data_2VSC
# 
_entry.id   2VSC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2VSC         
PDBE  EBI-35998    
WWPDB D_1290035998 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2JJS unspecified 'STRUCTURE OF HUMAN CD47 IN COMPLEX WITH HUMAN SIGNAL REGULATORY PROTEIN (SIRP) ALPHA' 
PDB 2JJT unspecified 'STRUCTURE OF HUMAN CD47 IN COMPLEX WITH HUMAN SIGNAL REGULATORY PROTEIN (SIRP) ALPHA' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2VSC 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2008-04-22 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hatherley, D.' 1 
'Graham, S.C.'  2 
'Turner, J.'    3 
'Harlos, K.'    4 
'Stuart, D.I.'  5 
'Barclay, A.N.' 6 
# 
_citation.id                        primary 
_citation.title                     
'Paired Receptor Specificity Explained by Structures of Signal Regulatory Proteins Alone and Complexed with Cd47.' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            31 
_citation.page_first                266 
_citation.page_last                 ? 
_citation.year                      2008 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18657508 
_citation.pdbx_database_id_DOI      10.1016/J.MOLCEL.2008.05.026 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hatherley, D.' 1 ? 
primary 'Graham, S.C.'  2 ? 
primary 'Turner, J.'    3 ? 
primary 'Harlos, K.'    4 ? 
primary 'Stuart, D.I.'  5 ? 
primary 'Barclay, A.N.' 6 ? 
# 
_cell.entry_id           2VSC 
_cell.length_a           201.137 
_cell.length_b           47.502 
_cell.length_c           56.811 
_cell.angle_alpha        90.00 
_cell.angle_beta         99.31 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2VSC 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'LEUKOCYTE SURFACE ANTIGEN CD47'         14518.302 4   ? YES 
'IMMUNOGLOBULIN-SUPERFAMILY ECTODOMAIN, RESIDUES 19-136' ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   12  ? ?   ? ? 
3 non-polymer syn 'MAGNESIUM ION'                          24.305    2   ? ?   ? ? 
4 water       nat water                                    18.015    353 ? ?   ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'INTEGRIN-ASSOCIATED PROTEIN, IAP, ANTIGENIC SURFACE DETERMINANT PROTEIN OA3, PROTEIN MER6, CD47' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(PCA)LLFNKTKSVEFTFGNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKG
DASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWSTRHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;QLLFNKTKSVEFTFGNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASL
KMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWSTRHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PCA n 
1 2   LEU n 
1 3   LEU n 
1 4   PHE n 
1 5   ASN n 
1 6   LYS n 
1 7   THR n 
1 8   LYS n 
1 9   SER n 
1 10  VAL n 
1 11  GLU n 
1 12  PHE n 
1 13  THR n 
1 14  PHE n 
1 15  GLY n 
1 16  ASN n 
1 17  ASP n 
1 18  THR n 
1 19  VAL n 
1 20  VAL n 
1 21  ILE n 
1 22  PRO n 
1 23  CYS n 
1 24  PHE n 
1 25  VAL n 
1 26  THR n 
1 27  ASN n 
1 28  MET n 
1 29  GLU n 
1 30  ALA n 
1 31  GLN n 
1 32  ASN n 
1 33  THR n 
1 34  THR n 
1 35  GLU n 
1 36  VAL n 
1 37  TYR n 
1 38  VAL n 
1 39  LYS n 
1 40  TRP n 
1 41  LYS n 
1 42  PHE n 
1 43  LYS n 
1 44  GLY n 
1 45  ARG n 
1 46  ASP n 
1 47  ILE n 
1 48  TYR n 
1 49  THR n 
1 50  PHE n 
1 51  ASP n 
1 52  GLY n 
1 53  ALA n 
1 54  LEU n 
1 55  ASN n 
1 56  LYS n 
1 57  SER n 
1 58  THR n 
1 59  VAL n 
1 60  PRO n 
1 61  THR n 
1 62  ASP n 
1 63  PHE n 
1 64  SER n 
1 65  SER n 
1 66  ALA n 
1 67  LYS n 
1 68  ILE n 
1 69  GLU n 
1 70  VAL n 
1 71  SER n 
1 72  GLN n 
1 73  LEU n 
1 74  LEU n 
1 75  LYS n 
1 76  GLY n 
1 77  ASP n 
1 78  ALA n 
1 79  SER n 
1 80  LEU n 
1 81  LYS n 
1 82  MET n 
1 83  ASP n 
1 84  LYS n 
1 85  SER n 
1 86  ASP n 
1 87  ALA n 
1 88  VAL n 
1 89  SER n 
1 90  HIS n 
1 91  THR n 
1 92  GLY n 
1 93  ASN n 
1 94  TYR n 
1 95  THR n 
1 96  CYS n 
1 97  GLU n 
1 98  VAL n 
1 99  THR n 
1 100 GLU n 
1 101 LEU n 
1 102 THR n 
1 103 ARG n 
1 104 GLU n 
1 105 GLY n 
1 106 GLU n 
1 107 THR n 
1 108 ILE n 
1 109 ILE n 
1 110 GLU n 
1 111 LEU n 
1 112 LYS n 
1 113 TYR n 
1 114 ARG n 
1 115 VAL n 
1 116 VAL n 
1 117 SER n 
1 118 TRP n 
1 119 SER n 
1 120 THR n 
1 121 ARG n 
1 122 HIS n 
1 123 HIS n 
1 124 HIS n 
1 125 HIS n 
1 126 HIS n 
1 127 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'CRICETULUS GRISEUS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     10029 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              LEC3.2.8.1 
_entity_src_gen.pdbx_host_org_cell_line            CHO 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PEE14 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP CD47_HUMAN 1 ? ? Q08722 ? 
2 PDB 2VSC       1 ? ? 2VSC   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2VSC A 1   ? 118 ? Q08722 19  ? 136 ? 1   118 
2 2 2VSC A 119 ? 127 ? 2VSC   119 ? 127 ? 119 127 
3 1 2VSC B 1   ? 118 ? Q08722 19  ? 136 ? 1   118 
4 2 2VSC B 119 ? 127 ? 2VSC   119 ? 127 ? 119 127 
5 1 2VSC C 1   ? 118 ? Q08722 19  ? 136 ? 1   118 
6 2 2VSC C 119 ? 127 ? 2VSC   119 ? 127 ? 119 127 
7 1 2VSC D 1   ? 118 ? Q08722 19  ? 136 ? 1   118 
8 2 2VSC D 119 ? 127 ? 2VSC   119 ? 127 ? 119 127 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2VSC GLY A 15 ? UNP Q08722 CYS 33 'engineered mutation' 15 1 
3 2VSC GLY B 15 ? UNP Q08722 CYS 33 'engineered mutation' 15 2 
5 2VSC GLY C 15 ? UNP Q08722 CYS 33 'engineered mutation' 15 3 
7 2VSC GLY D 15 ? UNP Q08722 CYS 33 'engineered mutation' 15 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer                  . 'MAGNESIUM ION'                          ? 'Mg 2'           24.305  
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PCA 'L-peptide linking'          n 'PYROGLUTAMIC ACID'                      ? 'C5 H7 N O3'     129.114 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2VSC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.6 
_exptl_crystal.density_percent_sol   52.5 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;200 NL 17 MG/ML CD47 PLUS 100 NL RESERVOIR (0.2 M MGCL2, 0.1 M BIS-TRIS PH 5.5, 25% W/V PEG 3350) EQUILIBRATED AGAINST 95 UL OF RESERVOIR AT 20.5 C.
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2006-04-12 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111) MONOCHROMATOR' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.978 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE BM14' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   BM14 
_diffrn_source.pdbx_wavelength             0.978 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2VSC 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             28.30 
_reflns.d_resolution_high            1.90 
_reflns.number_obs                   41496 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.8 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.90 
_reflns.B_iso_Wilson_estimate        24.90 
_reflns.pdbx_redundancy              3.7 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              2.00 
_reflns_shell.percent_possible_all   91.8 
_reflns_shell.Rmerge_I_obs           0.40 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.90 
_reflns_shell.pdbx_redundancy        3.1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2VSC 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     39392 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             28.19 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    98.6 
_refine.ls_R_factor_obs                          0.219 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.216 
_refine.ls_R_factor_R_free                       0.263 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  2100 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.938 
_refine.correlation_coeff_Fo_to_Fc_free          0.909 
_refine.B_iso_mean                               25.59 
_refine.aniso_B[1][1]                            0.07000 
_refine.aniso_B[2][2]                            -0.76000 
_refine.aniso_B[3][3]                            0.74000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.15000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. B VALUES INCLUDE TLS CONTRIBUTIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2JJS, CHAIN C' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.180 
_refine.pdbx_overall_ESU_R_Free                  0.166 
_refine.overall_SU_ML                            0.135 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             8.331 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3647 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         170 
_refine_hist.number_atoms_solvent             353 
_refine_hist.number_atoms_total               4170 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        28.19 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.010  0.022  ? 3916 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.004  0.020  ? 2605 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.367  2.017  ? 5333 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.847  3.003  ? 6313 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.621  5.000  ? 459  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.938 25.155 ? 161  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.381 15.000 ? 676  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       14.853 15.000 ? 13   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.080  0.200  ? 651  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 4355 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 734  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.181  0.200  ? 615  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.196  0.200  ? 2624 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.176  0.200  ? 1845 'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.108  0.200  ? 2087 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.150  0.200  ? 303  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.136  0.200  ? 19   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.200  0.200  ? 41   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.176  0.200  ? 10   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.621  1.500  ? 2978 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.769  2.000  ? 3747 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.411  3.000  ? 1903 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.133  4.500  ? 1579 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.90 
_refine_ls_shell.d_res_low                        1.95 
_refine_ls_shell.number_reflns_R_work             2484 
_refine_ls_shell.R_factor_R_work                  0.2490 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3530 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             139 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2VSC 
_struct.title                     'Structure of the immunoglobulin-superfamily ectodomain of human CD47' 
_struct.pdbx_descriptor           'LEUKOCYTE SURFACE ANTIGEN CD47' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2VSC 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            
;IMMUNOGLOBULIN DOMAIN, SIGNAL REGULATORY PROTEIN, CD47, MEMBRANE, GLYCOPROTEIN, CELL ADHESION, IMMUNOGLOBULIN SUPERFAMILY, PYRROLIDONE CARBOXYLIC ACID, TRANSMEMBRANE, PAIRED RECEPTOR, ALTERNATIVE SPLICING
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 2 ? 
K N N 2 ? 
L N N 2 ? 
M N N 2 ? 
N N N 2 ? 
O N N 2 ? 
P N N 3 ? 
Q N N 2 ? 
R N N 2 ? 
S N N 4 ? 
T N N 4 ? 
U N N 4 ? 
V N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 VAL A 70 ? LYS A 75 ? VAL A 70 LYS A 75 5 ? 6 
HELX_P HELX_P2 2 LYS A 84 ? VAL A 88 ? LYS A 84 VAL A 88 1 ? 5 
HELX_P HELX_P3 3 VAL B 70 ? LYS B 75 ? VAL B 70 LYS B 75 5 ? 6 
HELX_P HELX_P4 4 LYS B 84 ? VAL B 88 ? LYS B 84 VAL B 88 1 ? 5 
HELX_P HELX_P5 5 VAL C 70 ? LYS C 75 ? VAL C 70 LYS C 75 5 ? 6 
HELX_P HELX_P6 6 LYS C 84 ? VAL C 88 ? LYS C 84 VAL C 88 1 ? 5 
HELX_P HELX_P7 7 VAL D 70 ? LYS D 75 ? VAL D 70 LYS D 75 5 ? 6 
HELX_P HELX_P8 8 LYS D 84 ? VAL D 88 ? LYS D 84 VAL D 88 1 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 23 SG  ? ? ? 1_555 A CYS 96 SG ? ? A CYS 23   A CYS 96   1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf2  disulf ?    ? B CYS 23 SG  ? ? ? 1_555 B CYS 96 SG ? ? B CYS 23   B CYS 96   1_555 ? ? ? ? ? ? ? 2.050 ? ?               
disulf3  disulf ?    ? C CYS 23 SG  ? ? ? 1_555 C CYS 96 SG ? ? C CYS 23   C CYS 96   1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf4  disulf ?    ? D CYS 23 SG  ? ? ? 1_555 D CYS 96 SG ? ? D CYS 23   D CYS 96   1_555 ? ? ? ? ? ? ? 2.042 ? ?               
covale1  covale both ? A PCA 1  C   ? ? ? 1_555 A LEU 2  N  ? ? A PCA 1    A LEU 2    1_555 ? ? ? ? ? ? ? 1.338 ? ?               
covale2  covale one  ? A ASN 16 ND2 ? ? ? 1_555 E NAG .  C1 ? ? A ASN 16   A NAG 1116 1_555 ? ? ? ? ? ? ? 1.447 ? N-Glycosylation 
covale3  covale one  ? A ASN 32 ND2 ? ? ? 1_555 F NAG .  C1 ? ? A ASN 32   A NAG 1117 1_555 ? ? ? ? ? ? ? 1.446 ? N-Glycosylation 
covale4  covale one  ? A ASN 55 ND2 ? ? ? 1_555 G NAG .  C1 ? ? A ASN 55   A NAG 1118 1_555 ? ? ? ? ? ? ? 1.442 ? N-Glycosylation 
covale5  covale one  ? A ASN 93 ND2 ? ? ? 1_555 H NAG .  C1 ? ? A ASN 93   A NAG 1119 1_555 ? ? ? ? ? ? ? 1.457 ? N-Glycosylation 
covale6  covale both ? B PCA 1  C   ? ? ? 1_555 B LEU 2  N  ? ? B PCA 1    B LEU 2    1_555 ? ? ? ? ? ? ? 1.332 ? ?               
covale7  covale one  ? B ASN 16 ND2 ? ? ? 1_555 J NAG .  C1 ? ? B ASN 16   B NAG 1116 1_555 ? ? ? ? ? ? ? 1.460 ? N-Glycosylation 
covale8  covale one  ? B ASN 93 ND2 ? ? ? 1_555 K NAG .  C1 ? ? B ASN 93   B NAG 1117 1_555 ? ? ? ? ? ? ? 1.442 ? N-Glycosylation 
covale9  covale both ? C PCA 1  C   ? ? ? 1_555 C LEU 2  N  ? ? C PCA 1    C LEU 2    1_555 ? ? ? ? ? ? ? 1.328 ? ?               
covale10 covale one  ? C ASN 16 ND2 ? ? ? 1_555 L NAG .  C1 ? ? C ASN 16   C NAG 1116 1_555 ? ? ? ? ? ? ? 1.443 ? N-Glycosylation 
covale11 covale one  ? C ASN 32 ND2 ? ? ? 1_555 M NAG .  C1 ? ? C ASN 32   C NAG 1117 1_555 ? ? ? ? ? ? ? 1.433 ? N-Glycosylation 
covale12 covale one  ? C ASN 55 ND2 ? ? ? 1_555 N NAG .  C1 ? ? C ASN 55   C NAG 1118 1_555 ? ? ? ? ? ? ? 1.434 ? N-Glycosylation 
covale13 covale one  ? C ASN 93 ND2 ? ? ? 1_555 O NAG .  C1 ? ? C ASN 93   C NAG 1119 1_555 ? ? ? ? ? ? ? 1.450 ? N-Glycosylation 
covale14 covale both ? D PCA 1  C   ? ? ? 1_555 D LEU 2  N  ? ? D PCA 1    D LEU 2    1_555 ? ? ? ? ? ? ? 1.331 ? ?               
covale15 covale one  ? D ASN 16 ND2 ? ? ? 1_555 Q NAG .  C1 ? ? D ASN 16   D NAG 1117 1_555 ? ? ? ? ? ? ? 1.447 ? N-Glycosylation 
covale16 covale one  ? D ASN 32 ND2 ? ? ? 1_555 R NAG .  C1 ? ? D ASN 32   D NAG 1118 1_555 ? ? ? ? ? ? ? 1.460 ? N-Glycosylation 
metalc1  metalc ?    ? I MG  .  MG  ? ? ? 1_555 S HOH .  O  ? ? A MG  1120 A HOH 2077 1_555 ? ? ? ? ? ? ? 2.162 ? ?               
metalc2  metalc ?    ? I MG  .  MG  ? ? ? 1_555 S HOH .  O  ? ? A MG  1120 A HOH 2078 1_555 ? ? ? ? ? ? ? 2.151 ? ?               
metalc3  metalc ?    ? I MG  .  MG  ? ? ? 1_555 S HOH .  O  ? ? A MG  1120 A HOH 2079 1_555 ? ? ? ? ? ? ? 2.172 ? ?               
metalc4  metalc ?    ? I MG  .  MG  ? ? ? 1_555 S HOH .  O  ? ? A MG  1120 A HOH 2080 1_555 ? ? ? ? ? ? ? 2.191 ? ?               
metalc5  metalc ?    ? I MG  .  MG  ? ? ? 1_555 S HOH .  O  ? ? A MG  1120 A HOH 2081 1_555 ? ? ? ? ? ? ? 2.183 ? ?               
metalc6  metalc ?    ? I MG  .  MG  ? ? ? 1_555 S HOH .  O  ? ? A MG  1120 A HOH 2082 1_555 ? ? ? ? ? ? ? 2.167 ? ?               
metalc7  metalc ?    ? P MG  .  MG  ? ? ? 1_555 U HOH .  O  ? ? C MG  1120 C HOH 2119 1_555 ? ? ? ? ? ? ? 2.160 ? ?               
metalc8  metalc ?    ? P MG  .  MG  ? ? ? 1_555 U HOH .  O  ? ? C MG  1120 C HOH 2120 1_555 ? ? ? ? ? ? ? 2.179 ? ?               
metalc9  metalc ?    ? P MG  .  MG  ? ? ? 1_555 U HOH .  O  ? ? C MG  1120 C HOH 2121 1_555 ? ? ? ? ? ? ? 2.183 ? ?               
metalc10 metalc ?    ? P MG  .  MG  ? ? ? 1_555 U HOH .  O  ? ? C MG  1120 C HOH 2122 1_555 ? ? ? ? ? ? ? 2.178 ? ?               
metalc11 metalc ?    ? P MG  .  MG  ? ? ? 1_555 U HOH .  O  ? ? C MG  1120 C HOH 2123 1_555 ? ? ? ? ? ? ? 2.183 ? ?               
metalc12 metalc ?    ? P MG  .  MG  ? ? ? 1_555 U HOH .  O  ? ? C MG  1120 C HOH 2124 1_555 ? ? ? ? ? ? ? 2.187 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 6  ? 
AB ? 2  ? 
BA ? 12 ? 
BB ? 2  ? 
BC ? 2  ? 
CA ? 2  ? 
DA ? 6  ? 
DB ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? parallel      
AA 2  3  ? anti-parallel 
AA 3  4  ? anti-parallel 
AA 4  5  ? anti-parallel 
AA 5  6  ? anti-parallel 
AB 1  2  ? anti-parallel 
BA 1  2  ? parallel      
BA 2  3  ? anti-parallel 
BA 3  4  ? anti-parallel 
BA 4  5  ? anti-parallel 
BA 5  6  ? anti-parallel 
BA 6  7  ? anti-parallel 
BA 7  8  ? anti-parallel 
BA 8  9  ? anti-parallel 
BA 9  10 ? anti-parallel 
BA 10 11 ? anti-parallel 
BA 11 12 ? parallel      
BB 1  2  ? anti-parallel 
BC 1  2  ? anti-parallel 
CA 1  2  ? anti-parallel 
DA 1  2  ? parallel      
DA 2  3  ? anti-parallel 
DA 3  4  ? anti-parallel 
DA 4  5  ? anti-parallel 
DA 5  6  ? anti-parallel 
DB 1  2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  SER A 9   ? PHE A 12  ? SER A 9   PHE A 12  
AA 2  ARG B 103 ? TYR B 113 ? ARG B 103 TYR B 113 
AA 3  GLY A 92  ? GLU A 100 ? GLY A 92  GLU A 100 
AA 4  VAL A 36  ? PHE A 42  ? VAL A 36  PHE A 42  
AA 5  ARG A 45  ? ASP A 51  ? ARG A 45  ASP A 51  
AA 6  LYS A 56  ? THR A 58  ? LYS A 56  THR A 58  
AB 1  THR A 18  ? ILE A 21  ? THR A 18  ILE A 21  
AB 2  LEU A 80  ? ASP A 83  ? LEU A 80  ASP A 83  
BA 1  SER B 9   ? PHE B 12  ? SER B 9   PHE B 12  
BA 2  ARG A 103 ? TYR A 113 ? ARG A 103 TYR A 113 
BA 3  GLY B 92  ? GLU B 100 ? GLY B 92  GLU B 100 
BA 4  VAL B 36  ? PHE B 42  ? VAL B 36  PHE B 42  
BA 5  ARG B 45  ? ASP B 51  ? ARG B 45  ASP B 51  
BA 6  LYS B 56  ? PRO B 60  ? LYS B 56  PRO B 60  
BA 7  LYS C 56  ? PRO C 60  ? LYS C 56  PRO C 60  
BA 8  ARG C 45  ? ASP C 51  ? ARG C 45  ASP C 51  
BA 9  VAL C 36  ? PHE C 42  ? VAL C 36  PHE C 42  
BA 10 GLY C 92  ? GLU C 100 ? GLY C 92  GLU C 100 
BA 11 ARG D 103 ? TYR D 113 ? ARG D 103 TYR D 113 
BA 12 SER C 9   ? PHE C 12  ? SER C 9   PHE C 12  
BB 1  PHE B 4   ? ASN B 5   ? PHE B 4   ASN B 5   
BB 2  PHE B 24  ? VAL B 25  ? PHE B 24  VAL B 25  
BC 1  THR B 18  ? ILE B 21  ? THR B 18  ILE B 21  
BC 2  LEU B 80  ? ASP B 83  ? LEU B 80  ASP B 83  
CA 1  THR C 18  ? ILE C 21  ? THR C 18  ILE C 21  
CA 2  LEU C 80  ? ASP C 83  ? LEU C 80  ASP C 83  
DA 1  SER D 9   ? PHE D 12  ? SER D 9   PHE D 12  
DA 2  ARG C 103 ? TYR C 113 ? ARG C 103 TYR C 113 
DA 3  GLY D 92  ? GLU D 100 ? GLY D 92  GLU D 100 
DA 4  VAL D 36  ? PHE D 42  ? VAL D 36  PHE D 42  
DA 5  ARG D 45  ? ASP D 51  ? ARG D 45  ASP D 51  
DA 6  LYS D 56  ? THR D 58  ? LYS D 56  THR D 58  
DB 1  THR D 18  ? ILE D 21  ? THR D 18  ILE D 21  
DB 2  LEU D 80  ? ASP D 83  ? LEU D 80  ASP D 83  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N VAL A 10  ? N VAL A 10  O GLU B 110 ? O GLU B 110 
AA 2  3  N LEU B 111 ? N LEU B 111 O GLY A 92  ? O GLY A 92  
AA 3  4  N THR A 99  ? N THR A 99  O TYR A 37  ? O TYR A 37  
AA 4  5  N PHE A 42  ? N PHE A 42  O ARG A 45  ? O ARG A 45  
AA 5  6  N ASP A 51  ? N ASP A 51  O LYS A 56  ? O LYS A 56  
AB 1  2  N ILE A 21  ? N ILE A 21  O LEU A 80  ? O LEU A 80  
BA 1  2  N VAL B 10  ? N VAL B 10  O GLU A 110 ? O GLU A 110 
BA 2  3  N LEU A 111 ? N LEU A 111 O GLY B 92  ? O GLY B 92  
BA 3  4  N THR B 99  ? N THR B 99  O TYR B 37  ? O TYR B 37  
BA 4  5  N PHE B 42  ? N PHE B 42  O ARG B 45  ? O ARG B 45  
BA 5  6  N ASP B 51  ? N ASP B 51  O LYS B 56  ? O LYS B 56  
BA 6  7  N VAL B 59  ? N VAL B 59  O SER C 57  ? O SER C 57  
BA 7  8  N THR C 58  ? N THR C 58  O THR C 49  ? O THR C 49  
BA 8  9  N PHE C 50  ? N PHE C 50  O VAL C 38  ? O VAL C 38  
BA 9  10 N LYS C 41  ? N LYS C 41  O THR C 95  ? O THR C 95  
BA 10 11 N GLU C 100 ? N GLU C 100 O ARG D 103 ? O ARG D 103 
BA 11 12 N LYS D 112 ? N LYS D 112 O VAL C 10  ? O VAL C 10  
BB 1  2  N ASN B 5   ? N ASN B 5   O PHE B 24  ? O PHE B 24  
BC 1  2  N ILE B 21  ? N ILE B 21  O LEU B 80  ? O LEU B 80  
CA 1  2  N ILE C 21  ? N ILE C 21  O LEU C 80  ? O LEU C 80  
DA 1  2  N VAL D 10  ? N VAL D 10  O GLU C 110 ? O GLU C 110 
DA 2  3  N LEU C 111 ? N LEU C 111 O GLY D 92  ? O GLY D 92  
DA 3  4  N THR D 99  ? N THR D 99  O TYR D 37  ? O TYR D 37  
DA 4  5  N PHE D 42  ? N PHE D 42  O ARG D 45  ? O ARG D 45  
DA 5  6  N ASP D 51  ? N ASP D 51  O LYS D 56  ? O LYS D 56  
DB 1  2  N ILE D 21  ? N ILE D 21  O LEU D 80  ? O LEU D 80  
# 
_database_PDB_matrix.entry_id          2VSC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2VSC 
_atom_sites.fract_transf_matrix[1][1]   0.004972 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000815 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021052 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017837 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1    N  N   . PCA A 1 1   ? 17.722  -24.467 17.105  1.00 24.87  ? 1    PCA A N   1 
HETATM 2    C  CA  . PCA A 1 1   ? 19.059  -25.066 17.091  1.00 24.85  ? 1    PCA A CA  1 
HETATM 3    C  CB  . PCA A 1 1   ? 20.023  -24.214 17.924  1.00 25.85  ? 1    PCA A CB  1 
HETATM 4    C  CG  . PCA A 1 1   ? 19.279  -22.940 18.311  1.00 26.77  ? 1    PCA A CG  1 
HETATM 5    C  CD  . PCA A 1 1   ? 17.861  -23.242 17.882  1.00 25.69  ? 1    PCA A CD  1 
HETATM 6    O  OE  . PCA A 1 1   ? 16.894  -22.518 18.153  1.00 25.09  ? 1    PCA A OE  1 
HETATM 7    C  C   . PCA A 1 1   ? 19.037  -26.521 17.560  1.00 22.83  ? 1    PCA A C   1 
HETATM 8    O  O   . PCA A 1 1   ? 20.082  -27.178 17.550  1.00 22.25  ? 1    PCA A O   1 
ATOM   9    N  N   . LEU A 1 2   ? 17.871  -27.044 17.955  1.00 21.15  ? 2    LEU A N   1 
ATOM   10   C  CA  . LEU A 1 2   ? 17.808  -28.435 18.348  1.00 20.27  ? 2    LEU A CA  1 
ATOM   11   C  C   . LEU A 1 2   ? 17.934  -29.368 17.133  1.00 21.57  ? 2    LEU A C   1 
ATOM   12   O  O   . LEU A 1 2   ? 17.370  -29.112 16.058  1.00 21.72  ? 2    LEU A O   1 
ATOM   13   C  CB  . LEU A 1 2   ? 16.549  -28.764 19.143  1.00 19.08  ? 2    LEU A CB  1 
ATOM   14   C  CG  . LEU A 1 2   ? 16.294  -28.025 20.471  1.00 18.51  ? 2    LEU A CG  1 
ATOM   15   C  CD1 . LEU A 1 2   ? 14.985  -28.525 21.043  1.00 18.39  ? 2    LEU A CD1 1 
ATOM   16   C  CD2 . LEU A 1 2   ? 17.451  -28.227 21.483  1.00 17.35  ? 2    LEU A CD2 1 
ATOM   17   N  N   . LEU A 1 3   ? 18.692  -30.441 17.318  1.00 21.15  ? 3    LEU A N   1 
ATOM   18   C  CA  . LEU A 1 3   ? 18.994  -31.376 16.246  1.00 23.20  ? 3    LEU A CA  1 
ATOM   19   C  C   . LEU A 1 3   ? 18.313  -32.702 16.533  1.00 22.57  ? 3    LEU A C   1 
ATOM   20   O  O   . LEU A 1 3   ? 18.096  -33.058 17.693  1.00 21.46  ? 3    LEU A O   1 
ATOM   21   C  CB  . LEU A 1 3   ? 20.516  -31.566 16.118  1.00 24.56  ? 3    LEU A CB  1 
ATOM   22   C  CG  . LEU A 1 3   ? 21.287  -30.310 15.690  1.00 25.02  ? 3    LEU A CG  1 
ATOM   23   C  CD1 . LEU A 1 3   ? 22.780  -30.516 15.801  1.00 25.98  ? 3    LEU A CD1 1 
ATOM   24   C  CD2 . LEU A 1 3   ? 20.885  -29.890 14.270  1.00 27.45  ? 3    LEU A CD2 1 
ATOM   25   N  N   . PHE A 1 4   ? 17.961  -33.418 15.473  1.00 23.97  ? 4    PHE A N   1 
ATOM   26   C  CA  . PHE A 1 4   ? 17.247  -34.692 15.595  1.00 24.95  ? 4    PHE A CA  1 
ATOM   27   C  C   . PHE A 1 4   ? 17.970  -35.863 14.938  1.00 27.23  ? 4    PHE A C   1 
ATOM   28   O  O   . PHE A 1 4   ? 18.630  -35.712 13.911  1.00 28.44  ? 4    PHE A O   1 
ATOM   29   C  CB  . PHE A 1 4   ? 15.826  -34.553 15.009  1.00 24.49  ? 4    PHE A CB  1 
ATOM   30   C  CG  . PHE A 1 4   ? 14.962  -33.583 15.769  1.00 23.26  ? 4    PHE A CG  1 
ATOM   31   C  CD1 . PHE A 1 4   ? 13.996  -34.034 16.652  1.00 22.22  ? 4    PHE A CD1 1 
ATOM   32   C  CD2 . PHE A 1 4   ? 15.137  -32.206 15.621  1.00 25.22  ? 4    PHE A CD2 1 
ATOM   33   C  CE1 . PHE A 1 4   ? 13.204  -33.128 17.376  1.00 22.35  ? 4    PHE A CE1 1 
ATOM   34   C  CE2 . PHE A 1 4   ? 14.355  -31.305 16.342  1.00 22.73  ? 4    PHE A CE2 1 
ATOM   35   C  CZ  . PHE A 1 4   ? 13.388  -31.768 17.214  1.00 21.96  ? 4    PHE A CZ  1 
ATOM   36   N  N   . ASN A 1 5   ? 17.825  -37.023 15.575  1.00 28.43  ? 5    ASN A N   1 
ATOM   37   C  CA  . ASN A 1 5   ? 18.079  -38.335 14.985  1.00 30.96  ? 5    ASN A CA  1 
ATOM   38   C  C   . ASN A 1 5   ? 16.827  -38.737 14.189  1.00 31.61  ? 5    ASN A C   1 
ATOM   39   O  O   . ASN A 1 5   ? 15.829  -39.241 14.740  1.00 29.95  ? 5    ASN A O   1 
ATOM   40   C  CB  . ASN A 1 5   ? 18.403  -39.327 16.110  1.00 31.83  ? 5    ASN A CB  1 
ATOM   41   C  CG  . ASN A 1 5   ? 18.537  -40.760 15.642  1.00 34.76  ? 5    ASN A CG  1 
ATOM   42   O  OD1 . ASN A 1 5   ? 18.926  -41.050 14.505  1.00 37.46  ? 5    ASN A OD1 1 
ATOM   43   N  ND2 . ASN A 1 5   ? 18.233  -41.678 16.546  1.00 39.05  ? 5    ASN A ND2 1 
ATOM   44   N  N   . LYS A 1 6   ? 16.883  -38.499 12.885  1.00 33.07  ? 6    LYS A N   1 
ATOM   45   C  CA  . LYS A 1 6   ? 15.675  -38.502 12.070  1.00 33.87  ? 6    LYS A CA  1 
ATOM   46   C  C   . LYS A 1 6   ? 15.335  -39.862 11.486  1.00 35.58  ? 6    LYS A C   1 
ATOM   47   O  O   . LYS A 1 6   ? 16.201  -40.716 11.296  1.00 37.28  ? 6    LYS A O   1 
ATOM   48   C  CB  . LYS A 1 6   ? 15.787  -37.466 10.957  1.00 35.23  ? 6    LYS A CB  1 
ATOM   49   C  CG  . LYS A 1 6   ? 15.976  -36.064 11.494  1.00 33.48  ? 6    LYS A CG  1 
ATOM   50   C  CD  . LYS A 1 6   ? 16.054  -35.058 10.374  1.00 35.98  ? 6    LYS A CD  1 
ATOM   51   C  CE  . LYS A 1 6   ? 16.172  -33.650 10.933  1.00 35.36  ? 6    LYS A CE  1 
ATOM   52   N  NZ  . LYS A 1 6   ? 14.921  -33.202 11.574  1.00 31.84  ? 6    LYS A NZ  1 
ATOM   53   N  N   . THR A 1 7   ? 14.038  -40.026 11.243  1.00 35.82  ? 7    THR A N   1 
ATOM   54   C  CA  . THR A 1 7   ? 13.447  -41.214 10.649  1.00 38.01  ? 7    THR A CA  1 
ATOM   55   C  C   . THR A 1 7   ? 12.373  -40.736 9.666   1.00 38.21  ? 7    THR A C   1 
ATOM   56   O  O   . THR A 1 7   ? 11.435  -40.047 10.063  1.00 35.31  ? 7    THR A O   1 
ATOM   57   C  CB  . THR A 1 7   ? 12.792  -42.103 11.739  1.00 37.70  ? 7    THR A CB  1 
ATOM   58   O  OG1 . THR A 1 7   ? 13.816  -42.678 12.568  1.00 39.76  ? 7    THR A OG1 1 
ATOM   59   C  CG2 . THR A 1 7   ? 11.983  -43.218 11.114  1.00 39.13  ? 7    THR A CG2 1 
ATOM   60   N  N   . LYS A 1 8   ? 12.509  -41.093 8.390   1.00 40.87  ? 8    LYS A N   1 
ATOM   61   C  CA  . LYS A 1 8   ? 11.593  -40.591 7.361   1.00 41.92  ? 8    LYS A CA  1 
ATOM   62   C  C   . LYS A 1 8   ? 10.164  -41.076 7.608   1.00 41.02  ? 8    LYS A C   1 
ATOM   63   O  O   . LYS A 1 8   ? 9.207   -40.311 7.464   1.00 39.53  ? 8    LYS A O   1 
ATOM   64   C  CB  . LYS A 1 8   ? 12.053  -40.992 5.950   1.00 46.28  ? 8    LYS A CB  1 
ATOM   65   C  CG  . LYS A 1 8   ? 11.017  -40.687 4.872   1.00 48.58  ? 8    LYS A CG  1 
ATOM   66   C  CD  . LYS A 1 8   ? 11.613  -40.535 3.501   1.00 52.71  ? 8    LYS A CD  1 
ATOM   67   C  CE  . LYS A 1 8   ? 10.528  -40.562 2.430   1.00 56.28  ? 8    LYS A CE  1 
ATOM   68   N  NZ  . LYS A 1 8   ? 11.097  -40.641 1.052   1.00 62.16  ? 8    LYS A NZ  1 
ATOM   69   N  N   . SER A 1 9   ? 10.037  -42.345 7.986   1.00 41.59  ? 9    SER A N   1 
ATOM   70   C  CA  . SER A 1 9   ? 8.731   -42.951 8.212   1.00 41.48  ? 9    SER A CA  1 
ATOM   71   C  C   . SER A 1 9   ? 8.829   -44.218 9.051   1.00 41.75  ? 9    SER A C   1 
ATOM   72   O  O   . SER A 1 9   ? 9.891   -44.850 9.145   1.00 43.28  ? 9    SER A O   1 
ATOM   73   C  CB  . SER A 1 9   ? 8.039   -43.257 6.873   1.00 44.84  ? 9    SER A CB  1 
ATOM   74   O  OG  . SER A 1 9   ? 8.750   -44.226 6.109   1.00 48.40  ? 9    SER A OG  1 
ATOM   75   N  N   . VAL A 1 10  ? 7.701   -44.574 9.654   1.00 40.59  ? 10   VAL A N   1 
ATOM   76   C  CA  . VAL A 1 10  ? 7.576   -45.759 10.482  1.00 41.33  ? 10   VAL A CA  1 
ATOM   77   C  C   . VAL A 1 10  ? 6.299   -46.471 10.049  1.00 43.39  ? 10   VAL A C   1 
ATOM   78   O  O   . VAL A 1 10  ? 5.305   -45.829 9.703   1.00 42.46  ? 10   VAL A O   1 
ATOM   79   C  CB  . VAL A 1 10  ? 7.500   -45.429 11.986  1.00 38.40  ? 10   VAL A CB  1 
ATOM   80   C  CG1 . VAL A 1 10  ? 8.849   -44.911 12.502  1.00 37.26  ? 10   VAL A CG1 1 
ATOM   81   C  CG2 . VAL A 1 10  ? 6.399   -44.418 12.257  1.00 35.13  ? 10   VAL A CG2 1 
ATOM   82   N  N   . GLU A 1 11  ? 6.344   -47.796 10.082  1.00 46.31  ? 11   GLU A N   1 
ATOM   83   C  CA  . GLU A 1 11  ? 5.281   -48.635 9.563   1.00 49.38  ? 11   GLU A CA  1 
ATOM   84   C  C   . GLU A 1 11  ? 4.578   -49.305 10.733  1.00 49.29  ? 11   GLU A C   1 
ATOM   85   O  O   . GLU A 1 11  ? 5.209   -49.594 11.749  1.00 48.57  ? 11   GLU A O   1 
ATOM   86   C  CB  . GLU A 1 11  ? 5.924   -49.694 8.668   1.00 53.78  ? 11   GLU A CB  1 
ATOM   87   C  CG  . GLU A 1 11  ? 4.999   -50.536 7.832   1.00 57.62  ? 11   GLU A CG  1 
ATOM   88   C  CD  . GLU A 1 11  ? 5.784   -51.549 7.035   1.00 62.73  ? 11   GLU A CD  1 
ATOM   89   O  OE1 . GLU A 1 11  ? 5.635   -52.755 7.297   1.00 66.90  ? 11   GLU A OE1 1 
ATOM   90   O  OE2 . GLU A 1 11  ? 6.593   -51.133 6.178   1.00 65.46  ? 11   GLU A OE2 1 
ATOM   91   N  N   . PHE A 1 12  ? 3.273   -49.529 10.603  1.00 50.51  ? 12   PHE A N   1 
ATOM   92   C  CA  . PHE A 1 12  ? 2.560   -50.446 11.501  1.00 51.88  ? 12   PHE A CA  1 
ATOM   93   C  C   . PHE A 1 12  ? 1.548   -51.268 10.723  1.00 55.75  ? 12   PHE A C   1 
ATOM   94   O  O   . PHE A 1 12  ? 1.086   -50.857 9.654   1.00 56.70  ? 12   PHE A O   1 
ATOM   95   C  CB  . PHE A 1 12  ? 1.918   -49.719 12.702  1.00 48.33  ? 12   PHE A CB  1 
ATOM   96   C  CG  . PHE A 1 12  ? 0.687   -48.910 12.372  1.00 46.83  ? 12   PHE A CG  1 
ATOM   97   C  CD1 . PHE A 1 12  ? -0.549  -49.252 12.905  1.00 48.26  ? 12   PHE A CD1 1 
ATOM   98   C  CD2 . PHE A 1 12  ? 0.773   -47.767 11.583  1.00 45.92  ? 12   PHE A CD2 1 
ATOM   99   C  CE1 . PHE A 1 12  ? -1.690  -48.493 12.631  1.00 46.74  ? 12   PHE A CE1 1 
ATOM   100  C  CE2 . PHE A 1 12  ? -0.359  -47.007 11.299  1.00 45.10  ? 12   PHE A CE2 1 
ATOM   101  C  CZ  . PHE A 1 12  ? -1.596  -47.379 11.821  1.00 45.81  ? 12   PHE A CZ  1 
ATOM   102  N  N   . THR A 1 13  ? 1.242   -52.451 11.257  1.00 58.95  ? 13   THR A N   1 
ATOM   103  C  CA  . THR A 1 13  ? 0.313   -53.383 10.628  1.00 63.11  ? 13   THR A CA  1 
ATOM   104  C  C   . THR A 1 13  ? -0.869  -53.596 11.565  1.00 63.19  ? 13   THR A C   1 
ATOM   105  O  O   . THR A 1 13  ? -0.995  -52.890 12.563  1.00 59.82  ? 13   THR A O   1 
ATOM   106  C  CB  . THR A 1 13  ? 1.004   -54.735 10.341  1.00 67.77  ? 13   THR A CB  1 
ATOM   107  O  OG1 . THR A 1 13  ? 1.353   -55.380 11.592  1.00 68.73  ? 13   THR A OG1 1 
ATOM   108  C  CG2 . THR A 1 13  ? 2.273   -54.516 9.504   1.00 68.08  ? 13   THR A CG2 1 
ATOM   109  N  N   . PHE A 1 14  ? -1.744  -54.553 11.244  1.00 67.37  ? 14   PHE A N   1 
ATOM   110  C  CA  . PHE A 1 14  ? -2.883  -54.868 12.115  1.00 68.25  ? 14   PHE A CA  1 
ATOM   111  C  C   . PHE A 1 14  ? -2.449  -55.395 13.483  1.00 68.67  ? 14   PHE A C   1 
ATOM   112  O  O   . PHE A 1 14  ? -3.209  -55.297 14.453  1.00 68.24  ? 14   PHE A O   1 
ATOM   113  C  CB  . PHE A 1 14  ? -3.841  -55.874 11.448  1.00 72.72  ? 14   PHE A CB  1 
ATOM   114  C  CG  . PHE A 1 14  ? -3.244  -57.245 11.213  1.00 77.28  ? 14   PHE A CG  1 
ATOM   115  C  CD1 . PHE A 1 14  ? -3.318  -58.230 12.192  1.00 79.69  ? 14   PHE A CD1 1 
ATOM   116  C  CD2 . PHE A 1 14  ? -2.641  -57.560 9.998   1.00 79.60  ? 14   PHE A CD2 1 
ATOM   117  C  CE1 . PHE A 1 14  ? -2.789  -59.500 11.972  1.00 84.90  ? 14   PHE A CE1 1 
ATOM   118  C  CE2 . PHE A 1 14  ? -2.104  -58.822 9.772   1.00 84.76  ? 14   PHE A CE2 1 
ATOM   119  C  CZ  . PHE A 1 14  ? -2.178  -59.795 10.760  1.00 87.18  ? 14   PHE A CZ  1 
ATOM   120  N  N   . GLY A 1 15  ? -1.239  -55.959 13.544  1.00 70.41  ? 15   GLY A N   1 
ATOM   121  C  CA  . GLY A 1 15  ? -0.709  -56.559 14.764  1.00 71.65  ? 15   GLY A CA  1 
ATOM   122  C  C   . GLY A 1 15  ? -0.313  -55.571 15.845  1.00 67.77  ? 15   GLY A C   1 
ATOM   123  O  O   . GLY A 1 15  ? -0.246  -55.937 17.017  1.00 68.91  ? 15   GLY A O   1 
ATOM   124  N  N   . ASN A 1 16  ? -0.031  -54.328 15.461  1.00 64.05  ? 16   ASN A N   1 
ATOM   125  C  CA  . ASN A 1 16  ? 0.316   -53.292 16.428  1.00 60.18  ? 16   ASN A CA  1 
ATOM   126  C  C   . ASN A 1 16  ? -0.909  -52.874 17.238  1.00 59.66  ? 16   ASN A C   1 
ATOM   127  O  O   . ASN A 1 16  ? -1.856  -52.302 16.686  1.00 59.28  ? 16   ASN A O   1 
ATOM   128  C  CB  . ASN A 1 16  ? 0.923   -52.070 15.732  1.00 56.70  ? 16   ASN A CB  1 
ATOM   129  C  CG  . ASN A 1 16  ? 2.292   -52.354 15.139  1.00 57.16  ? 16   ASN A CG  1 
ATOM   130  O  OD1 . ASN A 1 16  ? 2.405   -53.087 14.163  1.00 58.48  ? 16   ASN A OD1 1 
ATOM   131  N  ND2 . ASN A 1 16  ? 3.340   -51.772 15.737  1.00 55.37  ? 16   ASN A ND2 1 
ATOM   132  N  N   . ASP A 1 17  ? -0.903  -53.187 18.535  1.00 60.35  ? 17   ASP A N   1 
ATOM   133  C  CA  . ASP A 1 17  ? -1.970  -52.748 19.440  1.00 59.20  ? 17   ASP A CA  1 
ATOM   134  C  C   . ASP A 1 17  ? -1.758  -51.286 19.808  1.00 54.62  ? 17   ASP A C   1 
ATOM   135  O  O   . ASP A 1 17  ? -2.710  -50.535 20.045  1.00 53.28  ? 17   ASP A O   1 
ATOM   136  C  CB  . ASP A 1 17  ? -2.028  -53.626 20.701  1.00 62.50  ? 17   ASP A CB  1 
ATOM   137  C  CG  . ASP A 1 17  ? -2.864  -54.882 20.503  1.00 67.58  ? 17   ASP A CG  1 
ATOM   138  O  OD1 . ASP A 1 17  ? -3.940  -54.801 19.865  1.00 68.67  ? 17   ASP A OD1 1 
ATOM   139  O  OD2 . ASP A 1 17  ? -2.455  -55.955 20.998  1.00 72.46  ? 17   ASP A OD2 1 
ATOM   140  N  N   . THR A 1 18  ? -0.497  -50.887 19.865  1.00 52.40  ? 18   THR A N   1 
ATOM   141  C  CA  . THR A 1 18  ? -0.160  -49.490 20.030  1.00 47.96  ? 18   THR A CA  1 
ATOM   142  C  C   . THR A 1 18  ? 0.899   -49.116 19.004  1.00 45.90  ? 18   THR A C   1 
ATOM   143  O  O   . THR A 1 18  ? 1.547   -49.981 18.400  1.00 48.43  ? 18   THR A O   1 
ATOM   144  C  CB  . THR A 1 18  ? 0.334   -49.177 21.449  1.00 47.53  ? 18   THR A CB  1 
ATOM   145  O  OG1 . THR A 1 18  ? 1.661   -49.686 21.619  1.00 50.43  ? 18   THR A OG1 1 
ATOM   146  C  CG2 . THR A 1 18  ? -0.595  -49.775 22.504  1.00 49.97  ? 18   THR A CG2 1 
ATOM   147  N  N   . VAL A 1 19  ? 1.046   -47.815 18.815  1.00 41.61  ? 19   VAL A N   1 
ATOM   148  C  CA  . VAL A 1 19  ? 1.865   -47.241 17.776  1.00 39.36  ? 19   VAL A CA  1 
ATOM   149  C  C   . VAL A 1 19  ? 2.832   -46.247 18.450  1.00 36.14  ? 19   VAL A C   1 
ATOM   150  O  O   . VAL A 1 19  ? 2.449   -45.543 19.389  1.00 33.38  ? 19   VAL A O   1 
ATOM   151  C  CB  . VAL A 1 19  ? 0.953   -46.531 16.740  1.00 38.28  ? 19   VAL A CB  1 
ATOM   152  C  CG1 . VAL A 1 19  ? 1.717   -45.539 15.898  1.00 36.74  ? 19   VAL A CG1 1 
ATOM   153  C  CG2 . VAL A 1 19  ? 0.253   -47.561 15.846  1.00 40.85  ? 19   VAL A CG2 1 
ATOM   154  N  N   . VAL A 1 20  ? 4.075   -46.226 17.970  1.00 35.48  ? 20   VAL A N   1 
ATOM   155  C  CA  . VAL A 1 20  ? 5.109   -45.310 18.443  1.00 33.20  ? 20   VAL A CA  1 
ATOM   156  C  C   . VAL A 1 20  ? 5.654   -44.509 17.241  1.00 31.88  ? 20   VAL A C   1 
ATOM   157  O  O   . VAL A 1 20  ? 6.048   -45.088 16.215  1.00 33.37  ? 20   VAL A O   1 
ATOM   158  C  CB  . VAL A 1 20  ? 6.262   -46.081 19.134  1.00 34.64  ? 20   VAL A CB  1 
ATOM   159  C  CG1 . VAL A 1 20  ? 7.433   -45.173 19.429  1.00 32.90  ? 20   VAL A CG1 1 
ATOM   160  C  CG2 . VAL A 1 20  ? 5.772   -46.763 20.403  1.00 36.36  ? 20   VAL A CG2 1 
ATOM   161  N  N   . ILE A 1 21  ? 5.635   -43.184 17.361  1.00 29.33  ? 21   ILE A N   1 
ATOM   162  C  CA  . ILE A 1 21  ? 6.201   -42.290 16.354  1.00 28.42  ? 21   ILE A CA  1 
ATOM   163  C  C   . ILE A 1 21  ? 7.445   -41.652 16.974  1.00 27.05  ? 21   ILE A C   1 
ATOM   164  O  O   . ILE A 1 21  ? 7.327   -40.882 17.920  1.00 24.59  ? 21   ILE A O   1 
ATOM   165  C  CB  . ILE A 1 21  ? 5.214   -41.168 15.931  1.00 27.33  ? 21   ILE A CB  1 
ATOM   166  C  CG1 . ILE A 1 21  ? 3.825   -41.745 15.621  1.00 28.70  ? 21   ILE A CG1 1 
ATOM   167  C  CG2 . ILE A 1 21  ? 5.770   -40.362 14.733  1.00 26.39  ? 21   ILE A CG2 1 
ATOM   168  C  CD1 . ILE A 1 21  ? 2.778   -40.677 15.353  1.00 28.11  ? 21   ILE A CD1 1 
ATOM   169  N  N   . PRO A 1 22  ? 8.637   -41.973 16.432  1.00 28.01  ? 22   PRO A N   1 
ATOM   170  C  CA  . PRO A 1 22  ? 9.887   -41.622 17.085  1.00 27.27  ? 22   PRO A CA  1 
ATOM   171  C  C   . PRO A 1 22  ? 10.198  -40.141 17.001  1.00 25.07  ? 22   PRO A C   1 
ATOM   172  O  O   . PRO A 1 22  ? 9.888   -39.469 16.011  1.00 24.21  ? 22   PRO A O   1 
ATOM   173  C  CB  . PRO A 1 22  ? 10.935  -42.432 16.305  1.00 29.19  ? 22   PRO A CB  1 
ATOM   174  C  CG  . PRO A 1 22  ? 10.383  -42.531 14.957  1.00 30.98  ? 22   PRO A CG  1 
ATOM   175  C  CD  . PRO A 1 22  ? 8.879   -42.666 15.152  1.00 30.87  ? 22   PRO A CD  1 
ATOM   176  N  N   . CYS A 1 23  ? 10.774  -39.627 18.070  1.00 24.61  ? 23   CYS A N   1 
ATOM   177  C  CA  . CYS A 1 23  ? 11.299  -38.291 18.053  1.00 23.44  ? 23   CYS A CA  1 
ATOM   178  C  C   . CYS A 1 23  ? 12.408  -38.219 19.076  1.00 23.62  ? 23   CYS A C   1 
ATOM   179  O  O   . CYS A 1 23  ? 12.177  -38.444 20.262  1.00 24.29  ? 23   CYS A O   1 
ATOM   180  C  CB  . CYS A 1 23  ? 10.202  -37.277 18.347  1.00 21.98  ? 23   CYS A CB  1 
ATOM   181  S  SG  . CYS A 1 23  ? 10.744  -35.553 18.225  1.00 21.38  ? 23   CYS A SG  1 
ATOM   182  N  N   . PHE A 1 24  ? 13.614  -37.925 18.586  1.00 23.44  ? 24   PHE A N   1 
ATOM   183  C  CA  . PHE A 1 24  ? 14.827  -37.964 19.379  1.00 23.82  ? 24   PHE A CA  1 
ATOM   184  C  C   . PHE A 1 24  ? 15.663  -36.747 19.057  1.00 22.93  ? 24   PHE A C   1 
ATOM   185  O  O   . PHE A 1 24  ? 16.171  -36.615 17.945  1.00 23.54  ? 24   PHE A O   1 
ATOM   186  C  CB  . PHE A 1 24  ? 15.624  -39.243 19.100  1.00 25.99  ? 24   PHE A CB  1 
ATOM   187  C  CG  . PHE A 1 24  ? 14.920  -40.494 19.556  1.00 27.77  ? 24   PHE A CG  1 
ATOM   188  C  CD1 . PHE A 1 24  ? 15.013  -40.919 20.876  1.00 28.56  ? 24   PHE A CD1 1 
ATOM   189  C  CD2 . PHE A 1 24  ? 14.144  -41.237 18.668  1.00 29.26  ? 24   PHE A CD2 1 
ATOM   190  C  CE1 . PHE A 1 24  ? 14.349  -42.057 21.299  1.00 30.51  ? 24   PHE A CE1 1 
ATOM   191  C  CE2 . PHE A 1 24  ? 13.485  -42.393 19.084  1.00 30.06  ? 24   PHE A CE2 1 
ATOM   192  C  CZ  . PHE A 1 24  ? 13.588  -42.802 20.398  1.00 30.26  ? 24   PHE A CZ  1 
ATOM   193  N  N   . VAL A 1 25  ? 15.757  -35.865 20.045  1.00 21.65  ? 25   VAL A N   1 
ATOM   194  C  CA  . VAL A 1 25  ? 16.655  -34.721 20.037  1.00 20.84  ? 25   VAL A CA  1 
ATOM   195  C  C   . VAL A 1 25  ? 18.009  -35.240 20.503  1.00 22.17  ? 25   VAL A C   1 
ATOM   196  O  O   . VAL A 1 25  ? 18.114  -35.884 21.549  1.00 21.80  ? 25   VAL A O   1 
ATOM   197  C  CB  . VAL A 1 25  ? 16.152  -33.586 20.962  1.00 19.70  ? 25   VAL A CB  1 
ATOM   198  C  CG1 . VAL A 1 25  ? 17.154  -32.388 21.015  1.00 18.50  ? 25   VAL A CG1 1 
ATOM   199  C  CG2 . VAL A 1 25  ? 14.760  -33.114 20.506  1.00 18.96  ? 25   VAL A CG2 1 
ATOM   200  N  N   . THR A 1 26  ? 19.029  -34.964 19.693  1.00 22.94  ? 26   THR A N   1 
ATOM   201  C  CA  . THR A 1 26  ? 20.399  -35.406 19.939  1.00 24.93  ? 26   THR A CA  1 
ATOM   202  C  C   . THR A 1 26  ? 21.254  -34.418 20.735  1.00 24.89  ? 26   THR A C   1 
ATOM   203  O  O   . THR A 1 26  ? 22.333  -34.790 21.178  1.00 27.01  ? 26   THR A O   1 
ATOM   204  C  CB  . THR A 1 26  ? 21.103  -35.660 18.606  1.00 26.71  ? 26   THR A CB  1 
ATOM   205  O  OG1 . THR A 1 26  ? 21.107  -34.439 17.851  1.00 25.12  ? 26   THR A OG1 1 
ATOM   206  C  CG2 . THR A 1 26  ? 20.357  -36.770 17.822  1.00 27.23  ? 26   THR A CG2 1 
ATOM   207  N  N   . ASN A 1 27  ? 20.788  -33.173 20.900  1.00 23.73  ? 27   ASN A N   1 
ATOM   208  C  CA  . ASN A 1 27  ? 21.553  -32.135 21.589  1.00 23.46  ? 27   ASN A CA  1 
ATOM   209  C  C   . ASN A 1 27  ? 20.773  -31.366 22.663  1.00 22.49  ? 27   ASN A C   1 
ATOM   210  O  O   . ASN A 1 27  ? 20.938  -30.149 22.796  1.00 23.11  ? 27   ASN A O   1 
ATOM   211  C  CB  . ASN A 1 27  ? 22.195  -31.162 20.577  1.00 24.24  ? 27   ASN A CB  1 
ATOM   212  C  CG  . ASN A 1 27  ? 21.166  -30.345 19.772  1.00 22.98  ? 27   ASN A CG  1 
ATOM   213  O  OD1 . ASN A 1 27  ? 19.990  -30.702 19.694  1.00 22.35  ? 27   ASN A OD1 1 
ATOM   214  N  ND2 . ASN A 1 27  ? 21.622  -29.245 19.168  1.00 22.91  ? 27   ASN A ND2 1 
ATOM   215  N  N   . MET A 1 28  ? 19.978  -32.079 23.462  1.00 21.51  ? 28   MET A N   1 
ATOM   216  C  CA  . MET A 1 28  ? 19.269  -31.478 24.591  1.00 21.64  ? 28   MET A CA  1 
ATOM   217  C  C   . MET A 1 28  ? 20.249  -30.962 25.622  1.00 22.19  ? 28   MET A C   1 
ATOM   218  O  O   . MET A 1 28  ? 21.346  -31.496 25.778  1.00 23.56  ? 28   MET A O   1 
ATOM   219  C  CB  . MET A 1 28  ? 18.378  -32.493 25.327  1.00 21.68  ? 28   MET A CB  1 
ATOM   220  C  CG  . MET A 1 28  ? 17.241  -33.043 24.543  1.00 23.33  ? 28   MET A CG  1 
ATOM   221  S  SD  . MET A 1 28  ? 15.892  -31.901 24.256  1.00 25.70  ? 28   MET A SD  1 
ATOM   222  C  CE  . MET A 1 28  ? 15.029  -31.923 25.820  1.00 25.76  ? 28   MET A CE  1 
ATOM   223  N  N   . GLU A 1 29  ? 19.837  -29.913 26.317  1.00 22.24  ? 29   GLU A N   1 
ATOM   224  C  CA  . GLU A 1 29  ? 20.600  -29.338 27.416  1.00 24.02  ? 29   GLU A CA  1 
ATOM   225  C  C   . GLU A 1 29  ? 19.811  -29.265 28.716  1.00 24.73  ? 29   GLU A C   1 
ATOM   226  O  O   . GLU A 1 29  ? 20.416  -29.201 29.785  1.00 27.28  ? 29   GLU A O   1 
ATOM   227  C  CB  . GLU A 1 29  ? 21.070  -27.929 27.055  1.00 24.20  ? 29   GLU A CB  1 
ATOM   228  C  CG  . GLU A 1 29  ? 22.257  -27.898 26.130  1.00 24.55  ? 29   GLU A CG  1 
ATOM   229  C  CD  . GLU A 1 29  ? 22.552  -26.517 25.574  1.00 24.67  ? 29   GLU A CD  1 
ATOM   230  O  OE1 . GLU A 1 29  ? 21.803  -25.569 25.874  1.00 27.35  ? 29   GLU A OE1 1 
ATOM   231  O  OE2 . GLU A 1 29  ? 23.527  -26.373 24.825  1.00 24.28  ? 29   GLU A OE2 1 
ATOM   232  N  N   . ALA A 1 30  ? 18.479  -29.252 28.637  1.00 23.71  ? 30   ALA A N   1 
ATOM   233  C  CA  . ALA A 1 30  ? 17.655  -28.956 29.810  1.00 25.04  ? 30   ALA A CA  1 
ATOM   234  C  C   . ALA A 1 30  ? 17.859  -30.015 30.880  1.00 27.17  ? 30   ALA A C   1 
ATOM   235  O  O   . ALA A 1 30  ? 17.911  -31.214 30.578  1.00 26.50  ? 30   ALA A O   1 
ATOM   236  C  CB  . ALA A 1 30  ? 16.204  -28.832 29.436  1.00 23.91  ? 30   ALA A CB  1 
ATOM   237  N  N   . GLN A 1 31  ? 18.028  -29.559 32.123  1.00 29.51  ? 31   GLN A N   1 
ATOM   238  C  CA  . GLN A 1 31  ? 18.203  -30.464 33.264  1.00 32.35  ? 31   GLN A CA  1 
ATOM   239  C  C   . GLN A 1 31  ? 16.895  -30.677 34.023  1.00 33.38  ? 31   GLN A C   1 
ATOM   240  O  O   . GLN A 1 31  ? 16.847  -31.452 34.981  1.00 35.36  ? 31   GLN A O   1 
ATOM   241  C  CB  . GLN A 1 31  ? 19.279  -29.932 34.200  1.00 34.82  ? 31   GLN A CB  1 
ATOM   242  C  CG  . GLN A 1 31  ? 20.633  -29.764 33.534  1.00 35.52  ? 31   GLN A CG  1 
ATOM   243  C  CD  . GLN A 1 31  ? 21.177  -31.059 32.957  1.00 35.10  ? 31   GLN A CD  1 
ATOM   244  O  OE1 . GLN A 1 31  ? 21.582  -31.965 33.692  1.00 36.91  ? 31   GLN A OE1 1 
ATOM   245  N  NE2 . GLN A 1 31  ? 21.204  -31.146 31.628  1.00 31.69  ? 31   GLN A NE2 1 
ATOM   246  N  N   . ASN A 1 32  ? 15.837  -30.006 33.572  1.00 32.14  ? 32   ASN A N   1 
ATOM   247  C  CA  . ASN A 1 32  ? 14.534  -30.100 34.199  1.00 33.10  ? 32   ASN A CA  1 
ATOM   248  C  C   . ASN A 1 32  ? 13.473  -29.931 33.127  1.00 30.34  ? 32   ASN A C   1 
ATOM   249  O  O   . ASN A 1 32  ? 13.567  -29.035 32.283  1.00 29.46  ? 32   ASN A O   1 
ATOM   250  C  CB  . ASN A 1 32  ? 14.420  -29.025 35.291  1.00 36.11  ? 32   ASN A CB  1 
ATOM   251  C  CG  . ASN A 1 32  ? 13.262  -29.264 36.273  1.00 39.44  ? 32   ASN A CG  1 
ATOM   252  O  OD1 . ASN A 1 32  ? 12.098  -29.295 35.879  1.00 39.77  ? 32   ASN A OD1 1 
ATOM   253  N  ND2 . ASN A 1 32  ? 13.579  -29.245 37.570  1.00 49.14  ? 32   ASN A ND2 1 
ATOM   254  N  N   . THR A 1 33  ? 12.464  -30.799 33.150  1.00 30.21  ? 33   THR A N   1 
ATOM   255  C  CA  . THR A 1 33  ? 11.375  -30.751 32.171  1.00 27.88  ? 33   THR A CA  1 
ATOM   256  C  C   . THR A 1 33  ? 10.521  -29.475 32.300  1.00 28.11  ? 33   THR A C   1 
ATOM   257  O  O   . THR A 1 33  ? 9.801   -29.101 31.371  1.00 26.67  ? 33   THR A O   1 
ATOM   258  C  CB  . THR A 1 33  ? 10.496  -32.025 32.249  1.00 28.32  ? 33   THR A CB  1 
ATOM   259  O  OG1 . THR A 1 33  ? 9.938   -32.135 33.557  1.00 30.24  ? 33   THR A OG1 1 
ATOM   260  C  CG2 . THR A 1 33  ? 11.327  -33.280 31.956  1.00 27.01  ? 33   THR A CG2 1 
ATOM   261  N  N   . THR A 1 34  ? 10.628  -28.779 33.430  1.00 30.99  ? 34   THR A N   1 
ATOM   262  C  CA  . THR A 1 34  ? 9.998   -27.473 33.579  1.00 32.02  ? 34   THR A CA  1 
ATOM   263  C  C   . THR A 1 34  ? 10.391  -26.491 32.460  1.00 30.05  ? 34   THR A C   1 
ATOM   264  O  O   . THR A 1 34  ? 9.633   -25.585 32.152  1.00 30.15  ? 34   THR A O   1 
ATOM   265  C  CB  . THR A 1 34  ? 10.310  -26.864 34.952  1.00 35.72  ? 34   THR A CB  1 
ATOM   266  O  OG1 . THR A 1 34  ? 9.700   -27.679 35.972  1.00 39.57  ? 34   THR A OG1 1 
ATOM   267  C  CG2 . THR A 1 34  ? 9.750   -25.441 35.050  1.00 37.68  ? 34   THR A CG2 1 
ATOM   268  N  N   . GLU A 1 35  ? 11.551  -26.715 31.837  1.00 29.08  ? 35   GLU A N   1 
ATOM   269  C  CA  . GLU A 1 35  ? 12.076  -25.876 30.747  1.00 28.05  ? 35   GLU A CA  1 
ATOM   270  C  C   . GLU A 1 35  ? 11.722  -26.375 29.340  1.00 25.36  ? 35   GLU A C   1 
ATOM   271  O  O   . GLU A 1 35  ? 12.145  -25.772 28.352  1.00 24.02  ? 35   GLU A O   1 
ATOM   272  C  CB  . GLU A 1 35  ? 13.612  -25.822 30.811  1.00 28.55  ? 35   GLU A CB  1 
ATOM   273  C  CG  . GLU A 1 35  ? 14.261  -25.565 32.152  1.00 32.55  ? 35   GLU A CG  1 
ATOM   274  C  CD  . GLU A 1 35  ? 15.773  -25.867 32.140  1.00 33.25  ? 35   GLU A CD  1 
ATOM   275  O  OE1 . GLU A 1 35  ? 16.409  -25.822 31.037  1.00 32.66  ? 35   GLU A OE1 1 
ATOM   276  O  OE2 . GLU A 1 35  ? 16.317  -26.154 33.241  1.00 36.17  ? 35   GLU A OE2 1 
ATOM   277  N  N   . VAL A 1 36  ? 10.985  -27.482 29.231  1.00 24.27  ? 36   VAL A N   1 
ATOM   278  C  CA  . VAL A 1 36  ? 10.781  -28.127 27.941  1.00 21.99  ? 36   VAL A CA  1 
ATOM   279  C  C   . VAL A 1 36  ? 9.316   -27.995 27.519  1.00 22.30  ? 36   VAL A C   1 
ATOM   280  O  O   . VAL A 1 36  ? 8.417   -28.026 28.364  1.00 23.42  ? 36   VAL A O   1 
ATOM   281  C  CB  . VAL A 1 36  ? 11.236  -29.610 27.983  1.00 21.40  ? 36   VAL A CB  1 
ATOM   282  C  CG1 . VAL A 1 36  ? 11.027  -30.307 26.618  1.00 18.61  ? 36   VAL A CG1 1 
ATOM   283  C  CG2 . VAL A 1 36  ? 12.719  -29.699 28.438  1.00 20.69  ? 36   VAL A CG2 1 
ATOM   284  N  N   . TYR A 1 37  ? 9.102   -27.788 26.222  1.00 21.06  ? 37   TYR A N   1 
ATOM   285  C  CA  . TYR A 1 37  ? 7.781   -27.797 25.607  1.00 21.55  ? 37   TYR A CA  1 
ATOM   286  C  C   . TYR A 1 37  ? 7.795   -28.754 24.413  1.00 20.21  ? 37   TYR A C   1 
ATOM   287  O  O   . TYR A 1 37  ? 8.736   -28.743 23.633  1.00 18.79  ? 37   TYR A O   1 
ATOM   288  C  CB  . TYR A 1 37  ? 7.379   -26.391 25.143  1.00 23.27  ? 37   TYR A CB  1 
ATOM   289  C  CG  . TYR A 1 37  ? 5.896   -26.242 24.996  1.00 23.88  ? 37   TYR A CG  1 
ATOM   290  C  CD1 . TYR A 1 37  ? 5.145   -25.640 25.996  1.00 27.17  ? 37   TYR A CD1 1 
ATOM   291  C  CD2 . TYR A 1 37  ? 5.220   -26.763 23.886  1.00 25.63  ? 37   TYR A CD2 1 
ATOM   292  C  CE1 . TYR A 1 37  ? 3.775   -25.516 25.894  1.00 28.01  ? 37   TYR A CE1 1 
ATOM   293  C  CE2 . TYR A 1 37  ? 3.845   -26.646 23.774  1.00 26.62  ? 37   TYR A CE2 1 
ATOM   294  C  CZ  . TYR A 1 37  ? 3.127   -26.010 24.791  1.00 28.79  ? 37   TYR A CZ  1 
ATOM   295  O  OH  . TYR A 1 37  ? 1.768   -25.877 24.718  1.00 30.79  ? 37   TYR A OH  1 
ATOM   296  N  N   . VAL A 1 38  ? 6.770   -29.601 24.311  1.00 19.82  ? 38   VAL A N   1 
ATOM   297  C  CA  . VAL A 1 38  ? 6.645   -30.558 23.204  1.00 19.54  ? 38   VAL A CA  1 
ATOM   298  C  C   . VAL A 1 38  ? 5.276   -30.391 22.527  1.00 19.84  ? 38   VAL A C   1 
ATOM   299  O  O   . VAL A 1 38  ? 4.247   -30.349 23.194  1.00 20.94  ? 38   VAL A O   1 
ATOM   300  C  CB  . VAL A 1 38  ? 6.762   -32.030 23.684  1.00 19.63  ? 38   VAL A CB  1 
ATOM   301  C  CG1 . VAL A 1 38  ? 6.524   -32.995 22.515  1.00 19.34  ? 38   VAL A CG1 1 
ATOM   302  C  CG2 . VAL A 1 38  ? 8.125   -32.293 24.351  1.00 19.93  ? 38   VAL A CG2 1 
ATOM   303  N  N   . LYS A 1 39  ? 5.285   -30.292 21.207  1.00 20.15  ? 39   LYS A N   1 
ATOM   304  C  CA  . LYS A 1 39  ? 4.080   -30.204 20.391  1.00 20.90  ? 39   LYS A CA  1 
ATOM   305  C  C   . LYS A 1 39  ? 4.195   -31.178 19.227  1.00 20.52  ? 39   LYS A C   1 
ATOM   306  O  O   . LYS A 1 39  ? 5.147   -31.130 18.453  1.00 19.09  ? 39   LYS A O   1 
ATOM   307  C  CB  . LYS A 1 39  ? 3.945   -28.784 19.862  1.00 22.88  ? 39   LYS A CB  1 
ATOM   308  C  CG  . LYS A 1 39  ? 2.595   -28.425 19.269  1.00 24.22  ? 39   LYS A CG  1 
ATOM   309  C  CD  . LYS A 1 39  ? 2.651   -27.020 18.689  1.00 26.50  ? 39   LYS A CD  1 
ATOM   310  C  CE  . LYS A 1 39  ? 2.720   -25.938 19.762  1.00 29.26  ? 39   LYS A CE  1 
ATOM   311  N  NZ  . LYS A 1 39  ? 3.059   -24.610 19.160  1.00 33.09  ? 39   LYS A NZ  1 
ATOM   312  N  N   . TRP A 1 40  ? 3.212   -32.070 19.121  1.00 20.57  ? 40   TRP A N   1 
ATOM   313  C  CA  . TRP A 1 40  ? 3.068   -32.933 17.973  1.00 20.91  ? 40   TRP A CA  1 
ATOM   314  C  C   . TRP A 1 40  ? 1.906   -32.429 17.121  1.00 22.39  ? 40   TRP A C   1 
ATOM   315  O  O   . TRP A 1 40  ? 0.801   -32.194 17.620  1.00 22.46  ? 40   TRP A O   1 
ATOM   316  C  CB  . TRP A 1 40  ? 2.783   -34.352 18.419  1.00 20.51  ? 40   TRP A CB  1 
ATOM   317  C  CG  . TRP A 1 40  ? 3.963   -35.104 18.852  1.00 19.57  ? 40   TRP A CG  1 
ATOM   318  C  CD1 . TRP A 1 40  ? 4.485   -35.171 20.113  1.00 19.10  ? 40   TRP A CD1 1 
ATOM   319  C  CD2 . TRP A 1 40  ? 4.782   -35.930 18.030  1.00 18.51  ? 40   TRP A CD2 1 
ATOM   320  N  NE1 . TRP A 1 40  ? 5.556   -36.010 20.124  1.00 19.35  ? 40   TRP A NE1 1 
ATOM   321  C  CE2 . TRP A 1 40  ? 5.774   -36.479 18.854  1.00 18.23  ? 40   TRP A CE2 1 
ATOM   322  C  CE3 . TRP A 1 40  ? 4.759   -36.277 16.677  1.00 20.53  ? 40   TRP A CE3 1 
ATOM   323  C  CZ2 . TRP A 1 40  ? 6.745   -37.364 18.370  1.00 19.53  ? 40   TRP A CZ2 1 
ATOM   324  C  CZ3 . TRP A 1 40  ? 5.714   -37.149 16.194  1.00 21.04  ? 40   TRP A CZ3 1 
ATOM   325  C  CH2 . TRP A 1 40  ? 6.691   -37.693 17.040  1.00 21.10  ? 40   TRP A CH2 1 
ATOM   326  N  N   . LYS A 1 41  ? 2.188   -32.245 15.843  1.00 23.11  ? 41   LYS A N   1 
ATOM   327  C  CA  . LYS A 1 41  ? 1.231   -31.743 14.890  1.00 25.73  ? 41   LYS A CA  1 
ATOM   328  C  C   . LYS A 1 41  ? 0.935   -32.810 13.837  1.00 26.51  ? 41   LYS A C   1 
ATOM   329  O  O   . LYS A 1 41  ? 1.807   -33.621 13.490  1.00 25.42  ? 41   LYS A O   1 
ATOM   330  C  CB  . LYS A 1 41  ? 1.770   -30.478 14.221  1.00 26.73  ? 41   LYS A CB  1 
ATOM   331  C  CG  . LYS A 1 41  ? 2.247   -29.410 15.188  1.00 26.68  ? 41   LYS A CG  1 
ATOM   332  C  CD  . LYS A 1 41  ? 2.542   -28.086 14.481  1.00 29.11  ? 41   LYS A CD  1 
ATOM   333  C  CE  . LYS A 1 41  ? 3.642   -27.298 15.188  1.00 30.04  ? 41   LYS A CE  1 
ATOM   334  N  NZ  . LYS A 1 41  ? 3.470   -25.806 15.043  1.00 33.42  ? 41   LYS A NZ  1 
ATOM   335  N  N   . PHE A 1 42  ? -0.300  -32.780 13.349  1.00 28.31  ? 42   PHE A N   1 
ATOM   336  C  CA  . PHE A 1 42  ? -0.794  -33.645 12.275  1.00 30.68  ? 42   PHE A CA  1 
ATOM   337  C  C   . PHE A 1 42  ? -1.828  -32.861 11.463  1.00 33.23  ? 42   PHE A C   1 
ATOM   338  O  O   . PHE A 1 42  ? -2.840  -32.419 12.005  1.00 32.81  ? 42   PHE A O   1 
ATOM   339  C  CB  . PHE A 1 42  ? -1.432  -34.914 12.849  1.00 30.12  ? 42   PHE A CB  1 
ATOM   340  C  CG  . PHE A 1 42  ? -2.026  -35.822 11.803  1.00 32.67  ? 42   PHE A CG  1 
ATOM   341  C  CD1 . PHE A 1 42  ? -1.215  -36.643 11.020  1.00 32.81  ? 42   PHE A CD1 1 
ATOM   342  C  CD2 . PHE A 1 42  ? -3.399  -35.846 11.587  1.00 34.30  ? 42   PHE A CD2 1 
ATOM   343  C  CE1 . PHE A 1 42  ? -1.778  -37.488 10.047  1.00 35.38  ? 42   PHE A CE1 1 
ATOM   344  C  CE2 . PHE A 1 42  ? -3.951  -36.675 10.625  1.00 37.69  ? 42   PHE A CE2 1 
ATOM   345  C  CZ  . PHE A 1 42  ? -3.137  -37.494 9.855   1.00 37.37  ? 42   PHE A CZ  1 
ATOM   346  N  N   . LYS A 1 43  ? -1.553  -32.686 10.173  1.00 35.80  ? 43   LYS A N   1 
ATOM   347  C  CA  . LYS A 1 43  ? -2.422  -31.922 9.255   1.00 39.85  ? 43   LYS A CA  1 
ATOM   348  C  C   . LYS A 1 43  ? -2.765  -30.511 9.759   1.00 40.35  ? 43   LYS A C   1 
ATOM   349  O  O   . LYS A 1 43  ? -3.923  -30.089 9.753   1.00 42.57  ? 43   LYS A O   1 
ATOM   350  C  CB  . LYS A 1 43  ? -3.688  -32.717 8.914   1.00 41.46  ? 43   LYS A CB  1 
ATOM   351  C  CG  . LYS A 1 43  ? -3.410  -33.960 8.101   1.00 42.51  ? 43   LYS A CG  1 
ATOM   352  C  CD  . LYS A 1 43  ? -4.694  -34.668 7.721   1.00 45.58  ? 43   LYS A CD  1 
ATOM   353  C  CE  . LYS A 1 43  ? -4.430  -35.900 6.871   1.00 47.19  ? 43   LYS A CE  1 
ATOM   354  N  NZ  . LYS A 1 43  ? -3.660  -35.555 5.652   1.00 51.10  ? 43   LYS A NZ  1 
ATOM   355  N  N   . GLY A 1 44  ? -1.739  -29.794 10.195  1.00 39.46  ? 44   GLY A N   1 
ATOM   356  C  CA  . GLY A 1 44  ? -1.890  -28.402 10.604  1.00 40.70  ? 44   GLY A CA  1 
ATOM   357  C  C   . GLY A 1 44  ? -2.575  -28.133 11.943  1.00 40.08  ? 44   GLY A C   1 
ATOM   358  O  O   . GLY A 1 44  ? -2.999  -26.998 12.187  1.00 42.35  ? 44   GLY A O   1 
ATOM   359  N  N   . ARG A 1 45  ? -2.702  -29.147 12.805  1.00 37.72  ? 45   ARG A N   1 
ATOM   360  C  CA  A ARG A 1 45  ? -3.223  -28.938 14.158  0.70 36.76  ? 45   ARG A CA  1 
ATOM   361  C  CA  B ARG A 1 45  ? -3.228  -28.941 14.157  0.30 36.54  ? 45   ARG A CA  1 
ATOM   362  C  C   . ARG A 1 45  ? -2.424  -29.705 15.205  1.00 33.62  ? 45   ARG A C   1 
ATOM   363  O  O   . ARG A 1 45  ? -1.804  -30.723 14.900  1.00 31.60  ? 45   ARG A O   1 
ATOM   364  C  CB  A ARG A 1 45  ? -4.719  -29.263 14.252  0.70 38.99  ? 45   ARG A CB  1 
ATOM   365  C  CB  B ARG A 1 45  ? -4.708  -29.318 14.232  0.30 38.54  ? 45   ARG A CB  1 
ATOM   366  C  CG  A ARG A 1 45  ? -5.232  -30.318 13.287  0.70 40.49  ? 45   ARG A CG  1 
ATOM   367  C  CG  B ARG A 1 45  ? -5.008  -30.764 13.896  0.30 38.21  ? 45   ARG A CG  1 
ATOM   368  C  CD  A ARG A 1 45  ? -6.738  -30.394 13.337  0.70 43.33  ? 45   ARG A CD  1 
ATOM   369  C  CD  B ARG A 1 45  ? -6.463  -30.951 13.524  0.30 41.02  ? 45   ARG A CD  1 
ATOM   370  N  NE  A ARG A 1 45  ? -7.210  -30.855 14.642  0.70 43.58  ? 45   ARG A NE  1 
ATOM   371  N  NE  B ARG A 1 45  ? -6.731  -32.304 13.043  0.30 41.24  ? 45   ARG A NE  1 
ATOM   372  C  CZ  A ARG A 1 45  ? -7.564  -32.106 14.945  0.70 42.60  ? 45   ARG A CZ  1 
ATOM   373  C  CZ  B ARG A 1 45  ? -6.892  -33.373 13.821  0.30 40.55  ? 45   ARG A CZ  1 
ATOM   374  N  NH1 A ARG A 1 45  ? -7.526  -33.078 14.036  0.70 43.42  ? 45   ARG A NH1 1 
ATOM   375  N  NH1 B ARG A 1 45  ? -6.804  -33.272 15.148  0.30 39.08  ? 45   ARG A NH1 1 
ATOM   376  N  NH2 A ARG A 1 45  ? -7.974  -32.380 16.177  0.70 41.79  ? 45   ARG A NH2 1 
ATOM   377  N  NH2 B ARG A 1 45  ? -7.142  -34.556 13.264  0.30 41.12  ? 45   ARG A NH2 1 
ATOM   378  N  N   . ASP A 1 46  ? -2.457  -29.186 16.437  1.00 32.64  ? 46   ASP A N   1 
ATOM   379  C  CA  . ASP A 1 46  ? -1.699  -29.700 17.573  1.00 29.79  ? 46   ASP A CA  1 
ATOM   380  C  C   . ASP A 1 46  ? -2.429  -30.881 18.177  1.00 29.32  ? 46   ASP A C   1 
ATOM   381  O  O   . ASP A 1 46  ? -3.453  -30.700 18.832  1.00 30.90  ? 46   ASP A O   1 
ATOM   382  C  CB  . ASP A 1 46  ? -1.532  -28.601 18.637  1.00 30.25  ? 46   ASP A CB  1 
ATOM   383  C  CG  . ASP A 1 46  ? -0.855  -27.347 18.088  1.00 31.15  ? 46   ASP A CG  1 
ATOM   384  O  OD1 . ASP A 1 46  ? -0.295  -27.395 16.974  1.00 32.07  ? 46   ASP A OD1 1 
ATOM   385  O  OD2 . ASP A 1 46  ? -0.889  -26.310 18.776  1.00 34.12  ? 46   ASP A OD2 1 
ATOM   386  N  N   . ILE A 1 47  ? -1.915  -32.089 17.954  1.00 26.91  ? 47   ILE A N   1 
ATOM   387  C  CA  . ILE A 1 47  ? -2.624  -33.297 18.379  1.00 26.85  ? 47   ILE A CA  1 
ATOM   388  C  C   . ILE A 1 47  ? -2.073  -33.851 19.706  1.00 25.03  ? 47   ILE A C   1 
ATOM   389  O  O   . ILE A 1 47  ? -2.656  -34.756 20.311  1.00 24.77  ? 47   ILE A O   1 
ATOM   390  C  CB  . ILE A 1 47  ? -2.728  -34.341 17.211  1.00 27.07  ? 47   ILE A CB  1 
ATOM   391  C  CG1 . ILE A 1 47  ? -1.363  -34.891 16.769  1.00 26.60  ? 47   ILE A CG1 1 
ATOM   392  C  CG2 . ILE A 1 47  ? -3.426  -33.690 16.007  1.00 28.91  ? 47   ILE A CG2 1 
ATOM   393  C  CD1 . ILE A 1 47  ? -0.726  -35.867 17.719  1.00 24.20  ? 47   ILE A CD1 1 
ATOM   394  N  N   . TYR A 1 48  ? -0.981  -33.246 20.179  1.00 23.34  ? 48   TYR A N   1 
ATOM   395  C  CA  . TYR A 1 48  ? -0.469  -33.484 21.526  1.00 22.90  ? 48   TYR A CA  1 
ATOM   396  C  C   . TYR A 1 48  ? 0.464   -32.340 21.895  1.00 22.13  ? 48   TYR A C   1 
ATOM   397  O  O   . TYR A 1 48  ? 1.306   -31.935 21.091  1.00 22.04  ? 48   TYR A O   1 
ATOM   398  C  CB  . TYR A 1 48  ? 0.262   -34.842 21.665  1.00 22.31  ? 48   TYR A CB  1 
ATOM   399  C  CG  . TYR A 1 48  ? 0.845   -35.032 23.046  1.00 21.69  ? 48   TYR A CG  1 
ATOM   400  C  CD1 . TYR A 1 48  ? 0.112   -35.643 24.061  1.00 23.16  ? 48   TYR A CD1 1 
ATOM   401  C  CD2 . TYR A 1 48  ? 2.126   -34.553 23.354  1.00 21.09  ? 48   TYR A CD2 1 
ATOM   402  C  CE1 . TYR A 1 48  ? 0.640   -35.788 25.338  1.00 25.00  ? 48   TYR A CE1 1 
ATOM   403  C  CE2 . TYR A 1 48  ? 2.652   -34.687 24.625  1.00 22.43  ? 48   TYR A CE2 1 
ATOM   404  C  CZ  . TYR A 1 48  ? 1.911   -35.290 25.615  1.00 22.85  ? 48   TYR A CZ  1 
ATOM   405  O  OH  . TYR A 1 48  ? 2.449   -35.408 26.878  1.00 25.55  ? 48   TYR A OH  1 
ATOM   406  N  N   . THR A 1 49  ? 0.303   -31.800 23.101  1.00 22.57  ? 49   THR A N   1 
ATOM   407  C  CA  . THR A 1 49  ? 1.274   -30.848 23.640  1.00 21.95  ? 49   THR A CA  1 
ATOM   408  C  C   . THR A 1 49  ? 1.605   -31.230 25.078  1.00 22.38  ? 49   THR A C   1 
ATOM   409  O  O   . THR A 1 49  ? 0.720   -31.682 25.824  1.00 23.59  ? 49   THR A O   1 
ATOM   410  C  CB  . THR A 1 49  ? 0.744   -29.378 23.635  1.00 22.80  ? 49   THR A CB  1 
ATOM   411  O  OG1 . THR A 1 49  ? -0.295  -29.243 24.604  1.00 25.74  ? 49   THR A OG1 1 
ATOM   412  C  CG2 . THR A 1 49  ? 0.217   -28.961 22.266  1.00 22.03  ? 49   THR A CG2 1 
ATOM   413  N  N   . PHE A 1 50  ? 2.869   -31.057 25.466  1.00 21.68  ? 50   PHE A N   1 
ATOM   414  C  CA  . PHE A 1 50  ? 3.260   -31.141 26.877  1.00 22.88  ? 50   PHE A CA  1 
ATOM   415  C  C   . PHE A 1 50  ? 3.868   -29.797 27.270  1.00 23.21  ? 50   PHE A C   1 
ATOM   416  O  O   . PHE A 1 50  ? 4.848   -29.360 26.671  1.00 21.20  ? 50   PHE A O   1 
ATOM   417  C  CB  . PHE A 1 50  ? 4.242   -32.285 27.137  1.00 22.44  ? 50   PHE A CB  1 
ATOM   418  C  CG  . PHE A 1 50  ? 4.876   -32.251 28.521  1.00 23.77  ? 50   PHE A CG  1 
ATOM   419  C  CD1 . PHE A 1 50  ? 4.132   -32.592 29.648  1.00 26.53  ? 50   PHE A CD1 1 
ATOM   420  C  CD2 . PHE A 1 50  ? 6.212   -31.885 28.686  1.00 24.25  ? 50   PHE A CD2 1 
ATOM   421  C  CE1 . PHE A 1 50  ? 4.700   -32.568 30.913  1.00 28.63  ? 50   PHE A CE1 1 
ATOM   422  C  CE2 . PHE A 1 50  ? 6.792   -31.863 29.954  1.00 26.03  ? 50   PHE A CE2 1 
ATOM   423  C  CZ  . PHE A 1 50  ? 6.020   -32.206 31.073  1.00 27.45  ? 50   PHE A CZ  1 
ATOM   424  N  N   . ASP A 1 51  ? 3.256   -29.138 28.247  1.00 25.59  ? 51   ASP A N   1 
ATOM   425  C  CA  . ASP A 1 51  ? 3.783   -27.889 28.796  1.00 26.89  ? 51   ASP A CA  1 
ATOM   426  C  C   . ASP A 1 51  ? 4.552   -28.220 30.076  1.00 28.21  ? 51   ASP A C   1 
ATOM   427  O  O   . ASP A 1 51  ? 3.966   -28.368 31.147  1.00 30.16  ? 51   ASP A O   1 
ATOM   428  C  CB  . ASP A 1 51  ? 2.637   -26.912 29.068  1.00 29.05  ? 51   ASP A CB  1 
ATOM   429  C  CG  . ASP A 1 51  ? 3.107   -25.548 29.529  1.00 31.04  ? 51   ASP A CG  1 
ATOM   430  O  OD1 . ASP A 1 51  ? 4.281   -25.403 29.929  1.00 34.13  ? 51   ASP A OD1 1 
ATOM   431  O  OD2 . ASP A 1 51  ? 2.279   -24.610 29.526  1.00 34.64  ? 51   ASP A OD2 1 
ATOM   432  N  N   . GLY A 1 52  ? 5.868   -28.330 29.959  1.00 27.06  ? 52   GLY A N   1 
ATOM   433  C  CA  . GLY A 1 52  ? 6.699   -28.768 31.080  1.00 28.14  ? 52   GLY A CA  1 
ATOM   434  C  C   . GLY A 1 52  ? 6.626   -27.882 32.301  1.00 30.91  ? 52   GLY A C   1 
ATOM   435  O  O   . GLY A 1 52  ? 6.696   -28.362 33.439  1.00 33.07  ? 52   GLY A O   1 
ATOM   436  N  N   . ALA A 1 53  ? 6.451   -26.587 32.068  1.00 31.30  ? 53   ALA A N   1 
ATOM   437  C  CA  . ALA A 1 53  ? 6.317   -25.629 33.145  1.00 34.30  ? 53   ALA A CA  1 
ATOM   438  C  C   . ALA A 1 53  ? 5.091   -25.942 34.005  1.00 36.81  ? 53   ALA A C   1 
ATOM   439  O  O   . ALA A 1 53  ? 5.145   -25.819 35.225  1.00 38.93  ? 53   ALA A O   1 
ATOM   440  C  CB  . ALA A 1 53  ? 6.252   -24.204 32.584  1.00 34.78  ? 53   ALA A CB  1 
ATOM   441  N  N   . LEU A 1 54  ? 4.004   -26.367 33.366  1.00 35.88  ? 54   LEU A N   1 
ATOM   442  C  CA  . LEU A 1 54  ? 2.775   -26.729 34.079  1.00 38.57  ? 54   LEU A CA  1 
ATOM   443  C  C   . LEU A 1 54  ? 2.693   -28.222 34.437  1.00 38.17  ? 54   LEU A C   1 
ATOM   444  O  O   . LEU A 1 54  ? 1.839   -28.618 35.226  1.00 40.76  ? 54   LEU A O   1 
ATOM   445  C  CB  . LEU A 1 54  ? 1.554   -26.361 33.240  1.00 38.61  ? 54   LEU A CB  1 
ATOM   446  C  CG  . LEU A 1 54  ? 1.395   -24.885 32.875  1.00 40.59  ? 54   LEU A CG  1 
ATOM   447  C  CD1 . LEU A 1 54  ? 0.274   -24.741 31.839  1.00 41.24  ? 54   LEU A CD1 1 
ATOM   448  C  CD2 . LEU A 1 54  ? 1.121   -24.029 34.108  1.00 45.94  ? 54   LEU A CD2 1 
ATOM   449  N  N   . ASN A 1 55  ? 3.565   -29.040 33.855  1.00 35.21  ? 55   ASN A N   1 
ATOM   450  C  CA  . ASN A 1 55  ? 3.541   -30.487 34.055  1.00 35.37  ? 55   ASN A CA  1 
ATOM   451  C  C   . ASN A 1 55  ? 2.183   -31.041 33.629  1.00 34.91  ? 55   ASN A C   1 
ATOM   452  O  O   . ASN A 1 55  ? 1.588   -31.836 34.353  1.00 36.36  ? 55   ASN A O   1 
ATOM   453  C  CB  . ASN A 1 55  ? 3.796   -30.815 35.529  1.00 39.45  ? 55   ASN A CB  1 
ATOM   454  C  CG  . ASN A 1 55  ? 4.699   -32.024 35.740  1.00 42.38  ? 55   ASN A CG  1 
ATOM   455  O  OD1 . ASN A 1 55  ? 5.157   -32.687 34.798  1.00 41.15  ? 55   ASN A OD1 1 
ATOM   456  N  ND2 . ASN A 1 55  ? 5.041   -32.235 37.014  1.00 51.88  ? 55   ASN A ND2 1 
ATOM   457  N  N   . LYS A 1 56  ? 1.710   -30.594 32.464  1.00 31.94  ? 56   LYS A N   1 
ATOM   458  C  CA  . LYS A 1 56  ? 0.369   -30.919 31.964  1.00 32.22  ? 56   LYS A CA  1 
ATOM   459  C  C   . LYS A 1 56  ? 0.381   -31.196 30.474  1.00 28.78  ? 56   LYS A C   1 
ATOM   460  O  O   . LYS A 1 56  ? 1.129   -30.572 29.728  1.00 26.11  ? 56   LYS A O   1 
ATOM   461  C  CB  . LYS A 1 56  ? -0.598  -29.762 32.224  1.00 34.14  ? 56   LYS A CB  1 
ATOM   462  C  CG  . LYS A 1 56  ? -1.057  -29.646 33.663  1.00 38.42  ? 56   LYS A CG  1 
ATOM   463  C  CD  . LYS A 1 56  ? -2.241  -28.723 33.785  1.00 40.66  ? 56   LYS A CD  1 
ATOM   464  C  CE  . LYS A 1 56  ? -2.659  -28.543 35.255  1.00 44.84  ? 56   LYS A CE  1 
ATOM   465  N  NZ  . LYS A 1 56  ? -3.992  -27.922 35.398  1.00 48.81  ? 56   LYS A NZ  1 
ATOM   466  N  N   . SER A 1 57  ? -0.488  -32.110 30.046  1.00 28.59  ? 57   SER A N   1 
ATOM   467  C  CA  . SER A 1 57  ? -0.585  -32.495 28.655  1.00 26.64  ? 57   SER A CA  1 
ATOM   468  C  C   . SER A 1 57  ? -1.997  -32.271 28.159  1.00 27.53  ? 57   SER A C   1 
ATOM   469  O  O   . SER A 1 57  ? -2.954  -32.530 28.895  1.00 28.93  ? 57   SER A O   1 
ATOM   470  C  CB  . SER A 1 57  ? -0.270  -33.972 28.500  1.00 26.52  ? 57   SER A CB  1 
ATOM   471  O  OG  . SER A 1 57  ? 1.118   -34.196 28.566  1.00 28.89  ? 57   SER A OG  1 
ATOM   472  N  N   . THR A 1 58  ? -2.112  -31.827 26.908  1.00 25.91  ? 58   THR A N   1 
ATOM   473  C  CA  . THR A 1 58  ? -3.405  -31.573 26.268  1.00 26.99  ? 58   THR A CA  1 
ATOM   474  C  C   . THR A 1 58  ? -3.527  -32.339 24.956  1.00 25.73  ? 58   THR A C   1 
ATOM   475  O  O   . THR A 1 58  ? -2.600  -32.339 24.135  1.00 23.98  ? 58   THR A O   1 
ATOM   476  C  CB  . THR A 1 58  ? -3.559  -30.072 25.987  1.00 27.73  ? 58   THR A CB  1 
ATOM   477  O  OG1 . THR A 1 58  ? -3.294  -29.334 27.189  1.00 27.29  ? 58   THR A OG1 1 
ATOM   478  C  CG2 . THR A 1 58  ? -4.942  -29.764 25.473  1.00 28.94  ? 58   THR A CG2 1 
ATOM   479  N  N   . VAL A 1 59  ? -4.661  -33.006 24.771  1.00 26.95  ? 59   VAL A N   1 
ATOM   480  C  CA  . VAL A 1 59  ? -4.930  -33.756 23.549  1.00 26.62  ? 59   VAL A CA  1 
ATOM   481  C  C   . VAL A 1 59  ? -6.354  -33.512 23.060  1.00 29.03  ? 59   VAL A C   1 
ATOM   482  O  O   . VAL A 1 59  ? -7.282  -33.442 23.862  1.00 30.72  ? 59   VAL A O   1 
ATOM   483  C  CB  . VAL A 1 59  ? -4.717  -35.281 23.744  1.00 26.17  ? 59   VAL A CB  1 
ATOM   484  C  CG1 . VAL A 1 59  ? -3.302  -35.550 24.191  1.00 23.34  ? 59   VAL A CG1 1 
ATOM   485  C  CG2 . VAL A 1 59  ? -5.714  -35.872 24.743  1.00 28.10  ? 59   VAL A CG2 1 
ATOM   486  N  N   . PRO A 1 60  ? -6.532  -33.422 21.733  1.00 29.57  ? 60   PRO A N   1 
ATOM   487  C  CA  . PRO A 1 60  ? -7.879  -33.369 21.215  1.00 32.25  ? 60   PRO A CA  1 
ATOM   488  C  C   . PRO A 1 60  ? -8.535  -34.739 21.360  1.00 33.63  ? 60   PRO A C   1 
ATOM   489  O  O   . PRO A 1 60  ? -7.835  -35.767 21.443  1.00 31.70  ? 60   PRO A O   1 
ATOM   490  C  CB  . PRO A 1 60  ? -7.669  -33.005 19.742  1.00 31.73  ? 60   PRO A CB  1 
ATOM   491  C  CG  . PRO A 1 60  ? -6.368  -33.594 19.406  1.00 29.44  ? 60   PRO A CG  1 
ATOM   492  C  CD  . PRO A 1 60  ? -5.538  -33.432 20.647  1.00 27.73  ? 60   PRO A CD  1 
ATOM   493  N  N   . THR A 1 61  ? -9.858  -34.744 21.371  1.00 36.45  ? 61   THR A N   1 
ATOM   494  C  CA  . THR A 1 61  ? -10.634 -35.960 21.639  1.00 39.10  ? 61   THR A CA  1 
ATOM   495  C  C   . THR A 1 61  ? -10.433 -37.030 20.553  1.00 38.96  ? 61   THR A C   1 
ATOM   496  O  O   . THR A 1 61  ? -10.577 -38.219 20.818  1.00 39.52  ? 61   THR A O   1 
ATOM   497  C  CB  . THR A 1 61  ? -12.138 -35.650 21.847  1.00 42.69  ? 61   THR A CB  1 
ATOM   498  O  OG1 . THR A 1 61  ? -12.776 -35.359 20.595  1.00 45.56  ? 61   THR A OG1 1 
ATOM   499  C  CG2 . THR A 1 61  ? -12.312 -34.472 22.799  1.00 43.31  ? 61   THR A CG2 1 
ATOM   500  N  N   . ASP A 1 62  ? -10.074 -36.609 19.344  1.00 39.12  ? 62   ASP A N   1 
ATOM   501  C  CA  . ASP A 1 62  ? -9.739  -37.565 18.277  1.00 39.50  ? 62   ASP A CA  1 
ATOM   502  C  C   . ASP A 1 62  ? -8.333  -38.174 18.402  1.00 37.34  ? 62   ASP A C   1 
ATOM   503  O  O   . ASP A 1 62  ? -7.982  -39.078 17.639  1.00 37.95  ? 62   ASP A O   1 
ATOM   504  C  CB  . ASP A 1 62  ? -9.940  -36.946 16.890  1.00 41.04  ? 62   ASP A CB  1 
ATOM   505  C  CG  . ASP A 1 62  ? -9.062  -35.761 16.642  1.00 40.77  ? 62   ASP A CG  1 
ATOM   506  O  OD1 . ASP A 1 62  ? -8.691  -35.063 17.613  1.00 42.02  ? 62   ASP A OD1 1 
ATOM   507  O  OD2 . ASP A 1 62  ? -8.754  -35.514 15.461  1.00 43.30  ? 62   ASP A OD2 1 
ATOM   508  N  N   . PHE A 1 63  ? -7.541  -37.690 19.358  1.00 35.15  ? 63   PHE A N   1 
ATOM   509  C  CA  . PHE A 1 63  ? -6.291  -38.347 19.753  1.00 33.76  ? 63   PHE A CA  1 
ATOM   510  C  C   . PHE A 1 63  ? -6.241  -38.620 21.265  1.00 34.16  ? 63   PHE A C   1 
ATOM   511  O  O   . PHE A 1 63  ? -5.222  -38.369 21.905  1.00 32.46  ? 63   PHE A O   1 
ATOM   512  C  CB  . PHE A 1 63  ? -5.098  -37.484 19.372  1.00 31.01  ? 63   PHE A CB  1 
ATOM   513  C  CG  . PHE A 1 63  ? -4.785  -37.482 17.907  1.00 30.96  ? 63   PHE A CG  1 
ATOM   514  C  CD1 . PHE A 1 63  ? -3.862  -38.383 17.379  1.00 30.71  ? 63   PHE A CD1 1 
ATOM   515  C  CD2 . PHE A 1 63  ? -5.382  -36.564 17.057  1.00 31.80  ? 63   PHE A CD2 1 
ATOM   516  C  CE1 . PHE A 1 63  ? -3.556  -38.373 16.040  1.00 30.22  ? 63   PHE A CE1 1 
ATOM   517  C  CE2 . PHE A 1 63  ? -5.078  -36.548 15.713  1.00 31.90  ? 63   PHE A CE2 1 
ATOM   518  C  CZ  . PHE A 1 63  ? -4.161  -37.449 15.204  1.00 31.82  ? 63   PHE A CZ  1 
ATOM   519  N  N   . SER A 1 64  ? -7.323  -39.166 21.822  1.00 36.56  ? 64   SER A N   1 
ATOM   520  C  CA  . SER A 1 64  ? -7.470  -39.264 23.287  1.00 37.48  ? 64   SER A CA  1 
ATOM   521  C  C   . SER A 1 64  ? -6.371  -40.071 23.970  1.00 36.33  ? 64   SER A C   1 
ATOM   522  O  O   . SER A 1 64  ? -6.012  -39.786 25.103  1.00 36.33  ? 64   SER A O   1 
ATOM   523  C  CB  . SER A 1 64  ? -8.821  -39.873 23.651  1.00 40.82  ? 64   SER A CB  1 
ATOM   524  O  OG  . SER A 1 64  ? -9.866  -39.184 23.007  1.00 44.05  ? 64   SER A OG  1 
ATOM   525  N  N   . SER A 1 65  ? -5.854  -41.080 23.273  1.00 36.27  ? 65   SER A N   1 
ATOM   526  C  CA  . SER A 1 65  ? -4.818  -41.979 23.807  1.00 35.77  ? 65   SER A CA  1 
ATOM   527  C  C   . SER A 1 65  ? -3.398  -41.418 23.650  1.00 32.46  ? 65   SER A C   1 
ATOM   528  O  O   . SER A 1 65  ? -2.458  -41.934 24.257  1.00 31.61  ? 65   SER A O   1 
ATOM   529  C  CB  . SER A 1 65  ? -4.908  -43.348 23.114  1.00 37.32  ? 65   SER A CB  1 
ATOM   530  O  OG  . SER A 1 65  ? -4.393  -43.269 21.795  1.00 35.72  ? 65   SER A OG  1 
ATOM   531  N  N   . ALA A 1 66  ? -3.241  -40.361 22.852  1.00 30.66  ? 66   ALA A N   1 
ATOM   532  C  CA  . ALA A 1 66  ? -1.915  -39.817 22.547  1.00 28.60  ? 66   ALA A CA  1 
ATOM   533  C  C   . ALA A 1 66  ? -1.138  -39.389 23.791  1.00 28.34  ? 66   ALA A C   1 
ATOM   534  O  O   . ALA A 1 66  ? -1.656  -38.664 24.643  1.00 28.52  ? 66   ALA A O   1 
ATOM   535  C  CB  . ALA A 1 66  ? -2.018  -38.634 21.567  1.00 27.29  ? 66   ALA A CB  1 
ATOM   536  N  N   . LYS A 1 67  ? 0.116   -39.820 23.888  1.00 27.27  ? 67   LYS A N   1 
ATOM   537  C  CA  . LYS A 1 67  ? 0.965   -39.403 25.005  1.00 27.63  ? 67   LYS A CA  1 
ATOM   538  C  C   . LYS A 1 67  ? 2.463   -39.590 24.735  1.00 26.33  ? 67   LYS A C   1 
ATOM   539  O  O   . LYS A 1 67  ? 2.857   -40.300 23.796  1.00 25.10  ? 67   LYS A O   1 
ATOM   540  C  CB  . LYS A 1 67  ? 0.558   -40.132 26.300  1.00 30.33  ? 67   LYS A CB  1 
ATOM   541  C  CG  . LYS A 1 67  ? 0.905   -41.609 26.357  1.00 32.90  ? 67   LYS A CG  1 
ATOM   542  C  CD  . LYS A 1 67  ? 0.583   -42.170 27.724  1.00 36.07  ? 67   LYS A CD  1 
ATOM   543  C  CE  . LYS A 1 67  ? 1.680   -43.081 28.253  1.00 38.52  ? 67   LYS A CE  1 
ATOM   544  N  NZ  . LYS A 1 67  ? 1.141   -43.977 29.327  1.00 41.68  ? 67   LYS A NZ  1 
ATOM   545  N  N   . ILE A 1 68  ? 3.272   -38.926 25.565  1.00 25.54  ? 68   ILE A N   1 
ATOM   546  C  CA  . ILE A 1 68  ? 4.724   -39.124 25.607  1.00 24.83  ? 68   ILE A CA  1 
ATOM   547  C  C   . ILE A 1 68  ? 5.092   -39.624 27.005  1.00 26.51  ? 68   ILE A C   1 
ATOM   548  O  O   . ILE A 1 68  ? 4.328   -39.450 27.941  1.00 26.79  ? 68   ILE A O   1 
ATOM   549  C  CB  . ILE A 1 68  ? 5.526   -37.830 25.232  1.00 22.87  ? 68   ILE A CB  1 
ATOM   550  C  CG1 . ILE A 1 68  ? 5.395   -36.728 26.309  1.00 22.86  ? 68   ILE A CG1 1 
ATOM   551  C  CG2 . ILE A 1 68  ? 5.106   -37.345 23.858  1.00 21.39  ? 68   ILE A CG2 1 
ATOM   552  C  CD1 . ILE A 1 68  ? 6.295   -35.466 26.076  1.00 20.96  ? 68   ILE A CD1 1 
ATOM   553  N  N   . GLU A 1 69  ? 6.243   -40.273 27.139  1.00 27.71  ? 69   GLU A N   1 
ATOM   554  C  CA  . GLU A 1 69  ? 6.767   -40.620 28.470  1.00 29.89  ? 69   GLU A CA  1 
ATOM   555  C  C   . GLU A 1 69  ? 7.634   -39.460 28.939  1.00 28.82  ? 69   GLU A C   1 
ATOM   556  O  O   . GLU A 1 69  ? 8.735   -39.252 28.426  1.00 27.99  ? 69   GLU A O   1 
ATOM   557  C  CB  . GLU A 1 69  ? 7.579   -41.922 28.449  1.00 32.42  ? 69   GLU A CB  1 
ATOM   558  C  CG  . GLU A 1 69  ? 6.779   -43.187 28.166  1.00 35.82  ? 69   GLU A CG  1 
ATOM   559  C  CD  . GLU A 1 69  ? 5.664   -43.466 29.172  1.00 39.93  ? 69   GLU A CD  1 
ATOM   560  O  OE1 . GLU A 1 69  ? 5.787   -43.107 30.361  1.00 43.02  ? 69   GLU A OE1 1 
ATOM   561  O  OE2 . GLU A 1 69  ? 4.655   -44.069 28.769  1.00 43.23  ? 69   GLU A OE2 1 
ATOM   562  N  N   . VAL A 1 70  ? 7.124   -38.689 29.898  1.00 29.10  ? 70   VAL A N   1 
ATOM   563  C  CA  . VAL A 1 70  ? 7.826   -37.504 30.392  1.00 28.72  ? 70   VAL A CA  1 
ATOM   564  C  C   . VAL A 1 70  ? 9.165   -37.886 31.023  1.00 29.84  ? 70   VAL A C   1 
ATOM   565  O  O   . VAL A 1 70  ? 10.122  -37.116 30.948  1.00 29.48  ? 70   VAL A O   1 
ATOM   566  C  CB  . VAL A 1 70  ? 6.961   -36.689 31.384  1.00 30.05  ? 70   VAL A CB  1 
ATOM   567  C  CG1 . VAL A 1 70  ? 7.747   -35.508 31.961  1.00 30.28  ? 70   VAL A CG1 1 
ATOM   568  C  CG2 . VAL A 1 70  ? 5.673   -36.210 30.700  1.00 28.67  ? 70   VAL A CG2 1 
ATOM   569  N  N   . SER A 1 71  ? 9.242   -39.090 31.584  1.00 32.10  ? 71   SER A N   1 
ATOM   570  C  CA  . SER A 1 71  ? 10.493  -39.615 32.173  1.00 34.35  ? 71   SER A CA  1 
ATOM   571  C  C   . SER A 1 71  ? 11.666  -39.748 31.194  1.00 32.78  ? 71   SER A C   1 
ATOM   572  O  O   . SER A 1 71  ? 12.800  -39.956 31.629  1.00 34.62  ? 71   SER A O   1 
ATOM   573  C  CB  . SER A 1 71  ? 10.249  -40.991 32.793  1.00 37.57  ? 71   SER A CB  1 
ATOM   574  O  OG  . SER A 1 71  ? 9.902   -41.933 31.791  1.00 37.26  ? 71   SER A OG  1 
ATOM   575  N  N   . GLN A 1 72  ? 11.390  -39.653 29.893  1.00 29.97  ? 72   GLN A N   1 
ATOM   576  C  CA  . GLN A 1 72  ? 12.400  -39.857 28.850  1.00 29.13  ? 72   GLN A CA  1 
ATOM   577  C  C   . GLN A 1 72  ? 12.778  -38.570 28.142  1.00 26.40  ? 72   GLN A C   1 
ATOM   578  O  O   . GLN A 1 72  ? 13.671  -38.555 27.290  1.00 25.97  ? 72   GLN A O   1 
ATOM   579  C  CB  . GLN A 1 72  ? 11.878  -40.864 27.821  1.00 28.79  ? 72   GLN A CB  1 
ATOM   580  C  CG  . GLN A 1 72  ? 11.501  -42.196 28.417  1.00 31.68  ? 72   GLN A CG  1 
ATOM   581  C  CD  . GLN A 1 72  ? 12.675  -42.853 29.119  1.00 34.89  ? 72   GLN A CD  1 
ATOM   582  O  OE1 . GLN A 1 72  ? 13.734  -43.040 28.525  1.00 34.49  ? 72   GLN A OE1 1 
ATOM   583  N  NE2 . GLN A 1 72  ? 12.491  -43.205 30.385  1.00 35.32  ? 72   GLN A NE2 1 
ATOM   584  N  N   . LEU A 1 73  ? 12.111  -37.484 28.514  1.00 25.55  ? 73   LEU A N   1 
ATOM   585  C  CA  . LEU A 1 73  ? 12.152  -36.257 27.731  1.00 23.61  ? 73   LEU A CA  1 
ATOM   586  C  C   . LEU A 1 73  ? 13.521  -35.571 27.808  1.00 23.29  ? 73   LEU A C   1 
ATOM   587  O  O   . LEU A 1 73  ? 14.030  -35.079 26.795  1.00 21.76  ? 73   LEU A O   1 
ATOM   588  C  CB  . LEU A 1 73  ? 11.009  -35.325 28.166  1.00 23.37  ? 73   LEU A CB  1 
ATOM   589  C  CG  . LEU A 1 73  ? 10.893  -33.952 27.490  1.00 21.97  ? 73   LEU A CG  1 
ATOM   590  C  CD1 . LEU A 1 73  ? 10.893  -34.060 25.956  1.00 20.81  ? 73   LEU A CD1 1 
ATOM   591  C  CD2 . LEU A 1 73  ? 9.606   -33.298 27.995  1.00 21.74  ? 73   LEU A CD2 1 
ATOM   592  N  N   . LEU A 1 74  ? 14.142  -35.576 28.983  1.00 25.58  ? 74   LEU A N   1 
ATOM   593  C  CA  . LEU A 1 74  ? 15.478  -34.971 29.137  1.00 26.11  ? 74   LEU A CA  1 
ATOM   594  C  C   . LEU A 1 74  ? 16.582  -35.732 28.386  1.00 26.57  ? 74   LEU A C   1 
ATOM   595  O  O   . LEU A 1 74  ? 17.621  -35.161 28.065  1.00 26.57  ? 74   LEU A O   1 
ATOM   596  C  CB  . LEU A 1 74  ? 15.820  -34.784 30.613  1.00 28.67  ? 74   LEU A CB  1 
ATOM   597  C  CG  . LEU A 1 74  ? 14.893  -33.819 31.365  1.00 30.09  ? 74   LEU A CG  1 
ATOM   598  C  CD1 . LEU A 1 74  ? 15.464  -33.518 32.721  1.00 34.03  ? 74   LEU A CD1 1 
ATOM   599  C  CD2 . LEU A 1 74  ? 14.669  -32.517 30.591  1.00 30.72  ? 74   LEU A CD2 1 
ATOM   600  N  N   . LYS A 1 75  ? 16.349  -37.003 28.069  1.00 27.25  ? 75   LYS A N   1 
ATOM   601  C  CA  . LYS A 1 75  ? 17.226  -37.737 27.143  1.00 27.57  ? 75   LYS A CA  1 
ATOM   602  C  C   . LYS A 1 75  ? 17.035  -37.278 25.695  1.00 25.57  ? 75   LYS A C   1 
ATOM   603  O  O   . LYS A 1 75  ? 17.772  -37.708 24.793  1.00 25.79  ? 75   LYS A O   1 
ATOM   604  C  CB  . LYS A 1 75  ? 16.961  -39.235 27.206  1.00 29.85  ? 75   LYS A CB  1 
ATOM   605  C  CG  . LYS A 1 75  ? 17.245  -39.908 28.548  1.00 32.43  ? 75   LYS A CG  1 
ATOM   606  C  CD  . LYS A 1 75  ? 16.663  -41.341 28.532  1.00 34.65  ? 75   LYS A CD  1 
ATOM   607  C  CE  . LYS A 1 75  ? 16.848  -42.069 29.858  1.00 38.96  ? 75   LYS A CE  1 
ATOM   608  N  NZ  . LYS A 1 75  ? 16.487  -43.518 29.754  1.00 40.83  ? 75   LYS A NZ  1 
ATOM   609  N  N   . GLY A 1 76  ? 16.041  -36.423 25.469  1.00 23.39  ? 76   GLY A N   1 
ATOM   610  C  CA  . GLY A 1 76  ? 15.674  -35.986 24.118  1.00 22.49  ? 76   GLY A CA  1 
ATOM   611  C  C   . GLY A 1 76  ? 14.657  -36.873 23.414  1.00 22.64  ? 76   GLY A C   1 
ATOM   612  O  O   . GLY A 1 76  ? 14.368  -36.653 22.252  1.00 22.60  ? 76   GLY A O   1 
ATOM   613  N  N   . ASP A 1 77  ? 14.129  -37.878 24.108  1.00 23.47  ? 77   ASP A N   1 
ATOM   614  C  CA  . ASP A 1 77  ? 13.097  -38.750 23.545  1.00 23.51  ? 77   ASP A CA  1 
ATOM   615  C  C   . ASP A 1 77  ? 11.732  -38.117 23.776  1.00 22.16  ? 77   ASP A C   1 
ATOM   616  O  O   . ASP A 1 77  ? 11.223  -38.121 24.903  1.00 22.36  ? 77   ASP A O   1 
ATOM   617  C  CB  . ASP A 1 77  ? 13.192  -40.143 24.174  1.00 25.87  ? 77   ASP A CB  1 
ATOM   618  C  CG  . ASP A 1 77  ? 12.046  -41.065 23.806  1.00 26.48  ? 77   ASP A CG  1 
ATOM   619  O  OD1 . ASP A 1 77  ? 11.230  -40.762 22.902  1.00 23.57  ? 77   ASP A OD1 1 
ATOM   620  O  OD2 . ASP A 1 77  ? 11.992  -42.141 24.444  1.00 26.75  ? 77   ASP A OD2 1 
ATOM   621  N  N   . ALA A 1 78  ? 11.169  -37.561 22.703  1.00 20.75  ? 78   ALA A N   1 
ATOM   622  C  CA  . ALA A 1 78  ? 9.832   -36.973 22.713  1.00 20.46  ? 78   ALA A CA  1 
ATOM   623  C  C   . ALA A 1 78  ? 8.858   -37.816 21.872  1.00 21.00  ? 78   ALA A C   1 
ATOM   624  O  O   . ALA A 1 78  ? 7.916   -37.277 21.311  1.00 21.07  ? 78   ALA A O   1 
ATOM   625  C  CB  . ALA A 1 78  ? 9.871   -35.551 22.185  1.00 19.47  ? 78   ALA A CB  1 
ATOM   626  N  N   . SER A 1 79  ? 9.138   -39.112 21.763  1.00 22.34  ? 79   SER A N   1 
ATOM   627  C  CA  . SER A 1 79  ? 8.337   -40.062 20.973  1.00 23.28  ? 79   SER A CA  1 
ATOM   628  C  C   . SER A 1 79  ? 6.867   -40.100 21.392  1.00 23.46  ? 79   SER A C   1 
ATOM   629  O  O   . SER A 1 79  ? 6.550   -40.075 22.593  1.00 22.57  ? 79   SER A O   1 
ATOM   630  C  CB  . SER A 1 79  ? 8.922   -41.467 21.089  1.00 24.94  ? 79   SER A CB  1 
ATOM   631  O  OG  . SER A 1 79  ? 10.275  -41.488 20.670  1.00 24.90  ? 79   SER A OG  1 
ATOM   632  N  N   . LEU A 1 80  ? 5.984   -40.163 20.385  1.00 24.11  ? 80   LEU A N   1 
ATOM   633  C  CA  . LEU A 1 80  ? 4.545   -40.163 20.604  1.00 25.09  ? 80   LEU A CA  1 
ATOM   634  C  C   . LEU A 1 80  ? 4.016   -41.589 20.555  1.00 27.24  ? 80   LEU A C   1 
ATOM   635  O  O   . LEU A 1 80  ? 4.374   -42.390 19.678  1.00 28.11  ? 80   LEU A O   1 
ATOM   636  C  CB  . LEU A 1 80  ? 3.814   -39.256 19.587  1.00 24.34  ? 80   LEU A CB  1 
ATOM   637  C  CG  . LEU A 1 80  ? 2.339   -38.956 19.882  1.00 24.99  ? 80   LEU A CG  1 
ATOM   638  C  CD1 . LEU A 1 80  ? 2.189   -38.013 21.076  1.00 23.76  ? 80   LEU A CD1 1 
ATOM   639  C  CD2 . LEU A 1 80  ? 1.621   -38.397 18.659  1.00 25.44  ? 80   LEU A CD2 1 
ATOM   640  N  N   . LYS A 1 81  ? 3.182   -41.908 21.533  1.00 28.60  ? 81   LYS A N   1 
ATOM   641  C  CA  . LYS A 1 81  ? 2.547   -43.205 21.626  1.00 31.50  ? 81   LYS A CA  1 
ATOM   642  C  C   . LYS A 1 81  ? 1.051   -43.020 21.546  1.00 31.80  ? 81   LYS A C   1 
ATOM   643  O  O   . LYS A 1 81  ? 0.517   -42.136 22.200  1.00 30.57  ? 81   LYS A O   1 
ATOM   644  C  CB  . LYS A 1 81  ? 2.873   -43.841 22.960  1.00 33.06  ? 81   LYS A CB  1 
ATOM   645  C  CG  . LYS A 1 81  ? 4.331   -44.204 23.125  1.00 34.85  ? 81   LYS A CG  1 
ATOM   646  C  CD  . LYS A 1 81  ? 4.706   -44.193 24.577  1.00 36.33  ? 81   LYS A CD  1 
ATOM   647  C  CE  . LYS A 1 81  ? 4.906   -42.772 25.057  1.00 36.40  ? 81   LYS A CE  1 
ATOM   648  N  NZ  . LYS A 1 81  ? 4.101   -42.551 26.277  1.00 38.52  ? 81   LYS A NZ  1 
ATOM   649  N  N   . MET A 1 82  ? 0.379   -43.860 20.755  1.00 33.65  ? 82   MET A N   1 
ATOM   650  C  CA  . MET A 1 82  ? -1.073  -43.883 20.729  1.00 35.19  ? 82   MET A CA  1 
ATOM   651  C  C   . MET A 1 82  ? -1.589  -45.302 20.490  1.00 37.55  ? 82   MET A C   1 
ATOM   652  O  O   . MET A 1 82  ? -0.837  -46.191 20.083  1.00 37.62  ? 82   MET A O   1 
ATOM   653  C  CB  . MET A 1 82  ? -1.630  -42.916 19.673  1.00 34.03  ? 82   MET A CB  1 
ATOM   654  C  CG  . MET A 1 82  ? -1.459  -43.374 18.237  1.00 36.29  ? 82   MET A CG  1 
ATOM   655  S  SD  . MET A 1 82  ? -1.728  -42.061 17.031  1.00 36.43  ? 82   MET A SD  1 
ATOM   656  C  CE  . MET A 1 82  ? -0.318  -41.012 17.322  1.00 32.62  ? 82   MET A CE  1 
ATOM   657  N  N   . ASP A 1 83  ? -2.872  -45.488 20.777  1.00 39.41  ? 83   ASP A N   1 
ATOM   658  C  CA  . ASP A 1 83  ? -3.597  -46.722 20.456  1.00 42.49  ? 83   ASP A CA  1 
ATOM   659  C  C   . ASP A 1 83  ? -3.746  -46.861 18.949  1.00 42.84  ? 83   ASP A C   1 
ATOM   660  O  O   . ASP A 1 83  ? -3.752  -45.859 18.221  1.00 40.82  ? 83   ASP A O   1 
ATOM   661  C  CB  . ASP A 1 83  ? -4.993  -46.712 21.087  1.00 44.22  ? 83   ASP A CB  1 
ATOM   662  C  CG  . ASP A 1 83  ? -4.967  -46.914 22.596  1.00 45.62  ? 83   ASP A CG  1 
ATOM   663  O  OD1 . ASP A 1 83  ? -3.873  -47.147 23.163  1.00 46.13  ? 83   ASP A OD1 1 
ATOM   664  O  OD2 . ASP A 1 83  ? -6.052  -46.839 23.214  1.00 44.65  ? 83   ASP A OD2 1 
ATOM   665  N  N   . LYS A 1 84  ? -3.891  -48.101 18.489  1.00 45.74  ? 84   LYS A N   1 
ATOM   666  C  CA  . LYS A 1 84  ? -4.038  -48.379 17.054  1.00 47.09  ? 84   LYS A CA  1 
ATOM   667  C  C   . LYS A 1 84  ? -5.271  -47.708 16.458  1.00 47.15  ? 84   LYS A C   1 
ATOM   668  O  O   . LYS A 1 84  ? -5.238  -47.278 15.304  1.00 47.06  ? 84   LYS A O   1 
ATOM   669  C  CB  . LYS A 1 84  ? -4.061  -49.892 16.764  1.00 50.84  ? 84   LYS A CB  1 
ATOM   670  C  CG  . LYS A 1 84  ? -5.253  -50.657 17.319  1.00 54.17  ? 84   LYS A CG  1 
ATOM   671  C  CD  . LYS A 1 84  ? -5.230  -52.113 16.857  1.00 57.99  ? 84   LYS A CD  1 
ATOM   672  C  CE  . LYS A 1 84  ? -6.242  -52.957 17.596  1.00 61.45  ? 84   LYS A CE  1 
ATOM   673  N  NZ  . LYS A 1 84  ? -5.920  -54.400 17.473  1.00 66.04  ? 84   LYS A NZ  1 
ATOM   674  N  N   . SER A 1 85  ? -6.349  -47.624 17.241  1.00 47.82  ? 85   SER A N   1 
ATOM   675  C  CA  . SER A 1 85  ? -7.570  -46.959 16.792  1.00 48.19  ? 85   SER A CA  1 
ATOM   676  C  C   . SER A 1 85  ? -7.345  -45.473 16.489  1.00 45.30  ? 85   SER A C   1 
ATOM   677  O  O   . SER A 1 85  ? -7.930  -44.953 15.542  1.00 46.10  ? 85   SER A O   1 
ATOM   678  C  CB  . SER A 1 85  ? -8.718  -47.149 17.804  1.00 49.90  ? 85   SER A CB  1 
ATOM   679  O  OG  . SER A 1 85  ? -8.343  -46.732 19.108  1.00 49.90  ? 85   SER A OG  1 
ATOM   680  N  N   . ASP A 1 86  ? -6.496  -44.797 17.273  1.00 42.35  ? 86   ASP A N   1 
ATOM   681  C  CA  . ASP A 1 86  ? -6.137  -43.399 16.998  1.00 39.71  ? 86   ASP A CA  1 
ATOM   682  C  C   . ASP A 1 86  ? -5.149  -43.296 15.838  1.00 38.61  ? 86   ASP A C   1 
ATOM   683  O  O   . ASP A 1 86  ? -5.165  -42.309 15.116  1.00 38.57  ? 86   ASP A O   1 
ATOM   684  C  CB  . ASP A 1 86  ? -5.570  -42.690 18.242  1.00 37.67  ? 86   ASP A CB  1 
ATOM   685  C  CG  . ASP A 1 86  ? -6.646  -42.373 19.293  1.00 38.66  ? 86   ASP A CG  1 
ATOM   686  O  OD1 . ASP A 1 86  ? -7.842  -42.496 18.995  1.00 40.38  ? 86   ASP A OD1 1 
ATOM   687  O  OD2 . ASP A 1 86  ? -6.296  -41.987 20.428  1.00 38.62  ? 86   ASP A OD2 1 
ATOM   688  N  N   . ALA A 1 87  ? -4.314  -44.319 15.658  1.00 38.74  ? 87   ALA A N   1 
ATOM   689  C  CA  . ALA A 1 87  ? -3.321  -44.360 14.573  1.00 38.35  ? 87   ALA A CA  1 
ATOM   690  C  C   . ALA A 1 87  ? -3.926  -44.592 13.196  1.00 40.64  ? 87   ALA A C   1 
ATOM   691  O  O   . ALA A 1 87  ? -3.626  -43.856 12.262  1.00 40.25  ? 87   ALA A O   1 
ATOM   692  C  CB  . ALA A 1 87  ? -2.271  -45.428 14.858  1.00 38.54  ? 87   ALA A CB  1 
ATOM   693  N  N   . VAL A 1 88  ? -4.784  -45.607 13.080  1.00 43.05  ? 88   VAL A N   1 
ATOM   694  C  CA  . VAL A 1 88  ? -5.319  -46.049 11.788  1.00 46.17  ? 88   VAL A CA  1 
ATOM   695  C  C   . VAL A 1 88  ? -6.157  -44.976 11.077  1.00 46.20  ? 88   VAL A C   1 
ATOM   696  O  O   . VAL A 1 88  ? -6.211  -44.933 9.840   1.00 47.72  ? 88   VAL A O   1 
ATOM   697  C  CB  . VAL A 1 88  ? -6.167  -47.346 11.929  1.00 49.28  ? 88   VAL A CB  1 
ATOM   698  C  CG1 . VAL A 1 88  ? -6.766  -47.733 10.603  1.00 53.47  ? 88   VAL A CG1 1 
ATOM   699  C  CG2 . VAL A 1 88  ? -5.322  -48.500 12.453  1.00 50.59  ? 88   VAL A CG2 1 
ATOM   700  N  N   . SER A 1 89  ? -6.806  -44.114 11.852  1.00 44.25  ? 89   SER A N   1 
ATOM   701  C  CA  . SER A 1 89  ? -7.587  -43.026 11.276  1.00 45.40  ? 89   SER A CA  1 
ATOM   702  C  C   . SER A 1 89  ? -6.723  -41.797 10.949  1.00 43.43  ? 89   SER A C   1 
ATOM   703  O  O   . SER A 1 89  ? -7.200  -40.869 10.295  1.00 44.86  ? 89   SER A O   1 
ATOM   704  C  CB  . SER A 1 89  ? -8.750  -42.649 12.214  1.00 45.57  ? 89   SER A CB  1 
ATOM   705  O  OG  . SER A 1 89  ? -8.293  -42.510 13.549  1.00 44.93  ? 89   SER A OG  1 
ATOM   706  N  N   . HIS A 1 90  ? -5.453  -41.813 11.373  1.00 40.84  ? 90   HIS A N   1 
ATOM   707  C  CA  . HIS A 1 90  ? -4.553  -40.663 11.245  1.00 38.86  ? 90   HIS A CA  1 
ATOM   708  C  C   . HIS A 1 90  ? -3.168  -41.058 10.703  1.00 38.39  ? 90   HIS A C   1 
ATOM   709  O  O   . HIS A 1 90  ? -2.143  -40.843 11.355  1.00 36.51  ? 90   HIS A O   1 
ATOM   710  C  CB  . HIS A 1 90  ? -4.385  -39.971 12.603  1.00 35.97  ? 90   HIS A CB  1 
ATOM   711  C  CG  . HIS A 1 90  ? -5.663  -39.464 13.197  1.00 36.69  ? 90   HIS A CG  1 
ATOM   712  N  ND1 . HIS A 1 90  ? -6.216  -40.000 14.339  1.00 36.82  ? 90   HIS A ND1 1 
ATOM   713  C  CD2 . HIS A 1 90  ? -6.495  -38.469 12.807  1.00 38.47  ? 90   HIS A CD2 1 
ATOM   714  C  CE1 . HIS A 1 90  ? -7.331  -39.353 14.632  1.00 38.80  ? 90   HIS A CE1 1 
ATOM   715  N  NE2 . HIS A 1 90  ? -7.524  -38.421 13.716  1.00 38.99  ? 90   HIS A NE2 1 
ATOM   716  N  N   . THR A 1 91  ? -3.139  -41.627 9.506   1.00 40.94  ? 91   THR A N   1 
ATOM   717  C  CA  . THR A 1 91  ? -1.872  -41.898 8.837   1.00 41.09  ? 91   THR A CA  1 
ATOM   718  C  C   . THR A 1 91  ? -1.457  -40.654 8.059   1.00 40.99  ? 91   THR A C   1 
ATOM   719  O  O   . THR A 1 91  ? -2.305  -39.845 7.661   1.00 41.52  ? 91   THR A O   1 
ATOM   720  C  CB  . THR A 1 91  ? -1.955  -43.117 7.898   1.00 44.16  ? 91   THR A CB  1 
ATOM   721  O  OG1 . THR A 1 91  ? -2.941  -42.891 6.887   1.00 47.31  ? 91   THR A OG1 1 
ATOM   722  C  CG2 . THR A 1 91  ? -2.298  -44.360 8.682   1.00 44.45  ? 91   THR A CG2 1 
ATOM   723  N  N   . GLY A 1 92  ? -0.150  -40.504 7.855   1.00 40.46  ? 92   GLY A N   1 
ATOM   724  C  CA  . GLY A 1 92  ? 0.398   -39.332 7.173   1.00 40.63  ? 92   GLY A CA  1 
ATOM   725  C  C   . GLY A 1 92  ? 1.522   -38.691 7.958   1.00 37.48  ? 92   GLY A C   1 
ATOM   726  O  O   . GLY A 1 92  ? 2.100   -39.302 8.848   1.00 35.93  ? 92   GLY A O   1 
ATOM   727  N  N   . ASN A 1 93  ? 1.818   -37.440 7.632   1.00 37.43  ? 93   ASN A N   1 
ATOM   728  C  CA  . ASN A 1 93  ? 2.962   -36.740 8.201   1.00 35.25  ? 93   ASN A CA  1 
ATOM   729  C  C   . ASN A 1 93  ? 2.719   -36.090 9.572   1.00 32.00  ? 93   ASN A C   1 
ATOM   730  O  O   . ASN A 1 93  ? 1.876   -35.198 9.718   1.00 31.86  ? 93   ASN A O   1 
ATOM   731  C  CB  . ASN A 1 93  ? 3.454   -35.692 7.209   1.00 37.37  ? 93   ASN A CB  1 
ATOM   732  C  CG  . ASN A 1 93  ? 3.984   -36.315 5.936   1.00 42.15  ? 93   ASN A CG  1 
ATOM   733  O  OD1 . ASN A 1 93  ? 4.886   -37.145 5.984   1.00 42.31  ? 93   ASN A OD1 1 
ATOM   734  N  ND2 . ASN A 1 93  ? 3.442   -35.879 4.780   1.00 49.31  ? 93   ASN A ND2 1 
ATOM   735  N  N   . TYR A 1 94  ? 3.482   -36.552 10.562  1.00 29.36  ? 94   TYR A N   1 
ATOM   736  C  CA  . TYR A 1 94  ? 3.508   -35.961 11.891  1.00 26.82  ? 94   TYR A CA  1 
ATOM   737  C  C   . TYR A 1 94  ? 4.729   -35.050 12.053  1.00 25.65  ? 94   TYR A C   1 
ATOM   738  O  O   . TYR A 1 94  ? 5.799   -35.366 11.579  1.00 25.70  ? 94   TYR A O   1 
ATOM   739  C  CB  . TYR A 1 94  ? 3.589   -37.051 12.950  1.00 25.12  ? 94   TYR A CB  1 
ATOM   740  C  CG  . TYR A 1 94  ? 2.292   -37.766 13.160  1.00 26.31  ? 94   TYR A CG  1 
ATOM   741  C  CD1 . TYR A 1 94  ? 1.484   -37.480 14.254  1.00 24.90  ? 94   TYR A CD1 1 
ATOM   742  C  CD2 . TYR A 1 94  ? 1.858   -38.723 12.244  1.00 26.46  ? 94   TYR A CD2 1 
ATOM   743  C  CE1 . TYR A 1 94  ? 0.289   -38.143 14.445  1.00 25.81  ? 94   TYR A CE1 1 
ATOM   744  C  CE2 . TYR A 1 94  ? 0.667   -39.383 12.426  1.00 29.12  ? 94   TYR A CE2 1 
ATOM   745  C  CZ  . TYR A 1 94  ? -0.117  -39.086 13.527  1.00 28.02  ? 94   TYR A CZ  1 
ATOM   746  O  OH  . TYR A 1 94  ? -1.309  -39.740 13.706  1.00 28.68  ? 94   TYR A OH  1 
ATOM   747  N  N   . THR A 1 95  ? 4.552   -33.933 12.741  1.00 25.19  ? 95   THR A N   1 
ATOM   748  C  CA  . THR A 1 95  ? 5.654   -33.050 13.074  1.00 24.43  ? 95   THR A CA  1 
ATOM   749  C  C   . THR A 1 95  ? 5.832   -33.062 14.580  1.00 22.62  ? 95   THR A C   1 
ATOM   750  O  O   . THR A 1 95  ? 4.855   -32.886 15.327  1.00 22.68  ? 95   THR A O   1 
ATOM   751  C  CB  . THR A 1 95  ? 5.394   -31.621 12.584  1.00 25.81  ? 95   THR A CB  1 
ATOM   752  O  OG1 . THR A 1 95  ? 5.245   -31.630 11.157  1.00 28.32  ? 95   THR A OG1 1 
ATOM   753  C  CG2 . THR A 1 95  ? 6.547   -30.711 12.977  1.00 25.38  ? 95   THR A CG2 1 
ATOM   754  N  N   . CYS A 1 96  ? 7.066   -33.326 15.013  1.00 22.13  ? 96   CYS A N   1 
ATOM   755  C  CA  . CYS A 1 96  ? 7.458   -33.264 16.420  1.00 20.54  ? 96   CYS A CA  1 
ATOM   756  C  C   . CYS A 1 96  ? 8.257   -31.980 16.600  1.00 20.05  ? 96   CYS A C   1 
ATOM   757  O  O   . CYS A 1 96  ? 9.256   -31.781 15.924  1.00 20.07  ? 96   CYS A O   1 
ATOM   758  C  CB  . CYS A 1 96  ? 8.319   -34.465 16.795  1.00 20.77  ? 96   CYS A CB  1 
ATOM   759  S  SG  . CYS A 1 96  ? 9.022   -34.488 18.493  1.00 21.31  ? 96   CYS A SG  1 
ATOM   760  N  N   . GLU A 1 97  ? 7.788   -31.124 17.502  1.00 19.94  ? 97   GLU A N   1 
ATOM   761  C  CA  . GLU A 1 97  ? 8.425   -29.851 17.806  1.00 20.00  ? 97   GLU A CA  1 
ATOM   762  C  C   . GLU A 1 97  ? 8.798   -29.877 19.280  1.00 18.78  ? 97   GLU A C   1 
ATOM   763  O  O   . GLU A 1 97  ? 7.950   -30.185 20.148  1.00 18.26  ? 97   GLU A O   1 
ATOM   764  C  CB  . GLU A 1 97  ? 7.474   -28.696 17.477  1.00 21.32  ? 97   GLU A CB  1 
ATOM   765  C  CG  . GLU A 1 97  ? 8.073   -27.297 17.676  1.00 22.75  ? 97   GLU A CG  1 
ATOM   766  C  CD  . GLU A 1 97  ? 7.014   -26.198 17.819  1.00 25.82  ? 97   GLU A CD  1 
ATOM   767  O  OE1 . GLU A 1 97  ? 6.786   -25.469 16.833  1.00 30.71  ? 97   GLU A OE1 1 
ATOM   768  O  OE2 . GLU A 1 97  ? 6.427   -26.050 18.924  1.00 29.19  ? 97   GLU A OE2 1 
ATOM   769  N  N   . VAL A 1 98  ? 10.083  -29.611 19.557  1.00 18.83  ? 98   VAL A N   1 
ATOM   770  C  CA  . VAL A 1 98  ? 10.599  -29.536 20.927  1.00 18.51  ? 98   VAL A CA  1 
ATOM   771  C  C   . VAL A 1 98  ? 11.219  -28.168 21.159  1.00 18.12  ? 98   VAL A C   1 
ATOM   772  O  O   . VAL A 1 98  ? 11.878  -27.624 20.272  1.00 18.34  ? 98   VAL A O   1 
ATOM   773  C  CB  . VAL A 1 98  ? 11.632  -30.657 21.223  1.00 18.26  ? 98   VAL A CB  1 
ATOM   774  C  CG1 . VAL A 1 98  ? 12.087  -30.578 22.668  1.00 18.90  ? 98   VAL A CG1 1 
ATOM   775  C  CG2 . VAL A 1 98  ? 11.036  -32.024 20.931  1.00 18.45  ? 98   VAL A CG2 1 
ATOM   776  N  N   . THR A 1 99  ? 10.965  -27.586 22.331  1.00 18.53  ? 99   THR A N   1 
ATOM   777  C  CA  . THR A 1 99  ? 11.534  -26.283 22.699  1.00 19.80  ? 99   THR A CA  1 
ATOM   778  C  C   . THR A 1 99  ? 12.111  -26.359 24.098  1.00 19.97  ? 99   THR A C   1 
ATOM   779  O  O   . THR A 1 99  ? 11.480  -26.922 25.012  1.00 20.05  ? 99   THR A O   1 
ATOM   780  C  CB  . THR A 1 99  ? 10.460  -25.155 22.689  1.00 21.00  ? 99   THR A CB  1 
ATOM   781  O  OG1 . THR A 1 99  ? 9.787   -25.123 21.425  1.00 22.63  ? 99   THR A OG1 1 
