? 1.130   77.736 49.053 1.00 14.57  ? 143  LEU A CD1 1 
ATOM   1111 C CD2 . LEU A 1 143 ? 2.778   76.663 47.634 1.00 19.94  ? 143  LEU A CD2 1 
ATOM   1112 N N   . VAL A 1 144 ? -0.519  75.657 46.035 1.00 14.06  ? 144  VAL A N   1 
ATOM   1113 C CA  . VAL A 1 144 ? -1.764  75.044 46.536 1.00 14.35  ? 144  VAL A CA  1 
ATOM   1114 C C   . VAL A 1 144 ? -1.515  74.217 47.790 1.00 15.30  ? 144  VAL A C   1 
ATOM   1115 O O   . VAL A 1 144 ? -0.410  73.579 47.943 1.00 16.36  ? 144  VAL A O   1 
ATOM   1116 C CB  . VAL A 1 144 ? -2.617  74.287 45.409 1.00 14.07  ? 144  VAL A CB  1 
ATOM   1117 C CG1 . VAL A 1 144 ? -1.780  73.879 44.281 1.00 14.31  ? 144  VAL A CG1 1 
ATOM   1118 C CG2 . VAL A 1 144 ? -3.294  73.100 45.933 1.00 11.82  ? 144  VAL A CG2 1 
ATOM   1119 N N   . SER A 1 145 ? -2.468  74.264 48.728 1.00 14.89  ? 145  SER A N   1 
ATOM   1120 C CA  . SER A 1 145 ? -2.359  73.388 49.931 1.00 15.67  ? 145  SER A CA  1 
ATOM   1121 C C   . SER A 1 145 ? -3.547  72.509 50.008 1.00 17.09  ? 145  SER A C   1 
ATOM   1122 O O   . SER A 1 145 ? -4.665  72.916 49.733 1.00 16.96  ? 145  SER A O   1 
ATOM   1123 C CB  . SER A 1 145 ? -2.116  74.105 51.265 1.00 15.81  ? 145  SER A CB  1 
ATOM   1124 O OG  . SER A 1 145 ? -2.853  75.316 51.454 1.00 14.89  ? 145  SER A OG  1 
ATOM   1125 N N   . LEU A 1 146 ? -3.320  71.238 50.286 1.00 19.33  ? 146  LEU A N   1 
ATOM   1126 C CA  . LEU A 1 146 ? -4.452  70.342 50.154 1.00 20.47  ? 146  LEU A CA  1 
ATOM   1127 C C   . LEU A 1 146 ? -4.814  69.965 51.520 1.00 20.30  ? 146  LEU A C   1 
ATOM   1128 O O   . LEU A 1 146 ? -4.259  70.533 52.443 1.00 20.71  ? 146  LEU A O   1 
ATOM   1129 C CB  . LEU A 1 146 ? -4.161  69.141 49.282 1.00 20.35  ? 146  LEU A CB  1 
ATOM   1130 C CG  . LEU A 1 146 ? -2.855  68.474 49.446 1.00 22.38  ? 146  LEU A CG  1 
ATOM   1131 C CD1 . LEU A 1 146 ? -3.150  67.525 50.580 1.00 22.97  ? 146  LEU A CD1 1 
ATOM   1132 C CD2 . LEU A 1 146 ? -2.610  67.852 48.028 1.00 21.06  ? 146  LEU A CD2 1 
ATOM   1133 N N   . SER A 1 147 ? -5.754  69.050 51.658 1.00 19.43  ? 147  SER A N   1 
ATOM   1134 C CA  . SER A 1 147 ? -6.134  68.695 52.955 1.00 19.13  ? 147  SER A CA  1 
ATOM   1135 C C   . SER A 1 147 ? -6.754  67.338 52.881 1.00 18.19  ? 147  SER A C   1 
ATOM   1136 O O   . SER A 1 147 ? -7.386  67.020 51.880 1.00 17.90  ? 147  SER A O   1 
ATOM   1137 C CB  . SER A 1 147 ? -7.034  69.769 53.523 1.00 18.83  ? 147  SER A CB  1 
ATOM   1138 O OG  . SER A 1 147 ? -8.319  69.334 53.307 1.00 21.43  ? 147  SER A OG  1 
ATOM   1139 N N   . TYR A 1 148 ? -6.506  66.525 53.912 1.00 17.38  ? 148  TYR A N   1 
ATOM   1140 C CA  . TYR A 1 148 ? -6.810  65.102 53.850 1.00 17.40  ? 148  TYR A CA  1 
ATOM   1141 C C   . TYR A 1 148 ? -7.184  64.580 55.218 1.00 15.93  ? 148  TYR A C   1 
ATOM   1142 O O   . TYR A 1 148 ? -6.865  65.215 56.202 1.00 15.69  ? 148  TYR A O   1 
ATOM   1143 C CB  . TYR A 1 148 ? -5.610  64.341 53.307 1.00 17.48  ? 148  TYR A CB  1 
ATOM   1144 C CG  . TYR A 1 148 ? -4.383  64.453 54.163 1.00 20.24  ? 148  TYR A CG  1 
ATOM   1145 C CD1 . TYR A 1 148 ? -4.013  63.420 55.060 1.00 22.71  ? 148  TYR A CD1 1 
ATOM   1146 C CD2 . TYR A 1 148 ? -3.550  65.555 54.077 1.00 22.72  ? 148  TYR A CD2 1 
ATOM   1147 C CE1 . TYR A 1 148 ? -2.863  63.545 55.889 1.00 21.94  ? 148  TYR A CE1 1 
ATOM   1148 C CE2 . TYR A 1 148 ? -2.370  65.655 54.881 1.00 21.82  ? 148  TYR A CE2 1 
ATOM   1149 C CZ  . TYR A 1 148 ? -2.040  64.656 55.770 1.00 20.19  ? 148  TYR A CZ  1 
ATOM   1150 O OH  . TYR A 1 148 ? -0.900  64.778 56.555 1.00 19.77  ? 148  TYR A OH  1 
ATOM   1151 N N   . ARG A 1 149 ? -7.819  63.426 55.274 1.00 13.53  ? 149  ARG A N   1 
ATOM   1152 C CA  . ARG A 1 149 ? -8.370  62.941 56.513 1.00 13.77  ? 149  ARG A CA  1 
ATOM   1153 C C   . ARG A 1 149 ? -7.350  62.309 57.468 1.00 14.24  ? 149  ARG A C   1 
ATOM   1154 O O   . ARG A 1 149 ? -6.513  61.446 57.066 1.00 16.09  ? 149  ARG A O   1 
ATOM   1155 C CB  . ARG A 1 149 ? -9.438  61.876 56.206 1.00 13.57  ? 149  ARG A CB  1 
ATOM   1156 C CG  . ARG A 1 149 ? -10.774 62.469 55.895 1.00 14.93  ? 149  ARG A CG  1 
ATOM   1157 C CD  . ARG A 1 149 ? -11.728 61.424 55.505 1.00 16.50  ? 149  ARG A CD  1 
ATOM   1158 N NE  . ARG A 1 149 ? -11.417 60.853 54.183 1.00 16.77  ? 149  ARG A NE  1 
ATOM   1159 C CZ  . ARG A 1 149 ? -12.122 59.847 53.669 1.00 14.41  ? 149  ARG A CZ  1 
ATOM   1160 N NH1 . ARG A 1 149 ? -11.798 59.267 52.479 1.00 2.00   ? 149  ARG A NH1 1 
ATOM   1161 N NH2 . ARG A 1 149 ? -13.130 59.388 54.440 1.00 14.04  ? 149  ARG A NH2 1 
ATOM   1162 N N   . VAL A 1 150 ? -7.420  62.662 58.748 1.00 13.00  ? 150  VAL A N   1 
ATOM   1163 C CA  . VAL A 1 150 ? -6.418  62.136 59.736 1.00 11.03  ? 150  VAL A CA  1 
ATOM   1164 C C   . VAL A 1 150 ? -6.984  61.163 60.765 1.00 11.81  ? 150  VAL A C   1 
ATOM   1165 O O   . VAL A 1 150 ? -8.189  60.864 60.752 1.00 12.53  ? 150  VAL A O   1 
ATOM   1166 C CB  . VAL A 1 150 ? -5.638  63.277 60.393 1.00 9.13   ? 150  VAL A CB  1 
ATOM   1167 C CG1 . VAL A 1 150 ? -4.926  64.000 59.330 1.00 6.40   ? 150  VAL A CG1 1 
ATOM   1168 C CG2 . VAL A 1 150 ? -6.570  64.205 61.110 1.00 4.04   ? 150  VAL A CG2 1 
ATOM   1169 N N   . GLY A 1 151 ? -6.125  60.686 61.656 1.00 11.99  ? 151  GLY A N   1 
ATOM   1170 C CA  . GLY A 1 151 ? -6.472  59.603 62.611 1.00 13.24  ? 151  GLY A CA  1 
ATOM   1171 C C   . GLY A 1 151 ? -7.288  58.446 62.037 1.00 14.76  ? 151  GLY A C   1 
ATOM   1172 O O   . GLY A 1 151 ? -7.134  58.033 60.877 1.00 15.89  ? 151  GLY A O   1 
ATOM   1173 N N   . ALA A 1 152 ? -8.211  57.950 62.833 1.00 15.16  ? 152  ALA A N   1 
ATOM   1174 C CA  . ALA A 1 152 ? -9.092  56.897 62.397 1.00 15.23  ? 152  ALA A CA  1 
ATOM   1175 C C   . ALA A 1 152 ? -9.947  57.269 61.189 1.00 15.25  ? 152  ALA A C   1 
ATOM   1176 O O   . ALA A 1 152 ? -10.094 56.456 60.310 1.00 15.31  ? 152  ALA A O   1 
ATOM   1177 C CB  . ALA A 1 152 ? -9.956  56.518 63.520 1.00 15.71  ? 152  ALA A CB  1 
ATOM   1178 N N   . PHE A 1 153 ? -10.523 58.477 61.159 1.00 15.22  ? 153  PHE A N   1 
ATOM   1179 C CA  . PHE A 1 153 ? -11.315 58.945 59.983 1.00 14.82  ? 153  PHE A CA  1 
ATOM   1180 C C   . PHE A 1 153 ? -10.591 58.714 58.663 1.00 14.37  ? 153  PHE A C   1 
ATOM   1181 O O   . PHE A 1 153 ? -11.247 58.513 57.601 1.00 13.05  ? 153  PHE A O   1 
ATOM   1182 C CB  . PHE A 1 153 ? -11.622 60.441 60.102 1.00 15.22  ? 153  PHE A CB  1 
ATOM   1183 C CG  . PHE A 1 153 ? -12.225 60.785 61.376 1.00 17.74  ? 153  PHE A CG  1 
ATOM   1184 C CD1 . PHE A 1 153 ? -11.445 61.308 62.396 1.00 23.62  ? 153  PHE A CD1 1 
ATOM   1185 C CD2 . PHE A 1 153 ? -13.545 60.422 61.646 1.00 18.81  ? 153  PHE A CD2 1 
ATOM   1186 C CE1 . PHE A 1 153 ? -12.002 61.546 63.645 1.00 23.38  ? 153  PHE A CE1 1 
ATOM   1187 C CE2 . PHE A 1 153 ? -14.122 60.613 62.901 1.00 18.76  ? 153  PHE A CE2 1 
ATOM   1188 C CZ  . PHE A 1 153 ? -13.360 61.166 63.896 1.00 20.75  ? 153  PHE A CZ  1 
ATOM   1189 N N   . GLY A 1 154 ? -9.242  58.734 58.764 1.00 13.52  ? 154  GLY A N   1 
ATOM   1190 C CA  . GLY A 1 154 ? -8.349  58.769 57.613 1.00 12.93  ? 154  GLY A CA  1 
ATOM   1191 C C   . GLY A 1 154 ? -7.619  57.434 57.366 1.00 13.12  ? 154  GLY A C   1 
ATOM   1192 O O   . GLY A 1 154 ? -7.217  57.170 56.227 1.00 12.45  ? 154  GLY A O   1 
ATOM   1193 N N   . PHE A 1 155 ? -7.438  56.581 58.402 1.00 12.44  ? 155  PHE A N   1 
ATOM   1194 C CA  . PHE A 1 155 ? -6.499  55.469 58.284 1.00 11.04  ? 155  PHE A CA  1 
ATOM   1195 C C   . PHE A 1 155 ? -6.936  54.192 58.929 1.00 13.27  ? 155  PHE A C   1 
ATOM   1196 O O   . PHE A 1 155 ? -6.321  53.123 58.678 1.00 13.22  ? 155  PHE A O   1 
ATOM   1197 C CB  . PHE A 1 155 ? -5.164  55.897 58.776 1.00 10.09  ? 155  PHE A CB  1 
ATOM   1198 C CG  . PHE A 1 155 ? -4.540  56.935 57.902 1.00 10.20  ? 155  PHE A CG  1 
ATOM   1199 C CD1 . PHE A 1 155 ? -3.825  56.548 56.701 1.00 10.24  ? 155  PHE A CD1 1 
ATOM   1200 C CD2 . PHE A 1 155 ? -4.674  58.316 58.223 1.00 7.84   ? 155  PHE A CD2 1 
ATOM   1201 C CE1 . PHE A 1 155 ? -3.278  57.530 55.847 1.00 7.13   ? 155  PHE A CE1 1 
ATOM   1202 C CE2 . PHE A 1 155 ? -4.112  59.314 57.330 1.00 5.66   ? 155  PHE A CE2 1 
ATOM   1203 C CZ  . PHE A 1 155 ? -3.431  58.923 56.205 1.00 5.56   ? 155  PHE A CZ  1 
ATOM   1204 N N   . LEU A 1 156 ? -8.050  54.243 59.680 1.00 15.85  ? 156  LEU A N   1 
ATOM   1205 C CA  . LEU A 1 156 ? -8.707  53.009 60.156 1.00 17.69  ? 156  LEU A CA  1 
ATOM   1206 C C   . LEU A 1 156 ? -8.725  52.005 59.029 1.00 19.50  ? 156  LEU A C   1 
ATOM   1207 O O   . LEU A 1 156 ? -9.125  52.331 57.911 1.00 21.19  ? 156  LEU A O   1 
ATOM   1208 C CB  . LEU A 1 156 ? -10.114 53.287 60.539 1.00 17.57  ? 156  LEU A CB  1 
ATOM   1209 C CG  . LEU A 1 156 ? -10.741 51.962 60.896 1.00 18.90  ? 156  LEU A CG  1 
ATOM   1210 C CD1 . LEU A 1 156 ? -10.309 51.633 62.272 1.00 15.05  ? 156  LEU A CD1 1 
ATOM   1211 C CD2 . LEU A 1 156 ? -12.261 52.159 60.797 1.00 21.18  ? 156  LEU A CD2 1 
ATOM   1212 N N   . ALA A 1 157 ? -8.285  50.786 59.268 1.00 20.87  ? 157  ALA A N   1 
ATOM   1213 C CA  . ALA A 1 157 ? -8.102  49.883 58.140 1.00 21.88  ? 157  ALA A CA  1 
ATOM   1214 C C   . ALA A 1 157 ? -8.426  48.438 58.425 1.00 23.63  ? 157  ALA A C   1 
ATOM   1215 O O   . ALA A 1 157 ? -7.694  47.723 59.144 1.00 22.80  ? 157  ALA A O   1 
ATOM   1216 C CB  . ALA A 1 157 ? -6.716  49.994 57.599 1.00 21.88  ? 157  ALA A CB  1 
ATOM   1217 N N   . LEU A 1 158 ? -9.508  48.000 57.785 1.00 26.11  ? 158  LEU A N   1 
ATOM   1218 C CA  . LEU A 1 158 ? -10.001 46.665 57.949 1.00 28.57  ? 158  LEU A CA  1 
ATOM   1219 C C   . LEU A 1 158 ? -9.934  45.934 56.636 1.00 31.35  ? 158  LEU A C   1 
ATOM   1220 O O   . LEU A 1 158 ? -10.920 45.732 55.958 1.00 31.27  ? 158  LEU A O   1 
ATOM   1221 C CB  . LEU A 1 158 ? -11.418 46.734 58.458 1.00 28.45  ? 158  LEU A CB  1 
ATOM   1222 C CG  . LEU A 1 158 ? -11.573 47.069 59.930 1.00 26.93  ? 158  LEU A CG  1 
ATOM   1223 C CD1 . LEU A 1 158 ? -12.990 46.944 60.189 1.00 21.68  ? 158  LEU A CD1 1 
ATOM   1224 C CD2 . LEU A 1 158 ? -10.726 46.089 60.803 1.00 28.45  ? 158  LEU A CD2 1 
ATOM   1225 N N   . HIS A 1 159 ? -8.731  45.492 56.332 1.00 35.16  ? 159  HIS A N   1 
ATOM   1226 C CA  . HIS A 1 159 ? -8.353  44.970 55.042 1.00 38.27  ? 159  HIS A CA  1 
ATOM   1227 C C   . HIS A 1 159 ? -9.386  44.349 54.033 1.00 40.11  ? 159  HIS A C   1 
ATOM   1228 O O   . HIS A 1 159 ? -9.614  44.885 52.871 1.00 40.55  ? 159  HIS A O   1 
ATOM   1229 C CB  . HIS A 1 159 ? -7.161  44.068 55.162 1.00 37.80  ? 159  HIS A CB  1 
ATOM   1230 C CG  . HIS A 1 159 ? -6.519  43.872 53.839 1.00 42.13  ? 159  HIS A CG  1 
ATOM   1231 N ND1 . HIS A 1 159 ? -6.334  44.929 52.959 1.00 43.71  ? 159  HIS A ND1 1 
ATOM   1232 C CD2 . HIS A 1 159 ? -6.072  42.759 53.203 1.00 45.71  ? 159  HIS A CD2 1 
ATOM   1233 C CE1 . HIS A 1 159 ? -5.752  44.486 51.860 1.00 45.56  ? 159  HIS A CE1 1 
ATOM   1234 N NE2 . HIS A 1 159 ? -5.572  43.175 51.986 1.00 47.90  ? 159  HIS A NE2 1 
ATOM   1235 N N   . GLY A 1 160 ? -9.975  43.202 54.423 1.00 41.11  ? 160  GLY A N   1 
ATOM   1236 C CA  . GLY A 1 160 ? -10.893 42.461 53.493 1.00 40.94  ? 160  GLY A CA  1 
ATOM   1237 C C   . GLY A 1 160 ? -11.985 43.322 52.853 1.00 40.66  ? 160  GLY A C   1 
ATOM   1238 O O   . GLY A 1 160 ? -12.514 43.019 51.789 1.00 40.42  ? 160  GLY A O   1 
ATOM   1239 N N   . SER A 1 161 ? -12.277 44.440 53.495 1.00 40.68  ? 161  SER A N   1 
ATOM   1240 C CA  . SER A 1 161 ? -13.566 45.023 53.418 1.00 40.46  ? 161  SER A CA  1 
ATOM   1241 C C   . SER A 1 161 ? -13.508 46.266 52.609 1.00 40.63  ? 161  SER A C   1 
ATOM   1242 O O   . SER A 1 161 ? -12.497 46.909 52.563 1.00 40.68  ? 161  SER A O   1 
ATOM   1243 C CB  . SER A 1 161 ? -13.993 45.321 54.822 1.00 40.10  ? 161  SER A CB  1 
ATOM   1244 O OG  . SER A 1 161 ? -14.531 46.594 54.828 1.00 40.15  ? 161  SER A OG  1 
ATOM   1245 N N   . GLN A 1 162 ? -14.607 46.595 51.960 1.00 41.53  ? 162  GLN A N   1 
ATOM   1246 C CA  . GLN A 1 162 ? -14.633 47.729 51.059 1.00 43.02  ? 162  GLN A CA  1 
ATOM   1247 C C   . GLN A 1 162 ? -15.125 48.908 51.842 1.00 41.40  ? 162  GLN A C   1 
ATOM   1248 O O   . GLN A 1 162 ? -15.089 50.055 51.421 1.00 42.20  ? 162  GLN A O   1 
ATOM   1249 C CB  . GLN A 1 162 ? -15.589 47.458 49.872 1.00 44.89  ? 162  GLN A CB  1 
ATOM   1250 C CG  . GLN A 1 162 ? -15.041 46.536 48.703 1.00 53.93  ? 162  GLN A CG  1 
ATOM   1251 C CD  . GLN A 1 162 ? -13.502 46.831 48.267 1.00 65.89  ? 162  GLN A CD  1 
ATOM   1252 O OE1 . GLN A 1 162 ? -13.027 48.008 48.236 1.00 70.89  ? 162  GLN A OE1 1 
ATOM   1253 N NE2 . GLN A 1 162 ? -12.751 45.743 47.932 1.00 67.18  ? 162  GLN A NE2 1 
ATOM   1254 N N   . GLU A 1 163 ? -15.620 48.628 53.014 1.00 39.72  ? 163  GLU A N   1 
ATOM   1255 C CA  . GLU A 1 163 ? -16.206 49.695 53.791 1.00 38.21  ? 163  GLU A CA  1 
ATOM   1256 C C   . GLU A 1 163 ? -15.168 50.620 54.462 1.00 35.32  ? 163  GLU A C   1 
ATOM   1257 O O   . GLU A 1 163 ? -15.413 51.804 54.606 1.00 35.63  ? 163  GLU A O   1 
ATOM   1258 C CB  . GLU A 1 163 ? -17.237 49.109 54.788 1.00 39.40  ? 163  GLU A CB  1 
ATOM   1259 C CG  . GLU A 1 163 ? -18.587 48.723 54.122 1.00 43.90  ? 163  GLU A CG  1 
ATOM   1260 C CD  . GLU A 1 163 ? -19.204 49.928 53.323 1.00 50.44  ? 163  GLU A CD  1 
ATOM   1261 O OE1 . GLU A 1 163 ? -19.067 51.141 53.650 1.00 49.68  ? 163  GLU A OE1 1 
ATOM   1262 O OE2 . GLU A 1 163 ? -19.832 49.650 52.298 1.00 57.73  ? 163  GLU A OE2 1 
ATOM   1263 N N   . ALA A 1 164 ? -14.017 50.080 54.839 1.00 31.22  ? 164  ALA A N   1 
ATOM   1264 C CA  . ALA A 1 164 ? -13.000 50.827 55.528 1.00 28.44  ? 164  ALA A CA  1 
ATOM   1265 C C   . ALA A 1 164 ? -11.703 50.118 55.179 1.00 26.72  ? 164  ALA A C   1 
ATOM   1266 O O   . ALA A 1 164 ? -11.164 49.340 56.005 1.00 27.19  ? 164  ALA A O   1 
ATOM   1267 C CB  . ALA A 1 164 ? -13.234 50.831 57.001 1.00 27.49  ? 164  ALA A CB  1 
ATOM   1268 N N   . PRO A 1 165 ? -11.208 50.371 53.940 1.00 24.19  ? 165  PRO A N   1 
ATOM   1269 C CA  . PRO A 1 165 ? -10.154 49.578 53.349 1.00 21.51  ? 165  PRO A CA  1 
ATOM   1270 C C   . PRO A 1 165 ? -8.789  49.959 53.779 1.00 20.05  ? 165  PRO A C   1 
ATOM   1271 O O   . PRO A 1 165 ? -7.906  49.162 53.566 1.00 19.98  ? 165  PRO A O   1 
ATOM   1272 C CB  . PRO A 1 165 ? -10.273 49.870 51.845 1.00 20.60  ? 165  PRO A CB  1 
ATOM   1273 C CG  . PRO A 1 165 ? -10.818 51.176 51.755 1.00 22.54  ? 165  PRO A CG  1 
ATOM   1274 C CD  . PRO A 1 165 ? -11.658 51.431 53.013 1.00 23.86  ? 165  PRO A CD  1 
ATOM   1275 N N   . GLY A 1 166 ? -8.585  51.161 54.341 1.00 19.10  ? 166  GLY A N   1 
ATOM   1276 C CA  . GLY A 1 166 ? -7.201  51.643 54.592 1.00 15.95  ? 166  GLY A CA  1 
ATOM   1277 C C   . GLY A 1 166 ? -6.796  52.735 53.613 1.00 14.51  ? 166  GLY A C   1 
ATOM   1278 O O   . GLY A 1 166 ? -7.375  52.806 52.552 1.00 14.19  ? 166  GLY A O   1 
ATOM   1279 N N   . ASN A 1 167 ? -5.879  53.628 54.033 1.00 13.01  ? 167  ASN A N   1 
ATOM   1280 C CA  . ASN A 1 167 ? -5.051  54.503 53.197 1.00 11.80  ? 167  ASN A CA  1 
ATOM   1281 C C   . ASN A 1 167 ? -5.855  55.595 52.586 1.00 13.22  ? 167  ASN A C   1 
ATOM   1282 O O   . ASN A 1 167 ? -5.483  56.322 51.655 1.00 14.83  ? 167  ASN A O   1 
ATOM   1283 C CB  . ASN A 1 167 ? -4.319  53.727 52.168 1.00 9.16   ? 167  ASN A CB  1 
ATOM   1284 C CG  . ASN A 1 167 ? -3.279  52.872 52.762 1.00 10.84  ? 167  ASN A CG  1 
ATOM   1285 O OD1 . ASN A 1 167 ? -2.668  53.179 53.826 1.00 5.58   ? 167  ASN A OD1 1 
ATOM   1286 N ND2 . ASN A 1 167 ? -3.026  51.749 52.079 1.00 14.66  ? 167  ASN A ND2 1 
ATOM   1287 N N   . VAL A 1 168 ? -7.007  55.754 53.163 1.00 14.45  ? 168  VAL A N   1 
ATOM   1288 C CA  . VAL A 1 168 ? -8.029  56.578 52.556 1.00 14.27  ? 168  VAL A CA  1 
ATOM   1289 C C   . VAL A 1 168 ? -7.619  58.046 52.570 1.00 13.74  ? 168  VAL A C   1 
ATOM   1290 O O   . VAL A 1 168 ? -7.870  58.702 51.622 1.00 14.69  ? 168  VAL A O   1 
ATOM   1291 C CB  . VAL A 1 168 ? -9.330  56.240 53.302 1.00 15.21  ? 168  VAL A CB  1 
ATOM   1292 C CG1 . VAL A 1 168 ? -10.086 57.468 53.766 1.00 15.75  ? 168  VAL A CG1 1 
ATOM   1293 C CG2 . VAL A 1 168 ? -10.117 55.153 52.531 1.00 12.48  ? 168  VAL A CG2 1 
ATOM   1294 N N   . GLY A 1 169 ? -6.924  58.518 53.613 1.00 13.90  ? 169  GLY A N   1 
ATOM   1295 C CA  . GLY A 1 169 ? -6.381  59.881 53.710 1.00 12.81  ? 169  GLY A CA  1 
ATOM   1296 C C   . GLY A 1 169 ? -5.341  60.096 52.636 1.00 13.43  ? 169  GLY A C   1 
ATOM   1297 O O   . GLY A 1 169 ? -5.221  61.183 51.979 1.00 12.80  ? 169  GLY A O   1 
ATOM   1298 N N   . LEU A 1 170 ? -4.585  59.015 52.445 1.00 12.57  ? 170  LEU A N   1 
ATOM   1299 C CA  . LEU A 1 170 ? -3.666  58.933 51.343 1.00 10.85  ? 170  LEU A CA  1 
ATOM   1300 C C   . LEU A 1 170 ? -4.402  59.084 49.969 1.00 10.57  ? 170  LEU A C   1 
ATOM   1301 O O   . LEU A 1 170 ? -3.918  59.808 49.056 1.00 9.64   ? 170  LEU A O   1 
ATOM   1302 C CB  . LEU A 1 170 ? -2.926  57.617 51.529 1.00 10.55  ? 170  LEU A CB  1 
ATOM   1303 C CG  . LEU A 1 170 ? -1.433  57.626 51.435 1.00 6.43   ? 170  LEU A CG  1 
ATOM   1304 C CD1 . LEU A 1 170 ? -0.982  58.992 51.991 1.00 2.00   ? 170  LEU A CD1 1 
ATOM   1305 C CD2 . LEU A 1 170 ? -0.923  56.306 52.122 1.00 2.00   ? 170  LEU A CD2 1 
ATOM   1306 N N   . LEU A 1 171 ? -5.580  58.464 49.846 1.00 9.65   ? 171  LEU A N   1 
ATOM   1307 C CA  . LEU A 1 171 ? -6.411  58.712 48.650 1.00 11.34  ? 171  LEU A CA  1 
ATOM   1308 C C   . LEU A 1 171 ? -6.932  60.169 48.501 1.00 12.47  ? 171  LEU A C   1 
ATOM   1309 O O   . LEU A 1 171 ? -6.741  60.769 47.429 1.00 13.45  ? 171  LEU A O   1 
ATOM   1310 C CB  . LEU A 1 171 ? -7.527  57.650 48.447 1.00 11.82  ? 171  LEU A CB  1 
ATOM   1311 C CG  . LEU A 1 171 ? -7.014  56.154 48.232 1.00 9.62   ? 171  LEU A CG  1 
ATOM   1312 C CD1 . LEU A 1 171 ? -8.045  55.015 48.141 1.00 2.00   ? 171  LEU A CD1 1 
ATOM   1313 C CD2 . LEU A 1 171 ? -6.097  56.200 47.024 1.00 3.59   ? 171  LEU A CD2 1 
ATOM   1314 N N   . ASP A 1 172 ? -7.502  60.759 49.561 1.00 12.37  ? 172  ASP A N   1 
ATOM   1315 C CA  . ASP A 1 172 ? -7.805  62.174 49.570 1.00 12.31  ? 172  ASP A CA  1 
ATOM   1316 C C   . ASP A 1 172 ? -6.674  62.979 48.952 1.00 11.70  ? 172  ASP A C   1 
ATOM   1317 O O   . ASP A 1 172 ? -6.931  63.891 48.128 1.00 13.71  ? 172  ASP A O   1 
ATOM   1318 C CB  . ASP A 1 172 ? -7.976  62.725 50.974 1.00 14.40  ? 172  ASP A CB  1 
ATOM   1319 C CG  . ASP A 1 172 ? -9.080  62.025 51.800 1.00 18.02  ? 172  ASP A CG  1 
ATOM   1320 O OD1 . ASP A 1 172 ? -9.203  62.410 53.008 1.00 22.70  ? 172  ASP A OD1 1 
ATOM   1321 O OD2 . ASP A 1 172 ? -9.794  61.131 51.286 1.00 18.61  ? 172  ASP A OD2 1 
ATOM   1322 N N   . GLN A 1 173 ? -5.430  62.687 49.314 1.00 9.65   ? 173  GLN A N   1 
ATOM   1323 C CA  . GLN A 1 173 ? -4.308  63.501 48.828 1.00 7.99   ? 173  GLN A CA  1 
ATOM   1324 C C   . GLN A 1 173 ? -4.238  63.341 47.339 1.00 8.79   ? 173  GLN A C   1 
ATOM   1325 O O   . GLN A 1 173 ? -4.096  64.346 46.615 1.00 8.57   ? 173  GLN A O   1 
ATOM   1326 C CB  . GLN A 1 173 ? -3.004  63.067 49.455 1.00 7.85   ? 173  GLN A CB  1 
ATOM   1327 C CG  . GLN A 1 173 ? -2.750  63.572 50.860 1.00 6.29   ? 173  GLN A CG  1 
ATOM   1328 C CD  . GLN A 1 173 ? -1.535  62.906 51.484 1.00 11.04  ? 173  GLN A CD  1 
ATOM   1329 O OE1 . GLN A 1 173 ? -0.611  62.411 50.791 1.00 7.22   ? 173  GLN A OE1 1 
ATOM   1330 N NE2 . GLN A 1 173 ? -1.525  62.886 52.816 1.00 13.21  ? 173  GLN A NE2 1 
ATOM   1331 N N   . ARG A 1 174 ? -4.436  62.095 46.853 1.00 9.14   ? 174  ARG A N   1 
ATOM   1332 C CA  . ARG A 1 174 ? -4.286  61.814 45.398 1.00 9.90   ? 174  ARG A CA  1 
ATOM   1333 C C   . ARG A 1 174 ? -5.374  62.499 44.579 1.00 11.70  ? 174  ARG A C   1 
ATOM   1334 O O   . ARG A 1 174 ? -5.109  63.081 43.498 1.00 10.49  ? 174  ARG A O   1 
ATOM   1335 C CB  . ARG A 1 174 ? -4.416  60.337 45.162 1.00 10.08  ? 174  ARG A CB  1 
ATOM   1336 C CG  . ARG A 1 174 ? -4.070  59.875 43.791 1.00 7.93   ? 174  ARG A CG  1 
ATOM   1337 C CD  . ARG A 1 174 ? -4.452  58.485 43.661 1.00 7.16   ? 174  ARG A CD  1 
ATOM   1338 N NE  . ARG A 1 174 ? -3.334  57.573 43.852 1.00 13.86  ? 174  ARG A NE  1 
ATOM   1339 C CZ  . ARG A 1 174 ? -3.465  56.228 43.951 1.00 17.57  ? 174  ARG A CZ  1 
ATOM   1340 N NH1 . ARG A 1 174 ? -2.398  55.455 44.066 1.00 20.10  ? 174  ARG A NH1 1 
ATOM   1341 N NH2 . ARG A 1 174 ? -4.660  55.630 43.909 1.00 15.34  ? 174  ARG A NH2 1 
ATOM   1342 N N   . MET A 1 175 ? -6.605  62.432 45.131 1.00 12.81  ? 175  MET A N   1 
ATOM   1343 C CA  . MET A 1 175 ? -7.770  63.092 44.574 1.00 13.14  ? 175  MET A CA  1 
ATOM   1344 C C   . MET A 1 175 ? -7.595  64.590 44.405 1.00 12.94  ? 175  MET A C   1 
ATOM   1345 O O   . MET A 1 175 ? -8.018  65.146 43.388 1.00 11.93  ? 175  MET A O   1 
ATOM   1346 C CB  . MET A 1 175 ? -8.925  62.827 45.465 1.00 13.42  ? 175  MET A CB  1 
ATOM   1347 C CG  . MET A 1 175 ? -10.210 63.477 44.944 1.00 17.88  ? 175  MET A CG  1 
ATOM   1348 S SD  . MET A 1 175 ? -11.418 62.205 44.607 1.00 24.71  ? 175  MET A SD  1 
ATOM   1349 C CE  . MET A 1 175 ? -10.484 61.599 43.100 1.00 18.80  ? 175  MET A CE  1 
ATOM   1350 N N   . ALA A 1 176 ? -6.955  65.238 45.386 1.00 12.70  ? 176  ALA A N   1 
ATOM   1351 C CA  . ALA A 1 176 ? -6.624  66.634 45.197 1.00 12.42  ? 176  ALA A CA  1 
ATOM   1352 C C   . ALA A 1 176 ? -5.530  66.768 44.171 1.00 11.75  ? 176  ALA A C   1 
ATOM   1353 O O   . ALA A 1 176 ? -5.545  67.654 43.333 1.00 10.49  ? 176  ALA A O   1 
ATOM   1354 C CB  . ALA A 1 176 ? -6.214  67.238 46.441 1.00 12.65  ? 176  ALA A CB  1 
ATOM   1355 N N   . LEU A 1 177 ? -4.584  65.864 44.198 1.00 12.48  ? 177  LEU A N   1 
ATOM   1356 C CA  . LEU A 1 177 ? -3.551  65.943 43.146 1.00 14.72  ? 177  LEU A CA  1 
ATOM   1357 C C   . LEU A 1 177 ? -4.152  65.772 41.751 1.00 16.48  ? 177  LEU A C   1 
ATOM   1358 O O   . LEU A 1 177 ? -3.719  66.418 40.805 1.00 17.75  ? 177  LEU A O   1 
ATOM   1359 C CB  . LEU A 1 177 ? -2.444  64.907 43.345 1.00 14.31  ? 177  LEU A CB  1 
ATOM   1360 C CG  . LEU A 1 177 ? -1.073  65.292 43.876 1.00 11.42  ? 177  LEU A CG  1 
ATOM   1361 C CD1 . LEU A 1 177 ? -0.916  66.699 44.561 1.00 8.67   ? 177  LEU A CD1 1 
ATOM   1362 C CD2 . LEU A 1 177 ? -0.612  64.158 44.717 1.00 6.97   ? 177  LEU A CD2 1 
ATOM   1363 N N   . GLN A 1 178 ? -5.178  64.920 41.626 1.00 18.53  ? 178  GLN A N   1 
ATOM   1364 C CA  . GLN A 1 178 ? -5.980  64.845 40.372 1.00 17.89  ? 178  GLN A CA  1 
ATOM   1365 C C   . GLN A 1 178 ? -6.595  66.194 40.000 1.00 16.50  ? 178  GLN A C   1 
ATOM   1366 O O   . GLN A 1 178 ? -6.348  66.690 38.917 1.00 15.59  ? 178  GLN A O   1 
ATOM   1367 C CB  . GLN A 1 178 ? -7.093  63.791 40.488 1.00 18.65  ? 178  GLN A CB  1 
ATOM   1368 C CG  . GLN A 1 178 ? -7.805  63.322 39.152 1.00 20.47  ? 178  GLN A CG  1 
ATOM   1369 C CD  . GLN A 1 178 ? -6.824  62.917 38.079 1.00 25.54  ? 178  GLN A CD  1 
ATOM   1370 O OE1 . GLN A 1 178 ? -6.292  61.811 38.089 1.00 26.36  ? 178  GLN A OE1 1 
ATOM   1371 N NE2 . GLN A 1 178 ? -6.549  63.843 37.158 1.00 29.96  ? 178  GLN A NE2 1 
ATOM   1372 N N   . TRP A 1 179 ? -7.376  66.758 40.905 1.00 14.50  ? 179  TRP A N   1 
ATOM   1373 C CA  . TRP A 1 179 ? -7.974  68.018 40.628 1.00 15.51  ? 179  TRP A CA  1 
ATOM   1374 C C   . TRP A 1 179 ? -7.015  69.212 40.273 1.00 17.35  ? 179  TRP A C   1 
ATOM   1375 O O   . TRP A 1 179 ? -7.326  70.064 39.430 1.00 15.70  ? 179  TRP A O   1 
ATOM   1376 C CB  . TRP A 1 179 ? -8.842  68.381 41.787 1.00 14.35  ? 179  TRP A CB  1 
ATOM   1377 C CG  . TRP A 1 179 ? -9.800  69.470 41.473 1.00 12.58  ? 179  TRP A CG  1 
ATOM   1378 C CD1 . TRP A 1 179 ? -11.114 69.340 41.231 1.00 11.01  ? 179  TRP A CD1 1 
ATOM   1379 C CD2 . TRP A 1 179 ? -9.515  70.877 41.433 1.00 14.10  ? 179  TRP A CD2 1 
ATOM   1380 N NE1 . TRP A 1 179 ? -11.706 70.567 41.075 1.00 12.69  ? 179  TRP A NE1 1 
ATOM   1381 C CE2 . TRP A 1 179 ? -10.740 71.538 41.177 1.00 16.73  ? 179  TRP A CE2 1 
ATOM   1382 C CE3 . TRP A 1 179 ? -8.352  71.652 41.629 1.00 9.09   ? 179  TRP A CE3 1 
ATOM   1383 C CZ2 . TRP A 1 179 ? -10.833 72.981 41.065 1.00 18.29  ? 179  TRP A CZ2 1 
ATOM   1384 C CZ3 . TRP A 1 179 ? -8.452  73.106 41.502 1.00 12.37  ? 179  TRP A CZ3 1 
ATOM   1385 C CH2 . TRP A 1 179 ? -9.652  73.733 41.207 1.00 13.31  ? 179  TRP A CH2 1 
ATOM   1386 N N   . VAL A 1 180 ? -5.864  69.274 40.935 1.00 19.12  ? 180  VAL A N   1 
ATOM   1387 C CA  . VAL A 1 180 ? -4.835  70.175 40.505 1.00 20.89  ? 180  VAL A CA  1 
ATOM   1388 C C   . VAL A 1 180 ? -4.389  69.903 39.037 1.00 21.76  ? 180  VAL A C   1 
ATOM   1389 O O   . VAL A 1 180 ? -4.350  70.825 38.200 1.00 22.26  ? 180  VAL A O   1 
ATOM   1390 C CB  . VAL A 1 180 ? -3.644  70.063 41.454 1.00 21.62  ? 180  VAL A CB  1 
ATOM   1391 C CG1 . VAL A 1 180 ? -2.354  70.865 40.925 1.00 20.14  ? 180  VAL A CG1 1 
ATOM   1392 C CG2 . VAL A 1 180 ? -4.080  70.556 42.796 1.00 23.02  ? 180  VAL A CG2 1 
ATOM   1393 N N   . HIS A 1 181 ? -4.022  68.651 38.749 1.00 21.82  ? 181  HIS A N   1 
ATOM   1394 C CA  . HIS A 1 181 ? -3.680  68.220 37.405 1.00 21.53  ? 181  HIS A CA  1 
ATOM   1395 C C   . HIS A 1 181 ? -4.610  68.747 36.306 1.00 21.43  ? 181  HIS A C   1 
ATOM   1396 O O   . HIS A 1 181 ? -4.147  69.235 35.280 1.00 22.33  ? 181  HIS A O   1 
ATOM   1397 C CB  . HIS A 1 181 ? -3.785  66.715 37.347 1.00 21.85  ? 181  HIS A CB  1 
ATOM   1398 C CG  . HIS A 1 181 ? -3.202  66.157 36.097 1.00 23.86  ? 181  HIS A CG  1 
ATOM   1399 N ND1 . HIS A 1 181 ? -1.834  66.191 35.836 1.00 27.41  ? 181  HIS A ND1 1 
ATOM   1400 C CD2 . HIS A 1 181 ? -3.791  65.622 35.002 1.00 22.32  ? 181  HIS A CD2 1 
ATOM   1401 C CE1 . HIS A 1 181 ? -1.613  65.651 34.650 1.00 25.22  ? 181  HIS A CE1 1 
ATOM   1402 N NE2 . HIS A 1 181 ? -2.785  65.320 34.118 1.00 22.11  ? 181  HIS A NE2 1 
ATOM   1403 N N   . ASP A 1 182 ? -5.914  68.651 36.551 1.00 20.58  ? 182  ASP A N   1 
ATOM   1404 C CA  . ASP A 1 182 ? -6.948  68.935 35.598 1.00 20.10  ? 182  ASP A CA  1 
ATOM   1405 C C   . ASP A 1 182 ? -7.404  70.384 35.566 1.00 20.14  ? 182  ASP A C   1 
ATOM   1406 O O   . ASP A 1 182 ? -8.123  70.732 34.649 1.00 20.30  ? 182  ASP A O   1 
ATOM   1407 C CB  . ASP A 1 182 ? -8.195  68.069 35.887 1.00 20.23  ? 182  ASP A CB  1 
ATOM   1408 C CG  . ASP A 1 182 ? -7.935  66.605 35.677 1.00 20.14  ? 182  ASP A CG  1 
ATOM   1409 O OD1 . ASP A 1 182 ? -8.577  65.809 36.385 1.00 16.64  ? 182  ASP A OD1 1 
ATOM   1410 O OD2 . ASP A 1 182 ? -7.042  66.265 34.837 1.00 18.74  ? 182  ASP A OD2 1 
ATOM   1411 N N   . ASN A 1 183 ? -7.056  71.218 36.540 1.00 18.71  ? 183  ASN A N   1 
ATOM   1412 C CA  . ASN A 1 183 ? -7.658  72.493 36.574 1.00 18.15  ? 183  ASN A CA  1 
ATOM   1413 C C   . ASN A 1 183 ? -6.685  73.613 36.855 1.00 19.55  ? 183  ASN A C   1 
ATOM   1414 O O   . ASN A 1 183 ? -6.989  74.829 36.587 1.00 21.42  ? 183  ASN A O   1 
ATOM   1415 C CB  . ASN A 1 183 ? -8.747  72.515 37.598 1.00 17.98  ? 183  ASN A CB  1 
ATOM   1416 C CG  . ASN A 1 183 ? -9.894  71.652 37.226 1.00 19.72  ? 183  ASN A CG  1 
ATOM   1417 O OD1 . ASN A 1 183 ? -10.843 72.047 36.487 1.00 19.10  ? 183  ASN A OD1 1 
ATOM   1418 N ND2 . ASN A 1 183 ? -9.853  70.448 37.744 1.00 24.59  ? 183  ASN A ND2 1 
ATOM   1419 N N   . ILE A 1 184 ? -5.504  73.265 37.350 1.00 18.27  ? 184  ILE A N   1 
ATOM   1420 C CA  . ILE A 1 184 ? -4.568  74.311 37.704 1.00 16.85  ? 184  ILE A CA  1 
ATOM   1421 C C   . ILE A 1 184 ? -4.184  75.274 36.538 1.00 18.32  ? 184  ILE A C   1 
ATOM   1422 O O   . ILE A 1 184 ? -3.798  76.430 36.779 1.00 19.27  ? 184  ILE A O   1 
ATOM   1423 C CB  . ILE A 1 184 ? -3.328  73.724 38.305 1.00 15.94  ? 184  ILE A CB  1 
ATOM   1424 C CG1 . ILE A 1 184 ? -2.684  74.773 39.199 1.00 10.36  ? 184  ILE A CG1 1 
ATOM   1425 C CG2 . ILE A 1 184 ? -2.497  73.051 37.215 1.00 13.43  ? 184  ILE A CG2 1 
ATOM   1426 C CD1 . ILE A 1 184 ? -3.663  75.155 40.296 1.00 6.15   ? 184  ILE A CD1 1 
ATOM   1427 N N   . GLN A 1 185 ? -4.290  74.797 35.300 1.00 18.85  ? 185  GLN A N   1 
ATOM   1428 C CA  . GLN A 1 185 ? -4.067  75.602 34.079 1.00 19.49  ? 185  GLN A CA  1 
ATOM   1429 C C   . GLN A 1 185 ? -4.997  76.831 34.053 1.00 19.28  ? 185  GLN A C   1 
ATOM   1430 O O   . GLN A 1 185 ? -4.593  77.904 33.515 1.00 17.91  ? 185  GLN A O   1 
ATOM   1431 C CB  . GLN A 1 185 ? -4.280  74.762 32.801 1.00 18.93  ? 185  GLN A CB  1 
ATOM   1432 C CG  . GLN A 1 185 ? -5.694  74.180 32.783 1.00 22.10  ? 185  GLN A CG  1 
ATOM   1433 C CD  . GLN A 1 185 ? -5.963  73.306 31.570 1.00 29.43  ? 185  GLN A CD  1 
ATOM   1434 O OE1 . GLN A 1 185 ? -6.280  72.119 31.665 1.00 30.55  ? 185  GLN A OE1 1 
ATOM   1435 N NE2 . GLN A 1 185 ? -5.822  73.891 30.412 1.00 34.78  ? 185  GLN A NE2 1 
ATOM   1436 N N   . PHE A 1 186 ? -6.212  76.709 34.619 1.00 18.74  ? 186  PHE A N   1 
ATOM   1437 C CA  . PHE A 1 186 ? -7.102  77.892 34.561 1.00 20.01  ? 186  PHE A CA  1 
ATOM   1438 C C   . PHE A 1 186 ? -6.746  78.997 35.564 1.00 20.19  ? 186  PHE A C   1 
ATOM   1439 O O   . PHE A 1 186 ? -7.456  80.032 35.650 1.00 22.20  ? 186  PHE A O   1 
ATOM   1440 C CB  . PHE A 1 186 ? -8.575  77.546 34.661 1.00 19.24  ? 186  PHE A CB  1 
ATOM   1441 C CG  . PHE A 1 186 ? -8.955  76.388 33.825 1.00 23.41  ? 186  PHE A CG  1 
ATOM   1442 C CD1 . PHE A 1 186 ? -9.332  75.158 34.426 1.00 26.13  ? 186  PHE A CD1 1 
ATOM   1443 C CD2 . PHE A 1 186 ? -8.930  76.464 32.434 1.00 22.81  ? 186  PHE A CD2 1 
ATOM   1444 C CE1 . PHE A 1 186 ? -9.746  74.051 33.644 1.00 21.77  ? 186  PHE A CE1 1 
ATOM   1445 C CE2 . PHE A 1 186 ? -9.344  75.353 31.659 1.00 20.93  ? 186  PHE A CE2 1 
ATOM   1446 C CZ  . PHE A 1 186 ? -9.743  74.159 32.273 1.00 20.73  ? 186  PHE A CZ  1 
ATOM   1447 N N   . PHE A 1 187 ? -5.692  78.770 36.343 1.00 18.78  ? 187  PHE A N   1 
ATOM   1448 C CA  . PHE A 1 187 ? -5.288  79.703 37.320 1.00 17.91  ? 187  PHE A CA  1 
ATOM   1449 C C   . PHE A 1 187 ? -3.926  80.082 36.841 1.00 19.48  ? 187  PHE A C   1 
ATOM   1450 O O   . PHE A 1 187 ? -3.146  80.683 37.547 1.00 22.33  ? 187  PHE A O   1 
ATOM   1451 C CB  . PHE A 1 187 ? -5.153  79.017 38.639 1.00 15.02  ? 187  PHE A CB  1 
ATOM   1452 C CG  . PHE A 1 187 ? -6.415  78.523 39.169 1.00 14.73  ? 187  PHE A CG  1 
ATOM   1453 C CD1 . PHE A 1 187 ? -6.848  77.231 38.893 1.00 13.35  ? 187  PHE A CD1 1 
ATOM   1454 C CD2 . PHE A 1 187 ? -7.194  79.326 40.015 1.00 16.52  ? 187  PHE A CD2 1 
ATOM   1455 C CE1 . PHE A 1 187 ? -8.062  76.743 39.446 1.00 11.63  ? 187  PHE A CE1 1 
ATOM   1456 C CE2 . PHE A 1 187 ? -8.392  78.864 40.573 1.00 11.38  ? 187  PHE A CE2 1 
ATOM   1457 C CZ  . PHE A 1 187 ? -8.837  77.595 40.260 1.00 10.71  ? 187  PHE A CZ  1 
ATOM   1458 N N   . GLY A 1 188 ? -3.541  79.712 35.659 1.00 18.93  ? 188  GLY A N   1 
ATOM   1459 C CA  . GLY A 1 188 ? -2.197  80.112 35.352 1.00 18.80  ? 188  GLY A CA  1 
ATOM   1460 C C   . GLY A 1 188 ? -1.100  79.135 35.680 1.00 19.12  ? 188  GLY A C   1 
ATOM   1461 O O   . GLY A 1 188 ? 0.082   79.429 35.437 1.00 19.28  ? 188  GLY A O   1 
ATOM   1462 N N   . GLY A 1 189 ? -1.456  77.979 36.223 1.00 19.45  ? 189  GLY A N   1 
ATOM   1463 C CA  . GLY A 1 189 ? -0.410  77.004 36.563 1.00 20.41  ? 189  GLY A CA  1 
ATOM   1464 C C   . GLY A 1 189 ? -0.145  75.988 35.473 1.00 21.07  ? 189  GLY A C   1 
ATOM   1465 O O   . GLY A 1 189 ? -1.108  75.473 34.829 1.00 20.32  ? 189  GLY A O   1 
ATOM   1466 N N   . ASP A 1 190 ? 1.145   75.683 35.277 1.00 21.07  ? 190  ASP A N   1 
ATOM   1467 C CA  . ASP A 1 190 ? 1.531   74.702 34.280 1.00 21.67  ? 190  ASP A CA  1 
ATOM   1468 C C   . ASP A 1 190 ? 1.407   73.265 34.855 1.00 21.81  ? 190  ASP A C   1 
ATOM   1469 O O   . ASP A 1 190 ? 2.218   72.858 35.668 1.00 23.46  ? 190  ASP A O   1 
ATOM   1470 C CB  . ASP A 1 190 ? 2.961   75.007 33.819 1.00 20.94  ? 190  ASP A CB  1 
ATOM   1471 C CG  . ASP A 1 190 ? 3.636   73.809 33.055 1.00 22.53  ? 190  ASP A CG  1 
ATOM   1472 O OD1 . ASP A 1 190 ? 4.850   73.737 33.207 1.00 22.63  ? 190  ASP A OD1 1 
ATOM   1473 O OD2 . ASP A 1 190 ? 3.026   72.961 32.305 1.00 21.92  ? 190  ASP A OD2 1 
ATOM   1474 N N   . PRO A 1 191 ? 0.462   72.458 34.405 1.00 20.98  ? 191  PRO A N   1 
ATOM   1475 C CA  . PRO A 1 191 ? 0.399   71.168 35.084 1.00 22.50  ? 191  PRO A CA  1 
ATOM   1476 C C   . PRO A 1 191 ? 1.549   70.148 34.749 1.00 24.66  ? 191  PRO A C   1 
ATOM   1477 O O   . PRO A 1 191 ? 1.590   69.028 35.285 1.00 24.87  ? 191  PRO A O   1 
ATOM   1478 C CB  . PRO A 1 191 ? -0.978  70.631 34.661 1.00 21.97  ? 191  PRO A CB  1 
ATOM   1479 C CG  . PRO A 1 191 ? -1.205  71.207 33.446 1.00 19.92  ? 191  PRO A CG  1 
ATOM   1480 C CD  . PRO A 1 191 ? -0.516  72.554 33.351 1.00 19.83  ? 191  PRO A CD  1 
ATOM   1481 N N   . LYS A 1 192 ? 2.469   70.540 33.876 1.00 26.11  ? 192  LYS A N   1 
ATOM   1482 C CA  . LYS A 1 192 ? 3.576   69.699 33.492 1.00 28.71  ? 192  LYS A CA  1 
ATOM   1483 C C   . LYS A 1 192 ? 4.568   69.749 34.637 1.00 27.13  ? 192  LYS A C   1 
ATOM   1484 O O   . LYS A 1 192 ? 5.599   69.081 34.658 1.00 27.11  ? 192  LYS A O   1 
ATOM   1485 C CB  . LYS A 1 192 ? 4.196   70.247 32.182 1.00 28.08  ? 192  LYS A CB  1 
ATOM   1486 C CG  . LYS A 1 192 ? 3.627   69.453 30.922 1.00 34.82  ? 192  LYS A CG  1 
ATOM   1487 C CD  . LYS A 1 192 ? 3.857   70.130 29.431 1.00 34.27  ? 192  LYS A CD  1 
ATOM   1488 C CE  . LYS A 1 192 ? 3.695   71.692 29.429 1.00 40.09  ? 192  LYS A CE  1 
ATOM   1489 N NZ  . LYS A 1 192 ? 5.025   72.338 29.514 1.00 38.68  ? 192  LYS A NZ  1 
ATOM   1490 N N   . THR A 1 193 ? 4.236   70.571 35.606 1.00 26.84  ? 193  THR A N   1 
ATOM   1491 C CA  . THR A 1 193 ? 5.264   71.122 36.481 1.00 25.99  ? 193  THR A CA  1 
ATOM   1492 C C   . THR A 1 193 ? 4.829   71.356 37.895 1.00 25.05  ? 193  THR A C   1 
ATOM   1493 O O   . THR A 1 193 ? 5.097   72.404 38.465 1.00 25.49  ? 193  THR A O   1 
ATOM   1494 C CB  . THR A 1 193 ? 5.887   72.341 35.835 1.00 25.81  ? 193  THR A CB  1 
ATOM   1495 O OG1 . THR A 1 193 ? 6.697   71.820 34.795 1.00 25.03  ? 193  THR A OG1 1 
ATOM   1496 C CG2 . THR A 1 193 ? 6.742   73.203 36.805 1.00 25.90  ? 193  THR A CG2 1 
ATOM   1497 N N   . VAL A 1 194 ? 4.164   70.348 38.447 1.00 23.79  ? 194  VAL A N   1 
ATOM   1498 C CA  . VAL A 1 194 ? 3.875   70.392 39.846 1.00 22.67  ? 194  VAL A CA  1 
ATOM   1499 C C   . VAL A 1 194 ? 4.872   69.567 40.628 1.00 22.65  ? 194  VAL A C   1 
ATOM   1500 O O   . VAL A 1 194 ? 5.349   68.495 40.172 1.00 21.97  ? 194  VAL A O   1 
ATOM   1501 C CB  . VAL A 1 194 ? 2.443   70.038 40.227 1.00 21.70  ? 194  VAL A CB  1 
ATOM   1502 C CG1 . VAL A 1 194 ? 1.535   70.626 39.245 1.00 20.54  ? 194  VAL A CG1 1 
ATOM   1503 C CG2 . VAL A 1 194 ? 2.308   68.622 40.274 1.00 19.99  ? 194  VAL A CG2 1 
ATOM   1504 N N   . THR A 1 195 ? 5.144   70.146 41.810 1.00 21.48  ? 195  THR A N   1 
ATOM   1505 C CA  . THR A 1 195 ? 6.068   69.705 42.842 1.00 19.20  ? 195  THR A CA  1 
ATOM   1506 C C   . THR A 1 195 ? 5.241   69.476 44.100 1.00 16.69  ? 195  THR A C   1 
ATOM   1507 O O   . THR A 1 195 ? 4.604   70.418 44.646 1.00 16.86  ? 195  THR A O   1 
ATOM   1508 C CB  . THR A 1 195 ? 7.113   70.792 43.011 1.00 19.01  ? 195  THR A CB  1 
ATOM   1509 O OG1 . THR A 1 195 ? 7.728   70.967 41.729 1.00 21.20  ? 195  THR A OG1 1 
ATOM   1510 C CG2 . THR A 1 195 ? 8.161   70.362 43.969 1.00 22.00  ? 195  THR A CG2 1 
ATOM   1511 N N   . ILE A 1 196 ? 5.165   68.230 44.534 1.00 13.50  ? 196  ILE A N   1 
ATOM   1512 C CA  . ILE A 1 196 ? 4.589   68.070 45.810 1.00 12.21  ? 196  ILE A CA  1 
ATOM   1513 C C   . ILE A 1 196 ? 5.693   68.186 46.877 1.00 13.06  ? 196  ILE A C   1 
ATOM   1514 O O   . ILE A 1 196 ? 6.814   67.666 46.696 1.00 13.00  ? 196  ILE A O   1 
ATOM   1515 C CB  . ILE A 1 196 ? 3.912   66.822 45.921 1.00 11.14  ? 196  ILE A CB  1 
ATOM   1516 C CG1 . ILE A 1 196 ? 4.801   65.705 45.469 1.00 11.68  ? 196  ILE A CG1 1 
ATOM   1517 C CG2 . ILE A 1 196 ? 2.639   66.847 45.150 1.00 11.69  ? 196  ILE A CG2 1 
ATOM   1518 C CD1 . ILE A 1 196 ? 4.083   64.339 45.721 1.00 10.94  ? 196  ILE A CD1 1 
ATOM   1519 N N   . PHE A 1 197 ? 5.391   68.911 47.958 1.00 12.38  ? 197  PHE A N   1 
ATOM   1520 C CA  . PHE A 1 197 ? 6.337   69.099 49.030 1.00 13.93  ? 197  PHE A CA  1 
ATOM   1521 C C   . PHE A 1 197 ? 5.661   69.102 50.399 1.00 15.15  ? 197  PHE A C   1 
ATOM   1522 O O   . PHE A 1 197 ? 4.579   69.668 50.512 1.00 17.19  ? 197  PHE A O   1 
ATOM   1523 C CB  . PHE A 1 197 ? 7.231   70.328 48.817 1.00 12.21  ? 197  PHE A CB  1 
ATOM   1524 C CG  . PHE A 1 197 ? 6.583   71.654 49.138 1.00 14.10  ? 197  PHE A CG  1 
ATOM   1525 C CD1 . PHE A 1 197 ? 5.378   72.079 48.485 1.00 12.54  ? 197  PHE A CD1 1 
ATOM   1526 C CD2 . PHE A 1 197 ? 7.220   72.562 50.022 1.00 12.95  ? 197  PHE A CD2 1 
ATOM   1527 C CE1 . PHE A 1 197 ? 4.840   73.364 48.739 1.00 9.98   ? 197  PHE A CE1 1 
ATOM   1528 C CE2 . PHE A 1 197 ? 6.671   73.873 50.268 1.00 9.48   ? 197  PHE A CE2 1 
ATOM   1529 C CZ  . PHE A 1 197 ? 5.486   74.275 49.654 1.00 8.48   ? 197  PHE A CZ  1 
ATOM   1530 N N   . GLY A 1 198 ? 6.291   68.458 51.415 1.00 15.22  ? 198  GLY A N   1 
ATOM   1531 C CA  . GLY A 1 198 ? 5.690   68.256 52.764 1.00 13.63  ? 198  GLY A CA  1 
ATOM   1532 C C   . GLY A 1 198 ? 6.641   67.984 53.922 1.00 12.84  ? 198  GLY A C   1 
ATOM   1533 O O   . GLY A 1 198 ? 7.829   67.699 53.713 1.00 12.81  ? 198  GLY A O   1 
ATOM   1534 N N   . GLU A 1 199 ? 6.107   68.024 55.147 1.00 11.18  ? 199  GLU A N   1 
ATOM   1535 C CA  . GLU A 1 199 ? 6.894   67.884 56.373 1.00 10.15  ? 199  GLU A CA  1 
ATOM   1536 C C   . GLU A 1 199 ? 6.412   66.735 57.294 1.00 9.49   ? 199  GLU A C   1 
ATOM   1537 O O   . GLU A 1 199 ? 5.235   66.534 57.444 1.00 7.43   ? 199  GLU A O   1 
ATOM   1538 C CB  . GLU A 1 199 ? 6.960   69.251 57.061 1.00 9.91   ? 199  GLU A CB  1 
ATOM   1539 C CG  . GLU A 1 199 ? 8.047   69.484 58.089 1.00 10.76  ? 199  GLU A CG  1 
ATOM   1540 C CD  . GLU A 1 199 ? 7.504   69.080 59.426 1.00 15.49  ? 199  GLU A CD  1 
ATOM   1541 O OE1 . GLU A 1 199 ? 8.339   68.814 60.312 1.00 11.97  ? 199  GLU A OE1 1 
ATOM   1542 O OE2 . GLU A 1 199 ? 6.224   68.976 59.565 1.00 18.19  ? 199  GLU A OE2 1 
ATOM   1543 N N   . SER A 1 200 ? 7.356   66.004 57.908 1.00 9.67   ? 200  SER A N   1 
ATOM   1544 C CA  . SER A 1 200 ? 7.048   64.754 58.649 1.00 11.09  ? 200  SER A CA  1 
ATOM   1545 C C   . SER A 1 200 ? 6.004   63.902 57.995 1.00 11.04  ? 200  SER A C   1 
ATOM   1546 O O   . SER A 1 200 ? 6.294   63.370 56.963 1.00 14.40  ? 200  SER A O   1 
ATOM   1547 C CB  . SER A 1 200 ? 6.756   64.866 60.152 1.00 10.47  ? 200  SER A CB  1 
ATOM   1548 O OG  . SER A 1 200 ? 6.097   66.027 60.404 1.00 12.65  ? 200  SER A OG  1 
ATOM   1549 N N   . ALA A 1 201 ? 4.831   63.721 58.552 1.00 9.63   ? 201  ALA A N   1 
ATOM   1550 C CA  . ALA A 1 201 ? 3.869   62.852 57.865 1.00 8.68   ? 201  ALA A CA  1 
ATOM   1551 C C   . ALA A 1 201 ? 3.680   63.298 56.385 1.00 8.25   ? 201  ALA A C   1 
ATOM   1552 O O   . ALA A 1 201 ? 3.516   62.454 55.466 1.00 6.79   ? 201  ALA A O   1 
ATOM   1553 C CB  . ALA A 1 201 ? 2.489   62.779 58.658 1.00 7.52   ? 201  ALA A CB  1 
ATOM   1554 N N   . GLY A 1 202 ? 3.701   64.627 56.184 1.00 8.86   ? 202  GLY A N   1 
ATOM   1555 C CA  . GLY A 1 202 ? 3.625   65.257 54.868 1.00 9.86   ? 202  GLY A CA  1 
ATOM   1556 C C   . GLY A 1 202 ? 4.809   64.789 53.982 1.00 10.95  ? 202  GLY A C   1 
ATOM   1557 O O   . GLY A 1 202 ? 4.572   64.230 52.892 1.00 11.74  ? 202  GLY A O   1 
ATOM   1558 N N   . GLY A 1 203 ? 6.061   64.991 54.417 1.00 9.99   ? 203  GLY A N   1 
ATOM   1559 C CA  . GLY A 1 203 ? 7.163   64.284 53.797 1.00 11.22  ? 203  GLY A CA  1 
ATOM   1560 C C   . GLY A 1 203 ? 6.976   62.761 53.560 1.00 12.10  ? 203  GLY A C   1 
ATOM   1561 O O   . GLY A 1 203 ? 7.149   62.255 52.444 1.00 12.70  ? 203  GLY A O   1 
ATOM   1562 N N   . ALA A 1 204 ? 6.650   61.994 54.589 1.00 11.54  ? 204  ALA A N   1 
ATOM   1563 C CA  . ALA A 1 204 ? 6.411   60.583 54.339 1.00 11.40  ? 204  ALA A CA  1 
ATOM   1564 C C   . ALA A 1 204 ? 5.339   60.380 53.217 1.00 10.46  ? 204  ALA A C   1 
ATOM   1565 O O   . ALA A 1 204 ? 5.492   59.504 52.347 1.00 11.19  ? 204  ALA A O   1 
ATOM   1566 C CB  . ALA A 1 204 ? 6.104   59.774 55.680 1.00 10.50  ? 204  ALA A CB  1 
ATOM   1567 N N   . SER A 1 205 ? 4.296   61.185 53.200 1.00 9.17   ? 205  SER A N   1 
ATOM   1568 C CA  . SER A 1 205 ? 3.282   60.991 52.145 1.00 8.93   ? 205  SER A CA  1 
ATOM   1569 C C   . SER A 1 205 ? 3.813   61.278 50.736 1.00 9.89   ? 205  SER A C   1 
ATOM   1570 O O   . SER A 1 205 ? 3.443   60.531 49.763 1.00 10.32  ? 205  SER A O   1 
ATOM   1571 C CB  . SER A 1 205 ? 1.970   61.785 52.361 1.00 7.86   ? 205  SER A CB  1 
ATOM   1572 O OG  . SER A 1 205 ? 1.677   61.839 53.698 1.00 2.57   ? 205  SER A OG  1 
ATOM   1573 N N   . VAL A 1 206 ? 4.619   62.344 50.602 1.00 8.87   ? 206  VAL A N   1 
ATOM   1574 C CA  . VAL A 1 206 ? 5.227   62.618 49.302 1.00 10.43  ? 206  VAL A CA  1 
ATOM   1575 C C   . VAL A 1 206 ? 6.039   61.345 48.826 1.00 11.84  ? 206  VAL A C   1 
ATOM   1576 O O   . VAL A 1 206 ? 5.856   60.802 47.701 1.00 12.39  ? 206  VAL A O   1 
ATOM   1577 C CB  . VAL A 1 206 ? 6.094   63.859 49.377 1.00 9.11   ? 206  VAL A CB  1 
ATOM   1578 C CG1 . VAL A 1 206 ? 6.970   63.971 48.209 1.00 12.32  ? 206  VAL A CG1 1 
ATOM   1579 C CG2 . VAL A 1 206 ? 5.292   65.030 49.358 1.00 11.09  ? 206  VAL A CG2 1 
ATOM   1580 N N   . GLY A 1 207 ? 6.876   60.835 49.742 1.00 12.62  ? 207  GLY A N   1 
ATOM   1581 C CA  . GLY A 1 207 ? 7.673   59.660 49.536 1.00 12.13  ? 207  GLY A CA  1 
ATOM   1582 C C   . GLY A 1 207 ? 6.767   58.606 49.045 1.00 12.98  ? 207  GLY A C   1 
ATOM   1583 O O   . GLY A 1 207 ? 7.120   57.938 48.064 1.00 13.61  ? 207  GLY A O   1 
ATOM   1584 N N   . MET A 1 208 ? 5.594   58.487 49.676 1.00 12.92  ? 208  MET A N   1 
ATOM   1585 C CA  . MET A 1 208 ? 4.735   57.336 49.414 1.00 14.43  ? 208  MET A CA  1 
ATOM   1586 C C   . MET A 1 208 ? 4.127   57.406 48.038 1.00 14.60  ? 208  MET A C   1 
ATOM   1587 O O   . MET A 1 208 ? 3.979   56.366 47.416 1.00 15.33  ? 208  MET A O   1 
ATOM   1588 C CB  . MET A 1 208 ? 3.640   57.196 50.448 1.00 13.64  ? 208  MET A CB  1 
ATOM   1589 C CG  . MET A 1 208 ? 4.236   57.246 51.764 1.00 15.54  ? 208  MET A CG  1 
ATOM   1590 S SD  . MET A 1 208 ? 3.342   56.533 53.174 1.00 16.25  ? 208  MET A SD  1 
ATOM   1591 C CE  . MET A 1 208 ? 1.913   57.572 53.321 1.00 9.57   ? 208  MET A CE  1 
ATOM   1592 N N   . HIS A 1 209 ? 3.787   58.614 47.569 1.00 14.10  ? 209  HIS A N   1 
ATOM   1593 C CA  . HIS A 1 209 ? 3.269   58.786 46.193 1.00 14.23  ? 209  HIS A CA  1 
ATOM   1594 C C   . HIS A 1 209 ? 4.387   58.700 45.127 1.00 14.19  ? 209  HIS A C   1 
ATOM   1595 O O   . HIS A 1 209 ? 4.088   58.690 43.951 1.00 15.58  ? 209  HIS A O   1 
ATOM   1596 C CB  . HIS A 1 209 ? 2.659   60.157 45.945 1.00 13.35  ? 209  HIS A CB  1 
ATOM   1597 C CG  . HIS A 1 209 ? 1.402   60.426 46.681 1.00 12.24  ? 209  HIS A CG  1 
ATOM   1598 N ND1 . HIS A 1 209 ? 1.308   61.415 47.640 1.00 10.18  ? 209  HIS A ND1 1 
ATOM   1599 C CD2 . HIS A 1 209 ? 0.165   59.902 46.563 1.00 11.26  ? 209  HIS A CD2 1 
ATOM   1600 C CE1 . HIS A 1 209 ? 0.073   61.475 48.105 1.00 5.80   ? 209  HIS A CE1 1 
ATOM   1601 N NE2 . HIS A 1 209 ? -0.640  60.572 47.465 1.00 10.86  ? 209  HIS A NE2 1 
ATOM   1602 N N   . ILE A 1 210 ? 5.652   58.762 45.495 1.00 12.58  ? 210  ILE A N   1 
ATOM   1603 C CA  . ILE A 1 210 ? 6.657   58.406 44.544 1.00 10.85  ? 210  ILE A CA  1 
ATOM   1604 C C   . ILE A 1 210 ? 6.532   56.927 44.255 1.00 10.44  ? 210  ILE A C   1 
ATOM   1605 O O   . ILE A 1 210 ? 6.712   56.529 43.116 1.00 9.10   ? 210  ILE A O   1 
ATOM   1606 C CB  . ILE A 1 210 ? 7.994   58.710 45.126 1.00 11.13  ? 210  ILE A CB  1 
ATOM   1607 C CG1 . ILE A 1 210 ? 8.179   60.193 44.980 1.00 10.28  ? 210  ILE A CG1 1 
ATOM   1608 C CG2 . ILE A 1 210 ? 9.103   57.951 44.429 1.00 11.02  ? 210  ILE A CG2 1 
ATOM   1609 C CD1 . ILE A 1 210 ? 9.468   60.586 45.381 1.00 8.93   ? 210  ILE A CD1 1 
ATOM   1610 N N   . LEU A 1 211 ? 6.266   56.134 45.319 1.00 11.17  ? 211  LEU A N   1 
ATOM   1611 C CA  . LEU A 1 211 ? 6.237   54.660 45.311 1.00 10.29  ? 211  LEU A CA  1 
ATOM   1612 C C   . LEU A 1 211 ? 4.929   54.176 44.698 1.00 11.18  ? 211  LEU A C   1 
ATOM   1613 O O   . LEU A 1 211 ? 4.948   53.330 43.785 1.00 11.53  ? 211  LEU A O   1 
ATOM   1614 C CB  . LEU A 1 211 ? 6.459   54.056 46.689 1.00 8.86   ? 211  LEU A CB  1 
ATOM   1615 C CG  . LEU A 1 211 ? 7.860   54.171 47.290 1.00 9.72   ? 211  LEU A CG  1 
ATOM   1616 C CD1 . LEU A 1 211 ? 7.864   54.618 48.717 1.00 7.39   ? 211  LEU A CD1 1 
ATOM   1617 C CD2 . LEU A 1 211 ? 8.496   52.862 47.353 1.00 12.82  ? 211  LEU A CD2 1 
ATOM   1618 N N   . SER A 1 212 ? 3.795   54.726 45.118 1.00 11.66  ? 212  SER A N   1 
ATOM   1619 C CA  . SER A 1 212 ? 2.524   54.192 44.641 1.00 13.76  ? 212  SER A CA  1 
ATOM   1620 C C   . SER A 1 212 ? 2.309   54.362 43.158 1.00 15.37  ? 212  SER A C   1 
ATOM   1621 O O   . SER A 1 212 ? 2.305   55.458 42.688 1.00 17.04  ? 212  SER A O   1 
ATOM   1622 C CB  . SER A 1 212 ? 1.358   54.906 45.273 1.00 14.19  ? 212  SER A CB  1 
ATOM   1623 O OG  . SER A 1 212 ? 0.221   54.076 45.156 1.00 14.70  ? 212  SER A OG  1 
ATOM   1624 N N   . PRO A 1 213 ? 2.067   53.289 42.404 1.00 16.83  ? 213  PRO A N   1 
ATOM   1625 C CA  . PRO A 1 213 ? 1.766   53.437 40.968 1.00 16.46  ? 213  PRO A CA  1 
ATOM   1626 C C   . PRO A 1 213 ? 0.612   54.355 40.572 1.00 16.66  ? 213  PRO A C   1 
ATOM   1627 O O   . PRO A 1 213 ? 0.818   55.115 39.628 1.00 19.08  ? 213  PRO A O   1 
ATOM   1628 C CB  . PRO A 1 213 ? 1.466   52.029 40.540 1.00 16.65  ? 213  PRO A CB  1 
ATOM   1629 C CG  . PRO A 1 213 ? 2.353   51.162 41.488 1.00 18.22  ? 213  PRO A CG  1 
ATOM   1630 C CD  . PRO A 1 213 ? 2.149   51.870 42.811 1.00 17.43  ? 213  PRO A CD  1 
ATOM   1631 N N   . GLY A 1 214 ? -0.553  54.345 41.224 1.00 15.06  ? 214  GLY A N   1 
ATOM   1632 C CA  . GLY A 1 214 ? -1.612  55.285 40.804 1.00 14.20  ? 214  GLY A CA  1 
ATOM   1633 C C   . GLY A 1 214 ? -1.362  56.757 41.122 1.00 14.74  ? 214  GLY A C   1 
ATOM   1634 O O   . GLY A 1 214 ? -2.165  57.677 40.831 1.00 14.48  ? 214  GLY A O   1 
ATOM   1635 N N   . SER A 1 215 ? -0.230  57.020 41.752 1.00 15.35  ? 215  SER A N   1 
ATOM   1636 C CA  . SER A 1 215 ? 0.134   58.401 42.082 1.00 14.42  ? 215  SER A CA  1 
ATOM   1637 C C   . SER A 1 215 ? 1.210   58.962 41.173 1.00 13.35  ? 215  SER A C   1 
ATOM   1638 O O   . SER A 1 215 ? 1.265   60.171 40.978 1.00 12.91  ? 215  SER A O   1 
ATOM   1639 C CB  . SER A 1 215 ? 0.520   58.504 43.552 1.00 14.11  ? 215  SER A CB  1 
ATOM   1640 O OG  . SER A 1 215 ? -0.662  58.626 44.277 1.00 15.10  ? 215  SER A OG  1 
ATOM   1641 N N   . ARG A 1 216 ? 2.044   58.112 40.578 1.00 12.63  ? 216  ARG A N   1 
ATOM   1642 C CA  . ARG A 1 216 ? 3.234   58.665 39.872 1.00 12.52  ? 216  ARG A CA  1 
ATOM   1643 C C   . ARG A 1 216 ? 2.969   59.749 38.788 1.00 12.43  ? 216  ARG A C   1 
ATOM   1644 O O   . ARG A 1 216 ? 3.615   60.776 38.848 1.00 13.27  ? 216  ARG A O   1 
ATOM   1645 C CB  . ARG A 1 216 ? 4.227   57.607 39.418 1.00 11.99  ? 216  ARG A CB  1 
ATOM   1646 C CG  . ARG A 1 216 ? 4.370   56.454 40.381 1.00 10.16  ? 216  ARG A CG  1 
ATOM   1647 C CD  . ARG A 1 216 ? 5.342   55.395 39.848 1.00 12.58  ? 216  ARG A CD  1 
ATOM   1648 N NE  . ARG A 1 216 ? 5.398   54.300 40.807 1.00 16.52  ? 216  ARG A NE  1 
ATOM   1649 C CZ  . ARG A 1 216 ? 6.086   53.172 40.686 1.00 13.06  ? 216  ARG A CZ  1 
ATOM   1650 N NH1 . ARG A 1 216 ? 6.018   52.245 41.628 1.00 13.28  ? 216  ARG A NH1 1 
ATOM   1651 N NH2 . ARG A 1 216 ? 6.802   52.956 39.639 1.00 10.50  ? 216  ARG A NH2 1 
ATOM   1652 N N   . ASP A 1 217 ? 2.015   59.553 37.872 1.00 12.25  ? 217  ASP A N   1 
ATOM   1653 C CA  . ASP A 1 217 ? 1.778   60.431 36.726 1.00 12.82  ? 217  ASP A CA  1 
ATOM   1654 C C   . ASP A 1 217 ? 1.218   61.803 37.127 1.00 13.89  ? 217  ASP A C   1 
ATOM   1655 O O   . ASP A 1 217 ? 1.274   62.798 36.345 1.00 14.40  ? 217  ASP A O   1 
ATOM   1656 C CB  . ASP A 1 217 ? 0.836   59.774 35.744 1.00 13.35  ? 217  ASP A CB  1 
ATOM   1657 C CG  . ASP A 1 217 ? 1.218   58.243 35.422 1.00 18.32  ? 217  ASP A CG  1 
ATOM   1658 O OD1 . ASP A 1 217 ? 0.377   57.617 34.693 1.00 21.95  ? 217  ASP A OD1 1 
ATOM   1659 O OD2 . ASP A 1 217 ? 2.314   57.680 35.841 1.00 15.16  ? 217  ASP A OD2 1 
ATOM   1660 N N   . LEU A 1 218 ? 0.717   61.918 38.359 1.00 13.89  ? 218  LEU A N   1 
ATOM   1661 C CA  . LEU A 1 218 ? 0.122   63.192 38.785 1.00 13.51  ? 218  LEU A CA  1 
ATOM   1662 C C   . LEU A 1 218 ? 1.066   64.371 39.171 1.00 13.33  ? 218  LEU A C   1 
ATOM   1663 O O   . LEU A 1 218 ? 0.611   65.445 39.540 1.00 14.08  ? 218  LEU A O   1 
ATOM   1664 C CB  . LEU A 1 218 ? -0.848  62.922 39.898 1.00 13.69  ? 218  LEU A CB  1 
ATOM   1665 C CG  . LEU A 1 218 ? -2.015  62.016 39.518 1.00 16.02  ? 218  LEU A CG  1 
ATOM   1666 C CD1 . LEU A 1 218 ? -2.867  61.733 40.788 1.00 15.02  ? 218  LEU A CD1 1 
ATOM   1667 C CD2 . LEU A 1 218 ? -2.789  62.773 38.494 1.00 16.16  ? 218  LEU A CD2 1 
ATOM   1668 N N   . PHE A 1 219 ? 2.363   64.219 39.054 1.00 13.10  ? 219  PHE A N   1 
ATOM   1669 C CA  . PHE A 1 219 ? 3.236   65.292 39.449 1.00 13.84  ? 219  PHE A CA  1 
ATOM   1670 C C   . PHE A 1 219 ? 4.614   65.047 38.852 1.00 14.61  ? 219  PHE A C   1 
ATOM   1671 O O   . PHE A 1 219 ? 4.884   63.928 38.362 1.00 15.66  ? 219  PHE A O   1 
ATOM   1672 C CB  . PHE A 1 219 ? 3.296   65.413 40.987 1.00 12.84  ? 219  PHE A CB  1 
ATOM   1673 C CG  . PHE A 1 219 ? 3.890   64.213 41.653 1.00 12.89  ? 219  PHE A CG  1 
ATOM   1674 C CD1 . PHE A 1 219 ? 3.079   63.102 41.955 1.00 8.60   ? 219  PHE A CD1 1 
ATOM   1675 C CD2 . PHE A 1 219 ? 5.278   64.207 42.002 1.00 10.61  ? 219  PHE A CD2 1 
ATOM   1676 C CE1 . PHE A 1 219 ? 3.642   61.952 42.602 1.00 14.46  ? 219  PHE A CE1 1 
ATOM   1677 C CE2 . PHE A 1 219 ? 5.890   63.087 42.636 1.00 11.36  ? 219  PHE A CE2 1 
ATOM   1678 C CZ  . PHE A 1 219 ? 5.086   61.926 42.956 1.00 14.00  ? 219  PHE A CZ  1 
ATOM   1679 N N   . ARG A 1 220 ? 5.481   66.055 38.956 1.00 14.30  ? 220  ARG A N   1 
ATOM   1680 C CA  . ARG A 1 220 ? 6.770   66.084 38.319 1.00 14.43  ? 220  ARG A CA  1 
ATOM   1681 C C   . ARG A 1 220 ? 7.877   65.771 39.292 1.00 15.97  ? 220  ARG A C   1 
ATOM   1682 O O   . ARG A 1 220 ? 8.734   64.950 38.991 1.00 17.49  ? 220  ARG A O   1 
ATOM   1683 C CB  . ARG A 1 220 ? 7.025   67.492 37.733 1.00 13.82  ? 220  ARG A CB  1 
ATOM   1684 C CG  . ARG A 1 220 ? 8.350   67.733 37.000 1.00 12.88  ? 220  ARG A CG  1 
ATOM   1685 C CD  . ARG A 1 220 ? 8.191   67.394 35.635 1.00 16.18  ? 220  ARG A CD  1 
ATOM   1686 N NE  . ARG A 1 220 ? 9.334   67.515 34.730 1.00 22.92  ? 220  ARG A NE  1 
ATOM   1687 C CZ  . ARG A 1 220 ? 9.350   68.307 33.615 1.00 26.94  ? 220  ARG A CZ  1 
ATOM   1688 N NH1 . ARG A 1 220 ? 8.356   69.151 33.267 1.00 23.55  ? 220  ARG A NH1 1 
ATOM   1689 N NH2 . ARG A 1 220 ? 10.390  68.266 32.795 1.00 29.48  ? 220  ARG A NH2 1 
ATOM   1690 N N   . ARG A 1 221 ? 7.922   66.480 40.422 1.00 16.49  ? 221  ARG A N   1 
ATOM   1691 C CA  . ARG A 1 221 ? 9.129   66.560 41.282 1.00 16.12  ? 221  ARG A CA  1 
ATOM   1692 C C   . ARG A 1 221 ? 8.623   66.501 42.706 1.00 16.27  ? 221  ARG A C   1 
ATOM   1693 O O   . ARG A 1 221 ? 7.417   66.668 42.904 1.00 17.27  ? 221  ARG A O   1 
ATOM   1694 C CB  . ARG A 1 221 ? 9.855   67.909 41.079 1.00 16.40  ? 221  ARG A CB  1 
ATOM   1695 C CG  . ARG A 1 221 ? 10.506  68.026 39.782 1.00 12.72  ? 221  ARG A CG  1 
ATOM   1696 C CD  . ARG A 1 221 ? 11.422  69.131 39.947 1.00 16.62  ? 221  ARG A CD  1 
ATOM   1697 N NE  . ARG A 1 221 ? 11.403  70.113 38.854 1.00 21.16  ? 221  ARG A NE  1 
ATOM   1698 C CZ  . ARG A 1 221 ? 11.686  69.915 37.560 1.00 22.51  ? 221  ARG A CZ  1 
ATOM   1699 N NH1 . ARG A 1 221 ? 12.026  68.732 37.042 1.00 17.21  ? 221  ARG A NH1 1 
ATOM   1700 N NH2 . ARG A 1 221 ? 11.582  70.971 36.767 1.00 25.32  ? 221  ARG A NH2 1 
ATOM   1701 N N   . ALA A 1 222 ? 9.517   66.264 43.679 1.00 15.67  ? 222  ALA A N   1 
ATOM   1702 C CA  . ALA A 1 222 ? 9.166   66.158 45.105 1.00 14.77  ? 222  ALA A CA  1 
ATOM   1703 C C   . ALA A 1 222 ? 10.270  66.738 45.973 1.00 14.95  ? 222  ALA A C   1 
ATOM   1704 O O   . ALA A 1 222 ? 11.491  66.530 45.656 1.00 14.26  ? 222  ALA A O   1 
ATOM   1705 C CB  . ALA A 1 222 ? 8.887   64.708 45.499 1.00 13.35  ? 222  ALA A CB  1 
ATOM   1706 N N   . ILE A 1 223 ? 9.831   67.445 47.035 1.00 13.72  ? 223  ILE A N   1 
ATOM   1707 C CA  . ILE A 1 223 ? 10.675  67.915 48.105 1.00 12.64  ? 223  ILE A CA  1 
ATOM   1708 C C   . ILE A 1 223 ? 10.141  67.263 49.349 1.00 13.04  ? 223  ILE A C   1 
ATOM   1709 O O   . ILE A 1 223 ? 8.949   67.221 49.522 1.00 12.68  ? 223  ILE A O   1 
ATOM   1710 C CB  . ILE A 1 223 ? 10.473  69.366 48.311 1.00 13.16  ? 223  ILE A CB  1 
ATOM   1711 C CG1 . ILE A 1 223 ? 11.203  70.194 47.282 1.00 12.39  ? 223  ILE A CG1 1 
ATOM   1712 C CG2 . ILE A 1 223 ? 10.997  69.851 49.659 1.00 14.56  ? 223  ILE A CG2 1 
ATOM   1713 C CD1 . ILE A 1 223 ? 10.867  71.679 47.555 1.00 5.75   ? 223  ILE A CD1 1 
ATOM   1714 N N   . LEU A 1 224 ? 11.027  66.748 50.220 1.00 14.21  ? 224  LEU A N   1 
ATOM   1715 C CA  . LEU A 1 224 ? 10.666  66.053 51.493 1.00 14.77  ? 224  LEU A CA  1 
ATOM   1716 C C   . LEU A 1 224 ? 11.363  66.697 52.711 1.00 16.16  ? 224  LEU A C   1 
ATOM   1717 O O   . LEU A 1 224 ? 12.590  66.646 52.805 1.00 17.65  ? 224  LEU A O   1 
ATOM   1718 C CB  . LEU A 1 224 ? 10.997  64.540 51.472 1.00 14.59  ? 224  LEU A CB  1 
ATOM   1719 C CG  . LEU A 1 224 ? 10.310  63.674 50.388 1.00 14.81  ? 224  LEU A CG  1 
ATOM   1720 C CD1 . LEU A 1 224 ? 11.075  63.767 49.123 1.00 10.22  ? 224  LEU A CD1 1 
ATOM   1721 C CD2 . LEU A 1 224 ? 10.104  62.211 50.744 1.00 13.24  ? 224  LEU A CD2 1 
ATOM   1722 N N   . GLN A 1 225 ? 10.617  67.279 53.661 1.00 15.95  ? 225  GLN A N   1 
ATOM   1723 C CA  . GLN A 1 225 ? 11.265  67.675 54.903 1.00 15.35  ? 225  GLN A CA  1 
ATOM   1724 C C   . GLN A 1 225 ? 10.962  66.842 56.174 1.00 15.01  ? 225  GLN A C   1 
ATOM   1725 O O   . GLN A 1 225 ? 9.793   66.649 56.603 1.00 14.79  ? 225  GLN A O   1 
ATOM   1726 C CB  . GLN A 1 225 ? 11.261  69.206 55.129 1.00 15.78  ? 225  GLN A CB  1 
ATOM   1727 C CG  . GLN A 1 225 ? 9.941   70.049 54.848 1.00 14.85  ? 225  GLN A CG  1 
ATOM   1728 C CD  . GLN A 1 225 ? 10.152  71.153 53.797 1.00 8.63   ? 225  GLN A CD  1 
ATOM   1729 O OE1 . GLN A 1 225 ? 9.360   71.991 53.580 1.00 9.08   ? 225  GLN A OE1 1 
ATOM   1730 N NE2 . GLN A 1 225 ? 11.207  71.070 53.124 1.00 13.66  ? 225  GLN A NE2 1 
ATOM   1731 N N   . SER A 1 226 ? 12.074  66.360 56.740 1.00 14.51  ? 226  SER A N   1 
ATOM   1732 C CA  . SER A 1 226 ? 12.139  65.617 57.971 1.00 14.38  ? 226  SER A CA  1 
ATOM   1733 C C   . SER A 1 226 ? 11.201  64.429 57.848 1.00 15.18  ? 226  SER A C   1 
ATOM   1734 O O   . SER A 1 226 ? 10.405  64.196 58.745 1.00 17.81  ? 226  SER A O   1 
ATOM   1735 C CB  . SER A 1 226 ? 11.771  66.536 59.190 1.00 13.90  ? 226  SER A CB  1 
ATOM   1736 O OG  . SER A 1 226 ? 12.702  67.617 59.355 1.00 11.42  ? 226  SER A OG  1 
ATOM   1737 N N   . GLY A 1 227 ? 11.219  63.672 56.762 1.00 14.70  ? 227  GLY A N   1 
ATOM   1738 C CA  . GLY A 1 227 ? 10.178  62.638 56.628 1.00 14.42  ? 227  GLY A CA  1 
ATOM   1739 C C   . GLY A 1 227 ? 10.479  61.774 55.458 1.00 14.74  ? 227  GLY A C   1 
ATOM   1740 O O   . GLY A 1 227 ? 11.022  62.208 54.498 1.00 15.66  ? 227  GLY A O   1 
ATOM   1741 N N   . SER A 1 228 ? 10.089  60.533 55.476 1.00 16.05  ? 228  SER A N   1 
ATOM   1742 C CA  . SER A 1 228 ? 10.560  59.581 54.461 1.00 15.50  ? 228  SER A CA  1 
ATOM   1743 C C   . SER A 1 228 ? 9.484   58.485 54.462 1.00 15.02  ? 228  SER A C   1 
ATOM   1744 O O   . SER A 1 228 ? 8.997   58.198 55.543 1.00 14.91  ? 228  SER A O   1 
ATOM   1745 C CB  . SER A 1 228 ? 11.797  59.006 55.086 1.00 15.48  ? 228  SER A CB  1 
ATOM   1746 O OG  . SER A 1 228 ? 12.560  58.511 54.120 1.00 16.32  ? 228  SER A OG  1 
ATOM   1747 N N   . PRO A 1 229 ? 9.139   57.832 53.319 1.00 14.18  ? 229  PRO A N   1 
ATOM   1748 C CA  . PRO A 1 229 ? 7.959   56.907 53.365 1.00 13.13  ? 229  PRO A CA  1 
ATOM   1749 C C   . PRO A 1 229 ? 8.363   55.666 54.154 1.00 13.25  ? 229  PRO A C   1 
ATOM   1750 O O   . PRO A 1 229 ? 7.556   54.962 54.757 1.00 13.16  ? 229  PRO A O   1 
ATOM   1751 C CB  . PRO A 1 229 ? 7.772   56.530 51.938 1.00 12.71  ? 229  PRO A CB  1 
ATOM   1752 C CG  . PRO A 1 229 ? 9.159   56.648 51.346 1.00 11.60  ? 229  PRO A CG  1 
ATOM   1753 C CD  . PRO A 1 229 ? 9.836   57.783 52.022 1.00 13.58  ? 229  PRO A CD  1 
ATOM   1754 N N   . ASN A 1 230 ? 9.653   55.433 54.244 1.00 14.21  ? 230  ASN A N   1 
ATOM   1755 C CA  . ASN A 1 230 ? 10.120  54.312 55.045 1.00 14.71  ? 230  ASN A CA  1 
ATOM   1756 C C   . ASN A 1 230 ? 10.356  54.623 56.544 1.00 15.57  ? 230  ASN A C   1 
ATOM   1757 O O   . ASN A 1 230 ? 11.066  53.849 57.176 1.00 17.15  ? 230  ASN A O   1 
ATOM   1758 C CB  . ASN A 1 230 ? 11.352  53.681 54.425 1.00 12.60  ? 230  ASN A CB  1 
ATOM   1759 C CG  . ASN A 1 230 ? 12.523  54.546 54.571 1.00 15.36  ? 230  ASN A CG  1 
ATOM   1760 O OD1 . ASN A 1 230 ? 13.611  54.090 54.975 1.00 23.07  ? 230  ASN A OD1 1 
ATOM   1761 N ND2 . ASN A 1 230 ? 12.345  55.836 54.303 1.00 14.10  ? 230  ASN A ND2 1 
ATOM   1762 N N   . CYS A 1 231 ? 9.781   55.677 57.153 1.00 15.16  ? 231  CYS A N   1 
ATOM   1763 C CA  . CYS A 1 231 ? 10.068  55.897 58.585 1.00 15.10  ? 231  CYS A CA  1 
ATOM   1764 C C   . CYS A 1 231 ? 9.266   54.946 59.439 1.00 13.71  ? 231  CYS A C   1 
ATOM   1765 O O   . CYS A 1 231 ? 8.130   54.736 59.148 1.00 12.41  ? 231  CYS A O   1 
ATOM   1766 C CB  . CYS A 1 231 ? 9.684   57.277 59.031 1.00 15.45  ? 231  CYS A CB  1 
ATOM   1767 S SG  . CYS A 1 231 ? 10.812  58.453 58.537 1.00 21.26  ? 231  CYS A SG  1 
ATOM   1768 N N   . PRO A 1 232 ? 9.853   54.429 60.535 1.00 13.17  ? 232  PRO A N   1 
ATOM   1769 C CA  . PRO A 1 232 ? 9.257   53.326 61.206 1.00 12.51  ? 232  PRO A CA  1 
ATOM   1770 C C   . PRO A 1 232 ? 7.910   53.691 61.796 1.00 13.46  ? 232  PRO A C   1 
ATOM   1771 O O   . PRO A 1 232 ? 7.196   52.801 62.273 1.00 13.41  ? 232  PRO A O   1 
ATOM   1772 C CB  . PRO A 1 232 ? 10.264  53.019 62.323 1.00 11.25  ? 232  PRO A CB  1 
ATOM   1773 C CG  . PRO A 1 232 ? 10.946  54.199 62.553 1.00 12.01  ? 232  PRO A CG  1 
ATOM   1774 C CD  . PRO A 1 232 ? 11.084  54.844 61.229 1.00 13.42  ? 232  PRO A CD  1 
ATOM   1775 N N   . TRP A 1 233 ? 7.538   54.963 61.781 1.00 13.64  ? 233  TRP A N   1 
ATOM   1776 C CA  . TRP A 1 233 ? 6.300   55.310 62.439 1.00 14.82  ? 233  TRP A CA  1 
ATOM   1777 C C   . TRP A 1 233 ? 5.222   55.594 61.418 1.00 14.91  ? 233  TRP A C   1 
ATOM   1778 O O   . TRP A 1 233 ? 4.162   56.103 61.816 1.00 16.27  ? 233  TRP A O   1 
ATOM   1779 C CB  . TRP A 1 233 ? 6.446   56.545 63.283 1.00 15.93  ? 233  TRP A CB  1 
ATOM   1780 C CG  . TRP A 1 233 ? 7.242   57.618 62.582 1.00 19.52  ? 233  TRP A CG  1 
ATOM   1781 C CD1 . TRP A 1 233 ? 8.612   57.895 62.762 1.00 23.95  ? 233  TRP A CD1 1 
ATOM   1782 C CD2 . TRP A 1 233 ? 6.800   58.524 61.572 1.00 19.43  ? 233  TRP A CD2 1 
ATOM   1783 N NE1 . TRP A 1 233 ? 9.004   58.940 61.937 1.00 23.21  ? 233  TRP A NE1 1 
ATOM   1784 C CE2 . TRP A 1 233 ? 7.913   59.352 61.210 1.00 20.30  ? 233  TRP A CE2 1 
ATOM   1785 C CE3 . TRP A 1 233 ? 5.599   58.723 60.932 1.00 21.73  ? 233  TRP A CE3 1 
ATOM   1786 C CZ2 . TRP A 1 233 ? 7.832   60.369 60.250 1.00 17.38  ? 233  TRP A CZ2 1 
ATOM   1787 C CZ3 . TRP A 1 233 ? 5.534   59.764 59.960 1.00 23.44  ? 233  TRP A CZ3 1 
ATOM   1788 C CH2 . TRP A 1 233 ? 6.657   60.559 59.635 1.00 19.41  ? 233  TRP A CH2 1 
ATOM   1789 N N   . ALA A 1 234 ? 5.478   55.294 60.132 1.00 12.70  ? 234  ALA A N   1 
ATOM   1790 C CA  . ALA A 1 234 ? 4.713   55.887 59.029 1.00 10.84  ? 234  ALA A CA  1 
ATOM   1791 C C   . ALA A 1 234 ? 3.877   54.822 58.365 1.00 11.01  ? 234  ALA A C   1 
ATOM   1792 O O   . ALA A 1 234 ? 3.006   55.113 57.591 1.00 11.37  ? 234  ALA A O   1 
ATOM   1793 C CB  . ALA A 1 234 ? 5.610   56.615 58.021 1.00 8.33   ? 234  ALA A CB  1 
ATOM   1794 N N   . SER A 1 235 ? 4.125   53.565 58.658 1.00 11.49  ? 235  SER A N   1 
ATOM   1795 C CA  . SER A 1 235 ? 3.297   52.520 58.058 1.00 12.32  ? 235  SER A CA  1 
ATOM   1796 C C   . SER A 1 235 ? 3.083   51.286 58.980 1.00 12.61  ? 235  SER A C   1 
ATOM   1797 O O   . SER A 1 235 ? 3.821   51.063 59.930 1.00 12.72  ? 235  SER A O   1 
ATOM   1798 C CB  . SER A 1 235 ? 3.898   52.080 56.745 1.00 11.86  ? 235  SER A CB  1 
ATOM   1799 O OG  . SER A 1 235 ? 5.029   51.284 57.002 1.00 13.77  ? 235  SER A OG  1 
ATOM   1800 N N   . VAL A 1 236 ? 2.055   50.495 58.750 1.00 12.51  ? 236  VAL A N   1 
ATOM   1801 C CA  . VAL A 1 236 ? 2.015   49.278 59.525 1.00 11.47  ? 236  VAL A CA  1 
ATOM   1802 C C   . VAL A 1 236 ? 1.604   48.180 58.595 1.00 13.48  ? 236  VAL A C   1 
ATOM   1803 O O   . VAL A 1 236 ? 1.064   48.444 57.483 1.00 14.63  ? 236  VAL A O   1 
ATOM   1804 C CB  . VAL A 1 236 ? 0.981   49.371 60.702 1.00 11.28  ? 236  VAL A CB  1 
ATOM   1805 C CG1 . VAL A 1 236 ? 1.385   50.431 61.635 1.00 7.43   ? 236  VAL A CG1 1 
ATOM   1806 C CG2 . VAL A 1 236 ? -0.431  49.557 60.179 1.00 2.66   ? 236  VAL A CG2 1 
ATOM   1807 N N   . SER A 1 237 ? 1.745   46.965 59.081 1.00 13.92  ? 237  SER A N   1 
ATOM   1808 C CA  . SER A 1 237 ? 1.203   45.806 58.384 1.00 16.54  ? 237  SER A CA  1 
ATOM   1809 C C   . SER A 1 237 ? -0.310  45.754 58.356 1.00 15.73  ? 237  SER A C   1 
ATOM   1810 O O   . SER A 1 237 ? -0.919  46.345 59.214 1.00 16.21  ? 237  SER A O   1 
ATOM   1811 C CB  . SER A 1 237 ? 1.688   44.534 59.108 1.00 17.82  ? 237  SER A CB  1 
ATOM   1812 O OG  . SER A 1 237 ? 0.826   44.306 60.219 1.00 22.58  ? 237  SER A OG  1 
ATOM   1813 N N   . VAL A 1 238 ? -0.928  44.972 57.461 1.00 16.99  ? 238  VAL A N   1 
ATOM   1814 C CA  . VAL A 1 238 ? -2.432  44.985 57.423 1.00 17.48  ? 238  VAL A CA  1 
ATOM   1815 C C   . VAL A 1 238 ? -2.960  44.311 58.679 1.00 18.97  ? 238  VAL A C   1 
ATOM   1816 O O   . VAL A 1 238 ? -4.017  44.758 59.243 1.00 19.09  ? 238  VAL A O   1 
ATOM   1817 C CB  . VAL A 1 238 ? -3.127  44.416 56.138 1.00 16.53  ? 238  VAL A CB  1 
ATOM   1818 C CG1 . VAL A 1 238 ? -2.226  44.520 54.945 1.00 17.12  ? 238  VAL A CG1 1 
ATOM   1819 C CG2 . VAL A 1 238 ? -3.540  42.984 56.312 1.00 12.97  ? 238  VAL A CG2 1 
ATOM   1820 N N   . ALA A 1 239 ? -2.218  43.284 59.132 1.00 19.18  ? 239  ALA A N   1 
ATOM   1821 C CA  . ALA A 1 239 ? -2.616  42.586 60.349 1.00 21.39  ? 239  ALA A CA  1 
ATOM   1822 C C   . ALA A 1 239 ? -2.717  43.574 61.535 1.00 23.11  ? 239  ALA A C   1 
ATOM   1823 O O   . ALA A 1 239 ? -3.766  43.610 62.268 1.00 24.29  ? 239  ALA A O   1 
ATOM   1824 C CB  . ALA A 1 239 ? -1.690  41.465 60.671 1.00 21.26  ? 239  ALA A CB  1 
ATOM   1825 N N   . GLU A 1 240 ? -1.644  44.363 61.701 1.00 23.21  ? 240  GLU A N   1 
ATOM   1826 C CA  . GLU A 1 240 ? -1.560  45.314 62.750 1.00 23.59  ? 240  GLU A CA  1 
ATOM   1827 C C   . GLU A 1 240 ? -2.673  46.309 62.595 1.00 24.15  ? 240  GLU A C   1 
ATOM   1828 O O   . GLU A 1 240 ? -3.339  46.609 63.564 1.00 25.17  ? 240  GLU A O   1 
ATOM   1829 C CB  . GLU A 1 240 ? -0.245  46.048 62.745 1.00 23.91  ? 240  GLU A CB  1 
ATOM   1830 C CG  . GLU A 1 240 ? -0.225  47.151 63.773 1.00 25.74  ? 240  GLU A CG  1 
ATOM   1831 C CD  . GLU A 1 240 ? -0.186  46.601 65.194 1.00 29.04  ? 240  GLU A CD  1 
ATOM   1832 O OE1 . GLU A 1 240 ? 0.322   45.500 65.429 1.00 28.43  ? 240  GLU A OE1 1 
ATOM   1833 O OE2 . GLU A 1 240 ? -0.689  47.269 66.098 1.00 34.76  ? 240  GLU A OE2 1 
ATOM   1834 N N   . GLY A 1 241 ? -2.900  46.837 61.406 1.00 23.98  ? 241  GLY A N   1 
ATOM   1835 C CA  . GLY A 1 241 ? -3.996  47.769 61.280 1.00 24.23  ? 241  GLY A CA  1 
ATOM   1836 C C   . GLY A 1 241 ? -5.312  47.115 61.675 1.00 25.15  ? 241  GLY A C   1 
ATOM   1837 O O   . GLY A 1 241 ? -6.177  47.780 62.284 1.00 25.52  ? 241  GLY A O   1 
ATOM   1838 N N   . ARG A 1 242 ? -5.477  45.823 61.327 1.00 25.03  ? 242  ARG A N   1 
ATOM   1839 C CA  . ARG A 1 242 ? -6.692  45.107 61.671 1.00 25.95  ? 242  ARG A CA  1 
ATOM   1840 C C   . ARG A 1 242 ? -6.830  45.139 63.216 1.00 24.57  ? 242  ARG A C   1 
ATOM   1841 O O   . ARG A 1 242 ? -7.762  45.747 63.779 1.00 23.81  ? 242  ARG A O   1 
ATOM   1842 C CB  . ARG A 1 242 ? -6.714  43.673 61.053 1.00 25.25  ? 242  ARG A CB  1 
ATOM   1843 C CG  . ARG A 1 242 ? -7.620  42.669 61.911 1.00 30.84  ? 242  ARG A CG  1 
ATOM   1844 C CD  . ARG A 1 242 ? -8.579  41.615 61.203 1.00 30.01  ? 242  ARG A CD  1 
ATOM   1845 N NE  . ARG A 1 242 ? -9.640  42.189 60.370 1.00 35.90  ? 242  ARG A NE  1 
ATOM   1846 C CZ  . ARG A 1 242 ? -9.438  42.537 59.104 1.00 40.59  ? 242  ARG A CZ  1 
ATOM   1847 N NH1 . ARG A 1 242 ? -10.432 43.040 58.362 1.00 42.34  ? 242  ARG A NH1 1 
ATOM   1848 N NH2 . ARG A 1 242 ? -8.211  42.372 58.578 1.00 41.31  ? 242  ARG A NH2 1 
ATOM   1849 N N   . ARG A 1 243 ? -5.835  44.545 63.870 1.00 24.18  ? 243  ARG A N   1 
ATOM   1850 C CA  . ARG A 1 243 ? -5.669  44.556 65.320 1.00 25.05  ? 243  ARG A CA  1 
ATOM   1851 C C   . ARG A 1 243 ? -6.015  45.862 66.005 1.00 22.39  ? 243  ARG A C   1 
ATOM   1852 O O   . ARG A 1 243 ? -6.772  45.870 66.952 1.00 22.98  ? 243  ARG A O   1 
ATOM   1853 C CB  . ARG A 1 243 ? -4.236  44.163 65.649 1.00 25.64  ? 243  ARG A CB  1 
ATOM   1854 C CG  . ARG A 1 243 ? -3.924  43.550 67.062 1.00 29.24  ? 243  ARG A CG  1 
ATOM   1855 C CD  . ARG A 1 243 ? -2.644  44.235 67.858 1.00 30.90  ? 243  ARG A CD  1 
ATOM   1856 N NE  . ARG A 1 243 ? -3.089  45.073 69.001 1.00 40.13  ? 243  ARG A NE  1 
ATOM   1857 C CZ  . ARG A 1 243 ? -2.832  46.373 69.187 1.00 42.63  ? 243  ARG A CZ  1 
ATOM   1858 N NH1 . ARG A 1 243 ? -3.373  47.002 70.248 1.00 43.06  ? 243  ARG A NH1 1 
ATOM   1859 N NH2 . ARG A 1 243 ? -2.032  47.041 68.340 1.00 44.57  ? 243  ARG A NH2 1 
ATOM   1860 N N   . ARG A 1 244 ? -5.477  46.963 65.519 1.00 20.82  ? 244  ARG A N   1 
ATOM   1861 C CA  . ARG A 1 244 ? -5.777  48.281 66.093 1.00 19.52  ? 244  ARG A CA  1 
ATOM   1862 C C   . ARG A 1 244 ? -7.146  48.757 65.816 1.00 19.95  ? 244  ARG A C   1 
ATOM   1863 O O   . ARG A 1 244 ? -7.648  49.576 66.582 1.00 19.93  ? 244  ARG A O   1 
ATOM   1864 C CB  . ARG A 1 244 ? -4.857  49.393 65.620 1.00 18.05  ? 244  ARG A CB  1 
ATOM   1865 C CG  . ARG A 1 244 ? -3.429  49.210 66.048 1.00 15.50  ? 244  ARG A CG  1 
ATOM   1866 C CD  . ARG A 1 244 ? -2.590  50.360 65.607 1.00 7.94   ? 244  ARG A CD  1 
ATOM   1867 N NE  . ARG A 1 244 ? -1.246  49.914 65.768 1.00 4.81   ? 244  ARG A NE  1 
ATOM   1868 C CZ  . ARG A 1 244 ? -0.134  50.581 65.479 1.00 4.85   ? 244  ARG A CZ  1 
ATOM   1869 N NH1 . ARG A 1 244 ? 0.956   49.984 65.803 1.00 5.48   ? 244  ARG A NH1 1 
ATOM   1870 N NH2 . ARG A 1 244 ? -0.065  51.815 65.010 1.00 2.52   ? 244  ARG A NH2 1 
ATOM   1871 N N   . ALA A 1 245 ? -7.759  48.321 64.721 1.00 20.16  ? 245  ALA A N   1 
ATOM   1872 C CA  . ALA A 1 245 ? -9.111  48.831 64.489 1.00 20.76  ? 245  ALA A CA  1 
ATOM   1873 C C   . ALA A 1 245 ? -10.069 48.114 65.398 1.00 21.24  ? 245  ALA A C   1 
ATOM   1874 O O   . ALA A 1 245 ? -11.021 48.706 65.898 1.00 18.71  ? 245  ALA A O   1 
ATOM   1875 C CB  . ALA A 1 245 ? -9.481  48.602 63.172 1.00 21.40  ? 245  ALA A CB  1 
ATOM   1876 N N   . VAL A 1 246 ? -9.793  46.820 65.615 1.00 22.52  ? 246  VAL A N   1 
ATOM   1877 C CA  . VAL A 1 246 ? -10.708 46.070 66.458 1.00 24.41  ? 246  VAL A CA  1 
ATOM   1878 C C   . VAL A 1 246 ? -10.492 46.554 67.891 1.00 25.68  ? 246  VAL A C   1 
ATOM   1879 O O   . VAL A 1 246 ? -11.493 46.801 68.635 1.00 26.65  ? 246  VAL A O   1 
ATOM   1880 C CB  . VAL A 1 246 ? -10.674 44.519 66.275 1.00 23.76  ? 246  VAL A CB  1 
ATOM   1881 C CG1 . VAL A 1 246 ? -9.556  44.153 65.471 1.00 24.30  ? 246  VAL A CG1 1 
ATOM   1882 C CG2 . VAL A 1 246 ? -10.607 43.806 67.583 1.00 20.34  ? 246  VAL A CG2 1 
ATOM   1883 N N   . GLU A 1 247 ? -9.224  46.807 68.242 1.00 25.04  ? 247  GLU A N   1 
ATOM   1884 C CA  . GLU A 1 247 ? -8.977  47.427 69.535 1.00 24.62  ? 247  GLU A CA  1 
ATOM   1885 C C   . GLU A 1 247 ? -9.744  48.729 69.759 1.00 23.42  ? 247  GLU A C   1 
ATOM   1886 O O   . GLU A 1 247 ? -10.331 48.912 70.801 1.00 23.43  ? 247  GLU A O   1 
ATOM   1887 C CB  . GLU A 1 247 ? -7.513  47.607 69.749 1.00 25.07  ? 247  GLU A CB  1 
ATOM   1888 C CG  . GLU A 1 247 ? -7.126  47.757 71.181 1.00 30.94  ? 247  GLU A CG  1 
ATOM   1889 C CD  . GLU A 1 247 ? -7.680  46.639 72.119 1.00 37.02  ? 247  GLU A CD  1 
ATOM   1890 O OE1 . GLU A 1 247 ? -7.679  46.890 73.361 1.00 41.82  ? 247  GLU A OE1 1 
ATOM   1891 O OE2 . GLU A 1 247 ? -8.119  45.557 71.642 1.00 33.03  ? 247  GLU A OE2 1 
ATOM   1892 N N   . LEU A 1 248 ? -9.799  49.611 68.768 1.00 22.82  ? 248  LEU A N   1 
ATOM   1893 C CA  . LEU A 1 248 ? -10.669 50.791 68.858 1.00 22.19  ? 248  LEU A CA  1 
ATOM   1894 C C   . LEU A 1 248 ? -12.114 50.414 69.183 1.00 22.94  ? 248  LEU A C   1 
ATOM   1895 O O   . LEU A 1 248 ? -12.755 50.993 70.038 1.00 21.56  ? 248  LEU A O   1 
ATOM   1896 C CB  . LEU A 1 248 ? -10.652 51.511 67.545 1.00 20.78  ? 248  LEU A CB  1 
ATOM   1897 C CG  . LEU A 1 248 ? -11.363 52.853 67.543 1.00 20.27  ? 248  LEU A CG  1 
ATOM   1898 C CD1 . LEU A 1 248 ? -10.702 53.918 68.443 1.00 20.37  ? 248  LEU A CD1 1 
ATOM   1899 C CD2 . LEU A 1 248 ? -11.432 53.434 66.158 1.00 19.91  ? 248  LEU A CD2 1 
ATOM   1900 N N   . GLY A 1 249 ? -12.601 49.385 68.500 1.00 25.41  ? 249  GLY A N   1 
ATOM   1901 C CA  . GLY A 1 249 ? -14.000 48.942 68.637 1.00 28.02  ? 249  GLY A CA  1 
ATOM   1902 C C   . GLY A 1 249 ? -14.336 48.596 70.073 1.00 29.37  ? 249  GLY A C   1 
ATOM   1903 O O   . GLY A 1 249 ? -15.419 48.939 70.584 1.00 28.95  ? 249  GLY A O   1 
ATOM   1904 N N   . ARG A 1 250 ? -13.369 47.943 70.715 1.00 30.57  ? 250  ARG A N   1 
ATOM   1905 C CA  . ARG A 1 250 ? -13.437 47.607 72.112 1.00 32.17  ? 250  ARG A CA  1 
ATOM   1906 C C   . ARG A 1 250 ? -13.623 48.724 73.094 1.00 32.35  ? 250  ARG A C   1 
ATOM   1907 O O   . ARG A 1 250 ? -14.450 48.617 73.938 1.00 32.93  ? 250  ARG A O   1 
ATOM   1908 C CB  . ARG A 1 250 ? -12.185 46.937 72.489 1.00 32.55  ? 250  ARG A CB  1 
ATOM   1909 C CG  . ARG A 1 250 ? -12.332 45.544 72.552 1.00 35.94  ? 250  ARG A CG  1 
ATOM   1910 C CD  . ARG A 1 250 ? -11.124 45.026 73.236 1.00 43.01  ? 250  ARG A CD  1 
ATOM   1911 N NE  . ARG A 1 250 ? -11.274 43.591 73.174 1.00 52.20  ? 250  ARG A NE  1 
ATOM   1912 C CZ  . ARG A 1 250 ? -10.745 42.786 72.258 1.00 54.94  ? 250  ARG A CZ  1 
ATOM   1913 N NH1 . ARG A 1 250 ? -11.026 41.486 72.349 1.00 58.17  ? 250  ARG A NH1 1 
ATOM   1914 N NH2 . ARG A 1 250 ? -9.937  43.251 71.289 1.00 54.44  ? 250  ARG A NH2 1 
ATOM   1915 N N   . ASN A 1 251 ? -12.865 49.795 73.015 1.00 33.00  ? 251  ASN A N   1 
ATOM   1916 C CA  . ASN A 1 251 ? -13.102 50.863 73.975 1.00 34.12  ? 251  ASN A CA  1 
ATOM   1917 C C   . ASN A 1 251 ? -14.309 51.633 73.598 1.00 33.75  ? 251  ASN A C   1 
ATOM   1918 O O   . ASN A 1 251 ? -14.563 52.598 74.183 1.00 34.64  ? 251  ASN A O   1 
ATOM   1919 C CB  . ASN A 1 251 ? -11.921 51.878 74.084 1.00 34.99  ? 251  ASN A CB  1 
ATOM   1920 C CG  . ASN A 1 251 ? -10.504 51.237 73.801 1.00 35.42  ? 251  ASN A CG  1 
ATOM   1921 O OD1 . ASN A 1 251 ? -9.523  51.566 74.510 1.00 33.18  ? 251  ASN A OD1 1 
ATOM   1922 N ND2 . ASN A 1 251 ? -10.409 50.326 72.784 1.00 32.33  ? 251  ASN A ND2 1 
ATOM   1923 N N   . LEU A 1 252 ? -15.024 51.280 72.572 1.00 34.78  ? 252  LEU A N   1 
ATOM   1924 C CA  . LEU A 1 252 ? -16.337 51.910 72.399 1.00 36.06  ? 252  LEU A CA  1 
ATOM   1925 C C   . LEU A 1 252 ? -17.480 50.912 72.561 1.00 36.72  ? 252  LEU A C   1 
ATOM   1926 O O   . LEU A 1 252 ? -18.655 51.258 72.445 1.00 36.56  ? 252  LEU A O   1 
ATOM   1927 C CB  . LEU A 1 252 ? -16.423 52.623 71.061 1.00 35.59  ? 252  LEU A CB  1 
ATOM   1928 C CG  . LEU A 1 252 ? -15.405 53.740 71.001 1.00 34.91  ? 252  LEU A CG  1 
ATOM   1929 C CD1 . LEU A 1 252 ? -15.010 53.854 69.576 1.00 37.25  ? 252  LEU A CD1 1 
ATOM   1930 C CD2 . LEU A 1 252 ? -16.015 55.061 71.478 1.00 33.17  ? 252  LEU A CD2 1 
ATOM   1931 N N   . ASN A 1 253 ? -17.103 49.666 72.833 1.00 37.92  ? 253  ASN A N   1 
ATOM   1932 C CA  . ASN A 1 253 ? -18.037 48.579 73.094 1.00 39.32  ? 253  ASN A CA  1 
ATOM   1933 C C   . ASN A 1 253 ? -18.728 48.257 71.875 1.00 39.06  ? 253  ASN A C   1 
ATOM   1934 O O   . ASN A 1 253 ? -19.926 48.153 71.895 1.00 39.21  ? 253  ASN A O   1 
ATOM   1935 C CB  . ASN A 1 253 ? -19.179 48.993 74.025 1.00 40.12  ? 253  ASN A CB  1 
ATOM   1936 C CG  . ASN A 1 253 ? -18.691 49.408 75.363 1.00 43.25  ? 253  ASN A CG  1 
ATOM   1937 O OD1 . ASN A 1 253 ? -17.801 48.756 75.929 1.00 46.08  ? 253  ASN A OD1 1 
ATOM   1938 N ND2 . ASN A 1 253 ? -19.234 50.512 75.890 1.00 46.42  ? 253  ASN A ND2 1 
ATOM   1939 N N   . CYS A 1 254 ? -18.037 48.162 70.778 1.00 39.22  ? 254  CYS A N   1 
ATOM   1940 C CA  . CYS A 1 254 ? -18.751 47.609 69.691 1.00 38.95  ? 254  CYS A CA  1 
ATOM   1941 C C   . CYS A 1 254 ? -18.635 46.115 69.688 1.00 40.96  ? 254  CYS A C   1 
ATOM   1942 O O   . CYS A 1 254 ? -17.709 45.493 70.295 1.00 40.02  ? 254  CYS A O   1 
ATOM   1943 C CB  . CYS A 1 254 ? -18.317 48.154 68.347 1.00 38.87  ? 254  CYS A CB  1 
ATOM   1944 S SG  . CYS A 1 254 ? -18.251 49.867 68.289 1.00 34.06  ? 254  CYS A SG  1 
ATOM   1945 N N   . ASN A 1 255 ? -19.672 45.590 69.024 1.00 43.29  ? 255  ASN A N   1 
ATOM   1946 C CA  . ASN A 1 255 ? -19.808 44.248 68.541 1.00 44.74  ? 255  ASN A CA  1 
ATOM   1947 C C   . ASN A 1 255 ? -18.604 43.935 67.733 1.00 44.51  ? 255  ASN A C   1 
ATOM   1948 O O   . ASN A 1 255 ? -18.331 44.679 66.825 1.00 44.27  ? 255  ASN A O   1 
ATOM   1949 C CB  . ASN A 1 255 ? -20.952 44.308 67.551 1.00 45.54  ? 255  ASN A CB  1 
ATOM   1950 C CG  . ASN A 1 255 ? -21.714 43.054 67.544 1.00 48.48  ? 255  ASN A CG  1 
ATOM   1951 O OD1 . ASN A 1 255 ? -21.307 42.028 66.951 1.00 49.94  ? 255  ASN A OD1 1 
ATOM   1952 N ND2 . ASN A 1 255 ? -22.806 43.074 68.281 1.00 50.98  ? 255  ASN A ND2 1 
ATOM   1953 N N   . LEU A 1 256 ? -17.867 42.879 68.020 1.00 45.23  ? 256  LEU A N   1 
ATOM   1954 C CA  . LEU A 1 256 ? -16.706 42.581 67.154 1.00 46.43  ? 256  LEU A CA  1 
ATOM   1955 C C   . LEU A 1 256 ? -17.012 41.266 66.493 1.00 47.78  ? 256  LEU A C   1 
ATOM   1956 O O   . LEU A 1 256 ? -16.253 40.316 66.566 1.00 48.99  ? 256  LEU A O   1 
ATOM   1957 C CB  . LEU A 1 256 ? -15.367 42.548 67.911 1.00 45.61  ? 256  LEU A CB  1 
ATOM   1958 C CG  . LEU A 1 256 ? -15.202 43.538 69.075 1.00 44.41  ? 256  LEU A CG  1 