ATOM   782  C  CG2 . THR A 1 99  ? 11.078  -23.776 22.985  1.00 22.49  ? 99   THR A CG2 1 
ATOM   783  N  N   . GLU A 1 100 ? 13.301  -25.784 24.259  1.00 19.91  ? 100  GLU A N   1 
ATOM   784  C  CA  . GLU A 1 100 ? 13.896  -25.562 25.545  1.00 21.11  ? 100  GLU A CA  1 
ATOM   785  C  C   . GLU A 1 100 ? 13.805  -24.056 25.804  1.00 22.47  ? 100  GLU A C   1 
ATOM   786  O  O   . GLU A 1 100 ? 14.403  -23.257 25.081  1.00 22.17  ? 100  GLU A O   1 
ATOM   787  C  CB  . GLU A 1 100 ? 15.348  -26.002 25.556  1.00 21.15  ? 100  GLU A CB  1 
ATOM   788  C  CG  . GLU A 1 100 ? 15.552  -27.482 25.568  1.00 20.62  ? 100  GLU A CG  1 
ATOM   789  C  CD  . GLU A 1 100 ? 17.033  -27.857 25.626  1.00 21.06  ? 100  GLU A CD  1 
ATOM   790  O  OE1 . GLU A 1 100 ? 17.349  -28.965 26.072  1.00 22.22  ? 100  GLU A OE1 1 
ATOM   791  O  OE2 . GLU A 1 100 ? 17.889  -27.035 25.235  1.00 21.95  ? 100  GLU A OE2 1 
ATOM   792  N  N   . LEU A 1 101 ? 13.038  -23.686 26.821  1.00 22.75  ? 101  LEU A N   1 
ATOM   793  C  CA  . LEU A 1 101 ? 12.724  -22.279 27.082  1.00 25.37  ? 101  LEU A CA  1 
ATOM   794  C  C   . LEU A 1 101 ? 13.963  -21.496 27.461  1.00 24.12  ? 101  LEU A C   1 
ATOM   795  O  O   . LEU A 1 101 ? 14.911  -22.034 28.052  1.00 21.33  ? 101  LEU A O   1 
ATOM   796  C  CB  . LEU A 1 101 ? 11.659  -22.113 28.182  1.00 27.23  ? 101  LEU A CB  1 
ATOM   797  C  CG  . LEU A 1 101 ? 10.367  -22.958 28.118  1.00 30.23  ? 101  LEU A CG  1 
ATOM   798  C  CD1 . LEU A 1 101 ? 9.465   -22.636 29.318  1.00 35.43  ? 101  LEU A CD1 1 
ATOM   799  C  CD2 . LEU A 1 101 ? 9.600   -22.779 26.817  1.00 32.28  ? 101  LEU A CD2 1 
ATOM   800  N  N   . THR A 1 102 ? 13.940  -20.219 27.098  1.00 26.89  ? 102  THR A N   1 
ATOM   801  C  CA  . THR A 1 102 ? 14.909  -19.251 27.580  1.00 27.18  ? 102  THR A CA  1 
ATOM   802  C  C   . THR A 1 102 ? 14.968  -19.286 29.099  1.00 25.34  ? 102  THR A C   1 
ATOM   803  O  O   . THR A 1 102 ? 13.983  -19.622 29.781  1.00 25.80  ? 102  THR A O   1 
ATOM   804  C  CB  . THR A 1 102 ? 14.563  -17.809 27.123  1.00 31.70  ? 102  THR A CB  1 
ATOM   805  O  OG1 . THR A 1 102 ? 14.666  -17.726 25.702  1.00 38.45  ? 102  THR A OG1 1 
ATOM   806  C  CG2 . THR A 1 102 ? 15.502  -16.788 27.720  1.00 30.71  ? 102  THR A CG2 1 
ATOM   807  N  N   . ARG A 1 103 ? 16.146  -18.958 29.602  1.00 23.73  ? 103  ARG A N   1 
ATOM   808  C  CA  . ARG A 1 103 ? 16.424  -18.885 31.022  1.00 23.73  ? 103  ARG A CA  1 
ATOM   809  C  C   . ARG A 1 103 ? 17.212  -17.600 31.235  1.00 23.40  ? 103  ARG A C   1 
ATOM   810  O  O   . ARG A 1 103 ? 18.161  -17.319 30.497  1.00 23.02  ? 103  ARG A O   1 
ATOM   811  C  CB  . ARG A 1 103 ? 17.276  -20.073 31.473  1.00 22.59  ? 103  ARG A CB  1 
ATOM   812  C  CG  . ARG A 1 103 ? 16.667  -21.436 31.189  1.00 25.49  ? 103  ARG A CG  1 
ATOM   813  C  CD  . ARG A 1 103 ? 17.699  -22.528 31.391  1.00 24.39  ? 103  ARG A CD  1 
ATOM   814  N  NE  . ARG A 1 103 ? 17.840  -22.855 32.804  1.00 27.32  ? 103  ARG A NE  1 
ATOM   815  C  CZ  . ARG A 1 103 ? 18.979  -23.186 33.410  1.00 28.15  ? 103  ARG A CZ  1 
ATOM   816  N  NH1 . ARG A 1 103 ? 18.954  -23.501 34.693  1.00 31.72  ? 103  ARG A NH1 1 
ATOM   817  N  NH2 . ARG A 1 103 ? 20.142  -23.176 32.762  1.00 26.77  ? 103  ARG A NH2 1 
ATOM   818  N  N   . GLU A 1 104 ? 16.819  -16.807 32.223  1.00 24.82  ? 104  GLU A N   1 
ATOM   819  C  CA  . GLU A 1 104 ? 17.562  -15.584 32.561  1.00 25.23  ? 104  GLU A CA  1 
ATOM   820  C  C   . GLU A 1 104 ? 17.701  -15.447 34.085  1.00 25.34  ? 104  GLU A C   1 
ATOM   821  O  O   . GLU A 1 104 ? 17.029  -16.125 34.871  1.00 27.35  ? 104  GLU A O   1 
ATOM   822  C  CB  . GLU A 1 104 ? 16.902  -14.319 31.957  1.00 29.17  ? 104  GLU A CB  1 
ATOM   823  C  CG  . GLU A 1 104 ? 15.540  -13.883 32.584  1.00 35.44  ? 104  GLU A CG  1 
ATOM   824  C  CD  . GLU A 1 104 ? 15.124  -12.416 32.293  1.00 42.05  ? 104  GLU A CD  1 
ATOM   825  O  OE1 . GLU A 1 104 ? 15.984  -11.518 32.201  1.00 45.29  ? 104  GLU A OE1 1 
ATOM   826  O  OE2 . GLU A 1 104 ? 13.903  -12.146 32.197  1.00 51.93  ? 104  GLU A OE2 1 
ATOM   827  N  N   . GLY A 1 105 ? 18.579  -14.548 34.491  1.00 25.04  ? 105  GLY A N   1 
ATOM   828  C  CA  . GLY A 1 105 ? 18.692  -14.184 35.887  1.00 26.25  ? 105  GLY A CA  1 
ATOM   829  C  C   . GLY A 1 105 ? 19.616  -13.000 36.017  1.00 25.12  ? 105  GLY A C   1 
ATOM   830  O  O   . GLY A 1 105 ? 20.411  -12.709 35.116  1.00 23.24  ? 105  GLY A O   1 
ATOM   831  N  N   . GLU A 1 106 ? 19.505  -12.303 37.135  1.00 27.60  ? 106  GLU A N   1 
ATOM   832  C  CA  . GLU A 1 106 ? 20.373  -11.158 37.394  1.00 27.48  ? 106  GLU A CA  1 
ATOM   833  C  C   . GLU A 1 106 ? 20.788  -11.128 38.849  1.00 29.13  ? 106  GLU A C   1 
ATOM   834  O  O   . GLU A 1 106 ? 20.132  -11.710 39.701  1.00 32.65  ? 106  GLU A O   1 
ATOM   835  C  CB  . GLU A 1 106 ? 19.703  -9.838  36.992  1.00 30.73  ? 106  GLU A CB  1 
ATOM   836  C  CG  . GLU A 1 106 ? 18.508  -9.427  37.845  1.00 38.32  ? 106  GLU A CG  1 
ATOM   837  C  CD  . GLU A 1 106 ? 18.102  -7.976  37.649  1.00 44.09  ? 106  GLU A CD  1 
ATOM   838  O  OE1 . GLU A 1 106 ? 17.497  -7.679  36.599  1.00 49.51  ? 106  GLU A OE1 1 
ATOM   839  O  OE2 . GLU A 1 106 ? 18.359  -7.136  38.553  1.00 50.07  ? 106  GLU A OE2 1 
ATOM   840  N  N   . THR A 1 107 ? 21.886  -10.430 39.121  1.00 27.88  ? 107  THR A N   1 
ATOM   841  C  CA  . THR A 1 107 ? 22.371  -10.258 40.479  1.00 30.39  ? 107  THR A CA  1 
ATOM   842  C  C   . THR A 1 107 ? 23.093  -8.923  40.610  1.00 29.68  ? 107  THR A C   1 
ATOM   843  O  O   . THR A 1 107 ? 23.624  -8.376  39.624  1.00 25.99  ? 107  THR A O   1 
ATOM   844  C  CB  . THR A 1 107 ? 23.269  -11.444 40.956  1.00 30.47  ? 107  THR A CB  1 
ATOM   845  O  OG1 . THR A 1 107 ? 23.501  -11.334 42.371  1.00 35.70  ? 107  THR A OG1 1 
ATOM   846  C  CG2 . THR A 1 107 ? 24.596  -11.453 40.243  1.00 25.87  ? 107  THR A CG2 1 
ATOM   847  N  N   . ILE A 1 108 ? 23.081  -8.391  41.831  1.00 33.38  ? 108  ILE A N   1 
ATOM   848  C  CA  . ILE A 1 108 ? 23.641  -7.081  42.100  1.00 33.31  ? 108  ILE A CA  1 
ATOM   849  C  C   . ILE A 1 108 ? 24.862  -7.193  43.008  1.00 33.30  ? 108  ILE A C   1 
ATOM   850  O  O   . ILE A 1 108 ? 24.846  -7.908  43.999  1.00 36.76  ? 108  ILE A O   1 
ATOM   851  C  CB  . ILE A 1 108 ? 22.607  -6.129  42.743  1.00 39.45  ? 108  ILE A CB  1 
ATOM   852  C  CG1 . ILE A 1 108 ? 21.388  -5.954  41.835  1.00 41.03  ? 108  ILE A CG1 1 
ATOM   853  C  CG2 . ILE A 1 108 ? 23.249  -4.750  43.036  1.00 39.56  ? 108  ILE A CG2 1 
ATOM   854  C  CD1 . ILE A 1 108 ? 20.247  -5.200  42.492  1.00 50.71  ? 108  ILE A CD1 1 
ATOM   855  N  N   . ILE A 1 109 ? 25.922  -6.489  42.636  1.00 30.32  ? 109  ILE A N   1 
ATOM   856  C  CA  . ILE A 1 109 ? 27.136  -6.388  43.443  1.00 30.50  ? 109  ILE A CA  1 
ATOM   857  C  C   . ILE A 1 109 ? 27.482  -4.920  43.546  1.00 30.21  ? 109  ILE A C   1 
ATOM   858  O  O   . ILE A 1 109 ? 27.520  -4.234  42.530  1.00 28.34  ? 109  ILE A O   1 
ATOM   859  C  CB  . ILE A 1 109 ? 28.346  -7.092  42.780  1.00 27.70  ? 109  ILE A CB  1 
ATOM   860  C  CG1 . ILE A 1 109 ? 27.955  -8.470  42.225  1.00 29.29  ? 109  ILE A CG1 1 
ATOM   861  C  CG2 . ILE A 1 109 ? 29.509  -7.165  43.770  1.00 30.93  ? 109  ILE A CG2 1 
ATOM   862  C  CD1 . ILE A 1 109 ? 27.495  -8.403  40.749  1.00 25.90  ? 109  ILE A CD1 1 
ATOM   863  N  N   . GLU A 1 110 ? 27.726  -4.438  44.762  1.00 32.96  ? 110  GLU A N   1 
ATOM   864  C  CA  . GLU A 1 110 ? 28.243  -3.105  44.939  1.00 32.82  ? 110  GLU A CA  1 
ATOM   865  C  C   . GLU A 1 110 ? 29.766  -3.147  44.879  1.00 30.23  ? 110  GLU A C   1 
ATOM   866  O  O   . GLU A 1 110 ? 30.417  -3.893  45.619  1.00 31.52  ? 110  GLU A O   1 
ATOM   867  C  CB  . GLU A 1 110 ? 27.794  -2.489  46.273  1.00 38.41  ? 110  GLU A CB  1 
ATOM   868  C  CG  . GLU A 1 110 ? 27.966  -0.971  46.282  1.00 38.80  ? 110  GLU A CG  1 
ATOM   869  C  CD  . GLU A 1 110 ? 27.678  -0.316  47.630  1.00 45.25  ? 110  GLU A CD  1 
ATOM   870  O  OE1 . GLU A 1 110 ? 27.185  -0.999  48.557  1.00 49.03  ? 110  GLU A OE1 1 
ATOM   871  O  OE2 . GLU A 1 110 ? 27.948  0.899   47.756  1.00 44.34  ? 110  GLU A OE2 1 
ATOM   872  N  N   . LEU A 1 111 ? 30.317  -2.338  43.986  1.00 28.24  ? 111  LEU A N   1 
ATOM   873  C  CA  . LEU A 1 111 ? 31.732  -2.008  43.971  1.00 27.00  ? 111  LEU A CA  1 
ATOM   874  C  C   . LEU A 1 111 ? 31.968  -0.805  44.884  1.00 28.92  ? 111  LEU A C   1 
ATOM   875  O  O   . LEU A 1 111 ? 31.558  0.316   44.574  1.00 29.14  ? 111  LEU A O   1 
ATOM   876  C  CB  . LEU A 1 111 ? 32.171  -1.654  42.554  1.00 25.60  ? 111  LEU A CB  1 
ATOM   877  C  CG  . LEU A 1 111 ? 33.643  -1.284  42.402  1.00 26.48  ? 111  LEU A CG  1 
ATOM   878  C  CD1 . LEU A 1 111 ? 34.514  -2.496  42.702  1.00 26.95  ? 111  LEU A CD1 1 
ATOM   879  C  CD2 . LEU A 1 111 ? 33.932  -0.706  41.013  1.00 26.93  ? 111  LEU A CD2 1 
ATOM   880  N  N   . LYS A 1 112 ? 32.638  -1.052  46.000  1.00 30.96  ? 112  LYS A N   1 
ATOM   881  C  CA  . LYS A 1 112 ? 32.896  -0.016  46.985  1.00 33.26  ? 112  LYS A CA  1 
ATOM   882  C  C   . LYS A 1 112 ? 34.360  0.320   46.955  1.00 32.23  ? 112  LYS A C   1 
ATOM   883  O  O   . LYS A 1 112 ? 35.192  -0.548  46.708  1.00 32.39  ? 112  LYS A O   1 
ATOM   884  C  CB  . LYS A 1 112 ? 32.534  -0.504  48.386  1.00 38.34  ? 112  LYS A CB  1 
ATOM   885  C  CG  . LYS A 1 112 ? 31.141  -1.040  48.498  1.00 41.58  ? 112  LYS A CG  1 
ATOM   886  C  CD  . LYS A 1 112 ? 30.818  -1.467  49.924  1.00 49.11  ? 112  LYS A CD  1 
ATOM   887  C  CE  . LYS A 1 112 ? 30.224  -0.336  50.745  1.00 56.18  ? 112  LYS A CE  1 
ATOM   888  N  NZ  . LYS A 1 112 ? 29.127  -0.864  51.617  1.00 65.89  ? 112  LYS A NZ  1 
ATOM   889  N  N   . TYR A 1 113 ? 34.660  1.585   47.222  1.00 32.64  ? 113  TYR A N   1 
ATOM   890  C  CA  . TYR A 1 113 ? 36.025  2.062   47.309  1.00 32.85  ? 113  TYR A CA  1 
ATOM   891  C  C   . TYR A 1 113 ? 36.356  2.369   48.760  1.00 36.17  ? 113  TYR A C   1 
ATOM   892  O  O   . TYR A 1 113 ? 35.550  3.000   49.447  1.00 38.28  ? 113  TYR A O   1 
ATOM   893  C  CB  . TYR A 1 113 ? 36.173  3.332   46.480  1.00 31.35  ? 113  TYR A CB  1 
ATOM   894  C  CG  . TYR A 1 113 ? 37.583  3.872   46.494  1.00 32.40  ? 113  TYR A CG  1 
ATOM   895  C  CD1 . TYR A 1 113 ? 38.590  3.228   45.786  1.00 33.29  ? 113  TYR A CD1 1 
ATOM   896  C  CD2 . TYR A 1 113 ? 37.915  5.009   47.225  1.00 32.30  ? 113  TYR A CD2 1 
ATOM   897  C  CE1 . TYR A 1 113 ? 39.894  3.694   45.794  1.00 34.71  ? 113  TYR A CE1 1 
ATOM   898  C  CE2 . TYR A 1 113 ? 39.234  5.496   47.241  1.00 34.98  ? 113  TYR A CE2 1 
ATOM   899  C  CZ  . TYR A 1 113 ? 40.219  4.817   46.514  1.00 36.03  ? 113  TYR A CZ  1 
ATOM   900  O  OH  . TYR A 1 113 ? 41.521  5.263   46.495  1.00 37.31  ? 113  TYR A OH  1 
ATOM   901  N  N   . ARG A 1 114 ? 37.528  1.940   49.232  1.00 38.55  ? 114  ARG A N   1 
ATOM   902  C  CA  . ARG A 1 114 ? 37.967  2.271   50.606  1.00 42.77  ? 114  ARG A CA  1 
ATOM   903  C  C   . ARG A 1 114 ? 39.244  3.111   50.593  1.00 42.22  ? 114  ARG A C   1 
ATOM   904  O  O   . ARG A 1 114 ? 40.235  2.737   49.969  1.00 42.06  ? 114  ARG A O   1 
ATOM   905  C  CB  . ARG A 1 114 ? 38.186  1.021   51.465  1.00 48.93  ? 114  ARG A CB  1 
ATOM   906  C  CG  . ARG A 1 114 ? 38.557  1.358   52.931  1.00 55.46  ? 114  ARG A CG  1 
ATOM   907  C  CD  . ARG A 1 114 ? 38.493  0.127   53.823  1.00 64.79  ? 114  ARG A CD  1 
ATOM   908  N  NE  . ARG A 1 114 ? 39.330  -0.963  53.322  1.00 67.43  ? 114  ARG A NE  1 
ATOM   909  C  CZ  . ARG A 1 114 ? 40.649  -1.045  53.489  1.00 72.28  ? 114  ARG A CZ  1 
ATOM   910  N  NH1 . ARG A 1 114 ? 41.317  -0.116  54.166  1.00 74.77  ? 114  ARG A NH1 1 
ATOM   911  N  NH2 . ARG A 1 114 ? 41.306  -2.082  52.985  1.00 77.01  ? 114  ARG A NH2 1 
ATOM   912  N  N   . VAL A 1 115 ? 39.209  4.233   51.302  1.00 42.81  ? 115  VAL A N   1 
ATOM   913  C  CA  . VAL A 1 115 ? 40.299  5.212   51.278  1.00 42.76  ? 115  VAL A CA  1 
ATOM   914  C  C   . VAL A 1 115 ? 41.620  4.674   51.841  1.00 47.23  ? 115  VAL A C   1 
ATOM   915  O  O   . VAL A 1 115 ? 41.709  4.393   53.102  1.00 52.42  ? 115  VAL A O   1 
ATOM   916  C  CB  . VAL A 1 115 ? 39.876  6.497   52.018  1.00 43.47  ? 115  VAL A CB  1 
ATOM   917  C  CG1 . VAL A 1 115 ? 41.070  7.398   52.318  1.00 44.52  ? 115  VAL A CG1 1 
ATOM   918  C  CG2 . VAL A 1 115 ? 38.830  7.224   51.184  1.00 41.39  ? 115  VAL A CG2 1 
HETATM 919  N  N   . PCA B 1 1   ? 15.264  -17.996 35.608  1.00 36.47  ? 1    PCA B N   1 
HETATM 920  C  CA  . PCA B 1 1   ? 15.532  -19.286 36.286  1.00 36.64  ? 1    PCA B CA  1 
HETATM 921  C  CB  . PCA B 1 1   ? 14.820  -20.426 35.551  1.00 37.68  ? 1    PCA B CB  1 
HETATM 922  C  CG  . PCA B 1 1   ? 14.330  -19.864 34.218  1.00 38.01  ? 1    PCA B CG  1 
HETATM 923  C  CD  . PCA B 1 1   ? 14.567  -18.374 34.370  1.00 36.37  ? 1    PCA B CD  1 
HETATM 924  O  OE  . PCA B 1 1   ? 14.182  -17.552 33.530  1.00 35.63  ? 1    PCA B OE  1 
HETATM 925  C  C   . PCA B 1 1   ? 17.006  -19.621 36.544  1.00 34.06  ? 1    PCA B C   1 
HETATM 926  O  O   . PCA B 1 1   ? 17.295  -20.632 37.188  1.00 34.71  ? 1    PCA B O   1 
ATOM   927  N  N   . LEU B 1 2   ? 17.924  -18.795 36.045  1.00 31.27  ? 2    LEU B N   1 
ATOM   928  C  CA  . LEU B 1 2   ? 19.330  -18.916 36.378  1.00 29.65  ? 2    LEU B CA  1 
ATOM   929  C  C   . LEU B 1 2   ? 19.562  -18.452 37.806  1.00 30.79  ? 2    LEU B C   1 
ATOM   930  O  O   . LEU B 1 2   ? 19.021  -17.425 38.233  1.00 31.46  ? 2    LEU B O   1 
ATOM   931  C  CB  . LEU B 1 2   ? 20.208  -18.078 35.424  1.00 26.82  ? 2    LEU B CB  1 
ATOM   932  C  CG  . LEU B 1 2   ? 20.188  -18.392 33.920  1.00 25.44  ? 2    LEU B CG  1 
ATOM   933  C  CD1 . LEU B 1 2   ? 21.228  -17.553 33.143  1.00 22.46  ? 2    LEU B CD1 1 
ATOM   934  C  CD2 . LEU B 1 2   ? 20.425  -19.868 33.674  1.00 23.53  ? 2    LEU B CD2 1 
ATOM   935  N  N   . LEU B 1 3   ? 20.385  -19.202 38.527  1.00 30.94  ? 3    LEU B N   1 
ATOM   936  C  CA  . LEU B 1 3   ? 20.642  -18.958 39.934  1.00 33.35  ? 3    LEU B CA  1 
ATOM   937  C  C   . LEU B 1 3   ? 22.086  -18.523 40.150  1.00 32.32  ? 3    LEU B C   1 
ATOM   938  O  O   . LEU B 1 3   ? 22.987  -18.978 39.457  1.00 30.82  ? 3    LEU B O   1 
ATOM   939  C  CB  . LEU B 1 3   ? 20.350  -20.220 40.733  1.00 35.67  ? 3    LEU B CB  1 
ATOM   940  C  CG  . LEU B 1 3   ? 18.889  -20.654 40.762  1.00 37.15  ? 3    LEU B CG  1 
ATOM   941  C  CD1 . LEU B 1 3   ? 18.795  -22.001 41.414  1.00 39.57  ? 3    LEU B CD1 1 
ATOM   942  C  CD2 . LEU B 1 3   ? 18.019  -19.628 41.483  1.00 38.42  ? 3    LEU B CD2 1 
ATOM   943  N  N   . PHE B 1 4   ? 22.301  -17.633 41.112  1.00 33.81  ? 4    PHE B N   1 
ATOM   944  C  CA  . PHE B 1 4   ? 23.621  -17.065 41.339  1.00 33.38  ? 4    PHE B CA  1 
ATOM   945  C  C   . PHE B 1 4   ? 24.167  -17.359 42.739  1.00 36.61  ? 4    PHE B C   1 
ATOM   946  O  O   . PHE B 1 4   ? 23.435  -17.384 43.728  1.00 39.00  ? 4    PHE B O   1 
ATOM   947  C  CB  . PHE B 1 4   ? 23.597  -15.551 41.127  1.00 32.45  ? 4    PHE B CB  1 
ATOM   948  C  CG  . PHE B 1 4   ? 23.274  -15.139 39.727  1.00 30.33  ? 4    PHE B CG  1 
ATOM   949  C  CD1 . PHE B 1 4   ? 24.267  -14.682 38.874  1.00 29.38  ? 4    PHE B CD1 1 
ATOM   950  C  CD2 . PHE B 1 4   ? 21.973  -15.206 39.258  1.00 31.53  ? 4    PHE B CD2 1 
ATOM   951  C  CE1 . PHE B 1 4   ? 23.958  -14.293 37.565  1.00 26.96  ? 4    PHE B CE1 1 
ATOM   952  C  CE2 . PHE B 1 4   ? 21.665  -14.818 37.970  1.00 28.77  ? 4    PHE B CE2 1 
ATOM   953  C  CZ  . PHE B 1 4   ? 22.665  -14.362 37.123  1.00 27.60  ? 4    PHE B CZ  1 
ATOM   954  N  N   . ASN B 1 5   ? 25.465  -17.621 42.771  1.00 36.94  ? 5    ASN B N   1 
ATOM   955  C  CA  . ASN B 1 5   ? 26.280  -17.485 43.955  1.00 39.09  ? 5    ASN B CA  1 
ATOM   956  C  C   . ASN B 1 5   ? 26.493  -15.976 44.195  1.00 38.70  ? 5    ASN B C   1 
ATOM   957  O  O   . ASN B 1 5   ? 27.377  -15.363 43.583  1.00 36.66  ? 5    ASN B O   1 
ATOM   958  C  CB  . ASN B 1 5   ? 27.611  -18.201 43.707  1.00 39.08  ? 5    ASN B CB  1 
ATOM   959  C  CG  . ASN B 1 5   ? 28.535  -18.137 44.892  1.00 42.55  ? 5    ASN B CG  1 
ATOM   960  O  OD1 . ASN B 1 5   ? 28.119  -18.346 46.034  1.00 49.62  ? 5    ASN B OD1 1 
ATOM   961  N  ND2 . ASN B 1 5   ? 29.803  -17.856 44.632  1.00 45.22  ? 5    ASN B ND2 1 
ATOM   962  N  N   . LYS B 1 6   ? 25.662  -15.384 45.053  1.00 40.67  ? 6    LYS B N   1 
ATOM   963  C  CA  . LYS B 1 6   ? 25.623  -13.923 45.229  1.00 40.76  ? 6    LYS B CA  1 
ATOM   964  C  C   . LYS B 1 6   ? 26.737  -13.356 46.143  1.00 41.80  ? 6    LYS B C   1 
ATOM   965  O  O   . LYS B 1 6   ? 27.227  -14.028 47.062  1.00 43.95  ? 6    LYS B O   1 
ATOM   966  C  CB  . LYS B 1 6   ? 24.249  -13.480 45.782  1.00 43.08  ? 6    LYS B CB  1 
ATOM   967  C  CG  . LYS B 1 6   ? 23.868  -12.033 45.361  1.00 42.52  ? 6    LYS B CG  1 
ATOM   968  C  CD  . LYS B 1 6   ? 23.445  -11.095 46.497  1.00 45.73  ? 6    LYS B CD  1 
ATOM   969  C  CE  . LYS B 1 6   ? 23.564  -9.625  46.037  1.00 44.79  ? 6    LYS B CE  1 
ATOM   970  N  NZ  . LYS B 1 6   ? 22.825  -8.644  46.892  1.00 48.82  ? 6    LYS B NZ  1 
ATOM   971  N  N   . THR B 1 7   ? 27.121  -12.111 45.878  1.00 40.20  ? 7    THR B N   1 
ATOM   972  C  CA  . THR B 1 7   ? 27.985  -11.354 46.769  1.00 41.64  ? 7    THR B CA  1 
ATOM   973  C  C   . THR B 1 7   ? 27.401  -9.955  46.918  1.00 41.37  ? 7    THR B C   1 
ATOM   974  O  O   . THR B 1 7   ? 27.054  -9.323  45.935  1.00 38.72  ? 7    THR B O   1 
ATOM   975  C  CB  . THR B 1 7   ? 29.420  -11.281 46.237  1.00 40.47  ? 7    THR B CB  1 
ATOM   976  O  OG1 . THR B 1 7   ? 29.943  -12.612 46.146  1.00 41.31  ? 7    THR B OG1 1 
ATOM   977  C  CG2 . THR B 1 7   ? 30.297  -10.456 47.169  1.00 42.23  ? 7    THR B CG2 1 
ATOM   978  N  N   . LYS B 1 8   ? 27.269  -9.496  48.156  1.00 44.04  ? 8    LYS B N   1 
ATOM   979  C  CA  . LYS B 1 8   ? 26.635  -8.210  48.416  1.00 44.83  ? 8    LYS B CA  1 
ATOM   980  C  C   . LYS B 1 8   ? 27.463  -7.108  47.765  1.00 42.19  ? 8    LYS B C   1 
ATOM   981  O  O   . LYS B 1 8   ? 26.926  -6.235  47.090  1.00 41.05  ? 8    LYS B O   1 
ATOM   982  C  CB  . LYS B 1 8   ? 26.495  -7.965  49.920  1.00 49.01  ? 8    LYS B CB  1 
ATOM   983  C  CG  . LYS B 1 8   ? 25.938  -6.597  50.291  1.00 50.79  ? 8    LYS B CG  1 
ATOM   984  C  CD  . LYS B 1 8   ? 25.852  -6.409  51.790  1.00 55.31  ? 8    LYS B CD  1 
ATOM   985  C  CE  . LYS B 1 8   ? 25.753  -4.928  52.149  1.00 57.07  ? 8    LYS B CE  1 
ATOM   986  N  NZ  . LYS B 1 8   ? 25.465  -4.690  53.599  1.00 62.36  ? 8    LYS B NZ  1 
ATOM   987  N  N   . SER B 1 9   ? 28.775  -7.187  47.967  1.00 41.32  ? 9    SER B N   1 
ATOM   988  C  CA  . SER B 1 9   ? 29.700  -6.168  47.506  1.00 39.44  ? 9    SER B CA  1 
ATOM   989  C  C   . SER B 1 9   ? 31.149  -6.647  47.585  1.00 38.84  ? 9    SER B C   1 
ATOM   990  O  O   . SER B 1 9   ? 31.472  -7.616  48.289  1.00 40.39  ? 9    SER B O   1 
ATOM   991  C  CB  . SER B 1 9   ? 29.561  -4.928  48.391  1.00 41.50  ? 9    SER B CB  1 
ATOM   992  O  OG  . SER B 1 9   ? 29.913  -5.249  49.717  1.00 43.19  ? 9    SER B OG  1 
ATOM   993  N  N   . VAL B 1 10  ? 32.000  -5.942  46.854  1.00 36.65  ? 10   VAL B N   1 
ATOM   994  C  CA  . VAL B 1 10  ? 33.440  -6.116  46.886  1.00 36.65  ? 10   VAL B CA  1 
ATOM   995  C  C   . VAL B 1 10  ? 34.072  -4.725  46.961  1.00 37.11  ? 10   VAL B C   1 
ATOM   996  O  O   . VAL B 1 10  ? 33.442  -3.711  46.634  1.00 36.08  ? 10   VAL B O   1 
ATOM   997  C  CB  . VAL B 1 10  ? 33.971  -6.855  45.634  1.00 33.99  ? 10   VAL B CB  1 
ATOM   998  C  CG1 . VAL B 1 10  ? 33.399  -8.272  45.567  1.00 33.13  ? 10   VAL B CG1 1 
ATOM   999  C  CG2 . VAL B 1 10  ? 33.652  -6.070  44.374  1.00 31.00  ? 10   VAL B CG2 1 
ATOM   1000 N  N   . GLU B 1 11  ? 35.333  -4.697  47.366  1.00 38.29  ? 11   GLU B N   1 
ATOM   1001 C  CA  . GLU B 1 11  ? 35.986  -3.471  47.746  1.00 39.08  ? 11   GLU B CA  1 
ATOM   1002 C  C   . GLU B 1 11  ? 37.344  -3.404  47.094  1.00 37.81  ? 11   GLU B C   1 
ATOM   1003 O  O   . GLU B 1 11  ? 38.015  -4.432  46.967  1.00 37.94  ? 11   GLU B O   1 
ATOM   1004 C  CB  . GLU B 1 11  ? 36.157  -3.483  49.262  1.00 42.86  ? 11   GLU B CB  1 
ATOM   1005 C  CG  . GLU B 1 11  ? 36.665  -2.215  49.858  1.00 45.28  ? 11   GLU B CG  1 
ATOM   1006 C  CD  . GLU B 1 11  ? 36.842  -2.356  51.347  1.00 49.28  ? 11   GLU B CD  1 
ATOM   1007 O  OE1 . GLU B 1 11  ? 37.801  -3.042  51.759  1.00 52.40  ? 11   GLU B OE1 1 
ATOM   1008 O  OE2 . GLU B 1 11  ? 36.016  -1.797  52.097  1.00 53.35  ? 11   GLU B OE2 1 
ATOM   1009 N  N   . PHE B 1 12  ? 37.741  -2.203  46.692  1.00 36.77  ? 12   PHE B N   1 
ATOM   1010 C  CA  . PHE B 1 12  ? 39.091  -1.953  46.196  1.00 37.01  ? 12   PHE B CA  1 
ATOM   1011 C  C   . PHE B 1 12  ? 39.663  -0.667  46.809  1.00 38.69  ? 12   PHE B C   1 
ATOM   1012 O  O   . PHE B 1 12  ? 38.932  0.164   47.350  1.00 39.95  ? 12   PHE B O   1 
ATOM   1013 C  CB  . PHE B 1 12  ? 39.144  -1.914  44.656  1.00 34.31  ? 12   PHE B CB  1 
ATOM   1014 C  CG  . PHE B 1 12  ? 38.536  -0.677  44.029  1.00 33.38  ? 12   PHE B CG  1 
ATOM   1015 C  CD1 . PHE B 1 12  ? 39.344  0.277   43.421  1.00 34.49  ? 12   PHE B CD1 1 
ATOM   1016 C  CD2 . PHE B 1 12  ? 37.157  -0.496  43.997  1.00 33.12  ? 12   PHE B CD2 1 
ATOM   1017 C  CE1 . PHE B 1 12  ? 38.798  1.395   42.825  1.00 32.86  ? 12   PHE B CE1 1 
ATOM   1018 C  CE2 . PHE B 1 12  ? 36.602  0.616   43.402  1.00 30.59  ? 12   PHE B CE2 1 
ATOM   1019 C  CZ  . PHE B 1 12  ? 37.418  1.563   42.819  1.00 33.07  ? 12   PHE B CZ  1 
ATOM   1020 N  N   . THR B 1 13  ? 40.982  -0.544  46.750  1.00 39.92  ? 13   THR B N   1 
ATOM   1021 C  CA  . THR B 1 13  ? 41.684  0.636   47.265  1.00 41.62  ? 13   THR B CA  1 
ATOM   1022 C  C   . THR B 1 13  ? 42.581  1.174   46.163  1.00 40.89  ? 13   THR B C   1 
ATOM   1023 O  O   . THR B 1 13  ? 42.633  0.617   45.079  1.00 38.77  ? 13   THR B O   1 
ATOM   1024 C  CB  . THR B 1 13  ? 42.555  0.314   48.518  1.00 45.52  ? 13   THR B CB  1 
ATOM   1025 O  OG1 . THR B 1 13  ? 43.705  -0.468  48.133  1.00 45.11  ? 13   THR B OG1 1 
ATOM   1026 C  CG2 . THR B 1 13  ? 41.731  -0.402  49.610  1.00 45.73  ? 13   THR B CG2 1 
ATOM   1027 N  N   . PHE B 1 14  ? 43.308  2.252   46.453  1.00 43.01  ? 14   PHE B N   1 
ATOM   1028 C  CA  . PHE B 1 14  ? 44.233  2.840   45.473  1.00 42.85  ? 14   PHE B CA  1 
ATOM   1029 C  C   . PHE B 1 14  ? 45.297  1.841   44.979  1.00 43.28  ? 14   PHE B C   1 
ATOM   1030 O  O   . PHE B 1 14  ? 45.844  2.006   43.899  1.00 42.45  ? 14   PHE B O   1 
ATOM   1031 C  CB  . PHE B 1 14  ? 44.906  4.088   46.056  1.00 45.77  ? 14   PHE B CB  1 
ATOM   1032 C  CG  . PHE B 1 14  ? 46.061  3.788   46.951  1.00 49.16  ? 14   PHE B CG  1 
ATOM   1033 C  CD1 . PHE B 1 14  ? 47.358  4.081   46.546  1.00 51.46  ? 14   PHE B CD1 1 
ATOM   1034 C  CD2 . PHE B 1 14  ? 45.861  3.199   48.201  1.00 51.53  ? 14   PHE B CD2 1 
ATOM   1035 C  CE1 . PHE B 1 14  ? 48.434  3.809   47.377  1.00 55.58  ? 14   PHE B CE1 1 
ATOM   1036 C  CE2 . PHE B 1 14  ? 46.930  2.925   49.034  1.00 55.97  ? 14   PHE B CE2 1 
ATOM   1037 C  CZ  . PHE B 1 14  ? 48.220  3.229   48.626  1.00 57.24  ? 14   PHE B CZ  1 
ATOM   1038 N  N   . GLY B 1 15  ? 45.581  0.805   45.766  1.00 45.13  ? 15   GLY B N   1 
ATOM   1039 C  CA  . GLY B 1 15  ? 46.505  -0.244  45.340  1.00 46.11  ? 15   GLY B CA  1 
ATOM   1040 C  C   . GLY B 1 15  ? 46.028  -1.159  44.217  1.00 43.82  ? 15   GLY B C   1 
ATOM   1041 O  O   . GLY B 1 15  ? 46.851  -1.809  43.570  1.00 45.17  ? 15   GLY B O   1 
ATOM   1042 N  N   . ASN B 1 16  ? 44.717  -1.246  43.990  1.00 41.08  ? 16   ASN B N   1 
ATOM   1043 C  CA  . ASN B 1 16  ? 44.188  -2.073  42.891  1.00 38.69  ? 16   ASN B CA  1 
ATOM   1044 C  C   . ASN B 1 16  ? 44.473  -1.434  41.518  1.00 37.86  ? 16   ASN B C   1 
ATOM   1045 O  O   . ASN B 1 16  ? 43.959  -0.358  41.208  1.00 37.29  ? 16   ASN B O   1 
ATOM   1046 C  CB  . ASN B 1 16  ? 42.679  -2.298  43.052  1.00 36.55  ? 16   ASN B CB  1 
ATOM   1047 C  CG  . ASN B 1 16  ? 42.331  -3.131  44.289  1.00 37.06  ? 16   ASN B CG  1 
ATOM   1048 O  OD1 . ASN B 1 16  ? 42.386  -2.637  45.424  1.00 37.32  ? 16   ASN B OD1 1 
ATOM   1049 N  ND2 . ASN B 1 16  ? 41.980  -4.407  44.058  1.00 36.10  ? 16   ASN B ND2 1 
ATOM   1050 N  N   . ASP B 1 17  ? 45.315  -2.080  40.711  1.00 38.27  ? 17   ASP B N   1 
ATOM   1051 C  CA  . ASP B 1 17  ? 45.562  -1.629  39.337  1.00 36.79  ? 17   ASP B CA  1 
ATOM   1052 C  C   . ASP B 1 17  ? 44.367  -2.016  38.464  1.00 33.42  ? 17   ASP B C   1 
ATOM   1053 O  O   . ASP B 1 17  ? 44.063  -1.366  37.445  1.00 31.29  ? 17   ASP B O   1 
ATOM   1054 C  CB  . ASP B 1 17  ? 46.848  -2.263  38.780  1.00 39.24  ? 17   ASP B CB  1 
ATOM   1055 C  CG  . ASP B 1 17  ? 48.118  -1.710  39.431  1.00 44.24  ? 17   ASP B CG  1 
ATOM   1056 O  OD1 . ASP B 1 17  ? 48.034  -0.764  40.244  1.00 45.58  ? 17   ASP B OD1 1 
ATOM   1057 O  OD2 . ASP B 1 17  ? 49.216  -2.239  39.129  1.00 49.43  ? 17   ASP B OD2 1 
ATOM   1058 N  N   . THR B 1 18  ? 43.689  -3.081  38.879  1.00 32.10  ? 18   THR B N   1 
ATOM   1059 C  CA  . THR B 1 18  ? 42.525  -3.568  38.199  1.00 29.69  ? 18   THR B CA  1 
ATOM   1060 C  C   . THR B 1 18  ? 41.552  -4.143  39.226  1.00 29.14  ? 18   THR B C   1 
ATOM   1061 O  O   . THR B 1 18  ? 41.940  -4.466  40.343  1.00 30.85  ? 18   THR B O   1 
ATOM   1062 C  CB  . THR B 1 18  ? 42.912  -4.661  37.179  1.00 30.11  ? 18   THR B CB  1 
ATOM   1063 O  OG1 . THR B 1 18  ? 43.309  -5.853  37.868  1.00 30.83  ? 18   THR B OG1 1 
ATOM   1064 C  CG2 . THR B 1 18  ? 44.069  -4.194  36.287  1.00 29.72  ? 18   THR B CG2 1 
ATOM   1065 N  N   . VAL B 1 19  ? 40.286  -4.251  38.851  1.00 26.80  ? 19   VAL B N   1 
ATOM   1066 C  CA  . VAL B 1 19  ? 39.308  -4.832  39.746  1.00 26.89  ? 19   VAL B CA  1 
ATOM   1067 C  C   . VAL B 1 19  ? 38.511  -5.907  39.036  1.00 24.95  ? 19   VAL B C   1 
ATOM   1068 O  O   . VAL B 1 19  ? 38.431  -5.935  37.800  1.00 22.15  ? 19   VAL B O   1 
ATOM   1069 C  CB  . VAL B 1 19  ? 38.364  -3.776  40.396  1.00 27.00  ? 19   VAL B CB  1 
ATOM   1070 C  CG1 . VAL B 1 19  ? 39.180  -2.642  41.078  1.00 28.71  ? 19   VAL B CG1 1 
ATOM   1071 C  CG2 . VAL B 1 19  ? 37.384  -3.239  39.413  1.00 26.27  ? 19   VAL B CG2 1 
ATOM   1072 N  N   . VAL B 1 20  ? 37.960  -6.807  39.848  1.00 25.62  ? 20   VAL B N   1 
ATOM   1073 C  CA  . VAL B 1 20  ? 37.045  -7.837  39.386  1.00 25.30  ? 20   VAL B CA  1 
ATOM   1074 C  C   . VAL B 1 20  ? 35.746  -7.710  40.171  1.00 25.04  ? 20   VAL B C   1 
ATOM   1075 O  O   . VAL B 1 20  ? 35.773  -7.570  41.402  1.00 26.72  ? 20   VAL B O   1 
ATOM   1076 C  CB  . VAL B 1 20  ? 37.611  -9.259  39.619  1.00 27.15  ? 20   VAL B CB  1 
ATOM   1077 C  CG1 . VAL B 1 20  ? 36.603  -10.321 39.195  1.00 26.87  ? 20   VAL B CG1 1 
ATOM   1078 C  CG2 . VAL B 1 20  ? 38.927  -9.433  38.891  1.00 29.40  ? 20   VAL B CG2 1 
ATOM   1079 N  N   . ILE B 1 21  ? 34.627  -7.743  39.445  1.00 23.37  ? 21   ILE B N   1 
ATOM   1080 C  CA  . ILE B 1 21  ? 33.299  -7.785  40.031  1.00 23.82  ? 21   ILE B CA  1 
ATOM   1081 C  C   . ILE B 1 21  ? 32.732  -9.194  39.787  1.00 22.62  ? 21   ILE B C   1 
ATOM   1082 O  O   . ILE B 1 21  ? 32.475  -9.581  38.643  1.00 20.39  ? 21   ILE B O   1 
ATOM   1083 C  CB  . ILE B 1 21  ? 32.371  -6.706  39.428  1.00 22.72  ? 21   ILE B CB  1 
ATOM   1084 C  CG1 . ILE B 1 21  ? 33.082  -5.349  39.410  1.00 24.96  ? 21   ILE B CG1 1 
ATOM   1085 C  CG2 . ILE B 1 21  ? 31.071  -6.627  40.220  1.00 23.43  ? 21   ILE B CG2 1 
ATOM   1086 C  CD1 . ILE B 1 21  ? 32.157  -4.134  39.384  1.00 24.93  ? 21   ILE B CD1 1 
ATOM   1087 N  N   . PRO B 1 22  ? 32.554  -9.976  40.869  1.00 24.52  ? 22   PRO B N   1 
ATOM   1088 C  CA  . PRO B 1 22  ? 32.191  -11.370 40.678  1.00 24.22  ? 22   PRO B CA  1 
ATOM   1089 C  C   . PRO B 1 22  ? 30.770  -11.531 40.174  1.00 23.03  ? 22   PRO B C   1 
ATOM   1090 O  O   . PRO B 1 22  ? 29.891  -10.763 40.530  1.00 22.49  ? 22   PRO B O   1 
ATOM   1091 C  CB  . PRO B 1 22  ? 32.323  -11.970 42.089  1.00 26.80  ? 22   PRO B CB  1 
ATOM   1092 C  CG  . PRO B 1 22  ? 32.124  -10.811 43.007  1.00 27.35  ? 22   PRO B CG  1 
ATOM   1093 C  CD  . PRO B 1 22  ? 32.646  -9.611  42.293  1.00 26.28  ? 22   PRO B CD  1 
ATOM   1094 N  N   . CYS B 1 23  ? 30.563  -12.534 39.337  1.00 23.43  ? 23   CYS B N   1 
ATOM   1095 C  CA  . CYS B 1 23  ? 29.238  -12.939 38.940  1.00 23.46  ? 23   CYS B CA  1 
ATOM   1096 C  C   . CYS B 1 23  ? 29.310  -14.390 38.507  1.00 23.89  ? 23   CYS B C   1 
ATOM   1097 O  O   . CYS B 1 23  ? 29.974  -14.705 37.523  1.00 23.04  ? 23   CYS B O   1 
ATOM   1098 C  CB  . CYS B 1 23  ? 28.749  -12.083 37.786  1.00 22.63  ? 23   CYS B CB  1 
ATOM   1099 S  SG  . CYS B 1 23  ? 27.120  -12.535 37.165  1.00 22.52  ? 23   CYS B SG  1 
ATOM   1100 N  N   . PHE B 1 24  ? 28.614  -15.253 39.241  1.00 25.07  ? 24   PHE B N   1 
ATOM   1101 C  CA  . PHE B 1 24  ? 28.684  -16.682 39.034  1.00 25.84  ? 24   PHE B CA  1 
ATOM   1102 C  C   . PHE B 1 24  ? 27.279  -17.285 38.982  1.00 26.51  ? 24   PHE B C   1 
ATOM   1103 O  O   . PHE B 1 24  ? 26.524  -17.209 39.942  1.00 27.85  ? 24   PHE B O   1 
ATOM   1104 C  CB  . PHE B 1 24  ? 29.521  -17.321 40.149  1.00 28.59  ? 24   PHE B CB  1 
ATOM   1105 C  CG  . PHE B 1 24  ? 30.965  -16.913 40.122  1.00 29.11  ? 24   PHE B CG  1 
ATOM   1106 C  CD1 . PHE B 1 24  ? 31.874  -17.594 39.333  1.00 29.43  ? 24   PHE B CD1 1 
ATOM   1107 C  CD2 . PHE B 1 24  ? 31.418  -15.843 40.886  1.00 29.40  ? 24   PHE B CD2 1 
ATOM   1108 C  CE1 . PHE B 1 24  ? 33.207  -17.211 39.295  1.00 30.39  ? 24   PHE B CE1 1 
ATOM   1109 C  CE2 . PHE B 1 24  ? 32.758  -15.464 40.859  1.00 30.16  ? 24   PHE B CE2 1 
ATOM   1110 C  CZ  . PHE B 1 24  ? 33.650  -16.148 40.061  1.00 29.42  ? 24   PHE B CZ  1 
ATOM   1111 N  N   . VAL B 1 25  ? 26.931  -17.837 37.825  1.00 25.32  ? 25   VAL B N   1 
ATOM   1112 C  CA  . VAL B 1 25  ? 25.709  -18.596 37.652  1.00 24.95  ? 25   VAL B CA  1 
ATOM   1113 C  C   . VAL B 1 25  ? 26.041  -20.034 38.022  1.00 26.14  ? 25   VAL B C   1 
ATOM   1114 O  O   . VAL B 1 25  ? 27.008  -20.607 37.513  1.00 25.45  ? 25   VAL B O   1 
ATOM   1115 C  CB  . VAL B 1 25  ? 25.180  -18.499 36.210  1.00 23.43  ? 25   VAL B CB  1 
ATOM   1116 C  CG1 . VAL B 1 25  ? 23.894  -19.321 36.042  1.00 23.31  ? 25   VAL B CG1 1 
ATOM   1117 C  CG2 . VAL B 1 25  ? 24.926  -17.046 35.851  1.00 22.62  ? 25   VAL B CG2 1 
ATOM   1118 N  N   . THR B 1 26  ? 25.259  -20.591 38.936  1.00 27.55  ? 26   THR B N   1 
ATOM   1119 C  CA  . THR B 1 26  ? 25.511  -21.936 39.460  1.00 29.40  ? 26   THR B CA  1 
ATOM   1120 C  C   . THR B 1 26  ? 24.737  -23.030 38.718  1.00 29.42  ? 26   THR B C   1 
ATOM   1121 O  O   . THR B 1 26  ? 24.925  -24.216 39.009  1.00 30.27  ? 26   THR B O   1 
ATOM   1122 C  CB  . THR B 1 26  ? 25.175  -22.010 40.968  1.00 32.23  ? 26   THR B CB  1 
ATOM   1123 O  OG1 . THR B 1 26  ? 23.756  -21.874 41.165  1.00 32.72  ? 26   THR B OG1 1 
ATOM   1124 C  CG2 . THR B 1 26  ? 25.928  -20.902 41.729  1.00 32.38  ? 26   THR B CG2 1 
ATOM   1125 N  N   . ASN B 1 27  ? 23.875  -22.656 37.772  1.00 27.45  ? 27   ASN B N   1 
ATOM   1126 C  CA  . ASN B 1 27  ? 23.088  -23.654 37.074  1.00 27.97  ? 27   ASN B CA  1 
ATOM   1127 C  C   . ASN B 1 27  ? 23.092  -23.502 35.547  1.00 25.75  ? 27   ASN B C   1 
ATOM   1128 O  O   . ASN B 1 27  ? 22.073  -23.740 34.914  1.00 25.57  ? 27   ASN B O   1 
ATOM   1129 C  CB  . ASN B 1 27  ? 21.653  -23.762 37.672  1.00 29.66  ? 27   ASN B CB  1 
ATOM   1130 C  CG  . ASN B 1 27  ? 20.792  -22.524 37.413  1.00 29.72  ? 27   ASN B CG  1 
ATOM   1131 O  OD1 . ASN B 1 27  ? 21.305  -21.429 37.175  1.00 26.95  ? 27   ASN B OD1 1 
ATOM   1132 N  ND2 . ASN B 1 27  ? 19.470  -22.702 37.472  1.00 30.07  ? 27   ASN B ND2 1 
ATOM   1133 N  N   . MET B 1 28  ? 24.252  -23.150 34.976  1.00 24.25  ? 28   MET B N   1 
ATOM   1134 C  CA  . MET B 1 28  ? 24.416  -23.029 33.523  1.00 23.17  ? 28   MET B CA  1 
ATOM   1135 C  C   . MET B 1 28  ? 24.178  -24.351 32.833  1.00 23.61  ? 28   MET B C   1 
ATOM   1136 O  O   . MET B 1 28  ? 24.467  -25.407 33.377  1.00 24.48  ? 28   MET B O   1 
ATOM   1137 C  CB  . MET B 1 28  ? 25.831  -22.571 33.154  1.00 22.94  ? 28   MET B CB  1 
ATOM   1138 C  CG  . MET B 1 28  ? 26.178  -21.164 33.547  1.00 23.75  ? 28   MET B CG  1 
ATOM   1139 S  SD  . MET B 1 28  ? 25.301  -19.839 32.656  1.00 23.45  ? 28   MET B SD  1 
ATOM   1140 C  CE  . MET B 1 28  ? 26.120  -19.795 31.067  1.00 22.65  ? 28   MET B CE  1 
ATOM   1141 N  N   . GLU B 1 29  ? 23.645  -24.290 31.623  1.00 23.24  ? 29   GLU B N   1 
ATOM   1142 C  CA  . GLU B 1 29  ? 23.411  -25.500 30.831  1.00 23.77  ? 29   GLU B CA  1 
ATOM   1143 C  C   . GLU B 1 29  ? 24.008  -25.410 29.443  1.00 22.50  ? 29   GLU B C   1 
ATOM   1144 O  O   . GLU B 1 29  ? 24.200  -26.450 28.810  1.00 23.48  ? 29   GLU B O   1 
ATOM   1145 C  CB  . GLU B 1 29  ? 21.921  -25.756 30.667  1.00 24.27  ? 29   GLU B CB  1 
ATOM   1146 C  CG  . GLU B 1 29  ? 21.210  -26.205 31.903  1.00 26.27  ? 29   GLU B CG  1 
ATOM   1147 C  CD  . GLU B 1 29  ? 19.714  -26.234 31.677  1.00 27.44  ? 29   GLU B CD  1 
ATOM   1148 O  OE1 . GLU B 1 29  ? 19.001  -26.699 32.585  1.00 28.21  ? 29   GLU B OE1 1 
ATOM   1149 O  OE2 . GLU B 1 29  ? 19.270  -25.794 30.581  1.00 27.72  ? 29   GLU B OE2 1 
ATOM   1150 N  N   . ALA B 1 30  ? 24.261  -24.185 28.972  1.00 21.20  ? 30   ALA B N   1 
ATOM   1151 C  CA  . ALA B 1 30  ? 24.739  -23.944 27.607  1.00 20.96  ? 30   ALA B CA  1 
ATOM   1152 C  C   . ALA B 1 30  ? 26.021  -24.744 27.331  1.00 21.60  ? 30   ALA B C   1 
ATOM   1153 O  O   . ALA B 1 30  ? 26.957  -24.714 28.140  1.00 22.70  ? 30   ALA B O   1 
ATOM   1154 C  CB  . ALA B 1 30  ? 24.971  -22.431 27.368  1.00 19.24  ? 30   ALA B CB  1 
ATOM   1155 N  N   . GLN B 1 31  ? 26.055  -25.451 26.203  1.00 22.70  ? 31   GLN B N   1 
ATOM   1156 C  CA  . GLN B 1 31  ? 27.243  -26.213 25.770  1.00 24.47  ? 31   GLN B CA  1 
ATOM   1157 C  C   . GLN B 1 31  ? 28.194  -25.408 24.870  1.00 24.49  ? 31   GLN B C   1 
ATOM   1158 O  O   . GLN B 1 31  ? 29.335  -25.805 24.653  1.00 25.64  ? 31   GLN B O   1 
ATOM   1159 C  CB  . GLN B 1 31  ? 26.814  -27.492 25.041  1.00 25.94  ? 31   GLN B CB  1 
ATOM   1160 C  CG  . GLN B 1 31  ? 26.035  -28.435 25.923  1.00 27.29  ? 31   GLN B CG  1 
ATOM   1161 C  CD  . GLN B 1 31  ? 26.785  -28.747 27.203  1.00 29.16  ? 31   GLN B CD  1 
ATOM   1162 O  OE1 . GLN B 1 31  ? 27.728  -29.535 27.200  1.00 31.93  ? 31   GLN B OE1 1 
ATOM   1163 N  NE2 . GLN B 1 31  ? 26.383  -28.113 28.300  1.00 25.34  ? 31   GLN B NE2 1 
ATOM   1164 N  N   . ASN B 1 32  ? 27.704  -24.283 24.358  1.00 24.53  ? 32   ASN B N   1 
ATOM   1165 C  CA  . ASN B 1 32  ? 28.430  -23.390 23.446  1.00 24.39  ? 32   ASN B CA  1 
ATOM   1166 C  C   . ASN B 1 32  ? 27.960  -21.979 23.776  1.00 22.63  ? 32   ASN B C   1 
ATOM   1167 O  O   . ASN B 1 32  ? 26.846  -21.801 24.284  1.00 21.57  ? 32   ASN B O   1 
ATOM   1168 C  CB  . ASN B 1 32  ? 28.066  -23.760 21.990  1.00 26.25  ? 32   ASN B CB  1 
ATOM   1169 C  CG  . ASN B 1 32  ? 28.881  -23.019 20.951  1.00 28.46  ? 32   ASN B CG  1 
ATOM   1170 O  OD1 . ASN B 1 32  ? 28.834  -21.788 20.866  1.00 33.66  ? 32   ASN B OD1 1 
ATOM   1171 N  ND2 . ASN B 1 32  ? 29.590  -23.772 20.098  1.00 33.39  ? 32   ASN B ND2 1 
ATOM   1172 N  N   . THR B 1 33  ? 28.788  -20.978 23.508  1.00 22.27  ? 33   THR B N   1 
ATOM   1173 C  CA  . THR B 1 33  ? 28.453  -19.582 23.854  1.00 21.63  ? 33   THR B CA  1 
ATOM   1174 C  C   . THR B 1 33  ? 27.395  -18.984 22.929  1.00 21.81  ? 33   THR B C   1 
ATOM   1175 O  O   . THR B 1 33  ? 26.900  -17.895 23.182  1.00 21.50  ? 33   THR B O   1 
ATOM   1176 C  CB  . THR B 1 33  ? 29.706  -18.643 23.830  1.00 21.25  ? 33   THR B CB  1 
ATOM   1177 O  OG1 . THR B 1 33  ? 30.383  -18.778 22.578  1.00 23.14  ? 33   THR B OG1 1 
ATOM   1178 C  CG2 . THR B 1 33  ? 30.665  -18.994 24.925  1.00 22.69  ? 33   THR B CG2 1 
ATOM   1179 N  N   . THR B 1 34  ? 27.029  -19.715 21.876  1.00 23.67  ? 34   THR B N   1 
ATOM   1180 C  CA  . THR B 1 34  ? 26.103  -19.213 20.866  1.00 24.98  ? 34   THR B CA  1 
ATOM   1181 C  C   . THR B 1 34  ? 24.757  -18.729 21.431  1.00 24.45  ? 34   THR B C   1 
ATOM   1182 O  O   . THR B 1 34  ? 24.187  -17.757 20.917  1.00 26.05  ? 34   THR B O   1 
ATOM   1183 C  CB  . THR B 1 34  ? 25.871  -20.254 19.772  1.00 26.76  ? 34   THR B CB  1 
ATOM   1184 O  OG1 . THR B 1 34  ? 27.109  -20.495 19.088  1.00 30.88  ? 34   THR B OG1 1 
ATOM   1185 C  CG2 . THR B 1 34  ? 24.859  -19.748 18.749  1.00 29.52  ? 34   THR B CG2 1 
ATOM   1186 N  N   . GLU B 1 35  ? 24.241  -19.370 22.474  1.00 23.48  ? 35   GLU B N   1 
ATOM   1187 C  CA  . GLU B 1 35  ? 22.957  -18.913 23.020  1.00 23.95  ? 35   GLU B CA  1 
ATOM   1188 C  C   . GLU B 1 35  ? 23.114  -18.260 24.396  1.00 22.61  ? 35   GLU B C   1 
ATOM   1189 O  O   . GLU B 1 35  ? 22.167  -18.239 25.180  1.00 23.22  ? 35   GLU B O   1 
ATOM   1190 C  CB  . GLU B 1 35  ? 21.915  -20.039 23.090  1.00 25.28  ? 35   GLU B CB  1 
ATOM   1191 C  CG  . GLU B 1 35  ? 21.625  -20.786 21.779  1.00 27.41  ? 35   GLU B CG  1 
ATOM   1192 C  CD  . GLU B 1 35  ? 20.868  -19.961 20.751  1.00 29.88  ? 35   GLU B CD  1 
ATOM   1193 O  OE1 . GLU B 1 35  ? 20.550  -18.769 20.987  1.00 34.38  ? 35   GLU B OE1 1 
ATOM   1194 O  OE2 . GLU B 1 35  ? 20.617  -20.502 19.685  1.00 30.17  ? 35   GLU B OE2 1 
ATOM   1195 N  N   . VAL B 1 36  ? 24.302  -17.736 24.693  1.00 20.35  ? 36   VAL B N   1 
ATOM   1196 C  CA  . VAL B 1 36  ? 24.509  -17.047 25.947  1.00 19.64  ? 36   VAL B CA  1 
ATOM   1197 C  C   . VAL B 1 36  ? 24.562  -15.578 25.646  1.00 19.20  ? 36   VAL B C   1 
ATOM   1198 O  O   . VAL B 1 36  ? 25.189  -15.155 24.655  1.00 19.08  ? 36   VAL B O   1 
ATOM   1199 C  CB  . VAL B 1 36  ? 25.790  -17.526 26.668  1.00 18.95  ? 36   VAL B CB  1 
ATOM   1200 C  CG1 . VAL B 1 36  ? 25.997  -16.757 27.975  1.00 19.02  ? 36   VAL B CG1 1 
ATOM   1201 C  CG2 . VAL B 1 36  ? 25.727  -19.039 26.918  1.00 19.75  ? 36   VAL B CG2 1 
ATOM   1202 N  N   . TYR B 1 37  ? 23.887  -14.797 26.481  1.00 19.75  ? 37   TYR B N   1 
ATOM   1203 C  CA  . TYR B 1 37  ? 23.988  -13.339 26.433  1.00 20.00  ? 37   TYR B CA  1 
ATOM   1204 C  C   . TYR B 1 37  ? 24.346  -12.828 27.824  1.00 19.00  ? 37   TYR B C   1 
ATOM   1205 O  O   . TYR B 1 37  ? 23.794  -13.287 28.829  1.00 18.80  ? 37   TYR B O   1 
ATOM   1206 C  CB  . TYR B 1 37  ? 22.659  -12.727 25.966  1.00 22.93  ? 37   TYR B CB  1 
ATOM   1207 C  CG  . TYR B 1 37  ? 22.779  -11.327 25.408  1.00 23.23  ? 37   TYR B CG  1 
ATOM   1208 C  CD1 . TYR B 1 37  ? 22.915  -11.115 24.041  1.00 25.83  ? 37   TYR B CD1 1 
ATOM   1209 C  CD2 . TYR B 1 37  ? 22.775  -10.220 26.242  1.00 27.00  ? 37   TYR B CD2 1 
ATOM   1210 C  CE1 . TYR B 1 37  ? 23.035  -9.840  23.520  1.00 26.16  ? 37   TYR B CE1 1 
ATOM   1211 C  CE2 . TYR B 1 37  ? 22.895  -8.935  25.728  1.00 26.83  ? 37   TYR B CE2 1 
ATOM   1212 C  CZ  . TYR B 1 37  ? 23.023  -8.763  24.359  1.00 28.13  ? 37   TYR B CZ  1 
ATOM   1213 O  OH  . TYR B 1 37  ? 23.145  -7.503  23.817  1.00 30.16  ? 37   TYR B OH  1 
ATOM   1214 N  N   . VAL B 1 38  ? 25.287  -11.897 27.894  1.00 18.25  ? 38   VAL B N   1 
ATOM   1215 C  CA  . VAL B 1 38  ? 25.638  -11.272 29.166  1.00 18.77  ? 38   VAL B CA  1 
ATOM   1216 C  C   . VAL B 1 38  ? 25.514  -9.765  29.041  1.00 18.66  ? 38   VAL B C   1 
ATOM   1217 O  O   . VAL B 1 38  ? 25.936  -9.175  28.043  1.00 18.34  ? 38   VAL B O   1 
ATOM   1218 C  CB  . VAL B 1 38  ? 27.088  -11.587 29.614  1.00 18.19  ? 38   VAL B CB  1 
ATOM   1219 C  CG1 . VAL B 1 38  ? 27.403  -10.844 30.885  1.00 19.32  ? 38   VAL B CG1 1 
ATOM   1220 C  CG2 . VAL B 1 38  ? 27.297  -13.112 29.809  1.00 20.18  ? 38   VAL B CG2 1 
ATOM   1221 N  N   . LYS B 1 39  ? 24.927  -9.166  30.062  1.00 19.63  ? 39   LYS B N   1 
ATOM   1222 C  CA  . LYS B 1 39  ? 24.763  -7.728  30.141  1.00 20.29  ? 39   LYS B CA  1 
ATOM   1223 C  C   . LYS B 1 39  ? 25.192  -7.291  31.544  1.00 19.91  ? 39   LYS B C   1 
ATOM   1224 O  O   . LYS B 1 39  ? 24.652  -7.778  32.554  1.00 21.00  ? 39   LYS B O   1 
ATOM   1225 C  CB  . LYS B 1 39  ? 23.293  -7.387  29.862  1.00 21.56  ? 39   LYS B CB  1 
ATOM   1226 C  CG  . LYS B 1 39  ? 22.987  -5.942  29.702  1.00 24.41  ? 39   LYS B CG  1 
ATOM   1227 C  CD  . LYS B 1 39  ? 21.525  -5.710  29.377  1.00 26.56  ? 39   LYS B CD  1 
ATOM   1228 C  CE  . LYS B 1 39  ? 21.181  -6.004  27.939  1.00 28.62  ? 39   LYS B CE  1 
ATOM   1229 N  NZ  . LYS B 1 39  ? 19.828  -5.460  27.628  1.00 31.86  ? 39   LYS B NZ  1 
ATOM   1230 N  N   . TRP B 1 40  ? 26.177  -6.403  31.618  1.00 18.69  ? 40   TRP B N   1 
ATOM   1231 C  CA  . TRP B 1 40  ? 26.458  -5.706  32.862  1.00 19.06  ? 40   TRP B CA  1 
ATOM   1232 C  C   . TRP B 1 40  ? 25.898  -4.285  32.828  1.00 19.65  ? 40   TRP B C   1 
ATOM   1233 O  O   . TRP B 1 40  ? 26.112  -3.546  31.862  1.00 18.39  ? 40   TRP B O   1 
ATOM   1234 C  CB  . TRP B 1 40  ? 27.951  -5.619  33.129  1.00 18.15  ? 40   TRP B CB  1 
ATOM   1235 C  CG  . TRP B 1 40  ? 28.528  -6.844  33.662  1.00 17.54  ? 40   TRP B CG  1 
ATOM   1236 C  CD1 . TRP B 1 40  ? 28.984  -7.910  32.941  1.00 17.48  ? 40   TRP B CD1 1 
ATOM   1237 C  CD2 . TRP B 1 40  ? 28.760  -7.159  35.043  1.00 18.78  ? 40   TRP B CD2 1 
ATOM   1238 N  NE1 . TRP B 1 40  ? 29.481  -8.868  33.783  1.00 17.72  ? 40   TRP B NE1 1 
ATOM   1239 C  CE2 . TRP B 1 40  ? 29.345  -8.441  35.081  1.00 18.21  ? 40   TRP B CE2 1 
ATOM   1240 C  CE3 . TRP B 1 40  ? 28.512  -6.491  36.249  1.00 21.21  ? 40   TRP B CE3 1 
ATOM   1241 C  CZ2 . TRP B 1 40  ? 29.720  -9.056  36.281  1.00 19.70  ? 40   TRP B CZ2 1 
ATOM   1242 C  CZ3 . TRP B 1 40  ? 28.863  -7.112  37.448  1.00 21.21  ? 40   TRP B CZ3 1 
ATOM   1243 C  CH2 . TRP B 1 40  ? 29.468  -8.380  37.449  1.00 19.51  ? 40   TRP B CH2 1 
ATOM   1244 N  N   . LYS B 1 41  ? 25.205  -3.900  33.900  1.00 21.12  ? 41   LYS B N   1 
ATOM   1245 C  CA  . LYS B 1 41  ? 24.641  -2.567  33.986  1.00 22.82  ? 41   LYS B CA  1 
ATOM   1246 C  C   . LYS B 1 41  ? 25.204  -1.795  35.180  1.00 23.25  ? 41   LYS B C   1 
ATOM   1247 O  O   . LYS B 1 41  ? 25.550  -2.379  36.214  1.00 21.93  ? 41   LYS B O   1 
ATOM   1248 C  CB  . LYS B 1 41  ? 23.121  -2.631  34.081  1.00 24.62  ? 41   LYS B CB  1 
ATOM   1249 C  CG  . LYS B 1 41  ? 22.455  -3.477  32.996  1.00 26.01  ? 41   LYS B CG  1 
ATOM   1250 C  CD  . LYS B 1 41  ? 20.950  -3.525  33.207  1.00 28.25  ? 41   LYS B CD  1 
ATOM   1251 C  CE  . LYS B 1 41  ? 20.267  -4.465  32.212  1.00 30.70  ? 41   LYS B CE  1 
ATOM   1252 N  NZ  . LYS B 1 41  ? 18.762  -4.524  32.399  1.00 33.81  ? 41   LYS B NZ  1 
ATOM   1253 N  N   . PHE B 1 42  ? 25.279  -0.477  35.013  1.00 24.02  ? 42   PHE B N   1 
ATOM   1254 C  CA  . PHE B 1 42  ? 25.727  0.437   36.062  1.00 25.75  ? 42   PHE B CA  1 
ATOM   1255 C  C   . PHE B 1 42  ? 24.925  1.713   35.909  1.00 28.07  ? 42   PHE B C   1 
ATOM   1256 O  O   . PHE B 1 42  ? 24.897  2.304   34.824  1.00 27.57  ? 42   PHE B O   1 
ATOM   1257 C  CB  . PHE B 1 42  ? 27.219  0.738   35.945  1.00 24.16  ? 42   PHE B CB  1 
ATOM   1258 C  CG  . PHE B 1 42  ? 27.720  1.710   36.985  1.00 24.59  ? 42   PHE B CG  1 
ATOM   1259 C  CD1 . PHE B 1 42  ? 27.987  1.278   38.293  1.00 24.29  ? 42   PHE B CD1 1 
ATOM   1260 C  CD2 . PHE B 1 42  ? 27.906  3.063   36.667  1.00 24.74  ? 42   PHE B CD2 1 
ATOM   1261 C  CE1 . PHE B 1 42  ? 28.437  2.196   39.268  1.00 27.27  ? 42   PHE B CE1 1 
ATOM   1262 C  CE2 . PHE B 1 42  ? 28.357  3.972   37.624  1.00 25.90  ? 42   PHE B CE2 1 
ATOM   1263 C  CZ  . PHE B 1 42  ? 28.625  3.537   38.923  1.00 27.42  ? 42   PHE B CZ  1 
ATOM   1264 N  N   . LYS B 1 43  ? 24.275  2.113   37.000  1.00 31.40  ? 43   LYS B N   1 
ATOM   1265 C  CA  . LYS B 1 43  ? 23.303  3.202   37.013  1.00 34.92  ? 43   LYS B CA  1 
ATOM   1266 C  C   . LYS B 1 43  ? 22.348  3.141   35.823  1.00 35.93  ? 43   LYS B C   1 
ATOM   1267 O  O   . LYS B 1 43  ? 22.097  4.144   35.147  1.00 37.85  ? 43   LYS B O   1 
ATOM   1268 C  CB  . LYS B 1 43  ? 24.017  4.555   37.122  1.00 35.87  ? 43   LYS B CB  1 
ATOM   1269 C  CG  . LYS B 1 43  ? 24.688  4.724   38.478  1.00 37.19  ? 43   LYS B CG  1 
ATOM   1270 C  CD  . LYS B 1 43  ? 25.400  6.044   38.612  1.00 38.02  ? 43   LYS B CD  1 
ATOM   1271 C  CE  . LYS B 1 43  ? 25.692  6.347   40.077  1.00 40.79  ? 43   LYS B CE  1 
ATOM   1272 N  NZ  . LYS B 1 43  ? 24.463  6.806   40.834  1.00 44.38  ? 43   LYS B NZ  1 
ATOM   1273 N  N   . GLY B 1 44  ? 21.834  1.938   35.568  1.00 35.96  ? 44   GLY B N   1 
ATOM   1274 C  CA  . GLY B 1 44  ? 20.794  1.730   34.571  1.00 36.86  ? 44   GLY B CA  1 
ATOM   1275 C  C   . GLY B 1 44  ? 21.193  1.880   33.115  1.00 36.04  ? 44   GLY B C   1 
ATOM   1276 O  O   . GLY B 1 44  ? 20.333  2.066   32.264  1.00 38.27  ? 44   GLY B O   1 
ATOM   1277 N  N   . ARG B 1 45  ? 22.482  1.809   32.811  1.00 33.90  ? 45   ARG B N   1 
ATOM   1278 C  CA  . ARG B 1 45  ? 22.904  1.652   31.417  1.00 32.84  ? 45   ARG B CA  1 
ATOM   1279 C  C   . ARG B 1 45  ? 23.786  0.431   31.267  1.00 29.41  ? 45   ARG B C   1 
ATOM   1280 O  O   . ARG B 1 45  ? 24.430  0.014   32.210  1.00 27.26  ? 45   ARG B O   1 
ATOM   1281 C  CB  . ARG B 1 45  ? 23.612  2.893   30.885  1.00 33.57  ? 45   ARG B CB  1 
ATOM   1282 C  CG  . ARG B 1 45  ? 24.595  3.516   31.810  1.00 34.60  ? 45   ARG B CG  1 
ATOM   1283 C  CD  . ARG B 1 45  ? 24.934  4.916   31.321  1.00 37.71  ? 45   ARG B CD  1 
ATOM   1284 N  NE  . ARG B 1 45  ? 25.801  4.845   30.154  1.00 39.90  ? 45   ARG B NE  1 
ATOM   1285 C  CZ  . ARG B 1 45  ? 27.132  4.858   30.187  1.00 39.03  ? 45   ARG B CZ  1 
ATOM   1286 N  NH1 . ARG B 1 45  ? 27.788  4.954   31.340  1.00 39.16  ? 45   ARG B NH1 1 
ATOM   1287 N  NH2 . ARG B 1 45  ? 27.806  4.788   29.048  1.00 38.59  ? 45   ARG B NH2 1 
ATOM   1288 N  N   . ASP B 1 46  ? 23.793  -0.128  30.062  1.00 28.41  ? 46   ASP B N   1 
ATOM   1289 C  CA  . ASP B 1 46  ? 24.625  -1.265  29.746  1.00 26.49  ? 46   ASP B CA  1 
ATOM   1290 C  C   . ASP B 1 46  ? 26.058  -0.776  29.616  1.00 24.91  ? 46   ASP B C   1 
ATOM   1291 O  O   . ASP B 1 46  ? 26.343  0.052   28.763  1.00 25.97  ? 46   ASP B O   1 
ATOM   1292 C  CB  . ASP B 1 46  ? 24.171  -1.906  28.434  1.00 26.84  ? 46   ASP B CB  1 
ATOM   1293 C  CG  . ASP B 1 46  ? 22.707  -2.318  28.457  1.00 29.52  ? 46   ASP B CG  1 
ATOM   1294 O  OD1 . ASP B 1 46  ? 22.143  -2.488  29.556  1.00 34.59  ? 46   ASP B OD1 1 
ATOM   1295 O  OD2 . ASP B 1 46  ? 22.117  -2.450  27.377  1.00 32.66  ? 46   ASP B OD2 1 
ATOM   1296 N  N   . ILE B 1 47  ? 26.957  -1.280  30.454  1.00 22.52  ? 47   ILE B N   1 
ATOM   1297 C  CA  . ILE B 1 47  ? 28.378  -0.924  30.329  1.00 21.48  ? 47   ILE B CA  1 
ATOM   1298 C  C   . ILE B 1 47  ? 29.214  -2.063  29.693  1.00 19.31  ? 47   ILE B C   1 
ATOM   1299 O  O   . ILE B 1 47  ? 30.367  -1.887  29.350  1.00 18.19  ? 47   ILE B O   1 
ATOM   1300 C  CB  . ILE B 1 47  ? 28.956  -0.357  31.664  1.00 22.28  ? 47   ILE B CB  1 
ATOM   1301 C  CG1 . ILE B 1 47  ? 28.806  -1.322  32.855  1.00 22.51  ? 47   ILE B CG1 1 
ATOM   1302 C  CG2 . ILE B 1 47  ? 28.255  0.954   32.022  1.00 22.76  ? 47   ILE B CG2 1 
ATOM   1303 C  CD1 . ILE B 1 47  ? 29.865  -2.321  32.960  1.00 21.35  ? 47   ILE B CD1 1 
ATOM   1304 N  N   . TYR B 1 48  ? 28.603  -3.223  29.515  1.00 17.99  ? 48   TYR B N   1 
ATOM   1305 C  CA  . TYR B 1 48  ? 29.235  -4.341  28.823  1.00 17.73  ? 48   TYR B CA  1 
ATOM   1306 C  C   . TYR B 1 48  ? 28.159  -5.295  28.316  1.00 17.35  ? 48   TYR B C   1 
ATOM   1307 O  O   . TYR B 1 48  ? 27.224  -5.611  29.035  1.00 17.30  ? 48   TYR B O   1 
ATOM   1308 C  CB  . TYR B 1 48  ? 30.182  -5.121  29.746  1.00 17.24  ? 48   TYR B CB  1 
ATOM   1309 C  CG  . TYR B 1 48  ? 30.840  -6.273  29.013  1.00 16.88  ? 48   TYR B CG  1 
ATOM   1310 C  CD1 . TYR B 1 48  ? 32.039  -6.097  28.349  1.00 17.50  ? 48   TYR B CD1 1 
ATOM   1311 C  CD2 . TYR B 1 48  ? 30.230  -7.522  28.945  1.00 17.08  ? 48   TYR B CD2 1 
ATOM   1312 C  CE1 . TYR B 1 48  ? 32.627  -7.142  27.646  1.00 17.95  ? 48   TYR B CE1 1 
ATOM   1313 C  CE2 . TYR B 1 48  ? 30.803  -8.566  28.235  1.00 18.14  ? 48   TYR B CE2 1 
ATOM   1314 C  CZ  . TYR B 1 48  ? 32.001  -8.368  27.592  1.00 18.09  ? 48   TYR B CZ  1 
ATOM   1315 O  OH  . TYR B 1 48  ? 32.571  -9.410  26.889  1.00 20.49  ? 48   TYR B OH  1 
ATOM   1316 N  N   . THR B 1 49  ? 28.287  -5.727  27.066  1.00 18.43  ? 49   THR B N   1 
ATOM   1317 C  CA  . THR B 1 49  ? 27.443  -6.793  26.554  1.00 18.25  ? 49   THR B CA  1 
ATOM   1318 C  C   . THR B 1 49  ? 28.298  -7.778  25.777  1.00 18.02  ? 49   THR B C   1 
ATOM   1319 O  O   . THR B 1 49  ? 29.184  -7.369  25.011  1.00 18.12  ? 49   THR B O   1 
ATOM   1320 C  CB  . THR B 1 49  ? 26.316  -6.264  25.632  1.00 19.78  ? 49   THR B CB  1 
ATOM   1321 O  OG1 . THR B 1 49  ? 26.890  -5.734  24.440  1.00 21.79  ? 49   THR B OG1 1 
ATOM   1322 C  CG2 . THR B 1 49  ? 25.466  -5.184  26.310  1.00 19.66  ? 49   THR B CG2 1 
ATOM   1323 N  N   . PHE B 1 50  ? 28.038  -9.069  25.999  1.00 17.82  ? 50   PHE B N   1 
ATOM   1324 C  CA  . PHE B 1 50  ? 28.541  -10.144 25.145  1.00 17.65  ? 50   PHE B CA  1 
ATOM   1325 C  C   . PHE B 1 50  ? 27.327  -10.775 24.470  1.00 18.09  ? 50   PHE B C   1 
ATOM   1326 O  O   . PHE B 1 50  ? 26.399  -11.260 25.142  1.00 17.02  ? 50   PHE B O   1 
ATOM   1327 C  CB  . PHE B 1 50  ? 29.356  -11.176 25.947  1.00 17.13  ? 50   PHE B CB  1 
ATOM   1328 C  CG  . PHE B 1 50  ? 29.666  -12.433 25.174  1.00 17.58  ? 50   PHE B CG  1 
ATOM   1329 C  CD1 . PHE B 1 50  ? 30.639  -12.425 24.176  1.00 19.56  ? 50   PHE B CD1 1 
ATOM   1330 C  CD2 . PHE B 1 50  ? 28.951  -13.617 25.412  1.00 18.88  ? 50   PHE B CD2 1 
ATOM   1331 C  CE1 . PHE B 1 50  ? 30.918  -13.583 23.439  1.00 20.03  ? 50   PHE B CE1 1 
ATOM   1332 C  CE2 . PHE B 1 50  ? 29.222  -14.789 24.664  1.00 18.48  ? 50   PHE B CE2 1 
ATOM   1333 C  CZ  . PHE B 1 50  ? 30.194  -14.766 23.681  1.00 18.25  ? 50   PHE B CZ  1 
ATOM   1334 N  N   . ASP B 1 51  ? 27.329  -10.730 23.139  1.00 19.63  ? 51   ASP B N   1 
ATOM   1335 C  CA  . ASP B 1 51  ? 26.314  -11.348 22.333  1.00 20.57  ? 51   ASP B CA  1 
ATOM   1336 C  C   . ASP B 1 51  ? 26.884  -12.647 21.754  1.00 20.87  ? 51   ASP B C   1 
ATOM   1337 O  O   . ASP B 1 51  ? 27.653  -12.638 20.802  1.00 20.78  ? 51   ASP B O   1 
ATOM   1338 C  CB  . ASP B 1 51  ? 25.843  -10.397 21.227  1.00 22.02  ? 51   ASP B CB  1 
ATOM   1339 C  CG  . ASP B 1 51  ? 24.633  -10.917 20.488  1.00 24.90  ? 51   ASP B CG  1 
ATOM   1340 O  OD1 . ASP B 1 51  ? 24.430  -12.130 20.486  1.00 23.90  ? 51   ASP B OD1 1 
ATOM   1341 O  OD2 . ASP B 1 51  ? 23.874  -10.107 19.918  1.00 30.14  ? 51   ASP B OD2 1 
ATOM   1342 N  N   . GLY B 1 52  ? 26.506  -13.758 22.373  1.00 19.71  ? 52   GLY B N   1 
ATOM   1343 C  CA  . GLY B 1 52  ? 26.979  -15.060 21.964  1.00 21.03  ? 52   GLY B CA  1 
ATOM   1344 C  C   . GLY B 1 52  ? 26.621  -15.458 20.563  1.00 22.45  ? 52   GLY B C   1 
ATOM   1345 O  O   . GLY B 1 52  ? 27.338  -16.255 19.955  1.00 23.80  ? 52   GLY B O   1 
ATOM   1346 N  N   . ALA B 1 53  ? 25.506  -14.939 20.050  1.00 23.61  ? 53   ALA B N   1 
ATOM   1347 C  CA  . ALA B 1 53  ? 25.141  -15.183 18.665  1.00 26.29  ? 53   ALA B CA  1 
ATOM   1348 C  C   . ALA B 1 53  ? 26.237  -14.651 17.731  1.00 27.80  ? 53   ALA B C   1 
ATOM   1349 O  O   . ALA B 1 53  ? 26.624  -15.325 16.770  1.00 29.36  ? 53   ALA B O   1 
ATOM   1350 C  CB  . ALA B 1 53  ? 23.791  -14.541 18.330  1.00 28.12  ? 53   ALA B CB  1 
ATOM   1351 N  N   . LEU B 1 54  ? 26.761  -13.476 18.056  1.00 27.33  ? 54   LEU B N   1 
ATOM   1352 C  CA  . LEU B 1 54  ? 27.815  -12.827 17.246  1.00 29.21  ? 54   LEU B CA  1 
ATOM   1353 C  C   . LEU B 1 54  ? 29.248  -13.137 17.719  1.00 28.64  ? 54   LEU B C   1 
ATOM   1354 O  O   . LEU B 1 54  ? 30.207  -12.890 16.984  1.00 31.00  ? 54   LEU B O   1 
ATOM   1355 C  CB  . LEU B 1 54  ? 27.595  -11.311 17.200  1.00 29.10  ? 54   LEU B CB  1 
ATOM   1356 C  CG  . LEU B 1 54  ? 26.130  -10.849 17.143  1.00 30.42  ? 54   LEU B CG  1 
ATOM   1357 C  CD1 . LEU B 1 54  ? 26.020  -9.341  17.002  1.00 31.92  ? 54   LEU B CD1 1 
ATOM   1358 C  CD2 . LEU B 1 54  ? 25.422  -11.531 16.019  1.00 33.01  ? 54   LEU B CD2 1 
ATOM   1359 N  N   . ASN B 1 55  ? 29.384  -13.715 18.908  1.00 27.02  ? 55   ASN B N   1 
ATOM   1360 C  CA  . ASN B 1 55  ? 30.681  -13.880 19.576  1.00 26.85  ? 55   ASN B CA  1 
ATOM   1361 C  C   . ASN B 1 55  ? 31.410  -12.537 19.619  1.00 27.02  ? 55   ASN B C   1 
ATOM   1362 O  O   . ASN B 1 55  ? 32.609  -12.443 19.304  1.00 28.76  ? 55   ASN B O   1 
ATOM   1363 C  CB  . ASN B 1 55  ? 31.544  -15.004 18.933  1.00 28.54  ? 55   ASN B CB  1 
ATOM   1364 C  CG  . ASN B 1 55  ? 32.452  -15.715 19.952  1.00 28.23  ? 55   ASN B CG  1 
ATOM   1365 O  OD1 . ASN B 1 55  ? 32.556  -15.286 21.105  1.00 30.20  ? 55   ASN B OD1 1 
ATOM   1366 N  ND2 . ASN B 1 55  ? 33.117  -16.798 19.527  1.00 29.98  ? 55   ASN B ND2 1 
ATOM   1367 N  N   . LYS B 1 56  ? 30.663  -11.495 20.005  1.00 25.58  ? 56   LYS B N   1 
ATOM   1368 C  CA  . LYS B 1 56  ? 31.198  -10.124 20.087  1.00 24.94  ? 56   LYS B CA  1 
ATOM   1369 C  C   . LYS B 1 56  ? 30.781  -9.395  21.343  1.00 22.55  ? 56   LYS B C   1 
ATOM   1370 O  O   . LYS B 1 56  ? 29.680  -9.618  21.879  1.00 21.64  ? 56   LYS B O   1 
ATOM   1371 C  CB  . LYS B 1 56  ? 30.756  -9.274  18.892  1.00 26.46  ? 56   LYS B CB  1 
ATOM   1372 C  CG  . LYS B 1 56  ? 31.280  -9.748  17.562  1.00 29.60  ? 56   LYS B CG  1 
ATOM   1373 C  CD  . LYS B 1 56  ? 31.006  -8.724  16.477  1.00 31.78  ? 56   LYS B CD  1 
ATOM   1374 C  CE  . LYS B 1 56  ? 31.440  -9.212  15.112  1.00 34.53  ? 56   LYS B CE  1 
ATOM   1375 N  NZ  . LYS B 1 56  ? 30.892  -8.350  14.051  1.00 36.53  ? 56   LYS B NZ  1 
ATOM   1376 N  N   . SER B 1 57  ? 31.660  -8.491  21.779  1.00 21.12  ? 57   SER B N   1 
ATOM   1377 C  CA  . SER B 1 57  ? 31.451  -7.704  22.969  1.00 20.16  ? 57   SER B CA  1 
ATOM   1378 C  C   . SER B 1 57  ? 31.433  -6.230  22.617  1.00 20.14  ? 57   SER B C   1 
ATOM   1379 O  O   . SER B 1 57  ? 32.193  -5.774  21.770  1.00 21.35  ? 57   SER B O   1 
ATOM   1380 C  CB  . SER B 1 57  ? 32.551  -7.979  23.993  1.00 19.64  ? 57   SER B CB  1 
ATOM   1381 O  OG  . SER B 1 57  ? 32.624  -9.380  24.273  1.00 21.62  ? 57   SER B OG  1 
ATOM   1382 N  N   . THR B 1 58  ? 30.538  -5.500  23.265  1.00 19.22  ? 58   THR B N   1 
ATOM   1383 C  CA  . THR B 1 58  ? 30.314  -4.082  22.992  1.00 19.98  ? 58   THR B CA  1 
ATOM   1384 C  C   . THR B 1 58  ? 30.468  -3.350  24.316  1.00 18.46  ? 58   THR B C   1 
ATOM   1385 O  O   . THR B 1 58  ? 29.875  -3.751  25.313  1.00 16.48  ? 58   THR B O   1 
ATOM   1386 C  CB  . THR B 1 58  ? 28.908  -3.861  22.419  1.00 20.49  ? 58   THR B CB  1 
ATOM   1387 O  OG1 . THR B 1 58  ? 28.780  -4.600  21.203  1.00 22.24  ? 58   THR B OG1 1 
ATOM   1388 C  CG2 . THR B 1 58  ? 28.616  -2.381  22.159  1.00 22.10  ? 58   THR B CG2 1 
ATOM   1389 N  N   . VAL B 1 59  ? 31.296  -2.309  24.324  1.00 19.04  ? 59   VAL B N   1 
ATOM   1390 C  CA  . VAL B 1 59  ? 31.493  -1.468  25.501  1.00 19.17  ? 59   VAL B CA  1 
ATOM   1391 C  C   . VAL B 1 59  ? 31.434  0.023   25.166  1.00 20.49  ? 59   VAL B C   1 
ATOM   1392 O  O   . VAL B 1 59  ? 31.937  0.438   24.128  1.00 20.51  ? 59   VAL B O   1 
ATOM   1393 C  CB  . VAL B 1 59  ? 32.849  -1.778  26.195  1.00 18.86  ? 59   VAL B CB  1 
ATOM   1394 C  CG1 . VAL B 1 59  ? 32.902  -3.236  26.656  1.00 18.25  ? 59   VAL B CG1 1 
ATOM   1395 C  CG2 . VAL B 1 59  ? 34.042  -1.474  25.262  1.00 21.58  ? 59   VAL B CG2 1 
ATOM   1396 N  N   . PRO B 1 60  ? 30.875  0.847   26.081  1.00 21.01  ? 60   PRO B N   1 
ATOM   1397 C  CA  . PRO B 1 60  ? 30.916  2.273   25.854  1.00 22.87  ? 60   PRO B CA  1 
ATOM   1398 C  C   . PRO B 1 60  ? 32.297  2.830   26.194  1.00 23.31  ? 60   PRO B C   1 
ATOM   1399 O  O   . PRO B 1 60  ? 33.058  2.218   26.960  1.00 21.47  ? 60   PRO B O   1 
ATOM   1400 C  CB  . PRO B 1 60  ? 29.840  2.818   26.797  1.00 23.09  ? 60   PRO B CB  1 
ATOM   1401 C  CG  . PRO B 1 60  ? 29.799  1.853   27.927  1.00 21.38  ? 60   PRO B CG  1 
ATOM   1402 C  CD  . PRO B 1 60  ? 30.213  0.510   27.362  1.00 20.31  ? 60   PRO B CD  1 
ATOM   1403 N  N   . THR B 1 61  ? 32.598  3.976   25.612  1.00 25.50  ? 61   THR B N   1 
ATOM   1404 C  CA  . THR B 1 61  ? 33.909  4.591   25.720  1.00 27.09  ? 61   THR B CA  1 
ATOM   1405 C  C   . THR B 1 61  ? 34.231  4.972   27.152  1.00 26.99  ? 61   THR B C   1 
ATOM   1406 O  O   . THR B 1 61  ? 35.395  4.956   27.540  1.00 27.50  ? 61   THR B O   1 
ATOM   1407 C  CB  . THR B 1 61  ? 34.037  5.827   24.794  1.00 28.67  ? 61   THR B CB  1 
ATOM   1408 O  OG1 . THR B 1 61  ? 33.755  5.434   23.449  1.00 30.61  ? 61   THR B OG1 1 
ATOM   1409 C  CG2 . THR B 1 61  ? 35.449  6.405   24.849  1.00 31.29  ? 61   THR B CG2 1 
ATOM   1410 N  N   . ASP B 1 62  ? 33.216  5.290   27.949  1.00 27.21  ? 62   ASP B N   1 
ATOM   1411 C  CA  . ASP B 1 62  ? 33.479  5.617   29.348  1.00 27.91  ? 62   ASP B CA  1 
ATOM   1412 C  C   . ASP B 1 62  ? 33.779  4.391   30.195  1.00 26.49  ? 62   ASP B C   1 
ATOM   1413 O  O   . ASP B 1 62  ? 34.300  4.515   31.278  1.00 27.84  ? 62   ASP B O   1 
ATOM   1414 C  CB  . ASP B 1 62  ? 32.374  6.501   29.944  1.00 29.64  ? 62   ASP B CB  1 
ATOM   1415 C  CG  . ASP B 1 62  ? 31.125  5.741   30.252  1.00 31.40  ? 62   ASP B CG  1 
ATOM   1416 O  OD1 . ASP B 1 62  ? 30.522  5.197   29.306  1.00 33.92  ? 62   ASP B OD1 1 
ATOM   1417 O  OD2 . ASP B 1 62  ? 30.744  5.708   31.443  1.00 34.88  ? 62   ASP B OD2 1 
ATOM   1418 N  N   . PHE B 1 63  ? 33.513  3.197   29.673  1.00 25.15  ? 63   PHE B N   1 
ATOM   1419 C  CA  . PHE B 1 63  ? 33.936  1.949   30.316  1.00 24.09  ? 63   PHE B CA  1 
ATOM   1420 C  C   . PHE B 1 63  ? 34.815  1.126   29.397  1.00 22.95  ? 63   PHE B C   1 
ATOM   1421 O  O   . PHE B 1 63  ? 34.647  -0.086  29.297  1.00 22.12  ? 63   PHE B O   1 
ATOM   1422 C  CB  . PHE B 1 63  ? 32.723  1.110   30.677  1.00 24.86  ? 63   PHE B CB  1 
ATOM   1423 C  CG  . PHE B 1 63  ? 32.286  1.246   32.076  1.00 25.55  ? 63   PHE B CG  1 
ATOM   1424 C  CD1 . PHE B 1 63  ? 32.858  0.474   33.055  1.00 27.72  ? 63   PHE B CD1 1 
ATOM   1425 C  CD2 . PHE B 1 63  ? 31.258  2.109   32.403  1.00 29.43  ? 63   PHE B CD2 1 
ATOM   1426 C  CE1 . PHE B 1 63  ? 32.414  0.550   34.344  1.00 28.84  ? 63   PHE B CE1 1 
ATOM   1427 C  CE2 . PHE B 1 63  ? 30.807  2.190   33.697  1.00 29.56  ? 63   PHE B CE2 1 
ATOM   1428 C  CZ  . PHE B 1 63  ? 31.395  1.417   34.663  1.00 29.19  ? 63   PHE B CZ  1 
ATOM   1429 N  N   . SER B 1 64  ? 35.765  1.779   28.740  1.00 22.50  ? 64   SER B N   1 
ATOM   1430 C  CA  . SER B 1 64  ? 36.536  1.156   27.662  1.00 23.32  ? 64   SER B CA  1 
ATOM   1431 C  C   . SER B 1 64  ? 37.350  -0.110  28.051  1.00 22.50  ? 64   SER B C   1 
ATOM   1432 O  O   . SER B 1 64  ? 37.636  -0.929  27.185  1.00 22.09  ? 64   SER B O   1 
ATOM   1433 C  CB  . SER B 1 64  ? 37.479  2.192   27.035  1.00 24.56  ? 64   SER B CB  1 
ATOM   1434 O  OG  . SER B 1 64  ? 38.446  2.593   27.987  1.00 26.12  ? 64   SER B OG  1 
ATOM   1435 N  N   . SER B 1 65  ? 37.715  -0.271  29.328  1.00 22.29  ? 65   SER B N   1 
ATOM   1436 C  CA  . SER B 1 65  ? 38.495  -1.443  29.770  1.00 22.50  ? 65   SER B CA  1 
ATOM   1437 C  C   . SER B 1 65  ? 37.634  -2.657  30.187  1.00 20.94  ? 65   SER B C   1 
ATOM   1438 O  O   . SER B 1 65  ? 38.171  -3.748  30.395  1.00 21.38  ? 65   SER B O   1 
ATOM   1439 C  CB  . SER B 1 65  ? 39.433  -1.067  30.924  1.00 22.39  ? 65   SER B CB  1 
ATOM   1440 O  OG  . SER B 1 65  ? 38.701  -0.904  32.137  1.00 21.53  ? 65   SER B OG  1 
ATOM   1441 N  N   . ALA B 1 66  ? 36.324  -2.459  30.334  1.00 20.12  ? 66   ALA B N   1 
ATOM   1442 C  CA  . ALA B 1 66  ? 35.411  -3.532  30.742  1.00 19.55  ? 66   ALA B CA  1 
ATOM   1443 C  C   . ALA B 1 66  ? 35.469  -4.751  29.814  1.00 19.26  ? 66   ALA B C   1 
ATOM   1444 O  O   . ALA B 1 66  ? 35.354  -4.631  28.586  1.00 19.04  ? 66   ALA B O   1 
ATOM   1445 C  CB  . ALA B 1 66  ? 33.967  -3.029  30.870  1.00 17.89  ? 66   ALA B CB  1 
ATOM   1446 N  N   . LYS B 1 67  ? 35.657  -5.916  30.426  1.00 19.30  ? 67   LYS B N   1 
ATOM   1447 C  CA  . LYS B 1 67  ? 35.763  -7.172  29.711  1.00 20.35  ? 67   LYS B CA  1 
ATOM   1448 C  C   . LYS B 1 67  ? 35.332  -8.337  30.602  1.00 19.46  ? 67   LYS B C   1 
ATOM   1449 O  O   . LYS B 1 67  ? 35.433  -8.271  31.824  1.00 18.14  ? 67   LYS B O   1 
ATOM   1450 C  CB  . LYS B 1 67  ? 37.178  -7.431  29.217  1.00 22.20  ? 67   LYS B CB  1 
ATOM   1451 C  CG  . LYS B 1 67  ? 38.241  -7.554  30.306  1.00 25.50  ? 67   LYS B CG  1 
ATOM   1452 C  CD  . LYS B 1 67  ? 39.454  -8.339  29.818  1.00 27.83  ? 67   LYS B CD  1 
ATOM   1453 C  CE  . LYS B 1 67  ? 40.737  -8.011  30.588  1.00 32.30  ? 67   LYS B CE  1 
ATOM   1454 N  NZ  . LYS B 1 67  ? 40.571  -7.990  32.068  1.00 34.87  ? 67   LYS B NZ  1 
ATOM   1455 N  N   . ILE B 1 68  ? 34.848  -9.396  29.969  1.00 19.35  ? 68   ILE B N   1 
ATOM   1456 C  CA  . ILE B 1 68  ? 34.675  -10.681 30.644  1.00 19.60  ? 68   ILE B CA  1 
ATOM   1457 C  C   . ILE B 1 68  ? 35.606  -11.685 29.936  1.00 21.03  ? 68   ILE B C   1 
ATOM   1458 O  O   . ILE B 1 68  ? 36.062  -11.437 28.811  1.00 21.06  ? 68   ILE B O   1 
ATOM   1459 C  CB  . ILE B 1 68  ? 33.196  -11.158 30.652  1.00 18.56  ? 68   ILE B CB  1 
ATOM   1460 C  CG1 . ILE B 1 68  ? 32.744  -11.543 29.236  1.00 18.43  ? 68   ILE B CG1 1 
ATOM   1461 C  CG2 . ILE B 1 68  ? 32.303  -10.091 31.271  1.00 16.81  ? 68   ILE B CG2 1 
ATOM   1462 C  CD1 . ILE B 1 68  ? 31.427  -12.273 29.153  1.00 18.00  ? 68   ILE B CD1 1 
ATOM   1463 N  N   . GLU B 1 69  ? 35.925  -12.778 30.622  1.00 22.23  ? 69   GLU B N   1 
ATOM   1464 C  CA  . GLU B 1 69  ? 36.705  -13.860 30.029  1.00 23.63  ? 69   GLU B CA  1 
ATOM   1465 C  C   . GLU B 1 69  ? 35.714  -14.839 29.419  1.00 23.00  ? 69   GLU B C   1 
ATOM   1466 O  O   . GLU B 1 69  ? 35.137  -15.678 30.126  1.00 23.45  ? 69   GLU B O   1 
ATOM   1467 C  CB  . GLU B 1 69  ? 37.583  -14.561 31.071  1.00 25.46  ? 69   GLU B CB  1 
ATOM   1468 C  CG  . GLU B 1 69  ? 38.624  -13.683 31.765  1.00 28.57  ? 69   GLU B CG  1 
ATOM   1469 C  CD  . GLU B 1 69  ? 39.746  -13.172 30.844  1.00 33.97  ? 69   GLU B CD  1 
ATOM   1470 O  OE1 . GLU B 1 69  ? 40.037  -13.828 29.812  1.00 37.93  ? 69   GLU B OE1 1 
ATOM   1471 O  OE2 . GLU B 1 69  ? 40.349  -12.114 31.165  1.00 35.04  ? 69   GLU B OE2 1 
ATOM   1472 N  N   . VAL B 1 70  ? 35.479  -14.717 28.118  1.00 22.93  ? 70   VAL B N   1 
ATOM   1473 C  CA  . VAL B 1 70  ? 34.485  -15.576 27.445  1.00 23.36  ? 70   VAL B CA  1 
ATOM   1474 C  C   . VAL B 1 70  ? 34.784  -17.076 27.612  1.00 24.24  ? 70   VAL B C   1 
ATOM   1475 O  O   . VAL B 1 70  ? 33.858  -17.880 27.677  1.00 24.95  ? 70   VAL B O   1 
ATOM   1476 C  CB  . VAL B 1 70  ? 34.305  -15.215 25.942  1.00 23.40  ? 70   VAL B CB  1 
ATOM   1477 C  CG1 . VAL B 1 70  ? 33.385  -16.221 25.246  1.00 24.15  ? 70   VAL B CG1 1 
ATOM   1478 C  CG2 . VAL B 1 70  ? 33.711  -13.833 25.814  1.00 23.22  ? 70   VAL B CG2 1 
ATOM   1479 N  N   . SER B 1 71  ? 36.060  -17.436 27.725  1.00 25.94  ? 71   SER B N   1 
ATOM   1480 C  CA  . SER B 1 71  ? 36.472  -18.827 28.005  1.00 27.60  ? 71   SER B CA  1 
ATOM   1481 C  C   . SER B 1 71  ? 35.937  -19.401 29.326  1.00 27.14  ? 71   SER B C   1 
ATOM   1482 O  O   . SER B 1 71  ? 36.052  -20.605 29.562  1.00 28.11  ? 71   SER B O   1 
ATOM   1483 C  CB  . SER B 1 71  ? 37.996  -18.964 27.971  1.00 29.86  ? 71   SER B CB  1 
ATOM   1484 O  OG  . SER B 1 71  ? 38.628  -18.289 29.049  1.00 31.37  ? 71   SER B OG  1 
ATOM   1485 N  N   . GLN B 1 72  ? 35.340  -18.562 30.170  1.00 24.94  ? 72   GLN B N   1 
ATOM   1486 C  CA  . GLN B 1 72  ? 34.821  -19.010 31.463  1.00 25.51  ? 72   GLN B CA  1 
ATOM   1487 C  C   . GLN B 1 72  ? 33.304  -18.986 31.550  1.00 23.59  ? 72   GLN B C   1 
ATOM   1488 O  O   . GLN B 1 72  ? 32.734  -19.395 32.561  1.00 23.04  ? 72   GLN B O   1 
ATOM   1489 C  CB  . GLN B 1 72  ? 35.383  -18.129 32.583  1.00 25.51  ? 72   GLN B CB  1 
ATOM   1490 C  CG  . GLN B 1 72  ? 36.886  -18.118 32.677  1.00 28.39  ? 72   GLN B CG  1 
ATOM   1491 C  CD  . GLN B 1 72  ? 37.435  -19.458 33.111  1.00 32.48  ? 72   GLN B CD  1 
ATOM   1492 O  OE1 . GLN B 1 72  ? 37.068  -19.983 34.174  1.00 32.49  ? 72   GLN B OE1 1 
ATOM   1493 N  NE2 . GLN B 1 72  ? 38.321  -20.024 32.294  1.00 34.31  ? 72   GLN B NE2 1 
ATOM   1494 N  N   . LEU B 1 73  ? 32.639  -18.475 30.519  1.00 22.81  ? 73   LEU B N   1 
ATOM   1495 C  CA  . LEU B 1 73  ? 31.186  -18.294 30.613  1.00 22.24  ? 73   LEU B CA  1 
ATOM   1496 C  C   . LEU B 1 73  ? 30.417  -19.580 30.798  1.00 22.22  ? 73   LEU B C   1 
ATOM   1497 O  O   . LEU B 1 73  ? 29.439  -19.624 31.550  1.00 21.59  ? 73   LEU B O   1 
ATOM   1498 C  CB  . LEU B 1 73  ? 30.629  -17.582 29.380  1.00 22.22  ? 73   LEU B CB  1 
ATOM   1499 C  CG  . LEU B 1 73  ? 30.066  -16.177 29.500  1.00 24.87  ? 73   LEU B CG  1 
ATOM   1500 C  CD1 . LEU B 1 73  ? 29.347  -15.894 28.177  1.00 25.60  ? 73   LEU B CD1 1 
ATOM   1501 C  CD2 . LEU B 1 73  ? 29.131  -16.017 30.712  1.00 23.04  ? 73   LEU B CD2 1 
ATOM   1502 N  N   . LEU B 1 74  ? 30.837  -20.628 30.099  1.00 22.81  ? 74   LEU B N   1 
ATOM   1503 C  CA  . LEU B 1 74  ? 30.124  -21.899 30.166  1.00 23.69  ? 74   LEU B CA  1 
ATOM   1504 C  C   . LEU B 1 74  ? 30.212  -22.540 31.567  1.00 24.74  ? 74   LEU B C   1 
ATOM   1505 O  O   . LEU B 1 74  ? 29.374  -23.351 31.926  1.00 24.68  ? 74   LEU B O   1 
ATOM   1506 C  CB  . LEU B 1 74  ? 30.594  -22.832 29.049  1.00 24.66  ? 74   LEU B CB  1 
ATOM   1507 C  CG  . LEU B 1 74  ? 30.340  -22.256 27.633  1.00 25.22  ? 74   LEU B CG  1 
ATOM   1508 C  CD1 . LEU B 1 74  ? 30.712  -23.248 26.567  1.00 26.53  ? 74   LEU B CD1 1 
ATOM   1509 C  CD2 . LEU B 1 74  ? 28.892  -21.762 27.430  1.00 24.95  ? 74   LEU B CD2 1 
ATOM   1510 N  N   . LYS B 1 75  ? 31.215  -22.147 32.352  1.00 24.77  ? 75   LYS B N   1 
ATOM   1511 C  CA  . LYS B 1 75  ? 31.306  -22.519 33.770  1.00 26.37  ? 75   LYS B CA  1 
ATOM   1512 C  C   . LYS B 1 75  ? 30.376  -21.641 34.624  1.00 25.22  ? 75   LYS B C   1 
ATOM   1513 O  O   . LYS B 1 75  ? 30.215  -21.898 35.816  1.00 27.17  ? 75   LYS B O   1 
ATOM   1514 C  CB  . LYS B 1 75  ? 32.744  -22.348 34.298  1.00 27.54  ? 75   LYS B CB  1 
ATOM   1515 C  CG  . LYS B 1 75  ? 33.800  -23.233 33.637  1.00 30.58  ? 75   LYS B CG  1 
ATOM   1516 C  CD  . LYS B 1 75  ? 35.222  -22.911 34.156  1.00 32.19  ? 75   LYS B CD  1 
ATOM   1517 C  CE  . LYS B 1 75  ? 36.329  -23.237 33.121  1.00 34.18  ? 75   LYS B CE  1 
ATOM   1518 N  NZ  . LYS B 1 75  ? 37.697  -23.488 33.741  1.00 38.44  ? 75   LYS B NZ  1 
ATOM   1519 N  N   . GLY B 1 76  ? 29.786  -20.613 34.028  1.00 22.46  ? 76   GLY B N   1 
ATOM   1520 C  CA  . GLY B 1 76  ? 28.860  -19.725 34.734  1.00 22.28  ? 76   GLY B CA  1 
ATOM   1521 C  C   . GLY B 1 76  ? 29.542  -18.499 35.333  1.00 22.08  ? 76   GLY B C   1 
ATOM   1522 O  O   . GLY B 1 76  ? 28.914  -17.712 36.057  1.00 22.82  ? 76   GLY B O   1 
ATOM   1523 N  N   . ASP B 1 77  ? 30.816  -18.329 35.011  1.00 21.37  ? 77   ASP B N   1 
ATOM   1524 C  CA  . ASP B 1 77  ? 31.582  -17.181 35.448  1.00 21.14  ? 77   ASP B CA  1 
ATOM   1525 C  C   . ASP B 1 77  ? 31.380  -16.081 34.430  1.00 19.42  ? 77   ASP B C   1 
ATOM   1526 O  O   . ASP B 1 77  ? 31.823  -16.204 33.282  1.00 19.08  ? 77   ASP B O   1 
ATOM   1527 C  CB  . ASP B 1 77  ? 33.061  -17.568 35.575  1.00 22.32  ? 77   ASP B CB  1 
ATOM   1528 C  CG  . ASP B 1 77  ? 33.955  -16.416 36.034  1.00 22.32  ? 77   ASP B CG  1 
ATOM   1529 O  OD1 . ASP B 1 77  ? 33.460  -15.323 36.344  1.00 21.83  ? 77   ASP B OD1 1 
ATOM   1530 O  OD2 . ASP B 1 77  ? 35.176  -16.622 36.107  1.00 20.22  ? 77   ASP B OD2 1 
ATOM   1531 N  N   . ALA B 1 78  ? 30.710  -15.015 34.858  1.00 18.77  ? 78   ALA B N   1 
ATOM   1532 C  CA  . ALA B 1 78  ? 30.436  -13.861 34.006  1.00 17.80  ? 78   ALA B CA  1 
ATOM   1533 C  C   . ALA B 1 78  ? 31.128  -12.618 34.592  1.00 17.15  ? 78   ALA B C   1 
ATOM   1534 O  O   . ALA B 1 78  ? 30.715  -11.492 34.306  1.00 16.16  ? 78   ALA B O   1 
ATOM   1535 C  CB  . ALA B 1 78  ? 28.921  -13.631 33.917  1.00 16.44  ? 78   ALA B CB  1 
ATOM   1536 N  N   . SER B 1 79  ? 32.168  -12.848 35.409  1.00 18.93  ? 79   SER B N   1 
ATOM   1537 C  CA  . SER B 1 79  ? 32.812  -11.781 36.202  1.00 19.16  ? 79   SER B CA  1 
ATOM   1538 C  C   . SER B 1 79  ? 33.391  -10.662 35.322  1.00 19.22  ? 79   SER B C   1 
ATOM   1539 O  O   . SER B 1 79  ? 34.012  -10.936 34.271  1.00 18.57  ? 79   SER B O   1 
ATOM   1540 C  CB  . SER B 1 79  ? 33.901  -12.366 37.130  1.00 20.49  ? 79   SER B CB  1 
ATOM   1541 O  OG  . SER B 1 79  ? 33.359  -13.311 38.044  1.00 20.40  ? 79   SER B OG  1 
ATOM   1542 N  N   . LEU B 1 80  ? 33.175  -9.416  35.771  1.00 19.59  ? 80   LEU B N   1 
ATOM   1543 C  CA  . LEU B 1 80  ? 33.545  -8.232  35.032  1.00 19.60  ? 80   LEU B CA  1 
ATOM   1544 C  C   . LEU B 1 80  ? 34.911  -7.779  35.508  1.00 20.71  ? 80   LEU B C   1 
ATOM   1545 O  O   . LEU B 1 80  ? 35.154  -7.661  36.711  1.00 21.95  ? 80   LEU B O   1 
ATOM   1546 C  CB  . LEU B 1 80  ? 32.519  -7.110  35.216  1.00 19.11  ? 80   LEU B CB  1 
ATOM   1547 C  CG  . LEU B 1 80  ? 32.677  -5.885  34.306  1.00 19.26  ? 80   LEU B CG  1 
ATOM   1548 C  CD1 . LEU B 1 80  ? 32.528  -6.253  32.840  1.00 19.84  ? 80   LEU B CD1 1 
ATOM   1549 C  CD2 . LEU B 1 80  ? 31.709  -4.740  34.730  1.00 20.81  ? 80   LEU B CD2 1 
ATOM   1550 N  N   . LYS B 1 81  ? 35.801  -7.552  34.554  1.00 21.48  ? 81   LYS B N   1 
ATOM   1551 C  CA  . LYS B 1 81  ? 37.116  -6.985  34.821  1.00 23.38  ? 81   LYS B CA  1 
ATOM   1552 C  C   . LYS B 1 81  ? 37.241  -5.599  34.225  1.00 22.95  ? 81   LYS B C   1 
ATOM   1553 O  O   . LYS B 1 81  ? 36.698  -5.331  33.159  1.00 21.89  ? 81   LYS B O   1 
ATOM   1554 C  CB  . LYS B 1 81  ? 38.190  -7.889  34.241  1.00 24.72  ? 81   LYS B CB  1 
ATOM   1555 C  CG  . LYS B 1 81  ? 38.185  -9.245  34.893  1.00 26.49  ? 81   LYS B CG  1 
ATOM   1556 C  CD  . LYS B 1 81  ? 39.124  -10.214 34.214  1.00 28.55  ? 81   LYS B CD  1 
ATOM   1557 C  CE  . LYS B 1 81  ? 39.208  -11.499 35.022  1.00 29.84  ? 81   LYS B CE  1 
ATOM   1558 N  NZ  . LYS B 1 81  ? 40.524  -12.188 34.893  1.00 36.06  ? 81   LYS B NZ  1 
ATOM   1559 N  N   . MET B 1 82  ? 37.941  -4.717  34.936  1.00 24.30  ? 82   MET B N   1 
ATOM   1560 C  CA  . MET B 1 82  ? 38.253  -3.392  34.415  1.00 25.82  ? 82   MET B CA  1 
ATOM   1561 C  C   . MET B 1 82  ? 39.452  -2.783  35.113  1.00 26.78  ? 82   MET B C   1 
ATOM   1562 O  O   . MET B 1 82  ? 39.901  -3.241  36.170  1.00 26.89  ? 82   MET B O   1 
ATOM   1563 C  CB  . MET B 1 82  ? 37.069  -2.449  34.562  1.00 25.07  ? 82   MET B CB  1 
ATOM   1564 C  CG  . MET B 1 82  ? 36.773  -2.098  35.970  1.00 27.28  ? 82   MET B CG  1 
ATOM   1565 S  SD  . MET B 1 82  ? 35.350  -1.031  36.096  1.00 32.46  ? 82   MET B SD  1 
ATOM   1566 C  CE  . MET B 1 82  ? 35.022  -1.331  37.807  1.00 27.26  ? 82   MET B CE  1 
ATOM   1567 N  N   . ASP B 1 83  ? 39.968  -1.729  34.498  1.00 27.36  ? 83   ASP B N   1 
ATOM   1568 C  CA  . ASP B 1 83  ? 41.112  -1.022  35.050  1.00 28.60  ? 83   ASP B CA  1 
ATOM   1569 C  C   . ASP B 1 83  ? 40.646  -0.074  36.164  1.00 28.26  ? 83   ASP B C   1 
ATOM   1570 O  O   . ASP B 1 83  ? 39.453  0.263   36.268  1.00 26.36  ? 83   ASP B O   1 
ATOM   1571 C  CB  . ASP B 1 83  ? 41.889  -0.305  33.940  1.00 30.16  ? 83   ASP B CB  1 
ATOM   1572 C  CG  . ASP B 1 83  ? 41.148  0.891   33.370  1.00 32.40  ? 83   ASP B CG  1 
ATOM   1573 O  OD1 . ASP B 1 83  ? 40.168  1.347   33.987  1.00 34.58  ? 83   ASP B OD1 1 
ATOM   1574 O  OD2 . ASP B 1 83  ? 41.569  1.410   32.314  1.00 36.61  ? 83   ASP B OD2 1 
ATOM   1575 N  N   . LYS B 1 84  ? 41.590  0.331   37.006  1.00 29.16  ? 84   LYS B N   1 
ATOM   1576 C  CA  . LYS B 1 84  ? 41.291  1.211   38.144  1.00 30.03  ? 84   LYS B CA  1 
ATOM   1577 C  C   . LYS B 1 84  ? 40.643  2.539   37.761  1.00 29.17  ? 84   LYS B C   1 
ATOM   1578 O  O   . LYS B 1 84  ? 39.806  3.050   38.493  1.00 29.92  ? 84   LYS B O   1 
ATOM   1579 C  CB  . LYS B 1 84  ? 42.541  1.446   38.984  1.00 32.12  ? 84   LYS B CB  1 
ATOM   1580 C  CG  . LYS B 1 84  ? 43.681  2.139   38.292  1.00 33.55  ? 84   LYS B CG  1 
ATOM   1581 C  CD  . LYS B 1 84  ? 44.820  2.382   39.275  1.00 35.80  ? 84   LYS B CD  1 
ATOM   1582 C  CE  . LYS B 1 84  ? 45.946  3.156   38.646  1.00 38.04  ? 84   LYS B CE  1 
ATOM   1583 N  NZ  . LYS B 1 84  ? 47.003  3.530   39.656  1.00 40.38  ? 84   LYS B NZ  1 
ATOM   1584 N  N   . SER B 1 85  ? 41.018  3.096   36.620  1.00 29.22  ? 85   SER B N   1 
ATOM   1585 C  CA  . SER B 1 85  ? 40.435  4.367   36.170  1.00 29.50  ? 85   SER B CA  1 
ATOM   1586 C  C   . SER B 1 85  ? 38.920  4.211   36.049  1.00 27.24  ? 85   SER B C   1 
ATOM   1587 O  O   . SER B 1 85  ? 38.161  4.998   36.598  1.00 26.72  ? 85   SER B O   1 
ATOM   1588 C  CB  . SER B 1 85  ? 41.046  4.828   34.839  1.00 29.89  ? 85   SER B CB  1 
ATOM   1589 O  OG  . SER B 1 85  ? 40.845  3.861   33.822  1.00 32.95  ? 85   SER B OG  1 
ATOM   1590 N  N   . ASP B 1 86  ? 38.490  3.155   35.375  1.00 25.67  ? 86   ASP B N   1 
ATOM   1591 C  CA  . ASP B 1 86  ? 37.064  2.887   35.206  1.00 25.08  ? 86   ASP B CA  1 
ATOM   1592 C  C   . ASP B 1 86  ? 36.375  2.533   36.515  1.00 25.05  ? 86   ASP B C   1 
ATOM   1593 O  O   . ASP B 1 86  ? 35.212  2.892   36.715  1.00 25.14  ? 86   ASP B O   1 
ATOM   1594 C  CB  . ASP B 1 86  ? 36.831  1.759   34.180  1.00 23.51  ? 86   ASP B CB  1 
ATOM   1595 C  CG  . ASP B 1 86  ? 37.125  2.191   32.752  1.00 23.78  ? 86   ASP B CG  1 
ATOM   1596 O  OD1 . ASP B 1 86  ? 37.073  3.399   32.466  1.00 24.92  ? 86   ASP B OD1 1 
ATOM   1597 O  OD2 . ASP B 1 86  ? 37.392  1.322   31.897  1.00 24.16  ? 86   ASP B OD2 1 
ATOM   1598 N  N   . ALA B 1 87  ? 37.076  1.799   37.381  1.00 25.42  ? 87   ALA B N   1 
ATOM   1599 C  CA  . ALA B 1 87  ? 36.537  1.407   38.685  1.00 26.10  ? 87   ALA B CA  1 
ATOM   1600 C  C   . ALA B 1 87  ? 36.330  2.629   39.567  1.00 27.83  ? 87   ALA B C   1 
ATOM   1601 O  O   . ALA B 1 87  ? 35.244  2.842   40.089  1.00 28.25  ? 87   ALA B O   1 
ATOM   1602 C  CB  . ALA B 1 87  ? 37.455  0.392   39.369  1.00 26.31  ? 87   ALA B CB  1 
ATOM   1603 N  N   . VAL B 1 88  ? 37.372  3.440   39.711  1.00 29.53  ? 88   VAL B N   1 
ATOM   1604 C  CA  . VAL B 1 88  ? 37.315  4.656   40.525  1.00 31.39  ? 88   VAL B CA  1 
ATOM   1605 C  C   . VAL B 1 88  ? 36.183  5.592   40.104  1.00 31.69  ? 88   VAL B C   1 
ATOM   1606 O  O   . VAL B 1 88  ? 35.468  6.151   40.957  1.00 33.13  ? 88   VAL B O   1 
ATOM   1607 C  CB  . VAL B 1 88  ? 38.643  5.434   40.467  1.00 33.10  ? 88   VAL B CB  1 
ATOM   1608 C  CG1 . VAL B 1 88  ? 38.414  6.882   40.833  1.00 34.48  ? 88   VAL B CG1 1 
ATOM   1609 C  CG2 . VAL B 1 88  ? 39.668  4.807   41.384  1.00 35.13  ? 88   VAL B CG2 1 
ATOM   1610 N  N   . SER B 1 89  ? 36.027  5.754   38.791  1.00 30.20  ? 89   SER B N   1 
ATOM   1611 C  CA  . SER B 1 89  ? 35.021  6.648   38.236  1.00 30.64  ? 89   SER B CA  1 
ATOM   1612 C  C   . SER B 1 89  ? 33.623  6.038   38.184  1.00 30.12  ? 89   SER B C   1 
ATOM   1613 O  O   . SER B 1 89  ? 32.664  6.738   37.837  1.00 31.59  ? 89   SER B O   1 
ATOM   1614 C  CB  . SER B 1 89  ? 35.458  7.151   36.844  1.00 30.59  ? 89   SER B CB  1 
ATOM   1615 O  OG  . SER B 1 89  ? 35.789  6.073   35.984  1.00 29.59  ? 89   SER B OG  1 
ATOM   1616 N  N   . HIS B 1 90  ? 33.496  4.745   38.512  1.00 28.60  ? 90   HIS B N   1 
ATOM   1617 C  CA  . HIS B 1 90  ? 32.205  4.069   38.534  1.00 28.19  ? 90   HIS B CA  1 
ATOM   1618 C  C   . HIS B 1 90  ? 32.081  3.143   39.742  1.00 27.84  ? 90   HIS B C   1 
ATOM   1619 O  O   . HIS B 1 90  ? 31.901  1.929   39.591  1.00 26.90  ? 90   HIS B O   1 
ATOM   1620 C  CB  . HIS B 1 90  ? 31.995  3.276   37.243  1.00 27.36  ? 90   HIS B CB  1 
ATOM   1621 C  CG  . HIS B 1 90  ? 32.198  4.079   35.994  1.00 29.98  ? 90   HIS B CG  1 
ATOM   1622 N  ND1 . HIS B 1 90  ? 33.396  4.107   35.315  1.00 29.99  ? 90   HIS B ND1 1 
ATOM   1623 C  CD2 . HIS B 1 90  ? 31.355  4.881   35.303  1.00 33.55  ? 90   HIS B CD2 1 
ATOM   1624 C  CE1 . HIS B 1 90  ? 33.285  4.887   34.259  1.00 33.48  ? 90   HIS B CE1 1 
ATOM   1625 N  NE2 . HIS B 1 90  ? 32.058  5.379   34.232  1.00 35.79  ? 90   HIS B NE2 1 
ATOM   1626 N  N   . THR B 1 91  ? 32.185  3.712   40.941  1.00 28.95  ? 91   THR B N   1 
ATOM   1627 C  CA  . THR B 1 91  ? 31.913  2.966   42.168  1.00 30.05  ? 91   THR B CA  1 
ATOM   1628 C  C   . THR B 1 91  ? 30.408  3.025   42.385  1.00 30.71  ? 91   THR B C   1 
ATOM   1629 O  O   . THR B 1 91  ? 29.757  4.010   42.013  1.00 31.08  ? 91   THR B O   1 
ATOM   1630 C  CB  . THR B 1 91  ? 32.640  3.534   43.421  1.00 31.89  ? 91   THR B CB  1 
ATOM   1631 O  OG1 . THR B 1 91  ? 32.239  4.888   43.649  1.00 34.52  ? 91   THR B OG1 1 
ATOM   1632 C  CG2 . THR B 1 91  ? 34.144  3.493   43.250  1.00 31.25  ? 91   THR B CG2 1 
ATOM   1633 N  N   . GLY B 1 92  ? 29.861  1.971   42.983  1.00 30.75  ? 92   GLY B N   1 
ATOM   1634 C  CA  . GLY B 1 92  ? 28.422  1.863   43.171  1.00 32.20  ? 92   GLY B CA  1 
ATOM   1635 C  C   . GLY B 1 92  ? 27.914  0.484   42.769  1.00 30.68  ? 92   GLY B C   1 
ATOM   1636 O  O   . GLY B 1 92  ? 28.664  -0.494  42.776  1.00 28.34  ? 92   GLY B O   1 
ATOM   1637 N  N   . ASN B 1 93  ? 26.632  0.427   42.413  1.00 31.54  ? 93   ASN B N   1 
ATOM   1638 C  CA  . ASN B 1 93  ? 25.912  -0.834  42.274  1.00 31.48  ? 93   ASN B CA  1 
ATOM   1639 C  C   . ASN B 1 93  ? 25.860  -1.322  40.830  1.00 29.12  ? 93   ASN B C   1 
ATOM   1640 O  O   . ASN B 1 93  ? 25.342  -0.631  39.947  1.00 29.23  ? 93   ASN B O   1 
ATOM   1641 C  CB  . ASN B 1 93  ? 24.502  -0.703  42.857  1.00 34.62  ? 93   ASN B CB  1 
ATOM   1642 C  CG  . ASN B 1 93  ? 24.500  -0.761  44.363  1.00 38.20  ? 93   ASN B CG  1 
ATOM   1643 O  OD1 . ASN B 1 93  ? 24.880  -1.772  44.946  1.00 39.03  ? 93   ASN B OD1 1 
ATOM   1644 N  ND2 . ASN B 1 93  ? 24.070  0.328   45.002  1.00 43.95  ? 93   ASN B ND2 1 
ATOM   1645 N  N   . TYR B 1 94  ? 26.413  -2.516  40.619  1.00 27.38  ? 94   TYR B N   1 
ATOM   1646 C  CA  . TYR B 1 94  ? 26.489  -3.146  39.306  1.00 24.98  ? 94   TYR B CA  1 
ATOM   1647 C  C   . TYR B 1 94  ? 25.478  -4.283  39.218  1.00 25.29  ? 94   TYR B C   1 
ATOM   1648 O  O   . TYR B 1 94  ? 25.218  -4.962  40.221  1.00 26.65  ? 94   TYR B O   1 
ATOM   1649 C  CB  . TYR B 1 94  ? 27.888  -3.705  39.070  1.00 23.58  ? 94   TYR B CB  1 
ATOM   1650 C  CG  . TYR B 1 94  ? 28.926  -2.674  38.718  1.00 24.29  ? 94   TYR B CG  1 
ATOM   1651 C  CD1 . TYR B 1 94  ? 29.353  -2.501  37.383  1.00 24.60  ? 94   TYR B CD1 1 
ATOM   1652 C  CD2 . TYR B 1 94  ? 29.508  -1.888  39.699  1.00 24.17  ? 94   TYR B CD2 1 
ATOM   1653 C  CE1 . TYR B 1 94  ? 30.322  -1.569  37.064  1.00 22.98  ? 94   TYR B CE1 1 
ATOM   1654 C  CE2 . TYR B 1 94  ? 30.482  -0.952  39.388  1.00 23.90  ? 94   TYR B CE2 1 
ATOM   1655 C  CZ  . TYR B 1 94  ? 30.873  -0.787  38.068  1.00 23.10  ? 94   TYR B CZ  1 
ATOM   1656 O  OH  . TYR B 1 94  ? 31.826  0.122   37.750  1.00 23.73  ? 94   TYR B OH  1 
ATOM   1657 N  N   . THR B 1 95  ? 24.884  -4.460  38.035  1.00 23.79  ? 95   THR B N   1 
ATOM   1658 C  CA  . THR B 1 95  ? 23.968  -5.575  37.800  1.00 24.07  ? 95   THR B CA  1 
ATOM   1659 C  C   . THR B 1 95  ? 24.590  -6.471  36.728  1.00 21.95  ? 95   THR B C   1 
ATOM   1660 O  O   . THR B 1 95  ? 24.980  -5.994  35.674  1.00 19.92  ? 95   THR B O   1 
ATOM   1661 C  CB  . THR B 1 95  ? 22.561  -5.117  37.347  1.00 25.10  ? 95   THR B CB  1 
ATOM   1662 O  OG1 . THR B 1 95  ? 21.998  -4.209  38.304  1.00 28.02  ? 95   THR B OG1 1 
ATOM   1663 C  CG2 . THR B 1 95  ? 21.611  -6.324  37.154  1.00 26.05  ? 95   THR B CG2 1 
ATOM   1664 N  N   . CYS B 1 96  ? 24.669  -7.766  37.027  1.00 21.97  ? 96   CYS B N   1 
ATOM   1665 C  CA  . CYS B 1 96  ? 25.128  -8.770  36.097  1.00 20.85  ? 96   CYS B CA  1 
ATOM   1666 C  C   . CYS B 1 96  ? 23.916  -9.602  35.673  1.00 20.72  ? 96   CYS B C   1 
ATOM   1667 O  O   . CYS B 1 96  ? 23.296  -10.245 36.504  1.00 21.55  ? 96   CYS B O   1 
ATOM   1668 C  CB  . CYS B 1 96  ? 26.166  -9.670  36.769  1.00 20.92  ? 96   CYS B CB  1 
ATOM   1669 S  SG  . CYS B 1 96  ? 26.681  -11.105 35.763  1.00 20.92  ? 96   CYS B SG  1 
ATOM   1670 N  N   . GLU B 1 97  ? 23.585  -9.560  34.387  1.00 20.98  ? 97   GLU B N   1 
ATOM   1671 C  CA  . GLU B 1 97  ? 22.430  -10.268 33.827  1.00 21.25  ? 97   GLU B CA  1 
ATOM   1672 C  C   . GLU B 1 97  ? 22.912  -11.302 32.818  1.00 19.58  ? 97   GLU B C   1 
ATOM   1673 O  O   . GLU B 1 97  ? 23.662  -10.989 31.889  1.00 18.86  ? 97   GLU B O   1 
ATOM   1674 C  CB  . GLU B 1 97  ? 21.466  -9.285  33.156  1.00 22.19  ? 97   GLU B CB  1 
ATOM   1675 C  CG  . GLU B 1 97  ? 20.286  -9.946  32.405  1.00 24.72  ? 97   GLU B CG  1 
ATOM   1676 C  CD  . GLU B 1 97  ? 19.612  -9.002  31.400  1.00 27.08  ? 97   GLU B CD  1 
ATOM   1677 O  OE1 . GLU B 1 97  ? 18.794  -8.158  31.828  1.00 32.99  ? 97   GLU B OE1 1 
ATOM   1678 O  OE2 . GLU B 1 97  ? 19.908  -9.114  30.185  1.00 29.98  ? 97   GLU B OE2 1 
ATOM   1679 N  N   . VAL B 1 98  ? 22.480  -12.543 33.004  1.00 19.11  ? 98   VAL B N   1 
ATOM   1680 C  CA  . VAL B 1 98  ? 22.879  -13.636 32.125  1.00 18.28  ? 98   VAL B CA  1 
ATOM   1681 C  C   . VAL B 1 98  ? 21.631  -14.290 31.573  1.00 18.69  ? 98   VAL B C   1 
ATOM   1682 O  O   . VAL B 1 98  ? 20.657  -14.477 32.305  1.00 19.01  ? 98   VAL B O   1 
ATOM   1683 C  CB  . VAL B 1 98  ? 23.768  -14.687 32.856  1.00 17.94  ? 98   VAL B CB  1 
ATOM   1684 C  CG1 . VAL B 1 98  ? 24.189  -15.838 31.887  1.00 16.85  ? 98   VAL B CG1 1 
ATOM   1685 C  CG2 . VAL B 1 98  ? 24.973  -14.025 33.432  1.00 16.83  ? 98   VAL B CG2 1 
ATOM   1686 N  N   . THR B 1 99  ? 21.657  -14.605 30.274  1.00 18.25  ? 99   THR B N   1 
ATOM   1687 C  CA  . THR B 1 99  ? 20.521  -15.221 29.601  1.00 19.65  ? 99   THR B CA  1 
ATOM   1688 C  C   . THR B 1 99  ? 21.028  -16.408 28.806  1.00 18.58  ? 99   THR B C   1 
ATOM   1689 O  O   . THR B 1 99  ? 22.053  -16.325 28.141  1.00 18.29  ? 99   THR B O   1 
ATOM   1690 C  CB  . THR B 1 99  ? 19.840  -14.253 28.604  1.00 20.25  ? 99   THR B CB  1 
ATOM   1691 O  OG1 . THR B 1 99  ? 19.517  -13.018 29.247  1.00 22.22  ? 99   THR B OG1 1 
ATOM   1692 C  CG2 . THR B 1 99  ? 18.555  -14.849 28.005  1.00 21.59  ? 99   THR B CG2 1 
ATOM   1693 N  N   . GLU B 1 100 ? 20.334  -17.524 28.896  1.00 20.22  ? 100  GLU B N   1 
ATOM   1694 C  CA  . GLU B 1 100 ? 20.529  -18.603 27.942  1.00 20.49  ? 100  GLU B CA  1 
ATOM   1695 C  C   . GLU B 1 100 ? 19.277  -18.644 27.070  1.00 21.74  ? 100  GLU B C   1 
ATOM   1696 O  O   . GLU B 1 100 ? 18.171  -18.871 27.569  1.00 21.26  ? 100  GLU B O   1 
ATOM   1697 C  CB  . GLU B 1 100 ? 20.692  -19.933 28.651  1.00 21.18  ? 100  GLU B CB  1 
ATOM   1698 C  CG  . GLU B 1 100 ? 21.950  -20.080 29.435  1.00 20.97  ? 100  GLU B CG  1 
ATOM   1699 C  CD  . GLU B 1 100 ? 22.046  -21.437 30.102  1.00 21.90  ? 100  GLU B CD  1 
ATOM   1700 O  OE1 . GLU B 1 100 ? 23.184  -21.852 30.397  1.00 22.37  ? 100  GLU B OE1 1 
ATOM   1701 O  OE2 . GLU B 1 100 ? 20.985  -22.085 30.331  1.00 22.85  ? 100  GLU B OE2 1 
ATOM   1702 N  N   . LEU B 1 101 ? 19.451  -18.418 25.775  1.00 19.95  ? 101  LEU B N   1 
ATOM   1703 C  CA  . LEU B 1 101 ? 18.310  -18.159 24.905  1.00 21.46  ? 101  LEU B CA  1 
ATOM   1704 C  C   . LEU B 1 101 ? 17.554  -19.436 24.567  1.00 20.27  ? 101  LEU B C   1 
ATOM   1705 O  O   . LEU B 1 101 ? 18.040  -20.551 24.793  1.00 17.57  ? 101  LEU B O   1 
ATOM   1706 C  CB  . LEU B 1 101 ? 18.755  -17.432 23.630  1.00 23.39  ? 101  LEU B CB  1 
ATOM   1707 C  CG  . LEU B 1 101 ? 19.353  -16.047 23.878  1.00 26.48  ? 101  LEU B CG  1 
ATOM   1708 C  CD1 . LEU B 1 101 ? 20.143  -15.604 22.671  1.00 32.11  ? 101  LEU B CD1 1 
ATOM   1709 C  CD2 . LEU B 1 101 ? 18.292  -15.019 24.236  1.00 31.89  ? 101  LEU B CD2 1 
ATOM   1710 N  N   . THR B 1 102 ? 16.331  -19.248 24.086  1.00 22.34  ? 102  THR B N   1 
ATOM   1711 C  CA  . THR B 1 102 ? 15.488  -20.357 23.684  1.00 22.31  ? 102  THR B CA  1 
ATOM   1712 C  C   . THR B 1 102 ? 16.140  -21.159 22.558  1.00 19.54  ? 102  THR B C   1 
ATOM   1713 O  O   . THR B 1 102 ? 16.835  -20.607 21.696  1.00 19.62  ? 102  THR B O   1 
ATOM   1714 C  CB  . THR B 1 102 ? 14.111  -19.851 23.233  1.00 26.74  ? 102  THR B CB  1 
ATOM   1715 O  OG1 . THR B 1 102 ? 13.577  -19.001 24.249  1.00 33.63  ? 102  THR B OG1 1 
ATOM   1716 C  CG2 . THR B 1 102 ? 13.166  -20.987 22.987  1.00 24.76  ? 102  THR B CG2 1 
ATOM   1717 N  N   . ARG B 1 103 ? 15.917  -22.465 22.577  1.00 18.70  ? 103  ARG B N   1 
ATOM   1718 C  CA  . ARG B 1 103 ? 16.312  -23.309 21.473  1.00 17.98  ? 103  ARG B CA  1 
ATOM   1719 C  C   . ARG B 1 103 ? 15.110  -24.128 21.045  1.00 18.28  ? 103  ARG B C   1 
ATOM   1720 O  O   . ARG B 1 103 ? 14.308  -24.541 21.877  1.00 19.33  ? 103  ARG B O   1 
ATOM   1721 C  CB  . ARG B 1 103 ? 17.474  -24.222 21.863  1.00 17.62  ? 103  ARG B CB  1 
ATOM   1722 C  CG  . ARG B 1 103 ? 18.726  -23.464 22.273  1.00 17.94  ? 103  ARG B CG  1 
ATOM   1723 C  CD  . ARG B 1 103 ? 19.935  -24.369 22.196  1.00 20.90  ? 103  ARG B CD  1 
ATOM   1724 N  NE  . ARG B 1 103 ? 19.740  -25.528 23.052  1.00 20.91  ? 103  ARG B NE  1 
ATOM   1725 C  CZ  . ARG B 1 103 ? 20.303  -26.725 22.889  1.00 23.09  ? 103  ARG B CZ  1 
ATOM   1726 N  NH1 . ARG B 1 103 ? 21.162  -26.968 21.904  1.00 25.50  ? 103  ARG B NH1 1 
ATOM   1727 N  NH2 . ARG B 1 103 ? 20.010  -27.693 23.741  1.00 23.63  ? 103  ARG B NH2 1 
ATOM   1728 N  N   . GLU B 1 104 ? 14.978  -24.328 19.742  1.00 18.63  ? 104  GLU B N   1 
ATOM   1729 C  CA  . GLU B 1 104 ? 13.880  -25.134 19.212  1.00 19.23  ? 104  GLU B CA  1 
ATOM   1730 C  C   . GLU B 1 104 ? 14.296  -25.901 17.964  1.00 18.56  ? 104  GLU B C   1 
ATOM   1731 O  O   . GLU B 1 104 ? 15.338  -25.617 17.331  1.00 19.29  ? 104  GLU B O   1 
ATOM   1732 C  CB  . GLU B 1 104 ? 12.655  -24.268 18.910  1.00 22.45  ? 104  GLU B CB  1 
ATOM   1733 C  CG  . GLU B 1 104 ? 12.812  -23.268 17.767  1.00 28.11  ? 104  GLU B CG  1 
ATOM   1734 C  CD  . GLU B 1 104 ? 11.475  -22.670 17.304  1.00 34.35  ? 104  GLU B CD  1 
ATOM   1735 O  OE1 . GLU B 1 104 ? 10.475  -23.419 17.095  1.00 41.67  ? 104  GLU B OE1 1 
ATOM   1736 O  OE2 . GLU B 1 104 ? 11.416  -21.435 17.142  1.00 45.40  ? 104  GLU B OE2 1 
ATOM   1737 N  N   . GLY B 1 105 ? 13.440  -26.837 17.598  1.00 17.70  ? 105  GLY B N   1 
ATOM   1738 C  CA  . GLY B 1 105 ? 13.637  -27.643 16.425  1.00 18.72  ? 105  GLY B CA  1 
ATOM   1739 C  C   . GLY B 1 105 ? 12.411  -28.481 16.163  1.00 18.59  ? 105  GLY B C   1 
ATOM   1740 O  O   . GLY B 1 105 ? 11.572  -28.678 17.054  1.00 18.06  ? 105  GLY B O   1 
ATOM   1741 N  N   . GLU B 1 106 ? 12.285  -28.947 14.931  1.00 20.88  ? 106  GLU B N   1 
ATOM   1742 C  CA  . GLU B 1 106 ? 11.261  -29.905 14.597  1.00 21.38  ? 106  GLU B CA  1 
ATOM   1743 C  C   . GLU B 1 106 ? 11.729  -30.932 13.572  1.00 22.65  ? 106  GLU B C   1 
ATOM   1744 O  O   . GLU B 1 106 ? 12.694  -30.719 12.820  1.00 25.38  ? 106  GLU B O   1 
ATOM   1745 C  CB  . GLU B 1 106 ? 9.972   -29.202 14.133  1.00 24.16  ? 106  GLU B CB  1 
ATOM   1746 C  CG  . GLU B 1 106 ? 10.156  -28.167 13.049  1.00 29.89  ? 106  GLU B CG  1 
ATOM   1747 C  CD  . GLU B 1 106 ? 9.023   -27.133 13.002  1.00 34.57  ? 106  GLU B CD  1 
ATOM   1748 O  OE1 . GLU B 1 106 ? 9.041   -26.148 13.802  1.00 37.97  ? 106  GLU B OE1 1 
ATOM   1749 O  OE2 . GLU B 1 106 ? 8.155   -27.279 12.124  1.00 38.86  ? 106  GLU B OE2 1 
ATOM   1750 N  N   . THR B 1 107 ? 11.035  -32.056 13.567  1.00 22.06  ? 107  THR B N   1 
ATOM   1751 C  CA  . THR B 1 107 ? 11.297  -33.118 12.615  1.00 24.01  ? 107  THR B CA  1 
ATOM   1752 C  C   . THR B 1 107 ? 9.955   -33.747 12.230  1.00 24.29  ? 107  THR B C   1 
ATOM   1753 O  O   . THR B 1 107 ? 9.003   -33.713 13.001  1.00 22.40  ? 107  THR B O   1 
ATOM   1754 C  CB  . THR B 1 107 ? 12.281  -34.150 13.208  1.00 24.47  ? 107  THR B CB  1 
ATOM   1755 O  OG1 . THR B 1 107 ? 12.778  -34.994 12.162  1.00 28.21  ? 107  THR B OG1 1 
ATOM   1756 C  CG2 . THR B 1 107 ? 11.611  -34.967 14.348  1.00 23.22  ? 107  THR B CG2 1 
ATOM   1757 N  N   . ILE B 1 108 ? 9.911   -34.287 11.020  1.00 26.49  ? 108  ILE B N   1 
ATOM   1758 C  CA  . ILE B 1 108 ? 8.721   -34.863 10.425  1.00 27.64  ? 108  ILE B CA  1 
ATOM   1759 C  C   . ILE B 1 108 ? 8.947   -36.359 10.210  1.00 27.90  ? 108  ILE B C   1 
ATOM   1760 O  O   . ILE B 1 108 ? 10.001  -36.786 9.772   1.00 30.56  ? 108  ILE B O   1 
ATOM   1761 C  CB  . ILE B 1 108 ? 8.373   -34.158 9.082   1.00 31.99  ? 108  ILE B CB  1 
ATOM   1762 C  CG1 . ILE B 1 108 ? 8.194   -32.649 9.321   1.00 33.87  ? 108  ILE B CG1 1 
ATOM   1763 C  CG2 . ILE B 1 108 ? 7.107   -34.792 8.431   1.00 33.89  ? 108  ILE B CG2 1 
ATOM   1764 C  CD1 . ILE B 1 108 ? 8.220   -31.812 8.069   1.00 40.65  ? 108  ILE B CD1 1 
ATOM   1765 N  N   . ILE B 1 109 ? 7.946   -37.140 10.582  1.00 27.14  ? 109  ILE B N   1 
ATOM   1766 C  CA  . ILE B 1 109 ? 7.942   -38.567 10.406  1.00 27.98  ? 109  ILE B CA  1 
ATOM   1767 C  C   . ILE B 1 109 ? 6.623   -38.893 9.737   1.00 28.62  ? 109  ILE B C   1 
ATOM   1768 O  O   . ILE B 1 109 ? 5.576   -38.435 10.188  1.00 27.45  ? 109  ILE B O   1 
ATOM   1769 C  CB  . ILE B 1 109 ? 7.975   -39.327 11.758  1.00 27.13  ? 109  ILE B CB  1 
ATOM   1770 C  CG1 . ILE B 1 109 ? 9.052   -38.780 12.695  1.00 26.45  ? 109  ILE B CG1 1 
ATOM   1771 C  CG2 . ILE B 1 109 ? 8.168   -40.837 11.510  1.00 29.94  ? 109  ILE B CG2 1 
ATOM   1772 C  CD1 . ILE B 1 109 ? 8.585   -37.585 13.597  1.00 22.22  ? 109  ILE B CD1 1 
ATOM   1773 N  N   . GLU B 1 110 ? 6.654   -39.680 8.673   1.00 31.52  ? 110  GLU B N   1 
ATOM   1774 C  CA  . GLU B 1 110 ? 5.407   -40.223 8.131   1.00 32.71  ? 110  GLU B CA  1 
ATOM   1775 C  C   . GLU B 1 110 ? 5.064   -41.546 8.820   1.00 31.97  ? 110  GLU B C   1 
ATOM   1776 O  O   . GLU B 1 110 ? 5.903   -42.434 8.925   1.00 32.44  ? 110  GLU B O   1 
ATOM   1777 C  CB  . GLU B 1 110 ? 5.479   -40.407 6.620   1.00 37.05  ? 110  GLU B CB  1 
ATOM   1778 C  CG  . GLU B 1 110 ? 4.104   -40.670 6.012   1.00 39.27  ? 110  GLU B CG  1 
ATOM   1779 C  CD  . GLU B 1 110 ? 4.120   -40.883 4.519   1.00 44.46  ? 110  GLU B CD  1 
ATOM   1780 O  OE1 . GLU B 1 110 ? 5.217   -40.834 3.926   1.00 48.53  ? 110  GLU B OE1 1 
ATOM   1781 O  OE2 . GLU B 1 110 ? 3.029   -41.109 3.942   1.00 45.34  ? 110  GLU B OE2 1 
ATOM   1782 N  N   . LEU B 1 111 ? 3.826   -41.645 9.299   1.00 31.83  ? 111  LEU B N   1 
ATOM   1783 C  CA  . LEU B 1 111 ? 3.272   -42.875 9.882   1.00 33.14  ? 111  LEU B CA  1 
ATOM   1784 C  C   . LEU B 1 111 ? 2.521   -43.628 8.784   1.00 35.07  ? 111  LEU B C   1 
ATOM   1785 O  O   . LEU B 1 111 ? 1.586   -43.104 8.201   1.00 35.95  ? 111  LEU B O   1 
ATOM   1786 C  CB  . LEU B 1 111 ? 2.332   -42.545 11.055  1.00 33.27  ? 111  LEU B CB  1 
ATOM   1787 C  CG  . LEU B 1 111 ? 1.584   -43.690 11.767  1.00 36.47  ? 111  LEU B CG  1 
ATOM   1788 C  CD1 . LEU B 1 111 ? 2.487   -44.551 12.655  1.00 35.91  ? 111  LEU B CD1 1 
ATOM   1789 C  CD2 . LEU B 1 111 ? 0.433   -43.127 12.591  1.00 38.98  ? 111  LEU B CD2 1 
ATOM   1790 N  N   . LYS B 1 112 ? 2.971   -44.836 8.485   1.00 37.30  ? 112  LYS B N   1 
ATOM   1791 C  CA  . LYS B 1 112 ? 2.428   -45.617 7.372   1.00 40.40  ? 112  LYS B CA  1 
ATOM   1792 C  C   . LYS B 1 112 ? 1.702   -46.840 7.918   1.00 42.26  ? 112  LYS B C   1 