ATOM   1959 C CD1 . LEU A 1 256 ? -14.107 43.184 70.105 1.00 41.80  ? 256  LEU A CD1 1 
ATOM   1960 C CD2 . LEU A 1 256 ? -14.948 44.862 68.463 1.00 43.87  ? 256  LEU A CD2 1 
ATOM   1961 N N   . ASN A 1 257 ? -18.160 41.190 65.857 1.00 49.14  ? 257  ASN A N   1 
ATOM   1962 C CA  . ASN A 1 257 ? -18.502 39.949 65.212 1.00 50.58  ? 257  ASN A CA  1 
ATOM   1963 C C   . ASN A 1 257 ? -18.261 39.736 63.759 1.00 49.41  ? 257  ASN A C   1 
ATOM   1964 O O   . ASN A 1 257 ? -17.646 38.761 63.417 1.00 48.13  ? 257  ASN A O   1 
ATOM   1965 C CB  . ASN A 1 257 ? -19.862 39.481 65.640 1.00 52.29  ? 257  ASN A CB  1 
ATOM   1966 C CG  . ASN A 1 257 ? -19.724 38.467 66.710 1.00 57.59  ? 257  ASN A CG  1 
ATOM   1967 O OD1 . ASN A 1 257 ? -20.008 37.277 66.476 1.00 64.25  ? 257  ASN A OD1 1 
ATOM   1968 N ND2 . ASN A 1 257 ? -19.135 38.880 67.862 1.00 59.43  ? 257  ASN A ND2 1 
ATOM   1969 N N   . SER A 1 258 ? -18.775 40.628 62.922 1.00 49.43  ? 258  SER A N   1 
ATOM   1970 C CA  . SER A 1 258 ? -18.206 40.842 61.581 1.00 49.55  ? 258  SER A CA  1 
ATOM   1971 C C   . SER A 1 258 ? -17.500 42.213 61.521 1.00 49.01  ? 258  SER A C   1 
ATOM   1972 O O   . SER A 1 258 ? -17.783 43.094 62.338 1.00 48.10  ? 258  SER A O   1 
ATOM   1973 C CB  . SER A 1 258 ? -19.319 40.803 60.543 1.00 49.71  ? 258  SER A CB  1 
ATOM   1974 O OG  . SER A 1 258 ? -20.485 41.323 61.169 1.00 49.88  ? 258  SER A OG  1 
ATOM   1975 N N   . ASP A 1 259 ? -16.592 42.382 60.547 1.00 49.04  ? 259  ASP A N   1 
ATOM   1976 C CA  . ASP A 1 259 ? -16.131 43.728 60.098 1.00 48.67  ? 259  ASP A CA  1 
ATOM   1977 C C   . ASP A 1 259 ? -17.338 44.620 59.906 1.00 48.54  ? 259  ASP A C   1 
ATOM   1978 O O   . ASP A 1 259 ? -17.392 45.760 60.309 1.00 48.08  ? 259  ASP A O   1 
ATOM   1979 C CB  . ASP A 1 259 ? -15.435 43.652 58.741 1.00 47.86  ? 259  ASP A CB  1 
ATOM   1980 C CG  . ASP A 1 259 ? -14.023 43.138 58.821 1.00 48.08  ? 259  ASP A CG  1 
ATOM   1981 O OD1 . ASP A 1 259 ? -13.321 43.241 57.805 1.00 49.88  ? 259  ASP A OD1 1 
ATOM   1982 O OD2 . ASP A 1 259 ? -13.593 42.610 59.859 1.00 48.45  ? 259  ASP A OD2 1 
ATOM   1983 N N   . GLU A 1 260 ? -18.302 44.020 59.253 1.00 49.38  ? 260  GLU A N   1 
ATOM   1984 C CA  . GLU A 1 260 ? -19.552 44.584 58.906 1.00 49.89  ? 260  GLU A CA  1 
ATOM   1985 C C   . GLU A 1 260 ? -20.187 45.376 60.037 1.00 48.21  ? 260  GLU A C   1 
ATOM   1986 O O   . GLU A 1 260 ? -20.663 46.521 59.859 1.00 48.12  ? 260  GLU A O   1 
ATOM   1987 C CB  . GLU A 1 260 ? -20.407 43.405 58.401 1.00 51.63  ? 260  GLU A CB  1 
ATOM   1988 C CG  . GLU A 1 260 ? -20.325 43.250 56.873 1.00 58.96  ? 260  GLU A CG  1 
ATOM   1989 C CD  . GLU A 1 260 ? -20.798 44.608 56.210 1.00 70.21  ? 260  GLU A CD  1 
ATOM   1990 O OE1 . GLU A 1 260 ? -21.751 45.257 56.772 1.00 74.05  ? 260  GLU A OE1 1 
ATOM   1991 O OE2 . GLU A 1 260 ? -20.200 45.064 55.179 1.00 74.35  ? 260  GLU A OE2 1 
ATOM   1992 N N   . GLU A 1 261 ? -20.129 44.799 61.219 1.00 46.35  ? 261  GLU A N   1 
ATOM   1993 C CA  . GLU A 1 261 ? -20.726 45.422 62.373 1.00 45.37  ? 261  GLU A CA  1 
ATOM   1994 C C   . GLU A 1 261 ? -19.835 46.415 63.156 1.00 42.93  ? 261  GLU A C   1 
ATOM   1995 O O   . GLU A 1 261 ? -20.357 47.423 63.737 1.00 42.68  ? 261  GLU A O   1 
ATOM   1996 C CB  . GLU A 1 261 ? -21.171 44.315 63.289 1.00 46.94  ? 261  GLU A CB  1 
ATOM   1997 C CG  . GLU A 1 261 ? -22.591 43.846 63.008 1.00 53.79  ? 261  GLU A CG  1 
ATOM   1998 C CD  . GLU A 1 261 ? -22.895 42.592 63.784 1.00 61.17  ? 261  GLU A CD  1 
ATOM   1999 O OE1 . GLU A 1 261 ? -22.014 41.666 63.729 1.00 66.16  ? 261  GLU A OE1 1 
ATOM   2000 O OE2 . GLU A 1 261 ? -23.974 42.561 64.453 1.00 61.52  ? 261  GLU A OE2 1 
ATOM   2001 N N   . LEU A 1 262 ? -18.522 46.105 63.200 1.00 39.13  ? 262  LEU A N   1 
ATOM   2002 C CA  . LEU A 1 262 ? -17.527 47.004 63.722 1.00 35.62  ? 262  LEU A CA  1 
ATOM   2003 C C   . LEU A 1 262 ? -17.737 48.323 63.000 1.00 34.65  ? 262  LEU A C   1 
ATOM   2004 O O   . LEU A 1 262 ? -18.055 49.325 63.592 1.00 35.35  ? 262  LEU A O   1 
ATOM   2005 C CB  . LEU A 1 262 ? -16.142 46.473 63.436 1.00 34.76  ? 262  LEU A CB  1 
ATOM   2006 C CG  . LEU A 1 262 ? -15.096 46.576 64.531 1.00 31.86  ? 262  LEU A CG  1 
ATOM   2007 C CD1 . LEU A 1 262 ? -13.725 46.275 64.026 1.00 30.39  ? 262  LEU A CD1 1 
ATOM   2008 C CD2 . LEU A 1 262 ? -15.079 47.870 65.094 1.00 29.08  ? 262  LEU A CD2 1 
ATOM   2009 N N   . ILE A 1 263 ? -17.615 48.317 61.697 1.00 33.00  ? 263  ILE A N   1 
ATOM   2010 C CA  . ILE A 1 263 ? -17.749 49.534 60.956 1.00 32.00  ? 263  ILE A CA  1 
ATOM   2011 C C   . ILE A 1 263 ? -19.094 50.207 61.160 1.00 32.56  ? 263  ILE A C   1 
ATOM   2012 O O   . ILE A 1 263 ? -19.151 51.435 61.258 1.00 31.34  ? 263  ILE A O   1 
ATOM   2013 C CB  . ILE A 1 263 ? -17.446 49.282 59.485 1.00 31.47  ? 263  ILE A CB  1 
ATOM   2014 C CG1 . ILE A 1 263 ? -15.992 48.930 59.343 1.00 29.42  ? 263  ILE A CG1 1 
ATOM   2015 C CG2 . ILE A 1 263 ? -17.700 50.486 58.633 1.00 30.44  ? 263  ILE A CG2 1 
ATOM   2016 C CD1 . ILE A 1 263 ? -15.827 47.805 58.441 1.00 30.70  ? 263  ILE A CD1 1 
ATOM   2017 N N   . HIS A 1 264 ? -20.186 49.440 61.197 1.00 33.72  ? 264  HIS A N   1 
ATOM   2018 C CA  A HIS A 1 264 ? -21.462 50.108 61.305 0.50 34.89  ? 264  HIS A CA  1 
ATOM   2019 C CA  B HIS A 1 264 ? -21.551 50.045 61.408 0.50 34.59  ? 264  HIS A CA  1 
ATOM   2020 C C   . HIS A 1 264 ? -21.437 50.844 62.673 1.00 35.27  ? 264  HIS A C   1 
ATOM   2021 O O   . HIS A 1 264 ? -21.875 52.017 62.778 1.00 35.92  ? 264  HIS A O   1 
ATOM   2022 C CB  A HIS A 1 264 ? -22.658 49.149 61.013 0.50 34.74  ? 264  HIS A CB  1 
ATOM   2023 C CB  B HIS A 1 264 ? -22.739 49.019 61.529 0.50 34.22  ? 264  HIS A CB  1 
ATOM   2024 C CG  A HIS A 1 264 ? -22.864 48.843 59.542 0.50 35.13  ? 264  HIS A CG  1 
ATOM   2025 C CG  B HIS A 1 264 ? -24.041 49.614 62.054 0.50 33.34  ? 264  HIS A CG  1 
ATOM   2026 N ND1 A HIS A 1 264 ? -23.328 49.779 58.631 0.50 35.59  ? 264  HIS A ND1 1 
ATOM   2027 N ND1 B HIS A 1 264 ? -25.009 50.164 61.234 0.50 31.69  ? 264  HIS A ND1 1 
ATOM   2028 C CD2 A HIS A 1 264 ? -22.677 47.701 58.831 0.50 34.25  ? 264  HIS A CD2 1 
ATOM   2029 C CD2 B HIS A 1 264 ? -24.530 49.726 63.317 0.50 30.77  ? 264  HIS A CD2 1 
ATOM   2030 C CE1 A HIS A 1 264 ? -23.417 49.226 57.431 0.50 33.92  ? 264  HIS A CE1 1 
ATOM   2031 C CE1 B HIS A 1 264 ? -26.024 50.596 61.963 0.50 29.09  ? 264  HIS A CE1 1 
ATOM   2032 N NE2 A HIS A 1 264 ? -23.022 47.968 57.525 0.50 33.52  ? 264  HIS A NE2 1 
ATOM   2033 N NE2 B HIS A 1 264 ? -25.750 50.355 63.231 0.50 29.12  ? 264  HIS A NE2 1 
ATOM   2034 N N   . CYS A 1 265 ? -20.839 50.198 63.660 1.00 35.81  ? 265  CYS A N   1 
ATOM   2035 C CA  . CYS A 1 265 ? -20.719 50.791 64.954 1.00 35.27  ? 265  CYS A CA  1 
ATOM   2036 C C   . CYS A 1 265 ? -19.879 52.086 64.968 1.00 34.09  ? 265  CYS A C   1 
ATOM   2037 O O   . CYS A 1 265 ? -20.321 53.113 65.454 1.00 33.04  ? 265  CYS A O   1 
ATOM   2038 C CB  . CYS A 1 265 ? -20.074 49.757 65.874 1.00 35.95  ? 265  CYS A CB  1 
ATOM   2039 S SG  . CYS A 1 265 ? -20.012 50.427 67.530 1.00 39.67  ? 265  CYS A SG  1 
ATOM   2040 N N   . LEU A 1 266 ? -18.644 51.997 64.468 1.00 32.99  ? 266  LEU A N   1 
ATOM   2041 C CA  . LEU A 1 266 ? -17.735 53.079 64.548 1.00 31.94  ? 266  LEU A CA  1 
ATOM   2042 C C   . LEU A 1 266 ? -18.372 54.192 63.800 1.00 33.19  ? 266  LEU A C   1 
ATOM   2043 O O   . LEU A 1 266 ? -18.166 55.342 64.133 1.00 34.61  ? 266  LEU A O   1 
ATOM   2044 C CB  . LEU A 1 266 ? -16.406 52.712 63.952 1.00 30.82  ? 266  LEU A CB  1 
ATOM   2045 C CG  . LEU A 1 266 ? -15.735 51.607 64.759 1.00 28.24  ? 266  LEU A CG  1 
ATOM   2046 C CD1 . LEU A 1 266 ? -14.491 51.249 64.096 1.00 23.27  ? 266  LEU A CD1 1 
ATOM   2047 C CD2 . LEU A 1 266 ? -15.368 52.097 66.123 1.00 27.84  ? 266  LEU A CD2 1 
ATOM   2048 N N   . ARG A 1 267 ? -19.232 53.877 62.840 1.00 34.16  ? 267  ARG A N   1 
ATOM   2049 C CA  . ARG A 1 267 ? -19.821 54.924 62.025 1.00 34.35  ? 267  ARG A CA  1 
ATOM   2050 C C   . ARG A 1 267 ? -20.899 55.601 62.760 1.00 34.89  ? 267  ARG A C   1 
ATOM   2051 O O   . ARG A 1 267 ? -21.230 56.724 62.462 1.00 35.63  ? 267  ARG A O   1 
ATOM   2052 C CB  . ARG A 1 267 ? -20.326 54.392 60.720 1.00 34.44  ? 267  ARG A CB  1 
ATOM   2053 C CG  . ARG A 1 267 ? -19.331 54.616 59.617 1.00 35.88  ? 267  ARG A CG  1 
ATOM   2054 C CD  . ARG A 1 267 ? -19.926 54.187 58.338 1.00 39.39  ? 267  ARG A CD  1 
ATOM   2055 N NE  . ARG A 1 267 ? -18.930 53.519 57.527 1.00 45.12  ? 267  ARG A NE  1 
ATOM   2056 C CZ  . ARG A 1 267 ? -19.104 53.092 56.275 1.00 44.50  ? 267  ARG A CZ  1 
ATOM   2057 N NH1 . ARG A 1 267 ? -18.105 52.496 55.611 1.00 41.25  ? 267  ARG A NH1 1 
ATOM   2058 N NH2 . ARG A 1 267 ? -20.267 53.269 55.685 1.00 46.56  ? 267  ARG A NH2 1 
ATOM   2059 N N   . GLU A 1 268 ? -21.421 54.941 63.770 1.00 36.01  ? 268  GLU A N   1 
ATOM   2060 C CA  . GLU A 1 268 ? -22.499 55.504 64.561 1.00 37.58  ? 268  GLU A CA  1 
ATOM   2061 C C   . GLU A 1 268 ? -22.031 56.553 65.524 1.00 36.62  ? 268  GLU A C   1 
ATOM   2062 O O   . GLU A 1 268 ? -22.796 57.421 65.865 1.00 37.10  ? 268  GLU A O   1 
ATOM   2063 C CB  . GLU A 1 268 ? -23.100 54.405 65.423 1.00 40.36  ? 268  GLU A CB  1 
ATOM   2064 C CG  . GLU A 1 268 ? -24.387 54.768 66.178 1.00 45.71  ? 268  GLU A CG  1 
ATOM   2065 C CD  . GLU A 1 268 ? -25.582 54.547 65.287 1.00 52.33  ? 268  GLU A CD  1 
ATOM   2066 O OE1 . GLU A 1 268 ? -26.375 53.619 65.648 1.00 55.26  ? 268  GLU A OE1 1 
ATOM   2067 O OE2 . GLU A 1 268 ? -25.665 55.269 64.229 1.00 53.07  ? 268  GLU A OE2 1 
ATOM   2068 N N   . LYS A 1 269 ? -20.798 56.431 65.994 1.00 35.27  ? 269  LYS A N   1 
ATOM   2069 C CA  . LYS A 1 269 ? -20.259 57.267 67.024 1.00 34.04  ? 269  LYS A CA  1 
ATOM   2070 C C   . LYS A 1 269 ? -19.943 58.670 66.553 1.00 33.25  ? 269  LYS A C   1 
ATOM   2071 O O   . LYS A 1 269 ? -19.624 58.888 65.403 1.00 32.19  ? 269  LYS A O   1 
ATOM   2072 C CB  . LYS A 1 269 ? -19.015 56.573 67.505 1.00 34.45  ? 269  LYS A CB  1 
ATOM   2073 C CG  . LYS A 1 269 ? -19.275 55.621 68.680 1.00 36.33  ? 269  LYS A CG  1 
ATOM   2074 C CD  . LYS A 1 269 ? -20.036 54.337 68.328 1.00 40.02  ? 269  LYS A CD  1 
ATOM   2075 C CE  . LYS A 1 269 ? -20.899 53.835 69.525 1.00 39.14  ? 269  LYS A CE  1 
ATOM   2076 N NZ  . LYS A 1 269 ? -20.097 54.069 70.768 1.00 40.49  ? 269  LYS A NZ  1 
ATOM   2077 N N   . LYS A 1 270 ? -20.064 59.625 67.447 1.00 33.14  ? 270  LYS A N   1 
ATOM   2078 C CA  . LYS A 1 270 ? -19.754 60.996 67.143 1.00 34.50  ? 270  LYS A CA  1 
ATOM   2079 C C   . LYS A 1 270 ? -18.286 61.100 66.850 1.00 33.84  ? 270  LYS A C   1 
ATOM   2080 O O   . LYS A 1 270 ? -17.527 60.331 67.397 1.00 34.77  ? 270  LYS A O   1 
ATOM   2081 C CB  . LYS A 1 270 ? -19.951 61.801 68.404 1.00 36.62  ? 270  LYS A CB  1 
ATOM   2082 C CG  . LYS A 1 270 ? -21.386 62.171 68.781 1.00 41.31  ? 270  LYS A CG  1 
ATOM   2083 C CD  . LYS A 1 270 ? -21.401 62.361 70.387 1.00 49.38  ? 270  LYS A CD  1 
ATOM   2084 C CE  . LYS A 1 270 ? -22.826 62.446 71.052 1.00 48.69  ? 270  LYS A CE  1 
ATOM   2085 N NZ  . LYS A 1 270 ? -23.895 62.926 70.036 1.00 55.70  ? 270  LYS A NZ  1 
ATOM   2086 N N   . PRO A 1 271 ? -17.837 62.110 66.088 1.00 33.12  ? 271  PRO A N   1 
ATOM   2087 C CA  . PRO A 1 271 ? -16.397 62.114 65.848 1.00 32.29  ? 271  PRO A CA  1 
ATOM   2088 C C   . PRO A 1 271 ? -15.555 62.182 67.141 1.00 31.45  ? 271  PRO A C   1 
ATOM   2089 O O   . PRO A 1 271 ? -14.466 61.569 67.244 1.00 31.37  ? 271  PRO A O   1 
ATOM   2090 C CB  . PRO A 1 271 ? -16.152 63.376 64.961 1.00 32.80  ? 271  PRO A CB  1 
ATOM   2091 C CG  . PRO A 1 271 ? -17.401 64.125 64.883 1.00 32.80  ? 271  PRO A CG  1 
ATOM   2092 C CD  . PRO A 1 271 ? -18.520 63.268 65.474 1.00 33.54  ? 271  PRO A CD  1 
ATOM   2093 N N   . GLN A 1 272 ? -16.019 62.908 68.144 1.00 30.31  ? 272  GLN A N   1 
ATOM   2094 C CA  . GLN A 1 272 ? -15.119 63.056 69.267 1.00 28.87  ? 272  GLN A CA  1 
ATOM   2095 C C   . GLN A 1 272 ? -14.926 61.782 70.073 1.00 28.11  ? 272  GLN A C   1 
ATOM   2096 O O   . GLN A 1 272 ? -14.057 61.689 70.900 1.00 27.76  ? 272  GLN A O   1 
ATOM   2097 C CB  . GLN A 1 272 ? -15.588 64.181 70.144 1.00 29.18  ? 272  GLN A CB  1 
ATOM   2098 C CG  . GLN A 1 272 ? -14.633 64.512 71.307 1.00 31.12  ? 272  GLN A CG  1 
ATOM   2099 C CD  . GLN A 1 272 ? -13.279 65.021 70.847 1.00 35.03  ? 272  GLN A CD  1 
ATOM   2100 O OE1 . GLN A 1 272 ? -13.174 65.820 69.875 1.00 36.99  ? 272  GLN A OE1 1 
ATOM   2101 N NE2 . GLN A 1 272 ? -12.211 64.538 71.521 1.00 35.05  ? 272  GLN A NE2 1 
ATOM   2102 N N   . GLU A 1 273 ? -15.715 60.756 69.855 1.00 28.08  ? 273  GLU A N   1 
ATOM   2103 C CA  . GLU A 1 273 ? -15.525 59.658 70.769 1.00 28.48  ? 273  GLU A CA  1 
ATOM   2104 C C   . GLU A 1 273 ? -14.523 58.783 70.189 1.00 27.49  ? 273  GLU A C   1 
ATOM   2105 O O   . GLU A 1 273 ? -13.892 58.076 70.961 1.00 28.97  ? 273  GLU A O   1 
ATOM   2106 C CB  . GLU A 1 273 ? -16.764 58.829 71.008 1.00 29.54  ? 273  GLU A CB  1 
ATOM   2107 C CG  . GLU A 1 273 ? -18.044 59.621 70.785 1.00 34.19  ? 273  GLU A CG  1 
ATOM   2108 C CD  . GLU A 1 273 ? -19.270 58.863 71.213 1.00 38.42  ? 273  GLU A CD  1 
ATOM   2109 O OE1 . GLU A 1 273 ? -19.127 57.963 72.090 1.00 37.21  ? 273  GLU A OE1 1 
ATOM   2110 O OE2 . GLU A 1 273 ? -20.355 59.188 70.649 1.00 43.17  ? 273  GLU A OE2 1 
ATOM   2111 N N   . LEU A 1 274 ? -14.377 58.781 68.854 1.00 25.21  ? 274  LEU A N   1 
ATOM   2112 C CA  . LEU A 1 274 ? -13.227 58.102 68.254 1.00 23.08  ? 274  LEU A CA  1 
ATOM   2113 C C   . LEU A 1 274 ? -11.955 58.798 68.760 1.00 21.91  ? 274  LEU A C   1 
ATOM   2114 O O   . LEU A 1 274 ? -11.070 58.158 69.333 1.00 20.72  ? 274  LEU A O   1 
ATOM   2115 C CB  . LEU A 1 274 ? -13.297 58.115 66.739 1.00 23.77  ? 274  LEU A CB  1 
ATOM   2116 C CG  . LEU A 1 274 ? -14.296 57.312 65.853 1.00 24.06  ? 274  LEU A CG  1 
ATOM   2117 C CD1 . LEU A 1 274 ? -14.252 55.855 66.056 1.00 24.59  ? 274  LEU A CD1 1 
ATOM   2118 C CD2 . LEU A 1 274 ? -15.666 57.766 66.131 1.00 24.95  ? 274  LEU A CD2 1 
ATOM   2119 N N   . ILE A 1 275 ? -11.898 60.127 68.630 1.00 21.01  ? 275  ILE A N   1 
ATOM   2120 C CA  . ILE A 1 275 ? -10.707 60.913 69.057 1.00 19.10  ? 275  ILE A CA  1 
ATOM   2121 C C   . ILE A 1 275 ? -10.361 60.674 70.506 1.00 18.84  ? 275  ILE A C   1 
ATOM   2122 O O   . ILE A 1 275 ? -9.203  60.467 70.831 1.00 19.18  ? 275  ILE A O   1 
ATOM   2123 C CB  . ILE A 1 275 ? -10.934 62.404 68.875 1.00 18.92  ? 275  ILE A CB  1 
ATOM   2124 C CG1 . ILE A 1 275 ? -11.487 62.665 67.494 1.00 15.72  ? 275  ILE A CG1 1 
ATOM   2125 C CG2 . ILE A 1 275 ? -9.671  63.260 69.266 1.00 18.68  ? 275  ILE A CG2 1 
ATOM   2126 C CD1 . ILE A 1 275 ? -10.835 63.803 66.834 1.00 15.21  ? 275  ILE A CD1 1 
ATOM   2127 N N   . ASP A 1 276 ? -11.358 60.695 71.372 1.00 18.15  ? 276  ASP A N   1 
ATOM   2128 C CA  . ASP A 1 276 ? -11.104 60.494 72.778 1.00 18.75  ? 276  ASP A CA  1 
ATOM   2129 C C   . ASP A 1 276 ? -10.306 59.238 73.109 1.00 17.89  ? 276  ASP A C   1 
ATOM   2130 O O   . ASP A 1 276 ? -9.596  59.239 74.082 1.00 17.14  ? 276  ASP A O   1 
ATOM   2131 C CB  . ASP A 1 276 ? -12.422 60.497 73.581 1.00 20.14  ? 276  ASP A CB  1 
ATOM   2132 C CG  . ASP A 1 276 ? -12.977 61.938 73.826 1.00 22.84  ? 276  ASP A CG  1 
ATOM   2133 O OD1 . ASP A 1 276 ? -12.230 62.914 73.855 1.00 24.47  ? 276  ASP A OD1 1 
ATOM   2134 O OD2 . ASP A 1 276 ? -14.199 62.119 73.962 1.00 30.03  ? 276  ASP A OD2 1 
ATOM   2135 N N   . VAL A 1 277 ? -10.415 58.165 72.329 1.00 17.77  ? 277  VAL A N   1 
ATOM   2136 C CA  . VAL A 1 277 ? -9.728  56.896 72.724 1.00 17.84  ? 277  VAL A CA  1 
ATOM   2137 C C   . VAL A 1 277 ? -8.628  56.420 71.827 1.00 17.41  ? 277  VAL A C   1 
ATOM   2138 O O   . VAL A 1 277 ? -8.011  55.407 72.113 1.00 16.05  ? 277  VAL A O   1 
ATOM   2139 C CB  . VAL A 1 277 ? -10.660 55.716 72.903 1.00 17.62  ? 277  VAL A CB  1 
ATOM   2140 C CG1 . VAL A 1 277 ? -11.536 55.988 74.024 1.00 18.11  ? 277  VAL A CG1 1 
ATOM   2141 C CG2 . VAL A 1 277 ? -11.484 55.471 71.639 1.00 19.03  ? 277  VAL A CG2 1 
ATOM   2142 N N   . GLU A 1 278 ? -8.386  57.195 70.769 1.00 18.61  ? 278  GLU A N   1 
ATOM   2143 C CA  . GLU A 1 278 ? -7.466  56.874 69.697 1.00 19.48  ? 278  GLU A CA  1 
ATOM   2144 C C   . GLU A 1 278 ? -6.116  56.451 70.232 1.00 20.92  ? 278  GLU A C   1 
ATOM   2145 O O   . GLU A 1 278 ? -5.637  55.406 69.849 1.00 21.25  ? 278  GLU A O   1 
ATOM   2146 C CB  . GLU A 1 278 ? -7.432  58.032 68.703 1.00 19.75  ? 278  GLU A CB  1 
ATOM   2147 C CG  . GLU A 1 278 ? -6.083  58.609 68.344 1.00 23.79  ? 278  GLU A CG  1 
ATOM   2148 C CD  . GLU A 1 278 ? -6.040  59.224 66.950 1.00 28.88  ? 278  GLU A CD  1 
ATOM   2149 O OE1 . GLU A 1 278 ? -5.364  58.607 66.022 1.00 34.88  ? 278  GLU A OE1 1 
ATOM   2150 O OE2 . GLU A 1 278 ? -6.656  60.310 66.787 1.00 27.24  ? 278  GLU A OE2 1 
ATOM   2151 N N   . TRP A 1 279 ? -5.531  57.207 71.177 1.00 23.34  ? 279  TRP A N   1 
ATOM   2152 C CA  . TRP A 1 279 ? -4.253  56.859 71.836 1.00 23.93  ? 279  TRP A CA  1 
ATOM   2153 C C   . TRP A 1 279 ? -4.226  55.544 72.627 1.00 24.07  ? 279  TRP A C   1 
ATOM   2154 O O   . TRP A 1 279 ? -3.160  54.999 72.750 1.00 24.35  ? 279  TRP A O   1 
ATOM   2155 C CB  . TRP A 1 279 ? -3.725  58.007 72.650 1.00 24.98  ? 279  TRP A CB  1 
ATOM   2156 C CG  . TRP A 1 279 ? -3.396  59.167 71.797 1.00 28.65  ? 279  TRP A CG  1 
ATOM   2157 C CD1 . TRP A 1 279 ? -4.222  60.225 71.508 1.00 31.23  ? 279  TRP A CD1 1 
ATOM   2158 C CD2 . TRP A 1 279 ? -2.158  59.428 71.096 1.00 33.55  ? 279  TRP A CD2 1 
ATOM   2159 N NE1 . TRP A 1 279 ? -3.594  61.126 70.679 1.00 29.87  ? 279  TRP A NE1 1 
ATOM   2160 C CE2 . TRP A 1 279 ? -2.329  60.685 70.401 1.00 33.26  ? 279  TRP A CE2 1 
ATOM   2161 C CE3 . TRP A 1 279 ? -0.901  58.747 71.007 1.00 33.53  ? 279  TRP A CE3 1 
ATOM   2162 C CZ2 . TRP A 1 279 ? -1.281  61.293 69.600 1.00 31.11  ? 279  TRP A CZ2 1 
ATOM   2163 C CZ3 . TRP A 1 279 ? 0.131   59.310 70.207 1.00 30.86  ? 279  TRP A CZ3 1 
ATOM   2164 C CH2 . TRP A 1 279 ? -0.077  60.610 69.511 1.00 32.12  ? 279  TRP A CH2 1 
ATOM   2165 N N   . ASN A 1 280 ? -5.357  54.980 73.077 1.00 24.08  ? 280  ASN A N   1 
ATOM   2166 C CA  . ASN A 1 280 ? -5.335  53.643 73.714 1.00 24.42  ? 280  ASN A CA  1 
ATOM   2167 C C   . ASN A 1 280 ? -4.997  52.400 72.912 1.00 24.77  ? 280  ASN A C   1 
ATOM   2168 O O   . ASN A 1 280 ? -4.789  51.327 73.477 1.00 24.39  ? 280  ASN A O   1 
ATOM   2169 C CB  . ASN A 1 280 ? -6.649  53.334 74.376 1.00 24.55  ? 280  ASN A CB  1 
ATOM   2170 C CG  . ASN A 1 280 ? -7.003  54.324 75.376 1.00 27.25  ? 280  ASN A CG  1 
ATOM   2171 O OD1 . ASN A 1 280 ? -6.154  55.027 75.823 1.00 33.41  ? 280  ASN A OD1 1 
ATOM   2172 N ND2 . ASN A 1 280 ? -8.277  54.446 75.707 1.00 30.57  ? 280  ASN A ND2 1 
ATOM   2173 N N   . VAL A 1 281 ? -5.022  52.485 71.604 1.00 25.93  ? 281  VAL A N   1 
ATOM   2174 C CA  . VAL A 1 281 ? -4.813  51.270 70.798 1.00 27.30  ? 281  VAL A CA  1 
ATOM   2175 C C   . VAL A 1 281 ? -3.343  50.982 70.574 1.00 27.65  ? 281  VAL A C   1 
ATOM   2176 O O   . VAL A 1 281 ? -3.034  49.956 70.027 1.00 27.71  ? 281  VAL A O   1 
ATOM   2177 C CB  . VAL A 1 281 ? -5.494  51.353 69.421 1.00 27.20  ? 281  VAL A CB  1 
ATOM   2178 C CG1 . VAL A 1 281 ? -7.015  51.512 69.572 1.00 27.31  ? 281  VAL A CG1 1 
ATOM   2179 C CG2 . VAL A 1 281 ? -4.894  52.556 68.608 1.00 27.91  ? 281  VAL A CG2 1 
ATOM   2180 N N   . LEU A 1 282 ? -2.445  51.864 71.002 1.00 28.65  ? 282  LEU A N   1 
ATOM   2181 C CA  . LEU A 1 282 ? -1.041  51.645 70.770 1.00 30.25  ? 282  LEU A CA  1 
ATOM   2182 C C   . LEU A 1 282 ? -0.667  50.298 71.379 1.00 32.12  ? 282  LEU A C   1 
ATOM   2183 O O   . LEU A 1 282 ? -1.175  49.947 72.432 1.00 33.34  ? 282  LEU A O   1 
ATOM   2184 C CB  . LEU A 1 282 ? -0.232  52.781 71.386 1.00 30.65  ? 282  LEU A CB  1 
ATOM   2185 C CG  . LEU A 1 282 ? 0.137   54.033 70.548 1.00 29.26  ? 282  LEU A CG  1 
ATOM   2186 C CD1 . LEU A 1 282 ? 1.359   53.782 69.781 1.00 26.67  ? 282  LEU A CD1 1 
ATOM   2187 C CD2 . LEU A 1 282 ? -0.937  54.359 69.577 1.00 28.46  ? 282  LEU A CD2 1 
ATOM   2188 N N   . PRO A 1 283 ? 0.210   49.524 70.727 1.00 32.92  ? 283  PRO A N   1 
ATOM   2189 C CA  . PRO A 1 283 ? 0.529   48.173 71.181 1.00 32.95  ? 283  PRO A CA  1 
ATOM   2190 C C   . PRO A 1 283 ? 1.533   48.145 72.308 1.00 33.91  ? 283  PRO A C   1 
ATOM   2191 O O   . PRO A 1 283 ? 1.623   47.150 73.020 1.00 34.35  ? 283  PRO A O   1 
ATOM   2192 C CB  . PRO A 1 283 ? 1.230   47.558 69.986 1.00 32.38  ? 283  PRO A CB  1 
ATOM   2193 C CG  . PRO A 1 283 ? 1.050   48.524 68.893 1.00 33.86  ? 283  PRO A CG  1 
ATOM   2194 C CD  . PRO A 1 283 ? 0.960   49.867 69.523 1.00 33.23  ? 283  PRO A CD  1 
ATOM   2195 N N   . PHE A 1 284 ? 2.327   49.384 72.680 1.00 20.00  ? 284  PHE A N   1 
ATOM   2196 C CA  . PHE A 1 284 ? 3.646   49.636 73.250 1.00 20.00  ? 284  PHE A CA  1 
ATOM   2197 C C   . PHE A 1 284 ? 3.669   50.952 74.020 1.00 20.00  ? 284  PHE A C   1 
ATOM   2198 O O   . PHE A 1 284 ? 2.722   51.807 73.808 1.00 32.13  ? 284  PHE A O   1 
ATOM   2199 C CB  . PHE A 1 284 ? 4.710   49.651 72.151 1.00 20.00  ? 284  PHE A CB  1 
ATOM   2200 C CG  . PHE A 1 284 ? 4.946   48.309 71.518 1.00 20.00  ? 284  PHE A CG  1 
ATOM   2201 C CD1 . PHE A 1 284 ? 4.486   47.151 72.121 1.00 20.00  ? 284  PHE A CD1 1 
ATOM   2202 C CD2 . PHE A 1 284 ? 5.627   48.207 70.316 1.00 20.00  ? 284  PHE A CD2 1 
ATOM   2203 C CE1 . PHE A 1 284 ? 4.700   45.918 71.539 1.00 20.00  ? 284  PHE A CE1 1 
ATOM   2204 C CE2 . PHE A 1 284 ? 5.846   46.975 69.730 1.00 20.00  ? 284  PHE A CE2 1 
ATOM   2205 C CZ  . PHE A 1 284 ? 5.382   45.828 70.342 1.00 20.00  ? 284  PHE A CZ  1 
ATOM   2206 N N   . ASP A 1 285 ? 4.219   50.795 75.069 1.00 31.61  ? 285  ASP A N   1 
ATOM   2207 C CA  . ASP A 1 285 ? 4.488   52.129 75.578 1.00 31.01  ? 285  ASP A CA  1 
ATOM   2208 C C   . ASP A 1 285 ? 5.630   52.730 74.729 1.00 29.97  ? 285  ASP A C   1 
ATOM   2209 O O   . ASP A 1 285 ? 6.689   52.149 74.656 1.00 29.10  ? 285  ASP A O   1 
ATOM   2210 C CB  . ASP A 1 285 ? 4.874   52.078 77.068 1.00 31.44  ? 285  ASP A CB  1 
ATOM   2211 C CG  . ASP A 1 285 ? 4.877   53.460 77.733 1.00 33.36  ? 285  ASP A CG  1 
ATOM   2212 O OD1 . ASP A 1 285 ? 5.433   53.576 78.855 1.00 34.44  ? 285  ASP A OD1 1 
ATOM   2213 O OD2 . ASP A 1 285 ? 4.305   54.426 77.144 1.00 35.75  ? 285  ASP A OD2 1 
ATOM   2214 N N   . SER A 1 286 ? 5.433   53.896 74.090 1.00 28.66  ? 286  SER A N   1 
ATOM   2215 C CA  . SER A 1 286 ? 6.410   54.371 73.083 1.00 26.50  ? 286  SER A CA  1 
ATOM   2216 C C   . SER A 1 286 ? 6.461   55.848 72.938 1.00 24.61  ? 286  SER A C   1 
ATOM   2217 O O   . SER A 1 286 ? 5.816   56.507 73.694 1.00 26.06  ? 286  SER A O   1 
ATOM   2218 C CB  . SER A 1 286 ? 6.094   53.773 71.749 1.00 26.51  ? 286  SER A CB  1 
ATOM   2219 O OG  . SER A 1 286 ? 4.773   54.066 71.405 1.00 28.60  ? 286  SER A OG  1 
ATOM   2220 N N   . ILE A 1 287 ? 7.187   56.547 72.220 1.00 20.00  ? 287  ILE A N   1 
ATOM   2221 C CA  . ILE A 1 287 ? 7.103   57.915 71.726 1.00 20.00  ? 287  ILE A CA  1 
ATOM   2222 C C   . ILE A 1 287 ? 7.317   57.973 70.217 1.00 20.00  ? 287  ILE A C   1 
ATOM   2223 O O   . ILE A 1 287 ? 8.352   57.255 69.809 1.00 18.84  ? 287  ILE A O   1 
ATOM   2224 C CB  . ILE A 1 287 ? 8.133   58.811 72.441 1.00 20.00  ? 287  ILE A CB  1 
ATOM   2225 C CG1 . ILE A 1 287 ? 9.554   58.309 72.172 1.00 20.00  ? 287  ILE A CG1 1 
ATOM   2226 C CG2 . ILE A 1 287 ? 7.853   58.858 73.934 1.00 20.00  ? 287  ILE A CG2 1 
ATOM   2227 C CD1 . ILE A 1 287 ? 10.635  59.249 72.655 1.00 20.00  ? 287  ILE A CD1 1 
ATOM   2228 N N   . PHE A 1 288 ? 6.933   58.894 69.700 1.00 16.46  ? 288  PHE A N   1 
ATOM   2229 C CA  . PHE A 1 288 ? 6.989   58.978 68.213 1.00 13.88  ? 288  PHE A CA  1 
ATOM   2230 C C   . PHE A 1 288 ? 6.360   57.747 67.533 1.00 13.52  ? 288  PHE A C   1 
ATOM   2231 O O   . PHE A 1 288 ? 6.907   57.190 66.548 1.00 11.87  ? 288  PHE A O   1 
ATOM   2232 C CB  . PHE A 1 288 ? 8.424   59.060 67.701 1.00 13.00  ? 288  PHE A CB  1 
ATOM   2233 C CG  . PHE A 1 288 ? 8.607   60.008 66.545 1.00 12.35  ? 288  PHE A CG  1 
ATOM   2234 C CD1 . PHE A 1 288 ? 7.700   60.041 65.499 1.00 6.84   ? 288  PHE A CD1 1 
ATOM   2235 C CD2 . PHE A 1 288 ? 9.737   60.886 66.512 1.00 12.06  ? 288  PHE A CD2 1 
ATOM   2236 C CE1 . PHE A 1 288 ? 7.896   60.967 64.470 1.00 11.12  ? 288  PHE A CE1 1 
ATOM   2237 C CE2 . PHE A 1 288 ? 9.961   61.788 65.485 1.00 7.69   ? 288  PHE A CE2 1 
ATOM   2238 C CZ  . PHE A 1 288 ? 9.070   61.851 64.463 1.00 8.72   ? 288  PHE A CZ  1 
ATOM   2239 N N   . ARG A 1 289 ? 5.223   57.310 68.066 1.00 13.09  ? 289  ARG A N   1 
ATOM   2240 C CA  . ARG A 1 289 ? 4.437   56.333 67.342 1.00 14.03  ? 289  ARG A CA  1 
ATOM   2241 C C   . ARG A 1 289 ? 2.945   56.766 67.266 1.00 14.64  ? 289  ARG A C   1 
ATOM   2242 O O   . ARG A 1 289 ? 2.464   57.469 68.218 1.00 14.78  ? 289  ARG A O   1 
ATOM   2243 C CB  . ARG A 1 289 ? 4.644   54.984 67.945 1.00 12.92  ? 289  ARG A CB  1 
ATOM   2244 C CG  . ARG A 1 289 ? 6.048   54.629 67.890 1.00 13.86  ? 289  ARG A CG  1 
ATOM   2245 C CD  . ARG A 1 289 ? 6.310   53.963 66.606 1.00 17.46  ? 289  ARG A CD  1 
ATOM   2246 N NE  . ARG A 1 289 ? 7.578   53.192 66.565 1.00 15.63  ? 289  ARG A NE  1 
ATOM   2247 C CZ  . ARG A 1 289 ? 8.817   53.662 66.376 1.00 12.05  ? 289  ARG A CZ  1 
ATOM   2248 N NH1 . ARG A 1 289 ? 9.063   54.964 66.292 1.00 3.66   ? 289  ARG A NH1 1 
ATOM   2249 N NH2 . ARG A 1 289 ? 9.836   52.768 66.307 1.00 16.22  ? 289  ARG A NH2 1 
ATOM   2250 N N   . PHE A 1 290 ? 2.259   56.440 66.159 1.00 13.13  ? 290  PHE A N   1 
ATOM   2251 C CA  . PHE A 1 290 ? 0.926   56.878 66.101 1.00 14.62  ? 290  PHE A CA  1 
ATOM   2252 C C   . PHE A 1 290 ? -0.059  55.815 65.776 1.00 16.20  ? 290  PHE A C   1 
ATOM   2253 O O   . PHE A 1 290 ? 0.233   54.825 65.116 1.00 17.38  ? 290  PHE A O   1 
ATOM   2254 C CB  . PHE A 1 290 ? 0.796   58.083 65.188 1.00 14.72  ? 290  PHE A CB  1 
ATOM   2255 C CG  . PHE A 1 290 ? 1.956   59.023 65.306 1.00 16.85  ? 290  PHE A CG  1 
ATOM   2256 C CD1 . PHE A 1 290 ? 2.016   59.969 66.359 1.00 17.28  ? 290  PHE A CD1 1 
ATOM   2257 C CD2 . PHE A 1 290 ? 3.041   58.932 64.415 1.00 17.12  ? 290  PHE A CD2 1 
ATOM   2258 C CE1 . PHE A 1 290 ? 3.112   60.832 66.504 1.00 17.51  ? 290  PHE A CE1 1 
ATOM   2259 C CE2 . PHE A 1 290 ? 4.153   59.804 64.531 1.00 17.34  ? 290  PHE A CE2 1 
ATOM   2260 C CZ  . PHE A 1 290 ? 4.201   60.760 65.577 1.00 15.49  ? 290  PHE A CZ  1 
ATOM   2261 N N   . SER A 1 291 ? -1.280  56.044 66.206 1.00 16.88  ? 291  SER A N   1 
ATOM   2262 C CA  . SER A 1 291 ? -2.272  54.996 66.147 1.00 17.58  ? 291  SER A CA  1 
ATOM   2263 C C   . SER A 1 291 ? -2.591  54.474 64.715 1.00 16.55  ? 291  SER A C   1 
ATOM   2264 O O   . SER A 1 291 ? -2.317  53.283 64.373 1.00 14.55  ? 291  SER A O   1 
ATOM   2265 C CB  . SER A 1 291 ? -3.531  55.547 66.833 1.00 18.89  ? 291  SER A CB  1 
ATOM   2266 O OG  . SER A 1 291 ? -3.447  55.528 68.284 1.00 21.71  ? 291  SER A OG  1 
ATOM   2267 N N   . PHE A 1 292 ? -3.191  55.404 63.936 1.00 15.49  ? 292  PHE A N   1 
ATOM   2268 C CA  . PHE A 1 292 ? -3.663  55.212 62.577 1.00 13.64  ? 292  PHE A CA  1 
ATOM   2269 C C   . PHE A 1 292 ? -2.830  55.909 61.519 1.00 13.60  ? 292  PHE A C   1 
ATOM   2270 O O   . PHE A 1 292 ? -2.487  57.166 61.591 1.00 15.46  ? 292  PHE A O   1 
ATOM   2271 C CB  . PHE A 1 292 ? -5.037  55.723 62.561 1.00 13.83  ? 292  PHE A CB  1 
ATOM   2272 C CG  . PHE A 1 292 ? -5.889  54.974 63.475 1.00 15.13  ? 292  PHE A CG  1 
ATOM   2273 C CD1 . PHE A 1 292 ? -6.356  55.546 64.648 1.00 15.78  ? 292  PHE A CD1 1 
ATOM   2274 C CD2 . PHE A 1 292 ? -6.177  53.634 63.220 1.00 13.95  ? 292  PHE A CD2 1 
ATOM   2275 C CE1 . PHE A 1 292 ? -7.137  54.795 65.560 1.00 13.14  ? 292  PHE A CE1 1 
ATOM   2276 C CE2 . PHE A 1 292 ? -6.951  52.904 64.113 1.00 13.51  ? 292  PHE A CE2 1 
ATOM   2277 C CZ  . PHE A 1 292 ? -7.402  53.488 65.308 1.00 13.64  ? 292  PHE A CZ  1 
ATOM   2278 N N   . VAL A 1 293 ? -2.521  55.091 60.521 1.00 11.63  ? 293  VAL A N   1 
ATOM   2279 C CA  . VAL A 1 293 ? -1.281  55.204 59.784 1.00 9.08   ? 293  VAL A CA  1 
ATOM   2280 C C   . VAL A 1 293 ? -1.408  54.421 58.464 1.00 7.99   ? 293  VAL A C   1 
ATOM   2281 O O   . VAL A 1 293 ? -2.153  53.452 58.443 1.00 7.55   ? 293  VAL A O   1 
ATOM   2282 C CB  . VAL A 1 293 ? -0.151  54.702 60.700 1.00 8.22   ? 293  VAL A CB  1 
ATOM   2283 C CG1 . VAL A 1 293 ? 0.691   53.762 59.965 1.00 8.19   ? 293  VAL A CG1 1 
ATOM   2284 C CG2 . VAL A 1 293 ? 0.619   55.883 61.249 1.00 6.79   ? 293  VAL A CG2 1 
ATOM   2285 N N   . PRO A 1 294 ? -0.765  54.898 57.350 1.00 7.52   ? 294  PRO A N   1 
ATOM   2286 C CA  . PRO A 1 294 ? -0.704  54.107 56.143 1.00 6.76   ? 294  PRO A CA  1 
ATOM   2287 C C   . PRO A 1 294 ? -0.430  52.639 56.447 1.00 7.96   ? 294  PRO A C   1 
ATOM   2288 O O   . PRO A 1 294 ? 0.482   52.260 57.253 1.00 7.41   ? 294  PRO A O   1 
ATOM   2289 C CB  . PRO A 1 294 ? 0.462   54.722 55.377 1.00 4.68   ? 294  PRO A CB  1 
ATOM   2290 C CG  . PRO A 1 294 ? 0.357   56.192 55.714 1.00 5.01   ? 294  PRO A CG  1 
ATOM   2291 C CD  . PRO A 1 294 ? -0.091  56.224 57.154 1.00 7.67   ? 294  PRO A CD  1 
ATOM   2292 N N   . VAL A 1 295 ? -1.254  51.814 55.813 1.00 8.75   ? 295  VAL A N   1 
ATOM   2293 C CA  . VAL A 1 295 ? -1.101  50.394 55.915 1.00 9.99   ? 295  VAL A CA  1 
ATOM   2294 C C   . VAL A 1 295 ? -0.564  49.838 54.587 1.00 11.62  ? 295  VAL A C   1 
ATOM   2295 O O   . VAL A 1 295 ? -0.899  50.370 53.449 1.00 11.67  ? 295  VAL A O   1 
ATOM   2296 C CB  . VAL A 1 295 ? -2.446  49.825 56.229 1.00 9.92   ? 295  VAL A CB  1 
ATOM   2297 C CG1 . VAL A 1 295 ? -3.255  49.436 54.948 1.00 8.33   ? 295  VAL A CG1 1 
ATOM   2298 C CG2 . VAL A 1 295 ? -2.247  48.687 57.050 1.00 11.55  ? 295  VAL A CG2 1 
ATOM   2299 N N   . ILE A 1 296 ? 0.270   48.807 54.698 1.00 11.91  ? 296  ILE A N   1 
ATOM   2300 C CA  . ILE A 1 296 ? 0.951   48.249 53.481 1.00 13.74  ? 296  ILE A CA  1 
ATOM   2301 C C   . ILE A 1 296 ? 0.005   47.272 52.819 1.00 15.55  ? 296  ILE A C   1 
ATOM   2302 O O   . ILE A 1 296 ? 0.182   46.072 52.960 1.00 16.53  ? 296  ILE A O   1 
ATOM   2303 C CB  . ILE A 1 296 ? 2.374   47.582 53.748 1.00 12.40  ? 296  ILE A CB  1 
ATOM   2304 C CG1 . ILE A 1 296 ? 3.337   48.588 54.414 1.00 14.37  ? 296  ILE A CG1 1 
ATOM   2305 C CG2 . ILE A 1 296 ? 3.025   47.108 52.498 1.00 10.97  ? 296  ILE A CG2 1 
ATOM   2306 C CD1 . ILE A 1 296 ? 3.393   49.970 53.791 1.00 17.76  ? 296  ILE A CD1 1 
ATOM   2307 N N   . ASP A 1 297 ? -0.999  47.778 52.106 1.00 16.85  ? 297  ASP A N   1 
ATOM   2308 C CA  . ASP A 1 297 ? -2.118  46.957 51.726 1.00 18.62  ? 297  ASP A CA  1 
ATOM   2309 C C   . ASP A 1 297 ? -1.912  46.118 50.495 1.00 19.90  ? 297  ASP A C   1 
ATOM   2310 O O   . ASP A 1 297 ? -2.752  45.315 50.178 1.00 19.29  ? 297  ASP A O   1 
ATOM   2311 C CB  . ASP A 1 297 ? -3.336  47.836 51.491 1.00 19.42  ? 297  ASP A CB  1 
ATOM   2312 C CG  . ASP A 1 297 ? -3.085  48.895 50.389 1.00 21.72  ? 297  ASP A CG  1 
ATOM   2313 O OD1 . ASP A 1 297 ? -4.095  49.549 49.974 1.00 19.18  ? 297  ASP A OD1 1 
ATOM   2314 O OD2 . ASP A 1 297 ? -1.871  49.044 49.963 1.00 23.01  ? 297  ASP A OD2 1 
ATOM   2315 N N   . GLY A 1 298 ? -0.862  46.346 49.730 1.00 22.36  ? 298  GLY A N   1 
ATOM   2316 C CA  . GLY A 1 298 ? -0.781  45.643 48.436 1.00 24.93  ? 298  GLY A CA  1 
ATOM   2317 C C   . GLY A 1 298 ? -1.571  46.261 47.278 1.00 26.66  ? 298  GLY A C   1 
ATOM   2318 O O   . GLY A 1 298 ? -1.420  45.850 46.137 1.00 27.86  ? 298  GLY A O   1 
ATOM   2319 N N   . GLU A 1 299 ? -2.431  47.226 47.533 1.00 27.13  ? 299  GLU A N   1 
ATOM   2320 C CA  . GLU A 1 299 ? -3.064  47.898 46.436 1.00 28.79  ? 299  GLU A CA  1 
ATOM   2321 C C   . GLU A 1 299 ? -2.467  49.333 46.263 1.00 27.44  ? 299  GLU A C   1 
ATOM   2322 O O   . GLU A 1 299 ? -1.801  49.681 45.266 1.00 27.30  ? 299  GLU A O   1 
ATOM   2323 C CB  . GLU A 1 299 ? -4.503  47.960 46.747 1.00 30.32  ? 299  GLU A CB  1 
ATOM   2324 C CG  . GLU A 1 299 ? -5.351  48.120 45.508 1.00 42.65  ? 299  GLU A CG  1 
ATOM   2325 C CD  . GLU A 1 299 ? -6.766  48.703 45.871 1.00 55.57  ? 299  GLU A CD  1 
ATOM   2326 O OE1 . GLU A 1 299 ? -7.406  48.167 46.844 1.00 55.87  ? 299  GLU A OE1 1 
ATOM   2327 O OE2 . GLU A 1 299 ? -7.225  49.692 45.184 1.00 63.08  ? 299  GLU A OE2 1 
ATOM   2328 N N   . PHE A 1 300 ? -2.636  50.186 47.259 1.00 25.73  ? 300  PHE A N   1 
ATOM   2329 C CA  . PHE A 1 300 ? -1.758  51.332 47.295 1.00 22.71  ? 300  PHE A CA  1 
ATOM   2330 C C   . PHE A 1 300 ? -0.239  50.993 47.123 1.00 21.31  ? 300  PHE A C   1 
ATOM   2331 O O   . PHE A 1 300 ? 0.418   51.501 46.248 1.00 20.14  ? 300  PHE A O   1 
ATOM   2332 C CB  . PHE A 1 300 ? -2.036  52.167 48.522 1.00 21.83  ? 300  PHE A CB  1 
ATOM   2333 C CG  . PHE A 1 300 ? -1.699  53.631 48.315 1.00 20.70  ? 300  PHE A CG  1 
ATOM   2334 C CD1 . PHE A 1 300 ? -2.704  54.546 48.004 1.00 16.52  ? 300  PHE A CD1 1 
ATOM   2335 C CD2 . PHE A 1 300 ? -0.370  54.084 48.426 1.00 17.28  ? 300  PHE A CD2 1 
ATOM   2336 C CE1 . PHE A 1 300 ? -2.403  55.869 47.847 1.00 18.77  ? 300  PHE A CE1 1 
ATOM   2337 C CE2 . PHE A 1 300 ? -0.039  55.401 48.252 1.00 15.59  ? 300  PHE A CE2 1 
ATOM   2338 C CZ  . PHE A 1 300 ? -1.054  56.310 47.945 1.00 19.02  ? 300  PHE A CZ  1 
ATOM   2339 N N   . PHE A 1 301 ? 0.311   50.160 47.974 1.00 20.46  ? 301  PHE A N   1 
ATOM   2340 C CA  . PHE A 1 301 ? 1.694   49.825 47.804 1.00 21.02  ? 301  PHE A CA  1 
ATOM   2341 C C   . PHE A 1 301 ? 1.695   48.416 47.217 1.00 21.44  ? 301  PHE A C   1 
ATOM   2342 O O   . PHE A 1 301 ? 1.236   47.486 47.868 1.00 21.78  ? 301  PHE A O   1 
ATOM   2343 C CB  . PHE A 1 301 ? 2.492   49.885 49.145 1.00 20.38  ? 301  PHE A CB  1 
ATOM   2344 C CG  . PHE A 1 301 ? 2.297   51.135 49.897 1.00 19.54  ? 301  PHE A CG  1 
ATOM   2345 C CD1 . PHE A 1 301 ? 3.094   52.232 49.646 1.00 15.73  ? 301  PHE A CD1 1 
ATOM   2346 C CD2 . PHE A 1 301 ? 1.229   51.258 50.809 1.00 22.36  ? 301  PHE A CD2 1 
ATOM   2347 C CE1 . PHE A 1 301 ? 2.863   53.449 50.301 1.00 14.01  ? 301  PHE A CE1 1 
ATOM   2348 C CE2 . PHE A 1 301 ? 0.980   52.477 51.476 1.00 19.23  ? 301  PHE A CE2 1 
ATOM   2349 C CZ  . PHE A 1 301 ? 1.813   53.572 51.217 1.00 15.79  ? 301  PHE A CZ  1 
ATOM   2350 N N   . PRO A 1 302 ? 2.176   48.247 45.981 1.00 21.62  ? 302  PRO A N   1 
ATOM   2351 C CA  . PRO A 1 302 ? 2.123   46.880 45.436 1.00 21.90  ? 302  PRO A CA  1 
ATOM   2352 C C   . PRO A 1 302 ? 2.906   45.926 46.274 1.00 22.08  ? 302  PRO A C   1 
ATOM   2353 O O   . PRO A 1 302 ? 2.603   44.769 46.324 1.00 22.70  ? 302  PRO A O   1 
ATOM   2354 C CB  . PRO A 1 302 ? 2.725   46.996 44.039 1.00 20.79  ? 302  PRO A CB  1 
ATOM   2355 C CG  . PRO A 1 302 ? 3.483   48.262 44.068 1.00 23.60  ? 302  PRO A CG  1 
ATOM   2356 C CD  . PRO A 1 302 ? 2.729   49.197 45.019 1.00 21.84  ? 302  PRO A CD  1 
ATOM   2357 N N   . THR A 1 303 ? 3.907   46.372 46.972 1.00 23.18  ? 303  THR A N   1 
ATOM   2358 C CA  . THR A 1 303 ? 4.669   45.359 47.690 1.00 24.38  ? 303  THR A CA  1 
ATOM   2359 C C   . THR A 1 303 ? 5.344   45.987 48.867 1.00 24.19  ? 303  THR A C   1 
ATOM   2360 O O   . THR A 1 303 ? 4.949   47.048 49.293 1.00 24.65  ? 303  THR A O   1 
ATOM   2361 C CB  . THR A 1 303 ? 5.632   44.526 46.776 1.00 24.26  ? 303  THR A CB  1 
ATOM   2362 O OG1 . THR A 1 303 ? 6.126   43.451 47.550 1.00 27.19  ? 303  THR A OG1 1 
ATOM   2363 C CG2 . THR A 1 303 ? 6.847   45.326 46.270 1.00 26.30  ? 303  THR A CG2 1 
ATOM   2364 N N   . SER A 1 304 ? 6.318   45.359 49.459 1.00 24.33  ? 304  SER A N   1 
ATOM   2365 C CA  . SER A 1 304 ? 6.798   46.018 50.627 1.00 25.42  ? 304  SER A CA  1 
ATOM   2366 C C   . SER A 1 304 ? 7.716   47.231 50.276 1.00 26.08  ? 304  SER A C   1 
ATOM   2367 O O   . SER A 1 304 ? 8.374   47.326 49.221 1.00 27.13  ? 304  SER A O   1 
ATOM   2368 C CB  . SER A 1 304 ? 7.468   45.056 51.584 1.00 24.78  ? 304  SER A CB  1 
ATOM   2369 O OG  . SER A 1 304 ? 8.738   44.814 51.023 1.00 24.67  ? 304  SER A OG  1 
ATOM   2370 N N   . LEU A 1 305 ? 7.724   48.178 51.192 1.00 26.09  ? 305  LEU A N   1 
ATOM   2371 C CA  . LEU A 1 305 ? 8.433   49.336 50.992 1.00 25.80  ? 305  LEU A CA  1 
ATOM   2372 C C   . LEU A 1 305 ? 9.813   48.929 50.638 1.00 26.00  ? 305  LEU A C   1 
ATOM   2373 O O   . LEU A 1 305 ? 10.380  49.483 49.746 1.00 25.52  ? 305  LEU A O   1 
ATOM   2374 C CB  . LEU A 1 305 ? 8.392   50.095 52.268 1.00 25.68  ? 305  LEU A CB  1 
ATOM   2375 C CG  . LEU A 1 305 ? 7.600   51.376 52.147 1.00 26.65  ? 305  LEU A CG  1 
ATOM   2376 C CD1 . LEU A 1 305 ? 6.267   51.118 51.514 1.00 24.27  ? 305  LEU A CD1 1 
ATOM   2377 C CD2 . LEU A 1 305 ? 7.524   52.051 53.544 1.00 25.70  ? 305  LEU A CD2 1 
ATOM   2378 N N   . GLU A 1 306 ? 10.360  47.942 51.323 1.00 28.28  ? 306  GLU A N   1 
ATOM   2379 C CA  . GLU A 1 306 ? 11.815  47.825 51.296 1.00 28.53  ? 306  GLU A CA  1 
ATOM   2380 C C   . GLU A 1 306 ? 12.237  47.307 49.946 1.00 28.41  ? 306  GLU A C   1 
ATOM   2381 O O   . GLU A 1 306 ? 13.180  47.815 49.330 1.00 28.30  ? 306  GLU A O   1 
ATOM   2382 C CB  . GLU A 1 306 ? 12.345  46.964 52.452 1.00 29.22  ? 306  GLU A CB  1 