ATOM   1793 O  O   . LYS B 1 112 ? 2.191   -47.489 8.838   1.00 43.55  ? 112  LYS B O   1 
ATOM   1794 C  CB  . LYS B 1 112 ? 3.560   -46.070 6.452   1.00 43.61  ? 112  LYS B CB  1 
ATOM   1795 C  CG  . LYS B 1 112 ? 4.348   -44.951 5.759   1.00 44.00  ? 112  LYS B CG  1 
ATOM   1796 C  CD  . LYS B 1 112 ? 5.593   -45.534 5.070   1.00 49.28  ? 112  LYS B CD  1 
ATOM   1797 C  CE  . LYS B 1 112 ? 5.842   -44.924 3.684   1.00 54.94  ? 112  LYS B CE  1 
ATOM   1798 N  NZ  . LYS B 1 112 ? 6.812   -45.715 2.852   1.00 62.41  ? 112  LYS B NZ  1 
ATOM   1799 N  N   . TYR B 1 113 ? 0.537   -47.150 7.356   1.00 44.10  ? 113  TYR B N   1 
ATOM   1800 C  CA  . TYR B 1 113 ? -0.172  -48.377 7.686   1.00 46.96  ? 113  TYR B CA  1 
ATOM   1801 C  C   . TYR B 1 113 ? 0.003   -49.380 6.545   1.00 50.13  ? 113  TYR B C   1 
ATOM   1802 O  O   . TYR B 1 113 ? -0.406  -49.111 5.416   1.00 50.60  ? 113  TYR B O   1 
ATOM   1803 C  CB  . TYR B 1 113 ? -1.656  -48.085 7.918   1.00 48.13  ? 113  TYR B CB  1 
ATOM   1804 C  CG  . TYR B 1 113 ? -2.462  -49.280 8.383   1.00 51.61  ? 113  TYR B CG  1 
ATOM   1805 C  CD1 . TYR B 1 113 ? -2.233  -49.853 9.629   1.00 54.78  ? 113  TYR B CD1 1 
ATOM   1806 C  CD2 . TYR B 1 113 ? -3.450  -49.837 7.583   1.00 54.69  ? 113  TYR B CD2 1 
ATOM   1807 C  CE1 . TYR B 1 113 ? -2.965  -50.949 10.069  1.00 59.57  ? 113  TYR B CE1 1 
ATOM   1808 C  CE2 . TYR B 1 113 ? -4.194  -50.946 8.016   1.00 58.93  ? 113  TYR B CE2 1 
ATOM   1809 C  CZ  . TYR B 1 113 ? -3.940  -51.486 9.262   1.00 61.61  ? 113  TYR B CZ  1 
ATOM   1810 O  OH  . TYR B 1 113 ? -4.655  -52.568 9.695   1.00 66.86  ? 113  TYR B OH  1 
ATOM   1811 N  N   . ARG B 1 114 ? 0.614   -50.527 6.841   1.00 53.75  ? 114  ARG B N   1 
ATOM   1812 C  CA  . ARG B 1 114 ? 0.771   -51.605 5.859   1.00 57.76  ? 114  ARG B CA  1 
ATOM   1813 C  C   . ARG B 1 114 ? -0.233  -52.734 6.132   1.00 60.67  ? 114  ARG B C   1 
ATOM   1814 O  O   . ARG B 1 114 ? -0.561  -53.019 7.286   1.00 61.89  ? 114  ARG B O   1 
ATOM   1815 C  CB  . ARG B 1 114 ? 2.204   -52.151 5.872   1.00 61.94  ? 114  ARG B CB  1 
ATOM   1816 C  CG  . ARG B 1 114 ? 2.509   -53.123 4.727   1.00 68.30  ? 114  ARG B CG  1 
ATOM   1817 C  CD  . ARG B 1 114 ? 3.998   -53.427 4.623   1.00 74.83  ? 114  ARG B CD  1 
ATOM   1818 N  NE  . ARG B 1 114 ? 4.464   -54.297 5.707   1.00 80.28  ? 114  ARG B NE  1 
ATOM   1819 C  CZ  . ARG B 1 114 ? 4.563   -55.624 5.631   1.00 87.82  ? 114  ARG B CZ  1 
ATOM   1820 N  NH1 . ARG B 1 114 ? 4.196   -56.281 4.536   1.00 90.45  ? 114  ARG B NH1 1 
ATOM   1821 N  NH2 . ARG B 1 114 ? 5.013   -56.302 6.681   1.00 93.54  ? 114  ARG B NH2 1 
ATOM   1822 N  N   . VAL B 1 115 ? -0.710  -53.369 5.061   1.00 62.61  ? 115  VAL B N   1 
ATOM   1823 C  CA  . VAL B 1 115 ? -1.734  -54.424 5.169   1.00 65.87  ? 115  VAL B CA  1 
ATOM   1824 C  C   . VAL B 1 115 ? -1.182  -55.842 4.936   1.00 72.01  ? 115  VAL B C   1 
ATOM   1825 O  O   . VAL B 1 115 ? -0.121  -56.036 4.303   1.00 75.14  ? 115  VAL B O   1 
ATOM   1826 C  CB  . VAL B 1 115 ? -2.885  -54.175 4.175   1.00 64.78  ? 115  VAL B CB  1 
ATOM   1827 C  CG1 . VAL B 1 115 ? -4.030  -55.146 4.430   1.00 67.79  ? 115  VAL B CG1 1 
ATOM   1828 C  CG2 . VAL B 1 115 ? -3.369  -52.721 4.283   1.00 60.93  ? 115  VAL B CG2 1 
HETATM 1829 N  N   . PCA C 1 1   ? 37.862  9.555   -0.704  1.00 39.63  ? 1    PCA C N   1 
HETATM 1830 C  CA  . PCA C 1 1   ? 38.258  10.945  -0.444  1.00 39.01  ? 1    PCA C CA  1 
HETATM 1831 C  CB  . PCA C 1 1   ? 37.114  11.869  -0.803  1.00 40.52  ? 1    PCA C CB  1 
HETATM 1832 C  CG  . PCA C 1 1   ? 36.460  11.167  -1.981  1.00 43.79  ? 1    PCA C CG  1 
HETATM 1833 C  CD  . PCA C 1 1   ? 37.148  9.823   -1.960  1.00 42.67  ? 1    PCA C CD  1 
HETATM 1834 O  OE  . PCA C 1 1   ? 37.111  9.059   -2.927  1.00 45.57  ? 1    PCA C OE  1 
HETATM 1835 C  C   . PCA C 1 1   ? 38.881  11.261  0.907   1.00 35.38  ? 1    PCA C C   1 
HETATM 1836 O  O   . PCA C 1 1   ? 39.574  12.262  1.024   1.00 35.07  ? 1    PCA C O   1 
ATOM   1837 N  N   . LEU C 1 2   ? 38.661  10.428  1.917   1.00 32.67  ? 2    LEU C N   1 
ATOM   1838 C  CA  . LEU C 1 2   ? 39.533  10.478  3.081   1.00 30.97  ? 2    LEU C CA  1 
ATOM   1839 C  C   . LEU C 1 2   ? 40.885  9.929   2.624   1.00 31.59  ? 2    LEU C C   1 
ATOM   1840 O  O   . LEU C 1 2   ? 40.945  8.860   2.010   1.00 31.08  ? 2    LEU C O   1 
ATOM   1841 C  CB  . LEU C 1 2   ? 38.983  9.664   4.258   1.00 28.57  ? 2    LEU C CB  1 
ATOM   1842 C  CG  . LEU C 1 2   ? 37.743  10.180  5.010   1.00 27.76  ? 2    LEU C CG  1 
ATOM   1843 C  CD1 . LEU C 1 2   ? 37.580  9.441   6.332   1.00 25.40  ? 2    LEU C CD1 1 
ATOM   1844 C  CD2 . LEU C 1 2   ? 37.804  11.669  5.260   1.00 27.10  ? 2    LEU C CD2 1 
ATOM   1845 N  N   . LEU C 1 3   ? 41.953  10.674  2.908   1.00 32.33  ? 3    LEU C N   1 
ATOM   1846 C  CA  . LEU C 1 3   ? 43.315  10.317  2.481   1.00 33.62  ? 3    LEU C CA  1 
ATOM   1847 C  C   . LEU C 1 3   ? 44.142  9.911   3.678   1.00 32.11  ? 3    LEU C C   1 
ATOM   1848 O  O   . LEU C 1 3   ? 43.956  10.422  4.770   1.00 30.67  ? 3    LEU C O   1 
ATOM   1849 C  CB  . LEU C 1 3   ? 43.995  11.497  1.784   1.00 36.13  ? 3    LEU C CB  1 
ATOM   1850 C  CG  . LEU C 1 3   ? 43.320  11.990  0.506   1.00 38.42  ? 3    LEU C CG  1 
ATOM   1851 C  CD1 . LEU C 1 3   ? 43.953  13.292  0.005   1.00 41.49  ? 3    LEU C CD1 1 
ATOM   1852 C  CD2 . LEU C 1 3   ? 43.349  10.914  -0.571  1.00 38.95  ? 3    LEU C CD2 1 
ATOM   1853 N  N   . PHE C 1 4   ? 45.074  8.993   3.457   1.00 32.69  ? 4    PHE C N   1 
ATOM   1854 C  CA  . PHE C 1 4   ? 45.870  8.449   4.534   1.00 31.65  ? 4    PHE C CA  1 
ATOM   1855 C  C   . PHE C 1 4   ? 47.350  8.702   4.343   1.00 33.90  ? 4    PHE C C   1 
ATOM   1856 O  O   . PHE C 1 4   ? 47.839  8.797   3.210   1.00 36.03  ? 4    PHE C O   1 
ATOM   1857 C  CB  . PHE C 1 4   ? 45.607  6.949   4.663   1.00 30.01  ? 4    PHE C CB  1 
ATOM   1858 C  CG  . PHE C 1 4   ? 44.180  6.615   4.960   1.00 27.87  ? 4    PHE C CG  1 
ATOM   1859 C  CD1 . PHE C 1 4   ? 43.778  6.278   6.242   1.00 25.80  ? 4    PHE C CD1 1 
ATOM   1860 C  CD2 . PHE C 1 4   ? 43.232  6.637   3.949   1.00 28.73  ? 4    PHE C CD2 1 
ATOM   1861 C  CE1 . PHE C 1 4   ? 42.440  5.957   6.511   1.00 25.25  ? 4    PHE C CE1 1 
ATOM   1862 C  CE2 . PHE C 1 4   ? 41.916  6.330   4.208   1.00 27.72  ? 4    PHE C CE2 1 
ATOM   1863 C  CZ  . PHE C 1 4   ? 41.510  5.992   5.485   1.00 26.55  ? 4    PHE C CZ  1 
ATOM   1864 N  N   . ASN C 1 5   ? 48.048  8.846   5.469   1.00 34.27  ? 5    ASN C N   1 
ATOM   1865 C  CA  . ASN C 1 5   ? 49.506  8.814   5.504   1.00 35.75  ? 5    ASN C CA  1 
ATOM   1866 C  C   . ASN C 1 5   ? 49.862  7.338   5.533   1.00 35.08  ? 5    ASN C C   1 
ATOM   1867 O  O   . ASN C 1 5   ? 49.859  6.713   6.596   1.00 33.23  ? 5    ASN C O   1 
ATOM   1868 C  CB  . ASN C 1 5   ? 50.044  9.554   6.739   1.00 36.13  ? 5    ASN C CB  1 
ATOM   1869 C  CG  . ASN C 1 5   ? 51.529  9.313   6.977   1.00 38.52  ? 5    ASN C CG  1 
ATOM   1870 O  OD1 . ASN C 1 5   ? 52.300  9.072   6.043   1.00 43.25  ? 5    ASN C OD1 1 
ATOM   1871 N  ND2 . ASN C 1 5   ? 51.937  9.375   8.243   1.00 42.03  ? 5    ASN C ND2 1 
ATOM   1872 N  N   . LYS C 1 6   ? 50.121  6.771   4.359   1.00 36.14  ? 6    LYS C N   1 
ATOM   1873 C  CA  . LYS C 1 6   ? 50.173  5.312   4.230   1.00 35.67  ? 6    LYS C CA  1 
ATOM   1874 C  C   . LYS C 1 6   ? 51.423  4.661   4.838   1.00 35.26  ? 6    LYS C C   1 
ATOM   1875 O  O   . LYS C 1 6   ? 52.510  5.240   4.853   1.00 36.98  ? 6    LYS C O   1 
ATOM   1876 C  CB  . LYS C 1 6   ? 50.061  4.896   2.756   1.00 38.07  ? 6    LYS C CB  1 
ATOM   1877 C  CG  . LYS C 1 6   ? 48.671  5.046   2.152   1.00 38.40  ? 6    LYS C CG  1 
ATOM   1878 C  CD  . LYS C 1 6   ? 48.689  4.527   0.715   1.00 41.19  ? 6    LYS C CD  1 
ATOM   1879 C  CE  . LYS C 1 6   ? 47.392  4.789   -0.031  1.00 42.49  ? 6    LYS C CE  1 
ATOM   1880 N  NZ  . LYS C 1 6   ? 47.544  4.499   -1.486  1.00 45.85  ? 6    LYS C NZ  1 
ATOM   1881 N  N   . THR C 1 7   ? 51.236  3.445   5.332   1.00 33.28  ? 7    THR C N   1 
ATOM   1882 C  CA  . THR C 1 7   ? 52.317  2.569   5.747   1.00 33.51  ? 7    THR C CA  1 
ATOM   1883 C  C   . THR C 1 7   ? 52.067  1.194   5.157   1.00 32.82  ? 7    THR C C   1 
ATOM   1884 O  O   . THR C 1 7   ? 51.069  0.552   5.478   1.00 30.64  ? 7    THR C O   1 
ATOM   1885 C  CB  . THR C 1 7   ? 52.386  2.396   7.289   1.00 31.96  ? 7    THR C CB  1 
ATOM   1886 O  OG1 . THR C 1 7   ? 52.652  3.658   7.911   1.00 33.61  ? 7    THR C OG1 1 
ATOM   1887 C  CG2 . THR C 1 7   ? 53.497  1.442   7.642   1.00 32.48  ? 7    THR C CG2 1 
ATOM   1888 N  N   . LYS C 1 8   ? 52.998  0.727   4.333   1.00 34.65  ? 8    LYS C N   1 
ATOM   1889 C  CA  . LYS C 1 8   ? 52.915  -0.600  3.726   1.00 34.94  ? 8    LYS C CA  1 
ATOM   1890 C  C   . LYS C 1 8   ? 52.838  -1.716  4.779   1.00 32.57  ? 8    LYS C C   1 
ATOM   1891 O  O   . LYS C 1 8   ? 51.980  -2.599  4.708   1.00 31.21  ? 8    LYS C O   1 
ATOM   1892 C  CB  . LYS C 1 8   ? 54.132  -0.818  2.807   1.00 38.35  ? 8    LYS C CB  1 
ATOM   1893 C  CG  . LYS C 1 8   ? 54.409  -2.249  2.399   1.00 39.33  ? 8    LYS C CG  1 
ATOM   1894 C  CD  . LYS C 1 8   ? 55.579  -2.325  1.430   1.00 43.26  ? 8    LYS C CD  1 
ATOM   1895 C  CE  . LYS C 1 8   ? 55.984  -3.768  1.167   1.00 44.81  ? 8    LYS C CE  1 
ATOM   1896 N  NZ  . LYS C 1 8   ? 56.844  -3.883  -0.044  1.00 49.66  ? 8    LYS C NZ  1 
ATOM   1897 N  N   . SER C 1 9   ? 53.758  -1.691  5.735   1.00 31.35  ? 9    SER C N   1 
ATOM   1898 C  CA  . SER C 1 9   ? 53.868  -2.777  6.693   1.00 30.05  ? 9    SER C CA  1 
ATOM   1899 C  C   . SER C 1 9   ? 54.359  -2.270  8.034   1.00 28.88  ? 9    SER C C   1 
ATOM   1900 O  O   . SER C 1 9   ? 54.965  -1.193  8.109   1.00 30.17  ? 9    SER C O   1 
ATOM   1901 C  CB  . SER C 1 9   ? 54.829  -3.857  6.161   1.00 32.02  ? 9    SER C CB  1 
ATOM   1902 O  OG  . SER C 1 9   ? 56.151  -3.351  6.023   1.00 32.24  ? 9    SER C OG  1 
ATOM   1903 N  N   . VAL C 1 10  ? 54.061  -3.026  9.086   1.00 26.58  ? 10   VAL C N   1 
ATOM   1904 C  CA  . VAL C 1 10  ? 54.711  -2.858  10.379  1.00 26.23  ? 10   VAL C CA  1 
ATOM   1905 C  C   . VAL C 1 10  ? 55.068  -4.232  10.910  1.00 25.85  ? 10   VAL C C   1 
ATOM   1906 O  O   . VAL C 1 10  ? 54.396  -5.225  10.624  1.00 25.58  ? 10   VAL C O   1 
ATOM   1907 C  CB  . VAL C 1 10  ? 53.852  -2.141  11.469  1.00 24.42  ? 10   VAL C CB  1 
ATOM   1908 C  CG1 . VAL C 1 10  ? 53.589  -0.691  11.101  1.00 25.19  ? 10   VAL C CG1 1 
ATOM   1909 C  CG2 . VAL C 1 10  ? 52.547  -2.890  11.736  1.00 21.81  ? 10   VAL C CG2 1 
ATOM   1910 N  N   . GLU C 1 11  ? 56.123  -4.273  11.706  1.00 26.54  ? 11   GLU C N   1 
ATOM   1911 C  CA  . GLU C 1 11  ? 56.611  -5.523  12.227  1.00 26.81  ? 11   GLU C CA  1 
ATOM   1912 C  C   . GLU C 1 11  ? 56.662  -5.533  13.750  1.00 25.90  ? 11   GLU C C   1 
ATOM   1913 O  O   . GLU C 1 11  ? 56.935  -4.515  14.380  1.00 24.50  ? 11   GLU C O   1 
ATOM   1914 C  CB  . GLU C 1 11  ? 57.986  -5.780  11.645  1.00 28.98  ? 11   GLU C CB  1 
ATOM   1915 C  CG  . GLU C 1 11  ? 58.511  -7.159  11.905  1.00 30.88  ? 11   GLU C CG  1 
ATOM   1916 C  CD  . GLU C 1 11  ? 59.774  -7.409  11.145  1.00 33.76  ? 11   GLU C CD  1 
ATOM   1917 O  OE1 . GLU C 1 11  ? 60.834  -6.954  11.619  1.00 36.89  ? 11   GLU C OE1 1 
ATOM   1918 O  OE2 . GLU C 1 11  ? 59.709  -8.064  10.082  1.00 37.50  ? 11   GLU C OE2 1 
ATOM   1919 N  N   . PHE C 1 12  ? 56.385  -6.696  14.331  1.00 25.71  ? 12   PHE C N   1 
ATOM   1920 C  CA  . PHE C 1 12  ? 56.590  -6.922  15.751  1.00 25.93  ? 12   PHE C CA  1 
ATOM   1921 C  C   . PHE C 1 12  ? 57.354  -8.215  15.977  1.00 27.57  ? 12   PHE C C   1 
ATOM   1922 O  O   . PHE C 1 12  ? 57.435  -9.063  15.093  1.00 28.32  ? 12   PHE C O   1 
ATOM   1923 C  CB  . PHE C 1 12  ? 55.266  -6.873  16.553  1.00 24.01  ? 12   PHE C CB  1 
ATOM   1924 C  CG  . PHE C 1 12  ? 54.375  -8.086  16.397  1.00 22.48  ? 12   PHE C CG  1 
ATOM   1925 C  CD1 . PHE C 1 12  ? 54.210  -8.984  17.452  1.00 23.77  ? 12   PHE C CD1 1 
ATOM   1926 C  CD2 . PHE C 1 12  ? 53.693  -8.317  15.218  1.00 20.56  ? 12   PHE C CD2 1 
ATOM   1927 C  CE1 . PHE C 1 12  ? 53.375  -10.096 17.327  1.00 22.53  ? 12   PHE C CE1 1 
ATOM   1928 C  CE2 . PHE C 1 12  ? 52.863  -9.421  15.082  1.00 20.99  ? 12   PHE C CE2 1 
ATOM   1929 C  CZ  . PHE C 1 12  ? 52.709  -10.317 16.145  1.00 22.05  ? 12   PHE C CZ  1 
ATOM   1930 N  N   . THR C 1 13  ? 57.977  -8.299  17.150  1.00 28.48  ? 13   THR C N   1 
ATOM   1931 C  CA  . THR C 1 13  ? 58.719  -9.458  17.594  1.00 30.66  ? 13   THR C CA  1 
ATOM   1932 C  C   . THR C 1 13  ? 58.126  -9.884  18.930  1.00 30.53  ? 13   THR C C   1 
ATOM   1933 O  O   . THR C 1 13  ? 57.135  -9.321  19.375  1.00 28.47  ? 13   THR C O   1 
ATOM   1934 C  CB  . THR C 1 13  ? 60.222  -9.132  17.776  1.00 32.54  ? 13   THR C CB  1 
ATOM   1935 O  OG1 . THR C 1 13  ? 60.371  -8.097  18.764  1.00 32.54  ? 13   THR C OG1 1 
ATOM   1936 C  CG2 . THR C 1 13  ? 60.868  -8.684  16.442  1.00 32.60  ? 13   THR C CG2 1 
ATOM   1937 N  N   . PHE C 1 14  ? 58.756  -10.864 19.577  1.00 33.50  ? 14   PHE C N   1 
ATOM   1938 C  CA  . PHE C 1 14  ? 58.319  -11.335 20.894  1.00 34.53  ? 14   PHE C CA  1 
ATOM   1939 C  C   . PHE C 1 14  ? 58.349  -10.205 21.931  1.00 35.12  ? 14   PHE C C   1 
ATOM   1940 O  O   . PHE C 1 14  ? 57.571  -10.201 22.888  1.00 35.00  ? 14   PHE C O   1 
ATOM   1941 C  CB  . PHE C 1 14  ? 59.200  -12.507 21.345  1.00 37.80  ? 14   PHE C CB  1 
ATOM   1942 C  CG  . PHE C 1 14  ? 58.525  -13.418 22.317  1.00 39.15  ? 14   PHE C CG  1 
ATOM   1943 C  CD1 . PHE C 1 14  ? 57.504  -14.257 21.892  1.00 39.65  ? 14   PHE C CD1 1 
ATOM   1944 C  CD2 . PHE C 1 14  ? 58.890  -13.430 23.660  1.00 41.66  ? 14   PHE C CD2 1 
ATOM   1945 C  CE1 . PHE C 1 14  ? 56.859  -15.099 22.786  1.00 40.14  ? 14   PHE C CE1 1 
ATOM   1946 C  CE2 . PHE C 1 14  ? 58.244  -14.264 24.558  1.00 41.95  ? 14   PHE C CE2 1 
ATOM   1947 C  CZ  . PHE C 1 14  ? 57.229  -15.102 24.118  1.00 41.23  ? 14   PHE C CZ  1 
ATOM   1948 N  N   . GLY C 1 15  ? 59.218  -9.222  21.704  1.00 36.21  ? 15   GLY C N   1 
ATOM   1949 C  CA  . GLY C 1 15  ? 59.336  -8.057  22.578  1.00 36.99  ? 15   GLY C CA  1 
ATOM   1950 C  C   . GLY C 1 15  ? 58.139  -7.132  22.717  1.00 35.67  ? 15   GLY C C   1 
ATOM   1951 O  O   . GLY C 1 15  ? 58.006  -6.468  23.746  1.00 36.74  ? 15   GLY C O   1 
ATOM   1952 N  N   . ASN C 1 16  ? 57.280  -7.067  21.695  1.00 33.71  ? 16   ASN C N   1 
ATOM   1953 C  CA  . ASN C 1 16  ? 56.126  -6.159  21.687  1.00 31.80  ? 16   ASN C CA  1 
ATOM   1954 C  C   . ASN C 1 16  ? 54.953  -6.655  22.556  1.00 31.95  ? 16   ASN C C   1 
ATOM   1955 O  O   . ASN C 1 16  ? 54.167  -7.485  22.107  1.00 31.34  ? 16   ASN C O   1 
ATOM   1956 C  CB  . ASN C 1 16  ? 55.610  -5.968  20.259  1.00 30.19  ? 16   ASN C CB  1 
ATOM   1957 C  CG  . ASN C 1 16  ? 56.603  -5.283  19.346  1.00 29.03  ? 16   ASN C CG  1 
ATOM   1958 O  OD1 . ASN C 1 16  ? 57.606  -5.878  18.922  1.00 29.03  ? 16   ASN C OD1 1 
ATOM   1959 N  ND2 . ASN C 1 16  ? 56.302  -4.020  19.013  1.00 26.59  ? 16   ASN C ND2 1 
ATOM   1960 N  N   . ASP C 1 17  ? 54.820  -6.134  23.779  1.00 32.68  ? 17   ASP C N   1 
ATOM   1961 C  CA  . ASP C 1 17  ? 53.699  -6.514  24.664  1.00 32.13  ? 17   ASP C CA  1 
ATOM   1962 C  C   . ASP C 1 17  ? 52.363  -6.107  24.079  1.00 29.96  ? 17   ASP C C   1 
ATOM   1963 O  O   . ASP C 1 17  ? 51.364  -6.818  24.209  1.00 28.66  ? 17   ASP C O   1 
ATOM   1964 C  CB  . ASP C 1 17  ? 53.848  -5.867  26.041  1.00 34.50  ? 17   ASP C CB  1 
ATOM   1965 C  CG  . ASP C 1 17  ? 54.877  -6.554  26.897  1.00 37.52  ? 17   ASP C CG  1 
ATOM   1966 O  OD1 . ASP C 1 17  ? 55.048  -7.786  26.750  1.00 40.59  ? 17   ASP C OD1 1 
ATOM   1967 O  OD2 . ASP C 1 17  ? 55.490  -5.865  27.739  1.00 40.89  ? 17   ASP C OD2 1 
ATOM   1968 N  N   . THR C 1 18  ? 52.355  -4.940  23.439  1.00 28.78  ? 18   THR C N   1 
ATOM   1969 C  CA  . THR C 1 18  ? 51.218  -4.484  22.685  1.00 26.91  ? 18   THR C CA  1 
ATOM   1970 C  C   . THR C 1 18  ? 51.706  -4.258  21.276  1.00 25.61  ? 18   THR C C   1 
ATOM   1971 O  O   . THR C 1 18  ? 52.898  -3.978  21.049  1.00 27.27  ? 18   THR C O   1 
ATOM   1972 C  CB  . THR C 1 18  ? 50.682  -3.159  23.217  1.00 27.32  ? 18   THR C CB  1 
ATOM   1973 O  OG1 . THR C 1 18  ? 51.703  -2.172  23.088  1.00 31.02  ? 18   THR C OG1 1 
ATOM   1974 C  CG2 . THR C 1 18  ? 50.270  -3.278  24.674  1.00 28.50  ? 18   THR C CG2 1 
ATOM   1975 N  N   . VAL C 1 19  ? 50.781  -4.403  20.345  1.00 23.26  ? 19   VAL C N   1 
ATOM   1976 C  CA  . VAL C 1 19  ? 51.016  -4.276  18.920  1.00 22.11  ? 19   VAL C CA  1 
ATOM   1977 C  C   . VAL C 1 19  ? 50.210  -3.079  18.466  1.00 21.03  ? 19   VAL C C   1 
ATOM   1978 O  O   . VAL C 1 19  ? 49.033  -2.979  18.817  1.00 20.67  ? 19   VAL C O   1 
ATOM   1979 C  CB  . VAL C 1 19  ? 50.492  -5.539  18.192  1.00 21.34  ? 19   VAL C CB  1 
ATOM   1980 C  CG1 . VAL C 1 19  ? 50.279  -5.273  16.715  1.00 20.70  ? 19   VAL C CG1 1 
ATOM   1981 C  CG2 . VAL C 1 19  ? 51.431  -6.745  18.447  1.00 22.86  ? 19   VAL C CG2 1 
ATOM   1982 N  N   . VAL C 1 20  ? 50.840  -2.179  17.715  1.00 20.76  ? 20   VAL C N   1 
ATOM   1983 C  CA  . VAL C 1 20  ? 50.154  -1.023  17.127  1.00 20.08  ? 20   VAL C CA  1 
ATOM   1984 C  C   . VAL C 1 20  ? 50.165  -1.094  15.603  1.00 20.31  ? 20   VAL C C   1 
ATOM   1985 O  O   . VAL C 1 20  ? 51.228  -1.267  14.975  1.00 20.64  ? 20   VAL C O   1 
ATOM   1986 C  CB  . VAL C 1 20  ? 50.801  0.339   17.530  1.00 20.37  ? 20   VAL C CB  1 
ATOM   1987 C  CG1 . VAL C 1 20  ? 50.104  1.502   16.794  1.00 19.47  ? 20   VAL C CG1 1 
ATOM   1988 C  CG2 . VAL C 1 20  ? 50.773  0.524   19.046  1.00 21.63  ? 20   VAL C CG2 1 
ATOM   1989 N  N   . ILE C 1 21  ? 48.980  -0.968  15.011  1.00 19.10  ? 21   ILE C N   1 
ATOM   1990 C  CA  . ILE C 1 21  ? 48.864  -0.873  13.561  1.00 19.78  ? 21   ILE C CA  1 
ATOM   1991 C  C   . ILE C 1 21  ? 48.436  0.549   13.249  1.00 19.52  ? 21   ILE C C   1 
ATOM   1992 O  O   . ILE C 1 21  ? 47.341  0.964   13.648  1.00 19.64  ? 21   ILE C O   1 
ATOM   1993 C  CB  . ILE C 1 21  ? 47.848  -1.877  12.971  1.00 19.29  ? 21   ILE C CB  1 
ATOM   1994 C  CG1 . ILE C 1 21  ? 48.086  -3.289  13.506  1.00 20.18  ? 21   ILE C CG1 1 
ATOM   1995 C  CG2 . ILE C 1 21  ? 47.944  -1.886  11.438  1.00 19.15  ? 21   ILE C CG2 1 
ATOM   1996 C  CD1 . ILE C 1 21  ? 47.129  -4.329  12.897  1.00 20.27  ? 21   ILE C CD1 1 
ATOM   1997 N  N   . PRO C 1 22  ? 49.301  1.306   12.551  1.00 20.56  ? 22   PRO C N   1 
ATOM   1998 C  CA  . PRO C 1 22  ? 49.066  2.713   12.274  1.00 20.89  ? 22   PRO C CA  1 
ATOM   1999 C  C   . PRO C 1 22  ? 47.947  2.969   11.279  1.00 20.54  ? 22   PRO C C   1 
ATOM   2000 O  O   . PRO C 1 22  ? 47.782  2.244   10.308  1.00 19.82  ? 22   PRO C O   1 
ATOM   2001 C  CB  . PRO C 1 22  ? 50.405  3.188   11.687  1.00 22.31  ? 22   PRO C CB  1 
ATOM   2002 C  CG  . PRO C 1 22  ? 50.957  1.979   11.041  1.00 23.04  ? 22   PRO C CG  1 
ATOM   2003 C  CD  . PRO C 1 22  ? 50.563  0.836   11.944  1.00 21.65  ? 22   PRO C CD  1 
ATOM   2004 N  N   . CYS C 1 23  ? 47.165  4.005   11.540  1.00 21.38  ? 23   CYS C N   1 
ATOM   2005 C  CA  . CYS C 1 23  ? 46.213  4.489   10.558  1.00 21.48  ? 23   CYS C CA  1 
ATOM   2006 C  C   . CYS C 1 23  ? 46.014  5.977   10.792  1.00 22.44  ? 23   CYS C C   1 
ATOM   2007 O  O   . CYS C 1 23  ? 45.576  6.386   11.863  1.00 22.43  ? 23   CYS C O   1 
ATOM   2008 C  CB  . CYS C 1 23  ? 44.905  3.713   10.656  1.00 20.99  ? 23   CYS C CB  1 
ATOM   2009 S  SG  . CYS C 1 23  ? 43.666  4.194   9.434   1.00 21.86  ? 23   CYS C SG  1 
ATOM   2010 N  N   . PHE C 1 24  ? 46.389  6.778   9.795   1.00 23.92  ? 24   PHE C N   1 
ATOM   2011 C  CA  . PHE C 1 24  ? 46.416  8.230   9.920   1.00 24.39  ? 24   PHE C CA  1 
ATOM   2012 C  C   . PHE C 1 24  ? 45.793  8.890   8.708   1.00 24.92  ? 24   PHE C C   1 
ATOM   2013 O  O   . PHE C 1 24  ? 46.355  8.853   7.612   1.00 25.65  ? 24   PHE C O   1 
ATOM   2014 C  CB  . PHE C 1 24  ? 47.850  8.714   10.074  1.00 26.87  ? 24   PHE C CB  1 
ATOM   2015 C  CG  . PHE C 1 24  ? 48.497  8.264   11.341  1.00 26.47  ? 24   PHE C CG  1 
ATOM   2016 C  CD1 . PHE C 1 24  ? 48.352  9.004   12.509  1.00 29.13  ? 24   PHE C CD1 1 
ATOM   2017 C  CD2 . PHE C 1 24  ? 49.266  7.115   11.371  1.00 26.14  ? 24   PHE C CD2 1 
ATOM   2018 C  CE1 . PHE C 1 24  ? 48.961  8.580   13.696  1.00 28.63  ? 24   PHE C CE1 1 
ATOM   2019 C  CE2 . PHE C 1 24  ? 49.870  6.700   12.542  1.00 27.69  ? 24   PHE C CE2 1 
ATOM   2020 C  CZ  . PHE C 1 24  ? 49.718  7.450   13.705  1.00 27.94  ? 24   PHE C CZ  1 
ATOM   2021 N  N   . VAL C 1 25  ? 44.620  9.471   8.920   1.00 23.93  ? 25   VAL C N   1 
ATOM   2022 C  CA  . VAL C 1 25  ? 43.934  10.255  7.907   1.00 24.70  ? 25   VAL C CA  1 
ATOM   2023 C  C   . VAL C 1 25  ? 44.508  11.668  7.934   1.00 26.22  ? 25   VAL C C   1 
ATOM   2024 O  O   . VAL C 1 25  ? 44.635  12.283  8.998   1.00 26.19  ? 25   VAL C O   1 
ATOM   2025 C  CB  . VAL C 1 25  ? 42.424  10.287  8.180   1.00 23.85  ? 25   VAL C CB  1 
ATOM   2026 C  CG1 . VAL C 1 25  ? 41.652  11.067  7.082   1.00 24.25  ? 25   VAL C CG1 1 
ATOM   2027 C  CG2 . VAL C 1 25  ? 41.889  8.853   8.328   1.00 21.86  ? 25   VAL C CG2 1 
ATOM   2028 N  N   . THR C 1 26  ? 44.846  12.184  6.757   1.00 27.65  ? 26   THR C N   1 
ATOM   2029 C  CA  . THR C 1 26  ? 45.538  13.448  6.643   1.00 29.62  ? 26   THR C CA  1 
ATOM   2030 C  C   . THR C 1 26  ? 44.620  14.642  6.371   1.00 30.50  ? 26   THR C C   1 
ATOM   2031 O  O   . THR C 1 26  ? 45.060  15.785  6.470   1.00 30.86  ? 26   THR C O   1 
ATOM   2032 C  CB  . THR C 1 26  ? 46.612  13.371  5.542   1.00 31.67  ? 26   THR C CB  1 
ATOM   2033 O  OG1 . THR C 1 26  ? 46.052  12.812  4.347   1.00 31.93  ? 26   THR C OG1 1 
ATOM   2034 C  CG2 . THR C 1 26  ? 47.763  12.521  6.009   1.00 30.72  ? 26   THR C CG2 1 
ATOM   2035 N  N   . ASN C 1 27  ? 43.358  14.365  6.043   1.00 29.40  ? 27   ASN C N   1 
ATOM   2036 C  CA  . ASN C 1 27  ? 42.390  15.392  5.701   1.00 30.83  ? 27   ASN C CA  1 
ATOM   2037 C  C   . ASN C 1 27  ? 41.056  15.249  6.439   1.00 29.17  ? 27   ASN C C   1 
ATOM   2038 O  O   . ASN C 1 27  ? 39.997  15.448  5.841   1.00 29.50  ? 27   ASN C O   1 
ATOM   2039 C  CB  . ASN C 1 27  ? 42.161  15.404  4.179   1.00 32.43  ? 27   ASN C CB  1 
ATOM   2040 C  CG  . ASN C 1 27  ? 41.546  14.113  3.675   1.00 31.00  ? 27   ASN C CG  1 
ATOM   2041 O  OD1 . ASN C 1 27  ? 41.533  13.092  4.386   1.00 28.87  ? 27   ASN C OD1 1 
ATOM   2042 N  ND2 . ASN C 1 27  ? 41.010  14.152  2.462   1.00 31.11  ? 27   ASN C ND2 1 
ATOM   2043 N  N   . MET C 1 28  ? 41.102  14.941  7.734   1.00 27.95  ? 28   MET C N   1 
ATOM   2044 C  CA  . MET C 1 28  ? 39.897  14.915  8.551   1.00 27.20  ? 28   MET C CA  1 
ATOM   2045 C  C   . MET C 1 28  ? 39.263  16.287  8.584   1.00 29.01  ? 28   MET C C   1 
ATOM   2046 O  O   . MET C 1 28  ? 39.945  17.320  8.587   1.00 30.15  ? 28   MET C O   1 
ATOM   2047 C  CB  . MET C 1 28  ? 40.171  14.511  10.008  1.00 26.73  ? 28   MET C CB  1 
ATOM   2048 C  CG  . MET C 1 28  ? 40.648  13.108  10.247  1.00 26.06  ? 28   MET C CG  1 
ATOM   2049 S  SD  . MET C 1 28  ? 39.470  11.757  9.989   1.00 27.87  ? 28   MET C SD  1 
ATOM   2050 C  CE  . MET C 1 28  ? 38.364  11.813  11.402  1.00 27.79  ? 28   MET C CE  1 
ATOM   2051 N  N   . GLU C 1 29  ? 37.943  16.279  8.625   1.00 28.62  ? 29   GLU C N   1 
ATOM   2052 C  CA  . GLU C 1 29  ? 37.170  17.481  8.833   1.00 30.34  ? 29   GLU C CA  1 
ATOM   2053 C  C   . GLU C 1 29  ? 36.401  17.471  10.151  1.00 29.36  ? 29   GLU C C   1 
ATOM   2054 O  O   . GLU C 1 29  ? 36.165  18.526  10.713  1.00 30.86  ? 29   GLU C O   1 
ATOM   2055 C  CB  . GLU C 1 29  ? 36.209  17.664  7.658   1.00 31.32  ? 29   GLU C CB  1 
ATOM   2056 C  CG  . GLU C 1 29  ? 36.902  18.151  6.390   1.00 33.78  ? 29   GLU C CG  1 
ATOM   2057 C  CD  . GLU C 1 29  ? 36.039  18.038  5.143   1.00 35.71  ? 29   GLU C CD  1 
ATOM   2058 O  OE1 . GLU C 1 29  ? 36.580  18.263  4.028   1.00 38.05  ? 29   GLU C OE1 1 
ATOM   2059 O  OE2 . GLU C 1 29  ? 34.827  17.733  5.269   1.00 36.61  ? 29   GLU C OE2 1 
ATOM   2060 N  N   . ALA C 1 30  ? 36.006  16.289  10.636  1.00 27.60  ? 30   ALA C N   1 
ATOM   2061 C  CA  . ALA C 1 30  ? 35.086  16.175  11.773  1.00 27.26  ? 30   ALA C CA  1 
ATOM   2062 C  C   . ALA C 1 30  ? 35.578  16.935  13.001  1.00 28.02  ? 30   ALA C C   1 
ATOM   2063 O  O   . ALA C 1 30  ? 36.767  16.950  13.293  1.00 27.63  ? 30   ALA C O   1 
ATOM   2064 C  CB  . ALA C 1 30  ? 34.845  14.697  12.133  1.00 24.98  ? 30   ALA C CB  1 
ATOM   2065 N  N   . GLN C 1 31  ? 34.656  17.567  13.717  1.00 29.30  ? 31   GLN C N   1 
ATOM   2066 C  CA  . GLN C 1 31  ? 35.008  18.288  14.942  1.00 30.84  ? 31   GLN C CA  1 
ATOM   2067 C  C   . GLN C 1 31  ? 34.385  17.656  16.190  1.00 29.97  ? 31   GLN C C   1 
ATOM   2068 O  O   . GLN C 1 31  ? 34.533  18.168  17.289  1.00 30.99  ? 31   GLN C O   1 
ATOM   2069 C  CB  . GLN C 1 31  ? 34.616  19.756  14.803  1.00 33.67  ? 31   GLN C CB  1 
ATOM   2070 C  CG  . GLN C 1 31  ? 35.409  20.522  13.718  1.00 37.40  ? 31   GLN C CG  1 
ATOM   2071 C  CD  . GLN C 1 31  ? 36.923  20.452  13.919  1.00 40.21  ? 31   GLN C CD  1 
ATOM   2072 O  OE1 . GLN C 1 31  ? 37.471  21.067  14.837  1.00 45.82  ? 31   GLN C OE1 1 
ATOM   2073 N  NE2 . GLN C 1 31  ? 37.603  19.713  13.051  1.00 40.13  ? 31   GLN C NE2 1 
ATOM   2074 N  N   . ASN C 1 32  ? 33.719  16.522  15.991  1.00 28.22  ? 32   ASN C N   1 
ATOM   2075 C  CA  . ASN C 1 32  ? 32.982  15.798  17.022  1.00 27.71  ? 32   ASN C CA  1 
ATOM   2076 C  C   . ASN C 1 32  ? 33.068  14.329  16.637  1.00 25.65  ? 32   ASN C C   1 
ATOM   2077 O  O   . ASN C 1 32  ? 32.750  13.977  15.490  1.00 23.86  ? 32   ASN C O   1 
ATOM   2078 C  CB  . ASN C 1 32  ? 31.525  16.278  17.009  1.00 29.51  ? 32   ASN C CB  1 
ATOM   2079 C  CG  . ASN C 1 32  ? 30.665  15.670  18.119  1.00 30.25  ? 32   ASN C CG  1 
ATOM   2080 O  OD1 . ASN C 1 32  ? 30.967  14.610  18.681  1.00 26.83  ? 32   ASN C OD1 1 
ATOM   2081 N  ND2 . ASN C 1 32  ? 29.637  16.433  18.513  1.00 35.15  ? 32   ASN C ND2 1 
ATOM   2082 N  N   . THR C 1 33  ? 33.530  13.466  17.556  1.00 24.66  ? 33   THR C N   1 
ATOM   2083 C  CA  . THR C 1 33  ? 33.631  12.030  17.268  1.00 22.48  ? 33   THR C CA  1 
ATOM   2084 C  C   . THR C 1 33  ? 32.263  11.396  16.966  1.00 22.70  ? 33   THR C C   1 
ATOM   2085 O  O   . THR C 1 33  ? 32.207  10.323  16.357  1.00 20.89  ? 33   THR C O   1 
ATOM   2086 C  CB  . THR C 1 33  ? 34.320  11.230  18.427  1.00 21.52  ? 33   THR C CB  1 
ATOM   2087 O  OG1 . THR C 1 33  ? 33.639  11.496  19.650  1.00 21.32  ? 33   THR C OG1 1 
ATOM   2088 C  CG2 . THR C 1 33  ? 35.780  11.640  18.584  1.00 22.58  ? 33   THR C CG2 1 
ATOM   2089 N  N   . THR C 1 34  ? 31.176  12.058  17.389  1.00 25.00  ? 34   THR C N   1 
ATOM   2090 C  CA  . THR C 1 34  ? 29.795  11.645  17.027  1.00 25.67  ? 34   THR C CA  1 
ATOM   2091 C  C   . THR C 1 34  ? 29.620  11.397  15.519  1.00 24.59  ? 34   THR C C   1 
ATOM   2092 O  O   . THR C 1 34  ? 28.794  10.590  15.100  1.00 23.94  ? 34   THR C O   1 
ATOM   2093 C  CB  . THR C 1 34  ? 28.757  12.714  17.425  1.00 28.30  ? 34   THR C CB  1 
ATOM   2094 O  OG1 . THR C 1 34  ? 28.684  12.808  18.850  1.00 33.33  ? 34   THR C OG1 1 
ATOM   2095 C  CG2 . THR C 1 34  ? 27.403  12.350  16.894  1.00 29.90  ? 34   THR C CG2 1 
ATOM   2096 N  N   . GLU C 1 35  ? 30.385  12.125  14.715  1.00 24.42  ? 35   GLU C N   1 
ATOM   2097 C  CA  . GLU C 1 35  ? 30.280  12.037  13.268  1.00 24.41  ? 35   GLU C CA  1 
ATOM   2098 C  C   . GLU C 1 35  ? 31.341  11.112  12.657  1.00 22.32  ? 35   GLU C C   1 
ATOM   2099 O  O   . GLU C 1 35  ? 31.516  11.112  11.443  1.00 22.50  ? 35   GLU C O   1 
ATOM   2100 C  CB  . GLU C 1 35  ? 30.367  13.439  12.681  1.00 25.85  ? 35   GLU C CB  1 
ATOM   2101 C  CG  . GLU C 1 35  ? 29.165  14.337  13.083  1.00 28.72  ? 35   GLU C CG  1 
ATOM   2102 C  CD  . GLU C 1 35  ? 29.451  15.821  13.009  1.00 30.63  ? 35   GLU C CD  1 
ATOM   2103 O  OE1 . GLU C 1 35  ? 30.466  16.217  12.395  1.00 34.05  ? 35   GLU C OE1 1 
ATOM   2104 O  OE2 . GLU C 1 35  ? 28.630  16.610  13.544  1.00 35.26  ? 35   GLU C OE2 1 
ATOM   2105 N  N   . VAL C 1 36  ? 32.051  10.334  13.477  1.00 20.50  ? 36   VAL C N   1 
ATOM   2106 C  CA  . VAL C 1 36  ? 33.107  9.433   12.958  1.00 19.84  ? 36   VAL C CA  1 
ATOM   2107 C  C   . VAL C 1 36  ? 32.817  7.948   13.278  1.00 19.32  ? 36   VAL C C   1 
ATOM   2108 O  O   . VAL C 1 36  ? 32.281  7.587   14.353  1.00 19.07  ? 36   VAL C O   1 
ATOM   2109 C  CB  . VAL C 1 36  ? 34.523  9.849   13.463  1.00 19.35  ? 36   VAL C CB  1 
ATOM   2110 C  CG1 . VAL C 1 36  ? 35.618  8.948   12.859  1.00 17.96  ? 36   VAL C CG1 1 
ATOM   2111 C  CG2 . VAL C 1 36  ? 34.815  11.322  13.112  1.00 19.86  ? 36   VAL C CG2 1 
ATOM   2112 N  N   . TYR C 1 37  ? 33.125  7.102   12.302  1.00 19.50  ? 37   TYR C N   1 
ATOM   2113 C  CA  . TYR C 1 37  ? 33.000  5.663   12.423  1.00 19.23  ? 37   TYR C CA  1 
ATOM   2114 C  C   . TYR C 1 37  ? 34.320  5.064   11.954  1.00 18.25  ? 37   TYR C C   1 
ATOM   2115 O  O   . TYR C 1 37  ? 34.857  5.475   10.923  1.00 18.15  ? 37   TYR C O   1 
ATOM   2116 C  CB  . TYR C 1 37  ? 31.856  5.161   11.547  1.00 21.18  ? 37   TYR C CB  1 
ATOM   2117 C  CG  . TYR C 1 37  ? 31.347  3.799   11.931  1.00 21.09  ? 37   TYR C CG  1 
ATOM   2118 C  CD1 . TYR C 1 37  ? 30.164  3.658   12.654  1.00 23.70  ? 37   TYR C CD1 1 
ATOM   2119 C  CD2 . TYR C 1 37  ? 32.037  2.647   11.575  1.00 22.37  ? 37   TYR C CD2 1 
ATOM   2120 C  CE1 . TYR C 1 37  ? 29.679  2.410   13.000  1.00 22.73  ? 37   TYR C CE1 1 
ATOM   2121 C  CE2 . TYR C 1 37  ? 31.566  1.387   11.938  1.00 22.75  ? 37   TYR C CE2 1 
ATOM   2122 C  CZ  . TYR C 1 37  ? 30.376  1.286   12.637  1.00 24.34  ? 37   TYR C CZ  1 
ATOM   2123 O  OH  . TYR C 1 37  ? 29.894  0.052   12.990  1.00 25.23  ? 37   TYR C OH  1 
ATOM   2124 N  N   . VAL C 1 38  ? 34.831  4.117   12.724  1.00 17.27  ? 38   VAL C N   1 
ATOM   2125 C  CA  . VAL C 1 38  ? 36.053  3.392   12.389  1.00 16.87  ? 38   VAL C CA  1 
ATOM   2126 C  C   . VAL C 1 38  ? 35.769  1.904   12.355  1.00 16.97  ? 38   VAL C C   1 
ATOM   2127 O  O   . VAL C 1 38  ? 35.108  1.359   13.238  1.00 17.05  ? 38   VAL C O   1 
ATOM   2128 C  CB  . VAL C 1 38  ? 37.186  3.653   13.400  1.00 16.48  ? 38   VAL C CB  1 
ATOM   2129 C  CG1 . VAL C 1 38  ? 38.445  2.934   12.966  1.00 17.13  ? 38   VAL C CG1 1 
ATOM   2130 C  CG2 . VAL C 1 38  ? 37.431  5.167   13.562  1.00 18.36  ? 38   VAL C CG2 1 
ATOM   2131 N  N   . LYS C 1 39  ? 36.251  1.250   11.315  1.00 17.72  ? 39   LYS C N   1 
ATOM   2132 C  CA  . LYS C 1 39  ? 36.169  -0.199  11.231  1.00 18.22  ? 39   LYS C CA  1 
ATOM   2133 C  C   . LYS C 1 39  ? 37.518  -0.744  10.791  1.00 17.96  ? 39   LYS C C   1 
ATOM   2134 O  O   . LYS C 1 39  ? 38.115  -0.269  9.815   1.00 18.22  ? 39   LYS C O   1 
ATOM   2135 C  CB  . LYS C 1 39  ? 35.087  -0.587  10.250  1.00 19.68  ? 39   LYS C CB  1 
ATOM   2136 C  CG  . LYS C 1 39  ? 34.937  -2.053  9.947   1.00 22.13  ? 39   LYS C CG  1 
ATOM   2137 C  CD  . LYS C 1 39  ? 33.838  -2.218  8.867   1.00 24.76  ? 39   LYS C CD  1 
ATOM   2138 C  CE  . LYS C 1 39  ? 32.469  -1.750  9.332   1.00 27.84  ? 39   LYS C CE  1 
ATOM   2139 N  NZ  . LYS C 1 39  ? 31.372  -2.273  8.464   1.00 31.00  ? 39   LYS C NZ  1 
ATOM   2140 N  N   . TRP C 1 40  ? 37.985  -1.748  11.525  1.00 17.49  ? 40   TRP C N   1 
ATOM   2141 C  CA  . TRP C 1 40  ? 39.179  -2.503  11.161  1.00 17.67  ? 40   TRP C CA  1 
ATOM   2142 C  C   . TRP C 1 40  ? 38.788  -3.904  10.713  1.00 19.13  ? 40   TRP C C   1 
ATOM   2143 O  O   . TRP C 1 40  ? 37.908  -4.553  11.314  1.00 18.68  ? 40   TRP C O   1 
ATOM   2144 C  CB  . TRP C 1 40  ? 40.151  -2.574  12.334  1.00 16.80  ? 40   TRP C CB  1 
ATOM   2145 C  CG  . TRP C 1 40  ? 40.998  -1.349  12.503  1.00 16.30  ? 40   TRP C CG  1 
ATOM   2146 C  CD1 . TRP C 1 40  ? 40.690  -0.226  13.230  1.00 16.36  ? 40   TRP C CD1 1 
ATOM   2147 C  CD2 . TRP C 1 40  ? 42.307  -1.128  11.961  1.00 15.79  ? 40   TRP C CD2 1 
ATOM   2148 N  NE1 . TRP C 1 40  ? 41.738  0.662   13.176  1.00 16.71  ? 40   TRP C NE1 1 
ATOM   2149 C  CE2 . TRP C 1 40  ? 42.730  0.140   12.390  1.00 16.16  ? 40   TRP C CE2 1 
ATOM   2150 C  CE3 . TRP C 1 40  ? 43.165  -1.886  11.145  1.00 16.30  ? 40   TRP C CE3 1 
ATOM   2151 C  CZ2 . TRP C 1 40  ? 43.979  0.675   12.033  1.00 16.85  ? 40   TRP C CZ2 1 
ATOM   2152 C  CZ3 . TRP C 1 40  ? 44.377  -1.348  10.772  1.00 17.34  ? 40   TRP C CZ3 1 
ATOM   2153 C  CH2 . TRP C 1 40  ? 44.785  -0.083  11.227  1.00 17.90  ? 40   TRP C CH2 1 
ATOM   2154 N  N   . LYS C 1 41  ? 39.431  -4.363  9.646   1.00 20.09  ? 41   LYS C N   1 
ATOM   2155 C  CA  . LYS C 1 41  ? 39.096  -5.656  9.040   1.00 22.21  ? 41   LYS C CA  1 
ATOM   2156 C  C   . LYS C 1 41  ? 40.348  -6.512  8.921   1.00 22.52  ? 41   LYS C C   1 
ATOM   2157 O  O   . LYS C 1 41  ? 41.454  -6.012  8.696   1.00 21.56  ? 41   LYS C O   1 
ATOM   2158 C  CB  . LYS C 1 41  ? 38.444  -5.502  7.657   1.00 23.97  ? 41   LYS C CB  1 
ATOM   2159 C  CG  . LYS C 1 41  ? 37.241  -4.574  7.625   1.00 26.02  ? 41   LYS C CG  1 
ATOM   2160 C  CD  . LYS C 1 41  ? 36.495  -4.658  6.299   1.00 27.62  ? 41   LYS C CD  1 
ATOM   2161 C  CE  . LYS C 1 41  ? 35.084  -4.077  6.397   1.00 29.80  ? 41   LYS C CE  1 
ATOM   2162 N  NZ  . LYS C 1 41  ? 34.188  -4.472  5.258   1.00 34.83  ? 41   LYS C NZ  1 
ATOM   2163 N  N   . PHE C 1 42  ? 40.148  -7.802  9.102   1.00 23.59  ? 42   PHE C N   1 
ATOM   2164 C  CA  . PHE C 1 42  ? 41.194  -8.787  8.914   1.00 24.65  ? 42   PHE C CA  1 
ATOM   2165 C  C   . PHE C 1 42  ? 40.527  -10.021 8.338   1.00 27.03  ? 42   PHE C C   1 
ATOM   2166 O  O   . PHE C 1 42  ? 39.523  -10.469 8.882   1.00 26.66  ? 42   PHE C O   1 
ATOM   2167 C  CB  . PHE C 1 42  ? 41.883  -9.107  10.240  1.00 23.29  ? 42   PHE C CB  1 
ATOM   2168 C  CG  . PHE C 1 42  ? 42.964  -10.163 10.120  1.00 23.75  ? 42   PHE C CG  1 
ATOM   2169 C  CD1 . PHE C 1 42  ? 44.191  -9.855  9.561   1.00 23.20  ? 42   PHE C CD1 1 
ATOM   2170 C  CD2 . PHE C 1 42  ? 42.732  -11.463 10.543  1.00 24.32  ? 42   PHE C CD2 1 
ATOM   2171 C  CE1 . PHE C 1 42  ? 45.197  -10.836 9.448   1.00 23.88  ? 42   PHE C CE1 1 
ATOM   2172 C  CE2 . PHE C 1 42  ? 43.732  -12.464 10.423  1.00 25.05  ? 42   PHE C CE2 1 
ATOM   2173 C  CZ  . PHE C 1 42  ? 44.949  -12.145 9.876   1.00 25.47  ? 42   PHE C CZ  1 
ATOM   2174 N  N   . LYS C 1 43  ? 41.085  -10.531 7.232   1.00 29.54  ? 43   LYS C N   1 
ATOM   2175 C  CA  . LYS C 1 43  ? 40.549  -11.670 6.459   1.00 33.17  ? 43   LYS C CA  1 
ATOM   2176 C  C   . LYS C 1 43  ? 39.055  -11.522 6.129   1.00 34.75  ? 43   LYS C C   1 
ATOM   2177 O  O   . LYS C 1 43  ? 38.275  -12.477 6.209   1.00 36.05  ? 43   LYS C O   1 
ATOM   2178 C  CB  . LYS C 1 43  ? 40.860  -13.007 7.145   1.00 34.11  ? 43   LYS C CB  1 
ATOM   2179 C  CG  . LYS C 1 43  ? 42.332  -13.388 7.071   1.00 34.70  ? 43   LYS C CG  1 
ATOM   2180 C  CD  . LYS C 1 43  ? 42.606  -14.816 7.554   1.00 36.75  ? 43   LYS C CD  1 
ATOM   2181 C  CE  . LYS C 1 43  ? 42.186  -15.859 6.511   1.00 40.23  ? 43   LYS C CE  1 
ATOM   2182 N  NZ  . LYS C 1 43  ? 42.615  -17.255 6.820   1.00 43.03  ? 43   LYS C NZ  1 
ATOM   2183 N  N   . GLY C 1 44  ? 38.673  -10.303 5.763   1.00 34.73  ? 44   GLY C N   1 
ATOM   2184 C  CA  . GLY C 1 44  ? 37.302  -10.013 5.383   1.00 36.17  ? 44   GLY C CA  1 
ATOM   2185 C  C   . GLY C 1 44  ? 36.329  -9.777  6.524   1.00 35.75  ? 44   GLY C C   1 
ATOM   2186 O  O   . GLY C 1 44  ? 35.156  -9.483  6.262   1.00 37.66  ? 44   GLY C O   1 
ATOM   2187 N  N   . ARG C 1 45  ? 36.776  -9.889  7.780   1.00 33.91  ? 45   ARG C N   1 
ATOM   2188 C  CA  . ARG C 1 45  ? 35.859  -9.715  8.917   1.00 33.62  ? 45   ARG C CA  1 
ATOM   2189 C  C   . ARG C 1 45  ? 36.154  -8.499  9.767   1.00 30.32  ? 45   ARG C C   1 
ATOM   2190 O  O   . ARG C 1 45  ? 37.292  -8.086  9.900   1.00 28.93  ? 45   ARG C O   1 
ATOM   2191 C  CB  . ARG C 1 45  ? 35.757  -10.959 9.813   1.00 34.70  ? 45   ARG C CB  1 
ATOM   2192 C  CG  . ARG C 1 45  ? 36.902  -11.936 9.777   1.00 37.33  ? 45   ARG C CG  1 
ATOM   2193 C  CD  . ARG C 1 45  ? 36.508  -13.221 10.470  1.00 40.14  ? 45   ARG C CD  1 
ATOM   2194 N  NE  . ARG C 1 45  ? 36.122  -12.956 11.849  1.00 43.10  ? 45   ARG C NE  1 
ATOM   2195 C  CZ  . ARG C 1 45  ? 36.977  -12.760 12.853  1.00 42.86  ? 45   ARG C CZ  1 
ATOM   2196 N  NH1 . ARG C 1 45  ? 38.290  -12.826 12.649  1.00 44.05  ? 45   ARG C NH1 1 
ATOM   2197 N  NH2 . ARG C 1 45  ? 36.510  -12.510 14.075  1.00 41.11  ? 45   ARG C NH2 1 
ATOM   2198 N  N   . ASP C 1 46  ? 35.089  -7.940  10.335  1.00 29.92  ? 46   ASP C N   1 
ATOM   2199 C  CA  . ASP C 1 46  ? 35.173  -6.773  11.206  1.00 27.79  ? 46   ASP C CA  1 
ATOM   2200 C  C   . ASP C 1 46  ? 35.782  -7.149  12.542  1.00 26.34  ? 46   ASP C C   1 
ATOM   2201 O  O   . ASP C 1 46  ? 35.130  -7.768  13.375  1.00 27.63  ? 46   ASP C O   1 
ATOM   2202 C  CB  . ASP C 1 46  ? 33.783  -6.191  11.447  1.00 28.69  ? 46   ASP C CB  1 
ATOM   2203 C  CG  . ASP C 1 46  ? 33.173  -5.598  10.194  1.00 31.36  ? 46   ASP C CG  1 
ATOM   2204 O  OD1 . ASP C 1 46  ? 33.785  -5.707  9.115   1.00 34.79  ? 46   ASP C OD1 1 
ATOM   2205 O  OD2 . ASP C 1 46  ? 32.077  -5.024  10.292  1.00 35.70  ? 46   ASP C OD2 1 
ATOM   2206 N  N   . ILE C 1 47  ? 37.018  -6.744  12.774  1.00 23.69  ? 47   ILE C N   1 
ATOM   2207 C  CA  . ILE C 1 47  ? 37.679  -7.132  14.017  1.00 22.75  ? 47   ILE C CA  1 
ATOM   2208 C  C   . ILE C 1 47  ? 37.658  -6.024  15.069  1.00 19.95  ? 47   ILE C C   1 
ATOM   2209 O  O   . ILE C 1 47  ? 37.991  -6.264  16.213  1.00 18.75  ? 47   ILE C O   1 
ATOM   2210 C  CB  . ILE C 1 47  ? 39.096  -7.730  13.778  1.00 22.57  ? 47   ILE C CB  1 
ATOM   2211 C  CG1 . ILE C 1 47  ? 40.048  -6.713  13.142  1.00 23.60  ? 47   ILE C CG1 1 
ATOM   2212 C  CG2 . ILE C 1 47  ? 38.993  -8.951  12.901  1.00 25.03  ? 47   ILE C CG2 1 
ATOM   2213 C  CD1 . ILE C 1 47  ? 40.823  -5.918  14.107  1.00 22.16  ? 47   ILE C CD1 1 
ATOM   2214 N  N   . TYR C 1 48  ? 37.230  -4.827  14.682  1.00 18.90  ? 48   TYR C N   1 
ATOM   2215 C  CA  . TYR C 1 48  ? 37.018  -3.725  15.623  1.00 18.08  ? 48   TYR C CA  1 
ATOM   2216 C  C   . TYR C 1 48  ? 36.152  -2.675  14.947  1.00 17.75  ? 48   TYR C C   1 
ATOM   2217 O  O   . TYR C 1 48  ? 36.380  -2.324  13.790  1.00 16.22  ? 48   TYR C O   1 
ATOM   2218 C  CB  . TYR C 1 48  ? 38.333  -3.065  16.078  1.00 17.70  ? 48   TYR C CB  1 
ATOM   2219 C  CG  . TYR C 1 48  ? 38.100  -1.879  17.002  1.00 17.78  ? 48   TYR C CG  1 
ATOM   2220 C  CD1 . TYR C 1 48  ? 38.002  -2.048  18.386  1.00 16.42  ? 48   TYR C CD1 1 
ATOM   2221 C  CD2 . TYR C 1 48  ? 37.906  -0.600  16.482  1.00 18.30  ? 48   TYR C CD2 1 
ATOM   2222 C  CE1 . TYR C 1 48  ? 37.758  -0.947  19.224  1.00 17.81  ? 48   TYR C CE1 1 
ATOM   2223 C  CE2 . TYR C 1 48  ? 37.657  0.494   17.304  1.00 17.88  ? 48   TYR C CE2 1 
ATOM   2224 C  CZ  . TYR C 1 48  ? 37.594  0.328   18.660  1.00 17.38  ? 48   TYR C CZ  1 
ATOM   2225 O  OH  . TYR C 1 48  ? 37.333  1.429   19.466  1.00 20.79  ? 48   TYR C OH  1 
ATOM   2226 N  N   . THR C 1 49  ? 35.146  -2.186  15.669  1.00 18.28  ? 49   THR C N   1 
ATOM   2227 C  CA  . THR C 1 49  ? 34.429  -1.007  15.243  1.00 17.77  ? 49   THR C CA  1 
ATOM   2228 C  C   . THR C 1 49  ? 34.274  -0.035  16.403  1.00 17.98  ? 49   THR C C   1 
ATOM   2229 O  O   . THR C 1 49  ? 34.039  -0.450  17.545  1.00 17.16  ? 49   THR C O   1 
ATOM   2230 C  CB  . THR C 1 49  ? 33.015  -1.363  14.696  1.00 19.52  ? 49   THR C CB  1 
ATOM   2231 O  OG1 . THR C 1 49  ? 32.221  -1.883  15.753  1.00 21.21  ? 49   THR C OG1 1 
ATOM   2232 C  CG2 . THR C 1 49  ? 33.091  -2.412  13.566  1.00 19.95  ? 49   THR C CG2 1 
ATOM   2233 N  N   . PHE C 1 50  ? 34.417  1.253   16.084  1.00 17.45  ? 50   PHE C N   1 
ATOM   2234 C  CA  . PHE C 1 50  ? 33.983  2.336   16.936  1.00 17.23  ? 50   PHE C CA  1 
ATOM   2235 C  C   . PHE C 1 50  ? 32.877  3.100   16.216  1.00 17.84  ? 50   PHE C C   1 
ATOM   2236 O  O   . PHE C 1 50  ? 33.071  3.634   15.110  1.00 17.31  ? 50   PHE C O   1 
ATOM   2237 C  CB  . PHE C 1 50  ? 35.127  3.273   17.281  1.00 17.21  ? 50   PHE C CB  1 
ATOM   2238 C  CG  . PHE C 1 50  ? 34.690  4.527   17.992  1.00 17.97  ? 50   PHE C CG  1 
ATOM   2239 C  CD1 . PHE C 1 50  ? 34.276  4.488   19.313  1.00 19.98  ? 50   PHE C CD1 1 
ATOM   2240 C  CD2 . PHE C 1 50  ? 34.723  5.757   17.351  1.00 19.58  ? 50   PHE C CD2 1 
ATOM   2241 C  CE1 . PHE C 1 50  ? 33.886  5.665   19.976  1.00 20.46  ? 50   PHE C CE1 1 
ATOM   2242 C  CE2 . PHE C 1 50  ? 34.334  6.921   18.011  1.00 18.40  ? 50   PHE C CE2 1 
ATOM   2243 C  CZ  . PHE C 1 50  ? 33.935  6.881   19.303  1.00 21.19  ? 50   PHE C CZ  1 
ATOM   2244 N  N   . ASP C 1 51  ? 31.710  3.130   16.844  1.00 18.16  ? 51   ASP C N   1 
ATOM   2245 C  CA  . ASP C 1 51  ? 30.583  3.913   16.362  1.00 19.39  ? 51   ASP C CA  1 
ATOM   2246 C  C   . ASP C 1 51  ? 30.529  5.170   17.213  1.00 19.45  ? 51   ASP C C   1 
ATOM   2247 O  O   . ASP C 1 51  ? 30.051  5.134   18.336  1.00 20.42  ? 51   ASP C O   1 
ATOM   2248 C  CB  . ASP C 1 51  ? 29.292  3.114   16.486  1.00 20.78  ? 51   ASP C CB  1 
ATOM   2249 C  CG  . ASP C 1 51  ? 28.094  3.804   15.837  1.00 22.75  ? 51   ASP C CG  1 
ATOM   2250 O  OD1 . ASP C 1 51  ? 28.081  5.052   15.712  1.00 23.39  ? 51   ASP C OD1 1 
ATOM   2251 O  OD2 . ASP C 1 51  ? 27.162  3.071   15.455  1.00 25.03  ? 51   ASP C OD2 1 
ATOM   2252 N  N   . GLY C 1 52  ? 31.024  6.273   16.668  1.00 19.38  ? 52   GLY C N   1 
ATOM   2253 C  CA  . GLY C 1 52  ? 31.065  7.547   17.388  1.00 20.78  ? 52   GLY C CA  1 
ATOM   2254 C  C   . GLY C 1 52  ? 29.714  8.092   17.800  1.00 22.96  ? 52   GLY C C   1 
ATOM   2255 O  O   . GLY C 1 52  ? 29.591  8.770   18.823  1.00 24.49  ? 52   GLY C O   1 
ATOM   2256 N  N   . ALA C 1 53  ? 28.701  7.823   16.985  1.00 23.91  ? 53   ALA C N   1 
ATOM   2257 C  CA  . ALA C 1 53  ? 27.346  8.251   17.265  1.00 25.69  ? 53   ALA C CA  1 
ATOM   2258 C  C   . ALA C 1 53  ? 26.816  7.581   18.558  1.00 27.29  ? 53   ALA C C   1 
ATOM   2259 O  O   . ALA C 1 53  ? 26.119  8.210   19.359  1.00 28.86  ? 53   ALA C O   1 
ATOM   2260 C  CB  . ALA C 1 53  ? 26.454  7.931   16.076  1.00 26.31  ? 53   ALA C CB  1 
ATOM   2261 N  N   . LEU C 1 54  ? 27.180  6.317   18.753  1.00 27.06  ? 54   LEU C N   1 
ATOM   2262 C  CA  . LEU C 1 54  ? 26.806  5.557   19.954  1.00 28.35  ? 54   LEU C CA  1 
ATOM   2263 C  C   . LEU C 1 54  ? 27.837  5.625   21.090  1.00 27.82  ? 54   LEU C C   1 
ATOM   2264 O  O   . LEU C 1 54  ? 27.517  5.237   22.219  1.00 28.99  ? 54   LEU C O   1 
ATOM   2265 C  CB  . LEU C 1 54  ? 26.582  4.089   19.605  1.00 28.83  ? 54   LEU C CB  1 
ATOM   2266 C  CG  . LEU C 1 54  ? 25.582  3.758   18.498  1.00 30.94  ? 54   LEU C CG  1 
ATOM   2267 C  CD1 . LEU C 1 54  ? 25.406  2.257   18.417  1.00 31.59  ? 54   LEU C CD1 1 
ATOM   2268 C  CD2 . LEU C 1 54  ? 24.271  4.467   18.724  1.00 34.00  ? 54   LEU C CD2 1 
ATOM   2269 N  N   . ASN C 1 55  ? 29.038  6.138   20.815  1.00 25.89  ? 55   ASN C N   1 
ATOM   2270 C  CA  . ASN C 1 55  ? 30.137  6.100   21.779  1.00 26.21  ? 55   ASN C CA  1 
ATOM   2271 C  C   . ASN C 1 55  ? 30.338  4.675   22.273  1.00 25.17  ? 55   ASN C C   1 
ATOM   2272 O  O   . ASN C 1 55  ? 30.360  4.432   23.479  1.00 25.47  ? 55   ASN C O   1 
ATOM   2273 C  CB  . ASN C 1 55  ? 29.835  6.998   22.986  1.00 29.48  ? 55   ASN C CB  1 
ATOM   2274 C  CG  . ASN C 1 55  ? 30.778  8.176   23.122  1.00 34.65  ? 55   ASN C CG  1 
ATOM   2275 O  OD1 . ASN C 1 55  ? 31.881  8.217   22.554  1.00 36.90  ? 55   ASN C OD1 1 
ATOM   2276 N  ND2 . ASN C 1 55  ? 30.326  9.148   23.907  1.00 46.13  ? 55   ASN C ND2 1 
ATOM   2277 N  N   . LYS C 1 56  ? 30.428  3.733   21.336  1.00 23.40  ? 56   LYS C N   1 
ATOM   2278 C  CA  . LYS C 1 56  ? 30.591  2.323   21.678  1.00 23.20  ? 56   LYS C CA  1 
ATOM   2279 C  C   . LYS C 1 56  ? 31.511  1.612   20.698  1.00 20.60  ? 56   LYS C C   1 
ATOM   2280 O  O   . LYS C 1 56  ? 31.504  1.892   19.496  1.00 18.47  ? 56   LYS C O   1 
ATOM   2281 C  CB  . LYS C 1 56  ? 29.247  1.595   21.686  1.00 24.73  ? 56   LYS C CB  1 
ATOM   2282 C  CG  . LYS C 1 56  ? 28.257  2.108   22.685  1.00 27.80  ? 56   LYS C CG  1 
ATOM   2283 C  CD  . LYS C 1 56  ? 27.071  1.202   22.808  1.00 29.65  ? 56   LYS C CD  1 
ATOM   2284 C  CE  . LYS C 1 56  ? 26.116  1.712   23.884  1.00 31.69  ? 56   LYS C CE  1 
ATOM   2285 N  NZ  . LYS C 1 56  ? 24.811  0.994   23.835  1.00 35.60  ? 56   LYS C NZ  1 
ATOM   2286 N  N   . SER C 1 57  ? 32.291  0.681   21.237  1.00 19.48  ? 57   SER C N   1 
ATOM   2287 C  CA  . SER C 1 57  ? 33.206  -0.111  20.453  1.00 19.48  ? 57   SER C CA  1 
ATOM   2288 C  C   . SER C 1 57  ? 32.816  -1.575  20.565  1.00 19.68  ? 57   SER C C   1 
ATOM   2289 O  O   . SER C 1 57  ? 32.343  -1.996  21.610  1.00 20.02  ? 57   SER C O   1 
ATOM   2290 C  CB  . SER C 1 57  ? 34.614  0.114   20.962  1.00 19.24  ? 57   SER C CB  1 
ATOM   2291 O  OG  . SER C 1 57  ? 34.888  1.514   20.855  1.00 22.74  ? 57   SER C OG  1 
ATOM   2292 N  N   . THR C 1 58  ? 33.019  -2.327  19.475  1.00 19.73  ? 58   THR C N   1 
ATOM   2293 C  CA  . THR C 1 58  ? 32.600  -3.737  19.376  1.00 20.54  ? 58   THR C CA  1 
ATOM   2294 C  C   . THR C 1 58  ? 33.765  -4.546  18.817  1.00 19.69  ? 58   THR C C   1 
ATOM   2295 O  O   . THR C 1 58  ? 34.387  -4.123  17.843  1.00 18.14  ? 58   THR C O   1 
ATOM   2296 C  CB  . THR C 1 58  ? 31.378  -3.914  18.453  1.00 21.56  ? 58   THR C CB  1 
ATOM   2297 O  OG1 . THR C 1 58  ? 30.362  -2.979  18.816  1.00 22.26  ? 58   THR C OG1 1 
ATOM   2298 C  CG2 . THR C 1 58  ? 30.829  -5.353  18.542  1.00 22.97  ? 58   THR C CG2 1 
ATOM   2299 N  N   . VAL C 1 59  ? 34.065  -5.674  19.462  1.00 20.50  ? 59   VAL C N   1 
ATOM   2300 C  CA  . VAL C 1 59  ? 35.133  -6.589  19.043  1.00 20.17  ? 59   VAL C CA  1 
ATOM   2301 C  C   . VAL C 1 59  ? 34.648  -8.043  19.084  1.00 22.00  ? 59   VAL C C   1 
ATOM   2302 O  O   . VAL C 1 59  ? 33.762  -8.377  19.861  1.00 22.61  ? 59   VAL C O   1 
ATOM   2303 C  CB  . VAL C 1 59  ? 36.369  -6.476  19.967  1.00 19.76  ? 59   VAL C CB  1 
ATOM   2304 C  CG1 . VAL C 1 59  ? 37.021  -5.109  19.818  1.00 19.41  ? 59   VAL C CG1 1 
ATOM   2305 C  CG2 . VAL C 1 59  ? 35.991  -6.773  21.421  1.00 22.11  ? 59   VAL C CG2 1 
ATOM   2306 N  N   . PRO C 1 60  ? 35.228  -8.916  18.241  1.00 22.48  ? 60   PRO C N   1 
ATOM   2307 C  CA  . PRO C 1 60  ? 34.924  -10.339 18.368  1.00 24.38  ? 60   PRO C CA  1 
ATOM   2308 C  C   . PRO C 1 60  ? 35.816  -10.915 19.445  1.00 24.47  ? 60   PRO C C   1 
ATOM   2309 O  O   . PRO C 1 60  ? 36.781  -10.276 19.835  1.00 22.90  ? 60   PRO C O   1 
ATOM   2310 C  CB  . PRO C 1 60  ? 35.261  -10.897 16.985  1.00 24.03  ? 60   PRO C CB  1 
ATOM   2311 C  CG  . PRO C 1 60  ? 36.341  -9.980  16.475  1.00 21.71  ? 60   PRO C CG  1 
ATOM   2312 C  CD  . PRO C 1 60  ? 36.216  -8.662  17.180  1.00 21.75  ? 60   PRO C CD  1 
ATOM   2313 N  N   . THR C 1 61  ? 35.508  -12.109 19.924  1.00 27.39  ? 61   THR C N   1 
ATOM   2314 C  CA  . THR C 1 61  ? 36.249  -12.671 21.046  1.00 28.79  ? 61   THR C CA  1 
ATOM   2315 C  C   . THR C 1 61  ? 37.726  -12.935 20.724  1.00 28.08  ? 61   THR C C   1 
ATOM   2316 O  O   . THR C 1 61  ? 38.584  -12.775 21.589  1.00 28.08  ? 61   THR C O   1 
ATOM   2317 C  CB  . THR C 1 61  ? 35.567  -13.939 21.564  1.00 31.42  ? 61   THR C CB  1 
ATOM   2318 O  OG1 . THR C 1 61  ? 34.250  -13.591 22.007  1.00 33.94  ? 61   THR C OG1 1 
ATOM   2319 C  CG2 . THR C 1 61  ? 36.351  -14.546 22.733  1.00 33.17  ? 61   THR C CG2 1 
ATOM   2320 N  N   . ASP C 1 62  ? 38.014  -13.287 19.473  1.00 28.23  ? 62   ASP C N   1 
ATOM   2321 C  CA  . ASP C 1 62  ? 39.386  -13.574 19.024  1.00 27.46  ? 62   ASP C CA  1 
ATOM   2322 C  C   . ASP C 1 62  ? 40.252  -12.316 18.825  1.00 25.28  ? 62   ASP C C   1 
ATOM   2323 O  O   . ASP C 1 62  ? 41.456  -12.418 18.598  1.00 23.61  ? 62   ASP C O   1 
ATOM   2324 C  CB  . ASP C 1 62  ? 39.386  -14.470 17.762  1.00 29.19  ? 62   ASP C CB  1 
ATOM   2325 C  CG  . ASP C 1 62  ? 38.863  -13.758 16.515  1.00 28.83  ? 62   ASP C CG  1 
ATOM   2326 O  OD1 . ASP C 1 62  ? 38.058  -12.821 16.638  1.00 27.73  ? 62   ASP C OD1 1 
ATOM   2327 O  OD2 . ASP C 1 62  ? 39.250  -14.161 15.392  1.00 31.83  ? 62   ASP C OD2 1 
ATOM   2328 N  N   . PHE C 1 63  ? 39.632  -11.138 18.926  1.00 23.71  ? 63   PHE C N   1 
ATOM   2329 C  CA  . PHE C 1 63  ? 40.353  -9.880  19.003  1.00 22.06  ? 63   PHE C CA  1 
ATOM   2330 C  C   . PHE C 1 63  ? 39.890  -9.088  20.232  1.00 22.18  ? 63   PHE C C   1 
ATOM   2331 O  O   . PHE C 1 63  ? 39.713  -7.871  20.161  1.00 20.27  ? 63   PHE C O   1 
ATOM   2332 C  CB  . PHE C 1 63  ? 40.134  -9.071  17.725  1.00 20.51  ? 63   PHE C CB  1 
ATOM   2333 C  CG  . PHE C 1 63  ? 40.937  -9.557  16.545  1.00 20.20  ? 63   PHE C CG  1 
ATOM   2334 C  CD1 . PHE C 1 63  ? 42.182  -9.018  16.269  1.00 20.29  ? 63   PHE C CD1 1 
ATOM   2335 C  CD2 . PHE C 1 63  ? 40.439  -10.540 15.704  1.00 21.55  ? 63   PHE C CD2 1 
ATOM   2336 C  CE1 . PHE C 1 63  ? 42.921  -9.453  15.160  1.00 18.79  ? 63   PHE C CE1 1 
ATOM   2337 C  CE2 . PHE C 1 63  ? 41.160  -10.987 14.606  1.00 21.11  ? 63   PHE C CE2 1 
ATOM   2338 C  CZ  . PHE C 1 63  ? 42.404  -10.439 14.329  1.00 21.54  ? 63   PHE C CZ  1 
ATOM   2339 N  N   . SER C 1 64  ? 39.711  -9.772  21.369  1.00 23.08  ? 64   SER C N   1 
ATOM   2340 C  CA  . SER C 1 64  ? 39.052  -9.126  22.521  1.00 23.80  ? 64   SER C CA  1 
ATOM   2341 C  C   . SER C 1 64  ? 39.807  -7.919  23.115  1.00 22.63  ? 64   SER C C   1 
ATOM   2342 O  O   . SER C 1 64  ? 39.190  -7.072  23.778  1.00 22.46  ? 64   SER C O   1 
ATOM   2343 C  CB  . SER C 1 64  ? 38.698  -10.122 23.627  1.00 25.96  ? 64   SER C CB  1 
ATOM   2344 O  OG  . SER C 1 64  ? 39.847  -10.641 24.263  1.00 28.41  ? 64   SER C OG  1 
ATOM   2345 N  N   . SER C 1 65  ? 41.108  -7.823  22.849  1.00 21.16  ? 65   SER C N   1 
ATOM   2346 C  CA  . SER C 1 65  ? 41.923  -6.714  23.353  1.00 20.57  ? 65   SER C CA  1 
ATOM   2347 C  C   . SER C 1 65  ? 41.971  -5.513  22.409  1.00 18.66  ? 65   SER C C   1 
ATOM   2348 O  O   . SER C 1 65  ? 42.421  -4.432  22.806  1.00 18.80  ? 65   SER C O   1 
ATOM   2349 C  CB  . SER C 1 65  ? 43.355  -7.197  23.661  1.00 20.22  ? 65   SER C CB  1 
ATOM   2350 O  OG  . SER C 1 65  ? 44.125  -7.370  22.489  1.00 17.95  ? 65   SER C OG  1 
ATOM   2351 N  N   . ALA C 1 66  ? 41.486  -5.682  21.182  1.00 18.19  ? 66   ALA C N   1 
ATOM   2352 C  CA  . ALA C 1 66  ? 41.576  -4.619  20.185  1.00 17.37  ? 66   ALA C CA  1 
ATOM   2353 C  C   . ALA C 1 66  ? 40.871  -3.321  20.627  1.00 17.60  ? 66   ALA C C   1 
ATOM   2354 O  O   . ALA C 1 66  ? 39.759  -3.332  21.157  1.00 17.29  ? 66   ALA C O   1 
ATOM   2355 C  CB  . ALA C 1 66  ? 41.043  -5.102  18.812  1.00 17.12  ? 66   ALA C CB  1 
ATOM   2356 N  N   . LYS C 1 67  ? 41.560  -2.202  20.432  1.00 17.36  ? 67   LYS C N   1 
ATOM   2357 C  CA  . LYS C 1 67  ? 41.016  -0.882  20.741  1.00 18.77  ? 67   LYS C CA  1 
ATOM   2358 C  C   . LYS C 1 67  ? 41.690  0.208   19.904  1.00 17.94  ? 67   LYS C C   1 
ATOM   2359 O  O   . LYS C 1 67  ? 42.731  -0.018  19.285  1.00 17.06  ? 67   LYS C O   1 
ATOM   2360 C  CB  . LYS C 1 67  ? 41.206  -0.568  22.224  1.00 20.52  ? 67   LYS C CB  1 
ATOM   2361 C  CG  . LYS C 1 67  ? 42.627  -0.768  22.707  1.00 21.76  ? 67   LYS C CG  1 
ATOM   2362 C  CD  . LYS C 1 67  ? 42.989  0.200   23.847  1.00 24.69  ? 67   LYS C CD  1 
ATOM   2363 C  CE  . LYS C 1 67  ? 44.058  -0.351  24.800  1.00 27.48  ? 67   LYS C CE  1 
ATOM   2364 N  NZ  . LYS C 1 67  ? 45.451  -0.335  24.262  1.00 28.62  ? 67   LYS C NZ  1 
ATOM   2365 N  N   . ILE C 1 68  ? 41.045  1.372   19.857  1.00 18.24  ? 68   ILE C N   1 
ATOM   2366 C  CA  . ILE C 1 68  ? 41.681  2.605   19.406  1.00 18.28  ? 68   ILE C CA  1 
ATOM   2367 C  C   . ILE C 1 68  ? 41.575  3.633   20.546  1.00 19.63  ? 68   ILE C C   1 
ATOM   2368 O  O   . ILE C 1 68  ? 40.784  3.461   21.488  1.00 19.22  ? 68   ILE C O   1 
ATOM   2369 C  CB  . ILE C 1 68  ? 41.026  3.166   18.123  1.00 17.79  ? 68   ILE C CB  1 
ATOM   2370 C  CG1 . ILE C 1 68  ? 39.598  3.666   18.410  1.00 18.00  ? 68   ILE C CG1 1 
ATOM   2371 C  CG2 . ILE C 1 68  ? 41.040  2.110   17.006  1.00 17.32  ? 68   ILE C CG2 1 
ATOM   2372 C  CD1 . ILE C 1 68  ? 38.972  4.566   17.294  1.00 19.15  ? 68   ILE C CD1 1 
ATOM   2373 N  N   . GLU C 1 69  ? 42.385  4.685   20.464  1.00 19.60  ? 69   GLU C N   1 
ATOM   2374 C  CA  . GLU C 1 69  ? 42.312  5.795   21.397  1.00 21.01  ? 69   GLU C CA  1 
ATOM   2375 C  C   . GLU C 1 69  ? 41.378  6.842   20.811  1.00 20.85  ? 69   GLU C C   1 
ATOM   2376 O  O   . GLU C 1 69  ? 41.761  7.615   19.914  1.00 20.94  ? 69   GLU C O   1 
ATOM   2377 C  CB  . GLU C 1 69  ? 43.693  6.413   21.629  1.00 22.96  ? 69   GLU C CB  1 
ATOM   2378 C  CG  . GLU C 1 69  ? 44.687  5.481   22.295  1.00 25.71  ? 69   GLU C CG  1 
ATOM   2379 C  CD  . GLU C 1 69  ? 44.279  5.062   23.699  1.00 31.47  ? 69   GLU C CD  1 
ATOM   2380 O  OE1 . GLU C 1 69  ? 43.451  5.776   24.327  1.00 34.13  ? 69   GLU C OE1 1 
ATOM   2381 O  OE2 . GLU C 1 69  ? 44.811  4.024   24.174  1.00 30.89  ? 69   GLU C OE2 1 
ATOM   2382 N  N   . VAL C 1 70  ? 40.153  6.869   21.303  1.00 20.25  ? 70   VAL C N   1 
ATOM   2383 C  CA  . VAL C 1 70  ? 39.137  7.776   20.757  1.00 20.41  ? 70   VAL C CA  1 
ATOM   2384 C  C   . VAL C 1 70  ? 39.577  9.253   20.839  1.00 21.42  ? 70   VAL C C   1 
ATOM   2385 O  O   . VAL C 1 70  ? 39.255  10.052  19.960  1.00 21.06  ? 70   VAL C O   1 
ATOM   2386 C  CB  . VAL C 1 70  ? 37.770  7.505   21.407  1.00 20.79  ? 70   VAL C CB  1 
ATOM   2387 C  CG1 . VAL C 1 70  ? 36.733  8.530   20.972  1.00 21.12  ? 70   VAL C CG1 1 
ATOM   2388 C  CG2 . VAL C 1 70  ? 37.333  6.051   21.042  1.00 19.13  ? 70   VAL C CG2 1 
ATOM   2389 N  N   . SER C 1 71  ? 40.385  9.579   21.846  1.00 23.18  ? 71   SER C N   1 
ATOM   2390 C  CA  . SER C 1 71  ? 40.897  10.934  22.031  1.00 25.25  ? 71   SER C CA  1 
ATOM   2391 C  C   . SER C 1 71  ? 41.866  11.412  20.945  1.00 25.08  ? 71   SER C C   1 
ATOM   2392 O  O   . SER C 1 71  ? 42.180  12.603  20.894  1.00 26.31  ? 71   SER C O   1 
ATOM   2393 C  CB  . SER C 1 71  ? 41.583  11.056  23.386  1.00 27.05  ? 71   SER C CB  1 
ATOM   2394 O  OG  . SER C 1 71  ? 42.812  10.359  23.406  1.00 26.62  ? 71   SER C OG  1 
ATOM   2395 N  N   . GLN C 1 72  ? 42.311  10.502  20.079  1.00 23.68  ? 72   GLN C N   1 
ATOM   2396 C  CA  . GLN C 1 72  ? 43.250  10.816  18.992  1.00 23.90  ? 72   GLN C CA  1 
ATOM   2397 C  C   . GLN C 1 72  ? 42.569  10.859  17.612  1.00 22.96  ? 72   GLN C C   1 
ATOM   2398 O  O   . GLN C 1 72  ? 43.164  11.248  16.603  1.00 23.07  ? 72   GLN C O   1 
ATOM   2399 C  CB  . GLN C 1 72  ? 44.380  9.789   19.024  1.00 24.09  ? 72   GLN C CB  1 
ATOM   2400 C  CG  . GLN C 1 72  ? 45.054  9.682   20.417  1.00 25.95  ? 72   GLN C CG  1 
ATOM   2401 C  CD  . GLN C 1 72  ? 45.662  10.995  20.868  1.00 29.75  ? 72   GLN C CD  1 
ATOM   2402 O  OE1 . GLN C 1 72  ? 46.457  11.593  20.139  1.00 31.15  ? 72   GLN C OE1 1 
ATOM   2403 N  NE2 . GLN C 1 72  ? 45.277  11.469  22.065  1.00 28.40  ? 72   GLN C NE2 1 
ATOM   2404 N  N   . LEU C 1 73  ? 41.286  10.533  17.595  1.00 22.71  ? 73   LEU C N   1 
ATOM   2405 C  CA  . LEU C 1 73  ? 40.560  10.294  16.378  1.00 21.82  ? 73   LEU C CA  1 
ATOM   2406 C  C   . LEU C 1 73  ? 40.347  11.570  15.549  1.00 22.90  ? 73   LEU C C   1 
ATOM   2407 O  O   . LEU C 1 73  ? 40.492  11.532  14.337  1.00 22.95  ? 73   LEU C O   1 
ATOM   2408 C  CB  . LEU C 1 73  ? 39.247  9.580   16.731  1.00 21.51  ? 73   LEU C CB  1 
ATOM   2409 C  CG  . LEU C 1 73  ? 38.411  8.907   15.663  1.00 21.79  ? 73   LEU C CG  1 
ATOM   2410 C  CD1 . LEU C 1 73  ? 39.265  7.994   14.733  1.00 21.17  ? 73   LEU C CD1 1 
ATOM   2411 C  CD2 . LEU C 1 73  ? 37.299  8.105   16.358  1.00 21.12  ? 73   LEU C CD2 1 
ATOM   2412 N  N   . LEU C 1 74  ? 40.072  12.704  16.187  1.00 23.86  ? 74   LEU C N   1 
ATOM   2413 C  CA  . LEU C 1 74  ? 39.823  13.952  15.428  1.00 25.66  ? 74   LEU C CA  1 
ATOM   2414 C  C   . LEU C 1 74  ? 41.090  14.525  14.759  1.00 26.92  ? 74   LEU C C   1 
ATOM   2415 O  O   . LEU C 1 74  ? 40.999  15.229  13.761  1.00 27.83  ? 74   LEU C O   1 
ATOM   2416 C  CB  . LEU C 1 74  ? 39.163  15.013  16.308  1.00 27.33  ? 74   LEU C CB  1 
ATOM   2417 C  CG  . LEU C 1 74  ? 37.756  14.684  16.836  1.00 26.60  ? 74   LEU C CG  1 
ATOM   2418 C  CD1 . LEU C 1 74  ? 37.112  15.922  17.412  1.00 26.92  ? 74   LEU C CD1 1 
ATOM   2419 C  CD2 . LEU C 1 74  ? 36.860  14.075  15.760  1.00 24.93  ? 74   LEU C CD2 1 
ATOM   2420 N  N   . LYS C 1 75  ? 42.271  14.201  15.277  1.00 27.46  ? 75   LYS C N   1 
ATOM   2421 C  CA  . LYS C 1 75  ? 43.511  14.554  14.564  1.00 28.72  ? 75   LYS C CA  1 
ATOM   2422 C  C   . LYS C 1 75  ? 43.865  13.532  13.465  1.00 27.32  ? 75   LYS C C   1 
ATOM   2423 O  O   . LYS C 1 75  ? 44.921  13.634  12.841  1.00 28.65  ? 75   LYS C O   1 
ATOM   2424 C  CB  . LYS C 1 75  ? 44.674  14.739  15.539  1.00 30.04  ? 75   LYS C CB  1 
ATOM   2425 C  CG  . LYS C 1 75  ? 44.989  13.551  16.379  1.00 29.29  ? 75   LYS C CG  1 
ATOM   2426 C  CD  . LYS C 1 75  ? 46.156  13.817  17.334  1.00 32.12  ? 75   LYS C CD  1 
ATOM   2427 C  CE  . LYS C 1 75  ? 45.709  14.534  18.608  1.00 35.00  ? 75   LYS C CE  1 
ATOM   2428 N  NZ  . LYS C 1 75  ? 46.698  14.312  19.714  1.00 37.05  ? 75   LYS C NZ  1 
ATOM   2429 N  N   . GLY C 1 76  ? 42.982  12.572  13.208  1.00 24.85  ? 76   GLY C N   1 
ATOM   2430 C  CA  . GLY C 1 76  ? 43.161  11.629  12.099  1.00 24.23  ? 76   GLY C CA  1 
ATOM   2431 C  C   . GLY C 1 76  ? 43.773  10.292  12.482  1.00 22.63  ? 76   GLY C C   1 
ATOM   2432 O  O   . GLY C 1 76  ? 43.921  9.401   11.647  1.00 23.30  ? 76   GLY C O   1 
ATOM   2433 N  N   . ASP C 1 77  ? 44.121  10.129  13.750  1.00 22.31  ? 77   ASP C N   1 
ATOM   2434 C  CA  . ASP C 1 77  ? 44.755  8.885   14.220  1.00 20.64  ? 77   ASP C CA  1 
ATOM   2435 C  C   . ASP C 1 77  ? 43.678  7.838   14.593  1.00 19.60  ? 77   ASP C C   1 
ATOM   2436 O  O   . ASP C 1 77  ? 42.981  7.980   15.593  1.00 19.61  ? 77   ASP C O   1 
ATOM   2437 C  CB  . ASP C 1 77  ? 45.675  9.200   15.392  1.00 21.19  ? 77   ASP C CB  1 
ATOM   2438 C  CG  . ASP C 1 77  ? 46.392  7.968   15.942  1.00 20.10  ? 77   ASP C CG  1 
ATOM   2439 O  OD1 . ASP C 1 77  ? 46.247  6.852   15.400  1.00 17.36  ? 77   ASP C OD1 1 
ATOM   2440 O  OD2 . ASP C 1 77  ? 47.099  8.135   16.935  1.00 18.99  ? 77   ASP C OD2 1 
ATOM   2441 N  N   . ALA C 1 78  ? 43.542  6.811   13.754  1.00 17.79  ? 78   ALA C N   1 
ATOM   2442 C  CA  . ALA C 1 78  ? 42.627  5.701   13.990  1.00 16.96  ? 78   ALA C CA  1 
ATOM   2443 C  C   . ALA C 1 78  ? 43.427  4.400   14.208  1.00 16.15  ? 78   ALA C C   1 
ATOM   2444 O  O   . ALA C 1 78  ? 42.933  3.305   13.897  1.00 14.50  ? 78   ALA C O   1 
ATOM   2445 C  CB  . ALA C 1 78  ? 41.674  5.547   12.794  1.00 16.88  ? 78   ALA C CB  1 
ATOM   2446 N  N   . SER C 1 79  ? 44.641  4.532   14.752  1.00 16.42  ? 79   SER C N   1 
ATOM   2447 C  CA  . SER C 1 79  ? 45.544  3.376   14.955  1.00 16.47  ? 79   SER C CA  1 
ATOM   2448 C  C   . SER C 1 79  ? 44.953  2.337   15.898  1.00 16.33  ? 79   SER C C   1 
ATOM   2449 O  O   . SER C 1 79  ? 44.391  2.658   16.955  1.00 15.45  ? 79   SER C O   1 
ATOM   2450 C  CB  . SER C 1 79  ? 46.911  3.833   15.463  1.00 17.56  ? 79   SER C CB  1 
ATOM   2451 O  OG  . SER C 1 79  ? 47.501  4.724   14.536  1.00 17.04  ? 79   SER C OG  1 
ATOM   2452 N  N   . LEU C 1 80  ? 45.110  1.071   15.502  1.00 16.44  ? 80   LEU C N   1 
ATOM   2453 C  CA  . LEU C 1 80  ? 44.588  -0.035  16.250  1.00 16.60  ? 80   LEU C CA  1 
ATOM   2454 C  C   . LEU C 1 80  ? 45.657  -0.562  17.208  1.00 17.09  ? 80   LEU C C   1 
ATOM   2455 O  O   . LEU C 1 80  ? 46.839  -0.713  16.823  1.00 17.64  ? 80   LEU C O   1 
ATOM   2456 C  CB  . LEU C 1 80  ? 44.130  -1.131  15.280  1.00 16.15  ? 80   LEU C CB  1 
ATOM   2457 C  CG  . LEU C 1 80  ? 43.463  -2.330  15.961  1.00 16.35  ? 80   LEU C CG  1 
ATOM   2458 C  CD1 . LEU C 1 80  ? 42.143  -1.927  16.566  1.00 16.86  ? 80   LEU C CD1 1 
ATOM   2459 C  CD2 . LEU C 1 80  ? 43.287  -3.458  14.967  1.00 18.10  ? 80   LEU C CD2 1 
ATOM   2460 N  N   . LYS C 1 81  ? 45.248  -0.854  18.439  1.00 17.50  ? 81   LYS C N   1 
ATOM   2461 C  CA  . LYS C 1 81  ? 46.132  -1.429  19.443  1.00 19.05  ? 81   LYS C CA  1 
ATOM   2462 C  C   . LYS C 1 81  ? 45.570  -2.745  19.954  1.00 18.93  ? 81   LYS C C   1 
ATOM   2463 O  O   . LYS C 1 81  ? 44.392  -2.850  20.233  1.00 18.42  ? 81   LYS C O   1 
ATOM   2464 C  CB  . LYS C 1 81  ? 46.327  -0.479  20.640  1.00 20.22  ? 81   LYS C CB  1 
ATOM   2465 C  CG  . LYS C 1 81  ? 46.817  0.898   20.269  1.00 21.93  ? 81   LYS C CG  1 
ATOM   2466 C  CD  . LYS C 1 81  ? 46.564  1.932   21.390  1.00 23.45  ? 81   LYS C CD  1 
ATOM   2467 C  CE  . LYS C 1 81  ? 47.839  2.327   22.103  1.00 26.84  ? 81   LYS C CE  1 
ATOM   2468 N  NZ  . LYS C 1 81  ? 47.679  3.630   22.797  1.00 28.55  ? 81   LYS C NZ  1 
ATOM   2469 N  N   . MET C 1 82  ? 46.420  -3.756  20.074  1.00 19.08  ? 82   MET C N   1 
ATOM   2470 C  CA  . MET C 1 82  ? 45.994  -5.001  20.687  1.00 20.23  ? 82   MET C CA  1 
ATOM   2471 C  C   . MET C 1 82  ? 47.137  -5.643  21.462  1.00 20.83  ? 82   MET C C   1 
ATOM   2472 O  O   . MET C 1 82  ? 48.307  -5.318  21.261  1.00 20.40  ? 82   MET C O   1 
ATOM   2473 C  CB  . MET C 1 82  ? 45.454  -5.948  19.609  1.00 19.73  ? 82   MET C CB  1 
ATOM   2474 C  CG  . MET C 1 82  ? 46.519  -6.474  18.655  1.00 21.59  ? 82   MET C CG  1 
ATOM   2475 S  SD  . MET C 1 82  ? 45.859  -7.524  17.353  1.00 22.70  ? 82   MET C SD  1 
ATOM   2476 C  CE  . MET C 1 82  ? 45.211  -6.361  16.215  1.00 20.26  ? 82   MET C CE  1 
ATOM   2477 N  N   . ASP C 1 83  ? 46.793  -6.551  22.363  1.00 22.17  ? 83   ASP C N   1 
ATOM   2478 C  CA  . ASP C 1 83  ? 47.801  -7.358  23.047  1.00 24.26  ? 83   ASP C CA  1 
ATOM   2479 C  C   . ASP C 1 83  ? 48.471  -8.279  22.022  1.00 24.20  ? 83   ASP C C   1 
ATOM   2480 O  O   . ASP C 1 83  ? 47.843  -8.708  21.043  1.00 23.43  ? 83   ASP C O   1 
ATOM   2481 C  CB  . ASP C 1 83  ? 47.164  -8.191  24.162  1.00 25.85  ? 83   ASP C CB  1 
ATOM   2482 C  CG  . ASP C 1 83  ? 46.577  -7.336  25.290  1.00 28.26  ? 83   ASP C CG  1 
ATOM   2483 O  OD1 . ASP C 1 83  ? 46.888  -6.119  25.407  1.00 29.24  ? 83   ASP C OD1 1 
ATOM   2484 O  OD2 . ASP C 1 83  ? 45.803  -7.907  26.079  1.00 30.23  ? 83   ASP C OD2 1 
ATOM   2485 N  N   . LYS C 1 84  ? 49.743  -8.595  22.223  1.00 25.72  ? 84   LYS C N   1 
ATOM   2486 C  CA  . LYS C 1 84  ? 50.426  -9.419  21.227  1.00 26.06  ? 84   LYS C CA  1 
ATOM   2487 C  C   . LYS C 1 84  ? 49.806  -10.795 21.070  1.00 26.12  ? 84   LYS C C   1 
ATOM   2488 O  O   . LYS C 1 84  ? 49.929  -11.389 20.007  1.00 26.17  ? 84   LYS C O   1 
ATOM   2489 C  CB  . LYS C 1 84  ? 51.937  -9.532  21.453  1.00 27.88  ? 84   LYS C CB  1 
ATOM   2490 C  CG  . LYS C 1 84  ? 52.410  -10.179 22.677  1.00 30.75  ? 84   LYS C CG  1 
ATOM   2491 C  CD  . LYS C 1 84  ? 53.844  -10.768 22.450  1.00 31.96  ? 84   LYS C CD  1 
ATOM   2492 C  CE  . LYS C 1 84  ? 54.316  -11.533 23.636  1.00 34.48  ? 84   LYS C CE  1 
ATOM   2493 N  NZ  . LYS C 1 84  ? 55.713  -12.022 23.500  1.00 36.33  ? 84   LYS C NZ  1 
ATOM   2494 N  N   . SER C 1 85  ? 49.129  -11.299 22.097  1.00 26.31  ? 85   SER C N   1 
ATOM   2495 C  CA  . SER C 1 85  ? 48.506  -12.617 22.000  1.00 27.75  ? 85   SER C CA  1 
ATOM   2496 C  C   . SER C 1 85  ? 47.380  -12.647 20.958  1.00 26.64  ? 85   SER C C   1 
ATOM   2497 O  O   . SER C 1 85  ? 47.098  -13.700 20.370  1.00 27.95  ? 85   SER C O   1 
ATOM   2498 C  CB  . SER C 1 85  ? 48.005  -13.087 23.372  1.00 29.47  ? 85   SER C CB  1 
ATOM   2499 O  OG  . SER C 1 85  ? 47.062  -12.188 23.921  1.00 28.88  ? 85   SER C OG  1 
ATOM   2500 N  N   . ASP C 1 86  ? 46.736  -11.501 20.739  1.00 24.47  ? 86   ASP C N   1 
ATOM   2501 C  CA  . ASP C 1 86  ? 45.743  -11.366 19.674  1.00 23.74  ? 86   ASP C CA  1 
ATOM   2502 C  C   . ASP C 1 86  ? 46.376  -11.070 18.311  1.00 23.16  ? 86   ASP C C   1 
ATOM   2503 O  O   . ASP C 1 86  ? 45.727  -11.240 17.276  1.00 22.89  ? 86   ASP C O   1 
ATOM   2504 C  CB  . ASP C 1 86  ? 44.726  -10.275 20.015  1.00 22.35  ? 86   ASP C CB  1 
ATOM   2505 C  CG  . ASP C 1 86  ? 43.780  -10.676 21.123  1.00 23.85  ? 86   ASP C CG  1 
ATOM   2506 O  OD1 . ASP C 1 86  ? 43.665  -11.878 21.437  1.00 26.49  ? 86   ASP C OD1 1 
ATOM   2507 O  OD2 . ASP C 1 86  ? 43.141  -9.777  21.682  1.00 25.57  ? 86   ASP C OD2 1 
ATOM   2508 N  N   . ALA C 1 87  ? 47.632  -10.625 18.313  1.00 22.61  ? 87   ALA C N   1 
ATOM   2509 C  CA  . ALA C 1 87  ? 48.351  -10.335 17.070  1.00 22.41  ? 87   ALA C CA  1 
ATOM   2510 C  C   . ALA C 1 87  ? 49.057  -11.593 16.513  1.00 23.44  ? 87   ALA C C   1 
ATOM   2511 O  O   . ALA C 1 87  ? 49.080  -11.814 15.302  1.00 23.17  ? 87   ALA C O   1 
ATOM   2512 C  CB  . ALA C 1 87  ? 49.360  -9.188  17.292  1.00 20.88  ? 87   ALA C CB  1 
ATOM   2513 N  N   . VAL C 1 88  ? 49.603  -12.424 17.402  1.00 25.15  ? 88   VAL C N   1 
ATOM   2514 C  CA  . VAL C 1 88  ? 50.465  -13.543 17.012  1.00 27.25  ? 88   VAL C CA  1 
ATOM   2515 C  C   . VAL C 1 88  ? 49.908  -14.470 15.905  1.00 28.46  ? 88   VAL C C   1 
ATOM   2516 O  O   . VAL C 1 88  ? 50.640  -14.854 14.976  1.00 29.86  ? 88   VAL C O   1 
ATOM   2517 C  CB  . VAL C 1 88  ? 50.881  -14.368 18.272  1.00 29.29  ? 88   VAL C CB  1 
ATOM   2518 C  CG1 . VAL C 1 88  ? 51.278  -15.742 17.910  1.00 31.67  ? 88   VAL C CG1 1 
ATOM   2519 C  CG2 . VAL C 1 88  ? 52.031  -13.656 19.006  1.00 29.87  ? 88   VAL C CG2 1 
ATOM   2520 N  N   . SER C 1 89  ? 48.639  -14.848 16.005  1.00 27.77  ? 89   SER C N   1 
ATOM   2521 C  CA  . SER C 1 89  ? 48.056  -15.781 15.039  1.00 29.56  ? 89   SER C CA  1 
ATOM   2522 C  C   . SER C 1 89  ? 47.194  -15.047 13.989  1.00 28.20  ? 89   SER C C   1 
ATOM   2523 O  O   . SER C 1 89  ? 46.399  -15.671 13.267  1.00 29.48  ? 89   SER C O   1 
ATOM   2524 C  CB  . SER C 1 89  ? 47.208  -16.800 15.780  1.00 30.63  ? 89   SER C CB  1 
ATOM   2525 O  OG  . SER C 1 89  ? 46.038  -16.166 16.253  1.00 33.72  ? 89   SER C OG  1 
ATOM   2526 N  N   . HIS C 1 90  ? 47.363  -13.731 13.925  1.00 25.80  ? 90   HIS C N   1 
ATOM   2527 C  CA  . HIS C 1 90  ? 46.617  -12.875 13.016  1.00 24.66  ? 90   HIS C CA  1 
ATOM   2528 C  C   . HIS C 1 90  ? 47.601  -11.934 12.333  1.00 23.80  ? 90   HIS C C   1 
ATOM   2529 O  O   . HIS C 1 90  ? 47.547  -10.710 12.510  1.00 22.02  ? 90   HIS C O   1 
ATOM   2530 C  CB  . HIS C 1 90  ? 45.570  -12.059 13.767  1.00 23.44  ? 90   HIS C CB  1 
ATOM   2531 C  CG  . HIS C 1 90  ? 44.526  -12.881 14.458  1.00 23.76  ? 90   HIS C CG  1 
ATOM   2532 N  ND1 . HIS C 1 90  ? 44.197  -12.700 15.783  1.00 23.92  ? 90   HIS C ND1 1 
ATOM   2533 C  CD2 . HIS C 1 90  ? 43.707  -13.854 13.998  1.00 26.46  ? 90   HIS C CD2 1 
ATOM   2534 C  CE1 . HIS C 1 90  ? 43.241  -13.546 16.119  1.00 25.56  ? 90   HIS C CE1 1 
ATOM   2535 N  NE2 . HIS C 1 90  ? 42.928  -14.262 15.054  1.00 26.98  ? 90   HIS C NE2 1 
ATOM   2536 N  N   . THR C 1 91  ? 48.499  -12.517 11.549  1.00 24.47  ? 91   THR C N   1 
ATOM   2537 C  CA  . THR C 1 91  ? 49.425  -11.730 10.734  1.00 24.92  ? 91   THR C CA  1 
ATOM   2538 C  C   . THR C 1 91  ? 48.886  -11.683 9.314   1.00 25.63  ? 91   THR C C   1 
ATOM   2539 O  O   . THR C 1 91  ? 48.157  -12.582 8.880   1.00 27.09  ? 91   THR C O   1 
ATOM   2540 C  CB  . THR C 1 91  ? 50.864  -12.308 10.741  1.00 25.98  ? 91   THR C CB  1 
ATOM   2541 O  OG1 . THR C 1 91  ? 50.826  -13.691 10.390  1.00 26.54  ? 91   THR C OG1 1 
ATOM   2542 C  CG2 . THR C 1 91  ? 51.504  -12.135 12.114  1.00 26.05  ? 91   THR C CG2 1 
ATOM   2543 N  N   . GLY C 1 92  ? 49.244  -10.628 8.599   1.00 25.25  ? 92   GLY C N   1 
ATOM   2544 C  CA  . GLY C 1 92  ? 48.739  -10.401 7.259   1.00 26.48  ? 92   GLY C CA  1 
ATOM   2545 C  C   . GLY C 1 92  ? 48.177  -8.994  7.152   1.00 24.96  ? 92   GLY C C   1 
ATOM   2546 O  O   . GLY C 1 92  ? 48.497  -8.113  7.955   1.00 21.89  ? 92   GLY C O   1 
ATOM   2547 N  N   . ASN C 1 93  ? 47.344  -8.791  6.141   1.00 26.17  ? 93   ASN C N   1 
ATOM   2548 C  CA  . ASN C 1 93  ? 46.844  -7.467  5.820   1.00 25.41  ? 93   ASN C CA  1 
ATOM   2549 C  C   . ASN C 1 93  ? 45.604  -7.040  6.637   1.00 23.74  ? 93   ASN C C   1 
ATOM   2550 O  O   . ASN C 1 93  ? 44.563  -7.718  6.675   1.00 24.03  ? 93   ASN C O   1 
ATOM   2551 C  CB  . ASN C 1 93  ? 46.570  -7.365  4.323   1.00 27.96  ? 93   ASN C CB  1 
ATOM   2552 C  CG  . ASN C 1 93  ? 47.808  -6.954  3.500   1.00 30.95  ? 93   ASN C CG  1 
ATOM   2553 O  OD1 . ASN C 1 93  ? 48.682  -6.204  3.960   1.00 30.29  ? 93   ASN C OD1 1 
ATOM   2554 N  ND2 . ASN C 1 93  ? 47.800  -7.359  2.223   1.00 36.55  ? 93   ASN C ND2 1 
ATOM   2555 N  N   . TYR C 1 94  ? 45.750  -5.898  7.288   1.00 21.68  ? 94   TYR C N   1 
ATOM   2556 C  CA  . TYR C 1 94  ? 44.642  -5.230  7.979   1.00 21.03  ? 94   TYR C CA  1 
ATOM   2557 C  C   . TYR C 1 94  ? 44.167  -4.049  7.152   1.00 21.22  ? 94   TYR C C   1 
ATOM   2558 O  O   . TYR C 1 94  ? 44.953  -3.391  6.481   1.00 21.82  ? 94   TYR C O   1 
ATOM   2559 C  CB  . TYR C 1 94  ? 45.087  -4.732  9.355   1.00 19.20  ? 94   TYR C CB  1 
ATOM   2560 C  CG  . TYR C 1 94  ? 45.254  -5.827  10.368  1.00 20.12  ? 94   TYR C CG  1 
ATOM   2561 C  CD1 . TYR C 1 94  ? 44.293  -6.039  11.352  1.00 19.10  ? 94   TYR C CD1 1 
ATOM   2562 C  CD2 . TYR C 1 94  ? 46.368  -6.652  10.352  1.00 20.93  ? 94   TYR C CD2 1 
ATOM   2563 C  CE1 . TYR C 1 94  ? 44.431  -7.034  12.285  1.00 17.50  ? 94   TYR C CE1 1 
ATOM   2564 C  CE2 . TYR C 1 94  ? 46.519  -7.653  11.293  1.00 20.59  ? 94   TYR C CE2 1 
ATOM   2565 C  CZ  . TYR C 1 94  ? 45.555  -7.846  12.243  1.00 19.84  ? 94   TYR C CZ  1 
ATOM   2566 O  OH  . TYR C 1 94  ? 45.707  -8.856  13.165  1.00 20.63  ? 94   TYR C OH  1 
ATOM   2567 N  N   . THR C 1 95  ? 42.873  -3.789  7.225   1.00 20.99  ? 95   THR C N   1 
ATOM   2568 C  CA  . THR C 1 95  ? 42.263  -2.633  6.540   1.00 21.61  ? 95   THR C CA  1 
ATOM   2569 C  C   . THR C 1 95  ? 41.731  -1.728  7.621   1.00 19.73  ? 95   THR C C   1 
ATOM   2570 O  O   . THR C 1 95  ? 41.045  -2.186  8.531   1.00 18.55  ? 95   THR C O   1 
ATOM   2571 C  CB  . THR C 1 95  ? 41.112  -3.060  5.615   1.00 22.43  ? 95   THR C CB  1 
ATOM   2572 O  OG1 . THR C 1 95  ? 41.584  -4.095  4.762   1.00 24.45  ? 95   THR C OG1 1 
ATOM   2573 C  CG2 . THR C 1 95  ? 40.554  -1.857  4.780   1.00 23.29  ? 95   THR C CG2 1 
ATOM   2574 N  N   . CYS C 1 96  ? 42.102  -0.461  7.541   1.00 20.35  ? 96   CYS C N   1 
ATOM   2575 C  CA  . CYS C 1 96  ? 41.536  0.572   8.380   1.00 19.56  ? 96   CYS C CA  1 
ATOM   2576 C  C   . CYS C 1 96  ? 40.594  1.411   7.529   1.00 20.95  ? 96   CYS C C   1 
ATOM   2577 O  O   . CYS C 1 96  ? 40.981  1.947   6.469   1.00 21.87  ? 96   CYS C O   1 
ATOM   2578 C  CB  . CYS C 1 96  ? 42.657  1.428   8.948   1.00 19.76  ? 96   CYS C CB  1 
ATOM   2579 S  SG  . CYS C 1 96  ? 42.129  2.909   9.798   1.00 19.27  ? 96   CYS C SG  1 
ATOM   2580 N  N   . GLU C 1 97  ? 39.345  1.489   7.983   1.00 20.85  ? 97   GLU C N   1 
ATOM   2581 C  CA  . GLU C 1 97  ? 38.296  2.204   7.271   1.00 21.47  ? 97   GLU C CA  1 
ATOM   2582 C  C   . GLU C 1 97  ? 37.716  3.294   8.159   1.00 20.32  ? 97   GLU C C   1 
ATOM   2583 O  O   . GLU C 1 97  ? 37.188  3.016   9.231   1.00 19.31  ? 97   GLU C O   1 
ATOM   2584 C  CB  . GLU C 1 97  ? 37.188  1.239   6.846   1.00 22.25  ? 97   GLU C CB  1 
ATOM   2585 C  CG  . GLU C 1 97  ? 36.159  1.858   5.918   1.00 25.24  ? 97   GLU C CG  1 
ATOM   2586 C  CD  . GLU C 1 97  ? 34.825  1.144   5.983   1.00 26.77  ? 97   GLU C CD  1 
ATOM   2587 O  OE1 . GLU C 1 97  ? 34.573  0.306   5.088   1.00 31.88  ? 97   GLU C OE1 1 
ATOM   2588 O  OE2 . GLU C 1 97  ? 34.057  1.398   6.940   1.00 30.03  ? 97   GLU C OE2 1 
ATOM   2589 N  N   . VAL C 1 98  ? 37.791  4.536   7.688   1.00 21.00  ? 98   VAL C N   1 
ATOM   2590 C  CA  . VAL C 1 98  ? 37.222  5.674   8.413   1.00 19.96  ? 98   VAL C CA  1 
ATOM   2591 C  C   . VAL C 1 98  ? 36.092  6.311   7.609   1.00 20.96  ? 98   VAL C C   1 
ATOM   2592 O  O   . VAL C 1 98  ? 36.165  6.441   6.385   1.00 20.33  ? 98   VAL C O   1 
ATOM   2593 C  CB  . VAL C 1 98  ? 38.337  6.678   8.801   1.00 20.39  ? 98   VAL C CB  1 
ATOM   2594 C  CG1 . VAL C 1 98  ? 37.798  7.825   9.684   1.00 18.87  ? 98   VAL C CG1 1 
ATOM   2595 C  CG2 . VAL C 1 98  ? 39.466  5.920   9.525   1.00 19.05  ? 98   VAL C CG2 1 
ATOM   2596 N  N   . THR C 1 99  ? 35.023  6.683   8.318   1.00 20.23  ? 99   THR C N   1 
ATOM   2597 C  CA  . THR C 1 99  ? 33.869  7.334   7.717   1.00 21.84  ? 99   THR C CA  1 
ATOM   2598 C  C   . THR C 1 99  ? 33.558  8.562   8.547   1.00 21.52  ? 99   THR C C   1 
ATOM   2599 O  O   . THR C 1 99  ? 33.589  8.495   9.784   1.00 19.81  ? 99   THR C O   1 
ATOM   2600 C  CB  . THR C 1 99  ? 32.622  6.420   7.732   1.00 22.29  ? 99   THR C CB  1 
ATOM   2601 O  OG1 . THR C 1 99  ? 32.927  5.193   7.065   1.00 22.99  ? 99   THR C OG1 1 
ATOM   2602 C  CG2 . THR C 1 99  ? 31.415  7.096   7.064   1.00 23.45  ? 99   THR C CG2 1 
ATOM   2603 N  N   . GLU C 1 100 ? 33.327  9.671   7.862   1.00 22.95  ? 100  GLU C N   1 
ATOM   2604 C  CA  . GLU C 1 100 ? 32.740  10.867  8.467   1.00 23.89  ? 100  GLU C CA  1 
ATOM   2605 C  C   . GLU C 1 100 ? 31.299  10.977  7.995   1.00 24.87  ? 100  GLU C C   1 
ATOM   2606 O  O   . GLU C 1 100 ? 31.040  11.030  6.797   1.00 25.80  ? 100  GLU C O   1 
ATOM   2607 C  CB  . GLU C 1 100 ? 33.522  12.116  8.060   1.00 25.06  ? 100  GLU C CB  1 
ATOM   2608 C  CG  . GLU C 1 100 ? 34.929  12.173  8.641   1.00 23.47  ? 100  GLU C CG  1 
ATOM   2609 C  CD  . GLU C 1 100 ? 35.659  13.454  8.254   1.00 25.64  ? 100  GLU C CD  1 
ATOM   2610 O  OE1 . GLU C 1 100 ? 36.553  13.889  9.015   1.00 26.17  ? 100  GLU C OE1 1 
ATOM   2611 O  OE2 . GLU C 1 100 ? 35.340  14.021  7.190   1.00 26.85  ? 100  GLU C OE2 1 
ATOM   2612 N  N   . LEU C 1 101 ? 30.374  11.019  8.948   1.00 22.66  ? 101  LEU C N   1 
ATOM   2613 C  CA  . LEU C 1 101 ? 28.940  10.952  8.675   1.00 24.79  ? 101  LEU C CA  1 
ATOM   2614 C  C   . LEU C 1 101 ? 28.391  12.256  8.173   1.00 23.70  ? 101  LEU C C   1 
ATOM   2615 O  O   . LEU C 1 101 ? 28.981  13.318  8.372   1.00 20.68  ? 101  LEU C O   1 
ATOM   2616 C  CB  . LEU C 1 101 ? 28.138  10.599  9.934   1.00 26.18  ? 101  LEU C CB  1 
ATOM   2617 C  CG  . LEU C 1 101 ? 28.562  9.408   10.771  1.00 29.37  ? 101  LEU C CG  1 
ATOM   2618 C  CD1 . LEU C 1 101 ? 27.476  9.162   11.800  1.00 33.80  ? 101  LEU C CD1 1 
ATOM   2619 C  CD2 . LEU C 1 101 ? 28.833  8.166   9.909   1.00 33.07  ? 101  LEU C CD2 1 
ATOM   2620 N  N   . THR C 1 102 ? 27.231  12.132  7.538   1.00 27.12  ? 102  THR C N   1 
ATOM   2621 C  CA  . THR C 1 102 ? 26.460  13.249  7.032   1.00 27.02  ? 102  THR C CA  1 
ATOM   2622 C  C   . THR C 1 102 ? 26.190  14.274  8.117   1.00 24.44  ? 102  THR C C   1 
ATOM   2623 O  O   . THR C 1 102 ? 25.951  13.916  9.274   1.00 24.22  ? 102  THR C O   1 
ATOM   2624 C  CB  . THR C 1 102 ? 25.085  12.781  6.488   1.00 31.85  ? 102  THR C CB  1 
ATOM   2625 O  OG1 . THR C 1 102 ? 25.254  11.637  5.646   1.00 38.63  ? 102  THR C OG1 1 
ATOM   2626 C  CG2 . THR C 1 102 ? 24.429  13.884  5.690   1.00 32.10  ? 102  THR C CG2 1 
ATOM   2627 N  N   . ARG C 1 103 ? 26.226  15.546  7.721   1.00 23.19  ? 103  ARG C N   1 
ATOM   2628 C  CA  . ARG C 1 103 ? 25.719  16.652  8.526   1.00 22.57  ? 103  ARG C CA  1 
ATOM   2629 C  C   . ARG C 1 103 ? 24.732  17.459  7.699   1.00 23.14  ? 103  ARG C C   1 
ATOM   2630 O  O   . ARG C 1 103 ? 24.926  17.642  6.525   1.00 23.59  ? 103  ARG C O   1 
ATOM   2631 C  CB  . ARG C 1 103 ? 26.859  17.583  8.925   1.00 21.31  ? 103  ARG C CB  1 
ATOM   2632 C  CG  . ARG C 1 103 ? 27.834  17.000  9.917   1.00 22.74  ? 103  ARG C CG  1 
ATOM   2633 C  CD  . ARG C 1 103 ? 28.400  18.110  10.786  1.00 23.88  ? 103  ARG C CD  1 
ATOM   2634 N  NE  . ARG C 1 103 ? 29.080  19.015  9.924   1.00 24.94  ? 103  ARG C NE  1 
ATOM   2635 C  CZ  . ARG C 1 103 ? 29.475  20.241  10.217  1.00 25.14  ? 103  ARG C CZ  1 
ATOM   2636 N  NH1 . ARG C 1 103 ? 29.294  20.772  11.417  1.00 29.04  ? 103  ARG C NH1 1 
ATOM   2637 N  NH2 . ARG C 1 103 ? 30.048  20.935  9.253   1.00 24.19  ? 103  ARG C NH2 1 
ATOM   2638 N  N   . GLU C 1 104 ? 23.692  17.989  8.320   1.00 24.87  ? 104  GLU C N   1 
ATOM   2639 C  CA  . GLU C 1 104 ? 22.745  18.799  7.568   1.00 25.94  ? 104  GLU C CA  1 
ATOM   2640 C  C   . GLU C 1 104 ? 22.010  19.786  8.448   1.00 26.29  ? 104  GLU C C   1 
ATOM   2641 O  O   . GLU C 1 104 ? 22.108  19.747  9.668   1.00 26.74  ? 104  GLU C O   1 
ATOM   2642 C  CB  . GLU C 1 104 ? 21.774  17.925  6.752   1.00 29.18  ? 104  GLU C CB  1 
ATOM   2643 C  CG  . GLU C 1 104 ? 20.858  16.997  7.520   1.00 35.81  ? 104  GLU C CG  1 
ATOM   2644 C  CD  . GLU C 1 104 ? 19.915  16.235  6.587   1.00 42.18  ? 104  GLU C CD  1 
ATOM   2645 O  OE1 . GLU C 1 104 ? 19.696  16.688  5.433   1.00 48.14  ? 104  GLU C OE1 1 
ATOM   2646 O  OE2 . GLU C 1 104 ? 19.378  15.183  6.997   1.00 51.81  ? 104  GLU C OE2 1 
ATOM   2647 N  N   . GLY C 1 105 ? 21.292  20.685  7.792   1.00 26.28  ? 105  GLY C N   1 
ATOM   2648 C  CA  . GLY C 1 105 ? 20.541  21.716  8.476   1.00 28.44  ? 105  GLY C CA  1 
ATOM   2649 C  C   . GLY C 1 105 ? 19.759  22.508  7.464   1.00 28.12  ? 105  GLY C C   1 
ATOM   2650 O  O   . GLY C 1 105 ? 19.975  22.382  6.264   1.00 26.90  ? 105  GLY C O   1 
ATOM   2651 N  N   . GLU C 1 106 ? 18.846  23.342  7.933   1.00 30.86  ? 106  GLU C N   1 
ATOM   2652 C  CA  . GLU C 1 106 ? 18.061  24.164  7.016   1.00 31.10  ? 106  GLU C CA  1 
ATOM   2653 C  C   . GLU C 1 106 ? 17.669  25.450  7.714   1.00 32.75  ? 106  GLU C C   1 
ATOM   2654 O  O   . GLU C 1 106 ? 17.700  25.522  8.935   1.00 35.03  ? 106  GLU C O   1 
ATOM   2655 C  CB  . GLU C 1 106 ? 16.828  23.400  6.510   1.00 34.66  ? 106  GLU C CB  1 
ATOM   2656 C  CG  . GLU C 1 106 ? 15.731  23.178  7.549   1.00 41.68  ? 106  GLU C CG  1 
ATOM   2657 C  CD  . GLU C 1 106 ? 14.676  22.174  7.101   1.00 47.38  ? 106  GLU C CD  1 
ATOM   2658 O  OE1 . GLU C 1 106 ? 15.042  21.080  6.614   1.00 50.76  ? 106  GLU C OE1 1 
ATOM   2659 O  OE2 . GLU C 1 106 ? 13.475  22.466  7.264   1.00 56.46  ? 106  GLU C OE2 1 
ATOM   2660 N  N   . THR C 1 107 ? 17.317  26.463  6.930   1.00 32.29  ? 107  THR C N   1 
ATOM   2661 C  CA  . THR C 1 107 ? 16.966  27.771  7.481   1.00 35.21  ? 107  THR C CA  1 
ATOM   2662 C  C   . THR C 1 107 ? 15.906  28.403  6.580   1.00 35.28  ? 107  THR C C   1 
ATOM   2663 O  O   . THR C 1 107 ? 15.814  28.058  5.403   1.00 32.65  ? 107  THR C O   1 
ATOM   2664 C  CB  . THR C 1 107 ? 18.224  28.668  7.599   1.00 34.33  ? 107  THR C CB  1 
ATOM   2665 O  OG1 . THR C 1 107 ? 17.912  29.845  8.362   1.00 39.41  ? 107  THR C OG1 1 
ATOM   2666 C  CG2 . THR C 1 107 ? 18.732  29.069  6.217   1.00 31.60  ? 107  THR C CG2 1 
ATOM   2667 N  N   . ILE C 1 108 ? 15.086  29.287  7.142   1.00 39.58  ? 108  ILE C N   1 
ATOM   2668 C  CA  . ILE C 1 108 ? 13.991  29.894  6.398   1.00 40.75  ? 108  ILE C CA  1 
ATOM   2669 C  C   . ILE C 1 108 ? 14.204  31.396  6.193   1.00 40.89  ? 108  ILE C C   1 
ATOM   2670 O  O   . ILE C 1 108 ? 14.636  32.113  7.096   1.00 43.92  ? 108  ILE C O   1 
ATOM   2671 C  CB  . ILE C 1 108 ? 12.626  29.710  7.109   1.00 46.95  ? 108  ILE C CB  1 
ATOM   2672 C  CG1 . ILE C 1 108 ? 12.307  28.241  7.344   1.00 49.35  ? 108  ILE C CG1 1 
ATOM   2673 C  CG2 . ILE C 1 108 ? 11.496  30.325  6.267   1.00 47.71  ? 108  ILE C CG2 1 
ATOM   2674 C  CD1 . ILE C 1 108 ? 11.110  28.037  8.233   1.00 58.54  ? 108  ILE C CD1 1 
ATOM   2675 N  N   . ILE C 1 109 ? 13.873  31.873  5.003   1.00 39.22  ? 109  ILE C N   1 
ATOM   2676 C  CA  . ILE C 1 109 ? 13.831  33.307  4.774   1.00 40.37  ? 109  ILE C CA  1 
ATOM   2677 C  C   . ILE C 1 109 ? 12.675  33.672  3.845   1.00 40.54  ? 109  ILE C C   1 
ATOM   2678 O  O   . ILE C 1 109 ? 12.443  33.033  2.813   1.00 38.71  ? 109  ILE C O   1 
ATOM   2679 C  CB  . ILE C 1 109 ? 15.229  33.861  4.330   1.00 39.31  ? 109  ILE C CB  1 
ATOM   2680 C  CG1 . ILE C 1 109 ? 15.091  35.173  3.556   1.00 40.65  ? 109  ILE C CG1 1 
ATOM   2681 C  CG2 . ILE C 1 109 ? 16.047  32.788  3.570   1.00 35.50  ? 109  ILE C CG2 1 
ATOM   2682 C  CD1 . ILE C 1 109 ? 16.333  36.033  3.615   1.00 43.08  ? 109  ILE C CD1 1 
ATOM   2683 N  N   . GLU C 1 110 ? 11.929  34.694  4.260   1.00 43.53  ? 110  GLU C N   1 
ATOM   2684 C  CA  . GLU C 1 110 ? 10.836  35.217  3.470   1.00 44.56  ? 110  GLU C CA  1 
ATOM   2685 C  C   . GLU C 1 110 ? 11.370  36.210  2.452   1.00 42.24  ? 110  GLU C C   1 
ATOM   2686 O  O   . GLU C 1 110 ? 12.091  37.147  2.794   1.00 43.39  ? 110  GLU C O   1 
ATOM   2687 C  CB  . GLU C 1 110 ? 9.800   35.897  4.358   1.00 49.66  ? 110  GLU C CB  1 
ATOM   2688 C  CG  . GLU C 1 110 ? 8.629   36.457  3.568   1.00 51.18  ? 110  GLU C CG  1 
ATOM   2689 C  CD  . GLU C 1 110 ? 7.437   36.797  4.423   1.00 57.39  ? 110  GLU C CD  1 
ATOM   2690 O  OE1 . GLU C 1 110 ? 7.473   36.546  5.644   1.00 62.11  ? 110  GLU C OE1 1 
ATOM   2691 O  OE2 . GLU C 1 110 ? 6.459   37.316  3.861   1.00 57.73  ? 110  GLU C OE2 1 
ATOM   2692 N  N   . LEU C 1 111 ? 11.031  35.979  1.195   1.00 40.94  ? 111  LEU C N   1 
ATOM   2693 C  CA  . LEU C 1 111 ? 11.259  36.967  0.155   1.00 40.78  ? 111  LEU C CA  1 
ATOM   2694 C  C   . LEU C 1 111 ? 10.031  37.884  0.077   1.00 42.85  ? 111  LEU C C   1 
ATOM   2695 O  O   . LEU C 1 111 ? 8.915   37.409  -0.163  1.00 44.17  ? 111  LEU C O   1 
ATOM   2696 C  CB  . LEU C 1 111 ? 11.513  36.284  -1.187  1.00 40.14  ? 111  LEU C CB  1 
ATOM   2697 C  CG  . LEU C 1 111 ? 11.744  37.255  -2.354  1.00 41.54  ? 111  LEU C CG  1 
ATOM   2698 C  CD1 . LEU C 1 111 ? 13.075  37.988  -2.160  1.00 40.60  ? 111  LEU C CD1 1 
ATOM   2699 C  CD2 . LEU C 1 111 ? 11.699  36.523  -3.676  1.00 43.41  ? 111  LEU C CD2 1 
ATOM   2700 N  N   . LYS C 1 112 ? 10.251  39.185  0.285   1.00 44.11  ? 112  LYS C N   1 
ATOM   2701 C  CA  . LYS C 1 112 ? 9.180   40.185  0.340   1.00 46.46  ? 112  LYS C CA  1 
ATOM   2702 C  C   . LYS C 1 112 ? 9.356   41.225  -0.769  1.00 46.33  ? 112  LYS C C   1 
ATOM   2703 O  O   . LYS C 1 112 ? 10.474  41.658  -1.034  1.00 46.15  ? 112  LYS C O   1 
ATOM   2704 C  CB  . LYS C 1 112 ? 9.185   40.899  1.703   1.00 50.31  ? 112  LYS C CB  1 
ATOM   2705 C  CG  . LYS C 1 112 ? 9.043   39.991  2.912   1.00 51.93  ? 112  LYS C CG  1 
ATOM   2706 C  CD  . LYS C 1 112 ? 8.878   40.791  4.199   1.00 58.69  ? 112  LYS C CD  1 
ATOM   2707 C  CE  . LYS C 1 112 ? 8.757   39.868  5.436   1.00 62.79  ? 112  LYS C CE  1 
ATOM   2708 N  NZ  . LYS C 1 112 ? 8.594   40.623  6.730   1.00 70.99  ? 112  LYS C NZ  1 
ATOM   2709 N  N   . TYR C 1 113 ? 8.246   41.620  -1.398  1.00 47.20  ? 113  TYR C N   1 
ATOM   2710 C  CA  . TYR C 1 113 ? 8.235   42.653  -2.443  1.00 48.37  ? 113  TYR C CA  1 
ATOM   2711 C  C   . TYR C 1 113 ? 7.765   43.994  -1.888  1.00 50.83  ? 113  TYR C C   1 
ATOM   2712 O  O   . TYR C 1 113 ? 6.682   44.071  -1.325  1.00 51.98  ? 113  TYR C O   1 
ATOM   2713 C  CB  . TYR C 1 113 ? 7.294   42.262  -3.588  1.00 48.66  ? 113  TYR C CB  1 
ATOM   2714 C  CG  . TYR C 1 113 ? 7.343   43.232  -4.754  1.00 50.89  ? 113  TYR C CG  1 
ATOM   2715 C  CD1 . TYR C 1 113 ? 8.315   43.099  -5.739  1.00 52.37  ? 113  TYR C CD1 1 
ATOM   2716 C  CD2 . TYR C 1 113 ? 6.437   44.287  -4.861  1.00 52.74  ? 113  TYR C CD2 1 
ATOM   2717 C  CE1 . TYR C 1 113 ? 8.383   43.974  -6.804  1.00 55.61  ? 113  TYR C CE1 1 
ATOM   2718 C  CE2 . TYR C 1 113 ? 6.497   45.190  -5.939  1.00 54.72  ? 113  TYR C CE2 1 
ATOM   2719 C  CZ  . TYR C 1 113 ? 7.475   45.017  -6.904  1.00 56.18  ? 113  TYR C CZ  1 
ATOM   2720 O  OH  . TYR C 1 113 ? 7.572   45.873  -7.971  1.00 60.77  ? 113  TYR C OH  1 
ATOM   2721 N  N   . ARG C 1 114 ? 8.565   45.040  -2.087  1.00 53.05  ? 114  ARG C N   1 
ATOM   2722 C  CA  . ARG C 1 114 ? 8.260   46.377  -1.599  1.00 57.53  ? 114  ARG C CA  1 
ATOM   2723 C  C   . ARG C 1 114 ? 7.852   47.279  -2.777  1.00 58.70  ? 114  ARG C C   1 
ATOM   2724 O  O   . ARG C 1 114 ? 8.556   47.341  -3.785  1.00 58.85  ? 114  ARG C O   1 
ATOM   2725 C  CB  . ARG C 1 114 ? 9.483   46.967  -0.890  1.00 61.66  ? 114  ARG C CB  1 
ATOM   2726 C  CG  . ARG C 1 114 ? 9.246   48.357  -0.270  1.00 68.24  ? 114  ARG C CG  1 
ATOM   2727 C  CD  . ARG C 1 114 ? 10.273  49.388  -0.740  1.00 74.38  ? 114  ARG C CD  1 
ATOM   2728 N  NE  . ARG C 1 114 ? 11.625  49.110  -0.257  1.00 78.75  ? 114  ARG C NE  1 
ATOM   2729 C  CZ  . ARG C 1 114 ? 12.688  49.872  -0.510  1.00 85.10  ? 114  ARG C CZ  1 
ATOM   2730 N  NH1 . ARG C 1 114 ? 12.576  50.967  -1.252  1.00 89.80  ? 114  ARG C NH1 1 
ATOM   2731 N  NH2 . ARG C 1 114 ? 13.874  49.530  -0.022  1.00 88.84  ? 114  ARG C NH2 1 
ATOM   2732 N  N   . VAL C 1 115 ? 6.726   47.977  -2.639  1.00 60.57  ? 115  VAL C N   1 
ATOM   2733 C  CA  . VAL C 1 115 ? 6.228   48.864  -3.703  1.00 62.27  ? 115  VAL C CA  1 
ATOM   2734 C  C   . VAL C 1 115 ? 6.658   50.314  -3.476  1.00 68.01  ? 115  VAL C C   1 
ATOM   2735 O  O   . VAL C 1 115 ? 6.728   50.786  -2.278  1.00 72.23  ? 115  VAL C O   1 
ATOM   2736 C  CB  . VAL C 1 115 ? 4.690   48.817  -3.808  1.00 61.72  ? 115  VAL C CB  1 
ATOM   2737 C  CG1 . VAL C 1 115 ? 4.213   49.653  -4.990  1.00 63.00  ? 115  VAL C CG1 1 
ATOM   2738 C  CG2 . VAL C 1 115 ? 4.208   47.364  -3.937  1.00 58.82  ? 115  VAL C CG2 1 
HETATM 2739 N  N   . PCA D 1 1   ? 23.259  18.998  12.016  1.00 35.89  ? 1    PCA D N   1 
HETATM 2740 C  CA  . PCA D 1 1   ? 24.171  19.725  12.908  1.00 36.61  ? 1    PCA D CA  1 
HETATM 2741 C  CB  . PCA D 1 1   ? 25.371  18.833  13.281  1.00 36.18  ? 1    PCA D CB  1 
HETATM 2742 C  CG  . PCA D 1 1   ? 25.115  17.461  12.664  1.00 35.30  ? 1    PCA D CG  1 
HETATM 2743 C  CD  . PCA D 1 1   ? 23.901  17.704  11.802  1.00 35.35  ? 1    PCA D CD  1 
HETATM 2744 O  OE  . PCA D 1 1   ? 23.487  16.878  10.995  1.00 35.23  ? 1    PCA D OE  1 
HETATM 2745 C  C   . PCA D 1 1   ? 24.585  21.094  12.331  1.00 35.13  ? 1    PCA D C   1 
HETATM 2746 O  O   . PCA D 1 1   ? 25.136  21.919  13.058  1.00 37.24  ? 1    PCA D O   1 
ATOM   2747 N  N   . LEU D 1 2   ? 24.297  21.352  11.057  1.00 32.84  ? 2    LEU D N   1 
ATOM   2748 C  CA  . LEU D 1 2   ? 24.715  22.605  10.415  1.00 31.62  ? 2    LEU D CA  1 
ATOM   2749 C  C   . LEU D 1 2   ? 23.942  23.790  10.997  1.00 33.92  ? 2    LEU D C   1 
ATOM   2750 O  O   . LEU D 1 2   ? 22.759  23.664  11.326  1.00 34.77  ? 2    LEU D O   1 
ATOM   2751 C  CB  . LEU D 1 2   ? 24.540  22.549  8.882   1.00 29.42  ? 2    LEU D CB  1 
ATOM   2752 C  CG  . LEU D 1 2   ? 25.421  21.564  8.078   1.00 27.71  ? 2    LEU D CG  1 
ATOM   2753 C  CD1 . LEU D 1 2   ? 25.157  21.705  6.587   1.00 24.75  ? 2    LEU D CD1 1 
ATOM   2754 C  CD2 . LEU D 1 2   ? 26.933  21.728  8.379   1.00 25.61  ? 2    LEU D CD2 1 
ATOM   2755 N  N   . LEU D 1 3   ? 24.631  24.925  11.148  1.00 35.00  ? 3    LEU D N   1 
ATOM   2756 C  CA  . LEU D 1 3   ? 24.048  26.141  11.719  1.00 37.85  ? 3    LEU D CA  1 
ATOM   2757 C  C   . LEU D 1 3   ? 24.183  27.281  10.720  1.00 37.48  ? 3    LEU D C   1 
ATOM   2758 O  O   . LEU D 1 3   ? 25.160  27.347  9.979   1.00 36.01  ? 3    LEU D O   1 
ATOM   2759 C  CB  . LEU D 1 3   ? 24.742  26.542  13.022  1.00 41.47  ? 3    LEU D CB  1 
ATOM   2760 C  CG  . LEU D 1 3   ? 24.725  25.540  14.176  1.00 43.36  ? 3    LEU D CG  1 
ATOM   2761 C  CD1 . LEU D 1 3   ? 25.502  26.115  15.343  1.00 47.13  ? 3    LEU D CD1 1 
ATOM   2762 C  CD2 . LEU D 1 3   ? 23.298  25.223  14.568  1.00 45.28  ? 3    LEU D CD2 1 
ATOM   2763 N  N   . PHE D 1 4   ? 23.203  28.180  10.732  1.00 39.47  ? 4    PHE D N   1 
ATOM   2764 C  CA  . PHE D 1 4   ? 23.073  29.219  9.715   1.00 39.16  ? 4    PHE D CA  1 
ATOM   2765 C  C   . PHE D 1 4   ? 23.101  30.629  10.296  1.00 43.50  ? 4    PHE D C   1 
ATOM   2766 O  O   . PHE D 1 4   ? 22.668  30.855  11.417  1.00 47.28  ? 4    PHE D O   1 
ATOM   2767 C  CB  . PHE D 1 4   ? 21.759  29.033  8.939   1.00 37.30  ? 4    PHE D CB  1 
ATOM   2768 C  CG  . PHE D 1 4   ? 21.701  27.760  8.156   1.00 32.95  ? 4    PHE D CG  1 
ATOM   2769 C  CD1 . PHE D 1 4   ? 21.834  27.769  6.782   1.00 31.94  ? 4    PHE D CD1 1 
ATOM   2770 C  CD2 . PHE D 1 4   ? 21.526  26.543  8.804   1.00 33.93  ? 4    PHE D CD2 1 
ATOM   2771 C  CE1 . PHE D 1 4   ? 21.790  26.586  6.053   1.00 30.27  ? 4    PHE D CE1 1 
ATOM   2772 C  CE2 . PHE D 1 4   ? 21.487  25.356  8.082   1.00 32.33  ? 4    PHE D CE2 1 
ATOM   2773 C  CZ  . PHE D 1 4   ? 21.618  25.379  6.706   1.00 29.69  ? 4    PHE D CZ  1 
ATOM   2774 N  N   . ASN D 1 5   ? 23.588  31.578  9.500   1.00 44.70  ? 5    ASN D N   1 
ATOM   2775 C  CA  . ASN D 1 5   ? 23.538  32.996  9.852   1.00 48.94  ? 5    ASN D CA  1 
ATOM   2776 C  C   . ASN D 1 5   ? 22.178  33.543  9.424   1.00 48.96  ? 5    ASN D C   1 
ATOM   2777 O  O   . ASN D 1 5   ? 21.996  33.972  8.285   1.00 47.54  ? 5    ASN D O   1 
ATOM   2778 C  CB  . ASN D 1 5   ? 24.688  33.747  9.173   1.00 50.87  ? 5    ASN D CB  1 
ATOM   2779 C  CG  . ASN D 1 5   ? 24.680  35.229  9.473   1.00 56.44  ? 5    ASN D CG  1 
ATOM   2780 O  OD1 . ASN D 1 5   ? 24.152  35.665  10.490  1.00 61.73  ? 5    ASN D OD1 1 
ATOM   2781 N  ND2 . ASN D 1 5   ? 25.267  36.015  8.580   1.00 59.75  ? 5    ASN D ND2 1 
ATOM   2782 N  N   . LYS D 1 6   ? 21.225  33.530  10.350  1.00 50.84  ? 6    LYS D N   1 
ATOM   2783 C  CA  . LYS D 1 6   ? 19.812  33.667  9.994   1.00 50.02  ? 6    LYS D CA  1 
ATOM   2784 C  C   . LYS D 1 6   ? 19.395  35.059  9.507   1.00 51.71  ? 6    LYS D C   1 
ATOM   2785 O  O   . LYS D 1 6   ? 19.852  36.086  10.007  1.00 55.35  ? 6    LYS D O   1 
ATOM   2786 C  CB  . LYS D 1 6   ? 18.927  33.232  11.167  1.00 52.89  ? 6    LYS D CB  1 
ATOM   2787 C  CG  . LYS D 1 6   ? 19.092  31.760  11.545  1.00 51.28  ? 6    LYS D CG  1 
ATOM   2788 C  CD  . LYS D 1 6   ? 18.018  31.324  12.525  1.00 54.50  ? 6    LYS D CD  1 
ATOM   2789 C  CE  . LYS D 1 6   ? 18.182  29.866  12.938  1.00 54.47  ? 6    LYS D CE  1 
ATOM   2790 N  NZ  . LYS D 1 6   ? 17.094  29.480  13.879  1.00 59.05  ? 6    LYS D NZ  1 
ATOM   2791 N  N   . THR D 1 7   ? 18.534  35.064  8.498   1.00 48.89  ? 7    THR D N   1 
ATOM   2792 C  CA  . THR D 1 7   ? 17.844  36.265  8.061   1.00 50.68  ? 7    THR D CA  1 
ATOM   2793 C  C   . THR D 1 7   ? 16.358  35.924  8.006   1.00 49.90  ? 7    THR D C   1 
ATOM   2794 O  O   . THR D 1 7   ? 15.974  34.939  7.378   1.00 46.18  ? 7    THR D O   1 
ATOM   2795 C  CB  . THR D 1 7   ? 18.362  36.734  6.682   1.00 49.13  ? 7    THR D CB  1 
ATOM   2796 O  OG1 . THR D 1 7   ? 19.713  37.200  6.813   1.00 51.58  ? 7    THR D OG1 1 
ATOM   2797 C  CG2 . THR D 1 7   ? 17.504  37.849  6.116   1.00 50.34  ? 7    THR D CG2 1 
ATOM   2798 N  N   . LYS D 1 8   ? 15.528  36.715  8.686   1.00 53.75  ? 8    LYS D N   1 
ATOM   2799 C  CA  . LYS D 1 8   ? 14.081  36.479  8.676   1.00 54.29  ? 8    LYS D CA  1 
ATOM   2800 C  C   . LYS D 1 8   ? 13.512  36.762  7.303   1.00 51.58  ? 8    LYS D C   1 
ATOM   2801 O  O   . LYS D 1 8   ? 12.714  35.986  6.779   1.00 49.93  ? 8    LYS D O   1 
ATOM   2802 C  CB  . LYS D 1 8   ? 13.350  37.342  9.702   1.00 59.86  ? 8    LYS D CB  1 