ATOM   2383 C CG  . GLU A 1 306 ? 13.898  46.643 52.430 1.00 32.99  ? 306  GLU A CG  1 
ATOM   2384 C CD  . GLU A 1 306 ? 14.850  47.907 52.358 1.00 46.76  ? 306  GLU A CD  1 
ATOM   2385 O OE1 . GLU A 1 306 ? 15.985  47.821 51.758 1.00 47.24  ? 306  GLU A OE1 1 
ATOM   2386 O OE2 . GLU A 1 306 ? 14.446  48.990 52.907 1.00 52.03  ? 306  GLU A OE2 1 
ATOM   2387 N N   . SER A 1 307 ? 11.498  46.319 49.465 1.00 27.90  ? 307  SER A N   1 
ATOM   2388 C CA  . SER A 1 307 ? 11.850  45.711 48.212 1.00 28.20  ? 307  SER A CA  1 
ATOM   2389 C C   . SER A 1 307 ? 11.499  46.614 47.005 1.00 28.45  ? 307  SER A C   1 
ATOM   2390 O O   . SER A 1 307 ? 12.168  46.497 45.967 1.00 29.45  ? 307  SER A O   1 
ATOM   2391 C CB  . SER A 1 307 ? 11.157  44.393 48.084 1.00 27.49  ? 307  SER A CB  1 
ATOM   2392 O OG  . SER A 1 307 ? 9.822   44.728 48.101 1.00 27.35  ? 307  SER A OG  1 
ATOM   2393 N N   . MET A 1 308 ? 10.486  47.486 47.129 1.00 27.15  ? 308  MET A N   1 
ATOM   2394 C CA  . MET A 1 308 ? 10.263  48.508 46.111 1.00 27.05  ? 308  MET A CA  1 
ATOM   2395 C C   . MET A 1 308 ? 11.538  49.363 45.958 1.00 26.89  ? 308  MET A C   1 
ATOM   2396 O O   . MET A 1 308 ? 12.055  49.620 44.839 1.00 26.22  ? 308  MET A O   1 
ATOM   2397 C CB  . MET A 1 308 ? 8.995   49.352 46.394 1.00 25.90  ? 308  MET A CB  1 
ATOM   2398 C CG  . MET A 1 308 ? 7.740   48.540 46.369 1.00 25.91  ? 308  MET A CG  1 
ATOM   2399 S SD  . MET A 1 308 ? 6.181   49.434 46.397 1.00 28.65  ? 308  MET A SD  1 
ATOM   2400 C CE  . MET A 1 308 ? 6.244   50.606 45.037 1.00 28.43  ? 308  MET A CE  1 
ATOM   2401 N N   . LEU A 1 309 ? 12.062  49.765 47.108 1.00 27.58  ? 309  LEU A N   1 
ATOM   2402 C CA  . LEU A 1 309 ? 13.187  50.659 47.138 1.00 28.19  ? 309  LEU A CA  1 
ATOM   2403 C C   . LEU A 1 309 ? 14.311  49.925 46.442 1.00 29.40  ? 309  LEU A C   1 
ATOM   2404 O O   . LEU A 1 309 ? 15.065  50.506 45.626 1.00 30.25  ? 309  LEU A O   1 
ATOM   2405 C CB  . LEU A 1 309 ? 13.558  51.060 48.561 1.00 26.83  ? 309  LEU A CB  1 
ATOM   2406 C CG  . LEU A 1 309 ? 12.761  52.286 49.041 1.00 27.57  ? 309  LEU A CG  1 
ATOM   2407 C CD1 . LEU A 1 309 ? 13.008  52.468 50.480 1.00 30.87  ? 309  LEU A CD1 1 
ATOM   2408 C CD2 . LEU A 1 309 ? 13.095  53.571 48.433 1.00 24.04  ? 309  LEU A CD2 1 
ATOM   2409 N N   . ASN A 1 310 ? 14.373  48.627 46.714 1.00 30.34  ? 310  ASN A N   1 
ATOM   2410 C CA  . ASN A 1 310 ? 15.473  47.796 46.265 1.00 31.04  ? 310  ASN A CA  1 
ATOM   2411 C C   . ASN A 1 310 ? 15.648  47.612 44.809 1.00 29.42  ? 310  ASN A C   1 
ATOM   2412 O O   . ASN A 1 310 ? 16.768  47.551 44.329 1.00 29.39  ? 310  ASN A O   1 
ATOM   2413 C CB  . ASN A 1 310 ? 15.307  46.439 46.841 1.00 32.94  ? 310  ASN A CB  1 
ATOM   2414 C CG  . ASN A 1 310 ? 16.181  46.267 47.994 1.00 40.32  ? 310  ASN A CG  1 
ATOM   2415 O OD1 . ASN A 1 310 ? 17.252  46.931 48.068 1.00 44.87  ? 310  ASN A OD1 1 
ATOM   2416 N ND2 . ASN A 1 310 ? 15.748  45.422 48.960 1.00 47.11  ? 310  ASN A ND2 1 
ATOM   2417 N N   . SER A 1 311 ? 14.523  47.523 44.114 1.00 27.47  ? 311  SER A N   1 
ATOM   2418 C CA  . SER A 1 311 ? 14.536  47.274 42.698 1.00 25.54  ? 311  SER A CA  1 
ATOM   2419 C C   . SER A 1 311 ? 14.070  48.423 41.837 1.00 23.62  ? 311  SER A C   1 
ATOM   2420 O O   . SER A 1 311 ? 13.438  48.162 40.855 1.00 23.40  ? 311  SER A O   1 
ATOM   2421 C CB  . SER A 1 311 ? 13.601  46.129 42.438 1.00 25.13  ? 311  SER A CB  1 
ATOM   2422 O OG  . SER A 1 311 ? 12.496  46.346 43.257 1.00 25.72  ? 311  SER A OG  1 
ATOM   2423 N N   . GLY A 1 312 ? 14.326  49.669 42.206 1.00 22.18  ? 312  GLY A N   1 
ATOM   2424 C CA  . GLY A 1 312 ? 13.803  50.830 41.470 1.00 19.81  ? 312  GLY A CA  1 
ATOM   2425 C C   . GLY A 1 312 ? 12.284  50.878 41.195 1.00 18.97  ? 312  GLY A C   1 
ATOM   2426 O O   . GLY A 1 312 ? 11.826  51.520 40.228 1.00 18.23  ? 312  GLY A O   1 
ATOM   2427 N N   . ASN A 1 313 ? 11.457  50.229 42.002 1.00 17.06  ? 313  ASN A N   1 
ATOM   2428 C CA  . ASN A 1 313 ? 10.099  50.287 41.600 1.00 15.46  ? 313  ASN A CA  1 
ATOM   2429 C C   . ASN A 1 313 ? 9.475   51.556 42.172 1.00 15.23  ? 313  ASN A C   1 
ATOM   2430 O O   . ASN A 1 313 ? 8.800   51.525 43.204 1.00 14.37  ? 313  ASN A O   1 
ATOM   2431 C CB  . ASN A 1 313 ? 9.390   49.016 41.992 1.00 16.34  ? 313  ASN A CB  1 
ATOM   2432 C CG  . ASN A 1 313 ? 7.869   49.056 41.703 1.00 16.78  ? 313  ASN A CG  1 
ATOM   2433 O OD1 . ASN A 1 313 ? 7.357   49.945 40.997 1.00 14.79  ? 313  ASN A OD1 1 
ATOM   2434 N ND2 . ASN A 1 313 ? 7.144   48.094 42.299 1.00 18.19  ? 313  ASN A ND2 1 
ATOM   2435 N N   . PHE A 1 314 ? 9.731   52.678 41.482 1.00 14.81  ? 314  PHE A N   1 
ATOM   2436 C CA  . PHE A 1 314 ? 9.245   53.974 41.904 1.00 14.70  ? 314  PHE A CA  1 
ATOM   2437 C C   . PHE A 1 314 ? 9.435   55.132 40.907 1.00 14.12  ? 314  PHE A C   1 
ATOM   2438 O O   . PHE A 1 314 ? 10.295  55.079 40.070 1.00 12.99  ? 314  PHE A O   1 
ATOM   2439 C CB  . PHE A 1 314 ? 9.914   54.296 43.248 1.00 15.17  ? 314  PHE A CB  1 
ATOM   2440 C CG  . PHE A 1 314 ? 11.444  54.310 43.199 1.00 15.49  ? 314  PHE A CG  1 
ATOM   2441 C CD1 . PHE A 1 314 ? 12.127  55.324 42.567 1.00 15.13  ? 314  PHE A CD1 1 
ATOM   2442 C CD2 . PHE A 1 314 ? 12.195  53.345 43.888 1.00 14.62  ? 314  PHE A CD2 1 
ATOM   2443 C CE1 . PHE A 1 314 ? 13.541  55.335 42.589 1.00 16.77  ? 314  PHE A CE1 1 
ATOM   2444 C CE2 . PHE A 1 314 ? 13.615  53.390 43.931 1.00 12.13  ? 314  PHE A CE2 1 
ATOM   2445 C CZ  . PHE A 1 314 ? 14.285  54.371 43.281 1.00 12.81  ? 314  PHE A CZ  1 
ATOM   2446 N N   . LYS A 1 315 ? 8.713   56.227 41.061 1.00 13.87  ? 315  LYS A N   1 
ATOM   2447 C CA  . LYS A 1 315 ? 8.897   57.273 40.083 1.00 15.07  ? 315  LYS A CA  1 
ATOM   2448 C C   . LYS A 1 315 ? 10.307  57.854 40.007 1.00 16.67  ? 315  LYS A C   1 
ATOM   2449 O O   . LYS A 1 315 ? 10.776  58.405 41.018 1.00 17.99  ? 315  LYS A O   1 
ATOM   2450 C CB  . LYS A 1 315 ? 7.995   58.419 40.404 1.00 14.74  ? 315  LYS A CB  1 
ATOM   2451 C CG  . LYS A 1 315 ? 7.817   59.446 39.302 1.00 14.19  ? 315  LYS A CG  1 
ATOM   2452 C CD  . LYS A 1 315 ? 7.417   60.780 39.934 1.00 12.92  ? 315  LYS A CD  1 
ATOM   2453 C CE  . LYS A 1 315 ? 7.167   61.830 38.900 1.00 13.60  ? 315  LYS A CE  1 
ATOM   2454 N NZ  . LYS A 1 315 ? 6.097   61.402 37.962 1.00 14.96  ? 315  LYS A NZ  1 
ATOM   2455 N N   . LYS A 1 316 ? 10.978  57.813 38.840 1.00 16.56  ? 316  LYS A N   1 
ATOM   2456 C CA  . LYS A 1 316 ? 12.324  58.414 38.791 1.00 16.28  ? 316  LYS A CA  1 
ATOM   2457 C C   . LYS A 1 316 ? 12.353  59.872 38.351 1.00 15.99  ? 316  LYS A C   1 
ATOM   2458 O O   . LYS A 1 316 ? 12.326  60.225 37.222 1.00 18.01  ? 316  LYS A O   1 
ATOM   2459 C CB  . LYS A 1 316 ? 13.300  57.562 38.039 1.00 15.09  ? 316  LYS A CB  1 
ATOM   2460 C CG  . LYS A 1 316 ? 13.180  56.124 38.444 1.00 17.68  ? 316  LYS A CG  1 
ATOM   2461 C CD  . LYS A 1 316 ? 13.149  55.265 37.177 1.00 23.63  ? 316  LYS A CD  1 
ATOM   2462 C CE  . LYS A 1 316 ? 13.541  53.824 37.391 1.00 26.33  ? 316  LYS A CE  1 
ATOM   2463 N NZ  . LYS A 1 316 ? 12.384  53.233 38.094 1.00 25.75  ? 316  LYS A NZ  1 
ATOM   2464 N N   . THR A 1 317 ? 12.414  60.761 39.283 1.00 16.12  ? 317  THR A N   1 
ATOM   2465 C CA  . THR A 1 317 ? 12.511  62.143 38.937 1.00 14.40  ? 317  THR A CA  1 
ATOM   2466 C C   . THR A 1 317 ? 13.641  62.728 39.810 1.00 14.84  ? 317  THR A C   1 
ATOM   2467 O O   . THR A 1 317 ? 14.658  62.016 40.081 1.00 14.23  ? 317  THR A O   1 
ATOM   2468 C CB  . THR A 1 317 ? 11.191  62.829 39.162 1.00 13.26  ? 317  THR A CB  1 
ATOM   2469 O OG1 . THR A 1 317 ? 11.435  64.226 39.077 1.00 13.04  ? 317  THR A OG1 1 
ATOM   2470 C CG2 . THR A 1 317 ? 10.647  62.456 40.524 1.00 10.87  ? 317  THR A CG2 1 
ATOM   2471 N N   . GLN A 1 318 ? 13.536  64.006 40.185 1.00 13.94  ? 318  GLN A N   1 
ATOM   2472 C CA  . GLN A 1 318 ? 14.577  64.492 41.033 1.00 14.17  ? 318  GLN A CA  1 
ATOM   2473 C C   . GLN A 1 318 ? 13.929  65.048 42.237 1.00 14.18  ? 318  GLN A C   1 
ATOM   2474 O O   . GLN A 1 318 ? 12.825  65.588 42.148 1.00 14.25  ? 318  GLN A O   1 
ATOM   2475 C CB  . GLN A 1 318 ? 15.583  65.442 40.357 1.00 14.19  ? 318  GLN A CB  1 
ATOM   2476 C CG  . GLN A 1 318 ? 15.054  66.731 39.862 1.00 14.21  ? 318  GLN A CG  1 
ATOM   2477 C CD  . GLN A 1 318 ? 14.343  66.591 38.516 1.00 17.69  ? 318  GLN A CD  1 
ATOM   2478 O OE1 . GLN A 1 318 ? 13.297  67.171 38.295 1.00 22.01  ? 318  GLN A OE1 1 
ATOM   2479 N NE2 . GLN A 1 318 ? 14.923  65.846 37.607 1.00 19.68  ? 318  GLN A NE2 1 
ATOM   2480 N N   . ILE A 1 319 ? 14.626  64.841 43.357 1.00 13.94  ? 319  ILE A N   1 
ATOM   2481 C CA  . ILE A 1 319 ? 14.151  65.136 44.696 1.00 14.27  ? 319  ILE A CA  1 
ATOM   2482 C C   . ILE A 1 319 ? 15.190  65.928 45.491 1.00 13.31  ? 319  ILE A C   1 
ATOM   2483 O O   . ILE A 1 319 ? 16.359  65.726 45.357 1.00 12.71  ? 319  ILE A O   1 
ATOM   2484 C CB  . ILE A 1 319 ? 13.751  63.831 45.508 1.00 14.58  ? 319  ILE A CB  1 
ATOM   2485 C CG1 . ILE A 1 319 ? 14.893  62.803 45.463 1.00 16.19  ? 319  ILE A CG1 1 
ATOM   2486 C CG2 . ILE A 1 319 ? 12.533  63.192 44.932 1.00 12.29  ? 319  ILE A CG2 1 
ATOM   2487 C CD1 . ILE A 1 319 ? 14.986  61.938 46.625 1.00 15.13  ? 319  ILE A CD1 1 
ATOM   2488 N N   . LEU A 1 320 ? 14.669  66.817 46.322 1.00 13.61  ? 320  LEU A N   1 
ATOM   2489 C CA  . LEU A 1 320 ? 15.341  67.669 47.304 1.00 12.74  ? 320  LEU A CA  1 
ATOM   2490 C C   . LEU A 1 320 ? 14.648  67.352 48.674 1.00 12.88  ? 320  LEU A C   1 
ATOM   2491 O O   . LEU A 1 320 ? 13.421  67.258 48.734 1.00 11.18  ? 320  LEU A O   1 
ATOM   2492 C CB  . LEU A 1 320 ? 15.099  69.088 46.907 1.00 10.58  ? 320  LEU A CB  1 
ATOM   2493 C CG  . LEU A 1 320 ? 15.700  70.058 47.829 1.00 12.15  ? 320  LEU A CG  1 
ATOM   2494 C CD1 . LEU A 1 320 ? 16.113  71.230 47.032 1.00 11.51  ? 320  LEU A CD1 1 
ATOM   2495 C CD2 . LEU A 1 320 ? 14.623  70.457 48.865 1.00 16.22  ? 320  LEU A CD2 1 
ATOM   2496 N N   . LEU A 1 321 ? 15.458  67.140 49.722 1.00 13.70  ? 321  LEU A N   1 
ATOM   2497 C CA  . LEU A 1 321 ? 15.034  66.652 51.046 1.00 14.73  ? 321  LEU A CA  1 
ATOM   2498 C C   . LEU A 1 321 ? 16.084  66.894 52.165 1.00 17.91  ? 321  LEU A C   1 
ATOM   2499 O O   . LEU A 1 321 ? 17.287  67.295 51.936 1.00 19.94  ? 321  LEU A O   1 
ATOM   2500 C CB  . LEU A 1 321 ? 14.581  65.186 51.058 1.00 12.58  ? 321  LEU A CB  1 
ATOM   2501 C CG  . LEU A 1 321 ? 15.611  64.054 50.953 1.00 11.17  ? 321  LEU A CG  1 
ATOM   2502 C CD1 . LEU A 1 321 ? 14.978  62.582 50.676 1.00 6.99   ? 321  LEU A CD1 1 
ATOM   2503 C CD2 . LEU A 1 321 ? 16.631  64.433 49.901 1.00 2.67   ? 321  LEU A CD2 1 
ATOM   2504 N N   . GLY A 1 322 ? 15.643  66.682 53.409 1.00 19.18  ? 322  GLY A N   1 
ATOM   2505 C CA  . GLY A 1 322 ? 16.478  67.137 54.506 1.00 19.33  ? 322  GLY A CA  1 
ATOM   2506 C C   . GLY A 1 322 ? 15.914  66.896 55.867 1.00 19.38  ? 322  GLY A C   1 
ATOM   2507 O O   . GLY A 1 322 ? 14.766  66.412 56.016 1.00 18.37  ? 322  GLY A O   1 
ATOM   2508 N N   . VAL A 1 323 ? 16.784  67.189 56.839 1.00 19.09  ? 323  VAL A N   1 
ATOM   2509 C CA  . VAL A 1 323 ? 16.536  66.938 58.240 1.00 18.33  ? 323  VAL A CA  1 
ATOM   2510 C C   . VAL A 1 323 ? 16.962  68.209 59.006 1.00 18.33  ? 323  VAL A C   1 
ATOM   2511 O O   . VAL A 1 323 ? 17.819  68.975 58.535 1.00 17.90  ? 323  VAL A O   1 
ATOM   2512 C CB  . VAL A 1 323 ? 17.232  65.625 58.747 1.00 17.73  ? 323  VAL A CB  1 
ATOM   2513 C CG1 . VAL A 1 323 ? 16.970  64.466 57.868 1.00 15.24  ? 323  VAL A CG1 1 
ATOM   2514 C CG2 . VAL A 1 323 ? 18.687  65.801 58.800 1.00 20.76  ? 323  VAL A CG2 1 
ATOM   2515 N N   . ASN A 1 324 ? 16.288  68.470 60.129 1.00 18.42  ? 324  ASN A N   1 
ATOM   2516 C CA  . ASN A 1 324 ? 16.728  69.467 61.100 1.00 18.44  ? 324  ASN A CA  1 
ATOM   2517 C C   . ASN A 1 324 ? 17.700  68.935 62.168 1.00 18.99  ? 324  ASN A C   1 
ATOM   2518 O O   . ASN A 1 324 ? 17.803  67.720 62.395 1.00 19.05  ? 324  ASN A O   1 
ATOM   2519 C CB  . ASN A 1 324 ? 15.558  70.060 61.797 1.00 17.79  ? 324  ASN A CB  1 
ATOM   2520 C CG  . ASN A 1 324 ? 14.707  70.869 60.899 1.00 19.71  ? 324  ASN A CG  1 
ATOM   2521 O OD1 . ASN A 1 324 ? 13.527  71.082 61.211 1.00 24.92  ? 324  ASN A OD1 1 
ATOM   2522 N ND2 . ASN A 1 324 ? 15.254  71.340 59.788 1.00 17.75  ? 324  ASN A ND2 1 
ATOM   2523 N N   . LYS A 1 325 ? 18.403  69.840 62.833 1.00 18.78  ? 325  LYS A N   1 
ATOM   2524 C CA  . LYS A 1 325 ? 19.520  69.419 63.652 1.00 19.82  ? 325  LYS A CA  1 
ATOM   2525 C C   . LYS A 1 325 ? 19.046  68.660 64.882 1.00 20.18  ? 325  LYS A C   1 
ATOM   2526 O O   . LYS A 1 325 ? 19.690  67.675 65.226 1.00 20.41  ? 325  LYS A O   1 
ATOM   2527 C CB  . LYS A 1 325 ? 20.462  70.589 63.969 1.00 19.87  ? 325  LYS A CB  1 
ATOM   2528 C CG  . LYS A 1 325 ? 21.613  70.359 64.892 1.00 22.38  ? 325  LYS A CG  1 
ATOM   2529 C CD  . LYS A 1 325 ? 21.408  71.378 66.076 1.00 31.47  ? 325  LYS A CD  1 
ATOM   2530 C CE  . LYS A 1 325 ? 22.642  72.149 66.490 1.00 33.58  ? 325  LYS A CE  1 
ATOM   2531 N NZ  . LYS A 1 325 ? 23.576  71.054 66.732 1.00 33.59  ? 325  LYS A NZ  1 
ATOM   2532 N N   . ASP A 1 326 ? 17.922  69.057 65.514 1.00 20.43  ? 326  ASP A N   1 
ATOM   2533 C CA  . ASP A 1 326 ? 17.368  68.290 66.705 1.00 19.88  ? 326  ASP A CA  1 
ATOM   2534 C C   . ASP A 1 326 ? 15.969  67.753 66.468 1.00 19.03  ? 326  ASP A C   1 
ATOM   2535 O O   . ASP A 1 326 ? 14.951  68.274 66.929 1.00 18.34  ? 326  ASP A O   1 
ATOM   2536 C CB  . ASP A 1 326 ? 17.410  69.124 67.957 1.00 19.52  ? 326  ASP A CB  1 
ATOM   2537 C CG  . ASP A 1 326 ? 18.703  69.816 68.090 1.00 21.39  ? 326  ASP A CG  1 
ATOM   2538 O OD1 . ASP A 1 326 ? 18.763  71.027 67.782 1.00 18.32  ? 326  ASP A OD1 1 
ATOM   2539 O OD2 . ASP A 1 326 ? 19.679  69.105 68.437 1.00 25.63  ? 326  ASP A OD2 1 
ATOM   2540 N N   . GLU A 1 327 ? 15.913  66.701 65.688 1.00 18.09  ? 327  GLU A N   1 
ATOM   2541 C CA  . GLU A 1 327 ? 14.599  66.210 65.378 1.00 16.18  ? 327  GLU A CA  1 
ATOM   2542 C C   . GLU A 1 327 ? 13.952  65.620 66.639 1.00 14.49  ? 327  GLU A C   1 
ATOM   2543 O O   . GLU A 1 327 ? 12.733  65.534 66.628 1.00 15.32  ? 327  GLU A O   1 
ATOM   2544 C CB  . GLU A 1 327 ? 14.618  65.138 64.254 1.00 16.05  ? 327  GLU A CB  1 
ATOM   2545 C CG  . GLU A 1 327 ? 15.185  65.530 62.902 1.00 14.62  ? 327  GLU A CG  1 
ATOM   2546 C CD  . GLU A 1 327 ? 14.142  66.156 61.997 1.00 14.11  ? 327  GLU A CD  1 
ATOM   2547 O OE1 . GLU A 1 327 ? 12.969  66.286 62.386 1.00 17.27  ? 327  GLU A OE1 1 
ATOM   2548 O OE2 . GLU A 1 327 ? 14.493  66.566 60.883 1.00 16.16  ? 327  GLU A OE2 1 
ATOM   2549 N N   . GLY A 1 328 ? 14.726  65.236 67.678 1.00 11.98  ? 328  GLY A N   1 
ATOM   2550 C CA  . GLY A 1 328 ? 14.181  64.472 68.802 1.00 10.57  ? 328  GLY A CA  1 
ATOM   2551 C C   . GLY A 1 328 ? 13.428  65.253 69.914 1.00 11.59  ? 328  GLY A C   1 
ATOM   2552 O O   . GLY A 1 328 ? 12.487  64.740 70.560 1.00 11.88  ? 328  GLY A O   1 
ATOM   2553 N N   . SER A 1 329 ? 13.791  66.513 70.140 1.00 11.20  ? 329  SER A N   1 
ATOM   2554 C CA  . SER A 1 329 ? 13.452  67.141 71.374 1.00 10.99  ? 329  SER A CA  1 
ATOM   2555 C C   . SER A 1 329 ? 11.966  67.196 71.613 1.00 11.81  ? 329  SER A C   1 
ATOM   2556 O O   . SER A 1 329 ? 11.496  66.751 72.675 1.00 11.34  ? 329  SER A O   1 
ATOM   2557 C CB  . SER A 1 329 ? 14.059  68.490 71.357 1.00 10.94  ? 329  SER A CB  1 
ATOM   2558 O OG  . SER A 1 329 ? 13.938  68.886 70.029 1.00 12.59  ? 329  SER A OG  1 
ATOM   2559 N N   . PHE A 1 330 ? 11.229  67.657 70.594 1.00 12.31  ? 330  PHE A N   1 
ATOM   2560 C CA  . PHE A 1 330 ? 9.785   67.916 70.693 1.00 11.89  ? 330  PHE A CA  1 
ATOM   2561 C C   . PHE A 1 330 ? 9.045   66.650 71.216 1.00 11.91  ? 330  PHE A C   1 
ATOM   2562 O O   . PHE A 1 330 ? 8.124   66.652 72.113 1.00 9.60   ? 330  PHE A O   1 
ATOM   2563 C CB  . PHE A 1 330 ? 9.247   68.366 69.335 1.00 11.78  ? 330  PHE A CB  1 
ATOM   2564 C CG  . PHE A 1 330 ? 7.796   68.462 69.319 1.00 14.71  ? 330  PHE A CG  1 
ATOM   2565 C CD1 . PHE A 1 330 ? 7.159   69.672 69.734 1.00 16.28  ? 330  PHE A CD1 1 
ATOM   2566 C CD2 . PHE A 1 330 ? 7.012   67.297 69.008 1.00 15.52  ? 330  PHE A CD2 1 
ATOM   2567 C CE1 . PHE A 1 330 ? 5.763   69.766 69.795 1.00 13.10  ? 330  PHE A CE1 1 
ATOM   2568 C CE2 . PHE A 1 330 ? 5.637   67.333 69.078 1.00 14.36  ? 330  PHE A CE2 1 
ATOM   2569 C CZ  . PHE A 1 330 ? 4.993   68.580 69.479 1.00 16.07  ? 330  PHE A CZ  1 
ATOM   2570 N N   . PHE A 1 331 ? 9.510   65.535 70.684 1.00 12.59  ? 331  PHE A N   1 
ATOM   2571 C CA  . PHE A 1 331 ? 8.944   64.262 71.120 1.00 12.91  ? 331  PHE A CA  1 
ATOM   2572 C C   . PHE A 1 331 ? 9.263   63.885 72.534 1.00 12.84  ? 331  PHE A C   1 
ATOM   2573 O O   . PHE A 1 331 ? 8.337   63.502 73.228 1.00 13.23  ? 331  PHE A O   1 
ATOM   2574 C CB  . PHE A 1 331 ? 9.275   63.178 70.106 1.00 13.20  ? 331  PHE A CB  1 
ATOM   2575 C CG  . PHE A 1 331 ? 8.670   63.475 68.780 1.00 13.52  ? 331  PHE A CG  1 
ATOM   2576 C CD1 . PHE A 1 331 ? 9.386   64.212 67.836 1.00 15.19  ? 331  PHE A CD1 1 
ATOM   2577 C CD2 . PHE A 1 331 ? 7.343   63.173 68.549 1.00 9.48   ? 331  PHE A CD2 1 
ATOM   2578 C CE1 . PHE A 1 331 ? 8.783   64.583 66.642 1.00 16.40  ? 331  PHE A CE1 1 
ATOM   2579 C CE2 . PHE A 1 331 ? 6.749   63.557 67.380 1.00 12.53  ? 331  PHE A CE2 1 
ATOM   2580 C CZ  . PHE A 1 331 ? 7.462   64.247 66.410 1.00 12.64  ? 331  PHE A CZ  1 
ATOM   2581 N N   . LEU A 1 332 ? 10.536  64.006 72.944 1.00 11.54  ? 332  LEU A N   1 
ATOM   2582 C CA  . LEU A 1 332 ? 10.922  63.729 74.295 1.00 11.80  ? 332  LEU A CA  1 
ATOM   2583 C C   . LEU A 1 332 ? 10.166  64.643 75.311 1.00 14.09  ? 332  LEU A C   1 
ATOM   2584 O O   . LEU A 1 332 ? 9.672   64.196 76.366 1.00 13.96  ? 332  LEU A O   1 
ATOM   2585 C CB  . LEU A 1 332 ? 12.419  63.953 74.443 1.00 10.60  ? 332  LEU A CB  1 
ATOM   2586 C CG  . LEU A 1 332 ? 13.406  63.010 73.769 1.00 9.57   ? 332  LEU A CG  1 
ATOM   2587 C CD1 . LEU A 1 332 ? 14.829  63.640 73.506 1.00 2.00   ? 332  LEU A CD1 1 
ATOM   2588 C CD2 . LEU A 1 332 ? 13.472  61.753 74.576 1.00 6.12   ? 332  LEU A CD2 1 
ATOM   2589 N N   . LEU A 1 333 ? 10.088  65.940 74.993 1.00 15.36  ? 333  LEU A N   1 
ATOM   2590 C CA  . LEU A 1 333 ? 9.381   66.883 75.845 1.00 16.25  ? 333  LEU A CA  1 
ATOM   2591 C C   . LEU A 1 333 ? 7.951   66.376 76.200 1.00 18.47  ? 333  LEU A C   1 
ATOM   2592 O O   . LEU A 1 333 ? 7.495   66.515 77.320 1.00 19.28  ? 333  LEU A O   1 
ATOM   2593 C CB  . LEU A 1 333 ? 9.318   68.266 75.198 1.00 13.94  ? 333  LEU A CB  1 
ATOM   2594 C CG  . LEU A 1 333 ? 8.922   69.519 75.961 1.00 12.30  ? 333  LEU A CG  1 
ATOM   2595 C CD1 . LEU A 1 333 ? 7.845   70.273 75.220 1.00 15.14  ? 333  LEU A CD1 1 
ATOM   2596 C CD2 . LEU A 1 333 ? 8.401   69.226 77.317 1.00 13.16  ? 333  LEU A CD2 1 
ATOM   2597 N N   . TYR A 1 334 ? 7.260   65.798 75.223 1.00 20.28  ? 334  TYR A N   1 
ATOM   2598 C CA  . TYR A 1 334 ? 5.901   65.367 75.378 1.00 20.34  ? 334  TYR A CA  1 
ATOM   2599 C C   . TYR A 1 334 ? 5.905   64.030 75.956 1.00 21.00  ? 334  TYR A C   1 
ATOM   2600 O O   . TYR A 1 334 ? 4.959   63.656 76.555 1.00 23.14  ? 334  TYR A O   1 
ATOM   2601 C CB  . TYR A 1 334 ? 5.217   65.297 74.016 1.00 19.95  ? 334  TYR A CB  1 
ATOM   2602 C CG  . TYR A 1 334 ? 4.680   66.654 73.646 1.00 20.71  ? 334  TYR A CG  1 
ATOM   2603 C CD1 . TYR A 1 334 ? 5.543   67.729 73.349 1.00 21.86  ? 334  TYR A CD1 1 
ATOM   2604 C CD2 . TYR A 1 334 ? 3.316   66.892 73.668 1.00 19.68  ? 334  TYR A CD2 1 
ATOM   2605 C CE1 . TYR A 1 334 ? 5.005   68.994 73.055 1.00 23.05  ? 334  TYR A CE1 1 
ATOM   2606 C CE2 . TYR A 1 334 ? 2.777   68.138 73.390 1.00 20.39  ? 334  TYR A CE2 1 
ATOM   2607 C CZ  . TYR A 1 334 ? 3.599   69.196 73.083 1.00 19.81  ? 334  TYR A CZ  1 
ATOM   2608 O OH  . TYR A 1 334 ? 3.006   70.434 72.824 1.00 17.20  ? 334  TYR A OH  1 
ATOM   2609 N N   . GLY A 1 335 ? 6.946   63.259 75.823 1.00 21.54  ? 335  GLY A N   1 
ATOM   2610 C CA  . GLY A 1 335 ? 6.678   61.881 76.097 1.00 22.51  ? 335  GLY A CA  1 
ATOM   2611 C C   . GLY A 1 335 ? 7.573   61.152 77.052 1.00 22.57  ? 335  GLY A C   1 
ATOM   2612 O O   . GLY A 1 335 ? 7.346   59.992 77.300 1.00 23.77  ? 335  GLY A O   1 
ATOM   2613 N N   . ALA A 1 336 ? 8.594   61.797 77.555 1.00 21.68  ? 336  ALA A N   1 
ATOM   2614 C CA  . ALA A 1 336 ? 9.617   61.084 78.236 1.00 21.27  ? 336  ALA A CA  1 
ATOM   2615 C C   . ALA A 1 336 ? 9.820   61.689 79.634 1.00 21.83  ? 336  ALA A C   1 
ATOM   2616 O O   . ALA A 1 336 ? 10.086  62.892 79.815 1.00 20.80  ? 336  ALA A O   1 
ATOM   2617 C CB  . ALA A 1 336 ? 10.943  61.137 77.409 1.00 20.89  ? 336  ALA A CB  1 
ATOM   2618 N N   . PRO A 1 337 ? 9.817   60.831 80.645 1.00 22.69  ? 337  PRO A N   1 
ATOM   2619 C CA  . PRO A 1 337 ? 10.120  61.195 82.045 1.00 22.41  ? 337  PRO A CA  1 
ATOM   2620 C C   . PRO A 1 337 ? 11.436  62.023 82.121 1.00 22.15  ? 337  PRO A C   1 
ATOM   2621 O O   . PRO A 1 337 ? 12.477  61.593 81.539 1.00 22.28  ? 337  PRO A O   1 
ATOM   2622 C CB  . PRO A 1 337 ? 10.322  59.817 82.702 1.00 22.22  ? 337  PRO A CB  1 
ATOM   2623 C CG  . PRO A 1 337 ? 10.752  58.889 81.538 1.00 23.64  ? 337  PRO A CG  1 
ATOM   2624 C CD  . PRO A 1 337 ? 9.694   59.375 80.483 1.00 23.71  ? 337  PRO A CD  1 
ATOM   2625 N N   . GLY A 1 338 ? 11.401  63.184 82.784 1.00 21.36  ? 338  GLY A N   1 
ATOM   2626 C CA  . GLY A 1 338 ? 12.615  63.962 82.958 1.00 21.39  ? 338  GLY A CA  1 
ATOM   2627 C C   . GLY A 1 338 ? 12.679  65.321 82.270 1.00 22.96  ? 338  GLY A C   1 
ATOM   2628 O O   . GLY A 1 338 ? 13.375  66.250 82.796 1.00 24.16  ? 338  GLY A O   1 
ATOM   2629 N N   . PHE A 1 339 ? 11.934  65.473 81.142 1.00 21.79  ? 339  PHE A N   1 
ATOM   2630 C CA  . PHE A 1 339 ? 11.941  66.696 80.302 1.00 19.37  ? 339  PHE A CA  1 
ATOM   2631 C C   . PHE A 1 339 ? 10.804  67.636 80.615 1.00 19.29  ? 339  PHE A C   1 
ATOM   2632 O O   . PHE A 1 339 ? 9.706   67.173 80.802 1.00 20.29  ? 339  PHE A O   1 
ATOM   2633 C CB  . PHE A 1 339 ? 11.810  66.332 78.818 1.00 18.21  ? 339  PHE A CB  1 
ATOM   2634 C CG  . PHE A 1 339 ? 12.861  65.458 78.334 1.00 15.01  ? 339  PHE A CG  1 
ATOM   2635 C CD1 . PHE A 1 339 ? 12.825  64.113 78.606 1.00 11.76  ? 339  PHE A CD1 1 
ATOM   2636 C CD2 . PHE A 1 339 ? 13.904  65.970 77.622 1.00 13.70  ? 339  PHE A CD2 1 
ATOM   2637 C CE1 . PHE A 1 339 ? 13.799  63.303 78.157 1.00 12.62  ? 339  PHE A CE1 1 
ATOM   2638 C CE2 . PHE A 1 339 ? 14.926  65.138 77.146 1.00 12.45  ? 339  PHE A CE2 1 
ATOM   2639 C CZ  . PHE A 1 339 ? 14.868  63.817 77.404 1.00 13.63  ? 339  PHE A CZ  1 
ATOM   2640 N N   . SER A 1 340 ? 11.022  68.944 80.607 1.00 18.58  ? 340  SER A N   1 
ATOM   2641 C CA  . SER A 1 340 ? 9.926   69.825 80.851 1.00 19.49  ? 340  SER A CA  1 
ATOM   2642 C C   . SER A 1 340 ? 10.168  71.128 80.202 1.00 19.83  ? 340  SER A C   1 
ATOM   2643 O O   . SER A 1 340 ? 11.325  71.539 80.095 1.00 20.92  ? 340  SER A O   1 
ATOM   2644 C CB  . SER A 1 340 ? 9.720   70.125 82.333 1.00 19.56  ? 340  SER A CB  1 
ATOM   2645 O OG  . SER A 1 340 ? 10.355  69.208 83.193 1.00 22.63  ? 340  SER A OG  1 
ATOM   2646 N N   . LYS A 1 341 ? 9.086   71.832 79.851 1.00 19.83  ? 341  LYS A N   1 
ATOM   2647 C CA  . LYS A 1 341 ? 9.266   73.068 79.132 1.00 20.58  ? 341  LYS A CA  1 
ATOM   2648 C C   . LYS A 1 341 ? 10.112  74.102 79.896 1.00 21.65  ? 341  LYS A C   1 
ATOM   2649 O O   . LYS A 1 341 ? 11.017  74.739 79.302 1.00 22.67  ? 341  LYS A O   1 
ATOM   2650 C CB  . LYS A 1 341 ? 7.978   73.668 78.654 1.00 19.76  ? 341  LYS A CB  1 
ATOM   2651 C CG  . LYS A 1 341 ? 8.243   74.903 77.808 1.00 19.74  ? 341  LYS A CG  1 
ATOM   2652 C CD  . LYS A 1 341 ? 6.927   75.334 77.149 1.00 23.77  ? 341  LYS A CD  1 
ATOM   2653 C CE  . LYS A 1 341 ? 5.898   75.912 78.152 1.00 19.91  ? 341  LYS A CE  1 
ATOM   2654 N NZ  . LYS A 1 341 ? 6.489   77.117 78.708 1.00 15.28  ? 341  LYS A NZ  1 
ATOM   2655 N N   . ASP A 1 342 ? 9.887   74.239 81.207 1.00 21.57  ? 342  ASP A N   1 
ATOM   2656 C CA  . ASP A 1 342 ? 10.546  75.309 81.909 1.00 20.92  ? 342  ASP A CA  1 
ATOM   2657 C C   . ASP A 1 342 ? 11.894  75.003 82.624 1.00 21.53  ? 342  ASP A C   1 
ATOM   2658 O O   . ASP A 1 342 ? 12.438  75.899 83.208 1.00 21.38  ? 342  ASP A O   1 
ATOM   2659 C CB  . ASP A 1 342 ? 9.545   75.980 82.827 1.00 20.53  ? 342  ASP A CB  1 
ATOM   2660 C CG  . ASP A 1 342 ? 8.375   76.578 82.085 1.00 20.61  ? 342  ASP A CG  1 
ATOM   2661 O OD1 . ASP A 1 342 ? 7.390   76.979 82.724 1.00 24.03  ? 342  ASP A OD1 1 
ATOM   2662 O OD2 . ASP A 1 342 ? 8.396   76.698 80.861 1.00 20.99  ? 342  ASP A OD2 1 
ATOM   2663 N N   . SER A 1 343 ? 12.426  73.781 82.617 1.00 22.01  ? 343  SER A N   1 
ATOM   2664 C CA  . SER A 1 343 ? 13.791  73.571 83.134 1.00 23.56  ? 343  SER A CA  1 
ATOM   2665 C C   . SER A 1 343 ? 14.694  73.108 82.068 1.00 24.71  ? 343  SER A C   1 
ATOM   2666 O O   . SER A 1 343 ? 14.238  72.860 80.974 1.00 25.25  ? 343  SER A O   1 
ATOM   2667 C CB  . SER A 1 343 ? 13.796  72.454 84.144 1.00 24.13  ? 343  SER A CB  1 
ATOM   2668 O OG  . SER A 1 343 ? 13.237  71.275 83.606 1.00 25.13  ? 343  SER A OG  1 
ATOM   2669 N N   . GLU A 1 344 ? 15.961  72.891 82.382 1.00 26.64  ? 344  GLU A N   1 
ATOM   2670 C CA  . GLU A 1 344 ? 16.890  72.439 81.325 1.00 29.10  ? 344  GLU A CA  1 
ATOM   2671 C C   . GLU A 1 344 ? 16.929  70.958 81.088 1.00 28.26  ? 344  GLU A C   1 
ATOM   2672 O O   . GLU A 1 344 ? 17.667  70.448 80.216 1.00 27.34  ? 344  GLU A O   1 
ATOM   2673 C CB  . GLU A 1 344 ? 18.305  72.791 81.620 1.00 30.71  ? 344  GLU A CB  1 
ATOM   2674 C CG  . GLU A 1 344 ? 18.650  74.230 81.658 1.00 40.16  ? 344  GLU A CG  1 
ATOM   2675 C CD  . GLU A 1 344 ? 19.661  74.346 82.788 1.00 54.92  ? 344  GLU A CD  1 
ATOM   2676 O OE1 . GLU A 1 344 ? 19.362  73.864 83.962 1.00 58.72  ? 344  GLU A OE1 1 
ATOM   2677 O OE2 . GLU A 1 344 ? 20.785  74.811 82.471 1.00 60.66  ? 344  GLU A OE2 1 
ATOM   2678 N N   . SER A 1 345 ? 16.175  70.266 81.912 1.00 28.06  ? 345  SER A N   1 
ATOM   2679 C CA  . SER A 1 345 ? 15.898  68.877 81.681 1.00 27.93  ? 345  SER A CA  1 
ATOM   2680 C C   . SER A 1 345 ? 17.162  68.029 81.644 1.00 28.09  ? 345  SER A C   1 
ATOM   2681 O O   . SER A 1 345 ? 17.386  67.302 80.702 1.00 28.35  ? 345  SER A O   1 
ATOM   2682 C CB  . SER A 1 345 ? 15.013  68.713 80.425 1.00 27.50  ? 345  SER A CB  1 
ATOM   2683 O OG  . SER A 1 345 ? 13.807  69.477 80.552 1.00 26.57  ? 345  SER A OG  1 
ATOM   2684 N N   . LYS A 1 346 ? 17.984  68.118 82.687 1.00 28.84  ? 346  LYS A N   1 
ATOM   2685 C CA  . LYS A 1 346 ? 19.098  67.189 82.908 1.00 29.54  ? 346  LYS A CA  1 
ATOM   2686 C C   . LYS A 1 346 ? 18.534  65.791 83.210 1.00 29.26  ? 346  LYS A C   1 
ATOM   2687 O O   . LYS A 1 346 ? 17.639  65.618 84.021 1.00 29.52  ? 346  LYS A O   1 
ATOM   2688 C CB  . LYS A 1 346 ? 19.953  67.746 84.031 1.00 29.65  ? 346  LYS A CB  1 
ATOM   2689 C CG  . LYS A 1 346 ? 20.569  69.180 83.697 1.00 30.97  ? 346  LYS A CG  1 
ATOM   2690 C CD  . LYS A 1 346 ? 21.627  69.745 84.782 1.00 32.75  ? 346  LYS A CD  1 
ATOM   2691 C CE  . LYS A 1 346 ? 21.309  71.258 85.254 1.00 37.15  ? 346  LYS A CE  1 
ATOM   2692 N NZ  . LYS A 1 346 ? 22.430  72.317 85.061 1.00 37.76  ? 346  LYS A NZ  1 
ATOM   2693 N N   . ILE A 1 347 ? 18.956  64.769 82.513 1.00 29.14  ? 347  ILE A N   1 
ATOM   2694 C CA  . ILE A 1 347 ? 18.226  63.512 82.691 1.00 29.40  ? 347  ILE A CA  1 
ATOM   2695 C C   . ILE A 1 347 ? 19.069  62.584 83.543 1.00 29.86  ? 347  ILE A C   1 
ATOM   2696 O O   . ILE A 1 347 ? 20.273  62.520 83.335 1.00 29.34  ? 347  ILE A O   1 
ATOM   2697 C CB  . ILE A 1 347 ? 17.828  62.985 81.293 1.00 29.44  ? 347  ILE A CB  1 
ATOM   2698 C CG1 . ILE A 1 347 ? 16.418  63.429 81.037 1.00 31.73  ? 347  ILE A CG1 1 
ATOM   2699 C CG2 . ILE A 1 347 ? 17.835  61.512 81.139 1.00 28.06  ? 347  ILE A CG2 1 
ATOM   2700 C CD1 . ILE A 1 347 ? 16.323  64.858 80.594 1.00 30.99  ? 347  ILE A CD1 1 
ATOM   2701 N N   . SER A 1 348 ? 18.496  61.894 84.522 1.00 30.99  ? 348  SER A N   1 
ATOM   2702 C CA  . SER A 1 348 ? 19.342  60.959 85.295 1.00 33.21  ? 348  SER A CA  1 
ATOM   2703 C C   . SER A 1 348 ? 19.757  59.692 84.486 1.00 35.86  ? 348  SER A C   1 
ATOM   2704 O O   . SER A 1 348 ? 19.180  59.390 83.425 1.00 36.66  ? 348  SER A O   1 
ATOM   2705 C CB  . SER A 1 348 ? 18.675  60.537 86.587 1.00 32.32  ? 348  SER A CB  1 
ATOM   2706 O OG  . SER A 1 348 ? 17.378  60.056 86.313 1.00 32.86  ? 348  SER A OG  1 
ATOM   2707 N N   . ARG A 1 349 ? 20.764  58.946 84.961 1.00 37.67  ? 349  ARG A N   1 
ATOM   2708 C CA  A ARG A 1 349 ? 21.116  57.732 84.221 0.50 37.83  ? 349  ARG A CA  1 
ATOM   2709 C CA  B ARG A 1 349 ? 21.177  57.681 84.350 0.50 38.26  ? 349  ARG A CA  1 
ATOM   2710 C C   . ARG A 1 349 ? 19.945  56.749 84.369 1.00 38.04  ? 349  ARG A C   1 
ATOM   2711 O O   . ARG A 1 349 ? 19.822  55.801 83.618 1.00 38.54  ? 349  ARG A O   1 
ATOM   2712 C CB  A ARG A 1 349 ? 22.507  57.165 84.597 0.50 37.88  ? 349  ARG A CB  1 
ATOM   2713 C CB  B ARG A 1 349 ? 22.380  57.106 85.138 0.50 38.52  ? 349  ARG A CB  1 
ATOM   2714 C CG  A ARG A 1 349 ? 23.351  56.633 83.385 0.50 37.30  ? 349  ARG A CG  1 
ATOM   2715 C CG  B ARG A 1 349 ? 23.627  56.657 84.305 0.50 39.31  ? 349  ARG A CG  1 
ATOM   2716 C CD  A ARG A 1 349 ? 23.199  55.097 83.142 0.50 36.87  ? 349  ARG A CD  1 
ATOM   2717 C CD  B ARG A 1 349 ? 24.727  56.034 85.233 0.50 38.67  ? 349  ARG A CD  1 
ATOM   2718 N NE  A ARG A 1 349 ? 23.716  54.626 81.856 0.50 35.59  ? 349  ARG A NE  1 
ATOM   2719 N NE  B ARG A 1 349 ? 25.148  54.675 84.851 0.50 38.82  ? 349  ARG A NE  1 
ATOM   2720 C CZ  A ARG A 1 349 ? 23.956  55.402 80.793 0.50 36.10  ? 349  ARG A CZ  1 
ATOM   2721 C CZ  B ARG A 1 349 ? 24.404  53.564 84.974 0.50 38.68  ? 349  ARG A CZ  1 
ATOM   2722 N NH1 A ARG A 1 349 ? 23.729  56.719 80.813 0.50 34.11  ? 349  ARG A NH1 1 
ATOM   2723 N NH1 B ARG A 1 349 ? 23.151  53.601 85.445 0.50 36.84  ? 349  ARG A NH1 1 
ATOM   2724 N NH2 A ARG A 1 349 ? 24.436  54.859 79.688 0.50 35.47  ? 349  ARG A NH2 1 
ATOM   2725 N NH2 B ARG A 1 349 ? 24.918  52.398 84.608 0.50 36.95  ? 349  ARG A NH2 1 
ATOM   2726 N N   . GLU A 1 350 ? 19.036  57.055 85.252 1.00 37.94  ? 350  GLU A N   1 
ATOM   2727 C CA  . GLU A 1 350 ? 17.849  56.312 85.442 1.00 40.05  ? 350  GLU A CA  1 
ATOM   2728 C C   . GLU A 1 350 ? 16.770  56.601 84.379 1.00 38.85  ? 350  GLU A C   1 
ATOM   2729 O O   . GLU A 1 350 ? 16.117  55.704 83.848 1.00 38.74  ? 350  GLU A O   1 
ATOM   2730 C CB  . GLU A 1 350 ? 17.343  56.828 86.781 1.00 43.14  ? 350  GLU A CB  1 
ATOM   2731 C CG  . GLU A 1 350 ? 16.019  56.243 87.312 1.00 51.79  ? 350  GLU A CG  1 
ATOM   2732 C CD  . GLU A 1 350 ? 16.285  54.849 87.807 1.00 63.54  ? 350  GLU A CD  1 
ATOM   2733 O OE1 . GLU A 1 350 ? 17.489  54.624 88.196 1.00 66.98  ? 350  GLU A OE1 1 
ATOM   2734 O OE2 . GLU A 1 350 ? 15.334  54.000 87.767 1.00 67.97  ? 350  GLU A OE2 1 
ATOM   2735 N N   . ASP A 1 351 ? 16.546  57.888 84.128 1.00 37.43  ? 351  ASP A N   1 
ATOM   2736 C CA  . ASP A 1 351 ? 15.567  58.379 83.173 1.00 35.33  ? 351  ASP A CA  1 
ATOM   2737 C C   . ASP A 1 351 ? 16.010  58.139 81.710 1.00 33.73  ? 351  ASP A C   1 
ATOM   2738 O O   . ASP A 1 351 ? 15.180  57.926 80.843 1.00 34.23  ? 351  ASP A O   1 
ATOM   2739 C CB  . ASP A 1 351 ? 15.378  59.884 83.411 1.00 36.22  ? 351  ASP A CB  1 
ATOM   2740 C CG  . ASP A 1 351 ? 14.346  60.209 84.531 1.00 36.06  ? 351  ASP A CG  1 
ATOM   2741 O OD1 . ASP A 1 351 ? 13.358  59.431 84.674 1.00 28.71  ? 351  ASP A OD1 1 
ATOM   2742 O OD2 . ASP A 1 351 ? 14.548  61.280 85.204 1.00 35.45  ? 351  ASP A OD2 1 
ATOM   2743 N N   . PHE A 1 352 ? 17.307  58.187 81.449 1.00 30.89  ? 352  PHE A N   1 
ATOM   2744 C CA  . PHE A 1 352 ? 17.868  57.829 80.181 1.00 29.35  ? 352  PHE A CA  1 
ATOM   2745 C C   . PHE A 1 352 ? 17.501  56.439 79.757 1.00 30.16  ? 352  PHE A C   1 
ATOM   2746 O O   . PHE A 1 352 ? 17.089  56.208 78.639 1.00 29.84  ? 352  PHE A O   1 
ATOM   2747 C CB  . PHE A 1 352 ? 19.349  57.877 80.328 1.00 28.33  ? 352  PHE A CB  1 
ATOM   2748 C CG  . PHE A 1 352 ? 20.090  57.646 79.083 1.00 26.45  ? 352  PHE A CG  1 
ATOM   2749 C CD1 . PHE A 1 352 ? 20.338  58.693 78.212 1.00 26.07  ? 352  PHE A CD1 1 
ATOM   2750 C CD2 . PHE A 1 352 ? 20.583  56.389 78.795 1.00 28.27  ? 352  PHE A CD2 1 
ATOM   2751 C CE1 . PHE A 1 352 ? 21.063  58.523 77.069 1.00 27.60  ? 352  PHE A CE1 1 
ATOM   2752 C CE2 . PHE A 1 352 ? 21.349  56.151 77.644 1.00 28.80  ? 352  PHE A CE2 1 
ATOM   2753 C CZ  . PHE A 1 352 ? 21.598  57.230 76.771 1.00 30.80  ? 352  PHE A CZ  1 
ATOM   2754 N N   . MET A 1 353 ? 17.683  55.501 80.663 1.00 30.88  ? 353  MET A N   1 
ATOM   2755 C CA  . MET A 1 353 ? 17.284  54.119 80.445 1.00 31.81  ? 353  MET A CA  1 
ATOM   2756 C C   . MET A 1 353 ? 15.853  53.961 80.051 1.00 30.22  ? 353  MET A C   1 
ATOM   2757 O O   . MET A 1 353 ? 15.577  53.194 79.126 1.00 30.57  ? 353  MET A O   1 
ATOM   2758 C CB  . MET A 1 353 ? 17.502  53.243 81.700 1.00 34.05  ? 353  MET A CB  1 
ATOM   2759 C CG  . MET A 1 353 ? 19.003  52.880 82.008 1.00 40.26  ? 353  MET A CG  1 
ATOM   2760 S SD  . MET A 1 353 ? 19.784  52.132 80.511 1.00 56.27  ? 353  MET A SD  1 
ATOM   2761 C CE  . MET A 1 353 ? 18.483  51.016 79.757 1.00 48.12  ? 353  MET A CE  1 
ATOM   2762 N N   . SER A 1 354 ? 14.940  54.630 80.750 1.00 27.62  ? 354  SER A N   1 
ATOM   2763 C CA  . SER A 1 354 ? 13.552  54.473 80.370 1.00 26.23  ? 354  SER A CA  1 
ATOM   2764 C C   . SER A 1 354 ? 13.201  55.270 79.127 1.00 26.01  ? 354  SER A C   1 
ATOM   2765 O O   . SER A 1 354 ? 12.273  54.892 78.410 1.00 26.52  ? 354  SER A O   1 
ATOM   2766 C CB  . SER A 1 354 ? 12.595  54.748 81.523 1.00 25.88  ? 354  SER A CB  1 
ATOM   2767 O OG  . SER A 1 354 ? 13.292  55.412 82.529 1.00 24.54  ? 354  SER A OG  1 
ATOM   2768 N N   . GLY A 1 355 ? 13.948  56.357 78.876 1.00 25.62  ? 355  GLY A N   1 
ATOM   2769 C CA  . GLY A 1 355 ? 13.886  57.147 77.636 1.00 24.07  ? 355  GLY A CA  1 
ATOM   2770 C C   . GLY A 1 355 ? 14.163  56.227 76.478 1.00 24.13  ? 355  GLY A C   1 
ATOM   2771 O O   . GLY A 1 355 ? 13.328  56.016 75.616 1.00 25.18  ? 355  GLY A O   1 
ATOM   2772 N N   . VAL A 1 356 ? 15.317  55.590 76.514 1.00 23.80  ? 356  VAL A N   1 
ATOM   2773 C CA  . VAL A 1 356 ? 15.763  54.679 75.488 1.00 22.80  ? 356  VAL A CA  1 
ATOM   2774 C C   . VAL A 1 356 ? 14.773  53.611 75.217 1.00 23.19  ? 356  VAL A C   1 
ATOM   2775 O O   . VAL A 1 356 ? 14.481  53.358 74.077 1.00 23.52  ? 356  VAL A O   1 
ATOM   2776 C CB  . VAL A 1 356 ? 17.099  54.070 75.902 1.00 23.42  ? 356  VAL A CB  1 
ATOM   2777 C CG1 . VAL A 1 356 ? 17.398  52.762 75.158 1.00 21.01  ? 356  VAL A CG1 1 
ATOM   2778 C CG2 . VAL A 1 356 ? 18.216  55.139 75.750 1.00 21.94  ? 356  VAL A CG2 1 
ATOM   2779 N N   . LYS A 1 357 ? 14.273  52.981 76.271 1.00 24.03  ? 357  LYS A N   1 
ATOM   2780 C CA  . LYS A 1 357 ? 13.194  51.977 76.202 1.00 25.15  ? 357  LYS A CA  1 
ATOM   2781 C C   . LYS A 1 357 ? 12.000  52.407 75.393 1.00 24.05  ? 357  LYS A C   1 
ATOM   2782 O O   . LYS A 1 357 ? 11.438  51.584 74.704 1.00 25.68  ? 357  LYS A O   1 
ATOM   2783 C CB  . LYS A 1 357 ? 12.626  51.688 77.589 1.00 26.45  ? 357  LYS A CB  1 
ATOM   2784 C CG  . LYS A 1 357 ? 13.370  50.642 78.394 1.00 32.75  ? 357  LYS A CG  1 
ATOM   2785 C CD  . LYS A 1 357 ? 12.442  49.541 78.925 1.00 43.27  ? 357  LYS A CD  1 
ATOM   2786 C CE  . LYS A 1 357 ? 11.591  48.967 77.718 1.00 48.24  ? 357  LYS A CE  1 
ATOM   2787 N NZ  . LYS A 1 357 ? 11.258  47.497 77.786 1.00 52.58  ? 357  LYS A NZ  1 
ATOM   2788 N N   . LEU A 1 358 ? 11.572  53.659 75.535 1.00 22.27  ? 358  LEU A N   1 
ATOM   2789 C CA  . LEU A 1 358 ? 10.341  54.158 74.969 1.00 20.41  ? 358  LEU A CA  1 
ATOM   2790 C C   . LEU A 1 358 ? 10.549  54.468 73.518 1.00 22.20  ? 358  LEU A C   1 
ATOM   2791 O O   . LEU A 1 358 ? 9.586   54.437 72.734 1.00 23.43  ? 358  LEU A O   1 
ATOM   2792 C CB  . LEU A 1 358 ? 10.028  55.480 75.607 1.00 18.83  ? 358  LEU A CB  1 
ATOM   2793 C CG  . LEU A 1 358 ? 9.401   55.451 76.963 1.00 14.43  ? 358  LEU A CG  1 
ATOM   2794 C CD1 . LEU A 1 358 ? 9.373   56.836 77.373 1.00 5.90   ? 358  LEU A CD1 1 
ATOM   2795 C CD2 . LEU A 1 358 ? 8.019   54.866 76.901 1.00 10.42  ? 358  LEU A CD2 1 
ATOM   2796 N N   . SER A 1 359 ? 11.791  54.818 73.161 1.00 22.16  ? 359  SER A N   1 
ATOM   2797 C CA  . SER A 1 359 ? 12.177  55.114 71.788 1.00 21.76  ? 359  SER A CA  1 
ATOM   2798 C C   . SER A 1 359 ? 12.417  53.945 70.940 1.00 22.01  ? 359  SER A C   1 
ATOM   2799 O O   . SER A 1 359 ? 12.334  54.095 69.775 1.00 22.66  ? 359  SER A O   1 
ATOM   2800 C CB  . SER A 1 359 ? 13.465  55.841 71.801 1.00 21.57  ? 359  SER A CB  1 
ATOM   2801 O OG  . SER A 1 359 ? 13.333  56.704 72.888 1.00 22.45  ? 359  SER A OG  1 
ATOM   2802 N N   . VAL A 1 360 ? 12.770  52.796 71.475 1.00 22.39  ? 360  VAL A N   1 
ATOM   2803 C CA  . VAL A 1 360 ? 13.035  51.697 70.594 1.00 23.93  ? 360  VAL A CA  1 
ATOM   2804 C C   . VAL A 1 360 ? 12.228  50.563 71.112 1.00 25.80  ? 360  VAL A C   1 
ATOM   2805 O O   . VAL A 1 360 ? 12.765  49.582 71.621 1.00 26.11  ? 360  VAL A O   1 
ATOM   2806 C CB  . VAL A 1 360 ? 14.523  51.289 70.520 1.00 24.02  ? 360  VAL A CB  1 
ATOM   2807 C CG1 . VAL A 1 360 ? 14.731  50.435 69.283 1.00 24.79  ? 360  VAL A CG1 1 
ATOM   2808 C CG2 . VAL A 1 360 ? 15.441  52.469 70.434 1.00 23.49  ? 360  VAL A CG2 1 
ATOM   2809 N N   . PRO A 1 361 ? 10.897  50.704 71.029 1.00 28.12  ? 361  PRO A N   1 
ATOM   2810 C CA  . PRO A 1 361 ? 9.922   49.797 71.735 1.00 28.82  ? 361  PRO A CA  1 
ATOM   2811 C C   . PRO A 1 361 ? 9.856   48.370 71.201 1.00 30.49  ? 361  PRO A C   1 
ATOM   2812 O O   . PRO A 1 361 ? 9.302   47.507 71.830 1.00 30.73  ? 361  PRO A O   1 
ATOM   2813 C CB  . PRO A 1 361 ? 8.605   50.459 71.447 1.00 28.77  ? 361  PRO A CB  1 
ATOM   2814 C CG  . PRO A 1 361 ? 8.859   51.328 70.139 1.00 27.07  ? 361  PRO A CG  1 
ATOM   2815 C CD  . PRO A 1 361 ? 10.231  51.803 70.280 1.00 27.50  ? 361  PRO A CD  1 
ATOM   2816 N N   . HIS A 1 362 ? 10.413  48.125 70.032 1.00 32.45  ? 362  HIS A N   1 
ATOM   2817 C CA  . HIS A 1 362 ? 10.445  46.781 69.449 1.00 33.98  ? 362  HIS A CA  1 
ATOM   2818 C C   . HIS A 1 362 ? 11.744  46.088 69.783 1.00 35.10  ? 362  HIS A C   1 
ATOM   2819 O O   . HIS A 1 362 ? 11.917  44.980 69.348 1.00 36.56  ? 362  HIS A O   1 
ATOM   2820 C CB  . HIS A 1 362 ? 10.394  46.871 67.910 1.00 34.36  ? 362  HIS A CB  1 
ATOM   2821 C CG  . HIS A 1 362 ? 11.090  48.099 67.364 1.00 37.46  ? 362  HIS A CG  1 
ATOM   2822 N ND1 . HIS A 1 362 ? 12.331  48.054 66.748 1.00 38.16  ? 362  HIS A ND1 1 
ATOM   2823 C CD2 . HIS A 1 362 ? 10.718  49.405 67.376 1.00 38.21  ? 362  HIS A CD2 1 
ATOM   2824 C CE1 . HIS A 1 362 ? 12.689  49.273 66.412 1.00 40.06  ? 362  HIS A CE1 1 
ATOM   2825 N NE2 . HIS A 1 362 ? 11.727  50.109 66.785 1.00 41.45  ? 362  HIS A NE2 1 
ATOM   2826 N N   . ALA A 1 363 ? 12.714  46.734 70.445 1.00 35.07  ? 363  ALA A N   1 
ATOM   2827 C CA  . ALA A 1 363 ? 13.992  46.076 70.672 1.00 34.38  ? 363  ALA A CA  1 
ATOM   2828 C C   . ALA A 1 363 ? 13.828  45.166 71.886 1.00 34.84  ? 363  ALA A C   1 
ATOM   2829 O O   . ALA A 1 363 ? 13.066  45.516 72.780 1.00 34.78  ? 363  ALA A O   1 
ATOM   2830 C CB  . ALA A 1 363 ? 15.040  47.100 70.921 1.00 33.69  ? 363  ALA A CB  1 
ATOM   2831 N N   . ASN A 1 364 ? 14.504  44.001 71.924 1.00 35.58  ? 364  ASN A N   1 
ATOM   2832 C CA  . ASN A 1 364 ? 14.669  43.236 73.201 1.00 35.08  ? 364  ASN A CA  1 
ATOM   2833 C C   . ASN A 1 364 ? 15.764  43.955 73.893 1.00 34.70  ? 364  ASN A C   1 
ATOM   2834 O O   . ASN A 1 364 ? 16.270  44.964 73.399 1.00 35.00  ? 364  ASN A O   1 
ATOM   2835 C CB  . ASN A 1 364 ? 15.131  41.807 72.977 1.00 35.23  ? 364  ASN A CB  1 
ATOM   2836 C CG  . ASN A 1 364 ? 16.240  41.715 71.939 1.00 35.63  ? 364  ASN A CG  1 
ATOM   2837 O OD1 . ASN A 1 364 ? 16.804  42.726 71.539 1.00 39.31  ? 364  ASN A OD1 1 
ATOM   2838 N ND2 . ASN A 1 364 ? 16.522  40.519 71.470 1.00 34.26  ? 364  ASN A ND2 1 
ATOM   2839 N N   . ASP A 1 365 ? 16.231  43.420 74.994 1.00 34.56  ? 365  ASP A N   1 
ATOM   2840 C CA  . ASP A 1 365 ? 17.138  44.271 75.753 1.00 34.45  ? 365  ASP A CA  1 
ATOM   2841 C C   . ASP A 1 365 ? 18.533  44.127 75.330 1.00 31.21  ? 365  ASP A C   1 
ATOM   2842 O O   . ASP A 1 365 ? 19.338  44.962 75.686 1.00 31.31  ? 365  ASP A O   1 
ATOM   2843 C CB  . ASP A 1 365 ? 17.054  43.993 77.234 1.00 36.51  ? 365  ASP A CB  1 
ATOM   2844 C CG  . ASP A 1 365 ? 17.139  42.568 77.493 1.00 42.56  ? 365  ASP A CG  1 
ATOM   2845 O OD1 . ASP A 1 365 ? 16.810  42.218 78.668 1.00 52.11  ? 365  ASP A OD1 1 
ATOM   2846 O OD2 . ASP A 1 365 ? 17.533  41.839 76.493 1.00 46.81  ? 365  ASP A OD2 1 
ATOM   2847 N N   . LEU A 1 366 ? 18.828  43.061 74.621 1.00 27.62  ? 366  LEU A N   1 
ATOM   2848 C CA  . LEU A 1 366 ? 20.104  43.013 74.044 1.00 25.97  ? 366  LEU A CA  1 
ATOM   2849 C C   . LEU A 1 366 ? 20.178  44.198 73.040 1.00 24.83  ? 366  LEU A C   1 
ATOM   2850 O O   . LEU A 1 366 ? 21.106  45.021 73.064 1.00 23.91  ? 366  LEU A O   1 
ATOM   2851 C CB  . LEU A 1 366 ? 20.352  41.638 73.395 1.00 26.65  ? 366  LEU A CB  1 
ATOM   2852 C CG  . LEU A 1 366 ? 21.725  41.628 72.695 1.00 27.03  ? 366  LEU A CG  1 
ATOM   2853 C CD1 . LEU A 1 366 ? 22.856  41.857 73.729 1.00 29.32  ? 366  LEU A CD1 1 
ATOM   2854 C CD2 . LEU A 1 366 ? 21.997  40.450 71.895 1.00 24.76  ? 366  LEU A CD2 1 
ATOM   2855 N N   . GLY A 1 367 ? 19.170  44.311 72.189 1.00 23.65  ? 367  GLY A N   1 
ATOM   2856 C CA  . GLY A 1 367 ? 19.004  45.497 71.368 1.00 23.19  ? 367  GLY A CA  1 
ATOM   2857 C C   . GLY A 1 367 ? 19.166  46.782 72.164 1.00 22.90  ? 367  GLY A C   1 
ATOM   2858 O O   . GLY A 1 367 ? 19.984  47.653 71.797 1.00 22.40  ? 367  GLY A O   1 
ATOM   2859 N N   . LEU A 1 368 ? 18.418  46.888 73.268 1.00 22.32  ? 368  LEU A N   1 
ATOM   2860 C CA  . LEU A 1 368 ? 18.600  48.002 74.182 1.00 22.84  ? 368  LEU A CA  1 
ATOM   2861 C C   . LEU A 1 368 ? 20.073  48.330 74.585 1.00 24.32  ? 368  LEU A C   1 
ATOM   2862 O O   . LEU A 1 368 ? 20.483  49.509 74.570 1.00 24.36  ? 368  LEU A O   1 
ATOM   2863 C CB  . LEU A 1 368 ? 17.688  47.876 75.379 1.00 21.67  ? 368  LEU A CB  1 
ATOM   2864 C CG  . LEU A 1 368 ? 16.181  48.009 75.070 1.00 20.87  ? 368  LEU A CG  1 
ATOM   2865 C CD1 . LEU A 1 368 ? 15.361  47.915 76.315 1.00 18.86  ? 368  LEU A CD1 1 
ATOM   2866 C CD2 . LEU A 1 368 ? 15.666  49.252 74.290 1.00 17.48  ? 368  LEU A CD2 1 
ATOM   2867 N N   . ASP A 1 369 ? 20.884  47.305 74.884 1.00 25.03  ? 369  ASP A N   1 
ATOM   2868 C CA  . ASP A 1 369 ? 22.260  47.558 75.330 1.00 25.91  ? 369  ASP A CA  1 
ATOM   2869 C C   . ASP A 1 369 ? 23.013  48.120 74.185 1.00 25.23  ? 369  ASP A C   1 
ATOM   2870 O O   . ASP A 1 369 ? 23.806  49.024 74.353 1.00 25.87  ? 369  ASP A O   1 
ATOM   2871 C CB  . ASP A 1 369 ? 22.954  46.289 75.772 1.00 26.17  ? 369  ASP A CB  1 
ATOM   2872 C CG  . ASP A 1 369 ? 22.401  45.744 77.085 1.00 32.82  ? 369  ASP A CG  1 
ATOM   2873 O OD1 . ASP A 1 369 ? 21.545  46.437 77.734 1.00 36.27  ? 369  ASP A OD1 1 
ATOM   2874 O OD2 . ASP A 1 369 ? 22.827  44.605 77.493 1.00 39.08  ? 369  ASP A OD2 1 
ATOM   2875 N N   . ALA A 1 370 ? 22.763  47.562 73.008 1.00 24.19  ? 370  ALA A N   1 
ATOM   2876 C CA  . ALA A 1 370 ? 23.497  47.946 71.856 1.00 22.78  ? 370  ALA A CA  1 
ATOM   2877 C C   . ALA A 1 370 ? 23.324  49.443 71.640 1.00 22.83  ? 370  ALA A C   1 
ATOM   2878 O O   . ALA A 1 370 ? 24.256  50.105 71.152 1.00 24.03  ? 370  ALA A O   1 
ATOM   2879 C CB  . ALA A 1 370 ? 23.019  47.201 70.709 1.00 22.72  ? 370  ALA A CB  1 
ATOM   2880 N N   . VAL A 1 371 ? 22.170  49.991 72.044 1.00 20.75  ? 371  VAL A N   1 
ATOM   2881 C CA  . VAL A 1 371 ? 21.875  51.372 71.754 1.00 18.58  ? 371  VAL A CA  1 
ATOM   2882 C C   . VAL A 1 371 ? 22.594  52.242 72.766 1.00 18.33  ? 371  VAL A C   1 
ATOM   2883 O O   . VAL A 1 371 ? 23.242  53.283 72.435 1.00 16.69  ? 371  VAL A O   1 
ATOM   2884 C CB  . VAL A 1 371 ? 20.347  51.591 71.778 1.00 19.07  ? 371  VAL A CB  1 
ATOM   2885 C CG1 . VAL A 1 371 ? 20.002  53.033 71.587 1.00 17.45  ? 371  VAL A CG1 1 
ATOM   2886 C CG2 . VAL A 1 371 ? 19.710  50.843 70.675 1.00 19.05  ? 371  VAL A CG2 1 
ATOM   2887 N N   . THR A 1 372 ? 22.453  51.800 74.018 1.00 18.30  ? 372  THR A N   1 
ATOM   2888 C CA  . THR A 1 372 ? 23.036  52.455 75.172 1.00 18.74  ? 372  THR A CA  1 
ATOM   2889 C C   . THR A 1 372 ? 24.509  52.579 74.949 1.00 19.13  ? 372  THR A C   1 
ATOM   2890 O O   . THR A 1 372 ? 25.038  53.683 75.070 1.00 19.36  ? 372  THR A O   1 
ATOM   2891 C CB  . THR A 1 372 ? 22.825  51.653 76.422 1.00 19.08  ? 372  THR A CB  1 
ATOM   2892 O OG1 . THR A 1 372 ? 21.434  51.448 76.611 1.00 21.01  ? 372  THR A OG1 1 
ATOM   2893 C CG2 . THR A 1 372 ? 23.304  52.370 77.599 1.00 19.83  ? 372  THR A CG2 1 
ATOM   2894 N N   . LEU A 1 373 ? 25.148  51.450 74.595 1.00 19.98  ? 373  LEU A N   1 
ATOM   2895 C CA  . LEU A 1 373 ? 26.555  51.372 74.265 1.00 20.37  ? 373  LEU A CA  1 
ATOM   2896 C C   . LEU A 1 373 ? 26.869  52.386 73.226 1.00 21.26  ? 373  LEU A C   1 
ATOM   2897 O O   . LEU A 1 373 ? 27.751  53.239 73.383 1.00 21.37  ? 373  LEU A O   1 
ATOM   2898 C CB  . LEU A 1 373 ? 26.867  50.056 73.666 1.00 20.53  ? 373  LEU A CB  1 
ATOM   2899 C CG  . LEU A 1 373 ? 28.342  49.935 73.287 1.00 22.69  ? 373  LEU A CG  1 
ATOM   2900 C CD1 . LEU A 1 373 ? 29.282  49.734 74.479 1.00 23.94  ? 373  LEU A CD1 1 
ATOM   2901 C CD2 . LEU A 1 373 ? 28.470  48.740 72.405 1.00 30.08  ? 373  LEU A CD2 1 
ATOM   2902 N N   . GLN A 1 374 ? 26.113  52.354 72.150 1.00 22.57  ? 374  GLN A N   1 
ATOM   2903 C CA  . GLN A 1 374 ? 26.359  53.334 71.088 1.00 23.44  ? 374  GLN A CA  1 
ATOM   2904 C C   . GLN A 1 374 ? 26.256  54.835 71.393 1.00 23.72  ? 374  GLN A C   1 
ATOM   2905 O O   . GLN A 1 374 ? 26.861  55.596 70.673 1.00 22.88  ? 374  GLN A O   1 
ATOM   2906 C CB  . GLN A 1 374 ? 25.440  53.016 69.955 1.00 23.76  ? 374  GLN A CB  1 
ATOM   2907 C CG  . GLN A 1 374 ? 26.003  53.309 68.690 1.00 26.36  ? 374  GLN A CG  1 
ATOM   2908 C CD  . GLN A 1 374 ? 27.221  52.497 68.438 1.00 33.80  ? 374  GLN A CD  1 
ATOM   2909 O OE1 . GLN A 1 374 ? 28.113  53.005 67.745 1.00 36.66  ? 374  GLN A OE1 1 
ATOM   2910 N NE2 . GLN A 1 374 ? 27.314  51.229 69.013 1.00 32.47  ? 374  GLN A NE2 1 
ATOM   2911 N N   . TYR A 1 375 ? 25.460  55.258 72.400 1.00 25.10  ? 375  TYR A N   1 
ATOM   2912 C CA  . TYR A 1 375 ? 25.139  56.691 72.571 1.00 26.36  ? 375  TYR A CA  1 
ATOM   2913 C C   . TYR A 1 375 ? 25.555  57.175 73.916 1.00 29.20  ? 375  TYR A C   1 
ATOM   2914 O O   . TYR A 1 375 ? 25.124  58.261 74.357 1.00 30.39  ? 375  TYR A O   1 
ATOM   2915 C CB  . TYR A 1 375 ? 23.623  56.979 72.408 1.00 24.41  ? 375  TYR A CB  1 
ATOM   2916 C CG  . TYR A 1 375 ? 23.171  57.094 70.967 1.00 22.84  ? 375  TYR A CG  1 
ATOM   2917 C CD1 . TYR A 1 375 ? 22.696  55.956 70.281 1.00 21.03  ? 375  TYR A CD1 1 
ATOM   2918 C CD2 . TYR A 1 375 ? 23.291  58.312 70.254 1.00 20.75  ? 375  TYR A CD2 1 
ATOM   2919 C CE1 . TYR A 1 375 ? 22.354  56.025 68.941 1.00 18.93  ? 375  TYR A CE1 1 
ATOM   2920 C CE2 . TYR A 1 375 ? 22.959  58.414 68.905 1.00 17.75  ? 375  TYR A CE2 1 
ATOM   2921 C CZ  . TYR A 1 375 ? 22.470  57.254 68.262 1.00 20.98  ? 375  TYR A CZ  1 
ATOM   2922 O OH  . TYR A 1 375 ? 22.064  57.277 66.947 1.00 21.22  ? 375  TYR A OH  1 
ATOM   2923 N N   . THR A 1 376 ? 26.310  56.361 74.651 1.00 31.89  ? 376  THR A N   1 
ATOM   2924 C CA  . THR A 1 376 ? 26.653  56.756 76.033 1.00 32.91  ? 376  THR A CA  1 
ATOM   2925 C C   . THR A 1 376 ? 28.027  57.288 76.043 1.00 34.40  ? 376  THR A C   1 
ATOM   2926 O O   . THR A 1 376 ? 28.894  56.800 75.340 1.00 34.74  ? 376  THR A O   1 
ATOM   2927 C CB  . THR A 1 376 ? 26.587  55.623 77.049 1.00 32.10  ? 376  THR A CB  1 
ATOM   2928 O OG1 . THR A 1 376 ? 25.281  55.074 77.071 1.00 30.46  ? 376  THR A OG1 1 
ATOM   2929 C CG2 . THR A 1 376 ? 26.846  56.163 78.427 1.00 33.12  ? 376  THR A CG2 1 
ATOM   2930 N N   . ASP A 1 377 ? 28.223  58.321 76.836 1.00 37.35  ? 377  ASP A N   1 
ATOM   2931 C CA  . ASP A 1 377 ? 29.582  58.742 77.113 1.00 39.76  ? 377  ASP A CA  1 
ATOM   2932 C C   . ASP A 1 377 ? 30.214  57.968 78.285 1.00 40.02  ? 377  ASP A C   1 
ATOM   2933 O O   . ASP A 1 377 ? 30.059  58.353 79.432 1.00 40.71  ? 377  ASP A O   1 
ATOM   2934 C CB  . ASP A 1 377 ? 29.666  60.234 77.375 1.00 40.00  ? 377  ASP A CB  1 
ATOM   2935 C CG  . ASP A 1 377 ? 31.095  60.688 77.372 1.00 43.69  ? 377  ASP A CG  1 
ATOM   2936 O OD1 . ASP A 1 377 ? 31.954  59.753 77.412 1.00 45.14  ? 377  ASP A OD1 1 
ATOM   2937 O OD2 . ASP A 1 377 ? 31.370  61.926 77.309 1.00 46.72  ? 377  ASP A OD2 1 
ATOM   2938 N N   . TRP A 1 378 ? 30.966  56.918 78.010 1.00 40.20  ? 378  TRP A N   1 
ATOM   2939 C CA  . TRP A 1 378 ? 31.283  55.999 79.075 1.00 40.84  ? 378  TRP A CA  1 
ATOM   2940 C C   . TRP A 1 378 ? 32.264  56.525 80.082 1.00 43.02  ? 378  TRP A C   1 
ATOM   2941 O O   . TRP A 1 378 ? 32.525  55.916 81.123 1.00 43.14  ? 378  TRP A O   1 
ATOM   2942 C CB  . TRP A 1 378 ? 31.761  54.728 78.477 1.00 39.32  ? 378  TRP A CB  1 
ATOM   2943 C CG  . TRP A 1 378 ? 30.661  54.036 77.859 1.00 37.93  ? 378  TRP A CG  1 
ATOM   2944 C CD1 . TRP A 1 378 ? 30.369  53.942 76.511 1.00 35.87  ? 378  TRP A CD1 1 
ATOM   2945 C CD2 . TRP A 1 378 ? 29.647  53.323 78.546 1.00 35.75  ? 378  TRP A CD2 1 
ATOM   2946 N NE1 . TRP A 1 378 ? 29.235  53.175 76.330 1.00 35.43  ? 378  TRP A NE1 1 
ATOM   2947 C CE2 . TRP A 1 378 ? 28.771  52.784 77.561 1.00 36.30  ? 378  TRP A CE2 1 
ATOM   2948 C CE3 . TRP A 1 378 ? 29.383  53.090 79.895 1.00 33.34  ? 378  TRP A CE3 1 
ATOM   2949 C CZ2 . TRP A 1 378 ? 27.631  52.058 77.900 1.00 37.63  ? 378  TRP A CZ2 1 
ATOM   2950 C CZ3 . TRP A 1 378 ? 28.259  52.361 80.232 1.00 35.77  ? 378  TRP A CZ3 1 
ATOM   2951 C CH2 . TRP A 1 378 ? 27.385  51.860 79.247 1.00 37.00  ? 378  TRP A CH2 1 
ATOM   2952 N N   . MET A 1 379 ? 32.769  57.707 79.784 1.00 46.15  ? 379  MET A N   1 
ATOM   2953 C CA  . MET A 1 379 ? 33.736  58.357 80.625 1.00 50.08  ? 379  MET A CA  1 
ATOM   2954 C C   . MET A 1 379 ? 33.191  59.554 81.419 1.00 49.72  ? 379  MET A C   1 
ATOM   2955 O O   . MET A 1 379 ? 33.878  60.552 81.558 1.00 50.58  ? 379  MET A O   1 
ATOM   2956 C CB  . MET A 1 379 ? 34.815  58.852 79.731 1.00 48.87  ? 379  MET A CB  1 
ATOM   2957 C CG  . MET A 1 379 ? 36.010  59.028 80.530 1.00 52.48  ? 379  MET A CG  1 
ATOM   2958 S SD  . MET A 1 379 ? 37.397  59.171 79.417 1.00 58.17  ? 379  MET A SD  1 
ATOM   2959 C CE  . MET A 1 379 ? 38.802  58.906 80.571 1.00 55.71  ? 379  MET A CE  1 
ATOM   2960 N N   . ASP A 1 380 ? 31.979  59.425 81.958 1.00 49.98  ? 380  ASP A N   1 
ATOM   2961 C CA  . ASP A 1 380 ? 31.069  60.530 82.299 1.00 49.36  ? 380  ASP A CA  1 
ATOM   2962 C C   . ASP A 1 380 ? 29.634  60.041 82.048 1.00 49.04  ? 380  ASP A C   1 
ATOM   2963 O O   . ASP A 1 380 ? 28.782  60.779 81.585 1.00 48.73  ? 380  ASP A O   1 
ATOM   2964 C CB  . ASP A 1 380 ? 31.324  61.754 81.414 1.00 49.46  ? 380  ASP A CB  1 
ATOM   2965 C CG  . ASP A 1 380 ? 30.878  63.057 82.082 1.00 50.37  ? 380  ASP A CG  1 
ATOM   2966 O OD1 . ASP A 1 380 ? 31.150  64.153 81.519 1.00 46.85  ? 380  ASP A OD1 1 
ATOM   2967 O OD2 . ASP A 1 380 ? 30.260  62.954 83.187 1.00 53.13  ? 380  ASP A OD2 1 
ATOM   2968 N N   . ASP A 1 381 ? 29.384  58.766 82.323 1.00 48.84  ? 381  ASP A N   1 
ATOM   2969 C CA  . ASP A 1 381 ? 28.131  58.130 82.007 1.00 48.25  ? 381  ASP A CA  1 
ATOM   2970 C C   . ASP A 1 381 ? 27.062  58.673 82.933 1.00 48.68  ? 381  ASP A C   1 
ATOM   2971 O O   . ASP A 1 381 ? 25.942  58.137 83.008 1.00 50.23  ? 381  ASP A O   1 
ATOM   2972 C CB  . ASP A 1 381 ? 28.276  56.629 82.165 1.00 47.79  ? 381  ASP A CB  1 
ATOM   2973 C CG  . ASP A 1 381 ? 28.441  56.204 83.618 1.00 48.07  ? 381  ASP A CG  1 
ATOM   2974 O OD1 . ASP A 1 381 ? 27.625  55.328 84.010 1.00 47.63  ? 381  ASP A OD1 1 
ATOM   2975 O OD2 . ASP A 1 381 ? 29.345  56.742 84.354 1.00 45.61  ? 381  ASP A OD2 1 
ATOM   2976 N N   . ASN A 1 382 ? 27.392  59.742 83.657 1.00 48.48  ? 382  ASN A N   1 
ATOM   2977 C CA  . ASN A 1 382 ? 26.367  60.371 84.500 1.00 47.21  ? 382  ASN A CA  1 
ATOM   2978 C C   . ASN A 1 382 ? 25.954  61.783 84.228 1.00 45.02  ? 382  ASN A C   1 
ATOM   2979 O O   . ASN A 1 382 ? 24.889  62.146 84.676 1.00 46.21  ? 382  ASN A O   1 
ATOM   2980 C CB  . ASN A 1 382 ? 26.622  60.244 85.995 1.00 48.16  ? 382  ASN A CB  1 
ATOM   2981 C CG  . ASN A 1 382 ? 25.415  59.674 86.695 1.00 50.77  ? 382  ASN A CG  1 
ATOM   2982 O OD1 . ASN A 1 382 ? 25.506  58.586 87.288 1.00 55.93  ? 382  ASN A OD1 1 
ATOM   2983 N ND2 . ASN A 1 382 ? 24.244  60.331 86.539 1.00 51.16  ? 382  ASN A ND2 1 
ATOM   2984 N N   . ASN A 1 383 ? 26.785  62.582 83.563 1.00 41.38  ? 383  ASN A N   1 
ATOM   2985 C CA  . ASN A 1 383 ? 26.423  63.923 83.140 1.00 37.40  ? 383  ASN A CA  1 
ATOM   2986 C C   . ASN A 1 383 ? 24.992  64.038 82.599 1.00 35.39  ? 383  ASN A C   1 
ATOM   2987 O O   . ASN A 1 383 ? 24.693  63.520 81.524 1.00 35.24  ? 383  ASN A O   1 
ATOM   2988 C CB  . ASN A 1 383 ? 27.395  64.321 82.071 1.00 37.24  ? 383  ASN A CB  1 
ATOM   2989 C CG  . ASN A 1 383 ? 27.289  65.740 81.693 1.00 37.20  ? 383  ASN A CG  1 
ATOM   2990 O OD1 . ASN A 1 383 ? 26.204  66.316 81.551 1.00 38.27  ? 383  ASN A OD1 1 
ATOM   2991 N ND2 . ASN A 1 383 ? 28.422  66.320 81.454 1.00 38.09  ? 383  ASN A ND2 1 
ATOM   2992 N N   . GLY A 1 384 ? 24.128  64.735 83.347 1.00 32.83  ? 384  GLY A N   1 
ATOM   2993 C CA  . GLY A 1 384 ? 22.725  64.953 82.989 1.00 29.47  ? 384  GLY A CA  1 
ATOM   2994 C C   . GLY A 1 384 ? 22.540  65.585 81.630 1.00 27.54  ? 384  GLY A C   1 
ATOM   2995 O O   . GLY A 1 384 ? 21.752  65.142 80.878 1.00 28.01  ? 384  GLY A O   1 
ATOM   2996 N N   . ILE A 1 385 ? 23.277  66.610 81.301 1.00 25.34  ? 385  ILE A N   1 
ATOM   2997 C CA  . ILE A 1 385 ? 23.189  67.168 80.002 1.00 24.29  ? 385  ILE A CA  1 
ATOM   2998 C C   . ILE A 1 385 ? 23.521  66.191 78.895 1.00 25.02  ? 385  ILE A C   1 
ATOM   2999 O O   . ILE A 1 385 ? 22.902  66.169 77.841 1.00 26.34  ? 385  ILE A O   1 
ATOM   3000 C CB  . ILE A 1 385 ? 24.184  68.232 79.917 1.00 24.28  ? 385  ILE A CB  1 
ATOM   3001 C CG1 . ILE A 1 385 ? 23.630  69.454 80.628 1.00 22.64  ? 385  ILE A CG1 1 
ATOM   3002 C CG2 . ILE A 1 385 ? 24.545  68.501 78.489 1.00 22.33  ? 385  ILE A CG2 1 
ATOM   3003 C CD1 . ILE A 1 385 ? 24.221  70.660 80.112 1.00 23.79  ? 385  ILE A CD1 1 
ATOM   3004 N N   . LYS A 1 386 ? 24.538  65.396 79.091 1.00 25.10  ? 386  LYS A N   1 
ATOM   3005 C CA  . LYS A 1 386 ? 24.951  64.492 78.041 1.00 24.40  ? 386  LYS A CA  1 
ATOM   3006 C C   . LYS A 1 386 ? 23.922  63.414 77.767 1.00 22.70  ? 386  LYS A C   1 
ATOM   3007 O O   . LYS A 1 386 ? 23.765  62.956 76.681 1.00 21.31  ? 386  LYS A O   1 
ATOM   3008 C CB  . LYS A 1 386 ? 26.315  63.918 78.409 1.00 25.13  ? 386  LYS A CB  1 
ATOM   3009 C CG  . LYS A 1 386 ? 27.373  64.979 78.200 1.00 28.71  ? 386  LYS A CG  1 
ATOM   3010 C CD  . LYS A 1 386 ? 28.684  64.427 77.664 1.00 33.85  ? 386  LYS A CD  1 
ATOM   3011 C CE  . LYS A 1 386 ? 29.854  65.096 78.475 1.00 38.51  ? 386  LYS A CE  1 
ATOM   3012 N NZ  . LYS A 1 386 ? 31.163  64.296 78.548 1.00 42.44  ? 386  LYS A NZ  1 
ATOM   3013 N N   . ASN A 1 387 ? 23.225  63.021 78.787 1.00 22.41  ? 387  ASN A N   1 
ATOM   3014 C CA  . ASN A 1 387 ? 22.143  62.153 78.642 1.00 23.62  ? 387  ASN A CA  1 
ATOM   3015 C C   . ASN A 1 387 ? 20.951  62.780 77.961 1.00 24.14  ? 387  ASN A C   1 
ATOM   3016 O O   . ASN A 1 387 ? 20.329  62.144 77.143 1.00 26.22  ? 387  ASN A O   1 
ATOM   3017 C CB  . ASN A 1 387 ? 21.722  61.778 80.013 1.00 24.71  ? 387  ASN A CB  1 
ATOM   3018 C CG  . ASN A 1 387 ? 22.723  60.928 80.661 1.00 28.90  ? 387  ASN A CG  1 
ATOM   3019 O OD1 . ASN A 1 387 ? 23.583  60.402 79.973 1.00 38.23  ? 387  ASN A OD1 1 
ATOM   3020 N ND2 . ASN A 1 387 ? 22.633  60.738 81.966 1.00 30.75  ? 387  ASN A ND2 1 
ATOM   3021 N N   . ARG A 1 388 ? 20.588  64.012 78.307 1.00 23.43  ? 388  ARG A N   1 
ATOM   3022 C CA  . ARG A 1 388 ? 19.493  64.742 77.621 1.00 21.49  ? 388  ARG A CA  1 
ATOM   3023 C C   . ARG A 1 388 ? 19.792  64.715 76.146 1.00 20.87  ? 388  ARG A C   1 
ATOM   3024 O O   . ARG A 1 388 ? 19.026  64.135 75.360 1.00 20.97  ? 388  ARG A O   1 
ATOM   3025 C CB  . ARG A 1 388 ? 19.463  66.205 78.037 1.00 20.78  ? 388  ARG A CB  1 
ATOM   3026 C CG  . ARG A 1 388 ? 18.185  66.859 77.875 1.00 18.85  ? 388  ARG A CG  1 
ATOM   3027 C CD  . ARG A 1 388 ? 18.362  68.238 77.184 1.00 20.24  ? 388  ARG A CD  1 
ATOM   3028 N NE  . ARG A 1 388 ? 19.040  69.341 77.889 1.00 19.57  ? 388  ARG A NE  1 
ATOM   3029 C CZ  . ARG A 1 388 ? 20.167  69.896 77.460 1.00 21.23  ? 388  ARG A CZ  1 
ATOM   3030 N NH1 . ARG A 1 388 ? 20.708  70.909 78.101 1.00 23.50  ? 388  ARG A NH1 1 
ATOM   3031 N NH2 . ARG A 1 388 ? 20.752  69.440 76.372 1.00 23.29  ? 388  ARG A NH2 1 
ATOM   3032 N N   . ASP A 1 389 ? 20.899  65.339 75.768 1.00 19.10  ? 389  ASP A N   1 
ATOM   3033 C CA  . ASP A 1 389 ? 21.292  65.307 74.390 1.00 18.88  ? 389  ASP A CA  1 
ATOM   3034 C C   . ASP A 1 389 ? 21.417  63.947 73.715 1.00 18.53  ? 389  ASP A C   1 
ATOM   3035 O O   . ASP A 1 389 ? 21.126  63.906 72.526 1.00 20.00  ? 389  ASP A O   1 
ATOM   3036 C CB  . ASP A 1 389 ? 22.595  65.995 74.243 1.00 18.76  ? 389  ASP A CB  1 
ATOM   3037 C CG  . ASP A 1 389 ? 22.500  67.417 74.585 1.00 20.23  ? 389  ASP A CG  1 
ATOM   3038 O OD1 . ASP A 1 389 ? 23.586  67.972 74.645 1.00 21.54  ? 389  ASP A OD1 1 
ATOM   3039 O OD2 . ASP A 1 389 ? 21.385  67.986 74.751 1.00 19.49  ? 389  ASP A OD2 1 
ATOM   3040 N N   . GLY A 1 390 ? 21.832  62.874 74.421 1.00 16.53  ? 390  GLY A N   1 
ATOM   3041 C CA  . GLY A 1 390 ? 22.145  61.608 73.800 1.00 15.49  ? 390  GLY A CA  1 
ATOM   3042 C C   . GLY A 1 390 ? 20.824  61.065 73.334 1.00 16.69  ? 390  GLY A C   1 
ATOM   3043 O O   . GLY A 1 390 ? 20.698  60.516 72.252 1.00 17.01  ? 390  GLY A O   1 
ATOM   3044 N N   . LEU A 1 391 ? 19.817  61.258 74.179 1.00 17.27  ? 391  LEU A N   1 
ATOM   3045 C CA  . LEU A 1 391 ? 18.451  60.867 73.966 1.00 17.25  ? 391  LEU A CA  1 
ATOM   3046 C C   . LEU A 1 391 ? 17.829  61.608 72.791 1.00 17.52  ? 391  LEU A C   1 
ATOM   3047 O O   . LEU A 1 391 ? 17.201  60.972 71.930 1.00 18.66  ? 391  LEU A O   1 
ATOM   3048 C CB  . LEU A 1 391 ? 17.711  61.169 75.241 1.00 16.33  ? 391  LEU A CB  1 
ATOM   3049 C CG  . LEU A 1 391 ? 16.715  60.144 75.842 1.00 20.32  ? 391  LEU A CG  1 
ATOM   3050 C CD1 . LEU A 1 391 ? 17.019  58.631 75.716 1.00 19.26  ? 391  LEU A CD1 1 
ATOM   3051 C CD2 . LEU A 1 391 ? 16.434  60.488 77.329 1.00 18.96  ? 391  LEU A CD2 1 
ATOM   3052 N N   . ASP A 1 392 ? 18.013  62.936 72.711 1.00 17.06  ? 392  ASP A N   1 
ATOM   3053 C CA  . ASP A 1 392 ? 17.603  63.716 71.540 1.00 16.69  ? 392  ASP A CA  1 
ATOM   3054 C C   . ASP A 1 392 ? 18.166  63.125 70.277 1.00 14.83  ? 392  ASP A C   1 
ATOM   3055 O O   . ASP A 1 392 ? 17.515  63.036 69.260 1.00 15.94  ? 392  ASP A O   1 
ATOM   3056 C CB  . ASP A 1 392 ? 18.076  65.129 71.695 1.00 19.09  ? 392  ASP A CB  1 
ATOM   3057 C CG  . ASP A 1 392 ? 17.689  66.036 70.521 1.00 24.93  ? 392  ASP A CG  1 
ATOM   3058 O OD1 . ASP A 1 392 ? 16.600  66.672 70.498 1.00 30.49  ? 392  ASP A OD1 1 
ATOM   3059 O OD2 . ASP A 1 392 ? 18.543  66.215 69.645 1.00 33.27  ? 392  ASP A OD2 1 
ATOM   3060 N N   . ASP A 1 393 ? 19.370  62.639 70.319 1.00 12.74  ? 393  ASP A N   1 
ATOM   3061 C CA  . ASP A 1 393 ? 19.882  62.029 69.093 1.00 11.61  ? 393  ASP A CA  1 
ATOM   3062 C C   . ASP A 1 393 ? 19.396  60.649 68.784 1.00 10.22  ? 393  ASP A C   1 
ATOM   3063 O O   . ASP A 1 393 ? 19.365  60.258 67.636 1.00 9.46   ? 393  ASP A O   1 
ATOM   3064 C CB  . ASP A 1 393 ? 21.357  61.882 69.180 1.00 12.36  ? 393  ASP A CB  1 
ATOM   3065 C CG  . ASP A 1 393 ? 22.053  63.160 69.123 1.00 14.23  ? 393  ASP A CG  1 
ATOM   3066 O OD1 . ASP A 1 393 ? 21.581  64.143 68.561 1.00 19.02  ? 393  ASP A OD1 1 
ATOM   3067 O OD2 . ASP A 1 393 ? 23.136  63.196 69.681 1.00 25.79  ? 393  ASP A OD2 1 
ATOM   3068 N N   . ILE A 1 394 ? 19.143  59.853 69.808 1.00 9.21   ? 394  ILE A N   1 
ATOM   3069 C CA  . ILE A 1 394 ? 18.537  58.582 69.574 1.00 8.37   ? 394  ILE A CA  1 
ATOM   3070 C C   . ILE A 1 394 ? 17.156  58.758 68.861 1.00 9.49   ? 394  ILE A C   1 
ATOM   3071 O O   . ILE A 1 394 ? 16.880  58.098 67.842 1.00 8.15   ? 394  ILE A O   1 
ATOM   3072 C CB  . ILE A 1 394 ? 18.389  57.842 70.863 1.00 7.62   ? 394  ILE A CB  1 
ATOM   3073 C CG1 . ILE A 1 394 ? 19.769  57.572 71.430 1.00 9.48   ? 394  ILE A CG1 1 
ATOM   3074 C CG2 . ILE A 1 394 ? 17.562  56.598 70.629 1.00 3.25   ? 394  ILE A CG2 1 
ATOM   3075 C CD1 . ILE A 1 394 ? 19.806  56.591 72.611 1.00 12.11  ? 394  ILE A CD1 1 
ATOM   3076 N N   . VAL A 1 395 ? 16.324  59.683 69.363 1.00 9.97   ? 395  VAL A N   1 
ATOM   3077 C CA  . VAL A 1 395 ? 14.986  59.732 68.863 1.00 10.73  ? 395  VAL A CA  1 
ATOM   3078 C C   . VAL A 1 395 ? 15.092  60.259 67.427 1.00 12.11  ? 395  VAL A C   1 
ATOM   3079 O O   . VAL A 1 395 ? 14.419  59.693 66.522 1.00 12.48  ? 395  VAL A O   1 
ATOM   3080 C CB  . VAL A 1 395 ? 14.068  60.563 69.780 1.00 11.65  ? 395  VAL A CB  1 
ATOM   3081 C CG1 . VAL A 1 395 ? 12.676  60.778 69.143 1.00 7.96   ? 395  VAL A CG1 1 
ATOM   3082 C CG2 . VAL A 1 395 ? 14.028  59.942 71.252 1.00 9.93   ? 395  VAL A CG2 1 
ATOM   3083 N N   . GLY A 1 396 ? 15.977  61.279 67.225 1.00 12.40  ? 396  GLY A N   1 
ATOM   3084 C CA  . GLY A 1 396 ? 16.265  61.896 65.917 1.00 12.12  ? 396  GLY A CA  1 
ATOM   3085 C C   . GLY A 1 396 ? 16.675  60.861 64.846 1.00 13.52  ? 396  GLY A C   1 
ATOM   3086 O O   . GLY A 1 396 ? 16.085  60.725 63.784 1.00 13.25  ? 396  GLY A O   1 
ATOM   3087 N N   . ASP A 1 397 ? 17.703  60.106 65.184 1.00 14.73  ? 397  ASP A N   1 
ATOM   3088 C CA  . ASP A 1 397 ? 18.392  59.244 64.296 1.00 15.48  ? 397  ASP A CA  1 
ATOM   3089 C C   . ASP A 1 397 ? 17.487  58.132 63.965 1.00 16.03  ? 397  ASP A C   1 
ATOM   3090 O O   . ASP A 1 397 ? 17.359  57.776 62.799 1.00 17.73  ? 397  ASP A O   1 
ATOM   3091 C CB  . ASP A 1 397 ? 19.602  58.666 65.003 1.00 15.69  ? 397  ASP A CB  1 
ATOM   3092 C CG  . ASP A 1 397 ? 20.774  59.656 65.085 1.00 17.10  ? 397  ASP A CG  1 
ATOM   3093 O OD1 . ASP A 1 397 ? 21.763  59.313 65.785 1.00 20.30  ? 397  ASP A OD1 1 
ATOM   3094 O OD2 . ASP A 1 397 ? 20.747  60.742 64.449 1.00 12.62  ? 397  ASP A OD2 1 
ATOM   3095 N N   . HIS A 1 398 ? 16.839  57.577 64.968 1.00 15.47  ? 398  HIS A N   1 
ATOM   3096 C CA  . HIS A 1 398 ? 16.185  56.327 64.720 1.00 15.29  ? 398  HIS A CA  1 
ATOM   3097 C C   . HIS A 1 398 ? 14.891  56.575 63.958 1.00 15.52  ? 398  HIS A C   1 
ATOM   3098 O O   . HIS A 1 398 ? 14.475  55.726 63.119 1.00 16.14  ? 398  HIS A O   1 
ATOM   3099 C CB  . HIS A 1 398 ? 15.952  55.568 66.011 1.00 15.29  ? 398  HIS A CB  1 
ATOM   3100 C CG  . HIS A 1 398 ? 14.845  54.582 65.908 1.00 15.13  ? 398  HIS A CG  1 
ATOM   3101 N ND1 . HIS A 1 398 ? 14.919  53.487 65.087 1.00 12.93  ? 398  HIS A ND1 1 
ATOM   3102 C CD2 . HIS A 1 398 ? 13.593  54.593 66.415 1.00 15.94  ? 398  HIS A CD2 1 
ATOM   3103 C CE1 . HIS A 1 398 ? 13.787  52.816 65.159 1.00 13.71  ? 398  HIS A CE1 1 
ATOM   3104 N NE2 . HIS A 1 398 ? 12.956  53.474 65.943 1.00 13.11  ? 398  HIS A NE2 1 
ATOM   3105 N N   . ASN A 1 399 ? 14.316  57.756 64.192 1.00 14.54  ? 399  ASN A N   1 
ATOM   3106 C CA  . ASN A 1 399 ? 13.056  58.098 63.613 1.00 14.42  ? 399  ASN A CA  1 
ATOM   3107 C C   . ASN A 1 399 ? 13.028  58.988 62.397 1.00 13.76  ? 399  ASN A C   1 
ATOM   3108 O O   . ASN A 1 399 ? 12.006  59.063 61.741 1.00 15.11  ? 399  ASN A O   1 
ATOM   3109 C CB  . ASN A 1 399 ? 12.162  58.752 64.657 1.00 15.68  ? 399  ASN A CB  1 
ATOM   3110 C CG  . ASN A 1 399 ? 11.477  57.738 65.562 1.00 17.26  ? 399  ASN A CG  1 
ATOM   3111 O OD1 . ASN A 1 399 ? 10.595  56.989 65.145 1.00 19.04  ? 399  ASN A OD1 1 
ATOM   3112 N ND2 . ASN A 1 399 ? 11.875  57.728 66.805 1.00 16.62  ? 399  ASN A ND2 1 
ATOM   3113 N N   . VAL A 1 400 ? 14.048  59.732 62.084 1.00 12.79  ? 400  VAL A N   1 
ATOM   3114 C CA  . VAL A 1 400 ? 13.887  60.639 60.975 1.00 12.29  ? 400  VAL A CA  1 
ATOM   3115 C C   . VAL A 1 400 ? 15.159  60.560 60.122 1.00 14.91  ? 400  VAL A C   1 
ATOM   3116 O O   . VAL A 1 400 ? 15.115  60.282 58.890 1.00 15.40  ? 400  VAL A O   1 
ATOM   3117 C CB  . VAL A 1 400 ? 13.733  62.060 61.442 1.00 10.12  ? 400  VAL A CB  1 
ATOM   3118 C CG1 . VAL A 1 400 ? 13.874  63.026 60.279 1.00 10.56  ? 400  VAL A CG1 1 
ATOM   3119 C CG2 . VAL A 1 400 ? 12.399  62.307 62.085 1.00 12.06  ? 400  VAL A CG2 1 
ATOM   3120 N N   . ILE A 1 401 ? 16.310  60.812 60.770 1.00 15.97  ? 401  ILE A N   1 
ATOM   3121 C CA  . ILE A 1 401 ? 17.540  60.997 60.035 1.00 15.17  ? 401  ILE A CA  1 
ATOM   3122 C C   . ILE A 1 401 ? 17.992  59.747 59.427 1.00 15.53  ? 401  ILE A C   1 
ATOM   3123 O O   . ILE A 1 401 ? 18.218  59.754 58.233 1.00 16.14  ? 401  ILE A O   1 
ATOM   3124 C CB  . ILE A 1 401 ? 18.638  61.604 60.824 1.00 15.33  ? 401  ILE A CB  1 
ATOM   3125 C CG1 . ILE A 1 401 ? 18.174  62.929 61.383 1.00 14.07  ? 401  ILE A CG1 1 
ATOM   3126 C CG2 . ILE A 1 401 ? 19.972  61.799 59.953 1.00 14.21  ? 401  ILE A CG2 1 
ATOM   3127 C CD1 . ILE A 1 401 ? 19.289  63.490 62.173 1.00 15.18  ? 401  ILE A CD1 1 
ATOM   3128 N N   . CYS A 1 402 ? 18.067  58.660 60.171 1.00 15.37  ? 402  CYS A N   1 
ATOM   3129 C CA  . CYS A 1 402 ? 18.556  57.505 59.478 1.00 16.69  ? 402  CYS A CA  1 
ATOM   3130 C C   . CYS A 1 402 ? 17.588  56.829 58.519 1.00 17.56  ? 402  CYS A C   1 
ATOM   3131 O O   . CYS A 1 402 ? 18.046  56.382 57.512 1.00 18.34  ? 402  CYS A O   1 
ATOM   3132 C CB  . CYS A 1 402 ? 19.215  56.487 60.371 1.00 17.63  ? 402  CYS A CB  1 
ATOM   3133 S SG  . CYS A 1 402 ? 20.528  57.084 61.327 1.00 18.41  ? 402  CYS A SG  1 
ATOM   3134 N N   . PRO A 1 403 ? 16.256  56.753 58.811 1.00 18.54  ? 403  PRO A N   1 
ATOM   3135 C CA  . PRO A 1 403 ? 15.414  56.150 57.767 1.00 18.00  ? 403  PRO A CA  1 
ATOM   3136 C C   . PRO A 1 403 ? 15.465  56.993 56.469 1.00 17.57  ? 403  PRO A C   1 
ATOM   3137 O O   . PRO A 1 403 ? 15.314  56.420 55.379 1.00 18.56  ? 403  PRO A O   1 
ATOM   3138 C CB  . PRO A 1 403 ? 13.991  56.155 58.388 1.00 17.49  ? 403  PRO A CB  1 
ATOM   3139 C CG  . PRO A 1 403 ? 14.259  56.187 59.858 1.00 18.18  ? 403  PRO A CG  1 
ATOM   3140 C CD  . PRO A 1 403 ? 15.424  57.167 59.965 1.00 18.85  ? 403  PRO A CD  1 
ATOM   3141 N N   . LEU A 1 404 ? 15.713  58.297 56.574 1.00 16.10  ? 404  LEU A N   1 
ATOM   3142 C CA  . LEU A 1 404 ? 15.651  59.174 55.408 1.00 15.70  ? 404  LEU A CA  1 
ATOM   3143 C C   . LEU A 1 404 ? 16.926  58.967 54.670 1.00 15.73  ? 404  LEU A C   1 
ATOM   3144 O O   . LEU A 1 404 ? 16.912  58.912 53.458 1.00 16.69  ? 404  LEU A O   1 
ATOM   3145 C CB  . LEU A 1 404 ? 15.479  60.650 55.782 1.00 15.72  ? 404  LEU A CB  1 
ATOM   3146 C CG  . LEU A 1 404 ? 15.602  61.744 54.722 1.00 15.29  ? 404  LEU A CG  1 
ATOM   3147 C CD1 . LEU A 1 404 ? 14.903  62.975 55.198 1.00 15.99  ? 404  LEU A CD1 1 
ATOM   3148 C CD2 . LEU A 1 404 ? 16.993  62.097 54.437 1.00 13.84  ? 404  LEU A CD2 1 
ATOM   3149 N N   . MET A 1 405 ? 18.043  58.821 55.377 1.00 15.63  ? 405  MET A N   1 
ATOM   3150 C CA  . MET A 1 405 ? 19.296  58.480 54.701 1.00 14.53  ? 405  MET A CA  1 
ATOM   3151 C C   . MET A 1 405 ? 19.203  57.148 53.921 1.00 15.63  ? 405  MET A C   1 
ATOM   3152 O O   . MET A 1 405 ? 19.614  57.048 52.745 1.00 15.75  ? 405  MET A O   1 
ATOM   3153 C CB  . MET A 1 405 ? 20.404  58.467 55.684 1.00 12.93  ? 405  MET A CB  1 
ATOM   3154 C CG  . MET A 1 405 ? 20.752  59.854 56.148 1.00 13.30  ? 405  MET A CG  1 
ATOM   3155 S SD  . MET A 1 405 ? 21.221  61.023 54.878 1.00 15.07  ? 405  MET A SD  1 
ATOM   3156 C CE  . MET A 1 405 ? 22.687  60.297 54.154 1.00 22.00  ? 405  MET A CE  1 
ATOM   3157 N N   . HIS A 1 406 ? 18.609  56.136 54.534 1.00 16.22  ? 406  HIS A N   1 
ATOM   3158 C CA  . HIS A 1 406 ? 18.404  54.924 53.829 1.00 17.94  ? 406  HIS A CA  1 
ATOM   3159 C C   . HIS A 1 406 ? 17.570  55.199 52.554 1.00 18.46  ? 406  HIS A C   1 
ATOM   3160 O O   . HIS A 1 406 ? 17.906  54.731 51.443 1.00 18.50  ? 406  HIS A O   1 
ATOM   3161 C CB  . HIS A 1 406 ? 17.779  53.881 54.743 1.00 18.20  ? 406  HIS A CB  1 
ATOM   3162 C CG  . HIS A 1 406 ? 17.651  52.530 54.102 1.00 22.37  ? 406  HIS A CG  1 
ATOM   3163 N ND1 . HIS A 1 406 ? 18.750  51.711 53.852 1.00 24.10  ? 406  HIS A ND1 1 
ATOM   3164 C CD2 . HIS A 1 406 ? 16.556  51.870 53.618 1.00 23.90  ? 406  HIS A CD2 1 
ATOM   3165 C CE1 . HIS A 1 406 ? 18.319  50.586 53.284 1.00 29.14  ? 406  HIS A CE1 1 
ATOM   3166 N NE2 . HIS A 1 406 ? 16.997  50.666 53.107 1.00 24.48  ? 406  HIS A NE2 1 
ATOM   3167 N N   . PHE A 1 407 ? 16.517  55.997 52.687 1.00 19.26  ? 407  PHE A N   1 
ATOM   3168 C CA  . PHE A 1 407 ? 15.646  56.260 51.526 1.00 20.21  ? 407  PHE A CA  1 
ATOM   3169 C C   . PHE A 1 407 ? 16.443  56.881 50.455 1.00 21.20  ? 407  PHE A C   1 
ATOM   3170 O O   . PHE A 1 407 ? 16.245  56.524 49.313 1.00 22.79  ? 407  PHE A O   1 
ATOM   3171 C CB  . PHE A 1 407 ? 14.451  57.143 51.857 1.00 19.00  ? 407  PHE A CB  1 
ATOM   3172 C CG  . PHE A 1 407 ? 13.680  57.626 50.678 1.00 17.14  ? 407  PHE A CG  1 
ATOM   3173 C CD1 . PHE A 1 407 ? 12.659  56.877 50.143 1.00 19.70  ? 407  PHE A CD1 1 
ATOM   3174 C CD2 . PHE A 1 407 ? 13.898  58.859 50.165 1.00 16.47  ? 407  PHE A CD2 1 
ATOM   3175 C CE1 . PHE A 1 407 ? 11.836  57.344 49.023 1.00 14.98  ? 407  PHE A CE1 1 
ATOM   3176 C CE2 . PHE A 1 407 ? 13.137  59.286 49.078 1.00 18.19  ? 407  PHE A CE2 1 
ATOM   3177 C CZ  . PHE A 1 407 ? 12.101  58.507 48.508 1.00 15.28  ? 407  PHE A CZ  1 
ATOM   3178 N N   . VAL A 1 408 ? 17.325  57.803 50.823 1.00 22.06  ? 408  VAL A N   1 
ATOM   3179 C CA  . VAL A 1 408 ? 18.217  58.512 49.879 1.00 23.40  ? 408  VAL A CA  1 
ATOM   3180 C C   . VAL A 1 408 ? 19.191  57.596 49.122 1.00 23.94  ? 408  VAL A C   1 
ATOM   3181 O O   . VAL A 1 408 ? 19.211  57.548 47.903 1.00 23.55  ? 408  VAL A O   1 
ATOM   3182 C CB  . VAL A 1 408 ? 18.994  59.569 50.611 1.00 22.69  ? 408  VAL A CB  1 
ATOM   3183 C CG1 . VAL A 1 408 ? 20.166  59.926 49.869 1.00 22.53  ? 408  VAL A CG1 1 
ATOM   3184 C CG2 . VAL A 1 408 ? 18.165  60.752 50.698 1.00 24.77  ? 408  VAL A CG2 1 
ATOM   3185 N N   . ASN A 1 409 ? 19.977  56.854 49.857 1.00 25.37  ? 409  ASN A N   1 
ATOM   3186 C CA  . ASN A 1 409 ? 20.766  55.825 49.243 1.00 27.88  ? 409  ASN A CA  1 
ATOM   3187 C C   . ASN A 1 409 ? 20.065  54.920 48.290 1.00 27.30  ? 409  ASN A C   1 
ATOM   3188 O O   . ASN A 1 409 ? 20.631  54.575 47.316 1.00 28.09  ? 409  ASN A O   1 
ATOM   3189 C CB  . ASN A 1 409 ? 21.561  55.065 50.294 1.00 28.84  ? 409  ASN A CB  1 
ATOM   3190 C CG  . ASN A 1 409 ? 22.571  56.011 50.960 1.00 35.18  ? 409  ASN A CG  1 
ATOM   3191 O OD1 . ASN A 1 409 ? 23.162  56.863 50.263 1.00 39.71  ? 409  ASN A OD1 1 
ATOM   3192 N ND2 . ASN A 1 409 ? 22.721  55.941 52.294 1.00 39.64  ? 409  ASN A ND2 1 
ATOM   3193 N N   . LYS A 1 410 ? 18.847  54.520 48.517 1.00 27.05  ? 410  LYS A N   1 
ATOM   3194 C CA  . LYS A 1 410 ? 18.280  53.648 47.516 1.00 27.16  ? 410  LYS A CA  1 
ATOM   3195 C C   . LYS A 1 410 ? 17.705  54.495 46.386 1.00 27.02  ? 410  LYS A C   1 
ATOM   3196 O O   . LYS A 1 410 ? 17.730  54.161 45.192 1.00 26.61  ? 410  LYS A O   1 
ATOM   3197 C CB  . LYS A 1 410 ? 17.245  52.751 48.158 1.00 26.89  ? 410  LYS A CB  1 
ATOM   3198 C CG  . LYS A 1 410 ? 17.848  51.936 49.242 1.00 29.38  ? 410  LYS A CG  1 
ATOM   3199 C CD  . LYS A 1 410 ? 19.167  51.167 48.763 1.00 37.39  ? 410  LYS A CD  1 
ATOM   3200 C CE  . LYS A 1 410 ? 19.147  49.558 48.728 1.00 38.15  ? 410  LYS A CE  1 
ATOM   3201 N NZ  . LYS A 1 410 ? 18.188  48.890 49.750 1.00 37.00  ? 410  LYS A NZ  1 
ATOM   3202 N N   . TYR A 1 411 ? 17.182  55.640 46.765 1.00 27.13  ? 411  TYR A N   1 
ATOM   3203 C CA  . TYR A 1 411 ? 16.633  56.481 45.728 1.00 26.53  ? 411  TYR A CA  1 
ATOM   3204 C C   . TYR A 1 411 ? 17.701  56.806 44.696 1.00 26.24  ? 411  TYR A C   1 
ATOM   3205 O O   . TYR A 1 411 ? 17.414  56.779 43.532 1.00 26.22  ? 411  TYR A O   1 
ATOM   3206 C CB  . TYR A 1 411 ? 15.928  57.751 46.230 1.00 25.22  ? 411  TYR A CB  1 
ATOM   3207 C CG  . TYR A 1 411 ? 15.101  58.317 45.121 1.00 24.06  ? 411  TYR A CG  1 
ATOM   3208 C CD1 . TYR A 1 411 ? 13.875  57.724 44.770 1.00 21.85  ? 411  TYR A CD1 1 
ATOM   3209 C CD2 . TYR A 1 411 ? 15.553  59.403 44.382 1.00 23.44  ? 411  TYR A CD2 1 
ATOM   3210 C CE1 . TYR A 1 411 ? 13.121  58.207 43.739 1.00 21.43  ? 411  TYR A CE1 1 
ATOM   3211 C CE2 . TYR A 1 411 ? 14.810  59.899 43.352 1.00 22.21  ? 411  TYR A CE2 1 
ATOM   3212 C CZ  . TYR A 1 411 ? 13.608  59.297 43.038 1.00 23.82  ? 411  TYR A CZ  1 
ATOM   3213 O OH  . TYR A 1 411 ? 12.890  59.797 42.007 1.00 25.45  ? 411  TYR A OH  1 
ATOM   3214 N N   . THR A 1 412 ? 18.937  57.073 45.096 1.00 25.30  ? 412  THR A N   1 
ATOM   3215 C CA  . THR A 1 412 ? 19.764  57.724 44.123 1.00 24.15  ? 412  THR A CA  1 
ATOM   3216 C C   . THR A 1 412 ? 20.486  56.816 43.123 1.00 24.33  ? 412  THR A C   1 
ATOM   3217 O O   . THR A 1 412 ? 20.907  57.283 42.098 1.00 24.00  ? 412  THR A O   1 
ATOM   3218 C CB  . THR A 1 412 ? 20.524  58.926 44.711 1.00 24.48  ? 412  THR A CB  1 
ATOM   3219 O OG1 . THR A 1 412 ? 21.830  58.542 45.033 1.00 22.90  ? 412  THR A OG1 1 
ATOM   3220 C CG2 . THR A 1 412 ? 19.857  59.475 45.991 1.00 22.01  ? 412  THR A CG2 1 
ATOM   3221 N N   . LYS A 1 413 ? 20.547  55.514 43.395 1.00 26.14  ? 413  LYS A N   1 
ATOM   3222 C CA  A LYS A 1 413 ? 20.834  54.422 42.405 0.50 26.58  ? 413  LYS A CA  1 
ATOM   3223 C CA  B LYS A 1 413 ? 20.975  54.566 42.369 0.50 26.80  ? 413  LYS A CA  1 
ATOM   3224 C C   . LYS A 1 413 ? 20.004  54.635 41.172 1.00 26.94  ? 413  LYS A C   1 
ATOM   3225 O O   . LYS A 1 413 ? 20.464  54.700 40.093 1.00 27.51  ? 413  LYS A O   1 
ATOM   3226 C CB  A LYS A 1 413 ? 20.377  53.047 42.926 0.50 26.05  ? 413  LYS A CB  1 
ATOM   3227 C CB  B LYS A 1 413 ? 21.276  53.153 42.926 0.50 26.47  ? 413  LYS A CB  1 
ATOM   3228 C CG  A LYS A 1 413 ? 21.374  52.231 43.709 0.50 26.93  ? 413  LYS A CG  1 
ATOM   3229 C CG  B LYS A 1 413 ? 22.332  53.189 44.094 0.50 26.59  ? 413  LYS A CG  1 
ATOM   3230 C CD  A LYS A 1 413 ? 20.754  51.711 45.066 0.50 28.49  ? 413  LYS A CD  1 