ATOM   2803 C  CG  . LYS D 1 8   ? 11.862  37.003  9.805   1.00 61.83  ? 8    LYS D CG  1 
ATOM   2804 C  CD  . LYS D 1 8   ? 11.107  37.953  10.725  1.00 68.21  ? 8    LYS D CD  1 
ATOM   2805 C  CE  . LYS D 1 8   ? 9.597   37.860  10.498  1.00 70.11  ? 8    LYS D CE  1 
ATOM   2806 N  NZ  . LYS D 1 8   ? 8.795   38.448  11.618  1.00 78.00  ? 8    LYS D NZ  1 
ATOM   2807 N  N   . SER D 1 9   ? 13.912  37.890  6.730   1.00 52.02  ? 9    SER D N   1 
ATOM   2808 C  CA  . SER D 1 9   ? 13.424  38.265  5.416   1.00 50.05  ? 9    SER D CA  1 
ATOM   2809 C  C   . SER D 1 9   ? 14.397  39.137  4.655   1.00 49.68  ? 9    SER D C   1 
ATOM   2810 O  O   . SER D 1 9   ? 15.228  39.825  5.248   1.00 52.04  ? 9    SER D O   1 
ATOM   2811 C  CB  . SER D 1 9   ? 12.086  38.975  5.556   1.00 52.76  ? 9    SER D CB  1 
ATOM   2812 O  OG  . SER D 1 9   ? 12.232  40.218  6.221   1.00 57.42  ? 9    SER D OG  1 
ATOM   2813 N  N   . VAL D 1 10  ? 14.291  39.078  3.329   1.00 47.66  ? 10   VAL D N   1 
ATOM   2814 C  CA  . VAL D 1 10  ? 14.935  40.051  2.439   1.00 48.79  ? 10   VAL D CA  1 
ATOM   2815 C  C   . VAL D 1 10  ? 13.874  40.723  1.574   1.00 49.55  ? 10   VAL D C   1 
ATOM   2816 O  O   . VAL D 1 10  ? 12.795  40.168  1.340   1.00 48.45  ? 10   VAL D O   1 
ATOM   2817 C  CB  . VAL D 1 10  ? 16.053  39.412  1.562   1.00 46.97  ? 10   VAL D CB  1 
ATOM   2818 C  CG1 . VAL D 1 10  ? 17.235  39.053  2.428   1.00 46.25  ? 10   VAL D CG1 1 
ATOM   2819 C  CG2 . VAL D 1 10  ? 15.536  38.201  0.788   1.00 43.35  ? 10   VAL D CG2 1 
ATOM   2820 N  N   . GLU D 1 11  ? 14.179  41.932  1.119   1.00 51.92  ? 11   GLU D N   1 
ATOM   2821 C  CA  . GLU D 1 11  ? 13.216  42.742  0.404   1.00 53.32  ? 11   GLU D CA  1 
ATOM   2822 C  C   . GLU D 1 11  ? 13.748  43.161  -0.960  1.00 53.34  ? 11   GLU D C   1 
ATOM   2823 O  O   . GLU D 1 11  ? 14.947  43.370  -1.125  1.00 54.31  ? 11   GLU D O   1 
ATOM   2824 C  CB  . GLU D 1 11  ? 12.890  43.980  1.233   1.00 57.45  ? 11   GLU D CB  1 
ATOM   2825 C  CG  . GLU D 1 11  ? 11.435  44.347  1.233   1.00 59.45  ? 11   GLU D CG  1 
ATOM   2826 C  CD  . GLU D 1 11  ? 11.152  45.495  2.163   1.00 64.13  ? 11   GLU D CD  1 
ATOM   2827 O  OE1 . GLU D 1 11  ? 11.786  46.557  1.999   1.00 69.30  ? 11   GLU D OE1 1 
ATOM   2828 O  OE2 . GLU D 1 11  ? 10.296  45.335  3.058   1.00 67.84  ? 11   GLU D OE2 1 
ATOM   2829 N  N   . PHE D 1 12  ? 12.846  43.276  -1.929  1.00 52.91  ? 12   PHE D N   1 
ATOM   2830 C  CA  . PHE D 1 12  ? 13.188  43.829  -3.243  1.00 54.35  ? 12   PHE D CA  1 
ATOM   2831 C  C   . PHE D 1 12  ? 12.040  44.645  -3.821  1.00 56.29  ? 12   PHE D C   1 
ATOM   2832 O  O   . PHE D 1 12  ? 10.899  44.537  -3.378  1.00 55.65  ? 12   PHE D O   1 
ATOM   2833 C  CB  . PHE D 1 12  ? 13.628  42.730  -4.220  1.00 51.91  ? 12   PHE D CB  1 
ATOM   2834 C  CG  . PHE D 1 12  ? 12.503  41.876  -4.751  1.00 50.07  ? 12   PHE D CG  1 
ATOM   2835 C  CD1 . PHE D 1 12  ? 12.161  41.915  -6.099  1.00 52.23  ? 12   PHE D CD1 1 
ATOM   2836 C  CD2 . PHE D 1 12  ? 11.795  41.027  -3.918  1.00 46.97  ? 12   PHE D CD2 1 
ATOM   2837 C  CE1 . PHE D 1 12  ? 11.133  41.122  -6.598  1.00 51.56  ? 12   PHE D CE1 1 
ATOM   2838 C  CE2 . PHE D 1 12  ? 10.760  40.236  -4.410  1.00 46.44  ? 12   PHE D CE2 1 
ATOM   2839 C  CZ  . PHE D 1 12  ? 10.436  40.279  -5.753  1.00 48.93  ? 12   PHE D CZ  1 
ATOM   2840 N  N   . THR D 1 13  ? 12.374  45.462  -4.814  1.00 59.02  ? 13   THR D N   1 
ATOM   2841 C  CA  . THR D 1 13  ? 11.445  46.391  -5.428  1.00 61.82  ? 13   THR D CA  1 
ATOM   2842 C  C   . THR D 1 13  ? 11.535  46.262  -6.948  1.00 63.14  ? 13   THR D C   1 
ATOM   2843 O  O   . THR D 1 13  ? 12.244  45.396  -7.465  1.00 61.66  ? 13   THR D O   1 
ATOM   2844 C  CB  . THR D 1 13  ? 11.806  47.828  -5.028  1.00 65.93  ? 13   THR D CB  1 
ATOM   2845 O  OG1 . THR D 1 13  ? 13.034  48.217  -5.701  1.00 69.93  ? 13   THR D OG1 1 
ATOM   2846 C  CG2 . THR D 1 13  ? 12.018  47.920  -3.507  1.00 65.57  ? 13   THR D CG2 1 
ATOM   2847 N  N   . PHE D 1 14  ? 10.820  47.125  -7.667  1.00 66.03  ? 14   PHE D N   1 
ATOM   2848 C  CA  . PHE D 1 14  ? 10.898  47.137  -9.125  1.00 68.97  ? 14   PHE D CA  1 
ATOM   2849 C  C   . PHE D 1 14  ? 12.330  47.362  -9.633  1.00 72.11  ? 14   PHE D C   1 
ATOM   2850 O  O   . PHE D 1 14  ? 12.696  46.837  -10.691 1.00 73.90  ? 14   PHE D O   1 
ATOM   2851 C  CB  . PHE D 1 14  ? 9.955   48.195  -9.719  1.00 71.95  ? 14   PHE D CB  1 
ATOM   2852 C  CG  . PHE D 1 14  ? 10.396  49.615  -9.482  1.00 75.43  ? 14   PHE D CG  1 
ATOM   2853 C  CD1 . PHE D 1 14  ? 11.247  50.249  -10.376 1.00 80.22  ? 14   PHE D CD1 1 
ATOM   2854 C  CD2 . PHE D 1 14  ? 9.945   50.320  -8.376  1.00 75.30  ? 14   PHE D CD2 1 
ATOM   2855 C  CE1 . PHE D 1 14  ? 11.646  51.563  -10.168 1.00 85.23  ? 14   PHE D CE1 1 
ATOM   2856 C  CE2 . PHE D 1 14  ? 10.340  51.634  -8.158  1.00 80.19  ? 14   PHE D CE2 1 
ATOM   2857 C  CZ  . PHE D 1 14  ? 11.191  52.257  -9.054  1.00 85.08  ? 14   PHE D CZ  1 
ATOM   2858 N  N   . GLY D 1 15  ? 13.119  48.140  -8.877  1.00 74.02  ? 15   GLY D N   1 
ATOM   2859 C  CA  . GLY D 1 15  ? 14.497  48.467  -9.251  1.00 78.25  ? 15   GLY D CA  1 
ATOM   2860 C  C   . GLY D 1 15  ? 15.457  47.290  -9.326  1.00 76.70  ? 15   GLY D C   1 
ATOM   2861 O  O   . GLY D 1 15  ? 16.499  47.378  -9.982  1.00 80.51  ? 15   GLY D O   1 
ATOM   2862 N  N   . ASN D 1 16  ? 15.124  46.193  -8.645  1.00 71.79  ? 16   ASN D N   1 
ATOM   2863 C  CA  . ASN D 1 16  ? 15.919  44.966  -8.727  1.00 69.96  ? 16   ASN D CA  1 
ATOM   2864 C  C   . ASN D 1 16  ? 15.688  44.260  -10.060 1.00 71.50  ? 16   ASN D C   1 
ATOM   2865 O  O   . ASN D 1 16  ? 14.559  43.890  -10.376 1.00 70.45  ? 16   ASN D O   1 
ATOM   2866 C  CB  . ASN D 1 16  ? 15.574  44.010  -7.578  1.00 64.34  ? 16   ASN D CB  1 
ATOM   2867 C  CG  . ASN D 1 16  ? 15.947  44.574  -6.221  1.00 64.37  ? 16   ASN D CG  1 
ATOM   2868 O  OD1 . ASN D 1 16  ? 15.259  45.461  -5.700  1.00 65.28  ? 16   ASN D OD1 1 
ATOM   2869 N  ND2 . ASN D 1 16  ? 17.070  44.079  -5.651  1.00 64.71  ? 16   ASN D ND2 1 
ATOM   2870 N  N   . ASP D 1 17  ? 16.754  44.083  -10.837 1.00 75.23  ? 17   ASP D N   1 
ATOM   2871 C  CA  . ASP D 1 17  ? 16.703  43.277  -12.059 1.00 77.25  ? 17   ASP D CA  1 
ATOM   2872 C  C   . ASP D 1 17  ? 16.925  41.802  -11.725 1.00 73.15  ? 17   ASP D C   1 
ATOM   2873 O  O   . ASP D 1 17  ? 16.466  40.913  -12.442 1.00 73.23  ? 17   ASP D O   1 
ATOM   2874 C  CB  . ASP D 1 17  ? 17.745  43.764  -13.062 1.00 84.21  ? 17   ASP D CB  1 
ATOM   2875 C  CG  . ASP D 1 17  ? 17.616  45.248  -13.359 1.00 89.74  ? 17   ASP D CG  1 
ATOM   2876 O  OD1 . ASP D 1 17  ? 16.458  45.759  -13.451 1.00 89.39  ? 17   ASP D OD1 1 
ATOM   2877 O  OD2 . ASP D 1 17  ? 18.681  45.902  -13.500 1.00 96.40  ? 17   ASP D OD2 1 
ATOM   2878 N  N   . THR D 1 18  ? 17.646  41.557  -10.635 1.00 69.96  ? 18   THR D N   1 
ATOM   2879 C  CA  . THR D 1 18  ? 17.801  40.217  -10.079 1.00 65.93  ? 18   THR D CA  1 
ATOM   2880 C  C   . THR D 1 18  ? 17.716  40.308  -8.562  1.00 61.24  ? 18   THR D C   1 
ATOM   2881 O  O   . THR D 1 18  ? 17.909  41.383  -7.987  1.00 62.15  ? 18   THR D O   1 
ATOM   2882 C  CB  . THR D 1 18  ? 19.156  39.592  -10.448 1.00 68.23  ? 18   THR D CB  1 
ATOM   2883 O  OG1 . THR D 1 18  ? 20.204  40.289  -9.766  1.00 69.99  ? 18   THR D OG1 1 
ATOM   2884 C  CG2 . THR D 1 18  ? 19.402  39.656  -11.957 1.00 73.76  ? 18   THR D CG2 1 
ATOM   2885 N  N   . VAL D 1 19  ? 17.433  39.178  -7.925  1.00 56.96  ? 19   VAL D N   1 
ATOM   2886 C  CA  . VAL D 1 19  ? 17.340  39.118  -6.472  1.00 53.43  ? 19   VAL D CA  1 
ATOM   2887 C  C   . VAL D 1 19  ? 18.221  38.002  -5.914  1.00 50.90  ? 19   VAL D C   1 
ATOM   2888 O  O   . VAL D 1 19  ? 18.492  37.003  -6.591  1.00 51.20  ? 19   VAL D O   1 
ATOM   2889 C  CB  . VAL D 1 19  ? 15.876  38.914  -6.003  1.00 51.32  ? 19   VAL D CB  1 
ATOM   2890 C  CG1 . VAL D 1 19  ? 14.988  40.049  -6.511  1.00 52.86  ? 19   VAL D CG1 1 
ATOM   2891 C  CG2 . VAL D 1 19  ? 15.333  37.552  -6.450  1.00 50.82  ? 19   VAL D CG2 1 
ATOM   2892 N  N   . VAL D 1 20  ? 18.682  38.195  -4.684  1.00 49.10  ? 20   VAL D N   1 
ATOM   2893 C  CA  . VAL D 1 20  ? 19.420  37.168  -3.952  1.00 46.50  ? 20   VAL D CA  1 
ATOM   2894 C  C   . VAL D 1 20  ? 18.641  36.806  -2.684  1.00 43.03  ? 20   VAL D C   1 
ATOM   2895 O  O   . VAL D 1 20  ? 18.150  37.690  -1.988  1.00 43.47  ? 20   VAL D O   1 
ATOM   2896 C  CB  . VAL D 1 20  ? 20.849  37.648  -3.568  1.00 48.48  ? 20   VAL D CB  1 
ATOM   2897 C  CG1 . VAL D 1 20  ? 21.551  36.613  -2.714  1.00 46.34  ? 20   VAL D CG1 1 
ATOM   2898 C  CG2 . VAL D 1 20  ? 21.678  37.939  -4.813  1.00 52.15  ? 20   VAL D CG2 1 
ATOM   2899 N  N   . ILE D 1 21  ? 18.506  35.507  -2.420  1.00 40.47  ? 21   ILE D N   1 
ATOM   2900 C  CA  . ILE D 1 21  ? 17.977  34.999  -1.144  1.00 38.49  ? 21   ILE D CA  1 
ATOM   2901 C  C   . ILE D 1 21  ? 19.140  34.389  -0.366  1.00 37.46  ? 21   ILE D C   1 
ATOM   2902 O  O   . ILE D 1 21  ? 19.651  33.319  -0.735  1.00 36.23  ? 21   ILE D O   1 
ATOM   2903 C  CB  . ILE D 1 21  ? 16.866  33.933  -1.342  1.00 37.48  ? 21   ILE D CB  1 
ATOM   2904 C  CG1 . ILE D 1 21  ? 15.849  34.402  -2.391  1.00 39.05  ? 21   ILE D CG1 1 
ATOM   2905 C  CG2 . ILE D 1 21  ? 16.172  33.615  -0.011  1.00 35.80  ? 21   ILE D CG2 1 
ATOM   2906 C  CD1 . ILE D 1 21  ? 14.788  33.371  -2.719  1.00 39.43  ? 21   ILE D CD1 1 
ATOM   2907 N  N   . PRO D 1 22  ? 19.572  35.065  0.717   1.00 38.31  ? 22   PRO D N   1 
ATOM   2908 C  CA  . PRO D 1 22  ? 20.803  34.661  1.391   1.00 38.21  ? 22   PRO D CA  1 
ATOM   2909 C  C   . PRO D 1 22  ? 20.685  33.331  2.129   1.00 35.55  ? 22   PRO D C   1 
ATOM   2910 O  O   . PRO D 1 22  ? 19.639  33.025  2.709   1.00 35.21  ? 22   PRO D O   1 
ATOM   2911 C  CB  . PRO D 1 22  ? 21.072  35.809  2.376   1.00 41.18  ? 22   PRO D CB  1 
ATOM   2912 C  CG  . PRO D 1 22  ? 19.763  36.504  2.550   1.00 41.29  ? 22   PRO D CG  1 
ATOM   2913 C  CD  . PRO D 1 22  ? 18.929  36.228  1.356   1.00 39.89  ? 22   PRO D CD  1 
ATOM   2914 N  N   . CYS D 1 23  ? 21.742  32.539  2.067   1.00 34.69  ? 23   CYS D N   1 
ATOM   2915 C  CA  . CYS D 1 23  ? 21.813  31.304  2.834   1.00 32.66  ? 23   CYS D CA  1 
ATOM   2916 C  C   . CYS D 1 23  ? 23.266  30.989  3.165   1.00 33.21  ? 23   CYS D C   1 
ATOM   2917 O  O   . CYS D 1 23  ? 24.053  30.593  2.287   1.00 33.82  ? 23   CYS D O   1 
ATOM   2918 C  CB  . CYS D 1 23  ? 21.149  30.142  2.092   1.00 31.03  ? 23   CYS D CB  1 
ATOM   2919 S  SG  . CYS D 1 23  ? 21.103  28.600  3.094   1.00 29.80  ? 23   CYS D SG  1 
ATOM   2920 N  N   . PHE D 1 24  ? 23.603  31.161  4.444   1.00 33.48  ? 24   PHE D N   1 
ATOM   2921 C  CA  . PHE D 1 24  ? 24.979  31.097  4.916   1.00 34.35  ? 24   PHE D CA  1 
ATOM   2922 C  C   . PHE D 1 24  ? 25.102  30.120  6.086   1.00 32.70  ? 24   PHE D C   1 
ATOM   2923 O  O   . PHE D 1 24  ? 24.541  30.348  7.151   1.00 32.67  ? 24   PHE D O   1 
ATOM   2924 C  CB  . PHE D 1 24  ? 25.451  32.481  5.362   1.00 38.81  ? 24   PHE D CB  1 
ATOM   2925 C  CG  . PHE D 1 24  ? 25.575  33.466  4.240   1.00 42.08  ? 24   PHE D CG  1 
ATOM   2926 C  CD1 . PHE D 1 24  ? 26.634  33.389  3.347   1.00 43.99  ? 24   PHE D CD1 1 
ATOM   2927 C  CD2 . PHE D 1 24  ? 24.626  34.471  4.064   1.00 43.25  ? 24   PHE D CD2 1 
ATOM   2928 C  CE1 . PHE D 1 24  ? 26.744  34.300  2.296   1.00 45.55  ? 24   PHE D CE1 1 
ATOM   2929 C  CE2 . PHE D 1 24  ? 24.733  35.387  3.018   1.00 46.06  ? 24   PHE D CE2 1 
ATOM   2930 C  CZ  . PHE D 1 24  ? 25.796  35.299  2.133   1.00 47.70  ? 24   PHE D CZ  1 
ATOM   2931 N  N   . VAL D 1 25  ? 25.821  29.031  5.860   1.00 30.73  ? 25   VAL D N   1 
ATOM   2932 C  CA  . VAL D 1 25  ? 26.122  28.069  6.905   1.00 29.72  ? 25   VAL D CA  1 
ATOM   2933 C  C   . VAL D 1 25  ? 27.376  28.535  7.646   1.00 32.68  ? 25   VAL D C   1 
ATOM   2934 O  O   . VAL D 1 25  ? 28.420  28.756  7.022   1.00 33.78  ? 25   VAL D O   1 
ATOM   2935 C  CB  . VAL D 1 25  ? 26.380  26.670  6.330   1.00 27.32  ? 25   VAL D CB  1 
ATOM   2936 C  CG1 . VAL D 1 25  ? 26.684  25.680  7.460   1.00 24.39  ? 25   VAL D CG1 1 
ATOM   2937 C  CG2 . VAL D 1 25  ? 25.191  26.203  5.521   1.00 23.57  ? 25   VAL D CG2 1 
ATOM   2938 N  N   . THR D 1 26  ? 27.266  28.676  8.965   1.00 34.32  ? 26   THR D N   1 
ATOM   2939 C  CA  . THR D 1 26  ? 28.357  29.200  9.791   1.00 38.11  ? 26   THR D CA  1 
ATOM   2940 C  C   . THR D 1 26  ? 29.352  28.158  10.336  1.00 38.22  ? 26   THR D C   1 
ATOM   2941 O  O   . THR D 1 26  ? 30.396  28.537  10.873  1.00 42.23  ? 26   THR D O   1 
ATOM   2942 C  CB  . THR D 1 26  ? 27.803  29.976  10.988  1.00 42.00  ? 26   THR D CB  1 
ATOM   2943 O  OG1 . THR D 1 26  ? 27.200  29.066  11.917  1.00 40.53  ? 26   THR D OG1 1 
ATOM   2944 C  CG2 . THR D 1 26  ? 26.776  30.995  10.533  1.00 41.24  ? 26   THR D CG2 1 
ATOM   2945 N  N   . ASN D 1 27  ? 29.032  26.868  10.229  1.00 34.63  ? 27   ASN D N   1 
ATOM   2946 C  CA  . ASN D 1 27  ? 29.946  25.809  10.671  1.00 34.54  ? 27   ASN D CA  1 
ATOM   2947 C  C   . ASN D 1 27  ? 30.238  24.795  9.570   1.00 31.83  ? 27   ASN D C   1 
ATOM   2948 O  O   . ASN D 1 27  ? 30.307  23.586  9.821   1.00 30.62  ? 27   ASN D O   1 
ATOM   2949 C  CB  . ASN D 1 27  ? 29.397  25.109  11.913  1.00 34.90  ? 27   ASN D CB  1 
ATOM   2950 C  CG  . ASN D 1 27  ? 28.030  24.487  11.691  1.00 32.99  ? 27   ASN D CG  1 
ATOM   2951 O  OD1 . ASN D 1 27  ? 27.354  24.773  10.697  1.00 32.04  ? 27   ASN D OD1 1 
ATOM   2952 N  ND2 . ASN D 1 27  ? 27.606  23.633  12.635  1.00 34.46  ? 27   ASN D ND2 1 
ATOM   2953 N  N   . MET D 1 28  ? 30.440  25.303  8.357   1.00 32.11  ? 28   MET D N   1 
ATOM   2954 C  CA  . MET D 1 28  ? 30.746  24.477  7.191   1.00 30.43  ? 28   MET D CA  1 
ATOM   2955 C  C   . MET D 1 28  ? 32.105  23.790  7.345   1.00 31.28  ? 28   MET D C   1 
ATOM   2956 O  O   . MET D 1 28  ? 33.038  24.355  7.914   1.00 34.18  ? 28   MET D O   1 
ATOM   2957 C  CB  . MET D 1 28  ? 30.734  25.352  5.928   1.00 32.08  ? 28   MET D CB  1 
ATOM   2958 C  CG  . MET D 1 28  ? 30.386  24.620  4.639   1.00 30.88  ? 28   MET D CG  1 
ATOM   2959 S  SD  . MET D 1 28  ? 28.634  24.216  4.460   1.00 29.53  ? 28   MET D SD  1 
ATOM   2960 C  CE  . MET D 1 28  ? 28.707  23.294  2.926   1.00 30.66  ? 28   MET D CE  1 
ATOM   2961 N  N   . GLU D 1 29  ? 32.208  22.562  6.852   1.00 29.60  ? 29   GLU D N   1 
ATOM   2962 C  CA  . GLU D 1 29  ? 33.454  21.786  6.940   1.00 30.51  ? 29   GLU D CA  1 
ATOM   2963 C  C   . GLU D 1 29  ? 33.985  21.372  5.571   1.00 31.69  ? 29   GLU D C   1 
ATOM   2964 O  O   . GLU D 1 29  ? 35.197  21.231  5.397   1.00 34.19  ? 29   GLU D O   1 
ATOM   2965 C  CB  . GLU D 1 29  ? 33.225  20.519  7.771   1.00 28.56  ? 29   GLU D CB  1 
ATOM   2966 C  CG  . GLU D 1 29  ? 33.372  20.669  9.263   1.00 29.92  ? 29   GLU D CG  1 
ATOM   2967 C  CD  . GLU D 1 29  ? 32.954  19.418  10.023  1.00 27.37  ? 29   GLU D CD  1 
ATOM   2968 O  OE1 . GLU D 1 29  ? 32.750  19.511  11.251  1.00 30.15  ? 29   GLU D OE1 1 
ATOM   2969 O  OE2 . GLU D 1 29  ? 32.823  18.332  9.417   1.00 27.41  ? 29   GLU D OE2 1 
ATOM   2970 N  N   . ALA D 1 30  ? 33.073  21.161  4.615   1.00 30.85  ? 30   ALA D N   1 
ATOM   2971 C  CA  . ALA D 1 30  ? 33.409  20.572  3.315   1.00 32.27  ? 30   ALA D CA  1 
ATOM   2972 C  C   . ALA D 1 30  ? 34.443  21.376  2.531   1.00 36.23  ? 30   ALA D C   1 
ATOM   2973 O  O   . ALA D 1 30  ? 34.292  22.588  2.349   1.00 37.92  ? 30   ALA D O   1 
ATOM   2974 C  CB  . ALA D 1 30  ? 32.152  20.386  2.480   1.00 31.71  ? 30   ALA D CB  1 
ATOM   2975 N  N   . GLN D 1 31  ? 35.481  20.679  2.069   1.00 38.53  ? 31   GLN D N   1 
ATOM   2976 C  CA  . GLN D 1 31  ? 36.560  21.275  1.290   1.00 43.19  ? 31   GLN D CA  1 
ATOM   2977 C  C   . GLN D 1 31  ? 36.464  20.939  -0.206  1.00 46.03  ? 31   GLN D C   1 
ATOM   2978 O  O   . GLN D 1 31  ? 37.360  21.287  -0.981  1.00 50.66  ? 31   GLN D O   1 
ATOM   2979 C  CB  . GLN D 1 31  ? 37.912  20.829  1.847   1.00 45.36  ? 31   GLN D CB  1 
ATOM   2980 C  CG  . GLN D 1 31  ? 38.127  21.152  3.328   1.00 44.72  ? 31   GLN D CG  1 
ATOM   2981 C  CD  . GLN D 1 31  ? 38.240  22.643  3.594   1.00 48.97  ? 31   GLN D CD  1 
ATOM   2982 O  OE1 . GLN D 1 31  ? 39.204  23.288  3.170   1.00 55.31  ? 31   GLN D OE1 1 
ATOM   2983 N  NE2 . GLN D 1 31  ? 37.259  23.200  4.300   1.00 46.71  ? 31   GLN D NE2 1 
ATOM   2984 N  N   . ASN D 1 32  ? 35.378  20.281  -0.610  1.00 43.61  ? 32   ASN D N   1 
ATOM   2985 C  CA  . ASN D 1 32  ? 35.133  19.953  -2.020  1.00 47.15  ? 32   ASN D CA  1 
ATOM   2986 C  C   . ASN D 1 32  ? 33.627  19.913  -2.290  1.00 44.40  ? 32   ASN D C   1 
ATOM   2987 O  O   . ASN D 1 32  ? 32.879  19.305  -1.527  1.00 40.23  ? 32   ASN D O   1 
ATOM   2988 C  CB  . ASN D 1 32  ? 35.779  18.601  -2.357  1.00 49.44  ? 32   ASN D CB  1 
ATOM   2989 C  CG  . ASN D 1 32  ? 35.813  18.320  -3.851  1.00 55.89  ? 32   ASN D CG  1 
ATOM   2990 O  OD1 . ASN D 1 32  ? 34.768  18.169  -4.486  1.00 55.64  ? 32   ASN D OD1 1 
ATOM   2991 N  ND2 . ASN D 1 32  ? 37.035  18.266  -4.424  1.00 63.70  ? 32   ASN D ND2 1 
ATOM   2992 N  N   . THR D 1 33  ? 33.170  20.560  -3.361  1.00 46.86  ? 33   THR D N   1 
ATOM   2993 C  CA  . THR D 1 33  ? 31.714  20.714  -3.563  1.00 45.12  ? 33   THR D CA  1 
ATOM   2994 C  C   . THR D 1 33  ? 31.025  19.419  -4.019  1.00 45.66  ? 33   THR D C   1 
ATOM   2995 O  O   . THR D 1 33  ? 29.801  19.319  -4.005  1.00 43.38  ? 33   THR D O   1 
ATOM   2996 C  CB  . THR D 1 33  ? 31.367  21.888  -4.492  1.00 47.76  ? 33   THR D CB  1 
ATOM   2997 O  OG1 . THR D 1 33  ? 32.009  21.716  -5.754  1.00 53.17  ? 33   THR D OG1 1 
ATOM   2998 C  CG2 . THR D 1 33  ? 31.824  23.197  -3.873  1.00 47.55  ? 33   THR D CG2 1 
ATOM   2999 N  N   . THR D 1 34  ? 31.827  18.415  -4.357  1.00 48.85  ? 34   THR D N   1 
ATOM   3000 C  CA  . THR D 1 34  ? 31.340  17.054  -4.563  1.00 50.64  ? 34   THR D CA  1 
ATOM   3001 C  C   . THR D 1 34  ? 30.619  16.461  -3.343  1.00 45.58  ? 34   THR D C   1 
ATOM   3002 O  O   . THR D 1 34  ? 29.775  15.568  -3.479  1.00 46.13  ? 34   THR D O   1 
ATOM   3003 C  CB  . THR D 1 34  ? 32.510  16.135  -4.900  1.00 54.21  ? 34   THR D CB  1 
ATOM   3004 O  OG1 . THR D 1 34  ? 33.088  16.555  -6.139  1.00 61.69  ? 34   THR D OG1 1 
ATOM   3005 C  CG2 . THR D 1 34  ? 32.054  14.696  -5.004  1.00 56.24  ? 34   THR D CG2 1 
ATOM   3006 N  N   . GLU D 1 35  ? 30.951  16.970  -2.161  1.00 41.95  ? 35   GLU D N   1 
ATOM   3007 C  CA  . GLU D 1 35  ? 30.377  16.491  -0.902  1.00 38.53  ? 35   GLU D CA  1 
ATOM   3008 C  C   . GLU D 1 35  ? 29.308  17.413  -0.331  1.00 35.83  ? 35   GLU D C   1 
ATOM   3009 O  O   . GLU D 1 35  ? 28.923  17.275  0.829   1.00 33.36  ? 35   GLU D O   1 
ATOM   3010 C  CB  . GLU D 1 35  ? 31.503  16.312  0.111   1.00 37.12  ? 35   GLU D CB  1 
ATOM   3011 C  CG  . GLU D 1 35  ? 32.431  15.160  -0.242  1.00 40.66  ? 35   GLU D CG  1 
ATOM   3012 C  CD  . GLU D 1 35  ? 33.890  15.494  -0.013  1.00 42.96  ? 35   GLU D CD  1 
ATOM   3013 O  OE1 . GLU D 1 35  ? 34.204  16.228  0.953   1.00 41.17  ? 35   GLU D OE1 1 
ATOM   3014 O  OE2 . GLU D 1 35  ? 34.725  15.021  -0.801  1.00 48.50  ? 35   GLU D OE2 1 
ATOM   3015 N  N   . VAL D 1 36  ? 28.822  18.344  -1.148  1.00 36.98  ? 36   VAL D N   1 
ATOM   3016 C  CA  . VAL D 1 36  ? 27.761  19.230  -0.743  1.00 34.78  ? 36   VAL D CA  1 
ATOM   3017 C  C   . VAL D 1 36  ? 26.509  18.951  -1.559  1.00 36.71  ? 36   VAL D C   1 
ATOM   3018 O  O   . VAL D 1 36  ? 26.581  18.536  -2.711  1.00 40.53  ? 36   VAL D O   1 
ATOM   3019 C  CB  . VAL D 1 36  ? 28.192  20.711  -0.836  1.00 34.53  ? 36   VAL D CB  1 
ATOM   3020 C  CG1 . VAL D 1 36  ? 27.126  21.628  -0.219  1.00 32.66  ? 36   VAL D CG1 1 
ATOM   3021 C  CG2 . VAL D 1 36  ? 29.533  20.901  -0.121  1.00 33.31  ? 36   VAL D CG2 1 
ATOM   3022 N  N   . TYR D 1 37  ? 25.360  19.144  -0.920  1.00 35.26  ? 37   TYR D N   1 
ATOM   3023 C  CA  . TYR D 1 37  ? 24.052  18.986  -1.545  1.00 37.38  ? 37   TYR D CA  1 
ATOM   3024 C  C   . TYR D 1 37  ? 23.203  20.155  -1.058  1.00 35.30  ? 37   TYR D C   1 
ATOM   3025 O  O   . TYR D 1 37  ? 22.993  20.297  0.144   1.00 32.77  ? 37   TYR D O   1 
ATOM   3026 C  CB  . TYR D 1 37  ? 23.402  17.648  -1.140  1.00 39.04  ? 37   TYR D CB  1 
ATOM   3027 C  CG  . TYR D 1 37  ? 22.184  17.253  -1.960  1.00 43.13  ? 37   TYR D CG  1 
ATOM   3028 C  CD1 . TYR D 1 37  ? 22.263  16.253  -2.913  1.00 48.44  ? 37   TYR D CD1 1 
ATOM   3029 C  CD2 . TYR D 1 37  ? 20.946  17.876  -1.772  1.00 44.09  ? 37   TYR D CD2 1 
ATOM   3030 C  CE1 . TYR D 1 37  ? 21.157  15.889  -3.671  1.00 53.46  ? 37   TYR D CE1 1 
ATOM   3031 C  CE2 . TYR D 1 37  ? 19.836  17.516  -2.526  1.00 47.32  ? 37   TYR D CE2 1 
ATOM   3032 C  CZ  . TYR D 1 37  ? 19.951  16.524  -3.472  1.00 52.71  ? 37   TYR D CZ  1 
ATOM   3033 O  OH  . TYR D 1 37  ? 18.863  16.154  -4.226  1.00 58.88  ? 37   TYR D OH  1 
ATOM   3034 N  N   . VAL D 1 38  ? 22.752  21.004  -1.982  1.00 36.52  ? 38   VAL D N   1 
ATOM   3035 C  CA  . VAL D 1 38  ? 21.812  22.086  -1.651  1.00 35.24  ? 38   VAL D CA  1 
ATOM   3036 C  C   . VAL D 1 38  ? 20.403  21.754  -2.149  1.00 37.82  ? 38   VAL D C   1 
ATOM   3037 O  O   . VAL D 1 38  ? 20.228  21.091  -3.186  1.00 41.36  ? 38   VAL D O   1 
ATOM   3038 C  CB  . VAL D 1 38  ? 22.234  23.438  -2.275  1.00 35.69  ? 38   VAL D CB  1 
ATOM   3039 C  CG1 . VAL D 1 38  ? 21.253  24.552  -1.856  1.00 34.64  ? 38   VAL D CG1 1 
ATOM   3040 C  CG2 . VAL D 1 38  ? 23.671  23.786  -1.895  1.00 34.27  ? 38   VAL D CG2 1 
ATOM   3041 N  N   . LYS D 1 39  ? 19.407  22.226  -1.404  1.00 36.50  ? 39   LYS D N   1 
ATOM   3042 C  CA  . LYS D 1 39  ? 18.010  22.033  -1.747  1.00 38.95  ? 39   LYS D CA  1 
ATOM   3043 C  C   . LYS D 1 39  ? 17.245  23.262  -1.275  1.00 37.08  ? 39   LYS D C   1 
ATOM   3044 O  O   . LYS D 1 39  ? 17.227  23.570  -0.077  1.00 34.12  ? 39   LYS D O   1 
ATOM   3045 C  CB  . LYS D 1 39  ? 17.476  20.760  -1.086  1.00 40.35  ? 39   LYS D CB  1 
ATOM   3046 C  CG  . LYS D 1 39  ? 16.014  20.452  -1.371  1.00 45.49  ? 39   LYS D CG  1 
ATOM   3047 C  CD  . LYS D 1 39  ? 15.567  19.159  -0.696  1.00 48.05  ? 39   LYS D CD  1 
ATOM   3048 C  CE  . LYS D 1 39  ? 16.104  17.927  -1.403  1.00 52.43  ? 39   LYS D CE  1 
ATOM   3049 N  NZ  . LYS D 1 39  ? 15.579  16.655  -0.816  1.00 56.64  ? 39   LYS D NZ  1 
ATOM   3050 N  N   . TRP D 1 40  ? 16.647  23.981  -2.226  1.00 38.70  ? 40   TRP D N   1 
ATOM   3051 C  CA  . TRP D 1 40  ? 15.784  25.108  -1.911  1.00 38.25  ? 40   TRP D CA  1 
ATOM   3052 C  C   . TRP D 1 40  ? 14.327  24.735  -2.124  1.00 41.68  ? 40   TRP D C   1 
ATOM   3053 O  O   . TRP D 1 40  ? 13.981  24.172  -3.158  1.00 44.80  ? 40   TRP D O   1 
ATOM   3054 C  CB  . TRP D 1 40  ? 16.125  26.304  -2.783  1.00 37.68  ? 40   TRP D CB  1 
ATOM   3055 C  CG  . TRP D 1 40  ? 17.310  27.051  -2.329  1.00 34.41  ? 40   TRP D CG  1 
ATOM   3056 C  CD1 . TRP D 1 40  ? 18.617  26.796  -2.649  1.00 33.52  ? 40   TRP D CD1 1 
ATOM   3057 C  CD2 . TRP D 1 40  ? 17.319  28.201  -1.480  1.00 32.44  ? 40   TRP D CD2 1 
ATOM   3058 N  NE1 . TRP D 1 40  ? 19.433  27.714  -2.040  1.00 31.14  ? 40   TRP D NE1 1 
ATOM   3059 C  CE2 . TRP D 1 40  ? 18.664  28.588  -1.317  1.00 31.16  ? 40   TRP D CE2 1 
ATOM   3060 C  CE3 . TRP D 1 40  ? 16.321  28.934  -0.823  1.00 32.21  ? 40   TRP D CE3 1 
ATOM   3061 C  CZ2 . TRP D 1 40  ? 19.035  29.699  -0.547  1.00 30.59  ? 40   TRP D CZ2 1 
ATOM   3062 C  CZ3 . TRP D 1 40  ? 16.691  30.030  -0.058  1.00 31.20  ? 40   TRP D CZ3 1 
ATOM   3063 C  CH2 . TRP D 1 40  ? 18.035  30.402  0.075   1.00 30.44  ? 40   TRP D CH2 1 
ATOM   3064 N  N   . LYS D 1 41  ? 13.487  25.071  -1.144  1.00 41.71  ? 41   LYS D N   1 
ATOM   3065 C  CA  . LYS D 1 41  ? 12.069  24.742  -1.175  1.00 45.87  ? 41   LYS D CA  1 
ATOM   3066 C  C   . LYS D 1 41  ? 11.224  26.011  -1.159  1.00 45.84  ? 41   LYS D C   1 
ATOM   3067 O  O   . LYS D 1 41  ? 11.617  27.033  -0.593  1.00 42.08  ? 41   LYS D O   1 
ATOM   3068 C  CB  . LYS D 1 41  ? 11.682  23.828  -0.001  1.00 47.12  ? 41   LYS D CB  1 
ATOM   3069 C  CG  . LYS D 1 41  ? 11.670  22.340  -0.347  1.00 51.49  ? 41   LYS D CG  1 
ATOM   3070 C  CD  . LYS D 1 41  ? 11.296  21.463  0.853   1.00 53.37  ? 41   LYS D CD  1 
ATOM   3071 C  CE  . LYS D 1 41  ? 12.476  21.287  1.806   1.00 50.83  ? 41   LYS D CE  1 
ATOM   3072 N  NZ  . LYS D 1 41  ? 12.168  20.363  2.935   1.00 53.48  ? 41   LYS D NZ  1 
ATOM   3073 N  N   . PHE D 1 42  ? 10.065  25.916  -1.801  1.00 50.41  ? 42   PHE D N   1 
ATOM   3074 C  CA  . PHE D 1 42  ? 9.089   26.999  -1.852  1.00 51.76  ? 42   PHE D CA  1 
ATOM   3075 C  C   . PHE D 1 42  ? 7.707   26.374  -1.959  1.00 57.42  ? 42   PHE D C   1 
ATOM   3076 O  O   . PHE D 1 42  ? 7.407   25.696  -2.942  1.00 61.14  ? 42   PHE D O   1 
ATOM   3077 C  CB  . PHE D 1 42  ? 9.360   27.913  -3.052  1.00 51.28  ? 42   PHE D CB  1 
ATOM   3078 C  CG  . PHE D 1 42  ? 8.337   29.005  -3.230  1.00 52.63  ? 42   PHE D CG  1 
ATOM   3079 C  CD1 . PHE D 1 42  ? 8.221   30.026  -2.291  1.00 50.87  ? 42   PHE D CD1 1 
ATOM   3080 C  CD2 . PHE D 1 42  ? 7.494   29.015  -4.336  1.00 56.21  ? 42   PHE D CD2 1 
ATOM   3081 C  CE1 . PHE D 1 42  ? 7.273   31.034  -2.448  1.00 52.10  ? 42   PHE D CE1 1 
ATOM   3082 C  CE2 . PHE D 1 42  ? 6.549   30.016  -4.499  1.00 58.12  ? 42   PHE D CE2 1 
ATOM   3083 C  CZ  . PHE D 1 42  ? 6.440   31.028  -3.555  1.00 55.74  ? 42   PHE D CZ  1 
ATOM   3084 N  N   . LYS D 1 43  ? 6.881   26.584  -0.937  1.00 59.11  ? 43   LYS D N   1 
ATOM   3085 C  CA  . LYS D 1 43  ? 5.527   26.033  -0.899  1.00 65.51  ? 43   LYS D CA  1 
ATOM   3086 C  C   . LYS D 1 43  ? 5.510   24.531  -1.199  1.00 69.68  ? 43   LYS D C   1 
ATOM   3087 O  O   . LYS D 1 43  ? 4.811   24.067  -2.105  1.00 75.01  ? 43   LYS D O   1 
ATOM   3088 C  CB  . LYS D 1 43  ? 4.615   26.806  -1.857  1.00 68.09  ? 43   LYS D CB  1 
ATOM   3089 C  CG  . LYS D 1 43  ? 4.494   28.275  -1.495  1.00 65.30  ? 43   LYS D CG  1 
ATOM   3090 C  CD  . LYS D 1 43  ? 3.677   29.050  -2.505  1.00 67.98  ? 43   LYS D CD  1 
ATOM   3091 C  CE  . LYS D 1 43  ? 3.479   30.482  -2.049  1.00 66.09  ? 43   LYS D CE  1 
ATOM   3092 N  NZ  . LYS D 1 43  ? 2.556   30.557  -0.881  1.00 69.89  ? 43   LYS D NZ  1 
ATOM   3093 N  N   . GLY D 1 44  ? 6.307   23.789  -0.433  1.00 68.22  ? 44   GLY D N   1 
ATOM   3094 C  CA  . GLY D 1 44  ? 6.363   22.328  -0.512  1.00 72.13  ? 44   GLY D CA  1 
ATOM   3095 C  C   . GLY D 1 44  ? 7.298   21.749  -1.561  1.00 71.58  ? 44   GLY D C   1 
ATOM   3096 O  O   . GLY D 1 44  ? 7.763   20.618  -1.414  1.00 73.25  ? 44   GLY D O   1 
ATOM   3097 N  N   . ARG D 1 45  ? 7.582   22.514  -2.612  1.00 70.19  ? 45   ARG D N   1 
ATOM   3098 C  CA  . ARG D 1 45  ? 8.266   21.988  -3.789  1.00 71.69  ? 45   ARG D CA  1 
ATOM   3099 C  C   . ARG D 1 45  ? 9.739   22.327  -3.800  1.00 65.81  ? 45   ARG D C   1 
ATOM   3100 O  O   . ARG D 1 45  ? 10.150  23.371  -3.298  1.00 60.98  ? 45   ARG D O   1 
ATOM   3101 C  CB  . ARG D 1 45  ? 7.645   22.549  -5.066  1.00 75.17  ? 45   ARG D CB  1 
ATOM   3102 C  CG  . ARG D 1 45  ? 6.305   21.945  -5.434  1.00 83.53  ? 45   ARG D CG  1 
ATOM   3103 C  CD  . ARG D 1 45  ? 5.898   22.345  -6.844  1.00 88.11  ? 45   ARG D CD  1 
ATOM   3104 N  NE  . ARG D 1 45  ? 5.941   23.800  -7.041  1.00 85.05  ? 45   ARG D NE  1 
ATOM   3105 C  CZ  . ARG D 1 45  ? 6.933   24.480  -7.623  1.00 81.41  ? 45   ARG D CZ  1 
ATOM   3106 N  NH1 . ARG D 1 45  ? 6.843   25.799  -7.732  1.00 78.57  ? 45   ARG D NH1 1 
ATOM   3107 N  NH2 . ARG D 1 45  ? 8.014   23.865  -8.098  1.00 82.08  ? 45   ARG D NH2 1 
ATOM   3108 N  N   . ASP D 1 46  ? 10.518  21.439  -4.409  1.00 67.33  ? 46   ASP D N   1 
ATOM   3109 C  CA  . ASP D 1 46  ? 11.938  21.665  -4.647  1.00 63.31  ? 46   ASP D CA  1 
ATOM   3110 C  C   . ASP D 1 46  ? 12.102  22.563  -5.868  1.00 64.00  ? 46   ASP D C   1 
ATOM   3111 O  O   . ASP D 1 46  ? 11.853  22.133  -6.999  1.00 69.82  ? 46   ASP D O   1 
ATOM   3112 C  CB  . ASP D 1 46  ? 12.658  20.329  -4.862  1.00 65.78  ? 46   ASP D CB  1 
ATOM   3113 C  CG  . ASP D 1 46  ? 12.866  19.555  -3.566  1.00 64.74  ? 46   ASP D CG  1 
ATOM   3114 O  OD1 . ASP D 1 46  ? 12.835  20.178  -2.481  1.00 61.75  ? 46   ASP D OD1 1 
ATOM   3115 O  OD2 . ASP D 1 46  ? 13.083  18.323  -3.634  1.00 68.47  ? 46   ASP D OD2 1 
ATOM   3116 N  N   . ILE D 1 47  ? 12.497  23.813  -5.632  1.00 59.21  ? 47   ILE D N   1 
ATOM   3117 C  CA  . ILE D 1 47  ? 12.644  24.806  -6.705  1.00 59.87  ? 47   ILE D CA  1 
ATOM   3118 C  C   . ILE D 1 47  ? 14.102  25.033  -7.126  1.00 58.07  ? 47   ILE D C   1 
ATOM   3119 O  O   . ILE D 1 47  ? 14.358  25.674  -8.144  1.00 60.09  ? 47   ILE D O   1 
ATOM   3120 C  CB  . ILE D 1 47  ? 11.915  26.151  -6.372  1.00 57.83  ? 47   ILE D CB  1 
ATOM   3121 C  CG1 . ILE D 1 47  ? 12.442  26.801  -5.084  1.00 51.91  ? 47   ILE D CG1 1 
ATOM   3122 C  CG2 . ILE D 1 47  ? 10.417  25.912  -6.270  1.00 60.55  ? 47   ILE D CG2 1 
ATOM   3123 C  CD1 . ILE D 1 47  ? 13.574  27.781  -5.303  1.00 49.31  ? 47   ILE D CD1 1 
ATOM   3124 N  N   . TYR D 1 48  ? 15.051  24.511  -6.351  1.00 54.96  ? 48   TYR D N   1 
ATOM   3125 C  CA  . TYR D 1 48  ? 16.429  24.373  -6.813  1.00 54.77  ? 48   TYR D CA  1 
ATOM   3126 C  C   . TYR D 1 48  ? 17.186  23.307  -6.021  1.00 52.83  ? 48   TYR D C   1 
ATOM   3127 O  O   . TYR D 1 48  ? 17.206  23.342  -4.792  1.00 49.02  ? 48   TYR D O   1 
ATOM   3128 C  CB  . TYR D 1 48  ? 17.213  25.688  -6.735  1.00 51.92  ? 48   TYR D CB  1 
ATOM   3129 C  CG  . TYR D 1 48  ? 18.666  25.495  -7.150  1.00 52.77  ? 48   TYR D CG  1 
ATOM   3130 C  CD1 . TYR D 1 48  ? 19.030  25.510  -8.493  1.00 57.48  ? 48   TYR D CD1 1 
ATOM   3131 C  CD2 . TYR D 1 48  ? 19.661  25.247  -6.201  1.00 49.89  ? 48   TYR D CD2 1 
ATOM   3132 C  CE1 . TYR D 1 48  ? 20.345  25.318  -8.883  1.00 58.97  ? 48   TYR D CE1 1 
ATOM   3133 C  CE2 . TYR D 1 48  ? 20.984  25.051  -6.581  1.00 49.81  ? 48   TYR D CE2 1 
ATOM   3134 C  CZ  . TYR D 1 48  ? 21.319  25.090  -7.922  1.00 55.42  ? 48   TYR D CZ  1 
ATOM   3135 O  OH  . TYR D 1 48  ? 22.623  24.891  -8.316  1.00 57.69  ? 48   TYR D OH  1 
ATOM   3136 N  N   . THR D 1 49  ? 17.827  22.383  -6.736  1.00 56.01  ? 49   THR D N   1 
ATOM   3137 C  CA  . THR D 1 49  ? 18.698  21.378  -6.117  1.00 54.59  ? 49   THR D CA  1 
ATOM   3138 C  C   . THR D 1 49  ? 20.076  21.346  -6.787  1.00 55.57  ? 49   THR D C   1 
ATOM   3139 O  O   . THR D 1 49  ? 20.172  21.420  -8.008  1.00 60.09  ? 49   THR D O   1 
ATOM   3140 C  CB  . THR D 1 49  ? 18.064  19.960  -6.161  1.00 58.50  ? 49   THR D CB  1 
ATOM   3141 O  OG1 . THR D 1 49  ? 17.347  19.790  -7.385  1.00 65.04  ? 49   THR D OG1 1 
ATOM   3142 C  CG2 . THR D 1 49  ? 17.093  19.757  -5.003  1.00 57.03  ? 49   THR D CG2 1 
ATOM   3143 N  N   . PHE D 1 50  ? 21.133  21.266  -5.978  1.00 51.76  ? 50   PHE D N   1 
ATOM   3144 C  CA  . PHE D 1 50  ? 22.482  20.945  -6.458  1.00 53.82  ? 50   PHE D CA  1 
ATOM   3145 C  C   . PHE D 1 50  ? 22.950  19.652  -5.798  1.00 53.08  ? 50   PHE D C   1 
ATOM   3146 O  O   . PHE D 1 50  ? 23.085  19.593  -4.579  1.00 48.60  ? 50   PHE D O   1 
ATOM   3147 C  CB  . PHE D 1 50  ? 23.492  22.071  -6.170  1.00 51.26  ? 50   PHE D CB  1 
ATOM   3148 C  CG  . PHE D 1 50  ? 24.941  21.638  -6.320  1.00 52.21  ? 50   PHE D CG  1 
ATOM   3149 C  CD1 . PHE D 1 50  ? 25.466  21.328  -7.568  1.00 59.28  ? 50   PHE D CD1 1 
ATOM   3150 C  CD2 . PHE D 1 50  ? 25.766  21.517  -5.207  1.00 49.66  ? 50   PHE D CD2 1 
ATOM   3151 C  CE1 . PHE D 1 50  ? 26.800  20.910  -7.715  1.00 60.62  ? 50   PHE D CE1 1 
ATOM   3152 C  CE2 . PHE D 1 50  ? 27.089  21.101  -5.337  1.00 50.98  ? 50   PHE D CE2 1 
ATOM   3153 C  CZ  . PHE D 1 50  ? 27.608  20.800  -6.592  1.00 57.01  ? 50   PHE D CZ  1 
ATOM   3154 N  N   . ASP D 1 51  ? 23.197  18.627  -6.606  1.00 58.16  ? 51   ASP D N   1 
ATOM   3155 C  CA  . ASP D 1 51  ? 23.724  17.351  -6.132  1.00 58.57  ? 51   ASP D CA  1 
ATOM   3156 C  C   . ASP D 1 51  ? 25.228  17.338  -6.392  1.00 59.46  ? 51   ASP D C   1 
ATOM   3157 O  O   . ASP D 1 51  ? 25.668  17.317  -7.547  1.00 64.94  ? 51   ASP D O   1 
ATOM   3158 C  CB  . ASP D 1 51  ? 23.026  16.201  -6.871  1.00 65.22  ? 51   ASP D CB  1 
ATOM   3159 C  CG  . ASP D 1 51  ? 23.320  14.824  -6.275  1.00 65.84  ? 51   ASP D CG  1 
ATOM   3160 O  OD1 . ASP D 1 51  ? 24.173  14.701  -5.368  1.00 63.48  ? 51   ASP D OD1 1 
ATOM   3161 O  OD2 . ASP D 1 51  ? 22.688  13.847  -6.736  1.00 72.16  ? 51   ASP D OD2 1 
ATOM   3162 N  N   . GLY D 1 52  ? 26.014  17.371  -5.317  1.00 55.06  ? 52   GLY D N   1 
ATOM   3163 C  CA  . GLY D 1 52  ? 27.473  17.288  -5.418  1.00 55.78  ? 52   GLY D CA  1 
ATOM   3164 C  C   . GLY D 1 52  ? 27.947  15.959  -5.980  1.00 60.47  ? 52   GLY D C   1 
ATOM   3165 O  O   . GLY D 1 52  ? 28.851  15.922  -6.811  1.00 65.18  ? 52   GLY D O   1 
ATOM   3166 N  N   . ALA D 1 53  ? 27.324  14.874  -5.520  1.00 60.34  ? 53   ALA D N   1 
ATOM   3167 C  CA  . ALA D 1 53  ? 27.639  13.519  -5.963  1.00 65.20  ? 53   ALA D CA  1 
ATOM   3168 C  C   . ALA D 1 53  ? 27.466  13.370  -7.476  1.00 73.11  ? 53   ALA D C   1 
ATOM   3169 O  O   . ALA D 1 53  ? 28.316  12.794  -8.148  1.00 78.30  ? 53   ALA D O   1 
ATOM   3170 C  CB  . ALA D 1 53  ? 26.756  12.514  -5.235  1.00 64.42  ? 53   ALA D CB  1 
ATOM   3171 N  N   . LEU D 1 54  ? 26.365  13.900  -8.001  1.00 74.61  ? 54   LEU D N   1 
ATOM   3172 C  CA  . LEU D 1 54  ? 26.100  13.868  -9.438  1.00 82.59  ? 54   LEU D CA  1 
ATOM   3173 C  C   . LEU D 1 54  ? 26.460  15.186  -10.144 1.00 83.10  ? 54   LEU D C   1 
ATOM   3174 O  O   . LEU D 1 54  ? 26.118  15.364  -11.314 1.00 89.54  ? 54   LEU D O   1 
ATOM   3175 C  CB  . LEU D 1 54  ? 24.627  13.516  -9.698  1.00 85.74  ? 54   LEU D CB  1 
ATOM   3176 C  CG  . LEU D 1 54  ? 24.108  12.160  -9.195  1.00 87.76  ? 54   LEU D CG  1 
ATOM   3177 C  CD1 . LEU D 1 54  ? 22.703  11.906  -9.742  1.00 93.57  ? 54   LEU D CD1 1 
ATOM   3178 C  CD2 . LEU D 1 54  ? 25.036  11.012  -9.571  1.00 92.98  ? 54   LEU D CD2 1 
ATOM   3179 N  N   . ASN D 1 55  ? 27.160  16.094  -9.454  1.00 76.98  ? 55   ASN D N   1 
ATOM   3180 C  CA  . ASN D 1 55  ? 27.544  17.397  -10.025 1.00 77.87  ? 55   ASN D CA  1 
ATOM   3181 C  C   . ASN D 1 55  ? 26.410  17.957  -10.891 1.00 81.16  ? 55   ASN D C   1 
ATOM   3182 O  O   . ASN D 1 55  ? 26.621  18.385  -12.029 1.00 87.62  ? 55   ASN D O   1 
ATOM   3183 C  CB  . ASN D 1 55  ? 28.849  17.269  -10.831 1.00 83.83  ? 55   ASN D CB  1 
ATOM   3184 C  CG  . ASN D 1 55  ? 29.497  18.619  -11.145 1.00 84.04  ? 55   ASN D CG  1 
ATOM   3185 O  OD1 . ASN D 1 55  ? 29.384  19.579  -10.382 1.00 78.26  ? 55   ASN D OD1 1 
ATOM   3186 N  ND2 . ASN D 1 55  ? 30.198  18.683  -12.271 1.00 92.13  ? 55   ASN D ND2 1 
ATOM   3187 N  N   . LYS D 1 56  ? 25.211  17.944  -10.314 1.00 77.50  ? 56   LYS D N   1 
ATOM   3188 C  CA  . LYS D 1 56  ? 23.960  18.152  -11.032 1.00 81.00  ? 56   LYS D CA  1 
ATOM   3189 C  C   . LYS D 1 56  ? 23.085  19.199  -10.341 1.00 75.19  ? 56   LYS D C   1 
ATOM   3190 O  O   . LYS D 1 56  ? 22.693  19.027  -9.183  1.00 69.11  ? 56   LYS D O   1 
ATOM   3191 C  CB  . LYS D 1 56  ? 23.224  16.808  -11.117 1.00 85.19  ? 56   LYS D CB  1 
ATOM   3192 C  CG  . LYS D 1 56  ? 21.727  16.874  -11.417 1.00 87.35  ? 56   LYS D CG  1 
ATOM   3193 C  CD  . LYS D 1 56  ? 21.273  15.716  -12.323 1.00 96.68  ? 56   LYS D CD  1 
ATOM   3194 C  CE  . LYS D 1 56  ? 21.487  14.339  -11.719 1.00 97.20  ? 56   LYS D CE  1 
ATOM   3195 N  NZ  . LYS D 1 56  ? 21.278  13.267  -12.748 1.00 107.18 ? 56   LYS D NZ  1 
ATOM   3196 N  N   . SER D 1 57  ? 22.797  20.286  -11.057 1.00 76.74  ? 57   SER D N   1 
ATOM   3197 C  CA  . SER D 1 57  ? 21.820  21.274  -10.615 1.00 72.60  ? 57   SER D CA  1 
ATOM   3198 C  C   . SER D 1 57  ? 20.501  21.023  -11.341 1.00 77.29  ? 57   SER D C   1 
ATOM   3199 O  O   . SER D 1 57  ? 20.492  20.475  -12.436 1.00 84.63  ? 57   SER D O   1 
ATOM   3200 C  CB  . SER D 1 57  ? 22.315  22.698  -10.877 1.00 71.61  ? 57   SER D CB  1 
ATOM   3201 O  OG  . SER D 1 57  ? 23.212  23.110  -9.863  1.00 66.67  ? 57   SER D OG  1 
ATOM   3202 N  N   . THR D 1 58  ? 19.396  21.417  -10.719 1.00 73.81  ? 58   THR D N   1 
ATOM   3203 C  CA  . THR D 1 58  ? 18.061  21.162  -11.260 1.00 78.26  ? 58   THR D CA  1 
ATOM   3204 C  C   . THR D 1 58  ? 17.098  22.284  -10.880 1.00 74.78  ? 58   THR D C   1 
ATOM   3205 O  O   . THR D 1 58  ? 17.163  22.817  -9.775  1.00 68.33  ? 58   THR D O   1 
ATOM   3206 C  CB  . THR D 1 58  ? 17.498  19.829  -10.728 1.00 79.58  ? 58   THR D CB  1 
ATOM   3207 O  OG1 . THR D 1 58  ? 18.369  18.754  -11.098 1.00 82.85  ? 58   THR D OG1 1 
ATOM   3208 C  CG2 . THR D 1 58  ? 16.101  19.565  -11.269 1.00 85.20  ? 58   THR D CG2 1 
ATOM   3209 N  N   . VAL D 1 59  ? 16.214  22.637  -11.811 1.00 79.62  ? 59   VAL D N   1 
ATOM   3210 C  CA  . VAL D 1 59  ? 15.172  23.633  -11.566 1.00 77.36  ? 59   VAL D CA  1 
ATOM   3211 C  C   . VAL D 1 59  ? 13.871  23.236  -12.260 1.00 83.68  ? 59   VAL D C   1 
ATOM   3212 O  O   . VAL D 1 59  ? 13.904  22.599  -13.310 1.00 91.00  ? 59   VAL D O   1 
ATOM   3213 C  CB  . VAL D 1 59  ? 15.570  25.035  -12.084 1.00 76.47  ? 59   VAL D CB  1 
ATOM   3214 C  CG1 . VAL D 1 59  ? 16.640  25.653  -11.196 1.00 69.82  ? 59   VAL D CG1 1 
ATOM   3215 C  CG2 . VAL D 1 59  ? 16.024  24.970  -13.542 1.00 83.65  ? 59   VAL D CG2 1 
ATOM   3216 N  N   . PRO D 1 60  ? 12.722  23.607  -11.669 1.00 81.72  ? 60   PRO D N   1 
ATOM   3217 C  CA  . PRO D 1 60  ? 11.452  23.445  -12.352 1.00 88.17  ? 60   PRO D CA  1 
ATOM   3218 C  C   . PRO D 1 60  ? 11.210  24.621  -13.298 1.00 90.33  ? 60   PRO D C   1 
ATOM   3219 O  O   . PRO D 1 60  ? 11.728  25.717  -13.063 1.00 85.42  ? 60   PRO D O   1 
ATOM   3220 C  CB  . PRO D 1 60  ? 10.443  23.436  -11.204 1.00 85.06  ? 60   PRO D CB  1 
ATOM   3221 C  CG  . PRO D 1 60  ? 11.063  24.263  -10.149 1.00 76.28  ? 60   PRO D CG  1 
ATOM   3222 C  CD  . PRO D 1 60  ? 12.549  24.200  -10.331 1.00 74.38  ? 60   PRO D CD  1 
ATOM   3223 N  N   . THR D 1 61  ? 10.433  24.391  -14.353 1.00 98.08  ? 61   THR D N   1 
ATOM   3224 C  CA  . THR D 1 61  ? 10.231  25.392  -15.400 1.00 101.54 ? 61   THR D CA  1 
ATOM   3225 C  C   . THR D 1 61  ? 9.839   26.768  -14.850 1.00 95.44  ? 61   THR D C   1 
ATOM   3226 O  O   . THR D 1 61  ? 10.316  27.791  -15.344 1.00 94.85  ? 61   THR D O   1 
ATOM   3227 C  CB  . THR D 1 61  ? 9.169   24.924  -16.414 1.00 111.18 ? 61   THR D CB  1 
ATOM   3228 O  OG1 . THR D 1 61  ? 9.515   23.620  -16.898 1.00 117.45 ? 61   THR D OG1 1 
ATOM   3229 C  CG2 . THR D 1 61  ? 9.068   25.892  -17.596 1.00 115.95 ? 61   THR D CG2 1 
ATOM   3230 N  N   . ASP D 1 62  ? 8.992   26.796  -13.821 1.00 91.59  ? 62   ASP D N   1 
ATOM   3231 C  CA  . ASP D 1 62  ? 8.536   28.066  -13.246 1.00 86.54  ? 62   ASP D CA  1 
ATOM   3232 C  C   . ASP D 1 62  ? 9.691   28.879  -12.627 1.00 79.50  ? 62   ASP D C   1 
ATOM   3233 O  O   . ASP D 1 62  ? 9.633   30.111  -12.582 1.00 77.32  ? 62   ASP D O   1 
ATOM   3234 C  CB  . ASP D 1 62  ? 7.392   27.843  -12.240 1.00 85.27  ? 62   ASP D CB  1 
ATOM   3235 C  CG  . ASP D 1 62  ? 7.863   27.266  -10.918 1.00 80.80  ? 62   ASP D CG  1 
ATOM   3236 O  OD1 . ASP D 1 62  ? 8.340   26.109  -10.895 1.00 83.83  ? 62   ASP D OD1 1 
ATOM   3237 O  OD2 . ASP D 1 62  ? 7.739   27.972  -9.891  1.00 76.34  ? 62   ASP D OD2 1 
ATOM   3238 N  N   . PHE D 1 63  ? 10.738  28.182  -12.186 1.00 76.61  ? 63   PHE D N   1 
ATOM   3239 C  CA  . PHE D 1 63  ? 11.963  28.799  -11.660 1.00 71.08  ? 63   PHE D CA  1 
ATOM   3240 C  C   . PHE D 1 63  ? 13.143  28.584  -12.616 1.00 74.20  ? 63   PHE D C   1 
ATOM   3241 O  O   . PHE D 1 63  ? 14.098  27.883  -12.283 1.00 72.66  ? 63   PHE D O   1 
ATOM   3242 C  CB  . PHE D 1 63  ? 12.317  28.183  -10.308 1.00 65.54  ? 63   PHE D CB  1 
ATOM   3243 C  CG  . PHE D 1 63  ? 11.648  28.827  -9.136  1.00 60.98  ? 63   PHE D CG  1 
ATOM   3244 C  CD1 . PHE D 1 63  ? 12.200  29.951  -8.535  1.00 56.60  ? 63   PHE D CD1 1 
ATOM   3245 C  CD2 . PHE D 1 63  ? 10.489  28.285  -8.601  1.00 62.34  ? 63   PHE D CD2 1 
ATOM   3246 C  CE1 . PHE D 1 63  ? 11.601  30.531  -7.424  1.00 53.31  ? 63   PHE D CE1 1 
ATOM   3247 C  CE2 . PHE D 1 63  ? 9.880   28.862  -7.492  1.00 59.09  ? 63   PHE D CE2 1 
ATOM   3248 C  CZ  . PHE D 1 63  ? 10.441  29.982  -6.902  1.00 54.48  ? 63   PHE D CZ  1 
ATOM   3249 N  N   . SER D 1 64  ? 13.086  29.199  -13.791 1.00 78.78  ? 64   SER D N   1 
ATOM   3250 C  CA  . SER D 1 64  ? 14.081  28.956  -14.839 1.00 83.88  ? 64   SER D CA  1 
ATOM   3251 C  C   . SER D 1 64  ? 15.453  29.571  -14.561 1.00 80.57  ? 64   SER D C   1 
ATOM   3252 O  O   . SER D 1 64  ? 16.490  28.962  -14.897 1.00 82.88  ? 64   SER D O   1 
ATOM   3253 C  CB  . SER D 1 64  ? 13.562  29.471  -16.185 1.00 90.99  ? 64   SER D CB  1 
ATOM   3254 O  OG  . SER D 1 64  ? 12.308  28.892  -16.479 1.00 94.99  ? 64   SER D OG  1 
ATOM   3255 N  N   . SER D 1 65  ? 15.463  30.769  -13.965 1.00 76.02  ? 65   SER D N   1 
ATOM   3256 C  CA  . SER D 1 65  ? 16.719  31.482  -13.698 1.00 74.16  ? 65   SER D CA  1 
ATOM   3257 C  C   . SER D 1 65  ? 17.384  31.095  -12.366 1.00 67.75  ? 65   SER D C   1 
ATOM   3258 O  O   . SER D 1 65  ? 18.433  31.648  -12.025 1.00 65.68  ? 65   SER D O   1 
ATOM   3259 C  CB  . SER D 1 65  ? 16.506  33.003  -13.753 1.00 73.70  ? 65   SER D CB  1 
ATOM   3260 O  OG  . SER D 1 65  ? 15.724  33.481  -12.662 1.00 68.42  ? 65   SER D OG  1 
ATOM   3261 N  N   . ALA D 1 66  ? 16.778  30.154  -11.633 1.00 64.95  ? 66   ALA D N   1 
ATOM   3262 C  CA  . ALA D 1 66  ? 17.265  29.744  -10.306 1.00 59.59  ? 66   ALA D CA  1 
ATOM   3263 C  C   . ALA D 1 66  ? 18.640  29.091  -10.359 1.00 60.35  ? 66   ALA D C   1 
ATOM   3264 O  O   . ALA D 1 66  ? 18.854  28.126  -11.093 1.00 63.87  ? 66   ALA D O   1 
ATOM   3265 C  CB  . ALA D 1 66  ? 16.267  28.794  -9.631  1.00 57.75  ? 66   ALA D CB  1 
ATOM   3266 N  N   . LYS D 1 67  ? 19.561  29.605  -9.544  1.00 57.40  ? 67   LYS D N   1 
ATOM   3267 C  CA  . LYS D 1 67  ? 20.910  29.056  -9.467  1.00 57.60  ? 67   LYS D CA  1 
ATOM   3268 C  C   . LYS D 1 67  ? 21.626  29.485  -8.195  1.00 53.14  ? 67   LYS D C   1 
ATOM   3269 O  O   . LYS D 1 67  ? 21.256  30.467  -7.554  1.00 50.27  ? 67   LYS D O   1 
ATOM   3270 C  CB  . LYS D 1 67  ? 21.734  29.498  -10.683 1.00 63.59  ? 67   LYS D CB  1 
ATOM   3271 C  CG  . LYS D 1 67  ? 21.658  30.996  -10.969 1.00 65.09  ? 67   LYS D CG  1 
ATOM   3272 C  CD  . LYS D 1 67  ? 22.876  31.511  -11.712 1.00 69.91  ? 67   LYS D CD  1 
ATOM   3273 C  CE  . LYS D 1 67  ? 22.633  32.900  -12.290 1.00 73.47  ? 67   LYS D CE  1 
ATOM   3274 N  NZ  . LYS D 1 67  ? 22.075  33.893  -11.314 1.00 68.89  ? 67   LYS D NZ  1 
ATOM   3275 N  N   . ILE D 1 68  ? 22.658  28.727  -7.835  1.00 52.74  ? 68   ILE D N   1 
ATOM   3276 C  CA  . ILE D 1 68  ? 23.633  29.176  -6.853  1.00 50.33  ? 68   ILE D CA  1 
ATOM   3277 C  C   . ILE D 1 68  ? 24.992  29.255  -7.537  1.00 54.97  ? 68   ILE D C   1 
ATOM   3278 O  O   . ILE D 1 68  ? 25.187  28.688  -8.616  1.00 58.75  ? 68   ILE D O   1 
ATOM   3279 C  CB  . ILE D 1 68  ? 23.714  28.225  -5.635  1.00 46.36  ? 68   ILE D CB  1 
ATOM   3280 C  CG1 . ILE D 1 68  ? 24.299  26.863  -6.038  1.00 47.30  ? 68   ILE D CG1 1 
ATOM   3281 C  CG2 . ILE D 1 68  ? 22.336  28.055  -5.006  1.00 41.89  ? 68   ILE D CG2 1 
ATOM   3282 C  CD1 . ILE D 1 68  ? 24.657  25.976  -4.868  1.00 43.67  ? 68   ILE D CD1 1 
ATOM   3283 N  N   . GLU D 1 69  ? 25.923  29.964  -6.911  1.00 54.98  ? 69   GLU D N   1 
ATOM   3284 C  CA  . GLU D 1 69  ? 27.315  29.915  -7.324  1.00 59.30  ? 69   GLU D CA  1 
ATOM   3285 C  C   . GLU D 1 69  ? 27.983  28.752  -6.543  1.00 56.57  ? 69   GLU D C   1 
ATOM   3286 O  O   . GLU D 1 69  ? 28.352  28.901  -5.375  1.00 53.41  ? 69   GLU D O   1 
ATOM   3287 C  CB  . GLU D 1 69  ? 27.984  31.279  -7.091  1.00 61.58  ? 69   GLU D CB  1 
ATOM   3288 C  CG  . GLU D 1 69  ? 29.292  31.473  -7.859  1.00 68.46  ? 69   GLU D CG  1 
ATOM   3289 C  CD  . GLU D 1 69  ? 29.710  32.932  -7.965  1.00 73.18  ? 69   GLU D CD  1 
ATOM   3290 O  OE1 . GLU D 1 69  ? 29.029  33.710  -8.684  1.00 76.90  ? 69   GLU D OE1 1 
ATOM   3291 O  OE2 . GLU D 1 69  ? 30.740  33.292  -7.353  1.00 75.98  ? 69   GLU D OE2 1 
ATOM   3292 N  N   . VAL D 1 70  ? 28.110  27.595  -7.207  1.00 58.38  ? 70   VAL D N   1 
ATOM   3293 C  CA  . VAL D 1 70  ? 28.491  26.316  -6.565  1.00 55.93  ? 70   VAL D CA  1 
ATOM   3294 C  C   . VAL D 1 70  ? 29.811  26.371  -5.794  1.00 55.68  ? 70   VAL D C   1 
ATOM   3295 O  O   . VAL D 1 70  ? 29.966  25.701  -4.771  1.00 52.75  ? 70   VAL D O   1 
ATOM   3296 C  CB  . VAL D 1 70  ? 28.586  25.152  -7.608  1.00 60.12  ? 70   VAL D CB  1 
ATOM   3297 C  CG1 . VAL D 1 70  ? 29.287  23.913  -7.003  1.00 57.91  ? 70   VAL D CG1 1 
ATOM   3298 C  CG2 . VAL D 1 70  ? 27.209  24.780  -8.148  1.00 59.43  ? 70   VAL D CG2 1 
ATOM   3299 N  N   . SER D 1 71  ? 30.759  27.157  -6.294  1.00 60.31  ? 71   SER D N   1 
ATOM   3300 C  CA  . SER D 1 71  ? 32.080  27.279  -5.678  1.00 61.30  ? 71   SER D CA  1 
ATOM   3301 C  C   . SER D 1 71  ? 31.995  27.847  -4.265  1.00 57.02  ? 71   SER D C   1 
ATOM   3302 O  O   . SER D 1 71  ? 32.750  27.434  -3.373  1.00 55.61  ? 71   SER D O   1 
ATOM   3303 C  CB  . SER D 1 71  ? 32.977  28.177  -6.534  1.00 68.42  ? 71   SER D CB  1 
ATOM   3304 O  OG  . SER D 1 71  ? 32.392  29.456  -6.713  1.00 68.86  ? 71   SER D OG  1 
ATOM   3305 N  N   . GLN D 1 72  ? 31.057  28.775  -4.075  1.00 55.06  ? 72   GLN D N   1 
ATOM   3306 C  CA  . GLN D 1 72  ? 30.918  29.517  -2.826  1.00 52.51  ? 72   GLN D CA  1 
ATOM   3307 C  C   . GLN D 1 72  ? 30.330  28.668  -1.704  1.00 46.84  ? 72   GLN D C   1 
ATOM   3308 O  O   . GLN D 1 72  ? 30.249  29.128  -0.568  1.00 44.92  ? 72   GLN D O   1 
ATOM   3309 C  CB  . GLN D 1 72  ? 30.038  30.763  -3.037  1.00 53.45  ? 72   GLN D CB  1 
ATOM   3310 C  CG  . GLN D 1 72  ? 30.559  31.769  -4.082  1.00 59.99  ? 72   GLN D CG  1 
ATOM   3311 C  CD  . GLN D 1 72  ? 31.861  32.454  -3.664  1.00 65.32  ? 72   GLN D CD  1 
ATOM   3312 O  OE1 . GLN D 1 72  ? 32.062  32.771  -2.494  1.00 64.82  ? 72   GLN D OE1 1 
ATOM   3313 N  NE2 . GLN D 1 72  ? 32.742  32.693  -4.630  1.00 72.12  ? 72   GLN D NE2 1 
ATOM   3314 N  N   . LEU D 1 73  ? 29.904  27.446  -2.024  1.00 44.79  ? 73   LEU D N   1 
ATOM   3315 C  CA  . LEU D 1 73  ? 29.465  26.496  -1.006  1.00 40.70  ? 73   LEU D CA  1 
ATOM   3316 C  C   . LEU D 1 73  ? 30.561  26.250  0.010   1.00 40.61  ? 73   LEU D C   1 
ATOM   3317 O  O   . LEU D 1 73  ? 30.271  26.056  1.188   1.00 38.66  ? 73   LEU D O   1 
ATOM   3318 C  CB  . LEU D 1 73  ? 29.047  25.167  -1.631  1.00 39.85  ? 73   LEU D CB  1 
ATOM   3319 C  CG  . LEU D 1 73  ? 27.765  25.137  -2.460  1.00 40.38  ? 73   LEU D CG  1 
ATOM   3320 C  CD1 . LEU D 1 73  ? 27.548  23.723  -2.953  1.00 40.91  ? 73   LEU D CD1 1 
ATOM   3321 C  CD2 . LEU D 1 73  ? 26.563  25.627  -1.656  1.00 36.57  ? 73   LEU D CD2 1 
ATOM   3322 N  N   . LEU D 1 74  ? 31.818  26.268  -0.439  1.00 44.20  ? 74   LEU D N   1 
ATOM   3323 C  CA  . LEU D 1 74  ? 32.959  26.022  0.447   1.00 44.67  ? 74   LEU D CA  1 
ATOM   3324 C  C   . LEU D 1 74  ? 33.089  27.071  1.561   1.00 44.96  ? 74   LEU D C   1 
ATOM   3325 O  O   . LEU D 1 74  ? 33.687  26.793  2.606   1.00 43.93  ? 74   LEU D O   1 
ATOM   3326 C  CB  . LEU D 1 74  ? 34.265  25.923  -0.350  1.00 49.68  ? 74   LEU D CB  1 
ATOM   3327 C  CG  . LEU D 1 74  ? 34.395  24.725  -1.305  1.00 51.21  ? 74   LEU D CG  1 
ATOM   3328 C  CD1 . LEU D 1 74  ? 35.751  24.716  -1.974  1.00 57.14  ? 74   LEU D CD1 1 
ATOM   3329 C  CD2 . LEU D 1 74  ? 34.168  23.412  -0.587  1.00 47.87  ? 74   LEU D CD2 1 
ATOM   3330 N  N   . LYS D 1 75  ? 32.524  28.261  1.338   1.00 46.00  ? 75   LYS D N   1 
ATOM   3331 C  CA  . LYS D 1 75  ? 32.422  29.282  2.388   1.00 46.75  ? 75   LYS D CA  1 
ATOM   3332 C  C   . LYS D 1 75  ? 31.119  29.178  3.200   1.00 42.74  ? 75   LYS D C   1 
ATOM   3333 O  O   . LYS D 1 75  ? 30.897  29.978  4.113   1.00 43.81  ? 75   LYS D O   1 
ATOM   3334 C  CB  . LYS D 1 75  ? 32.538  30.679  1.781   1.00 51.38  ? 75   LYS D CB  1 
ATOM   3335 C  CG  . LYS D 1 75  ? 33.931  31.014  1.272   1.00 57.35  ? 75   LYS D CG  1 
ATOM   3336 C  CD  . LYS D 1 75  ? 33.952  32.373  0.622   1.00 62.66  ? 75   LYS D CD  1 
ATOM   3337 C  CE  . LYS D 1 75  ? 35.365  32.833  0.321   1.00 70.04  ? 75   LYS D CE  1 
ATOM   3338 N  NZ  . LYS D 1 75  ? 35.380  34.272  -0.050  1.00 76.42  ? 75   LYS D NZ  1 
ATOM   3339 N  N   . GLY D 1 76  ? 30.275  28.188  2.884   1.00 38.65  ? 76   GLY D N   1 
ATOM   3340 C  CA  . GLY D 1 76  ? 28.968  28.031  3.526   1.00 34.91  ? 76   GLY D CA  1 
ATOM   3341 C  C   . GLY D 1 76  ? 27.890  28.877  2.878   1.00 34.93  ? 76   GLY D C   1 
ATOM   3342 O  O   . GLY D 1 76  ? 26.786  28.984  3.408   1.00 33.11  ? 76   GLY D O   1 
ATOM   3343 N  N   . ASP D 1 77  ? 28.215  29.470  1.728   1.00 36.69  ? 77   ASP D N   1 
ATOM   3344 C  CA  . ASP D 1 77  ? 27.290  30.280  0.952   1.00 37.13  ? 77   ASP D CA  1 
ATOM   3345 C  C   . ASP D 1 77  ? 26.502  29.407  -0.036  1.00 35.15  ? 77   ASP D C   1 
ATOM   3346 O  O   . ASP D 1 77  ? 27.051  28.959  -1.051  1.00 36.80  ? 77   ASP D O   1 
ATOM   3347 C  CB  . ASP D 1 77  ? 28.078  31.358  0.196   1.00 41.40  ? 77   ASP D CB  1 
ATOM   3348 C  CG  . ASP D 1 77  ? 27.190  32.380  -0.485  1.00 43.16  ? 77   ASP D CG  1 
ATOM   3349 O  OD1 . ASP D 1 77  ? 25.946  32.267  -0.402  1.00 42.17  ? 77   ASP D OD1 1 
ATOM   3350 O  OD2 . ASP D 1 77  ? 27.751  33.309  -1.108  1.00 46.64  ? 77   ASP D OD2 1 
ATOM   3351 N  N   . ALA D 1 78  ? 25.225  29.184  0.279   1.00 32.42  ? 78   ALA D N   1 
ATOM   3352 C  CA  . ALA D 1 78  ? 24.281  28.473  -0.584  1.00 32.18  ? 78   ALA D CA  1 
ATOM   3353 C  C   . ALA D 1 78  ? 23.196  29.410  -1.154  1.00 32.97  ? 78   ALA D C   1 
ATOM   3354 O  O   . ALA D 1 78  ? 22.149  28.935  -1.581  1.00 32.32  ? 78   ALA D O   1 
ATOM   3355 C  CB  . ALA D 1 78  ? 23.625  27.344  0.179   1.00 29.81  ? 78   ALA D CB  1 
ATOM   3356 N  N   . SER D 1 79  ? 23.470  30.717  -1.191  1.00 34.58  ? 79   SER D N   1 
ATOM   3357 C  CA  . SER D 1 79  ? 22.468  31.728  -1.582  1.00 35.76  ? 79   SER D CA  1 
ATOM   3358 C  C   . SER D 1 79  ? 21.874  31.503  -2.977  1.00 37.40  ? 79   SER D C   1 
ATOM   3359 O  O   . SER D 1 79  ? 22.587  31.187  -3.925  1.00 39.36  ? 79   SER D O   1 
ATOM   3360 C  CB  . SER D 1 79  ? 23.055  33.147  -1.496  1.00 38.01  ? 79   SER D CB  1 
ATOM   3361 O  OG  . SER D 1 79  ? 23.537  33.434  -0.188  1.00 37.54  ? 79   SER D OG  1 
ATOM   3362 N  N   . LEU D 1 80  ? 20.557  31.680  -3.084  1.00 36.99  ? 80   LEU D N   1 
ATOM   3363 C  CA  . LEU D 1 80  ? 19.834  31.464  -4.332  1.00 39.40  ? 80   LEU D CA  1 
ATOM   3364 C  C   . LEU D 1 80  ? 19.722  32.770  -5.124  1.00 42.13  ? 80   LEU D C   1 
ATOM   3365 O  O   . LEU D 1 80  ? 19.354  33.810  -4.567  1.00 41.46  ? 80   LEU D O   1 
ATOM   3366 C  CB  . LEU D 1 80  ? 18.432  30.914  -4.027  1.00 38.02  ? 80   LEU D CB  1 
ATOM   3367 C  CG  . LEU D 1 80  ? 17.613  30.359  -5.195  1.00 40.65  ? 80   LEU D CG  1 
ATOM   3368 C  CD1 . LEU D 1 80  ? 18.378  29.286  -5.976  1.00 41.23  ? 80   LEU D CD1 1 
ATOM   3369 C  CD2 . LEU D 1 80  ? 16.304  29.806  -4.671  1.00 40.25  ? 80   LEU D CD2 1 
ATOM   3370 N  N   . LYS D 1 81  ? 20.037  32.702  -6.419  1.00 46.02  ? 81   LYS D N   1 
ATOM   3371 C  CA  . LYS D 1 81  ? 19.927  33.841  -7.334  1.00 49.73  ? 81   LYS D CA  1 
ATOM   3372 C  C   . LYS D 1 81  ? 18.870  33.566  -8.405  1.00 51.93  ? 81   LYS D C   1 
ATOM   3373 O  O   . LYS D 1 81  ? 18.804  32.475  -8.971  1.00 52.90  ? 81   LYS D O   1 
ATOM   3374 C  CB  . LYS D 1 81  ? 21.257  34.119  -8.042  1.00 53.64  ? 81   LYS D CB  1 
ATOM   3375 C  CG  . LYS D 1 81  ? 22.426  34.514  -7.147  1.00 53.92  ? 81   LYS D CG  1 
ATOM   3376 C  CD  . LYS D 1 81  ? 23.598  35.010  -8.007  1.00 59.26  ? 81   LYS D CD  1 
ATOM   3377 C  CE  . LYS D 1 81  ? 24.922  35.006  -7.256  1.00 60.24  ? 81   LYS D CE  1 
ATOM   3378 N  NZ  . LYS D 1 81  ? 26.086  35.282  -8.165  1.00 66.87  ? 81   LYS D NZ  1 
ATOM   3379 N  N   . MET D 1 82  ? 18.047  34.568  -8.683  1.00 53.32  ? 82   MET D N   1 
ATOM   3380 C  CA  . MET D 1 82  ? 17.047  34.461  -9.741  1.00 56.43  ? 82   MET D CA  1 
ATOM   3381 C  C   . MET D 1 82  ? 16.719  35.838  -10.304 1.00 58.96  ? 82   MET D C   1 
ATOM   3382 O  O   . MET D 1 82  ? 16.938  36.856  -9.637  1.00 57.42  ? 82   MET D O   1 
ATOM   3383 C  CB  . MET D 1 82  ? 15.782  33.785  -9.201  1.00 53.90  ? 82   MET D CB  1 
ATOM   3384 C  CG  . MET D 1 82  ? 14.971  34.647  -8.241  1.00 51.17  ? 82   MET D CG  1 
ATOM   3385 S  SD  . MET D 1 82  ? 13.601  33.742  -7.515  1.00 51.56  ? 82   MET D SD  1 
ATOM   3386 C  CE  . MET D 1 82  ? 14.476  32.685  -6.374  1.00 47.40  ? 82   MET D CE  1 
ATOM   3387 N  N   . ASP D 1 83  ? 16.195  35.855  -11.532 1.00 63.11  ? 83   ASP D N   1 
ATOM   3388 C  CA  . ASP D 1 83  ? 15.732  37.088  -12.170 1.00 66.14  ? 83   ASP D CA  1 
ATOM   3389 C  C   . ASP D 1 83  ? 14.483  37.626  -11.484 1.00 62.93  ? 83   ASP D C   1 
ATOM   3390 O  O   . ASP D 1 83  ? 13.744  36.880  -10.844 1.00 60.07  ? 83   ASP D O   1 
ATOM   3391 C  CB  . ASP D 1 83  ? 15.412  36.857  -13.652 1.00 72.29  ? 83   ASP D CB  1 
ATOM   3392 C  CG  . ASP D 1 83  ? 16.640  36.549  -14.478 1.00 76.91  ? 83   ASP D CG  1 
ATOM   3393 O  OD1 . ASP D 1 83  ? 17.663  36.108  -13.903 1.00 76.78  ? 83   ASP D OD1 1 
ATOM   3394 O  OD2 . ASP D 1 83  ? 16.576  36.734  -15.709 1.00 82.67  ? 83   ASP D OD2 1 
ATOM   3395 N  N   . LYS D 1 84  ? 14.240  38.922  -11.653 1.00 64.50  ? 84   LYS D N   1 
ATOM   3396 C  CA  . LYS D 1 84  ? 13.053  39.559  -11.087 1.00 62.36  ? 84   LYS D CA  1 
ATOM   3397 C  C   . LYS D 1 84  ? 11.767  38.841  -11.496 1.00 62.87  ? 84   LYS D C   1 
ATOM   3398 O  O   . LYS D 1 84  ? 10.817  38.773  -10.718 1.00 60.27  ? 84   LYS D O   1 
ATOM   3399 C  CB  . LYS D 1 84  ? 12.986  41.028  -11.496 1.00 65.28  ? 84   LYS D CB  1 
ATOM   3400 C  CG  . LYS D 1 84  ? 12.814  41.282  -12.996 1.00 70.69  ? 84   LYS D CG  1 
ATOM   3401 C  CD  . LYS D 1 84  ? 12.815  42.762  -13.271 1.00 73.84  ? 84   LYS D CD  1 
ATOM   3402 C  CE  . LYS D 1 84  ? 12.604  43.073  -14.749 1.00 79.66  ? 84   LYS D CE  1 
ATOM   3403 N  NZ  . LYS D 1 84  ? 12.317  44.515  -14.920 1.00 82.65  ? 84   LYS D NZ  1 
ATOM   3404 N  N   . SER D 1 85  ? 11.767  38.281  -12.704 1.00 67.05  ? 85   SER D N   1 
ATOM   3405 C  CA  . SER D 1 85  ? 10.582  37.647  -13.287 1.00 69.75  ? 85   SER D CA  1 
ATOM   3406 C  C   . SER D 1 85  ? 10.117  36.454  -12.461 1.00 66.74  ? 85   SER D C   1 
ATOM   3407 O  O   . SER D 1 85  ? 8.926   36.329  -12.149 1.00 66.40  ? 85   SER D O   1 
ATOM   3408 C  CB  . SER D 1 85  ? 10.888  37.208  -14.723 1.00 75.95  ? 85   SER D CB  1 
ATOM   3409 O  OG  . SER D 1 85  ? 12.108  38.069  -15.279 1.00 79.25  ? 85   SER D OG  1 
ATOM   3410 N  N   . ASP D 1 86  ? 11.071  35.590  -12.110 1.00 64.87  ? 86   ASP D N   1 
ATOM   3411 C  CA  . ASP D 1 86  ? 10.831  34.453  -11.221 1.00 62.05  ? 86   ASP D CA  1 
ATOM   3412 C  C   . ASP D 1 86  ? 10.591  34.919  -9.788  1.00 57.12  ? 86   ASP D C   1 
ATOM   3413 O  O   . ASP D 1 86  ? 9.836   34.287  -9.047  1.00 56.18  ? 86   ASP D O   1 
ATOM   3414 C  CB  . ASP D 1 86  ? 12.030  33.492  -11.225 1.00 61.37  ? 86   ASP D CB  1 
ATOM   3415 C  CG  . ASP D 1 86  ? 12.288  32.872  -12.586 1.00 66.76  ? 86   ASP D CG  1 
ATOM   3416 O  OD1 . ASP D 1 86  ? 11.405  32.942  -13.470 1.00 69.58  ? 86   ASP D OD1 1 
ATOM   3417 O  OD2 . ASP D 1 86  ? 13.387  32.310  -12.765 1.00 65.40  ? 86   ASP D OD2 1 
ATOM   3418 N  N   . ALA D 1 87  ? 11.254  36.006  -9.398  1.00 55.14  ? 87   ALA D N   1 
ATOM   3419 C  CA  . ALA D 1 87  ? 11.049  36.607  -8.078  1.00 51.68  ? 87   ALA D CA  1 
ATOM   3420 C  C   . ALA D 1 87  ? 9.579   37.006  -7.859  1.00 52.25  ? 87   ALA D C   1 
ATOM   3421 O  O   . ALA D 1 87  ? 8.901   36.398  -7.040  1.00 50.60  ? 87   ALA D O   1 
ATOM   3422 C  CB  . ALA D 1 87  ? 11.965  37.814  -7.893  1.00 51.49  ? 87   ALA D CB  1 
ATOM   3423 N  N   . VAL D 1 88  ? 9.089   37.994  -8.616  1.00 54.50  ? 88   VAL D N   1 
ATOM   3424 C  CA  . VAL D 1 88  ? 7.733   38.552  -8.395  1.00 55.81  ? 88   VAL D CA  1 
ATOM   3425 C  C   . VAL D 1 88  ? 6.635   37.481  -8.323  1.00 57.24  ? 88   VAL D C   1 
ATOM   3426 O  O   . VAL D 1 88  ? 5.702   37.583  -7.520  1.00 57.10  ? 88   VAL D O   1 
ATOM   3427 C  CB  . VAL D 1 88  ? 7.322   39.598  -9.485  1.00 59.01  ? 88   VAL D CB  1 
ATOM   3428 C  CG1 . VAL D 1 88  ? 8.289   40.773  -9.503  1.00 59.08  ? 88   VAL D CG1 1 
ATOM   3429 C  CG2 . VAL D 1 88  ? 7.217   38.954  -10.866 1.00 62.36  ? 88   VAL D CG2 1 
ATOM   3430 N  N   . SER D 1 89  ? 6.759   36.456  -9.162  1.00 59.56  ? 89   SER D N   1 
ATOM   3431 C  CA  . SER D 1 89  ? 5.786   35.368  -9.214  1.00 62.06  ? 89   SER D CA  1 
ATOM   3432 C  C   . SER D 1 89  ? 5.925   34.383  -8.042  1.00 59.61  ? 89   SER D C   1 
ATOM   3433 O  O   . SER D 1 89  ? 5.099   33.477  -7.911  1.00 62.60  ? 89   SER D O   1 
ATOM   3434 C  CB  . SER D 1 89  ? 5.903   34.623  -10.554 1.00 66.47  ? 89   SER D CB  1 
ATOM   3435 O  OG  . SER D 1 89  ? 7.257   34.309  -10.856 1.00 65.31  ? 89   SER D OG  1 
ATOM   3436 N  N   . HIS D 1 90  ? 6.939   34.564  -7.190  1.00 55.27  ? 90   HIS D N   1 
ATOM   3437 C  CA  . HIS D 1 90  ? 7.222   33.616  -6.101  1.00 52.75  ? 90   HIS D CA  1 
ATOM   3438 C  C   . HIS D 1 90  ? 7.675   34.262  -4.778  1.00 49.11  ? 90   HIS D C   1 
ATOM   3439 O  O   . HIS D 1 90  ? 8.677   33.839  -4.183  1.00 46.23  ? 90   HIS D O   1 
ATOM   3440 C  CB  . HIS D 1 90  ? 8.280   32.606  -6.548  1.00 52.33  ? 90   HIS D CB  1 
ATOM   3441 C  CG  . HIS D 1 90  ? 7.900   31.817  -7.760  1.00 56.96  ? 90   HIS D CG  1 
ATOM   3442 N  ND1 . HIS D 1 90  ? 8.566   31.933  -8.962  1.00 59.12  ? 90   HIS D ND1 1 
ATOM   3443 C  CD2 . HIS D 1 90  ? 6.930   30.894  -7.955  1.00 61.64  ? 90   HIS D CD2 1 
ATOM   3444 C  CE1 . HIS D 1 90  ? 8.022   31.116  -9.844  1.00 64.55  ? 90   HIS D CE1 1 
ATOM   3445 N  NE2 . HIS D 1 90  ? 7.024   30.478  -9.261  1.00 66.61  ? 90   HIS D NE2 1 
ATOM   3446 N  N   . THR D 1 91  ? 6.940   35.267  -4.302  1.00 49.23  ? 91   THR D N   1 
ATOM   3447 C  CA  . THR D 1 91  ? 7.255   35.862  -2.999  1.00 47.15  ? 91   THR D CA  1 
ATOM   3448 C  C   . THR D 1 91  ? 6.791   34.950  -1.868  1.00 47.57  ? 91   THR D C   1 
ATOM   3449 O  O   . THR D 1 91  ? 5.880   34.134  -2.042  1.00 50.39  ? 91   THR D O   1 
ATOM   3450 C  CB  . THR D 1 91  ? 6.630   37.267  -2.814  1.00 47.98  ? 91   THR D CB  1 
ATOM   3451 O  OG1 . THR D 1 91  ? 5.228   37.204  -3.079  1.00 51.17  ? 91   THR D OG1 1 
ATOM   3452 C  CG2 . THR D 1 91  ? 7.293   38.271  -3.743  1.00 47.25  ? 91   THR D CG2 1 
ATOM   3453 N  N   . GLY D 1 92  ? 7.415   35.100  -0.709  1.00 45.58  ? 92   GLY D N   1 
ATOM   3454 C  CA  . GLY D 1 92  ? 7.062   34.308  0.460   1.00 46.88  ? 92   GLY D CA  1 
ATOM   3455 C  C   . GLY D 1 92  ? 8.221   33.473  0.972   1.00 44.31  ? 92   GLY D C   1 
ATOM   3456 O  O   . GLY D 1 92  ? 9.389   33.756  0.689   1.00 41.63  ? 92   GLY D O   1 
ATOM   3457 N  N   . ASN D 1 93  ? 7.878   32.415  1.702   1.00 46.09  ? 93   ASN D N   1 
ATOM   3458 C  CA  . ASN D 1 93  ? 8.840   31.675  2.517   1.00 44.54  ? 93   ASN D CA  1 
ATOM   3459 C  C   . ASN D 1 93  ? 9.686   30.651  1.751   1.00 42.68  ? 93   ASN D C   1 
ATOM   3460 O  O   . ASN D 1 93  ? 9.161   29.690  1.180   1.00 44.74  ? 93   ASN D O   1 
ATOM   3461 C  CB  . ASN D 1 93  ? 8.109   30.988  3.683   1.00 48.13  ? 93   ASN D CB  1 
ATOM   3462 C  CG  . ASN D 1 93  ? 7.864   31.931  4.854   1.00 51.43  ? 93   ASN D CG  1 
ATOM   3463 O  OD1 . ASN D 1 93  ? 8.815   32.433  5.458   1.00 52.87  ? 93   ASN D OD1 1 
ATOM   3464 N  ND2 . ASN D 1 93  ? 6.587   32.167  5.189   1.00 58.18  ? 93   ASN D ND2 1 
ATOM   3465 N  N   . TYR D 1 94  ? 10.998  30.865  1.760   1.00 39.41  ? 94   TYR D N   1 
ATOM   3466 C  CA  . TYR D 1 94  ? 11.951  29.916  1.170   1.00 37.48  ? 94   TYR D CA  1 
ATOM   3467 C  C   . TYR D 1 94  ? 12.690  29.152  2.267   1.00 35.96  ? 94   TYR D C   1 
ATOM   3468 O  O   . TYR D 1 94  ? 13.049  29.727  3.288   1.00 34.77  ? 94   TYR D O   1 
ATOM   3469 C  CB  . TYR D 1 94  ? 12.948  30.650  0.280   1.00 35.92  ? 94   TYR D CB  1 
ATOM   3470 C  CG  . TYR D 1 94  ? 12.382  31.079  -1.051  1.00 38.12  ? 94   TYR D CG  1 
ATOM   3471 C  CD1 . TYR D 1 94  ? 12.491  30.262  -2.177  1.00 39.34  ? 94   TYR D CD1 1 
ATOM   3472 C  CD2 . TYR D 1 94  ? 11.725  32.308  -1.191  1.00 39.27  ? 94   TYR D CD2 1 
ATOM   3473 C  CE1 . TYR D 1 94  ? 11.968  30.655  -3.401  1.00 41.54  ? 94   TYR D CE1 1 
ATOM   3474 C  CE2 . TYR D 1 94  ? 11.201  32.708  -2.410  1.00 40.73  ? 94   TYR D CE2 1 
ATOM   3475 C  CZ  . TYR D 1 94  ? 11.328  31.881  -3.511  1.00 42.17  ? 94   TYR D CZ  1 
ATOM   3476 O  OH  . TYR D 1 94  ? 10.805  32.282  -4.717  1.00 45.30  ? 94   TYR D OH  1 
ATOM   3477 N  N   . THR D 1 95  ? 12.889  27.855  2.045   1.00 36.18  ? 95   THR D N   1 
ATOM   3478 C  CA  . THR D 1 95  ? 13.770  27.037  2.868   1.00 35.06  ? 95   THR D CA  1 
ATOM   3479 C  C   . THR D 1 95  ? 15.017  26.644  2.082   1.00 33.24  ? 95   THR D C   1 
ATOM   3480 O  O   . THR D 1 95  ? 14.927  26.071  0.999   1.00 34.44  ? 95   THR D O   1 
ATOM   3481 C  CB  . THR D 1 95  ? 13.093  25.743  3.351   1.00 37.37  ? 95   THR D CB  1 
ATOM   3482 O  OG1 . THR D 1 95  ? 11.877  26.060  4.025   1.00 40.06  ? 95   THR D OG1 1 
ATOM   3483 C  CG2 . THR D 1 95  ? 14.022  24.980  4.313   1.00 35.99  ? 95   THR D CG2 1 
ATOM   3484 N  N   . CYS D 1 96  ? 16.170  26.960  2.650   1.00 31.58  ? 96   CYS D N   1 
ATOM   3485 C  CA  . CYS D 1 96  ? 17.461  26.493  2.148   1.00 30.46  ? 96   CYS D CA  1 
ATOM   3486 C  C   . CYS D 1 96  ? 17.967  25.360  3.045   1.00 30.48  ? 96   CYS D C   1 
ATOM   3487 O  O   . CYS D 1 96  ? 18.108  25.527  4.269   1.00 30.81  ? 96   CYS D O   1 
ATOM   3488 C  CB  . CYS D 1 96  ? 18.435  27.660  2.133   1.00 29.46  ? 96   CYS D CB  1 
ATOM   3489 S  SG  . CYS D 1 96  ? 20.171  27.265  1.861   1.00 28.52  ? 96   CYS D SG  1 
ATOM   3490 N  N   . GLU D 1 97  ? 18.205  24.201  2.435   1.00 30.78  ? 97   GLU D N   1 
ATOM   3491 C  CA  . GLU D 1 97  ? 18.706  23.021  3.126   1.00 30.28  ? 97   GLU D CA  1 
ATOM   3492 C  C   . GLU D 1 97  ? 20.073  22.686  2.552   1.00 28.80  ? 97   GLU D C   1 
ATOM   3493 O  O   . GLU D 1 97  ? 20.190  22.519  1.349   1.00 29.91  ? 97   GLU D O   1 
ATOM   3494 C  CB  . GLU D 1 97  ? 17.756  21.850  2.882   1.00 33.07  ? 97   GLU D CB  1 
ATOM   3495 C  CG  . GLU D 1 97  ? 18.054  20.606  3.683   1.00 34.36  ? 97   GLU D CG  1 
ATOM   3496 C  CD  . GLU D 1 97  ? 17.531  19.364  2.998   1.00 38.35  ? 97   GLU D CD  1 
ATOM   3497 O  OE1 . GLU D 1 97  ? 16.496  18.837  3.442   1.00 44.92  ? 97   GLU D OE1 1 
ATOM   3498 O  OE2 . GLU D 1 97  ? 18.140  18.930  1.995   1.00 41.46  ? 97   GLU D OE2 1 
ATOM   3499 N  N   . VAL D 1 98  ? 21.090  22.618  3.412   1.00 26.90  ? 98   VAL D N   1 
ATOM   3500 C  CA  . VAL D 1 98  ? 22.448  22.224  3.025   1.00 25.68  ? 98   VAL D CA  1 
ATOM   3501 C  C   . VAL D 1 98  ? 22.825  20.913  3.725   1.00 25.28  ? 98   VAL D C   1 
ATOM   3502 O  O   . VAL D 1 98  ? 22.602  20.749  4.928   1.00 24.52  ? 98   VAL D O   1 
ATOM   3503 C  CB  . VAL D 1 98  ? 23.494  23.306  3.386   1.00 24.71  ? 98   VAL D CB  1 
ATOM   3504 C  CG1 . VAL D 1 98  ? 24.888  22.869  2.968   1.00 25.06  ? 98   VAL D CG1 1 
ATOM   3505 C  CG2 . VAL D 1 98  ? 23.133  24.663  2.733   1.00 24.54  ? 98   VAL D CG2 1 
ATOM   3506 N  N   . THR D 1 99  ? 23.379  19.983  2.953   1.00 26.14  ? 99   THR D N   1 
ATOM   3507 C  CA  . THR D 1 99  ? 23.891  18.728  3.480   1.00 26.40  ? 99   THR D CA  1 
ATOM   3508 C  C   . THR D 1 99  ? 25.368  18.568  3.111   1.00 26.05  ? 99   THR D C   1 
ATOM   3509 O  O   . THR D 1 99  ? 25.776  18.850  1.983   1.00 26.33  ? 99   THR D O   1 
ATOM   3510 C  CB  . THR D 1 99  ? 23.100  17.524  2.911   1.00 29.27  ? 99   THR D CB  1 
ATOM   3511 O  OG1 . THR D 1 99  ? 21.697  17.723  3.128   1.00 31.49  ? 99   THR D OG1 1 
ATOM   3512 C  CG2 . THR D 1 99  ? 23.551  16.191  3.556   1.00 29.36  ? 99   THR D CG2 1 
ATOM   3513 N  N   . GLU D 1 100 ? 26.170  18.121  4.077   1.00 25.29  ? 100  GLU D N   1 
ATOM   3514 C  CA  . GLU D 1 100 ? 27.521  17.692  3.788   1.00 25.21  ? 100  GLU D CA  1 
ATOM   3515 C  C   . GLU D 1 100 ? 27.505  16.186  3.800   1.00 26.55  ? 100  GLU D C   1 
ATOM   3516 O  O   . GLU D 1 100 ? 27.210  15.559  4.814   1.00 26.15  ? 100  GLU D O   1 
ATOM   3517 C  CB  . GLU D 1 100 ? 28.503  18.236  4.805   1.00 24.47  ? 100  GLU D CB  1 
ATOM   3518 C  CG  . GLU D 1 100 ? 28.591  19.748  4.755   1.00 22.82  ? 100  GLU D CG  1 
ATOM   3519 C  CD  . GLU D 1 100 ? 29.649  20.287  5.677   1.00 23.95  ? 100  GLU D CD  1 
ATOM   3520 O  OE1 . GLU D 1 100 ? 30.196  21.375  5.398   1.00 27.26  ? 100  GLU D OE1 1 
ATOM   3521 O  OE2 . GLU D 1 100 ? 29.922  19.615  6.681   1.00 20.15  ? 100  GLU D OE2 1 
ATOM   3522 N  N   . LEU D 1 101 ? 27.813  15.620  2.644   1.00 29.72  ? 101  LEU D N   1 
ATOM   3523 C  CA  . LEU D 1 101 ? 27.612  14.213  2.398   1.00 30.99  ? 101  LEU D CA  1 
ATOM   3524 C  C   . LEU D 1 101 ? 28.660  13.440  3.163   1.00 29.19  ? 101  LEU D C   1 
ATOM   3525 O  O   . LEU D 1 101 ? 29.725  13.974  3.485   1.00 26.24  ? 101  LEU D O   1 
ATOM   3526 C  CB  . LEU D 1 101 ? 27.720  13.906  0.895   1.00 31.77  ? 101  LEU D CB  1 
ATOM   3527 C  CG  . LEU D 1 101 ? 26.816  14.674  -0.075  1.00 34.47  ? 101  LEU D CG  1 
ATOM   3528 C  CD1 . LEU D 1 101 ? 27.134  14.288  -1.520  1.00 37.91  ? 101  LEU D CD1 1 
ATOM   3529 C  CD2 . LEU D 1 101 ? 25.333  14.447  0.221   1.00 38.28  ? 101  LEU D CD2 1 
ATOM   3530 N  N   . THR D 1 102 ? 28.335  12.190  3.465   1.00 31.32  ? 102  THR D N   1 
ATOM   3531 C  CA  . THR D 1 102 ? 29.299  11.249  4.016   1.00 30.86  ? 102  THR D CA  1 
ATOM   3532 C  C   . THR D 1 102 ? 30.577  11.177  3.178   1.00 28.09  ? 102  THR D C   1 
ATOM   3533 O  O   . THR D 1 102 ? 30.524  11.266  1.955   1.00 29.40  ? 102  THR D O   1 
ATOM   3534 C  CB  . THR D 1 102 ? 28.671  9.834   4.092   1.00 34.60  ? 102  THR D CB  1 
ATOM   3535 O  OG1 . THR D 1 102 ? 27.442  9.899   4.826   1.00 39.44  ? 102  THR D OG1 1 
ATOM   3536 C  CG2 . THR D 1 102 ? 29.612  8.856   4.753   1.00 32.85  ? 102  THR D CG2 1 
ATOM   3537 N  N   . ARG D 1 103 ? 31.720  11.038  3.851   1.00 27.23  ? 103  ARG D N   1 
ATOM   3538 C  CA  . ARG D 1 103 ? 33.019  10.766  3.206   1.00 26.22  ? 103  ARG D CA  1 
ATOM   3539 C  C   . ARG D 1 103 ? 33.588  9.485   3.799   1.00 25.46  ? 103  ARG D C   1 
ATOM   3540 O  O   . ARG D 1 103 ? 33.399  9.215   4.970   1.00 25.87  ? 103  ARG D O   1 
ATOM   3541 C  CB  . ARG D 1 103 ? 34.030  11.887  3.492   1.00 24.88  ? 103  ARG D CB  1 
ATOM   3542 C  CG  . ARG D 1 103 ? 33.820  13.196  2.768   1.00 28.65  ? 103  ARG D CG  1 
ATOM   3543 C  CD  . ARG D 1 103 ? 35.168  13.909  2.599   1.00 29.65  ? 103  ARG D CD  1 
ATOM   3544 N  NE  . ARG D 1 103 ? 35.743  14.298  3.876   1.00 32.89  ? 103  ARG D NE  1 
ATOM   3545 C  CZ  . ARG D 1 103 ? 36.990  14.743  4.041   1.00 34.61  ? 103  ARG D CZ  1 
ATOM   3546 N  NH1 . ARG D 1 103 ? 37.824  14.870  3.016   1.00 35.96  ? 103  ARG D NH1 1 
ATOM   3547 N  NH2 . ARG D 1 103 ? 37.403  15.068  5.251   1.00 36.05  ? 103  ARG D NH2 1 
ATOM   3548 N  N   . GLU D 1 104 ? 34.320  8.715   3.001   1.00 26.16  ? 104  GLU D N   1 
ATOM   3549 C  CA  . GLU D 1 104 ? 35.047  7.540   3.530   1.00 25.81  ? 104  GLU D CA  1 
ATOM   3550 C  C   . GLU D 1 104 ? 36.405  7.401   2.846   1.00 25.20  ? 104  GLU D C   1 
ATOM   3551 O  O   . GLU D 1 104 ? 36.689  8.050   1.843   1.00 25.07  ? 104  GLU D O   1 
ATOM   3552 C  CB  . GLU D 1 104 ? 34.238  6.246   3.325   1.00 29.11  ? 104  GLU D CB  1 
ATOM   3553 C  CG  . GLU D 1 104 ? 33.763  6.032   1.865   1.00 33.76  ? 104  GLU D CG  1 
ATOM   3554 C  CD  . GLU D 1 104 ? 33.537  4.571   1.479   1.00 39.32  ? 104  GLU D CD  1 
ATOM   3555 O  OE1 . GLU D 1 104 ? 33.874  3.660   2.266   1.00 41.93  ? 104  GLU D OE1 1 
ATOM   3556 O  OE2 . GLU D 1 104 ? 33.024  4.330   0.356   1.00 48.50  ? 104  GLU D OE2 1 
ATOM   3557 N  N   . GLY D 1 105 ? 37.233  6.534   3.416   1.00 24.14  ? 105  GLY D N   1 
ATOM   3558 C  CA  . GLY D 1 105 ? 38.453  6.091   2.782   1.00 24.89  ? 105  GLY D CA  1 
ATOM   3559 C  C   . GLY D 1 105 ? 38.932  4.887   3.566   1.00 23.75  ? 105  GLY D C   1 
ATOM   3560 O  O   . GLY D 1 105 ? 38.456  4.610   4.679   1.00 23.24  ? 105  GLY D O   1 
ATOM   3561 N  N   . GLU D 1 106 ? 39.866  4.160   2.990   1.00 25.16  ? 106  GLU D N   1 
ATOM   3562 C  CA  . GLU D 1 106 ? 40.479  3.053   3.696   1.00 24.07  ? 106  GLU D CA  1 
ATOM   3563 C  C   . GLU D 1 106 ? 41.921  2.880   3.265   1.00 24.44  ? 106  GLU D C   1 
ATOM   3564 O  O   . GLU D 1 106 ? 42.316  3.352   2.207   1.00 26.84  ? 106  GLU D O   1 
ATOM   3565 C  CB  . GLU D 1 106 ? 39.676  1.760   3.495   1.00 26.66  ? 106  GLU D CB  1 
ATOM   3566 C  CG  . GLU D 1 106 ? 39.766  1.121   2.120   1.00 31.70  ? 106  GLU D CG  1 
ATOM   3567 C  CD  . GLU D 1 106 ? 38.548  0.260   1.788   1.00 36.53  ? 106  GLU D CD  1 
ATOM   3568 O  OE1 . GLU D 1 106 ? 37.398  0.707   2.051   1.00 41.30  ? 106  GLU D OE1 1 
ATOM   3569 O  OE2 . GLU D 1 106 ? 38.730  -0.839  1.233   1.00 41.28  ? 106  GLU D OE2 1 
ATOM   3570 N  N   . THR D 1 107 ? 42.702  2.215   4.114   1.00 22.87  ? 107  THR D N   1 
ATOM   3571 C  CA  . THR D 1 107 ? 44.102  1.932   3.832   1.00 23.92  ? 107  THR D CA  1 
ATOM   3572 C  C   . THR D 1 107 ? 44.437  0.566   4.422   1.00 22.75  ? 107  THR D C   1 
ATOM   3573 O  O   . THR D 1 107 ? 43.736  0.068   5.307   1.00 20.71  ? 107  THR D O   1 
ATOM   3574 C  CB  . THR D 1 107 ? 45.016  3.048   4.419   1.00 24.22  ? 107  THR D CB  1 
ATOM   3575 O  OG1 . THR D 1 107 ? 46.304  3.009   3.793   1.00 27.41  ? 107  THR D OG1 1 
ATOM   3576 C  CG2 . THR D 1 107 ? 45.124  2.946   5.969   1.00 21.34  ? 107  THR D CG2 1 
ATOM   3577 N  N   . ILE D 1 108 ? 45.499  -0.025  3.905   1.00 24.35  ? 108  ILE D N   1 
ATOM   3578 C  CA  . ILE D 1 108 ? 45.904  -1.375  4.267   1.00 24.11  ? 108  ILE D CA  1 
ATOM   3579 C  C   . ILE D 1 108 ? 47.312  -1.365  4.821   1.00 23.85  ? 108  ILE D C   1 
ATOM   3580 O  O   . ILE D 1 108 ? 48.196  -0.701  4.279   1.00 26.45  ? 108  ILE D O   1 
ATOM   3581 C  CB  . ILE D 1 108 ? 45.798  -2.306  3.048   1.00 28.62  ? 108  ILE D CB  1 
ATOM   3582 C  CG1 . ILE D 1 108 ? 44.320  -2.612  2.764   1.00 30.24  ? 108  ILE D CG1 1 
ATOM   3583 C  CG2 . ILE D 1 108 ? 46.577  -3.592  3.245   1.00 28.53  ? 108  ILE D CG2 1 
ATOM   3584 C  CD1 . ILE D 1 108 ? 44.040  -2.881  1.298   1.00 35.53  ? 108  ILE D CD1 1 
ATOM   3585 N  N   . ILE D 1 109 ? 47.492  -2.058  5.950   1.00 21.55  ? 109  ILE D N   1 
ATOM   3586 C  CA  . ILE D 1 109 ? 48.792  -2.206  6.577   1.00 21.76  ? 109  ILE D CA  1 
ATOM   3587 C  C   . ILE D 1 109 ? 48.964  -3.678  6.802   1.00 20.84  ? 109  ILE D C   1 
ATOM   3588 O  O   . ILE D 1 109 ? 48.052  -4.351  7.286   1.00 19.89  ? 109  ILE D O   1 
ATOM   3589 C  CB  . ILE D 1 109 ? 48.903  -1.537  7.959   1.00 21.04  ? 109  ILE D CB  1 
ATOM   3590 C  CG1 . ILE D 1 109 ? 48.281  -0.149  7.953   1.00 21.73  ? 109  ILE D CG1 1 
ATOM   3591 C  CG2 . ILE D 1 109 ? 50.361  -1.489  8.389   1.00 22.37  ? 109  ILE D CG2 1 
ATOM   3592 C  CD1 . ILE D 1 109 ? 46.746  -0.121  8.105   1.00 21.10  ? 109  ILE D CD1 1 
ATOM   3593 N  N   . GLU D 1 110 ? 50.121  -4.188  6.396   1.00 22.48  ? 110  GLU D N   1 
ATOM   3594 C  CA  . GLU D 1 110 ? 50.483  -5.560  6.694   1.00 21.79  ? 110  GLU D CA  1 
ATOM   3595 C  C   . GLU D 1 110 ? 51.181  -5.632  8.039   1.00 19.84  ? 110  GLU D C   1 
ATOM   3596 O  O   . GLU D 1 110 ? 52.164  -4.923  8.277   1.00 20.67  ? 110  GLU D O   1 
ATOM   3597 C  CB  . GLU D 1 110 ? 51.434  -6.136  5.638   1.00 25.01  ? 110  GLU D CB  1 
ATOM   3598 C  CG  . GLU D 1 110 ? 51.585  -7.656  5.778   1.00 25.71  ? 110  GLU D CG  1 
ATOM   3599 C  CD  . GLU D 1 110 ? 52.542  -8.285  4.763   1.00 31.50  ? 110  GLU D CD  1 
ATOM   3600 O  OE1 . GLU D 1 110 ? 52.939  -7.613  3.778   1.00 39.04  ? 110  GLU D OE1 1 
ATOM   3601 O  OE2 . GLU D 1 110 ? 52.900  -9.465  4.961   1.00 32.28  ? 110  GLU D OE2 1 
ATOM   3602 N  N   . LEU D 1 111 ? 50.690  -6.521  8.887   1.00 18.50  ? 111  LEU D N   1 
ATOM   3603 C  CA  . LEU D 1 111 ? 51.319  -6.818  10.151  1.00 18.98  ? 111  LEU D CA  1 
ATOM   3604 C  C   . LEU D 1 111 ? 52.210  -8.018  9.895   1.00 19.81  ? 111  LEU D C   1 
ATOM   3605 O  O   . LEU D 1 111 ? 51.735  -9.064  9.434   1.00 20.02  ? 111  LEU D O   1 
ATOM   3606 C  CB  . LEU D 1 111 ? 50.291  -7.165  11.226  1.00 18.90  ? 111  LEU D CB  1 
ATOM   3607 C  CG  . LEU D 1 111 ? 50.873  -7.406  12.628  1.00 20.02  ? 111  LEU D CG  1 
ATOM   3608 C  CD1 . LEU D 1 111 ? 51.461  -6.149  13.243  1.00 22.65  ? 111  LEU D CD1 1 
ATOM   3609 C  CD2 . LEU D 1 111 ? 49.811  -8.003  13.550  1.00 21.03  ? 111  LEU D CD2 1 
ATOM   3610 N  N   . LYS D 1 112 ? 53.498  -7.849  10.178  1.00 21.69  ? 112  LYS D N   1 
ATOM   3611 C  CA  . LYS D 1 112 ? 54.461  -8.934  10.013  1.00 22.62  ? 112  LYS D CA  1 
ATOM   3612 C  C   . LYS D 1 112 ? 55.056  -9.251  11.371  1.00 22.84  ? 112  LYS D C   1 
ATOM   3613 O  O   . LYS D 1 112 ? 55.291  -8.348  12.169  1.00 23.65  ? 112  LYS D O   1 
ATOM   3614 C  CB  . LYS D 1 112 ? 55.555  -8.533  9.033   1.00 25.86  ? 112  LYS D CB  1 
ATOM   3615 C  CG  . LYS D 1 112 ? 55.074  -8.120  7.652   1.00 27.87  ? 112  LYS D CG  1 
ATOM   3616 C  CD  . LYS D 1 112 ? 56.214  -7.528  6.829   1.00 33.17  ? 112  LYS D CD  1 
ATOM   3617 C  CE  . LYS D 1 112 ? 55.912  -7.529  5.319   1.00 38.32  ? 112  LYS D CE  1 
ATOM   3618 N  NZ  . LYS D 1 112 ? 57.135  -7.335  4.464   1.00 47.02  ? 112  LYS D NZ  1 
ATOM   3619 N  N   . TYR D 1 113 ? 55.269  -10.544 11.614  1.00 22.38  ? 113  TYR D N   1 
ATOM   3620 C  CA  . TYR D 1 113 ? 55.967  -11.047 12.782  1.00 23.34  ? 113  TYR D CA  1 
ATOM   3621 C  C   . TYR D 1 113 ? 57.403  -11.517 12.431  1.00 24.38  ? 113  TYR D C   1 
ATOM   3622 O  O   . TYR D 1 113 ? 57.637  -12.178 11.410  1.00 22.95  ? 113  TYR D O   1 
ATOM   3623 C  CB  . TYR D 1 113 ? 55.169  -12.194 13.414  1.00 22.75  ? 113  TYR D CB  1 
ATOM   3624 C  CG  . TYR D 1 113 ? 55.809  -12.675 14.695  1.00 24.95  ? 113  TYR D CG  1 
ATOM   3625 C  CD1 . TYR D 1 113 ? 55.741  -11.915 15.861  1.00 26.57  ? 113  TYR D CD1 1 
ATOM   3626 C  CD2 . TYR D 1 113 ? 56.499  -13.866 14.737  1.00 25.75  ? 113  TYR D CD2 1 
ATOM   3627 C  CE1 . TYR D 1 113 ? 56.352  -12.350 17.039  1.00 29.39  ? 113  TYR D CE1 1 
ATOM   3628 C  CE2 . TYR D 1 113 ? 57.122  -14.305 15.905  1.00 26.61  ? 113  TYR D CE2 1 
ATOM   3629 C  CZ  . TYR D 1 113 ? 57.033  -13.550 17.047  1.00 29.36  ? 113  TYR D CZ  1 
ATOM   3630 O  OH  . TYR D 1 113 ? 57.644  -13.995 18.199  1.00 32.78  ? 113  TYR D OH  1 
ATOM   3631 N  N   . ARG D 1 114 ? 58.372  -11.145 13.260  1.00 27.19  ? 114  ARG D N   1 
ATOM   3632 C  CA  . ARG D 1 114 ? 59.745  -11.626 13.075  1.00 30.07  ? 114  ARG D CA  1 
ATOM   3633 C  C   . ARG D 1 114 ? 60.178  -12.446 14.274  1.00 30.63  ? 114  ARG D C   1 
ATOM   3634 O  O   . ARG D 1 114 ? 60.044  -12.000 15.406  1.00 32.15  ? 114  ARG D O   1 
ATOM   3635 C  CB  . ARG D 1 114 ? 60.727  -10.466 12.860  1.00 34.52  ? 114  ARG D CB  1 
ATOM   3636 C  CG  . ARG D 1 114 ? 62.178  -10.930 12.784  1.00 38.56  ? 114  ARG D CG  1 
ATOM   3637 C  CD  . ARG D 1 114 ? 63.083  -9.883  12.145  1.00 45.79  ? 114  ARG D CD  1 
ATOM   3638 N  NE  . ARG D 1 114 ? 62.996  -8.590  12.814  1.00 49.41  ? 114  ARG D NE  1 
ATOM   3639 C  CZ  . ARG D 1 114 ? 63.700  -8.217  13.884  1.00 55.47  ? 114  ARG D CZ  1 
ATOM   3640 N  NH1 . ARG D 1 114 ? 64.585  -9.025  14.457  1.00 57.62  ? 114  ARG D NH1 1 
ATOM   3641 N  NH2 . ARG D 1 114 ? 63.517  -6.998  14.381  1.00 60.89  ? 114  ARG D NH2 1 
ATOM   3642 N  N   . VAL D 1 115 ? 60.703  -13.641 14.025  1.00 30.89  ? 115  VAL D N   1 
ATOM   3643 C  CA  . VAL D 1 115 ? 61.290  -14.456 15.096  1.00 32.76  ? 115  VAL D CA  1 
ATOM   3644 C  C   . VAL D 1 115 ? 62.701  -13.919 15.387  1.00 37.72  ? 115  VAL D C   1 
ATOM   3645 O  O   . VAL D 1 115 ? 63.577  -13.976 14.524  1.00 39.76  ? 115  VAL D O   1 
ATOM   3646 C  CB  . VAL D 1 115 ? 61.333  -15.963 14.722  1.00 31.63  ? 115  VAL D CB  1 
ATOM   3647 C  CG1 . VAL D 1 115 ? 61.989  -16.790 15.841  1.00 32.36  ? 115  VAL D CG1 1 
ATOM   3648 C  CG2 . VAL D 1 115 ? 59.913  -16.487 14.429  1.00 29.41  ? 115  VAL D CG2 1 
ATOM   3649 N  N   . VAL D 1 116 ? 62.912  -13.384 16.591  1.00 41.50  ? 116  VAL D N   1 
ATOM   3650 C  CA  . VAL D 1 116 ? 64.196  -12.753 16.939  1.00 47.86  ? 116  VAL D CA  1 
ATOM   3651 C  C   . VAL D 1 116 ? 65.296  -13.784 17.231  1.00 49.69  ? 116  VAL D C   1 
ATOM   3652 O  O   . VAL D 1 116 ? 65.128  -14.698 18.043  1.00 49.20  ? 116  VAL D O   1 
ATOM   3653 C  CB  . VAL D 1 116 ? 64.064  -11.762 18.133  1.00 53.04  ? 116  VAL D CB  1 
ATOM   3654 C  CG1 . VAL D 1 116 ? 65.434  -11.477 18.762  1.00 61.91  ? 116  VAL D CG1 1 
ATOM   3655 C  CG2 . VAL D 1 116 ? 63.439  -10.475 17.678  1.00 53.94  ? 116  VAL D CG2 1 
HETATM 3656 C  C1  . NAG E 2 .   ? 4.604   -52.141 15.138  1.00 57.20  ? 1116 NAG A C1  1 
HETATM 3657 C  C2  . NAG E 2 .   ? 5.627   -51.036 15.360  1.00 52.69  ? 1116 NAG A C2  1 
HETATM 3658 C  C3  . NAG E 2 .   ? 6.993   -51.448 14.824  1.00 56.19  ? 1116 NAG A C3  1 
HETATM 3659 C  C4  . NAG E 2 .   ? 7.395   -52.787 15.428  1.00 61.39  ? 1116 NAG A C4  1 
HETATM 3660 C  C5  . NAG E 2 .   ? 6.301   -53.821 15.198  1.00 65.67  ? 1116 NAG A C5  1 
HETATM 3661 C  C6  . NAG E 2 .   ? 6.621   -55.175 15.832  1.00 70.92  ? 1116 NAG A C6  1 
HETATM 3662 C  C7  . NAG E 2 .   ? 4.963   -48.679 15.305  1.00 44.09  ? 1116 NAG A C7  1 
HETATM 3663 C  C8  . NAG E 2 .   ? 4.558   -47.518 14.436  1.00 40.45  ? 1116 NAG A C8  1 
HETATM 3664 N  N2  . NAG E 2 .   ? 5.210   -49.829 14.670  1.00 48.64  ? 1116 NAG A N2  1 
HETATM 3665 O  O3  . NAG E 2 .   ? 7.951   -50.458 15.154  1.00 52.85  ? 1116 NAG A O3  1 
HETATM 3666 O  O4  . NAG E 2 .   ? 8.597   -53.222 14.834  1.00 65.03  ? 1116 NAG A O4  1 
HETATM 3667 O  O5  . NAG E 2 .   ? 5.062   -53.353 15.696  1.00 62.37  ? 1116 NAG A O5  1 
HETATM 3668 O  O6  . NAG E 2 .   ? 5.925   -55.311 17.052  1.00 71.88  ? 1116 NAG A O6  1 
HETATM 3669 O  O7  . NAG E 2 .   ? 5.021   -48.562 16.530  1.00 42.35  ? 1116 NAG A O7  1 
HETATM 3670 C  C1  . NAG F 2 .   ? 12.396  -29.072 38.383  1.00 55.98  ? 1117 NAG A C1  1 
HETATM 3671 C  C2  . NAG F 2 .   ? 12.496  -29.730 39.760  1.00 62.04  ? 1117 NAG A C2  1 
HETATM 3672 C  C3  . NAG F 2 .   ? 11.273  -29.331 40.590  1.00 65.64  ? 1117 NAG A C3  1 
HETATM 3673 C  C4  . NAG F 2 .   ? 11.135  -27.821 40.670  1.00 66.80  ? 1117 NAG A C4  1 
HETATM 3674 C  C5  . NAG F 2 .   ? 11.099  -27.230 39.269  1.00 62.24  ? 1117 NAG A C5  1 
HETATM 3675 C  C6  . NAG F 2 .   ? 11.119  -25.700 39.339  1.00 63.29  ? 1117 NAG A C6  1 
HETATM 3676 C  C7  . NAG F 2 .   ? 11.798  -32.053 39.189  1.00 62.65  ? 1117 NAG A C7  1 
HETATM 3677 C  C8  . NAG F 2 .   ? 12.158  -33.507 39.311  1.00 63.39  ? 1117 NAG A C8  1 
HETATM 3678 N  N2  . NAG F 2 .   ? 12.659  -31.182 39.743  1.00 63.39  ? 1117 NAG A N2  1 
HETATM 3679 O  O3  . NAG F 2 .   ? 11.354  -29.836 41.898  1.00 70.02  ? 1117 NAG A O3  1 
HETATM 3680 O  O4  . NAG F 2 .   ? 9.941   -27.507 41.356  1.00 70.91  ? 1117 NAG A O4  1 
HETATM 3681 O  O5  . NAG F 2 .   ? 12.230  -27.672 38.537  1.00 58.40  ? 1117 NAG A O5  1 
HETATM 3682 O  O6  . NAG F 2 .   ? 12.244  -25.241 40.066  1.00 65.29  ? 1117 NAG A O6  1 
HETATM 3683 O  O7  . NAG F 2 .   ? 10.766  -31.746 38.588  1.00 61.67  ? 1117 NAG A O7  1 
HETATM 3684 C  C1  . NAG G 2 .   ? 6.091   -33.179 37.305  1.00 57.11  ? 1118 NAG A C1  1 
HETATM 3685 C  C2  . NAG G 2 .   ? 6.758   -32.622 38.562  1.00 61.57  ? 1118 NAG A C2  1 
HETATM 3686 C  C3  . NAG G 2 .   ? 7.869   -33.541 39.045  1.00 64.55  ? 1118 NAG A C3  1 
HETATM 3687 C  C4  . NAG G 2 .   ? 7.357   -34.968 39.168  1.00 66.56  ? 1118 NAG A C4  1 
HETATM 3688 C  C5  . NAG G 2 .   ? 6.666   -35.420 37.877  1.00 62.74  ? 1118 NAG A C5  1 
HETATM 3689 C  C6  . NAG G 2 .   ? 6.076   -36.823 38.004  1.00 64.98  ? 1118 NAG A C6  1 
HETATM 3690 C  C7  . NAG G 2 .   ? 7.480   -30.281 39.005  1.00 64.12  ? 1118 NAG A C7  1 
HETATM 3691 C  C8  . NAG G 2 .   ? 7.007   -30.346 40.431  1.00 68.90  ? 1118 NAG A C8  1 
HETATM 3692 N  N2  . NAG G 2 .   ? 7.340   -31.339 38.199  1.00 61.00  ? 1118 NAG A N2  1 
HETATM 3693 O  O3  . NAG G 2 .   ? 8.316   -33.130 40.322  1.00 68.22  ? 1118 NAG A O3  1 
HETATM 3694 O  O4  . NAG G 2 .   ? 8.469   -35.796 39.448  1.00 68.54  ? 1118 NAG A O4  1 
HETATM 3695 O  O5  . NAG G 2 .   ? 5.649   -34.510 37.479  1.00 59.98  ? 1118 NAG A O5  1 
HETATM 3696 O  O6  . NAG G 2 .   ? 6.967   -37.760 37.438  1.00 63.24  ? 1118 NAG A O6  1 
HETATM 3697 O  O7  . NAG G 2 .   ? 8.014   -29.249 38.598  1.00 63.56  ? 1118 NAG A O7  1 
HETATM 3698 C  C1  . NAG H 2 .   ? 4.071   -36.410 3.578   1.00 55.75  ? 1119 NAG A C1  1 
HETATM 3699 C  C2  . NAG H 2 .   ? 3.020   -36.619 2.491   1.00 60.62  ? 1119 NAG A C2  1 
HETATM 3700 C  C3  . NAG H 2 .   ? 3.641   -36.986 1.150   1.00 66.22  ? 1119 NAG A C3  1 
HETATM 3701 C  C4  . NAG H 2 .   ? 4.785   -36.050 0.782   1.00 66.78  ? 1119 NAG A C4  1 
HETATM 3702 C  C5  . NAG H 2 .   ? 5.778   -35.870 1.927   1.00 62.23  ? 1119 NAG A C5  1 
HETATM 3703 C  C6  . NAG H 2 .   ? 6.759   -34.733 1.626   1.00 62.94  ? 1119 NAG A C6  1 
HETATM 3704 C  C7  . NAG H 2 .   ? 0.797   -37.562 3.008   1.00 61.14  ? 1119 NAG A C7  1 
HETATM 3705 C  C8  . NAG H 2 .   ? 0.052   -38.788 3.449   1.00 60.41  ? 1119 NAG A C8  1 
HETATM 3706 N  N2  . NAG H 2 .   ? 2.123   -37.687 2.899   1.00 60.53  ? 1119 NAG A N2  1 
HETATM 3707 O  O3  . NAG H 2 .   ? 2.660   -36.946 0.135   1.00 71.02  ? 1119 NAG A O3  1 
HETATM 3708 O  O4  . NAG H 2 .   ? 5.446   -36.568 -0.350  1.00 71.87  ? 1119 NAG A O4  1 
HETATM 3709 O  O5  . NAG H 2 .   ? 5.127   -35.564 3.146   1.00 57.19  ? 1119 NAG A O5  1 
HETATM 3710 O  O6  . NAG H 2 .   ? 8.084   -35.213 1.536   1.00 63.58  ? 1119 NAG A O6  1 
HETATM 3711 O  O7  . NAG H 2 .   ? 0.176   -36.524 2.779   1.00 62.35  ? 1119 NAG A O7  1 
HETATM 3712 MG MG  . MG  I 3 .   ? 18.281  -23.270 27.169  1.00 26.33  ? 1120 MG  A MG  1 
HETATM 3713 C  C1  . NAG J 2 .   ? 41.729  -5.290  45.193  1.00 38.95  ? 1116 NAG B C1  1 
HETATM 3714 C  C2  . NAG J 2 .   ? 40.699  -6.364  44.869  1.00 37.31  ? 1116 NAG B C2  1 
HETATM 3715 C  C3  . NAG J 2 .   ? 40.537  -7.375  46.001  1.00 40.68  ? 1116 NAG B C3  1 
HETATM 3716 C  C4  . NAG J 2 .   ? 41.883  -7.964  46.385  1.00 43.47  ? 1116 NAG B C4  1 
HETATM 3717 C  C5  . NAG J 2 .   ? 42.850  -6.823  46.663  1.00 46.19  ? 1116 NAG B C5  1 
HETATM 3718 C  C6  . NAG J 2 .   ? 44.255  -7.280  47.061  1.00 49.48  ? 1116 NAG B C6  1 
HETATM 3719 C  C7  . NAG J 2 .   ? 38.655  -5.934  43.586  1.00 30.72  ? 1116 NAG B C7  1 
HETATM 3720 C  C8  . NAG J 2 .   ? 37.302  -5.300  43.652  1.00 29.05  ? 1116 NAG B C8  1 
HETATM 3721 N  N2  . NAG J 2 .   ? 39.385  -5.786  44.683  1.00 35.14  ? 1116 NAG B N2  1 
HETATM 3722 O  O3  . NAG J 2 .   ? 39.697  -8.414  45.561  1.00 37.23  ? 1116 NAG B O3  1 
HETATM 3723 O  O4  . NAG J 2 .   ? 41.751  -8.756  47.550  1.00 47.59  ? 1116 NAG B O4  1 
HETATM 3724 O  O5  . NAG J 2 .   ? 42.923  -5.927  45.566  1.00 43.77  ? 1116 NAG B O5  1 
HETATM 3725 O  O6  . NAG J 2 .   ? 44.474  -8.589  46.598  1.00 49.86  ? 1116 NAG B O6  1 
HETATM 3726 O  O7  . NAG J 2 .   ? 39.042  -6.488  42.558  1.00 28.83  ? 1116 NAG B O7  1 
HETATM 3727 C  C1  . NAG K 2 .   ? 24.060  0.210   46.439  1.00 50.14  ? 1117 NAG B C1  1 
HETATM 3728 C  C2  . NAG K 2 .   ? 24.043  1.637   46.977  1.00 52.41  ? 1117 NAG B C2  1 
HETATM 3729 C  C3  . NAG K 2 .   ? 23.856  1.647   48.488  1.00 57.48  ? 1117 NAG B C3  1 
HETATM 3730 C  C4  . NAG K 2 .   ? 22.626  0.832   48.865  1.00 60.05  ? 1117 NAG B C4  1 
HETATM 3731 C  C5  . NAG K 2 .   ? 22.711  -0.569  48.267  1.00 57.28  ? 1117 NAG B C5  1 
HETATM 3732 C  C6  . NAG K 2 .   ? 21.449  -1.369  48.566  1.00 59.58  ? 1117 NAG B C6  1 
HETATM 3733 C  C7  . NAG K 2 .   ? 25.334  3.523   46.075  1.00 50.71  ? 1117 NAG B C7  1 
HETATM 3734 C  C8  . NAG K 2 .   ? 26.692  4.096   45.777  1.00 47.83  ? 1117 NAG B C8  1 
HETATM 3735 N  N2  . NAG K 2 .   ? 25.294  2.305   46.621  1.00 50.89  ? 1117 NAG B N2  1 
HETATM 3736 O  O3  . NAG K 2 .   ? 23.702  2.967   48.975  1.00 58.90  ? 1117 NAG B O3  1 
HETATM 3737 O  O4  . NAG K 2 .   ? 22.478  0.789   50.272  1.00 64.82  ? 1117 NAG B O4  1 
HETATM 3738 O  O5  . NAG K 2 .   ? 22.910  -0.505  46.866  1.00 53.52  ? 1117 NAG B O5  1 
HETATM 3739 O  O6  . NAG K 2 .   ? 21.519  -2.602  47.889  1.00 58.37  ? 1117 NAG B O6  1 
HETATM 3740 O  O7  . NAG K 2 .   ? 24.331  4.178   45.805  1.00 53.47  ? 1117 NAG B O7  1 
HETATM 3741 C  C1  . NAG L 2 .   ? 57.228  -3.302  18.171  1.00 27.55  ? 1116 NAG C C1  1 
HETATM 3742 C  C2  . NAG L 2 .   ? 56.483  -2.302  17.289  1.00 27.41  ? 1116 NAG C C2  1 
HETATM 3743 C  C3  . NAG L 2 .   ? 57.476  -1.473  16.498  1.00 28.56  ? 1116 NAG C C3  1 
HETATM 3744 C  C4  . NAG L 2 .   ? 58.530  -0.856  17.383  1.00 31.93  ? 1116 NAG C C4  1 
HETATM 3745 C  C5  . NAG L 2 .   ? 59.208  -1.899  18.253  1.00 31.61  ? 1116 NAG C C5  1 
HETATM 3746 C  C6  . NAG L 2 .   ? 60.092  -1.109  19.207  1.00 33.97  ? 1116 NAG C C6  1 
HETATM 3747 C  C7  . NAG L 2 .   ? 54.220  -2.955  16.455  1.00 23.64  ? 1116 NAG C C7  1 
HETATM 3748 C  C8  . NAG L 2 .   ? 53.487  -3.660  15.345  1.00 21.90  ? 1116 NAG C C8  1 
HETATM 3749 N  N2  . NAG L 2 .   ? 55.543  -2.913  16.336  1.00 23.25  ? 1116 NAG C N2  1 
HETATM 3750 O  O3  . NAG L 2 .   ? 56.748  -0.430  15.925  1.00 27.33  ? 1116 NAG C O3  1 
HETATM 3751 O  O4  . NAG L 2 .   ? 59.501  -0.220  16.574  1.00 35.81  ? 1116 NAG C O4  1 
HETATM 3752 O  O5  . NAG L 2 .   ? 58.229  -2.663  18.946  1.00 29.38  ? 1116 NAG C O5  1 
HETATM 3753 O  O6  . NAG L 2 .   ? 60.757  -1.937  20.113  1.00 35.09  ? 1116 NAG C O6  1 
HETATM 3754 O  O7  . NAG L 2 .   ? 53.587  -2.469  17.380  1.00 23.60  ? 1116 NAG C O7  1 
HETATM 3755 C  C1  . NAG M 2 .   ? 29.065  16.021  19.761  1.00 40.42  ? 1117 NAG C C1  1 
HETATM 3756 C  C2  . NAG M 2 .   ? 29.474  17.229  20.605  1.00 44.39  ? 1117 NAG C C2  1 
HETATM 3757 C  C3  . NAG M 2 .   ? 28.789  17.288  21.952  1.00 48.02  ? 1117 NAG C C3  1 
HETATM 3758 C  C4  . NAG M 2 .   ? 27.294  17.121  21.732  1.00 48.34  ? 1117 NAG C C4  1 
HETATM 3759 C  C5  . NAG M 2 .   ? 26.989  15.884  20.884  1.00 46.09  ? 1117 NAG C C5  1 
HETATM 3760 C  C6  . NAG M 2 .   ? 25.508  15.633  20.649  1.00 47.12  ? 1117 NAG C C6  1 
HETATM 3761 C  C7  . NAG M 2 .   ? 31.712  16.427  21.435  1.00 46.43  ? 1117 NAG C C7  1 
HETATM 3762 C  C8  . NAG M 2 .   ? 31.129  15.314  22.256  1.00 46.32  ? 1117 NAG C C8  1 
HETATM 3763 N  N2  . NAG M 2 .   ? 30.935  17.256  20.732  1.00 46.00  ? 1117 NAG C N2  1 
HETATM 3764 O  O3  . NAG M 2 .   ? 29.055  18.539  22.566  1.00 52.56  ? 1117 NAG C O3  1 
HETATM 3765 O  O4  . NAG M 2 .   ? 26.639  17.143  22.977  1.00 50.83  ? 1117 NAG C O4  1 
HETATM 3766 O  O5  . NAG M 2 .   ? 27.678  15.897  19.637  1.00 41.76  ? 1117 NAG C O5  1 
HETATM 3767 O  O6  . NAG M 2 .   ? 25.396  14.630  19.659  1.00 45.48  ? 1117 NAG C O6  1 
HETATM 3768 O  O7  . NAG M 2 .   ? 32.935  16.551  21.403  1.00 50.45  ? 1117 NAG C O7  1 
HETATM 3769 C  C1  . NAG N 2 .   ? 31.129  10.327  24.050  1.00 54.44  ? 1118 NAG C C1  1 
HETATM 3770 C  C2  . NAG N 2 .   ? 30.276  11.252  24.913  1.00 59.88  ? 1118 NAG C C2  1 
HETATM 3771 C  C3  . NAG N 2 .   ? 30.951  12.602  25.079  1.00 61.99  ? 1118 NAG C C3  1 
HETATM 3772 C  C4  . NAG N 2 .   ? 32.335  12.347  25.666  1.00 62.08  ? 1118 NAG C C4  1 
HETATM 3773 C  C5  . NAG N 2 .   ? 33.115  11.370  24.779  1.00 59.28  ? 1118 NAG C C5  1 
HETATM 3774 C  C6  . NAG N 2 .   ? 34.522  11.095  25.316  1.00 59.88  ? 1118 NAG C C6  1 
HETATM 3775 C  C7  . NAG N 2 .   ? 28.369  11.644  23.306  1.00 63.00  ? 1118 NAG C C7  1 
HETATM 3776 C  C8  . NAG N 2 .   ? 29.301  12.060  22.199  1.00 61.64  ? 1118 NAG C C8  1 
HETATM 3777 N  N2  . NAG N 2 .   ? 28.868  11.305  24.504  1.00 62.89  ? 1118 NAG C N2  1 
HETATM 3778 O  O3  . NAG N 2 .   ? 30.179  13.390  25.958  1.00 64.91  ? 1118 NAG C O3  1 
HETATM 3779 O  O4  . NAG N 2 .   ? 33.045  13.560  25.747  1.00 63.77  ? 1118 NAG C O4  1 
HETATM 3780 O  O5  . NAG N 2 .   ? 32.409  10.148  24.633  1.00 56.63  ? 1118 NAG C O5  1 
HETATM 3781 O  O6  . NAG N 2 .   ? 34.561  11.170  26.743  1.00 62.51  ? 1118 NAG C O6  1 
HETATM 3782 O  O7  . NAG N 2 .   ? 27.156  11.605  23.091  1.00 63.44  ? 1118 NAG C O7  1 
HETATM 3783 C  C1  . NAG O 2 .   ? 48.801  -6.813  1.327   1.00 41.05  ? 1119 NAG C C1  1 
HETATM 3784 C  C2  . NAG O 2 .   ? 49.444  -7.907  0.475   1.00 45.56  ? 1119 NAG C C2  1 
HETATM 3785 C  C3  . NAG O 2 .   ? 50.272  -7.321  -0.669  1.00 47.95  ? 1119 NAG C C3  1 
HETATM 3786 C  C4  . NAG O 2 .   ? 49.473  -6.307  -1.472  1.00 48.48  ? 1119 NAG C C4  1 
HETATM 3787 C  C5  . NAG O 2 .   ? 48.852  -5.276  -0.534  1.00 43.75  ? 1119 NAG C C5  1 
HETATM 3788 C  C6  . NAG O 2 .   ? 47.912  -4.307  -1.232  1.00 43.85  ? 1119 NAG C C6  1 
HETATM 3789 C  C7  . NAG O 2 .   ? 49.919  -9.897  1.834   1.00 47.44  ? 1119 NAG C C7  1 
HETATM 3790 C  C8  . NAG O 2 .   ? 50.952  -10.672 2.592   1.00 46.84  ? 1119 NAG C C8  1 
HETATM 3791 N  N2  . NAG O 2 .   ? 50.326  -8.765  1.261   1.00 46.47  ? 1119 NAG C N2  1 
HETATM 3792 O  O3  . NAG O 2 .   ? 50.663  -8.346  -1.551  1.00 51.43  ? 1119 NAG C O3  1 
HETATM 3793 O  O4  . NAG O 2 .   ? 50.332  -5.718  -2.434  1.00 50.70  ? 1119 NAG C O4  1 
HETATM 3794 O  O5  . NAG O 2 .   ? 48.112  -5.883  0.502   1.00 40.71  ? 1119 NAG C O5  1 
HETATM 3795 O  O6  . NAG O 2 .   ? 47.636  -3.273  -0.312  1.00 40.15  ? 1119 NAG C O6  1 
HETATM 3796 O  O7  . NAG O 2 .   ? 48.761  -10.313 1.786   1.00 50.02  ? 1119 NAG C O7  1 
HETATM 3797 MG MG  . MG  P 3 .   ? 31.350  15.517  6.487   1.00 25.23  ? 1120 MG  C MG  1 
HETATM 3798 C  C1  . NAG Q 2 .   ? 17.413  44.744  -4.413  1.00 97.98  ? 1117 NAG D C1  1 
HETATM 3799 C  C2  . NAG Q 2 .   ? 18.098  43.826  -3.397  1.00 95.92  ? 1117 NAG D C2  1 
HETATM 3800 C  C3  . NAG Q 2 .   ? 18.523  44.587  -2.144  1.00 103.45 ? 1117 NAG D C3  1 
HETATM 3801 C  C4  . NAG Q 2 .   ? 19.283  45.863  -2.486  1.00 114.30 ? 1117 NAG D C4  1 
HETATM 3802 C  C5  . NAG Q 2 .   ? 18.533  46.698  -3.529  1.00 115.27 ? 1117 NAG D C5  1 
HETATM 3803 C  C6  . NAG Q 2 .   ? 19.327  47.921  -3.992  1.00 126.72 ? 1117 NAG D C6  1 
HETATM 3804 C  C7  . NAG Q 2 .   ? 17.338  41.482  -3.142  1.00 81.76  ? 1117 NAG D C7  1 
HETATM 3805 C  C8  . NAG Q 2 .   ? 16.244  40.590  -2.626  1.00 76.76  ? 1117 NAG D C8  1 
HETATM 3806 N  N2  . NAG Q 2 .   ? 17.143  42.811  -2.975  1.00 88.14  ? 1117 NAG D N2  1 
HETATM 3807 O  O3  . NAG Q 2 .   ? 19.360  43.744  -1.380  1.00 103.94 ? 1117 NAG D O3  1 
HETATM 3808 O  O4  . NAG Q 2 .   ? 19.427  46.644  -1.307  1.00 122.93 ? 1117 NAG D O4  1 
HETATM 3809 O  O5  . NAG Q 2 .   ? 18.165  45.918  -4.655  1.00 107.87 ? 1117 NAG D O5  1 
HETATM 3810 O  O6  . NAG Q 2 .   ? 20.313  47.522  -4.932  1.00 129.07 ? 1117 NAG D O6  1 
HETATM 3811 O  O7  . NAG Q 2 .   ? 18.323  40.965  -3.699  1.00 81.30  ? 1117 NAG D O7  1 
HETATM 3812 C  C1  . NAG R 2 .   ? 36.976  18.061  -5.868  1.00 71.53  ? 1118 NAG D C1  1 
HETATM 3813 C  C2  . NAG R 2 .   ? 38.101  18.804  -6.595  1.00 82.82  ? 1118 NAG D C2  1 
HETATM 3814 C  C3  . NAG R 2 .   ? 37.922  18.688  -8.104  1.00 91.78  ? 1118 NAG D C3  1 
HETATM 3815 C  C4  . NAG R 2 .   ? 37.825  17.220  -8.493  1.00 91.23  ? 1118 NAG D C4  1 
HETATM 3816 C  C5  . NAG R 2 .   ? 36.708  16.551  -7.692  1.00 81.19  ? 1118 NAG D C5  1 
HETATM 3817 C  C6  . NAG R 2 .   ? 36.538  15.080  -8.066  1.00 82.28  ? 1118 NAG D C6  1 
HETATM 3818 C  C7  . NAG R 2 .   ? 38.846  20.697  -5.217  1.00 85.66  ? 1118 NAG D C7  1 
HETATM 3819 C  C8  . NAG R 2 .   ? 38.730  22.174  -4.967  1.00 89.25  ? 1118 NAG D C8  1 
HETATM 3820 N  N2  . NAG R 2 .   ? 38.107  20.209  -6.216  1.00 85.01  ? 1118 NAG D N2  1 
HETATM 3821 O  O3  . NAG R 2 .   ? 39.014  19.289  -8.773  1.00 103.15 ? 1118 NAG D O3  1 
HETATM 3822 O  O4  . NAG R 2 .   ? 37.520  17.138  -9.863  1.00 101.70 ? 1118 NAG D O4  1 
HETATM 3823 O  O5  . NAG R 2 .   ? 36.926  16.701  -6.294  1.00 72.42  ? 1118 NAG D O5  1 
HETATM 3824 O  O6  . NAG R 2 .   ? 37.729  14.383  -7.786  1.00 83.44  ? 1118 NAG D O6  1 
HETATM 3825 O  O7  . NAG R 2 .   ? 39.588  20.008  -4.513  1.00 85.04  ? 1118 NAG D O7  1 
HETATM 3826 O  O   . HOH S 4 .   ? 17.162  -26.687 14.755  1.00 26.77  ? 2001 HOH A O   1 
HETATM 3827 O  O   . HOH S 4 .   ? 13.997  -37.772 15.655  1.00 24.63  ? 2002 HOH A O   1 
HETATM 3828 O  O   . HOH S 4 .   ? 14.083  -41.231 15.009  1.00 31.33  ? 2003 HOH A O   1 
HETATM 3829 O  O   . HOH S 4 .   ? 15.120  -42.778 7.743   1.00 34.37  ? 2004 HOH A O   1 
HETATM 3830 O  O   . HOH S 4 .   ? 11.268  -46.755 10.340  1.00 39.17  ? 2005 HOH A O   1 
HETATM 3831 O  O   . HOH S 4 .   ? 8.840   -48.956 10.844  1.00 43.34  ? 2006 HOH A O   1 
HETATM 3832 O  O   . HOH S 4 .   ? 7.189   -46.515 26.058  1.00 40.74  ? 2007 HOH A O   1 
HETATM 3833 O  O   . HOH S 4 .   ? 14.274  -46.221 19.099  1.00 49.57  ? 2008 HOH A O   1 
HETATM 3834 O  O   . HOH S 4 .   ? 2.629   -47.029 21.814  1.00 45.40  ? 2009 HOH A O   1 
HETATM 3835 O  O   . HOH S 4 .   ? -1.285  -26.516 28.843  1.00 41.42  ? 2010 HOH A O   1 
HETATM 3836 O  O   . HOH S 4 .   ? 11.959  -38.728 14.023  1.00 25.68  ? 2011 HOH A O   1 
HETATM 3837 O  O   . HOH S 4 .   ? 20.006  -35.101 23.656  1.00 21.18  ? 2012 HOH A O   1 
HETATM 3838 O  O   . HOH S 4 .   ? 24.497  -29.045 18.935  1.00 24.82  ? 2013 HOH A O   1 
HETATM 3839 O  O   . HOH S 4 .   ? 17.088  -37.773 32.835  1.00 38.99  ? 2014 HOH A O   1 
HETATM 3840 O  O   . HOH S 4 .   ? 23.961  -28.305 22.869  1.00 27.21  ? 2015 HOH A O   1 
HETATM 3841 O  O   . HOH S 4 .   ? 24.324  -24.458 23.100  1.00 36.02  ? 2016 HOH A O   1 
HETATM 3842 O  O   . HOH S 4 .   ? 9.136   -44.716 26.536  1.00 41.62  ? 2017 HOH A O   1 
HETATM 3843 O  O   . HOH S 4 .   ? 19.007  -32.975 29.001  1.00 28.10  ? 2018 HOH A O   1 
HETATM 3844 O  O   . HOH S 4 .   ? 11.297  -45.981 19.124  1.00 29.66  ? 2019 HOH A O   1 
HETATM 3845 O  O   . HOH S 4 .   ? 7.903   -30.853 34.179  1.00 35.17  ? 2020 HOH A O   1 
HETATM 3846 O  O   . HOH S 4 .   ? 9.581   -33.943 35.530  1.00 40.24  ? 2021 HOH A O   1 
HETATM 3847 O  O   . HOH S 4 .   ? 12.868  -32.911 35.354  1.00 37.12  ? 2022 HOH A O   1 
HETATM 3848 O  O   . HOH S 4 .   ? 7.954   -25.672 29.612  1.00 24.46  ? 2023 HOH A O   1 
HETATM 3849 O  O   . HOH S 4 .   ? 9.638   -18.727 27.778  1.00 37.45  ? 2024 HOH A O   1 
HETATM 3850 O  O   . HOH S 4 .   ? 4.488   -23.857 16.554  1.00 47.20  ? 2025 HOH A O   1 
HETATM 3851 O  O   . HOH S 4 .   ? 42.963  4.493   42.092  1.00 26.03  ? 2026 HOH A O   1 
HETATM 3852 O  O   . HOH S 4 .   ? -0.025  -33.876 8.262   1.00 35.74  ? 2027 HOH A O   1 
HETATM 3853 O  O   . HOH S 4 .   ? -6.424  -30.819 9.799   1.00 43.37  ? 2028 HOH A O   1 
HETATM 3854 O  O   . HOH S 4 .   ? -0.756  -35.961 6.085   1.00 33.19  ? 2029 HOH A O   1 
HETATM 3855 O  O   . HOH S 4 .   ? 0.934   -30.699 10.670  1.00 39.24  ? 2030 HOH A O   1 
HETATM 3856 O  O   . HOH S 4 .   ? -1.842  -26.277 21.274  1.00 43.86  ? 2031 HOH A O   1 
HETATM 3857 O  O   . HOH S 4 .   ? -3.973  -26.026 15.825  1.00 38.59  ? 2032 HOH A O   1 
HETATM 3858 O  O   . HOH S 4 .   ? 1.710   -37.293 28.265  1.00 28.27  ? 2033 HOH A O   1 
HETATM 3859 O  O   . HOH S 4 .   ? -0.304  -28.847 27.319  1.00 31.93  ? 2034 HOH A O   1 
HETATM 3860 O  O   . HOH S 4 .   ? 6.286   -24.018 29.044  1.00 24.06  ? 2035 HOH A O   1 
HETATM 3861 O  O   . HOH S 4 .   ? -6.086  -27.947 33.601  1.00 34.37  ? 2036 HOH A O   1 
HETATM 3862 O  O   . HOH S 4 .   ? -4.642  -34.282 28.135  0.50 34.34  ? 2037 HOH A O   1 
HETATM 3863 O  O   . HOH S 4 .   ? -3.230  -30.526 21.957  1.00 29.20  ? 2038 HOH A O   1 
HETATM 3864 O  O   . HOH S 4 .   ? -3.788  -39.351 26.263  1.00 34.48  ? 2039 HOH A O   1 
HETATM 3865 O  O   . HOH S 4 .   ? -9.534  -41.083 20.914  1.00 30.33  ? 2040 HOH A O   1 
HETATM 3866 O  O   . HOH S 4 .   ? -3.157  -41.723 27.709  1.00 36.32  ? 2041 HOH A O   1 
HETATM 3867 O  O   . HOH S 4 .   ? 12.907  -36.604 31.558  1.00 30.68  ? 2042 HOH A O   1 
HETATM 3868 O  O   . HOH S 4 .   ? 7.308   -41.373 32.123  1.00 33.22  ? 2043 HOH A O   1 
HETATM 3869 O  O   . HOH S 4 .   ? 15.012  -38.334 30.678  1.00 34.39  ? 2044 HOH A O   1 
HETATM 3870 O  O   . HOH S 4 .   ? 14.278  -43.174 25.991  1.00 30.90  ? 2045 HOH A O   1 
HETATM 3871 O  O   . HOH S 4 .   ? 19.751  -35.780 26.245  1.00 29.95  ? 2046 HOH A O   1 
HETATM 3872 O  O   . HOH S 4 .   ? 9.520   -42.862 24.804  1.00 28.97  ? 2047 HOH A O   1 
HETATM 3873 O  O   . HOH S 4 .   ? 12.003  -44.514 22.850  1.00 26.04  ? 2048 HOH A O   1 
HETATM 3874 O  O   . HOH S 4 .   ? 9.081   -38.411 25.885  1.00 35.12  ? 2049 HOH A O   1 
HETATM 3875 O  O   . HOH S 4 .   ? 10.507  -44.168 20.698  1.00 29.98  ? 2050 HOH A O   1 
HETATM 3876 O  O   . HOH S 4 .   ? 7.910   -40.636 24.839  1.00 24.19  ? 2051 HOH A O   1 
HETATM 3877 O  O   . HOH S 4 .   ? -6.960  -49.336 19.843  1.00 47.95  ? 2052 HOH A O   1 
HETATM 3878 O  O   . HOH S 4 .   ? -8.073  -44.489 21.846  1.00 48.18  ? 2053 HOH A O   1 
HETATM 3879 O  O   . HOH S 4 .   ? -6.221  -46.640 7.726   1.00 48.34  ? 2054 HOH A O   1 
HETATM 3880 O  O   . HOH S 4 .   ? 2.716   -32.589 10.217  1.00 30.55  ? 2055 HOH A O   1 
HETATM 3881 O  O   . HOH S 4 .   ? 5.933   -29.477 9.767   1.00 33.88  ? 2056 HOH A O   1 
HETATM 3882 O  O   . HOH S 4 .   ? 5.464   -24.153 20.623  1.00 54.39  ? 2057 HOH A O   1 
HETATM 3883 O  O   . HOH S 4 .   ? 7.708   -27.108 21.134  1.00 16.58  ? 2058 HOH A O   1 
HETATM 3884 O  O   . HOH S 4 .   ? 9.500   -22.733 19.928  1.00 32.67  ? 2059 HOH A O   1 
HETATM 3885 O  O   . HOH S 4 .   ? 15.416  -16.540 23.874  1.00 32.68  ? 2060 HOH A O   1 
HETATM 3886 O  O   . HOH S 4 .   ? 11.176  -18.816 30.078  1.00 40.10  ? 2061 HOH A O   1 
HETATM 3887 O  O   . HOH S 4 .   ? 15.974  -23.751 35.352  1.00 40.20  ? 2062 HOH A O   1 
HETATM 3888 O  O   . HOH S 4 .   ? 17.118  -11.344 34.595  1.00 42.02  ? 2063 HOH A O   1 
HETATM 3889 O  O   . HOH S 4 .   ? 18.548  -8.519  41.502  1.00 40.88  ? 2064 HOH A O   1 
HETATM 3890 O  O   . HOH S 4 .   ? 17.436  -13.300 38.890  1.00 27.22  ? 2065 HOH A O   1 
HETATM 3891 O  O   . HOH S 4 .   ? 25.755  -10.720 43.578  1.00 26.71  ? 2066 HOH A O   1 
HETATM 3892 O  O   . HOH S 4 .   ? 20.663  -9.436  43.617  1.00 29.42  ? 2067 HOH A O   1 
HETATM 3893 O  O   . HOH S 4 .   ? 29.924  2.088   46.334  1.00 26.35  ? 2068 HOH A O   1 
HETATM 3894 O  O   . HOH S 4 .   ? 26.293  -3.338  49.273  1.00 36.84  ? 2069 HOH A O   1 
HETATM 3895 O  O   . HOH S 4 .   ? 27.592  3.101   49.258  1.00 46.70  ? 2070 HOH A O   1 
HETATM 3896 O  O   . HOH S 4 .   ? 42.000  7.298   47.961  1.00 34.18  ? 2071 HOH A O   1 
HETATM 3897 O  O   . HOH S 4 .   ? 32.338  3.242   47.719  1.00 36.55  ? 2072 HOH A O   1 
HETATM 3898 O  O   . HOH S 4 .   ? 42.239  6.185   43.974  1.00 37.60  ? 2073 HOH A O   1 
HETATM 3899 O  O   . HOH S 4 .   ? 8.403   -48.834 17.552  1.00 45.16  ? 2074 HOH A O   1 
HETATM 3900 O  O   . HOH S 4 .   ? 5.827   -50.263 18.834  1.00 50.26  ? 2075 HOH A O   1 
HETATM 3901 O  O   . HOH S 4 .   ? 22.030  -23.017 25.204  1.00 25.46  ? 2076 HOH A O   1 
HETATM 3902 O  O   . HOH S 4 .   ? 18.917  -25.200 26.430  1.00 26.17  ? 2077 HOH A O   1 
HETATM 3903 O  O   . HOH S 4 .   ? 17.524  -21.419 27.960  1.00 21.91  ? 2078 HOH A O   1 
HETATM 3904 O  O   . HOH S 4 .   ? 19.592  -23.597 28.870  1.00 22.19  ? 2079 HOH A O   1 
HETATM 3905 O  O   . HOH S 4 .   ? 19.922  -22.201 26.186  1.00 25.24  ? 2080 HOH A O   1 
HETATM 3906 O  O   . HOH S 4 .   ? 16.592  -24.207 28.187  1.00 24.11  ? 2081 HOH A O   1 
HETATM 3907 O  O   . HOH S 4 .   ? 17.098  -22.890 25.394  1.00 22.10  ? 2082 HOH A O   1 
HETATM 3908 O  O   . HOH T 4 .   ? 19.468  -16.192 42.158  1.00 32.84  ? 2001 HOH B O   1 
HETATM 3909 O  O   . HOH T 4 .   ? 29.491  -13.844 43.739  1.00 33.19  ? 2002 HOH B O   1 
HETATM 3910 O  O   . HOH T 4 .   ? 27.038  -13.989 41.411  1.00 21.97  ? 2003 HOH B O   1 
HETATM 3911 O  O   . HOH T 4 .   ? 29.648  -15.706 47.319  1.00 60.93  ? 2004 HOH B O   1 
HETATM 3912 O  O   . HOH T 4 .   ? 27.187  -10.969 50.505  1.00 39.55  ? 2005 HOH B O   1 
HETATM 3913 O  O   . HOH T 4 .   ? 29.966  -8.788  50.405  1.00 37.06  ? 2006 HOH B O   1 
HETATM 3914 O  O   . HOH T 4 .   ? 40.619  -3.917  49.109  1.00 30.88  ? 2007 HOH B O   1 
HETATM 3915 O  O   . HOH T 4 .   ? 36.454  -7.262  48.236  1.00 28.74  ? 2008 HOH B O   1 
HETATM 3916 O  O   . HOH T 4 .   ? 24.200  -31.231 28.455  1.00 32.53  ? 2009 HOH B O   1 
HETATM 3917 O  O   . HOH T 4 .   ? 33.507  -21.605 25.281  1.00 40.23  ? 2010 HOH B O   1 
HETATM 3918 O  O   . HOH T 4 .   ? 42.721  3.767   48.812  1.00 29.91  ? 2011 HOH B O   1 
HETATM 3919 O  O   . HOH T 4 .   ? 45.647  4.330   42.585  1.00 37.88  ? 2012 HOH B O   1 
HETATM 3920 O  O   . HOH T 4 .   ? 47.305  1.134   42.071  1.00 36.50  ? 2013 HOH B O   1 
HETATM 3921 O  O   . HOH T 4 .   ? 17.619  -1.024  28.678  1.00 42.69  ? 2014 HOH B O   1 
HETATM 3922 O  O   . HOH T 4 .   ? 43.303  -6.165  42.448  1.00 37.11  ? 2015 HOH B O   1 
HETATM 3923 O  O   . HOH T 4 .   ? 42.603  1.821   42.217  1.00 24.57  ? 2016 HOH B O   1 
HETATM 3924 O  O   . HOH T 4 .   ? 45.675  0.018   35.683  1.00 34.68  ? 2017 HOH B O   1 
HETATM 3925 O  O   . HOH T 4 .   ? 46.101  -4.965  41.049  1.00 35.42  ? 2018 HOH B O   1 
HETATM 3926 O  O   . HOH T 4 .   ? 41.961  -7.821  38.857  1.00 36.89  ? 2019 HOH B O   1 
HETATM 3927 O  O   . HOH T 4 .   ? 19.789  -11.562 22.005  1.00 44.14  ? 2020 HOH B O   1 
HETATM 3928 O  O   . HOH T 4 .   ? 20.295  -13.974 19.226  1.00 26.09  ? 2021 HOH B O   1 
HETATM 3929 O  O   . HOH T 4 .   ? 21.301  -12.531 16.693  1.00 48.74  ? 2022 HOH B O   1 
HETATM 3930 O  O   . HOH T 4 .   ? 23.026  -7.420  16.272  1.00 50.79  ? 2023 HOH B O   1 
HETATM 3931 O  O   . HOH T 4 .   ? 40.656  -7.348  36.490  1.00 34.56  ? 2024 HOH B O   1 
HETATM 3932 O  O   . HOH T 4 .   ? 36.755  -9.156  43.351  1.00 22.72  ? 2025 HOH B O   1 
HETATM 3933 O  O   . HOH T 4 .   ? 27.918  -11.699 42.355  1.00 23.88  ? 2026 HOH B O   1 
HETATM 3934 O  O   . HOH T 4 .   ? 26.543  -1.160  19.386  1.00 38.09  ? 2027 HOH B O   1 
HETATM 3935 O  O   . HOH T 4 .   ? 29.398  -20.708 39.011  1.00 38.72  ? 2028 HOH B O   1 
HETATM 3936 O  O   . HOH T 4 .   ? 27.003  -23.228 36.504  1.00 21.47  ? 2029 HOH B O   1 
HETATM 3937 O  O   . HOH T 4 .   ? 22.460  -20.545 43.175  1.00 33.95  ? 2030 HOH B O   1 
HETATM 3938 O  O   . HOH T 4 .   ? 22.607  -24.283 41.382  1.00 31.15  ? 2031 HOH B O   1 
HETATM 3939 O  O   . HOH T 4 .   ? 33.758  -24.685 29.633  1.00 31.00  ? 2032 HOH B O   1 
HETATM 3940 O  O   . HOH T 4 .   ? 26.669  -27.007 31.973  1.00 40.74  ? 2033 HOH B O   1 
HETATM 3941 O  O   . HOH T 4 .   ? 23.252  -28.811 29.753  1.00 22.40  ? 2034 HOH B O   1 
HETATM 3942 O  O   . HOH T 4 .   ? 20.486  -26.654 35.227  1.00 31.12  ? 2035 HOH B O   1 
HETATM 3943 O  O   . HOH T 4 .   ? 40.500  -19.764 35.622  1.00 28.56  ? 2036 HOH B O   1 
HETATM 3944 O  O   . HOH T 4 .   ? 27.424  -24.770 30.734  1.00 31.29  ? 2037 HOH B O   1 
HETATM 3945 O  O   . HOH T 4 .   ? 30.723  -27.104 27.043  1.00 34.80  ? 2038 HOH B O   1 
HETATM 3946 O  O   . HOH T 4 .   ? 24.316  -21.892 23.548  1.00 31.47  ? 2039 HOH B O   1 
HETATM 3947 O  O   . HOH T 4 .   ? 29.763  -17.312 20.552  1.00 30.80  ? 2040 HOH B O   1 
HETATM 3948 O  O   . HOH T 4 .   ? 31.745  -22.135 23.040  1.00 20.12  ? 2041 HOH B O   1 
HETATM 3949 O  O   . HOH T 4 .   ? 23.436  -15.462 22.321  1.00 21.67  ? 2042 HOH B O   1 
HETATM 3950 O  O   . HOH T 4 .   ? 20.969  -0.852  40.919  1.00 39.14  ? 2043 HOH B O   1 
HETATM 3951 O  O   . HOH T 4 .   ? 18.647  -10.169 26.301  1.00 47.26  ? 2044 HOH B O   1 
HETATM 3952 O  O   . HOH T 4 .   ? 23.775  -7.494  21.050  1.00 38.09  ? 2045 HOH B O   1 
HETATM 3953 O  O   . HOH T 4 .   ? 19.536  -3.015  27.510  1.00 41.80  ? 2046 HOH B O   1 
HETATM 3954 O  O   . HOH T 4 .   ? 11.871  -25.018 11.381  1.00 41.14  ? 2047 HOH B O   1 
HETATM 3955 O  O   . HOH T 4 .   ? 24.254  1.757   39.601  1.00 33.15  ? 2048 HOH B O   1 
HETATM 3956 O  O   . HOH T 4 .   ? 21.758  -0.643  36.901  1.00 39.57  ? 2049 HOH B O   1 
HETATM 3957 O  O   . HOH T 4 .   ? 27.870  6.148   34.598  1.00 28.40  ? 2050 HOH B O   1 
HETATM 3958 O  O   . HOH T 4 .   ? 22.018  1.313   27.900  1.00 26.22  ? 2051 HOH B O   1 
HETATM 3959 O  O   . HOH T 4 .   ? 20.117  -1.414  30.803  1.00 51.48  ? 2052 HOH B O   1 
HETATM 3960 O  O   . HOH T 4 .   ? 35.329  -9.134  26.976  1.00 29.01  ? 2053 HOH B O   1 
HETATM 3961 O  O   . HOH T 4 .   ? 22.360  -10.451 18.175  1.00 32.20  ? 2054 HOH B O   1 
HETATM 3962 O  O   . HOH T 4 .   ? 22.192  -13.322 21.234  1.00 25.91  ? 2055 HOH B O   1 
HETATM 3963 O  O   . HOH T 4 .   ? 36.061  -17.373 20.721  1.00 44.27  ? 2056 HOH B O   1 
HETATM 3964 O  O   . HOH T 4 .   ? 28.024  -7.337  21.957  1.00 28.30  ? 2057 HOH B O   1 
HETATM 3965 O  O   . HOH T 4 .   ? 34.266  -11.007 23.087  1.00 35.07  ? 2058 HOH B O   1 
HETATM 3966 O  O   . HOH T 4 .   ? 27.637  -2.236  26.111  1.00 26.59  ? 2059 HOH B O   1 
HETATM 3967 O  O   . HOH T 4 .   ? 27.772  -3.587  19.101  1.00 40.20  ? 2060 HOH B O   1 
HETATM 3968 O  O   . HOH T 4 .   ? 30.464  6.353   26.817  1.00 27.45  ? 2061 HOH B O   1 
HETATM 3969 O  O   . HOH T 4 .   ? 40.893  1.074   27.729  1.00 46.37  ? 2062 HOH B O   1 
HETATM 3970 O  O   . HOH T 4 .   ? 39.952  -5.171  31.724  1.00 27.89  ? 2063 HOH B O   1 
HETATM 3971 O  O   . HOH T 4 .   ? 37.213  -3.592  26.928  1.00 23.59  ? 2064 HOH B O   1 
HETATM 3972 O  O   . HOH T 4 .   ? 41.861  -7.220  34.243  1.00 49.66  ? 2065 HOH B O   1 
HETATM 3973 O  O   . HOH T 4 .   ? 38.811  -10.760 27.881  1.00 33.81  ? 2066 HOH B O   1 
HETATM 3974 O  O   . HOH T 4 .   ? 36.400  -11.188 25.404  1.00 38.85  ? 2067 HOH B O   1 
HETATM 3975 O  O   . HOH T 4 .   ? 33.054  -20.340 27.751  1.00 29.81  ? 2068 HOH B O   1 
HETATM 3976 O  O   . HOH T 4 .   ? 37.480  -13.482 26.435  1.00 29.13  ? 2069 HOH B O   1 
HETATM 3977 O  O   . HOH T 4 .   ? 38.815  -15.695 28.016  1.00 39.39  ? 2070 HOH B O   1 
HETATM 3978 O  O   . HOH T 4 .   ? 33.879  -22.071 30.224  1.00 34.74  ? 2071 HOH B O   1 
HETATM 3979 O  O   . HOH T 4 .   ? 35.701  -19.292 24.742  1.00 41.07  ? 2072 HOH B O   1 
HETATM 3980 O  O   . HOH T 4 .   ? 40.294  -22.147 33.408  1.00 39.50  ? 2073 HOH B O   1 
HETATM 3981 O  O   . HOH T 4 .   ? 33.163  -14.677 31.699  1.00 28.20  ? 2074 HOH B O   1 
HETATM 3982 O  O   . HOH T 4 .   ? 36.433  -14.519 34.986  1.00 27.23  ? 2075 HOH B O   1 
HETATM 3983 O  O   . HOH T 4 .   ? 34.978  -13.072 33.541  1.00 18.87  ? 2076 HOH B O   1 
HETATM 3984 O  O   . HOH T 4 .   ? 35.607  -13.453 39.492  1.00 26.70  ? 2077 HOH B O   1 
HETATM 3985 O  O   . HOH T 4 .   ? 39.051  -15.275 34.719  1.00 39.24  ? 2078 HOH B O   1 
HETATM 3986 O  O   . HOH T 4 .   ? 41.415  -9.887  37.192  1.00 27.59  ? 2079 HOH B O   1 
HETATM 3987 O  O   . HOH T 4 .   ? 41.553  -4.489  33.532  1.00 35.27  ? 2080 HOH B O   1 
HETATM 3988 O  O   . HOH T 4 .   ? 39.924  3.025   30.566  1.00 37.65  ? 2081 HOH B O   1 
HETATM 3989 O  O   . HOH T 4 .   ? 43.666  2.652   34.884  1.00 32.87  ? 2082 HOH B O   1 
HETATM 3990 O  O   . HOH T 4 .   ? 36.754  6.085   33.137  1.00 38.97  ? 2083 HOH B O   1 
HETATM 3991 O  O   . HOH T 4 .   ? 31.007  8.389   37.054  1.00 36.80  ? 2084 HOH B O   1 
HETATM 3992 O  O   . HOH T 4 .   ? 23.095  -1.624  38.779  1.00 27.89  ? 2085 HOH B O   1 
HETATM 3993 O  O   . HOH T 4 .   ? 25.151  3.185   42.163  1.00 22.69  ? 2086 HOH B O   1 
HETATM 3994 O  O   . HOH T 4 .   ? 18.668  -8.451  28.298  1.00 40.65  ? 2087 HOH B O   1 
HETATM 3995 O  O   . HOH T 4 .   ? 21.660  -11.303 29.512  1.00 22.28  ? 2088 HOH B O   1 
HETATM 3996 O  O   . HOH T 4 .   ? 11.202  -19.477 25.446  1.00 27.15  ? 2089 HOH B O   1 
HETATM 3997 O  O   . HOH T 4 .   ? 12.005  -16.820 23.926  1.00 41.10  ? 2090 HOH B O   1 
HETATM 3998 O  O   . HOH T 4 .   ? 22.602  -24.951 20.192  1.00 23.14  ? 2091 HOH B O   1 
HETATM 3999 O  O   . HOH T 4 .   ? 10.521  -25.433 15.875  1.00 38.84  ? 2092 HOH B O   1 
HETATM 4000 O  O   . HOH T 4 .   ? 11.642  -30.697 10.022  1.00 40.53  ? 2093 HOH B O   1 
HETATM 4001 O  O   . HOH T 4 .   ? 14.363  -27.892 13.028  1.00 17.84  ? 2094 HOH B O   1 
HETATM 4002 O  O   . HOH T 4 .   ? 12.881  -28.291 10.891  1.00 36.91  ? 2095 HOH B O   1 
HETATM 4003 O  O   . HOH T 4 .   ? 8.627   -28.910 10.144  1.00 43.12  ? 2096 HOH B O   1 
HETATM 4004 O  O   . HOH T 4 .   ? 12.331  -24.892 14.043  1.00 49.51  ? 2097 HOH B O   1 
HETATM 4005 O  O   . HOH T 4 .   ? 12.276  -37.578 12.087  1.00 25.38  ? 2098 HOH B O   1 
HETATM 4006 O  O   . HOH T 4 .   ? 12.556  -33.532 8.981   1.00 29.94  ? 2099 HOH B O   1 
HETATM 4007 O  O   . HOH T 4 .   ? -0.448  -45.686 5.273   1.00 40.51  ? 2100 HOH B O   1 
HETATM 4008 O  O   . HOH T 4 .   ? 41.543  -11.860 46.651  1.00 41.18  ? 2101 HOH B O   1 
HETATM 4009 O  O   . HOH T 4 .   ? 37.202  -8.859  46.261  1.00 29.12  ? 2102 HOH B O   1 
HETATM 4010 O  O   . HOH T 4 .   ? 45.136  -7.479  43.985  1.00 32.48  ? 2103 HOH B O   1 
HETATM 4011 O  O   . HOH T 4 .   ? 41.240  -7.822  41.450  1.00 27.40  ? 2104 HOH B O   1 
HETATM 4012 O  O   . HOH U 4 .   ? 35.352  5.735   -4.258  1.00 41.92  ? 2001 HOH C O   1 
HETATM 4013 O  O   . HOH U 4 .   ? 41.400  7.296   -0.096  1.00 35.68  ? 2002 HOH C O   1 
HETATM 4014 O  O   . HOH U 4 .   ? 45.191  7.436   1.039   1.00 31.79  ? 2003 HOH C O   1 
HETATM 4015 O  O   . HOH U 4 .   ? 51.963  10.134  11.054  1.00 48.95  ? 2004 HOH C O   1 
HETATM 4016 O  O   . HOH U 4 .   ? 47.507  5.714   7.482   1.00 21.30  ? 2005 HOH C O   1 
HETATM 4017 O  O   . HOH U 4 .   ? 53.798  7.008   7.207   1.00 54.00  ? 2006 HOH C O   1 
HETATM 4018 O  O   . HOH U 4 .   ? 50.986  8.005   2.062   1.00 35.95  ? 2007 HOH C O   1 
HETATM 4019 O  O   . HOH U 4 .   ? 50.895  5.156   8.664   1.00 28.01  ? 2008 HOH C O   1 
HETATM 4020 O  O   . HOH U 4 .   ? 50.434  -3.917  2.932   1.00 24.69  ? 2009 HOH C O   1 
HETATM 4021 O  O   . HOH U 4 .   ? 57.522  -3.854  8.253   1.00 24.45  ? 2010 HOH C O   1 
HETATM 4022 O  O   . HOH U 4 .   ? 56.281  -0.330  5.788   1.00 39.00  ? 2011 HOH C O   1 
HETATM 4023 O  O   . HOH U 4 .   ? 57.448  -1.776  12.164  1.00 24.98  ? 2012 HOH C O   1 
HETATM 4024 O  O   . HOH U 4 .   ? 59.891  -5.012  15.351  1.00 29.77  ? 2013 HOH C O   1 
HETATM 4025 O  O   . HOH U 4 .   ? 59.793  -2.876  13.797  1.00 29.83  ? 2014 HOH C O   1 
HETATM 4026 O  O   . HOH U 4 .   ? 39.907  20.869  7.126   1.00 30.09  ? 2015 HOH C O   1 
HETATM 4027 O  O   . HOH U 4 .   ? 30.963  19.651  15.058  1.00 30.25  ? 2016 HOH C O   1 
HETATM 4028 O  O   . HOH U 4 .   ? 60.238  -5.633  18.448  1.00 38.58  ? 2017 HOH C O   1 
HETATM 4029 O  O   . HOH U 4 .   ? 24.457  9.425   13.454  1.00 26.27  ? 2018 HOH C O   1 
HETATM 4030 O  O   . HOH U 4 .   ? 37.668  -6.732  3.398   1.00 35.16  ? 2019 HOH C O   1 
HETATM 4031 O  O   . HOH U 4 .   ? 55.836  -3.046  23.277  1.00 39.71  ? 2020 HOH C O   1 
HETATM 4032 O  O   . HOH U 4 .   ? 50.854  -8.564  26.348  1.00 38.67  ? 2021 HOH C O   1 
HETATM 4033 O  O   . HOH U 4 .   ? 54.322  -2.118  20.090  1.00 30.99  ? 2022 HOH C O   1 
HETATM 4034 O  O   . HOH U 4 .   ? 25.263  7.126   12.965  1.00 30.93  ? 2023 HOH C O   1 
HETATM 4035 O  O   . HOH U 4 .   ? 53.356  0.290   14.987  1.00 21.89  ? 2024 HOH C O   1 
HETATM 4036 O  O   . HOH U 4 .   ? 48.709  3.227   7.852   1.00 22.45  ? 2025 HOH C O   1 
HETATM 4037 O  O   . HOH U 4 .   ? 47.233  12.390  10.050  1.00 36.21  ? 2026 HOH C O   1 
HETATM 4038 O  O   . HOH U 4 .   ? 43.691  14.893  9.420   1.00 20.68  ? 2027 HOH C O   1 
HETATM 4039 O  O   . HOH U 4 .   ? 45.391  15.135  2.656   1.00 34.87  ? 2028 HOH C O   1 
HETATM 4040 O  O   . HOH U 4 .   ? 40.550  18.489  6.404   1.00 38.89  ? 2029 HOH C O   1 
HETATM 4041 O  O   . HOH U 4 .   ? 36.877  20.842  10.057  1.00 28.17  ? 2030 HOH C O   1 
HETATM 4042 O  O   . HOH U 4 .   ? 39.118  17.718  3.901   1.00 39.55  ? 2031 HOH C O   1 
HETATM 4043 O  O   . HOH U 4 .   ? 48.810  4.097   18.617  1.00 26.82  ? 2032 HOH C O   1 
HETATM 4044 O  O   . HOH U 4 .   ? 51.337  9.979   16.329  1.00 31.62  ? 2033 HOH C O   1 
HETATM 4045 O  O   . HOH U 4 .   ? 39.238  16.947  12.871  1.00 31.06  ? 2034 HOH C O   1 
HETATM 4046 O  O   . HOH U 4 .   ? 52.237  4.390   15.138  1.00 31.72  ? 2035 HOH C O   1 
HETATM 4047 O  O   . HOH U 4 .   ? 31.908  19.900  18.499  1.00 44.15  ? 2036 HOH C O   1 
HETATM 4048 O  O   . HOH U 4 .   ? 39.692  20.996  10.501  1.00 40.68  ? 2037 HOH C O   1 
HETATM 4049 O  O   . HOH U 4 .   ? 29.103  18.984  17.371  1.00 39.88  ? 2038 HOH C O   1 
HETATM 4050 O  O   . HOH U 4 .   ? 31.451  10.090  20.221  1.00 30.20  ? 2039 HOH C O   1 
HETATM 4051 O  O   . HOH U 4 .   ? 42.310  -16.064 11.201  1.00 30.57  ? 2040 HOH C O   1 
HETATM 4052 O  O   . HOH U 4 .   ? 54.115  -15.397 11.485  1.00 33.66  ? 2041 HOH C O   1 
HETATM 4053 O  O   . HOH U 4 .   ? 51.464  -12.716 5.958   1.00 35.51  ? 2042 HOH C O   1 
HETATM 4054 O  O   . HOH U 4 .   ? 54.000  -14.740 8.864   1.00 38.83  ? 2043 HOH C O   1 
HETATM 4055 O  O   . HOH U 4 .   ? 29.326  8.091   13.842  1.00 24.98  ? 2044 HOH C O   1 
HETATM 4056 O  O   . HOH U 4 .   ? 26.031  11.141  14.740  1.00 26.88  ? 2045 HOH C O   1 
HETATM 4057 O  O   . HOH U 4 .   ? 42.903  -10.053 3.326   1.00 45.87  ? 2046 HOH C O   1 
HETATM 4058 O  O   . HOH U 4 .   ? 45.286  -12.328 5.765   1.00 34.08  ? 2047 HOH C O   1 
HETATM 4059 O  O   . HOH U 4 .   ? 31.949  18.018  13.252  1.00 31.04  ? 2048 HOH C O   1 
HETATM 4060 O  O   . HOH U 4 .   ? 43.247  -7.260  2.445   1.00 30.86  ? 2049 HOH C O   1 
HETATM 4061 O  O   . HOH U 4 .   ? 30.996  -4.913  7.309   1.00 42.58  ? 2050 HOH C O   1 
HETATM 4062 O  O   . HOH U 4 .   ? 18.803  19.875  11.808  1.00 39.50  ? 2051 HOH C O   1 
HETATM 4063 O  O   . HOH U 4 .   ? 15.513  23.313  11.318  1.00 35.32  ? 2052 HOH C O   1 
HETATM 4064 O  O   . HOH U 4 .   ? 39.837  -7.962  5.122   1.00 32.96  ? 2053 HOH C O   1 
HETATM 4065 O  O   . HOH U 4 .   ? 32.520  -9.108  9.648   1.00 38.97  ? 2054 HOH C O   1 
HETATM 4066 O  O   . HOH U 4 .   ? 38.399  1.161   21.733  1.00 25.20  ? 2055 HOH C O   1 
HETATM 4067 O  O   . HOH U 4 .   ? 27.540  6.073   13.391  1.00 27.36  ? 2056 HOH C O   1 
HETATM 4068 O  O   . HOH U 4 .   ? 24.759  3.921   14.950  1.00 37.71  ? 2057 HOH C O   1 
HETATM 4069 O  O   . HOH U 4 .   ? 24.986  10.918  18.686  1.00 28.20  ? 2058 HOH C O   1 
HETATM 4070 O  O   . HOH U 4 .   ? 28.131  5.325   25.281  1.00 29.13  ? 2059 HOH C O   1 
HETATM 4071 O  O   . HOH U 4 .   ? 25.291  -2.223  24.173  1.00 35.24  ? 2060 HOH C O   1 
HETATM 4072 O  O   . HOH U 4 .   ? 34.078  -3.821  22.633  1.00 29.00  ? 2061 HOH C O   1 
HETATM 4073 O  O   . HOH U 4 .   ? 35.188  3.264   22.756  1.00 30.31  ? 2062 HOH C O   1 
HETATM 4074 O  O   . HOH U 4 .   ? 33.606  -5.569  15.585  1.00 23.30  ? 2063 HOH C O   1 
HETATM 4075 O  O   . HOH U 4 .   ? 30.648  -0.409  17.873  1.00 22.63  ? 2064 HOH C O   1 
HETATM 4076 O  O   . HOH U 4 .   ? 41.097  -12.534 22.080  1.00 35.12  ? 2065 HOH C O   1 
HETATM 4077 O  O   . HOH U 4 .   ? 35.706  -14.517 17.895  1.00 34.48  ? 2066 HOH C O   1 
HETATM 4078 O  O   . HOH U 4 .   ? 42.961  -14.347 19.859  1.00 28.65  ? 2067 HOH C O   1 
HETATM 4079 O  O   . HOH U 4 .   ? 40.647  -9.411  26.368  1.00 31.62  ? 2068 HOH C O   1 
HETATM 4080 O  O   . HOH U 4 .   ? 40.835  -3.375  25.196  1.00 29.08  ? 2069 HOH C O   1 
HETATM 4081 O  O   . HOH U 4 .   ? 44.914  -3.109  23.439  1.00 32.86  ? 2070 HOH C O   1 
HETATM 4082 O  O   . HOH U 4 .   ? 43.445  -3.683  25.557  1.00 44.59  ? 2071 HOH C O   1 
HETATM 4083 O  O   . HOH U 4 .   ? 39.036  -4.405  23.451  1.00 16.93  ? 2072 HOH C O   1 
HETATM 4084 O  O   . HOH U 4 .   ? 38.193  3.281   23.737  1.00 34.76  ? 2073 HOH C O   1 
HETATM 4085 O  O   . HOH U 4 .   ? 41.523  2.922   23.958  1.00 52.82  ? 2074 HOH C O   1 
HETATM 4086 O  O   . HOH U 4 .   ? 39.211  12.583  18.990  1.00 22.26  ? 2075 HOH C O   1 
HETATM 4087 O  O   . HOH U 4 .   ? 39.362  5.596   23.852  1.00 26.46  ? 2076 HOH C O   1 
HETATM 4088 O  O   . HOH U 4 .   ? 41.567  14.786  22.538  1.00 38.00  ? 2077 HOH C O   1 
HETATM 4089 O  O   . HOH U 4 .   ? 41.348  7.973   24.248  1.00 34.65  ? 2078 HOH C O   1 
HETATM 4090 O  O   . HOH U 4 .   ? 41.978  13.954  18.596  1.00 31.13  ? 2079 HOH C O   1 
HETATM 4091 O  O   . HOH U 4 .   ? 47.771  10.694  18.055  1.00 29.29  ? 2080 HOH C O   1 
HETATM 4092 O  O   . HOH U 4 .   ? 42.747  16.208  11.726  1.00 27.42  ? 2081 HOH C O   1 
HETATM 4093 O  O   . HOH U 4 .   ? 42.334  6.501   17.625  1.00 22.49  ? 2082 HOH C O   1 
HETATM 4094 O  O   . HOH U 4 .   ? 49.798  7.496   17.367  1.00 22.11  ? 2083 HOH C O   1 
HETATM 4095 O  O   . HOH U 4 .   ? 46.572  6.159   18.889  1.00 28.20  ? 2084 HOH C O   1 
HETATM 4096 O  O   . HOH U 4 .   ? 49.896  4.890   15.944  1.00 31.34  ? 2085 HOH C O   1 
HETATM 4097 O  O   . HOH U 4 .   ? 44.352  4.884   18.224  1.00 21.73  ? 2086 HOH C O   1 
HETATM 4098 O  O   . HOH U 4 .   ? 47.679  6.589   21.250  1.00 36.44  ? 2087 HOH C O   1 
HETATM 4099 O  O   . HOH U 4 .   ? 44.397  -5.624  26.836  1.00 42.79  ? 2088 HOH C O   1 
HETATM 4100 O  O   . HOH U 4 .   ? 46.973  -7.587  28.669  1.00 44.88  ? 2089 HOH C O   1 
HETATM 4101 O  O   . HOH U 4 .   ? 47.144  -3.799  24.120  1.00 26.16  ? 2090 HOH C O   1 
HETATM 4102 O  O   . HOH U 4 .   ? 44.595  -13.534 23.593  1.00 44.02  ? 2091 HOH C O   1 
HETATM 4103 O  O   . HOH U 4 .   ? 49.460  -10.721 25.060  1.00 24.63  ? 2092 HOH C O   1 
HETATM 4104 O  O   . HOH U 4 .   ? 48.005  -15.988 21.153  1.00 30.71  ? 2093 HOH C O   1 
HETATM 4105 O  O   . HOH U 4 .   ? 42.867  -10.801 24.503  1.00 39.88  ? 2094 HOH C O   1 
HETATM 4106 O  O   . HOH U 4 .   ? 46.529  -14.445 17.772  1.00 39.22  ? 2095 HOH C O   1 
HETATM 4107 O  O   . HOH U 4 .   ? 45.091  -15.869 10.362  1.00 27.97  ? 2096 HOH C O   1 
HETATM 4108 O  O   . HOH U 4 .   ? 47.300  -17.798 18.973  1.00 39.18  ? 2097 HOH C O   1 
HETATM 4109 O  O   . HOH U 4 .   ? 51.288  -14.602 7.839   1.00 33.23  ? 2098 HOH C O   1 
HETATM 4110 O  O   . HOH U 4 .   ? 51.103  -15.373 12.395  1.00 40.19  ? 2099 HOH C O   1 
HETATM 4111 O  O   . HOH U 4 .   ? 43.808  -10.148 5.838   1.00 23.32  ? 2100 HOH C O   1 
HETATM 4112 O  O   . HOH U 4 .   ? 42.597  -6.518  5.157   1.00 20.14  ? 2101 HOH C O   1 
HETATM 4113 O  O   . HOH U 4 .   ? 40.763  -4.002  2.003   1.00 47.57  ? 2102 HOH C O   1 
HETATM 4114 O  O   . HOH U 4 .   ? 34.415  3.259   8.776   1.00 19.02  ? 2103 HOH C O   1 
HETATM 4115 O  O   . HOH U 4 .   ? 18.327  22.894  10.796  1.00 31.14  ? 2104 HOH C O   1 
HETATM 4116 O  O   . HOH U 4 .   ? 17.602  32.276  7.474   1.00 37.56  ? 2105 HOH C O   1 
HETATM 4117 O  O   . HOH U 4 .   ? 15.386  29.394  10.315  1.00 36.38  ? 2106 HOH C O   1 
HETATM 4118 O  O   . HOH U 4 .   ? 54.365  0.993   17.696  1.00 32.23  ? 2107 HOH C O   1 
HETATM 4119 O  O   . HOH U 4 .   ? 58.691  -3.006  21.917  1.00 39.37  ? 2108 HOH C O   1 
HETATM 4120 O  O   . HOH U 4 .   ? 28.719  20.204  20.968  1.00 28.62  ? 2109 HOH C O   1 
HETATM 4121 O  O   . HOH U 4 .   ? 34.484  14.809  19.857  1.00 18.78  ? 2110 HOH C O   1 
HETATM 4122 O  O   . HOH U 4 .   ? 23.914  16.570  24.065  1.00 26.43  ? 2111 HOH C O   1 
HETATM 4123 O  O   . HOH U 4 .   ? 25.611  20.034  21.219  1.00 26.28  ? 2112 HOH C O   1 
HETATM 4124 O  O   . HOH U 4 .   ? 28.086  16.786  24.947  1.00 33.14  ? 2113 HOH C O   1 
HETATM 4125 O  O   . HOH U 4 .   ? 34.863  8.861   28.537  1.00 29.14  ? 2114 HOH C O   1 
HETATM 4126 O  O   . HOH U 4 .   ? 52.822  -9.759  -1.048  1.00 46.49  ? 2115 HOH C O   1 
HETATM 4127 O  O   . HOH U 4 .   ? 47.218  -10.731 4.074   1.00 30.89  ? 2116 HOH C O   1 
HETATM 4128 O  O   . HOH U 4 .   ? 33.172  17.223  3.166   1.00 28.12  ? 2117 HOH C O   1 
HETATM 4129 O  O   . HOH U 4 .   ? 31.934  15.918  10.441  1.00 24.29  ? 2118 HOH C O   1 
HETATM 4130 O  O   . HOH U 4 .   ? 31.325  13.514  5.678   1.00 25.60  ? 2119 HOH C O   1 
HETATM 4131 O  O   . HOH U 4 .   ? 31.432  17.548  7.271   1.00 24.01  ? 2120 HOH C O   1 
HETATM 4132 O  O   . HOH U 4 .   ? 31.382  14.611  8.473   1.00 24.89  ? 2121 HOH C O   1 
HETATM 4133 O  O   . HOH U 4 .   ? 33.527  15.558  6.450   1.00 22.66  ? 2122 HOH C O   1 
HETATM 4134 O  O   . HOH U 4 .   ? 29.171  15.522  6.613   1.00 22.22  ? 2123 HOH C O   1 
HETATM 4135 O  O   . HOH U 4 .   ? 31.306  16.248  4.426   1.00 23.14  ? 2124 HOH C O   1 
HETATM 4136 O  O   . HOH V 4 .   ? 26.958  21.934  15.750  1.00 31.81  ? 2001 HOH D O   1 
HETATM 4137 O  O   . HOH V 4 .   ? 21.294  21.203  12.509  1.00 34.03  ? 2002 HOH D O   1 
HETATM 4138 O  O   . HOH V 4 .   ? 24.786  22.295  16.994  1.00 32.05  ? 2003 HOH D O   1 
HETATM 4139 O  O   . HOH V 4 .   ? 20.336  24.486  11.710  1.00 34.03  ? 2004 HOH D O   1 
HETATM 4140 O  O   . HOH V 4 .   ? 24.094  37.509  7.028   1.00 70.78  ? 2005 HOH D O   1 
HETATM 4141 O  O   . HOH V 4 .   ? 21.266  31.473  6.654   1.00 27.89  ? 2006 HOH D O   1 
HETATM 4142 O  O   . HOH V 4 .   ? 27.109  38.137  8.906   1.00 56.04  ? 2007 HOH D O   1 
HETATM 4143 O  O   . HOH V 4 .   ? 25.143  33.287  13.593  1.00 46.52  ? 2008 HOH D O   1 
HETATM 4144 O  O   . HOH V 4 .   ? 38.752  17.713  0.216   1.00 34.89  ? 2009 HOH D O   1 
HETATM 4145 O  O   . HOH V 4 .   ? 19.389  33.052  5.211   1.00 32.87  ? 2010 HOH D O   1 
HETATM 4146 O  O   . HOH V 4 .   ? 31.091  28.104  7.583   1.00 38.16  ? 2011 HOH D O   1 
HETATM 4147 O  O   . HOH V 4 .   ? 25.045  30.209  13.266  1.00 31.08  ? 2012 HOH D O   1 
HETATM 4148 O  O   . HOH V 4 .   ? 37.413  21.588  7.249   1.00 33.91  ? 2013 HOH D O   1 
HETATM 4149 O  O   . HOH V 4 .   ? 35.377  21.520  -5.140  1.00 36.24  ? 2014 HOH D O   1 
HETATM 4150 O  O   . HOH V 4 .   ? 31.006  19.841  -7.550  1.00 44.60  ? 2015 HOH D O   1 
HETATM 4151 O  O   . HOH V 4 .   ? 33.789  23.898  -6.974  1.00 31.47  ? 2016 HOH D O   1 
HETATM 4152 O  O   . HOH V 4 .   ? 30.845  13.258  -2.682  1.00 35.02  ? 2017 HOH D O   1 
HETATM 4153 O  O   . HOH V 4 .   ? 36.175  17.896  1.298   1.00 34.91  ? 2018 HOH D O   1 
HETATM 4154 O  O   . HOH V 4 .   ? 24.443  9.510   9.303   1.00 38.26  ? 2019 HOH D O   1 
HETATM 4155 O  O   . HOH V 4 .   ? 37.544  3.962   -0.303  1.00 40.87  ? 2020 HOH D O   1 
HETATM 4156 O  O   . HOH V 4 .   ? 8.217   24.576  0.745   1.00 42.19  ? 2021 HOH D O   1 
HETATM 4157 O  O   . HOH V 4 .   ? 26.354  28.294  -3.696  1.00 42.16  ? 2022 HOH D O   1 
HETATM 4158 O  O   . HOH V 4 .   ? 26.654  32.831  -10.046 1.00 41.86  ? 2023 HOH D O   1 
HETATM 4159 O  O   . HOH V 4 .   ? 33.762  24.593  4.007   1.00 39.55  ? 2024 HOH D O   1 
HETATM 4160 O  O   . HOH V 4 .   ? 26.153  32.906  -4.151  1.00 28.44  ? 2025 HOH D O   1 
HETATM 4161 O  O   . HOH V 4 .   ? 10.906  33.274  7.422   1.00 46.12  ? 2026 HOH D O   1 
HETATM 4162 O  O   . HOH V 4 .   ? 4.959   31.301  1.465   1.00 45.30  ? 2027 HOH D O   1 
HETATM 4163 O  O   . HOH V 4 .   ? 20.474  19.385  1.421   1.00 24.59  ? 2028 HOH D O   1 
HETATM 4164 O  O   . HOH V 4 .   ? 26.229  9.283   7.220   1.00 33.71  ? 2029 HOH D O   1 
HETATM 4165 O  O   . HOH V 4 .   ? 34.175  9.391   0.124   1.00 30.19  ? 2030 HOH D O   1 
HETATM 4166 O  O   . HOH V 4 .   ? 40.066  4.711   0.189   1.00 32.11  ? 2031 HOH D O   1 
HETATM 4167 O  O   . HOH V 4 .   ? 44.067  4.637   0.700   1.00 31.44  ? 2032 HOH D O   1 
HETATM 4168 O  O   . HOH V 4 .   ? 48.621  2.231   5.139   1.00 24.06  ? 2033 HOH D O   1 
HETATM 4169 O  O   . HOH V 4 .   ? 46.663  1.457   0.892   1.00 26.34  ? 2034 HOH D O   1 
HETATM 4170 O  O   . HOH V 4 .   ? 49.204  0.224   1.755   1.00 28.94  ? 2035 HOH D O   1 
HETATM 4171 O  O   . HOH V 4 .   ? 52.705  -10.670 7.234   1.00 24.73  ? 2036 HOH D O   1 
HETATM 4172 O  O   . HOH V 4 .   ? 58.740  -10.673 9.331   1.00 33.26  ? 2037 HOH D O   1 
HETATM 4173 O  O   . HOH V 4 .   ? 54.812  -12.111 8.907   1.00 28.17  ? 2038 HOH D O   1 
HETATM 4174 O  O   . HOH V 4 .   ? 60.265  -12.618 17.893  1.00 23.30  ? 2039 HOH D O   1 
HETATM 4175 O  O   . HOH V 4 .   ? 64.644  -15.962 13.341  1.00 42.31  ? 2040 HOH D O   1 
HETATM 4176 O  O   . HOH V 4 .   ? 61.031  -14.613 11.501  1.00 30.12  ? 2041 HOH D O   1 
HETATM 4177 O  O   . HOH V 4 .   ? 65.156  -12.188 13.626  1.00 39.00  ? 2042 HOH D O   1 
HETATM 4178 O  O   . HOH V 4 .   ? 18.511  47.037  -7.479  1.00 81.67  ? 2043 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . PCA A 1   ? 0.2585 0.2992 0.3871 -0.1043 0.0519  -0.0036 1    PCA A N   
2    C CA  . PCA A 1   ? 0.2456 0.3113 0.3872 -0.1109 0.0621  -0.0187 1    PCA A CA  
3    C CB  . PCA A 1   ? 0.2511 0.3095 0.4217 -0.1166 0.0599  -0.0249 1    PCA A CB  
4    C CG  . PCA A 1   ? 0.2722 0.2970 0.4480 -0.1160 0.0505  -0.0133 1    PCA A CG  
5    C CD  . PCA A 1   ? 0.2695 0.2855 0.4211 -0.1055 0.0454  -0.0019 1    PCA A CD  
6    O OE  . PCA A 1   ? 0.2682 0.2602 0.4247 -0.0985 0.0365  0.0053  1    PCA A OE  
7    C C   . PCA A 1   ? 0.2149 0.2948 0.3578 -0.0974 0.0612  -0.0381 1    PCA A C   
8    O O   . PCA A 1   ? 0.1941 0.2956 0.3556 -0.0989 0.0677  -0.0523 1    PCA A O   
9    N N   . LEU A 2   ? 0.2021 0.2704 0.3311 -0.0846 0.0532  -0.0382 2    LEU A N   
10   C CA  . LEU A 2   ? 0.1867 0.2640 0.3196 -0.0741 0.0519  -0.0518 2    LEU A CA  
11   C C   . LEU A 2   ? 0.1973 0.2962 0.3259 -0.0787 0.0633  -0.0597 2    LEU A C   
12   O O   . LEU A 2   ? 0.2047 0.3099 0.3107 -0.0871 0.0682  -0.0517 2    LEU A O   
13   C CB  . LEU A 2   ? 0.1807 0.2423 0.3020 -0.0628 0.0424  -0.0497 2    LEU A CB  
14   C CG  . LEU A 2   ? 0.1774 0.2245 0.3014 -0.0583 0.0333  -0.0497 2    LEU A CG  
15   C CD1 . LEU A 2   ? 0.1823 0.2230 0.2936 -0.0501 0.0289  -0.0494 2    LEU A CD1 
16   C CD2 . LEU A 2   ? 0.1544 0.2098 0.2952 -0.0579 0.0279  -0.0584 2    LEU A CD2 
17   N N   . LEU A 3   ? 0.1794 0.2919 0.3325 -0.0734 0.0664  -0.0766 3    LEU A N   
18   C CA  . LEU A 3   ? 0.1950 0.3314 0.3550 -0.0775 0.0797  -0.0938 3    LEU A CA  
19   C C   . LEU A 3   ? 0.1869 0.3150 0.3556 -0.0655 0.0745  -0.1039 3    LEU A C   
20   O O   . LEU A 3   ? 0.1756 0.2849 0.3548 -0.0543 0.0615  -0.0975 3    LEU A O   
21   C CB  . LEU A 3   ? 0.1918 0.3529 0.3884 -0.0808 0.0895  -0.1102 3    LEU A CB  
22   C CG  . LEU A 3   ? 0.1949 0.3686 0.3870 -0.0975 0.0984  -0.1015 3    LEU A CG  
23   C CD1 . LEU A 3   ? 0.1833 0.3835 0.4202 -0.0994 0.1063  -0.1191 3    LEU A CD1 
24   C CD2 . LEU A 3   ? 0.2322 0.4222 0.3885 -0.1157 0.1124  -0.0947 3    LEU A CD2 
25   N N   . PHE A 4   ? 0.2013 0.3450 0.3646 -0.0704 0.0846  -0.1192 4    PHE A N   
26   C CA  . PHE A 4   ? 0.2127 0.3473 0.3882 -0.0621 0.0810  -0.1310 4    PHE A CA  
27   C C   . PHE A 4   ? 0.2223 0.3768 0.4355 -0.0613 0.0934  -0.1632 4    PHE A C   
28   O O   . PHE A 4   ? 0.2272 0.4131 0.4401 -0.0725 0.1098  -0.1812 4    PHE A O   
29   C CB  . PHE A 4   ? 0.2197 0.3524 0.3584 -0.0680 0.0788  -0.1243 4    PHE A CB  
30   C CG  . PHE A 4   ? 0.2188 0.3304 0.3344 -0.0646 0.0661  -0.0977 4    PHE A CG  
31   C CD1 . PHE A 4   ? 0.2116 0.3037 0.3291 -0.0564 0.0563  -0.0913 4    PHE A CD1 
32   C CD2 . PHE A 4   ? 0.2498 0.3615 0.3467 -0.0707 0.0651  -0.0804 4    PHE A CD2 
33   C CE1 . PHE A 4   ? 0.2232 0.3015 0.3246 -0.0533 0.0475  -0.0730 4    PHE A CE1 
34   C CE2 . PHE A 4   ? 0.2286 0.3205 0.3145 -0.0660 0.0542  -0.0617 4    PHE A CE2 
35   C CZ  . PHE A 4   ? 0.2227 0.3005 0.3111 -0.0568 0.0464  -0.0606 4    PHE A CZ  
36   N N   . ASN A 5   ? 0.2321 0.3682 0.4801 -0.0490 0.0856  -0.1699 5    ASN A N   
37   C CA  . ASN A 5   ? 0.2469 0.3920 0.5373 -0.0461 0.0946  -0.2029 5    ASN A CA  
38   C C   . ASN A 5   ? 0.2632 0.4110 0.5270 -0.0553 0.0988  -0.2141 5    ASN A C   
39   O O   . ASN A 5   ? 0.2510 0.3733 0.5136 -0.0512 0.0877  -0.2030 5    ASN A O   
40   C CB  . ASN A 5   ? 0.2497 0.3674 0.5925 -0.0292 0.0799  -0.1969 5    ASN A CB  
41   C CG  . ASN A 5   ? 0.2686 0.3849 0.6674 -0.0237 0.0860  -0.2294 5    ASN A CG  
42   O OD1 . ASN A 5   ? 0.2877 0.4336 0.7021 -0.0302 0.1050  -0.2672 5    ASN A OD1 
43   N ND2 . ASN A 5   ? 0.3232 0.4056 0.7552 -0.0128 0.0701  -0.2152 5    ASN A ND2 
44   N N   . LYS A 6   ? 0.2774 0.4606 0.5183 -0.0701 0.1149  -0.2358 6    LYS A N   
45   C CA  . LYS A 6   ? 0.2972 0.4916 0.4983 -0.0823 0.1153  -0.2399 6    LYS A CA  
46   C C   . LYS A 6   ? 0.3062 0.5077 0.5381 -0.0844 0.1225  -0.2795 6    LYS A C   
47   O O   . LYS A 6   ? 0.3082 0.5176 0.5908 -0.0800 0.1338  -0.3128 6    LYS A O   
48   C CB  . LYS A 6   ? 0.3186 0.5502 0.4696 -0.1007 0.1251  -0.2363 6    LYS A CB  
49   C CG  . LYS A 6   ? 0.3097 0.5286 0.4340 -0.1001 0.1167  -0.1963 6    LYS A CG  
50   C CD  . LYS A 6   ? 0.3460 0.5977 0.4234 -0.1202 0.1245  -0.1860 6    LYS A CD  
51   C CE  . LYS A 6   ? 0.3507 0.5824 0.4103 -0.1194 0.1147  -0.1459 6    LYS A CE  
52   N NZ  . LYS A 6   ? 0.3213 0.5226 0.3659 -0.1100 0.0948  -0.1192 6    LYS A NZ  
53   N N   . THR A 7   ? 0.3187 0.5173 0.5252 -0.0909 0.1148  -0.2765 7    THR A N   
54   C CA  . THR A 7   ? 0.3364 0.5420 0.5659 -0.0968 0.1194  -0.3135 7    THR A CA  
55   C C   . THR A 7   ? 0.3471 0.5842 0.5204 -0.1144 0.1167  -0.3137 7    THR A C   
56   O O   . THR A 7   ? 0.3249 0.5498 0.4670 -0.1132 0.1015  -0.2790 7    THR A O   
57   C CB  . THR A 7   ? 0.3344 0.4941 0.6038 -0.0850 0.1062  -0.3023 7    THR A CB  
58   O OG1 . THR A 7   ? 0.3506 0.4840 0.6760 -0.0693 0.1056  -0.3017 7    THR A OG1 
59   C CG2 . THR A 7   ? 0.3436 0.5082 0.6349 -0.0942 0.1092  -0.3379 7    THR A CG2 
60   N N   . LYS A 8   ? 0.3696 0.6510 0.5320 -0.1310 0.1307  -0.3537 8    LYS A N   
61   C CA  . LYS A 8   ? 0.3896 0.7098 0.4935 -0.1501 0.1255  -0.3517 8    LYS A CA  
62   C C   . LYS A 8   ? 0.3817 0.6867 0.4903 -0.1497 0.1091  -0.3486 8    LYS A C   
63   O O   . LYS A 8   ? 0.3733 0.6876 0.4410 -0.1544 0.0933  -0.3192 8    LYS A O   
64   C CB  . LYS A 8   ? 0.4303 0.8085 0.5195 -0.1713 0.1450  -0.4007 8    LYS A CB  
65   C CG  . LYS A 8   ? 0.4643 0.8872 0.4943 -0.1931 0.1359  -0.4017 8    LYS A CG  
66   C CD  . LYS A 8   ? 0.5083 0.9976 0.4968 -0.2186 0.1541  -0.4314 8    LYS A CD  
67   C CE  . LYS A 8   ? 0.5544 1.0923 0.4917 -0.2415 0.1427  -0.4419 8    LYS A CE  
68   N NZ  . LYS A 8   ? 0.6182 1.2294 0.5143 -0.2706 0.1632  -0.4811 8    LYS A NZ  
69   N N   . SER A 9   ? 0.3780 0.6593 0.5429 -0.1442 0.1124  -0.3782 9    SER A N   
70   C CA  . SER A 9   ? 0.3765 0.6445 0.5550 -0.1469 0.0999  -0.3802 9    SER A CA  
71   C C   . SER A 9   ? 0.3712 0.5940 0.6212 -0.1366 0.1024  -0.3956 9    SER A C   
72   O O   . SER A 9   ? 0.3794 0.5901 0.6749 -0.1291 0.1145  -0.4191 9    SER A O   
73   C CB  . SER A 9   ? 0.4104 0.7300 0.5631 -0.1692 0.1007  -0.4177 9    SER A CB  
74   O OG  . SER A 9   ? 0.4379 0.7795 0.6215 -0.1782 0.1201  -0.4769 9    SER A OG  
75   N N   . VAL A 10  ? 0.3598 0.5593 0.6231 -0.1369 0.0902  -0.3804 10   VAL A N   
76   C CA  . VAL A 10  ? 0.3626 0.5170 0.6906 -0.1312 0.0897  -0.3857 10   VAL A CA  
77   C C   . VAL A 10  ? 0.3810 0.5458 0.7219 -0.1475 0.0852  -0.4092 10   VAL A C   
78   O O   . VAL A 10  ? 0.3738 0.5677 0.6720 -0.1566 0.0756  -0.3976 10   VAL A O   
79   C CB  . VAL A 10  ? 0.3387 0.4493 0.6710 -0.1170 0.0794  -0.3323 10   VAL A CB  
80   C CG1 . VAL A 10  ? 0.3284 0.4266 0.6606 -0.1013 0.0824  -0.3139 10   VAL A CG1 
81   C CG2 . VAL A 10  ? 0.3093 0.4330 0.5924 -0.1202 0.0683  -0.2982 10   VAL A CG2 
82   N N   . GLU A 11  ? 0.4043 0.5448 0.8105 -0.1507 0.0908  -0.4421 11   GLU A N   
83   C CA  . GLU A 11  ? 0.4315 0.5825 0.8620 -0.1688 0.0891  -0.4758 11   GLU A CA  
84   C C   . GLU A 11  ? 0.4324 0.5330 0.9074 -0.1679 0.0815  -0.4464 11   GLU A C   
85   O O   . GLU A 11  ? 0.4280 0.4820 0.9355 -0.1541 0.0810  -0.4180 11   GLU A O   
86   C CB  . GLU A 11  ? 0.4675 0.6278 0.9481 -0.1756 0.1037  -0.5421 11   GLU A CB  
87   C CG  . GLU A 11  ? 0.5006 0.6844 1.0042 -0.1978 0.1045  -0.5933 11   GLU A CG  
88   C CD  . GLU A 11  ? 0.5442 0.7352 1.1041 -0.2024 0.1217  -0.6636 11   GLU A CD  
89   O OE1 . GLU A 11  ? 0.5835 0.7350 1.2233 -0.2046 0.1239  -0.6893 11   GLU A OE1 
90   O OE2 . GLU A 11  ? 0.5744 0.8099 1.1028 -0.2038 0.1341  -0.6928 11   GLU A OE2 
91   N N   . PHE A 12  ? 0.4435 0.5571 0.9187 -0.1840 0.0749  -0.4507 12   PHE A N   
92   C CA  . PHE A 12  ? 0.4573 0.5277 0.9863 -0.1907 0.0718  -0.4353 12   PHE A CA  
93   C C   . PHE A 12  ? 0.4890 0.5801 1.0492 -0.2139 0.0717  -0.4808 12   PHE A C   
94   O O   . PHE A 12  ? 0.4948 0.6414 1.0180 -0.2248 0.0688  -0.5108 12   PHE A O   
95   C CB  . PHE A 12  ? 0.4265 0.4840 0.9258 -0.1860 0.0639  -0.3740 12   PHE A CB  
96   C CG  . PHE A 12  ? 0.4065 0.5103 0.8626 -0.1955 0.0562  -0.3678 12   PHE A CG  
97   C CD1 . PHE A 12  ? 0.4181 0.5195 0.8960 -0.2093 0.0530  -0.3550 12   PHE A CD1 
98   C CD2 . PHE A 12  ? 0.3991 0.5492 0.7962 -0.1905 0.0512  -0.3703 12   PHE A CD2 
99   C CE1 . PHE A 12  ? 0.3936 0.5410 0.8413 -0.2158 0.0446  -0.3498 12   PHE A CE1 
100  C CE2 . PHE A 12  ? 0.3855 0.5771 0.7511 -0.1966 0.0402  -0.3607 12   PHE A CE2 
101  C CZ  . PHE A 12  ? 0.3851 0.5766 0.7789 -0.2081 0.0366  -0.3526 12   PHE A CZ  
102  N N   . THR A 13  ? 0.5210 0.5673 1.1515 -0.2225 0.0735  -0.4849 13   THR A N   
103  C CA  . THR A 13  ? 0.5550 0.6128 1.2300 -0.2465 0.0739  -0.5303 13   THR A CA  
104  C C   . THR A 13  ? 0.5566 0.5951 1.2493 -0.2594 0.0683  -0.4917 13   THR A C   
105  O O   . THR A 13  ? 0.5286 0.5564 1.1878 -0.2498 0.0649  -0.4349 13   THR A O   
106  C CB  . THR A 13  ? 0.5988 0.6178 1.3583 -0.2489 0.0832  -0.5777 13   THR A CB  
107  O OG1 . THR A 13  ? 0.6166 0.5639 1.4308 -0.2402 0.0818  -0.5336 13   THR A OG1 
108  C CG2 . THR A 13  ? 0.5996 0.6408 1.3462 -0.2353 0.0926  -0.6169 13   THR A CG2 
109  N N   . PHE A 14  ? 0.5919 0.6300 1.3379 -0.2830 0.0687  -0.5251 14   PHE A N   
110  C CA  . PHE A 14  ? 0.6000 0.6218 1.3713 -0.2996 0.0664  -0.4913 14   PHE A CA  
111  C C   . PHE A 14  ? 0.6166 0.5682 1.4245 -0.2939 0.0695  -0.4381 14   PHE A C   
112  O O   . PHE A 14  ? 0.6153 0.5581 1.4194 -0.3036 0.0693  -0.3922 14   PHE A O   
113  C CB  . PHE A 14  ? 0.6328 0.6671 1.4630 -0.3288 0.0666  -0.5422 14   PHE A CB  
114  C CG  . PHE A 14  ? 0.6792 0.6626 1.5945 -0.3353 0.0737  -0.5831 14   PHE A CG  
115  C CD1 . PHE A 14  ? 0.7090 0.6237 1.6952 -0.3437 0.0765  -0.5529 14   PHE A CD1 
116  C CD2 . PHE A 14  ? 0.6966 0.7031 1.6246 -0.3347 0.0778  -0.6530 14   PHE A CD2 
117  C CE1 . PHE A 14  ? 0.7621 0.6253 1.8383 -0.3483 0.0810  -0.5901 14   PHE A CE1 
118  C CE2 . PHE A 14  ? 0.7477 0.7081 1.7645 -0.3393 0.0854  -0.6973 14   PHE A CE2 
119  C CZ  . PHE A 14  ? 0.7772 0.6627 1.8726 -0.3448 0.0859  -0.6654 14   PHE A CZ  
120  N N   . GLY A 15  ? 0.6414 0.5478 1.4862 -0.2793 0.0721  -0.4448 15   GLY A N   
121  C CA  . GLY A 15  ? 0.6661 0.5046 1.5518 -0.2733 0.0706  -0.3940 15   GLY A CA  
122  C C   . GLY A 15  ? 0.6388 0.4746 1.4615 -0.2561 0.0666  -0.3282 15   GLY A C   
123  O O   . GLY A 15  ? 0.6618 0.4542 1.5022 -0.2586 0.0636  -0.2749 15   GLY A O   
124  N N   . ASN A 16  ? 0.6004 0.4828 1.3503 -0.2405 0.0661  -0.3313 16   ASN A N   
125  C CA  . ASN A 16  ? 0.5706 0.4555 1.2603 -0.2251 0.0628  -0.2764 16   ASN A CA  
126  C C   . ASN A 16  ? 0.5677 0.4702 1.2291 -0.2404 0.0640  -0.2392 16   ASN A C   
127  O O   . ASN A 16  ? 0.5554 0.5066 1.1904 -0.2486 0.0649  -0.2584 16   ASN A O   
128  C CB  . ASN A 16  ? 0.5331 0.4612 1.1599 -0.2062 0.0623  -0.2920 16   ASN A CB  
129  C CG  . ASN A 16  ? 0.5359 0.4503 1.1857 -0.1898 0.0641  -0.3214 16   ASN A CG  
130  O OD1 . ASN A 16  ? 0.5373 0.4559 1.2287 -0.1961 0.0689  -0.3746 16   ASN A OD1 
131  N ND2 . ASN A 16  ? 0.5254 0.4271 1.1511 -0.1696 0.0612  -0.2903 16   ASN A ND2 
132  N N   . ASP A 17  ? 0.5856 0.4521 1.2555 -0.2456 0.0636  -0.1867 17   ASP A N   
133  C CA  . ASP A 17  ? 0.5739 0.4614 1.2142 -0.2609 0.0685  -0.1502 17   ASP A CA  
134  C C   . ASP A 17  ? 0.5287 0.4514 1.0953 -0.2429 0.0680  -0.1307 17   ASP A C   
135  O O   . ASP A 17  ? 0.5084 0.4715 1.0443 -0.2493 0.0729  -0.1244 17   ASP A O   
136  C CB  . ASP A 17  ? 0.6211 0.4620 1.2918 -0.2772 0.0694  -0.0992 17   ASP A CB  
137  C CG  . ASP A 17  ? 0.6694 0.4882 1.4102 -0.3054 0.0734  -0.1122 17   ASP A CG  
138  O OD1 . ASP A 17  ? 0.6680 0.5259 1.4154 -0.3205 0.0793  -0.1456 17   ASP A OD1 
139  O OD2 . ASP A 17  ? 0.7326 0.4945 1.5260 -0.3133 0.0693  -0.0877 17   ASP A OD2 
140  N N   . THR A 18  ? 0.5127 0.4202 1.0580 -0.2202 0.0622  -0.1232 18   THR A N   
141  C CA  . THR A 18  ? 0.4673 0.4055 0.9494 -0.2024 0.0610  -0.1129 18   THR A CA  
142  C C   . THR A 18  ? 0.4424 0.3859 0.9157 -0.1823 0.0567  -0.1442 18   THR A C   
143  O O   . THR A 18  ? 0.4680 0.3877 0.9844 -0.1800 0.0555  -0.1692 18   THR A O   
144  C CB  . THR A 18  ? 0.4771 0.3979 0.9309 -0.1983 0.0595  -0.0621 18   THR A CB  
145  O OG1 . THR A 18  ? 0.5201 0.4014 0.9947 -0.1850 0.0507  -0.0511 18   THR A OG1 
146  C CG2 . THR A 18  ? 0.5066 0.4195 0.9724 -0.2231 0.0658  -0.0283 18   THR A CG2 
147  N N   . VAL A 19  ? 0.3946 0.3707 0.8155 -0.1690 0.0556  -0.1438 19   VAL A N   
148  C CA  . VAL A 19  ? 0.3668 0.3598 0.7689 -0.1543 0.0535  -0.1712 19   VAL A CA  
149  C C   . VAL A 19  ? 0.3402 0.3293 0.7035 -0.1366 0.0509  -0.1434 19   VAL A C   
150  O O   . VAL A 19  ? 0.3129 0.3086 0.6469 -0.1362 0.0509  -0.1139 19   VAL A O   
151  C CB  . VAL A 19  ? 0.3452 0.3868 0.7223 -0.1589 0.0523  -0.1968 19   VAL A CB  
152  C CG1 . VAL A 19  ? 0.3308 0.3960 0.6690 -0.1452 0.0496  -0.2089 19   VAL A CG1 
153  C CG2 . VAL A 19  ? 0.3616 0.4118 0.7789 -0.1763 0.0532  -0.2349 19   VAL A CG2 
154  N N   . VAL A 20  ? 0.3332 0.3145 0.7005 -0.1237 0.0498  -0.1567 20   VAL A N   
155  C CA  . VAL A 20  ? 0.3148 0.2952 0.6514 -0.1080 0.0469  -0.1369 20   VAL A CA  
156  C C   . VAL A 20  ? 0.2964 0.3066 0.6083 -0.1009 0.0495  -0.1640 20   VAL A C   
157  O O   . VAL A 20  ? 0.3056 0.3221 0.6403 -0.1028 0.0539  -0.1988 20   VAL A O   
158  C CB  . VAL A 20  ? 0.3336 0.2771 0.7057 -0.0997 0.0421  -0.1216 20   VAL A CB  
159  C CG1 . VAL A 20  ? 0.3182 0.2671 0.6648 -0.0843 0.0386  -0.1096 20   VAL A CG1 
160  C CG2 . VAL A 20  ? 0.3596 0.2753 0.7468 -0.1092 0.0374  -0.0844 20   VAL A CG2 
161  N N   . ILE A 21  ? 0.2726 0.3024 0.5394 -0.0947 0.0477  -0.1489 21   ILE A N   
162  C CA  . ILE A 21  ? 0.2618 0.3175 0.5006 -0.0899 0.0491  -0.1636 21   ILE A CA  
163  C C   . ILE A 21  ? 0.2518 0.2958 0.4804 -0.0775 0.0484  -0.1457 21   ILE A C   
164  O O   . ILE A 21  ? 0.2292 0.2681 0.4369 -0.0730 0.0443  -0.1193 21   ILE A O   
165  C CB  . ILE A 21  ? 0.2504 0.3362 0.4520 -0.0927 0.0448  -0.1577 21   ILE A CB  
166  C CG1 . ILE A 21  ? 0.2585 0.3582 0.4740 -0.1049 0.0427  -0.1695 21   ILE A CG1 
167  C CG2 . ILE A 21  ? 0.2390 0.3520 0.4119 -0.0921 0.0451  -0.1695 21   ILE A CG2 
168  C CD1 . ILE A 21  ? 0.2495 0.3789 0.4397 -0.1050 0.0350  -0.1602 21   ILE A CD1 
169  N N   . PRO A 22  ? 0.2579 0.3017 0.5046 -0.0729 0.0530  -0.1641 22   PRO A N   
170  C CA  . PRO A 22  ? 0.2509 0.2834 0.5020 -0.0617 0.0511  -0.1497 22   PRO A CA  
171  C C   . PRO A 22  ? 0.2311 0.2812 0.4402 -0.0590 0.0509  -0.1374 22   PRO A C   
172  O O   . PRO A 22  ? 0.2210 0.2956 0.4032 -0.0648 0.0544  -0.1469 22   PRO A O   
173  C CB  . PRO A 22  ? 0.2608 0.2965 0.5519 -0.0590 0.0586  -0.1815 22   PRO A CB  
174  C CG  . PRO A 22  ? 0.2780 0.3419 0.5574 -0.0704 0.0673  -0.2137 22   PRO A CG  
175  C CD  . PRO A 22  ? 0.2820 0.3426 0.5484 -0.0791 0.0613  -0.2040 22   PRO A CD  
176  N N   . CYS A 23  ? 0.2310 0.2687 0.4353 -0.0515 0.0451  -0.1143 23   CYS A N   
177  C CA  . CYS A 23  ? 0.2218 0.2711 0.3979 -0.0490 0.0451  -0.1054 23   CYS A CA  
178  C C   . CYS A 23  ? 0.2233 0.2608 0.4133 -0.0410 0.0393  -0.0922 23   CYS A C   
179  O O   . CYS A 23  ? 0.2365 0.2592 0.4273 -0.0391 0.0310  -0.0730 23   CYS A O   
180  C CB  . CYS A 23  ? 0.2125 0.2661 0.3564 -0.0512 0.0416  -0.0902 23   CYS A CB  
181  S SG  . CYS A 23  ? 0.2109 0.2733 0.3283 -0.0491 0.0409  -0.0799 23   CYS A SG  
182  N N   . PHE A 24  ? 0.2137 0.2627 0.4145 -0.0384 0.0436  -0.1030 24   PHE A N   
183  C CA  . PHE A 24  ? 0.2123 0.2566 0.4362 -0.0307 0.0368  -0.0955 24   PHE A CA  
184  C C   . PHE A 24  ? 0.2000 0.2616 0.4096 -0.0328 0.0414  -0.0974 24   PHE A C   
185  O O   . PHE A 24  ? 0.1999 0.2806 0.4140 -0.0375 0.0534  -0.1157 24   PHE A O   
186  C CB  . PHE A 24  ? 0.2230 0.2643 0.5002 -0.0243 0.0378  -0.1125 24   PHE A CB  
187  C CG  . PHE A 24  ? 0.2457 0.2629 0.5467 -0.0228 0.0309  -0.1063 24   PHE A CG  
188  C CD1 . PHE A 24  ? 0.2586 0.2557 0.5709 -0.0181 0.0148  -0.0776 24   PHE A CD1 
189  C CD2 . PHE A 24  ? 0.2615 0.2779 0.5725 -0.0288 0.0399  -0.1278 24   PHE A CD2 
190  C CE1 . PHE A 24  ? 0.2839 0.2569 0.6183 -0.0198 0.0086  -0.0663 24   PHE A CE1 
191  C CE2 . PHE A 24  ? 0.2707 0.2623 0.6090 -0.0298 0.0341  -0.1218 24   PHE A CE2 
192  C CZ  . PHE A 24  ? 0.2770 0.2450 0.6278 -0.0256 0.0189  -0.0890 24   PHE A CZ  
193  N N   . VAL A 25  ? 0.1913 0.2479 0.3833 -0.0318 0.0328  -0.0794 25   VAL A N   
194  C CA  . VAL A 25  ? 0.1790 0.2469 0.3659 -0.0343 0.0342  -0.0789 25   VAL A CA  
195  C C   . VAL A 25  ? 0.1805 0.2550 0.4067 -0.0277 0.0280  -0.0827 25   VAL A C   
196  O O   . VAL A 25  ? 0.1746 0.2392 0.4146 -0.0210 0.0138  -0.0707 25   VAL A O   
197  C CB  . VAL A 25  ? 0.1767 0.2367 0.3351 -0.0362 0.0272  -0.0641 25   VAL A CB  
198  C CG1 . VAL A 25  ? 0.1579 0.2266 0.3185 -0.0404 0.0278  -0.0653 25   VAL A CG1 
199  C CG2 . VAL A 25  ? 0.1781 0.2331 0.3091 -0.0398 0.0316  -0.0609 25   VAL A CG2 
200  N N   . THR A 26  ? 0.1773 0.2718 0.4225 -0.0308 0.0383  -0.0980 26   THR A N   
201  C CA  . THR A 26  ? 0.1820 0.2905 0.4748 -0.0241 0.0342  -0.1067 26   THR A CA  
202  C C   . THR A 26  ? 0.1781 0.2955 0.4722 -0.0262 0.0249  -0.0980 26   THR A C   
203  O O   . THR A 26  ? 0.1868 0.3170 0.5223 -0.0194 0.0158  -0.1014 26   THR A O   
204  C CB  . THR A 26  ? 0.1873 0.3215 0.5059 -0.0285 0.0540  -0.1339 26   THR A CB  
205  O OG1 . THR A 26  ? 0.1740 0.3219 0.4585 -0.0436 0.0674  -0.1335 26   THR A OG1 
206  C CG2 . THR A 26  ? 0.1934 0.3228 0.5182 -0.0270 0.0627  -0.1504 26   THR A CG2 
207  N N   . ASN A 27  ? 0.1783 0.2899 0.4336 -0.0354 0.0263  -0.0888 27   ASN A N   
208  C CA  . ASN A 27  ? 0.1713 0.2909 0.4292 -0.0403 0.0191  -0.0856 27   ASN A CA  
209  C C   . ASN A 27  ? 0.1757 0.2795 0.3993 -0.0424 0.0082  -0.0733 27   ASN A C   
210  O O   . ASN A 27  ? 0.1866 0.2903 0.4013 -0.0510 0.0098  -0.0750 27   ASN A O   
211  C CB  . ASN A 27  ? 0.1748 0.3096 0.4365 -0.0534 0.0357  -0.0944 27   ASN A CB  
212  C CG  . ASN A 27  ? 0.1767 0.2978 0.3988 -0.0629 0.0467  -0.0866 27   ASN A CG  
213  O OD1 . ASN A 27  ? 0.1819 0.2878 0.3796 -0.0584 0.0452  -0.0806 27   ASN A OD1 
214  N ND2 . ASN A 27  ? 0.1744 0.3020 0.3941 -0.0769 0.0564  -0.0845 27   ASN A ND2 
215  N N   . MET A 28  ? 0.1721 0.2643 0.3809 -0.0361 -0.0021 -0.0630 28   MET A N   
216  C CA  . MET A 28  ? 0.1862 0.2717 0.3640 -0.0392 -0.0105 -0.0559 28   MET A CA  
217  C C   . MET A 28  ? 0.1852 0.2866 0.3713 -0.0426 -0.0246 -0.0580 28   MET A C   
218  O O   . MET A 28  ? 0.1871 0.3037 0.4044 -0.0387 -0.0349 -0.0573 28   MET A O   
219  C CB  . MET A 28  ? 0.1948 0.2719 0.3569 -0.0351 -0.0183 -0.0423 28   MET A CB  
220  C CG  . MET A 28  ? 0.2235 0.2866 0.3764 -0.0335 -0.0070 -0.0412 28   MET A CG  
221  S SD  . MET A 28  ? 0.2664 0.3219 0.3880 -0.0386 0.0046  -0.0460 28   MET A SD  
222  C CE  . MET A 28  ? 0.2752 0.3335 0.3702 -0.0420 -0.0023 -0.0388 28   MET A CE  
223  N N   . GLU A 29  ? 0.1939 0.2944 0.3566 -0.0497 -0.0257 -0.0634 29   GLU A N   
224  C CA  . GLU A 29  ? 0.2100 0.3288 0.3740 -0.0559 -0.0397 -0.0700 29   GLU A CA  
225  C C   . GLU A 29  ? 0.2291 0.3536 0.3568 -0.0603 -0.0476 -0.0686 29   GLU A C   
226  O O   . GLU A 29  ? 0.2559 0.4026 0.3781 -0.0658 -0.0639 -0.0699 29   GLU A O   
227  C CB  . GLU A 29  ? 0.2082 0.3260 0.3852 -0.0649 -0.0317 -0.0868 29   GLU A CB  
228  C CG  . GLU A 29  ? 0.1972 0.3240 0.4115 -0.0666 -0.0269 -0.0897 29   GLU A CG  
229  C CD  . GLU A 29  ? 0.1972 0.3168 0.4234 -0.0785 -0.0156 -0.1002 29   GLU A CD  
230  O OE1 . GLU A 29  ? 0.2419 0.3448 0.4525 -0.0830 -0.0126 -0.1061 29   GLU A OE1 
231  O OE2 . GLU A 29  ? 0.1787 0.3094 0.4342 -0.0841 -0.0089 -0.1027 29   GLU A OE2 
232  N N   . ALA A 30  ? 0.2291 0.3393 0.3325 -0.0596 -0.0362 -0.0674 30   ALA A N   
233  C CA  . ALA A 30  ? 0.2535 0.3745 0.3235 -0.0668 -0.0373 -0.0734 30   ALA A CA  
234  C C   . ALA A 30  ? 0.2805 0.4207 0.3311 -0.0700 -0.0544 -0.0539 30   ALA A C   
235  O O   . ALA A 30  ? 0.2716 0.4035 0.3316 -0.0634 -0.0600 -0.0313 30   ALA A O   
236  C CB  . ALA A 30  ? 0.2484 0.3544 0.3055 -0.0645 -0.0211 -0.0761 30   ALA A CB  
237  N N   . GLN A 31  ? 0.3095 0.4762 0.3354 -0.0814 -0.0639 -0.0628 31   GLN A N   
238  C CA  . GLN A 31  ? 0.3465 0.5370 0.3455 -0.0884 -0.0830 -0.0397 31   GLN A CA  
239  C C   . GLN A 31  ? 0.3709 0.5710 0.3263 -0.0988 -0.0729 -0.0361 31   GLN A C   
240  O O   . GLN A 31  ? 0.3994 0.6195 0.3248 -0.1084 -0.0864 -0.0119 31   GLN A O   
241  C CB  . GLN A 31  ? 0.3684 0.5923 0.3625 -0.0980 -0.1027 -0.0498 31   GLN A CB  
242  C CG  . GLN A 31  ? 0.3620 0.5835 0.4041 -0.0898 -0.1129 -0.0535 31   GLN A CG  
243  C CD  . GLN A 31  ? 0.3498 0.5594 0.4246 -0.0760 -0.1245 -0.0234 31   GLN A CD  
244  O OE1 . GLN A 31  ? 0.3686 0.5939 0.4397 -0.0759 -0.1483 0.0036  31   GLN A OE1 
245  N NE2 . GLN A 31  ? 0.3038 0.4871 0.4133 -0.0647 -0.1084 -0.0284 31   GLN A NE2 
246  N N   . ASN A 32  ? 0.3597 0.5471 0.3145 -0.0974 -0.0497 -0.0579 32   ASN A N   
247  C CA  . ASN A 32  ? 0.3784 0.5789 0.3005 -0.1070 -0.0356 -0.0611 32   ASN A CA  
248  C C   . ASN A 32  ? 0.3452 0.5187 0.2888 -0.0965 -0.0152 -0.0694 32   ASN A C   
249  O O   . ASN A 32  ? 0.3305 0.4859 0.3028 -0.0874 -0.0082 -0.0886 32   ASN A O   
250  C CB  . ASN A 32  ? 0.4136 0.6484 0.3102 -0.1213 -0.0309 -0.0950 32   ASN A CB  
251  C CG  . ASN A 32  ? 0.4596 0.7246 0.3142 -0.1370 -0.0179 -0.0979 32   ASN A CG  
252  O OD1 . ASN A 32  ? 0.4648 0.7202 0.3263 -0.1336 0.0018  -0.1037 32   ASN A OD1 
253  N ND2 . ASN A 32  ? 0.5824 0.8902 0.3945 -0.1562 -0.0273 -0.1006 32   ASN A ND2 
254  N N   . THR A 33  ? 0.3482 0.5203 0.2794 -0.0994 -0.0073 -0.0525 33   THR A N   
255  C CA  . THR A 33  ? 0.3184 0.4711 0.2700 -0.0907 0.0094  -0.0589 33   THR A CA  
256  C C   . THR A 33  ? 0.3157 0.4789 0.2734 -0.0905 0.0262  -0.0945 33   THR A C   
257  O O   . THR A 33  ? 0.2943 0.4408 0.2783 -0.0801 0.0357  -0.1030 33   THR A O   
258  C CB  . THR A 33  ? 0.3277 0.4797 0.2686 -0.0966 0.0135  -0.0337 33   THR A CB  
259  O OG1 . THR A 33  ? 0.3533 0.5386 0.2569 -0.1146 0.0189  -0.0328 33   THR A OG1 
260  C CG2 . THR A 33  ? 0.3140 0.4473 0.2648 -0.0932 -0.0037 -0.0006 33   THR A CG2 
261  N N   . THR A 34  ? 0.3493 0.5416 0.2867 -0.1017 0.0284  -0.1172 34   THR A N   
262  C CA  . THR A 34  ? 0.3537 0.5543 0.3087 -0.0999 0.0434  -0.1577 34   THR A CA  
263  C C   . THR A 34  ? 0.3254 0.4919 0.3246 -0.0844 0.0410  -0.1686 34   THR A C   
264  O O   . THR A 34  ? 0.3190 0.4787 0.3478 -0.0770 0.0520  -0.1919 34   THR A O   
265  C CB  . THR A 34  ? 0.3967 0.6355 0.3248 -0.1160 0.0445  -0.1860 34   THR A CB  
266  O OG1 . THR A 34  ? 0.4481 0.7237 0.3318 -0.1336 0.0507  -0.1757 34   THR A OG1 
267  C CG2 . THR A 34  ? 0.4096 0.6526 0.3694 -0.1121 0.0601  -0.2347 34   THR A CG2 
268  N N   . GLU A 35  ? 0.3173 0.4638 0.3238 -0.0801 0.0266  -0.1495 35   GLU A N   
269  C CA  . GLU A 35  ? 0.3020 0.4188 0.3449 -0.0700 0.0242  -0.1529 35   GLU A CA  
270  C C   . GLU A 35  ? 0.2711 0.3627 0.3297 -0.0589 0.0254  -0.1296 35   GLU A C   
271  O O   . GLU A 35  ? 0.2534 0.3233 0.3361 -0.0533 0.0235  -0.1264 35   GLU A O   
272  C CB  . GLU A 35  ? 0.3079 0.4244 0.3526 -0.0743 0.0101  -0.1479 35   GLU A CB  
273  C CG  . GLU A 35  ? 0.3552 0.5020 0.3797 -0.0874 0.0023  -0.1654 35   GLU A CG  
274  C CD  . GLU A 35  ? 0.3611 0.5123 0.3900 -0.0902 -0.0155 -0.1524 35   GLU A CD  
275  O OE1 . GLU A 35  ? 0.3515 0.4801 0.4091 -0.0828 -0.0171 -0.1411 35   GLU A OE1 
276  O OE2 . GLU A 35  ? 0.3961 0.5781 0.4001 -0.1009 -0.0282 -0.1536 35   GLU A OE2 
277  N N   . VAL A 36  ? 0.2606 0.3569 0.3047 -0.0583 0.0282  -0.1129 36   VAL A N   
278  C CA  . VAL A 36  ? 0.2341 0.3122 0.2893 -0.0506 0.0276  -0.0934 36   VAL A CA  
279  C C   . VAL A 36  ? 0.2343 0.3127 0.3004 -0.0455 0.0369  -0.0981 36   VAL A C   
280  O O   . VAL A 36  ? 0.2446 0.3419 0.3034 -0.0497 0.0451  -0.1094 36   VAL A O   
281  C CB  . VAL A 36  ? 0.2308 0.3105 0.2719 -0.0536 0.0209  -0.0711 36   VAL A CB  
282  C CG1 . VAL A 36  ? 0.1960 0.2601 0.2508 -0.0473 0.0220  -0.0589 36   VAL A CG1 
283  C CG2 . VAL A 36  ? 0.2212 0.3048 0.2601 -0.0567 0.0085  -0.0667 36   VAL A CG2 
284  N N   . TYR A 37  ? 0.2179 0.2801 0.3020 -0.0378 0.0353  -0.0902 37   TYR A N   
285  C CA  . TYR A 37  ? 0.2187 0.2833 0.3167 -0.0320 0.0391  -0.0899 37   TYR A CA  
286  C C   . TYR A 37  ? 0.2052 0.2635 0.2994 -0.0314 0.0351  -0.0720 37   TYR A C   
287  O O   . TYR A 37  ? 0.1912 0.2385 0.2841 -0.0315 0.0304  -0.0634 37   TYR A O   
288  C CB  . TYR A 37  ? 0.2338 0.2882 0.3621 -0.0233 0.0376  -0.0988 37   TYR A CB  
289  C CG  . TYR A 37  ? 0.2305 0.2963 0.3806 -0.0164 0.0411  -0.1054 37   TYR A CG  
290  C CD1 . TYR A 37  ? 0.2610 0.3425 0.4290 -0.0145 0.0503  -0.1307 37   TYR A CD1 
291  C CD2 . TYR A 37  ? 0.2506 0.3178 0.4053 -0.0129 0.0357  -0.0900 37   TYR A CD2 
292  C CE1 . TYR A 37  ? 0.2568 0.3542 0.4531 -0.0074 0.0543  -0.1398 37   TYR A CE1 
293  C CE2 . TYR A 37  ? 0.2496 0.3324 0.4297 -0.0065 0.0369  -0.0968 37   TYR A CE2 
294  C CZ  . TYR A 37  ? 0.2641 0.3618 0.4681 -0.0029 0.0465  -0.1214 37   TYR A CZ  
295  O OH  . TYR A 37  ? 0.2715 0.3894 0.5090 0.0042  0.0488  -0.1314 37   TYR A OH  
296  N N   . VAL A 38  ? 0.1968 0.2657 0.2905 -0.0329 0.0385  -0.0697 38   VAL A N   
297  C CA  . VAL A 38  ? 0.1943 0.2609 0.2873 -0.0340 0.0354  -0.0594 38   VAL A CA  
298  C C   . VAL A 38  ? 0.1889 0.2668 0.2979 -0.0303 0.0346  -0.0618 38   VAL A C   
299  O O   . VAL A 38  ? 0.1947 0.2872 0.3138 -0.0305 0.0403  -0.0701 38   VAL A O   
300  C CB  . VAL A 38  ? 0.1983 0.2663 0.2814 -0.0419 0.0378  -0.0534 38   VAL A CB  
301  C CG1 . VAL A 38  ? 0.1928 0.2591 0.2828 -0.0436 0.0361  -0.0508 38   VAL A CG1 
302  C CG2 . VAL A 38  ? 0.2083 0.2679 0.2810 -0.0442 0.0342  -0.0477 38   VAL A CG2 
303  N N   . LYS A 39  ? 0.1927 0.2687 0.3041 -0.0283 0.0273  -0.0548 39   LYS A N   
304  C CA  . LYS A 39  ? 0.1925 0.2831 0.3184 -0.0254 0.0214  -0.0538 39   LYS A CA  
305  C C   . LYS A 39  ? 0.1897 0.2864 0.3038 -0.0325 0.0177  -0.0506 39   LYS A C   
306  O O   . LYS A 39  ? 0.1782 0.2689 0.2781 -0.0354 0.0156  -0.0453 39   LYS A O   
307  C CB  . LYS A 39  ? 0.2142 0.2997 0.3552 -0.0164 0.0117  -0.0465 39   LYS A CB  
308  C CG  . LYS A 39  ? 0.2172 0.3199 0.3833 -0.0098 0.0016  -0.0440 39   LYS A CG  
309  C CD  . LYS A 39  ? 0.2439 0.3349 0.4281 -0.0008 -0.0116 -0.0294 39   LYS A CD  
310  C CE  . LYS A 39  ? 0.2744 0.3507 0.4864 0.0083  -0.0063 -0.0410 39   LYS A CE  
311  N NZ  . LYS A 39  ? 0.3236 0.3786 0.5551 0.0146  -0.0193 -0.0236 39   LYS A NZ  
312  N N   . TRP A 40  ? 0.1824 0.2944 0.3050 -0.0370 0.0187  -0.0571 40   TRP A N   
313  C CA  . TRP A 40  ? 0.1846 0.3080 0.3019 -0.0446 0.0145  -0.0607 40   TRP A CA  
314  C C   . TRP A 40  ? 0.1916 0.3386 0.3204 -0.0421 0.0018  -0.0580 40   TRP A C   
315  O O   . TRP A 40  ? 0.1804 0.3401 0.3330 -0.0376 0.0007  -0.0611 40   TRP A O   
316  C CB  . TRP A 40  ? 0.1771 0.3004 0.3019 -0.0536 0.0226  -0.0706 40   TRP A CB  
317  C CG  . TRP A 40  ? 0.1744 0.2769 0.2922 -0.0567 0.0294  -0.0707 40   TRP A CG  
318  C CD1 . TRP A 40  ? 0.1743 0.2616 0.2899 -0.0555 0.0348  -0.0638 40   TRP A CD1 
319  C CD2 . TRP A 40  ? 0.1630 0.2612 0.2792 -0.0614 0.0305  -0.0795 40   TRP A CD2 
320  N NE1 . TRP A 40  ? 0.1822 0.2541 0.2988 -0.0576 0.0362  -0.0638 40   TRP A NE1 
321  C CE2 . TRP A 40  ? 0.1650 0.2424 0.2854 -0.0604 0.0351  -0.0759 40   TRP A CE2 
322  C CE3 . TRP A 40  ? 0.1844 0.2983 0.2973 -0.0673 0.0280  -0.0925 40   TRP A CE3 
323  C CZ2 . TRP A 40  ? 0.1807 0.2498 0.3115 -0.0622 0.0377  -0.0860 40   TRP A CZ2 
324  C CZ3 . TRP A 40  ? 0.1910 0.2994 0.3089 -0.0714 0.0337  -0.1067 40   TRP A CZ3 
325  C CH2 . TRP A 40  ? 0.1951 0.2799 0.3266 -0.0675 0.0387  -0.1041 40   TRP A CH2 
326  N N   . LYS A 41  ? 0.2029 0.3596 0.3154 -0.0458 -0.0079 -0.0521 41   LYS A N   
327  C CA  . LYS A 41  ? 0.2257 0.4076 0.3442 -0.0446 -0.0252 -0.0439 41   LYS A CA  
328  C C   . LYS A 41  ? 0.2311 0.4389 0.3373 -0.0583 -0.0290 -0.0569 41   LYS A C   
329  O O   . LYS A 41  ? 0.2249 0.4285 0.3125 -0.0681 -0.0191 -0.0693 41   LYS A O   
330  C CB  . LYS A 41  ? 0.2447 0.4205 0.3502 -0.0405 -0.0367 -0.0206 41   LYS A CB  
331  C CG  . LYS A 41  ? 0.2490 0.3960 0.3689 -0.0291 -0.0322 -0.0122 41   LYS A CG  
332  C CD  . LYS A 41  ? 0.2828 0.4219 0.4012 -0.0257 -0.0467 0.0145  41   LYS A CD  
333  C CE  . LYS A 41  ? 0.3048 0.4121 0.4247 -0.0226 -0.0373 0.0183  41   LYS A CE  
334  N NZ  . LYS A 41  ? 0.3444 0.4356 0.4897 -0.0135 -0.0515 0.0407  41   LYS A NZ  
335  N N   . PHE A 42  ? 0.2388 0.4758 0.3609 -0.0586 -0.0436 -0.0571 42   PHE A N   
336  C CA  . PHE A 42  ? 0.2608 0.5308 0.3741 -0.0728 -0.0517 -0.0715 42   PHE A CA  
337  C C   . PHE A 42  ? 0.2792 0.5829 0.4004 -0.0693 -0.0779 -0.0551 42   PHE A C   
338  O O   . PHE A 42  ? 0.2590 0.5697 0.4181 -0.0579 -0.0855 -0.0506 42   PHE A O   
339  C CB  . PHE A 42  ? 0.2440 0.5172 0.3830 -0.0801 -0.0405 -0.0965 42   PHE A CB  
340  C CG  . PHE A 42  ? 0.2653 0.5732 0.4030 -0.0959 -0.0488 -0.1172 42   PHE A CG  
341  C CD1 . PHE A 42  ? 0.2740 0.5848 0.3876 -0.1097 -0.0418 -0.1370 42   PHE A CD1 
342  C CD2 . PHE A 42  ? 0.2654 0.6074 0.4303 -0.0976 -0.0635 -0.1209 42   PHE A CD2 
343  C CE1 . PHE A 42  ? 0.2947 0.6412 0.4083 -0.1263 -0.0489 -0.1627 42   PHE A CE1 
344  C CE2 . PHE A 42  ? 0.2966 0.6743 0.4611 -0.1141 -0.0726 -0.1430 42   PHE A CE2 
345  C CZ  . PHE A 42  ? 0.3012 0.6806 0.4382 -0.1291 -0.0651 -0.1649 42   PHE A CZ  
346  N N   . LYS A 43  ? 0.3154 0.6428 0.4019 -0.0796 -0.0919 -0.0459 43   LYS A N   
347  C CA  . LYS A 43  ? 0.3548 0.7170 0.4423 -0.0782 -0.1224 -0.0229 43   LYS A CA  
348  C C   . LYS A 43  ? 0.3566 0.7005 0.4758 -0.0571 -0.1360 0.0087  43   LYS A C   
349  O O   . LYS A 43  ? 0.3649 0.7296 0.5231 -0.0465 -0.1561 0.0169  43   LYS A O   
350  C CB  . LYS A 43  ? 0.3537 0.7576 0.4639 -0.0853 -0.1344 -0.0435 43   LYS A CB  
351  C CG  . LYS A 43  ? 0.3689 0.7976 0.4486 -0.1083 -0.1272 -0.0746 43   LYS A CG  
352  C CD  . LYS A 43  ? 0.3846 0.8571 0.4900 -0.1173 -0.1417 -0.0956 43   LYS A CD  
353  C CE  . LYS A 43  ? 0.4052 0.9033 0.4845 -0.1417 -0.1346 -0.1328 43   LYS A CE  
354  N NZ  . LYS A 43  ? 0.4664 0.9887 0.4865 -0.1548 -0.1428 -0.1236 43   LYS A NZ  
355  N N   . GLY A 44  ? 0.3618 0.6673 0.4703 -0.0510 -0.1250 0.0235  44   GLY A N   
356  C CA  . GLY A 44  ? 0.3745 0.6573 0.5146 -0.0327 -0.1368 0.0511  44   GLY A CA  
357  C C   . GLY A 44  ? 0.3530 0.6203 0.5496 -0.0140 -0.1279 0.0362  44   GLY A C   
358  O O   . GLY A 44  ? 0.3718 0.6287 0.6086 0.0030  -0.1413 0.0533  44   GLY A O   
359  N N   . ARG A 45  ? 0.3211 0.5881 0.5238 -0.0178 -0.1055 0.0048  45   ARG A N   
360  C CA  A ARG A 45  ? 0.2979 0.5543 0.5446 -0.0048 -0.0916 -0.0113 45   ARG A CA  
361  C CA  B ARG A 45  ? 0.2951 0.5516 0.5418 -0.0048 -0.0916 -0.0114 45   ARG A CA  
362  C C   . ARG A 45  ? 0.2725 0.5053 0.4996 -0.0122 -0.0627 -0.0310 45   ARG A C   
363  O O   . ARG A 45  ? 0.2588 0.4896 0.4522 -0.0265 -0.0539 -0.0387 45   ARG A O   
364  C CB  A ARG A 45  ? 0.2985 0.5927 0.5904 -0.0010 -0.0993 -0.0249 45   ARG A CB  
365  C CB  B ARG A 45  ? 0.2931 0.5878 0.5834 -0.0019 -0.0990 -0.0254 45   ARG A CB  
366  C CG  A ARG A 45  ? 0.3107 0.6408 0.5870 -0.0169 -0.1096 -0.0322 45   ARG A CG  
367  C CG  B ARG A 45  ? 0.2867 0.6054 0.5597 -0.0205 -0.0929 -0.0447 45   ARG A CG  
368  C CD  A ARG A 45  ? 0.3152 0.6857 0.6454 -0.0115 -0.1214 -0.0424 45   ARG A CD  
369  C CD  B ARG A 45  ? 0.2931 0.6574 0.6081 -0.0195 -0.1096 -0.0519 45   ARG A CD  
370  N NE  A ARG A 45  ? 0.3080 0.6780 0.6700 -0.0114 -0.0957 -0.0674 45   ARG A NE  
371  N NE  B ARG A 45  ? 0.2931 0.6808 0.5932 -0.0399 -0.1065 -0.0714 45   ARG A NE  
372  C CZ  A ARG A 45  ? 0.2910 0.6746 0.6528 -0.0282 -0.0800 -0.0892 45   ARG A CZ  
373  C CZ  B ARG A 45  ? 0.2827 0.6667 0.5914 -0.0514 -0.0833 -0.0946 45   ARG A CZ  
374  N NH1 A ARG A 45  ? 0.3048 0.7031 0.6417 -0.0454 -0.0871 -0.0954 45   ARG A NH1 
375  N NH1 B ARG A 45  ? 0.2660 0.6286 0.5903 -0.0461 -0.0607 -0.0998 45   ARG A NH1 
376  N NH2 A ARG A 45  ? 0.2719 0.6559 0.6601 -0.0295 -0.0565 -0.1057 45   ARG A NH2 
377  N NH2 B ARG A 45  ? 0.2859 0.6888 0.5875 -0.0703 -0.0832 -0.1125 45   ARG A NH2 
378  N N   . ASP A 46  ? 0.2571 0.4743 0.5089 -0.0022 -0.0493 -0.0397 46   ASP A N   
379  C CA  . ASP A 46  ? 0.2339 0.4302 0.4678 -0.0081 -0.0256 -0.0531 46   ASP A CA  
380  C C   . ASP A 46  ? 0.2189 0.4340 0.4612 -0.0184 -0.0120 -0.0711 46   ASP A C   
381  O O   . ASP A 46  ? 0.2202 0.4556 0.4982 -0.0140 -0.0069 -0.0827 46   ASP A O   
382  C CB  . ASP A 46  ? 0.2379 0.4177 0.4938 0.0041  -0.0178 -0.0578 46   ASP A CB  
383  C CG  . ASP A 46  ? 0.2566 0.4132 0.5138 0.0133  -0.0315 -0.0388 46   ASP A CG  
384  O OD1 . ASP A 46  ? 0.2789 0.4310 0.5085 0.0073  -0.0434 -0.0193 46   ASP A OD1 
385  O OD2 . ASP A 46  ? 0.2883 0.4324 0.5757 0.0247  -0.0292 -0.0446 46   ASP A OD2 
386  N N   . ILE A 47  ? 0.1994 0.4088 0.4142 -0.0327 -0.0055 -0.0742 47   ILE A N   
387  C CA  . ILE A 47  ? 0.1900 0.4140 0.4162 -0.0455 0.0052  -0.0875 47   ILE A CA  
388  C C   . ILE A 47  ? 0.1776 0.3820 0.3916 -0.0526 0.0251  -0.0895 47   ILE A C   
389  O O   . ILE A 47  ? 0.1677 0.3812 0.3922 -0.0648 0.0363  -0.0955 47   ILE A O   
390  C CB  . ILE A 47  ? 0.1918 0.4273 0.4096 -0.0580 -0.0031 -0.0929 47   ILE A CB  
391  C CG1 . ILE A 47  ? 0.2056 0.4158 0.3893 -0.0639 0.0002  -0.0914 47   ILE A CG1 
392  C CG2 . ILE A 47  ? 0.2021 0.4665 0.4298 -0.0524 -0.0257 -0.0882 47   ILE A CG2 
393  C CD1 . ILE A 47  ? 0.1850 0.3700 0.3645 -0.0715 0.0166  -0.0946 47   ILE A CD1 
394  N N   . TYR A 48  ? 0.1712 0.3512 0.3643 -0.0462 0.0282  -0.0823 48   TYR A N   
395  C CA  . TYR A 48  ? 0.1743 0.3416 0.3542 -0.0513 0.0430  -0.0818 48   TYR A CA  
396  C C   . TYR A 48  ? 0.1742 0.3248 0.3419 -0.0407 0.0415  -0.0787 48   TYR A C   
397  O O   . TYR A 48  ? 0.1820 0.3171 0.3383 -0.0353 0.0320  -0.0712 48   TYR A O   
398  C CB  . TYR A 48  ? 0.1789 0.3276 0.3413 -0.0639 0.0474  -0.0755 48   TYR A CB  
399  C CG  . TYR A 48  ? 0.1801 0.3180 0.3259 -0.0694 0.0575  -0.0682 48   TYR A CG  
400  C CD1 . TYR A 48  ? 0.1931 0.3444 0.3423 -0.0828 0.0695  -0.0665 48   TYR A CD1 
401  C CD2 . TYR A 48  ? 0.1858 0.3045 0.3112 -0.0633 0.0544  -0.0621 48   TYR A CD2 
402  C CE1 . TYR A 48  ? 0.2254 0.3723 0.3524 -0.0905 0.0768  -0.0563 48   TYR A CE1 
403  C CE2 . TYR A 48  ? 0.2100 0.3246 0.3177 -0.0693 0.0602  -0.0548 48   TYR A CE2 
404  C CZ  . TYR A 48  ? 0.2111 0.3404 0.3167 -0.0830 0.0706  -0.0509 48   TYR A CZ  
405  O OH  . TYR A 48  ? 0.2531 0.3833 0.3344 -0.0915 0.0744  -0.0404 48   TYR A OH  
406  N N   . THR A 49  ? 0.1765 0.3337 0.3475 -0.0399 0.0521  -0.0866 49   THR A N   
407  C CA  . THR A 49  ? 0.1777 0.3191 0.3371 -0.0335 0.0524  -0.0878 49   THR A CA  
408  C C   . THR A 49  ? 0.1887 0.3348 0.3269 -0.0444 0.0652  -0.0912 49   THR A C   
409  O O   . THR A 49  ? 0.1950 0.3642 0.3372 -0.0539 0.0773  -0.0976 49   THR A O   
410  C CB  . THR A 49  ? 0.1757 0.3235 0.3669 -0.0194 0.0496  -0.1000 49   THR A CB  
411  O OG1 . THR A 49  ? 0.1967 0.3724 0.4088 -0.0213 0.0635  -0.1194 49   THR A OG1 
412  C CG2 . THR A 49  ? 0.1580 0.3064 0.3725 -0.0093 0.0334  -0.0910 49   THR A CG2 
413  N N   . PHE A 50  ? 0.1933 0.3218 0.3087 -0.0450 0.0623  -0.0858 50   PHE A N   
414  C CA  . PHE A 50  ? 0.2131 0.3508 0.3056 -0.0550 0.0705  -0.0890 50   PHE A CA  
415  C C   . PHE A 50  ? 0.2174 0.3517 0.3128 -0.0477 0.0695  -0.1045 50   PHE A C   
416  O O   . PHE A 50  ? 0.1993 0.3116 0.2949 -0.0410 0.0593  -0.0987 50   PHE A O   
417  C CB  . PHE A 50  ? 0.2207 0.3444 0.2875 -0.0642 0.0650  -0.0680 50   PHE A CB  
418  C CG  . PHE A 50  ? 0.2436 0.3774 0.2821 -0.0742 0.0671  -0.0660 50   PHE A CG  
419  C CD1 . PHE A 50  ? 0.2748 0.4358 0.2973 -0.0893 0.0791  -0.0671 50   PHE A CD1 
420  C CD2 . PHE A 50  ? 0.2576 0.3790 0.2847 -0.0708 0.0567  -0.0630 50   PHE A CD2 
421  C CE1 . PHE A 50  ? 0.3071 0.4839 0.2967 -0.1015 0.0794  -0.0638 50   PHE A CE1 
422  C CE2 . PHE A 50  ? 0.2844 0.4205 0.2839 -0.0813 0.0553  -0.0611 50   PHE A CE2 
423  C CZ  . PHE A 50  ? 0.3002 0.4649 0.2779 -0.0971 0.0661  -0.0609 50   PHE A CZ  
424  N N   . ASP A 51  ? 0.2375 0.3955 0.3391 -0.0503 0.0814  -0.1271 51   ASP A N   
425  C CA  . ASP A 51  ? 0.2522 0.4092 0.3603 -0.0459 0.0824  -0.1489 51   ASP A CA  
426  C C   . ASP A 51  ? 0.2774 0.4492 0.3452 -0.0615 0.0857  -0.1503 51   ASP A C   
427  O O   . ASP A 51  ? 0.2963 0.5008 0.3488 -0.0740 0.0994  -0.1639 51   ASP A O   
428  C CB  . ASP A 51  ? 0.2596 0.4371 0.4072 -0.0385 0.0939  -0.1798 51   ASP A CB  
429  C CG  . ASP A 51  ? 0.2801 0.4522 0.4472 -0.0327 0.0949  -0.2075 51   ASP A CG  
430  O OD1 . ASP A 51  ? 0.3311 0.4929 0.4727 -0.0391 0.0895  -0.2060 51   ASP A OD1 
431  O OD2 . ASP A 51  ? 0.3074 0.4872 0.5215 -0.0218 0.1009  -0.2334 51   ASP A OD2 
432  N N   . GLY A 52  ? 0.2751 0.4273 0.3256 -0.0620 0.0726  -0.1360 52   GLY A N   
433  C CA  . GLY A 52  ? 0.2966 0.4634 0.3090 -0.0762 0.0693  -0.1303 52   GLY A CA  
434  C C   . GLY A 52  ? 0.3253 0.5219 0.3271 -0.0851 0.0788  -0.1625 52   GLY A C   
435  O O   . GLY A 52  ? 0.3554 0.5817 0.3192 -0.1023 0.0819  -0.1604 52   GLY A O   
436  N N   . ALA A 53  ? 0.3207 0.5110 0.3576 -0.0747 0.0832  -0.1927 53   ALA A N   
437  C CA  . ALA A 53  ? 0.3489 0.5672 0.3870 -0.0819 0.0944  -0.2334 53   ALA A CA  
438  C C   . ALA A 53  ? 0.3703 0.6318 0.3966 -0.0935 0.1151  -0.2508 53   ALA A C   
439  O O   . ALA A 53  ? 0.3944 0.6945 0.3902 -0.1107 0.1245  -0.2727 53   ALA A O   
440  C CB  . ALA A 53  ? 0.3443 0.5399 0.4372 -0.0661 0.0948  -0.2613 53   ALA A CB  
441  N N   . LEU A 54  ? 0.3514 0.6113 0.4007 -0.0864 0.1222  -0.2413 54   LEU A N   
442  C CA  . LEU A 54  ? 0.3725 0.6760 0.4170 -0.0985 0.1438  -0.2563 54   LEU A CA  
443  C C   . LEU A 54  ? 0.3790 0.6954 0.3760 -0.1177 0.1440  -0.2181 54   LEU A C   
444  O O   . LEU A 54  ? 0.4034 0.7610 0.3843 -0.1351 0.1629  -0.2259 54   LEU A O   
445  C CB  . LEU A 54  ? 0.3544 0.6547 0.4578 -0.0814 0.1510  -0.2688 54   LEU A CB  
446  C CG  . LEU A 54  ? 0.3640 0.6507 0.5275 -0.0611 0.1505  -0.3038 54   LEU A CG  
447  C CD1 . LEU A 54  ? 0.3557 0.6348 0.5766 -0.0426 0.1488  -0.3008 54   LEU A CD1 
448  C CD2 . LEU A 54  ? 0.4155 0.7424 0.5877 -0.0695 0.1711  -0.3570 54   LEU A CD2 
449  N N   . ASN A 55  ? 0.3588 0.6408 0.3384 -0.1154 0.1240  -0.1779 55   ASN A N   
450  C CA  . ASN A 55  ? 0.3712 0.6544 0.3185 -0.1307 0.1206  -0.1384 55   ASN A CA  
451  C C   . ASN A 55  ? 0.3539 0.6468 0.3255 -0.1326 0.1345  -0.1359 55   ASN A C   
452  O O   . ASN A 55  ? 0.3710 0.6914 0.3191 -0.1537 0.1465  -0.1236 55   ASN A O   
453  C CB  . ASN A 55  ? 0.4280 0.7499 0.3213 -0.1565 0.1255  -0.1336 55   ASN A CB  
454  C CG  . ASN A 55  ? 0.4822 0.7874 0.3407 -0.1667 0.1056  -0.0848 55   ASN A CG  
455  O OD1 . ASN A 55  ? 0.4737 0.7381 0.3518 -0.1542 0.0901  -0.0580 55   ASN A OD1 
456  N ND2 . ASN A 55  ? 0.6078 0.9476 0.4159 -0.1893 0.1044  -0.0757 55   ASN A ND2 
457  N N   . LYS A 56  ? 0.3073 0.5802 0.3259 -0.1123 0.1319  -0.1462 56   LYS A N   
458  C CA  . LYS A 56  ? 0.2953 0.5819 0.3471 -0.1113 0.1429  -0.1505 56   LYS A CA  
459  C C   . LYS A 56  ? 0.2539 0.5048 0.3347 -0.0946 0.1267  -0.1344 56   LYS A C   
460  O O   . LYS A 56  ? 0.2264 0.4486 0.3172 -0.0784 0.1122  -0.1340 56   LYS A O   
461  C CB  . LYS A 56  ? 0.2959 0.6145 0.3866 -0.1035 0.1595  -0.1936 56   LYS A CB  
462  C CG  . LYS A 56  ? 0.3406 0.7108 0.4083 -0.1247 0.1838  -0.2176 56   LYS A CG  
463  C CD  . LYS A 56  ? 0.3392 0.7453 0.4602 -0.1164 0.2032  -0.2627 56   LYS A CD  
464  C CE  . LYS A 56  ? 0.3804 0.8461 0.4770 -0.1398 0.2316  -0.2946 56   LYS A CE  
465  N NZ  . LYS A 56  ? 0.3966 0.9065 0.5516 -0.1348 0.2553  -0.3390 56   LYS A NZ  
466  N N   . SER A 57  ? 0.2449 0.5021 0.3394 -0.1012 0.1304  -0.1228 57   SER A N   
467  C CA  . SER A 57  ? 0.2206 0.4528 0.3390 -0.0898 0.1161  -0.1108 57   SER A CA  
468  C C   . SER A 57  ? 0.2084 0.4665 0.3711 -0.0849 0.1225  -0.1277 57   SER A C   
469  O O   . SER A 57  ? 0.2117 0.5053 0.3824 -0.0985 0.1405  -0.1382 57   SER A O   
470  C CB  . SER A 57  ? 0.2310 0.4452 0.3312 -0.1035 0.1110  -0.0821 57   SER A CB  
471  O OG  . SER A 57  ? 0.2798 0.4648 0.3531 -0.1015 0.0985  -0.0649 57   SER A OG  
472  N N   . THR A 58  ? 0.1833 0.4271 0.3741 -0.0673 0.1071  -0.1286 58   THR A N   
473  C CA  . THR A 58  ? 0.1728 0.4415 0.4110 -0.0597 0.1061  -0.1416 58   THR A CA  
474  C C   . THR A 58  ? 0.1591 0.4153 0.4033 -0.0591 0.0900  -0.1259 58   THR A C   
475  O O   . THR A 58  ? 0.1531 0.3792 0.3790 -0.0525 0.0748  -0.1123 58   THR A O   
476  C CB  . THR A 58  ? 0.1700 0.4398 0.4440 -0.0375 0.0990  -0.1586 58   THR A CB  
477  O OG1 . THR A 58  ? 0.1630 0.4423 0.4314 -0.0387 0.1142  -0.1792 58   THR A OG1 
478  C CG2 . THR A 58  ? 0.1559 0.4568 0.4868 -0.0281 0.0964  -0.1720 58   THR A CG2 
479  N N   . VAL A 59  ? 0.1568 0.4402 0.4269 -0.0682 0.0946  -0.1308 59   VAL A N   
480  C CA  . VAL A 59  ? 0.1507 0.4304 0.4303 -0.0704 0.0799  -0.1227 59   VAL A CA  
481  C C   . VAL A 59  ? 0.1510 0.4704 0.4815 -0.0659 0.0759  -0.1372 59   VAL A C   
482  O O   . VAL A 59  ? 0.1521 0.5054 0.5100 -0.0719 0.0925  -0.1522 59   VAL A O   
483  C CB  . VAL A 59  ? 0.1558 0.4231 0.4153 -0.0924 0.0870  -0.1109 59   VAL A CB  
484  C CG1 . VAL A 59  ? 0.1464 0.3766 0.3639 -0.0945 0.0870  -0.0949 59   VAL A CG1 
485  C CG2 . VAL A 59  ? 0.1651 0.4629 0.4397 -0.1120 0.1078  -0.1161 59   VAL A CG2 
486  N N   . PRO A 60  ? 0.1533 0.4736 0.4967 -0.0572 0.0536  -0.1329 60   PRO A N   
487  C CA  . PRO A 60  ? 0.1569 0.5185 0.5499 -0.0551 0.0457  -0.1443 60   PRO A CA  
488  C C   . PRO A 60  ? 0.1659 0.5454 0.5666 -0.0791 0.0570  -0.1498 60   PRO A C   
489  O O   . PRO A 60  ? 0.1620 0.5137 0.5289 -0.0948 0.0629  -0.1403 60   PRO A O   
490  C CB  . PRO A 60  ? 0.1533 0.5088 0.5433 -0.0434 0.0162  -0.1329 60   PRO A CB  
491  C CG  . PRO A 60  ? 0.1550 0.4716 0.4919 -0.0511 0.0155  -0.1203 60   PRO A CG  
492  C CD  . PRO A 60  ? 0.1502 0.4407 0.4629 -0.0520 0.0351  -0.1182 60   PRO A CD  
493  N N   . THR A 61  ? 0.1695 0.5945 0.6208 -0.0819 0.0592  -0.1649 61   THR A N   
494  C CA  . THR A 61  ? 0.1898 0.6372 0.6584 -0.1074 0.0732  -0.1720 61   THR A CA  
495  C C   . THR A 61  ? 0.1970 0.6301 0.6535 -0.1199 0.0578  -0.1675 61   THR A C   
496  O O   . THR A 61  ? 0.2056 0.6337 0.6623 -0.1436 0.0701  -0.1678 61   THR A O   
497  C CB  . THR A 61  ? 0.1936 0.7005 0.7279 -0.1073 0.0789  -0.1928 61   THR A CB  
498  O OG1 . THR A 61  ? 0.2097 0.7417 0.7798 -0.0950 0.0499  -0.1973 61   THR A OG1 
499  C CG2 . THR A 61  ? 0.1895 0.7129 0.7431 -0.0917 0.0934  -0.2049 61   THR A CG2 
500  N N   . ASP A 62  ? 0.2045 0.6311 0.6506 -0.1056 0.0317  -0.1638 62   ASP A N   
501  C CA  . ASP A 62  ? 0.2191 0.6342 0.6478 -0.1178 0.0186  -0.1653 62   ASP A CA  
502  C C   . ASP A 62  ? 0.2251 0.5880 0.6055 -0.1233 0.0263  -0.1548 62   ASP A C   
503  O O   . ASP A 62  ? 0.2401 0.5913 0.6106 -0.1346 0.0204  -0.1613 62   ASP A O   
504  C CB  . ASP A 62  ? 0.2300 0.6676 0.6618 -0.1051 -0.0120 -0.1657 62   ASP A CB  
505  C CG  . ASP A 62  ? 0.2440 0.6589 0.6461 -0.0833 -0.0234 -0.1481 62   ASP A CG  
506  O OD1 . ASP A 62  ? 0.2673 0.6632 0.6661 -0.0723 -0.0099 -0.1413 62   ASP A OD1 
507  O OD2 . ASP A 62  ? 0.2814 0.7003 0.6634 -0.0794 -0.0459 -0.1415 62   ASP A OD2 
508  N N   . PHE A 63  ? 0.2149 0.5501 0.5703 -0.1153 0.0390  -0.1418 63   PHE A N   
509  C CA  . PHE A 63  ? 0.2244 0.5143 0.5439 -0.1214 0.0478  -0.1306 63   PHE A CA  
510  C C   . PHE A 63  ? 0.2345 0.5146 0.5487 -0.1316 0.0698  -0.1204 63   PHE A C   
511  O O   . PHE A 63  ? 0.2327 0.4850 0.5155 -0.1262 0.0744  -0.1074 63   PHE A O   
512  C CB  . PHE A 63  ? 0.2093 0.4746 0.4942 -0.1034 0.0379  -0.1211 63   PHE A CB  
513  C CG  . PHE A 63  ? 0.2112 0.4795 0.4858 -0.0999 0.0193  -0.1263 63   PHE A CG  
514  C CD1 . PHE A 63  ? 0.2223 0.4664 0.4782 -0.1081 0.0198  -0.1304 63   PHE A CD1 
515  C CD2 . PHE A 63  ? 0.2088 0.5063 0.4931 -0.0890 0.0011  -0.1268 63   PHE A CD2 
516  C CE1 . PHE A 63  ? 0.2174 0.4716 0.4593 -0.1079 0.0058  -0.1390 63   PHE A CE1 
517  C CE2 . PHE A 63  ? 0.2132 0.5191 0.4795 -0.0895 -0.0164 -0.1285 63   PHE A CE2 
518  C CZ  . PHE A 63  ? 0.2269 0.5134 0.4689 -0.1002 -0.0123 -0.1366 63   PHE A CZ  
519  N N   . SER A 64  ? 0.2464 0.5528 0.5899 -0.1489 0.0829  -0.1256 64   SER A N   
520  C CA  . SER A 64  ? 0.2591 0.5699 0.5950 -0.1615 0.1053  -0.1157 64   SER A CA  
521  C C   . SER A 64  ? 0.2704 0.5379 0.5719 -0.1723 0.1109  -0.0925 64   SER A C   
522  O O   . SER A 64  ? 0.2796 0.5452 0.5554 -0.1755 0.1226  -0.0800 64   SER A O   
523  C CB  . SER A 64  ? 0.2756 0.6244 0.6508 -0.1834 0.1199  -0.1241 64   SER A CB  
524  O OG  . SER A 64  ? 0.2884 0.6811 0.7040 -0.1726 0.1121  -0.1457 64   SER A OG  
525  N N   . SER A 65  ? 0.2793 0.5150 0.5837 -0.1781 0.1014  -0.0884 65   SER A N   
526  C CA  . SER A 65  ? 0.2939 0.4858 0.5794 -0.1866 0.1026  -0.0655 65   SER A CA  
527  C C   . SER A 65  ? 0.2725 0.4356 0.5253 -0.1661 0.0917  -0.0592 65   SER A C   
528  O O   . SER A 65  ? 0.2775 0.4092 0.5143 -0.1691 0.0910  -0.0385 65   SER A O   
529  C CB  . SER A 65  ? 0.3105 0.4802 0.6272 -0.2012 0.0981  -0.0695 65   SER A CB  
530  O OG  . SER A 65  ? 0.2923 0.4530 0.6118 -0.1868 0.0830  -0.0896 65   SER A OG  
531  N N   . ALA A 66  ? 0.2480 0.4230 0.4939 -0.1462 0.0821  -0.0745 66   ALA A N   
532  C CA  . ALA A 66  ? 0.2388 0.3896 0.4584 -0.1290 0.0724  -0.0706 66   ALA A CA  
533  C C   . ALA A 66  ? 0.2490 0.3882 0.4397 -0.1265 0.0778  -0.0527 66   ALA A C   
534  O O   . ALA A 66  ? 0.2460 0.4085 0.4289 -0.1276 0.0872  -0.0532 66   ALA A O   
535  C CB  . ALA A 66  ? 0.2170 0.3858 0.4342 -0.1115 0.0620  -0.0847 66   ALA A CB  
536  N N   . LYS A 67  ? 0.2504 0.3578 0.4279 -0.1233 0.0716  -0.0401 67   LYS A N   
537  C CA  . LYS A 67  ? 0.2671 0.3667 0.4161 -0.1209 0.0724  -0.0234 67   LYS A CA  
538  C C   . LYS A 67  ? 0.2627 0.3326 0.4050 -0.1104 0.0609  -0.0162 67   LYS A C   
539  O O   . LYS A 67  ? 0.2462 0.2985 0.4088 -0.1077 0.0551  -0.0231 67   LYS A O   
540  C CB  . LYS A 67  ? 0.3024 0.4058 0.4442 -0.1413 0.0816  -0.0016 67   LYS A CB  
541  C CG  . LYS A 67  ? 0.3397 0.4116 0.4988 -0.1532 0.0765  0.0194  67   LYS A CG  
542  C CD  . LYS A 67  ? 0.3831 0.4601 0.5271 -0.1753 0.0839  0.0491  67   LYS A CD  
543  C CE  . LYS A 67  ? 0.4267 0.4680 0.5691 -0.1784 0.0705  0.0824  67   LYS A CE  
544  N NZ  . LYS A 67  ? 0.4682 0.5099 0.6056 -0.2057 0.0763  0.1173  67   LYS A NZ  
545  N N   . ILE A 68  ? 0.2614 0.3307 0.3783 -0.1052 0.0585  -0.0066 68   ILE A N   
546  C CA  . ILE A 68  ? 0.2613 0.3077 0.3745 -0.0971 0.0474  0.0035  68   ILE A CA  
547  C C   . ILE A 68  ? 0.2893 0.3318 0.3860 -0.1080 0.0441  0.0315  68   ILE A C   
548  O O   . ILE A 68  ? 0.2925 0.3556 0.3697 -0.1210 0.0529  0.0387  68   ILE A O   
549  C CB  . ILE A 68  ? 0.2393 0.2906 0.3392 -0.0820 0.0436  -0.0096 68   ILE A CB  
550  C CG1 . ILE A 68  ? 0.2414 0.3121 0.3153 -0.0831 0.0478  -0.0101 68   ILE A CG1 
551  C CG2 . ILE A 68  ? 0.2145 0.2721 0.3261 -0.0744 0.0448  -0.0299 68   ILE A CG2 
552  C CD1 . ILE A 68  ? 0.2200 0.2904 0.2861 -0.0705 0.0431  -0.0213 68   ILE A CD1 
553  N N   . GLU A 69  ? 0.3090 0.3287 0.4152 -0.1037 0.0311  0.0477  69   GLU A N   
554  C CA  . GLU A 69  ? 0.3434 0.3622 0.4302 -0.1127 0.0221  0.0791  69   GLU A CA  
555  C C   . GLU A 69  ? 0.3336 0.3686 0.3928 -0.1042 0.0166  0.0726  69   GLU A C   
556  O O   . GLU A 69  ? 0.3218 0.3462 0.3953 -0.0900 0.0069  0.0656  69   GLU A O   
557  C CB  . GLU A 69  ? 0.3752 0.3615 0.4953 -0.1111 0.0067  0.1029  69   GLU A CB  
558  C CG  . GLU A 69  ? 0.4141 0.3795 0.5672 -0.1228 0.0105  0.1125  69   GLU A CG  
559  C CD  . GLU A 69  ? 0.4693 0.4493 0.5985 -0.1470 0.0198  0.1359  69   GLU A CD  
560  O OE1 . GLU A 69  ? 0.5154 0.5150 0.6042 -0.1571 0.0174  0.1584  69   GLU A OE1 
561  O OE2 . GLU A 69  ? 0.5053 0.4807 0.6565 -0.1583 0.0303  0.1305  69   GLU A OE2 
562  N N   . VAL A 70  ? 0.3395 0.4033 0.3627 -0.1142 0.0246  0.0709  70   VAL A N   
563  C CA  . VAL A 70  ? 0.3369 0.4186 0.3359 -0.1087 0.0211  0.0584  70   VAL A CA  
564  C C   . VAL A 70  ? 0.3551 0.4303 0.3485 -0.1076 0.0003  0.0818  70   VAL A C   
565  O O   . VAL A 70  ? 0.3493 0.4284 0.3423 -0.0975 -0.0073 0.0693  70   VAL A O   
566  C CB  . VAL A 70  ? 0.3529 0.4707 0.3181 -0.1219 0.0356  0.0465  70   VAL A CB  
567  C CG1 . VAL A 70  ? 0.3571 0.4925 0.3011 -0.1181 0.0312  0.0299  70   VAL A CG1 
568  C CG2 . VAL A 70  ? 0.3268 0.4535 0.3090 -0.1191 0.0538  0.0208  70   VAL A CG2 
569  N N   . SER A 71  ? 0.3865 0.4511 0.3822 -0.1176 -0.0103 0.1170  71   SER A N   
570  C CA  . SER A 71  ? 0.4160 0.4735 0.4155 -0.1152 -0.0351 0.1458  71   SER A CA  
571  C C   . SER A 71  ? 0.3885 0.4232 0.4339 -0.0935 -0.0469 0.1353  71   SER A C   
572  O O   . SER A 71  ? 0.4084 0.4434 0.4634 -0.0881 -0.0680 0.1522  71   SER A O   
573  C CB  . SER A 71  ? 0.4602 0.5027 0.4648 -0.1293 -0.0456 0.1904  71   SER A CB  
574  O OG  . SER A 71  ? 0.4514 0.4592 0.5050 -0.1230 -0.0413 0.1890  71   SER A OG  
575  N N   . GLN A 72  ? 0.3482 0.3682 0.4223 -0.0826 -0.0336 0.1076  72   GLN A N   
576  C CA  . GLN A 72  ? 0.3283 0.3319 0.4467 -0.0651 -0.0394 0.0932  72   GLN A CA  
577  C C   . GLN A 72  ? 0.2914 0.3086 0.4030 -0.0564 -0.0303 0.0611  72   GLN A C   
578  O O   . GLN A 72  ? 0.2775 0.2893 0.4199 -0.0447 -0.0320 0.0467  72   GLN A O   
579  C CB  . GLN A 72  ? 0.3191 0.2981 0.4766 -0.0625 -0.0315 0.0857  72   GLN A CB  
580  C CG  . GLN A 72  ? 0.3569 0.3151 0.5318 -0.0721 -0.0402 0.1182  72   GLN A CG  
581  C CD  . GLN A 72  ? 0.3930 0.3406 0.5922 -0.0661 -0.0653 0.1485  72   GLN A CD  
582  O OE1 . GLN A 72  ? 0.3761 0.3157 0.6185 -0.0497 -0.0734 0.1362  72   GLN A OE1 
583  N NE2 . GLN A 72  ? 0.4059 0.3574 0.5788 -0.0803 -0.0781 0.1890  72   GLN A NE2 
584  N N   . LEU A 73  ? 0.2868 0.3226 0.3615 -0.0630 -0.0201 0.0499  73   LEU A N   
585  C CA  . LEU A 73  ? 0.2607 0.3032 0.3330 -0.0566 -0.0098 0.0221  73   LEU A CA  
586  C C   . LEU A 73  ? 0.2520 0.3017 0.3311 -0.0503 -0.0193 0.0157  73   LEU A C   
587  O O   . LEU A 73  ? 0.2278 0.2743 0.3245 -0.0432 -0.0142 -0.0007 73   LEU A O   
588  C CB  . LEU A 73  ? 0.2623 0.3205 0.3053 -0.0639 0.0027  0.0108  73   LEU A CB  
589  C CG  . LEU A 73  ? 0.2428 0.3050 0.2868 -0.0577 0.0113  -0.0135 73   LEU A CG  
590  C CD1 . LEU A 73  ? 0.2285 0.3057 0.2565 -0.0634 0.0230  -0.0244 73   LEU A CD1 
591  C CD2 . LEU A 73  ? 0.2367 0.2855 0.3036 -0.0497 0.0155  -0.0215 73   LEU A CD2 
592  N N   . LEU A 74  ? 0.2813 0.3438 0.3468 -0.0550 -0.0337 0.0297  74   LEU A N   
593  C CA  . LEU A 74  ? 0.2807 0.3543 0.3570 -0.0506 -0.0451 0.0230  74   LEU A CA  
594  C C   . LEU A 74  ? 0.2742 0.3380 0.3974 -0.0389 -0.0535 0.0259  74   LEU A C   
595  O O   . LEU A 74  ? 0.2647 0.3378 0.4071 -0.0344 -0.0563 0.0130  74   LEU A O   
596  C CB  . LEU A 74  ? 0.3150 0.4118 0.3627 -0.0605 -0.0607 0.0357  74   LEU A CB  
597  C CG  . LEU A 74  ? 0.3410 0.4560 0.3463 -0.0728 -0.0490 0.0212  74   LEU A CG  
598  C CD1 . LEU A 74  ? 0.3904 0.5356 0.3669 -0.0841 -0.0647 0.0262  74   LEU A CD1 
599  C CD2 . LEU A 74  ? 0.3478 0.4582 0.3612 -0.0682 -0.0328 -0.0108 74   LEU A CD2 
600  N N   . LYS A 75  ? 0.2807 0.3268 0.4281 -0.0348 -0.0558 0.0392  75   LYS A N   
601  C CA  . LYS A 75  ? 0.2701 0.3068 0.4707 -0.0226 -0.0578 0.0318  75   LYS A CA  
602  C C   . LYS A 75  ? 0.2426 0.2778 0.4511 -0.0202 -0.0364 0.0026  75   LYS A C   
603  O O   . LYS A 75  ? 0.2319 0.2674 0.4807 -0.0126 -0.0324 -0.0122 75   LYS A O   
604  C CB  . LYS A 75  ? 0.2961 0.3110 0.5271 -0.0195 -0.0657 0.0508  75   LYS A CB  
605  C CG  . LYS A 75  ? 0.3294 0.3435 0.5594 -0.0223 -0.0909 0.0887  75   LYS A CG  
606  C CD  . LYS A 75  ? 0.3578 0.3425 0.6163 -0.0228 -0.0951 0.1100  75   LYS A CD  
607  C CE  . LYS A 75  ? 0.4147 0.3960 0.6697 -0.0285 -0.1218 0.1568  75   LYS A CE  
608  N NZ  . LYS A 75  ? 0.4354 0.3816 0.7345 -0.0276 -0.1283 0.1794  75   LYS A NZ  
609  N N   . GLY A 76  ? 0.2268 0.2634 0.3985 -0.0273 -0.0230 -0.0057 76   GLY A N   
610  C CA  . GLY A 76  ? 0.2154 0.2519 0.3871 -0.0274 -0.0059 -0.0262 76   GLY A CA  
611  C C   . GLY A 76  ? 0.2193 0.2445 0.3963 -0.0287 0.0023  -0.0300 76   GLY A C   
612  O O   . GLY A 76  ? 0.2177 0.2472 0.3938 -0.0299 0.0140  -0.0462 76   GLY A O   
613  N N   . ASP A 77  ? 0.2322 0.2449 0.4145 -0.0304 -0.0045 -0.0139 77   ASP A N   
614  C CA  . ASP A 77  ? 0.2336 0.2352 0.4246 -0.0342 0.0027  -0.0181 77   ASP A CA  
615  C C   . ASP A 77  ? 0.2264 0.2344 0.3813 -0.0425 0.0099  -0.0157 77   ASP A C   
616  O O   . ASP A 77  ? 0.2349 0.2438 0.3707 -0.0488 0.0062  0.0018  77   ASP A O   
617  C CB  . ASP A 77  ? 0.2598 0.2419 0.4812 -0.0340 -0.0082 0.0005  77   ASP A CB  
618  C CG  . ASP A 77  ? 0.2684 0.2369 0.5009 -0.0414 -0.0014 -0.0016 77   ASP A CG  
619  O OD1 . ASP A 77  ? 0.2323 0.2095 0.4536 -0.0454 0.0110  -0.0218 77   ASP A OD1 
620  O OD2 . ASP A 77  ? 0.2704 0.2193 0.5265 -0.0441 -0.0107 0.0193  77   ASP A OD2 
621  N N   . ALA A 78  ? 0.2083 0.2247 0.3554 -0.0431 0.0199  -0.0333 78   ALA A N   
622  C CA  . ALA A 78  ? 0.2091 0.2341 0.3342 -0.0483 0.0257  -0.0345 78   ALA A CA  
623  C C   . ALA A 78  ? 0.2115 0.2362 0.3501 -0.0533 0.0307  -0.0441 78   ALA A C   
624  O O   . ALA A 78  ? 0.2116 0.2490 0.3401 -0.0553 0.0345  -0.0517 78   ALA A O   
625  C CB  . ALA A 78  ? 0.1982 0.2344 0.3071 -0.0450 0.0286  -0.0427 78   ALA A CB  
626  N N   . SER A 79  ? 0.2239 0.2345 0.3905 -0.0548 0.0291  -0.0449 79   SER A N   
627  C CA  . SER A 79  ? 0.2296 0.2382 0.4166 -0.0614 0.0335  -0.0589 79   SER A CA  
628  C C   . SER A 79  ? 0.2328 0.2481 0.4103 -0.0711 0.0365  -0.0521 79   SER A C   
629  O O   . SER A 79  ? 0.2260 0.2385 0.3929 -0.0757 0.0357  -0.0317 79   SER A O   
630  C CB  . SER A 79  ? 0.2446 0.2303 0.4728 -0.0612 0.0299  -0.0584 79   SER A CB  
631  O OG  . SER A 79  ? 0.2384 0.2227 0.4851 -0.0512 0.0283  -0.0692 79   SER A OG  
632  N N   . LEU A 80  ? 0.2349 0.2646 0.4165 -0.0759 0.0401  -0.0704 80   LEU A N   
633  C CA  . LEU A 80  ? 0.2433 0.2865 0.4237 -0.0849 0.0431  -0.0688 80   LEU A CA  
634  C C   . LEU A 80  ? 0.2639 0.2947 0.4766 -0.0970 0.0452  -0.0729 80   LEU A C   
635  O O   . LEU A 80  ? 0.2694 0.2923 0.5063 -0.0983 0.0448  -0.0921 80   LEU A O   
636  C CB  . LEU A 80  ? 0.2286 0.2993 0.3970 -0.0827 0.0418  -0.0831 80   LEU A CB  
637  C CG  . LEU A 80  ? 0.2287 0.3205 0.4003 -0.0882 0.0435  -0.0820 80   LEU A CG  
638  C CD1 . LEU A 80  ? 0.2168 0.3125 0.3737 -0.0835 0.0469  -0.0676 80   LEU A CD1 
639  C CD2 . LEU A 80  ? 0.2256 0.3445 0.3965 -0.0866 0.0368  -0.0958 80   LEU A CD2 
640  N N   . LYS A 81  ? 0.2804 0.3105 0.4958 -0.1077 0.0488  -0.0563 81   LYS A N   
641  C CA  . LYS A 81  ? 0.3105 0.3277 0.5588 -0.1229 0.0515  -0.0552 81   LYS A CA  
642  C C   . LYS A 81  ? 0.3039 0.3495 0.5547 -0.1343 0.0576  -0.0627 81   LYS A C   
643  O O   . LYS A 81  ? 0.2884 0.3555 0.5176 -0.1335 0.0619  -0.0540 81   LYS A O   
644  C CB  . LYS A 81  ? 0.3373 0.3306 0.5884 -0.1302 0.0506  -0.0220 81   LYS A CB  
645  C CG  . LYS A 81  ? 0.3662 0.3311 0.6267 -0.1189 0.0411  -0.0116 81   LYS A CG  
646  C CD  . LYS A 81  ? 0.3944 0.3509 0.6352 -0.1228 0.0363  0.0263  81   LYS A CD  
647  C CE  . LYS A 81  ? 0.4019 0.3847 0.5965 -0.1150 0.0378  0.0273  81   LYS A CE  
648  N NZ  . LYS A 81  ? 0.4320 0.4326 0.5991 -0.1302 0.0446  0.0482  81   LYS A NZ  
649  N N   . MET A 82  ? 0.3160 0.3645 0.5981 -0.1452 0.0582  -0.0823 82   MET A N   
650  C CA  . MET A 82  ? 0.3217 0.3987 0.6166 -0.1588 0.0632  -0.0894 82   MET A CA  
651  C C   . MET A 82  ? 0.3417 0.4041 0.6808 -0.1781 0.0657  -0.0985 82   MET A C   
652  O O   . MET A 82  ? 0.3450 0.3767 0.7076 -0.1781 0.0624  -0.1068 82   MET A O   
653  C CB  . MET A 82  ? 0.2978 0.4127 0.5823 -0.1501 0.0572  -0.1120 82   MET A CB  
654  C CG  . MET A 82  ? 0.3207 0.4409 0.6173 -0.1512 0.0497  -0.1414 82   MET A CG  
655  S SD  . MET A 82  ? 0.3176 0.4796 0.5871 -0.1391 0.0376  -0.1551 82   MET A SD  
656  C CE  . MET A 82  ? 0.2884 0.4311 0.5201 -0.1197 0.0370  -0.1370 82   MET A CE  
657  N N   . ASP A 83  ? 0.3521 0.4374 0.7080 -0.1947 0.0725  -0.0985 83   ASP A N   
658  C CA  . ASP A 83  ? 0.3777 0.4564 0.7804 -0.2164 0.0752  -0.1115 83   ASP A CA  
659  C C   . ASP A 83  ? 0.3710 0.4674 0.7895 -0.2143 0.0665  -0.1527 83   ASP A C   
660  O O   . ASP A 83  ? 0.3440 0.4717 0.7353 -0.2002 0.0591  -0.1664 83   ASP A O   
661  C CB  . ASP A 83  ? 0.3845 0.4946 0.8009 -0.2356 0.0857  -0.1041 83   ASP A CB  
662  C CG  . ASP A 83  ? 0.4112 0.5063 0.8158 -0.2477 0.0974  -0.0643 83   ASP A CG  
663  O OD1 . ASP A 83  ? 0.4357 0.4931 0.8239 -0.2415 0.0939  -0.0396 83   ASP A OD1 
664  O OD2 . ASP A 83  ? 0.3861 0.5121 0.7982 -0.2649 0.1099  -0.0579 83   ASP A OD2 
665  N N   . LYS A 84  ? 0.3989 0.4766 0.8623 -0.2302 0.0669  -0.1721 84   LYS A N   
666  C CA  . LYS A 84  ? 0.4038 0.5023 0.8831 -0.2328 0.0596  -0.2173 84   LYS A CA  
667  C C   . LYS A 84  ? 0.3874 0.5440 0.8600 -0.2378 0.0537  -0.2338 84   LYS A C   
668  O O   . LYS A 84  ? 0.3814 0.5693 0.8373 -0.2317 0.0430  -0.2605 84   LYS A O   
669  C CB  . LYS A 84  ? 0.4420 0.5092 0.9804 -0.2516 0.0625  -0.2397 84   LYS A CB  
670  C CG  . LYS A 84  ? 0.4700 0.5370 1.0514 -0.2782 0.0691  -0.2322 84   LYS A CG  
671  C CD  . LYS A 84  ? 0.5078 0.5417 1.1539 -0.2965 0.0704  -0.2606 84   LYS A CD  
672  C CE  . LYS A 84  ? 0.5401 0.5617 1.2330 -0.3253 0.0785  -0.2434 84   LYS A CE  
673  N NZ  . LYS A 84  ? 0.5934 0.5614 1.3543 -0.3401 0.0798  -0.2570 84   LYS A NZ  
674  N N   . SER A 85  ? 0.3852 0.5596 0.8723 -0.2496 0.0600  -0.2172 85   SER A N   
675  C CA  . SER A 85  ? 0.3692 0.6017 0.8602 -0.2522 0.0533  -0.2308 85   SER A CA  
676  C C   . SER A 85  ? 0.3383 0.5985 0.7846 -0.2271 0.0428  -0.2233 85   SER A C   
677  O O   . SER A 85  ? 0.3343 0.6382 0.7791 -0.2239 0.0282  -0.2413 85   SER A O   
678  C CB  . SER A 85  ? 0.3755 0.6243 0.8961 -0.2700 0.0661  -0.2150 85   SER A CB  
679  O OG  . SER A 85  ? 0.3903 0.6192 0.8863 -0.2640 0.0789  -0.1786 85   SER A OG  
680  N N   . ASP A 86  ? 0.3206 0.5556 0.7330 -0.2104 0.0484  -0.1959 86   ASP A N   
681  C CA  . ASP A 86  ? 0.2941 0.5462 0.6684 -0.1871 0.0388  -0.1880 86   ASP A CA  
682  C C   . ASP A 86  ? 0.2911 0.5365 0.6393 -0.1782 0.0278  -0.2023 86   ASP A C   
683  O O   . ASP A 86  ? 0.2896 0.5617 0.6143 -0.1662 0.0147  -0.2029 86   ASP A O   