ATOM   3231 C CD  B LYS A 1 413 ? 23.127  51.868 44.303 0.50 27.83  ? 413  LYS A CD  1 
ATOM   3232 C CE  A LYS A 1 413 ? 19.527  50.751 44.903 0.50 27.57  ? 413  LYS A CE  1 
ATOM   3233 C CE  B LYS A 1 413 ? 23.512  51.557 45.804 0.50 27.37  ? 413  LYS A CE  1 
ATOM   3234 N NZ  A LYS A 1 413 ? 18.304  51.248 45.620 0.50 21.39  ? 413  LYS A NZ  1 
ATOM   3235 N NZ  B LYS A 1 413 ? 22.552  50.594 46.528 0.50 27.21  ? 413  LYS A NZ  1 
ATOM   3236 N N   . PHE A 1 414 ? 18.697  54.718 41.344 1.00 27.78  ? 414  PHE A N   1 
ATOM   3237 C CA  . PHE A 1 414 ? 17.891  54.954 40.148 1.00 28.96  ? 414  PHE A CA  1 
ATOM   3238 C C   . PHE A 1 414 ? 17.294  56.359 39.882 1.00 29.47  ? 414  PHE A C   1 
ATOM   3239 O O   . PHE A 1 414 ? 16.637  56.567 38.883 1.00 31.02  ? 414  PHE A O   1 
ATOM   3240 C CB  . PHE A 1 414 ? 16.789  53.920 40.003 1.00 29.20  ? 414  PHE A CB  1 
ATOM   3241 C CG  . PHE A 1 414 ? 17.144  52.594 40.479 1.00 28.54  ? 414  PHE A CG  1 
ATOM   3242 C CD1 . PHE A 1 414 ? 17.545  51.614 39.579 1.00 30.55  ? 414  PHE A CD1 1 
ATOM   3243 C CD2 . PHE A 1 414 ? 17.027  52.285 41.809 1.00 28.39  ? 414  PHE A CD2 1 
ATOM   3244 C CE1 . PHE A 1 414 ? 17.868  50.279 39.998 1.00 30.06  ? 414  PHE A CE1 1 
ATOM   3245 C CE2 . PHE A 1 414 ? 17.334  50.980 42.260 1.00 33.77  ? 414  PHE A CE2 1 
ATOM   3246 C CZ  . PHE A 1 414 ? 17.746  49.946 41.324 1.00 30.93  ? 414  PHE A CZ  1 
ATOM   3247 N N   . GLY A 1 415 ? 17.520  57.327 40.745 1.00 30.26  ? 415  GLY A N   1 
ATOM   3248 C CA  . GLY A 1 415 ? 16.917  58.670 40.605 1.00 30.11  ? 415  GLY A CA  1 
ATOM   3249 C C   . GLY A 1 415 ? 17.483  59.516 39.491 1.00 29.98  ? 415  GLY A C   1 
ATOM   3250 O O   . GLY A 1 415 ? 18.403  59.117 38.774 1.00 29.98  ? 415  GLY A O   1 
ATOM   3251 N N   . ASN A 1 416 ? 16.906  60.683 39.316 1.00 30.17  ? 416  ASN A N   1 
ATOM   3252 C CA  . ASN A 1 416 ? 17.390  61.517 38.278 1.00 30.57  ? 416  ASN A CA  1 
ATOM   3253 C C   . ASN A 1 416 ? 17.878  62.820 38.854 1.00 29.85  ? 416  ASN A C   1 
ATOM   3254 O O   . ASN A 1 416 ? 17.574  63.886 38.319 1.00 29.62  ? 416  ASN A O   1 
ATOM   3255 C CB  . ASN A 1 416 ? 16.316  61.724 37.232 1.00 31.00  ? 416  ASN A CB  1 
ATOM   3256 C CG  . ASN A 1 416 ? 16.847  62.426 35.969 1.00 35.80  ? 416  ASN A CG  1 
ATOM   3257 O OD1 . ASN A 1 416 ? 16.179  63.281 35.343 1.00 45.84  ? 416  ASN A OD1 1 
ATOM   3258 N ND2 . ASN A 1 416 ? 18.057  62.059 35.583 1.00 40.10  ? 416  ASN A ND2 1 
ATOM   3259 N N   . GLY A 1 417 ? 18.654  62.725 39.941 1.00 29.28  ? 417  GLY A N   1 
ATOM   3260 C CA  . GLY A 1 417 ? 19.159  63.926 40.673 1.00 27.87  ? 417  GLY A CA  1 
ATOM   3261 C C   . GLY A 1 417 ? 18.604  64.063 42.081 1.00 26.65  ? 417  GLY A C   1 
ATOM   3262 O O   . GLY A 1 417 ? 17.404  63.872 42.317 1.00 26.29  ? 417  GLY A O   1 
ATOM   3263 N N   . THR A 1 418 ? 19.483  64.392 43.016 1.00 25.61  ? 418  THR A N   1 
ATOM   3264 C CA  . THR A 1 418 ? 19.136  64.337 44.431 1.00 24.70  ? 418  THR A CA  1 
ATOM   3265 C C   . THR A 1 418 ? 19.871  65.430 45.202 1.00 24.82  ? 418  THR A C   1 
ATOM   3266 O O   . THR A 1 418 ? 21.079  65.498 45.118 1.00 26.45  ? 418  THR A O   1 
ATOM   3267 C CB  . THR A 1 418 ? 19.510  62.937 45.011 1.00 24.12  ? 418  THR A CB  1 
ATOM   3268 O OG1 . THR A 1 418 ? 18.685  61.907 44.418 1.00 24.57  ? 418  THR A OG1 1 
ATOM   3269 C CG2 . THR A 1 418 ? 19.346  62.948 46.453 1.00 21.08  ? 418  THR A CG2 1 
ATOM   3270 N N   . TYR A 1 419 ? 19.171  66.271 45.958 1.00 24.80  ? 419  TYR A N   1 
ATOM   3271 C CA  . TYR A 1 419 ? 19.779  67.389 46.725 1.00 24.45  ? 419  TYR A CA  1 
ATOM   3272 C C   . TYR A 1 419 ? 19.454  67.295 48.226 1.00 24.18  ? 419  TYR A C   1 
ATOM   3273 O O   . TYR A 1 419 ? 18.253  67.065 48.574 1.00 24.27  ? 419  TYR A O   1 
ATOM   3274 C CB  . TYR A 1 419 ? 19.281  68.712 46.175 1.00 24.83  ? 419  TYR A CB  1 
ATOM   3275 C CG  . TYR A 1 419 ? 19.751  68.930 44.753 1.00 27.80  ? 419  TYR A CG  1 
ATOM   3276 C CD1 . TYR A 1 419 ? 18.975  68.486 43.669 1.00 29.19  ? 419  TYR A CD1 1 
ATOM   3277 C CD2 . TYR A 1 419 ? 20.986  69.583 44.477 1.00 28.21  ? 419  TYR A CD2 1 
ATOM   3278 C CE1 . TYR A 1 419 ? 19.404  68.671 42.399 1.00 26.71  ? 419  TYR A CE1 1 
ATOM   3279 C CE2 . TYR A 1 419 ? 21.396  69.779 43.205 1.00 26.03  ? 419  TYR A CE2 1 
ATOM   3280 C CZ  . TYR A 1 419 ? 20.594  69.299 42.185 1.00 25.57  ? 419  TYR A CZ  1 
ATOM   3281 O OH  . TYR A 1 419 ? 20.978  69.429 40.917 1.00 27.51  ? 419  TYR A OH  1 
ATOM   3282 N N   . LEU A 1 420 ? 20.469  67.463 49.107 1.00 22.43  ? 420  LEU A N   1 
ATOM   3283 C CA  . LEU A 1 420 ? 20.270  67.157 50.517 1.00 21.28  ? 420  LEU A CA  1 
ATOM   3284 C C   . LEU A 1 420 ? 20.667  68.302 51.431 1.00 22.05  ? 420  LEU A C   1 
ATOM   3285 O O   . LEU A 1 420 ? 21.800  68.795 51.311 1.00 22.57  ? 420  LEU A O   1 
ATOM   3286 C CB  . LEU A 1 420 ? 21.099  65.946 50.870 1.00 21.11  ? 420  LEU A CB  1 
ATOM   3287 C CG  . LEU A 1 420 ? 20.884  65.332 52.272 1.00 22.04  ? 420  LEU A CG  1 
ATOM   3288 C CD1 . LEU A 1 420 ? 19.418  65.250 52.746 1.00 21.30  ? 420  LEU A CD1 1 
ATOM   3289 C CD2 . LEU A 1 420 ? 21.538  63.994 52.418 1.00 21.08  ? 420  LEU A CD2 1 
ATOM   3290 N N   . TYR A 1 421 ? 19.776  68.733 52.353 1.00 21.29  ? 421  TYR A N   1 
ATOM   3291 C CA  . TYR A 1 421 ? 20.155  69.820 53.284 1.00 20.02  ? 421  TYR A CA  1 
ATOM   3292 C C   . TYR A 1 421 ? 20.167  69.355 54.714 1.00 19.09  ? 421  TYR A C   1 
ATOM   3293 O O   . TYR A 1 421 ? 19.606  68.319 55.073 1.00 17.35  ? 421  TYR A O   1 
ATOM   3294 C CB  . TYR A 1 421 ? 19.256  71.061 53.160 1.00 20.79  ? 421  TYR A CB  1 
ATOM   3295 C CG  . TYR A 1 421 ? 17.849  70.805 53.634 1.00 22.56  ? 421  TYR A CG  1 
ATOM   3296 C CD1 . TYR A 1 421 ? 17.510  70.889 54.978 1.00 20.69  ? 421  TYR A CD1 1 
ATOM   3297 C CD2 . TYR A 1 421 ? 16.862  70.382 52.743 1.00 24.23  ? 421  TYR A CD2 1 
ATOM   3298 C CE1 . TYR A 1 421 ? 16.198  70.545 55.424 1.00 21.85  ? 421  TYR A CE1 1 
ATOM   3299 C CE2 . TYR A 1 421 ? 15.558  70.099 53.182 1.00 23.61  ? 421  TYR A CE2 1 
ATOM   3300 C CZ  . TYR A 1 421 ? 15.237  70.187 54.507 1.00 22.38  ? 421  TYR A CZ  1 
ATOM   3301 O OH  . TYR A 1 421 ? 13.959  69.896 54.899 1.00 22.49  ? 421  TYR A OH  1 
ATOM   3302 N N   . PHE A 1 422 ? 20.823  70.141 55.545 1.00 19.39  ? 422  PHE A N   1 
ATOM   3303 C CA  . PHE A 1 422 ? 20.852  69.898 56.976 1.00 19.54  ? 422  PHE A CA  1 
ATOM   3304 C C   . PHE A 1 422 ? 20.558  71.262 57.513 1.00 19.60  ? 422  PHE A C   1 
ATOM   3305 O O   . PHE A 1 422 ? 21.427  72.130 57.472 1.00 20.36  ? 422  PHE A O   1 
ATOM   3306 C CB  . PHE A 1 422 ? 22.240  69.515 57.435 1.00 19.12  ? 422  PHE A CB  1 
ATOM   3307 C CG  . PHE A 1 422 ? 22.319  69.141 58.898 1.00 19.95  ? 422  PHE A CG  1 
ATOM   3308 C CD1 . PHE A 1 422 ? 21.772  67.965 59.362 1.00 20.34  ? 422  PHE A CD1 1 
ATOM   3309 C CD2 . PHE A 1 422 ? 22.989  69.964 59.817 1.00 21.48  ? 422  PHE A CD2 1 
ATOM   3310 C CE1 . PHE A 1 422 ? 21.892  67.628 60.734 1.00 20.49  ? 422  PHE A CE1 1 
ATOM   3311 C CE2 . PHE A 1 422 ? 23.091  69.645 61.188 1.00 18.44  ? 422  PHE A CE2 1 
ATOM   3312 C CZ  . PHE A 1 422 ? 22.544  68.495 61.640 1.00 18.59  ? 422  PHE A CZ  1 
ATOM   3313 N N   . PHE A 1 423 ? 19.338  71.471 57.966 1.00 18.78  ? 423  PHE A N   1 
ATOM   3314 C CA  . PHE A 1 423 ? 18.998  72.751 58.483 1.00 19.43  ? 423  PHE A CA  1 
ATOM   3315 C C   . PHE A 1 423 ? 19.337  72.791 59.972 1.00 21.47  ? 423  PHE A C   1 
ATOM   3316 O O   . PHE A 1 423 ? 18.731  72.089 60.818 1.00 21.92  ? 423  PHE A O   1 
ATOM   3317 C CB  . PHE A 1 423 ? 17.534  72.962 58.313 1.00 18.17  ? 423  PHE A CB  1 
ATOM   3318 C CG  . PHE A 1 423 ? 17.026  74.251 58.838 1.00 16.90  ? 423  PHE A CG  1 
ATOM   3319 C CD1 . PHE A 1 423 ? 17.014  75.391 58.021 1.00 13.15  ? 423  PHE A CD1 1 
ATOM   3320 C CD2 . PHE A 1 423 ? 16.480  74.325 60.128 1.00 15.41  ? 423  PHE A CD2 1 
ATOM   3321 C CE1 . PHE A 1 423 ? 16.461  76.562 58.478 1.00 9.57   ? 423  PHE A CE1 1 
ATOM   3322 C CE2 . PHE A 1 423 ? 15.936  75.514 60.607 1.00 12.77  ? 423  PHE A CE2 1 
ATOM   3323 C CZ  . PHE A 1 423 ? 15.923  76.627 59.779 1.00 13.25  ? 423  PHE A CZ  1 
ATOM   3324 N N   . ASN A 1 424 ? 20.283  73.655 60.304 1.00 22.44  ? 424  ASN A N   1 
ATOM   3325 C CA  . ASN A 1 424 ? 20.610  73.845 61.669 1.00 23.13  ? 424  ASN A CA  1 
ATOM   3326 C C   . ASN A 1 424 ? 20.539  75.298 62.130 1.00 22.71  ? 424  ASN A C   1 
ATOM   3327 O O   . ASN A 1 424 ? 21.347  75.723 62.832 1.00 21.79  ? 424  ASN A O   1 
ATOM   3328 C CB  . ASN A 1 424 ? 21.951  73.185 61.923 1.00 23.59  ? 424  ASN A CB  1 
ATOM   3329 C CG  . ASN A 1 424 ? 23.018  73.757 61.082 1.00 25.76  ? 424  ASN A CG  1 
ATOM   3330 O OD1 . ASN A 1 424 ? 22.778  74.505 60.170 1.00 29.75  ? 424  ASN A OD1 1 
ATOM   3331 N ND2 . ASN A 1 424 ? 24.223  73.461 61.423 1.00 31.28  ? 424  ASN A ND2 1 
ATOM   3332 N N   . HIS A 1 425 ? 19.507  76.044 61.800 1.00 23.68  ? 425  HIS A N   1 
ATOM   3333 C CA  . HIS A 1 425 ? 19.406  77.384 62.379 1.00 24.38  ? 425  HIS A CA  1 
ATOM   3334 C C   . HIS A 1 425 ? 18.319  77.536 63.418 1.00 24.28  ? 425  HIS A C   1 
ATOM   3335 O O   . HIS A 1 425 ? 17.181  77.191 63.231 1.00 23.21  ? 425  HIS A O   1 
ATOM   3336 C CB  . HIS A 1 425 ? 19.225  78.434 61.315 1.00 23.91  ? 425  HIS A CB  1 
ATOM   3337 C CG  . HIS A 1 425 ? 19.064  79.805 61.864 1.00 26.60  ? 425  HIS A CG  1 
ATOM   3338 N ND1 . HIS A 1 425 ? 20.124  80.515 62.395 1.00 29.04  ? 425  HIS A ND1 1 
ATOM   3339 C CD2 . HIS A 1 425 ? 17.973  80.623 61.940 1.00 27.78  ? 425  HIS A CD2 1 
ATOM   3340 C CE1 . HIS A 1 425 ? 19.683  81.708 62.792 1.00 27.64  ? 425  HIS A CE1 1 
ATOM   3341 N NE2 . HIS A 1 425 ? 18.389  81.807 62.509 1.00 26.27  ? 425  HIS A NE2 1 
ATOM   3342 N N   . ARG A 1 426 ? 18.695  78.066 64.545 1.00 25.76  ? 426  ARG A N   1 
ATOM   3343 C CA  . ARG A 1 426 ? 17.726  78.237 65.560 1.00 27.96  ? 426  ARG A CA  1 
ATOM   3344 C C   . ARG A 1 426 ? 17.119  79.638 65.454 1.00 28.14  ? 426  ARG A C   1 
ATOM   3345 O O   . ARG A 1 426 ? 17.829  80.643 65.611 1.00 29.01  ? 426  ARG A O   1 
ATOM   3346 C CB  . ARG A 1 426 ? 18.360  78.063 66.933 1.00 28.46  ? 426  ARG A CB  1 
ATOM   3347 C CG  . ARG A 1 426 ? 17.233  78.017 67.923 1.00 33.18  ? 426  ARG A CG  1 
ATOM   3348 C CD  . ARG A 1 426 ? 17.602  78.232 69.338 1.00 38.89  ? 426  ARG A CD  1 
ATOM   3349 N NE  . ARG A 1 426 ? 16.628  77.439 70.082 1.00 44.26  ? 426  ARG A NE  1 
ATOM   3350 C CZ  . ARG A 1 426 ? 15.752  77.918 70.963 1.00 44.37  ? 426  ARG A CZ  1 
ATOM   3351 N NH1 . ARG A 1 426 ? 15.766  79.224 71.297 1.00 39.97  ? 426  ARG A NH1 1 
ATOM   3352 N NH2 . ARG A 1 426 ? 14.911  77.043 71.542 1.00 43.58  ? 426  ARG A NH2 1 
ATOM   3353 N N   . ALA A 1 427 ? 15.818  79.747 65.227 1.00 27.68  ? 427  ALA A N   1 
ATOM   3354 C CA  . ALA A 1 427 ? 15.300  81.078 65.030 1.00 26.39  ? 427  ALA A CA  1 
ATOM   3355 C C   . ALA A 1 427 ? 15.465  81.875 66.318 1.00 26.80  ? 427  ALA A C   1 
ATOM   3356 O O   . ALA A 1 427 ? 15.109  81.439 67.432 1.00 25.51  ? 427  ALA A O   1 
ATOM   3357 C CB  . ALA A 1 427 ? 13.906  81.050 64.619 1.00 25.89  ? 427  ALA A CB  1 
ATOM   3358 N N   . SER A 1 428 ? 16.032  83.060 66.110 1.00 27.24  ? 428  SER A N   1 
ATOM   3359 C CA  . SER A 1 428 ? 16.229  84.075 67.125 1.00 27.93  ? 428  SER A CA  1 
ATOM   3360 C C   . SER A 1 428 ? 14.992  84.368 67.996 1.00 27.93  ? 428  SER A C   1 
ATOM   3361 O O   . SER A 1 428 ? 15.132  84.781 69.123 1.00 28.50  ? 428  SER A O   1 
ATOM   3362 C CB  . SER A 1 428 ? 16.666  85.378 66.452 1.00 28.33  ? 428  SER A CB  1 
ATOM   3363 O OG  . SER A 1 428 ? 15.513  86.153 66.124 1.00 29.42  ? 428  SER A OG  1 
ATOM   3364 N N   . ASN A 1 429 ? 13.783  84.224 67.494 1.00 27.26  ? 429  ASN A N   1 
ATOM   3365 C CA  . ASN A 1 429 ? 12.677  84.484 68.382 1.00 26.75  ? 429  ASN A CA  1 
ATOM   3366 C C   . ASN A 1 429 ? 11.954  83.225 68.765 1.00 27.47  ? 429  ASN A C   1 
ATOM   3367 O O   . ASN A 1 429 ? 10.706  83.320 68.983 1.00 28.06  ? 429  ASN A O   1 
ATOM   3368 C CB  . ASN A 1 429 ? 11.648  85.355 67.679 1.00 26.90  ? 429  ASN A CB  1 
ATOM   3369 C CG  . ASN A 1 429 ? 11.316  84.844 66.301 1.00 26.83  ? 429  ASN A CG  1 
ATOM   3370 O OD1 . ASN A 1 429 ? 11.645  83.681 65.968 1.00 26.92  ? 429  ASN A OD1 1 
ATOM   3371 N ND2 . ASN A 1 429 ? 10.706  85.719 65.458 1.00 25.54  ? 429  ASN A ND2 1 
ATOM   3372 N N   . LEU A 1 430 ? 12.639  82.060 68.795 1.00 26.07  ? 430  LEU A N   1 
ATOM   3373 C CA  . LEU A 1 430 ? 11.884  80.813 68.869 1.00 25.39  ? 430  LEU A CA  1 
ATOM   3374 C C   . LEU A 1 430 ? 11.325  80.860 70.240 1.00 24.80  ? 430  LEU A C   1 
ATOM   3375 O O   . LEU A 1 430 ? 12.057  81.284 71.114 1.00 24.96  ? 430  LEU A O   1 
ATOM   3376 C CB  . LEU A 1 430 ? 12.804  79.633 68.789 1.00 25.65  ? 430  LEU A CB  1 
ATOM   3377 C CG  . LEU A 1 430 ? 12.285  78.470 67.960 1.00 26.88  ? 430  LEU A CG  1 
ATOM   3378 C CD1 . LEU A 1 430 ? 12.955  77.180 68.416 1.00 27.46  ? 430  LEU A CD1 1 
ATOM   3379 C CD2 . LEU A 1 430 ? 10.805  78.423 68.066 1.00 26.43  ? 430  LEU A CD2 1 
ATOM   3380 N N   . VAL A 1 431 ? 10.057  80.499 70.460 1.00 23.93  ? 431  VAL A N   1 
ATOM   3381 C CA  . VAL A 1 431 ? 9.505   80.583 71.851 1.00 22.73  ? 431  VAL A CA  1 
ATOM   3382 C C   . VAL A 1 431 ? 9.689   79.355 72.737 1.00 22.92  ? 431  VAL A C   1 
ATOM   3383 O O   . VAL A 1 431 ? 9.224   79.423 73.851 1.00 23.34  ? 431  VAL A O   1 
ATOM   3384 C CB  . VAL A 1 431 ? 7.992   80.743 71.906 1.00 21.82  ? 431  VAL A CB  1 
ATOM   3385 C CG1 . VAL A 1 431 ? 7.536   82.117 71.537 1.00 20.37  ? 431  VAL A CG1 1 
ATOM   3386 C CG2 . VAL A 1 431 ? 7.421   79.759 70.991 1.00 23.53  ? 431  VAL A CG2 1 
ATOM   3387 N N   . TRP A 1 432 ? 10.255  78.233 72.247 1.00 22.57  ? 432  TRP A N   1 
ATOM   3388 C CA  . TRP A 1 432 ? 10.498  76.994 73.075 1.00 22.01  ? 432  TRP A CA  1 
ATOM   3389 C C   . TRP A 1 432 ? 11.842  77.185 73.729 1.00 22.23  ? 432  TRP A C   1 
ATOM   3390 O O   . TRP A 1 432 ? 12.634  78.009 73.266 1.00 22.94  ? 432  TRP A O   1 
ATOM   3391 C CB  . TRP A 1 432 ? 10.572  75.690 72.233 1.00 20.90  ? 432  TRP A CB  1 
ATOM   3392 C CG  . TRP A 1 432 ? 9.330   75.300 71.573 1.00 19.61  ? 432  TRP A CG  1 
ATOM   3393 C CD1 . TRP A 1 432 ? 8.965   75.636 70.331 1.00 17.13  ? 432  TRP A CD1 1 
ATOM   3394 C CD2 . TRP A 1 432 ? 8.230   74.558 72.132 1.00 19.66  ? 432  TRP A CD2 1 
ATOM   3395 N NE1 . TRP A 1 432 ? 7.710   75.159 70.052 1.00 16.46  ? 432  TRP A NE1 1 
ATOM   3396 C CE2 . TRP A 1 432 ? 7.240   74.479 71.139 1.00 19.43  ? 432  TRP A CE2 1 
ATOM   3397 C CE3 . TRP A 1 432 ? 7.997   73.932 73.361 1.00 20.91  ? 432  TRP A CE3 1 
ATOM   3398 C CZ2 . TRP A 1 432 ? 6.044   73.768 71.320 1.00 19.30  ? 432  TRP A CZ2 1 
ATOM   3399 C CZ3 . TRP A 1 432 ? 6.795   73.237 73.552 1.00 19.23  ? 432  TRP A CZ3 1 
ATOM   3400 C CH2 . TRP A 1 432 ? 5.836   73.172 72.530 1.00 19.91  ? 432  TRP A CH2 1 
ATOM   3401 N N   . PRO A 1 433 ? 12.125  76.448 74.803 1.00 22.16  ? 433  PRO A N   1 
ATOM   3402 C CA  . PRO A 1 433 ? 13.431  76.640 75.386 1.00 22.24  ? 433  PRO A CA  1 
ATOM   3403 C C   . PRO A 1 433 ? 14.494  76.190 74.517 1.00 22.87  ? 433  PRO A C   1 
ATOM   3404 O O   . PRO A 1 433 ? 14.310  75.369 73.652 1.00 23.00  ? 433  PRO A O   1 
ATOM   3405 C CB  . PRO A 1 433 ? 13.445  75.743 76.607 1.00 22.01  ? 433  PRO A CB  1 
ATOM   3406 C CG  . PRO A 1 433 ? 12.366  74.751 76.384 1.00 22.20  ? 433  PRO A CG  1 
ATOM   3407 C CD  . PRO A 1 433 ? 11.311  75.502 75.576 1.00 23.16  ? 433  PRO A CD  1 
ATOM   3408 N N   . GLU A 1 434 ? 15.622  76.779 74.829 1.00 25.05  ? 434  GLU A N   1 
ATOM   3409 C CA  . GLU A 1 434 ? 16.938  76.524 74.321 1.00 27.26  ? 434  GLU A CA  1 
ATOM   3410 C C   . GLU A 1 434 ? 17.472  75.079 74.189 1.00 26.17  ? 434  GLU A C   1 
ATOM   3411 O O   . GLU A 1 434 ? 18.141  74.761 73.210 1.00 25.94  ? 434  GLU A O   1 
ATOM   3412 C CB  . GLU A 1 434 ? 17.816  77.155 75.333 1.00 28.92  ? 434  GLU A CB  1 
ATOM   3413 C CG  . GLU A 1 434 ? 19.242  77.101 74.929 1.00 39.09  ? 434  GLU A CG  1 
ATOM   3414 C CD  . GLU A 1 434 ? 19.643  78.439 74.327 1.00 49.91  ? 434  GLU A CD  1 
ATOM   3415 O OE1 . GLU A 1 434 ? 18.704  79.069 73.714 1.00 53.94  ? 434  GLU A OE1 1 
ATOM   3416 O OE2 . GLU A 1 434 ? 20.857  78.840 74.504 1.00 50.82  ? 434  GLU A OE2 1 
ATOM   3417 N N   . TRP A 1 435 ? 17.243  74.247 75.208 1.00 24.82  ? 435  TRP A N   1 
ATOM   3418 C CA  . TRP A 1 435 ? 17.821  72.942 75.233 1.00 22.61  ? 435  TRP A CA  1 
ATOM   3419 C C   . TRP A 1 435 ? 17.284  72.120 74.057 1.00 23.74  ? 435  TRP A C   1 
ATOM   3420 O O   . TRP A 1 435 ? 17.904  71.127 73.632 1.00 24.49  ? 435  TRP A O   1 
ATOM   3421 C CB  . TRP A 1 435 ? 17.541  72.286 76.579 1.00 21.31  ? 435  TRP A CB  1 
ATOM   3422 C CG  . TRP A 1 435 ? 16.094  71.924 76.928 1.00 18.75  ? 435  TRP A CG  1 
ATOM   3423 C CD1 . TRP A 1 435 ? 15.256  72.574 77.802 1.00 20.73  ? 435  TRP A CD1 1 
ATOM   3424 C CD2 . TRP A 1 435 ? 15.361  70.770 76.496 1.00 17.35  ? 435  TRP A CD2 1 
ATOM   3425 N NE1 . TRP A 1 435 ? 14.001  71.891 77.930 1.00 14.02  ? 435  TRP A NE1 1 
ATOM   3426 C CE2 . TRP A 1 435 ? 14.052  70.807 77.117 1.00 15.04  ? 435  TRP A CE2 1 
ATOM   3427 C CE3 . TRP A 1 435 ? 15.663  69.708 75.639 1.00 17.76  ? 435  TRP A CE3 1 
ATOM   3428 C CZ2 . TRP A 1 435 ? 13.065  69.812 76.890 1.00 21.42  ? 435  TRP A CZ2 1 
ATOM   3429 C CZ3 . TRP A 1 435 ? 14.653  68.704 75.395 1.00 19.67  ? 435  TRP A CZ3 1 
ATOM   3430 C CH2 . TRP A 1 435 ? 13.384  68.754 76.029 1.00 20.20  ? 435  TRP A CH2 1 
ATOM   3431 N N   . MET A 1 436 ? 16.137  72.517 73.510 1.00 23.21  ? 436  MET A N   1 
ATOM   3432 C CA  . MET A 1 436 ? 15.535  71.733 72.459 1.00 22.68  ? 436  MET A CA  1 
ATOM   3433 C C   . MET A 1 436 ? 16.244  72.003 71.106 1.00 22.32  ? 436  MET A C   1 
ATOM   3434 O O   . MET A 1 436 ? 16.118  71.242 70.164 1.00 22.61  ? 436  MET A O   1 
ATOM   3435 C CB  . MET A 1 436 ? 14.049  72.040 72.377 1.00 22.41  ? 436  MET A CB  1 
ATOM   3436 C CG  . MET A 1 436 ? 13.339  71.797 73.617 1.00 20.94  ? 436  MET A CG  1 
ATOM   3437 S SD  . MET A 1 436 ? 11.568  71.689 73.325 1.00 24.12  ? 436  MET A SD  1 
ATOM   3438 C CE  . MET A 1 436 ? 11.092  73.280 73.774 1.00 26.55  ? 436  MET A CE  1 
ATOM   3439 N N   . GLY A 1 437 ? 16.957  73.109 70.987 1.00 21.76  ? 437  GLY A N   1 
ATOM   3440 C CA  . GLY A 1 437 ? 17.699  73.378 69.748 1.00 21.03  ? 437  GLY A CA  1 
ATOM   3441 C C   . GLY A 1 437 ? 16.804  73.715 68.557 1.00 20.31  ? 437  GLY A C   1 
ATOM   3442 O O   . GLY A 1 437 ? 15.719  74.235 68.737 1.00 21.63  ? 437  GLY A O   1 
ATOM   3443 N N   . VAL A 1 438 ? 17.322  73.454 67.356 1.00 18.94  ? 438  VAL A N   1 
ATOM   3444 C CA  . VAL A 1 438 ? 16.644  73.425 66.082 1.00 17.17  ? 438  VAL A CA  1 
ATOM   3445 C C   . VAL A 1 438 ? 15.617  72.259 66.025 1.00 17.29  ? 438  VAL A C   1 
ATOM   3446 O O   . VAL A 1 438 ? 15.954  71.129 65.690 1.00 17.54  ? 438  VAL A O   1 
ATOM   3447 C CB  . VAL A 1 438 ? 17.673  73.203 64.972 1.00 16.04  ? 438  VAL A CB  1 
ATOM   3448 C CG1 . VAL A 1 438 ? 16.986  73.215 63.636 1.00 17.54  ? 438  VAL A CG1 1 
ATOM   3449 C CG2 . VAL A 1 438 ? 18.759  74.255 64.966 1.00 13.88  ? 438  VAL A CG2 1 
ATOM   3450 N N   . ILE A 1 439 ? 14.374  72.563 66.317 1.00 16.21  ? 439  ILE A N   1 
ATOM   3451 C CA  . ILE A 1 439 ? 13.377  71.585 66.554 1.00 16.97  ? 439  ILE A CA  1 
ATOM   3452 C C   . ILE A 1 439 ? 12.695  71.093 65.261 1.00 17.88  ? 439  ILE A C   1 
ATOM   3453 O O   . ILE A 1 439 ? 12.701  71.793 64.251 1.00 18.34  ? 439  ILE A O   1 
ATOM   3454 C CB  . ILE A 1 439 ? 12.296  72.262 67.431 1.00 17.22  ? 439  ILE A CB  1 
ATOM   3455 C CG1 . ILE A 1 439 ? 12.794  72.543 68.841 1.00 13.50  ? 439  ILE A CG1 1 
ATOM   3456 C CG2 . ILE A 1 439 ? 11.014  71.425 67.484 1.00 17.55  ? 439  ILE A CG2 1 
ATOM   3457 C CD1 . ILE A 1 439 ? 11.845  73.440 69.466 1.00 9.28   ? 439  ILE A CD1 1 
ATOM   3458 N N   . HIS A 1 440 ? 12.054  69.905 65.318 1.00 18.47  ? 440  HIS A N   1 
ATOM   3459 C CA  . HIS A 1 440 ? 11.312  69.271 64.178 1.00 17.99  ? 440  HIS A CA  1 
ATOM   3460 C C   . HIS A 1 440 ? 10.220  70.262 63.854 1.00 18.51  ? 440  HIS A C   1 
ATOM   3461 O O   . HIS A 1 440 ? 9.470   70.664 64.747 1.00 20.24  ? 440  HIS A O   1 
ATOM   3462 C CB  . HIS A 1 440 ? 10.799  67.914 64.656 1.00 17.36  ? 440  HIS A CB  1 
ATOM   3463 C CG  . HIS A 1 440 ? 9.831   67.201 63.762 1.00 18.53  ? 440  HIS A CG  1 
ATOM   3464 N ND1 . HIS A 1 440 ? 10.233  66.355 62.747 1.00 20.56  ? 440  HIS A ND1 1 
ATOM   3465 C CD2 . HIS A 1 440 ? 8.474   67.059 63.847 1.00 21.99  ? 440  HIS A CD2 1 
ATOM   3466 C CE1 . HIS A 1 440 ? 9.163   65.774 62.207 1.00 22.93  ? 440  HIS A CE1 1 
ATOM   3467 N NE2 . HIS A 1 440 ? 8.077   66.182 62.858 1.00 19.93  ? 440  HIS A NE2 1 
ATOM   3468 N N   . GLY A 1 441 ? 10.197  70.760 62.623 1.00 17.83  ? 441  GLY A N   1 
ATOM   3469 C CA  . GLY A 1 441 ? 9.070   71.545 62.193 1.00 17.10  ? 441  GLY A CA  1 
ATOM   3470 C C   . GLY A 1 441 ? 9.434   72.979 62.094 1.00 17.63  ? 441  GLY A C   1 
ATOM   3471 O O   . GLY A 1 441 ? 8.658   73.808 61.669 1.00 18.10  ? 441  GLY A O   1 
ATOM   3472 N N   . TYR A 1 442 ? 10.646  73.320 62.438 1.00 17.35  ? 442  TYR A N   1 
ATOM   3473 C CA  . TYR A 1 442 ? 10.818  74.711 62.581 1.00 16.95  ? 442  TYR A CA  1 
ATOM   3474 C C   . TYR A 1 442 ? 11.555  75.393 61.497 1.00 16.98  ? 442  TYR A C   1 
ATOM   3475 O O   . TYR A 1 442 ? 11.775  76.603 61.577 1.00 19.24  ? 442  TYR A O   1 
ATOM   3476 C CB  . TYR A 1 442 ? 11.296  75.036 63.994 1.00 18.10  ? 442  TYR A CB  1 
ATOM   3477 C CG  . TYR A 1 442 ? 10.112  75.163 64.920 1.00 18.59  ? 442  TYR A CG  1 
ATOM   3478 C CD1 . TYR A 1 442 ? 9.568   74.039 65.538 1.00 16.81  ? 442  TYR A CD1 1 
ATOM   3479 C CD2 . TYR A 1 442 ? 9.487   76.403 65.103 1.00 17.88  ? 442  TYR A CD2 1 
ATOM   3480 C CE1 . TYR A 1 442 ? 8.481   74.144 66.330 1.00 13.09  ? 442  TYR A CE1 1 
ATOM   3481 C CE2 . TYR A 1 442 ? 8.399   76.503 65.879 1.00 17.77  ? 442  TYR A CE2 1 
ATOM   3482 C CZ  . TYR A 1 442 ? 7.918   75.365 66.497 1.00 16.43  ? 442  TYR A CZ  1 
ATOM   3483 O OH  . TYR A 1 442 ? 6.815   75.490 67.284 1.00 20.77  ? 442  TYR A OH  1 
ATOM   3484 N N   . GLU A 1 443 ? 11.909  74.637 60.463 1.00 16.59  ? 443  GLU A N   1 
ATOM   3485 C CA  . GLU A 1 443 ? 12.305  75.203 59.137 1.00 15.36  ? 443  GLU A CA  1 
ATOM   3486 C C   . GLU A 1 443 ? 11.058  75.700 58.353 1.00 15.26  ? 443  GLU A C   1 
ATOM   3487 O O   . GLU A 1 443 ? 11.226  76.603 57.518 1.00 16.76  ? 443  GLU A O   1 
ATOM   3488 C CB  . GLU A 1 443 ? 13.002  74.187 58.256 1.00 12.78  ? 443  GLU A CB  1 
ATOM   3489 C CG  . GLU A 1 443 ? 11.959  73.311 57.464 1.00 12.28  ? 443  GLU A CG  1 
ATOM   3490 C CD  . GLU A 1 443 ? 11.269  72.171 58.299 1.00 11.05  ? 443  GLU A CD  1 
ATOM   3491 O OE1 . GLU A 1 443 ? 11.361  72.088 59.517 1.00 10.75  ? 443  GLU A OE1 1 
ATOM   3492 O OE2 . GLU A 1 443 ? 10.585  71.301 57.742 1.00 16.65  ? 443  GLU A OE2 1 
ATOM   3493 N N   . ILE A 1 444 ? 9.869   75.108 58.586 1.00 13.07  ? 444  ILE A N   1 
ATOM   3494 C CA  . ILE A 1 444 ? 8.741   75.380 57.762 1.00 12.26  ? 444  ILE A CA  1 
ATOM   3495 C C   . ILE A 1 444 ? 8.544   76.910 57.647 1.00 14.89  ? 444  ILE A C   1 
ATOM   3496 O O   . ILE A 1 444 ? 8.360   77.455 56.544 1.00 15.33  ? 444  ILE A O   1 
ATOM   3497 C CB  . ILE A 1 444 ? 7.449   74.781 58.319 1.00 12.73  ? 444  ILE A CB  1 
ATOM   3498 C CG1 . ILE A 1 444 ? 7.452   73.237 58.362 1.00 12.26  ? 444  ILE A CG1 1 
ATOM   3499 C CG2 . ILE A 1 444 ? 6.220   75.333 57.518 1.00 14.35  ? 444  ILE A CG2 1 
ATOM   3500 C CD1 . ILE A 1 444 ? 6.125   72.533 58.793 1.00 8.79   ? 444  ILE A CD1 1 
ATOM   3501 N N   . GLU A 1 445 ? 8.612   77.637 58.767 1.00 16.37  ? 445  GLU A N   1 
ATOM   3502 C CA  . GLU A 1 445 ? 8.380   79.076 58.740 1.00 17.15  ? 445  GLU A CA  1 
ATOM   3503 C C   . GLU A 1 445 ? 9.411   79.779 57.868 1.00 16.74  ? 445  GLU A C   1 
ATOM   3504 O O   . GLU A 1 445 ? 9.119   80.803 57.250 1.00 16.39  ? 445  GLU A O   1 
ATOM   3505 C CB  . GLU A 1 445 ? 8.335   79.668 60.142 1.00 17.94  ? 445  GLU A CB  1 
ATOM   3506 C CG  . GLU A 1 445 ? 9.617   79.425 60.919 1.00 22.26  ? 445  GLU A CG  1 
ATOM   3507 C CD  . GLU A 1 445 ? 9.401   79.524 62.406 1.00 24.19  ? 445  GLU A CD  1 
ATOM   3508 O OE1 . GLU A 1 445 ? 9.972   80.492 62.951 1.00 23.31  ? 445  GLU A OE1 1 
ATOM   3509 O OE2 . GLU A 1 445 ? 8.662   78.664 63.004 1.00 23.20  ? 445  GLU A OE2 1 
ATOM   3510 N N   . PHE A 1 446 ? 10.605  79.232 57.753 1.00 17.24  ? 446  PHE A N   1 
ATOM   3511 C CA  . PHE A 1 446 ? 11.514  79.841 56.754 1.00 18.44  ? 446  PHE A CA  1 
ATOM   3512 C C   . PHE A 1 446 ? 11.147  79.554 55.293 1.00 19.30  ? 446  PHE A C   1 
ATOM   3513 O O   . PHE A 1 446 ? 11.281  80.436 54.421 1.00 19.49  ? 446  PHE A O   1 
ATOM   3514 C CB  . PHE A 1 446 ? 12.936  79.424 56.993 1.00 17.79  ? 446  PHE A CB  1 
ATOM   3515 C CG  . PHE A 1 446 ? 13.538  80.115 58.135 1.00 17.71  ? 446  PHE A CG  1 
ATOM   3516 C CD1 . PHE A 1 446 ? 13.180  79.756 59.441 1.00 18.59  ? 446  PHE A CD1 1 
ATOM   3517 C CD2 . PHE A 1 446 ? 14.483  81.120 57.933 1.00 15.72  ? 446  PHE A CD2 1 
ATOM   3518 C CE1 . PHE A 1 446 ? 13.756  80.404 60.530 1.00 15.93  ? 446  PHE A CE1 1 
ATOM   3519 C CE2 . PHE A 1 446 ? 15.056  81.771 58.989 1.00 11.75  ? 446  PHE A CE2 1 
ATOM   3520 C CZ  . PHE A 1 446 ? 14.697  81.415 60.297 1.00 15.02  ? 446  PHE A CZ  1 
ATOM   3521 N N   . VAL A 1 447 ? 10.742  78.292 55.043 1.00 18.62  ? 447  VAL A N   1 
ATOM   3522 C CA  . VAL A 1 447 ? 10.257  77.855 53.727 1.00 16.55  ? 447  VAL A CA  1 
ATOM   3523 C C   . VAL A 1 447 ? 9.068   78.752 53.283 1.00 16.04  ? 447  VAL A C   1 
ATOM   3524 O O   . VAL A 1 447 ? 9.060   79.184 52.151 1.00 15.23  ? 447  VAL A O   1 
ATOM   3525 C CB  . VAL A 1 447 ? 9.898   76.327 53.715 1.00 15.52  ? 447  VAL A CB  1 
ATOM   3526 C CG1 . VAL A 1 447 ? 8.989   76.046 52.598 1.00 13.98  ? 447  VAL A CG1 1 
ATOM   3527 C CG2 . VAL A 1 447 ? 11.132  75.460 53.671 1.00 11.03  ? 447  VAL A CG2 1 
ATOM   3528 N N   . PHE A 1 448 ? 8.127   79.055 54.193 1.00 15.26  ? 448  PHE A N   1 
ATOM   3529 C CA  . PHE A 1 448 ? 6.913   79.813 53.850 1.00 15.16  ? 448  PHE A CA  1 
ATOM   3530 C C   . PHE A 1 448 ? 7.059   81.294 53.976 1.00 15.52  ? 448  PHE A C   1 
ATOM   3531 O O   . PHE A 1 448 ? 6.167   82.034 53.738 1.00 14.01  ? 448  PHE A O   1 
ATOM   3532 C CB  . PHE A 1 448 ? 5.718   79.324 54.628 1.00 14.65  ? 448  PHE A CB  1 
ATOM   3533 C CG  . PHE A 1 448 ? 5.043   78.182 53.972 1.00 15.84  ? 448  PHE A CG  1 
ATOM   3534 C CD1 . PHE A 1 448 ? 3.934   78.383 53.164 1.00 17.82  ? 448  PHE A CD1 1 
ATOM   3535 C CD2 . PHE A 1 448 ? 5.542   76.892 54.105 1.00 17.77  ? 448  PHE A CD2 1 
ATOM   3536 C CE1 . PHE A 1 448 ? 3.312   77.287 52.521 1.00 17.73  ? 448  PHE A CE1 1 
ATOM   3537 C CE2 . PHE A 1 448 ? 4.926   75.805 53.495 1.00 18.11  ? 448  PHE A CE2 1 
ATOM   3538 C CZ  . PHE A 1 448 ? 3.809   76.003 52.683 1.00 17.70  ? 448  PHE A CZ  1 
ATOM   3539 N N   . GLY A 1 449 ? 8.237   81.713 54.369 1.00 18.53  ? 449  GLY A N   1 
ATOM   3540 C CA  . GLY A 1 449 ? 8.651   83.093 54.219 1.00 20.80  ? 449  GLY A CA  1 
ATOM   3541 C C   . GLY A 1 449 ? 8.148   84.032 55.268 1.00 22.21  ? 449  GLY A C   1 
ATOM   3542 O O   . GLY A 1 449 ? 7.923   85.167 54.950 1.00 23.13  ? 449  GLY A O   1 
ATOM   3543 N N   . LEU A 1 450 ? 8.007   83.598 56.516 1.00 23.89  ? 450  LEU A N   1 
ATOM   3544 C CA  . LEU A 1 450 ? 7.531   84.500 57.606 1.00 25.27  ? 450  LEU A CA  1 
ATOM   3545 C C   . LEU A 1 450 ? 8.597   85.449 58.092 1.00 26.42  ? 450  LEU A C   1 
ATOM   3546 O O   . LEU A 1 450 ? 8.283   86.501 58.545 1.00 26.79  ? 450  LEU A O   1 
ATOM   3547 C CB  . LEU A 1 450 ? 6.985   83.728 58.816 1.00 25.38  ? 450  LEU A CB  1 
ATOM   3548 C CG  . LEU A 1 450 ? 5.861   82.741 58.527 1.00 25.57  ? 450  LEU A CG  1 
ATOM   3549 C CD1 . LEU A 1 450 ? 4.989   82.485 59.761 1.00 27.89  ? 450  LEU A CD1 1 
ATOM   3550 C CD2 . LEU A 1 450 ? 5.032   83.357 57.460 1.00 22.32  ? 450  LEU A CD2 1 
ATOM   3551 N N   . PRO A 1 451 ? 9.875   85.066 58.056 1.00 28.22  ? 451  PRO A N   1 
ATOM   3552 C CA  . PRO A 1 451 ? 10.810  86.136 58.372 1.00 30.04  ? 451  PRO A CA  1 
ATOM   3553 C C   . PRO A 1 451 ? 10.696  87.430 57.511 1.00 32.18  ? 451  PRO A C   1 
ATOM   3554 O O   . PRO A 1 451 ? 11.303  88.473 57.875 1.00 33.15  ? 451  PRO A O   1 
ATOM   3555 C CB  . PRO A 1 451 ? 12.184  85.453 58.239 1.00 29.45  ? 451  PRO A CB  1 
ATOM   3556 C CG  . PRO A 1 451 ? 11.884  83.989 58.486 1.00 27.10  ? 451  PRO A CG  1 
ATOM   3557 C CD  . PRO A 1 451 ? 10.574  83.778 57.852 1.00 28.58  ? 451  PRO A CD  1 
ATOM   3558 N N   . LEU A 1 452 ? 9.914   87.416 56.435 1.00 33.31  ? 452  LEU A N   1 
ATOM   3559 C CA  . LEU A 1 452 ? 9.767   88.683 55.695 1.00 35.54  ? 452  LEU A CA  1 
ATOM   3560 C C   . LEU A 1 452 ? 8.849   89.732 56.330 1.00 36.42  ? 452  LEU A C   1 
ATOM   3561 O O   . LEU A 1 452 ? 8.872   90.897 55.919 1.00 36.14  ? 452  LEU A O   1 
ATOM   3562 C CB  . LEU A 1 452 ? 9.334   88.465 54.248 1.00 35.59  ? 452  LEU A CB  1 
ATOM   3563 C CG  . LEU A 1 452 ? 10.136  87.498 53.410 1.00 34.81  ? 452  LEU A CG  1 
ATOM   3564 C CD1 . LEU A 1 452 ? 9.776   87.905 52.023 1.00 35.23  ? 452  LEU A CD1 1 
ATOM   3565 C CD2 . LEU A 1 452 ? 11.634  87.616 53.653 1.00 32.83  ? 452  LEU A CD2 1 
ATOM   3566 N N   . VAL A 1 453 ? 8.036   89.293 57.294 1.00 38.11  ? 453  VAL A N   1 
ATOM   3567 C CA  . VAL A 1 453 ? 7.025   90.133 57.914 1.00 39.91  ? 453  VAL A CA  1 
ATOM   3568 C C   . VAL A 1 453 ? 7.615   90.715 59.204 1.00 41.97  ? 453  VAL A C   1 
ATOM   3569 O O   . VAL A 1 453 ? 7.910   89.952 60.157 1.00 41.59  ? 453  VAL A O   1 
ATOM   3570 C CB  . VAL A 1 453 ? 5.617   89.414 58.041 1.00 39.95  ? 453  VAL A CB  1 
ATOM   3571 C CG1 . VAL A 1 453 ? 5.652   87.962 57.566 1.00 40.11  ? 453  VAL A CG1 1 
ATOM   3572 C CG2 . VAL A 1 453 ? 4.988   89.513 59.435 1.00 39.17  ? 453  VAL A CG2 1 
ATOM   3573 N N   . LYS A 1 454 ? 7.824   92.061 59.179 1.00 44.06  ? 454  LYS A N   1 
ATOM   3574 C CA  . LYS A 1 454 ? 8.642   92.806 60.180 1.00 45.89  ? 454  LYS A CA  1 
ATOM   3575 C C   . LYS A 1 454 ? 8.106   92.626 61.573 1.00 45.21  ? 454  LYS A C   1 
ATOM   3576 O O   . LYS A 1 454 ? 8.862   92.415 62.546 1.00 45.35  ? 454  LYS A O   1 
ATOM   3577 C CB  . LYS A 1 454 ? 8.729   94.302 59.868 1.00 46.93  ? 454  LYS A CB  1 
ATOM   3578 C CG  . LYS A 1 454 ? 9.767   94.677 58.754 1.00 54.57  ? 454  LYS A CG  1 
ATOM   3579 C CD  . LYS A 1 454 ? 9.149   95.687 57.686 1.00 61.33  ? 454  LYS A CD  1 
ATOM   3580 C CE  . LYS A 1 454 ? 7.699   95.194 57.160 1.00 64.13  ? 454  LYS A CE  1 
ATOM   3581 N NZ  . LYS A 1 454 ? 7.258   95.697 55.796 1.00 61.49  ? 454  LYS A NZ  1 
ATOM   3582 N N   . GLU A 1 455 ? 6.786   92.662 61.662 1.00 44.61  ? 455  GLU A N   1 
ATOM   3583 C CA  . GLU A 1 455 ? 6.171   92.541 62.947 1.00 44.12  ? 455  GLU A CA  1 
ATOM   3584 C C   . GLU A 1 455 ? 6.119   91.174 63.528 1.00 42.52  ? 455  GLU A C   1 
ATOM   3585 O O   . GLU A 1 455 ? 5.478   91.024 64.529 1.00 42.79  ? 455  GLU A O   1 
ATOM   3586 C CB  . GLU A 1 455 ? 4.795   93.162 62.976 1.00 44.75  ? 455  GLU A CB  1 
ATOM   3587 C CG  . GLU A 1 455 ? 4.192   93.446 61.624 1.00 51.54  ? 455  GLU A CG  1 
ATOM   3588 C CD  . GLU A 1 455 ? 2.736   92.923 61.565 1.00 60.66  ? 455  GLU A CD  1 
ATOM   3589 O OE1 . GLU A 1 455 ? 2.266   92.482 60.482 1.00 65.69  ? 455  GLU A OE1 1 
ATOM   3590 O OE2 . GLU A 1 455 ? 2.053   92.911 62.612 1.00 63.10  ? 455  GLU A OE2 1 
ATOM   3591 N N   . LEU A 1 456 ? 6.789   90.169 62.964 1.00 40.91  ? 456  LEU A N   1 
ATOM   3592 C CA  . LEU A 1 456 ? 7.012   88.965 63.778 1.00 39.33  ? 456  LEU A CA  1 
ATOM   3593 C C   . LEU A 1 456 ? 8.427   88.869 64.302 1.00 39.33  ? 456  LEU A C   1 
ATOM   3594 O O   . LEU A 1 456 ? 8.734   87.892 64.993 1.00 39.76  ? 456  LEU A O   1 
ATOM   3595 C CB  . LEU A 1 456 ? 6.634   87.654 63.105 1.00 38.26  ? 456  LEU A CB  1 
ATOM   3596 C CG  . LEU A 1 456 ? 5.438   87.596 62.188 1.00 36.59  ? 456  LEU A CG  1 
ATOM   3597 C CD1 . LEU A 1 456 ? 5.747   86.536 61.122 1.00 34.45  ? 456  LEU A CD1 1 
ATOM   3598 C CD2 . LEU A 1 456 ? 4.099   87.372 62.920 1.00 30.88  ? 456  LEU A CD2 1 
ATOM   3599 N N   . ASN A 1 457 ? 9.285   89.845 63.981 1.00 38.72  ? 457  ASN A N   1 
ATOM   3600 C CA  . ASN A 1 457 ? 10.484  90.107 64.810 1.00 39.09  ? 457  ASN A CA  1 
ATOM   3601 C C   . ASN A 1 457 ? 11.652  89.251 64.420 1.00 37.09  ? 457  ASN A C   1 
ATOM   3602 O O   . ASN A 1 457 ? 12.247  88.668 65.322 1.00 36.68  ? 457  ASN A O   1 
ATOM   3603 C CB  . ASN A 1 457 ? 10.291  89.744 66.356 1.00 40.51  ? 457  ASN A CB  1 
ATOM   3604 C CG  . ASN A 1 457 ? 9.375   90.753 67.190 1.00 43.78  ? 457  ASN A CG  1 
ATOM   3605 O OD1 . ASN A 1 457 ? 9.305   91.950 66.866 1.00 50.12  ? 457  ASN A OD1 1 
ATOM   3606 N ND2 . ASN A 1 457 ? 8.708   90.246 68.286 1.00 40.17  ? 457  ASN A ND2 1 
ATOM   3607 N N   . TYR A 1 458 ? 12.015  89.115 63.146 1.00 35.23  ? 458  TYR A N   1 
ATOM   3608 C CA  . TYR A 1 458 ? 13.219  88.229 62.867 1.00 33.06  ? 458  TYR A CA  1 
ATOM   3609 C C   . TYR A 1 458 ? 14.476  89.027 62.687 1.00 32.29  ? 458  TYR A C   1 
ATOM   3610 O O   . TYR A 1 458 ? 14.376  90.215 62.597 1.00 32.34  ? 458  TYR A O   1 
ATOM   3611 C CB  . TYR A 1 458 ? 13.037  87.254 61.695 1.00 30.55  ? 458  TYR A CB  1 
ATOM   3612 C CG  . TYR A 1 458 ? 12.013  86.153 61.893 1.00 27.89  ? 458  TYR A CG  1 
ATOM   3613 C CD1 . TYR A 1 458 ? 12.428  84.862 62.191 1.00 27.35  ? 458  TYR A CD1 1 
ATOM   3614 C CD2 . TYR A 1 458 ? 10.622  86.386 61.749 1.00 25.41  ? 458  TYR A CD2 1 
ATOM   3615 C CE1 . TYR A 1 458 ? 11.501  83.818 62.329 1.00 24.41  ? 458  TYR A CE1 1 
ATOM   3616 C CE2 . TYR A 1 458 ? 9.692   85.348 61.886 1.00 20.98  ? 458  TYR A CE2 1 
ATOM   3617 C CZ  . TYR A 1 458 ? 10.159  84.084 62.172 1.00 22.93  ? 458  TYR A CZ  1 
ATOM   3618 O OH  . TYR A 1 458 ? 9.352   83.020 62.291 1.00 24.34  ? 458  TYR A OH  1 
ATOM   3619 N N   . THR A 1 459 ? 15.642  88.404 62.678 1.00 32.12  ? 459  THR A N   1 
ATOM   3620 C CA  . THR A 1 459 ? 16.827  89.152 62.387 1.00 33.64  ? 459  THR A CA  1 
ATOM   3621 C C   . THR A 1 459 ? 16.744  89.514 60.924 1.00 33.88  ? 459  THR A C   1 
ATOM   3622 O O   . THR A 1 459 ? 16.093  88.845 60.172 1.00 34.21  ? 459  THR A O   1 
ATOM   3623 C CB  . THR A 1 459 ? 18.091  88.277 62.432 1.00 34.74  ? 459  THR A CB  1 
ATOM   3624 O OG1 . THR A 1 459 ? 18.118  87.491 63.613 1.00 35.31  ? 459  THR A OG1 1 
ATOM   3625 C CG2 . THR A 1 459 ? 19.382  89.122 62.358 1.00 36.80  ? 459  THR A CG2 1 
ATOM   3626 N N   . ALA A 1 460 ? 17.410  90.593 60.555 1.00 34.71  ? 460  ALA A N   1 
ATOM   3627 C CA  . ALA A 1 460 ? 17.985  90.847 59.240 1.00 34.91  ? 460  ALA A CA  1 
ATOM   3628 C C   . ALA A 1 460 ? 18.445  89.608 58.510 1.00 35.47  ? 460  ALA A C   1 
ATOM   3629 O O   . ALA A 1 460 ? 17.988  89.404 57.369 1.00 35.36  ? 460  ALA A O   1 
ATOM   3630 C CB  . ALA A 1 460 ? 19.233  91.783 59.409 1.00 35.18  ? 460  ALA A CB  1 
ATOM   3631 N N   . GLU A 1 461 ? 19.381  88.828 59.109 1.00 35.30  ? 461  GLU A N   1 
ATOM   3632 C CA  . GLU A 1 461 ? 20.000  87.697 58.374 1.00 36.15  ? 461  GLU A CA  1 
ATOM   3633 C C   . GLU A 1 461 ? 19.013  86.598 58.198 1.00 34.18  ? 461  GLU A C   1 
ATOM   3634 O O   . GLU A 1 461 ? 19.249  85.739 57.341 1.00 34.91  ? 461  GLU A O   1 
ATOM   3635 C CB  . GLU A 1 461 ? 21.188  86.989 59.054 1.00 37.66  ? 461  GLU A CB  1 
ATOM   3636 C CG  . GLU A 1 461 ? 22.426  87.797 59.397 1.00 46.76  ? 461  GLU A CG  1 
ATOM   3637 C CD  . GLU A 1 461 ? 22.272  88.475 60.778 1.00 59.12  ? 461  GLU A CD  1 
ATOM   3638 O OE1 . GLU A 1 461 ? 21.639  89.605 60.809 1.00 62.37  ? 461  GLU A OE1 1 
ATOM   3639 O OE2 . GLU A 1 461 ? 22.749  87.852 61.809 1.00 62.36  ? 461  GLU A OE2 1 
ATOM   3640 N N   . GLU A 1 462 ? 17.989  86.563 59.067 1.00 31.31  ? 462  GLU A N   1 
ATOM   3641 C CA  . GLU A 1 462 ? 16.959  85.549 59.038 1.00 28.29  ? 462  GLU A CA  1 
ATOM   3642 C C   . GLU A 1 462 ? 16.088  85.689 57.821 1.00 28.94  ? 462  GLU A C   1 
ATOM   3643 O O   . GLU A 1 462 ? 15.988  84.773 57.037 1.00 30.03  ? 462  GLU A O   1 
ATOM   3644 C CB  . GLU A 1 462 ? 16.191  85.548 60.321 1.00 27.15  ? 462  GLU A CB  1 
ATOM   3645 C CG  . GLU A 1 462 ? 17.047  84.907 61.379 1.00 25.09  ? 462  GLU A CG  1 
ATOM   3646 C CD  . GLU A 1 462 ? 16.368  84.770 62.713 1.00 22.77  ? 462  GLU A CD  1 
ATOM   3647 O OE1 . GLU A 1 462 ? 16.703  83.809 63.435 1.00 22.67  ? 462  GLU A OE1 1 
ATOM   3648 O OE2 . GLU A 1 462 ? 15.507  85.612 63.054 1.00 23.37  ? 462  GLU A OE2 1 
ATOM   3649 N N   . GLU A 1 463 ? 15.474  86.838 57.628 1.00 29.15  ? 463  GLU A N   1 
ATOM   3650 C CA  . GLU A 1 463 ? 15.027  87.263 56.316 1.00 29.35  ? 463  GLU A CA  1 
ATOM   3651 C C   . GLU A 1 463 ? 15.971  86.942 55.162 1.00 28.22  ? 463  GLU A C   1 
ATOM   3652 O O   . GLU A 1 463 ? 15.543  86.463 54.134 1.00 27.58  ? 463  GLU A O   1 
ATOM   3653 C CB  . GLU A 1 463 ? 14.894  88.746 56.333 1.00 30.45  ? 463  GLU A CB  1 
ATOM   3654 C CG  . GLU A 1 463 ? 13.729  89.231 55.519 1.00 37.39  ? 463  GLU A CG  1 
ATOM   3655 C CD  . GLU A 1 463 ? 13.971  90.628 54.939 1.00 44.58  ? 463  GLU A CD  1 