684  C CB  . ASP A 86  ? 0.2837 0.5143 0.6332 -0.1748 0.0491  -0.1585 86   ASP A CB  
685  C CG  . ASP A 86  ? 0.2822 0.5377 0.6490 -0.1813 0.0606  -0.1483 86   ASP A CG  
686  O OD1 . ASP A 86  ? 0.2805 0.5734 0.6803 -0.1911 0.0589  -0.1626 86   ASP A OD1 
687  O OD2 . ASP A 86  ? 0.2922 0.5347 0.6406 -0.1775 0.0720  -0.1282 86   ASP A OD2 
688  N N   . ALA A 87  ? 0.3014 0.5130 0.6576 -0.1851 0.0332  -0.2135 87   ALA A N   
689  C CA  . ALA A 87  ? 0.3041 0.5131 0.6400 -0.1796 0.0277  -0.2335 87   ALA A CA  
690  C C   . ALA A 87  ? 0.3175 0.5688 0.6579 -0.1913 0.0163  -0.2682 87   ALA A C   
691  O O   . ALA A 87  ? 0.3152 0.5936 0.6206 -0.1847 0.0058  -0.2736 87   ALA A O   
692  C CB  . ALA A 87  ? 0.3157 0.4776 0.6712 -0.1821 0.0378  -0.2391 87   ALA A CB  
693  N N   . VAL A 88  ? 0.3315 0.5904 0.7139 -0.2108 0.0176  -0.2903 88   VAL A N   
694  C CA  . VAL A 88  ? 0.3544 0.6540 0.7458 -0.2262 0.0070  -0.3304 88   VAL A CA  
695  C C   . VAL A 88  ? 0.3437 0.7021 0.7096 -0.2223 -0.0130 -0.3262 88   VAL A C   
696  O O   . VAL A 88  ? 0.3562 0.7542 0.7029 -0.2297 -0.0263 -0.3514 88   VAL A O   
697  C CB  . VAL A 88  ? 0.3758 0.6708 0.8260 -0.2500 0.0124  -0.3546 88   VAL A CB  
698  C CG1 . VAL A 88  ? 0.4098 0.7536 0.8682 -0.2673 -0.0003 -0.3996 88   VAL A CG1 
699  C CG2 . VAL A 88  ? 0.4012 0.6362 0.8848 -0.2548 0.0281  -0.3598 88   VAL A CG2 
700  N N   . SER A 89  ? 0.3157 0.6823 0.6834 -0.2112 -0.0160 -0.2949 89   SER A N   
701  C CA  . SER A 89  ? 0.3177 0.7354 0.6717 -0.2032 -0.0374 -0.2856 89   SER A CA  
702  C C   . SER A 89  ? 0.3108 0.7254 0.6140 -0.1832 -0.0457 -0.2613 89   SER A C   
703  O O   . SER A 89  ? 0.3207 0.7742 0.6094 -0.1763 -0.0671 -0.2503 89   SER A O   
704  C CB  . SER A 89  ? 0.3024 0.7354 0.6935 -0.2000 -0.0360 -0.2690 89   SER A CB  
705  O OG  . SER A 89  ? 0.3087 0.6987 0.6999 -0.1912 -0.0158 -0.2450 89   SER A OG  
706  N N   . HIS A 90  ? 0.3007 0.6700 0.5811 -0.1751 -0.0306 -0.2520 90   HIS A N   
707  C CA  . HIS A 90  ? 0.2929 0.6529 0.5307 -0.1578 -0.0346 -0.2273 90   HIS A CA  
708  C C   . HIS A 90  ? 0.3032 0.6433 0.5123 -0.1608 -0.0250 -0.2409 90   HIS A C   
709  O O   . HIS A 90  ? 0.2956 0.5978 0.4939 -0.1499 -0.0127 -0.2261 90   HIS A O   
710  C CB  . HIS A 90  ? 0.2653 0.5927 0.5087 -0.1412 -0.0244 -0.1973 90   HIS A CB  
711  C CG  . HIS A 90  ? 0.2564 0.6067 0.5309 -0.1365 -0.0299 -0.1870 90   HIS A CG  
712  N ND1 . HIS A 90  ? 0.2509 0.5896 0.5585 -0.1421 -0.0143 -0.1870 90   HIS A ND1 
713  C CD2 . HIS A 90  ? 0.2644 0.6511 0.5463 -0.1270 -0.0491 -0.1765 90   HIS A CD2 
714  C CE1 . HIS A 90  ? 0.2565 0.6268 0.5909 -0.1366 -0.0206 -0.1816 90   HIS A CE1 
715  N NE2 . HIS A 90  ? 0.2532 0.6515 0.5767 -0.1256 -0.0429 -0.1755 90   HIS A NE2 
716  N N   . THR A 91  ? 0.3287 0.6993 0.5274 -0.1763 -0.0302 -0.2721 91   THR A N   
717  C CA  . THR A 91  ? 0.3417 0.7060 0.5137 -0.1801 -0.0202 -0.2904 91   THR A CA  
718  C C   . THR A 91  ? 0.3490 0.7404 0.4682 -0.1750 -0.0323 -0.2680 91   THR A C   
719  O O   . THR A 91  ? 0.3490 0.7738 0.4548 -0.1738 -0.0535 -0.2483 91   THR A O   
720  C CB  . THR A 91  ? 0.3680 0.7559 0.5540 -0.2015 -0.0166 -0.3414 91   THR A CB  
721  O OG1 . THR A 91  ? 0.3938 0.8405 0.5633 -0.2147 -0.0374 -0.3520 91   THR A OG1 
722  C CG2 . THR A 91  ? 0.3636 0.7171 0.6084 -0.2076 -0.0047 -0.3600 91   THR A CG2 
723  N N   . GLY A 92  ? 0.3555 0.7323 0.4493 -0.1726 -0.0195 -0.2690 92   GLY A N   
724  C CA  . GLY A 92  ? 0.3675 0.7647 0.4114 -0.1706 -0.0276 -0.2439 92   GLY A CA  
725  C C   . GLY A 92  ? 0.3435 0.6988 0.3819 -0.1550 -0.0150 -0.2186 92   GLY A C   
726  O O   . GLY A 92  ? 0.3271 0.6434 0.3945 -0.1478 0.0010  -0.2271 92   GLY A O   
727  N N   . ASN A 93  ? 0.3516 0.7156 0.3550 -0.1508 -0.0244 -0.1854 93   ASN A N   
728  C CA  . ASN A 93  ? 0.3377 0.6687 0.3330 -0.1397 -0.0133 -0.1638 93   ASN A CA  
729  C C   . ASN A 93  ? 0.3014 0.5919 0.3225 -0.1198 -0.0154 -0.1357 93   ASN A C   
730  O O   . ASN A 93  ? 0.2970 0.5924 0.3209 -0.1119 -0.0320 -0.1100 93   ASN A O   
731  C CB  . ASN A 93  ? 0.3715 0.7288 0.3197 -0.1478 -0.0208 -0.1406 93   ASN A CB  
732  C CG  . ASN A 93  ? 0.4282 0.8286 0.3445 -0.1702 -0.0119 -0.1719 93   ASN A CG  
733  O OD1 . ASN A 93  ? 0.4286 0.8217 0.3574 -0.1738 0.0102  -0.2052 93   ASN A OD1 
734  N ND2 . ASN A 93  ? 0.5163 0.9651 0.3921 -0.1858 -0.0297 -0.1611 93   ASN A ND2 
735  N N   . TYR A 94  ? 0.2731 0.5271 0.3153 -0.1121 0.0009  -0.1424 94   TYR A N   
736  C CA  . TYR A 94  ? 0.2469 0.4663 0.3060 -0.0964 0.0023  -0.1199 94   TYR A CA  
737  C C   . TYR A 94  ? 0.2432 0.4459 0.2853 -0.0907 0.0075  -0.1025 94   TYR A C   
738  O O   . TYR A 94  ? 0.2464 0.4521 0.2780 -0.0970 0.0181  -0.1148 94   TYR A O   
739  C CB  . TYR A 94  ? 0.2239 0.4161 0.3144 -0.0939 0.0141  -0.1337 94   TYR A CB  
740  C CG  . TYR A 94  ? 0.2279 0.4292 0.3428 -0.0989 0.0101  -0.1436 94   TYR A CG  
741  C CD1 . TYR A 94  ? 0.2074 0.3986 0.3402 -0.0920 0.0089  -0.1289 94   TYR A CD1 
742  C CD2 . TYR A 94  ? 0.2197 0.4442 0.3414 -0.1128 0.0089  -0.1711 94   TYR A CD2 
743  C CE1 . TYR A 94  ? 0.2062 0.4099 0.3646 -0.0991 0.0074  -0.1384 94   TYR A CE1 
744  C CE2 . TYR A 94  ? 0.2412 0.4755 0.3898 -0.1197 0.0053  -0.1813 94   TYR A CE2 
745  C CZ  . TYR A 94  ? 0.2244 0.4483 0.3918 -0.1130 0.0048  -0.1632 94   TYR A CZ  
746  O OH  . TYR A 94  ? 0.2183 0.4559 0.4154 -0.1222 0.0032  -0.1735 94   TYR A OH  
747  N N   . THR A 95  ? 0.2418 0.4284 0.2870 -0.0793 0.0010  -0.0773 95   THR A N   
748  C CA  . THR A 95  ? 0.2415 0.4086 0.2782 -0.0744 0.0058  -0.0621 95   THR A CA  
749  C C   . THR A 95  ? 0.2212 0.3587 0.2795 -0.0633 0.0122  -0.0611 95   THR A C   
750  O O   . THR A 95  ? 0.2179 0.3516 0.2923 -0.0565 0.0079  -0.0574 95   THR A O   
751  C CB  . THR A 95  ? 0.2614 0.4332 0.2862 -0.0723 -0.0082 -0.0339 95   THR A CB  
752  O OG1 . THR A 95  ? 0.2915 0.4961 0.2885 -0.0858 -0.0162 -0.0302 95   THR A OG1 
753  C CG2 . THR A 95  ? 0.2646 0.4135 0.2863 -0.0695 -0.0022 -0.0200 95   THR A CG2 
754  N N   . CYS A 96  ? 0.2198 0.3420 0.2792 -0.0630 0.0225  -0.0661 96   CYS A N   
755  C CA  . CYS A 96  ? 0.2029 0.3015 0.2758 -0.0548 0.0264  -0.0626 96   CYS A CA  
756  C C   . CYS A 96  ? 0.2022 0.2910 0.2686 -0.0515 0.0253  -0.0491 96   CYS A C   
757  O O   . CYS A 96  ? 0.2039 0.2972 0.2613 -0.0571 0.0293  -0.0487 96   CYS A O   
758  C CB  . CYS A 96  ? 0.2047 0.2942 0.2901 -0.0563 0.0345  -0.0755 96   CYS A CB  
759  S SG  . CYS A 96  ? 0.2157 0.2821 0.3120 -0.0490 0.0353  -0.0669 96   CYS A SG  
760  N N   . GLU A 97  ? 0.2018 0.2796 0.2762 -0.0440 0.0213  -0.0411 97   GLU A N   
761  C CA  . GLU A 97  ? 0.2063 0.2712 0.2825 -0.0411 0.0197  -0.0315 97   GLU A CA  
762  C C   . GLU A 97  ? 0.1921 0.2452 0.2763 -0.0368 0.0237  -0.0386 97   GLU A C   
763  O O   . GLU A 97  ? 0.1829 0.2382 0.2726 -0.0337 0.0248  -0.0440 97   GLU A O   
764  C CB  . GLU A 97  ? 0.2203 0.2847 0.3052 -0.0360 0.0097  -0.0192 97   GLU A CB  
765  C CG  . GLU A 97  ? 0.2410 0.2873 0.3360 -0.0339 0.0069  -0.0088 97   GLU A CG  
766  C CD  . GLU A 97  ? 0.2736 0.3129 0.3945 -0.0239 -0.0033 -0.0017 97   GLU A CD  
767  O OE1 . GLU A 97  ? 0.3350 0.3730 0.4589 -0.0248 -0.0146 0.0192  97   GLU A OE1 
768  O OE2 . GLU A 97  ? 0.3105 0.3474 0.4510 -0.0156 0.0001  -0.0170 97   GLU A OE2 
769  N N   . VAL A 98  ? 0.1953 0.2411 0.2790 -0.0391 0.0262  -0.0389 98   VAL A N   
770  C CA  . VAL A 98  ? 0.1920 0.2315 0.2797 -0.0372 0.0269  -0.0447 98   VAL A CA  
771  C C   . VAL A 98  ? 0.1876 0.2178 0.2830 -0.0376 0.0253  -0.0442 98   VAL A C   
772  O O   . VAL A 98  ? 0.1908 0.2181 0.2880 -0.0421 0.0255  -0.0369 98   VAL A O   
773  C CB  . VAL A 98  ? 0.1877 0.2298 0.2762 -0.0393 0.0282  -0.0475 98   VAL A CB  
774  C CG1 . VAL A 98  ? 0.1964 0.2373 0.2845 -0.0388 0.0246  -0.0493 98   VAL A CG1 
775  C CG2 . VAL A 98  ? 0.1886 0.2345 0.2779 -0.0398 0.0298  -0.0490 98   VAL A CG2 
776  N N   . THR A 99  ? 0.1919 0.2193 0.2928 -0.0350 0.0247  -0.0533 99   THR A N   
777  C CA  . THR A 99  ? 0.2069 0.2240 0.3215 -0.0363 0.0232  -0.0589 99   THR A CA  
778  C C   . THR A 99  ? 0.2080 0.2327 0.3180 -0.0393 0.0229  -0.0731 99   THR A C   
779  O O   . THR A 99  ? 0.2090 0.2454 0.3073 -0.0387 0.0245  -0.0797 99   THR A O   
780  C CB  . THR A 99  ? 0.2185 0.2261 0.3533 -0.0299 0.0218  -0.0626 99   THR A CB  
781  O OG1 . THR A 99  ? 0.2391 0.2441 0.3765 -0.0271 0.0177  -0.0454 99   THR A OG1 
782  C CG2 . THR A 99  ? 0.2351 0.2264 0.3932 -0.0321 0.0201  -0.0699 99   THR A CG2 
783  N N   . GLU A 100 ? 0.2055 0.2271 0.3240 -0.0447 0.0205  -0.0770 100  GLU A N   
784  C CA  . GLU A 100 ? 0.2180 0.2497 0.3343 -0.0492 0.0173  -0.0925 100  GLU A CA  
785  C C   . GLU A 100 ? 0.2317 0.2515 0.3707 -0.0509 0.0185  -0.1089 100  GLU A C   
786  O O   . GLU A 100 ? 0.2264 0.2304 0.3856 -0.0543 0.0180  -0.1036 100  GLU A O   
787  C CB  . GLU A 100 ? 0.2149 0.2553 0.3332 -0.0545 0.0117  -0.0882 100  GLU A CB  
788  C CG  . GLU A 100 ? 0.2085 0.2598 0.3151 -0.0517 0.0082  -0.0763 100  GLU A CG  
789  C CD  . GLU A 100 ? 0.2057 0.2683 0.3262 -0.0544 0.0011  -0.0747 100  GLU A CD  
790  O OE1 . GLU A 100 ? 0.2178 0.2905 0.3359 -0.0516 -0.0067 -0.0670 100  GLU A OE1 
791  O OE2 . GLU A 100 ? 0.2111 0.2731 0.3498 -0.0597 0.0025  -0.0802 100  GLU A OE2 
792  N N   . LEU A 101 ? 0.2128 0.3281 0.3235 -0.1594 0.1333  -0.0804 101  LEU A N   
793  C CA  . LEU A 101 ? 0.2479 0.3343 0.3818 -0.1496 0.0932  -0.0740 101  LEU A CA  
794  C C   . LEU A 101 ? 0.2582 0.3211 0.3371 -0.1562 0.0872  -0.0494 101  LEU A C   
795  O O   . LEU A 101 ? 0.2314 0.2978 0.2814 -0.1556 0.1194  -0.0505 101  LEU A O   
796  C CB  . LEU A 101 ? 0.2402 0.3360 0.4586 -0.1311 0.1184  -0.1246 101  LEU A CB  
797  C CG  . LEU A 101 ? 0.2413 0.3753 0.5322 -0.1324 0.1466  -0.1750 101  LEU A CG  
798  C CD1 . LEU A 101 ? 0.2681 0.4325 0.6455 -0.1444 0.1950  -0.2587 101  LEU A CD1 
799  C CD2 . LEU A 101 ? 0.2431 0.3812 0.6020 -0.1203 0.0779  -0.1739 101  LEU A CD2 
800  N N   . THR A 102 ? 0.3077 0.3329 0.3811 -0.1642 0.0278  -0.0285 102  THR A N   
801  C CA  . THR A 102 ? 0.3337 0.3318 0.3672 -0.1686 0.0181  -0.0094 102  THR A CA  
802  C C   . THR A 102 ? 0.2960 0.3020 0.3648 -0.1378 0.0645  -0.0354 102  THR A C   
803  O O   . THR A 102 ? 0.2760 0.2985 0.4056 -0.1265 0.0930  -0.0763 102  THR A O   
804  C CB  . THR A 102 ? 0.4116 0.3409 0.4518 -0.1792 -0.0765 0.0157  102  THR A CB  
805  O OG1 . THR A 102 ? 0.5464 0.4300 0.4843 -0.2458 -0.1341 0.0557  102  THR A OG1 
806  C CG2 . THR A 102 ? 0.4203 0.3215 0.4252 -0.1819 -0.0833 0.0324  102  THR A CG2 
807  N N   . ARG A 103 ? 0.2969 0.2897 0.3148 -0.1425 0.0746  -0.0192 103  ARG A N   
808  C CA  . ARG A 103 ? 0.3064 0.2811 0.3143 -0.1343 0.1035  -0.0309 103  ARG A CA  
809  C C   . ARG A 103 ? 0.3145 0.2679 0.3067 -0.1323 0.0783  -0.0136 103  ARG A C   
810  O O   . ARG A 103 ? 0.3225 0.2768 0.2754 -0.1484 0.0599  0.0085  103  ARG A O   
811  C CB  . ARG A 103 ? 0.3126 0.2710 0.2747 -0.1413 0.1182  -0.0246 103  ARG A CB  
812  C CG  . ARG A 103 ? 0.3442 0.3097 0.3146 -0.1471 0.1310  -0.0358 103  ARG A CG  
813  C CD  . ARG A 103 ? 0.3423 0.2768 0.3077 -0.1463 0.1055  -0.0340 103  ARG A CD  
814  N NE  . ARG A 103 ? 0.4379 0.2751 0.3252 -0.1707 0.0835  -0.0161 103  ARG A NE  
815  C CZ  . ARG A 103 ? 0.4751 0.2423 0.3524 -0.1691 0.0230  -0.0045 103  ARG A CZ  
816  N NH1 . ARG A 103 ? 0.6008 0.2444 0.3602 -0.2168 -0.0139 0.0250  103  ARG A NH1 
817  N NH2 . ARG A 103 ? 0.4062 0.2217 0.3893 -0.1346 -0.0050 -0.0323 103  ARG A NH2 
818  N N   . GLU A 104 ? 0.3253 0.2674 0.3504 -0.1256 0.0851  -0.0372 104  GLU A N   
819  C CA  . GLU A 104 ? 0.3417 0.2601 0.3567 -0.1217 0.0614  -0.0232 104  GLU A CA  
820  C C   . GLU A 104 ? 0.3539 0.2618 0.3472 -0.1340 0.1032  -0.0500 104  GLU A C   
821  O O   . GLU A 104 ? 0.3828 0.2952 0.3612 -0.1629 0.1489  -0.0862 104  GLU A O   
822  C CB  . GLU A 104 ? 0.3704 0.2698 0.4681 -0.1092 -0.0065 -0.0292 104  GLU A CB  
823  C CG  . GLU A 104 ? 0.3870 0.3156 0.6438 -0.0892 -0.0064 -0.1110 104  GLU A CG  
824  C CD  . GLU A 104 ? 0.4401 0.3300 0.8275 -0.0651 -0.1060 -0.1312 104  GLU A CD  
825  O OE1 . GLU A 104 ? 0.5190 0.3544 0.8473 -0.0705 -0.1514 -0.0836 104  GLU A OE1 
826  O OE2 . GLU A 104 ? 0.4967 0.4072 1.0692 -0.0411 -0.1491 -0.2066 104  GLU A OE2 
827  N N   . GLY A 105 ? 0.3652 0.2518 0.3344 -0.1308 0.0884  -0.0336 105  GLY A N   
828  C CA  . GLY A 105 ? 0.3957 0.2666 0.3350 -0.1548 0.1215  -0.0606 105  GLY A CA  
829  C C   . GLY A 105 ? 0.3874 0.2416 0.3253 -0.1397 0.0928  -0.0402 105  GLY A C   
830  O O   . GLY A 105 ? 0.3708 0.2174 0.2947 -0.1250 0.0550  0.0006  105  GLY A O   
831  N N   . GLU A 106 ? 0.4168 0.2697 0.3620 -0.1595 0.1192  -0.0789 106  GLU A N   
832  C CA  . GLU A 106 ? 0.4217 0.2569 0.3656 -0.1467 0.0946  -0.0629 106  GLU A CA  
833  C C   . GLU A 106 ? 0.4798 0.2888 0.3383 -0.1917 0.1328  -0.0798 106  GLU A C   
834  O O   . GLU A 106 ? 0.5424 0.3485 0.3498 -0.2506 0.1826  -0.1213 106  GLU A O   
835  C CB  . GLU A 106 ? 0.4093 0.2624 0.4957 -0.1188 0.0548  -0.1003 106  GLU A CB  
836  C CG  . GLU A 106 ? 0.4414 0.3494 0.6651 -0.1336 0.0960  -0.2116 106  GLU A CG  
837  C CD  . GLU A 106 ? 0.4517 0.3643 0.8592 -0.0965 0.0294  -0.2623 106  GLU A CD  
838  O OE1 . GLU A 106 ? 0.4918 0.3799 1.0095 -0.0606 -0.0595 -0.2569 106  GLU A OE1 
839  O OE2 . GLU A 106 ? 0.5093 0.4375 0.9555 -0.1079 0.0517  -0.3099 106  GLU A OE2 
840  N N   . THR A 107 ? 0.4844 0.2664 0.3085 -0.1809 0.1083  -0.0492 107  THR A N   
841  C CA  . THR A 107 ? 0.5607 0.3026 0.2914 -0.2290 0.1289  -0.0582 107  THR A CA  
842  C C   . THR A 107 ? 0.5360 0.2838 0.3081 -0.2030 0.1101  -0.0559 107  THR A C   
843  O O   . THR A 107 ? 0.4693 0.2259 0.2923 -0.1573 0.0690  -0.0235 107  THR A O   
844  C CB  . THR A 107 ? 0.6377 0.2924 0.2275 -0.2583 0.0923  -0.0038 107  THR A CB  
845  O OG1 . THR A 107 ? 0.7713 0.3553 0.2299 -0.3348 0.0997  -0.0090 107  THR A OG1 
846  C CG2 . THR A 107 ? 0.5686 0.2186 0.1957 -0.2022 0.0346  0.0373  107  THR A CG2 
847  N N   . ILE A 108 ? 0.5990 0.3377 0.3316 -0.2511 0.1444  -0.0953 108  ILE A N   
848  C CA  . ILE A 108 ? 0.5790 0.3267 0.3600 -0.2313 0.1329  -0.1053 108  ILE A CA  
849  C C   . ILE A 108 ? 0.6478 0.3275 0.2900 -0.2625 0.1158  -0.0632 108  ILE A C   
850  O O   . ILE A 108 ? 0.7576 0.3777 0.2613 -0.3371 0.1286  -0.0622 108  ILE A O   
851  C CB  . ILE A 108 ? 0.5945 0.4063 0.4983 -0.2576 0.1836  -0.2137 108  ILE A CB  
852  C CG1 . ILE A 108 ? 0.5319 0.4025 0.6246 -0.2158 0.1697  -0.2695 108  ILE A CG1 
853  C CG2 . ILE A 108 ? 0.5762 0.3888 0.5380 -0.2338 0.1612  -0.2228 108  ILE A CG2 
854  C CD1 . ILE A 108 ? 0.5620 0.5195 0.8452 -0.2425 0.2192  -0.4203 108  ILE A CD1 
855  N N   . ILE A 109 ? 0.6026 0.2771 0.2721 -0.2169 0.0755  -0.0280 109  ILE A N   
856  C CA  . ILE A 109 ? 0.6530 0.2711 0.2348 -0.2335 0.0466  0.0000  109  ILE A CA  
857  C C   . ILE A 109 ? 0.6177 0.2659 0.2642 -0.2130 0.0528  -0.0186 109  ILE A C   
858  O O   . ILE A 109 ? 0.5534 0.2342 0.2892 -0.1698 0.0353  -0.0114 109  ILE A O   
859  C CB  . ILE A 109 ? 0.6231 0.2191 0.2102 -0.1951 -0.0140 0.0429  109  ILE A CB  
860  C CG1 . ILE A 109 ? 0.6479 0.2335 0.2314 -0.1927 -0.0297 0.0543  109  ILE A CG1 
861  C CG2 . ILE A 109 ? 0.7115 0.2333 0.2303 -0.2134 -0.0672 0.0597  109  ILE A CG2 
862  C CD1 . ILE A 109 ? 0.5476 0.2109 0.2257 -0.1558 -0.0078 0.0473  109  ILE A CD1 
863  N N   . GLU A 110 ? 0.6826 0.3044 0.2653 -0.2583 0.0700  -0.0397 110  GLU A N   
864  C CA  . GLU A 110 ? 0.6554 0.2968 0.2946 -0.2379 0.0679  -0.0537 110  GLU A CA  
865  C C   . GLU A 110 ? 0.6512 0.2526 0.2448 -0.2151 0.0154  -0.0025 110  GLU A C   
866  O O   . GLU A 110 ? 0.7231 0.2571 0.2172 -0.2448 -0.0196 0.0206  110  GLU A O   
867  C CB  . GLU A 110 ? 0.7336 0.3830 0.3428 -0.3056 0.1217  -0.1207 110  GLU A CB  
868  C CG  . GLU A 110 ? 0.6844 0.3745 0.4153 -0.2720 0.1219  -0.1573 110  GLU A CG  
869  C CD  . GLU A 110 ? 0.7631 0.4768 0.4793 -0.3455 0.1830  -0.2416 110  GLU A CD  
870  O OE1 . GLU A 110 ? 0.8552 0.5575 0.4503 -0.4452 0.2386  -0.2822 110  GLU A OE1 
871  O OE2 . GLU A 110 ? 0.7101 0.4496 0.5249 -0.3188 0.1765  -0.2724 110  GLU A OE2 
872  N N   . LEU A 111 ? 0.5901 0.2229 0.2597 -0.1733 -0.0010 0.0082  111  LEU A N   
873  C CA  . LEU A 111 ? 0.5793 0.2037 0.2427 -0.1616 -0.0305 0.0232  111  LEU A CA  
874  C C   . LEU A 111 ? 0.6093 0.2239 0.2657 -0.1737 -0.0200 0.0069  111  LEU A C   
875  O O   . LEU A 111 ? 0.5840 0.2189 0.3042 -0.1639 -0.0113 -0.0077 111  LEU A O   
876  C CB  . LEU A 111 ? 0.5322 0.1941 0.2463 -0.1483 -0.0373 0.0310  111  LEU A CB  
877  C CG  . LEU A 111 ? 0.5330 0.2126 0.2604 -0.1534 -0.0485 0.0183  111  LEU A CG  
878  C CD1 . LEU A 111 ? 0.5271 0.2109 0.2860 -0.1411 -0.0779 -0.0056 111  LEU A CD1 
879  C CD2 . LEU A 111 ? 0.5292 0.2368 0.2573 -0.1871 -0.0383 0.0177  111  LEU A CD2 
880  N N   . LYS A 112 ? 0.6759 0.2439 0.2567 -0.1991 -0.0378 0.0098  112  LYS A N   
881  C CA  . LYS A 112 ? 0.7166 0.2737 0.2734 -0.2223 -0.0239 -0.0097 112  LYS A CA  
882  C C   . LYS A 112 ? 0.7019 0.2493 0.2735 -0.1991 -0.0661 0.0045  112  LYS A C   
883  O O   . LYS A 112 ? 0.7062 0.2357 0.2887 -0.1834 -0.1157 0.0148  112  LYS A O   
884  C CB  . LYS A 112 ? 0.8476 0.3415 0.2677 -0.3008 -0.0146 -0.0204 112  LYS A CB  
885  C CG  . LYS A 112 ? 0.8914 0.4022 0.2864 -0.3480 0.0390  -0.0539 112  LYS A CG  
886  C CD  . LYS A 112 ? 1.0733 0.5112 0.2815 -0.4719 0.0603  -0.0732 112  LYS A CD  
887  C CE  . LYS A 112 ? 1.1315 0.6350 0.3681 -0.5326 0.1472  -0.1658 112  LYS A CE  
888  N NZ  . LYS A 112 ? 1.2971 0.7973 0.4091 -0.6729 0.2252  -0.2362 112  LYS A NZ  
889  N N   . TYR A 113 ? 0.6922 0.2571 0.2906 -0.1974 -0.0495 -0.0107 113  TYR A N   
890  C CA  . TYR A 113 ? 0.6896 0.2531 0.3054 -0.1841 -0.0791 -0.0099 113  TYR A CA  
891  C C   . TYR A 113 ? 0.7759 0.2865 0.3117 -0.2197 -0.0921 -0.0150 113  TYR A C   
892  O O   . TYR A 113 ? 0.8114 0.3258 0.3172 -0.2549 -0.0466 -0.0391 113  TYR A O   
893  C CB  . TYR A 113 ? 0.6358 0.2398 0.3158 -0.1713 -0.0590 -0.0155 113  TYR A CB  
894  C CG  . TYR A 113 ? 0.6386 0.2548 0.3375 -0.1708 -0.0742 -0.0274 113  TYR A CG  
895  C CD1 . TYR A 113 ? 0.6215 0.2754 0.3681 -0.1683 -0.0875 -0.0508 113  TYR A CD1 
896  C CD2 . TYR A 113 ? 0.6434 0.2476 0.3362 -0.1773 -0.0697 -0.0354 113  TYR A CD2 
897  C CE1 . TYR A 113 ? 0.6129 0.2984 0.4076 -0.1751 -0.0929 -0.0892 113  TYR A CE1 
898  C CE2 . TYR A 113 ? 0.6642 0.2847 0.3801 -0.1796 -0.0810 -0.0531 113  TYR A CE2 
899  C CZ  . TYR A 113 ? 0.6446 0.3090 0.4153 -0.1798 -0.0911 -0.0839 113  TYR A CZ  
900  O OH  . TYR A 113 ? 0.6301 0.3320 0.4554 -0.1895 -0.0933 -0.1291 113  TYR A OH  
901  N N   . ARG A 114 ? 0.8285 0.2915 0.3447 -0.2181 -0.1588 -0.0067 114  ARG A N   
902  C CA  . ARG A 114 ? 0.9401 0.3296 0.3554 -0.2645 -0.1904 -0.0026 114  ARG A CA  
903  C C   . ARG A 114 ? 0.8977 0.3147 0.3919 -0.2315 -0.2125 -0.0206 114  ARG A C   
904  O O   . ARG A 114 ? 0.8507 0.2945 0.4527 -0.1901 -0.2575 -0.0395 114  ARG A O   
905  C CB  . ARG A 114 ? 1.1049 0.3606 0.3936 -0.3133 -0.2893 0.0315  114  ARG A CB  
906  C CG  . ARG A 114 ? 1.2773 0.4245 0.4055 -0.3941 -0.3334 0.0457  114  ARG A CG  
907  C CD  . ARG A 114 ? 1.5215 0.4867 0.4534 -0.4837 -0.4467 0.0964  114  ARG A CD  
908  N NE  . ARG A 114 ? 1.5400 0.4419 0.5801 -0.4189 -0.5868 0.1151  114  ARG A NE  
909  C CZ  . ARG A 114 ? 1.5838 0.4339 0.7285 -0.3732 -0.7141 0.1064  114  ARG A CZ  
910  N NH1 . ARG A 114 ? 1.6267 0.4670 0.7474 -0.3878 -0.7209 0.0979  114  ARG A NH1 
911  N NH2 . ARG A 114 ? 1.6042 0.4167 0.9050 -0.3119 -0.8410 0.0915  114  ARG A NH2 
912  N N   . VAL A 115 ? 0.9161 0.3375 0.3730 -0.2573 -0.1750 -0.0324 115  VAL A N   
913  C CA  . VAL A 115 ? 0.8809 0.3355 0.4084 -0.2315 -0.1810 -0.0516 115  VAL A CA  
914  C C   . VAL A 115 ? 0.9546 0.3490 0.4910 -0.2252 -0.2813 -0.0540 115  VAL A C   
915  O O   . VAL A 115 ? 1.1021 0.3846 0.5049 -0.2788 -0.3447 -0.0297 115  VAL A O   
916  C CB  . VAL A 115 ? 0.8974 0.3639 0.3902 -0.2629 -0.1246 -0.0699 115  VAL A CB  
917  C CG1 . VAL A 115 ? 0.8958 0.3702 0.4253 -0.2498 -0.1438 -0.0834 115  VAL A CG1 
918  C CG2 . VAL A 115 ? 0.8220 0.3533 0.3973 -0.2436 -0.0607 -0.0871 115  VAL A CG2 
919  N N   . PCA B 1   ? 0.3820 0.4890 0.5145 -0.1802 0.1295  -0.0817 1    PCA B N   
920  C CA  . PCA B 1   ? 0.4106 0.4868 0.4948 -0.2067 0.1333  -0.0698 1    PCA B CA  
921  C CB  . PCA B 1   ? 0.4098 0.4991 0.5230 -0.2153 0.1246  -0.0686 1    PCA B CB  
922  C CG  . PCA B 1   ? 0.3824 0.5062 0.5556 -0.1910 0.1071  -0.0765 1    PCA B CG  
923  C CD  . PCA B 1   ? 0.3548 0.4884 0.5385 -0.1712 0.1120  -0.0842 1    PCA B CD  
924  O OE  . PCA B 1   ? 0.3223 0.4802 0.5514 -0.1507 0.0999  -0.0915 1    PCA B OE  
925  C C   . PCA B 1   ? 0.4138 0.4436 0.4369 -0.2054 0.1142  -0.0506 1    PCA B C   
926  O O   . PCA B 1   ? 0.4468 0.4446 0.4276 -0.2268 0.1130  -0.0391 1    PCA B O   
927  N N   . LEU B 2   ? 0.3804 0.4059 0.4019 -0.1817 0.0978  -0.0469 2    LEU B N   
928  C CA  . LEU B 2   ? 0.3879 0.3755 0.3633 -0.1794 0.0813  -0.0314 2    LEU B CA  
929  C C   . LEU B 2   ? 0.4252 0.3896 0.3550 -0.1961 0.0962  -0.0311 2    LEU B C   
930  O O   . LEU B 2   ? 0.4250 0.4058 0.3644 -0.1952 0.1168  -0.0454 2    LEU B O   
931  C CB  . LEU B 2   ? 0.3452 0.3382 0.3358 -0.1518 0.0634  -0.0295 2    LEU B CB  
932  C CG  . LEU B 2   ? 0.3123 0.3196 0.3345 -0.1358 0.0473  -0.0297 2    LEU B CG  
933  C CD1 . LEU B 2   ? 0.2755 0.2794 0.2986 -0.1146 0.0335  -0.0266 2    LEU B CD1 
934  C CD2 . LEU B 2   ? 0.2982 0.2865 0.3093 -0.1453 0.0366  -0.0212 2    LEU B CD2 
935  N N   . LEU B 3   ? 0.4577 0.3804 0.3375 -0.2113 0.0837  -0.0151 3    LEU B N   
936  C CA  . LEU B 3   ? 0.5188 0.4079 0.3404 -0.2333 0.0930  -0.0116 3    LEU B CA  
937  C C   . LEU B 3   ? 0.5242 0.3847 0.3190 -0.2229 0.0673  0.0014  3    LEU B C   
938  O O   . LEU B 3   ? 0.5020 0.3565 0.3125 -0.2077 0.0410  0.0127  3    LEU B O   
939  C CB  . LEU B 3   ? 0.5740 0.4297 0.3516 -0.2656 0.0954  -0.0011 3    LEU B CB  
940  C CG  . LEU B 3   ? 0.5768 0.4585 0.3761 -0.2836 0.1255  -0.0146 3    LEU B CG  
941  C CD1 . LEU B 3   ? 0.6367 0.4782 0.3886 -0.3155 0.1217  -0.0001 3    LEU B CD1 
942  C CD2 . LEU B 3   ? 0.5859 0.4877 0.3861 -0.2938 0.1639  -0.0359 3    LEU B CD2 
943  N N   . PHE B 4   ? 0.5615 0.4046 0.3184 -0.2320 0.0762  -0.0021 4    PHE B N   
944  C CA  . PHE B 4   ? 0.5708 0.3903 0.3074 -0.2229 0.0517  0.0084  4    PHE B CA  
945  C C   . PHE B 4   ? 0.6550 0.4195 0.3163 -0.2515 0.0408  0.0216  4    PHE B C   
946  O O   . PHE B 4   ? 0.7077 0.4533 0.3211 -0.2792 0.0641  0.0156  4    PHE B O   
947  C CB  . PHE B 4   ? 0.5443 0.3869 0.3018 -0.2054 0.0637  -0.0064 4    PHE B CB  
948  C CG  . PHE B 4   ? 0.4807 0.3675 0.3042 -0.1772 0.0653  -0.0154 4    PHE B CG  
949  C CD1 . PHE B 4   ? 0.4585 0.3517 0.3062 -0.1549 0.0446  -0.0093 4    PHE B CD1 
950  C CD2 . PHE B 4   ? 0.4723 0.3927 0.3330 -0.1752 0.0867  -0.0297 4    PHE B CD2 
951  C CE1 . PHE B 4   ? 0.4002 0.3267 0.2974 -0.1329 0.0452  -0.0164 4    PHE B CE1 
952  C CE2 . PHE B 4   ? 0.4077 0.3625 0.3230 -0.1513 0.0826  -0.0361 4    PHE B CE2 
953  C CZ  . PHE B 4   ? 0.3889 0.3434 0.3165 -0.1311 0.0616  -0.0287 4    PHE B CZ  
954  N N   . ASN B 5   ? 0.6708 0.4090 0.3237 -0.2456 0.0044  0.0396  5    ASN B N   
955  C CA  . ASN B 5   ? 0.7361 0.4235 0.3255 -0.2653 -0.0165 0.0527  5    ASN B CA  
956  C C   . ASN B 5   ? 0.7305 0.4260 0.3140 -0.2580 -0.0060 0.0402  5    ASN B C   
957  O O   . ASN B 5   ? 0.6867 0.3979 0.3083 -0.2349 -0.0236 0.0420  5    ASN B O   
958  C CB  . ASN B 5   ? 0.7372 0.4040 0.3436 -0.2550 -0.0617 0.0738  5    ASN B CB  
959  C CG  . ASN B 5   ? 0.8197 0.4313 0.3657 -0.2749 -0.0932 0.0905  5    ASN B CG  
960  O OD1 . ASN B 5   ? 0.9494 0.5170 0.4190 -0.3078 -0.0888 0.0954  5    ASN B OD1 
961  N ND2 . ASN B 5   ? 0.8426 0.4542 0.4212 -0.2575 -0.1259 0.0994  5    ASN B ND2 
962  N N   . LYS B 6   ? 0.7740 0.4589 0.3122 -0.2784 0.0252  0.0257  6    LYS B N   
963  C CA  . LYS B 6   ? 0.7722 0.4669 0.3096 -0.2706 0.0420  0.0085  6    LYS B CA  
964  C C   . LYS B 6   ? 0.8199 0.4677 0.3007 -0.2829 0.0155  0.0189  6    LYS B C   
965  O O   . LYS B 6   ? 0.8852 0.4820 0.3026 -0.3089 -0.0075 0.0361  6    LYS B O   
966  C CB  . LYS B 6   ? 0.8049 0.5084 0.3235 -0.2866 0.0902  -0.0161 6    LYS B CB  
967  C CG  . LYS B 6   ? 0.7722 0.5098 0.3337 -0.2639 0.1125  -0.0396 6    LYS B CG  
968  C CD  . LYS B 6   ? 0.8394 0.5512 0.3470 -0.2839 0.1427  -0.0598 6    LYS B CD  
969  C CE  . LYS B 6   ? 0.8068 0.5399 0.3550 -0.2571 0.1472  -0.0758 6    LYS B CE  
970  N NZ  . LYS B 6   ? 0.8709 0.5925 0.3915 -0.2693 0.1865  -0.1044 6    LYS B NZ  
971  N N   . THR B 7   ? 0.7874 0.4497 0.2902 -0.2653 0.0162  0.0090  7    THR B N   
972  C CA  . THR B 7   ? 0.8373 0.4579 0.2869 -0.2784 -0.0027 0.0132  7    THR B CA  
973  C C   . THR B 7   ? 0.8310 0.4623 0.2787 -0.2735 0.0301  -0.0125 7    THR B C   
974  O O   . THR B 7   ? 0.7606 0.4366 0.2740 -0.2459 0.0441  -0.0248 7    THR B O   
975  C CB  . THR B 7   ? 0.8090 0.4324 0.2962 -0.2605 -0.0464 0.0313  7    THR B CB  
976  O OG1 . THR B 7   ? 0.8213 0.4328 0.3156 -0.2640 -0.0766 0.0528  7    THR B OG1 
977  C CG2 . THR B 7   ? 0.8629 0.4437 0.2979 -0.2755 -0.0685 0.0354  7    THR B CG2 
978  N N   . LYS B 8   ? 0.9062 0.4919 0.2752 -0.3017 0.0417  -0.0209 8    LYS B N   
979  C CA  . LYS B 8   ? 0.9165 0.5067 0.2802 -0.2991 0.0769  -0.0491 8    LYS B CA  
980  C C   . LYS B 8   ? 0.8637 0.4687 0.2708 -0.2727 0.0564  -0.0488 8    LYS B C   
981  O O   . LYS B 8   ? 0.8200 0.4595 0.2800 -0.2493 0.0777  -0.0670 8    LYS B O   
982  C CB  . LYS B 8   ? 1.0245 0.5536 0.2840 -0.3381 0.0914  -0.0581 8    LYS B CB  
983  C CG  . LYS B 8   ? 1.0513 0.5775 0.3008 -0.3367 0.1279  -0.0900 8    LYS B CG  
984  C CD  . LYS B 8   ? 1.1686 0.6281 0.3049 -0.3790 0.1436  -0.1000 8    LYS B CD  
985  C CE  . LYS B 8   ? 1.1999 0.6457 0.3229 -0.3751 0.1655  -0.1280 8    LYS B CE  
986  N NZ  . LYS B 8   ? 1.3264 0.7072 0.3359 -0.4182 0.1925  -0.1455 8    LYS B NZ  
987  N N   . SER B 9   ? 0.8683 0.4461 0.2554 -0.2776 0.0129  -0.0270 9    SER B N   
988  C CA  . SER B 9   ? 0.8316 0.4163 0.2505 -0.2597 -0.0085 -0.0249 9    SER B CA  
989  C C   . SER B 9   ? 0.8310 0.3967 0.2481 -0.2643 -0.0596 0.0024  9    SER B C   
990  O O   . SER B 9   ? 0.8768 0.4087 0.2491 -0.2860 -0.0822 0.0191  9    SER B O   
991  C CB  . SER B 9   ? 0.8878 0.4371 0.2521 -0.2734 0.0071  -0.0444 9    SER B CB  
992  O OG  . SER B 9   ? 0.9605 0.4491 0.2313 -0.3095 -0.0069 -0.0371 9    SER B OG  
993  N N   . VAL B 10  ? 0.7790 0.3658 0.2479 -0.2445 -0.0777 0.0063  10   VAL B N   
994  C CA  . VAL B 10  ? 0.7783 0.3534 0.2610 -0.2466 -0.1238 0.0275  10   VAL B CA  
995  C C   . VAL B 10  ? 0.7874 0.3532 0.2696 -0.2448 -0.1316 0.0208  10   VAL B C   
996  O O   . VAL B 10  ? 0.7673 0.3456 0.2581 -0.2337 -0.1023 0.0017  10   VAL B O   
997  C CB  . VAL B 10  ? 0.7006 0.3222 0.2686 -0.2222 -0.1369 0.0400  10   VAL B CB  
998  C CG1 . VAL B 10  ? 0.6881 0.3145 0.2561 -0.2247 -0.1326 0.0471  10   VAL B CG1 
999  C CG2 . VAL B 10  ? 0.6271 0.2948 0.2561 -0.1954 -0.1120 0.0271  10   VAL B CG2 
1000 N N   . GLU B 11  ? 0.8113 0.3547 0.2889 -0.2554 -0.1738 0.0371  11   GLU B N   
1001 C CA  . GLU B 11  ? 0.8349 0.3559 0.2943 -0.2628 -0.1871 0.0327  11   GLU B CA  
1002 C C   . GLU B 11  ? 0.7873 0.3326 0.3169 -0.2520 -0.2217 0.0482  11   GLU B C   
1003 O O   . GLU B 11  ? 0.7744 0.3292 0.3381 -0.2508 -0.2499 0.0657  11   GLU B O   
1004 C CB  . GLU B 11  ? 0.9375 0.3914 0.2995 -0.2978 -0.2080 0.0363  11   GLU B CB  
1005 C CG  . GLU B 11  ? 0.9926 0.4118 0.3162 -0.3110 -0.2194 0.0286  11   GLU B CG  
1006 C CD  . GLU B 11  ? 1.1023 0.4495 0.3206 -0.3490 -0.2430 0.0335  11   GLU B CD  
1007 O OE1 . GLU B 11  ? 1.1507 0.4765 0.3636 -0.3626 -0.2927 0.0573  11   GLU B OE1 
1008 O OE2 . GLU B 11  ? 1.1917 0.5021 0.3332 -0.3658 -0.2121 0.0130  11   GLU B OE2 
1009 N N   . PHE B 12  ? 0.7630 0.3176 0.3165 -0.2449 -0.2187 0.0406  12   PHE B N   
1010 C CA  . PHE B 12  ? 0.7385 0.3128 0.3548 -0.2403 -0.2493 0.0529  12   PHE B CA  
1011 C C   . PHE B 12  ? 0.7820 0.3227 0.3655 -0.2559 -0.2649 0.0484  12   PHE B C   
1012 O O   . PHE B 12  ? 0.8288 0.3380 0.3510 -0.2638 -0.2443 0.0323  12   PHE B O   
1013 C CB  . PHE B 12  ? 0.6569 0.2890 0.3578 -0.2134 -0.2279 0.0506  12   PHE B CB  
1014 C CG  . PHE B 12  ? 0.6420 0.2826 0.3437 -0.2023 -0.1964 0.0345  12   PHE B CG  
1015 C CD1 . PHE B 12  ? 0.6391 0.2918 0.3795 -0.1993 -0.2024 0.0355  12   PHE B CD1 
1016 C CD2 . PHE B 12  ? 0.6503 0.2877 0.3203 -0.1947 -0.1617 0.0189  12   PHE B CD2 
1017 C CE1 . PHE B 12  ? 0.6183 0.2727 0.3575 -0.1896 -0.1777 0.0230  12   PHE B CE1 
1018 C CE2 . PHE B 12  ? 0.6139 0.2570 0.2915 -0.1825 -0.1381 0.0051  12   PHE B CE2 
1019 C CZ  . PHE B 12  ? 0.6332 0.2817 0.3417 -0.1800 -0.1474 0.0081  12   PHE B CZ  
1020 N N   . THR B 13  ? 0.7806 0.3278 0.4084 -0.2610 -0.3016 0.0616  13   THR B N   
1021 C CA  . THR B 13  ? 0.8191 0.3369 0.4253 -0.2772 -0.3221 0.0595  13   THR B CA  
1022 C C   . THR B 13  ? 0.7654 0.3278 0.4604 -0.2644 -0.3236 0.0626  13   THR B C   
1023 O O   . THR B 13  ? 0.6994 0.3106 0.4632 -0.2448 -0.3080 0.0653  13   THR B O   
1024 C CB  . THR B 13  ? 0.8977 0.3692 0.4628 -0.3050 -0.3753 0.0744  13   THR B CB  
1025 O OG1 . THR B 13  ? 0.8534 0.3577 0.5028 -0.2998 -0.4114 0.0929  13   THR B OG1 
1026 C CG2 . THR B 13  ? 0.9482 0.3707 0.4184 -0.3226 -0.3753 0.0745  13   THR B CG2 
1027 N N   . PHE B 14  ? 0.8003 0.3433 0.4904 -0.2782 -0.3420 0.0617  14   PHE B N   
1028 C CA  . PHE B 14  ? 0.7585 0.3402 0.5294 -0.2718 -0.3432 0.0647  14   PHE B CA  
1029 C C   . PHE B 14  ? 0.7185 0.3450 0.5809 -0.2664 -0.3659 0.0793  14   PHE B C   
1030 O O   . PHE B 14  ? 0.6679 0.3389 0.6060 -0.2563 -0.3521 0.0791  14   PHE B O   
1031 C CB  . PHE B 14  ? 0.8153 0.3622 0.5615 -0.2926 -0.3657 0.0627  14   PHE B CB  
1032 C CG  . PHE B 14  ? 0.8615 0.3903 0.6161 -0.3142 -0.4199 0.0770  14   PHE B CG  
1033 C CD1 . PHE B 14  ? 0.8536 0.4118 0.6898 -0.3199 -0.4442 0.0855  14   PHE B CD1 
1034 C CD2 . PHE B 14  ? 0.9318 0.4126 0.6136 -0.3310 -0.4483 0.0825  14   PHE B CD2 
1035 C CE1 . PHE B 14  ? 0.9052 0.4482 0.7583 -0.3396 -0.4995 0.0990  14   PHE B CE1 
1036 C CE2 . PHE B 14  ? 0.9936 0.4523 0.6809 -0.3521 -0.5054 0.0979  14   PHE B CE2 
1037 C CZ  . PHE B 14  ? 0.9687 0.4599 0.7461 -0.3552 -0.5332 0.1062  14   PHE B CZ  
1038 N N   . GLY B 15  ? 0.7492 0.3614 0.6042 -0.2738 -0.3999 0.0910  15   GLY B N   
1039 C CA  . GLY B 15  ? 0.7174 0.3702 0.6643 -0.2655 -0.4220 0.1030  15   GLY B CA  
1040 C C   . GLY B 15  ? 0.6559 0.3554 0.6535 -0.2404 -0.3867 0.0992  15   GLY B C   
1041 O O   . GLY B 15  ? 0.6286 0.3704 0.7173 -0.2306 -0.3938 0.1035  15   GLY B O   
1042 N N   . ASN B 16  ? 0.6419 0.3342 0.5847 -0.2303 -0.3494 0.0901  16   ASN B N   
1043 C CA  . ASN B 16  ? 0.5843 0.3174 0.5684 -0.2080 -0.3163 0.0858  16   ASN B CA  
1044 C C   . ASN B 16  ? 0.5399 0.3154 0.5833 -0.1966 -0.2849 0.0778  16   ASN B C   
1045 O O   . ASN B 16  ? 0.5467 0.3131 0.5569 -0.1970 -0.2619 0.0694  16   ASN B O   
1046 C CB  . ASN B 16  ? 0.5876 0.3014 0.4996 -0.2025 -0.2874 0.0780  16   ASN B CB  
1047 C CG  . ASN B 16  ? 0.6281 0.3008 0.4792 -0.2158 -0.3117 0.0860  16   ASN B CG  
1048 O OD1 . ASN B 16  ? 0.6686 0.2947 0.4547 -0.2365 -0.3332 0.0880  16   ASN B OD1 
1049 N ND2 . ASN B 16  ? 0.6060 0.2919 0.4737 -0.2061 -0.3085 0.0907  16   ASN B ND2 
1050 N N   . ASP B 17  ? 0.5018 0.3202 0.6320 -0.1880 -0.2845 0.0799  17   ASP B N   
1051 C CA  . ASP B 17  ? 0.4537 0.3103 0.6339 -0.1802 -0.2501 0.0718  17   ASP B CA  
1052 C C   . ASP B 17  ? 0.4166 0.2824 0.5707 -0.1638 -0.2117 0.0641  17   ASP B C   
1053 O O   . ASP B 17  ? 0.3863 0.2637 0.5388 -0.1598 -0.1809 0.0574  17   ASP B O   
1054 C CB  . ASP B 17  ? 0.4359 0.3357 0.7196 -0.1777 -0.2575 0.0729  17   ASP B CB  
1055 C CG  . ASP B 17  ? 0.4852 0.3842 0.8117 -0.1946 -0.2937 0.0792  17   ASP B CG  
1056 O OD1 . ASP B 17  ? 0.5330 0.3957 0.8033 -0.2095 -0.3121 0.0828  17   ASP B OD1 
1057 O OD2 . ASP B 17  ? 0.5072 0.4426 0.9283 -0.1930 -0.3043 0.0793  17   ASP B OD2 
1058 N N   . THR B 18  ? 0.4104 0.2676 0.5417 -0.1564 -0.2166 0.0664  18   THR B N   
1059 C CA  . THR B 18  ? 0.3854 0.2497 0.4928 -0.1425 -0.1862 0.0599  18   THR B CA  
1060 C C   . THR B 18  ? 0.4096 0.2428 0.4549 -0.1444 -0.1960 0.0626  18   THR B C   
1061 O O   . THR B 18  ? 0.4449 0.2536 0.4736 -0.1558 -0.2281 0.0712  18   THR B O   
1062 C CB  . THR B 18  ? 0.3562 0.2579 0.5297 -0.1301 -0.1730 0.0573  18   THR B CB  
1063 O OG1 . THR B 18  ? 0.3580 0.2570 0.5564 -0.1289 -0.2008 0.0647  18   THR B OG1 
1064 C CG2 . THR B 18  ? 0.3186 0.2513 0.5594 -0.1329 -0.1627 0.0535  18   THR B CG2 
1065 N N   . VAL B 19  ? 0.3920 0.2245 0.4018 -0.1355 -0.1692 0.0553  19   VAL B N   
1066 C CA  . VAL B 19  ? 0.4200 0.2269 0.3747 -0.1392 -0.1718 0.0558  19   VAL B CA  
1067 C C   . VAL B 19  ? 0.3847 0.2115 0.3518 -0.1261 -0.1523 0.0528  19   VAL B C   
1068 O O   . VAL B 19  ? 0.3279 0.1833 0.3302 -0.1137 -0.1314 0.0475  19   VAL B O   
1069 C CB  . VAL B 19  ? 0.4535 0.2309 0.3415 -0.1460 -0.1598 0.0471  19   VAL B CB  
1070 C CG1 . VAL B 19  ? 0.4887 0.2418 0.3605 -0.1603 -0.1796 0.0488  19   VAL B CG1 
1071 C CG2 . VAL B 19  ? 0.4383 0.2323 0.3276 -0.1320 -0.1274 0.0358  19   VAL B CG2 
1072 N N   . VAL B 20  ? 0.4110 0.2182 0.3444 -0.1320 -0.1607 0.0569  20   VAL B N   
1073 C CA  . VAL B 20  ? 0.4026 0.2217 0.3368 -0.1234 -0.1438 0.0541  20   VAL B CA  
1074 C C   . VAL B 20  ? 0.4286 0.2244 0.2984 -0.1321 -0.1299 0.0482  20   VAL B C   
1075 O O   . VAL B 20  ? 0.4781 0.2389 0.2981 -0.1493 -0.1444 0.0520  20   VAL B O   
1076 C CB  . VAL B 20  ? 0.4184 0.2347 0.3784 -0.1242 -0.1668 0.0649  20   VAL B CB  
1077 C CG1 . VAL B 20  ? 0.4140 0.2380 0.3690 -0.1177 -0.1494 0.0618  20   VAL B CG1 
1078 C CG2 . VAL B 20  ? 0.4134 0.2556 0.4481 -0.1152 -0.1781 0.0673  20   VAL B CG2 
1079 N N   . ILE B 21  ? 0.4005 0.2151 0.2722 -0.1215 -0.1018 0.0381  21   ILE B N   
1080 C CA  . ILE B 21  ? 0.4251 0.2275 0.2525 -0.1278 -0.0832 0.0295  21   ILE B CA  
1081 C C   . ILE B 21  ? 0.4039 0.2157 0.2400 -0.1265 -0.0789 0.0327  21   ILE B C   
1082 O O   . ILE B 21  ? 0.3534 0.1934 0.2279 -0.1120 -0.0682 0.0297  21   ILE B O   
1083 C CB  . ILE B 21  ? 0.4051 0.2221 0.2362 -0.1166 -0.0575 0.0146  21   ILE B CB  
1084 C CG1 . ILE B 21  ? 0.4361 0.2446 0.2677 -0.1158 -0.0641 0.0130  21   ILE B CG1 
1085 C CG2 . ILE B 21  ? 0.4311 0.2359 0.2232 -0.1247 -0.0370 0.0024  21   ILE B CG2 
1086 C CD1 . ILE B 21  ? 0.4419 0.2460 0.2594 -0.1102 -0.0445 -0.0021 21   ILE B CD1 
1087 N N   . PRO B 22  ? 0.4511 0.2343 0.2462 -0.1440 -0.0886 0.0394  22   PRO B N   
1088 C CA  . PRO B 22  ? 0.4434 0.2299 0.2470 -0.1447 -0.0897 0.0450  22   PRO B CA  
1089 C C   . PRO B 22  ? 0.4205 0.2282 0.2264 -0.1399 -0.0588 0.0323  22   PRO B C   
1090 O O   . PRO B 22  ? 0.4215 0.2288 0.2041 -0.1440 -0.0375 0.0200  22   PRO B O   
1091 C CB  . PRO B 22  ? 0.5105 0.2516 0.2563 -0.1695 -0.1090 0.0564  22   PRO B CB  
1092 C CG  . PRO B 22  ? 0.5423 0.2603 0.2367 -0.1833 -0.1013 0.0489  22   PRO B CG  
1093 C CD  . PRO B 22  ? 0.5082 0.2496 0.2405 -0.1664 -0.0987 0.0420  22   PRO B CD  
1094 N N   . CYS B 23  ? 0.4086 0.2348 0.2470 -0.1310 -0.0571 0.0342  23   CYS B N   
1095 C CA  . CYS B 23  ? 0.4019 0.2455 0.2438 -0.1299 -0.0340 0.0246  23   CYS B CA  
1096 C C   . CYS B 23  ? 0.4012 0.2456 0.2610 -0.1293 -0.0432 0.0324  23   CYS B C   
1097 O O   . CYS B 23  ? 0.3722 0.2313 0.2720 -0.1146 -0.0513 0.0342  23   CYS B O   
1098 C CB  . CYS B 23  ? 0.3691 0.2452 0.2457 -0.1114 -0.0178 0.0126  23   CYS B CB  
1099 S SG  . CYS B 23  ? 0.3534 0.2551 0.2470 -0.1083 0.0047  0.0007  23   CYS B SG  
1100 N N   . PHE B 24  ? 0.4328 0.2588 0.2610 -0.1468 -0.0398 0.0355  24   PHE B N   
1101 C CA  . PHE B 24  ? 0.4425 0.2594 0.2797 -0.1498 -0.0517 0.0443  24   PHE B CA  
1102 C C   . PHE B 24  ? 0.4510 0.2768 0.2797 -0.1598 -0.0298 0.0370  24   PHE B C   
1103 O O   . PHE B 24  ? 0.4863 0.2976 0.2742 -0.1800 -0.0159 0.0346  24   PHE B O   
1104 C CB  . PHE B 24  ? 0.5038 0.2763 0.3063 -0.1663 -0.0806 0.0617  24   PHE B CB  
1105 C CG  . PHE B 24  ? 0.5043 0.2716 0.3301 -0.1559 -0.1070 0.0694  24   PHE B CG  
1106 C CD1 . PHE B 24  ? 0.4875 0.2642 0.3665 -0.1396 -0.1241 0.0735  24   PHE B CD1 
1107 C CD2 . PHE B 24  ? 0.5219 0.2754 0.3198 -0.1631 -0.1134 0.0707  24   PHE B CD2 
1108 C CE1 . PHE B 24  ? 0.4886 0.2660 0.4001 -0.1304 -0.1461 0.0785  24   PHE B CE1 
1109 C CE2 . PHE B 24  ? 0.5230 0.2743 0.3485 -0.1550 -0.1391 0.0777  24   PHE B CE2 
1110 C CZ  . PHE B 24  ? 0.4887 0.2544 0.3747 -0.1386 -0.1549 0.0815  24   PHE B CZ  
1111 N N   . VAL B 25  ? 0.4147 0.2649 0.2826 -0.1467 -0.0252 0.0319  25   VAL B N   
1112 C CA  . VAL B 25  ? 0.4065 0.2658 0.2756 -0.1560 -0.0101 0.0265  25   VAL B CA  
1113 C C   . VAL B 25  ? 0.4377 0.2646 0.2908 -0.1686 -0.0281 0.0401  25   VAL B C   
1114 O O   . VAL B 25  ? 0.4242 0.2428 0.3001 -0.1566 -0.0485 0.0468  25   VAL B O   
1115 C CB  . VAL B 25  ? 0.3602 0.2556 0.2743 -0.1378 -0.0013 0.0152  25   VAL B CB  
1116 C CG1 . VAL B 25  ? 0.3534 0.2591 0.2732 -0.1491 0.0112  0.0096  25   VAL B CG1 
1117 C CG2 . VAL B 25  ? 0.3369 0.2572 0.2655 -0.1251 0.0105  0.0044  25   VAL B CG2 
1118 N N   . THR B 26  ? 0.4751 0.2818 0.2897 -0.1938 -0.0198 0.0435  26   THR B N   
1119 C CA  . THR B 26  ? 0.5208 0.2869 0.3094 -0.2106 -0.0392 0.0590  26   THR B CA  
1120 C C   . THR B 26  ? 0.5102 0.2860 0.3217 -0.2122 -0.0333 0.0555  26   THR B C   
1121 O O   . THR B 26  ? 0.5381 0.2790 0.3330 -0.2244 -0.0506 0.0679  26   THR B O   
1122 C CB  . THR B 26  ? 0.5930 0.3194 0.3122 -0.2439 -0.0354 0.0675  26   THR B CB  
1123 O OG1 . THR B 26  ? 0.5958 0.3421 0.3055 -0.2606 0.0002  0.0539  26   THR B OG1 
1124 C CG2 . THR B 26  ? 0.6092 0.3214 0.2996 -0.2444 -0.0426 0.0700  26   THR B CG2 
1125 N N   . ASN B 27  ? 0.4586 0.2775 0.3070 -0.2011 -0.0126 0.0395  27   ASN B N   
1126 C CA  . ASN B 27  ? 0.4556 0.2830 0.3240 -0.2049 -0.0086 0.0355  27   ASN B CA  
1127 C C   . ASN B 27  ? 0.4005 0.2605 0.3175 -0.1799 -0.0092 0.0241  27   ASN B C   
1128 O O   . ASN B 27  ? 0.3839 0.2664 0.3211 -0.1824 0.0015  0.0147  27   ASN B O   
1129 C CB  . ASN B 27  ? 0.4786 0.3161 0.3322 -0.2304 0.0171  0.0289  27   ASN B CB  
1130 C CG  . ASN B 27  ? 0.4546 0.3381 0.3365 -0.2223 0.0421  0.0110  27   ASN B CG  
1131 O OD1 . ASN B 27  ? 0.4111 0.3085 0.3045 -0.2032 0.0407  0.0067  27   ASN B OD1 
1132 N ND2 . ASN B 27  ? 0.4461 0.3527 0.3436 -0.2374 0.0642  0.0004  27   ASN B ND2 
1133 N N   . MET B 28  ? 0.3762 0.2356 0.3096 -0.1587 -0.0223 0.0252  28   MET B N   
1134 C CA  . MET B 28  ? 0.3437 0.2251 0.3116 -0.1384 -0.0221 0.0149  28   MET B CA  
1135 C C   . MET B 28  ? 0.3499 0.2196 0.3276 -0.1410 -0.0283 0.0129  28   MET B C   
1136 O O   . MET B 28  ? 0.3755 0.2136 0.3410 -0.1510 -0.0404 0.0222  28   MET B O   
1137 C CB  . MET B 28  ? 0.3373 0.2152 0.3192 -0.1199 -0.0322 0.0163  28   MET B CB  
1138 C CG  . MET B 28  ? 0.3449 0.2356 0.3217 -0.1143 -0.0274 0.0164  28   MET B CG  
1139 S SD  . MET B 28  ? 0.3243 0.2522 0.3144 -0.1044 -0.0105 0.0031  28   MET B SD  
1140 C CE  . MET B 28  ? 0.3045 0.2389 0.3171 -0.0864 -0.0135 -0.0033 28   MET B CE  
1141 N N   . GLU B 29  ? 0.3318 0.2225 0.3287 -0.1331 -0.0226 0.0013  29   GLU B N   
1142 C CA  . GLU B 29  ? 0.3404 0.2184 0.3444 -0.1356 -0.0282 -0.0033 29   GLU B CA  
1143 C C   . GLU B 29  ? 0.3182 0.2000 0.3366 -0.1185 -0.0288 -0.0142 29   GLU B C   
1144 O O   . GLU B 29  ? 0.3357 0.1986 0.3579 -0.1180 -0.0338 -0.0193 29   GLU B O   
1145 C CB  . GLU B 29  ? 0.3402 0.2348 0.3472 -0.1505 -0.0213 -0.0084 29   GLU B CB  
1146 C CG  . GLU B 29  ? 0.3736 0.2597 0.3648 -0.1736 -0.0162 -0.0004 29   GLU B CG  
1147 C CD  . GLU B 29  ? 0.3738 0.2873 0.3814 -0.1870 -0.0055 -0.0087 29   GLU B CD  
1148 O OE1 . GLU B 29  ? 0.3887 0.2974 0.3858 -0.2099 0.0032  -0.0046 29   GLU B OE1 
1149 O OE2 . GLU B 29  ? 0.3613 0.2996 0.3924 -0.1761 -0.0070 -0.0190 29   GLU B OE2 
1150 N N   . ALA B 30  ? 0.2933 0.1961 0.3159 -0.1067 -0.0226 -0.0184 30   ALA B N   
1151 C CA  . ALA B 30  ? 0.2883 0.1932 0.3148 -0.0949 -0.0196 -0.0291 30   ALA B CA  
1152 C C   . ALA B 30  ? 0.3006 0.1827 0.3373 -0.0868 -0.0210 -0.0327 30   ALA B C   
1153 O O   . ALA B 30  ? 0.3134 0.1881 0.3610 -0.0821 -0.0256 -0.0254 30   ALA B O   
1154 C CB  . ALA B 30  ? 0.2604 0.1849 0.2855 -0.0858 -0.0140 -0.0295 30   ALA B CB  
1155 N N   . GLN B 31  ? 0.3190 0.1891 0.3543 -0.0856 -0.0179 -0.0451 31   GLN B N   
1156 C CA  . GLN B 31  ? 0.3425 0.1925 0.3947 -0.0765 -0.0145 -0.0543 31   GLN B CA  
1157 C C   . GLN B 31  ? 0.3384 0.1971 0.3951 -0.0663 0.0007  -0.0651 31   GLN B C   
1158 O O   . GLN B 31  ? 0.3476 0.1972 0.4293 -0.0573 0.0076  -0.0738 31   GLN B O   
1159 C CB  . GLN B 31  ? 0.3709 0.1977 0.4168 -0.0824 -0.0158 -0.0654 31   GLN B CB  
1160 C CG  . GLN B 31  ? 0.3935 0.2064 0.4369 -0.0944 -0.0299 -0.0549 31   GLN B CG  
1161 C CD  . GLN B 31  ? 0.4161 0.2159 0.4761 -0.0916 -0.0413 -0.0412 31   GLN B CD  
1162 O OE1 . GLN B 31  ? 0.4512 0.2282 0.5338 -0.0828 -0.0467 -0.0451 31   GLN B OE1 
1163 N NE2 . GLN B 31  ? 0.3672 0.1790 0.4165 -0.0994 -0.0460 -0.0259 31   GLN B NE2 
1164 N N   . ASN B 32  ? 0.3407 0.2158 0.3756 -0.0688 0.0057  -0.0647 32   ASN B N   
1165 C CA  . ASN B 32  ? 0.3399 0.2199 0.3669 -0.0644 0.0204  -0.0730 32   ASN B CA  
1166 C C   . ASN B 32  ? 0.3151 0.2148 0.3298 -0.0651 0.0159  -0.0616 32   ASN B C   
1167 O O   . ASN B 32  ? 0.3008 0.2095 0.3094 -0.0698 0.0047  -0.0534 32   ASN B O   
1168 C CB  . ASN B 32  ? 0.3795 0.2425 0.3753 -0.0718 0.0287  -0.0881 32   ASN B CB  
1169 C CG  . ASN B 32  ? 0.4145 0.2737 0.3930 -0.0721 0.0478  -0.0986 32   ASN B CG  
1170 O OD1 . ASN B 32  ? 0.4817 0.3520 0.4452 -0.0732 0.0475  -0.0909 32   ASN B OD1 
1171 N ND2 . ASN B 32  ? 0.4837 0.3241 0.4608 -0.0732 0.0662  -0.1176 32   ASN B ND2 
1172 N N   . THR B 33  ? 0.3085 0.2147 0.3230 -0.0609 0.0257  -0.0623 33   THR B N   
1173 C CA  . THR B 33  ? 0.2988 0.2196 0.3036 -0.0604 0.0207  -0.0519 33   THR B CA  
1174 C C   . THR B 33  ? 0.3128 0.2308 0.2851 -0.0665 0.0149  -0.0525 33   THR B C   
1175 O O   . THR B 33  ? 0.3071 0.2351 0.2746 -0.0651 0.0075  -0.0447 33   THR B O   
1176 C CB  . THR B 33  ? 0.2892 0.2151 0.3032 -0.0561 0.0316  -0.0516 33   THR B CB  
1177 O OG1 . THR B 33  ? 0.3209 0.2353 0.3230 -0.0596 0.0492  -0.0648 33   THR B OG1 
1178 C CG2 . THR B 33  ? 0.2930 0.2245 0.3446 -0.0498 0.0291  -0.0475 33   THR B CG2 
1179 N N   . THR B 34  ? 0.3490 0.2507 0.2998 -0.0733 0.0158  -0.0620 34   THR B N   
1180 C CA  . THR B 34  ? 0.3802 0.2726 0.2962 -0.0810 0.0051  -0.0621 34   THR B CA  
1181 C C   . THR B 34  ? 0.3634 0.2735 0.2920 -0.0800 -0.0148 -0.0525 34   THR B C   
1182 O O   . THR B 34  ? 0.3895 0.2980 0.3023 -0.0811 -0.0272 -0.0480 34   THR B O   
1183 C CB  . THR B 34  ? 0.4200 0.2882 0.3088 -0.0909 0.0065  -0.0743 34   THR B CB  
1184 O OG1 . THR B 34  ? 0.4822 0.3334 0.3577 -0.0928 0.0298  -0.0868 34   THR B OG1 
1185 C CG2 . THR B 34  ? 0.4725 0.3268 0.3221 -0.1009 -0.0117 -0.0722 34   THR B CG2 
1186 N N   . GLU B 35  ? 0.3363 0.2616 0.2941 -0.0787 -0.0179 -0.0498 35   GLU B N   
1187 C CA  . GLU B 35  ? 0.3292 0.2750 0.3058 -0.0789 -0.0310 -0.0445 35   GLU B CA  
1188 C C   . GLU B 35  ? 0.2984 0.2627 0.2980 -0.0726 -0.0247 -0.0379 35   GLU B C   
1189 O O   . GLU B 35  ? 0.2931 0.2751 0.3142 -0.0747 -0.0272 -0.0367 35   GLU B O   
1190 C CB  . GLU B 35  ? 0.3406 0.2902 0.3295 -0.0878 -0.0387 -0.0478 35   GLU B CB  
1191 C CG  . GLU B 35  ? 0.3834 0.3113 0.3466 -0.0967 -0.0477 -0.0553 35   GLU B CG  
1192 C CD  . GLU B 35  ? 0.4216 0.3456 0.3681 -0.0993 -0.0671 -0.0542 35   GLU B CD  
1193 O OE1 . GLU B 35  ? 0.4694 0.4080 0.4289 -0.0922 -0.0744 -0.0479 35   GLU B OE1 
1194 O OE2 . GLU B 35  ? 0.4422 0.3441 0.3601 -0.1090 -0.0769 -0.0597 35   GLU B OE2 
1195 N N   . VAL B 36  ? 0.2730 0.2324 0.2678 -0.0668 -0.0154 -0.0351 36   VAL B N   
1196 C CA  . VAL B 36  ? 0.2556 0.2266 0.2639 -0.0627 -0.0115 -0.0293 36   VAL B CA  
1197 C C   . VAL B 36  ? 0.2514 0.2247 0.2534 -0.0566 -0.0143 -0.0270 36   VAL B C   
1198 O O   . VAL B 36  ? 0.2607 0.2210 0.2434 -0.0559 -0.0139 -0.0274 36   VAL B O   
1199 C CB  . VAL B 36  ? 0.2483 0.2109 0.2606 -0.0616 -0.0044 -0.0263 36   VAL B CB  
1200 C CG1 . VAL B 36  ? 0.2455 0.2144 0.2627 -0.0604 -0.0034 -0.0197 36   VAL B CG1 
1201 C CG2 . VAL B 36  ? 0.2595 0.2132 0.2777 -0.0675 -0.0054 -0.0276 36   VAL B CG2 
1202 N N   . TYR B 37  ? 0.2490 0.2361 0.2654 -0.0536 -0.0158 -0.0255 37   TYR B N   
1203 C CA  . TYR B 37  ? 0.2533 0.2397 0.2670 -0.0467 -0.0190 -0.0232 37   TYR B CA  
1204 C C   . TYR B 37  ? 0.2367 0.2280 0.2571 -0.0453 -0.0105 -0.0216 37   TYR B C   
1205 O O   . TYR B 37  ? 0.2276 0.2282 0.2585 -0.0499 -0.0046 -0.0239 37   TYR B O   
1206 C CB  . TYR B 37  ? 0.2825 0.2778 0.3108 -0.0429 -0.0323 -0.0260 37   TYR B CB  
1207 C CG  . TYR B 37  ? 0.2933 0.2772 0.3122 -0.0360 -0.0426 -0.0223 37   TYR B CG  
1208 C CD1 . TYR B 37  ? 0.3422 0.3056 0.3338 -0.0388 -0.0556 -0.0185 37   TYR B CD1 
1209 C CD2 . TYR B 37  ? 0.3356 0.3235 0.3668 -0.0289 -0.0395 -0.0228 37   TYR B CD2 
1210 C CE1 . TYR B 37  ? 0.3570 0.3032 0.3337 -0.0352 -0.0674 -0.0129 37   TYR B CE1 
1211 C CE2 . TYR B 37  ? 0.3417 0.3143 0.3635 -0.0230 -0.0510 -0.0187 37   TYR B CE2 
1212 C CZ  . TYR B 37  ? 0.3744 0.3257 0.3688 -0.0265 -0.0659 -0.0126 37   TYR B CZ  
1213 O OH  . TYR B 37  ? 0.4126 0.3421 0.3912 -0.0234 -0.0797 -0.0063 37   TYR B OH  
1214 N N   . VAL B 38  ? 0.2339 0.2158 0.2438 -0.0418 -0.0094 -0.0178 38   VAL B N   
1215 C CA  . VAL B 38  ? 0.2404 0.2219 0.2508 -0.0418 -0.0042 -0.0166 38   VAL B CA  
1216 C C   . VAL B 38  ? 0.2409 0.2180 0.2499 -0.0349 -0.0081 -0.0172 38   VAL B C   
1217 O O   . VAL B 38  ? 0.2439 0.2106 0.2424 -0.0325 -0.0143 -0.0136 38   VAL B O   
1218 C CB  . VAL B 38  ? 0.2389 0.2105 0.2417 -0.0456 -0.0021 -0.0109 38   VAL B CB  
1219 C CG1 . VAL B 38  ? 0.2572 0.2233 0.2535 -0.0478 -0.0011 -0.0092 38   VAL B CG1 
1220 C CG2 . VAL B 38  ? 0.2629 0.2336 0.2702 -0.0512 -0.0015 -0.0098 38   VAL B CG2 
1221 N N   . LYS B 39  ? 0.2491 0.2308 0.2660 -0.0334 -0.0034 -0.0224 39   LYS B N   
1222 C CA  . LYS B 39  ? 0.2590 0.2339 0.2781 -0.0259 -0.0067 -0.0250 39   LYS B CA  
1223 C C   . LYS B 39  ? 0.2602 0.2278 0.2684 -0.0305 0.0028  -0.0277 39   LYS B C   
1224 O O   . LYS B 39  ? 0.2715 0.2455 0.2807 -0.0370 0.0140  -0.0341 39   LYS B O   
1225 C CB  . LYS B 39  ? 0.2609 0.2492 0.3090 -0.0178 -0.0108 -0.0337 39   LYS B CB  
1226 C CG  . LYS B 39  ? 0.2969 0.2758 0.3548 -0.0071 -0.0191 -0.0367 39   LYS B CG  
1227 C CD  . LYS B 39  ? 0.3051 0.2998 0.4043 0.0026  -0.0270 -0.0458 39   LYS B CD  
1228 C CE  . LYS B 39  ? 0.3319 0.3234 0.4322 0.0044  -0.0491 -0.0380 39   LYS B CE  
1229 N NZ  . LYS B 39  ? 0.3536 0.3565 0.5006 0.0163  -0.0645 -0.0457 39   LYS B NZ  
1230 N N   . TRP B 40  ? 0.2553 0.2065 0.2485 -0.0303 -0.0013 -0.0229 40   TRP B N   
1231 C CA  . TRP B 40  ? 0.2685 0.2076 0.2481 -0.0344 0.0042  -0.0270 40   TRP B CA  
1232 C C   . TRP B 40  ? 0.2760 0.2069 0.2635 -0.0248 0.0030  -0.0349 40   TRP B C   
1233 O O   . TRP B 40  ? 0.2622 0.1846 0.2521 -0.0180 -0.0083 -0.0297 40   TRP B O   
1234 C CB  . TRP B 40  ? 0.2677 0.1925 0.2293 -0.0420 -0.0020 -0.0172 40   TRP B CB  
1235 C CG  . TRP B 40  ? 0.2614 0.1879 0.2171 -0.0515 -0.0028 -0.0115 40   TRP B CG  
1236 C CD1 . TRP B 40  ? 0.2538 0.1892 0.2210 -0.0518 -0.0061 -0.0054 40   TRP B CD1 
1237 C CD2 . TRP B 40  ? 0.2885 0.2021 0.2228 -0.0634 -0.0025 -0.0109 40   TRP B CD2 
1238 N NE1 . TRP B 40  ? 0.2608 0.1907 0.2217 -0.0607 -0.0100 -0.0005 40   TRP B NE1 
1239 C CE2 . TRP B 40  ? 0.2799 0.1949 0.2171 -0.0692 -0.0095 -0.0023 40   TRP B CE2 
1240 C CE3 . TRP B 40  ? 0.3334 0.2302 0.2424 -0.0710 0.0027  -0.0175 40   TRP B CE3 
1241 C CZ2 . TRP B 40  ? 0.3121 0.2098 0.2266 -0.0827 -0.0164 0.0031  40   TRP B CZ2 
1242 C CZ3 . TRP B 40  ? 0.3493 0.2282 0.2285 -0.0869 -0.0008 -0.0133 40   TRP B CZ3 
1243 C CH2 . TRP B 40  ? 0.3270 0.2055 0.2087 -0.0927 -0.0126 -0.0016 40   TRP B CH2 
1244 N N   . LYS B 41  ? 0.2946 0.2243 0.2837 -0.0255 0.0155  -0.0482 41   LYS B N   
1245 C CA  . LYS B 41  ? 0.3147 0.2352 0.3172 -0.0148 0.0160  -0.0592 41   LYS B CA  
1246 C C   . LYS B 41  ? 0.3376 0.2344 0.3116 -0.0223 0.0235  -0.0654 41   LYS B C   
1247 O O   . LYS B 41  ? 0.3318 0.2229 0.2784 -0.0369 0.0329  -0.0661 41   LYS B O   
1248 C CB  . LYS B 41  ? 0.3175 0.2590 0.3590 -0.0063 0.0268  -0.0755 41   LYS B CB  
1249 C CG  . LYS B 41  ? 0.3180 0.2826 0.3875 -0.0013 0.0173  -0.0703 41   LYS B CG  
1250 C CD  . LYS B 41  ? 0.3222 0.3115 0.4399 0.0057  0.0280  -0.0879 41   LYS B CD  
1251 C CE  . LYS B 41  ? 0.3366 0.3486 0.4814 0.0076  0.0165  -0.0828 41   LYS B CE  
1252 N NZ  . LYS B 41  ? 0.3465 0.3880 0.5502 0.0139  0.0257  -0.1008 41   LYS B NZ  
1253 N N   . PHE B 42  ? 0.3524 0.2307 0.3294 -0.0136 0.0168  -0.0692 42   PHE B N   
1254 C CA  . PHE B 42  ? 0.3922 0.2435 0.3426 -0.0198 0.0224  -0.0774 42   PHE B CA  
1255 C C   . PHE B 42  ? 0.4165 0.2573 0.3928 -0.0038 0.0227  -0.0920 42   PHE B C   
1256 O O   . PHE B 42  ? 0.4056 0.2416 0.4002 0.0080  0.0046  -0.0839 42   PHE B O   
1257 C CB  . PHE B 42  ? 0.3884 0.2197 0.3097 -0.0293 0.0068  -0.0611 42   PHE B CB  
1258 C CG  . PHE B 42  ? 0.4143 0.2143 0.3057 -0.0375 0.0085  -0.0688 42   PHE B CG  
1259 C CD1 . PHE B 42  ? 0.4261 0.2146 0.2822 -0.0542 0.0174  -0.0738 42   PHE B CD1 
1260 C CD2 . PHE B 42  ? 0.4235 0.2000 0.3167 -0.0303 -0.0008 -0.0707 42   PHE B CD2 
1261 C CE1 . PHE B 42  ? 0.4868 0.2411 0.3083 -0.0641 0.0176  -0.0819 42   PHE B CE1 
1262 C CE2 . PHE B 42  ? 0.4586 0.2030 0.3225 -0.0386 0.0002  -0.0791 42   PHE B CE2 
1263 C CZ  . PHE B 42  ? 0.4935 0.2272 0.3209 -0.0557 0.0096  -0.0853 42   PHE B CZ  
1264 N N   . LYS B 43  ? 0.4610 0.2951 0.4371 -0.0047 0.0435  -0.1141 43   LYS B N   
1265 C CA  . LYS B 43  ? 0.4950 0.3234 0.5084 0.0126  0.0491  -0.1344 43   LYS B CA  
1266 C C   . LYS B 43  ? 0.4806 0.3330 0.5515 0.0320  0.0355  -0.1324 43   LYS B C   
1267 O O   . LYS B 43  ? 0.5011 0.3391 0.5978 0.0481  0.0173  -0.1324 43   LYS B O   
1268 C CB  . LYS B 43  ? 0.5275 0.3162 0.5193 0.0147  0.0371  -0.1341 43   LYS B CB  
1269 C CG  . LYS B 43  ? 0.5705 0.3331 0.5095 -0.0045 0.0518  -0.1427 43   LYS B CG  
1270 C CD  . LYS B 43  ? 0.6019 0.3238 0.5189 -0.0043 0.0393  -0.1431 43   LYS B CD  
1271 C CE  . LYS B 43  ? 0.6630 0.3554 0.5313 -0.0218 0.0572  -0.1600 43   LYS B CE  
1272 N NZ  . LYS B 43  ? 0.7029 0.3923 0.5911 -0.0138 0.0877  -0.1942 43   LYS B NZ  
1273 N N   . GLY B 44  ? 0.4641 0.3496 0.5525 0.0288  0.0412  -0.1293 44   GLY B N   
1274 C CA  . GLY B 44  ? 0.4484 0.3593 0.5928 0.0443  0.0287  -0.1297 44   GLY B CA  
1275 C C   . GLY B 44  ? 0.4423 0.3432 0.5840 0.0509  -0.0054 -0.1066 44   GLY B C   
1276 O O   . GLY B 44  ? 0.4531 0.3629 0.6381 0.0652  -0.0234 -0.1068 44   GLY B O   
1277 N N   . ARG B 45  ? 0.4384 0.3196 0.5302 0.0392  -0.0149 -0.0873 45   ARG B N   
1278 C CA  . ARG B 45  ? 0.4313 0.3053 0.5113 0.0390  -0.0398 -0.0660 45   ARG B CA  
1279 C C   . ARG B 45  ? 0.3946 0.2801 0.4426 0.0230  -0.0337 -0.0529 45   ARG B C   
1280 O O   . ARG B 45  ? 0.3740 0.2614 0.4004 0.0117  -0.0179 -0.0549 45   ARG B O   
1281 C CB  . ARG B 45  ? 0.4607 0.2966 0.5181 0.0407  -0.0588 -0.0553 45   ARG B CB  
1282 C CG  . ARG B 45  ? 0.4913 0.3061 0.5173 0.0316  -0.0482 -0.0576 45   ARG B CG  
1283 C CD  . ARG B 45  ? 0.5472 0.3228 0.5627 0.0361  -0.0678 -0.0512 45   ARG B CD  
1284 N NE  . ARG B 45  ? 0.5899 0.3515 0.5745 0.0253  -0.0834 -0.0286 45   ARG B NE  
1285 C CZ  . ARG B 45  ? 0.5941 0.3452 0.5435 0.0084  -0.0792 -0.0176 45   ARG B CZ  
1286 N NH1 . ARG B 45  ? 0.5998 0.3502 0.5380 0.0007  -0.0656 -0.0247 45   ARG B NH1 
1287 N NH2 . ARG B 45  ? 0.6003 0.3403 0.5256 -0.0022 -0.0889 -0.0002 45   ARG B NH2 
1288 N N   . ASP B 46  ? 0.3815 0.2712 0.4267 0.0219  -0.0480 -0.0402 46   ASP B N   
1289 C CA  . ASP B 46  ? 0.3626 0.2611 0.3830 0.0087  -0.0427 -0.0295 46   ASP B CA  
1290 C C   . ASP B 46  ? 0.3614 0.2377 0.3474 -0.0012 -0.0442 -0.0183 46   ASP B C   
1291 O O   . ASP B 46  ? 0.3872 0.2403 0.3593 -0.0010 -0.0580 -0.0097 46   ASP B O   
1292 C CB  . ASP B 46  ? 0.3640 0.2680 0.3876 0.0094  -0.0567 -0.0219 46   ASP B CB  
1293 C CG  . ASP B 46  ? 0.3762 0.3036 0.4419 0.0189  -0.0597 -0.0325 46   ASP B CG  
1294 O OD1 . ASP B 46  ? 0.4258 0.3721 0.5165 0.0212  -0.0427 -0.0465 46   ASP B OD1 
1295 O OD2 . ASP B 46  ? 0.4141 0.3395 0.4872 0.0220  -0.0792 -0.0272 46   ASP B OD2 
1296 N N   . ILE B 47  ? 0.3336 0.2152 0.3068 -0.0113 -0.0316 -0.0178 47   ILE B N   
1297 C CA  . ILE B 47  ? 0.3328 0.1994 0.2839 -0.0218 -0.0331 -0.0079 47   ILE B CA  
1298 C C   . ILE B 47  ? 0.3024 0.1819 0.2496 -0.0309 -0.0287 0.0001  47   ILE B C   
1299 O O   . ILE B 47  ? 0.2935 0.1662 0.2316 -0.0399 -0.0277 0.0071  47   ILE B O   
1300 C CB  . ILE B 47  ? 0.3496 0.2054 0.2915 -0.0271 -0.0286 -0.0126 47   ILE B CB  
1301 C CG1 . ILE B 47  ? 0.3477 0.2176 0.2897 -0.0319 -0.0180 -0.0191 47   ILE B CG1 
1302 C CG2 . ILE B 47  ? 0.3615 0.1977 0.3056 -0.0180 -0.0322 -0.0218 47   ILE B CG2 
1303 C CD1 . ILE B 47  ? 0.3315 0.2099 0.2697 -0.0424 -0.0185 -0.0102 47   ILE B CD1 
1304 N N   . TYR B 48  ? 0.2757 0.1741 0.2336 -0.0286 -0.0248 -0.0027 48   TYR B N   
1305 C CA  . TYR B 48  ? 0.2694 0.1777 0.2265 -0.0351 -0.0200 0.0018  48   TYR B CA  
1306 C C   . TYR B 48  ? 0.2575 0.1789 0.2230 -0.0307 -0.0208 -0.0019 48   TYR B C   
1307 O O   . TYR B 48  ? 0.2483 0.1813 0.2278 -0.0262 -0.0192 -0.0085 48   TYR B O   
1308 C CB  . TYR B 48  ? 0.2577 0.1752 0.2222 -0.0416 -0.0139 0.0025  48   TYR B CB  
1309 C CG  . TYR B 48  ? 0.2472 0.1746 0.2196 -0.0457 -0.0083 0.0044  48   TYR B CG  
1310 C CD1 . TYR B 48  ? 0.2554 0.1799 0.2297 -0.0524 -0.0033 0.0075  48   TYR B CD1 
1311 C CD2 . TYR B 48  ? 0.2434 0.1824 0.2233 -0.0438 -0.0060 0.0011  48   TYR B CD2 
1312 C CE1 . TYR B 48  ? 0.2542 0.1877 0.2401 -0.0555 0.0059  0.0052  48   TYR B CE1 
1313 C CE2 . TYR B 48  ? 0.2523 0.1968 0.2401 -0.0467 -0.0001 0.0004  48   TYR B CE2 
1314 C CZ  . TYR B 48  ? 0.2512 0.1932 0.2430 -0.0518 0.0069  0.0013  48   TYR B CZ  
1315 O OH  . TYR B 48  ? 0.2757 0.2233 0.2795 -0.0541 0.0168  -0.0033 48   TYR B OH  
1316 N N   . THR B 49  ? 0.2759 0.1935 0.2307 -0.0343 -0.0222 0.0013  49   THR B N   
1317 C CA  . THR B 49  ? 0.2683 0.1964 0.2286 -0.0331 -0.0238 -0.0021 49   THR B CA  
1318 C C   . THR B 49  ? 0.2691 0.1964 0.2192 -0.0413 -0.0147 -0.0015 49   THR B C   
1319 O O   . THR B 49  ? 0.2810 0.1946 0.2129 -0.0483 -0.0099 0.0017  49   THR B O   
1320 C CB  . THR B 49  ? 0.2926 0.2111 0.2479 -0.0285 -0.0402 -0.0011 49   THR B CB  
1321 O OG1 . THR B 49  ? 0.3373 0.2309 0.2598 -0.0360 -0.0454 0.0061  49   THR B OG1 
1322 C CG2 . THR B 49  ? 0.2844 0.2033 0.2594 -0.0178 -0.0490 -0.0044 49   THR B CG2 
1323 N N   . PHE B 50  ? 0.2580 0.1986 0.2207 -0.0415 -0.0103 -0.0058 50   PHE B N   
1324 C CA  . PHE B 50  ? 0.2588 0.1971 0.2149 -0.0474 -0.0024 -0.0089 50   PHE B CA  
1325 C C   . PHE B 50  ? 0.2665 0.2045 0.2163 -0.0475 -0.0111 -0.0120 50   PHE B C   
1326 O O   . PHE B 50  ? 0.2421 0.1939 0.2107 -0.0440 -0.0157 -0.0142 50   PHE B O   
1327 C CB  . PHE B 50  ? 0.2412 0.1900 0.2197 -0.0478 0.0063  -0.0111 50   PHE B CB  
1328 C CG  . PHE B 50  ? 0.2472 0.1940 0.2269 -0.0512 0.0145  -0.0175 50   PHE B CG  
1329 C CD1 . PHE B 50  ? 0.2778 0.2161 0.2491 -0.0567 0.0277  -0.0222 50   PHE B CD1 
1330 C CD2 . PHE B 50  ? 0.2593 0.2108 0.2473 -0.0505 0.0110  -0.0206 50   PHE B CD2 
1331 C CE1 . PHE B 50  ? 0.2849 0.2190 0.2572 -0.0599 0.0386  -0.0319 50   PHE B CE1 
1332 C CE2 . PHE B 50  ? 0.2563 0.2016 0.2443 -0.0535 0.0183  -0.0283 50   PHE B CE2 
1333 C CZ  . PHE B 50  ? 0.2588 0.1952 0.2392 -0.0573 0.0325  -0.0349 50   PHE B CZ  
1334 N N   . ASP B 51  ? 0.3017 0.2218 0.2224 -0.0541 -0.0134 -0.0123 51   ASP B N   
1335 C CA  . ASP B 51  ? 0.3194 0.2338 0.2282 -0.0572 -0.0248 -0.0150 51   ASP B CA  
1336 C C   . ASP B 51  ? 0.3286 0.2373 0.2272 -0.0647 -0.0108 -0.0229 51   ASP B C   
1337 O O   . ASP B 51  ? 0.3435 0.2335 0.2126 -0.0737 0.0003  -0.0261 51   ASP B O   
1338 C CB  . ASP B 51  ? 0.3575 0.2471 0.2321 -0.0618 -0.0421 -0.0091 51   ASP B CB  
1339 C CG  . ASP B 51  ? 0.3986 0.2821 0.2652 -0.0648 -0.0621 -0.0103 51   ASP B CG  
1340 O OD1 . ASP B 51  ? 0.3805 0.2726 0.2550 -0.0675 -0.0565 -0.0172 51   ASP B OD1 
1341 O OD2 . ASP B 51  ? 0.4742 0.3425 0.3286 -0.0645 -0.0863 -0.0038 51   ASP B OD2 
1342 N N   . GLY B 52  ? 0.3007 0.2242 0.2241 -0.0619 -0.0096 -0.0272 52   GLY B N   
1343 C CA  . GLY B 52  ? 0.3204 0.2376 0.2413 -0.0667 0.0019  -0.0359 52   GLY B CA  
1344 C C   . GLY B 52  ? 0.3585 0.2529 0.2415 -0.0769 -0.0010 -0.0419 52   GLY B C   
1345 O O   . GLY B 52  ? 0.3839 0.2655 0.2549 -0.0827 0.0149  -0.0521 52   GLY B O   
1346 N N   . ALA B 53  ? 0.3815 0.2688 0.2468 -0.0797 -0.0224 -0.0368 53   ALA B N   
1347 C CA  . ALA B 53  ? 0.4406 0.2989 0.2594 -0.0925 -0.0310 -0.0404 53   ALA B CA  
1348 C C   . ALA B 53  ? 0.4841 0.3151 0.2571 -0.1032 -0.0143 -0.0428 53   ALA B C   
1349 O O   . ALA B 53  ? 0.5242 0.3311 0.2603 -0.1158 -0.0014 -0.0533 53   ALA B O   
1350 C CB  . ALA B 53  ? 0.4667 0.3214 0.2804 -0.0928 -0.0635 -0.0321 53   ALA B CB  
1351 N N   . LEU B 54  ? 0.4761 0.3101 0.2520 -0.0997 -0.0115 -0.0346 54   LEU B N   
1352 C CA  . LEU B 54  ? 0.5220 0.3314 0.2564 -0.1124 0.0062  -0.0356 54   LEU B CA  
1353 C C   . LEU B 54  ? 0.4992 0.3253 0.2638 -0.1101 0.0392  -0.0447 54   LEU B C   
1354 O O   . LEU B 54  ? 0.5438 0.3533 0.2808 -0.1231 0.0619  -0.0507 54   LEU B O   
1355 C CB  . LEU B 54  ? 0.5306 0.3278 0.2473 -0.1129 -0.0116 -0.0209 54   LEU B CB  
1356 C CG  . LEU B 54  ? 0.5491 0.3413 0.2655 -0.1073 -0.0497 -0.0106 54   LEU B CG  
1357 C CD1 . LEU B 54  ? 0.5806 0.3536 0.2789 -0.1075 -0.0680 0.0030  54   LEU B CD1 
1358 C CD2 . LEU B 54  ? 0.6051 0.3703 0.2787 -0.1203 -0.0649 -0.0136 54   LEU B CD2 
1359 N N   . ASN B 55  ? 0.4496 0.3065 0.2705 -0.0955 0.0412  -0.0462 55   ASN B N   
1360 C CA  . ASN B 55  ? 0.4277 0.3031 0.2893 -0.0903 0.0626  -0.0513 55   ASN B CA  
1361 C C   . ASN B 55  ? 0.4325 0.3062 0.2878 -0.0944 0.0681  -0.0440 55   ASN B C   
1362 O O   . ASN B 55  ? 0.4522 0.3263 0.3143 -0.1015 0.0923  -0.0514 55   ASN B O   
1363 C CB  . ASN B 55  ? 0.4494 0.3190 0.3162 -0.0958 0.0892  -0.0694 55   ASN B CB  
1364 C CG  . ASN B 55  ? 0.4154 0.3101 0.3471 -0.0834 0.0981  -0.0745 55   ASN B CG  
1365 O OD1 . ASN B 55  ? 0.4234 0.3366 0.3874 -0.0740 0.0855  -0.0635 55   ASN B OD1 
1366 N ND2 . ASN B 55  ? 0.4324 0.3242 0.3824 -0.0839 0.1182  -0.0916 55   ASN B ND2 
1367 N N   . LYS B 56  ? 0.4179 0.2900 0.2642 -0.0903 0.0462  -0.0305 56   LYS B N   
1368 C CA  . LYS B 56  ? 0.4150 0.2806 0.2519 -0.0942 0.0464  -0.0219 56   LYS B CA  
1369 C C   . LYS B 56  ? 0.3698 0.2511 0.2358 -0.0810 0.0289  -0.0124 56   LYS B C   
1370 O O   . LYS B 56  ? 0.3513 0.2414 0.2295 -0.0712 0.0119  -0.0103 56   LYS B O   
1371 C CB  . LYS B 56  ? 0.4666 0.2962 0.2424 -0.1081 0.0371  -0.0152 56   LYS B CB  
1372 C CG  . LYS B 56  ? 0.5301 0.3345 0.2600 -0.1275 0.0582  -0.0248 56   LYS B CG  
1373 C CD  . LYS B 56  ? 0.5952 0.3565 0.2558 -0.1454 0.0472  -0.0147 56   LYS B CD  
1374 C CE  . LYS B 56  ? 0.6609 0.3897 0.2615 -0.1694 0.0696  -0.0252 56   LYS B CE  
1375 N NZ  . LYS B 56  ? 0.7295 0.4076 0.2510 -0.1884 0.0490  -0.0124 56   LYS B NZ  
1376 N N   . SER B 57  ? 0.3476 0.2311 0.2236 -0.0827 0.0347  -0.0082 57   SER B N   
1377 C CA  . SER B 57  ? 0.3250 0.2182 0.2227 -0.0729 0.0215  -0.0013 57   SER B CA  
1378 C C   . SER B 57  ? 0.3417 0.2121 0.2115 -0.0782 0.0128  0.0075  57   SER B C   
1379 O O   . SER B 57  ? 0.3714 0.2245 0.2153 -0.0923 0.0240  0.0090  57   SER B O   
1380 C CB  . SER B 57  ? 0.2984 0.2119 0.2360 -0.0704 0.0310  -0.0035 57   SER B CB  
1381 O OG  . SER B 57  ? 0.3098 0.2388 0.2729 -0.0659 0.0362  -0.0105 57   SER B OG  
1382 N N   . THR B 58  ? 0.3288 0.1973 0.2040 -0.0678 -0.0059 0.0123  58   THR B N   
1383 C CA  . THR B 58  ? 0.3548 0.1975 0.2069 -0.0696 -0.0199 0.0207  58   THR B CA  
1384 C C   . THR B 58  ? 0.3237 0.1755 0.2020 -0.0610 -0.0231 0.0208  58   THR B C   
1385 O O   . THR B 58  ? 0.2835 0.1544 0.1884 -0.0499 -0.0256 0.0155  58   THR B O   
1386 C CB  . THR B 58  ? 0.3709 0.1987 0.2090 -0.0633 -0.0433 0.0239  58   THR B CB  
1387 O OG1 . THR B 58  ? 0.4077 0.2229 0.2143 -0.0740 -0.0421 0.0235  58   THR B OG1 
1388 C CG2 . THR B 58  ? 0.4082 0.2048 0.2267 -0.0629 -0.0630 0.0333  58   THR B CG2 
1389 N N   . VAL B 59  ? 0.3403 0.1758 0.2072 -0.0689 -0.0215 0.0262  59   VAL B N   
1390 C CA  . VAL B 59  ? 0.3363 0.1723 0.2196 -0.0635 -0.0262 0.0262  59   VAL B CA  
1391 C C   . VAL B 59  ? 0.3723 0.1746 0.2317 -0.0667 -0.0391 0.0337  59   VAL B C   
1392 O O   . VAL B 59  ? 0.3901 0.1699 0.2191 -0.0808 -0.0374 0.0412  59   VAL B O   
1393 C CB  . VAL B 59  ? 0.3199 0.1728 0.2239 -0.0712 -0.0124 0.0245  59   VAL B CB  
1394 C CG1 . VAL B 59  ? 0.2941 0.1752 0.2242 -0.0666 -0.0045 0.0181  59   VAL B CG1 
1395 C CG2 . VAL B 59  ? 0.3617 0.2052 0.2530 -0.0887 0.0005  0.0285  59   VAL B CG2 
1396 N N   . PRO B 60  ? 0.3770 0.1728 0.2483 -0.0554 -0.0504 0.0310  60   PRO B N   
1397 C CA  . PRO B 60  ? 0.4188 0.1794 0.2707 -0.0580 -0.0636 0.0376  60   PRO B CA  
1398 C C   . PRO B 60  ? 0.4284 0.1825 0.2748 -0.0729 -0.0542 0.0412  60   PRO B C   
1399 O O   . PRO B 60  ? 0.3897 0.1691 0.2570 -0.0762 -0.0418 0.0365  60   PRO B O   
1400 C CB  . PRO B 60  ? 0.4145 0.1739 0.2888 -0.0394 -0.0748 0.0287  60   PRO B CB  
1401 C CG  . PRO B 60  ? 0.3731 0.1666 0.2727 -0.0346 -0.0604 0.0179  60   PRO B CG  
1402 C CD  . PRO B 60  ? 0.3519 0.1684 0.2516 -0.0420 -0.0493 0.0204  60   PRO B CD  
1403 N N   . THR B 61  ? 0.4771 0.1955 0.2963 -0.0828 -0.0629 0.0503  61   THR B N   
1404 C CA  . THR B 61  ? 0.5025 0.2118 0.3150 -0.1009 -0.0545 0.0551  61   THR B CA  
1405 C C   . THR B 61  ? 0.4908 0.2081 0.3267 -0.0957 -0.0563 0.0481  61   THR B C   
1406 O O   . THR B 61  ? 0.4898 0.2179 0.3373 -0.1089 -0.0474 0.0487  61   THR B O   
1407 C CB  . THR B 61  ? 0.5519 0.2135 0.3239 -0.1146 -0.0657 0.0677  61   THR B CB  
1408 O OG1 . THR B 61  ? 0.5918 0.2399 0.3312 -0.1233 -0.0651 0.0748  61   THR B OG1 
1409 C CG2 . THR B 61  ? 0.5885 0.2437 0.3564 -0.1372 -0.0537 0.0722  61   THR B CG2 
1410 N N   . ASP B 62  ? 0.4926 0.2044 0.3368 -0.0779 -0.0672 0.0402  62   ASP B N   
1411 C CA  . ASP B 62  ? 0.4968 0.2106 0.3530 -0.0757 -0.0673 0.0317  62   ASP B CA  
1412 C C   . ASP B 62  ? 0.4598 0.2098 0.3368 -0.0753 -0.0567 0.0254  62   ASP B C   
1413 O O   . ASP B 62  ? 0.4757 0.2260 0.3562 -0.0800 -0.0577 0.0213  62   ASP B O   
1414 C CB  . ASP B 62  ? 0.5265 0.2172 0.3824 -0.0595 -0.0783 0.0223  62   ASP B CB  
1415 C CG  . ASP B 62  ? 0.5347 0.2478 0.4105 -0.0417 -0.0746 0.0112  62   ASP B CG  
1416 O OD1 . ASP B 62  ? 0.5622 0.2847 0.4421 -0.0363 -0.0775 0.0155  62   ASP B OD1 
1417 O OD2 . ASP B 62  ? 0.5740 0.2928 0.4587 -0.0354 -0.0685 -0.0024 62   ASP B OD2 
1418 N N   . PHE B 63  ? 0.4306 0.2067 0.3182 -0.0716 -0.0487 0.0256  63   PHE B N   
1419 C CA  . PHE B 63  ? 0.4004 0.2071 0.3078 -0.0731 -0.0408 0.0224  63   PHE B CA  
1420 C C   . PHE B 63  ? 0.3757 0.2011 0.2951 -0.0826 -0.0305 0.0277  63   PHE B C   
1421 O O   . PHE B 63  ? 0.3530 0.2010 0.2865 -0.0783 -0.0240 0.0249  63   PHE B O   
1422 C CB  . PHE B 63  ? 0.4030 0.2246 0.3169 -0.0595 -0.0386 0.0145  63   PHE B CB  
1423 C CG  . PHE B 63  ? 0.4138 0.2316 0.3254 -0.0558 -0.0396 0.0053  63   PHE B CG  
1424 C CD1 . PHE B 63  ? 0.4368 0.2652 0.3512 -0.0630 -0.0385 0.0048  63   PHE B CD1 
1425 C CD2 . PHE B 63  ? 0.4703 0.2715 0.3765 -0.0457 -0.0416 -0.0037 63   PHE B CD2 
1426 C CE1 . PHE B 63  ? 0.4587 0.2778 0.3593 -0.0637 -0.0380 -0.0038 63   PHE B CE1 
1427 C CE2 . PHE B 63  ? 0.4754 0.2720 0.3757 -0.0445 -0.0366 -0.0157 63   PHE B CE2 
1428 C CZ  . PHE B 63  ? 0.4712 0.2748 0.3630 -0.0553 -0.0341 -0.0152 63   PHE B CZ  
1429 N N   . SER B 64  ? 0.3750 0.1900 0.2897 -0.0966 -0.0270 0.0339  64   SER B N   
1430 C CA  . SER B 64  ? 0.3781 0.2070 0.3010 -0.1077 -0.0112 0.0360  64   SER B CA  
1431 C C   . SER B 64  ? 0.3424 0.2059 0.3064 -0.1083 -0.0024 0.0311  64   SER B C   
1432 O O   . SER B 64  ? 0.3292 0.2071 0.3031 -0.1116 0.0130  0.0281  64   SER B O   
1433 C CB  . SER B 64  ? 0.4037 0.2143 0.3150 -0.1267 -0.0060 0.0423  64   SER B CB  
1434 O OG  . SER B 64  ? 0.4130 0.2300 0.3494 -0.1339 -0.0109 0.0424  64   SER B OG  
1435 N N   . SER B 65  ? 0.3295 0.2021 0.3153 -0.1059 -0.0135 0.0300  65   SER B N   
1436 C CA  . SER B 65  ? 0.3090 0.2092 0.3367 -0.1058 -0.0124 0.0274  65   SER B CA  
1437 C C   . SER B 65  ? 0.2858 0.1958 0.3140 -0.0927 -0.0156 0.0240  65   SER B C   
1438 O O   . SER B 65  ? 0.2740 0.2029 0.3353 -0.0912 -0.0157 0.0223  65   SER B O   
1439 C CB  . SER B 65  ? 0.3003 0.2008 0.3496 -0.1132 -0.0285 0.0303  65   SER B CB  
1440 O OG  . SER B 65  ? 0.3037 0.1875 0.3270 -0.1074 -0.0449 0.0305  65   SER B OG  
1441 N N   . ALA B 66  ? 0.2904 0.1873 0.2868 -0.0837 -0.0189 0.0227  66   ALA B N   
1442 C CA  . ALA B 66  ? 0.2809 0.1861 0.2759 -0.0742 -0.0202 0.0193  66   ALA B CA  
1443 C C   . ALA B 66  ? 0.2657 0.1882 0.2778 -0.0716 -0.0090 0.0166  66   ALA B C   
1444 O O   . ALA B 66  ? 0.2667 0.1874 0.2692 -0.0733 0.0021  0.0152  66   ALA B O   
1445 C CB  . ALA B 66  ? 0.2732 0.1657 0.2408 -0.0657 -0.0220 0.0158  66   ALA B CB  
1446 N N   . LYS B 67  ? 0.2554 0.1896 0.2883 -0.0692 -0.0132 0.0158  67   LYS B N   
1447 C CA  . LYS B 67  ? 0.2574 0.2056 0.3103 -0.0661 -0.0039 0.0116  67   LYS B CA  
1448 C C   . LYS B 67  ? 0.2435 0.1938 0.3021 -0.0616 -0.0138 0.0124  67   LYS B C   
1449 O O   . LYS B 67  ? 0.2308 0.1732 0.2853 -0.0644 -0.0285 0.0172  67   LYS B O   
1450 C CB  . LYS B 67  ? 0.2629 0.2247 0.3559 -0.0712 0.0045  0.0090  67   LYS B CB  
1451 C CG  . LYS B 67  ? 0.2906 0.2583 0.4201 -0.0738 -0.0118 0.0132  67   LYS B CG  
1452 C CD  . LYS B 67  ? 0.2938 0.2822 0.4815 -0.0740 -0.0036 0.0070  67   LYS B CD  
1453 C CE  . LYS B 67  ? 0.3325 0.3293 0.5655 -0.0796 -0.0195 0.0110  67   LYS B CE  
1454 N NZ  . LYS B 67  ? 0.3754 0.3561 0.5936 -0.0802 -0.0507 0.0216  67   LYS B NZ  
1455 N N   . ILE B 68  ? 0.2388 0.1953 0.3012 -0.0573 -0.0063 0.0078  68   ILE B N   
1456 C CA  . ILE B 68  ? 0.2381 0.1950 0.3115 -0.0551 -0.0150 0.0090  68   ILE B CA  
1457 C C   . ILE B 68  ? 0.2395 0.2068 0.3527 -0.0524 -0.0083 0.0035  68   ILE B C   
1458 O O   . ILE B 68  ? 0.2345 0.2090 0.3568 -0.0533 0.0087  -0.0036 68   ILE B O   
1459 C CB  . ILE B 68  ? 0.2349 0.1883 0.2818 -0.0529 -0.0128 0.0070  68   ILE B CB  
1460 C CG1 . ILE B 68  ? 0.2323 0.1911 0.2770 -0.0498 0.0004  -0.0002 68   ILE B CG1 
1461 C CG2 . ILE B 68  ? 0.2246 0.1710 0.2429 -0.0541 -0.0148 0.0082  68   ILE B CG2 
1462 C CD1 . ILE B 68  ? 0.2315 0.1902 0.2623 -0.0484 0.0001  -0.0026 68   ILE B CD1 
1463 N N   . GLU B 69  ? 0.2479 0.2128 0.3839 -0.0504 -0.0214 0.0061  69   GLU B N   
1464 C CA  . GLU B 69  ? 0.2481 0.2213 0.4286 -0.0453 -0.0161 -0.0014 69   GLU B CA  
1465 C C   . GLU B 69  ? 0.2479 0.2160 0.4100 -0.0424 -0.0074 -0.0073 69   GLU B C   
1466 O O   . GLU B 69  ? 0.2604 0.2173 0.4134 -0.0425 -0.0209 -0.0019 69   GLU B O   
1467 C CB  . GLU B 69  ? 0.2598 0.2285 0.4791 -0.0436 -0.0406 0.0055  69   GLU B CB  
1468 C CG  . GLU B 69  ? 0.2904 0.2629 0.5323 -0.0479 -0.0553 0.0122  69   GLU B CG  
1469 C CD  . GLU B 69  ? 0.3353 0.3307 0.6247 -0.0472 -0.0370 0.0019  69   GLU B CD  
1470 O OE1 . GLU B 69  ? 0.3712 0.3788 0.6912 -0.0421 -0.0158 -0.0116 69   GLU B OE1 
1471 O OE2 . GLU B 69  ? 0.3455 0.3452 0.6407 -0.0537 -0.0422 0.0062  69   GLU B OE2 
1472 N N   . VAL B 70  ? 0.2491 0.2217 0.4002 -0.0426 0.0141  -0.0177 70   VAL B N   
1473 C CA  . VAL B 70  ? 0.2641 0.2298 0.3936 -0.0418 0.0206  -0.0238 70   VAL B CA  
1474 C C   . VAL B 70  ? 0.2666 0.2273 0.4272 -0.0369 0.0155  -0.0283 70   VAL B C   
1475 O O   . VAL B 70  ? 0.2849 0.2358 0.4273 -0.0377 0.0104  -0.0276 70   VAL B O   
1476 C CB  . VAL B 70  ? 0.2728 0.2374 0.3790 -0.0458 0.0421  -0.0343 70   VAL B CB  
1477 C CG1 . VAL B 70  ? 0.2922 0.2470 0.3784 -0.0463 0.0455  -0.0415 70   VAL B CG1 
1478 C CG2 . VAL B 70  ? 0.2836 0.2456 0.3532 -0.0503 0.0402  -0.0273 70   VAL B CG2 
1479 N N   . SER B 71  ? 0.2691 0.2358 0.4805 -0.0320 0.0150  -0.0326 71   SER B N   
1480 C CA  . SER B 71  ? 0.2797 0.2385 0.5302 -0.0251 0.0049  -0.0360 71   SER B CA  
1481 C C   . SER B 71  ? 0.2845 0.2256 0.5213 -0.0270 -0.0245 -0.0198 71   SER B C   
1482 O O   . SER B 71  ? 0.2943 0.2213 0.5525 -0.0230 -0.0364 -0.0200 71   SER B O   
1483 C CB  . SER B 71  ? 0.2809 0.2527 0.6010 -0.0182 0.0066  -0.0437 71   SER B CB  
1484 O OG  . SER B 71  ? 0.2924 0.2686 0.6307 -0.0195 -0.0158 -0.0299 71   SER B OG  
1485 N N   . GLN B 72  ? 0.2704 0.2084 0.4687 -0.0346 -0.0350 -0.0067 72   GLN B N   
1486 C CA  . GLN B 72  ? 0.2924 0.2099 0.4668 -0.0414 -0.0586 0.0080  72   GLN B CA  
1487 C C   . GLN B 72  ? 0.2865 0.1992 0.4104 -0.0497 -0.0515 0.0099  72   GLN B C   
1488 O O   . GLN B 72  ? 0.2942 0.1891 0.3921 -0.0591 -0.0648 0.0201  72   GLN B O   
1489 C CB  . GLN B 72  ? 0.2955 0.2089 0.4650 -0.0468 -0.0767 0.0203  72   GLN B CB  
1490 C CG  . GLN B 72  ? 0.3108 0.2304 0.5374 -0.0403 -0.0896 0.0203  72   GLN B CG  
1491 C CD  . GLN B 72  ? 0.3564 0.2583 0.6194 -0.0358 -0.1136 0.0248  72   GLN B CD  
1492 O OE1 . GLN B 72  ? 0.3760 0.2492 0.6092 -0.0444 -0.1386 0.0394  72   GLN B OE1 
1493 N NE2 . GLN B 72  ? 0.3537 0.2694 0.6807 -0.0233 -0.1058 0.0116  72   GLN B NE2 
1494 N N   . LEU B 73  ? 0.2767 0.2038 0.3863 -0.0481 -0.0312 0.0002  73   LEU B N   
1495 C CA  . LEU B 73  ? 0.2814 0.2093 0.3542 -0.0549 -0.0262 0.0011  73   LEU B CA  
1496 C C   . LEU B 73  ? 0.2880 0.2032 0.3532 -0.0607 -0.0310 0.0021  73   LEU B C   
1497 O O   . LEU B 73  ? 0.2898 0.2006 0.3301 -0.0707 -0.0329 0.0074  73   LEU B O   
1498 C CB  . LEU B 73  ? 0.2799 0.2218 0.3425 -0.0518 -0.0103 -0.0083 73   LEU B CB  
1499 C CG  . LEU B 73  ? 0.3170 0.2679 0.3599 -0.0527 -0.0069 -0.0064 73   LEU B CG  
1500 C CD1 . LEU B 73  ? 0.3282 0.2848 0.3597 -0.0510 0.0017  -0.0141 73   LEU B CD1 
1501 C CD2 . LEU B 73  ? 0.3005 0.2492 0.3257 -0.0597 -0.0118 -0.0009 73   LEU B CD2 
1502 N N   . LEU B 74  ? 0.2904 0.1987 0.3774 -0.0556 -0.0304 -0.0046 74   LEU B N   
1503 C CA  . LEU B 74  ? 0.3092 0.2020 0.3890 -0.0617 -0.0355 -0.0043 74   LEU B CA  
1504 C C   . LEU B 74  ? 0.3332 0.2023 0.4045 -0.0709 -0.0555 0.0105  74   LEU B C   
1505 O O   . LEU B 74  ? 0.3435 0.1984 0.3960 -0.0820 -0.0594 0.0145  74   LEU B O   
1506 C CB  . LEU B 74  ? 0.3154 0.2024 0.4192 -0.0539 -0.0292 -0.0174 74   LEU B CB  
1507 C CG  . LEU B 74  ? 0.3206 0.2223 0.4153 -0.0510 -0.0094 -0.0314 74   LEU B CG  
1508 C CD1 . LEU B 74  ? 0.3364 0.2266 0.4450 -0.0469 -0.0001 -0.0468 74   LEU B CD1 
1509 C CD2 . LEU B 74  ? 0.3251 0.2360 0.3870 -0.0592 -0.0071 -0.0299 74   LEU B CD2 
1510 N N   . LYS B 75  ? 0.3322 0.1948 0.4141 -0.0688 -0.0695 0.0192  75   LYS B N   
1511 C CA  . LYS B 75  ? 0.3690 0.2033 0.4295 -0.0812 -0.0921 0.0358  75   LYS B CA  
1512 C C   . LYS B 75  ? 0.3695 0.2058 0.3829 -0.0961 -0.0845 0.0411  75   LYS B C   
1513 O O   . LYS B 75  ? 0.4144 0.2238 0.3941 -0.1122 -0.0978 0.0537  75   LYS B O   
1514 C CB  . LYS B 75  ? 0.3772 0.2023 0.4669 -0.0745 -0.1143 0.0434  75   LYS B CB  
1515 C CG  . LYS B 75  ? 0.3968 0.2197 0.5454 -0.0590 -0.1228 0.0367  75   LYS B CG  
1516 C CD  . LYS B 75  ? 0.4039 0.2252 0.5938 -0.0519 -0.1456 0.0430  75   LYS B CD  
1517 C CE  . LYS B 75  ? 0.3979 0.2384 0.6624 -0.0326 -0.1376 0.0268  75   LYS B CE  
1518 N NZ  . LYS B 75  ? 0.4354 0.2672 0.7579 -0.0250 -0.1694 0.0339  75   LYS B NZ  
1519 N N   . GLY B 76  ? 0.3263 0.1908 0.3365 -0.0918 -0.0636 0.0311  76   GLY B N   
1520 C CA  . GLY B 76  ? 0.3335 0.2035 0.3096 -0.1029 -0.0526 0.0314  76   GLY B CA  
1521 C C   . GLY B 76  ? 0.3336 0.2038 0.3014 -0.1016 -0.0565 0.0346  76   GLY B C   
1522 O O   . GLY B 76  ? 0.3531 0.2227 0.2913 -0.1110 -0.0475 0.0335  76   GLY B O   
1523 N N   . ASP B 77  ? 0.3145 0.1861 0.3115 -0.0905 -0.0680 0.0364  77   ASP B N   
1524 C CA  . ASP B 77  ? 0.3117 0.1844 0.3072 -0.0892 -0.0737 0.0392  77   ASP B CA  
1525 C C   . ASP B 77  ? 0.2767 0.1768 0.2845 -0.0784 -0.0543 0.0280  77   ASP B C   
1526 O O   . ASP B 77  ? 0.2572 0.1721 0.2956 -0.0674 -0.0478 0.0215  77   ASP B O   
1527 C CB  . ASP B 77  ? 0.3181 0.1816 0.3484 -0.0837 -0.0967 0.0462  77   ASP B CB  
1528 C CG  . ASP B 77  ? 0.3165 0.1812 0.3502 -0.0841 -0.1060 0.0497  77   ASP B CG  
1529 O OD1 . ASP B 77  ? 0.3199 0.1869 0.3226 -0.0892 -0.0955 0.0472  77   ASP B OD1 
1530 O OD2 . ASP B 77  ? 0.2780 0.1406 0.3498 -0.0794 -0.1251 0.0543  77   ASP B OD2 
1531 N N   . ALA B 78  ? 0.2764 0.1791 0.2577 -0.0829 -0.0451 0.0253  78   ALA B N   
1532 C CA  . ALA B 78  ? 0.2553 0.1773 0.2437 -0.0737 -0.0312 0.0168  78   ALA B CA  
1533 C C   . ALA B 78  ? 0.2523 0.1677 0.2317 -0.0753 -0.0365 0.0193  78   ALA B C   
1534 O O   . ALA B 78  ? 0.2395 0.1618 0.2128 -0.0713 -0.0270 0.0135  78   ALA B O   
1535 C CB  . ALA B 78  ? 0.2395 0.1711 0.2142 -0.0752 -0.0166 0.0089  78   ALA B CB  
1536 N N   . SER B 79  ? 0.2801 0.1794 0.2598 -0.0814 -0.0547 0.0283  79   SER B N   
1537 C CA  . SER B 79  ? 0.2919 0.1789 0.2570 -0.0872 -0.0642 0.0319  79   SER B CA  
1538 C C   . SER B 79  ? 0.2801 0.1827 0.2675 -0.0783 -0.0576 0.0274  79   SER B C   
1539 O O   . SER B 79  ? 0.2547 0.1735 0.2775 -0.0703 -0.0538 0.0256  79   SER B O   
1540 C CB  . SER B 79  ? 0.3151 0.1810 0.2826 -0.0957 -0.0918 0.0441  79   SER B CB  
1541 O OG  . SER B 79  ? 0.3329 0.1749 0.2672 -0.1082 -0.1002 0.0506  79   SER B OG  
1542 N N   . LEU B 80  ? 0.2955 0.1898 0.2589 -0.0817 -0.0547 0.0247  80   LEU B N   
1543 C CA  . LEU B 80  ? 0.2893 0.1916 0.2640 -0.0761 -0.0487 0.0213  80   LEU B CA  
1544 C C   . LEU B 80  ? 0.3019 0.1964 0.2886 -0.0825 -0.0653 0.0280  80   LEU B C   
1545 O O   . LEU B 80  ? 0.3323 0.2060 0.2959 -0.0930 -0.0806 0.0326  80   LEU B O   
1546 C CB  . LEU B 80  ? 0.2944 0.1897 0.2419 -0.0747 -0.0378 0.0135  80   LEU B CB  
1547 C CG  . LEU B 80  ? 0.2929 0.1912 0.2479 -0.0684 -0.0327 0.0109  80   LEU B CG  
1548 C CD1 . LEU B 80  ? 0.2881 0.2031 0.2627 -0.0605 -0.0243 0.0102  80   LEU B CD1 
1549 C CD2 . LEU B 80  ? 0.3243 0.2101 0.2565 -0.0660 -0.0265 0.0025  80   LEU B CD2 
1550 N N   . LYS B 81  ? 0.2946 0.2048 0.3167 -0.0785 -0.0621 0.0279  81   LYS B N   
1551 C CA  . LYS B 81  ? 0.3115 0.2206 0.3562 -0.0849 -0.0754 0.0326  81   LYS B CA  
1552 C C   . LYS B 81  ? 0.3084 0.2170 0.3467 -0.0862 -0.0652 0.0295  81   LYS B C   
1553 O O   . LYS B 81  ? 0.2941 0.2097 0.3279 -0.0804 -0.0478 0.0249  81   LYS B O   
1554 C CB  . LYS B 81  ? 0.3031 0.2324 0.4038 -0.0817 -0.0779 0.0334  81   LYS B CB  
1555 C CG  . LYS B 81  ? 0.3242 0.2480 0.4340 -0.0806 -0.0939 0.0381  81   LYS B CG  
1556 C CD  . LYS B 81  ? 0.3227 0.2669 0.4951 -0.0737 -0.0936 0.0354  81   LYS B CD  
1557 C CE  . LYS B 81  ? 0.3404 0.2713 0.5222 -0.0731 -0.1174 0.0427  81   LYS B CE  
1558 N NZ  . LYS B 81  ? 0.3901 0.3348 0.6453 -0.0681 -0.1320 0.0426  81   LYS B NZ  
1559 N N   . MET B 82  ? 0.3313 0.2270 0.3652 -0.0954 -0.0791 0.0331  82   MET B N   
1560 C CA  . MET B 82  ? 0.3528 0.2445 0.3836 -0.0992 -0.0724 0.0317  82   MET B CA  
1561 C C   . MET B 82  ? 0.3623 0.2469 0.4084 -0.1114 -0.0913 0.0368  82   MET B C   
1562 O O   . MET B 82  ? 0.3655 0.2419 0.4143 -0.1174 -0.1136 0.0418  82   MET B O   
1563 C CB  . MET B 82  ? 0.3654 0.2365 0.3506 -0.0958 -0.0655 0.0268  82   MET B CB  
1564 C CG  . MET B 82  ? 0.4132 0.2594 0.3638 -0.1021 -0.0780 0.0255  82   MET B CG  
1565 S SD  . MET B 82  ? 0.4989 0.3248 0.4097 -0.0953 -0.0651 0.0146  82   MET B SD  
1566 C CE  . MET B 82  ? 0.4543 0.2563 0.3253 -0.1058 -0.0733 0.0107  82   MET B CE  
1567 N N   . ASP B 83  ? 0.3671 0.2517 0.4207 -0.1172 -0.0845 0.0365  83   ASP B N   
1568 C CA  . ASP B 83  ? 0.3787 0.2577 0.4502 -0.1307 -0.1017 0.0407  83   ASP B CA  
1569 C C   . ASP B 83  ? 0.4039 0.2467 0.4231 -0.1369 -0.1160 0.0404  83   ASP B C   
1570 O O   . ASP B 83  ? 0.4002 0.2254 0.3758 -0.1298 -0.1060 0.0347  83   ASP B O   
1571 C CB  . ASP B 83  ? 0.3845 0.2769 0.4847 -0.1380 -0.0864 0.0402  83   ASP B CB  
1572 C CG  . ASP B 83  ? 0.4356 0.3046 0.4908 -0.1384 -0.0738 0.0387  83   ASP B CG  
1573 O OD1 . ASP B 83  ? 0.4866 0.3301 0.4971 -0.1329 -0.0796 0.0366  83   ASP B OD1 
1574 O OD2 . ASP B 83  ? 0.4840 0.3579 0.5492 -0.1456 -0.0582 0.0393  83   ASP B OD2 
1575 N N   . LYS B 84  ? 0.4165 0.2481 0.4433 -0.1506 -0.1395 0.0449  84   LYS B N   
1576 C CA  . LYS B 84  ? 0.4584 0.2507 0.4320 -0.1599 -0.1542 0.0430  84   LYS B CA  
1577 C C   . LYS B 84  ? 0.4659 0.2369 0.4057 -0.1581 -0.1389 0.0362  84   LYS B C   
1578 O O   . LYS B 84  ? 0.5019 0.2425 0.3925 -0.1574 -0.1383 0.0287  84   LYS B O   
1579 C CB  . LYS B 84  ? 0.4821 0.2655 0.4730 -0.1772 -0.1856 0.0500  84   LYS B CB  
1580 C CG  . LYS B 84  ? 0.4775 0.2787 0.5183 -0.1862 -0.1861 0.0528  84   LYS B CG  
1581 C CD  . LYS B 84  ? 0.5042 0.2942 0.5617 -0.2043 -0.2223 0.0594  84   LYS B CD  
1582 C CE  . LYS B 84  ? 0.5090 0.3174 0.6190 -0.2162 -0.2216 0.0611  84   LYS B CE  
1583 N NZ  . LYS B 84  ? 0.5383 0.3327 0.6633 -0.2357 -0.2608 0.0672  84   LYS B NZ  
1584 N N   . SER B 85  ? 0.4536 0.2376 0.4191 -0.1582 -0.1261 0.0379  85   SER B N   
1585 C CA  . SER B 85  ? 0.4759 0.2347 0.4104 -0.1566 -0.1159 0.0338  85   SER B CA  
1586 C C   . SER B 85  ? 0.4601 0.2111 0.3640 -0.1391 -0.1017 0.0258  85   SER B C   
1587 O O   . SER B 85  ? 0.4751 0.1964 0.3436 -0.1358 -0.1019 0.0175  85   SER B O   
1588 C CB  . SER B 85  ? 0.4676 0.2393 0.4290 -0.1622 -0.1033 0.0390  85   SER B CB  
1589 O OG  . SER B 85  ? 0.4887 0.2903 0.4730 -0.1532 -0.0856 0.0399  85   SER B OG  
1590 N N   . ASP B 86  ? 0.4250 0.2034 0.3469 -0.1282 -0.0895 0.0266  86   ASP B N   
1591 C CA  . ASP B 86  ? 0.4244 0.2014 0.3271 -0.1124 -0.0773 0.0193  86   ASP B CA  
1592 C C   . ASP B 86  ? 0.4370 0.2018 0.3129 -0.1112 -0.0804 0.0112  86   ASP B C   
1593 O O   . ASP B 86  ? 0.4492 0.2014 0.3045 -0.1017 -0.0709 0.0007  86   ASP B O   
1594 C CB  . ASP B 86  ? 0.3862 0.1940 0.3132 -0.1039 -0.0652 0.0222  86   ASP B CB  
1595 C CG  . ASP B 86  ? 0.3850 0.1967 0.3219 -0.1056 -0.0560 0.0271  86   ASP B CG  
1596 O OD1 . ASP B 86  ? 0.4135 0.2008 0.3327 -0.1089 -0.0584 0.0283  86   ASP B OD1 
1597 O OD2 . ASP B 86  ? 0.3750 0.2101 0.3331 -0.1050 -0.0460 0.0295  86   ASP B OD2 
1598 N N   . ALA B 87  ? 0.4403 0.2079 0.3178 -0.1215 -0.0935 0.0158  87   ALA B N   
1599 C CA  . ALA B 87  ? 0.4673 0.2163 0.3081 -0.1265 -0.0974 0.0100  87   ALA B CA  
1600 C C   . ALA B 87  ? 0.5159 0.2264 0.3151 -0.1342 -0.0999 0.0001  87   ALA B C   
1601 O O   . ALA B 87  ? 0.5364 0.2314 0.3055 -0.1301 -0.0857 -0.0134 87   ALA B O   
1602 C CB  . ALA B 87  ? 0.4658 0.2190 0.3148 -0.1382 -0.1180 0.0204  87   ALA B CB  
1603 N N   . VAL B 88  ? 0.5419 0.2375 0.3427 -0.1460 -0.1164 0.0052  88   VAL B N   
1604 C CA  . VAL B 88  ? 0.5927 0.2470 0.3528 -0.1551 -0.1211 -0.0045 88   VAL B CA  
1605 C C   . VAL B 88  ? 0.6039 0.2455 0.3546 -0.1402 -0.1009 -0.0187 88   VAL B C   
1606 O O   . VAL B 88  ? 0.6448 0.2562 0.3578 -0.1412 -0.0928 -0.0348 88   VAL B O   
1607 C CB  . VAL B 88  ? 0.6131 0.2577 0.3869 -0.1696 -0.1420 0.0044  88   VAL B CB  
1608 C CG1 . VAL B 88  ? 0.6558 0.2592 0.3952 -0.1738 -0.1414 -0.0067 88   VAL B CG1 
1609 C CG2 . VAL B 88  ? 0.6407 0.2816 0.4126 -0.1876 -0.1692 0.0139  88   VAL B CG2 
1610 N N   . SER B 89  ? 0.5668 0.2292 0.3516 -0.1272 -0.0935 -0.0134 89   SER B N   
1611 C CA  . SER B 89  ? 0.5770 0.2263 0.3610 -0.1118 -0.0817 -0.0234 89   SER B CA  
1612 C C   . SER B 89  ? 0.5633 0.2284 0.3528 -0.0951 -0.0637 -0.0346 89   SER B C   
1613 O O   . SER B 89  ? 0.5831 0.2383 0.3789 -0.0805 -0.0558 -0.0451 89   SER B O   
1614 C CB  . SER B 89  ? 0.5658 0.2218 0.3748 -0.1090 -0.0855 -0.0110 89   SER B CB  
1615 O OG  . SER B 89  ? 0.5315 0.2245 0.3685 -0.1078 -0.0819 0.0006  89   SER B OG  
1616 N N   . HIS B 90  ? 0.5355 0.2244 0.3269 -0.0974 -0.0589 -0.0323 90   HIS B N   
1617 C CA  . HIS B 90  ? 0.5223 0.2283 0.3205 -0.0853 -0.0411 -0.0428 90   HIS B CA  
1618 C C   . HIS B 90  ? 0.5281 0.2319 0.2977 -0.0979 -0.0358 -0.0473 90   HIS B C   
1619 O O   . HIS B 90  ? 0.5043 0.2327 0.2850 -0.0975 -0.0327 -0.0411 90   HIS B O   
1620 C CB  . HIS B 90  ? 0.4883 0.2290 0.3224 -0.0740 -0.0395 -0.0323 90   HIS B CB  
1621 C CG  . HIS B 90  ? 0.5167 0.2543 0.3680 -0.0667 -0.0464 -0.0247 90   HIS B CG  
1622 N ND1 . HIS B 90  ? 0.5131 0.2546 0.3719 -0.0761 -0.0561 -0.0097 90   HIS B ND1 
1623 C CD2 . HIS B 90  ? 0.5617 0.2897 0.4233 -0.0526 -0.0457 -0.0298 90   HIS B CD2 
1624 C CE1 . HIS B 90  ? 0.5588 0.2904 0.4228 -0.0709 -0.0591 -0.0052 90   HIS B CE1 
1625 N NE2 . HIS B 90  ? 0.5914 0.3124 0.4562 -0.0561 -0.0561 -0.0159 90   HIS B NE2 
1626 N N   . THR B 91  ? 0.5678 0.2370 0.2952 -0.1112 -0.0355 -0.0578 91   THR B N   
1627 C CA  . THR B 91  ? 0.5999 0.2561 0.2857 -0.1269 -0.0284 -0.0641 91   THR B CA  
1628 C C   . THR B 91  ? 0.6063 0.2671 0.2933 -0.1173 0.0026  -0.0865 91   THR B C   
1629 O O   . THR B 91  ? 0.6051 0.2629 0.3131 -0.1020 0.0135  -0.1009 91   THR B O   
1630 C CB  . THR B 91  ? 0.6574 0.2678 0.2864 -0.1497 -0.0411 -0.0672 91   THR B CB  
1631 O OG1 . THR B 91  ? 0.7044 0.2871 0.3200 -0.1456 -0.0301 -0.0862 91   THR B OG1 
1632 C CG2 . THR B 91  ? 0.6468 0.2558 0.2849 -0.1599 -0.0740 -0.0459 91   THR B CG2 
1633 N N   . GLY B 92  ? 0.6108 0.2783 0.2791 -0.1268 0.0159  -0.0895 92   GLY B N   
1634 C CA  . GLY B 92  ? 0.6219 0.3014 0.3003 -0.1199 0.0483  -0.1112 92   GLY B CA  
1635 C C   . GLY B 92  ? 0.5833 0.2977 0.2847 -0.1181 0.0544  -0.1028 92   GLY B C   
1636 O O   . GLY B 92  ? 0.5567 0.2738 0.2462 -0.1284 0.0362  -0.0829 92   GLY B O   
1637 N N   . ASN B 93  ? 0.5729 0.3132 0.3122 -0.1045 0.0784  -0.1188 93   ASN B N   
1638 C CA  . ASN B 93  ? 0.5574 0.3262 0.3125 -0.1070 0.0905  -0.1167 93   ASN B CA  
1639 C C   . ASN B 93  ? 0.4964 0.3025 0.3076 -0.0875 0.0758  -0.1022 93   ASN B C   
1640 O O   . ASN B 93  ? 0.4775 0.2994 0.3338 -0.0669 0.0752  -0.1083 93   ASN B O   
1641 C CB  . ASN B 93  ? 0.5915 0.3680 0.3560 -0.1082 0.1280  -0.1450 93   ASN B CB  
1642 C CG  . ASN B 93  ? 0.6730 0.4120 0.3665 -0.1368 0.1480  -0.1574 93   ASN B CG  
1643 O OD1 . ASN B 93  ? 0.7036 0.4287 0.3505 -0.1594 0.1427  -0.1440 93   ASN B OD1 
1644 N ND2 . ASN B 93  ? 0.7568 0.4746 0.4384 -0.1372 0.1704  -0.1836 93   ASN B ND2 
1645 N N   . TYR B 94  ? 0.4737 0.2886 0.2782 -0.0954 0.0623  -0.0833 94   TYR B N   
1646 C CA  . TYR B 94  ? 0.4192 0.2640 0.2660 -0.0814 0.0493  -0.0697 94   TYR B CA  
1647 C C   . TYR B 94  ? 0.4093 0.2784 0.2731 -0.0835 0.0637  -0.0735 94   TYR B C   
1648 O O   . TYR B 94  ? 0.4409 0.2994 0.2723 -0.1020 0.0764  -0.0769 94   TYR B O   
1649 C CB  . TYR B 94  ? 0.4076 0.2456 0.2428 -0.0876 0.0249  -0.0480 94   TYR B CB  
1650 C CG  . TYR B 94  ? 0.4207 0.2456 0.2568 -0.0833 0.0085  -0.0415 94   TYR B CG  
1651 C CD1 . TYR B 94  ? 0.4082 0.2493 0.2774 -0.0704 -0.0019 -0.0323 94   TYR B CD1 
1652 C CD2 . TYR B 94  ? 0.4415 0.2351 0.2417 -0.0949 0.0037  -0.0445 94   TYR B CD2 
1653 C CE1 . TYR B 94  ? 0.3919 0.2203 0.2608 -0.0701 -0.0144 -0.0261 94   TYR B CE1 
1654 C CE2 . TYR B 94  ? 0.4412 0.2228 0.2441 -0.0932 -0.0118 -0.0382 94   TYR B CE2 
1655 C CZ  . TYR B 94  ? 0.4129 0.2130 0.2519 -0.0809 -0.0197 -0.0290 94   TYR B CZ  
1656 O OH  . TYR B 94  ? 0.4241 0.2122 0.2652 -0.0824 -0.0324 -0.0227 94   TYR B OH  
1657 N N   . THR B 95  ? 0.3652 0.2631 0.2757 -0.0671 0.0611  -0.0729 95   THR B N   
1658 C CA  . THR B 95  ? 0.3533 0.2760 0.2852 -0.0692 0.0709  -0.0751 95   THR B CA  
1659 C C   . THR B 95  ? 0.3191 0.2524 0.2624 -0.0648 0.0513  -0.0570 95   THR B C   
1660 O O   . THR B 95  ? 0.2863 0.2234 0.2471 -0.0518 0.0372  -0.0507 95   THR B O   
1661 C CB  . THR B 95  ? 0.3409 0.2895 0.3231 -0.0551 0.0840  -0.0927 95   THR B CB  
1662 O OG1 . THR B 95  ? 0.3821 0.3214 0.3611 -0.0571 0.1057  -0.1136 95   THR B OG1 
1663 C CG2 . THR B 95  ? 0.3359 0.3115 0.3424 -0.0605 0.0937  -0.0951 95   THR B CG2 
1664 N N   . CYS B 96  ? 0.3236 0.2576 0.2534 -0.0775 0.0518  -0.0496 96   CYS B N   
1665 C CA  . CYS B 96  ? 0.3021 0.2453 0.2447 -0.0743 0.0376  -0.0366 96   CYS B CA  
1666 C C   . CYS B 96  ? 0.2841 0.2505 0.2525 -0.0741 0.0468  -0.0427 96   CYS B C   
1667 O O   . CYS B 96  ? 0.2985 0.2645 0.2556 -0.0883 0.0606  -0.0475 96   CYS B O   
1668 C CB  . CYS B 96  ? 0.3198 0.2426 0.2323 -0.0883 0.0269  -0.0233 96   CYS B CB  
1669 S SG  . CYS B 96  ? 0.3104 0.2420 0.2425 -0.0849 0.0133  -0.0112 96   CYS B SG  
1670 N N   . GLU B 97  ? 0.2713 0.2550 0.2708 -0.0606 0.0385  -0.0424 97   GLU B N   
1671 C CA  . GLU B 97  ? 0.2572 0.2636 0.2864 -0.0597 0.0420  -0.0480 97   GLU B CA  
1672 C C   . GLU B 97  ? 0.2364 0.2425 0.2650 -0.0591 0.0283  -0.0373 97   GLU B C   
1673 O O   . GLU B 97  ? 0.2304 0.2301 0.2563 -0.0506 0.0162  -0.0309 97   GLU B O   
1674 C CB  . GLU B 97  ? 0.2508 0.2742 0.3181 -0.0449 0.0399  -0.0584 97   GLU B CB  
1675 C CG  . GLU B 97  ? 0.2620 0.3101 0.3672 -0.0429 0.0366  -0.0633 97   GLU B CG  
1676 C CD  . GLU B 97  ? 0.2766 0.3343 0.4181 -0.0261 0.0209  -0.0675 97   GLU B CD  
1677 O OE1 . GLU B 97  ? 0.3363 0.4059 0.5114 -0.0188 0.0286  -0.0811 97   GLU B OE1 
1678 O OE2 . GLU B 97  ? 0.3179 0.3682 0.4529 -0.0212 0.0004  -0.0577 97   GLU B OE2 
1679 N N   . VAL B 98  ? 0.2286 0.2395 0.2580 -0.0699 0.0324  -0.0366 98   VAL B N   
1680 C CA  . VAL B 98  ? 0.2194 0.2269 0.2481 -0.0703 0.0215  -0.0292 98   VAL B CA  
1681 C C   . VAL B 98  ? 0.2101 0.2364 0.2638 -0.0729 0.0223  -0.0356 98   VAL B C   
1682 O O   . VAL B 98  ? 0.2059 0.2447 0.2718 -0.0820 0.0351  -0.0429 98   VAL B O   
1683 C CB  . VAL B 98  ? 0.2301 0.2172 0.2343 -0.0817 0.0195  -0.0199 98   VAL B CB  
1684 C CG1 . VAL B 98  ? 0.2161 0.1986 0.2257 -0.0801 0.0098  -0.0155 98   VAL B CG1 
1685 C CG2 . VAL B 98  ? 0.2279 0.1981 0.2134 -0.0801 0.0148  -0.0136 98   VAL B CG2 
1686 N N   . THR B 99  ? 0.2019 0.2291 0.2623 -0.0667 0.0095  -0.0338 99   THR B N   
1687 C CA  . THR B 99  ? 0.2069 0.2493 0.2904 -0.0697 0.0045  -0.0390 99   THR B CA  
1688 C C   . THR B 99  ? 0.2034 0.2312 0.2713 -0.0739 -0.0036 -0.0344 99   THR B C   
1689 O O   . THR B 99  ? 0.2113 0.2232 0.2606 -0.0682 -0.0086 -0.0304 99   THR B O   
1690 C CB  . THR B 99  ? 0.2035 0.2567 0.3091 -0.0580 -0.0090 -0.0431 99   THR B CB  
1691 O OG1 . THR B 99  ? 0.2195 0.2823 0.3424 -0.0504 -0.0028 -0.0486 99   THR B OG1 
1692 C CG2 . THR B 99  ? 0.2041 0.2754 0.3407 -0.0623 -0.0183 -0.0487 99   THR B CG2 
1693 N N   . GLU B 100 ? 0.2199 0.2521 0.2962 -0.0851 -0.0024 -0.0365 100  GLU B N   
1694 C CA  . GLU B 100 ? 0.2312 0.2499 0.2976 -0.0885 -0.0117 -0.0358 100  GLU B CA  
1695 C C   . GLU B 100 ? 0.2343 0.2686 0.3229 -0.0904 -0.0232 -0.0419 100  GLU B C   
1696 O O   . GLU B 100 ? 0.2120 0.2669 0.3289 -0.0985 -0.0194 -0.0463 100  GLU B O   
1697 C CB  . GLU B 100 ? 0.2470 0.2528 0.3049 -0.1013 -0.0065 -0.0325 100  GLU B CB  
1698 C CG  . GLU B 100 ? 0.2576 0.2433 0.2960 -0.1002 -0.0030 -0.0249 100  GLU B CG  
1699 C CD  . GLU B 100 ? 0.2790 0.2455 0.3078 -0.1136 -0.0036 -0.0198 100  GLU B CD  
1700 O OE1 . GLU B 100 ? 0.2960 0.2403 0.3136 -0.1109 -0.0086 -0.0134 100  GLU B OE1 
1701 O OE2 . GLU B 100 ? 0.2868 0.2595 0.3221 -0.1275 -0.0006 -0.0219 100  GLU B OE2 
1702 N N   . LEU B 101 ? 0.2191 0.2311 0.3079 -0.0794 0.0227  -0.0409 101  LEU B N   
1703 C CA  . LEU B 101 ? 0.2232 0.2377 0.3544 -0.0590 0.0074  -0.0601 101  LEU B CA  
1704 C C   . LEU B 101 ? 0.1987 0.2453 0.3261 -0.0600 0.0316  -0.0661 101  LEU B C   
1705 O O   . LEU B 101 ? 0.1761 0.2290 0.2627 -0.0761 0.0508  -0.0453 101  LEU B O   
1706 C CB  . LEU B 101 ? 0.2732 0.2319 0.3835 -0.0624 -0.0357 -0.0206 101  LEU B CB  
1707 C CG  . LEU B 101 ? 0.3297 0.2380 0.4384 -0.0688 -0.0738 -0.0125 101  LEU B CG  
1708 C CD1 . LEU B 101 ? 0.4484 0.2952 0.4763 -0.1147 -0.1006 0.0381  101  LEU B CD1 
1709 C CD2 . LEU B 101 ? 0.3762 0.2604 0.5751 -0.0367 -0.1279 -0.0627 101  LEU B CD2 
1710 N N   . THR B 102 ? 0.2010 0.2601 0.3879 -0.0411 0.0157  -0.1016 102  THR B N   
1711 C CA  . THR B 102 ? 0.1880 0.2791 0.3806 -0.0419 0.0358  -0.1125 102  THR B CA  
1712 C C   . THR B 102 ? 0.1801 0.2473 0.3151 -0.0464 0.0329  -0.0561 102  THR B C   
1713 O O   . THR B 102 ? 0.2054 0.2325 0.3077 -0.0548 0.0081  -0.0230 102  THR B O   
1714 C CB  . THR B 102 ? 0.2030 0.3094 0.5035 -0.0139 0.0002  -0.1706 102  THR B CB  
1715 O OG1 . THR B 102 ? 0.2426 0.3939 0.6411 -0.0102 0.0068  -0.2558 102  THR B OG1 
1716 C CG2 . THR B 102 ? 0.1566 0.3104 0.4736 -0.0195 0.0293  -0.1946 102  THR B CG2 
1717 N N   . ARG B 103 ? 0.1664 0.2592 0.2848 -0.0550 0.0606  -0.0552 103  ARG B N   
1718 C CA  . ARG B 103 ? 0.1652 0.2555 0.2626 -0.0575 0.0628  -0.0305 103  ARG B CA  
1719 C C   . ARG B 103 ? 0.1573 0.2671 0.2702 -0.0517 0.0679  -0.0467 103  ARG B C   
1720 O O   . ARG B 103 ? 0.1575 0.2925 0.2845 -0.0596 0.0859  -0.0749 103  ARG B O   
1721 C CB  . ARG B 103 ? 0.1601 0.2549 0.2543 -0.0665 0.0723  -0.0214 103  ARG B CB  
1722 C CG  . ARG B 103 ? 0.1652 0.2504 0.2659 -0.0717 0.0648  -0.0153 103  ARG B CG  
1723 C CD  . ARG B 103 ? 0.1793 0.2806 0.3341 -0.0720 0.0575  -0.0297 103  ARG B CD  
1724 N NE  . ARG B 103 ? 0.1910 0.2568 0.3465 -0.0697 0.0232  -0.0231 103  ARG B NE  
1725 C CZ  . ARG B 103 ? 0.1972 0.2577 0.4223 -0.0599 -0.0113 -0.0420 103  ARG B CZ  
1726 N NH1 . ARG B 103 ? 0.1713 0.2949 0.5027 -0.0489 0.0042  -0.0933 103  ARG B NH1 
1727 N NH2 . ARG B 103 ? 0.2405 0.2275 0.4299 -0.0734 -0.0672 -0.0194 103  ARG B NH2 
1728 N N   . GLU B 104 ? 0.1707 0.2690 0.2681 -0.0537 0.0554  -0.0340 104  GLU B N   
1729 C CA  . GLU B 104 ? 0.1677 0.2815 0.2815 -0.0472 0.0547  -0.0476 104  GLU B CA  
1730 C C   . GLU B 104 ? 0.1739 0.2849 0.2464 -0.0664 0.0629  -0.0337 104  GLU B C   
1731 O O   . GLU B 104 ? 0.1998 0.3027 0.2305 -0.0969 0.0720  -0.0251 104  GLU B O   
1732 C CB  . GLU B 104 ? 0.1968 0.2933 0.3629 -0.0287 0.0061  -0.0707 104  GLU B CB  
1733 C CG  . GLU B 104 ? 0.3127 0.3246 0.4307 -0.0425 -0.0647 -0.0366 104  GLU B CG  
1734 C CD  . GLU B 104 ? 0.3805 0.3487 0.5758 -0.0175 -0.1536 -0.0618 104  GLU B CD  
1735 O OE1 . GLU B 104 ? 0.4409 0.4471 0.6952 -0.0010 -0.1517 -0.0936 104  GLU B OE1 
1736 O OE2 . GLU B 104 ? 0.5418 0.4293 0.7538 -0.0135 -0.2404 -0.0547 104  GLU B OE2 
1737 N N   . GLY B 105 ? 0.1527 0.2802 0.2394 -0.0602 0.0668  -0.0449 105  GLY B N   
1738 C CA  . GLY B 105 ? 0.1741 0.3074 0.2295 -0.0814 0.0782  -0.0464 105  GLY B CA  
1739 C C   . GLY B 105 ? 0.1615 0.3054 0.2395 -0.0681 0.0712  -0.0572 105  GLY B C   
1740 O O   . GLY B 105 ? 0.1329 0.2959 0.2574 -0.0504 0.0734  -0.0725 105  GLY B O   
1741 N N   . GLU B 106 ? 0.2065 0.3428 0.2439 -0.0915 0.0687  -0.0580 106  GLU B N   
1742 C CA  . GLU B 106 ? 0.2006 0.3504 0.2612 -0.0809 0.0650  -0.0704 106  GLU B CA  
1743 C C   . GLU B 106 ? 0.2196 0.3885 0.2524 -0.1087 0.0922  -0.0885 106  GLU B C   
1744 O O   . GLU B 106 ? 0.2689 0.4438 0.2516 -0.1537 0.1150  -0.1018 106  GLU B O   
1745 C CB  . GLU B 106 ? 0.2460 0.3575 0.3147 -0.0726 0.0041  -0.0661 106  GLU B CB  
1746 C CG  . GLU B 106 ? 0.3790 0.4041 0.3527 -0.1127 -0.0580 -0.0332 106  GLU B CG  
1747 C CD  . GLU B 106 ? 0.4407 0.4012 0.4716 -0.0868 -0.1608 -0.0334 106  GLU B CD  
1748 O OE1 . GLU B 106 ? 0.4633 0.4175 0.5619 -0.0587 -0.1867 -0.0448 106  GLU B OE1 
1749 O OE2 . GLU B 106 ? 0.5156 0.4257 0.5354 -0.0952 -0.2272 -0.0293 106  GLU B OE2 
1750 N N   . THR B 107 ? 0.1932 0.3808 0.2641 -0.0926 0.0961  -0.1027 107  THR B N   
1751 C CA  . THR B 107 ? 0.2109 0.4219 0.2793 -0.1131 0.1177  -0.1341 107  THR B CA  
1752 C C   . THR B 107 ? 0.2174 0.4188 0.2867 -0.1044 0.0962  -0.1300 107  THR B C   
1753 O O   . THR B 107 ? 0.1813 0.3810 0.2887 -0.0796 0.0794  -0.1201 107  THR B O   
1754 C CB  . THR B 107 ? 0.1757 0.4194 0.3345 -0.0941 0.1351  -0.1713 107  THR B CB  
1755 O OG1 . THR B 107 ? 0.1978 0.4849 0.3891 -0.1169 0.1615  -0.2327 107  THR B OG1 
1756 C CG2 . THR B 107 ? 0.1583 0.3719 0.3521 -0.0667 0.1058  -0.1497 107  THR B CG2 
1757 N N   . ILE B 108 ? 0.2576 0.4629 0.2859 -0.1371 0.1039  -0.1505 108  ILE B N   
1758 C CA  . ILE B 108 ? 0.2793 0.4715 0.2994 -0.1362 0.0789  -0.1489 108  ILE B CA  
1759 C C   . ILE B 108 ? 0.2521 0.4830 0.3249 -0.1323 0.1088  -0.1914 108  ILE B C   
1760 O O   . ILE B 108 ? 0.2674 0.5345 0.3594 -0.1536 0.1441  -0.2400 108  ILE B O   
1761 C CB  . ILE B 108 ? 0.3949 0.5277 0.2931 -0.1930 0.0389  -0.1299 108  ILE B CB  
1762 C CG1 . ILE B 108 ? 0.4533 0.5190 0.3146 -0.1939 -0.0223 -0.0871 108  ILE B CG1 
1763 C CG2 . ILE B 108 ? 0.4249 0.5381 0.3246 -0.1896 -0.0009 -0.1304 108  ILE B CG2 
1764 C CD1 . ILE B 108 ? 0.6293 0.5905 0.3247 -0.2774 -0.0852 -0.0524 108  ILE B CD1 
1765 N N   . ILE B 109 ? 0.2291 0.4572 0.3449 -0.1078 0.0917  -0.1859 109  ILE B N   
1766 C CA  . ILE B 109 ? 0.2193 0.4601 0.3839 -0.1032 0.0976  -0.2180 109  ILE B CA  
1767 C C   . ILE B 109 ? 0.2378 0.4710 0.3786 -0.1108 0.0787  -0.2123 109  ILE B C   
1768 O O   . ILE B 109 ? 0.2213 0.4490 0.3726 -0.1004 0.0573  -0.1911 109  ILE B O   
1769 C CB  . ILE B 109 ? 0.1981 0.4146 0.4182 -0.0835 0.0791  -0.2052 109  ILE B CB  
1770 C CG1 . ILE B 109 ? 0.1882 0.3919 0.4250 -0.0743 0.0758  -0.1949 109  ILE B CG1 
1771 C CG2 . ILE B 109 ? 0.2186 0.4205 0.4987 -0.0792 0.0579  -0.2398 109  ILE B CG2 
1772 C CD1 . ILE B 109 ? 0.1511 0.3499 0.3434 -0.0786 0.0821  -0.1558 109  ILE B CD1 
1773 N N   . GLU B 110 ? 0.2755 0.5187 0.4036 -0.1312 0.0869  -0.2465 110  GLU B N   
1774 C CA  . GLU B 110 ? 0.2968 0.5296 0.4164 -0.1349 0.0626  -0.2435 110  GLU B CA  
1775 C C   . GLU B 110 ? 0.2622 0.4969 0.4556 -0.1157 0.0597  -0.2543 110  GLU B C   
1776 O O   . GLU B 110 ? 0.2516 0.4854 0.4955 -0.1090 0.0635  -0.2859 110  GLU B O   
1777 C CB  . GLU B 110 ? 0.3793 0.6082 0.4203 -0.1830 0.0672  -0.2715 110  GLU B CB  
1778 C CG  . GLU B 110 ? 0.4236 0.6251 0.4432 -0.1878 0.0221  -0.2572 110  GLU B CG  
1779 C CD  . GLU B 110 ? 0.5339 0.7130 0.4424 -0.2534 0.0184  -0.2793 110  GLU B CD  
1780 O OE1 . GLU B 110 ? 0.5997 0.8002 0.4439 -0.3088 0.0676  -0.3195 110  GLU B OE1 
1781 O OE2 . GLU B 110 ? 0.5637 0.7091 0.4498 -0.2603 -0.0310 -0.2669 110  GLU B OE2 
1782 N N   . LEU B 111 ? 0.2557 0.4891 0.4647 -0.1144 0.0440  -0.2370 111  LEU B N   
1783 C CA  . LEU B 111 ? 0.2670 0.4863 0.5060 -0.1257 0.0371  -0.2401 111  LEU B CA  
1784 C C   . LEU B 111 ? 0.2876 0.5139 0.5310 -0.1311 0.0255  -0.2628 111  LEU B C   
1785 O O   . LEU B 111 ? 0.2936 0.5386 0.5338 -0.1323 0.0123  -0.2655 111  LEU B O   
1786 C CB  . LEU B 111 ? 0.2603 0.4961 0.5076 -0.1500 0.0474  -0.2301 111  LEU B CB  
1787 C CG  . LEU B 111 ? 0.3116 0.5267 0.5474 -0.2010 0.0469  -0.2312 111  LEU B CG  
1788 C CD1 . LEU B 111 ? 0.3530 0.4749 0.5366 -0.2308 0.0153  -0.1979 111  LEU B CD1 
1789 C CD2 . LEU B 111 ? 0.3140 0.5941 0.5732 -0.2448 0.0834  -0.2607 111  LEU B CD2 
1790 N N   . LYS B 112 ? 0.3161 0.5200 0.5811 -0.1319 0.0167  -0.2856 112  LYS B N   
1791 C CA  . LYS B 112 ? 0.3520 0.5633 0.6196 -0.1394 0.0095  -0.3158 112  LYS B CA  
1792 C C   . LYS B 112 ? 0.3777 0.5551 0.6730 -0.1538 -0.0152 -0.3102 112  LYS B C   
1793 O O   . LYS B 112 ? 0.4079 0.5291 0.7176 -0.1616 -0.0418 -0.2964 112  LYS B O   
1794 C CB  . LYS B 112 ? 0.3803 0.6070 0.6696 -0.1384 0.0242  -0.3748 112  LYS B CB  
1795 C CG  . LYS B 112 ? 0.3944 0.6541 0.6233 -0.1589 0.0597  -0.3911 112  LYS B CG  
1796 C CD  . LYS B 112 ? 0.4258 0.7332 0.7136 -0.1741 0.0955  -0.4865 112  LYS B CD  
1797 C CE  . LYS B 112 ? 0.5255 0.8675 0.6943 -0.2494 0.1420  -0.5267 112  LYS B CE  
1798 N NZ  . LYS B 112 ? 0.5690 0.9901 0.8121 -0.2862 0.1968  -0.6589 112  LYS B NZ  
1799 N N   . TYR B 113 ? 0.3958 0.5910 0.6889 -0.1672 -0.0196 -0.3178 113  TYR B N   
1800 C CA  . TYR B 113 ? 0.4379 0.6007 0.7454 -0.1946 -0.0403 -0.3180 113  TYR B CA  
1801 C C   . TYR B 113 ? 0.4737 0.6248 0.8060 -0.1832 -0.0582 -0.3581 113  TYR B C   
1802 O O   . TYR B 113 ? 0.4733 0.6611 0.7883 -0.1808 -0.0489 -0.3802 113  TYR B O   
1803 C CB  . TYR B 113 ? 0.4334 0.6441 0.7514 -0.2235 -0.0267 -0.3199 113  TYR B CB  
1804 C CG  . TYR B 113 ? 0.4885 0.6712 0.8012 -0.2778 -0.0359 -0.3213 113  TYR B CG  
1805 C CD1 . TYR B 113 ? 0.5717 0.6840 0.8255 -0.3388 -0.0456 -0.2902 113  TYR B CD1 
1806 C CD2 . TYR B 113 ? 0.5078 0.7170 0.8532 -0.2835 -0.0446 -0.3489 113  TYR B CD2 
1807 C CE1 . TYR B 113 ? 0.6633 0.7260 0.8741 -0.4161 -0.0616 -0.2836 113  TYR B CE1 
1808 C CE2 . TYR B 113 ? 0.5757 0.7562 0.9070 -0.3459 -0.0513 -0.3506 113  TYR B CE2 
1809 C CZ  . TYR B 113 ? 0.6602 0.7647 0.9159 -0.4177 -0.0585 -0.3164 113  TYR B CZ  
1810 O OH  . TYR B 113 ? 0.7608 0.8139 0.9658 -0.5047 -0.0727 -0.3103 113  TYR B OH  
1811 N N   . ARG B 114 ? 0.5269 0.6152 0.9003 -0.1820 -0.0971 -0.3718 114  ARG B N   
1812 C CA  . ARG B 114 ? 0.5609 0.6428 0.9908 -0.1708 -0.1179 -0.4304 114  ARG B CA  
1813 C C   . ARG B 114 ? 0.6201 0.6423 1.0428 -0.2035 -0.1599 -0.4101 114  ARG B C   
1814 O O   . ARG B 114 ? 0.6735 0.6249 1.0531 -0.2451 -0.1911 -0.3577 114  ARG B O   
1815 C CB  . ARG B 114 ? 0.5865 0.6438 1.1230 -0.1381 -0.1507 -0.4904 114  ARG B CB  
1816 C CG  . ARG B 114 ? 0.6250 0.7117 1.2584 -0.1251 -0.1561 -0.5909 114  ARG B CG  
1817 C CD  . ARG B 114 ? 0.6461 0.7559 1.4413 -0.0891 -0.1738 -0.6942 114  ARG B CD  
1818 N NE  . ARG B 114 ? 0.7227 0.7069 1.6207 -0.0629 -0.2928 -0.6788 114  ARG B NE  
1819 C CZ  . ARG B 114 ? 0.8008 0.7097 1.8262 -0.0452 -0.3869 -0.7318 114  ARG B CZ  
1820 N NH1 . ARG B 114 ? 0.7984 0.7651 1.8732 -0.0471 -0.3585 -0.8113 114  ARG B NH1 
1821 N NH2 . ARG B 114 ? 0.9019 0.6565 1.9958 -0.0326 -0.5265 -0.7005 114  ARG B NH2 
1822 N N   . VAL B 115 ? 0.6293 0.6753 1.0744 -0.2015 -0.1590 -0.4533 115  VAL B N   
1823 C CA  . VAL B 115 ? 0.6893 0.6867 1.1267 -0.2366 -0.1946 -0.4392 115  VAL B CA  
1824 C C   . VAL B 115 ? 0.7662 0.6841 1.2856 -0.2240 -0.2650 -0.4839 115  VAL B C   
1825 O O   . VAL B 115 ? 0.7653 0.7074 1.3824 -0.1807 -0.2699 -0.5615 115  VAL B O   
1826 C CB  . VAL B 115 ? 0.6593 0.7291 1.0728 -0.2456 -0.1611 -0.4541 115  VAL B CB  
1827 C CG1 . VAL B 115 ? 0.7104 0.7453 1.1199 -0.2904 -0.1876 -0.4406 115  VAL B CG1 
1828 C CG2 . VAL B 115 ? 0.6002 0.7381 0.9769 -0.2444 -0.1220 -0.4281 115  VAL B CG2 
1829 N N   . PCA C 1   ? 0.5660 0.5889 0.3508 0.1959  0.0518  0.1828  1    PCA C N   
1830 C CA  . PCA C 1   ? 0.5482 0.5643 0.3695 0.1908  0.0731  0.2123  1    PCA C CA  
1831 C CB  . PCA C 1   ? 0.5663 0.5812 0.3921 0.2001  0.0626  0.2284  1    PCA C CB  
1832 C CG  . PCA C 1   ? 0.6228 0.6503 0.3907 0.2223  0.0423  0.2227  1    PCA C CG  
1833 C CD  . PCA C 1   ? 0.6161 0.6468 0.3583 0.2198  0.0407  0.1966  1    PCA C CD  
1834 O OE  . PCA C 1   ? 0.6681 0.7063 0.3570 0.2381  0.0302  0.1877  1    PCA C OE  
1835 C C   . PCA C 1   ? 0.4880 0.4930 0.3632 0.1666  0.0842  0.2059  1    PCA C C   
1836 O O   . PCA C 1   ? 0.4762 0.4750 0.3814 0.1624  0.1038  0.2285  1    PCA C O   
1837 N N   . LEU C 2   ? 0.4502 0.4523 0.3387 0.1514  0.0713  0.1762  2    LEU C N   
1838 C CA  . LEU C 2   ? 0.4190 0.4132 0.3446 0.1322  0.0814  0.1682  2    LEU C CA  
1839 C C   . LEU C 2   ? 0.4289 0.4309 0.3406 0.1359  0.0967  0.1732  2    LEU C C   
1840 O O   . LEU C 2   ? 0.4323 0.4427 0.3059 0.1464  0.0910  0.1619  2    LEU C O   
1841 C CB  . LEU C 2   ? 0.3860 0.3762 0.3234 0.1178  0.0655  0.1385  2    LEU C CB  
1842 C CG  . LEU C 2   ? 0.3702 0.3536 0.3310 0.1120  0.0549  0.1318  2    LEU C CG  
1843 C CD1 . LEU C 2   ? 0.3367 0.3161 0.3122 0.0971  0.0480  0.1075  2    LEU C CD1 
1844 C CD2 . LEU C 2   ? 0.3553 0.3270 0.3475 0.1099  0.0664  0.1495  2    LEU C CD2 
1845 N N   . LEU C 3   ? 0.4277 0.4269 0.3739 0.1280  0.1157  0.1897  3    LEU C N   
1846 C CA  . LEU C 3   ? 0.4409 0.4506 0.3858 0.1316  0.1344  0.1997  3    LEU C CA  
1847 C C   . LEU C 3   ? 0.4109 0.4180 0.3912 0.1126  0.1327  0.1824  3    LEU C C   
1848 O O   . LEU C 3   ? 0.3852 0.3804 0.3997 0.0966  0.1247  0.1733  3    LEU C O   
1849 C CB  . LEU C 3   ? 0.4650 0.4772 0.4305 0.1379  0.1590  0.2372  3    LEU C CB  
1850 C CG  . LEU C 3   ? 0.5054 0.5215 0.4329 0.1601  0.1638  0.2615  3    LEU C CG  
1851 C CD1 . LEU C 3   ? 0.5339 0.5492 0.4933 0.1634  0.1897  0.3028  3    LEU C CD1 
1852 C CD2 . LEU C 3   ? 0.5289 0.5590 0.3920 0.1822  0.1636  0.2561  3    LEU C CD2 
1853 N N   . PHE C 4   ? 0.4178 0.4362 0.3881 0.1166  0.1401  0.1777  4    PHE C N   
1854 C CA  . PHE C 4   ? 0.3948 0.4131 0.3946 0.1012  0.1359  0.1612  4    PHE C CA  
1855 C C   . PHE C 4   ? 0.4079 0.4383 0.4417 0.1000  0.1570  0.1797  4    PHE C C   
1856 O O   . PHE C 4   ? 0.4355 0.4783 0.4553 0.1159  0.1778  0.2017  4    PHE C O   
1857 C CB  . PHE C 4   ? 0.3844 0.4046 0.3511 0.1050  0.1219  0.1351  4    PHE C CB  
1858 C CG  . PHE C 4   ? 0.3678 0.3782 0.3128 0.1035  0.1007  0.1170  4    PHE C CG  
1859 C CD1 . PHE C 4   ? 0.3391 0.3407 0.3006 0.0884  0.0859  0.0978  4    PHE C CD1 
1860 C CD2 . PHE C 4   ? 0.3904 0.4020 0.2993 0.1184  0.0957  0.1205  4    PHE C CD2 
1861 C CE1 . PHE C 4   ? 0.3387 0.3340 0.2866 0.0873  0.0695  0.0841  4    PHE C CE1 
1862 C CE2 . PHE C 4   ? 0.3831 0.3888 0.2814 0.1163  0.0755  0.1050  4    PHE C CE2 
1863 C CZ  . PHE C 4   ? 0.3633 0.3614 0.2840 0.1004  0.0639  0.0877  4    PHE C CZ  
1864 N N   . ASN C 5   ? 0.3982 0.4260 0.4780 0.0820  0.1514  0.1715  5    ASN C N   
1865 C CA  . ASN C 5   ? 0.3985 0.4408 0.5190 0.0783  0.1658  0.1829  5    ASN C CA  
1866 C C   . ASN C 5   ? 0.3956 0.4472 0.4902 0.0854  0.1615  0.1648  5    ASN C C   
1867 O O   . ASN C 5   ? 0.3718 0.4179 0.4730 0.0745  0.1430  0.1425  5    ASN C O   
1868 C CB  . ASN C 5   ? 0.3860 0.4207 0.5660 0.0565  0.1552  0.1778  5    ASN C CB  
1869 C CG  . ASN C 5   ? 0.3946 0.4466 0.6222 0.0506  0.1627  0.1837  5    ASN C CG  
1870 O OD1 . ASN C 5   ? 0.4467 0.5177 0.6789 0.0625  0.1856  0.2036  5    ASN C OD1 
1871 N ND2 . ASN C 5   ? 0.4291 0.4756 0.6921 0.0335  0.1430  0.1663  5    ASN C ND2 
1872 N N   . LYS C 6   ? 0.4157 0.4799 0.4776 0.1055  0.1786  0.1743  6    LYS C N   
1873 C CA  . LYS C 6   ? 0.4203 0.4877 0.4473 0.1159  0.1724  0.1534  6    LYS C CA  
1874 C C   . LYS C 6   ? 0.3987 0.4778 0.4633 0.1105  0.1751  0.1486  6    LYS C C   
1875 O O   . LYS C 6   ? 0.3994 0.4929 0.5127 0.1062  0.1910  0.1680  6    LYS C O   
1876 C CB  . LYS C 6   ? 0.4656 0.5407 0.4401 0.1424  0.1886  0.1611  6    LYS C CB  
1877 C CG  . LYS C 6   ? 0.4905 0.5540 0.4144 0.1515  0.1764  0.1561  6    LYS C CG  
1878 C CD  . LYS C 6   ? 0.5424 0.6138 0.4088 0.1802  0.1896  0.1600  6    LYS C CD  
1879 C CE  . LYS C 6   ? 0.5782 0.6414 0.3948 0.1919  0.1768  0.1586  6    LYS C CE  
1880 N NZ  . LYS C 6   ? 0.6375 0.7096 0.3950 0.2227  0.1918  0.1666  6    LYS C NZ  
1881 N N   . THR C 7   ? 0.3819 0.4550 0.4277 0.1108  0.1588  0.1239  7    THR C N   
1882 C CA  . THR C 7   ? 0.3729 0.4567 0.4438 0.1112  0.1602  0.1179  7    THR C CA  
1883 C C   . THR C 7   ? 0.3807 0.4605 0.4057 0.1291  0.1585  0.1003  7    THR C C   
1884 O O   . THR C 7   ? 0.3686 0.4315 0.3642 0.1265  0.1383  0.0799  7    THR C O   
1885 C CB  . THR C 7   ? 0.3455 0.4216 0.4470 0.0910  0.1363  0.1033  7    THR C CB  
1886 O OG1 . THR C 7   ? 0.3517 0.4287 0.4967 0.0746  0.1340  0.1144  7    THR C OG1 
1887 C CG2 . THR C 7   ? 0.3398 0.4281 0.4663 0.0942  0.1367  0.0989  7    THR C CG2 
1888 N N   . LYS C 8   ? 0.3994 0.4944 0.4229 0.1472  0.1801  0.1077  8    LYS C N   
1889 C CA  . LYS C 8   ? 0.4185 0.5081 0.4008 0.1668  0.1797  0.0886  8    LYS C CA  
1890 C C   . LYS C 8   ? 0.3888 0.4661 0.3826 0.1572  0.1564  0.0659  8    LYS C C   
1891 O O   . LYS C 8   ? 0.3893 0.4485 0.3480 0.1615  0.1401  0.0443  8    LYS C O   
1892 C CB  . LYS C 8   ? 0.4527 0.5635 0.4411 0.1885  0.2108  0.1026  8    LYS C CB  
1893 C CG  . LYS C 8   ? 0.4756 0.5818 0.4370 0.2086  0.2118  0.0814  8    LYS C CG  
1894 C CD  . LYS C 8   ? 0.5164 0.6456 0.4818 0.2331  0.2475  0.0976  8    LYS C CD  
1895 C CE  . LYS C 8   ? 0.5439 0.6675 0.4912 0.2532  0.2485  0.0746  8    LYS C CE  
1896 N NZ  . LYS C 8   ? 0.6051 0.7476 0.5340 0.2845  0.2856  0.0863  8    LYS C NZ  
1897 N N   . SER C 9   ? 0.3528 0.4402 0.3982 0.1451  0.1544  0.0719  9    SER C N   
1898 C CA  . SER C 9   ? 0.3354 0.4138 0.3927 0.1395  0.1356  0.0555  9    SER C CA  
1899 C C   . SER C 9   ? 0.3023 0.3868 0.4081 0.1188  0.1226  0.0622  9    SER C C   
1900 O O   . SER C 9   ? 0.3018 0.4013 0.4433 0.1109  0.1313  0.0793  9    SER C O   
1901 C CB  . SER C 9   ? 0.3559 0.4429 0.4176 0.1596  0.1491  0.0513  9    SER C CB  
1902 O OG  . SER C 9   ? 0.3343 0.4482 0.4424 0.1628  0.1700  0.0719  9    SER C OG  
1903 N N   . VAL C 10  ? 0.2774 0.3490 0.3837 0.1105  0.1008  0.0491  10   VAL C N   
1904 C CA  . VAL C 10  ? 0.2572 0.3354 0.4039 0.0964  0.0862  0.0526  10   VAL C CA  
1905 C C   . VAL C 10  ? 0.2526 0.3262 0.4035 0.1026  0.0758  0.0437  10   VAL C C   
1906 O O   . VAL C 10  ? 0.2653 0.3219 0.3849 0.1109  0.0727  0.0313  10   VAL C O   
1907 C CB  . VAL C 10  ? 0.2409 0.3059 0.3809 0.0778  0.0667  0.0485  10   VAL C CB  
1908 C CG1 . VAL C 10  ? 0.2479 0.3158 0.3933 0.0704  0.0749  0.0580  10   VAL C CG1 
1909 C CG2 . VAL C 10  ? 0.2292 0.2716 0.3280 0.0774  0.0547  0.0347  10   VAL C CG2 
1910 N N   . GLU C 11  ? 0.2422 0.3304 0.4358 0.0984  0.0685  0.0503  11   GLU C N   
1911 C CA  . GLU C 11  ? 0.2427 0.3290 0.4469 0.1057  0.0591  0.0459  11   GLU C CA  
1912 C C   . GLU C 11  ? 0.2283 0.3113 0.4447 0.0926  0.0334  0.0460  11   GLU C C   
1913 O O   . GLU C 11  ? 0.2006 0.2930 0.4372 0.0799  0.0241  0.0507  11   GLU C O   
1914 C CB  . GLU C 11  ? 0.2484 0.3590 0.4937 0.1192  0.0756  0.0552  11   GLU C CB  
1915 C CG  . GLU C 11  ? 0.2697 0.3775 0.5260 0.1319  0.0705  0.0506  11   GLU C CG  
1916 C CD  . GLU C 11  ? 0.2853 0.4177 0.5798 0.1489  0.0920  0.0591  11   GLU C CD  
1917 O OE1 . GLU C 11  ? 0.2982 0.4564 0.6470 0.1438  0.0892  0.0722  11   GLU C OE1 
1918 O OE2 . GLU C 11  ? 0.3423 0.4687 0.6139 0.1680  0.1110  0.0519  11   GLU C OE2 
1919 N N   . PHE C 12  ? 0.2352 0.3035 0.4381 0.0970  0.0216  0.0407  12   PHE C N   
1920 C CA  . PHE C 12  ? 0.2356 0.3027 0.4471 0.0901  -0.0014 0.0437  12   PHE C CA  
1921 C C   . PHE C 12  ? 0.2487 0.3179 0.4808 0.1029  -0.0057 0.0471  12   PHE C C   
1922 O O   . PHE C 12  ? 0.2603 0.3241 0.4917 0.1166  0.0082  0.0432  12   PHE C O   
1923 C CB  . PHE C 12  ? 0.2324 0.2771 0.4027 0.0804  -0.0132 0.0388  12   PHE C CB  
1924 C CG  . PHE C 12  ? 0.2291 0.2512 0.3739 0.0866  -0.0113 0.0343  12   PHE C CG  
1925 C CD1 . PHE C 12  ? 0.2509 0.2617 0.3906 0.0876  -0.0248 0.0394  12   PHE C CD1 
1926 C CD2 . PHE C 12  ? 0.2140 0.2258 0.3414 0.0918  0.0026  0.0256  12   PHE C CD2 
1927 C CE1 . PHE C 12  ? 0.2473 0.2361 0.3725 0.0916  -0.0230 0.0371  12   PHE C CE1 
1928 C CE2 . PHE C 12  ? 0.2322 0.2221 0.3434 0.0959  0.0009  0.0193  12   PHE C CE2 
1929 C CZ  . PHE C 12  ? 0.2485 0.2265 0.3626 0.0949  -0.0112 0.0258  12   PHE C CZ  
1930 N N   . THR C 13  ? 0.2510 0.3286 0.5026 0.0999  -0.0260 0.0540  13   THR C N   
1931 C CA  . THR C 13  ? 0.2703 0.3506 0.5441 0.1117  -0.0345 0.0603  13   THR C CA  
1932 C C   . THR C 13  ? 0.2833 0.3472 0.5296 0.1073  -0.0558 0.0642  13   THR C C   
1933 O O   . THR C 13  ? 0.2734 0.3246 0.4839 0.0966  -0.0598 0.0606  13   THR C O   
1934 C CB  . THR C 13  ? 0.2645 0.3768 0.5949 0.1145  -0.0410 0.0689  13   THR C CB  
1935 O OG1 . THR C 13  ? 0.2596 0.3818 0.5948 0.1003  -0.0627 0.0698  13   THR C OG1 
1936 C CG2 . THR C 13  ? 0.2482 0.3804 0.6102 0.1204  -0.0148 0.0697  13   THR C CG2 
1937 N N   . PHE C 14  ? 0.3146 0.3799 0.5783 0.1173  -0.0680 0.0736  14   PHE C N   
1938 C CA  . PHE C 14  ? 0.3408 0.3927 0.5783 0.1165  -0.0871 0.0823  14   PHE C CA  
1939 C C   . PHE C 14  ? 0.3500 0.4122 0.5722 0.1055  -0.1068 0.0816  14   PHE C C   
1940 O O   . PHE C 14  ? 0.3668 0.4148 0.5485 0.1025  -0.1164 0.0847  14   PHE C O   
1941 C CB  . PHE C 14  ? 0.3717 0.4272 0.6375 0.1312  -0.0975 0.0951  14   PHE C CB  
1942 C CG  . PHE C 14  ? 0.4060 0.4390 0.6424 0.1349  -0.1068 0.1075  14   PHE C CG  
1943 C CD1 . PHE C 14  ? 0.4276 0.4323 0.6466 0.1362  -0.0921 0.1067  14   PHE C CD1 
1944 C CD2 . PHE C 14  ? 0.4388 0.4788 0.6654 0.1376  -0.1308 0.1207  14   PHE C CD2 
1945 C CE1 . PHE C 14  ? 0.4474 0.4317 0.6460 0.1389  -0.0978 0.1221  14   PHE C CE1 
1946 C CE2 . PHE C 14  ? 0.4590 0.4787 0.6560 0.1427  -0.1359 0.1365  14   PHE C CE2 
1947 C CZ  . PHE C 14  ? 0.4629 0.4549 0.6490 0.1428  -0.1178 0.1388  14   PHE C CZ  
1948 N N   . GLY C 15  ? 0.3447 0.4308 0.6004 0.1002  -0.1116 0.0768  15   GLY C N   
1949 C CA  . GLY C 15  ? 0.3542 0.4490 0.6024 0.0894  -0.1325 0.0713  15   GLY C CA  
1950 C C   . GLY C 15  ? 0.3581 0.4359 0.5612 0.0779  -0.1276 0.0610  15   GLY C C   
1951 O O   . GLY C 15  ? 0.3799 0.4560 0.5601 0.0731  -0.1475 0.0559  15   GLY C O   
1952 N N   . ASN C 16  ? 0.3418 0.4074 0.5317 0.0749  -0.1028 0.0568  16   ASN C N   
1953 C CA  . ASN C 16  ? 0.3343 0.3857 0.4882 0.0648  -0.0960 0.0479  16   ASN C CA  
1954 C C   . ASN C 16  ? 0.3601 0.3902 0.4635 0.0665  -0.0982 0.0507  16   ASN C C   
1955 O O   . ASN C 16  ? 0.3615 0.3774 0.4520 0.0698  -0.0836 0.0546  16   ASN C O   
1956 C CB  . ASN C 16  ? 0.3139 0.3615 0.4716 0.0630  -0.0704 0.0441  16   ASN C CB  
1957 C CG  . ASN C 16  ? 0.2772 0.3458 0.4798 0.0615  -0.0620 0.0442  16   ASN C CG  
1958 O OD1 . ASN C 16  ? 0.2602 0.3440 0.4988 0.0700  -0.0583 0.0503  16   ASN C OD1 
1959 N ND2 . ASN C 16  ? 0.2459 0.3154 0.4491 0.0515  -0.0566 0.0393  16   ASN C ND2 
1960 N N   . ASP C 17  ? 0.3793 0.4071 0.4553 0.0648  -0.1159 0.0484  17   ASP C N   
1961 C CA  . ASP C 17  ? 0.3947 0.4047 0.4213 0.0681  -0.1142 0.0538  17   ASP C CA  
1962 C C   . ASP C 17  ? 0.3782 0.3748 0.3854 0.0614  -0.0935 0.0484  17   ASP C C   
1963 O O   . ASP C 17  ? 0.3733 0.3564 0.3595 0.0638  -0.0820 0.0568  17   ASP C O   
1964 C CB  . ASP C 17  ? 0.4350 0.4461 0.4299 0.0702  -0.1363 0.0492  17   ASP C CB  
1965 C CG  . ASP C 17  ? 0.4681 0.4892 0.4682 0.0804  -0.1594 0.0590  17   ASP C CG  
1966 O OD1 . ASP C 17  ? 0.5035 0.5232 0.5156 0.0882  -0.1540 0.0750  17   ASP C OD1 
1967 O OD2 . ASP C 17  ? 0.5107 0.5400 0.5028 0.0813  -0.1845 0.0500  17   ASP C OD2 
1968 N N   . THR C 18  ? 0.3578 0.3589 0.3769 0.0529  -0.0894 0.0359  18   THR C N   
1969 C CA  . THR C 18  ? 0.3408 0.3323 0.3494 0.0473  -0.0709 0.0310  18   THR C CA  
1970 C C   . THR C 18  ? 0.3098 0.3103 0.3531 0.0446  -0.0602 0.0282  18   THR C C   
1971 O O   . THR C 18  ? 0.3149 0.3304 0.3908 0.0443  -0.0669 0.0277  18   THR C O   
1972 C CB  . THR C 18  ? 0.3547 0.3414 0.3420 0.0417  -0.0742 0.0200  18   THR C CB  
1973 O OG1 . THR C 18  ? 0.3886 0.3860 0.4040 0.0364  -0.0860 0.0112  18   THR C OG1 
1974 C CG2 . THR C 18  ? 0.3860 0.3649 0.3319 0.0477  -0.0839 0.0216  18   THR C CG2 
1975 N N   . VAL C 19  ? 0.2848 0.2774 0.3214 0.0437  -0.0438 0.0272  19   VAL C N   
1976 C CA  . VAL C 19  ? 0.2615 0.2602 0.3185 0.0445  -0.0307 0.0252  19   VAL C CA  
1977 C C   . VAL C 19  ? 0.2522 0.2474 0.2993 0.0380  -0.0228 0.0199  19   VAL C C   
1978 O O   . VAL C 19  ? 0.2597 0.2434 0.2825 0.0357  -0.0208 0.0180  19   VAL C O   
1979 C CB  . VAL C 19  ? 0.2564 0.2457 0.3088 0.0513  -0.0218 0.0265  19   VAL C CB  
1980 C CG1 . VAL C 19  ? 0.2466 0.2378 0.3021 0.0537  -0.0080 0.0214  19   VAL C CG1 
1981 C CG2 . VAL C 19  ? 0.2689 0.2609 0.3387 0.0598  -0.0277 0.0323  19   VAL C CG2 
1982 N N   . VAL C 20  ? 0.2379 0.2436 0.3073 0.0357  -0.0172 0.0198  20   VAL C N   
1983 C CA  . VAL C 20  ? 0.2320 0.2343 0.2966 0.0310  -0.0083 0.0177  20   VAL C CA  
1984 C C   . VAL C 20  ? 0.2313 0.2390 0.3013 0.0370  0.0080  0.0218  20   VAL C C   
1985 O O   . VAL C 20  ? 0.2232 0.2443 0.3167 0.0419  0.0145  0.0272  20   VAL C O   
1986 C CB  . VAL C 20  ? 0.2265 0.2339 0.3138 0.0229  -0.0149 0.0160  20   VAL C CB  
1987 C CG1 . VAL C 20  ? 0.2170 0.2192 0.3035 0.0195  -0.0036 0.0168  20   VAL C CG1 
1988 C CG2 . VAL C 20  ? 0.2491 0.2495 0.3232 0.0193  -0.0336 0.0080  20   VAL C CG2 
1989 N N   . ILE C 21  ? 0.2264 0.2252 0.2740 0.0382  0.0147  0.0196  21   ILE C N   
1990 C CA  . ILE C 21  ? 0.2350 0.2379 0.2787 0.0457  0.0282  0.0227  21   ILE C CA  
1991 C C   . ILE C 21  ? 0.2312 0.2336 0.2768 0.0410  0.0339  0.0273  21   ILE C C   
1992 O O   . ILE C 21  ? 0.2409 0.2331 0.2720 0.0367  0.0297  0.0234  21   ILE C O   
1993 C CB  . ILE C 21  ? 0.2404 0.2337 0.2590 0.0523  0.0280  0.0159  21   ILE C CB  
1994 C CG1 . ILE C 21  ? 0.2528 0.2408 0.2729 0.0551  0.0205  0.0115  21   ILE C CG1 
1995 C CG2 . ILE C 21  ? 0.2402 0.2387 0.2486 0.0641  0.0397  0.0170  21   ILE C CG2 
1996 C CD1 . ILE C 21  ? 0.2633 0.2395 0.2673 0.0605  0.0180  0.0030  21   ILE C CD1 
1997 N N   . PRO C 22  ? 0.2334 0.2471 0.3008 0.0426  0.0448  0.0376  22   PRO C N   
1998 C CA  . PRO C 22  ? 0.2347 0.2469 0.3123 0.0379  0.0509  0.0453  22   PRO C CA  
1999 C C   . PRO C 22  ? 0.2409 0.2479 0.2915 0.0450  0.0585  0.0483  22   PRO C C   
2000 O O   . PRO C 22  ? 0.2377 0.2482 0.2671 0.0564  0.0644  0.0485  22   PRO C O   
2001 C CB  . PRO C 22  ? 0.2352 0.2636 0.3489 0.0393  0.0634  0.0595  22   PRO C CB  
2002 C CG  . PRO C 22  ? 0.2439 0.2824 0.3491 0.0515  0.0709  0.0598  22   PRO C CG  
2003 C CD  . PRO C 22  ? 0.2354 0.2645 0.3228 0.0501  0.0545  0.0447  22   PRO C CD  
2004 N N   . CYS C 23  ? 0.2545 0.2524 0.3055 0.0394  0.0564  0.0492  23   CYS C N   
2005 C CA  . CYS C 23  ? 0.2627 0.2580 0.2955 0.0466  0.0630  0.0559  23   CYS C CA  
2006 C C   . CYS C 23  ? 0.2703 0.2586 0.3237 0.0401  0.0656  0.0635  23   CYS C C   
2007 O O   . CYS C 23  ? 0.2720 0.2494 0.3310 0.0318  0.0562  0.0536  23   CYS C O   
2008 C CB  . CYS C 23  ? 0.2681 0.2565 0.2728 0.0493  0.0532  0.0441  23   CYS C CB  
2009 S SG  . CYS C 23  ? 0.2866 0.2744 0.2696 0.0594  0.0557  0.0506  23   CYS C SG  
2010 N N   . PHE C 24  ? 0.2835 0.2772 0.3483 0.0451  0.0796  0.0818  24   PHE C N   
2011 C CA  . PHE C 24  ? 0.2822 0.2680 0.3764 0.0389  0.0838  0.0923  24   PHE C CA  
2012 C C   . PHE C 24  ? 0.2929 0.2791 0.3748 0.0498  0.0956  0.1109  24   PHE C C   
2013 O O   . PHE C 24  ? 0.2996 0.2976 0.3774 0.0598  0.1107  0.1288  24   PHE C O   
2014 C CB  . PHE C 24  ? 0.2963 0.2891 0.4355 0.0313  0.0901  0.1021  24   PHE C CB  
2015 C CG  . PHE C 24  ? 0.2862 0.2782 0.4414 0.0206  0.0747  0.0844  24   PHE C CG  
2016 C CD1 . PHE C 24  ? 0.3193 0.2963 0.4914 0.0095  0.0602  0.0709  24   PHE C CD1 
2017 C CD2 . PHE C 24  ? 0.2786 0.2843 0.4304 0.0235  0.0737  0.0809  24   PHE C CD2 
2018 C CE1 . PHE C 24  ? 0.3102 0.2870 0.4907 0.0019  0.0435  0.0544  24   PHE C CE1 
2019 C CE2 . PHE C 24  ? 0.2935 0.2995 0.4592 0.0152  0.0578  0.0668  24   PHE C CE2 
2020 C CZ  . PHE C 24  ? 0.2971 0.2891 0.4753 0.0045  0.0419  0.0539  24   PHE C CZ  
2021 N N   . VAL C 25  ? 0.2870 0.2611 0.3612 0.0498  0.0891  0.1072  25   VAL C N   
2022 C CA  . VAL C 25  ? 0.2998 0.2725 0.3660 0.0601  0.0971  0.1256  25   VAL C CA  
2023 C C   . VAL C 25  ? 0.3075 0.2718 0.4171 0.0541  0.1073  0.1433  25   VAL C C   
2024 O O   . VAL C 25  ? 0.3016 0.2522 0.4412 0.0416  0.0999  0.1321  25   VAL C O   
2025 C CB  . VAL C 25  ? 0.2978 0.2625 0.3460 0.0627  0.0852  0.1146  25   VAL C CB  
2026 C CG1 . VAL C 25  ? 0.3058 0.2707 0.3449 0.0756  0.0905  0.1347  25   VAL C CG1 
2027 C CG2 . VAL C 25  ? 0.2806 0.2521 0.2979 0.0651  0.0735  0.0960  25   VAL C CG2 
2028 N N   . THR C 26  ? 0.3223 0.2937 0.4347 0.0639  0.1242  0.1712  26   THR C N   
2029 C CA  . THR C 26  ? 0.3331 0.2981 0.4941 0.0581  0.1370  0.1933  26   THR C CA  
2030 C C   . THR C 26  ? 0.3465 0.2959 0.5166 0.0625  0.1387  0.2074  26   THR C C   
2031 O O   . THR C 26  ? 0.3391 0.2768 0.5568 0.0554  0.1463  0.2227  26   THR C O   
2032 C CB  . THR C 26  ? 0.3509 0.3342 0.5181 0.0667  0.1599  0.2218  26   THR C CB  
2033 O OG1 . THR C 26  ? 0.3689 0.3637 0.4808 0.0874  0.1667  0.2322  26   THR C OG1 
2034 C CG2 . THR C 26  ? 0.3295 0.3259 0.5119 0.0591  0.1597  0.2103  26   THR C CG2 
2035 N N   . ASN C 27  ? 0.3459 0.2951 0.4759 0.0738  0.1304  0.2022  27   ASN C N   
2036 C CA  . ASN C 27  ? 0.3662 0.3034 0.5017 0.0812  0.1309  0.2164  27   ASN C CA  
2037 C C   . ASN C 27  ? 0.3525 0.2812 0.4747 0.0808  0.1132  0.1923  27   ASN C C   
2038 O O   . ASN C 27  ? 0.3621 0.2924 0.4662 0.0934  0.1096  0.2008  27   ASN C O   
2039 C CB  . ASN C 27  ? 0.3931 0.3437 0.4955 0.1015  0.1421  0.2459  27   ASN C CB  
2040 C CG  . ASN C 27  ? 0.3888 0.3552 0.4337 0.1133  0.1307  0.2312  27   ASN C CG  
2041 O OD1 . ASN C 27  ? 0.3645 0.3339 0.3985 0.1052  0.1187  0.2028  27   ASN C OD1 
2042 N ND2 . ASN C 27  ? 0.3995 0.3747 0.4080 0.1330  0.1327  0.2501  27   ASN C ND2 
2043 N N   . MET C 28  ? 0.3363 0.2569 0.4688 0.0677  0.1027  0.1640  28   MET C N   
2044 C CA  . MET C 28  ? 0.3318 0.2442 0.4577 0.0677  0.0908  0.1434  28   MET C CA  
2045 C C   . MET C 28  ? 0.3512 0.2455 0.5055 0.0715  0.0939  0.1534  28   MET C C   
2046 O O   . MET C 28  ? 0.3584 0.2380 0.5491 0.0666  0.1017  0.1656  28   MET C O   
2047 C CB  . MET C 28  ? 0.3265 0.2312 0.4578 0.0549  0.0821  0.1144  28   MET C CB  
2048 C CG  . MET C 28  ? 0.3215 0.2409 0.4277 0.0509  0.0768  0.1013  28   MET C CG  
2049 S SD  . MET C 28  ? 0.3525 0.2874 0.4191 0.0590  0.0681  0.0919  28   MET C SD  
2050 C CE  . MET C 28  ? 0.3536 0.2786 0.4237 0.0557  0.0615  0.0705  28   MET C CE  
2051 N N   . GLU C 29  ? 0.3498 0.2452 0.4926 0.0802  0.0875  0.1483  29   GLU C N   
2052 C CA  . GLU C 29  ? 0.3684 0.2462 0.5381 0.0854  0.0892  0.1529  29   GLU C CA  
2053 C C   . GLU C 29  ? 0.3579 0.2258 0.5320 0.0826  0.0831  0.1246  29   GLU C C   
2054 O O   . GLU C 29  ? 0.3749 0.2211 0.5765 0.0833  0.0856  0.1198  29   GLU C O   
2055 C CB  . GLU C 29  ? 0.3810 0.2700 0.5389 0.1021  0.0884  0.1759  29   GLU C CB  
2056 C CG  . GLU C 29  ? 0.4110 0.3031 0.5692 0.1091  0.0990  0.2099  29   GLU C CG  
2057 C CD  . GLU C 29  ? 0.4393 0.3475 0.5699 0.1280  0.0945  0.2311  29   GLU C CD  
2058 O OE1 . GLU C 29  ? 0.4711 0.3854 0.5893 0.1373  0.1040  0.2600  29   GLU C OE1 
2059 O OE2 . GLU C 29  ? 0.4510 0.3668 0.5731 0.1345  0.0816  0.2199  29   GLU C OE2 
2060 N N   . ALA C 30  ? 0.3395 0.2222 0.4870 0.0806  0.0764  0.1068  30   ALA C N   
2061 C CA  . ALA C 30  ? 0.3367 0.2152 0.4839 0.0818  0.0742  0.0851  30   ALA C CA  
2062 C C   . ALA C 30  ? 0.3495 0.2029 0.5122 0.0756  0.0763  0.0658  30   ALA C C   
2063 O O   . ALA C 30  ? 0.3461 0.1917 0.5122 0.0652  0.0743  0.0602  30   ALA C O   
2064 C CB  . ALA C 30  ? 0.3106 0.2083 0.4303 0.0782  0.0686  0.0723  30   ALA C CB  
2065 N N   . GLN C 31  ? 0.3662 0.2075 0.5394 0.0832  0.0795  0.0545  31   GLN C N   
2066 C CA  . GLN C 31  ? 0.3918 0.2068 0.5733 0.0806  0.0797  0.0309  31   GLN C CA  
2067 C C   . GLN C 31  ? 0.3880 0.2067 0.5440 0.0844  0.0813  0.0074  31   GLN C C   
2068 O O   . GLN C 31  ? 0.4090 0.2070 0.5616 0.0860  0.0812  -0.0154 31   GLN C O   
2069 C CB  . GLN C 31  ? 0.4241 0.2148 0.6404 0.0887  0.0843  0.0356  31   GLN C CB  
2070 C CG  . GLN C 31  ? 0.4643 0.2464 0.7104 0.0842  0.0850  0.0609  31   GLN C CG  
2071 C CD  . GLN C 31  ? 0.4998 0.2747 0.7531 0.0684  0.0796  0.0558  31   GLN C CD  
2072 O OE1 . GLN C 31  ? 0.5737 0.3241 0.8430 0.0623  0.0740  0.0341  31   GLN C OE1 
2073 N NE2 . GLN C 31  ? 0.4951 0.2916 0.7381 0.0627  0.0805  0.0747  31   GLN C NE2 
2074 N N   . ASN C 32  ? 0.3632 0.2081 0.5011 0.0863  0.0825  0.0136  32   ASN C N   
2075 C CA  . ASN C 32  ? 0.3603 0.2143 0.4783 0.0909  0.0879  -0.0005 32   ASN C CA  
2076 C C   . ASN C 32  ? 0.3315 0.2111 0.4320 0.0839  0.0833  0.0078  32   ASN C C   
2077 O O   . ASN C 32  ? 0.3006 0.1964 0.4096 0.0841  0.0792  0.0250  32   ASN C O   
2078 C CB  . ASN C 32  ? 0.3752 0.2340 0.5122 0.1053  0.0978  0.0040  32   ASN C CB  
2079 C CG  . ASN C 32  ? 0.3859 0.2548 0.5086 0.1125  0.1089  -0.0074 32   ASN C CG  
2080 O OD1 . ASN C 32  ? 0.3476 0.2265 0.4452 0.1064  0.1084  -0.0125 32   ASN C OD1 
2081 N ND2 . ASN C 32  ? 0.4439 0.3079 0.5838 0.1271  0.1209  -0.0110 32   ASN C ND2 
2082 N N   . THR C 33  ? 0.3266 0.2085 0.4018 0.0786  0.0823  -0.0046 33   THR C N   
2083 C CA  . THR C 33  ? 0.2965 0.1992 0.3584 0.0721  0.0780  0.0024  33   THR C CA  
2084 C C   . THR C 33  ? 0.2883 0.2119 0.3622 0.0775  0.0825  0.0121  33   THR C C   
2085 O O   . THR C 33  ? 0.2604 0.2003 0.3331 0.0725  0.0758  0.0198  33   THR C O   
2086 C CB  . THR C 33  ? 0.2946 0.1948 0.3284 0.0672  0.0768  -0.0106 33   THR C CB  
2087 O OG1 . THR C 33  ? 0.2980 0.1918 0.3203 0.0765  0.0875  -0.0221 33   THR C OG1 
2088 C CG2 . THR C 33  ? 0.3150 0.2001 0.3429 0.0596  0.0671  -0.0192 33   THR C CG2 
2089 N N   . THR C 34  ? 0.3127 0.2355 0.4019 0.0882  0.0931  0.0109  34   THR C N   
2090 C CA  . THR C 34  ? 0.3056 0.2505 0.4193 0.0939  0.0967  0.0221  34   THR C CA  
2091 C C   . THR C 34  ? 0.2822 0.2410 0.4110 0.0916  0.0821  0.0365  34   THR C C   
2092 O O   . THR C 34  ? 0.2617 0.2415 0.4065 0.0912  0.0769  0.0436  34   THR C O   
2093 C CB  . THR C 34  ? 0.3328 0.2738 0.4688 0.1080  0.1096  0.0210  34   THR C CB  
2094 O OG1 . THR C 34  ? 0.4056 0.3372 0.5236 0.1140  0.1250  0.0069  34   THR C OG1 
2095 C CG2 . THR C 34  ? 0.3329 0.2998 0.5034 0.1132  0.1103  0.0347  34   THR C CG2 
2096 N N   . GLU C 35  ? 0.2854 0.2324 0.4099 0.0910  0.0754  0.0411  35   GLU C N   
2097 C CA  . GLU C 35  ? 0.2798 0.2380 0.4097 0.0927  0.0629  0.0556  35   GLU C CA  
2098 C C   . GLU C 35  ? 0.2605 0.2220 0.3655 0.0840  0.0535  0.0559  35   GLU C C   
2099 O O   . GLU C 35  ? 0.2628 0.2301 0.3621 0.0872  0.0445  0.0667  35   GLU C O   
2100 C CB  . GLU C 35  ? 0.2984 0.2431 0.4408 0.1006  0.0647  0.0659  35   GLU C CB  
2101 C CG  . GLU C 35  ? 0.3253 0.2685 0.4972 0.1124  0.0728  0.0672  35   GLU C CG  
2102 C CD  . GLU C 35  ? 0.3529 0.2723 0.5385 0.1189  0.0788  0.0715  35   GLU C CD  
2103 O OE1 . GLU C 35  ? 0.4027 0.3103 0.5806 0.1146  0.0756  0.0795  35   GLU C OE1 
2104 O OE2 . GLU C 35  ? 0.4063 0.3188 0.6145 0.1292  0.0877  0.0683  35   GLU C OE2 
2105 N N   . VAL C 36  ? 0.2442 0.2021 0.3326 0.0752  0.0559  0.0447  36   VAL C N   
2106 C CA  . VAL C 36  ? 0.2419 0.2024 0.3096 0.0682  0.0484  0.0442  36   VAL C CA  
2107 C C   . VAL C 36  ? 0.2329 0.2052 0.2959 0.0629  0.0435  0.0382  36   VAL C C   
2108 O O   . VAL C 36  ? 0.2271 0.2010 0.2964 0.0611  0.0504  0.0330  36   VAL C O   
2109 C CB  . VAL C 36  ? 0.2447 0.1893 0.3012 0.0621  0.0528  0.0390  36   VAL C CB  
2110 C CG1 . VAL C 36  ? 0.2309 0.1808 0.2709 0.0570  0.0471  0.0404  36   VAL C CG1 
2111 C CG2 . VAL C 36  ? 0.2511 0.1821 0.3213 0.0659  0.0574  0.0465  36   VAL C CG2 
2112 N N   . TYR C 37  ? 0.2359 0.2159 0.2889 0.0618  0.0324  0.0398  37   TYR C N   
2113 C CA  . TYR C 37  ? 0.2306 0.2180 0.2821 0.0565  0.0254  0.0338  37   TYR C CA  
2114 C C   . TYR C 37  ? 0.2275 0.2102 0.2558 0.0539  0.0216  0.0307  37   TYR C C   
2115 O O   . TYR C 37  ? 0.2304 0.2130 0.2463 0.0593  0.0191  0.0358  37   TYR C O   
2116 C CB  . TYR C 37  ? 0.2452 0.2469 0.3128 0.0601  0.0116  0.0356  37   TYR C CB  
2117 C CG  . TYR C 37  ? 0.2367 0.2452 0.3196 0.0533  0.0057  0.0300  37   TYR C CG  
2118 C CD1 . TYR C 37  ? 0.2555 0.2736 0.3713 0.0513  0.0107  0.0333  37   TYR C CD1 
2119 C CD2 . TYR C 37  ? 0.2587 0.2637 0.3277 0.0493  -0.0034 0.0227  37   TYR C CD2 
2120 C CE1 . TYR C 37  ? 0.2338 0.2582 0.3716 0.0441  0.0067  0.0318  37   TYR C CE1 
2121 C CE2 . TYR C 37  ? 0.2556 0.2639 0.3448 0.0424  -0.0090 0.0187  37   TYR C CE2 
2122 C CZ  . TYR C 37  ? 0.2605 0.2786 0.3857 0.0391  -0.0041 0.0244  37   TYR C CZ  
2123 O OH  . TYR C 37  ? 0.2615 0.2830 0.4141 0.0314  -0.0082 0.0240  37   TYR C OH  
2124 N N   . VAL C 38  ? 0.2176 0.1974 0.2412 0.0472  0.0229  0.0245  38   VAL C N   
2125 C CA  . VAL C 38  ? 0.2192 0.1959 0.2260 0.0455  0.0198  0.0210  38   VAL C CA  
2126 C C   . VAL C 38  ? 0.2183 0.1978 0.2288 0.0426  0.0110  0.0150  38   VAL C C   
2127 O O   . VAL C 38  ? 0.2141 0.1945 0.2394 0.0377  0.0129  0.0150  38   VAL C O   
2128 C CB  . VAL C 38  ? 0.2192 0.1875 0.2194 0.0406  0.0276  0.0194  38   VAL C CB  
2129 C CG1 . VAL C 38  ? 0.2310 0.1993 0.2204 0.0403  0.0249  0.0176  38   VAL C CG1 
2130 C CG2 . VAL C 38  ? 0.2438 0.2057 0.2479 0.0419  0.0347  0.0230  38   VAL C CG2 
2131 N N   . LYS C 39  ? 0.2316 0.2118 0.2298 0.0467  0.0024  0.0106  39   LYS C N   
2132 C CA  . LYS C 39  ? 0.2371 0.2153 0.2398 0.0443  -0.0073 0.0022  39   LYS C CA  
2133 C C   . LYS C 39  ? 0.2419 0.2152 0.2251 0.0482  -0.0067 -0.0023 39   LYS C C   
2134 O O   . LYS C 39  ? 0.2508 0.2264 0.2151 0.0566  -0.0051 -0.0012 39   LYS C O   
2135 C CB  . LYS C 39  ? 0.2510 0.2347 0.2620 0.0482  -0.0234 -0.0037 39   LYS C CB  
2136 C CG  . LYS C 39  ? 0.2808 0.2597 0.3004 0.0463  -0.0376 -0.0157 39   LYS C CG  
2137 C CD  . LYS C 39  ? 0.3094 0.2945 0.3369 0.0512  -0.0583 -0.0240 39   LYS C CD  
2138 C CE  . LYS C 39  ? 0.3327 0.3291 0.3959 0.0457  -0.0597 -0.0161 39   LYS C CE  
2139 N NZ  . LYS C 39  ? 0.3635 0.3665 0.4477 0.0472  -0.0848 -0.0262 39   LYS C NZ  
2140 N N   . TRP C 40  ? 0.2359 0.2032 0.2254 0.0432  -0.0064 -0.0053 40   TRP C N   
2141 C CA  . TRP C 40  ? 0.2435 0.2065 0.2213 0.0476  -0.0067 -0.0106 40   TRP C CA  
2142 C C   . TRP C 40  ? 0.2621 0.2179 0.2468 0.0490  -0.0198 -0.0223 40   TRP C C   
2143 O O   . TRP C 40  ? 0.2497 0.2022 0.2577 0.0414  -0.0253 -0.0222 40   TRP C O   
2144 C CB  . TRP C 40  ? 0.2321 0.1926 0.2135 0.0425  0.0016  -0.0049 40   TRP C CB  
2145 C CG  . TRP C 40  ? 0.2263 0.1916 0.2016 0.0428  0.0109  0.0019  40   TRP C CG  
2146 C CD1 . TRP C 40  ? 0.2255 0.1915 0.2045 0.0381  0.0160  0.0072  40   TRP C CD1 
2147 C CD2 . TRP C 40  ? 0.2201 0.1896 0.1903 0.0480  0.0164  0.0038  40   TRP C CD2 
2148 N NE1 . TRP C 40  ? 0.2293 0.1976 0.2082 0.0385  0.0217  0.0112  40   TRP C NE1 
2149 C CE2 . TRP C 40  ? 0.2218 0.1942 0.1979 0.0441  0.0230  0.0110  40   TRP C CE2 
2150 C CE3 . TRP C 40  ? 0.2281 0.1992 0.1921 0.0564  0.0173  0.0000  40   TRP C CE3 
2151 C CZ2 . TRP C 40  ? 0.2264 0.2051 0.2087 0.0463  0.0303  0.0169  40   TRP C CZ2 
2152 C CZ3 . TRP C 40  ? 0.2379 0.2171 0.2040 0.0607  0.0272  0.0067  40   TRP C CZ3 
2153 C CH2 . TRP C 40  ? 0.2394 0.2231 0.2178 0.0546  0.0335  0.0162  40   TRP C CH2 
2154 N N   . LYS C 41  ? 0.2812 0.2343 0.2477 0.0595  -0.0240 -0.0322 41   LYS C N   
2155 C CA  . LYS C 41  ? 0.3102 0.2530 0.2805 0.0632  -0.0393 -0.0485 41   LYS C CA  
2156 C C   . LYS C 41  ? 0.3196 0.2544 0.2818 0.0703  -0.0352 -0.0547 41   LYS C C   
2157 O O   . LYS C 41  ? 0.3108 0.2521 0.2563 0.0776  -0.0224 -0.0493 41   LYS C O   
2158 C CB  . LYS C 41  ? 0.3383 0.2833 0.2891 0.0738  -0.0531 -0.0607 41   LYS C CB  
2159 C CG  . LYS C 41  ? 0.3578 0.3132 0.3178 0.0695  -0.0581 -0.0535 41   LYS C CG  
2160 C CD  . LYS C 41  ? 0.3830 0.3399 0.3265 0.0802  -0.0784 -0.0674 41   LYS C CD  
2161 C CE  . LYS C 41  ? 0.3991 0.3662 0.3671 0.0740  -0.0888 -0.0620 41   LYS C CE  
2162 N NZ  . LYS C 41  ? 0.4641 0.4321 0.4272 0.0820  -0.1167 -0.0791 41   LYS C NZ  
2163 N N   . PHE C 42  ? 0.3315 0.2526 0.3120 0.0680  -0.0456 -0.0647 42   PHE C N   
2164 C CA  . PHE C 42  ? 0.3497 0.2602 0.3268 0.0765  -0.0443 -0.0734 42   PHE C CA  
2165 C C   . PHE C 42  ? 0.3818 0.2745 0.3707 0.0788  -0.0638 -0.0940 42   PHE C C   
2166 O O   . PHE C 42  ? 0.3684 0.2552 0.3893 0.0664  -0.0738 -0.0924 42   PHE C O   
2167 C CB  . PHE C 42  ? 0.3261 0.2351 0.3238 0.0687  -0.0347 -0.0586 42   PHE C CB  
2168 C CG  . PHE C 42  ? 0.3343 0.2328 0.3351 0.0781  -0.0335 -0.0656 42   PHE C CG  
2169 C CD1 . PHE C 42  ? 0.3309 0.2379 0.3128 0.0910  -0.0223 -0.0665 42   PHE C CD1 
2170 C CD2 . PHE C 42  ? 0.3389 0.2192 0.3659 0.0748  -0.0426 -0.0698 42   PHE C CD2 
2171 C CE1 . PHE C 42  ? 0.3401 0.2387 0.3284 0.1016  -0.0199 -0.0728 42   PHE C CE1 
2172 C CE2 . PHE C 42  ? 0.3501 0.2188 0.3829 0.0852  -0.0416 -0.0765 42   PHE C CE2 
2173 C CZ  . PHE C 42  ? 0.3589 0.2373 0.3715 0.0991  -0.0304 -0.0788 42   PHE C CZ  
2174 N N   . LYS C 43  ? 0.4246 0.3091 0.3888 0.0955  -0.0685 -0.1135 43   LYS C N   
2175 C CA  . LYS C 43  ? 0.4758 0.3403 0.4441 0.1015  -0.0905 -0.1403 43   LYS C CA  
2176 C C   . LYS C 43  ? 0.4913 0.3566 0.4725 0.0934  -0.1119 -0.1483 43   LYS C C   
2177 O O   . LYS C 43  ? 0.5014 0.3512 0.5173 0.0855  -0.1313 -0.1608 43   LYS C O   
2178 C CB  . LYS C 43  ? 0.4826 0.3265 0.4867 0.0968  -0.0937 -0.1436 43   LYS C CB  
2179 C CG  . LYS C 43  ? 0.4962 0.3366 0.4858 0.1111  -0.0788 -0.1445 43   LYS C CG  
2180 C CD  . LYS C 43  ? 0.5186 0.3347 0.5429 0.1101  -0.0850 -0.1509 43   LYS C CD  
2181 C CE  . LYS C 43  ? 0.5717 0.3622 0.5945 0.1206  -0.1070 -0.1852 43   LYS C CE  
2182 N NZ  . LYS C 43  ? 0.6055 0.3686 0.6610 0.1235  -0.1119 -0.1939 43   LYS C NZ  
2183 N N   . GLY C 44  ? 0.4924 0.3763 0.4507 0.0952  -0.1086 -0.1396 44   GLY C N   
2184 C CA  . GLY C 44  ? 0.5050 0.3944 0.4748 0.0898  -0.1288 -0.1453 44   GLY C CA  
2185 C C   . GLY C 44  ? 0.4808 0.3782 0.4994 0.0691  -0.1269 -0.1265 44   GLY C C   
2186 O O   . GLY C 44  ? 0.4966 0.4020 0.5323 0.0643  -0.1424 -0.1287 44   GLY C O   
2187 N N   . ARG C 45  ? 0.4503 0.3472 0.4908 0.0585  -0.1082 -0.1074 45   ARG C N   
2188 C CA  . ARG C 45  ? 0.4300 0.3346 0.5126 0.0417  -0.1029 -0.0884 45   ARG C CA  
2189 C C   . ARG C 45  ? 0.3875 0.3075 0.4571 0.0387  -0.0800 -0.0657 45   ARG C C   
2190 O O   . ARG C 45  ? 0.3787 0.3001 0.4202 0.0448  -0.0661 -0.0606 45   ARG C O   
2191 C CB  . ARG C 45  ? 0.4342 0.3240 0.5604 0.0310  -0.1032 -0.0835 45   ARG C CB  
2192 C CG  . ARG C 45  ? 0.4766 0.3478 0.5940 0.0380  -0.1017 -0.0918 45   ARG C CG  
2193 C CD  . ARG C 45  ? 0.5009 0.3551 0.6692 0.0273  -0.1071 -0.0876 45   ARG C CD  
2194 N NE  . ARG C 45  ? 0.5268 0.3912 0.7196 0.0151  -0.0893 -0.0580 45   ARG C NE  
2195 C CZ  . ARG C 45  ? 0.5278 0.3953 0.7054 0.0162  -0.0699 -0.0387 45   ARG C CZ  
2196 N NH1 . ARG C 45  ? 0.5549 0.4174 0.7016 0.0271  -0.0657 -0.0445 45   ARG C NH1 
2197 N NH2 . ARG C 45  ? 0.4971 0.3736 0.6911 0.0076  -0.0548 -0.0136 45   ARG C NH2 
2198 N N   . ASP C 46  ? 0.3702 0.3019 0.4646 0.0296  -0.0772 -0.0533 46   ASP C N   
2199 C CA  . ASP C 46  ? 0.3422 0.2862 0.4275 0.0271  -0.0573 -0.0346 46   ASP C CA  
2200 C C   . ASP C 46  ? 0.3236 0.2624 0.4149 0.0215  -0.0414 -0.0206 46   ASP C C   
2201 O O   . ASP C 46  ? 0.3298 0.2669 0.4533 0.0132  -0.0383 -0.0105 46   ASP C O   
2202 C CB  . ASP C 46  ? 0.3397 0.2970 0.4533 0.0211  -0.0581 -0.0265 46   ASP C CB  
2203 C CG  . ASP C 46  ? 0.3738 0.3393 0.4785 0.0282  -0.0743 -0.0371 46   ASP C CG  
2204 O OD1 . ASP C 46  ? 0.4296 0.3895 0.5026 0.0384  -0.0848 -0.0512 46   ASP C OD1 
2205 O OD2 . ASP C 46  ? 0.4164 0.3949 0.5451 0.0252  -0.0760 -0.0303 46   ASP C OD2 
2206 N N   . ILE C 47  ? 0.3000 0.2379 0.3620 0.0266  -0.0313 -0.0179 47   ILE C N   
2207 C CA  . ILE C 47  ? 0.2891 0.2224 0.3529 0.0233  -0.0203 -0.0056 47   ILE C CA  
2208 C C   . ILE C 47  ? 0.2545 0.1969 0.3066 0.0213  -0.0059 0.0075  47   ILE C C   
2209 O O   . ILE C 47  ? 0.2406 0.1807 0.2911 0.0196  0.0021  0.0184  47   ILE C O   
2210 C CB  . ILE C 47  ? 0.2945 0.2197 0.3434 0.0301  -0.0216 -0.0115 47   ILE C CB  
2211 C CG1 . ILE C 47  ? 0.3145 0.2477 0.3347 0.0377  -0.0170 -0.0157 47   ILE C CG1 
2212 C CG2 . ILE C 47  ? 0.3256 0.2377 0.3878 0.0332  -0.0353 -0.0261 47   ILE C CG2 
2213 C CD1 . ILE C 47  ? 0.2974 0.2369 0.3076 0.0360  -0.0065 -0.0047 47   ILE C CD1 
2214 N N   . TYR C 48  ? 0.2412 0.1925 0.2844 0.0229  -0.0037 0.0058  48   TYR C N   
2215 C CA  . TYR C 48  ? 0.2315 0.1888 0.2666 0.0219  0.0086  0.0146  48   TYR C CA  
2216 C C   . TYR C 48  ? 0.2235 0.1889 0.2619 0.0238  0.0079  0.0123  48   TYR C C   
2217 O O   . TYR C 48  ? 0.2067 0.1736 0.2359 0.0283  0.0004  0.0052  48   TYR C O   
2218 C CB  . TYR C 48  ? 0.2354 0.1910 0.2459 0.0246  0.0134  0.0146  48   TYR C CB  
2219 C CG  . TYR C 48  ? 0.2391 0.1970 0.2396 0.0247  0.0229  0.0186  48   TYR C CG  
2220 C CD1 . TYR C 48  ? 0.2249 0.1807 0.2183 0.0245  0.0304  0.0257  48   TYR C CD1 
2221 C CD2 . TYR C 48  ? 0.2457 0.2068 0.2428 0.0268  0.0247  0.0153  48   TYR C CD2 
2222 C CE1 . TYR C 48  ? 0.2471 0.2031 0.2266 0.0273  0.0386  0.0255  48   TYR C CE1 
2223 C CE2 . TYR C 48  ? 0.2432 0.2031 0.2332 0.0280  0.0327  0.0160  48   TYR C CE2 
2224 C CZ  . TYR C 48  ? 0.2412 0.1981 0.2210 0.0286  0.0391  0.0191  48   TYR C CZ  
2225 O OH  . TYR C 48  ? 0.2894 0.2430 0.2576 0.0323  0.0465  0.0160  48   TYR C OH  
2226 N N   . THR C 49  ? 0.2241 0.1952 0.2753 0.0221  0.0167  0.0198  49   THR C N   
2227 C CA  . THR C 49  ? 0.2141 0.1926 0.2684 0.0255  0.0183  0.0196  49   THR C CA  
2228 C C   . THR C 49  ? 0.2195 0.1979 0.2657 0.0274  0.0339  0.0250  49   THR C C   
2229 O O   . THR C 49  ? 0.2087 0.1868 0.2567 0.0263  0.0441  0.0317  49   THR C O   
2230 C CB  . THR C 49  ? 0.2217 0.2100 0.3100 0.0238  0.0107  0.0208  49   THR C CB  
2231 O OG1 . THR C 49  ? 0.2333 0.2259 0.3468 0.0195  0.0214  0.0310  49   THR C OG1 
2232 C CG2 . THR C 49  ? 0.2258 0.2114 0.3210 0.0228  -0.0086 0.0108  49   THR C CG2 
2233 N N   . PHE C 50  ? 0.2164 0.1939 0.2527 0.0317  0.0357  0.0223  50   PHE C N   
2234 C CA  . PHE C 50  ? 0.2149 0.1911 0.2487 0.0357  0.0482  0.0237  50   PHE C CA  
2235 C C   . PHE C 50  ? 0.2128 0.1973 0.2677 0.0399  0.0476  0.0263  50   PHE C C   
2236 O O   . PHE C 50  ? 0.2066 0.1912 0.2600 0.0423  0.0390  0.0252  50   PHE C O   
2237 C CB  . PHE C 50  ? 0.2261 0.1911 0.2367 0.0371  0.0496  0.0176  50   PHE C CB  
2238 C CG  . PHE C 50  ? 0.2385 0.1980 0.2464 0.0426  0.0596  0.0147  50   PHE C CG  
2239 C CD1 . PHE C 50  ? 0.2679 0.2255 0.2658 0.0466  0.0711  0.0139  50   PHE C CD1 
2240 C CD2 . PHE C 50  ? 0.2584 0.2132 0.2724 0.0456  0.0585  0.0130  50   PHE C CD2 
2241 C CE1 . PHE C 50  ? 0.2784 0.2285 0.2704 0.0544  0.0807  0.0077  50   PHE C CE1 
2242 C CE2 . PHE C 50  ? 0.2464 0.1925 0.2604 0.0517  0.0671  0.0081  50   PHE C CE2 
2243 C CZ  . PHE C 50  ? 0.2867 0.2299 0.2888 0.0563  0.0776  0.0036  50   PHE C CZ  
2244 N N   . ASP C 51  ? 0.2072 0.1999 0.2827 0.0422  0.0577  0.0318  51   ASP C N   
2245 C CA  . ASP C 51  ? 0.2113 0.2136 0.3119 0.0477  0.0587  0.0355  51   ASP C CA  
2246 C C   . ASP C 51  ? 0.2182 0.2123 0.3083 0.0555  0.0740  0.0332  51   ASP C C   
2247 O O   . ASP C 51  ? 0.2298 0.2255 0.3204 0.0592  0.0898  0.0351  51   ASP C O   
2248 C CB  . ASP C 51  ? 0.2103 0.2294 0.3500 0.0457  0.0606  0.0436  51   ASP C CB  
2249 C CG  . ASP C 51  ? 0.2192 0.2525 0.3927 0.0515  0.0571  0.0480  51   ASP C CG  
2250 O OD1 . ASP C 51  ? 0.2315 0.2599 0.3974 0.0595  0.0614  0.0469  51   ASP C OD1 
2251 O OD2 . ASP C 51  ? 0.2300 0.2790 0.4420 0.0478  0.0488  0.0528  51   ASP C OD2 
2252 N N   . GLY C 52  ? 0.2238 0.2081 0.3045 0.0589  0.0699  0.0293  52   GLY C N   
2253 C CA  . GLY C 52  ? 0.2484 0.2198 0.3214 0.0662  0.0813  0.0237  52   GLY C CA  
2254 C C   . GLY C 52  ? 0.2652 0.2447 0.3624 0.0759  0.0945  0.0275  52   GLY C C   
2255 O O   . GLY C 52  ? 0.2914 0.2610 0.3783 0.0836  0.1086  0.0206  52   GLY C O   
2256 N N   . ALA C 53  ? 0.2603 0.2578 0.3904 0.0767  0.0889  0.0372  53   ALA C N   
2257 C CA  . ALA C 53  ? 0.2674 0.2779 0.4308 0.0860  0.1007  0.0433  53   ALA C CA  
2258 C C   . ALA C 53  ? 0.2839 0.3026 0.4504 0.0878  0.1206  0.0458  53   ALA C C   
2259 O O   . ALA C 53  ? 0.3007 0.3209 0.4750 0.0993  0.1401  0.0460  53   ALA C O   
2260 C CB  . ALA C 53  ? 0.2559 0.2869 0.4568 0.0851  0.0852  0.0530  53   ALA C CB  
2261 N N   . LEU C 54  ? 0.2819 0.3049 0.4412 0.0779  0.1170  0.0488  54   LEU C N   
2262 C CA  . LEU C 54  ? 0.2960 0.3260 0.4552 0.0793  0.1365  0.0557  54   LEU C CA  
2263 C C   . LEU C 54  ? 0.3132 0.3242 0.4197 0.0824  0.1456  0.0469  54   LEU C C   
2264 O O   . LEU C 54  ? 0.3300 0.3450 0.4266 0.0885  0.1654  0.0532  54   LEU C O   
2265 C CB  . LEU C 54  ? 0.2886 0.3323 0.4743 0.0673  0.1277  0.0661  54   LEU C CB  
2266 C CG  . LEU C 54  ? 0.2908 0.3541 0.5306 0.0625  0.1127  0.0726  54   LEU C CG  
2267 C CD1 . LEU C 54  ? 0.2871 0.3593 0.5539 0.0505  0.1056  0.0805  54   LEU C CD1 
2268 C CD2 . LEU C 54  ? 0.3102 0.3913 0.5905 0.0726  0.1278  0.0810  54   LEU C CD2 
2269 N N   . ASN C 55  ? 0.3058 0.2978 0.3803 0.0794  0.1315  0.0337  55   ASN C N   
2270 C CA  . ASN C 55  ? 0.3307 0.3061 0.3591 0.0805  0.1328  0.0240  55   ASN C CA  
2271 C C   . ASN C 55  ? 0.3175 0.3001 0.3388 0.0747  0.1349  0.0345  55   ASN C C   
2272 O O   . ASN C 55  ? 0.3309 0.3112 0.3256 0.0821  0.1492  0.0368  55   ASN C O   
2273 C CB  . ASN C 55  ? 0.3832 0.3492 0.3876 0.0957  0.1512  0.0151  55   ASN C CB  
2274 C CG  . ASN C 55  ? 0.4657 0.4076 0.4432 0.0987  0.1413  -0.0051 55   ASN C CG  
2275 O OD1 . ASN C 55  ? 0.4995 0.4321 0.4706 0.0885  0.1226  -0.0109 55   ASN C OD1 
2276 N ND2 . ASN C 55  ? 0.6187 0.5504 0.5836 0.1134  0.1550  -0.0162 55   ASN C ND2 
2277 N N   . LYS C 56  ? 0.2846 0.2751 0.3294 0.0632  0.1210  0.0415  56   LYS C N   
2278 C CA  . LYS C 56  ? 0.2798 0.2749 0.3266 0.0569  0.1214  0.0524  56   LYS C CA  
2279 C C   . LYS C 56  ? 0.2482 0.2385 0.2961 0.0460  0.0996  0.0483  56   LYS C C   
2280 O O   . LYS C 56  ? 0.2156 0.2076 0.2786 0.0425  0.0856  0.0429  56   LYS C O   
2281 C CB  . LYS C 56  ? 0.2775 0.2916 0.3706 0.0554  0.1328  0.0693  56   LYS C CB  
2282 C CG  . LYS C 56  ? 0.3119 0.3349 0.4093 0.0677  0.1595  0.0776  56   LYS C CG  
2283 C CD  . LYS C 56  ? 0.3113 0.3550 0.4602 0.0646  0.1727  0.0985  56   LYS C CD  
2284 C CE  . LYS C 56  ? 0.3324 0.3874 0.4841 0.0797  0.2048  0.1091  56   LYS C CE  
2285 N NZ  . LYS C 56  ? 0.3514 0.4314 0.5699 0.0761  0.2184  0.1314  56   LYS C NZ  
2286 N N   . SER C 57  ? 0.2420 0.2265 0.2718 0.0430  0.0977  0.0518  57   SER C N   
2287 C CA  . SER C 57  ? 0.2435 0.2230 0.2737 0.0350  0.0800  0.0481  57   SER C CA  
2288 C C   . SER C 57  ? 0.2362 0.2199 0.2915 0.0294  0.0808  0.0609  57   SER C C   
2289 O O   . SER C 57  ? 0.2389 0.2260 0.2957 0.0324  0.0968  0.0748  57   SER C O   
2290 C CB  . SER C 57  ? 0.2571 0.2247 0.2492 0.0368  0.0745  0.0402  57   SER C CB  
2291 O OG  . SER C 57  ? 0.3078 0.2701 0.2860 0.0407  0.0734  0.0285  57   SER C OG  
2292 N N   . THR C 58  ? 0.2309 0.2133 0.3056 0.0225  0.0642  0.0564  58   THR C N   
2293 C CA  . THR C 58  ? 0.2297 0.2129 0.3380 0.0158  0.0608  0.0655  58   THR C CA  
2294 C C   . THR C 58  ? 0.2268 0.1978 0.3236 0.0131  0.0453  0.0571  58   THR C C   
2295 O O   . THR C 58  ? 0.2128 0.1811 0.2955 0.0144  0.0329  0.0430  58   THR C O   
2296 C CB  . THR C 58  ? 0.2234 0.2173 0.3784 0.0108  0.0526  0.0644  58   THR C CB  
2297 O OG1 . THR C 58  ? 0.2238 0.2309 0.3910 0.0152  0.0664  0.0705  58   THR C OG1 
2298 C CG2 . THR C 58  ? 0.2265 0.2202 0.4259 0.0026  0.0501  0.0749  58   THR C CG2 
2299 N N   . VAL C 59  ? 0.2372 0.2015 0.3401 0.0110  0.0482  0.0679  59   VAL C N   
2300 C CA  . VAL C 59  ? 0.2388 0.1909 0.3365 0.0099  0.0352  0.0617  59   VAL C CA  
2301 C C   . VAL C 59  ? 0.2507 0.1962 0.3888 0.0038  0.0327  0.0716  59   VAL C C   
2302 O O   . VAL C 59  ? 0.2485 0.1991 0.4114 0.0011  0.0461  0.0899  59   VAL C O   
2303 C CB  . VAL C 59  ? 0.2482 0.1947 0.3081 0.0157  0.0396  0.0658  59   VAL C CB  
2304 C CG1 . VAL C 59  ? 0.2533 0.2033 0.2810 0.0199  0.0380  0.0534  59   VAL C CG1 
2305 C CG2 . VAL C 59  ? 0.2792 0.2272 0.3338 0.0185  0.0563  0.0868  59   VAL C CG2 
2306 N N   . PRO C 60  ? 0.2577 0.1912 0.4052 0.0024  0.0166  0.0598  60   PRO C N   
2307 C CA  . PRO C 60  ? 0.2721 0.1945 0.4598 -0.0032 0.0132  0.0685  60   PRO C CA  
2308 C C   . PRO C 60  ? 0.2815 0.1956 0.4525 0.0010  0.0225  0.0851  60   PRO C C   
2309 O O   . PRO C 60  ? 0.2749 0.1913 0.4039 0.0080  0.0254  0.0833  60   PRO C O   
2310 C CB  . PRO C 60  ? 0.2686 0.1796 0.4649 -0.0032 -0.0089 0.0444  60   PRO C CB  
2311 C CG  . PRO C 60  ? 0.2541 0.1684 0.4023 0.0055  -0.0114 0.0302  60   PRO C CG  
2312 C CD  . PRO C 60  ? 0.2583 0.1871 0.3811 0.0072  0.0029  0.0392  60   PRO C CD  
2313 N N   . THR C 61  ? 0.3100 0.2143 0.5164 -0.0030 0.0259  0.1021  61   THR C N   
2314 C CA  . THR C 61  ? 0.3353 0.2327 0.5260 0.0026  0.0358  0.1231  61   THR C CA  
2315 C C   . THR C 61  ? 0.3385 0.2253 0.5032 0.0097  0.0231  0.1103  61   THR C C   
2316 O O   . THR C 61  ? 0.3488 0.2373 0.4807 0.0173  0.0281  0.1209  61   THR C O   
2317 C CB  . THR C 61  ? 0.3551 0.2428 0.5959 -0.0032 0.0433  0.1476  61   THR C CB  
2318 O OG1 . THR C 61  ? 0.3739 0.2764 0.6393 -0.0083 0.0595  0.1636  61   THR C OG1 
2319 C CG2 . THR C 61  ? 0.3863 0.2666 0.6076 0.0049  0.0533  0.1729  61   THR C CG2 
2320 N N   . ASP C 62  ? 0.3390 0.2167 0.5170 0.0086  0.0066  0.0868  62   ASP C N   
2321 C CA  . ASP C 62  ? 0.3382 0.2075 0.4977 0.0168  -0.0033 0.0737  62   ASP C CA  
2322 C C   . ASP C 62  ? 0.3205 0.2040 0.4361 0.0229  -0.0033 0.0619  62   ASP C C   
2323 O O   . ASP C 62  ? 0.3044 0.1861 0.4063 0.0302  -0.0083 0.0549  62   ASP C O   
2324 C CB  . ASP C 62  ? 0.3564 0.2091 0.5434 0.0165  -0.0191 0.0519  62   ASP C CB  
2325 C CG  . ASP C 62  ? 0.3519 0.2116 0.5319 0.0152  -0.0286 0.0272  62   ASP C CG  
2326 O OD1 . ASP C 62  ? 0.3349 0.2097 0.5091 0.0104  -0.0231 0.0309  62   ASP C OD1 
2327 O OD2 . ASP C 62  ? 0.3936 0.2430 0.5726 0.0208  -0.0417 0.0042  62   ASP C OD2 
2328 N N   . PHE C 63  ? 0.3013 0.1990 0.4007 0.0200  0.0030  0.0608  63   PHE C N   
2329 C CA  . PHE C 63  ? 0.2882 0.1979 0.3519 0.0243  0.0048  0.0544  63   PHE C CA  
2330 C C   . PHE C 63  ? 0.2931 0.2117 0.3378 0.0240  0.0169  0.0685  63   PHE C C   
2331 O O   . PHE C 63  ? 0.2719 0.1996 0.2987 0.0240  0.0198  0.0612  63   PHE C O   
2332 C CB  . PHE C 63  ? 0.2681 0.1837 0.3274 0.0238  -0.0004 0.0352  63   PHE C CB  
2333 C CG  . PHE C 63  ? 0.2659 0.1753 0.3263 0.0293  -0.0100 0.0191  63   PHE C CG  
2334 C CD1 . PHE C 63  ? 0.2715 0.1872 0.3124 0.0358  -0.0096 0.0137  63   PHE C CD1 
2335 C CD2 . PHE C 63  ? 0.2794 0.1771 0.3622 0.0289  -0.0194 0.0085  63   PHE C CD2 
2336 C CE1 . PHE C 63  ? 0.2538 0.1658 0.2943 0.0437  -0.0144 0.0000  63   PHE C CE1 
2337 C CE2 . PHE C 63  ? 0.2779 0.1686 0.3556 0.0373  -0.0273 -0.0088 63   PHE C CE2 
2338 C CZ  . PHE C 63  ? 0.2883 0.1871 0.3430 0.0456  -0.0227 -0.0121 63   PHE C CZ  
2339 N N   . SER C 64  ? 0.3052 0.2200 0.3518 0.0254  0.0246  0.0891  64   SER C N   
2340 C CA  . SER C 64  ? 0.3183 0.2410 0.3450 0.0277  0.0391  0.1030  64   SER C CA  
2341 C C   . SER C 64  ? 0.3158 0.2451 0.2989 0.0341  0.0376  0.0952  64   SER C C   
2342 O O   . SER C 64  ? 0.3182 0.2535 0.2816 0.0369  0.0482  0.0975  64   SER C O   
2343 C CB  . SER C 64  ? 0.3447 0.2628 0.3787 0.0304  0.0505  0.1304  64   SER C CB  
2344 O OG  . SER C 64  ? 0.3842 0.2966 0.3985 0.0378  0.0441  0.1385  64   SER C OG  
2345 N N   . SER C 65  ? 0.3010 0.2294 0.2734 0.0365  0.0244  0.0849  65   SER C N   
2346 C CA  . SER C 65  ? 0.3023 0.2362 0.2429 0.0407  0.0186  0.0757  65   SER C CA  
2347 C C   . SER C 65  ? 0.2757 0.2145 0.2188 0.0365  0.0157  0.0568  65   SER C C   
2348 O O   . SER C 65  ? 0.2831 0.2249 0.2065 0.0382  0.0120  0.0481  65   SER C O   
2349 C CB  . SER C 65  ? 0.2999 0.2334 0.2350 0.0456  0.0052  0.0771  65   SER C CB  
2350 O OG  . SER C 65  ? 0.2631 0.1977 0.2211 0.0430  -0.0028 0.0658  65   SER C OG  
2351 N N   . ALA C 66  ? 0.2618 0.2004 0.2290 0.0317  0.0164  0.0507  66   ALA C N   
2352 C CA  . ALA C 66  ? 0.2493 0.1926 0.2183 0.0295  0.0143  0.0367  66   ALA C CA  
2353 C C   . ALA C 66  ? 0.2558 0.2018 0.2110 0.0294  0.0213  0.0335  66   ALA C C   
2354 O O   . ALA C 66  ? 0.2519 0.1982 0.2067 0.0299  0.0311  0.0404  66   ALA C O   
2355 C CB  . ALA C 66  ? 0.2391 0.1814 0.2299 0.0271  0.0126  0.0311  66   ALA C CB  
2356 N N   . LYS C 67  ? 0.2546 0.2024 0.2024 0.0293  0.0170  0.0238  67   LYS C N   
2357 C CA  . LYS C 67  ? 0.2761 0.2231 0.2141 0.0300  0.0220  0.0179  67   LYS C CA  
2358 C C   . LYS C 67  ? 0.2623 0.2104 0.2088 0.0276  0.0175  0.0090  67   LYS C C   
2359 O O   . LYS C 67  ? 0.2467 0.1983 0.2033 0.0262  0.0114  0.0082  67   LYS C O   
2360 C CB  . LYS C 67  ? 0.3087 0.2516 0.2195 0.0349  0.0217  0.0171  67   LYS C CB  
2361 C CG  . LYS C 67  ? 0.3271 0.2700 0.2297 0.0357  0.0077  0.0142  67   LYS C CG  
2362 C CD  . LYS C 67  ? 0.3747 0.3125 0.2508 0.0402  0.0006  0.0036  67   LYS C CD  
2363 C CE  . LYS C 67  ? 0.4155 0.3542 0.2745 0.0446  -0.0141 0.0050  67   LYS C CE  
2364 N NZ  . LYS C 67  ? 0.4195 0.3643 0.3035 0.0394  -0.0296 0.0005  67   LYS C NZ  
2365 N N   . ILE C 68  ? 0.2673 0.2128 0.2131 0.0280  0.0226  0.0045  68   ILE C N   
2366 C CA  . ILE C 68  ? 0.2656 0.2089 0.2201 0.0260  0.0193  -0.0020 68   ILE C CA  
2367 C C   . ILE C 68  ? 0.2907 0.2244 0.2309 0.0282  0.0183  -0.0117 68   ILE C C   
2368 O O   . ILE C 68  ? 0.2929 0.2237 0.2137 0.0334  0.0241  -0.0122 68   ILE C O   
2369 C CB  . ILE C 68  ? 0.2535 0.1994 0.2229 0.0261  0.0253  0.0013  68   ILE C CB  
2370 C CG1 . ILE C 68  ? 0.2578 0.2012 0.2251 0.0294  0.0334  0.0013  68   ILE C CG1 
2371 C CG2 . ILE C 68  ? 0.2429 0.1964 0.2187 0.0266  0.0244  0.0070  68   ILE C CG2 
2372 C CD1 . ILE C 68  ? 0.2670 0.2117 0.2489 0.0311  0.0370  0.0045  68   ILE C CD1 
2373 N N   . GLU C 69  ? 0.2884 0.2169 0.2395 0.0251  0.0115  -0.0195 69   GLU C N   
2374 C CA  . GLU C 69  ? 0.3138 0.2295 0.2548 0.0275  0.0078  -0.0331 69   GLU C CA  
2375 C C   . GLU C 69  ? 0.3097 0.2191 0.2633 0.0291  0.0179  -0.0332 69   GLU C C   
2376 O O   . GLU C 69  ? 0.3028 0.2106 0.2823 0.0248  0.0175  -0.0304 69   GLU C O   
2377 C CB  . GLU C 69  ? 0.3351 0.2468 0.2906 0.0219  -0.0081 -0.0426 69   GLU C CB  
2378 C CG  . GLU C 69  ? 0.3708 0.2896 0.3165 0.0216  -0.0214 -0.0431 69   GLU C CG  
2379 C CD  . GLU C 69  ? 0.4595 0.3729 0.3632 0.0304  -0.0248 -0.0497 69   GLU C CD  
2380 O OE1 . GLU C 69  ? 0.5041 0.4059 0.3867 0.0368  -0.0195 -0.0597 69   GLU C OE1 
2381 O OE2 . GLU C 69  ? 0.4540 0.3747 0.3452 0.0326  -0.0320 -0.0439 69   GLU C OE2 
2382 N N   . VAL C 70  ? 0.3081 0.2151 0.2463 0.0364  0.0285  -0.0341 70   VAL C N   
2383 C CA  . VAL C 70  ? 0.3065 0.2096 0.2593 0.0398  0.0386  -0.0325 70   VAL C CA  
2384 C C   . VAL C 70  ? 0.3207 0.2068 0.2864 0.0392  0.0334  -0.0444 70   VAL C C   
2385 O O   . VAL C 70  ? 0.3093 0.1924 0.2987 0.0388  0.0380  -0.0385 70   VAL C O   
2386 C CB  . VAL C 70  ? 0.3151 0.2212 0.2536 0.0488  0.0522  -0.0307 70   VAL C CB  
2387 C CG1 . VAL C 70  ? 0.3146 0.2168 0.2710 0.0543  0.0617  -0.0303 70   VAL C CG1 
2388 C CG2 . VAL C 70  ? 0.2876 0.2103 0.2288 0.0464  0.0560  -0.0159 70   VAL C CG2 
2389 N N   . SER C 71  ? 0.3512 0.2259 0.3037 0.0388  0.0218  -0.0607 71   SER C N   
2390 C CA  . SER C 71  ? 0.3782 0.2337 0.3474 0.0369  0.0130  -0.0755 71   SER C CA  
2391 C C   . SER C 71  ? 0.3615 0.2187 0.3726 0.0257  0.0074  -0.0659 71   SER C C   
2392 O O   . SER C 71  ? 0.3740 0.2149 0.4108 0.0228  0.0025  -0.0736 71   SER C O   
2393 C CB  . SER C 71  ? 0.4134 0.2572 0.3572 0.0394  -0.0030 -0.0977 71   SER C CB  
2394 O OG  . SER C 71  ? 0.4027 0.2570 0.3517 0.0312  -0.0178 -0.0950 71   SER C OG  
2395 N N   . GLN C 72  ? 0.3348 0.2108 0.3543 0.0207  0.0097  -0.0488 72   GLN C N   
2396 C CA  . GLN C 72  ? 0.3234 0.2053 0.3796 0.0126  0.0092  -0.0356 72   GLN C CA  
2397 C C   . GLN C 72  ? 0.3054 0.1956 0.3712 0.0159  0.0239  -0.0154 72   GLN C C   
2398 O O   . GLN C 72  ? 0.2965 0.1912 0.3889 0.0125  0.0283  -0.0008 72   GLN C O   
2399 C CB  . GLN C 72  ? 0.3205 0.2176 0.3773 0.0076  0.0011  -0.0323 72   GLN C CB  
2400 C CG  . GLN C 72  ? 0.3505 0.2413 0.3942 0.0061  -0.0173 -0.0516 72   GLN C CG  
2401 C CD  . GLN C 72  ? 0.3953 0.2690 0.4662 0.0005  -0.0304 -0.0666 72   GLN C CD  
2402 O OE1 . GLN C 72  ? 0.3973 0.2730 0.5132 -0.0079 -0.0310 -0.0579 72   GLN C OE1 
2403 N NE2 . GLN C 72  ? 0.3927 0.2486 0.4378 0.0060  -0.0403 -0.0893 72   GLN C NE2 
2404 N N   . LEU C 73  ? 0.3083 0.2008 0.3537 0.0235  0.0315  -0.0140 73   LEU C N   
2405 C CA  . LEU C 73  ? 0.2927 0.1962 0.3403 0.0280  0.0405  0.0026  73   LEU C CA  
2406 C C   . LEU C 73  ? 0.3008 0.1962 0.3732 0.0302  0.0465  0.0135  73   LEU C C   
2407 O O   . LEU C 73  ? 0.2960 0.2008 0.3753 0.0321  0.0514  0.0309  73   LEU C O   
2408 C CB  . LEU C 73  ? 0.2936 0.2031 0.3207 0.0343  0.0443  0.0000  73   LEU C CB  
2409 C CG  . LEU C 73  ? 0.2927 0.2168 0.3182 0.0385  0.0475  0.0125  73   LEU C CG  
2410 C CD1 . LEU C 73  ? 0.2825 0.2182 0.3039 0.0360  0.0440  0.0201  73   LEU C CD1 
2411 C CD2 . LEU C 73  ? 0.2861 0.2161 0.3004 0.0416  0.0498  0.0081  73   LEU C CD2 
2412 N N   . LEU C 74  ? 0.3150 0.1916 0.3998 0.0313  0.0462  0.0039  74   LEU C N   
2413 C CA  . LEU C 74  ? 0.3322 0.1981 0.4448 0.0343  0.0524  0.0163  74   LEU C CA  
2414 C C   . LEU C 74  ? 0.3384 0.2019 0.4825 0.0265  0.0528  0.0295  74   LEU C C   
2415 O O   . LEU C 74  ? 0.3437 0.2059 0.5078 0.0297  0.0610  0.0497  74   LEU C O   
2416 C CB  . LEU C 74  ? 0.3582 0.2016 0.4786 0.0389  0.0524  0.0007  74   LEU C CB  
2417 C CG  . LEU C 74  ? 0.3552 0.2023 0.4533 0.0494  0.0578  -0.0068 74   LEU C CG  
2418 C CD1 . LEU C 74  ? 0.3623 0.1866 0.4739 0.0572  0.0614  -0.0184 74   LEU C CD1 
2419 C CD2 . LEU C 74  ? 0.3282 0.1962 0.4229 0.0551  0.0634  0.0125  74   LEU C CD2 
2420 N N   . LYS C 75  ? 0.3423 0.2076 0.4934 0.0171  0.0447  0.0208  75   LYS C N   
2421 C CA  . LYS C 75  ? 0.3449 0.2147 0.5315 0.0096  0.0475  0.0370  75   LYS C CA  
2422 C C   . LYS C 75  ? 0.3235 0.2183 0.4960 0.0131  0.0565  0.0564  75   LYS C C   
2423 O O   . LYS C 75  ? 0.3288 0.2325 0.5272 0.0092  0.0626  0.0719  75   LYS C O   
2424 C CB  . LYS C 75  ? 0.3564 0.2189 0.5663 -0.0018 0.0332  0.0201  75   LYS C CB  
2425 C CG  . LYS C 75  ? 0.3533 0.2268 0.5328 -0.0031 0.0220  0.0038  75   LYS C CG  
2426 C CD  . LYS C 75  ? 0.3830 0.2501 0.5872 -0.0133 0.0037  -0.0132 75   LYS C CD  
2427 C CE  . LYS C 75  ? 0.4318 0.2736 0.6246 -0.0120 -0.0105 -0.0417 75   LYS C CE  
2428 N NZ  . LYS C 75  ? 0.4577 0.2980 0.6520 -0.0183 -0.0336 -0.0631 75   LYS C NZ  
2429 N N   . GLY C 76  ? 0.3013 0.2071 0.4358 0.0213  0.0579  0.0554  76   GLY C N   
2430 C CA  . GLY C 76  ? 0.2928 0.2184 0.4092 0.0274  0.0648  0.0699  76   GLY C CA  
2431 C C   . GLY C 76  ? 0.2741 0.2119 0.3738 0.0247  0.0588  0.0596  76   GLY C C   
2432 O O   . GLY C 76  ? 0.2836 0.2355 0.3661 0.0309  0.0632  0.0670  76   GLY C O   
2433 N N   . ASP C 77  ? 0.2714 0.2026 0.3738 0.0172  0.0478  0.0418  77   ASP C N   
2434 C CA  . ASP C 77  ? 0.2510 0.1926 0.3406 0.0151  0.0410  0.0336  77   ASP C CA  
2435 C C   . ASP C 77  ? 0.2490 0.1919 0.3039 0.0200  0.0376  0.0247  77   ASP C C   
2436 O O   . ASP C 77  ? 0.2559 0.1893 0.2998 0.0195  0.0329  0.0130  77   ASP C O   
2437 C CB  . ASP C 77  ? 0.2539 0.1891 0.3621 0.0062  0.0286  0.0205  77   ASP C CB  
2438 C CG  . ASP C 77  ? 0.2400 0.1861 0.3376 0.0051  0.0200  0.0141  77   ASP C CG  
2439 O OD1 . ASP C 77  ? 0.2078 0.1647 0.2871 0.0107  0.0249  0.0196  77   ASP C OD1 
2440 O OD2 . ASP C 77  ? 0.2236 0.1660 0.3319 -0.0007 0.0064  0.0027  77   ASP C OD2 
2441 N N   . ALA C 78  ? 0.2273 0.1817 0.2671 0.0256  0.0410  0.0307  78   ALA C N   
2442 C CA  . ALA C 78  ? 0.2237 0.1801 0.2407 0.0287  0.0371  0.0241  78   ALA C CA  
2443 C C   . ALA C 78  ? 0.2131 0.1761 0.2243 0.0280  0.0326  0.0206  78   ALA C C   
2444 O O   . ALA C 78  ? 0.1955 0.1617 0.1935 0.0317  0.0308  0.0189  78   ALA C O   
2445 C CB  . ALA C 78  ? 0.2245 0.1858 0.2312 0.0365  0.0404  0.0310  78   ALA C CB  
2446 N N   . SER C 79  ? 0.2113 0.1758 0.2367 0.0233  0.0292  0.0192  79   SER C N   
2447 C CA  . SER C 79  ? 0.2094 0.1812 0.2350 0.0238  0.0248  0.0178  79   SER C CA  
2448 C C   . SER C 79  ? 0.2155 0.1827 0.2224 0.0240  0.0178  0.0110  79   SER C C   
2449 O O   . SER C 79  ? 0.2102 0.1696 0.2074 0.0216  0.0140  0.0055  79   SER C O   
2450 C CB  . SER C 79  ? 0.2134 0.1896 0.2644 0.0184  0.0196  0.0178  79   SER C CB  
2451 O OG  . SER C 79  ? 0.1967 0.1786 0.2723 0.0179  0.0291  0.0284  79   SER C OG  
2452 N N   . LEU C 80  ? 0.2170 0.1883 0.2192 0.0281  0.0174  0.0121  80   LEU C N   
2453 C CA  . LEU C 80  ? 0.2245 0.1911 0.2152 0.0285  0.0126  0.0097  80   LEU C CA  
2454 C C   . LEU C 80  ? 0.2288 0.1972 0.2232 0.0277  0.0047  0.0099  80   LEU C C   
2455 O O   . LEU C 80  ? 0.2279 0.2043 0.2379 0.0293  0.0035  0.0117  80   LEU C O   
2456 C CB  . LEU C 80  ? 0.2198 0.1863 0.2077 0.0334  0.0140  0.0094  80   LEU C CB  
2457 C CG  . LEU C 80  ? 0.2255 0.1854 0.2103 0.0326  0.0100  0.0094  80   LEU C CG  
2458 C CD1 . LEU C 80  ? 0.2346 0.1911 0.2149 0.0291  0.0126  0.0109  80   LEU C CD1 
2459 C CD2 . LEU C 80  ? 0.2474 0.2048 0.2356 0.0373  0.0077  0.0055  80   LEU C CD2 
2460 N N   . LYS C 81  ? 0.2406 0.2032 0.2211 0.0269  0.0001  0.0095  81   LYS C N   
2461 C CA  . LYS C 81  ? 0.2606 0.2245 0.2388 0.0282  -0.0097 0.0111  81   LYS C CA  
2462 C C   . LYS C 81  ? 0.2642 0.2228 0.2321 0.0315  -0.0089 0.0181  81   LYS C C   
2463 O O   . LYS C 81  ? 0.2633 0.2163 0.2205 0.0312  -0.0023 0.0208  81   LYS C O   
2464 C CB  . LYS C 81  ? 0.2805 0.2414 0.2461 0.0266  -0.0181 0.0051  81   LYS C CB  
2465 C CG  . LYS C 81  ? 0.2961 0.2586 0.2784 0.0218  -0.0202 -0.0021 81   LYS C CG  
2466 C CD  . LYS C 81  ? 0.3242 0.2773 0.2895 0.0211  -0.0276 -0.0130 81   LYS C CD  
2467 C CE  . LYS C 81  ? 0.3626 0.3187 0.3386 0.0190  -0.0466 -0.0208 81   LYS C CE  
2468 N NZ  . LYS C 81  ? 0.3906 0.3351 0.3592 0.0173  -0.0546 -0.0360 81   LYS C NZ  
2469 N N   . MET C 82  ? 0.2627 0.2234 0.2388 0.0351  -0.0148 0.0229  82   MET C N   
2470 C CA  . MET C 82  ? 0.2815 0.2352 0.2518 0.0383  -0.0145 0.0325  82   MET C CA  
2471 C C   . MET C 82  ? 0.2876 0.2443 0.2595 0.0434  -0.0256 0.0389  82   MET C C   
2472 O O   . MET C 82  ? 0.2744 0.2405 0.2602 0.0442  -0.0334 0.0347  82   MET C O   
2473 C CB  . MET C 82  ? 0.2718 0.2201 0.2579 0.0387  -0.0088 0.0324  82   MET C CB  
2474 C CG  . MET C 82  ? 0.2882 0.2400 0.2921 0.0433  -0.0114 0.0280  82   MET C CG  
2475 S SD  . MET C 82  ? 0.3017 0.2434 0.3173 0.0462  -0.0079 0.0214  82   MET C SD  
2476 C CE  . MET C 82  ? 0.2718 0.2191 0.2790 0.0440  -0.0023 0.0117  82   MET C CE  
2477 N N   . ASP C 83  ? 0.3105 0.2604 0.2713 0.0474  -0.0258 0.0513  83   ASP C N   
2478 C CA  . ASP C 83  ? 0.3355 0.2874 0.2989 0.0542  -0.0368 0.0607  83   ASP C CA  
2479 C C   . ASP C 83  ? 0.3241 0.2760 0.3194 0.0568  -0.0368 0.0599  83   ASP C C   
2480 O O   . ASP C 83  ? 0.3127 0.2573 0.3202 0.0548  -0.0279 0.0557  83   ASP C O   
2481 C CB  . ASP C 83  ? 0.3649 0.3080 0.3093 0.0593  -0.0337 0.0786  83   ASP C CB  
2482 C CG  . ASP C 83  ? 0.4081 0.3518 0.3139 0.0612  -0.0320 0.0796  83   ASP C CG  
2483 O OD1 . ASP C 83  ? 0.4227 0.3720 0.3162 0.0593  -0.0390 0.0646  83   ASP C OD1 
2484 O OD2 . ASP C 83  ? 0.4408 0.3783 0.3297 0.0657  -0.0228 0.0960  83   ASP C OD2 
2485 N N   . LYS C 84  ? 0.3361 0.2961 0.3453 0.0626  -0.0477 0.0627  84   LYS C N   
2486 C CA  . LYS C 84  ? 0.3301 0.2906 0.3696 0.0677  -0.0453 0.0605  84   LYS C CA  
2487 C C   . LYS C 84  ? 0.3341 0.2769 0.3813 0.0713  -0.0400 0.0679  84   LYS C C   
2488 O O   . LYS C 84  ? 0.3303 0.2676 0.3966 0.0748  -0.0350 0.0599  84   LYS C O   
2489 C CB  . LYS C 84  ? 0.3409 0.3162 0.4021 0.0744  -0.0570 0.0634  84   LYS C CB  
2490 C CG  . LYS C 84  ? 0.3790 0.3542 0.4352 0.0812  -0.0707 0.0778  84   LYS C CG  
2491 C CD  . LYS C 84  ? 0.3778 0.3656 0.4707 0.0906  -0.0789 0.0812  84   LYS C CD  
2492 C CE  . LYS C 84  ? 0.4112 0.3985 0.5003 0.0996  -0.0942 0.0981  84   LYS C CE  
2493 N NZ  . LYS C 84  ? 0.4165 0.4188 0.5449 0.1093  -0.1041 0.1021  84   LYS C NZ  
2494 N N   . SER C 85  ? 0.3446 0.2775 0.3777 0.0713  -0.0403 0.0829  85   SER C N   
2495 C CA  . SER C 85  ? 0.3637 0.2782 0.4126 0.0732  -0.0352 0.0926  85   SER C CA  
2496 C C   . SER C 85  ? 0.3499 0.2546 0.4076 0.0658  -0.0261 0.0802  85   SER C C   
2497 O O   . SER C 85  ? 0.3639 0.2530 0.4450 0.0672  -0.0252 0.0782  85   SER C O   
2498 C CB  . SER C 85  ? 0.3928 0.3008 0.4261 0.0752  -0.0343 0.1163  85   SER C CB  
2499 O OG  . SER C 85  ? 0.3934 0.3056 0.3984 0.0695  -0.0274 0.1176  85   SER C OG  
2500 N N   . ASP C 86  ? 0.3255 0.2383 0.3660 0.0586  -0.0216 0.0711  86   ASP C N   
2501 C CA  . ASP C 86  ? 0.3157 0.2232 0.3633 0.0528  -0.0163 0.0581  86   ASP C CA  
2502 C C   . ASP C 86  ? 0.3051 0.2175 0.3574 0.0566  -0.0174 0.0391  86   ASP C C   
2503 O O   . ASP C 86  ? 0.3021 0.2078 0.3598 0.0556  -0.0164 0.0266  86   ASP C O   
2504 C CB  . ASP C 86  ? 0.3018 0.2162 0.3311 0.0454  -0.0101 0.0585  86   ASP C CB  
2505 C CG  . ASP C 86  ? 0.3235 0.2323 0.3504 0.0429  -0.0036 0.0771  86   ASP C CG  
2506 O OD1 . ASP C 86  ? 0.3546 0.2518 0.4000 0.0445  -0.0033 0.0902  86   ASP C OD1 
2507 O OD2 . ASP C 86  ? 0.3494 0.2651 0.3572 0.0403  0.0029  0.0798  86   ASP C OD2 
2508 N N   . ALA C 87  ? 0.2943 0.2195 0.3452 0.0618  -0.0196 0.0378  87   ALA C N   
2509 C CA  . ALA C 87  ? 0.2874 0.2203 0.3438 0.0677  -0.0163 0.0244  87   ALA C CA  
2510 C C   . ALA C 87  ? 0.2969 0.2210 0.3726 0.0790  -0.0172 0.0201  87   ALA C C   
2511 O O   . ALA C 87  ? 0.2946 0.2150 0.3706 0.0858  -0.0130 0.0058  87   ALA C O   
2512 C CB  . ALA C 87  ? 0.2617 0.2147 0.3169 0.0671  -0.0163 0.0264  87   ALA C CB  
2513 N N   . VAL C 88  ? 0.3155 0.2353 0.4049 0.0829  -0.0229 0.0324  88   VAL C N   
2514 C CA  . VAL C 88  ? 0.3369 0.2496 0.4487 0.0955  -0.0238 0.0301  88   VAL C CA  
2515 C C   . VAL C 88  ? 0.3571 0.2487 0.4755 0.1010  -0.0218 0.0134  88   VAL C C   
2516 O O   . VAL C 88  ? 0.3725 0.2636 0.4983 0.1139  -0.0177 0.0007  88   VAL C O   
2517 C CB  . VAL C 88  ? 0.3600 0.2676 0.4852 0.0984  -0.0319 0.0497  88   VAL C CB  
2518 C CG1 . VAL C 88  ? 0.3874 0.2777 0.5383 0.1099  -0.0329 0.0479  88   VAL C CG1 
2519 C CG2 . VAL C 88  ? 0.3592 0.2905 0.4853 0.1005  -0.0379 0.0592  88   VAL C CG2 
2520 N N   . SER C 89  ? 0.3544 0.2288 0.4720 0.0924  -0.0252 0.0125  89   SER C N   
2521 C CA  . SER C 89  ? 0.3811 0.2328 0.5092 0.0964  -0.0286 -0.0056 89   SER C CA  
2522 C C   . SER C 89  ? 0.3698 0.2245 0.4770 0.0926  -0.0283 -0.0238 89   SER C C   
2523 O O   . SER C 89  ? 0.3901 0.2266 0.5033 0.0928  -0.0357 -0.0402 89   SER C O   
2524 C CB  . SER C 89  ? 0.3939 0.2237 0.5461 0.0890  -0.0346 0.0060  89   SER C CB  
2525 O OG  . SER C 89  ? 0.4339 0.2690 0.5783 0.0747  -0.0335 0.0146  89   SER C OG  
2526 N N   . HIS C 90  ? 0.3393 0.2164 0.4246 0.0896  -0.0218 -0.0207 90   HIS C N   
2527 C CA  . HIS C 90  ? 0.3300 0.2130 0.3939 0.0871  -0.0207 -0.0330 90   HIS C CA  
2528 C C   . HIS C 90  ? 0.3183 0.2211 0.3649 0.0960  -0.0102 -0.0354 90   HIS C C   
2529 O O   . HIS C 90  ? 0.2941 0.2133 0.3294 0.0894  -0.0051 -0.0274 90   HIS C O   
2530 C CB  . HIS C 90  ? 0.3139 0.2034 0.3734 0.0721  -0.0213 -0.0214 90   HIS C CB  
2531 C CG  . HIS C 90  ? 0.3161 0.1902 0.3967 0.0629  -0.0275 -0.0144 90   HIS C CG  
2532 N ND1 . HIS C 90  ? 0.3152 0.1932 0.4003 0.0541  -0.0238 0.0064  90   HIS C ND1 
2533 C CD2 . HIS C 90  ? 0.3499 0.2051 0.4503 0.0612  -0.0366 -0.0247 90   HIS C CD2 
2534 C CE1 . HIS C 90  ? 0.3328 0.1966 0.4417 0.0477  -0.0271 0.0123  90   HIS C CE1 
2535 N NE2 . HIS C 90  ? 0.3509 0.2003 0.4738 0.0505  -0.0361 -0.0067 90   HIS C NE2 
2536 N N   . THR C 91  ? 0.3271 0.2279 0.3748 0.1117  -0.0057 -0.0457 91   THR C N   
2537 C CA  . THR C 91  ? 0.3305 0.2509 0.3653 0.1226  0.0081  -0.0466 91   THR C CA  
2538 C C   . THR C 91  ? 0.3513 0.2657 0.3568 0.1335  0.0096  -0.0656 91   THR C C   
2539 O O   . THR C 91  ? 0.3784 0.2714 0.3794 0.1369  -0.0021 -0.0832 91   THR C O   
2540 C CB  . THR C 91  ? 0.3350 0.2622 0.3898 0.1364  0.0163  -0.0435 91   THR C CB  
2541 O OG1 . THR C 91  ? 0.3477 0.2517 0.4089 0.1478  0.0107  -0.0586 91   THR C OG1 
2542 C CG2 . THR C 91  ? 0.3236 0.2621 0.4043 0.1269  0.0126  -0.0235 91   THR C CG2 
2543 N N   . GLY C 92  ? 0.3466 0.2796 0.3331 0.1393  0.0226  -0.0614 92   GLY C N   
2544 C CA  . GLY C 92  ? 0.3749 0.3056 0.3257 0.1514  0.0245  -0.0758 92   GLY C CA  
2545 C C   . GLY C 92  ? 0.3556 0.3006 0.2921 0.1422  0.0281  -0.0637 92   GLY C C   
2546 O O   . GLY C 92  ? 0.3060 0.2650 0.2605 0.1299  0.0339  -0.0453 92   GLY C O   
2547 N N   . ASN C 93  ? 0.3831 0.3236 0.2875 0.1495  0.0229  -0.0753 93   ASN C N   
2548 C CA  . ASN C 93  ? 0.3746 0.3281 0.2628 0.1453  0.0275  -0.0634 93   ASN C CA  
2549 C C   . ASN C 93  ? 0.3504 0.2995 0.2519 0.1253  0.0130  -0.0593 93   ASN C C   
2550 O O   . ASN C 93  ? 0.3583 0.2931 0.2617 0.1207  -0.0049 -0.0728 93   ASN C O   
2551 C CB  . ASN C 93  ? 0.4217 0.3751 0.2654 0.1654  0.0290  -0.0749 93   ASN C CB  
2552 C CG  . ASN C 93  ? 0.4597 0.4295 0.2867 0.1848  0.0551  -0.0645 93   ASN C CG  
2553 O OD1 . ASN C 93  ? 0.4373 0.4243 0.2894 0.1789  0.0726  -0.0426 93   ASN C OD1 
2554 N ND2 . ASN C 93  ? 0.5467 0.5121 0.3300 0.2087  0.0572  -0.0799 93   ASN C ND2 
2555 N N   . TYR C 94  ? 0.3159 0.2777 0.2301 0.1141  0.0215  -0.0405 94   TYR C N   
2556 C CA  . TYR C 94  ? 0.3051 0.2660 0.2281 0.0986  0.0131  -0.0347 94   TYR C CA  
2557 C C   . TYR C 94  ? 0.3113 0.2809 0.2143 0.1031  0.0175  -0.0279 94   TYR C C   
2558 O O   . TYR C 94  ? 0.3190 0.2993 0.2108 0.1128  0.0324  -0.0183 94   TYR C O   
2559 C CB  . TYR C 94  ? 0.2718 0.2376 0.2204 0.0845  0.0176  -0.0209 94   TYR C CB  
2560 C CG  . TYR C 94  ? 0.2803 0.2368 0.2475 0.0786  0.0105  -0.0237 94   TYR C CG  
2561 C CD1 . TYR C 94  ? 0.2662 0.2151 0.2444 0.0667  0.0020  -0.0218 94   TYR C CD1 
2562 C CD2 . TYR C 94  ? 0.2879 0.2439 0.2633 0.0864  0.0139  -0.0258 94   TYR C CD2 
2563 C CE1 . TYR C 94  ? 0.2436 0.1839 0.2376 0.0626  -0.0027 -0.0200 94   TYR C CE1 
2564 C CE2 . TYR C 94  ? 0.2808 0.2275 0.2741 0.0822  0.0070  -0.0254 94   TYR C CE2 
2565 C CZ  . TYR C 94  ? 0.2715 0.2098 0.2726 0.0704  -0.0012 -0.0217 94   TYR C CZ  
2566 O OH  . TYR C 94  ? 0.2791 0.2079 0.2968 0.0676  -0.0062 -0.0173 94   TYR C OH  
2567 N N   . THR C 95  ? 0.3097 0.2756 0.2123 0.0965  0.0054  -0.0305 95   THR C N   
2568 C CA  . THR C 95  ? 0.3201 0.2937 0.2073 0.1005  0.0072  -0.0223 95   THR C CA  
2569 C C   . THR C 95  ? 0.2878 0.2634 0.1986 0.0851  0.0088  -0.0109 95   THR C C   
2570 O O   . THR C 95  ? 0.2686 0.2384 0.1978 0.0743  0.0003  -0.0152 95   THR C O   
2571 C CB  . THR C 95  ? 0.3384 0.3075 0.2065 0.1083  -0.0111 -0.0365 95   THR C CB  
2572 O OG1 . THR C 95  ? 0.3738 0.3363 0.2190 0.1229  -0.0155 -0.0530 95   THR C OG1 
2573 C CG2 . THR C 95  ? 0.3528 0.3311 0.2009 0.1162  -0.0098 -0.0255 95   THR C CG2 
2574 N N   . CYS C 96  ? 0.2929 0.2758 0.2045 0.0853  0.0212  0.0042  96   CYS C N   
2575 C CA  . CYS C 96  ? 0.2770 0.2597 0.2065 0.0743  0.0226  0.0129  96   CYS C CA  
2576 C C   . CYS C 96  ? 0.2973 0.2833 0.2155 0.0810  0.0199  0.0189  96   CYS C C   
2577 O O   . CYS C 96  ? 0.3131 0.3046 0.2133 0.0928  0.0274  0.0282  96   CYS C O   
2578 C CB  . CYS C 96  ? 0.2732 0.2589 0.2186 0.0689  0.0358  0.0242  96   CYS C CB  
2579 S SG  . CYS C 96  ? 0.2620 0.2440 0.2262 0.0590  0.0386  0.0325  96   CYS C SG  
2580 N N   . GLU C 97  ? 0.2928 0.2769 0.2226 0.0751  0.0099  0.0153  97   GLU C N   
2581 C CA  . GLU C 97  ? 0.3009 0.2892 0.2257 0.0815  0.0038  0.0205  97   GLU C CA  
2582 C C   . GLU C 97  ? 0.2790 0.2660 0.2272 0.0735  0.0095  0.0290  97   GLU C C   
2583 O O   . GLU C 97  ? 0.2610 0.2452 0.2277 0.0640  0.0077  0.0236  97   GLU C O   
2584 C CB  . GLU C 97  ? 0.3109 0.3003 0.2342 0.0839  -0.0161 0.0067  97   GLU C CB  
2585 C CG  . GLU C 97  ? 0.3489 0.3453 0.2646 0.0934  -0.0271 0.0109  97   GLU C CG  
2586 C CD  . GLU C 97  ? 0.3606 0.3600 0.2966 0.0894  -0.0478 -0.0010 97   GLU C CD  
2587 O OE1 . GLU C 97  ? 0.4306 0.4299 0.3509 0.0971  -0.0662 -0.0150 97   GLU C OE1 
2588 O OE2 . GLU C 97  ? 0.3901 0.3918 0.3592 0.0791  -0.0456 0.0029  97   GLU C OE2 
2589 N N   . VAL C 98  ? 0.2877 0.2758 0.2344 0.0789  0.0173  0.0432  98   VAL C N   
2590 C CA  . VAL C 98  ? 0.2685 0.2525 0.2373 0.0740  0.0226  0.0500  98   VAL C CA  
2591 C C   . VAL C 98  ? 0.2794 0.2688 0.2482 0.0836  0.0157  0.0582  98   VAL C C   
2592 O O   . VAL C 98  ? 0.2767 0.2714 0.2244 0.0957  0.0127  0.0663  98   VAL C O   
2593 C CB  . VAL C 98  ? 0.2729 0.2499 0.2519 0.0699  0.0371  0.0594  98   VAL C CB  
2594 C CG1 . VAL C 98  ? 0.2491 0.2170 0.2510 0.0652  0.0414  0.0614  98   VAL C CG1 
2595 C CG2 . VAL C 98  ? 0.2563 0.2314 0.2361 0.0618  0.0397  0.0508  98   VAL C CG2 
2596 N N   . THR C 99  ? 0.2625 0.2517 0.2544 0.0799  0.0134  0.0565  99   THR C N   
2597 C CA  . THR C 99  ? 0.2778 0.2736 0.2784 0.0888  0.0061  0.0647  99   THR C CA  
2598 C C   . THR C 99  ? 0.2682 0.2558 0.2936 0.0866  0.0178  0.0711  99   THR C C   
2599 O O   . THR C 99  ? 0.2444 0.2256 0.2827 0.0778  0.0251  0.0620  99   THR C O   
2600 C CB  . THR C 99  ? 0.2753 0.2822 0.2893 0.0879  -0.0104 0.0544  99   THR C CB  
2601 O OG1 . THR C 99  ? 0.2900 0.3003 0.2832 0.0891  -0.0233 0.0437  99   THR C OG1 
2602 C CG2 . THR C 99  ? 0.2822 0.2991 0.3097 0.0981  -0.0209 0.0634  99   THR C CG2 
2603 N N   . GLU C 100 ? 0.2856 0.2717 0.3147 0.0962  0.0200  0.0866  100  GLU C N   
2604 C CA  . GLU C 100 ? 0.2911 0.2690 0.3476 0.0977  0.0280  0.0921  100  GLU C CA  
2605 C C   . GLU C 100 ? 0.2942 0.2853 0.3656 0.1073  0.0165  0.0971  100  GLU C C   
2606 O O   . GLU C 100 ? 0.3073 0.3074 0.3657 0.1181  0.0055  0.1081  100  GLU C O   
2607 C CB  . GLU C 100 ? 0.3094 0.2741 0.3685 0.1015  0.0391  0.1087  100  GLU C CB  
2608 C CG  . GLU C 100 ? 0.2940 0.2464 0.3512 0.0908  0.0497  0.1041  100  GLU C CG  
2609 C CD  . GLU C 100 ? 0.3210 0.2602 0.3929 0.0929  0.0609  0.1224  100  GLU C CD  
2610 O OE1 . GLU C 100 ? 0.3271 0.2524 0.4149 0.0831  0.0681  0.1168  100  GLU C OE1 
2611 O OE2 . GLU C 100 ? 0.3361 0.2787 0.4056 0.1047  0.0614  0.1431  100  GLU C OE2 
2612 N N   . LEU C 101 ? 0.3439 0.3015 0.2158 0.1086  0.0305  0.0567  101  LEU C N   
2613 C CA  . LEU C 101 ? 0.3557 0.2988 0.2873 0.1041  -0.0075 0.0475  101  LEU C CA  
2614 C C   . LEU C 101 ? 0.3567 0.2974 0.2463 0.1098  -0.0060 0.0357  101  LEU C C   
2615 O O   . LEU C 101 ? 0.3282 0.2883 0.1691 0.1090  0.0261  0.0428  101  LEU C O   
2616 C CB  . LEU C 101 ? 0.3155 0.3148 0.3645 0.0844  0.0122  0.0960  101  LEU C CB  
2617 C CG  . LEU C 101 ? 0.3241 0.3500 0.4417 0.0790  0.0277  0.1308  101  LEU C CG  
2618 C CD1 . LEU C 101 ? 0.3119 0.4059 0.5666 0.0844  0.0591  0.2076  101  LEU C CD1 
2619 C CD2 . LEU C 101 ? 0.3811 0.3439 0.5317 0.0794  -0.0342 0.1018  101  LEU C CD2 
2620 N N   . THR C 102 ? 0.3949 0.3057 0.3297 0.1141  -0.0556 0.0205  102  THR C N   
2621 C CA  . THR C 102 ? 0.4023 0.3099 0.3144 0.1193  -0.0615 0.0107  102  THR C CA  
2622 C C   . THR C 102 ? 0.3447 0.3118 0.2722 0.1026  -0.0086 0.0430  102  THR C C   
2623 O O   . THR C 102 ? 0.3072 0.3180 0.2950 0.0984  0.0198  0.0818  102  THR C O   
2624 C CB  . THR C 102 ? 0.4412 0.3132 0.4558 0.1181  -0.1381 0.0018  102  THR C CB  
2625 O OG1 . THR C 102 ? 0.5597 0.3453 0.5629 0.1472  -0.2222 -0.0409 102  THR C OG1 
2626 C CG2 . THR C 102 ? 0.4679 0.3218 0.4300 0.1339  -0.1526 -0.0193 102  THR C CG2 
2627 N N   . ARG C 103 ? 0.3524 0.3137 0.2149 0.1102  0.0017  0.0299  103  ARG C N   
2628 C CA  . ARG C 103 ? 0.3380 0.3245 0.1950 0.1123  0.0256  0.0437  103  ARG C CA  
2629 C C   . ARG C 103 ? 0.3482 0.3238 0.2071 0.1165  0.0090  0.0336  103  ARG C C   
2630 O O   . ARG C 103 ? 0.3772 0.3222 0.1968 0.1251  -0.0118 0.0114  103  ARG C O   
2631 C CB  . ARG C 103 ? 0.3458 0.3201 0.1438 0.1148  0.0323  0.0356  103  ARG C CB  
2632 C CG  . ARG C 103 ? 0.3645 0.3429 0.1564 0.1156  0.0374  0.0429  103  ARG C CG  
2633 C CD  . ARG C 103 ? 0.4028 0.3498 0.1549 0.1320  0.0102  0.0299  103  ARG C CD  
2634 N NE  . ARG C 103 ? 0.4088 0.3395 0.1991 0.1119  -0.0120 0.0334  103  ARG C NE  
2635 C CZ  . ARG C 103 ? 0.4184 0.3090 0.2277 0.1151  -0.0612 0.0257  103  ARG C CZ  
2636 N NH1 . ARG C 103 ? 0.5073 0.3441 0.2520 0.1522  -0.1094 -0.0091 103  ARG C NH1 
2637 N NH2 . ARG C 103 ? 0.3748 0.2740 0.2702 0.0955  -0.0659 0.0596  103  ARG C NH2 
2638 N N   . GLU C 104 ? 0.3505 0.3527 0.2416 0.1263  0.0250  0.0569  104  GLU C N   
2639 C CA  . GLU C 104 ? 0.3637 0.3586 0.2634 0.1287  0.0095  0.0501  104  GLU C CA  
2640 C C   . GLU C 104 ? 0.3651 0.3840 0.2500 0.1566  0.0432  0.0745  104  GLU C C   
2641 O O   . GLU C 104 ? 0.3745 0.4112 0.2304 0.1916  0.0769  0.0988  104  GLU C O   
2642 C CB  . GLU C 104 ? 0.3727 0.3586 0.3775 0.1182  -0.0410 0.0557  104  GLU C CB  
2643 C CG  . GLU C 104 ? 0.3836 0.4188 0.5581 0.1121  -0.0380 0.1220  104  GLU C CG  
2644 C CD  . GLU C 104 ? 0.4252 0.4277 0.7496 0.0954  -0.1299 0.1233  104  GLU C CD  
2645 O OE1 . GLU C 104 ? 0.5422 0.4843 0.8028 0.1036  -0.1886 0.0683  104  GLU C OE1 
2646 O OE2 . GLU C 104 ? 0.4728 0.5034 0.9922 0.0809  -0.1552 0.1834  104  GLU C OE2 
2647 N N   . GLY C 105 ? 0.3688 0.3794 0.2503 0.1580  0.0323  0.0659  105  GLY C N   
2648 C CA  . GLY C 105 ? 0.4026 0.4250 0.2531 0.1968  0.0608  0.0847  105  GLY C CA  
2649 C C   . GLY C 105 ? 0.3949 0.4094 0.2642 0.1856  0.0412  0.0744  105  GLY C C   
2650 O O   . GLY C 105 ? 0.3858 0.3764 0.2597 0.1593  0.0047  0.0460  105  GLY C O   
2651 N N   . GLU C 106 ? 0.4272 0.4575 0.2879 0.2228  0.0676  0.0995  106  GLU C N   
2652 C CA  . GLU C 106 ? 0.4254 0.4505 0.3055 0.2134  0.0503  0.0922  106  GLU C CA  
2653 C C   . GLU C 106 ? 0.4784 0.4895 0.2767 0.2663  0.0764  0.0941  106  GLU C C   
2654 O O   . GLU C 106 ? 0.5303 0.5394 0.2611 0.3289  0.1084  0.1117  106  GLU C O   
2655 C CB  . GLU C 106 ? 0.4034 0.4717 0.4418 0.1972  0.0339  0.1404  106  GLU C CB  
2656 C CG  . GLU C 106 ? 0.4304 0.5732 0.5799 0.2399  0.0913  0.2370  106  GLU C CG  
2657 C CD  . GLU C 106 ? 0.4059 0.5956 0.7989 0.2094  0.0540  0.3067  106  GLU C CD  
2658 O OE1 . GLU C 106 ? 0.4315 0.5949 0.9022 0.1677  -0.0105 0.2858  106  GLU C OE1 
2659 O OE2 . GLU C 106 ? 0.4576 0.7057 0.9820 0.2325  0.0802  0.3884  106  GLU C OE2 
2660 N N   . THR C 107 ? 0.4835 0.4745 0.2690 0.2568  0.0580  0.0735  107  THR C N   
2661 C CA  . THR C 107 ? 0.5589 0.5176 0.2614 0.3099  0.0668  0.0645  107  THR C CA  
2662 C C   . THR C 107 ? 0.5344 0.5148 0.2914 0.2983  0.0672  0.0800  107  THR C C   
2663 O O   . THR C 107 ? 0.4751 0.4679 0.2976 0.2496  0.0405  0.0740  107  THR C O   
2664 C CB  . THR C 107 ? 0.6017 0.4790 0.2238 0.3068  0.0166  0.0059  107  THR C CB  
2665 O OG1 . THR C 107 ? 0.7184 0.5337 0.2451 0.3767  -0.0008 -0.0157 107  THR C OG1 
2666 C CG2 . THR C 107 ? 0.5481 0.4234 0.2292 0.2475  -0.0090 -0.0044 107  THR C CG2 
2667 N N   . ILE C 108 ? 0.6044 0.5817 0.3177 0.3589  0.0936  0.0991  108  ILE C N   
2668 C CA  . ILE C 108 ? 0.5904 0.5946 0.3634 0.3531  0.0988  0.1225  108  ILE C CA  
2669 C C   . ILE C 108 ? 0.6443 0.5819 0.3275 0.3695  0.0723  0.0753  108  ILE C C   
2670 O O   . ILE C 108 ? 0.7431 0.6124 0.3134 0.4274  0.0578  0.0432  108  ILE C O   
2671 C CB  . ILE C 108 ? 0.6230 0.6981 0.4627 0.4174  0.1631  0.2129  108  ILE C CB  
2672 C CG1 . ILE C 108 ? 0.5757 0.7277 0.5715 0.4005  0.1856  0.2876  108  ILE C CG1 
2673 C CG2 . ILE C 108 ? 0.5938 0.6986 0.5206 0.4030  0.1591  0.2405  108  ILE C CG2 
2674 C CD1 . ILE C 108 ? 0.6286 0.8710 0.7247 0.4825  0.2699  0.4153  108  ILE C CD1 
2675 N N   . ILE C 109 ? 0.6027 0.5495 0.3380 0.3285  0.0536  0.0706  109  ILE C N   
2676 C CA  . ILE C 109 ? 0.6487 0.5475 0.3378 0.3452  0.0353  0.0465  109  ILE C CA  
2677 C C   . ILE C 109 ? 0.6157 0.5569 0.3676 0.3351  0.0463  0.0749  109  ILE C C   
2678 O O   . ILE C 109 ? 0.5581 0.5340 0.3788 0.2954  0.0312  0.0843  109  ILE C O   
2679 C CB  . ILE C 109 ? 0.6546 0.4983 0.3408 0.3100  -0.0121 0.0103  109  ILE C CB  
2680 C CG1 . ILE C 109 ? 0.6695 0.4917 0.3833 0.3050  -0.0305 0.0114  109  ILE C CG1 
2681 C CG2 . ILE C 109 ? 0.5796 0.4578 0.3114 0.2619  -0.0110 0.0180  109  ILE C CG2 
2682 C CD1 . ILE C 109 ? 0.7077 0.4657 0.4634 0.2924  -0.0852 -0.0005 109  ILE C CD1 
2683 N N   . GLU C 110 ? 0.6718 0.5969 0.3853 0.3856  0.0624  0.0836  110  GLU C N   
2684 C CA  . GLU C 110 ? 0.6536 0.6142 0.4252 0.3812  0.0712  0.1114  110  GLU C CA  
2685 C C   . GLU C 110 ? 0.6405 0.5627 0.4016 0.3511  0.0363  0.0789  110  GLU C C   
2686 O O   . GLU C 110 ? 0.6924 0.5491 0.4072 0.3651  0.0116  0.0493  110  GLU C O   
2687 C CB  . GLU C 110 ? 0.7297 0.6951 0.4620 0.4627  0.1153  0.1474  110  GLU C CB  
2688 C CG  . GLU C 110 ? 0.7091 0.7170 0.5186 0.4567  0.1254  0.1840  110  GLU C CG  
2689 C CD  . GLU C 110 ? 0.7756 0.8213 0.5836 0.5460  0.1903  0.2538  110  GLU C CD  
2690 O OE1 . GLU C 110 ? 0.8629 0.9046 0.5925 0.6303  0.2365  0.2804  110  GLU C OE1 
2691 O OE2 . GLU C 110 ? 0.7442 0.8260 0.6232 0.5457  0.2002  0.2901  110  GLU C OE2 
2692 N N   . LEU C 111 ? 0.5943 0.5515 0.4096 0.3197  0.0247  0.0902  111  LEU C N   
2693 C CA  . LEU C 111 ? 0.5988 0.5410 0.4098 0.3146  0.0127  0.0867  111  LEU C CA  
2694 C C   . LEU C 111 ? 0.6163 0.5694 0.4426 0.3382  0.0242  0.1047  111  LEU C C   
2695 O O   . LEU C 111 ? 0.6009 0.5973 0.4802 0.3401  0.0254  0.1299  111  LEU C O   
2696 C CB  . LEU C 111 ? 0.5842 0.5451 0.3958 0.3056  -0.0055 0.0882  111  LEU C CB  
2697 C CG  . LEU C 111 ? 0.6068 0.5670 0.4045 0.3265  0.0008  0.1073  111  LEU C CG  
2698 C CD1 . LEU C 111 ? 0.5902 0.5345 0.4178 0.3207  0.0176  0.1300  111  LEU C CD1 
2699 C CD2 . LEU C 111 ? 0.6472 0.6116 0.3906 0.3613  -0.0215 0.1046  111  LEU C CD2 
2700 N N   . LYS C 112 ? 0.6545 0.5636 0.4581 0.3560  0.0215  0.0965  112  LYS C N   
2701 C CA  . LYS C 112 ? 0.6855 0.5924 0.4872 0.3883  0.0338  0.1098  112  LYS C CA  
2702 C C   . LYS C 112 ? 0.6749 0.5759 0.5094 0.3764  0.0221  0.1200  112  LYS C C   
2703 O O   . LYS C 112 ? 0.6724 0.5452 0.5357 0.3613  0.0040  0.1218  112  LYS C O   
2704 C CB  . LYS C 112 ? 0.7842 0.6196 0.5079 0.4478  0.0291  0.0862  112  LYS C CB  
2705 C CG  . LYS C 112 ? 0.8220 0.6633 0.4878 0.4922  0.0562  0.0907  112  LYS C CG  
2706 C CD  . LYS C 112 ? 0.9817 0.7353 0.5128 0.5973  0.0503  0.0654  112  LYS C CD  
2707 C CE  . LYS C 112 ? 1.0568 0.8230 0.5058 0.6727  0.0939  0.0864  112  LYS C CE  
2708 N NZ  . LYS C 112 ? 1.2604 0.9212 0.5159 0.8208  0.0862  0.0575  112  LYS C NZ  
2709 N N   . TYR C 113 ? 0.6681 0.6033 0.5219 0.3876  0.0345  0.1420  113  TYR C N   
2710 C CA  . TYR C 113 ? 0.6734 0.6110 0.5536 0.3900  0.0330  0.1621  113  TYR C CA  
2711 C C   . TYR C 113 ? 0.7193 0.6125 0.5995 0.4173  0.0308  0.1595  113  TYR C C   
2712 O O   . TYR C 113 ? 0.7399 0.6407 0.5945 0.4484  0.0486  0.1621  113  TYR C O   
2713 C CB  . TYR C 113 ? 0.6575 0.6461 0.5453 0.3958  0.0309  0.1800  113  TYR C CB  
2714 C CG  . TYR C 113 ? 0.6813 0.6785 0.5738 0.4161  0.0382  0.2081  113  TYR C CG  
2715 C CD1 . TYR C 113 ? 0.7030 0.7116 0.5751 0.4363  0.0481  0.2331  113  TYR C CD1 
2716 C CD2 . TYR C 113 ? 0.6959 0.6959 0.6123 0.4299  0.0462  0.2237  113  TYR C CD2 
2717 C CE1 . TYR C 113 ? 0.7348 0.7644 0.6138 0.4756  0.0717  0.2820  113  TYR C CE1 
2718 C CE2 . TYR C 113 ? 0.7124 0.7263 0.6406 0.4538  0.0587  0.2598  113  TYR C CE2 
2719 C CZ  . TYR C 113 ? 0.7303 0.7624 0.6417 0.4794  0.0744  0.2934  113  TYR C CZ  
2720 O OH  . TYR C 113 ? 0.7751 0.8342 0.6999 0.5235  0.1035  0.3519  113  TYR C OH  
2721 N N   . ARG C 114 ? 0.7462 0.5949 0.6745 0.4132  0.0072  0.1667  114  ARG C N   
2722 C CA  . ARG C 114 ? 0.8238 0.6028 0.7593 0.4430  -0.0213 0.1545  114  ARG C CA  
2723 C C   . ARG C 114 ? 0.8021 0.6210 0.8072 0.4398  -0.0027 0.2025  114  ARG C C   
2724 O O   . ARG C 114 ? 0.7637 0.6259 0.8465 0.4215  0.0116  0.2532  114  ARG C O   
2725 C CB  . ARG C 114 ? 0.8929 0.5707 0.8791 0.4402  -0.0951 0.1294  114  ARG C CB  
2726 C CG  . ARG C 114 ? 1.0151 0.5775 1.0002 0.4851  -0.1635 0.0967  114  ARG C CG  
2727 C CD  . ARG C 114 ? 1.0425 0.5593 1.2242 0.4505  -0.2329 0.1349  114  ARG C CD  
2728 N NE  . ARG C 114 ? 1.0853 0.5464 1.3603 0.4230  -0.3055 0.1279  114  ARG C NE  
2729 C CZ  . ARG C 114 ? 1.1008 0.5232 1.6093 0.3885  -0.3813 0.1802  114  ARG C CZ  
2730 N NH1 . ARG C 114 ? 1.1016 0.5382 1.7724 0.3794  -0.3874 0.2471  114  ARG C NH1 
2731 N NH2 . ARG C 114 ? 1.1300 0.5055 1.7398 0.3628  -0.4526 0.1791  114  ARG C NH2 
2732 N N   . VAL C 115 ? 0.8399 0.6489 0.8128 0.4721  0.0061  0.1979  115  VAL C N   
2733 C CA  . VAL C 115 ? 0.8297 0.6754 0.8607 0.4745  0.0240  0.2423  115  VAL C CA  
2734 C C   . VAL C 115 ? 0.9028 0.6666 1.0147 0.4846  -0.0235 0.2466  115  VAL C C   
2735 O O   . VAL C 115 ? 1.0091 0.6610 1.0742 0.5176  -0.0824 0.1898  115  VAL C O   
2736 C CB  . VAL C 115 ? 0.8245 0.7143 0.8062 0.5005  0.0566  0.2470  115  VAL C CB  
2737 C CG1 . VAL C 115 ? 0.8109 0.7399 0.8429 0.5049  0.0715  0.2906  115  VAL C CG1 
2738 C CG2 . VAL C 115 ? 0.7740 0.7301 0.7306 0.4869  0.0736  0.2480  115  VAL C CG2 
2739 N N   . PCA D 1   ? 0.4975 0.4907 0.3754 0.2721  0.1334  0.1232  1    PCA D N   
2740 C CA  . PCA D 1   ? 0.5591 0.5009 0.3311 0.3024  0.1133  0.1028  1    PCA D CA  
2741 C CB  . PCA D 1   ? 0.5516 0.4885 0.3346 0.2890  0.1036  0.0970  1    PCA D CB  
2742 C CG  . PCA D 1   ? 0.4865 0.4725 0.3822 0.2545  0.1246  0.1164  1    PCA D CG  
2743 C CD  . PCA D 1   ? 0.4613 0.4729 0.4088 0.2419  0.1322  0.1239  1    PCA D CD  
2744 O OE  . PCA D 1   ? 0.4194 0.4593 0.4600 0.2119  0.1308  0.1274  1    PCA D OE  
2745 C C   . PCA D 1   ? 0.5718 0.4699 0.2930 0.2885  0.0736  0.0645  1    PCA D C   
2746 O O   . PCA D 1   ? 0.6435 0.4874 0.2842 0.3175  0.0434  0.0450  1    PCA D O   
2747 N N   . LEU D 2   ? 0.5198 0.4381 0.2900 0.2499  0.0688  0.0554  2    LEU D N   
2748 C CA  . LEU D 2   ? 0.5236 0.4105 0.2672 0.2351  0.0364  0.0317  2    LEU D CA  
2749 C C   . LEU D 2   ? 0.5879 0.4386 0.2625 0.2776  0.0313  0.0304  2    LEU D C   
2750 O O   . LEU D 2   ? 0.5928 0.4662 0.2620 0.3087  0.0642  0.0537  2    LEU D O   
2751 C CB  . LEU D 2   ? 0.4640 0.3877 0.2661 0.1962  0.0386  0.0283  2    LEU D CB  
2752 C CG  . LEU D 2   ? 0.4170 0.3671 0.2689 0.1647  0.0376  0.0222  2    LEU D CG  
2753 C CD1 . LEU D 2   ? 0.3618 0.3399 0.2386 0.1485  0.0366  0.0159  2    LEU D CD1 
2754 C CD2 . LEU D 2   ? 0.4007 0.3272 0.2452 0.1550  0.0165  0.0180  2    LEU D CD2 
2755 N N   . LEU D 3   ? 0.6350 0.4282 0.2667 0.2820  -0.0127 0.0070  3    LEU D N   
2756 C CA  . LEU D 3   ? 0.7140 0.4540 0.2701 0.3280  -0.0309 -0.0044 3    LEU D CA  
2757 C C   . LEU D 3   ? 0.7038 0.4282 0.2922 0.2971  -0.0592 -0.0134 3    LEU D C   
2758 O O   . LEU D 3   ? 0.6619 0.3941 0.3120 0.2524  -0.0805 -0.0131 3    LEU D O   
2759 C CB  . LEU D 3   ? 0.8147 0.4779 0.2832 0.3755  -0.0758 -0.0300 3    LEU D CB  
2760 C CG  . LEU D 3   ? 0.8530 0.5244 0.2699 0.4217  -0.0507 -0.0182 3    LEU D CG  
2761 C CD1 . LEU D 3   ? 0.9639 0.5463 0.2804 0.4738  -0.1127 -0.0542 3    LEU D CD1 
2762 C CD2 . LEU D 3   ? 0.8725 0.5860 0.2618 0.4730  0.0124  0.0184  3    LEU D CD2 
2763 N N   . PHE D 4   ? 0.7478 0.4541 0.2979 0.3271  -0.0552 -0.0136 4    PHE D N   
2764 C CA  . PHE D 4   ? 0.7323 0.4358 0.3199 0.3014  -0.0709 -0.0125 4    PHE D CA  
2765 C C   . PHE D 4   ? 0.8352 0.4516 0.3661 0.3373  -0.1213 -0.0360 4    PHE D C   
2766 O O   . PHE D 4   ? 0.9313 0.4971 0.3678 0.3998  -0.1291 -0.0530 4    PHE D O   
2767 C CB  . PHE D 4   ? 0.6794 0.4455 0.2921 0.2985  -0.0234 0.0103  4    PHE D CB  
2768 C CG  . PHE D 4   ? 0.5778 0.4171 0.2571 0.2620  0.0079  0.0255  4    PHE D CG  
2769 C CD1 . PHE D 4   ? 0.5337 0.4127 0.2672 0.2247  0.0087  0.0309  4    PHE D CD1 
2770 C CD2 . PHE D 4   ? 0.5799 0.4444 0.2650 0.2723  0.0331  0.0351  4    PHE D CD2 
2771 C CE1 . PHE D 4   ? 0.4794 0.4115 0.2593 0.2020  0.0259  0.0345  4    PHE D CE1 
2772 C CE2 . PHE D 4   ? 0.5186 0.4379 0.2719 0.2400  0.0499  0.0434  4    PHE D CE2 
2773 C CZ  . PHE D 4   ? 0.4621 0.4097 0.2563 0.2068  0.0419  0.0376  4    PHE D CZ  
2774 N N   . ASN D 5   ? 0.8364 0.4356 0.4265 0.3040  -0.1554 -0.0334 5    ASN D N   
2775 C CA  . ASN D 5   ? 0.9283 0.4422 0.4890 0.3318  -0.2103 -0.0540 5    ASN D CA  
2776 C C   . ASN D 5   ? 0.9300 0.4651 0.4651 0.3541  -0.1734 -0.0423 5    ASN D C   
2777 O O   . ASN D 5   ? 0.8756 0.4513 0.4795 0.3190  -0.1603 -0.0179 5    ASN D O   
2778 C CB  . ASN D 5   ? 0.9237 0.4176 0.5917 0.2831  -0.2625 -0.0416 5    ASN D CB  
2779 C CG  . ASN D 5   ? 1.0271 0.4259 0.6915 0.3057  -0.3310 -0.0613 5    ASN D CG  
2780 O OD1 . ASN D 5   ? 1.1562 0.4765 0.7129 0.3673  -0.3602 -0.1013 5    ASN D OD1 
2781 N ND2 . ASN D 5   ? 1.0270 0.4319 0.8114 0.2624  -0.3570 -0.0294 5    ASN D ND2 
2782 N N   . LYS D 6   ? 0.9951 0.5064 0.4302 0.4196  -0.1539 -0.0541 6    LYS D N   
2783 C CA  . LYS D 6   ? 0.9736 0.5314 0.3957 0.4419  -0.1008 -0.0303 6    LYS D CA  
2784 C C   . LYS D 6   ? 1.0064 0.5247 0.4338 0.4487  -0.1255 -0.0336 6    LYS D C   
2785 O O   . LYS D 6   ? 1.0963 0.5186 0.4881 0.4743  -0.1881 -0.0648 6    LYS D O   
2786 C CB  . LYS D 6   ? 1.0434 0.5980 0.3681 0.5194  -0.0631 -0.0259 6    LYS D CB  
2787 C CG  . LYS D 6   ? 0.9979 0.6116 0.3390 0.5121  -0.0241 -0.0064 6    LYS D CG  
2788 C CD  . LYS D 6   ? 1.0529 0.6902 0.3277 0.5904  0.0311  0.0235  6    LYS D CD  
2789 C CE  . LYS D 6   ? 1.0217 0.7183 0.3296 0.5843  0.0695  0.0518  6    LYS D CE  
2790 N NZ  . LYS D 6   ? 1.0829 0.8147 0.3459 0.6668  0.1318  0.0998  6    LYS D NZ  
2791 N N   . THR D 7   ? 0.9292 0.5196 0.4087 0.4254  -0.0825 -0.0020 7    THR D N   
2792 C CA  . THR D 7   ? 0.9592 0.5276 0.4388 0.4404  -0.0898 0.0035  7    THR D CA  
2793 C C   . THR D 7   ? 0.9337 0.5656 0.3966 0.4714  -0.0281 0.0321  7    THR D C   
2794 O O   . THR D 7   ? 0.8377 0.5570 0.3597 0.4383  0.0114  0.0587  7    THR D O   
2795 C CB  . THR D 7   ? 0.8947 0.4961 0.4759 0.3777  -0.1030 0.0245  7    THR D CB  
2796 O OG1 . THR D 7   ? 0.9329 0.4743 0.5528 0.3541  -0.1624 0.0110  7    THR D OG1 
2797 C CG2 . THR D 7   ? 0.9086 0.5053 0.4989 0.3915  -0.0997 0.0393  7    THR D CG2 
2798 N N   . LYS D 8   ? 1.0229 0.6084 0.4109 0.5392  -0.0242 0.0279  8    LYS D N   
2799 C CA  . LYS D 8   ? 1.0082 0.6587 0.3959 0.5742  0.0366  0.0671  8    LYS D CA  
2800 C C   . LYS D 8   ? 0.9229 0.6370 0.3998 0.5253  0.0489  0.0934  8    LYS D C   
2801 O O   . LYS D 8   ? 0.8517 0.6534 0.3919 0.5067  0.0883  0.1282  8    LYS D O   
2802 C CB  . LYS D 8   ? 1.1370 0.7222 0.4151 0.6704  0.0416  0.0604  8    LYS D CB  
2803 C CG  . LYS D 8   ? 1.1309 0.7956 0.4229 0.7138  0.1138  0.1163  8    LYS D CG  
2804 C CD  . LYS D 8   ? 1.2705 0.8739 0.4471 0.8204  0.1255  0.1152  8    LYS D CD  
2805 C CE  . LYS D 8   ? 1.2476 0.9410 0.4753 0.8504  0.1954  0.1828  8    LYS D CE  
2806 N NZ  . LYS D 8   ? 1.4012 1.0554 0.5071 0.9763  0.2300  0.1986  8    LYS D NZ  
2807 N N   . SER D 9   ? 0.9403 0.6079 0.4282 0.5079  0.0097  0.0790  9    SER D N   
2808 C CA  . SER D 9   ? 0.8719 0.5969 0.4328 0.4705  0.0201  0.1059  9    SER D CA  
2809 C C   . SER D 9   ? 0.8643 0.5547 0.4687 0.4316  -0.0232 0.0996  9    SER D C   
2810 O O   . SER D 9   ? 0.9309 0.5333 0.5130 0.4422  -0.0709 0.0735  9    SER D O   
2811 C CB  . SER D 9   ? 0.9135 0.6418 0.4491 0.5211  0.0460  0.1261  9    SER D CB  
2812 O OG  . SER D 9   ? 1.0297 0.6557 0.4963 0.5697  0.0116  0.1000  9    SER D OG  
2813 N N   . VAL D 10  ? 0.7920 0.5538 0.4651 0.3909  -0.0094 0.1278  10   VAL D N   
2814 C CA  . VAL D 10  ? 0.7916 0.5418 0.5203 0.3651  -0.0348 0.1450  10   VAL D CA  
2815 C C   . VAL D 10  ? 0.7810 0.5724 0.5291 0.3749  -0.0143 0.1742  10   VAL D C   
2816 O O   . VAL D 10  ? 0.7500 0.6012 0.4897 0.3850  0.0179  0.1839  10   VAL D O   
2817 C CB  . VAL D 10  ? 0.7320 0.5328 0.5198 0.3178  -0.0352 0.1610  10   VAL D CB  
2818 C CG1 . VAL D 10  ? 0.7420 0.4895 0.5258 0.3072  -0.0652 0.1368  10   VAL D CG1 
2819 C CG2 . VAL D 10  ? 0.6549 0.5475 0.4448 0.3049  0.0005  0.1685  10   VAL D CG2 
2820 N N   . GLU D 11  ? 0.8088 0.5677 0.5961 0.3719  -0.0372 0.1924  11   GLU D N   
2821 C CA  . GLU D 11  ? 0.8123 0.5981 0.6154 0.3866  -0.0219 0.2207  11   GLU D CA  
2822 C C   . GLU D 11  ? 0.7704 0.6085 0.6479 0.3583  -0.0193 0.2660  11   GLU D C   