ATOM   3656 O OE1 . GLU A 1 463 ? 14.103  91.559 55.807 1.00 45.49  ? 463  GLU A OE1 1 
ATOM   3657 O OE2 . GLU A 1 463 ? 14.014  90.766 53.653 1.00 45.41  ? 463  GLU A OE2 1 
ATOM   3658 N N   . ALA A 1 464 ? 17.255  87.224 55.283 1.00 27.91  ? 464  ALA A N   1 
ATOM   3659 C CA  . ALA A 1 464 ? 18.148  86.749 54.202 1.00 28.02  ? 464  ALA A CA  1 
ATOM   3660 C C   . ALA A 1 464 ? 18.007  85.229 53.987 1.00 28.12  ? 464  ALA A C   1 
ATOM   3661 O O   . ALA A 1 464 ? 17.632  84.806 52.863 1.00 29.58  ? 464  ALA A O   1 
ATOM   3662 C CB  . ALA A 1 464 ? 19.629  87.176 54.387 1.00 27.62  ? 464  ALA A CB  1 
ATOM   3663 N N   . LEU A 1 465 ? 18.255  84.435 55.051 1.00 26.58  ? 465  LEU A N   1 
ATOM   3664 C CA  . LEU A 1 465 ? 18.093  83.000 55.038 1.00 25.15  ? 465  LEU A CA  1 
ATOM   3665 C C   . LEU A 1 465 ? 16.720  82.539 54.481 1.00 26.09  ? 465  LEU A C   1 
ATOM   3666 O O   . LEU A 1 465 ? 16.659  81.569 53.692 1.00 26.80  ? 465  LEU A O   1 
ATOM   3667 C CB  . LEU A 1 465 ? 18.266  82.461 56.431 1.00 24.10  ? 465  LEU A CB  1 
ATOM   3668 C CG  . LEU A 1 465 ? 18.222  80.934 56.571 1.00 23.35  ? 465  LEU A CG  1 
ATOM   3669 C CD1 . LEU A 1 465 ? 19.327  80.233 55.786 1.00 23.99  ? 465  LEU A CD1 1 
ATOM   3670 C CD2 . LEU A 1 465 ? 18.376  80.542 57.989 1.00 19.23  ? 465  LEU A CD2 1 
ATOM   3671 N N   . SER A 1 466 ? 15.629  83.214 54.862 1.00 25.40  ? 466  SER A N   1 
ATOM   3672 C CA  . SER A 1 466 ? 14.340  82.806 54.397 1.00 25.33  ? 466  SER A CA  1 
ATOM   3673 C C   . SER A 1 466 ? 14.265  82.907 52.882 1.00 27.38  ? 466  SER A C   1 
ATOM   3674 O O   . SER A 1 466 ? 13.828  81.924 52.248 1.00 29.44  ? 466  SER A O   1 
ATOM   3675 C CB  . SER A 1 466 ? 13.231  83.618 55.028 1.00 25.29  ? 466  SER A CB  1 
ATOM   3676 O OG  . SER A 1 466 ? 11.935  83.298 54.518 1.00 22.45  ? 466  SER A OG  1 
ATOM   3677 N N   . ARG A 1 467 ? 14.681  84.043 52.273 1.00 27.52  ? 467  ARG A N   1 
ATOM   3678 C CA  . ARG A 1 467 ? 14.452  84.261 50.817 1.00 26.55  ? 467  ARG A CA  1 
ATOM   3679 C C   . ARG A 1 467 ? 15.408  83.357 50.133 1.00 24.91  ? 467  ARG A C   1 
ATOM   3680 O O   . ARG A 1 467 ? 15.120  82.762 49.099 1.00 23.54  ? 467  ARG A O   1 
ATOM   3681 C CB  . ARG A 1 467 ? 14.782  85.669 50.356 1.00 27.64  ? 467  ARG A CB  1 
ATOM   3682 C CG  . ARG A 1 467 ? 14.032  86.848 50.963 1.00 28.24  ? 467  ARG A CG  1 
ATOM   3683 C CD  . ARG A 1 467 ? 14.689  88.149 50.429 1.00 28.86  ? 467  ARG A CD  1 
ATOM   3684 N NE  . ARG A 1 467 ? 13.976  89.303 50.950 1.00 36.28  ? 467  ARG A NE  1 
ATOM   3685 C CZ  . ARG A 1 467 ? 12.777  89.719 50.512 1.00 36.43  ? 467  ARG A CZ  1 
ATOM   3686 N NH1 . ARG A 1 467 ? 12.192  90.767 51.075 1.00 36.12  ? 467  ARG A NH1 1 
ATOM   3687 N NH2 . ARG A 1 467 ? 12.148  89.087 49.530 1.00 35.90  ? 467  ARG A NH2 1 
ATOM   3688 N N   . ARG A 1 468 ? 16.560  83.218 50.759 1.00 23.98  ? 468  ARG A N   1 
ATOM   3689 C CA  . ARG A 1 468 ? 17.523  82.319 50.207 1.00 23.53  ? 468  ARG A CA  1 
ATOM   3690 C C   . ARG A 1 468 ? 16.986  80.914 50.090 1.00 22.46  ? 468  ARG A C   1 
ATOM   3691 O O   . ARG A 1 468 ? 17.295  80.257 49.104 1.00 22.81  ? 468  ARG A O   1 
ATOM   3692 C CB  . ARG A 1 468 ? 18.819  82.366 50.953 1.00 23.06  ? 468  ARG A CB  1 
ATOM   3693 C CG  . ARG A 1 468 ? 19.756  81.395 50.401 1.00 26.41  ? 468  ARG A CG  1 
ATOM   3694 C CD  . ARG A 1 468 ? 21.138  81.771 50.830 1.00 34.43  ? 468  ARG A CD  1 
ATOM   3695 N NE  . ARG A 1 468 ? 21.829  80.582 51.347 1.00 41.82  ? 468  ARG A NE  1 
ATOM   3696 C CZ  . ARG A 1 468 ? 22.216  80.475 52.624 1.00 46.79  ? 468  ARG A CZ  1 
ATOM   3697 N NH1 . ARG A 1 468 ? 21.949  81.544 53.473 1.00 43.43  ? 468  ARG A NH1 1 
ATOM   3698 N NH2 . ARG A 1 468 ? 22.869  79.332 53.033 1.00 45.84  ? 468  ARG A NH2 1 
ATOM   3699 N N   . ILE A 1 469 ? 16.183  80.481 51.066 1.00 21.57  ? 469  ILE A N   1 
ATOM   3700 C CA  . ILE A 1 469 ? 15.590  79.138 51.056 1.00 21.77  ? 469  ILE A CA  1 
ATOM   3701 C C   . ILE A 1 469 ? 14.458  79.033 50.042 1.00 22.96  ? 469  ILE A C   1 
ATOM   3702 O O   . ILE A 1 469 ? 14.537  78.211 49.111 1.00 22.53  ? 469  ILE A O   1 
ATOM   3703 C CB  . ILE A 1 469 ? 15.076  78.663 52.464 1.00 21.53  ? 469  ILE A CB  1 
ATOM   3704 C CG1 . ILE A 1 469 ? 16.237  78.056 53.240 1.00 18.55  ? 469  ILE A CG1 1 
ATOM   3705 C CG2 . ILE A 1 469 ? 13.919  77.642 52.322 1.00 18.88  ? 469  ILE A CG2 1 
ATOM   3706 C CD1 . ILE A 1 469 ? 16.227  78.327 54.660 1.00 12.95  ? 469  ILE A CD1 1 
ATOM   3707 N N   . MET A 1 470 ? 13.417  79.857 50.247 1.00 23.45  ? 470  MET A N   1 
ATOM   3708 C CA  . MET A 1 470 ? 12.395  80.093 49.251 1.00 25.03  ? 470  MET A CA  1 
ATOM   3709 C C   . MET A 1 470 ? 12.911  80.091 47.811 1.00 25.79  ? 470  MET A C   1 
ATOM   3710 O O   . MET A 1 470 ? 12.193  79.689 46.936 1.00 27.39  ? 470  MET A O   1 
ATOM   3711 C CB  . MET A 1 470 ? 11.684  81.402 49.478 1.00 23.49  ? 470  MET A CB  1 
ATOM   3712 C CG  . MET A 1 470 ? 10.767  81.438 50.627 1.00 25.45  ? 470  MET A CG  1 
ATOM   3713 S SD  . MET A 1 470 ? 9.585   82.858 50.606 1.00 28.51  ? 470  MET A SD  1 
ATOM   3714 C CE  . MET A 1 470 ? 10.614  84.270 50.792 1.00 33.97  ? 470  MET A CE  1 
ATOM   3715 N N   . HIS A 1 471 ? 14.109  80.569 47.513 1.00 26.69  ? 471  HIS A N   1 
ATOM   3716 C CA  . HIS A 1 471 ? 14.447  80.626 46.130 1.00 27.38  ? 471  HIS A CA  1 
ATOM   3717 C C   . HIS A 1 471 ? 14.884  79.247 45.724 1.00 27.43  ? 471  HIS A C   1 
ATOM   3718 O O   . HIS A 1 471 ? 14.231  78.642 44.854 1.00 29.51  ? 471  HIS A O   1 
ATOM   3719 C CB  . HIS A 1 471 ? 15.565  81.565 45.880 1.00 28.97  ? 471  HIS A CB  1 
ATOM   3720 C CG  . HIS A 1 471 ? 15.736  81.923 44.428 1.00 34.63  ? 471  HIS A CG  1 
ATOM   3721 N ND1 . HIS A 1 471 ? 14.734  82.530 43.683 1.00 39.59  ? 471  HIS A ND1 1 
ATOM   3722 C CD2 . HIS A 1 471 ? 16.806  81.798 43.595 1.00 35.72  ? 471  HIS A CD2 1 
ATOM   3723 C CE1 . HIS A 1 471 ? 15.181  82.751 42.454 1.00 39.48  ? 471  HIS A CE1 1 
ATOM   3724 N NE2 . HIS A 1 471 ? 16.439  82.327 42.381 1.00 36.88  ? 471  HIS A NE2 1 
ATOM   3725 N N   . TYR A 1 472 ? 15.978  78.734 46.304 1.00 25.26  ? 472  TYR A N   1 
ATOM   3726 C CA  . TYR A 1 472 ? 16.225  77.275 46.354 1.00 22.40  ? 472  TYR A CA  1 
ATOM   3727 C C   . TYR A 1 472 ? 14.984  76.387 46.162 1.00 19.78  ? 472  TYR A C   1 
ATOM   3728 O O   . TYR A 1 472 ? 14.982  75.537 45.292 1.00 17.89  ? 472  TYR A O   1 
ATOM   3729 C CB  . TYR A 1 472 ? 16.800  76.905 47.717 1.00 23.97  ? 472  TYR A CB  1 
ATOM   3730 C CG  . TYR A 1 472 ? 18.260  77.181 47.887 1.00 26.53  ? 472  TYR A CG  1 
ATOM   3731 C CD1 . TYR A 1 472 ? 18.814  77.362 49.161 1.00 31.08  ? 472  TYR A CD1 1 
ATOM   3732 C CD2 . TYR A 1 472 ? 19.087  77.331 46.804 1.00 26.37  ? 472  TYR A CD2 1 
ATOM   3733 C CE1 . TYR A 1 472 ? 20.189  77.644 49.337 1.00 27.99  ? 472  TYR A CE1 1 
ATOM   3734 C CE2 . TYR A 1 472 ? 20.444  77.604 46.978 1.00 26.69  ? 472  TYR A CE2 1 
ATOM   3735 C CZ  . TYR A 1 472 ? 20.977  77.735 48.233 1.00 26.71  ? 472  TYR A CZ  1 
ATOM   3736 O OH  . TYR A 1 472 ? 22.317  77.972 48.362 1.00 29.11  ? 472  TYR A OH  1 
ATOM   3737 N N   . TRP A 1 473 ? 13.941  76.564 46.983 1.00 17.47  ? 473  TRP A N   1 
ATOM   3738 C CA  . TRP A 1 473 ? 12.816  75.692 46.833 1.00 16.63  ? 473  TRP A CA  1 
ATOM   3739 C C   . TRP A 1 473 ? 12.142  75.922 45.499 1.00 17.56  ? 473  TRP A C   1 
ATOM   3740 O O   . TRP A 1 473 ? 11.863  74.934 44.756 1.00 17.26  ? 473  TRP A O   1 
ATOM   3741 C CB  . TRP A 1 473 ? 11.787  75.820 47.920 1.00 15.10  ? 473  TRP A CB  1 
ATOM   3742 C CG  . TRP A 1 473 ? 11.886  74.817 49.109 1.00 15.15  ? 473  TRP A CG  1 
ATOM   3743 C CD1 . TRP A 1 473 ? 10.825  74.170 49.747 1.00 13.89  ? 473  TRP A CD1 1 
ATOM   3744 C CD2 . TRP A 1 473 ? 13.060  74.459 49.857 1.00 12.98  ? 473  TRP A CD2 1 
ATOM   3745 N NE1 . TRP A 1 473 ? 11.296  73.415 50.809 1.00 10.25  ? 473  TRP A NE1 1 
ATOM   3746 C CE2 . TRP A 1 473 ? 12.646  73.598 50.920 1.00 10.89  ? 473  TRP A CE2 1 
ATOM   3747 C CE3 . TRP A 1 473 ? 14.423  74.759 49.728 1.00 14.99  ? 473  TRP A CE3 1 
ATOM   3748 C CZ2 . TRP A 1 473 ? 13.572  73.018 51.844 1.00 12.10  ? 473  TRP A CZ2 1 
ATOM   3749 C CZ3 . TRP A 1 473 ? 15.369  74.154 50.667 1.00 15.15  ? 473  TRP A CZ3 1 
ATOM   3750 C CH2 . TRP A 1 473 ? 14.923  73.287 51.694 1.00 12.89  ? 473  TRP A CH2 1 
ATOM   3751 N N   . ALA A 1 474 ? 11.867  77.205 45.175 1.00 17.30  ? 474  ALA A N   1 
ATOM   3752 C CA  . ALA A 1 474 ? 11.043  77.519 43.985 1.00 16.18  ? 474  ALA A CA  1 
ATOM   3753 C C   . ALA A 1 474 ? 11.840  77.183 42.738 1.00 15.95  ? 474  ALA A C   1 
ATOM   3754 O O   . ALA A 1 474 ? 11.351  76.493 41.857 1.00 16.21  ? 474  ALA A O   1 
ATOM   3755 C CB  . ALA A 1 474 ? 10.621  78.882 43.973 1.00 14.85  ? 474  ALA A CB  1 
ATOM   3756 N N   . THR A 1 475 ? 13.093  77.606 42.695 1.00 15.37  ? 475  THR A N   1 
ATOM   3757 C CA  . THR A 1 475 ? 13.952  77.202 41.598 1.00 14.29  ? 475  THR A CA  1 
ATOM   3758 C C   . THR A 1 475 ? 13.965  75.665 41.428 1.00 16.38  ? 475  THR A C   1 
ATOM   3759 O O   . THR A 1 475 ? 13.801  75.189 40.282 1.00 18.14  ? 475  THR A O   1 
ATOM   3760 C CB  . THR A 1 475 ? 15.379  77.765 41.717 1.00 13.78  ? 475  THR A CB  1 
ATOM   3761 O OG1 . THR A 1 475 ? 15.308  79.202 41.832 1.00 10.58  ? 475  THR A OG1 1 
ATOM   3762 C CG2 . THR A 1 475 ? 16.219  77.339 40.511 1.00 7.48   ? 475  THR A CG2 1 
ATOM   3763 N N   . PHE A 1 476 ? 14.154  74.860 42.490 1.00 15.62  ? 476  PHE A N   1 
ATOM   3764 C CA  . PHE A 1 476 ? 14.215  73.443 42.244 1.00 14.71  ? 476  PHE A CA  1 
ATOM   3765 C C   . PHE A 1 476 ? 12.860  72.925 41.600 1.00 15.85  ? 476  PHE A C   1 
ATOM   3766 O O   . PHE A 1 476 ? 12.847  72.205 40.612 1.00 14.13  ? 476  PHE A O   1 
ATOM   3767 C CB  . PHE A 1 476 ? 14.571  72.729 43.532 1.00 14.91  ? 476  PHE A CB  1 
ATOM   3768 C CG  . PHE A 1 476 ? 14.226  71.269 43.510 1.00 14.02  ? 476  PHE A CG  1 
ATOM   3769 C CD1 . PHE A 1 476 ? 15.115  70.328 42.875 1.00 14.70  ? 476  PHE A CD1 1 
ATOM   3770 C CD2 . PHE A 1 476 ? 12.997  70.834 44.037 1.00 10.60  ? 476  PHE A CD2 1 
ATOM   3771 C CE1 . PHE A 1 476 ? 14.771  68.948 42.802 1.00 19.51  ? 476  PHE A CE1 1 
ATOM   3772 C CE2 . PHE A 1 476 ? 12.607  69.458 43.991 1.00 14.23  ? 476  PHE A CE2 1 
ATOM   3773 C CZ  . PHE A 1 476 ? 13.457  68.497 43.401 1.00 15.60  ? 476  PHE A CZ  1 
ATOM   3774 N N   . ALA A 1 477 ? 11.725  73.332 42.160 1.00 17.86  ? 477  ALA A N   1 
ATOM   3775 C CA  . ALA A 1 477 ? 10.395  72.988 41.649 1.00 19.97  ? 477  ALA A CA  1 
ATOM   3776 C C   . ALA A 1 477 ? 10.283  73.284 40.183 1.00 22.30  ? 477  ALA A C   1 
ATOM   3777 O O   . ALA A 1 477 ? 9.721   72.460 39.438 1.00 25.04  ? 477  ALA A O   1 
ATOM   3778 C CB  . ALA A 1 477 ? 9.277   73.748 42.410 1.00 18.50  ? 477  ALA A CB  1 
ATOM   3779 N N   . LYS A 1 478 ? 10.791  74.462 39.761 1.00 24.02  ? 478  LYS A N   1 
ATOM   3780 C CA  . LYS A 1 478 ? 10.715  74.965 38.383 1.00 24.62  ? 478  LYS A CA  1 
ATOM   3781 C C   . LYS A 1 478 ? 11.741  74.293 37.478 1.00 24.29  ? 478  LYS A C   1 
ATOM   3782 O O   . LYS A 1 478 ? 11.596  74.247 36.320 1.00 24.29  ? 478  LYS A O   1 
ATOM   3783 C CB  . LYS A 1 478 ? 10.991  76.443 38.440 1.00 25.63  ? 478  LYS A CB  1 
ATOM   3784 C CG  . LYS A 1 478 ? 11.346  77.193 37.062 1.00 32.24  ? 478  LYS A CG  1 
ATOM   3785 C CD  . LYS A 1 478 ? 10.698  78.618 37.154 1.00 39.29  ? 478  LYS A CD  1 
ATOM   3786 C CE  . LYS A 1 478 ? 9.615   78.713 38.456 1.00 37.52  ? 478  LYS A CE  1 
ATOM   3787 N NZ  . LYS A 1 478 ? 9.593   79.947 39.479 1.00 33.95  ? 478  LYS A NZ  1 
ATOM   3788 N N   . THR A 1 479 ? 12.784  73.724 38.046 1.00 24.84  ? 479  THR A N   1 
ATOM   3789 C CA  . THR A 1 479 ? 14.006  73.395 37.338 1.00 22.95  ? 479  THR A CA  1 
ATOM   3790 C C   . THR A 1 479 ? 14.567  72.022 37.477 1.00 23.26  ? 479  THR A C   1 
ATOM   3791 O O   . THR A 1 479 ? 15.196  71.582 36.555 1.00 22.73  ? 479  THR A O   1 
ATOM   3792 C CB  . THR A 1 479 ? 14.960  74.414 37.736 1.00 22.36  ? 479  THR A CB  1 
ATOM   3793 O OG1 . THR A 1 479 ? 14.762  75.332 36.736 1.00 22.22  ? 479  THR A OG1 1 
ATOM   3794 C CG2 . THR A 1 479 ? 16.364  74.083 37.670 1.00 22.58  ? 479  THR A CG2 1 
ATOM   3795 N N   . GLY A 1 480 ? 14.315  71.346 38.598 1.00 23.26  ? 480  GLY A N   1 
ATOM   3796 C CA  . GLY A 1 480 ? 15.014  70.119 38.930 1.00 23.61  ? 480  GLY A CA  1 
ATOM   3797 C C   . GLY A 1 480 ? 16.397  70.401 39.501 1.00 23.84  ? 480  GLY A C   1 
ATOM   3798 O O   . GLY A 1 480 ? 17.153  69.494 39.843 1.00 23.77  ? 480  GLY A O   1 
ATOM   3799 N N   . ASN A 1 481 ? 16.732  71.672 39.587 1.00 24.11  ? 481  ASN A N   1 
ATOM   3800 C CA  . ASN A 1 481 ? 17.966  72.061 40.219 1.00 25.96  ? 481  ASN A CA  1 
ATOM   3801 C C   . ASN A 1 481 ? 17.711  73.282 41.147 1.00 26.64  ? 481  ASN A C   1 
ATOM   3802 O O   . ASN A 1 481 ? 16.955  74.199 40.707 1.00 28.22  ? 481  ASN A O   1 
ATOM   3803 C CB  . ASN A 1 481 ? 18.975  72.383 39.114 1.00 26.52  ? 481  ASN A CB  1 
ATOM   3804 C CG  . ASN A 1 481 ? 20.374  72.566 39.624 1.00 26.29  ? 481  ASN A CG  1 
ATOM   3805 O OD1 . ASN A 1 481 ? 20.672  73.363 40.541 1.00 27.47  ? 481  ASN A OD1 1 
ATOM   3806 N ND2 . ASN A 1 481 ? 21.256  71.824 39.017 1.00 25.92  ? 481  ASN A ND2 1 
ATOM   3807 N N   . PRO A 1 482 ? 18.282  73.288 42.416 1.00 25.95  ? 482  PRO A N   1 
ATOM   3808 C CA  . PRO A 1 482 ? 18.011  74.441 43.250 1.00 26.15  ? 482  PRO A CA  1 
ATOM   3809 C C   . PRO A 1 482 ? 18.796  75.647 42.831 1.00 27.63  ? 482  PRO A C   1 
ATOM   3810 O O   . PRO A 1 482 ? 18.420  76.735 43.237 1.00 28.51  ? 482  PRO A O   1 
ATOM   3811 C CB  . PRO A 1 482 ? 18.382  73.979 44.661 1.00 23.33  ? 482  PRO A CB  1 
ATOM   3812 C CG  . PRO A 1 482 ? 19.339  73.054 44.466 1.00 22.36  ? 482  PRO A CG  1 
ATOM   3813 C CD  . PRO A 1 482 ? 19.084  72.321 43.185 1.00 25.40  ? 482  PRO A CD  1 
ATOM   3814 N N   . ASN A 1 483 ? 19.814  75.469 41.980 1.00 30.26  ? 483  ASN A N   1 
ATOM   3815 C CA  . ASN A 1 483 ? 20.821  76.509 41.651 1.00 32.97  ? 483  ASN A CA  1 
ATOM   3816 C C   . ASN A 1 483 ? 20.476  77.343 40.435 1.00 36.45  ? 483  ASN A C   1 
ATOM   3817 O O   . ASN A 1 483 ? 19.839  76.837 39.516 1.00 38.41  ? 483  ASN A O   1 
ATOM   3818 C CB  . ASN A 1 483 ? 22.112  75.799 41.354 1.00 31.67  ? 483  ASN A CB  1 
ATOM   3819 C CG  . ASN A 1 483 ? 22.701  75.144 42.583 1.00 30.18  ? 483  ASN A CG  1 
ATOM   3820 O OD1 . ASN A 1 483 ? 22.968  73.901 42.582 1.00 20.81  ? 483  ASN A OD1 1 
ATOM   3821 N ND2 . ASN A 1 483 ? 22.896  75.973 43.680 1.00 25.48  ? 483  ASN A ND2 1 
ATOM   3822 N N   . GLU A 1 484 ? 20.865  78.602 40.358 1.00 40.50  ? 484  GLU A N   1 
ATOM   3823 C CA  . GLU A 1 484 ? 20.616  79.271 39.080 1.00 45.44  ? 484  GLU A CA  1 
ATOM   3824 C C   . GLU A 1 484 ? 21.769  79.137 38.047 1.00 48.56  ? 484  GLU A C   1 
ATOM   3825 O O   . GLU A 1 484 ? 22.954  79.156 38.463 1.00 49.43  ? 484  GLU A O   1 
ATOM   3826 C CB  . GLU A 1 484 ? 20.343  80.711 39.315 1.00 45.13  ? 484  GLU A CB  1 
ATOM   3827 C CG  . GLU A 1 484 ? 18.975  81.057 39.024 1.00 49.43  ? 484  GLU A CG  1 
ATOM   3828 C CD  . GLU A 1 484 ? 18.593  82.238 39.883 1.00 56.22  ? 484  GLU A CD  1 
ATOM   3829 O OE1 . GLU A 1 484 ? 17.676  83.015 39.471 1.00 58.15  ? 484  GLU A OE1 1 
ATOM   3830 O OE2 . GLU A 1 484 ? 19.235  82.391 40.975 1.00 56.56  ? 484  GLU A OE2 1 
ATOM   3831 N N   A PRO A 1 485 ? 21.447  79.041 36.715 0.50 50.60  ? 485  PRO A N   1 
ATOM   3832 C CA  A PRO A 1 485 ? 22.532  79.106 35.742 0.50 52.28  ? 485  PRO A CA  1 
ATOM   3833 C C   A PRO A 1 485 ? 23.423  80.280 36.131 0.50 54.95  ? 485  PRO A C   1 
ATOM   3834 O O   A PRO A 1 485 ? 22.969  81.425 36.204 0.50 53.97  ? 485  PRO A O   1 
ATOM   3835 C CB  A PRO A 1 485 ? 21.806  79.350 34.438 0.50 52.10  ? 485  PRO A CB  1 
ATOM   3836 C CG  A PRO A 1 485 ? 20.512  78.664 34.618 0.50 51.13  ? 485  PRO A CG  1 
ATOM   3837 C CD  A PRO A 1 485 ? 20.135  78.896 36.053 0.50 50.43  ? 485  PRO A CD  1 
ATOM   3838 N N   . HIS A 1 486 ? 24.671  79.935 36.443 1.00 58.92  ? 486  HIS A N   1 
ATOM   3839 C CA  . HIS A 1 486 ? 25.681  80.753 37.250 1.00 63.75  ? 486  HIS A CA  1 
ATOM   3840 C C   . HIS A 1 486 ? 25.288  82.108 37.946 1.00 62.95  ? 486  HIS A C   1 
ATOM   3841 O O   A HIS A 1 486 ? 25.905  82.521 38.948 0.50 62.32  ? 486  HIS A O   1 
ATOM   3842 C CB  . HIS A 1 486 ? 27.055  80.897 36.489 1.00 66.28  ? 486  HIS A CB  1 
ATOM   3843 C CG  . HIS A 1 486 ? 27.662  79.576 36.003 1.00 76.61  ? 486  HIS A CG  1 
ATOM   3844 N ND1 . HIS A 1 486 ? 27.365  79.007 34.763 1.00 84.26  ? 486  HIS A ND1 1 
ATOM   3845 C CD2 . HIS A 1 486 ? 28.565  78.728 36.586 1.00 83.24  ? 486  HIS A CD2 1 
ATOM   3846 C CE1 . HIS A 1 486 ? 28.050  77.877 34.607 1.00 86.11  ? 486  HIS A CE1 1 
ATOM   3847 N NE2 . HIS A 1 486 ? 28.783  77.684 35.699 1.00 87.40  ? 486  HIS A NE2 1 
ATOM   3848 N N   . SER A 1 490 ? 27.492  80.427 44.951 1.00 46.02  ? 490  SER A N   1 
ATOM   3849 C CA  . SER A 1 490 ? 28.086  79.029 44.879 1.00 46.59  ? 490  SER A CA  1 
ATOM   3850 C C   . SER A 1 490 ? 27.168  77.785 45.239 1.00 45.42  ? 490  SER A C   1 
ATOM   3851 O O   . SER A 1 490 ? 26.226  77.854 46.044 1.00 44.86  ? 490  SER A O   1 
ATOM   3852 C CB  . SER A 1 490 ? 29.455  78.903 45.593 1.00 46.81  ? 490  SER A CB  1 
ATOM   3853 O OG  . SER A 1 490 ? 29.203  78.820 46.990 1.00 47.69  ? 490  SER A OG  1 
ATOM   3854 N N   . LYS A 1 491 ? 27.489  76.647 44.640 1.00 44.01  ? 491  LYS A N   1 
ATOM   3855 C CA  . LYS A 1 491 ? 26.428  75.738 44.300 1.00 43.77  ? 491  LYS A CA  1 
ATOM   3856 C C   . LYS A 1 491 ? 26.135  74.604 45.290 1.00 40.56  ? 491  LYS A C   1 
ATOM   3857 O O   . LYS A 1 491 ? 27.027  74.011 45.894 1.00 41.66  ? 491  LYS A O   1 
ATOM   3858 C CB  . LYS A 1 491 ? 26.611  75.225 42.850 1.00 43.91  ? 491  LYS A CB  1 
ATOM   3859 C CG  . LYS A 1 491 ? 27.820  74.313 42.622 1.00 47.26  ? 491  LYS A CG  1 
ATOM   3860 C CD  . LYS A 1 491 ? 28.006  73.967 41.070 1.00 50.07  ? 491  LYS A CD  1 
ATOM   3861 C CE  . LYS A 1 491 ? 27.431  72.564 40.594 1.00 57.10  ? 491  LYS A CE  1 
ATOM   3862 N NZ  . LYS A 1 491 ? 25.910  72.677 40.408 1.00 60.89  ? 491  LYS A NZ  1 
ATOM   3863 N N   . TRP A 1 492 ? 24.859  74.311 45.444 1.00 36.13  ? 492  TRP A N   1 
ATOM   3864 C CA  . TRP A 1 492 ? 24.428  73.170 46.161 1.00 31.67  ? 492  TRP A CA  1 
ATOM   3865 C C   . TRP A 1 492 ? 24.776  71.956 45.284 1.00 30.84  ? 492  TRP A C   1 
ATOM   3866 O O   . TRP A 1 492 ? 24.158  71.751 44.239 1.00 31.90  ? 492  TRP A O   1 
ATOM   3867 C CB  . TRP A 1 492 ? 22.924  73.333 46.348 1.00 28.83  ? 492  TRP A CB  1 
ATOM   3868 C CG  . TRP A 1 492 ? 22.265  72.372 47.226 1.00 25.50  ? 492  TRP A CG  1 
ATOM   3869 C CD1 . TRP A 1 492 ? 22.681  71.109 47.543 1.00 22.33  ? 492  TRP A CD1 1 
ATOM   3870 C CD2 . TRP A 1 492 ? 21.036  72.586 47.921 1.00 22.06  ? 492  TRP A CD2 1 
ATOM   3871 N NE1 . TRP A 1 492 ? 21.784  70.527 48.425 1.00 23.29  ? 492  TRP A NE1 1 
ATOM   3872 C CE2 . TRP A 1 492 ? 20.747  71.394 48.641 1.00 21.67  ? 492  TRP A CE2 1 
ATOM   3873 C CE3 . TRP A 1 492 ? 20.156  73.664 48.009 1.00 18.77  ? 492  TRP A CE3 1 
ATOM   3874 C CZ2 . TRP A 1 492 ? 19.617  71.253 49.439 1.00 22.37  ? 492  TRP A CZ2 1 
ATOM   3875 C CZ3 . TRP A 1 492 ? 19.028  73.526 48.790 1.00 22.11  ? 492  TRP A CZ3 1 
ATOM   3876 C CH2 . TRP A 1 492 ? 18.769  72.319 49.506 1.00 23.01  ? 492  TRP A CH2 1 
ATOM   3877 N N   . PRO A 1 493 ? 25.779  71.157 45.680 1.00 29.46  ? 493  PRO A N   1 
ATOM   3878 C CA  . PRO A 1 493 ? 26.204  69.966 44.911 1.00 28.97  ? 493  PRO A CA  1 
ATOM   3879 C C   . PRO A 1 493 ? 25.171  68.880 44.892 1.00 28.11  ? 493  PRO A C   1 
ATOM   3880 O O   . PRO A 1 493 ? 24.366  68.840 45.821 1.00 28.30  ? 493  PRO A O   1 
ATOM   3881 C CB  . PRO A 1 493 ? 27.419  69.433 45.701 1.00 28.70  ? 493  PRO A CB  1 
ATOM   3882 C CG  . PRO A 1 493 ? 27.310  69.971 46.999 1.00 29.22  ? 493  PRO A CG  1 
ATOM   3883 C CD  . PRO A 1 493 ? 26.599  71.328 46.877 1.00 29.34  ? 493  PRO A CD  1 
ATOM   3884 N N   . LEU A 1 494 ? 25.206  68.001 43.886 1.00 26.75  ? 494  LEU A N   1 
ATOM   3885 C CA  . LEU A 1 494 ? 24.299  66.891 43.894 1.00 26.80  ? 494  LEU A CA  1 
ATOM   3886 C C   . LEU A 1 494 ? 24.766  65.874 44.871 1.00 27.90  ? 494  LEU A C   1 
ATOM   3887 O O   . LEU A 1 494 ? 25.990  65.662 45.083 1.00 27.98  ? 494  LEU A O   1 
ATOM   3888 C CB  . LEU A 1 494 ? 24.255  66.168 42.601 1.00 26.37  ? 494  LEU A CB  1 
ATOM   3889 C CG  . LEU A 1 494 ? 23.530  66.686 41.379 1.00 27.14  ? 494  LEU A CG  1 
ATOM   3890 C CD1 . LEU A 1 494 ? 23.988  65.746 40.311 1.00 24.95  ? 494  LEU A CD1 1 
ATOM   3891 C CD2 . LEU A 1 494 ? 21.997  66.750 41.485 1.00 24.96  ? 494  LEU A CD2 1 
ATOM   3892 N N   . PHE A 1 495 ? 23.789  65.202 45.457 1.00 28.21  ? 495  PHE A N   1 
ATOM   3893 C CA  . PHE A 1 495 ? 24.142  64.110 46.322 1.00 29.28  ? 495  PHE A CA  1 
ATOM   3894 C C   . PHE A 1 495 ? 24.402  62.889 45.447 1.00 30.94  ? 495  PHE A C   1 
ATOM   3895 O O   . PHE A 1 495 ? 23.549  62.524 44.654 1.00 30.80  ? 495  PHE A O   1 
ATOM   3896 C CB  . PHE A 1 495 ? 23.058  63.836 47.355 1.00 26.98  ? 495  PHE A CB  1 
ATOM   3897 C CG  . PHE A 1 495 ? 23.290  62.592 48.171 1.00 24.79  ? 495  PHE A CG  1 
ATOM   3898 C CD1 . PHE A 1 495 ? 23.849  62.666 49.423 1.00 23.30  ? 495  PHE A CD1 1 
ATOM   3899 C CD2 . PHE A 1 495 ? 22.943  61.327 47.685 1.00 23.07  ? 495  PHE A CD2 1 
ATOM   3900 C CE1 . PHE A 1 495 ? 24.058  61.507 50.178 1.00 20.78  ? 495  PHE A CE1 1 
ATOM   3901 C CE2 . PHE A 1 495 ? 23.152  60.201 48.441 1.00 16.32  ? 495  PHE A CE2 1 
ATOM   3902 C CZ  . PHE A 1 495 ? 23.701  60.286 49.663 1.00 18.46  ? 495  PHE A CZ  1 
ATOM   3903 N N   . THR A 1 496 ? 25.575  62.274 45.602 1.00 33.29  ? 496  THR A N   1 
ATOM   3904 C CA  . THR A 1 496 ? 25.848  60.991 44.949 1.00 35.48  ? 496  THR A CA  1 
ATOM   3905 C C   . THR A 1 496 ? 26.172  59.888 45.945 1.00 36.93  ? 496  THR A C   1 
ATOM   3906 O O   . THR A 1 496 ? 26.649  60.171 47.031 1.00 37.39  ? 496  THR A O   1 
ATOM   3907 C CB  . THR A 1 496 ? 27.009  61.123 44.015 1.00 35.07  ? 496  THR A CB  1 
ATOM   3908 O OG1 . THR A 1 496 ? 28.188  61.293 44.807 1.00 38.20  ? 496  THR A OG1 1 
ATOM   3909 C CG2 . THR A 1 496 ? 26.803  62.346 43.123 1.00 32.84  ? 496  THR A CG2 1 
ATOM   3910 N N   . THR A 1 497 ? 25.915  58.635 45.571 1.00 39.18  ? 497  THR A N   1 
ATOM   3911 C CA  . THR A 1 497 ? 26.356  57.479 46.360 1.00 41.53  ? 497  THR A CA  1 
ATOM   3912 C C   . THR A 1 497 ? 27.896  57.468 46.563 1.00 43.31  ? 497  THR A C   1 
ATOM   3913 O O   . THR A 1 497 ? 28.353  57.257 47.694 1.00 43.41  ? 497  THR A O   1 
ATOM   3914 C CB  . THR A 1 497 ? 25.872  56.129 45.777 1.00 41.33  ? 497  THR A CB  1 
ATOM   3915 O OG1 . THR A 1 497 ? 25.967  56.179 44.354 1.00 41.24  ? 497  THR A OG1 1 
ATOM   3916 C CG2 . THR A 1 497 ? 24.408  55.806 46.204 1.00 40.86  ? 497  THR A CG2 1 
ATOM   3917 N N   . LYS A 1 498 ? 28.682  57.745 45.514 1.00 45.04  ? 498  LYS A N   1 
ATOM   3918 C CA  . LYS A 1 498 ? 30.116  57.772 45.682 1.00 47.39  ? 498  LYS A CA  1 
ATOM   3919 C C   . LYS A 1 498 ? 30.569  58.761 46.766 1.00 46.99  ? 498  LYS A C   1 
ATOM   3920 O O   . LYS A 1 498 ? 31.193  58.358 47.787 1.00 47.15  ? 498  LYS A O   1 
ATOM   3921 C CB  . LYS A 1 498 ? 30.849  57.993 44.364 1.00 48.46  ? 498  LYS A CB  1 
ATOM   3922 C CG  . LYS A 1 498 ? 32.258  57.223 44.347 1.00 51.59  ? 498  LYS A CG  1 
ATOM   3923 C CD  . LYS A 1 498 ? 32.881  56.999 42.887 1.00 52.00  ? 498  LYS A CD  1 
ATOM   3924 C CE  . LYS A 1 498 ? 34.512  57.018 42.826 1.00 53.73  ? 498  LYS A CE  1 
ATOM   3925 N NZ  . LYS A 1 498 ? 35.024  55.980 41.837 1.00 52.92  ? 498  LYS A NZ  1 
ATOM   3926 N N   . GLU A 1 499 ? 30.234  60.037 46.609 1.00 46.58  ? 499  GLU A N   1 
ATOM   3927 C CA  . GLU A 1 499 ? 30.650  60.993 47.650 1.00 46.28  ? 499  GLU A CA  1 
ATOM   3928 C C   . GLU A 1 499 ? 29.708  61.482 48.745 1.00 44.54  ? 499  GLU A C   1 
ATOM   3929 O O   . GLU A 1 499 ? 30.109  61.473 49.916 1.00 44.43  ? 499  GLU A O   1 
ATOM   3930 C CB  . GLU A 1 499 ? 31.257  62.154 47.017 1.00 47.18  ? 499  GLU A CB  1 
ATOM   3931 C CG  . GLU A 1 499 ? 32.543  61.781 46.449 1.00 53.24  ? 499  GLU A CG  1 
ATOM   3932 C CD  . GLU A 1 499 ? 32.988  62.897 45.564 1.00 62.83  ? 499  GLU A CD  1 
ATOM   3933 O OE1 . GLU A 1 499 ? 34.220  63.230 45.670 1.00 64.42  ? 499  GLU A OE1 1 
ATOM   3934 O OE2 . GLU A 1 499 ? 32.070  63.460 44.827 1.00 64.49  ? 499  GLU A OE2 1 
ATOM   3935 N N   . GLN A 1 500 ? 28.493  61.925 48.396 1.00 42.29  ? 500  GLN A N   1 
ATOM   3936 C CA  . GLN A 1 500 ? 27.426  62.062 49.406 1.00 39.77  ? 500  GLN A CA  1 
ATOM   3937 C C   . GLN A 1 500 ? 27.479  63.394 50.055 1.00 38.29  ? 500  GLN A C   1 
ATOM   3938 O O   . GLN A 1 500 ? 27.463  63.511 51.287 1.00 38.12  ? 500  GLN A O   1 
ATOM   3939 C CB  . GLN A 1 500 ? 27.565  61.032 50.509 1.00 39.73  ? 500  GLN A CB  1 
ATOM   3940 C CG  . GLN A 1 500 ? 27.535  59.607 50.023 1.00 42.02  ? 500  GLN A CG  1 
ATOM   3941 C CD  . GLN A 1 500 ? 27.140  58.649 51.102 1.00 44.58  ? 500  GLN A CD  1 
ATOM   3942 O OE1 . GLN A 1 500 ? 26.605  59.032 52.175 1.00 47.76  ? 500  GLN A OE1 1 
ATOM   3943 N NE2 . GLN A 1 500 ? 27.368  57.394 50.831 1.00 42.44  ? 500  GLN A NE2 1 
ATOM   3944 N N   . LYS A 1 501 ? 27.571  64.409 49.217 1.00 36.36  ? 501  LYS A N   1 
ATOM   3945 C CA  . LYS A 1 501 ? 27.722  65.746 49.704 1.00 34.21  ? 501  LYS A CA  1 
ATOM   3946 C C   . LYS A 1 501 ? 26.353  66.295 50.085 1.00 32.17  ? 501  LYS A C   1 
ATOM   3947 O O   . LYS A 1 501 ? 25.362  65.885 49.507 1.00 32.88  ? 501  LYS A O   1 
ATOM   3948 C CB  . LYS A 1 501 ? 28.380  66.543 48.615 1.00 34.34  ? 501  LYS A CB  1 
ATOM   3949 C CG  . LYS A 1 501 ? 29.524  65.786 48.021 1.00 35.65  ? 501  LYS A CG  1 
ATOM   3950 C CD  . LYS A 1 501 ? 30.605  66.799 47.665 1.00 39.79  ? 501  LYS A CD  1 
ATOM   3951 C CE  . LYS A 1 501 ? 31.634  66.252 46.695 1.00 42.73  ? 501  LYS A CE  1 
ATOM   3952 N NZ  . LYS A 1 501 ? 31.771  67.122 45.482 1.00 45.80  ? 501  LYS A NZ  1 
ATOM   3953 N N   . PHE A 1 502 ? 26.276  67.181 51.072 1.00 29.37  ? 502  PHE A N   1 
ATOM   3954 C CA  . PHE A 1 502 ? 24.993  67.783 51.458 1.00 27.53  ? 502  PHE A CA  1 
ATOM   3955 C C   . PHE A 1 502 ? 25.382  69.127 51.951 1.00 27.13  ? 502  PHE A C   1 
ATOM   3956 O O   . PHE A 1 502 ? 26.567  69.343 52.082 1.00 28.56  ? 502  PHE A O   1 
ATOM   3957 C CB  . PHE A 1 502 ? 24.310  67.006 52.578 1.00 26.16  ? 502  PHE A CB  1 
ATOM   3958 C CG  . PHE A 1 502 ? 25.105  66.947 53.861 1.00 22.95  ? 502  PHE A CG  1 
ATOM   3959 C CD1 . PHE A 1 502 ? 26.005  65.920 54.088 1.00 18.41  ? 502  PHE A CD1 1 
ATOM   3960 C CD2 . PHE A 1 502 ? 24.893  67.883 54.875 1.00 23.45  ? 502  PHE A CD2 1 
ATOM   3961 C CE1 . PHE A 1 502 ? 26.679  65.812 55.299 1.00 19.17  ? 502  PHE A CE1 1 
ATOM   3962 C CE2 . PHE A 1 502 ? 25.587  67.826 56.093 1.00 20.78  ? 502  PHE A CE2 1 
ATOM   3963 C CZ  . PHE A 1 502 ? 26.500  66.772 56.297 1.00 21.53  ? 502  PHE A CZ  1 
ATOM   3964 N N   . ILE A 1 503 ? 24.451  70.019 52.261 1.00 26.27  ? 503  ILE A N   1 
ATOM   3965 C CA  . ILE A 1 503 ? 24.865  71.359 52.644 1.00 26.48  ? 503  ILE A CA  1 
ATOM   3966 C C   . ILE A 1 503 ? 24.274  71.740 53.949 1.00 27.40  ? 503  ILE A C   1 
ATOM   3967 O O   . ILE A 1 503 ? 23.276  71.146 54.373 1.00 28.53  ? 503  ILE A O   1 
ATOM   3968 C CB  . ILE A 1 503 ? 24.422  72.452 51.643 1.00 26.77  ? 503  ILE A CB  1 
ATOM   3969 C CG1 . ILE A 1 503 ? 22.923  72.445 51.427 1.00 26.97  ? 503  ILE A CG1 1 
ATOM   3970 C CG2 . ILE A 1 503 ? 25.133  72.346 50.314 1.00 25.59  ? 503  ILE A CG2 1 
ATOM   3971 C CD1 . ILE A 1 503 ? 22.494  73.680 50.757 1.00 29.98  ? 503  ILE A CD1 1 
ATOM   3972 N N   . ASP A 1 504 ? 24.861  72.738 54.595 1.00 27.93  ? 504  ASP A N   1 
ATOM   3973 C CA  . ASP A 1 504 ? 24.252  73.279 55.792 1.00 29.36  ? 504  ASP A CA  1 
ATOM   3974 C C   . ASP A 1 504 ? 23.285  74.383 55.364 1.00 29.46  ? 504  ASP A C   1 
ATOM   3975 O O   . ASP A 1 504 ? 23.593  75.218 54.490 1.00 30.90  ? 504  ASP A O   1 
ATOM   3976 C CB  . ASP A 1 504 ? 25.319  73.888 56.687 1.00 30.38  ? 504  ASP A CB  1 
ATOM   3977 C CG  . ASP A 1 504 ? 26.144  72.840 57.508 1.00 34.82  ? 504  ASP A CG  1 
ATOM   3978 O OD1 . ASP A 1 504 ? 27.315  73.184 57.858 1.00 38.04  ? 504  ASP A OD1 1 
ATOM   3979 O OD2 . ASP A 1 504 ? 25.655  71.713 57.836 1.00 37.39  ? 504  ASP A OD2 1 
ATOM   3980 N N   . LEU A 1 505 ? 22.134  74.445 55.982 1.00 28.61  ? 505  LEU A N   1 
ATOM   3981 C CA  . LEU A 1 505 ? 21.297  75.555 55.715 1.00 29.05  ? 505  LEU A CA  1 
ATOM   3982 C C   . LEU A 1 505 ? 21.235  76.415 56.973 1.00 31.42  ? 505  LEU A C   1 
ATOM   3983 O O   . LEU A 1 505 ? 20.727  76.006 58.002 1.00 32.46  ? 505  LEU A O   1 
ATOM   3984 C CB  . LEU A 1 505 ? 19.950  75.018 55.383 1.00 28.15  ? 505  LEU A CB  1 
ATOM   3985 C CG  . LEU A 1 505 ? 19.283  75.652 54.208 1.00 24.77  ? 505  LEU A CG  1 
ATOM   3986 C CD1 . LEU A 1 505 ? 20.294  75.849 53.171 1.00 20.36  ? 505  LEU A CD1 1 
ATOM   3987 C CD2 . LEU A 1 505 ? 18.210  74.655 53.765 1.00 21.27  ? 505  LEU A CD2 1 
ATOM   3988 N N   . ASN A 1 506 ? 21.784  77.606 56.937 1.00 34.05  ? 506  ASN A N   1 
ATOM   3989 C CA  . ASN A 1 506 ? 21.800  78.461 58.126 1.00 36.53  ? 506  ASN A CA  1 
ATOM   3990 C C   . ASN A 1 506 ? 22.384  79.845 57.798 1.00 38.64  ? 506  ASN A C   1 
ATOM   3991 O O   . ASN A 1 506 ? 23.049  79.981 56.781 1.00 39.39  ? 506  ASN A O   1 
ATOM   3992 C CB  . ASN A 1 506 ? 22.574  77.795 59.252 1.00 35.99  ? 506  ASN A CB  1 
ATOM   3993 C CG  . ASN A 1 506 ? 24.034  77.808 59.003 1.00 35.47  ? 506  ASN A CG  1 
ATOM   3994 O OD1 . ASN A 1 506 ? 24.572  78.844 58.603 1.00 30.85  ? 506  ASN A OD1 1 
ATOM   3995 N ND2 . ASN A 1 506 ? 24.714  76.643 59.221 1.00 37.87  ? 506  ASN A ND2 1 
ATOM   3996 N N   . THR A 1 507 ? 22.162  80.850 58.648 1.00 41.05  ? 507  THR A N   1 
ATOM   3997 C CA  . THR A 1 507 ? 22.474  82.240 58.281 1.00 43.36  ? 507  THR A CA  1 
ATOM   3998 C C   . THR A 1 507 ? 23.924  82.599 57.984 1.00 45.23  ? 507  THR A C   1 
ATOM   3999 O O   . THR A 1 507 ? 24.189  83.765 57.754 1.00 45.98  ? 507  THR A O   1 
ATOM   4000 C CB  . THR A 1 507 ? 22.085  83.197 59.357 1.00 43.26  ? 507  THR A CB  1 
ATOM   4001 O OG1 . THR A 1 507 ? 22.798  82.817 60.538 1.00 43.46  ? 507  THR A OG1 1 
ATOM   4002 C CG2 . THR A 1 507 ? 20.577  83.194 59.578 1.00 41.75  ? 507  THR A CG2 1 
ATOM   4003 N N   . GLU A 1 508 ? 24.853  81.655 57.984 1.00 47.60  ? 508  GLU A N   1 
ATOM   4004 C CA  . GLU A 1 508 ? 26.152  81.962 57.428 1.00 50.96  ? 508  GLU A CA  1 
ATOM   4005 C C   . GLU A 1 508 ? 26.454  81.304 56.085 1.00 52.24  ? 508  GLU A C   1 
ATOM   4006 O O   . GLU A 1 508 ? 25.619  80.577 55.547 1.00 53.47  ? 508  GLU A O   1 
ATOM   4007 C CB  . GLU A 1 508 ? 27.246  81.690 58.416 1.00 51.86  ? 508  GLU A CB  1 
ATOM   4008 C CG  . GLU A 1 508 ? 27.547  80.242 58.674 1.00 58.07  ? 508  GLU A CG  1 
ATOM   4009 C CD  . GLU A 1 508 ? 27.945  80.062 60.156 1.00 67.88  ? 508  GLU A CD  1 
ATOM   4010 O OE1 . GLU A 1 508 ? 27.836  78.916 60.702 1.00 69.16  ? 508  GLU A OE1 1 
ATOM   4011 O OE2 . GLU A 1 508 ? 28.337  81.107 60.778 1.00 71.51  ? 508  GLU A OE2 1 
ATOM   4012 N N   . PRO A 1 509 ? 27.664  81.539 55.527 1.00 53.42  ? 509  PRO A N   1 
ATOM   4013 C CA  . PRO A 1 509 ? 27.824  81.136 54.119 1.00 53.57  ? 509  PRO A CA  1 
ATOM   4014 C C   . PRO A 1 509 ? 27.965  79.607 54.019 1.00 53.33  ? 509  PRO A C   1 
ATOM   4015 O O   . PRO A 1 509 ? 28.752  78.999 54.793 1.00 53.69  ? 509  PRO A O   1 
ATOM   4016 C CB  . PRO A 1 509 ? 29.123  81.845 53.683 1.00 54.00  ? 509  PRO A CB  1 
ATOM   4017 C CG  . PRO A 1 509 ? 29.725  82.511 54.937 1.00 53.51  ? 509  PRO A CG  1 
ATOM   4018 C CD  . PRO A 1 509 ? 28.923  82.061 56.114 1.00 53.61  ? 509  PRO A CD  1 
ATOM   4019 N N   . MET A 1 510 ? 27.222  78.993 53.092 1.00 52.47  ? 510  MET A N   1 
ATOM   4020 C CA  . MET A 1 510 ? 26.995  77.537 53.186 1.00 50.98  ? 510  MET A CA  1 
ATOM   4021 C C   . MET A 1 510 ? 28.255  76.726 53.051 1.00 48.94  ? 510  MET A C   1 
ATOM   4022 O O   . MET A 1 510 ? 29.160  77.132 52.382 1.00 47.99  ? 510  MET A O   1 
ATOM   4023 C CB  . MET A 1 510 ? 25.930  77.059 52.219 1.00 51.47  ? 510  MET A CB  1 
ATOM   4024 C CG  . MET A 1 510 ? 26.075  77.618 50.862 1.00 52.73  ? 510  MET A CG  1 
ATOM   4025 S SD  . MET A 1 510 ? 26.064  76.112 49.901 1.00 58.56  ? 510  MET A SD  1 
ATOM   4026 C CE  . MET A 1 510 ? 25.031  76.501 48.469 1.00 54.52  ? 510  MET A CE  1 
ATOM   4027 N N   . LYS A 1 511 ? 28.318  75.615 53.773 1.00 47.42  ? 511  LYS A N   1 
ATOM   4028 C CA  . LYS A 1 511 ? 29.400  74.667 53.641 1.00 45.53  ? 511  LYS A CA  1 
ATOM   4029 C C   . LYS A 1 511 ? 28.845  73.384 53.092 1.00 42.86  ? 511  LYS A C   1 
ATOM   4030 O O   . LYS A 1 511 ? 27.770  72.933 53.444 1.00 43.40  ? 511  LYS A O   1 
ATOM   4031 C CB  . LYS A 1 511 ? 29.976  74.344 54.989 1.00 46.30  ? 511  LYS A CB  1 
ATOM   4032 C CG  . LYS A 1 511 ? 30.688  75.460 55.704 1.00 51.25  ? 511  LYS A CG  1 
ATOM   4033 C CD  . LYS A 1 511 ? 31.007  74.905 57.135 1.00 61.98  ? 511  LYS A CD  1 
ATOM   4034 C CE  . LYS A 1 511 ? 31.015  75.968 58.278 1.00 64.51  ? 511  LYS A CE  1 
ATOM   4035 N NZ  . LYS A 1 511 ? 32.449  76.267 58.572 1.00 68.06  ? 511  LYS A NZ  1 
ATOM   4036 N N   . VAL A 1 512 ? 29.605  72.760 52.241 1.00 39.75  ? 512  VAL A N   1 
ATOM   4037 C CA  . VAL A 1 512 ? 29.277  71.428 51.819 1.00 36.09  ? 512  VAL A CA  1 
ATOM   4038 C C   . VAL A 1 512 ? 29.890  70.469 52.828 1.00 34.91  ? 512  VAL A C   1 
ATOM   4039 O O   . VAL A 1 512 ? 31.044  70.675 53.186 1.00 34.27  ? 512  VAL A O   1 
ATOM   4040 C CB  . VAL A 1 512 ? 29.969  71.229 50.509 1.00 35.35  ? 512  VAL A CB  1 
ATOM   4041 C CG1 . VAL A 1 512 ? 29.782  69.811 49.998 1.00 34.24  ? 512  VAL A CG1 1 
ATOM   4042 C CG2 . VAL A 1 512 ? 29.517  72.330 49.543 1.00 33.05  ? 512  VAL A CG2 1 
ATOM   4043 N N   . HIS A 1 513 ? 29.169  69.445 53.309 1.00 33.41  ? 513  HIS A N   1 
ATOM   4044 C CA  . HIS A 1 513 ? 29.864  68.345 54.038 1.00 32.06  ? 513  HIS A CA  1 
ATOM   4045 C C   . HIS A 1 513 ? 29.699  66.943 53.425 1.00 31.62  ? 513  HIS A C   1 
ATOM   4046 O O   . HIS A 1 513 ? 29.152  66.798 52.323 1.00 31.12  ? 513  HIS A O   1 
ATOM   4047 C CB  . HIS A 1 513 ? 29.443  68.226 55.471 1.00 31.59  ? 513  HIS A CB  1 
ATOM   4048 C CG  . HIS A 1 513 ? 29.375  69.507 56.238 1.00 31.72  ? 513  HIS A CG  1 
ATOM   4049 N ND1 . HIS A 1 513 ? 30.361  69.892 57.122 1.00 30.89  ? 513  HIS A ND1 1 
ATOM   4050 C CD2 . HIS A 1 513 ? 28.381  70.420 56.366 1.00 31.85  ? 513  HIS A CD2 1 
ATOM   4051 C CE1 . HIS A 1 513 ? 30.012  71.027 57.703 1.00 30.33  ? 513  HIS A CE1 1 
ATOM   4052 N NE2 . HIS A 1 513 ? 28.808  71.359 57.274 1.00 30.37  ? 513  HIS A NE2 1 
ATOM   4053 N N   . GLN A 1 514 ? 30.151  65.908 54.134 1.00 30.91  ? 514  GLN A N   1 
ATOM   4054 C CA  . GLN A 1 514 ? 29.848  64.563 53.638 1.00 32.72  ? 514  GLN A CA  1 
ATOM   4055 C C   . GLN A 1 514 ? 29.292  63.573 54.655 1.00 31.76  ? 514  GLN A C   1 
ATOM   4056 O O   . GLN A 1 514 ? 29.551  63.682 55.835 1.00 32.04  ? 514  GLN A O   1 
ATOM   4057 C CB  . GLN A 1 514 ? 31.065  63.900 52.980 1.00 33.91  ? 514  GLN A CB  1 
ATOM   4058 C CG  . GLN A 1 514 ? 32.144  64.825 52.564 1.00 38.89  ? 514  GLN A CG  1 
ATOM   4059 C CD  . GLN A 1 514 ? 32.810  64.335 51.305 1.00 46.41  ? 514  GLN A CD  1 
ATOM   4060 O OE1 . GLN A 1 514 ? 32.215  63.568 50.520 1.00 46.99  ? 514  GLN A OE1 1 
ATOM   4061 N NE2 . GLN A 1 514 ? 34.059  64.782 51.086 1.00 49.59  ? 514  GLN A NE2 1 
ATOM   4062 N N   . ARG A 1 515 ? 28.571  62.576 54.157 1.00 31.30  ? 515  ARG A N   1 
ATOM   4063 C CA  . ARG A 1 515 ? 28.096  61.425 54.950 1.00 31.39  ? 515  ARG A CA  1 
ATOM   4064 C C   . ARG A 1 515 ? 27.388  61.849 56.226 1.00 30.06  ? 515  ARG A C   1 
ATOM   4065 O O   . ARG A 1 515 ? 27.914  61.669 57.374 1.00 30.69  ? 515  ARG A O   1 
ATOM   4066 C CB  . ARG A 1 515 ? 29.210  60.410 55.259 1.00 31.30  ? 515  ARG A CB  1 
ATOM   4067 C CG  . ARG A 1 515 ? 30.314  60.385 54.272 1.00 33.23  ? 515  ARG A CG  1 
ATOM   4068 C CD  . ARG A 1 515 ? 30.662  58.959 53.899 1.00 41.09  ? 515  ARG A CD  1 
ATOM   4069 N NE  . ARG A 1 515 ? 31.136  58.967 52.520 1.00 47.40  ? 515  ARG A NE  1 
ATOM   4070 C CZ  . ARG A 1 515 ? 32.410  59.158 52.152 1.00 47.38  ? 515  ARG A CZ  1 
ATOM   4071 N NH1 . ARG A 1 515 ? 33.360  59.290 53.070 1.00 47.96  ? 515  ARG A NH1 1 
ATOM   4072 N NH2 . ARG A 1 515 ? 32.735  59.196 50.858 1.00 45.95  ? 515  ARG A NH2 1 
ATOM   4073 N N   . LEU A 1 516 ? 26.212  62.437 56.022 1.00 27.50  ? 516  LEU A N   1 
ATOM   4074 C CA  . LEU A 1 516 ? 25.365  62.820 57.136 1.00 25.31  ? 516  LEU A CA  1 
ATOM   4075 C C   . LEU A 1 516 ? 25.238  61.635 58.155 1.00 24.89  ? 516  LEU A C   1 
ATOM   4076 O O   . LEU A 1 516 ? 24.990  60.528 57.745 1.00 25.58  ? 516  LEU A O   1 
ATOM   4077 C CB  . LEU A 1 516 ? 24.024  63.283 56.586 1.00 24.67  ? 516  LEU A CB  1 
ATOM   4078 C CG  . LEU A 1 516 ? 23.087  63.932 57.568 1.00 25.18  ? 516  LEU A CG  1 
ATOM   4079 C CD1 . LEU A 1 516 ? 23.869  64.971 58.331 1.00 22.91  ? 516  LEU A CD1 1 
ATOM   4080 C CD2 . LEU A 1 516 ? 21.953  64.558 56.817 1.00 24.71  ? 516  LEU A CD2 1 
ATOM   4081 N N   . ARG A 1 517 ? 25.482  61.881 59.445 1.00 23.44  ? 517  ARG A N   1 
ATOM   4082 C CA  . ARG A 1 517 ? 25.452  60.914 60.549 1.00 23.04  ? 517  ARG A CA  1 
ATOM   4083 C C   . ARG A 1 517 ? 25.772  59.548 60.154 1.00 22.81  ? 517  ARG A C   1 
ATOM   4084 O O   . ARG A 1 517 ? 25.019  58.663 60.444 1.00 24.56  ? 517  ARG A O   1 
ATOM   4085 C CB  . ARG A 1 517 ? 24.106  60.886 61.259 1.00 20.94  ? 517  ARG A CB  1 
ATOM   4086 C CG  . ARG A 1 517 ? 23.475  62.252 61.486 1.00 24.01  ? 517  ARG A CG  1 
ATOM   4087 C CD  . ARG A 1 517 ? 23.779  62.989 62.783 1.00 22.17  ? 517  ARG A CD  1 
ATOM   4088 N NE  . ARG A 1 517 ? 23.398  62.052 63.823 1.00 30.31  ? 517  ARG A NE  1 
ATOM   4089 C CZ  . ARG A 1 517 ? 23.959  61.988 65.038 1.00 32.60  ? 517  ARG A CZ  1 
ATOM   4090 N NH1 . ARG A 1 517 ? 24.886  62.881 65.358 1.00 34.52  ? 517  ARG A NH1 1 
ATOM   4091 N NH2 . ARG A 1 517 ? 23.591  61.057 65.946 1.00 30.06  ? 517  ARG A NH2 1 
ATOM   4092 N N   . VAL A 1 518 ? 26.863  59.323 59.474 1.00 23.29  ? 518  VAL A N   1 
ATOM   4093 C CA  . VAL A 1 518 ? 26.985  58.015 58.769 1.00 23.54  ? 518  VAL A CA  1 
ATOM   4094 C C   . VAL A 1 518 ? 27.244  56.864 59.770 1.00 25.66  ? 518  VAL A C   1 
ATOM   4095 O O   . VAL A 1 518 ? 26.686  55.780 59.722 1.00 25.47  ? 518  VAL A O   1 
ATOM   4096 C CB  . VAL A 1 518 ? 28.127  58.083 57.778 1.00 22.72  ? 518  VAL A CB  1 
ATOM   4097 C CG1 . VAL A 1 518 ? 29.320  58.883 58.455 1.00 19.92  ? 518  VAL A CG1 1 
ATOM   4098 C CG2 . VAL A 1 518 ? 28.465  56.679 57.304 1.00 17.13  ? 518  VAL A CG2 1 
ATOM   4099 N N   . GLN A 1 519 ? 28.221  57.155 60.604 1.00 27.98  ? 519  GLN A N   1 
ATOM   4100 C CA  . GLN A 1 519 ? 28.447  56.653 61.904 1.00 29.47  ? 519  GLN A CA  1 
ATOM   4101 C C   . GLN A 1 519 ? 27.291  55.858 62.500 1.00 27.25  ? 519  GLN A C   1 
ATOM   4102 O O   . GLN A 1 519 ? 27.326  54.655 62.613 1.00 26.57  ? 519  GLN A O   1 
ATOM   4103 C CB  . GLN A 1 519 ? 28.727  57.976 62.712 1.00 33.01  ? 519  GLN A CB  1 
ATOM   4104 C CG  . GLN A 1 519 ? 29.842  57.848 63.827 1.00 43.03  ? 519  GLN A CG  1 
ATOM   4105 C CD  . GLN A 1 519 ? 30.535  56.421 63.769 1.00 54.64  ? 519  GLN A CD  1 
ATOM   4106 O OE1 . GLN A 1 519 ? 31.368  56.112 62.841 1.00 56.58  ? 519  GLN A OE1 1 
ATOM   4107 N NE2 . GLN A 1 519 ? 30.146  55.539 64.740 1.00 56.09  ? 519  GLN A NE2 1 
ATOM   4108 N N   . MET A 1 520 ? 26.256  56.593 62.862 1.00 26.13  ? 520  MET A N   1 
ATOM   4109 C CA  . MET A 1 520 ? 25.138  56.110 63.621 1.00 24.74  ? 520  MET A CA  1 
ATOM   4110 C C   . MET A 1 520 ? 24.099  55.555 62.643 1.00 22.61  ? 520  MET A C   1 
ATOM   4111 O O   . MET A 1 520 ? 23.225  54.770 62.972 1.00 22.18  ? 520  MET A O   1 
ATOM   4112 C CB  . MET A 1 520 ? 24.570  57.295 64.405 1.00 25.63  ? 520  MET A CB  1 
ATOM   4113 C CG  . MET A 1 520 ? 25.639  58.074 65.291 1.00 30.04  ? 520  MET A CG  1 
ATOM   4114 S SD  . MET A 1 520 ? 25.849  57.258 66.984 1.00 38.77  ? 520  MET A SD  1 
ATOM   4115 C CE  . MET A 1 520 ? 26.624  55.639 66.624 1.00 37.58  ? 520  MET A CE  1 
ATOM   4116 N N   . CYS A 1 521 ? 24.164  55.944 61.400 1.00 19.96  ? 521  CYS A N   1 
ATOM   4117 C CA  . CYS A 1 521 ? 23.111  55.436 60.596 1.00 18.15  ? 521  CYS A CA  1 
ATOM   4118 C C   . CYS A 1 521 ? 23.435  54.031 60.221 1.00 17.40  ? 521  CYS A C   1 
ATOM   4119 O O   . CYS A 1 521 ? 22.531  53.271 59.978 1.00 17.40  ? 521  CYS A O   1 
ATOM   4120 C CB  . CYS A 1 521 ? 22.852  56.337 59.415 1.00 17.78  ? 521  CYS A CB  1 
ATOM   4121 S SG  . CYS A 1 521 ? 22.009  57.804 59.967 1.00 18.18  ? 521  CYS A SG  1 
ATOM   4122 N N   . VAL A 1 522 ? 24.721  53.665 60.231 1.00 16.59  ? 522  VAL A N   1 
ATOM   4123 C CA  . VAL A 1 522 ? 25.055  52.276 59.934 1.00 15.56  ? 522  VAL A CA  1 
ATOM   4124 C C   . VAL A 1 522 ? 24.622  51.432 61.069 1.00 14.04  ? 522  VAL A C   1 
ATOM   4125 O O   . VAL A 1 522 ? 24.047  50.295 60.840 1.00 12.41  ? 522  VAL A O   1 
ATOM   4126 C CB  . VAL A 1 522 ? 26.519  51.957 59.359 1.00 16.62  ? 522  VAL A CB  1 
ATOM   4127 C CG1 . VAL A 1 522 ? 27.523  53.033 59.636 1.00 16.74  ? 522  VAL A CG1 1 
ATOM   4128 C CG2 . VAL A 1 522 ? 26.986  50.545 59.721 1.00 14.81  ? 522  VAL A CG2 1 
ATOM   4129 N N   . PHE A 1 523 ? 24.789  52.014 62.269 1.00 11.93  ? 523  PHE A N   1 
ATOM   4130 C CA  . PHE A 1 523 ? 24.104  51.390 63.451 1.00 11.08  ? 523  PHE A CA  1 
ATOM   4131 C C   . PHE A 1 523 ? 22.623  51.021 63.246 1.00 10.86  ? 523  PHE A C   1 
ATOM   4132 O O   . PHE A 1 523 ? 22.223  49.869 63.481 1.00 10.36  ? 523  PHE A O   1 
ATOM   4133 C CB  . PHE A 1 523 ? 24.214  52.184 64.714 1.00 9.17   ? 523  PHE A CB  1 
ATOM   4134 C CG  . PHE A 1 523 ? 23.585  51.538 65.844 1.00 8.02   ? 523  PHE A CG  1 
ATOM   4135 C CD1 . PHE A 1 523 ? 24.151  50.402 66.411 1.00 11.60  ? 523  PHE A CD1 1 
ATOM   4136 C CD2 . PHE A 1 523 ? 22.413  52.051 66.391 1.00 11.43  ? 523  PHE A CD2 1 
ATOM   4137 C CE1 . PHE A 1 523 ? 23.527  49.739 67.539 1.00 11.41  ? 523  PHE A CE1 1 
ATOM   4138 C CE2 . PHE A 1 523 ? 21.735  51.413 67.517 1.00 10.59  ? 523  PHE A CE2 1 
ATOM   4139 C CZ  . PHE A 1 523 ? 22.323  50.272 68.085 1.00 13.26  ? 523  PHE A CZ  1 
ATOM   4140 N N   . TRP A 1 524 ? 21.814  51.988 62.810 1.00 11.37  ? 524  TRP A N   1 
ATOM   4141 C CA  . TRP A 1 524 ? 20.360  51.780 62.806 1.00 12.08  ? 524  TRP A CA  1 
ATOM   4142 C C   . TRP A 1 524 ? 19.991  51.028 61.511 1.00 13.93  ? 524  TRP A C   1 
ATOM   4143 O O   . TRP A 1 524 ? 19.047  50.218 61.442 1.00 14.10  ? 524  TRP A O   1 
ATOM   4144 C CB  . TRP A 1 524 ? 19.653  53.101 62.890 1.00 10.22  ? 524  TRP A CB  1 
ATOM   4145 C CG  . TRP A 1 524 ? 19.776  53.771 64.176 1.00 8.49   ? 524  TRP A CG  1 
ATOM   4146 C CD1 . TRP A 1 524 ? 20.590  54.780 64.439 1.00 7.81   ? 524  TRP A CD1 1 
ATOM   4147 C CD2 . TRP A 1 524 ? 19.011  53.535 65.395 1.00 7.54   ? 524  TRP A CD2 1 
ATOM   4148 N NE1 . TRP A 1 524 ? 20.438  55.202 65.753 1.00 9.47   ? 524  TRP A NE1 1 
ATOM   4149 C CE2 . TRP A 1 524 ? 19.450  54.474 66.349 1.00 6.84   ? 524  TRP A CE2 1 
ATOM   4150 C CE3 . TRP A 1 524 ? 18.041  52.602 65.778 1.00 7.52   ? 524  TRP A CE3 1 
ATOM   4151 C CZ2 . TRP A 1 524 ? 18.954  54.520 67.652 1.00 6.29   ? 524  TRP A CZ2 1 
ATOM   4152 C CZ3 . TRP A 1 524 ? 17.537  52.650 67.086 1.00 7.76   ? 524  TRP A CZ3 1 
ATOM   4153 C CH2 . TRP A 1 524 ? 18.011  53.577 68.003 1.00 7.95   ? 524  TRP A CH2 1 
ATOM   4154 N N   . ASN A 1 525 ? 20.806  51.237 60.493 1.00 15.47  ? 525  ASN A N   1 
ATOM   4155 C CA  . ASN A 1 525 ? 20.445  50.705 59.201 1.00 16.71  ? 525  ASN A CA  1 
ATOM   4156 C C   . ASN A 1 525 ? 20.912  49.371 58.911 1.00 16.97  ? 525  ASN A C   1 
ATOM   4157 O O   . ASN A 1 525 ? 20.153  48.662 58.408 1.00 16.33  ? 525  ASN A O   1 
ATOM   4158 C CB  . ASN A 1 525 ? 20.664  51.712 58.079 1.00 16.91  ? 525  ASN A CB  1 
ATOM   4159 C CG  . ASN A 1 525 ? 19.659  52.853 58.209 1.00 16.36  ? 525  ASN A CG  1 
ATOM   4160 O OD1 . ASN A 1 525 ? 18.643  52.663 58.891 1.00 16.09  ? 525  ASN A OD1 1 
ATOM   4161 N ND2 . ASN A 1 525 ? 19.933  54.013 57.636 1.00 13.17  ? 525  ASN A ND2 1 
ATOM   4162 N N   . GLN A 1 526 ? 22.140  49.029 59.273 1.00 19.78  ? 526  GLN A N   1 
ATOM   4163 C CA  . GLN A 1 526 ? 22.579  47.642 59.177 1.00 21.54  ? 526  GLN A CA  1 
ATOM   4164 C C   . GLN A 1 526 ? 22.568  46.945 60.483 1.00 20.54  ? 526  GLN A C   1 
ATOM   4165 O O   . GLN A 1 526 ? 21.945  45.899 60.602 1.00 21.17  ? 526  GLN A O   1 
ATOM   4166 C CB  . GLN A 1 526 ? 23.963  47.483 58.611 1.00 22.45  ? 526  GLN A CB  1 
ATOM   4167 C CG  . GLN A 1 526 ? 24.048  47.579 57.108 1.00 32.20  ? 526  GLN A CG  1 
ATOM   4168 C CD  . GLN A 1 526 ? 24.765  48.884 56.677 1.00 43.93  ? 526  GLN A CD  1 
ATOM   4169 O OE1 . GLN A 1 526 ? 26.020  49.030 56.840 1.00 44.66  ? 526  GLN A OE1 1 
ATOM   4170 N NE2 . GLN A 1 526 ? 23.963  49.853 56.128 1.00 47.07  ? 526  GLN A NE2 1 
ATOM   4171 N N   . PHE A 1 527 ? 23.251  47.485 61.481 1.00 20.14  ? 527  PHE A N   1 
ATOM   4172 C CA  . PHE A 1 527 ? 23.618  46.584 62.566 1.00 19.70  ? 527  PHE A CA  1 
ATOM   4173 C C   . PHE A 1 527 ? 22.439  46.157 63.472 1.00 20.47  ? 527  PHE A C   1 
ATOM   4174 O O   . PHE A 1 527 ? 22.214  44.984 63.727 1.00 20.68  ? 527  PHE A O   1 
ATOM   4175 C CB  . PHE A 1 527 ? 24.825  47.097 63.355 1.00 19.62  ? 527  PHE A CB  1 
ATOM   4176 C CG  . PHE A 1 527 ? 25.167  46.211 64.492 1.00 20.44  ? 527  PHE A CG  1 
ATOM   4177 C CD1 . PHE A 1 527 ? 25.713  44.968 64.267 1.00 21.13  ? 527  PHE A CD1 1 
ATOM   4178 C CD2 . PHE A 1 527 ? 24.852  46.560 65.775 1.00 22.18  ? 527  PHE A CD2 1 
ATOM   4179 C CE1 . PHE A 1 527 ? 25.958  44.101 65.275 1.00 20.40  ? 527  PHE A CE1 1 
ATOM   4180 C CE2 . PHE A 1 527 ? 25.098  45.699 66.788 1.00 21.85  ? 527  PHE A CE2 1 
ATOM   4181 C CZ  . PHE A 1 527 ? 25.646  44.459 66.529 1.00 21.55  ? 527  PHE A CZ  1 
ATOM   4182 N N   . LEU A 1 528 ? 21.648  47.117 63.931 1.00 21.09  ? 528  LEU A N   1 
ATOM   4183 C CA  . LEU A 1 528 ? 20.610  46.806 64.862 1.00 21.24  ? 528  LEU A CA  1 
ATOM   4184 C C   . LEU A 1 528 ? 19.648  45.796 64.233 1.00 22.23  ? 528  LEU A C   1 
ATOM   4185 O O   . LEU A 1 528 ? 19.355  44.754 64.836 1.00 22.70  ? 528  LEU A O   1 
ATOM   4186 C CB  . LEU A 1 528 ? 19.891  48.096 65.244 1.00 20.94  ? 528  LEU A CB  1 
ATOM   4187 C CG  . LEU A 1 528 ? 19.376  48.189 66.693 1.00 20.24  ? 528  LEU A CG  1 
ATOM   4188 C CD1 . LEU A 1 528 ? 18.064  48.977 66.799 1.00 13.80  ? 528  LEU A CD1 1 
ATOM   4189 C CD2 . LEU A 1 528 ? 19.296  46.817 67.391 1.00 17.34  ? 528  LEU A CD2 1 
ATOM   4190 N N   . PRO A 1 529 ? 19.141  46.108 63.016 1.00 22.34  ? 529  PRO A N   1 
ATOM   4191 C CA  . PRO A 1 529 ? 18.186  45.227 62.376 1.00 22.51  ? 529  PRO A CA  1 
ATOM   4192 C C   . PRO A 1 529 ? 18.732  43.811 62.264 1.00 22.76  ? 529  PRO A C   1 
ATOM   4193 O O   . PRO A 1 529 ? 18.013  42.896 62.501 1.00 21.76  ? 529  PRO A O   1 
ATOM   4194 C CB  . PRO A 1 529 ? 18.014  45.874 61.015 1.00 21.79  ? 529  PRO A CB  1 
ATOM   4195 C CG  . PRO A 1 529 ? 18.309  47.301 61.244 1.00 20.71  ? 529  PRO A CG  1 
ATOM   4196 C CD  . PRO A 1 529 ? 19.391  47.303 62.189 1.00 21.89  ? 529  PRO A CD  1 
ATOM   4197 N N   . LYS A 1 530 ? 19.997  43.633 61.936 1.00 23.85  ? 530  LYS A N   1 
ATOM   4198 C CA  . LYS A 1 530 ? 20.547  42.289 61.879 1.00 26.62  ? 530  LYS A CA  1 
ATOM   4199 C C   . LYS A 1 530 ? 20.476  41.652 63.251 1.00 25.61  ? 530  LYS A C   1 
ATOM   4200 O O   . LYS A 1 530 ? 20.231  40.507 63.369 1.00 25.33  ? 530  LYS A O   1 
ATOM   4201 C CB  . LYS A 1 530 ? 22.012  42.386 61.466 1.00 27.63  ? 530  LYS A CB  1 
ATOM   4202 C CG  . LYS A 1 530 ? 22.619  41.299 60.586 1.00 29.30  ? 530  LYS A CG  1 
ATOM   4203 C CD  . LYS A 1 530 ? 23.811  42.003 59.636 1.00 31.67  ? 530  LYS A CD  1 
ATOM   4204 C CE  . LYS A 1 530 ? 24.790  40.949 58.804 1.00 34.88  ? 530  LYS A CE  1 
ATOM   4205 N NZ  . LYS A 1 530 ? 25.321  39.734 59.658 1.00 37.54  ? 530  LYS A NZ  1 
ATOM   4206 N N   . LEU A 1 531 ? 20.714  42.429 64.293 1.00 26.25  ? 531  LEU A N   1 
ATOM   4207 C CA  . LEU A 1 531 ? 20.798  41.918 65.647 1.00 26.40  ? 531  LEU A CA  1 
ATOM   4208 C C   . LEU A 1 531 ? 19.415  41.475 66.105 1.00 27.92  ? 531  LEU A C   1 
ATOM   4209 O O   . LEU A 1 531 ? 19.285  40.410 66.671 1.00 27.27  ? 531  LEU A O   1 
ATOM   4210 C CB  . LEU A 1 531 ? 21.377  42.993 66.591 1.00 25.29  ? 531  LEU A CB  1 
ATOM   4211 C CG  . LEU A 1 531 ? 21.606  42.685 68.081 1.00 23.03  ? 531  LEU A CG  1 
ATOM   4212 C CD1 . LEU A 1 531 ? 22.638  43.498 68.668 1.00 19.42  ? 531  LEU A CD1 1 
ATOM   4213 C CD2 . LEU A 1 531 ? 20.427  42.968 68.894 1.00 25.52  ? 531  LEU A CD2 1 
ATOM   4214 N N   . LEU A 1 532 ? 18.385  42.288 65.877 1.00 29.85  ? 532  LEU A N   1 
ATOM   4215 C CA  . LEU A 1 532 ? 17.045  41.876 66.308 1.00 32.91  ? 532  LEU A CA  1 
ATOM   4216 C C   . LEU A 1 532 ? 16.565  40.634 65.550 1.00 35.81  ? 532  LEU A C   1 
ATOM   4217 O O   . LEU A 1 532 ? 15.764  39.807 66.095 1.00 36.55  ? 532  LEU A O   1 
ATOM   4218 C CB  . LEU A 1 532 ? 16.012  42.987 66.228 1.00 31.50  ? 532  LEU A CB  1 
ATOM   4219 C CG  . LEU A 1 532 ? 16.310  44.075 67.224 1.00 31.06  ? 532  LEU A CG  1 
ATOM   4220 C CD1 . LEU A 1 532 ? 15.632  45.282 66.759 1.00 31.67  ? 532  LEU A CD1 1 
ATOM   4221 C CD2 . LEU A 1 532 ? 15.835  43.721 68.606 1.00 29.83  ? 532  LEU A CD2 1 
ATOM   4222 N N   . ASN A 1 533 ? 17.074  40.485 64.317 1.00 38.49  ? 533  ASN A N   1 
ATOM   4223 C CA  . ASN A 1 533 ? 16.748  39.326 63.501 1.00 40.47  ? 533  ASN A CA  1 
ATOM   4224 C C   . ASN A 1 533 ? 17.379  38.107 64.072 1.00 41.10  ? 533  ASN A C   1 
ATOM   4225 O O   . ASN A 1 533 ? 16.763  37.108 63.993 1.00 41.08  ? 533  ASN A O   1 
ATOM   4226 C CB  . ASN A 1 533 ? 17.153  39.464 62.044 1.00 41.11  ? 533  ASN A CB  1 
ATOM   4227 C CG  . ASN A 1 533 ? 16.141  38.810 61.094 1.00 45.58  ? 533  ASN A CG  1 
ATOM   4228 O OD1 . ASN A 1 533 ? 16.296  37.659 60.660 1.00 50.30  ? 533  ASN A OD1 1 
ATOM   4229 N ND2 . ASN A 1 533 ? 15.094  39.562 60.749 1.00 51.63  ? 533  ASN A ND2 1 
ATOM   4230 N N   . ALA A 1 534 ? 18.577  38.166 64.658 1.00 42.72  ? 534  ALA A N   1 
ATOM   4231 C CA  . ALA A 1 534 ? 19.188  36.929 65.173 1.00 44.80  ? 534  ALA A CA  1 
ATOM   4232 C C   . ALA A 1 534 ? 18.546  36.415 66.499 1.00 46.67  ? 534  ALA A C   1 
ATOM   4233 O O   . ALA A 1 534 ? 17.941  35.324 66.546 1.00 47.73  ? 534  ALA A O   1 
ATOM   4234 C CB  . ALA A 1 534 ? 20.667  37.048 65.266 1.00 43.66  ? 534  ALA A CB  1 
ATOM   4235 N N   . THR A 1 535 ? 18.682  37.196 67.561 1.00 48.61  ? 535  THR A N   1 
ATOM   4236 C CA  . THR A 1 535 ? 17.826  37.106 68.763 1.00 50.58  ? 535  THR A CA  1 
ATOM   4237 C C   . THR A 1 535 ? 16.316  37.321 68.507 1.00 51.30  ? 535  THR A C   1 
ATOM   4238 O O   . THR A 1 535 ? 15.482  36.464 68.829 1.00 52.75  ? 535  THR A O   1 
ATOM   4239 C CB  . THR A 1 535 ? 18.287  38.151 69.820 1.00 51.21  ? 535  THR A CB  1 
ATOM   4240 O OG1 . THR A 1 535 ? 18.090  39.518 69.343 1.00 52.34  ? 535  THR A OG1 1 
ATOM   4241 C CG2 . THR A 1 535 ? 19.756  37.941 70.101 1.00 51.60  ? 535  THR A CG2 1 
HETATM 4242 O O1  . FP1 B 2 .   ? 2.331   68.668 61.664 0.80 20.00  ? 1536 FP1 A O1  1 
HETATM 4243 N N2  . FP1 B 2 .   ? 2.881   68.938 62.987 0.80 20.00  ? 1536 FP1 A N2  1 
HETATM 4244 C C6  . FP1 B 2 .   ? 4.320   69.219 62.904 0.80 20.00  ? 1536 FP1 A C6  1 
HETATM 4245 C C5  . FP1 B 2 .   ? 4.880   69.506 64.310 0.80 20.00  ? 1536 FP1 A C5  1 
HETATM 4246 C C4  . FP1 B 2 .   ? 6.256   69.773 64.404 0.80 20.00  ? 1536 FP1 A C4  1 
HETATM 4247 C C3  . FP1 B 2 .   ? 6.819   70.043 65.672 0.80 20.00  ? 1536 FP1 A C3  1 
HETATM 4248 C C2  . FP1 B 2 .   ? 6.029   70.052 66.834 0.80 20.00  ? 1536 FP1 A C2  1 
HETATM 4249 C C1  . FP1 B 2 .   ? 4.652   69.787 66.760 0.80 20.00  ? 1536 FP1 A C1  1 
HETATM 4250 N N1  . FP1 B 2 .   ? 4.068   69.511 65.492 0.80 20.00  ? 1536 FP1 A N1  1 
HETATM 4251 C C7  . FP1 B 2 .   ? 2.613   69.235 65.479 0.80 20.00  ? 1536 FP1 A C7  1 
HETATM 4252 S S   . SO4 C 3 .   ? 3.723   65.692 65.368 1.00 29.93  ? 1537 SO4 A S   1 
HETATM 4253 O O1  . SO4 C 3 .   ? 3.554   64.511 66.251 1.00 28.54  ? 1537 SO4 A O1  1 
HETATM 4254 O O2  . SO4 C 3 .   ? 4.429   66.769 66.016 1.00 35.11  ? 1537 SO4 A O2  1 
HETATM 4255 O O3  . SO4 C 3 .   ? 4.398   65.570 64.058 1.00 31.37  ? 1537 SO4 A O3  1 
HETATM 4256 O O4  . SO4 C 3 .   ? 2.440   66.271 65.176 1.00 31.43  ? 1537 SO4 A O4  1 
HETATM 4257 C C1  . NAG D 4 .   ? 18.597  62.664 34.367 1.00 57.70  ? 1538 NAG A C1  1 
HETATM 4258 C C2  . NAG D 4 .   ? 20.127  62.550 34.235 1.00 62.86  ? 1538 NAG A C2  1 
HETATM 4259 C C3  . NAG D 4 .   ? 20.505  63.282 32.928 1.00 64.34  ? 1538 NAG A C3  1 
HETATM 4260 C C4  . NAG D 4 .   ? 19.666  62.801 31.718 1.00 63.78  ? 1538 NAG A C4  1 
HETATM 4261 C C5  . NAG D 4 .   ? 18.322  63.611 32.003 1.00 62.90  ? 1538 NAG A C5  1 
HETATM 4262 C C6  . NAG D 4 .   ? 17.038  63.552 31.099 1.00 60.77  ? 1538 NAG A C6  1 
HETATM 4263 C C7  . NAG D 4 .   ? 20.946  62.545 36.645 1.00 60.97  ? 1538 NAG A C7  1 
HETATM 4264 C C8  . NAG D 4 .   ? 21.120  63.594 37.710 1.00 57.49  ? 1538 NAG A C8  1 
HETATM 4265 N N2  . NAG D 4 .   ? 20.871  63.078 35.403 1.00 62.81  ? 1538 NAG A N2  1 
HETATM 4266 O O3  . NAG D 4 .   ? 21.893  63.470 32.696 1.00 65.40  ? 1538 NAG A O3  1 
HETATM 4267 O O4  . NAG D 4 .   ? 20.429  62.981 30.491 1.00 62.42  ? 1538 NAG A O4  1 
HETATM 4268 O O5  . NAG D 4 .   ? 17.962  63.563 33.420 1.00 61.50  ? 1538 NAG A O5  1 
HETATM 4269 O O6  . NAG D 4 .   ? 16.471  62.249 30.905 1.00 59.55  ? 1538 NAG A O6  1 
HETATM 4270 O O7  . NAG D 4 .   ? 20.864  61.320 36.919 1.00 59.78  ? 1538 NAG A O7  1 
HETATM 4271 C C1  . NAG E 4 .   ? -19.640 84.957 50.018 1.00 100.63 ? 1539 NAG A C1  1 
HETATM 4272 C C2  . NAG E 4 .   ? -18.544 84.968 51.127 1.00 100.93 ? 1539 NAG A C2  1 
HETATM 4273 C C3  . NAG E 4 .   ? -18.276 86.376 51.698 1.00 101.29 ? 1539 NAG A C3  1 
HETATM 4274 C C4  . NAG E 4 .   ? -18.871 87.551 50.930 1.00 101.85 ? 1539 NAG A C4  1 
HETATM 4275 C C5  . NAG E 4 .   ? -19.282 87.306 49.435 1.00 101.24 ? 1539 NAG A C5  1 
HETATM 4276 C C6  . NAG E 4 .   ? -18.360 88.116 48.505 1.00 99.66  ? 1539 NAG A C6  1 
HETATM 4277 C C7  . NAG E 4 .   ? -18.275 82.828 52.539 1.00 98.19  ? 1539 NAG A C7  1 
HETATM 4278 C C8  . NAG E 4 .   ? -17.398 82.085 51.551 1.00 98.65  ? 1539 NAG A C8  1 
HETATM 4279 N N2  . NAG E 4 .   ? -18.808 84.048 52.255 1.00 99.22  ? 1539 NAG A N2  1 
HETATM 4280 O O3  . NAG E 4 .   ? -16.914 86.702 51.737 1.00 100.92 ? 1539 NAG A O3  1 
HETATM 4281 O O4  . NAG E 4 .   ? -19.878 88.049 51.808 1.00 101.77 ? 1539 NAG A O4  1 
HETATM 4282 O O5  . NAG E 4 .   ? -19.388 85.932 48.999 1.00 100.74 ? 1539 NAG A O5  1 
HETATM 4283 O O6  . NAG E 4 .   ? -18.211 87.521 47.233 1.00 97.79  ? 1539 NAG A O6  1 
HETATM 4284 O O7  . NAG E 4 .   ? -18.507 82.281 53.614 1.00 94.79  ? 1539 NAG A O7  1 
HETATM 4285 O O   . HOH F 5 .   ? 24.315  60.666 39.938 1.00 9.11   ? 2001 HOH A O   1 
HETATM 4286 O O   . HOH F 5 .   ? 0.621   91.132 55.589 1.00 17.38  ? 2002 HOH A O   1 
HETATM 4287 O O   . HOH F 5 .   ? 2.634   91.239 54.669 1.00 14.95  ? 2003 HOH A O   1 
HETATM 4288 O O   . HOH F 5 .   ? 22.991  51.336 31.535 1.00 37.56  ? 2004 HOH A O   1 
HETATM 4289 O O   . HOH F 5 .   ? 25.310  64.251 35.943 1.00 18.47  ? 2005 HOH A O   1 
HETATM 4290 O O   . HOH F 5 .   ? -4.609  97.583 43.972 1.00 32.85  ? 2006 HOH A O   1 
HETATM 4291 O O   . HOH F 5 .   ? -15.609 68.456 50.509 1.00 39.34  ? 2007 HOH A O   1 
HETATM 4292 O O   . HOH F 5 .   ? -15.347 61.251 57.747 1.00 31.58  ? 2008 HOH A O   1 
HETATM 4293 O O   . HOH F 5 .   ? 18.253  55.158 33.015 1.00 25.43  ? 2009 HOH A O   1 
HETATM 4294 O O   . HOH F 5 .   ? 21.612  53.378 33.636 1.00 30.35  ? 2010 HOH A O   1 
HETATM 4295 O O   . HOH F 5 .   ? 20.532  58.837 33.063 1.00 22.89  ? 2011 HOH A O   1 
HETATM 4296 O O   . HOH F 5 .   ? 23.839  60.914 34.491 1.00 26.87  ? 2012 HOH A O   1 
HETATM 4297 O O   . HOH F 5 .   ? 24.778  59.507 36.909 1.00 21.38  ? 2013 HOH A O   1 
HETATM 4298 O O   . HOH F 5 .   ? -9.901  71.461 54.974 1.00 18.10  ? 2014 HOH A O   1 
HETATM 4299 O O   . HOH F 5 .   ? -12.314 64.576 60.071 1.00 18.48  ? 2015 HOH A O   1 
HETATM 4300 O O   . HOH F 5 .   ? -4.341  71.671 62.758 1.00 9.23   ? 2016 HOH A O   1 
HETATM 4301 O O   . HOH F 5 .   ? 2.278   65.075 77.411 1.00 26.98  ? 2017 HOH A O   1 
HETATM 4302 O O   . HOH F 5 .   ? -1.161  69.251 81.207 1.00 29.46  ? 2018 HOH A O   1 
HETATM 4303 O O   . HOH F 5 .   ? -0.256  71.017 62.770 1.00 9.83   ? 2019 HOH A O   1 
HETATM 4304 O O   . HOH F 5 .   ? -3.162  77.228 65.107 1.00 5.97   ? 2020 HOH A O   1 
HETATM 4305 O O   . HOH F 5 .   ? -7.387  74.441 68.480 1.00 16.52  ? 2021 HOH A O   1 
HETATM 4306 O O   . HOH F 5 .   ? -13.016 84.072 58.343 1.00 27.78  ? 2022 HOH A O   1 
HETATM 4307 O O   . HOH F 5 .   ? -18.325 67.345 61.577 1.00 18.77  ? 2023 HOH A O   1 
HETATM 4308 O O   . HOH F 5 .   ? -19.590 64.899 61.916 1.00 20.24  ? 2024 HOH A O   1 
HETATM 4309 O O   . HOH F 5 .   ? 3.489   84.155 32.514 1.00 29.39  ? 2025 HOH A O   1 
HETATM 4310 O O   . HOH F 5 .   ? 2.630   81.892 32.416 1.00 32.99  ? 2026 HOH A O   1 
HETATM 4311 O O   . HOH F 5 .   ? -1.586  70.867 53.266 1.00 7.33   ? 2027 HOH A O   1 
HETATM 4312 O O   . HOH F 5 .   ? 3.269   69.908 58.373 1.00 12.33  ? 2028 HOH A O   1 
HETATM 4313 O O   . HOH F 5 .   ? -0.841  64.066 59.724 1.00 20.73  ? 2029 HOH A O   1 
HETATM 4314 O O   . HOH F 5 .   ? -0.168  68.493 64.528 1.00 5.59   ? 2030 HOH A O   1 
HETATM 4315 O O   . HOH F 5 .   ? -7.295  69.383 58.407 1.00 15.44  ? 2031 HOH A O   1 
HETATM 4316 O O   . HOH F 5 .   ? -7.482  71.794 57.090 1.00 13.99  ? 2032 HOH A O   1 
HETATM 4317 O O   . HOH F 5 .   ? -0.030  69.958 60.062 1.00 8.22   ? 2033 HOH A O   1 
HETATM 4318 O O   . HOH F 5 .   ? 4.118   81.754 51.935 1.00 11.43  ? 2034 HOH A O   1 
HETATM 4319 O O   . HOH F 5 .   ? -4.088  87.181 54.438 1.00 20.16  ? 2035 HOH A O   1 
HETATM 4320 O O   . HOH F 5 .   ? -13.857 59.451 57.053 1.00 4.73   ? 2036 HOH A O   1 
HETATM 4321 O O   . HOH F 5 .   ? -9.744  63.124 60.354 1.00 9.93   ? 2037 HOH A O   1 
HETATM 4322 O O   . HOH F 5 .   ? -8.983  59.428 65.151 1.00 28.24  ? 2038 HOH A O   1 
HETATM 4323 O O   . HOH F 5 .   ? 21.109  55.729 34.636 1.00 18.92  ? 2039 HOH A O   1 
HETATM 4324 O O   . HOH F 5 .   ? 22.783  58.388 35.248 1.00 20.96  ? 2040 HOH A O   1 
HETATM 4325 O O   . HOH F 5 .   ? -4.462  53.287 56.558 1.00 4.36   ? 2041 HOH A O   1 
HETATM 4326 O O   . HOH F 5 .   ? 5.175   91.238 71.378 1.00 27.44  ? 2042 HOH A O   1 
HETATM 4327 O O   . HOH F 5 .   ? -4.040  52.593 44.179 1.00 30.77  ? 2043 HOH A O   1 
HETATM 4328 O O   . HOH F 5 .   ? -4.615  71.779 34.488 1.00 13.49  ? 2044 HOH A O   1 
HETATM 4329 O O   . HOH F 5 .   ? -9.911  65.869 38.909 1.00 32.12  ? 2045 HOH A O   1 
HETATM 4330 O O   . HOH F 5 .   ? 10.535  69.351 60.141 1.00 10.22  ? 2046 HOH A O   1 
HETATM 4331 O O   . HOH F 5 .   ? -1.537  52.268 42.922 1.00 8.04   ? 2047 HOH A O   1 
HETATM 4332 O O   . HOH F 5 .   ? -4.784  56.841 39.506 1.00 32.18  ? 2048 HOH A O   1 
HETATM 4333 O O   . HOH F 5 .   ? -0.321  58.515 38.407 1.00 20.90  ? 2049 HOH A O   1 
HETATM 4334 O O   . HOH F 5 .   ? 12.599  66.643 33.795 1.00 32.24  ? 2050 HOH A O   1 
HETATM 4335 O O   . HOH F 5 .   ? 3.500   46.873 61.403 1.00 25.04  ? 2051 HOH A O   1 
HETATM 4336 O O   . HOH F 5 .   ? 2.248   41.719 61.822 1.00 18.65  ? 2052 HOH A O   1 
HETATM 4337 O O   . HOH F 5 .   ? -1.524  42.266 65.271 1.00 22.18  ? 2053 HOH A O   1 
HETATM 4338 O O   . HOH F 5 .   ? -6.591  50.311 61.608 1.00 12.25  ? 2054 HOH A O   1 
HETATM 4339 O O   . HOH F 5 .   ? -0.784  61.663 72.873 1.00 20.58  ? 2055 HOH A O   1 
HETATM 4340 O O   . HOH F 5 .   ? 5.250   61.558 71.521 1.00 3.14   ? 2056 HOH A O   1 
HETATM 4341 O O   . HOH F 5 .   ? 4.249   59.566 70.333 1.00 32.14  ? 2057 HOH A O   1 
HETATM 4342 O O   . HOH F 5 .   ? 3.121   54.485 64.176 1.00 25.65  ? 2058 HOH A O   1 
HETATM 4343 O O   . HOH F 5 .   ? -1.913  58.645 67.577 1.00 33.64  ? 2059 HOH A O   1 
HETATM 4344 O O   . HOH F 5 .   ? 4.431   47.840 39.969 1.00 30.41  ? 2060 HOH A O   1 
HETATM 4345 O O   . HOH F 5 .   ? 5.328   59.563 35.907 1.00 30.44  ? 2061 HOH A O   1 
HETATM 4346 O O   . HOH F 5 .   ? 9.768   56.622 36.460 1.00 28.66  ? 2062 HOH A O   1 
HETATM 4347 O O   . HOH F 5 .   ? 11.413  64.461 35.837 1.00 36.45  ? 2063 HOH A O   1 
HETATM 4348 O O   . HOH F 5 .   ? 21.964  65.895 63.858 1.00 33.01  ? 2064 HOH A O   1 
HETATM 4349 O O   . HOH F 5 .   ? 12.370  68.172 67.829 1.00 14.76  ? 2065 HOH A O   1 
HETATM 4350 O O   . HOH F 5 .   ? 7.884   64.556 79.337 1.00 7.60   ? 2066 HOH A O   1 
HETATM 4351 O O   . HOH F 5 .   ? 16.460  73.254 85.744 1.00 30.70  ? 2067 HOH A O   1 
HETATM 4352 O O   . HOH F 5 .   ? 16.808  70.170 85.258 1.00 15.46  ? 2068 HOH A O   1 
HETATM 4353 O O   . HOH F 5 .   ? 10.293  57.503 85.542 1.00 18.51  ? 2069 HOH A O   1 
HETATM 4354 O O   . HOH F 5 .   ? 26.595  46.117 77.841 1.00 23.65  ? 2070 HOH A O   1 
HETATM 4355 O O   . HOH F 5 .   ? 20.606  63.057 65.557 1.00 24.68  ? 2071 HOH A O   1 
HETATM 4356 O O   . HOH F 5 .   ? 10.719  56.269 68.632 1.00 13.58  ? 2072 HOH A O   1 
HETATM 4357 O O   . HOH F 5 .   ? 21.564  52.258 53.732 1.00 2.00   ? 2073 HOH A O   1 
HETATM 4358 O O   . HOH F 5 .   ? 20.281  56.319 36.863 1.00 22.96  ? 2074 HOH A O   1 
HETATM 4359 O O   . HOH F 5 .   ? 25.290  72.093 63.856 1.00 26.44  ? 2075 HOH A O   1 
HETATM 4360 O O   . HOH F 5 .   ? 16.270  78.733 77.777 1.00 30.16  ? 2076 HOH A O   1 
HETATM 4361 O O   . HOH F 5 .   ? 19.953  70.495 72.523 1.00 28.31  ? 2077 HOH A O   1 
HETATM 4362 O O   . HOH F 5 .   ? 7.928   76.377 61.403 1.00 21.58  ? 2078 HOH A O   1 
HETATM 4363 O O   . HOH F 5 .   ? 7.105   79.674 64.627 1.00 39.39  ? 2079 HOH A O   1 
HETATM 4364 O O   . HOH F 5 .   ? 6.055   89.602 68.600 1.00 12.33  ? 2080 HOH A O   1 
HETATM 4365 O O   . HOH F 5 .   ? 7.376   92.015 70.033 1.00 10.76  ? 2081 HOH A O   1 
HETATM 4366 O O   . HOH F 5 .   ? 18.456  92.872 62.722 1.00 20.00  ? 2082 HOH A O   1 
HETATM 4367 O O   . HOH F 5 .   ? 27.241  68.822 40.879 1.00 34.04  ? 2083 HOH A O   1 
HETATM 4368 O O   . HOH F 5 .   ? 32.215  67.129 57.003 1.00 18.16  ? 2084 HOH A O   1 
HETATM 4369 O O   . HOH F 5 .   ? 24.813  58.366 56.220 1.00 33.76  ? 2085 HOH A O   1 
HETATM 4370 O O   . HOH F 5 .   ? 25.749  65.511 63.173 1.00 44.63  ? 2086 HOH A O   1 
HETATM 4371 O O   . HOH F 5 .   ? 25.647  61.679 68.093 1.00 37.78  ? 2087 HOH A O   1 
HETATM 4372 O O   . HOH F 5 .   ? 23.021  52.620 55.611 1.00 23.42  ? 2088 HOH A O   1 
HETATM 4373 O O   . HOH F 5 .   ? 16.844  38.570 57.764 1.00 33.53  ? 2089 HOH A O   1 
HETATM 4374 O O   . HOH F 5 .   ? 18.581  32.324 67.870 1.00 27.32  ? 2090 HOH A O   1 
HETATM 4375 O O   . HOH F 5 .   ? 4.343   64.806 61.738 1.00 6.25   ? 2091 HOH A O   1 
HETATM 4376 O O   . HOH F 5 .   ? 14.994  62.419 32.897 1.00 39.17  ? 2092 HOH A O   1 
HETATM 4377 O O   . HOH F 5 .   ? 21.351  59.037 38.276 1.00 22.58  ? 2093 HOH A O   1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'NAG A 1538 HAS WRONG CHIRALITY AT ATOM C1' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 486 HIS HIS A . n 
A 1 487 SER 487 487 ?   ?   ?   A . n 
A 1 488 GLN 488 488 ?   ?   ?   A . n 
A 1 489 GLU 489 489 ?   ?   ?   A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 ?   ?   ?   A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
A 1 538 ASP 538 538 ?   ?   ?   A . n 
A 1 539 GLY 539 539 ?   ?   ?   A . n 
A 1 540 GLU 540 540 ?   ?   ?   A . n 
A 1 541 LEU 541 541 ?   ?   ?   A . n 
A 1 542 SER 542 542 ?   ?   ?   A . n 
A 1 543 SER 543 543 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 FP1 1  1536 1536 FP1 FP1 A . 
C 3 SO4 1  1537 1537 SO4 SO4 A . 
D 4 NAG 1  1538 1538 NAG NAG A . 
E 4 NAG 1  1539 1539 NAG NAG A . 
F 5 HOH 1  2001 2001 HOH HOH A . 
F 5 HOH 2  2002 2002 HOH HOH A . 
F 5 HOH 3  2003 2003 HOH HOH A . 
F 5 HOH 4  2004 2004 HOH HOH A . 
F 5 HOH 5  2005 2005 HOH HOH A . 
F 5 HOH 6  2006 2006 HOH HOH A . 
F 5 HOH 7  2007 2007 HOH HOH A . 
F 5 HOH 8  2008 2008 HOH HOH A . 
F 5 HOH 9  2009 2009 HOH HOH A . 
F 5 HOH 10 2010 2010 HOH HOH A . 
F 5 HOH 11 2011 2011 HOH HOH A . 
F 5 HOH 12 2012 2012 HOH HOH A . 
F 5 HOH 13 2013 2013 HOH HOH A . 
F 5 HOH 14 2014 2014 HOH HOH A . 
F 5 HOH 15 2015 2015 HOH HOH A . 
F 5 HOH 16 2016 2016 HOH HOH A . 
F 5 HOH 17 2017 2017 HOH HOH A . 
F 5 HOH 18 2018 2018 HOH HOH A . 
F 5 HOH 19 2019 2019 HOH HOH A . 
F 5 HOH 20 2020 2020 HOH HOH A . 
F 5 HOH 21 2021 2021 HOH HOH A . 
F 5 HOH 22 2022 2022 HOH HOH A . 
F 5 HOH 23 2023 2023 HOH HOH A . 
F 5 HOH 24 2024 2024 HOH HOH A . 
F 5 HOH 25 2025 2025 HOH HOH A . 
F 5 HOH 26 2026 2026 HOH HOH A . 
F 5 HOH 27 2027 2027 HOH HOH A . 
F 5 HOH 28 2028 2028 HOH HOH A . 
F 5 HOH 29 2029 2029 HOH HOH A . 
F 5 HOH 30 2030 2030 HOH HOH A . 
F 5 HOH 31 2031 2031 HOH HOH A . 
F 5 HOH 32 2032 2032 HOH HOH A . 
F 5 HOH 33 2033 2033 HOH HOH A . 
F 5 HOH 34 2034 2034 HOH HOH A . 
F 5 HOH 35 2035 2035 HOH HOH A . 
F 5 HOH 36 2036 2036 HOH HOH A . 
F 5 HOH 37 2037 2037 HOH HOH A . 
F 5 HOH 38 2038 2038 HOH HOH A . 
F 5 HOH 39 2039 2039 HOH HOH A . 
F 5 HOH 40 2040 2040 HOH HOH A . 
F 5 HOH 41 2041 2041 HOH HOH A . 
F 5 HOH 42 2042 2042 HOH HOH A . 
F 5 HOH 43 2043 2043 HOH HOH A . 
F 5 HOH 44 2044 2044 HOH HOH A . 
F 5 HOH 45 2045 2045 HOH HOH A . 
F 5 HOH 46 2046 2046 HOH HOH A . 
F 5 HOH 47 2047 2047 HOH HOH A . 
F 5 HOH 48 2048 2048 HOH HOH A . 
F 5 HOH 49 2049 2049 HOH HOH A . 
F 5 HOH 50 2050 2050 HOH HOH A . 
F 5 HOH 51 2051 2051 HOH HOH A . 
F 5 HOH 52 2052 2052 HOH HOH A . 
F 5 HOH 53 2053 2053 HOH HOH A . 
F 5 HOH 54 2054 2054 HOH HOH A . 
F 5 HOH 55 2055 2055 HOH HOH A . 
F 5 HOH 56 2056 2056 HOH HOH A . 
F 5 HOH 57 2057 2057 HOH HOH A . 
F 5 HOH 58 2058 2058 HOH HOH A . 
F 5 HOH 59 2059 2059 HOH HOH A . 
F 5 HOH 60 2060 2060 HOH HOH A . 
F 5 HOH 61 2061 2061 HOH HOH A . 
F 5 HOH 62 2062 2062 HOH HOH A . 
F 5 HOH 63 2063 2063 HOH HOH A . 
F 5 HOH 64 2064 2064 HOH HOH A . 
F 5 HOH 65 2065 2065 HOH HOH A . 
F 5 HOH 66 2066 2066 HOH HOH A . 
F 5 HOH 67 2067 2067 HOH HOH A . 
F 5 HOH 68 2068 2068 HOH HOH A . 
F 5 HOH 69 2069 2069 HOH HOH A . 
F 5 HOH 70 2070 2070 HOH HOH A . 
F 5 HOH 71 2071 2071 HOH HOH A . 
F 5 HOH 72 2072 2072 HOH HOH A . 
F 5 HOH 73 2073 2073 HOH HOH A . 
F 5 HOH 74 2074 2074 HOH HOH A . 
F 5 HOH 75 2075 2075 HOH HOH A . 
F 5 HOH 76 2076 2076 HOH HOH A . 
F 5 HOH 77 2077 2077 HOH HOH A . 
F 5 HOH 78 2078 2078 HOH HOH A . 
F 5 HOH 79 2079 2079 HOH HOH A . 
F 5 HOH 80 2080 2080 HOH HOH A . 
F 5 HOH 81 2081 2081 HOH HOH A . 
F 5 HOH 82 2082 2082 HOH HOH A . 
F 5 HOH 83 2083 2083 HOH HOH A . 
F 5 HOH 84 2084 2084 HOH HOH A . 
F 5 HOH 85 2085 2085 HOH HOH A . 
F 5 HOH 86 2086 2086 HOH HOH A . 
F 5 HOH 87 2087 2087 HOH HOH A . 
F 5 HOH 88 2088 2088 HOH HOH A . 
F 5 HOH 89 2089 2089 HOH HOH A . 
F 5 HOH 90 2090 2090 HOH HOH A . 
F 5 HOH 91 2091 2091 HOH HOH A . 
F 5 HOH 92 2092 2092 HOH HOH A . 
F 5 HOH 93 2093 2093 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 59  A ASN 59  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 416 A ASN 416 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-05-13 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Advisory                    
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Derived calculations'      
6 4 'Structure model' Other                       
7 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' chem_comp                 
2 4 'Structure model' database_PDB_caveat       
3 4 'Structure model' entity                    
4 4 'Structure model' pdbx_chem_comp_identifier 
5 4 'Structure model' pdbx_database_status      
6 4 'Structure model' pdbx_entity_nonpoly       
7 4 'Structure model' struct_conn               
8 4 'Structure model' struct_site               
9 4 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_chem_comp.name'                      
2 4 'Structure model' '_chem_comp.type'                      
3 4 'Structure model' '_entity.pdbx_description'             
4 4 'Structure model' '_pdbx_database_status.status_code_sf' 
5 4 'Structure model' '_pdbx_entity_nonpoly.name'            
6 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'  
7 4 'Structure model' '_struct_conn.pdbx_role'               
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.2.0019 ? 1 
DENZO     'data reduction' .        ? 2 
SCALEPACK 'data scaling'   .        ? 3 
PROTIN    phasing          .        ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 ND2 A ASN 59  ? ? O5 A NAG 1539 ? ? 2.11 
2 1 ND2 A ASN 59  ? ? C2 A NAG 1539 ? ? 2.14 
3 1 N   A SER 108 ? ? O  A HOH 2026 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 C   A TRP 114 ? ? N  A ILE 115 ? ? 1.184 1.336 -0.152 0.023 Y 
2  1 CE1 A PHE 219 ? ? CZ A PHE 219 ? ? 1.487 1.369 0.118  0.019 N 
3  1 CB  A SER 228 ? ? OG A SER 228 ? ? 1.327 1.418 -0.091 0.013 N 
4  1 CB  A CYS 231 ? ? SG A CYS 231 ? ? 1.703 1.812 -0.109 0.016 N 
5  1 CA  A ALA 245 ? ? CB A ALA 245 ? ? 1.387 1.520 -0.133 0.021 N 
6  1 CB  A CYS 254 ? ? SG A CYS 254 ? ? 1.715 1.812 -0.097 0.016 N 
7  1 C   A PRO 283 ? ? N  A PHE 284 ? ? 1.518 1.336 0.182  0.023 Y 
8  1 C   A PHE 284 ? ? N  A ASP 285 ? ? 1.195 1.336 -0.141 0.023 Y 
9  1 C   A ILE 287 ? ? N  A PHE 288 ? ? 1.124 1.336 -0.212 0.023 Y 
10 1 CE1 A PHE 476 ? ? CZ A PHE 476 ? ? 1.513 1.369 0.144  0.019 N 
11 1 CD  A LYS 478 ? ? CE A LYS 478 ? ? 1.696 1.508 0.188  0.025 N 
12 1 CD  A LYS 530 ? ? CE A LYS 530 ? ? 1.662 1.508 0.154  0.025 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB A LEU 31  ? ? CG A LEU 31  ? ? CD1 A LEU 31  ? ? 122.81 111.00 11.81  1.70 N 
2  1 NE A ARG 44  ? ? CZ A ARG 44  ? ? NH2 A ARG 44  ? ? 115.89 120.30 -4.41  0.50 N 
3  1 NE A ARG 88  ? ? CZ A ARG 88  ? ? NH1 A ARG 88  ? ? 116.36 120.30 -3.94  0.50 N 
4  1 C  A ARG 105 ? ? N  A PRO 106 ? ? CA  A PRO 106 ? ? 108.69 119.30 -10.61 1.50 Y 
5  1 CB A VAL 129 ? ? CA A VAL 129 ? ? C   A VAL 129 ? ? 99.81  111.40 -11.59 1.90 N 
6  1 NE A ARG 149 ? ? CZ A ARG 149 ? ? NH2 A ARG 149 ? ? 115.59 120.30 -4.71  0.50 N 
7  1 CB A ASP 190 ? ? CG A ASP 190 ? ? OD2 A ASP 190 ? ? 125.59 118.30 7.29   0.90 N 
8  1 NE A ARG 220 ? ? CZ A ARG 220 ? ? NH1 A ARG 220 ? ? 124.31 120.30 4.01   0.50 N 
9  1 NE A ARG 221 ? ? CZ A ARG 221 ? ? NH1 A ARG 221 ? ? 124.02 120.30 3.72   0.50 N 
10 1 NE A ARG 221 ? ? CZ A ARG 221 ? ? NH2 A ARG 221 ? ? 116.36 120.30 -3.94  0.50 N 
11 1 NE A ARG 244 ? ? CZ A ARG 244 ? ? NH1 A ARG 244 ? ? 114.97 120.30 -5.33  0.50 N 
12 1 NE A ARG 244 ? ? CZ A ARG 244 ? ? NH2 A ARG 244 ? ? 126.12 120.30 5.82   0.50 N 
13 1 C  A PHE 284 ? ? N  A ASP 285 ? ? CA  A ASP 285 ? ? 105.79 121.70 -15.91 2.50 Y 
14 1 O  A SER 286 ? ? C  A SER 286 ? ? N   A ILE 287 ? ? 111.90 122.70 -10.80 1.60 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 11  ? ? -37.41  -28.09  
2  1 LEU A 23  ? ? 52.98   -121.23 
3  1 SER A 25  ? ? -63.65  -148.91 
4  1 PHE A 45  ? ? 73.92   -3.25   
5  1 ALA A 60  ? ? -98.56  50.03   
6  1 GLN A 74  ? ? -15.94  -55.86  
7  1 PHE A 75  ? ? -115.62 78.69   
8  1 CYS A 94  ? ? -150.24 23.52   
9  1 PHE A 120 ? ? 69.68   -15.90  
10 1 PHE A 155 ? ? -141.75 -7.93   
11 1 LEU A 158 ? ? -117.15 78.96   
12 1 HIS A 159 ? ? -24.42  -66.21  
13 1 ALA A 164 ? ? -153.62 77.30   
14 1 THR A 193 ? ? -146.80 46.49   
15 1 SER A 200 ? ? 38.82   -112.87 
16 1 LEU A 256 ? ? -115.23 53.66   
17 1 GLU A 299 ? ? -106.57 -63.11  
18 1 THR A 317 ? ? -132.78 -148.18 
19 1 ASP A 326 ? ? -119.49 75.54   
20 1 MET A 379 ? ? -106.95 41.18   
21 1 ASP A 380 ? ? 145.53  35.88   
22 1 VAL A 400 ? ? -136.65 -56.10  
23 1 VAL A 438 ? ? -66.17  95.84   
24 1 PRO A 451 ? ? -55.13  -9.80   
25 1 ASN A 457 ? ? 86.25   47.57   
26 1 MET A 470 ? ? -34.95  -35.33  
27 1 TYR A 472 ? ? -20.38  -56.00  
28 1 GLN A 500 ? ? 87.80   48.57   
29 1 THR A 507 ? ? -62.35  3.89    
30 1 ARG A 517 ? ? 28.59   51.69   
31 1 GLN A 519 ? ? -11.29  -72.70  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 ASN A 42  ? ? MET A 43  ? ? 140.61  
2 1 PHE A 292 ? ? VAL A 293 ? ? -147.81 
3 1 SER A 490 ? ? LYS A 491 ? ? -146.74 
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1 1 PHE A 284 ? ? 15.52  
2 1 ILE A 287 ? ? -15.74 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    C1 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    NAG 
_pdbx_validate_chiral.auth_seq_id     1538 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_validate_polymer_linkage.id 
_pdbx_validate_polymer_linkage.PDB_model_num 
_pdbx_validate_polymer_linkage.auth_atom_id_1 
_pdbx_validate_polymer_linkage.auth_asym_id_1 
_pdbx_validate_polymer_linkage.auth_comp_id_1 
_pdbx_validate_polymer_linkage.auth_seq_id_1 
_pdbx_validate_polymer_linkage.PDB_ins_code_1 
_pdbx_validate_polymer_linkage.label_alt_id_1 
_pdbx_validate_polymer_linkage.auth_atom_id_2 
_pdbx_validate_polymer_linkage.auth_asym_id_2 
_pdbx_validate_polymer_linkage.auth_comp_id_2 
_pdbx_validate_polymer_linkage.auth_seq_id_2 
_pdbx_validate_polymer_linkage.PDB_ins_code_2 
_pdbx_validate_polymer_linkage.label_alt_id_2 
_pdbx_validate_polymer_linkage.dist 
1 1 C A TRP 114 ? ? N A ILE 115 ? ? 1.18 
2 1 C A PHE 284 ? ? N A ASP 285 ? ? 1.19 
3 1 C A ILE 287 ? ? N A PHE 288 ? ? 1.12 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 2004 ? 9.54 . 
2 1 O ? A HOH 2009 ? 6.25 . 
3 1 O ? A HOH 2010 ? 6.69 . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 1   ? A ASP 1   
2  1 Y 1 A ASP 2   ? A ASP 2   
3  1 Y 1 A HIS 3   ? A HIS 3   
4  1 Y 1 A SER 487 ? A SER 487 
5  1 Y 1 A GLN 488 ? A GLN 488 
6  1 Y 1 A GLU 489 ? A GLU 489 
7  1 Y 1 A ALA 536 ? A ALA 536 
8  1 Y 1 A CYS 537 ? A CYS 537 
9  1 Y 1 A ASP 538 ? A ASP 538 
10 1 Y 1 A GLY 539 ? A GLY 539 
11 1 Y 1 A GLU 540 ? A GLU 540 
12 1 Y 1 A LEU 541 ? A LEU 541 
13 1 Y 1 A SER 542 ? A SER 542 
14 1 Y 1 A SER 543 ? A SER 543 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'N-hydroxy-1-(1-methylpyridin-2(1H)-ylidene)methanamine' FP1 
3 'SULFATE ION'                                            SO4 
4 2-acetamido-2-deoxy-beta-D-glucopyranose                 NAG 
5 water                                                    HOH 
#