2823 O O   . GLU D 11  ? 0.7703 0.5912 0.7019 0.3348  -0.0399 0.2811  11   GLU D O   
2824 C CB  . GLU D 11  ? 0.9067 0.5951 0.6809 0.4267  -0.0502 0.2051  11   GLU D CB  
2825 C CG  . GLU D 11  ? 0.9367 0.6449 0.6771 0.4664  -0.0206 0.2156  11   GLU D CG  
2826 C CD  . GLU D 11  ? 1.0482 0.6490 0.7394 0.5193  -0.0496 0.1925  11   GLU D CD  
2827 O OE1 . GLU D 11  ? 1.1211 0.6558 0.8561 0.5116  -0.0942 0.1940  11   GLU D OE1 
2828 O OE2 . GLU D 11  ? 1.1275 0.7094 0.7406 0.5739  -0.0287 0.1766  11   GLU D OE2 
2829 N N   . PHE D 12  ? 0.7401 0.6462 0.6241 0.3660  0.0070  0.2937  12   PHE D N   
2830 C CA  . PHE D 12  ? 0.7220 0.6804 0.6625 0.3571  0.0155  0.3449  12   PHE D CA  
2831 C C   . PHE D 12  ? 0.7379 0.7202 0.6806 0.3809  0.0280  0.3702  12   PHE D C   
2832 O O   . PHE D 12  ? 0.7440 0.7235 0.6471 0.4009  0.0358  0.3501  12   PHE D O   
2833 C CB  . PHE D 12  ? 0.6645 0.7074 0.6003 0.3448  0.0357  0.3561  12   PHE D CB  
2834 C CG  . PHE D 12  ? 0.6350 0.7414 0.5261 0.3573  0.0497  0.3404  12   PHE D CG  
2835 C CD1 . PHE D 12  ? 0.6396 0.8172 0.5277 0.3740  0.0607  0.3702  12   PHE D CD1 
2836 C CD2 . PHE D 12  ? 0.6094 0.7053 0.4698 0.3566  0.0477  0.3005  12   PHE D CD2 
2837 C CE1 . PHE D 12  ? 0.6253 0.8519 0.4818 0.3858  0.0561  0.3503  12   PHE D CE1 
2838 C CE2 . PHE D 12  ? 0.5868 0.7398 0.4380 0.3635  0.0496  0.2922  12   PHE D CE2 
2839 C CZ  . PHE D 12  ? 0.5986 0.8119 0.4486 0.3760  0.0472  0.3121  12   PHE D CZ  
2840 N N   . THR D 13  ? 0.7442 0.7557 0.7426 0.3814  0.0333  0.4233  13   THR D N   
2841 C CA  . THR D 13  ? 0.7683 0.8005 0.7801 0.4039  0.0434  0.4561  13   THR D CA  
2842 C C   . THR D 13  ? 0.7480 0.8780 0.7731 0.4129  0.0686  0.5069  13   THR D C   
2843 O O   . THR D 13  ? 0.7179 0.8955 0.7295 0.4075  0.0787  0.5105  13   THR D O   
2844 C CB  . THR D 13  ? 0.8254 0.7775 0.9023 0.4064  0.0182  0.4789  13   THR D CB  
2845 O OG1 . THR D 13  ? 0.8389 0.8108 1.0073 0.3885  0.0164  0.5361  13   THR D OG1 
2846 C CG2 . THR D 13  ? 0.8676 0.7079 0.9159 0.4082  -0.0191 0.4213  13   THR D CG2 
2847 N N   . PHE D 14  ? 0.7691 0.9281 0.8116 0.4353  0.0793  0.5467  14   PHE D N   
2848 C CA  . PHE D 14  ? 0.7757 1.0255 0.8192 0.4585  0.1033  0.6005  14   PHE D CA  
2849 C C   . PHE D 14  ? 0.7870 1.0587 0.8940 0.4553  0.1184  0.6599  14   PHE D C   
2850 O O   . PHE D 14  ? 0.7934 1.1440 0.8705 0.4815  0.1431  0.6912  14   PHE D O   
2851 C CB  . PHE D 14  ? 0.8004 1.0710 0.8626 0.4847  0.1115  0.6409  14   PHE D CB  
2852 C CG  . PHE D 14  ? 0.8306 1.0478 0.9875 0.4797  0.1074  0.6903  14   PHE D CG  
2853 C CD1 . PHE D 14  ? 0.8510 1.1116 1.0854 0.4895  0.1276  0.7735  14   PHE D CD1 
2854 C CD2 . PHE D 14  ? 0.8550 0.9781 1.0278 0.4725  0.0816  0.6577  14   PHE D CD2 
2855 C CE1 . PHE D 14  ? 0.8933 1.1020 1.2431 0.4812  0.1155  0.8251  14   PHE D CE1 
2856 C CE2 . PHE D 14  ? 0.9073 0.9669 1.1726 0.4701  0.0634  0.6960  14   PHE D CE2 
2857 C CZ  . PHE D 14  ? 0.9218 1.0233 1.2876 0.4691  0.0771  0.7805  14   PHE D CZ  
2858 N N   . GLY D 15  ? 0.8050 1.0055 1.0018 0.4296  0.1000  0.6770  15   GLY D N   
2859 C CA  . GLY D 15  ? 0.8185 1.0380 1.1168 0.4213  0.1102  0.7475  15   GLY D CA  
2860 C C   . GLY D 15  ? 0.7959 1.0508 1.0675 0.4141  0.1227  0.7370  15   GLY D C   
2861 O O   . GLY D 15  ? 0.8029 1.1108 1.1453 0.4233  0.1487  0.8115  15   GLY D O   
2862 N N   . ASN D 16  ? 0.7731 1.0021 0.9524 0.4009  0.1073  0.6526  16   ASN D N   
2863 C CA  . ASN D 16  ? 0.7518 1.0130 0.8934 0.3971  0.1179  0.6343  16   ASN D CA  
2864 C C   . ASN D 16  ? 0.7658 1.1234 0.8277 0.4435  0.1512  0.6523  16   ASN D C   
2865 O O   . ASN D 16  ? 0.7736 1.1489 0.7542 0.4623  0.1441  0.6121  16   ASN D O   
2866 C CB  . ASN D 16  ? 0.7219 0.9258 0.7970 0.3717  0.0905  0.5430  16   ASN D CB  
2867 C CG  . ASN D 16  ? 0.7387 0.8416 0.8655 0.3407  0.0531  0.5177  16   ASN D CG  
2868 O OD1 . ASN D 16  ? 0.7663 0.8120 0.9021 0.3439  0.0332  0.5061  16   ASN D OD1 
2869 N ND2 . ASN D 16  ? 0.7416 0.8183 0.8988 0.3169  0.0393  0.5080  16   ASN D ND2 
2870 N N   . ASP D 17  ? 0.7845 1.2026 0.8712 0.4684  0.1841  0.7146  17   ASP D N   
2871 C CA  . ASP D 17  ? 0.8164 1.3167 0.8021 0.5281  0.2118  0.7232  17   ASP D CA  
2872 C C   . ASP D 17  ? 0.7959 1.2832 0.7003 0.5209  0.1956  0.6474  17   ASP D C   
2873 O O   . ASP D 17  ? 0.8222 1.3430 0.6173 0.5628  0.1902  0.6091  17   ASP D O   
2874 C CB  . ASP D 17  ? 0.8598 1.4379 0.9020 0.5747  0.2640  0.8354  17   ASP D CB  
2875 C CG  . ASP D 17  ? 0.8890 1.4804 1.0402 0.5782  0.2799  0.9227  17   ASP D CG  
2876 O OD1 . ASP D 17  ? 0.9006 1.4771 1.0187 0.5816  0.2632  0.8991  17   ASP D OD1 
2877 O OD2 . ASP D 17  ? 0.9201 1.5386 1.2040 0.5774  0.3081  1.0206  17   ASP D OD2 
2878 N N   . THR D 18  ? 0.7544 1.1877 0.7159 0.4704  0.1815  0.6252  18   THR D N   
2879 C CA  . THR D 18  ? 0.7317 1.1405 0.6328 0.4533  0.1627  0.5511  18   THR D CA  
2880 C C   . THR D 18  ? 0.6854 1.0088 0.6325 0.3932  0.1296  0.5029  18   THR D C   
2881 O O   . THR D 18  ? 0.6836 0.9639 0.7140 0.3689  0.1197  0.5316  18   THR D O   
2882 C CB  . THR D 18  ? 0.7451 1.1931 0.6542 0.4728  0.1912  0.5868  18   THR D CB  
2883 O OG1 . THR D 18  ? 0.7330 1.1554 0.7709 0.4341  0.1949  0.6387  18   THR D OG1 
2884 C CG2 . THR D 18  ? 0.8019 1.3384 0.6621 0.5511  0.2342  0.6524  18   THR D CG2 
2885 N N   . VAL D 19  ? 0.6586 0.9551 0.5506 0.3762  0.1094  0.4310  19   VAL D N   
2886 C CA  . VAL D 19  ? 0.6316 0.8530 0.5454 0.3340  0.0832  0.3856  19   VAL D CA  
2887 C C   . VAL D 19  ? 0.6069 0.8154 0.5114 0.3160  0.0790  0.3553  19   VAL D C   
2888 O O   . VAL D 19  ? 0.6112 0.8635 0.4706 0.3356  0.0901  0.3459  19   VAL D O   
2889 C CB  . VAL D 19  ? 0.6267 0.8269 0.4965 0.3325  0.0662  0.3356  19   VAL D CB  
2890 C CG1 . VAL D 19  ? 0.6384 0.8500 0.5202 0.3508  0.0702  0.3663  19   VAL D CG1 
2891 C CG2 . VAL D 19  ? 0.6276 0.8646 0.4389 0.3442  0.0590  0.2936  19   VAL D CG2 
2892 N N   . VAL D 20  ? 0.5935 0.7369 0.5352 0.2848  0.0588  0.3384  20   VAL D N   
2893 C CA  . VAL D 20  ? 0.5704 0.6934 0.5032 0.2657  0.0510  0.3056  20   VAL D CA  
2894 C C   . VAL D 20  ? 0.5578 0.6242 0.4529 0.2538  0.0306  0.2485  20   VAL D C   
2895 O O   . VAL D 20  ? 0.5788 0.5937 0.4793 0.2550  0.0150  0.2429  20   VAL D O   
2896 C CB  . VAL D 20  ? 0.5759 0.6740 0.5921 0.2458  0.0413  0.3430  20   VAL D CB  
2897 C CG1 . VAL D 20  ? 0.5614 0.6342 0.5652 0.2266  0.0297  0.3062  20   VAL D CG1 
2898 C CG2 . VAL D 20  ? 0.5809 0.7502 0.6506 0.2651  0.0735  0.4187  20   VAL D CG2 
2899 N N   . ILE D 21  ? 0.5339 0.6122 0.3915 0.2500  0.0329  0.2110  21   ILE D N   
2900 C CA  . ILE D 21  ? 0.5313 0.5666 0.3644 0.2439  0.0227  0.1712  21   ILE D CA  
2901 C C   . ILE D 21  ? 0.5254 0.5317 0.3662 0.2270  0.0139  0.1578  21   ILE D C   
2902 O O   . ILE D 21  ? 0.4997 0.5393 0.3377 0.2206  0.0222  0.1507  21   ILE D O   
2903 C CB  . ILE D 21  ? 0.5134 0.5859 0.3249 0.2505  0.0287  0.1480  21   ILE D CB  
2904 C CG1 . ILE D 21  ? 0.5202 0.6329 0.3306 0.2673  0.0306  0.1629  21   ILE D CG1 
2905 C CG2 . ILE D 21  ? 0.5061 0.5456 0.3085 0.2541  0.0297  0.1293  21   ILE D CG2 
2906 C CD1 . ILE D 21  ? 0.5123 0.6605 0.3255 0.2715  0.0208  0.1425  21   ILE D CD1 
2907 N N   . PRO D 22  ? 0.5568 0.4952 0.4035 0.2244  -0.0092 0.1509  22   PRO D N   
2908 C CA  . PRO D 22  ? 0.5598 0.4680 0.4238 0.2086  -0.0268 0.1428  22   PRO D CA  
2909 C C   . PRO D 22  ? 0.5385 0.4496 0.3628 0.2088  -0.0178 0.1103  22   PRO D C   
2910 O O   . PRO D 22  ? 0.5491 0.4547 0.3342 0.2265  -0.0078 0.0926  22   PRO D O   
2911 C CB  . PRO D 22  ? 0.6241 0.4457 0.4949 0.2154  -0.0689 0.1344  22   PRO D CB  
2912 C CG  . PRO D 22  ? 0.6466 0.4483 0.4739 0.2432  -0.0643 0.1251  22   PRO D CG  
2913 C CD  . PRO D 22  ? 0.6010 0.4817 0.4330 0.2426  -0.0267 0.1462  22   PRO D CD  
2914 N N   . CYS D 23  ? 0.5153 0.4418 0.3607 0.1920  -0.0173 0.1115  23   CYS D N   
2915 C CA  . CYS D 23  ? 0.4991 0.4233 0.3187 0.1905  -0.0119 0.0852  23   CYS D CA  
2916 C C   . CYS D 23  ? 0.5010 0.4103 0.3505 0.1734  -0.0273 0.0889  23   CYS D C   
2917 O O   . CYS D 23  ? 0.4821 0.4353 0.3677 0.1620  -0.0144 0.1104  23   CYS D O   
2918 C CB  . CYS D 23  ? 0.4604 0.4432 0.2754 0.1905  0.0121  0.0783  23   CYS D CB  
2919 S SG  . CYS D 23  ? 0.4482 0.4288 0.2553 0.1881  0.0186  0.0549  23   CYS D SG  
2920 N N   . PHE D 24  ? 0.5320 0.3791 0.3611 0.1795  -0.0556 0.0693  24   PHE D N   
2921 C CA  . PHE D 24  ? 0.5400 0.3591 0.4062 0.1639  -0.0853 0.0725  24   PHE D CA  
2922 C C   . PHE D 24  ? 0.5429 0.3382 0.3612 0.1749  -0.0886 0.0433  24   PHE D C   
2923 O O   . PHE D 24  ? 0.5807 0.3255 0.3351 0.2058  -0.1026 0.0192  24   PHE D O   
2924 C CB  . PHE D 24  ? 0.6094 0.3583 0.5071 0.1652  -0.1394 0.0760  24   PHE D CB  
2925 C CG  . PHE D 24  ? 0.6169 0.3923 0.5897 0.1516  -0.1374 0.1193  24   PHE D CG  
2926 C CD1 . PHE D 24  ? 0.5925 0.4209 0.6581 0.1289  -0.1254 0.1693  24   PHE D CD1 
2927 C CD2 . PHE D 24  ? 0.6455 0.3989 0.5991 0.1678  -0.1417 0.1184  24   PHE D CD2 
2928 C CE1 . PHE D 24  ? 0.5758 0.4388 0.7161 0.1249  -0.1151 0.2232  24   PHE D CE1 
2929 C CE2 . PHE D 24  ? 0.6466 0.4286 0.6748 0.1579  -0.1368 0.1655  24   PHE D CE2 
2930 C CZ  . PHE D 24  ? 0.6168 0.4559 0.7398 0.1375  -0.1221 0.2208  24   PHE D CZ  
2931 N N   . VAL D 25  ? 0.4962 0.3305 0.3408 0.1573  -0.0721 0.0494  25   VAL D N   
2932 C CA  . VAL D 25  ? 0.4994 0.3168 0.3132 0.1650  -0.0745 0.0299  25   VAL D CA  
2933 C C   . VAL D 25  ? 0.5471 0.3101 0.3845 0.1592  -0.1261 0.0269  25   VAL D C   
2934 O O   . VAL D 25  ? 0.5283 0.3095 0.4456 0.1323  -0.1384 0.0544  25   VAL D O   
2935 C CB  . VAL D 25  ? 0.4410 0.3181 0.2790 0.1495  -0.0400 0.0359  25   VAL D CB  
2936 C CG1 . VAL D 25  ? 0.4173 0.2781 0.2315 0.1580  -0.0409 0.0217  25   VAL D CG1 
2937 C CG2 . VAL D 25  ? 0.3811 0.3033 0.2110 0.1541  -0.0075 0.0347  25   VAL D CG2 
2938 N N   . THR D 26  ? 0.6114 0.3101 0.3826 0.1906  -0.1576 -0.0021 26   THR D N   
2939 C CA  . THR D 26  ? 0.6783 0.3075 0.4624 0.1931  -0.2261 -0.0159 26   THR D CA  
2940 C C   . THR D 26  ? 0.6721 0.3103 0.4699 0.1841  -0.2322 -0.0168 26   THR D C   
2941 O O   . THR D 26  ? 0.7280 0.3162 0.5602 0.1787  -0.2951 -0.0230 26   THR D O   
2942 C CB  . THR D 26  ? 0.7913 0.3299 0.4745 0.2479  -0.2711 -0.0554 26   THR D CB  
2943 O OG1 . THR D 26  ? 0.8034 0.3470 0.3894 0.2921  -0.2374 -0.0698 26   THR D OG1 
2944 C CG2 . THR D 26  ? 0.7921 0.3182 0.4566 0.2622  -0.2639 -0.0551 26   THR D CG2 
2945 N N   . ASN D 27  ? 0.6130 0.3098 0.3929 0.1830  -0.1748 -0.0106 27   ASN D N   
2946 C CA  . ASN D 27  ? 0.6012 0.3124 0.3986 0.1742  -0.1743 -0.0080 27   ASN D CA  
2947 C C   . ASN D 27  ? 0.5190 0.3095 0.3809 0.1413  -0.1237 0.0181  27   ASN D C   
2948 O O   . ASN D 27  ? 0.4974 0.3149 0.3512 0.1432  -0.0960 0.0171  27   ASN D O   
2949 C CB  . ASN D 27  ? 0.6435 0.3341 0.3485 0.2191  -0.1625 -0.0272 27   ASN D CB  
2950 C CG  . ASN D 27  ? 0.6126 0.3509 0.2899 0.2345  -0.0989 -0.0171 27   ASN D CG  
2951 O OD1 . ASN D 27  ? 0.5799 0.3508 0.2868 0.2170  -0.0756 -0.0078 27   ASN D OD1 
2952 N ND2 . ASN D 27  ? 0.6449 0.3899 0.2745 0.2704  -0.0727 -0.0130 27   ASN D ND2 
2953 N N   . MET D 28  ? 0.4907 0.3153 0.4139 0.1185  -0.1139 0.0427  28   MET D N   
2954 C CA  . MET D 28  ? 0.4322 0.3259 0.3982 0.1033  -0.0699 0.0653  28   MET D CA  
2955 C C   . MET D 28  ? 0.4200 0.3292 0.4394 0.0903  -0.0750 0.0833  28   MET D C   
2956 O O   . MET D 28  ? 0.4517 0.3294 0.5176 0.0806  -0.1193 0.0952  28   MET D O   
2957 C CB  . MET D 28  ? 0.4279 0.3533 0.4375 0.0968  -0.0590 0.0959  28   MET D CB  
2958 C CG  . MET D 28  ? 0.3952 0.3829 0.3952 0.1054  -0.0110 0.1036  28   MET D CG  
2959 S SD  . MET D 28  ? 0.4011 0.3906 0.3303 0.1204  0.0068  0.0664  28   MET D SD  
2960 C CE  . MET D 28  ? 0.3973 0.4448 0.3229 0.1360  0.0384  0.0697  28   MET D CE  
2961 N N   . GLU D 29  ? 0.3846 0.3378 0.4025 0.0921  -0.0361 0.0840  29   GLU D N   
2962 C CA  . GLU D 29  ? 0.3734 0.3471 0.4386 0.0846  -0.0328 0.1028  29   GLU D CA  
2963 C C   . GLU D 29  ? 0.3562 0.3911 0.4567 0.0917  0.0072  0.1336  29   GLU D C   
2964 O O   . GLU D 29  ? 0.3576 0.4190 0.5226 0.0883  0.0111  0.1711  29   GLU D O   
2965 C CB  . GLU D 29  ? 0.3653 0.3291 0.3907 0.0916  -0.0235 0.0755  29   GLU D CB  
2966 C CG  . GLU D 29  ? 0.4086 0.3214 0.4068 0.0972  -0.0609 0.0607  29   GLU D CG  
2967 C CD  . GLU D 29  ? 0.3884 0.3024 0.3492 0.1114  -0.0398 0.0454  29   GLU D CD  
2968 O OE1 . GLU D 29  ? 0.4525 0.3284 0.3648 0.1324  -0.0600 0.0339  29   GLU D OE1 
2969 O OE2 . GLU D 29  ? 0.3706 0.3209 0.3499 0.1080  -0.0052 0.0466  29   GLU D OE2 
2970 N N   . ALA D 30  ? 0.3532 0.4103 0.4085 0.1088  0.0350  0.1191  30   ALA D N   
2971 C CA  . ALA D 30  ? 0.3562 0.4628 0.4071 0.1355  0.0716  0.1347  30   ALA D CA  
2972 C C   . ALA D 30  ? 0.3700 0.5212 0.4852 0.1456  0.0887  0.1999  30   ALA D C   
2973 O O   . ALA D 30  ? 0.3805 0.5322 0.5282 0.1376  0.0785  0.2273  30   ALA D O   
2974 C CB  . ALA D 30  ? 0.3695 0.4795 0.3559 0.1564  0.0809  0.1017  30   ALA D CB  
2975 N N   . GLN D 31  ? 0.3770 0.5682 0.5186 0.1668  0.1171  0.2309  31   GLN D N   
2976 C CA  . GLN D 31  ? 0.3905 0.6407 0.6098 0.1862  0.1459  0.3112  31   GLN D CA  
2977 C C   . GLN D 31  ? 0.4299 0.7326 0.5865 0.2506  0.1973  0.3283  31   GLN D C   
2978 O O   . GLN D 31  ? 0.4492 0.8150 0.6606 0.2847  0.2371  0.4059  31   GLN D O   
2979 C CB  . GLN D 31  ? 0.3841 0.6508 0.6886 0.1743  0.1453  0.3499  31   GLN D CB  
2980 C CG  . GLN D 31  ? 0.3770 0.5877 0.7344 0.1221  0.0855  0.3317  31   GLN D CG  
2981 C CD  . GLN D 31  ? 0.4075 0.6010 0.8521 0.0940  0.0446  0.3674  31   GLN D CD  
2982 O OE1 . GLN D 31  ? 0.4319 0.6695 1.0001 0.0924  0.0498  0.4469  31   GLN D OE1 
2983 N NE2 . GLN D 31  ? 0.4183 0.5475 0.8088 0.0754  0.0026  0.3140  31   GLN D NE2 
2984 N N   . ASN D 32  ? 0.4447 0.7217 0.4908 0.2734  0.1937  0.2603  32   ASN D N   
2985 C CA  . ASN D 32  ? 0.5075 0.8172 0.4668 0.3450  0.2263  0.2586  32   ASN D CA  
2986 C C   . ASN D 32  ? 0.5143 0.7843 0.3884 0.3469  0.1965  0.1892  32   ASN D C   
2987 O O   . ASN D 32  ? 0.4828 0.7023 0.3434 0.3121  0.1608  0.1281  32   ASN D O   
2988 C CB  . ASN D 32  ? 0.5495 0.8660 0.4631 0.3917  0.2459  0.2421  32   ASN D CB  
2989 C CG  . ASN D 32  ? 0.6525 1.0040 0.4671 0.4868  0.2811  0.2498  32   ASN D CG  
2990 O OD1 . ASN D 32  ? 0.6903 1.0143 0.4096 0.5167  0.2590  0.1934  32   ASN D OD1 
2991 N ND2 . ASN D 32  ? 0.7229 1.1373 0.5603 0.5422  0.3356  0.3247  32   ASN D ND2 
2992 N N   . THR D 33  ? 0.5521 0.8495 0.3787 0.3896  0.2117  0.2056  33   THR D N   
2993 C CA  . THR D 33  ? 0.5617 0.8244 0.3281 0.3842  0.1776  0.1480  33   THR D CA  
2994 C C   . THR D 33  ? 0.6104 0.8362 0.2883 0.4197  0.1478  0.0697  33   THR D C   
2995 O O   . THR D 33  ? 0.6012 0.7923 0.2546 0.4057  0.1084  0.0181  33   THR D O   
2996 C CB  . THR D 33  ? 0.5885 0.8889 0.3373 0.4149  0.1966  0.1898  33   THR D CB  
2997 O OG1 . THR D 33  ? 0.6597 1.0118 0.3489 0.5004  0.2388  0.2280  33   THR D OG1 
2998 C CG2 . THR D 33  ? 0.5433 0.8608 0.4026 0.3661  0.2060  0.2568  33   THR D CG2 
2999 N N   . THR D 34  ? 0.6608 0.8904 0.3049 0.4640  0.1613  0.0627  34   THR D N   
3000 C CA  . THR D 34  ? 0.7204 0.8993 0.3044 0.4897  0.1204  -0.0155 34   THR D CA  
3001 C C   . THR D 34  ? 0.6508 0.7792 0.3017 0.4159  0.0777  -0.0601 34   THR D C   
3002 O O   . THR D 34  ? 0.6794 0.7619 0.3116 0.4219  0.0291  -0.1230 34   THR D O   
3003 C CB  . THR D 34  ? 0.7727 0.9624 0.3246 0.5445  0.1469  -0.0069 34   THR D CB  
3004 O OG1 . THR D 34  ? 0.8758 1.1164 0.3516 0.6337  0.1913  0.0376  34   THR D OG1 
3005 C CG2 . THR D 34  ? 0.8359 0.9604 0.3407 0.5666  0.0947  -0.0913 34   THR D CG2 
3006 N N   . GLU D 35  ? 0.5745 0.7113 0.3081 0.3525  0.0927  -0.0234 35   GLU D N   
3007 C CA  . GLU D 35  ? 0.5237 0.6238 0.3167 0.2938  0.0656  -0.0488 35   GLU D CA  
3008 C C   . GLU D 35  ? 0.4830 0.5752 0.3032 0.2532  0.0522  -0.0455 35   GLU D C   
3009 O O   . GLU D 35  ? 0.4425 0.5151 0.3099 0.2124  0.0428  -0.0479 35   GLU D O   
3010 C CB  . GLU D 35  ? 0.4849 0.5925 0.3329 0.2649  0.0867  -0.0157 35   GLU D CB  
3011 C CG  . GLU D 35  ? 0.5347 0.6437 0.3665 0.3008  0.0974  -0.0239 35   GLU D CG  
3012 C CD  . GLU D 35  ? 0.5380 0.6860 0.4082 0.3017  0.1351  0.0362  35   GLU D CD  
3013 O OE1 . GLU D 35  ? 0.4929 0.6457 0.4255 0.2548  0.1351  0.0696  35   GLU D OE1 
3014 O OE2 . GLU D 35  ? 0.6103 0.7823 0.4503 0.3544  0.1610  0.0511  35   GLU D OE2 
3015 N N   . VAL D 36  ? 0.5035 0.6130 0.2888 0.2726  0.0545  -0.0366 36   VAL D N   
3016 C CA  . VAL D 36  ? 0.4718 0.5739 0.2759 0.2429  0.0425  -0.0344 36   VAL D CA  
3017 C C   . VAL D 36  ? 0.5102 0.6012 0.2835 0.2642  0.0093  -0.0747 36   VAL D C   
3018 O O   . VAL D 36  ? 0.5774 0.6711 0.2915 0.3138  -0.0022 -0.0977 36   VAL D O   
3019 C CB  . VAL D 36  ? 0.4575 0.5852 0.2693 0.2384  0.0669  0.0161  36   VAL D CB  
3020 C CG1 . VAL D 36  ? 0.4337 0.5442 0.2630 0.2088  0.0533  0.0156  36   VAL D CG1 
3021 C CG2 . VAL D 36  ? 0.4236 0.5587 0.2834 0.2196  0.0854  0.0557  36   VAL D CG2 
3022 N N   . TYR D 37  ? 0.4829 0.5596 0.2972 0.2322  -0.0093 -0.0824 37   TYR D N   
3023 C CA  . TYR D 37  ? 0.5126 0.5807 0.3268 0.2427  -0.0476 -0.1127 37   TYR D CA  
3024 C C   . TYR D 37  ? 0.4752 0.5536 0.3125 0.2186  -0.0371 -0.0858 37   TYR D C   
3025 O O   . TYR D 37  ? 0.4302 0.5017 0.3130 0.1878  -0.0239 -0.0667 37   TYR D O   
3026 C CB  . TYR D 37  ? 0.5212 0.5614 0.4009 0.2277  -0.0869 -0.1442 37   TYR D CB  
3027 C CG  . TYR D 37  ? 0.5724 0.5970 0.4695 0.2428  -0.1452 -0.1811 37   TYR D CG  
3028 C CD1 . TYR D 37  ? 0.6601 0.6536 0.5268 0.2812  -0.1962 -0.2330 37   TYR D CD1 
3029 C CD2 . TYR D 37  ? 0.5643 0.6008 0.5103 0.2232  -0.1559 -0.1654 37   TYR D CD2 
3030 C CE1 . TYR D 37  ? 0.7250 0.6940 0.6123 0.2973  -0.2668 -0.2731 37   TYR D CE1 
3031 C CE2 . TYR D 37  ? 0.5990 0.6218 0.5772 0.2349  -0.2180 -0.1965 37   TYR D CE2 
3032 C CZ  . TYR D 37  ? 0.6885 0.6749 0.6395 0.2704  -0.2784 -0.2524 37   TYR D CZ  
3033 O OH  . TYR D 37  ? 0.7625 0.7250 0.7495 0.2844  -0.3567 -0.2898 37   TYR D OH  
3034 N N   . VAL D 38  ? 0.4989 0.5930 0.2957 0.2409  -0.0410 -0.0827 38   VAL D N   
3035 C CA  . VAL D 38  ? 0.4736 0.5747 0.2907 0.2239  -0.0358 -0.0612 38   VAL D CA  
3036 C C   . VAL D 38  ? 0.4980 0.5975 0.3413 0.2294  -0.0776 -0.0856 38   VAL D C   
3037 O O   . VAL D 38  ? 0.5542 0.6473 0.3698 0.2595  -0.1166 -0.1219 38   VAL D O   
3038 C CB  . VAL D 38  ? 0.4868 0.6097 0.2595 0.2412  -0.0104 -0.0295 38   VAL D CB  
3039 C CG1 . VAL D 38  ? 0.4666 0.5888 0.2606 0.2250  -0.0074 -0.0104 38   VAL D CG1 
3040 C CG2 . VAL D 38  ? 0.4668 0.5942 0.2411 0.2352  0.0216  0.0026  38   VAL D CG2 
3041 N N   . LYS D 39  ? 0.4623 0.5654 0.3589 0.2064  -0.0733 -0.0650 39   LYS D N   
3042 C CA  . LYS D 39  ? 0.4737 0.5829 0.4232 0.2062  -0.1109 -0.0735 39   LYS D CA  
3043 C C   . LYS D 39  ? 0.4412 0.5658 0.4018 0.1988  -0.0846 -0.0371 39   LYS D C   
3044 O O   . LYS D 39  ? 0.3974 0.5185 0.3804 0.1849  -0.0512 -0.0084 39   LYS D O   
3045 C CB  . LYS D 39  ? 0.4604 0.5606 0.5122 0.1854  -0.1361 -0.0775 39   LYS D CB  
3046 C CG  . LYS D 39  ? 0.4904 0.6000 0.6378 0.1800  -0.1828 -0.0760 39   LYS D CG  
3047 C CD  . LYS D 39  ? 0.4804 0.5855 0.7599 0.1578  -0.2072 -0.0658 39   LYS D CD  
3048 C CE  . LYS D 39  ? 0.5483 0.6164 0.8272 0.1670  -0.2646 -0.1201 39   LYS D CE  
3049 N NZ  . LYS D 39  ? 0.5521 0.6130 0.9871 0.1426  -0.2987 -0.1063 39   LYS D NZ  
3050 N N   . TRP D 40  ? 0.4663 0.6047 0.3995 0.2166  -0.1004 -0.0397 40   TRP D N   
3051 C CA  . TRP D 40  ? 0.4512 0.6032 0.3990 0.2140  -0.0814 -0.0076 40   TRP D CA  
3052 C C   . TRP D 40  ? 0.4613 0.6302 0.4923 0.2111  -0.1184 -0.0053 40   TRP D C   
3053 O O   . TRP D 40  ? 0.4987 0.6676 0.5359 0.2235  -0.1715 -0.0372 40   TRP D O   
3054 C CB  . TRP D 40  ? 0.4657 0.6268 0.3389 0.2352  -0.0690 -0.0002 40   TRP D CB  
3055 C CG  . TRP D 40  ? 0.4420 0.5907 0.2748 0.2315  -0.0305 0.0198  40   TRP D CG  
3056 C CD1 . TRP D 40  ? 0.4434 0.5904 0.2400 0.2385  -0.0202 0.0163  40   TRP D CD1 
3057 C CD2 . TRP D 40  ? 0.4221 0.5547 0.2558 0.2233  -0.0039 0.0480  40   TRP D CD2 
3058 N NE1 . TRP D 40  ? 0.4185 0.5523 0.2126 0.2279  0.0070  0.0449  40   TRP D NE1 
3059 C CE2 . TRP D 40  ? 0.4184 0.5362 0.2293 0.2195  0.0120  0.0589  40   TRP D CE2 
3060 C CE3 . TRP D 40  ? 0.4150 0.5408 0.2681 0.2238  0.0046  0.0655  40   TRP D CE3 
3061 C CZ2 . TRP D 40  ? 0.4212 0.5084 0.2327 0.2133  0.0231  0.0795  40   TRP D CZ2 
3062 C CZ3 . TRP D 40  ? 0.4200 0.5134 0.2522 0.2256  0.0219  0.0822  40   TRP D CZ3 
3063 C CH2 . TRP D 40  ? 0.4244 0.4939 0.2383 0.2186  0.0247  0.0855  40   TRP D CH2 
3064 N N   . LYS D 41  ? 0.4360 0.6181 0.5306 0.2014  -0.0928 0.0346  41   LYS D N   
3065 C CA  . LYS D 41  ? 0.4429 0.6514 0.6484 0.1967  -0.1202 0.0559  41   LYS D CA  
3066 C C   . LYS D 41  ? 0.4386 0.6672 0.6359 0.2098  -0.0968 0.0888  41   LYS D C   
3067 O O   . LYS D 41  ? 0.4182 0.6349 0.5458 0.2203  -0.0503 0.1047  41   LYS D O   
3068 C CB  . LYS D 41  ? 0.4176 0.6382 0.7348 0.1825  -0.1045 0.0923  41   LYS D CB  
3069 C CG  . LYS D 41  ? 0.4450 0.6579 0.8535 0.1655  -0.1613 0.0683  41   LYS D CG  
3070 C CD  . LYS D 41  ? 0.4189 0.6522 0.9567 0.1527  -0.1382 0.1202  41   LYS D CD  
3071 C CE  . LYS D 41  ? 0.4177 0.6317 0.8818 0.1552  -0.0877 0.1202  41   LYS D CE  
3072 N NZ  . LYS D 41  ? 0.4036 0.6410 0.9873 0.1508  -0.0628 0.1746  41   LYS D NZ  
3073 N N   . PHE D 42  ? 0.4623 0.7164 0.7367 0.2105  -0.1376 0.0963  42   PHE D N   
3074 C CA  . PHE D 42  ? 0.4666 0.7461 0.7539 0.2237  -0.1207 0.1314  42   PHE D CA  
3075 C C   . PHE D 42  ? 0.4740 0.7903 0.9176 0.2147  -0.1613 0.1614  42   PHE D C   
3076 O O   . PHE D 42  ? 0.5069 0.8203 0.9959 0.2082  -0.2358 0.1275  42   PHE D O   
3077 C CB  . PHE D 42  ? 0.4968 0.7695 0.6821 0.2408  -0.1372 0.1029  42   PHE D CB  
3078 C CG  . PHE D 42  ? 0.5002 0.7983 0.7013 0.2545  -0.1260 0.1365  42   PHE D CG  
3079 C CD1 . PHE D 42  ? 0.4868 0.7817 0.6643 0.2653  -0.0660 0.1745  42   PHE D CD1 
3080 C CD2 . PHE D 42  ? 0.5274 0.8472 0.7610 0.2627  -0.1810 0.1268  42   PHE D CD2 
3081 C CE1 . PHE D 42  ? 0.4908 0.8068 0.6819 0.2821  -0.0544 0.2059  42   PHE D CE1 
3082 C CE2 . PHE D 42  ? 0.5364 0.8825 0.7892 0.2755  -0.1698 0.1608  42   PHE D CE2 
3083 C CZ  . PHE D 42  ? 0.5129 0.8585 0.7463 0.2844  -0.1030 0.2021  42   PHE D CZ  
3084 N N   . LYS D 43  ? 0.4557 0.8052 0.9851 0.2203  -0.1157 0.2271  43   LYS D N   
3085 C CA  . LYS D 43  ? 0.4599 0.8571 1.1722 0.2121  -0.1447 0.2782  43   LYS D CA  
3086 C C   . LYS D 43  ? 0.4730 0.8645 1.3099 0.1836  -0.2152 0.2593  43   LYS D C   
3087 O O   . LYS D 43  ? 0.5065 0.9028 1.4407 0.1715  -0.2984 0.2429  43   LYS D O   
3088 C CB  . LYS D 43  ? 0.4810 0.8989 1.2072 0.2203  -0.1800 0.2794  43   LYS D CB  
3089 C CG  . LYS D 43  ? 0.4766 0.8999 1.1046 0.2495  -0.1121 0.3062  43   LYS D CG  
3090 C CD  . LYS D 43  ? 0.5021 0.9452 1.1357 0.2582  -0.1466 0.3057  43   LYS D CD  
3091 C CE  . LYS D 43  ? 0.5037 0.9497 1.0577 0.2888  -0.0789 0.3381  43   LYS D CE  
3092 N NZ  . LYS D 43  ? 0.5052 0.9922 1.1583 0.3100  -0.0218 0.4179  43   LYS D NZ  
3093 N N   . GLY D 44  ? 0.4620 0.8367 1.2933 0.1756  -0.1883 0.2583  44   GLY D N   
3094 C CA  . GLY D 44  ? 0.4727 0.8374 1.4304 0.1497  -0.2472 0.2471  44   GLY D CA  
3095 C C   . GLY D 44  ? 0.5168 0.8225 1.3805 0.1439  -0.3177 0.1529  44   GLY D C   
3096 O O   . GLY D 44  ? 0.5284 0.8102 1.4446 0.1289  -0.3475 0.1338  44   GLY D O   
3097 N N   . ARG D 45  ? 0.5533 0.8371 1.2765 0.1628  -0.3405 0.0989  45   ARG D N   
3098 C CA  . ARG D 45  ? 0.6189 0.8533 1.2518 0.1754  -0.4131 0.0151  45   ARG D CA  
3099 C C   . ARG D 45  ? 0.6134 0.8209 1.0663 0.1918  -0.3611 -0.0193 45   ARG D C   
3100 O O   . ARG D 45  ? 0.5754 0.7970 0.9447 0.1972  -0.2855 0.0083  45   ARG D O   
3101 C CB  . ARG D 45  ? 0.6778 0.9105 1.2678 0.1995  -0.4750 -0.0174 45   ARG D CB  
3102 C CG  . ARG D 45  ? 0.7196 0.9623 1.4919 0.1858  -0.5676 -0.0073 45   ARG D CG  
3103 C CD  . ARG D 45  ? 0.8082 1.0340 1.5057 0.2196  -0.6468 -0.0600 45   ARG D CD  
3104 N NE  . ARG D 45  ? 0.8013 1.0577 1.3724 0.2416  -0.5777 -0.0381 45   ARG D NE  
3105 C CZ  . ARG D 45  ? 0.8253 1.0667 1.2012 0.2770  -0.5409 -0.0715 45   ARG D CZ  
3106 N NH1 . ARG D 45  ? 0.8047 1.0759 1.1048 0.2914  -0.4829 -0.0401 45   ARG D NH1 
3107 N NH2 . ARG D 45  ? 0.8847 1.0841 1.1498 0.3011  -0.5595 -0.1289 45   ARG D NH2 
3108 N N   . ASP D 46  ? 0.6636 0.8295 1.0652 0.2032  -0.4088 -0.0793 46   ASP D N   
3109 C CA  . ASP D 46  ? 0.6734 0.8181 0.9141 0.2255  -0.3691 -0.1105 46   ASP D CA  
3110 C C   . ASP D 46  ? 0.7266 0.8730 0.8321 0.2683  -0.3782 -0.1364 46   ASP D C   
3111 O O   . ASP D 46  ? 0.8195 0.9432 0.8902 0.3025  -0.4542 -0.1867 46   ASP D O   
3112 C CB  . ASP D 46  ? 0.7196 0.8217 0.9582 0.2312  -0.4147 -0.1602 46   ASP D CB  
3113 C CG  . ASP D 46  ? 0.6701 0.7746 1.0151 0.1932  -0.3823 -0.1263 46   ASP D CG  
3114 O OD1 . ASP D 46  ? 0.6146 0.7507 0.9808 0.1742  -0.3080 -0.0693 46   ASP D OD1 
3115 O OD2 . ASP D 46  ? 0.7101 0.7814 1.1100 0.1892  -0.4329 -0.1578 46   ASP D OD2 
3116 N N   . ILE D 47  ? 0.6823 0.8528 0.7145 0.2717  -0.3054 -0.1005 47   ILE D N   
3117 C CA  . ILE D 47  ? 0.7240 0.9072 0.6437 0.3123  -0.3001 -0.1055 47   ILE D CA  
3118 C C   . ILE D 47  ? 0.7442 0.9232 0.5389 0.3435  -0.2590 -0.1122 47   ILE D C   
3119 O O   . ILE D 47  ? 0.7965 0.9902 0.4964 0.3890  -0.2543 -0.1119 47   ILE D O   
3120 C CB  . ILE D 47  ? 0.6799 0.8949 0.6224 0.3008  -0.2586 -0.0547 47   ILE D CB  
3121 C CG1 . ILE D 47  ? 0.6013 0.8178 0.5532 0.2729  -0.1825 -0.0118 47   ILE D CG1 
3122 C CG2 . ILE D 47  ? 0.6689 0.8980 0.7336 0.2842  -0.3054 -0.0441 47   ILE D CG2 
3123 C CD1 . ILE D 47  ? 0.6009 0.8170 0.4556 0.2889  -0.1342 0.0026  47   ILE D CD1 
3124 N N   . TYR D 48  ? 0.7071 0.8719 0.5093 0.3230  -0.2271 -0.1099 48   TYR D N   
3125 C CA  . TYR D 48  ? 0.7376 0.8989 0.4446 0.3553  -0.2009 -0.1181 48   TYR D CA  
3126 C C   . TYR D 48  ? 0.7098 0.8471 0.4504 0.3317  -0.1954 -0.1324 48   TYR D C   
3127 O O   . TYR D 48  ? 0.6390 0.7746 0.4490 0.2866  -0.1651 -0.1064 48   TYR D O   
3128 C CB  . TYR D 48  ? 0.7066 0.8951 0.3710 0.3588  -0.1323 -0.0659 48   TYR D CB  
3129 C CG  . TYR D 48  ? 0.7379 0.9336 0.3338 0.3912  -0.1004 -0.0583 48   TYR D CG  
3130 C CD1 . TYR D 48  ? 0.8239 1.0384 0.3215 0.4615  -0.1046 -0.0638 48   TYR D CD1 
3131 C CD2 . TYR D 48  ? 0.6935 0.8798 0.3223 0.3595  -0.0666 -0.0424 48   TYR D CD2 
3132 C CE1 . TYR D 48  ? 0.8563 1.0868 0.2974 0.5008  -0.0671 -0.0446 48   TYR D CE1 
3133 C CE2 . TYR D 48  ? 0.7034 0.9029 0.2862 0.3897  -0.0363 -0.0270 48   TYR D CE2 
3134 C CZ  . TYR D 48  ? 0.7959 1.0207 0.2890 0.4609  -0.0327 -0.0242 48   TYR D CZ  
3135 O OH  . TYR D 48  ? 0.8307 1.0781 0.2829 0.5006  0.0059  0.0030  48   TYR D OH  
3136 N N   . THR D 49  ? 0.7768 0.8943 0.4571 0.3709  -0.2238 -0.1732 49   THR D N   
3137 C CA  . THR D 49  ? 0.7595 0.8551 0.4595 0.3563  -0.2156 -0.1860 49   THR D CA  
3138 C C   . THR D 49  ? 0.8043 0.9083 0.3989 0.4071  -0.1821 -0.1843 49   THR D C   
3139 O O   . THR D 49  ? 0.8926 1.0013 0.3893 0.4737  -0.1986 -0.2027 49   THR D O   
3140 C CB  . THR D 49  ? 0.8021 0.8558 0.5647 0.3523  -0.2930 -0.2391 49   THR D CB  
3141 O OG1 . THR D 49  ? 0.9068 0.9421 0.6225 0.4004  -0.3652 -0.2852 49   THR D OG1 
3142 C CG2 . THR D 49  ? 0.7334 0.7903 0.6433 0.2902  -0.2993 -0.2134 49   THR D CG2 
3143 N N   . PHE D 50  ? 0.7470 0.8569 0.3627 0.3819  -0.1334 -0.1563 50   PHE D N   
3144 C CA  . PHE D 50  ? 0.7936 0.9126 0.3388 0.4263  -0.1030 -0.1501 50   PHE D CA  
3145 C C   . PHE D 50  ? 0.7824 0.8685 0.3660 0.4070  -0.1185 -0.1792 50   PHE D C   
3146 O O   . PHE D 50  ? 0.7000 0.7830 0.3635 0.3495  -0.0988 -0.1584 50   PHE D O   
3147 C CB  . PHE D 50  ? 0.7451 0.9062 0.2964 0.4163  -0.0323 -0.0796 50   PHE D CB  
3148 C CG  . PHE D 50  ? 0.7612 0.9379 0.2846 0.4465  0.0048  -0.0582 50   PHE D CG  
3149 C CD1 . PHE D 50  ? 0.8780 1.0724 0.3019 0.5312  0.0130  -0.0617 50   PHE D CD1 
3150 C CD2 . PHE D 50  ? 0.7068 0.8809 0.2993 0.3981  0.0307  -0.0331 50   PHE D CD2 
3151 C CE1 . PHE D 50  ? 0.8951 1.1108 0.2976 0.5668  0.0540  -0.0332 50   PHE D CE1 
3152 C CE2 . PHE D 50  ? 0.7213 0.9140 0.3018 0.4247  0.0638  -0.0083 50   PHE D CE2 
3153 C CZ  . PHE D 50  ? 0.8197 1.0363 0.3102 0.5084  0.0792  -0.0047 50   PHE D CZ  
3154 N N   . ASP D 51  ? 0.8774 0.9356 0.3969 0.4625  -0.1559 -0.2282 51   ASP D N   
3155 C CA  . ASP D 51  ? 0.8843 0.9079 0.4332 0.4544  -0.1727 -0.2576 51   ASP D CA  
3156 C C   . ASP D 51  ? 0.9091 0.9584 0.3917 0.4966  -0.1151 -0.2279 51   ASP D C   
3157 O O   . ASP D 51  ? 1.0127 1.0703 0.3842 0.5793  -0.1104 -0.2366 51   ASP D O   
3158 C CB  . ASP D 51  ? 0.9957 0.9605 0.5220 0.4941  -0.2624 -0.3354 51   ASP D CB  
3159 C CG  . ASP D 51  ? 0.9974 0.9172 0.5869 0.4746  -0.2933 -0.3676 51   ASP D CG  
3160 O OD1 . ASP D 51  ? 0.9476 0.8860 0.5785 0.4395  -0.2393 -0.3307 51   ASP D OD1 
3161 O OD2 . ASP D 51  ? 1.0924 0.9540 0.6952 0.4966  -0.3794 -0.4315 51   ASP D OD2 
3162 N N   . GLY D 52  ? 0.8256 0.8905 0.3762 0.4464  -0.0706 -0.1878 52   GLY D N   
3163 C CA  . GLY D 52  ? 0.8354 0.9284 0.3554 0.4770  -0.0179 -0.1510 52   GLY D CA  
3164 C C   . GLY D 52  ? 0.9268 0.9857 0.3853 0.5361  -0.0429 -0.1997 52   GLY D C   
3165 O O   . GLY D 52  ? 1.0062 1.0894 0.3808 0.6104  -0.0093 -0.1817 52   GLY D O   
3166 N N   . ALA D 53  ? 0.9275 0.9307 0.4344 0.5078  -0.1012 -0.2559 53   ALA D N   
3167 C CA  . ALA D 53  ? 1.0205 0.9734 0.4835 0.5587  -0.1421 -0.3133 53   ALA D CA  
3168 C C   . ALA D 53  ? 1.1758 1.1054 0.4964 0.6632  -0.1791 -0.3615 53   ALA D C   
3169 O O   . ALA D 53  ? 1.2774 1.1966 0.5009 0.7444  -0.1689 -0.3770 53   ALA D O   
3170 C CB  . ALA D 53  ? 0.9939 0.8907 0.5632 0.5038  -0.2092 -0.3585 53   ALA D CB  
3171 N N   . LEU D 54  ? 1.2040 1.1254 0.5056 0.6686  -0.2219 -0.3838 54   LEU D N   
3172 C CA  . LEU D 54  ? 1.3619 1.2600 0.5162 0.7744  -0.2638 -0.4310 54   LEU D CA  
3173 C C   . LEU D 54  ? 1.3720 1.3445 0.4409 0.8231  -0.1919 -0.3656 54   LEU D C   
3174 O O   . LEU D 54  ? 1.4984 1.4624 0.4413 0.9126  -0.2202 -0.3941 54   LEU D O   
3175 C CB  . LEU D 54  ? 1.4111 1.2473 0.5994 0.7603  -0.3719 -0.5019 54   LEU D CB  
3176 C CG  . LEU D 54  ? 1.4288 1.1858 0.7199 0.7222  -0.4614 -0.5660 54   LEU D CG  
3177 C CD1 . LEU D 54  ? 1.5120 1.2111 0.8320 0.7279  -0.5774 -0.6312 54   LEU D CD1 
3178 C CD2 . LEU D 54  ? 1.5393 1.2443 0.7491 0.7938  -0.4801 -0.6133 54   LEU D CD2 
3179 N N   . ASN D 55  ? 1.2476 1.2899 0.3874 0.7701  -0.1047 -0.2772 55   ASN D N   
3180 C CA  . ASN D 55  ? 1.2477 1.3651 0.3458 0.8055  -0.0348 -0.1997 55   ASN D CA  
3181 C C   . ASN D 55  ? 1.3143 1.4245 0.3451 0.8419  -0.0783 -0.2276 55   ASN D C   
3182 O O   . ASN D 55  ? 1.4256 1.5677 0.3358 0.9399  -0.0548 -0.2075 55   ASN D O   
3183 C CB  . ASN D 55  ? 1.3422 1.5023 0.3408 0.9089  0.0289  -0.1557 55   ASN D CB  
3184 C CG  . ASN D 55  ? 1.3079 1.5618 0.3235 0.9272  0.1177  -0.0443 55   ASN D CG  
3185 O OD1 . ASN D 55  ? 1.1848 1.4689 0.3199 0.8392  0.1415  0.0082  55   ASN D OD1 
3186 N ND2 . ASN D 55  ? 1.4342 1.7332 0.3329 1.0490  0.1662  -0.0039 55   ASN D ND2 
3187 N N   . LYS D 56  ? 1.2522 1.3252 0.3672 0.7657  -0.1386 -0.2671 56   LYS D N   
3188 C CA  . LYS D 56  ? 1.3193 1.3672 0.3911 0.7909  -0.2063 -0.3132 56   LYS D CA  
3189 C C   . LYS D 56  ? 1.1998 1.2757 0.3815 0.7031  -0.1952 -0.2744 56   LYS D C   
3190 O O   . LYS D 56  ? 1.0856 1.1468 0.3935 0.6128  -0.2041 -0.2728 56   LYS D O   
3191 C CB  . LYS D 56  ? 1.3993 1.3597 0.4778 0.7967  -0.3150 -0.4117 56   LYS D CB  
3192 C CG  . LYS D 56  ? 1.4274 1.3526 0.5389 0.7811  -0.4054 -0.4599 56   LYS D CG  
3193 C CD  . LYS D 56  ? 1.6011 1.4389 0.6334 0.8578  -0.5234 -0.5625 56   LYS D CD  
3194 C CE  . LYS D 56  ? 1.6036 1.3760 0.7137 0.8282  -0.5738 -0.6109 56   LYS D CE  
3195 N NZ  . LYS D 56  ? 1.7969 1.4747 0.8008 0.9250  -0.6901 -0.7146 56   LYS D NZ  
3196 N N   . SER D 57  ? 1.2234 1.3410 0.3512 0.7386  -0.1720 -0.2391 57   SER D N   
3197 C CA  . SER D 57  ? 1.1372 1.2734 0.3477 0.6735  -0.1727 -0.2124 57   SER D CA  
3198 C C   . SER D 57  ? 1.2198 1.3195 0.3974 0.7018  -0.2619 -0.2756 57   SER D C   
3199 O O   . SER D 57  ? 1.3623 1.4348 0.4187 0.7923  -0.3102 -0.3264 57   SER D O   
3200 C CB  . SER D 57  ? 1.1066 1.3113 0.3030 0.6868  -0.0935 -0.1267 57   SER D CB  
3201 O OG  . SER D 57  ? 1.0060 1.2353 0.2920 0.6262  -0.0309 -0.0674 57   SER D OG  
3202 N N   . THR D 58  ? 1.1407 1.2380 0.4256 0.6304  -0.2870 -0.2717 58   THR D N   
3203 C CA  . THR D 58  ? 1.2048 1.2696 0.4991 0.6421  -0.3790 -0.3247 58   THR D CA  
3204 C C   . THR D 58  ? 1.1222 1.2226 0.4964 0.5896  -0.3615 -0.2801 58   THR D C   
3205 O O   . THR D 58  ? 1.0015 1.1251 0.4695 0.5191  -0.3056 -0.2301 58   THR D O   
3206 C CB  . THR D 58  ? 1.2080 1.2118 0.6039 0.6017  -0.4614 -0.3833 58   THR D CB  
3207 O OG1 . THR D 58  ? 1.2892 1.2507 0.6080 0.6547  -0.4843 -0.4310 58   THR D OG1 
3208 C CG2 . THR D 58  ? 1.2764 1.2464 0.7145 0.6085  -0.5677 -0.4319 58   THR D CG2 
3209 N N   . VAL D 59  ? 1.1990 1.2998 0.5264 0.6321  -0.4129 -0.3009 59   VAL D N   
3210 C CA  . VAL D 59  ? 1.1353 1.2668 0.5372 0.5903  -0.4067 -0.2639 59   VAL D CA  
3211 C C   . VAL D 59  ? 1.2191 1.3208 0.6396 0.6112  -0.5142 -0.3174 59   VAL D C   
3212 O O   . VAL D 59  ? 1.3590 1.4233 0.6753 0.6872  -0.5855 -0.3793 59   VAL D O   
3213 C CB  . VAL D 59  ? 1.1319 1.3192 0.4545 0.6251  -0.3323 -0.2024 59   VAL D CB  
3214 C CG1 . VAL D 59  ? 1.0259 1.2427 0.3841 0.5832  -0.2359 -0.1377 59   VAL D CG1 
3215 C CG2 . VAL D 59  ? 1.2771 1.4693 0.4321 0.7369  -0.3471 -0.2236 59   VAL D CG2 
3216 N N   . PRO D 60  ? 1.1450 1.2610 0.6990 0.5496  -0.5302 -0.2930 60   PRO D N   
3217 C CA  . PRO D 60  ? 1.2205 1.3196 0.8101 0.5666  -0.6295 -0.3291 60   PRO D CA  
3218 C C   . PRO D 60  ? 1.2710 1.4076 0.7536 0.6210  -0.6110 -0.3073 60   PRO D C   
3219 O O   . PRO D 60  ? 1.2043 1.3884 0.6527 0.6142  -0.5133 -0.2445 60   PRO D O   
3220 C CB  . PRO D 60  ? 1.1090 1.2240 0.8990 0.4790  -0.6302 -0.2894 60   PRO D CB  
3221 C CG  . PRO D 60  ? 0.9801 1.1348 0.7834 0.4357  -0.5120 -0.2216 60   PRO D CG  
3222 C CD  . PRO D 60  ? 1.0009 1.1489 0.6765 0.4695  -0.4582 -0.2288 60   PRO D CD  
3223 N N   . THR D 61  ? 1.3925 1.5047 0.8293 0.6762  -0.7102 -0.3584 61   THR D N   
3224 C CA  . THR D 61  ? 1.4660 1.6114 0.7807 0.7448  -0.7012 -0.3431 61   THR D CA  
3225 C C   . THR D 61  ? 1.3440 1.5531 0.7293 0.6937  -0.6156 -0.2592 61   THR D C   
3226 O O   . THR D 61  ? 1.3554 1.6069 0.6417 0.7361  -0.5468 -0.2143 61   THR D O   
3227 C CB  . THR D 61  ? 1.6090 1.7135 0.9019 0.7973  -0.8394 -0.4121 61   THR D CB  
3228 O OG1 . THR D 61  ? 1.7353 1.7648 0.9624 0.8493  -0.9325 -0.4995 61   THR D OG1 
3229 C CG2 . THR D 61  ? 1.7102 1.8485 0.8467 0.8867  -0.8300 -0.3992 61   THR D CG2 
3230 N N   . ASP D 62  ? 1.2347 1.4512 0.7939 0.6089  -0.6174 -0.2327 62   ASP D N   
3231 C CA  . ASP D 62  ? 1.1326 1.3993 0.7561 0.5672  -0.5436 -0.1594 62   ASP D CA  
3232 C C   . ASP D 62  ? 1.0496 1.3408 0.6303 0.5516  -0.4259 -0.1041 62   ASP D C   
3233 O O   . ASP D 62  ? 1.0129 1.3393 0.5855 0.5494  -0.3661 -0.0498 62   ASP D O   
3234 C CB  . ASP D 62  ? 1.0511 1.3227 0.8661 0.4934  -0.5661 -0.1376 62   ASP D CB  
3235 C CG  . ASP D 62  ? 0.9684 1.2286 0.8731 0.4340  -0.5201 -0.1206 62   ASP D CG  
3236 O OD1 . ASP D 62  ? 1.0186 1.2408 0.9256 0.4348  -0.5613 -0.1658 62   ASP D OD1 
3237 O OD2 . ASP D 62  ? 0.8820 1.1683 0.8502 0.3924  -0.4452 -0.0631 62   ASP D OD2 
3238 N N   . PHE D 63  ? 1.0272 1.2960 0.5875 0.5425  -0.4011 -0.1189 63   PHE D N   
3239 C CA  . PHE D 63  ? 0.9629 1.2482 0.4896 0.5309  -0.3057 -0.0722 63   PHE D CA  
3240 C C   . PHE D 63  ? 1.0470 1.3366 0.4357 0.6036  -0.2894 -0.0822 63   PHE D C   
3241 O O   . PHE D 63  ? 1.0383 1.3103 0.4120 0.6002  -0.2718 -0.0952 63   PHE D O   
3242 C CB  . PHE D 63  ? 0.8699 1.1322 0.4881 0.4659  -0.2829 -0.0714 63   PHE D CB  
3243 C CG  . PHE D 63  ? 0.7730 1.0445 0.4995 0.4070  -0.2484 -0.0295 63   PHE D CG  
3244 C CD1 . PHE D 63  ? 0.7159 0.9986 0.4361 0.3907  -0.1757 0.0203  63   PHE D CD1 
3245 C CD2 . PHE D 63  ? 0.7536 1.0204 0.5945 0.3734  -0.2908 -0.0365 63   PHE D CD2 
3246 C CE1 . PHE D 63  ? 0.6488 0.9296 0.4470 0.3511  -0.1472 0.0520  63   PHE D CE1 
3247 C CE2 . PHE D 63  ? 0.6788 0.9584 0.6078 0.3344  -0.2499 0.0089  63   PHE D CE2 
3248 C CZ  . PHE D 63  ? 0.6315 0.9138 0.5248 0.3278  -0.1786 0.0478  63   PHE D CZ  
3249 N N   . SER D 64  ? 1.1292 1.4472 0.4169 0.6755  -0.2895 -0.0691 64   SER D N   
3250 C CA  . SER D 64  ? 1.2383 1.5678 0.3812 0.7676  -0.2744 -0.0729 64   SER D CA  
3251 C C   . SER D 64  ? 1.1854 1.5528 0.3232 0.7673  -0.1732 0.0000  64   SER D C   
3252 O O   . SER D 64  ? 1.2391 1.6069 0.3030 0.8164  -0.1535 -0.0047 64   SER D O   
3253 C CB  . SER D 64  ? 1.3570 1.7120 0.3881 0.8567  -0.3013 -0.0717 64   SER D CB  
3254 O OG  . SER D 64  ? 1.4155 1.7320 0.4617 0.8581  -0.4079 -0.1406 64   SER D OG  
3255 N N   . SER D 65  ? 1.0899 1.4863 0.3123 0.7160  -0.1145 0.0683  65   SER D N   
3256 C CA  . SER D 65  ? 1.0460 1.4764 0.2952 0.7102  -0.0301 0.1453  65   SER D CA  
3257 C C   . SER D 65  ? 0.9450 1.3438 0.2854 0.6330  -0.0116 0.1414  65   SER D C   
3258 O O   . SER D 65  ? 0.8974 1.3165 0.2817 0.6191  0.0457  0.2018  65   SER D O   
3259 C CB  . SER D 65  ? 1.0104 1.4783 0.3117 0.6990  0.0145  0.2213  65   SER D CB  
3260 O OG  . SER D 65  ? 0.9193 1.3563 0.3241 0.6172  0.0020  0.2141  65   SER D OG  
3261 N N   . ALA D 66  ? 0.9128 1.2645 0.2904 0.5865  -0.0628 0.0762  66   ALA D N   
3262 C CA  . ALA D 66  ? 0.8282 1.1491 0.2867 0.5177  -0.0490 0.0702  66   ALA D CA  
3263 C C   . ALA D 66  ? 0.8478 1.1719 0.2733 0.5393  -0.0210 0.0760  66   ALA D C   
3264 O O   . ALA D 66  ? 0.9212 1.2394 0.2663 0.5934  -0.0474 0.0359  66   ALA D O   
3265 C CB  . ALA D 66  ? 0.8010 1.0815 0.3116 0.4757  -0.1069 0.0104  66   ALA D CB  
3266 N N   . LYS D 67  ? 0.7873 1.1155 0.2781 0.4993  0.0263  0.1235  67   LYS D N   
3267 C CA  . LYS D 67  ? 0.7896 1.1258 0.2733 0.5120  0.0564  0.1398  67   LYS D CA  
3268 C C   . LYS D 67  ? 0.7058 1.0250 0.2883 0.4456  0.0814  0.1720  67   LYS D C   
3269 O O   . LYS D 67  ? 0.6533 0.9595 0.2973 0.4048  0.0844  0.1947  67   LYS D O   
3270 C CB  . LYS D 67  ? 0.8656 1.2604 0.2902 0.5903  0.1019  0.2007  67   LYS D CB  
3271 C CG  . LYS D 67  ? 0.8561 1.2900 0.3271 0.5919  0.1378  0.2776  67   LYS D CG  
3272 C CD  . LYS D 67  ? 0.8929 1.3927 0.3708 0.6478  0.2022  0.3711  67   LYS D CD  
3273 C CE  . LYS D 67  ? 0.9109 1.4557 0.4248 0.6673  0.2328  0.4487  67   LYS D CE  
3274 N NZ  . LYS D 67  ? 0.8296 1.3365 0.4514 0.5851  0.2144  0.4536  67   LYS D NZ  
3275 N N   . ILE D 68  ? 0.6994 1.0135 0.2911 0.4408  0.0937  0.1700  68   ILE D N   
3276 C CA  . ILE D 68  ? 0.6425 0.9480 0.3219 0.3941  0.1164  0.2108  68   ILE D CA  
3277 C C   . ILE D 68  ? 0.6814 1.0381 0.3689 0.4364  0.1618  0.2764  68   ILE D C   
3278 O O   . ILE D 68  ? 0.7456 1.1364 0.3501 0.5057  0.1769  0.2765  68   ILE D O   
3279 C CB  . ILE D 68  ? 0.5998 0.8574 0.3040 0.3465  0.0927  0.1610  68   ILE D CB  
3280 C CG1 . ILE D 68  ? 0.6267 0.8899 0.2807 0.3788  0.0917  0.1312  68   ILE D CG1 
3281 C CG2 . ILE D 68  ? 0.5555 0.7757 0.2605 0.3162  0.0568  0.1106  68   ILE D CG2 
3282 C CD1 . ILE D 68  ? 0.5806 0.8065 0.2723 0.3351  0.0784  0.1000  68   ILE D CD1 
3283 N N   . GLU D 69  ? 0.6460 1.0068 0.4361 0.4009  0.1802  0.3347  69   GLU D N   
3284 C CA  . GLU D 69  ? 0.6693 1.0809 0.5029 0.4307  0.2230  0.4061  69   GLU D CA  
3285 C C   . GLU D 69  ? 0.6432 1.0264 0.4797 0.4068  0.2114  0.3661  69   GLU D C   
3286 O O   . GLU D 69  ? 0.5899 0.9342 0.5054 0.3467  0.1899  0.3616  69   GLU D O   
3287 C CB  . GLU D 69  ? 0.6456 1.0766 0.6176 0.4026  0.2383  0.4964  69   GLU D CB  
3288 C CG  . GLU D 69  ? 0.6836 1.1941 0.7236 0.4487  0.2946  0.6027  69   GLU D CG  
3289 C CD  . GLU D 69  ? 0.6836 1.2246 0.8722 0.4330  0.3085  0.7053  69   GLU D CD  
3290 O OE1 . GLU D 69  ? 0.7292 1.2947 0.8979 0.4613  0.3221  0.7331  69   GLU D OE1 
3291 O OE2 . GLU D 69  ? 0.6703 1.2109 1.0056 0.3936  0.3019  0.7616  69   GLU D OE2 
3292 N N   . VAL D 70  ? 0.6927 1.0904 0.4348 0.4607  0.2208  0.3336  70   VAL D N   
3293 C CA  . VAL D 70  ? 0.6783 1.0425 0.4041 0.4440  0.2040  0.2805  70   VAL D CA  
3294 C C   . VAL D 70  ? 0.6373 1.0110 0.4674 0.4097  0.2220  0.3313  70   VAL D C   
3295 O O   . VAL D 70  ? 0.6072 0.9381 0.4589 0.3652  0.1967  0.2894  70   VAL D O   
3296 C CB  . VAL D 70  ? 0.7662 1.1450 0.3729 0.5250  0.2114  0.2467  70   VAL D CB  
3297 C CG1 . VAL D 70  ? 0.7454 1.0987 0.3561 0.5129  0.2044  0.2128  70   VAL D CG1 
3298 C CG2 . VAL D 70  ? 0.8008 1.1467 0.3107 0.5490  0.1658  0.1708  70   VAL D CG2 
3299 N N   . SER D 71  ? 0.6513 1.0848 0.5555 0.4330  0.2645  0.4277  71   SER D N   
3300 C CA  . SER D 71  ? 0.6167 1.0675 0.6448 0.4034  0.2775  0.4896  71   SER D CA  
3301 C C   . SER D 71  ? 0.5534 0.9398 0.6734 0.3181  0.2252  0.4676  71   SER D C   
3302 O O   . SER D 71  ? 0.5238 0.8877 0.7014 0.2829  0.2075  0.4631  71   SER D O   
3303 C CB  . SER D 71  ? 0.6479 1.1824 0.7692 0.4443  0.3313  0.6138  71   SER D CB  
3304 O OG  . SER D 71  ? 0.6366 1.1730 0.8068 0.4286  0.3232  0.6475  71   SER D OG  
3305 N N   . GLN D 72  ? 0.5387 0.8928 0.6604 0.2934  0.1986  0.4511  72   GLN D N   
3306 C CA  . GLN D 72  ? 0.5048 0.7923 0.6980 0.2303  0.1468  0.4326  72   GLN D CA  
3307 C C   . GLN D 72  ? 0.4782 0.6990 0.6026 0.2004  0.1103  0.3415  72   GLN D C   
3308 O O   . GLN D 72  ? 0.4629 0.6233 0.6206 0.1619  0.0672  0.3187  72   GLN D O   
3309 C CB  . GLN D 72  ? 0.5178 0.7908 0.7222 0.2250  0.1337  0.4433  72   GLN D CB  
3310 C CG  . GLN D 72  ? 0.5487 0.8888 0.8420 0.2531  0.1696  0.5463  72   GLN D CG  
3311 C CD  . GLN D 72  ? 0.5548 0.9023 1.0249 0.2227  0.1557  0.6275  72   GLN D CD  
3312 O OE1 . GLN D 72  ? 0.5521 0.8279 1.0829 0.1722  0.0959  0.5980  72   GLN D OE1 
3313 N NE2 . GLN D 72  ? 0.5828 1.0178 1.1397 0.2599  0.2082  0.7341  72   GLN D NE2 
3314 N N   . LEU D 73  ? 0.4809 0.7103 0.5106 0.2248  0.1245  0.2921  73   LEU D N   
3315 C CA  . LEU D 73  ? 0.4599 0.6395 0.4469 0.2004  0.0982  0.2227  73   LEU D CA  
3316 C C   . LEU D 73  ? 0.4447 0.6032 0.4950 0.1713  0.0829  0.2336  73   LEU D C   
3317 O O   . LEU D 73  ? 0.4410 0.5471 0.4808 0.1448  0.0522  0.1930  73   LEU D O   
3318 C CB  . LEU D 73  ? 0.4715 0.6657 0.3769 0.2325  0.1103  0.1787  73   LEU D CB  
3319 C CG  . LEU D 73  ? 0.5003 0.6991 0.3349 0.2594  0.1051  0.1459  73   LEU D CG  
3320 C CD1 . LEU D 73  ? 0.5284 0.7258 0.3002 0.2897  0.0985  0.0972  73   LEU D CD1 
3321 C CD2 . LEU D 73  ? 0.4644 0.6226 0.3023 0.2262  0.0778  0.1158  73   LEU D CD2 
3322 N N   . LEU D 74  ? 0.4530 0.6556 0.5706 0.1822  0.1053  0.2940  74   LEU D N   
3323 C CA  . LEU D 74  ? 0.4386 0.6273 0.6314 0.1554  0.0872  0.3112  74   LEU D CA  
3324 C C   . LEU D 74  ? 0.4389 0.5680 0.7014 0.1145  0.0310  0.3125  74   LEU D C   
3325 O O   . LEU D 74  ? 0.4286 0.5200 0.7205 0.0917  -0.0036 0.2972  74   LEU D O   
3326 C CB  . LEU D 74  ? 0.4527 0.7117 0.7233 0.1801  0.1268  0.3912  74   LEU D CB  
3327 C CG  . LEU D 74  ? 0.4834 0.7900 0.6723 0.2341  0.1764  0.3844  74   LEU D CG  
3328 C CD1 . LEU D 74  ? 0.5067 0.8866 0.7779 0.2672  0.2215  0.4759  74   LEU D CD1 
3329 C CD2 . LEU D 74  ? 0.4773 0.7423 0.5993 0.2231  0.1593  0.3099  74   LEU D CD2 
3330 N N   . LYS D 75  ? 0.4501 0.5652 0.7324 0.1111  0.0168  0.3269  75   LYS D N   
3331 C CA  . LYS D 75  ? 0.4713 0.5111 0.7939 0.0830  -0.0469 0.3109  75   LYS D CA  
3332 C C   . LYS D 75  ? 0.4799 0.4580 0.6859 0.0866  -0.0668 0.2332  75   LYS D C   
3333 O O   . LYS D 75  ? 0.5171 0.4242 0.7232 0.0789  -0.1190 0.2092  75   LYS D O   
3334 C CB  . LYS D 75  ? 0.4938 0.5443 0.9141 0.0793  -0.0567 0.3719  75   LYS D CB  
3335 C CG  . LYS D 75  ? 0.4981 0.6029 1.0781 0.0722  -0.0490 0.4666  75   LYS D CG  
3336 C CD  . LYS D 75  ? 0.5226 0.6447 1.2133 0.0706  -0.0537 0.5372  75   LYS D CD  
3337 C CE  . LYS D 75  ? 0.5328 0.7040 1.4243 0.0581  -0.0572 0.6448  75   LYS D CE  
3338 N NZ  . LYS D 75  ? 0.5682 0.7375 1.5980 0.0474  -0.0812 0.7134  75   LYS D NZ  
3339 N N   . GLY D 76  ? 0.4507 0.4541 0.5637 0.1038  -0.0287 0.1973  76   GLY D N   
3340 C CA  . GLY D 76  ? 0.4460 0.4103 0.4703 0.1115  -0.0358 0.1424  76   GLY D CA  
3341 C C   . GLY D 76  ? 0.4518 0.4223 0.4531 0.1230  -0.0271 0.1452  76   GLY D C   
3342 O O   . GLY D 76  ? 0.4579 0.3980 0.4019 0.1319  -0.0331 0.1116  76   GLY D O   
3343 N N   . ASP D 77  ? 0.4431 0.4589 0.4922 0.1281  -0.0083 0.1930  77   ASP D N   
3344 C CA  . ASP D 77  ? 0.4489 0.4802 0.4817 0.1419  0.0032  0.2042  77   ASP D CA  
3345 C C   . ASP D 77  ? 0.4298 0.5110 0.3948 0.1667  0.0379  0.1865  77   ASP D C   
3346 O O   . ASP D 77  ? 0.4325 0.5672 0.3986 0.1883  0.0662  0.2131  77   ASP D O   
3347 C CB  . ASP D 77  ? 0.4620 0.5219 0.5892 0.1416  0.0071  0.2750  77   ASP D CB  
3348 C CG  . ASP D 77  ? 0.4831 0.5522 0.6045 0.1549  0.0141  0.2927  77   ASP D CG  
3349 O OD1 . ASP D 77  ? 0.5019 0.5560 0.5443 0.1642  0.0149  0.2482  77   ASP D OD1 
3350 O OD2 . ASP D 77  ? 0.4890 0.5848 0.6985 0.1567  0.0198  0.3592  77   ASP D OD2 
3351 N N   . ALA D 78  ? 0.4202 0.4817 0.3297 0.1697  0.0314  0.1440  78   ALA D N   
3352 C CA  . ALA D 78  ? 0.4223 0.5179 0.2826 0.1903  0.0445  0.1217  78   ALA D CA  
3353 C C   . ALA D 78  ? 0.4343 0.5381 0.2804 0.2027  0.0440  0.1294  78   ALA D C   
3354 O O   . ALA D 78  ? 0.4322 0.5499 0.2458 0.2149  0.0405  0.1042  78   ALA D O   
3355 C CB  . ALA D 78  ? 0.4058 0.4821 0.2445 0.1822  0.0351  0.0778  78   ALA D CB  
3356 N N   . SER D 79  ? 0.4457 0.5403 0.3279 0.1993  0.0425  0.1665  79   SER D N   
3357 C CA  . SER D 79  ? 0.4628 0.5582 0.3375 0.2095  0.0412  0.1765  79   SER D CA  
3358 C C   . SER D 79  ? 0.4778 0.6287 0.3146 0.2407  0.0571  0.1824  79   SER D C   
3359 O O   . SER D 79  ? 0.4913 0.6854 0.3190 0.2652  0.0759  0.2062  79   SER D O   
3360 C CB  . SER D 79  ? 0.4771 0.5523 0.4149 0.2015  0.0327  0.2220  79   SER D CB  
3361 O OG  . SER D 79  ? 0.4845 0.4933 0.4485 0.1799  0.0009  0.2064  79   SER D OG  
3362 N N   . LEU D 80  ? 0.4817 0.6308 0.2931 0.2471  0.0479  0.1622  80   LEU D N   
3363 C CA  . LEU D 80  ? 0.5115 0.7034 0.2822 0.2793  0.0482  0.1581  80   LEU D CA  
3364 C C   . LEU D 80  ? 0.5349 0.7515 0.3143 0.2991  0.0626  0.2059  80   LEU D C   
3365 O O   . LEU D 80  ? 0.5244 0.7133 0.3376 0.2829  0.0594  0.2212  80   LEU D O   
3366 C CB  . LEU D 80  ? 0.5004 0.6818 0.2626 0.2733  0.0246  0.1175  80   LEU D CB  
3367 C CG  . LEU D 80  ? 0.5349 0.7479 0.2615 0.3038  0.0026  0.0958  80   LEU D CG  
3368 C CD1 . LEU D 80  ? 0.5527 0.7801 0.2337 0.3320  -0.0050 0.0744  80   LEU D CD1 
3369 C CD2 . LEU D 80  ? 0.5221 0.7238 0.2832 0.2873  -0.0250 0.0676  80   LEU D CD2 
3370 N N   . LYS D 81  ? 0.5792 0.8463 0.3231 0.3420  0.0786  0.2306  81   LYS D N   
3371 C CA  . LYS D 81  ? 0.6121 0.9159 0.3616 0.3716  0.0984  0.2855  81   LYS D CA  
3372 C C   . LYS D 81  ? 0.6551 0.9888 0.3294 0.4155  0.0840  0.2620  81   LYS D C   
3373 O O   . LYS D 81  ? 0.6859 1.0297 0.2943 0.4468  0.0672  0.2223  81   LYS D O   
3374 C CB  . LYS D 81  ? 0.6381 0.9887 0.4113 0.4020  0.1372  0.3545  81   LYS D CB  
3375 C CG  . LYS D 81  ? 0.6164 0.9439 0.4884 0.3611  0.1442  0.3914  81   LYS D CG  
3376 C CD  . LYS D 81  ? 0.6444 1.0353 0.5721 0.3960  0.1880  0.4853  81   LYS D CD  
3377 C CE  . LYS D 81  ? 0.6269 1.0046 0.6574 0.3611  0.1895  0.5201  81   LYS D CE  
3378 N NZ  . LYS D 81  ? 0.6629 1.1187 0.7593 0.4028  0.2402  0.6233  81   LYS D NZ  
3379 N N   . MET D 82  ? 0.6661 1.0082 0.3516 0.4207  0.0835  0.2841  82   MET D N   
3380 C CA  . MET D 82  ? 0.7175 1.0891 0.3375 0.4652  0.0647  0.2678  82   MET D CA  
3381 C C   . MET D 82  ? 0.7336 1.1339 0.3730 0.4844  0.0862  0.3269  82   MET D C   
3382 O O   . MET D 82  ? 0.6953 1.0753 0.4111 0.4502  0.1026  0.3651  82   MET D O   
3383 C CB  . MET D 82  ? 0.6948 1.0348 0.3182 0.4381  0.0184  0.2040  82   MET D CB  
3384 C CG  . MET D 82  ? 0.6480 0.9606 0.3357 0.3970  0.0194  0.2138  82   MET D CG  
3385 S SD  . MET D 82  ? 0.6501 0.9408 0.3682 0.3702  -0.0218 0.1609  82   MET D SD  
3386 C CE  . MET D 82  ? 0.6025 0.8574 0.3412 0.3358  -0.0175 0.1339  82   MET D CE  
3387 N N   . ASP D 83  ? 0.7960 1.2380 0.3641 0.5436  0.0799  0.3315  83   ASP D N   
3388 C CA  . ASP D 83  ? 0.8196 1.2944 0.3990 0.5687  0.0982  0.3870  83   ASP D CA  
3389 C C   . ASP D 83  ? 0.7745 1.2159 0.4006 0.5260  0.0721  0.3644  83   ASP D C   
3390 O O   . ASP D 83  ? 0.7480 1.1567 0.3775 0.4958  0.0357  0.3047  83   ASP D O   
3391 C CB  . ASP D 83  ? 0.9165 1.4420 0.3881 0.6535  0.0912  0.3898  83   ASP D CB  
3392 C CG  . ASP D 83  ? 0.9792 1.5504 0.3928 0.7197  0.1320  0.4325  83   ASP D CG  
3393 O OD1 . ASP D 83  ? 0.9695 1.5284 0.4195 0.6944  0.1521  0.4381  83   ASP D OD1 
3394 O OD2 . ASP D 83  ? 1.0640 1.6860 0.3912 0.8043  0.1453  0.4636  83   ASP D OD2 
3395 N N   . LYS D 84  ? 0.7760 1.2301 0.4445 0.5292  0.0936  0.4198  84   LYS D N   
3396 C CA  . LYS D 84  ? 0.7452 1.1718 0.4526 0.5009  0.0756  0.4072  84   LYS D CA  
3397 C C   . LYS D 84  ? 0.7631 1.2020 0.4237 0.5169  0.0320  0.3559  84   LYS D C   
3398 O O   . LYS D 84  ? 0.7260 1.1377 0.4262 0.4844  0.0113  0.3282  84   LYS D O   
3399 C CB  . LYS D 84  ? 0.7617 1.2069 0.5119 0.5159  0.1027  0.4775  84   LYS D CB  
3400 C CG  . LYS D 84  ? 0.8266 1.3414 0.5181 0.5836  0.1154  0.5187  84   LYS D CG  
3401 C CD  . LYS D 84  ? 0.8392 1.3709 0.5956 0.5924  0.1462  0.5976  84   LYS D CD  
3402 C CE  . LYS D 84  ? 0.9085 1.5153 0.6028 0.6682  0.1643  0.6475  84   LYS D CE  
3403 N NZ  . LYS D 84  ? 0.9176 1.5364 0.6863 0.6705  0.1878  0.7194  84   LYS D NZ  
3404 N N   . SER D 85  ? 0.8297 1.3086 0.4095 0.5727  0.0150  0.3457  85   SER D N   
3405 C CA  . SER D 85  ? 0.8740 1.3621 0.4141 0.5962  -0.0430 0.2975  85   SER D CA  
3406 C C   . SER D 85  ? 0.8364 1.2862 0.4134 0.5529  -0.0878 0.2327  85   SER D C   
3407 O O   . SER D 85  ? 0.8163 1.2603 0.4464 0.5312  -0.1236 0.2137  85   SER D O   
3408 C CB  . SER D 85  ? 0.9787 1.5038 0.4033 0.6784  -0.0597 0.2910  85   SER D CB  
3409 O OG  . SER D 85  ? 1.0145 1.5817 0.4150 0.7201  0.0128  0.3730  85   SER D OG  
3410 N N   . ASP D 86  ? 0.8248 1.2540 0.3859 0.5422  -0.0826 0.2083  86   ASP D N   
3411 C CA  . ASP D 86  ? 0.7853 1.1789 0.3936 0.4991  -0.1153 0.1578  86   ASP D CA  
3412 C C   . ASP D 86  ? 0.7020 1.0695 0.3987 0.4411  -0.0851 0.1768  86   ASP D C   
3413 O O   . ASP D 86  ? 0.6744 1.0272 0.4329 0.4109  -0.1090 0.1543  86   ASP D O   
3414 C CB  . ASP D 86  ? 0.7964 1.1755 0.3600 0.5074  -0.1107 0.1327  86   ASP D CB  
3415 C CG  . ASP D 86  ? 0.8951 1.2907 0.3508 0.5801  -0.1439 0.1050  86   ASP D CG  
3416 O OD1 . ASP D 86  ? 0.9388 1.3484 0.3565 0.6202  -0.1893 0.0891  86   ASP D OD1 
3417 O OD2 . ASP D 86  ? 0.8965 1.2892 0.2994 0.6039  -0.1263 0.0987  86   ASP D OD2 
3418 N N   . ALA D 87  ? 0.6765 1.0367 0.3818 0.4323  -0.0354 0.2209  87   ALA D N   
3419 C CA  . ALA D 87  ? 0.6249 0.9489 0.3897 0.3942  -0.0126 0.2346  87   ALA D CA  
3420 C C   . ALA D 87  ? 0.6156 0.9472 0.4223 0.3927  -0.0248 0.2408  87   ALA D C   
3421 O O   . ALA D 87  ? 0.5828 0.9042 0.4355 0.3732  -0.0353 0.2248  87   ALA D O   
3422 C CB  . ALA D 87  ? 0.6257 0.9327 0.3980 0.3924  0.0246  0.2785  87   ALA D CB  
3423 N N   . VAL D 88  ? 0.6388 0.9951 0.4368 0.4171  -0.0206 0.2717  88   VAL D N   
3424 C CA  . VAL D 88  ? 0.6373 1.0029 0.4803 0.4186  -0.0257 0.2873  88   VAL D CA  
3425 C C   . VAL D 88  ? 0.6323 1.0182 0.5244 0.4105  -0.0671 0.2618  88   VAL D C   
3426 O O   . VAL D 88  ? 0.6091 0.9947 0.5657 0.3999  -0.0595 0.2770  88   VAL D O   
3427 C CB  . VAL D 88  ? 0.6731 1.0727 0.4963 0.4516  -0.0238 0.3224  88   VAL D CB  
3428 C CG1 . VAL D 88  ? 0.6836 1.0656 0.4957 0.4570  0.0163  0.3633  88   VAL D CG1 
3429 C CG2 . VAL D 88  ? 0.7187 1.1611 0.4896 0.4867  -0.0632 0.3045  88   VAL D CG2 
3430 N N   . SER D 89  ? 0.6643 1.0666 0.5322 0.4209  -0.1129 0.2269  89   SER D N   
3431 C CA  . SER D 89  ? 0.6690 1.0848 0.6042 0.4115  -0.1701 0.2011  89   SER D CA  
3432 C C   . SER D 89  ? 0.6239 1.0177 0.6233 0.3757  -0.1647 0.1888  89   SER D C   
3433 O O   . SER D 89  ? 0.6276 1.0338 0.7171 0.3620  -0.2086 0.1804  89   SER D O   
3434 C CB  . SER D 89  ? 0.7412 1.1669 0.6174 0.4448  -0.2353 0.1586  89   SER D CB  
3435 O OG  . SER D 89  ? 0.7628 1.1715 0.5473 0.4611  -0.2180 0.1384  89   SER D OG  
3436 N N   . HIS D 90  ? 0.5906 0.9532 0.5562 0.3621  -0.1151 0.1926  90   HIS D N   
3437 C CA  . HIS D 90  ? 0.5509 0.8929 0.5604 0.3354  -0.1065 0.1817  90   HIS D CA  
3438 C C   . HIS D 90  ? 0.5197 0.8294 0.5170 0.3281  -0.0478 0.2044  90   HIS D C   
3439 O O   . HIS D 90  ? 0.5023 0.7825 0.4718 0.3158  -0.0330 0.1883  90   HIS D O   
3440 C CB  . HIS D 90  ? 0.5664 0.8930 0.5288 0.3331  -0.1313 0.1389  90   HIS D CB  
3441 C CG  . HIS D 90  ? 0.6219 0.9630 0.5793 0.3518  -0.2010 0.1029  90   HIS D CG  
3442 N ND1 . HIS D 90  ? 0.6829 1.0265 0.5371 0.3901  -0.2170 0.0810  90   HIS D ND1 
3443 C CD2 . HIS D 90  ? 0.6492 0.9992 0.6937 0.3444  -0.2652 0.0855  90   HIS D CD2 
3444 C CE1 . HIS D 90  ? 0.7507 1.0958 0.6060 0.4117  -0.2921 0.0413  90   HIS D CE1 
3445 N NE2 . HIS D 90  ? 0.7350 1.0810 0.7148 0.3795  -0.3287 0.0414  90   HIS D NE2 
3446 N N   . THR D 91  ? 0.5156 0.8259 0.5289 0.3413  -0.0196 0.2387  91   THR D N   
3447 C CA  . THR D 91  ? 0.5114 0.7794 0.5007 0.3485  0.0246  0.2524  91   THR D CA  
3448 C C   . THR D 91  ? 0.4956 0.7702 0.5415 0.3471  0.0395  0.2642  91   THR D C   
3449 O O   . THR D 91  ? 0.4862 0.8060 0.6225 0.3400  0.0204  0.2797  91   THR D O   
3450 C CB  . THR D 91  ? 0.5305 0.7866 0.5058 0.3753  0.0488  0.2822  91   THR D CB  
3451 O OG1 . THR D 91  ? 0.5305 0.8370 0.5768 0.3857  0.0429  0.3115  91   THR D OG1 
3452 C CG2 . THR D 91  ? 0.5419 0.7850 0.4682 0.3776  0.0424  0.2807  91   THR D CG2 
3453 N N   . GLY D 92  ? 0.5006 0.7302 0.5010 0.3578  0.0700  0.2613  92   GLY D N   
3454 C CA  . GLY D 92  ? 0.5012 0.7385 0.5413 0.3692  0.0949  0.2815  92   GLY D CA  
3455 C C   . GLY D 92  ? 0.4887 0.6966 0.4982 0.3515  0.0922  0.2520  92   GLY D C   
3456 O O   . GLY D 92  ? 0.4895 0.6584 0.4339 0.3371  0.0788  0.2183  92   GLY D O   
3457 N N   . ASN D 93  ? 0.4819 0.7152 0.5540 0.3530  0.1058  0.2734  93   ASN D N   
3458 C CA  . ASN D 93  ? 0.4819 0.6870 0.5236 0.3481  0.1148  0.2563  93   ASN D CA  
3459 C C   . ASN D 93  ? 0.4506 0.6593 0.5117 0.3044  0.0765  0.2185  93   ASN D C   
3460 O O   . ASN D 93  ? 0.4332 0.6814 0.5852 0.2835  0.0487  0.2226  93   ASN D O   
3461 C CB  . ASN D 93  ? 0.4964 0.7325 0.5999 0.3776  0.1540  0.3073  93   ASN D CB  
3462 C CG  . ASN D 93  ? 0.5763 0.7808 0.5969 0.4421  0.2005  0.3307  93   ASN D CG  
3463 O OD1 . ASN D 93  ? 0.6541 0.7920 0.5628 0.4609  0.2005  0.2956  93   ASN D OD1 
3464 N ND2 . ASN D 93  ? 0.6282 0.8778 0.7047 0.4823  0.2360  0.3906  93   ASN D ND2 
3465 N N   . TYR D 94  ? 0.4510 0.6149 0.4316 0.2948  0.0710  0.1829  94   TYR D N   
3466 C CA  . TYR D 94  ? 0.4259 0.5894 0.4087 0.2645  0.0442  0.1498  94   TYR D CA  
3467 C C   . TYR D 94  ? 0.4170 0.5585 0.3909 0.2629  0.0601  0.1460  94   TYR D C   
3468 O O   . TYR D 94  ? 0.4330 0.5375 0.3506 0.2854  0.0830  0.1508  94   TYR D O   
3469 C CB  . TYR D 94  ? 0.4352 0.5778 0.3516 0.2575  0.0307  0.1259  94   TYR D CB  
3470 C CG  . TYR D 94  ? 0.4510 0.6241 0.3733 0.2608  0.0098  0.1265  94   TYR D CG  
3471 C CD1 . TYR D 94  ? 0.4558 0.6529 0.3861 0.2552  -0.0242 0.1030  94   TYR D CD1 
3472 C CD2 . TYR D 94  ? 0.4691 0.6428 0.3802 0.2776  0.0205  0.1485  94   TYR D CD2 
3473 C CE1 . TYR D 94  ? 0.4789 0.7014 0.3982 0.2697  -0.0478 0.1012  94   TYR D CE1 
3474 C CE2 . TYR D 94  ? 0.4766 0.6810 0.3899 0.2848  0.0016  0.1520  94   TYR D CE2 
3475 C CZ  . TYR D 94  ? 0.4865 0.7160 0.4000 0.2826  -0.0329 0.1283  94   TYR D CZ  
3476 O OH  . TYR D 94  ? 0.5213 0.7787 0.4214 0.3006  -0.0557 0.1296  94   TYR D OH  
3477 N N   . THR D 95  ? 0.3957 0.5556 0.4232 0.2412  0.0421  0.1349  95   THR D N   
3478 C CA  . THR D 95  ? 0.3907 0.5320 0.4096 0.2353  0.0524  0.1272  95   THR D CA  
3479 C C   . THR D 95  ? 0.3852 0.5106 0.3672 0.2135  0.0278  0.0873  95   THR D C   
3480 O O   . THR D 95  ? 0.3863 0.5292 0.3931 0.2028  -0.0038 0.0671  95   THR D O   
3481 C CB  . THR D 95  ? 0.3735 0.5482 0.4982 0.2302  0.0547  0.1543  95   THR D CB  
3482 O OG1 . THR D 95  ? 0.3806 0.5848 0.5568 0.2573  0.0852  0.2071  95   THR D OG1 
3483 C CG2 . THR D 95  ? 0.3679 0.5235 0.4760 0.2299  0.0717  0.1520  95   THR D CG2 
3484 N N   . CYS D 96  ? 0.3958 0.4864 0.3179 0.2142  0.0395  0.0777  96   CYS D N   
3485 C CA  . CYS D 96  ? 0.3925 0.4737 0.2913 0.1983  0.0267  0.0530  96   CYS D CA  
3486 C C   . CYS D 96  ? 0.3882 0.4616 0.3084 0.1910  0.0333  0.0502  96   CYS D C   
3487 O O   . CYS D 96  ? 0.4060 0.4576 0.3070 0.2036  0.0520  0.0632  96   CYS D O   
3488 C CB  . CYS D 96  ? 0.4074 0.4595 0.2527 0.2005  0.0300  0.0542  96   CYS D CB  
3489 S SG  . CYS D 96  ? 0.4026 0.4463 0.2348 0.1863  0.0253  0.0444  96   CYS D SG  
3490 N N   . GLU D 97  ? 0.3757 0.4637 0.3302 0.1781  0.0148  0.0319  97   GLU D N   
3491 C CA  . GLU D 97  ? 0.3607 0.4437 0.3463 0.1694  0.0180  0.0296  97   GLU D CA  
3492 C C   . GLU D 97  ? 0.3584 0.4304 0.3056 0.1629  0.0093  0.0045  97   GLU D C   
3493 O O   . GLU D 97  ? 0.3737 0.4555 0.3072 0.1681  -0.0105 -0.0160 97   GLU D O   
3494 C CB  . GLU D 97  ? 0.3571 0.4626 0.4370 0.1619  -0.0037 0.0317  97   GLU D CB  
3495 C CG  . GLU D 97  ? 0.3546 0.4592 0.4918 0.1536  0.0016  0.0409  97   GLU D CG  
3496 C CD  . GLU D 97  ? 0.3708 0.4830 0.6035 0.1410  -0.0423 0.0262  97   GLU D CD  
3497 O OE1 . GLU D 97  ? 0.4087 0.5437 0.7545 0.1363  -0.0456 0.0622  97   GLU D OE1 
3498 O OE2 . GLU D 97  ? 0.4273 0.5214 0.6265 0.1411  -0.0768 -0.0189 97   GLU D OE2 
3499 N N   . VAL D 98  ? 0.3478 0.4006 0.2737 0.1591  0.0240  0.0091  98   VAL D N   
3500 C CA  . VAL D 98  ? 0.3405 0.3888 0.2463 0.1540  0.0214  -0.0037 98   VAL D CA  
3501 C C   . VAL D 98  ? 0.3256 0.3694 0.2655 0.1465  0.0230  -0.0083 98   VAL D C   
3502 O O   . VAL D 98  ? 0.3140 0.3493 0.2685 0.1475  0.0362  0.0085  98   VAL D O   
3503 C CB  . VAL D 98  ? 0.3460 0.3753 0.2174 0.1525  0.0285  0.0103  98   VAL D CB  
3504 C CG1 . VAL D 98  ? 0.3479 0.3844 0.2201 0.1488  0.0303  0.0108  98   VAL D CG1 
3505 C CG2 . VAL D 98  ? 0.3493 0.3815 0.2016 0.1593  0.0267  0.0220  98   VAL D CG2 
3506 N N   . THR D 99  ? 0.3325 0.3816 0.2791 0.1473  0.0106  -0.0291 99   THR D N   
3507 C CA  . THR D 99  ? 0.3266 0.3691 0.3072 0.1407  0.0101  -0.0346 99   THR D CA  
3508 C C   . THR D 99  ? 0.3342 0.3752 0.2802 0.1458  0.0170  -0.0403 99   THR D C   
3509 O O   . THR D 99  ? 0.3464 0.3985 0.2557 0.1633  0.0148  -0.0483 99   THR D O   
3510 C CB  . THR D 99  ? 0.3434 0.3863 0.3825 0.1416  -0.0205 -0.0566 99   THR D CB  
3511 O OG1 . THR D 99  ? 0.3497 0.4033 0.4436 0.1366  -0.0283 -0.0406 99   THR D OG1 
3512 C CG2 . THR D 99  ? 0.3300 0.3635 0.4222 0.1333  -0.0219 -0.0568 99   THR D CG2 
3513 N N   . GLU D 100 ? 0.3231 0.3554 0.2825 0.1365  0.0284  -0.0294 100  GLU D N   
3514 C CA  . GLU D 100 ? 0.3244 0.3603 0.2732 0.1411  0.0348  -0.0301 100  GLU D CA  
3515 C C   . GLU D 100 ? 0.3322 0.3612 0.3153 0.1433  0.0253  -0.0497 100  GLU D C   
3516 O O   . GLU D 100 ? 0.3152 0.3369 0.3414 0.1310  0.0273  -0.0408 100  GLU D O   
3517 C CB  . GLU D 100 ? 0.3181 0.3456 0.2661 0.1296  0.0440  -0.0057 100  GLU D CB  
3518 C CG  . GLU D 100 ? 0.3048 0.3284 0.2338 0.1274  0.0410  0.0119  100  GLU D CG  
3519 C CD  . GLU D 100 ? 0.3220 0.3265 0.2615 0.1175  0.0313  0.0305  100  GLU D CD  
3520 O OE1 . GLU D 100 ? 0.3600 0.3636 0.3121 0.1135  0.0220  0.0510  100  GLU D OE1 
3521 O OE2 . GLU D 100 ? 0.2777 0.2671 0.2207 0.1153  0.0283  0.0268  100  GLU D OE2 
3522 N N   . LEU D 101 ? 0.4219 0.4445 0.2627 0.2330  0.0354  0.1043  101  LEU D N   
3523 C CA  . LEU D 101 ? 0.3976 0.4487 0.3310 0.2148  0.0130  0.1053  101  LEU D CA  
3524 C C   . LEU D 101 ? 0.3781 0.4237 0.3073 0.2003  0.0284  0.1061  101  LEU D C   
3525 O O   . LEU D 101 ? 0.3778 0.3885 0.2308 0.2001  0.0401  0.0923  101  LEU D O   
3526 C CB  . LEU D 101 ? 0.4216 0.4492 0.3364 0.2187  -0.0367 0.0654  101  LEU D CB  
3527 C CG  . LEU D 101 ? 0.4664 0.4862 0.3571 0.2469  -0.0632 0.0532  101  LEU D CG  
3528 C CD1 . LEU D 101 ? 0.5472 0.5266 0.3665 0.2867  -0.1140 0.0086  101  LEU D CD1 
3529 C CD2 . LEU D 101 ? 0.4548 0.5159 0.4837 0.2440  -0.0876 0.0774  101  LEU D CD2 
3530 N N   . THR D 102 ? 0.3579 0.4367 0.3956 0.1885  0.0213  0.1266  102  THR D N   
3531 C CA  . THR D 102 ? 0.3516 0.4265 0.3945 0.1740  0.0299  0.1252  102  THR D CA  
3532 C C   . THR D 102 ? 0.3576 0.3900 0.3197 0.1595  0.0081  0.0781  102  THR D C   
3533 O O   . THR D 102 ? 0.3898 0.4035 0.3239 0.1687  -0.0237 0.0509  102  THR D O   
3534 C CB  . THR D 102 ? 0.3294 0.4432 0.5418 0.1588  0.0092  0.1551  102  THR D CB  
3535 O OG1 . THR D 102 ? 0.3321 0.5027 0.6638 0.1809  0.0457  0.2291  102  THR D OG1 
3536 C CG2 . THR D 102 ? 0.3056 0.4184 0.5242 0.1475  0.0251  0.1606  102  THR D CG2 
3537 N N   . ARG D 103 ? 0.3653 0.3823 0.2870 0.1522  0.0278  0.0756  103  ARG D N   
3538 C CA  . ARG D 103 ? 0.3739 0.3660 0.2564 0.1421  0.0209  0.0537  103  ARG D CA  
3539 C C   . ARG D 103 ? 0.3489 0.3494 0.2691 0.1265  0.0199  0.0535  103  ARG D C   
3540 O O   . ARG D 103 ? 0.3404 0.3561 0.2863 0.1294  0.0384  0.0745  103  ARG D O   
3541 C CB  . ARG D 103 ? 0.3796 0.3432 0.2227 0.1427  0.0360  0.0578  103  ARG D CB  
3542 C CG  . ARG D 103 ? 0.4389 0.3888 0.2608 0.1566  0.0404  0.0668  103  ARG D CG  
3543 C CD  . ARG D 103 ? 0.4485 0.3758 0.3023 0.1513  0.0492  0.0877  103  ARG D CD  
3544 N NE  . ARG D 103 ? 0.4909 0.3839 0.3749 0.1415  0.0204  0.0747  103  ARG D NE  
3545 C CZ  . ARG D 103 ? 0.4944 0.3610 0.4597 0.1294  0.0026  0.0887  103  ARG D CZ  
3546 N NH1 . ARG D 103 ? 0.4798 0.3676 0.5190 0.1251  0.0357  0.1390  103  ARG D NH1 
3547 N NH2 . ARG D 103 ? 0.5244 0.3404 0.5050 0.1355  -0.0524 0.0576  103  ARG D NH2 
3548 N N   . GLU D 104 ? 0.3659 0.3541 0.2739 0.1255  0.0034  0.0345  104  GLU D N   
3549 C CA  . GLU D 104 ? 0.3509 0.3419 0.2879 0.1102  0.0027  0.0323  104  GLU D CA  
3550 C C   . GLU D 104 ? 0.3677 0.3399 0.2500 0.1203  0.0107  0.0237  104  GLU D C   
3551 O O   . GLU D 104 ? 0.3867 0.3487 0.2170 0.1499  0.0209  0.0291  104  GLU D O   
3552 C CB  . GLU D 104 ? 0.3595 0.3591 0.3875 0.1059  -0.0398 0.0250  104  GLU D CB  
3553 C CG  . GLU D 104 ? 0.4359 0.4033 0.4435 0.1373  -0.1036 -0.0158 104  GLU D CG  
3554 C CD  . GLU D 104 ? 0.4877 0.4297 0.5767 0.1431  -0.1801 -0.0469 104  GLU D CD  
3555 O OE1 . GLU D 104 ? 0.4893 0.4466 0.6573 0.1145  -0.1708 -0.0286 104  GLU D OE1 
3556 O OE2 . GLU D 104 ? 0.6248 0.5212 0.6968 0.1864  -0.2616 -0.0950 104  GLU D OE2 
3557 N N   . GLY D 105 ? 0.3477 0.3214 0.2483 0.1053  0.0154  0.0232  105  GLY D N   
3558 C CA  . GLY D 105 ? 0.3717 0.3358 0.2382 0.1215  0.0253  0.0235  105  GLY D CA  
3559 C C   . GLY D 105 ? 0.3445 0.3119 0.2460 0.0998  0.0180  0.0156  105  GLY D C   
3560 O O   . GLY D 105 ? 0.3183 0.2979 0.2669 0.0781  0.0180  0.0215  105  GLY D O   
3561 N N   . GLU D 106 ? 0.3755 0.3337 0.2469 0.1196  0.0196  0.0110  106  GLU D N   
3562 C CA  . GLU D 106 ? 0.3510 0.3109 0.2527 0.1000  0.0156  0.0053  106  GLU D CA  
3563 C C   . GLU D 106 ? 0.3654 0.3259 0.2373 0.1211  0.0433  0.0221  106  GLU D C   
3564 O O   . GLU D 106 ? 0.4120 0.3723 0.2356 0.1679  0.0672  0.0436  106  GLU D O   
3565 C CB  . GLU D 106 ? 0.3772 0.3214 0.3144 0.1035  -0.0359 -0.0236 106  GLU D CB  
3566 C CG  . GLU D 106 ? 0.4790 0.3807 0.3449 0.1621  -0.0831 -0.0614 106  GLU D CG  
3567 C CD  . GLU D 106 ? 0.5266 0.3943 0.4669 0.1685  -0.1731 -0.1013 106  GLU D CD  
3568 O OE1 . GLU D 106 ? 0.5525 0.4374 0.5794 0.1431  -0.1873 -0.0896 106  GLU D OE1 
3569 O OE2 . GLU D 106 ? 0.6075 0.4266 0.5343 0.2048  -0.2387 -0.1432 106  GLU D OE2 
3570 N N   . THR D 107 ? 0.3322 0.2985 0.2385 0.0964  0.0480  0.0239  107  THR D N   
3571 C CA  . THR D 107 ? 0.3430 0.3173 0.2488 0.1133  0.0752  0.0479  107  THR D CA  
3572 C C   . THR D 107 ? 0.3285 0.2957 0.2401 0.0997  0.0577  0.0254  107  THR D C   
3573 O O   . THR D 107 ? 0.2935 0.2575 0.2358 0.0715  0.0361  0.0078  107  THR D O   
3574 C CB  . THR D 107 ? 0.3133 0.3033 0.3037 0.0894  0.0956  0.0868  107  THR D CB  
3575 O OG1 . THR D 107 ? 0.3327 0.3450 0.3637 0.1163  0.1351  0.1387  107  THR D OG1 
3576 C CG2 . THR D 107 ? 0.2691 0.2454 0.2964 0.0527  0.0634  0.0610  107  THR D CG2 
3577 N N   . ILE D 108 ? 0.3561 0.3252 0.2441 0.1302  0.0761  0.0389  108  ILE D N   
3578 C CA  . ILE D 108 ? 0.3580 0.3157 0.2422 0.1264  0.0586  0.0172  108  ILE D CA  
3579 C C   . ILE D 108 ? 0.3305 0.3119 0.2636 0.1131  0.0902  0.0500  108  ILE D C   
3580 O O   . ILE D 108 ? 0.3460 0.3514 0.3076 0.1373  0.1299  0.0996  108  ILE D O   
3581 C CB  . ILE D 108 ? 0.4582 0.3793 0.2500 0.1951  0.0313  -0.0111 108  ILE D CB  
3582 C CG1 . ILE D 108 ? 0.4907 0.3741 0.2843 0.1963  -0.0377 -0.0593 108  ILE D CG1 
3583 C CG2 . ILE D 108 ? 0.4646 0.3722 0.2474 0.2046  0.0207  -0.0244 108  ILE D CG2 
3584 C CD1 . ILE D 108 ? 0.6162 0.4446 0.2892 0.2929  -0.0844 -0.0971 108  ILE D CD1 
3585 N N   . ILE D 109 ? 0.2919 0.2699 0.2571 0.0788  0.0733  0.0325  109  ILE D N   
3586 C CA  . ILE D 109 ? 0.2735 0.2648 0.2884 0.0678  0.0845  0.0511  109  ILE D CA  
3587 C C   . ILE D 109 ? 0.2757 0.2553 0.2607 0.0718  0.0747  0.0292  109  ILE D C   
3588 O O   . ILE D 109 ? 0.2704 0.2349 0.2505 0.0591  0.0526  0.0057  109  ILE D O   
3589 C CB  . ILE D 109 ? 0.2504 0.2337 0.3155 0.0395  0.0588  0.0420  109  ILE D CB  
3590 C CG1 . ILE D 109 ? 0.2550 0.2316 0.3389 0.0351  0.0472  0.0452  109  ILE D CG1 
3591 C CG2 . ILE D 109 ? 0.2385 0.2281 0.3834 0.0347  0.0502  0.0597  109  ILE D CG2 
3592 C CD1 . ILE D 109 ? 0.2702 0.2382 0.2934 0.0374  0.0439  0.0248  109  ILE D CD1 
3593 N N   . GLU D 110 ? 0.2932 0.2832 0.2776 0.0949  0.0953  0.0487  110  GLU D N   
3594 C CA  . GLU D 110 ? 0.2962 0.2725 0.2593 0.0987  0.0839  0.0287  110  GLU D CA  
3595 C C   . GLU D 110 ? 0.2490 0.2352 0.2696 0.0660  0.0793  0.0318  110  GLU D C   
3596 O O   . GLU D 110 ? 0.2310 0.2358 0.3183 0.0603  0.0855  0.0580  110  GLU D O   
3597 C CB  . GLU D 110 ? 0.3526 0.3318 0.2659 0.1575  0.1099  0.0487  110  GLU D CB  
3598 C CG  . GLU D 110 ? 0.3848 0.3330 0.2589 0.1695  0.0824  0.0141  110  GLU D CG  
3599 C CD  . GLU D 110 ? 0.4869 0.4289 0.2813 0.2499  0.1063  0.0303  110  GLU D CD  
3600 O OE1 . GLU D 110 ? 0.5895 0.5521 0.3417 0.3152  0.1529  0.0762  110  GLU D OE1 
3601 O OE2 . GLU D 110 ? 0.5125 0.4300 0.2840 0.2596  0.0847  0.0057  110  GLU D OE2 
3602 N N   . LEU D 111 ? 0.2407 0.2115 0.2509 0.0542  0.0633  0.0105  111  LEU D N   
3603 C CA  . LEU D 111 ? 0.2415 0.2117 0.2680 0.0489  0.0580  0.0093  111  LEU D CA  
3604 C C   . LEU D 111 ? 0.2532 0.2242 0.2752 0.0573  0.0652  0.0099  111  LEU D C   
3605 O O   . LEU D 111 ? 0.2678 0.2225 0.2705 0.0648  0.0591  -0.0012 111  LEU D O   
3606 C CB  . LEU D 111 ? 0.2477 0.2093 0.2611 0.0547  0.0582  0.0095  111  LEU D CB  
3607 C CG  . LEU D 111 ? 0.2731 0.2253 0.2621 0.0812  0.0545  0.0088  111  LEU D CG  
3608 C CD1 . LEU D 111 ? 0.3184 0.2492 0.2931 0.0999  0.0160  -0.0126 111  LEU D CD1 
3609 C CD2 . LEU D 111 ? 0.2887 0.2450 0.2655 0.1121  0.0836  0.0395  111  LEU D CD2 
3610 N N   . LYS D 112 ? 0.2607 0.2449 0.3185 0.0591  0.0666  0.0220  112  LYS D N   
3611 C CA  . LYS D 112 ? 0.2718 0.2611 0.3264 0.0719  0.0780  0.0278  112  LYS D CA  
3612 C C   . LYS D 112 ? 0.2715 0.2532 0.3432 0.0676  0.0577  0.0167  112  LYS D C   
3613 O O   . LYS D 112 ? 0.2737 0.2471 0.3776 0.0673  0.0263  0.0087  112  LYS D O   
3614 C CB  . LYS D 112 ? 0.2872 0.3086 0.3868 0.0933  0.1079  0.0707  112  LYS D CB  
3615 C CG  . LYS D 112 ? 0.3261 0.3530 0.3798 0.1289  0.1363  0.0906  112  LYS D CG  
3616 C CD  . LYS D 112 ? 0.3532 0.4287 0.4783 0.1678  0.1896  0.1675  112  LYS D CD  
3617 C CE  . LYS D 112 ? 0.4546 0.5291 0.4721 0.2503  0.2330  0.1938  112  LYS D CE  
3618 N NZ  . LYS D 112 ? 0.5300 0.6606 0.5958 0.3246  0.3127  0.2940  112  LYS D NZ  
3619 N N   . TYR D 113 ? 0.2778 0.2517 0.3210 0.0755  0.0649  0.0109  113  TYR D N   
3620 C CA  . TYR D 113 ? 0.2926 0.2590 0.3352 0.0860  0.0516  0.0037  113  TYR D CA  
3621 C C   . TYR D 113 ? 0.2858 0.2705 0.3698 0.0897  0.0565  0.0168  113  TYR D C   
3622 O O   . TYR D 113 ? 0.2699 0.2639 0.3380 0.0997  0.0833  0.0300  113  TYR D O   
3623 C CB  . TYR D 113 ? 0.3027 0.2541 0.3076 0.0971  0.0662  0.0057  113  TYR D CB  
3624 C CG  . TYR D 113 ? 0.3427 0.2844 0.3211 0.1277  0.0605  0.0040  113  TYR D CG  
3625 C CD1 . TYR D 113 ? 0.3857 0.3077 0.3161 0.1702  0.0374  -0.0076 113  TYR D CD1 
3626 C CD2 . TYR D 113 ? 0.3514 0.2934 0.3337 0.1304  0.0699  0.0082  113  TYR D CD2 
3627 C CE1 . TYR D 113 ? 0.4469 0.3474 0.3224 0.2236  0.0225  -0.0164 113  TYR D CE1 
3628 C CE2 . TYR D 113 ? 0.3772 0.3084 0.3254 0.1671  0.0637  0.0061  113  TYR D CE2 
3629 C CZ  . TYR D 113 ? 0.4388 0.3482 0.3284 0.2177  0.0397  -0.0065 113  TYR D CZ  
3630 O OH  . TYR D 113 ? 0.5105 0.3974 0.3378 0.2775  0.0252  -0.0149 113  TYR D OH  
3631 N N   . ARG D 114 ? 0.3040 0.2880 0.4412 0.0944  0.0228  0.0124  114  ARG D N   
3632 C CA  . ARG D 114 ? 0.3098 0.3177 0.5148 0.0984  0.0271  0.0343  114  ARG D CA  
3633 C C   . ARG D 114 ? 0.3386 0.3216 0.5037 0.1171  0.0000  0.0068  114  ARG D C   
3634 O O   . ARG D 114 ? 0.3784 0.3263 0.5167 0.1396  -0.0502 -0.0255 114  ARG D O   
3635 C CB  . ARG D 114 ? 0.3022 0.3375 0.6720 0.0881  0.0007  0.0682  114  ARG D CB  
3636 C CG  . ARG D 114 ? 0.3045 0.3739 0.7867 0.0949  0.0056  0.1066  114  ARG D CG  
3637 C CD  . ARG D 114 ? 0.3043 0.4252 1.0104 0.0864  0.0092  0.1825  114  ARG D CD  
3638 N NE  . ARG D 114 ? 0.3198 0.4088 1.1489 0.0652  -0.0803 0.1584  114  ARG D NE  
3639 C CZ  . ARG D 114 ? 0.3706 0.4197 1.3171 0.0642  -0.1893 0.1208  114  ARG D CZ  
3640 N NH1 . ARG D 114 ? 0.3927 0.4382 1.3583 0.0773  -0.2158 0.1084  114  ARG D NH1 
3641 N NH2 . ARG D 114 ? 0.4223 0.4242 1.4672 0.0585  -0.2868 0.0886  114  ARG D NH2 
3642 N N   . VAL D 115 ? 0.3453 0.3392 0.4892 0.1237  0.0302  0.0180  115  VAL D N   
3643 C CA  . VAL D 115 ? 0.3847 0.3602 0.4998 0.1456  0.0096  -0.0001 115  VAL D CA  
3644 C C   . VAL D 115 ? 0.4022 0.3913 0.6396 0.1474  -0.0387 0.0050  115  VAL D C   
3645 O O   . VAL D 115 ? 0.3800 0.4137 0.7171 0.1368  -0.0111 0.0496  115  VAL D O   
3646 C CB  . VAL D 115 ? 0.3874 0.3641 0.4505 0.1511  0.0517  0.0094  115  VAL D CB  
3647 C CG1 . VAL D 115 ? 0.4105 0.3718 0.4472 0.1769  0.0365  -0.0022 115  VAL D CG1 
3648 C CG2 . VAL D 115 ? 0.3850 0.3407 0.3916 0.1454  0.0744  0.0072  115  VAL D CG2 
3649 N N   . VAL D 116 ? 0.4639 0.4110 0.7019 0.1747  -0.1162 -0.0362 116  VAL D N   
3650 C CA  . VAL D 116 ? 0.4919 0.4358 0.8910 0.1766  -0.1986 -0.0413 116  VAL D CA  
3651 C C   . VAL D 116 ? 0.5021 0.4591 0.9269 0.1895  -0.1989 -0.0342 116  VAL D C   
3652 O O   . VAL D 116 ? 0.5540 0.4790 0.8363 0.2279  -0.1951 -0.0653 116  VAL D O   
3653 C CB  . VAL D 116 ? 0.5890 0.4557 0.9705 0.2225  -0.3186 -0.1093 116  VAL D CB  
3654 C CG1 . VAL D 116 ? 0.6579 0.4962 1.1981 0.2406  -0.4366 -0.1350 116  VAL D CG1 
3655 C CG2 . VAL D 116 ? 0.5805 0.4425 1.0266 0.1993  -0.3394 -0.1059 116  VAL D CG2 
3656 C C1  . NAG E .   ? 0.5403 0.4329 1.2001 -0.1553 0.0645  -0.3233 1116 NAG A C1  
3657 C C2  . NAG E .   ? 0.4947 0.4024 1.1047 -0.1353 0.0630  -0.3019 1116 NAG A C2  
3658 C C3  . NAG E .   ? 0.5269 0.4279 1.1802 -0.1204 0.0679  -0.3354 1116 NAG A C3  
3659 C C4  . NAG E .   ? 0.5823 0.4259 1.3245 -0.1162 0.0622  -0.3291 1116 NAG A C4  
3660 C C5  . NAG E .   ? 0.6272 0.4528 1.4152 -0.1372 0.0640  -0.3496 1116 NAG A C5  
3661 C C6  . NAG E .   ? 0.6835 0.4448 1.5664 -0.1349 0.0565  -0.3373 1116 NAG A C6  
3662 C C7  . NAG E .   ? 0.4072 0.3811 0.8871 -0.1330 0.0610  -0.2704 1116 NAG A C7  
3663 C C8  . NAG E .   ? 0.3642 0.3892 0.7835 -0.1352 0.0617  -0.2824 1116 NAG A C8  
3664 N N2  . NAG E .   ? 0.4496 0.4102 0.9881 -0.1379 0.0658  -0.3110 1116 NAG A N2  
3665 O O3  . NAG E .   ? 0.4941 0.4069 1.1071 -0.1036 0.0658  -0.3113 1116 NAG A O3  
3666 O O4  . NAG E .   ? 0.6113 0.4533 1.4062 -0.1017 0.0680  -0.3692 1116 NAG A O4  
3667 O O5  . NAG E .   ? 0.5982 0.4352 1.3362 -0.1529 0.0608  -0.3157 1116 NAG A O5  
3668 O O6  . NAG E .   ? 0.7093 0.4391 1.5829 -0.1451 0.0460  -0.2741 1116 NAG A O6  
3669 O O7  . NAG E .   ? 0.3952 0.3427 0.8712 -0.1281 0.0554  -0.2256 1116 NAG A O7  
3670 C C1  . NAG F .   ? 0.6694 1.0104 0.4474 -0.1723 -0.0062 -0.1193 1117 NAG A C1  
3671 C C2  . NAG F .   ? 0.7507 1.1403 0.4664 -0.1980 -0.0172 -0.0976 1117 NAG A C2  
3672 C C3  . NAG F .   ? 0.7931 1.2255 0.4755 -0.2173 0.0110  -0.1291 1117 NAG A C3  
3673 C C4  . NAG F .   ? 0.7958 1.2409 0.5014 -0.2146 0.0281  -0.1953 1117 NAG A C4  
3674 C C5  . NAG F .   ? 0.7341 1.1227 0.5081 -0.1860 0.0334  -0.2081 1117 NAG A C5  
3675 C C6  . NAG F .   ? 0.7351 1.1283 0.5414 -0.1826 0.0455  -0.2693 1117 NAG A C6  
3676 C C7  . NAG F .   ? 0.7719 1.1225 0.4860 -0.1954 -0.0237 -0.0112 1117 NAG A C7  
3677 C C8  . NAG F .   ? 0.7886 1.1253 0.4945 -0.1990 -0.0462 0.0496  1117 NAG A C8  
3678 N N2  . NAG F .   ? 0.7764 1.1530 0.4790 -0.1998 -0.0348 -0.0375 1117 NAG A N2  
3679 O O3  . NAG F .   ? 0.8528 1.3377 0.4698 -0.2458 0.0028  -0.1108 1117 NAG A O3  
3680 O O4  . NAG F .   ? 0.8412 1.3268 0.5263 -0.2300 0.0571  -0.2283 1117 NAG A O4  
3681 O O5  . NAG F .   ? 0.6909 1.0437 0.4845 -0.1726 0.0085  -0.1742 1117 NAG A O5  
3682 O O6  . NAG F .   ? 0.7581 1.1763 0.5462 -0.1948 0.0283  -0.2856 1117 NAG A O6  
3683 O O7  . NAG F .   ? 0.7567 1.0941 0.4926 -0.1886 0.0014  -0.0334 1117 NAG A O7  
3684 C C1  . NAG G .   ? 0.6883 1.0131 0.4685 -0.1962 0.0795  -0.0300 1118 NAG A C1  
3685 C C2  . NAG G .   ? 0.7468 1.1132 0.4794 -0.2127 0.0741  -0.0418 1118 NAG A C2  
3686 C C3  . NAG G .   ? 0.7968 1.1568 0.4989 -0.2213 0.0443  0.0076  1118 NAG A C3  
3687 C C4  . NAG G .   ? 0.8291 1.1797 0.5202 -0.2357 0.0424  0.0590  1118 NAG A C4  
3688 C C5  . NAG G .   ? 0.7773 1.0845 0.5222 -0.2181 0.0520  0.0603  1118 NAG A C5  
3689 C C6  . NAG G .   ? 0.8104 1.1070 0.5515 -0.2348 0.0523  0.1070  1118 NAG A C6  
3690 C C7  . NAG G .   ? 0.7666 1.1622 0.5076 -0.2036 0.0793  -0.1254 1118 NAG A C7  
3691 C C8  . NAG G .   ? 0.8251 1.2840 0.5089 -0.2349 0.0931  -0.1347 1118 NAG A C8  
3692 N N2  . NAG G .   ? 0.7337 1.0920 0.4920 -0.1950 0.0717  -0.0837 1118 NAG A N2  
3693 O O3  . NAG G .   ? 0.8445 1.2539 0.4937 -0.2424 0.0391  -0.0004 1118 NAG A O3  
3694 O O4  . NAG G .   ? 0.8634 1.1986 0.5424 -0.2373 0.0102  0.1064  1118 NAG A O4  
3695 O O5  . NAG G .   ? 0.7303 1.0510 0.4976 -0.2115 0.0786  0.0134  1118 NAG A O5  
3696 O O6  . NAG G .   ? 0.7950 1.0448 0.5629 -0.2220 0.0258  0.1446  1118 NAG A O6  
3697 O O7  . NAG G .   ? 0.7544 1.1347 0.5257 -0.1882 0.0756  -0.1573 1118 NAG A O7  
3698 C C1  . NAG H .   ? 0.5946 1.0904 0.4331 -0.2102 -0.0174 -0.1936 1119 NAG A C1  
3699 C C2  . NAG H .   ? 0.6463 1.2005 0.4565 -0.2289 -0.0387 -0.2032 1119 NAG A C2  
3700 C C3  . NAG H .   ? 0.7142 1.3281 0.4738 -0.2584 -0.0271 -0.2346 1119 NAG A C3  
3701 C C4  . NAG H .   ? 0.7339 1.3526 0.4508 -0.2661 -0.0162 -0.2043 1119 NAG A C4  
3702 C C5  . NAG H .   ? 0.6838 1.2407 0.4400 -0.2447 0.0047  -0.1965 1119 NAG A C5  
3703 C C6  . NAG H .   ? 0.7046 1.2638 0.4231 -0.2523 0.0107  -0.1571 1119 NAG A C6  
3704 C C7  . NAG H .   ? 0.6306 1.1899 0.5025 -0.2208 -0.0661 -0.2247 1119 NAG A C7  
3705 C C8  . NAG H .   ? 0.6069 1.1589 0.5294 -0.2212 -0.0618 -0.2659 1119 NAG A C8  
3706 N N2  . NAG H .   ? 0.6319 1.1804 0.4875 -0.2253 -0.0409 -0.2383 1119 NAG A N2  
3707 O O3  . NAG H .   ? 0.7673 1.4403 0.4909 -0.2771 -0.0525 -0.2334 1119 NAG A O3  
3708 O O4  . NAG H .   ? 0.7927 1.4691 0.4688 -0.2946 0.0025  -0.2440 1119 NAG A O4  
3709 O O5  . NAG H .   ? 0.6232 1.1262 0.4236 -0.2179 -0.0089 -0.1701 1119 NAG A O5  
3710 O O6  . NAG H .   ? 0.7091 1.2738 0.4327 -0.2598 0.0438  -0.1920 1119 NAG A O6  
3711 O O7  . NAG H .   ? 0.6471 1.2213 0.5008 -0.2167 -0.0924 -0.1809 1119 NAG A O7  
3713 C C1  . NAG J .   ? 0.6754 0.3190 0.4854 -0.2214 -0.3343 0.1012  1116 NAG B C1  
3714 C C2  . NAG J .   ? 0.6552 0.3078 0.4545 -0.2112 -0.3097 0.0992  1116 NAG B C2  
3715 C C3  . NAG J .   ? 0.7327 0.3388 0.4741 -0.2297 -0.3389 0.1128  1116 NAG B C3  
3716 C C4  . NAG J .   ? 0.7564 0.3527 0.5424 -0.2349 -0.3945 0.1315  1116 NAG B C4  
3717 C C5  . NAG J .   ? 0.7882 0.3796 0.5873 -0.2441 -0.4174 0.1320  1116 NAG B C5  
3718 C C6  . NAG J .   ? 0.8132 0.3983 0.6685 -0.2497 -0.4770 0.1497  1116 NAG B C6  
3719 C C7  . NAG J .   ? 0.5636 0.2546 0.3492 -0.1879 -0.2292 0.0729  1116 NAG B C7  
3720 C C8  . NAG J .   ? 0.5615 0.2452 0.2969 -0.1874 -0.1918 0.0567  1116 NAG B C8  
3721 N N2  . NAG J .   ? 0.6434 0.2962 0.3956 -0.2079 -0.2653 0.0828  1116 NAG B N2  
3722 O O3  . NAG J .   ? 0.6830 0.3030 0.4285 -0.2195 -0.3167 0.1114  1116 NAG B O3  
3723 O O4  . NAG J .   ? 0.8503 0.3906 0.5672 -0.2568 -0.4278 0.1467  1116 NAG B O4  
3724 O O5  . NAG J .   ? 0.7236 0.3624 0.5772 -0.2271 -0.3827 0.1175  1116 NAG B O5  
3725 O O6  . NAG J .   ? 0.7896 0.3962 0.7085 -0.2340 -0.4874 0.1574  1116 NAG B O6  
3726 O O7  . NAG J .   ? 0.5040 0.2331 0.3582 -0.1712 -0.2255 0.0750  1116 NAG B O7  
3727 C C1  . NAG K .   ? 0.8751 0.5521 0.4779 -0.1689 0.1916  -0.1962 1117 NAG B C1  
3728 C C2  . NAG K .   ? 0.9206 0.5649 0.5058 -0.1666 0.2044  -0.2208 1117 NAG B C2  
3729 C C3  . NAG K .   ? 1.0291 0.6270 0.5280 -0.2009 0.2342  -0.2410 1117 NAG B C3  
3730 C C4  . NAG K .   ? 1.0513 0.6719 0.5585 -0.2127 0.2773  -0.2591 1117 NAG B C4  
3731 C C5  . NAG K .   ? 0.9990 0.6517 0.5257 -0.2140 0.2583  -0.2302 1117 NAG B C5  
3732 C C6  . NAG K .   ? 1.0145 0.6928 0.5564 -0.2262 0.3009  -0.2479 1117 NAG B C6  
3733 C C7  . NAG K .   ? 0.8979 0.5191 0.5098 -0.1383 0.1585  -0.2101 1117 NAG B C7  
3734 C C8  . NAG K .   ? 0.8749 0.4730 0.4696 -0.1384 0.1192  -0.1884 1117 NAG B C8  
3735 N N2  . NAG K .   ? 0.9122 0.5352 0.4863 -0.1604 0.1650  -0.2015 1117 NAG B N2  
3736 O O3  . NAG K .   ? 1.0614 0.6291 0.5476 -0.1979 0.2518  -0.2692 1117 NAG B O3  
3737 O O4  . NAG K .   ? 1.1583 0.7306 0.5741 -0.2497 0.3074  -0.2773 1117 NAG B O4  
3738 O O5  . NAG K .   ? 0.9106 0.6051 0.5177 -0.1803 0.2292  -0.2132 1117 NAG B O5  
3739 O O6  . NAG K .   ? 0.9810 0.6890 0.5480 -0.2241 0.2805  -0.2214 1117 NAG B O6  
3740 O O7  . NAG K .   ? 0.9107 0.5476 0.5734 -0.1187 0.1818  -0.2344 1117 NAG B O7  
3741 C C1  . NAG L .   ? 0.2358 0.3256 0.4855 0.0495  -0.0463 0.0437  1116 NAG C C1  
3742 C C2  . NAG L .   ? 0.2402 0.3233 0.4780 0.0435  -0.0284 0.0420  1116 NAG C C2  
3743 C C3  . NAG L .   ? 0.2302 0.3351 0.5200 0.0411  -0.0161 0.0511  1116 NAG C C3  
3744 C C4  . NAG L .   ? 0.2515 0.3720 0.5896 0.0319  -0.0381 0.0513  1116 NAG C C4  
3745 C C5  . NAG L .   ? 0.2420 0.3704 0.5887 0.0385  -0.0580 0.0508  1116 NAG C C5  
3746 C C6  . NAG L .   ? 0.2531 0.3949 0.6426 0.0279  -0.0860 0.0472  1116 NAG C C6  
3747 C C7  . NAG L .   ? 0.2296 0.2794 0.3891 0.0492  -0.0092 0.0344  1116 NAG C C7  
3748 C C8  . NAG L .   ? 0.2189 0.2593 0.3540 0.0584  0.0070  0.0323  1116 NAG C C8  
3749 N N2  . NAG L .   ? 0.2036 0.2736 0.4061 0.0516  -0.0093 0.0409  1116 NAG C N2  
3750 O O3  . NAG L .   ? 0.2217 0.3179 0.4989 0.0347  -0.0041 0.0511  1116 NAG C O3  
3751 O O4  . NAG L .   ? 0.2734 0.4169 0.6703 0.0299  -0.0234 0.0636  1116 NAG C O4  
3752 O O5  . NAG L .   ? 0.2404 0.3464 0.5295 0.0425  -0.0669 0.0438  1116 NAG C O5  
3753 O O6  . NAG L .   ? 0.2615 0.4121 0.6596 0.0341  -0.1094 0.0473  1116 NAG C O6  
3754 O O7  . NAG L .   ? 0.2392 0.2783 0.3794 0.0413  -0.0216 0.0293  1116 NAG C O7  
3755 C C1  . NAG M .   ? 0.5154 0.3838 0.6366 0.1355  0.1351  -0.0240 1117 NAG C C1  
3756 C C2  . NAG M .   ? 0.5805 0.4144 0.6919 0.1439  0.1382  -0.0474 1117 NAG C C2  
3757 C C3  . NAG M .   ? 0.6348 0.4651 0.7247 0.1604  0.1565  -0.0646 1117 NAG C C3  
3758 C C4  . NAG M .   ? 0.6201 0.4762 0.7404 0.1726  0.1737  -0.0481 1117 NAG C C4  
3759 C C5  . NAG M .   ? 0.5749 0.4656 0.7107 0.1603  0.1676  -0.0237 1117 NAG C C5  
3760 C C6  . NAG M .   ? 0.5652 0.4852 0.7400 0.1701  0.1810  -0.0069 1117 NAG C C6  
3761 C C7  . NAG M .   ? 0.6301 0.4479 0.6860 0.1231  0.1168  -0.0690 1117 NAG C C7  
3762 C C8  . NAG M .   ? 0.6313 0.4694 0.6591 0.1284  0.1288  -0.0684 1117 NAG C C8  
3763 N N2  . NAG M .   ? 0.6136 0.4292 0.7049 0.1305  0.1225  -0.0589 1117 NAG C N2  
3764 O O3  . NAG M .   ? 0.7056 0.5008 0.7906 0.1706  0.1570  -0.0885 1117 NAG C O3  
3765 O O4  . NAG M .   ? 0.6584 0.5140 0.7589 0.1899  0.1954  -0.0612 1117 NAG C O4  
3766 O O5  . NAG M .   ? 0.5163 0.4062 0.6640 0.1465  0.1474  -0.0123 1117 NAG C O5  
3767 O O6  . NAG M .   ? 0.5300 0.4759 0.7223 0.1566  0.1671  0.0120  1117 NAG C O6  
3768 O O7  . NAG M .   ? 0.6877 0.4920 0.7372 0.1117  0.1018  -0.0766 1117 NAG C O7  
3769 C C1  . NAG N .   ? 0.7383 0.6446 0.6854 0.1160  0.1445  -0.0373 1118 NAG C C1  
3770 C C2  . NAG N .   ? 0.8131 0.7108 0.7513 0.1356  0.1639  -0.0484 1118 NAG C C2  
3771 C C3  . NAG N .   ? 0.8538 0.7211 0.7806 0.1397  0.1528  -0.0731 1118 NAG C C3  
3772 C C4  . NAG N .   ? 0.8727 0.7257 0.7606 0.1328  0.1343  -0.0879 1118 NAG C C4  
3773 C C5  . NAG N .   ? 0.8276 0.6947 0.7300 0.1133  0.1187  -0.0719 1118 NAG C C5  
3774 C C6  . NAG N .   ? 0.8491 0.7053 0.7207 0.1065  0.0994  -0.0846 1118 NAG C C6  
3775 C C7  . NAG N .   ? 0.8146 0.7401 0.8390 0.1374  0.1752  -0.0225 1118 NAG C C7  
3776 C C8  . NAG N .   ? 0.7980 0.7117 0.8324 0.1243  0.1515  -0.0246 1118 NAG C C8  
3777 N N2  . NAG N .   ? 0.8313 0.7483 0.8099 0.1425  0.1813  -0.0330 1118 NAG C N2  
3778 O O3  . NAG N .   ? 0.8987 0.7556 0.8121 0.1602  0.1712  -0.0866 1118 NAG C O3  
3779 O O4  . NAG N .   ? 0.9038 0.7286 0.7906 0.1332  0.1200  -0.1110 1118 NAG C O4  
3780 O O5  . NAG N .   ? 0.7831 0.6754 0.6933 0.1114  0.1303  -0.0502 1118 NAG C O5  
3781 O O6  . NAG N .   ? 0.9021 0.7477 0.7253 0.1209  0.1035  -0.1012 1118 NAG C O6  
3782 O O7  . NAG N .   ? 0.8020 0.7467 0.8615 0.1443  0.1888  -0.0095 1118 NAG C O7  
3783 C C1  . NAG O .   ? 0.6048 0.5885 0.3663 0.2293  0.0856  -0.0660 1119 NAG C C1  
3784 C C2  . NAG O .   ? 0.6738 0.6497 0.4075 0.2566  0.0930  -0.0869 1119 NAG C C2  
3785 C C3  . NAG O .   ? 0.7091 0.7047 0.4081 0.2830  0.1244  -0.0724 1119 NAG C C3  
3786 C C4  . NAG O .   ? 0.7281 0.7297 0.3841 0.2885  0.1233  -0.0623 1119 NAG C C4  
3787 C C5  . NAG O .   ? 0.6540 0.6608 0.3476 0.2584  0.1139  -0.0420 1119 NAG C C5  
3788 C C6  . NAG O .   ? 0.6663 0.6764 0.3235 0.2622  0.1084  -0.0324 1119 NAG C C6  
3789 C C7  . NAG O .   ? 0.6865 0.6363 0.4795 0.2453  0.0746  -0.1110 1119 NAG C C7  
3790 C C8  . NAG O .   ? 0.6647 0.6143 0.5007 0.2445  0.0818  -0.1085 1119 NAG C C8  
3791 N N2  . NAG O .   ? 0.6722 0.6451 0.4481 0.2528  0.0969  -0.0898 1119 NAG C N2  
3792 O O3  . NAG O .   ? 0.7688 0.7543 0.4308 0.3118  0.1292  -0.0967 1119 NAG C O3  
3793 O O4  . NAG O .   ? 0.7586 0.7803 0.3873 0.3125  0.1572  -0.0419 1119 NAG C O4  
3794 O O5  . NAG O .   ? 0.6110 0.6007 0.3350 0.2359  0.0861  -0.0582 1119 NAG C O5  
3795 O O6  . NAG O .   ? 0.6030 0.6199 0.3027 0.2365  0.1075  -0.0104 1119 NAG C O6  
3796 O O7  . NAG O .   ? 0.7301 0.6601 0.5104 0.2389  0.0488  -0.1301 1119 NAG C O7  
3798 C C1  . NAG Q .   ? 1.6084 0.8759 1.2385 0.8025  -0.0945 0.3600  1117 NAG D C1  
3799 C C2  . NAG Q .   ? 1.5904 0.8358 1.2184 0.7764  -0.1470 0.3017  1117 NAG D C2  
3800 C C3  . NAG Q .   ? 1.7193 0.8149 1.3963 0.7991  -0.2864 0.2308  1117 NAG D C3  
3801 C C4  . NAG Q .   ? 1.8039 0.8063 1.7329 0.7822  -0.3475 0.2838  1117 NAG D C4  
3802 C C5  . NAG Q .   ? 1.8025 0.8450 1.7323 0.8010  -0.2741 0.3532  1117 NAG D C5  
3803 C C6  . NAG Q .   ? 1.8717 0.8402 2.1028 0.7816  -0.3135 0.4387  1117 NAG D C6  
3804 C C7  . NAG Q .   ? 1.4346 0.8384 0.8336 0.7675  -0.0666 0.2519  1117 NAG D C7  
3805 C C8  . NAG Q .   ? 1.3987 0.8710 0.6469 0.7941  -0.0449 0.2112  1117 NAG D C8  
3806 N N2  . NAG Q .   ? 1.5348 0.8523 0.9616 0.7983  -0.1161 0.2479  1117 NAG D N2  
3807 O O3  . NAG Q .   ? 1.7246 0.7998 1.4248 0.7770  -0.3315 0.1909  1117 NAG D O3  
3808 O O4  . NAG Q .   ? 1.9638 0.8035 1.9035 0.8259  -0.5086 0.1917  1117 NAG D O4  
3809 O O5  . NAG Q .   ? 1.6881 0.8749 1.5355 0.7926  -0.1328 0.4191  1117 NAG D O5  
3810 O O6  . NAG Q .   ? 1.8058 0.8582 2.2399 0.7376  -0.2181 0.5654  1117 NAG D O6  
3811 O O7  . NAG Q .   ? 1.3843 0.8166 0.8883 0.7255  -0.0362 0.2959  1117 NAG D O7  
3812 C C1  . NAG R .   ? 0.9775 1.0065 0.7339 0.6045  0.4433  0.5611  1118 NAG D C1  
3813 C C2  . NAG R .   ? 1.0578 1.1375 0.9515 0.6762  0.5621  0.7306  1118 NAG D C2  
3814 C C3  . NAG R .   ? 1.2388 1.3282 0.9203 0.8552  0.6426  0.7891  1118 NAG D C3  
3815 C C4  . NAG R .   ? 1.3224 1.3791 0.7648 0.9326  0.6031  0.6991  1118 NAG D C4  
3816 C C5  . NAG R .   ? 1.2363 1.2388 0.6097 0.8293  0.4625  0.5253  1118 NAG D C5  
3817 C C6  . NAG R .   ? 1.3302 1.2879 0.5082 0.8990  0.3977  0.4295  1118 NAG D C6  
3818 C C7  . NAG R .   ? 0.9329 1.0163 1.3056 0.5091  0.5309  0.8184  1118 NAG D C7  
3819 C C8  . NAG R .   ? 0.9137 0.9827 1.4947 0.4652  0.5143  0.8713  1118 NAG D C8  
3820 N N2  . NAG R .   ? 1.0118 1.0971 1.1211 0.6133  0.5668  0.7928  1118 NAG D N2  
3821 O O3  . NAG R .   ? 1.3151 1.4670 1.1369 0.9410  0.7779  0.9762  1118 NAG D O3  
3822 O O4  . NAG R .   ? 1.5415 1.5806 0.7420 1.1225  0.6478  0.7258  1118 NAG D O4  
3823 O O5  . NAG R .   ? 1.0545 1.0673 0.6297 0.6676  0.4210  0.4990  1118 NAG D O5  
3824 O O6  . NAG R .   ? 1.3160 1.2990 0.5552 0.8913  0.4380  0.4722  1118 NAG D O6  
3825 O O7  . NAG R .   ? 0.8994 0.9825 1.3493 0.4553  0.4990  0.7946  1118 NAG D O7  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PCA 1   1   1   PCA PCA A . n 
A 1 2   LEU 2   2   2   LEU LEU A . n 
A 1 3   LEU 3   3   3   LEU LEU A . n 
A 1 4   PHE 4   4   4   PHE PHE A . n 
A 1 5   ASN 5   5   5   ASN ASN A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   LYS 8   8   8   LYS LYS A . n 
A 1 9   SER 9   9   9   SER SER A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  GLU 11  11  11  GLU GLU A . n 
A 1 12  PHE 12  12  12  PHE PHE A . n 
A 1 13  THR 13  13  13  THR THR A . n 
A 1 14  PHE 14  14  14  PHE PHE A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  ASN 16  16  16  ASN ASN A . n 
A 1 17  ASP 17  17  17  ASP ASP A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  ILE 21  21  21  ILE ILE A . n 
A 1 22  PRO 22  22  22  PRO PRO A . n 
A 1 23  CYS 23  23  23  CYS CYS A . n 
A 1 24  PHE 24  24  24  PHE PHE A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  THR 26  26  26  THR THR A . n 
A 1 27  ASN 27  27  27  ASN ASN A . n 
A 1 28  MET 28  28  28  MET MET A . n 
A 1 29  GLU 29  29  29  GLU GLU A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  GLN 31  31  31  GLN GLN A . n 
A 1 32  ASN 32  32  32  ASN ASN A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  THR 34  34  34  THR THR A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  VAL 36  36  36  VAL VAL A . n 
A 1 37  TYR 37  37  37  TYR TYR A . n 
A 1 38  VAL 38  38  38  VAL VAL A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  TRP 40  40  40  TRP TRP A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  PHE 42  42  42  PHE PHE A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  GLY 44  44  44  GLY GLY A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ASP 46  46  46  ASP ASP A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  TYR 48  48  48  TYR TYR A . n 
A 1 49  THR 49  49  49  THR THR A . n 
A 1 50  PHE 50  50  50  PHE PHE A . n 
A 1 51  ASP 51  51  51  ASP ASP A . n 
A 1 52  GLY 52  52  52  GLY GLY A . n 
A 1 53  ALA 53  53  53  ALA ALA A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  ASN 55  55  55  ASN ASN A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  PRO 60  60  60  PRO PRO A . n 
A 1 61  THR 61  61  61  THR THR A . n 
A 1 62  ASP 62  62  62  ASP ASP A . n 
A 1 63  PHE 63  63  63  PHE PHE A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  ALA 66  66  66  ALA ALA A . n 
A 1 67  LYS 67  67  67  LYS LYS A . n 
A 1 68  ILE 68  68  68  ILE ILE A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  GLN 72  72  72  GLN GLN A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  ASP 77  77  77  ASP ASP A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  MET 82  82  82  MET MET A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  ALA 87  87  87  ALA ALA A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  HIS 90  90  90  HIS HIS A . n 
A 1 91  THR 91  91  91  THR THR A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  ASN 93  93  93  ASN ASN A . n 
A 1 94  TYR 94  94  94  TYR TYR A . n 
A 1 95  THR 95  95  95  THR THR A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  GLU 97  97  97  GLU GLU A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 THR 102 102 102 THR THR A . n 
A 1 103 ARG 103 103 103 ARG ARG A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 GLY 105 105 105 GLY GLY A . n 
A 1 106 GLU 106 106 106 GLU GLU A . n 
A 1 107 THR 107 107 107 THR THR A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 ILE 109 109 109 ILE ILE A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 LYS 112 112 112 LYS LYS A . n 
A 1 113 TYR 113 113 113 TYR TYR A . n 
A 1 114 ARG 114 114 114 ARG ARG A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 VAL 116 116 ?   ?   ?   A . n 
A 1 117 SER 117 117 ?   ?   ?   A . n 
A 1 118 TRP 118 118 ?   ?   ?   A . n 
A 1 119 SER 119 119 ?   ?   ?   A . n 
A 1 120 THR 120 120 ?   ?   ?   A . n 
A 1 121 ARG 121 121 ?   ?   ?   A . n 
A 1 122 HIS 122 122 ?   ?   ?   A . n 
A 1 123 HIS 123 123 ?   ?   ?   A . n 
A 1 124 HIS 124 124 ?   ?   ?   A . n 
A 1 125 HIS 125 125 ?   ?   ?   A . n 
A 1 126 HIS 126 126 ?   ?   ?   A . n 
A 1 127 HIS 127 127 ?   ?   ?   A . n 
B 1 1   PCA 1   1   1   PCA PCA B . n 
B 1 2   LEU 2   2   2   LEU LEU B . n 
B 1 3   LEU 3   3   3   LEU LEU B . n 
B 1 4   PHE 4   4   4   PHE PHE B . n 
B 1 5   ASN 5   5   5   ASN ASN B . n 
B 1 6   LYS 6   6   6   LYS LYS B . n 
B 1 7   THR 7   7   7   THR THR B . n 
B 1 8   LYS 8   8   8   LYS LYS B . n 
B 1 9   SER 9   9   9   SER SER B . n 
B 1 10  VAL 10  10  10  VAL VAL B . n 
B 1 11  GLU 11  11  11  GLU GLU B . n 
B 1 12  PHE 12  12  12  PHE PHE B . n 
B 1 13  THR 13  13  13  THR THR B . n 
B 1 14  PHE 14  14  14  PHE PHE B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  ASN 16  16  16  ASN ASN B . n 
B 1 17  ASP 17  17  17  ASP ASP B . n 
B 1 18  THR 18  18  18  THR THR B . n 
B 1 19  VAL 19  19  19  VAL VAL B . n 
B 1 20  VAL 20  20  20  VAL VAL B . n 
B 1 21  ILE 21  21  21  ILE ILE B . n 
B 1 22  PRO 22  22  22  PRO PRO B . n 
B 1 23  CYS 23  23  23  CYS CYS B . n 
B 1 24  PHE 24  24  24  PHE PHE B . n 
B 1 25  VAL 25  25  25  VAL VAL B . n 
B 1 26  THR 26  26  26  THR THR B . n 
B 1 27  ASN 27  27  27  ASN ASN B . n 
B 1 28  MET 28  28  28  MET MET B . n 
B 1 29  GLU 29  29  29  GLU GLU B . n 
B 1 30  ALA 30  30  30  ALA ALA B . n 
B 1 31  GLN 31  31  31  GLN GLN B . n 
B 1 32  ASN 32  32  32  ASN ASN B . n 
B 1 33  THR 33  33  33  THR THR B . n 
B 1 34  THR 34  34  34  THR THR B . n 
B 1 35  GLU 35  35  35  GLU GLU B . n 
B 1 36  VAL 36  36  36  VAL VAL B . n 
B 1 37  TYR 37  37  37  TYR TYR B . n 
B 1 38  VAL 38  38  38  VAL VAL B . n 
B 1 39  LYS 39  39  39  LYS LYS B . n 
B 1 40  TRP 40  40  40  TRP TRP B . n 
B 1 41  LYS 41  41  41  LYS LYS B . n 
B 1 42  PHE 42  42  42  PHE PHE B . n 
B 1 43  LYS 43  43  43  LYS LYS B . n 
B 1 44  GLY 44  44  44  GLY GLY B . n 
B 1 45  ARG 45  45  45  ARG ARG B . n 
B 1 46  ASP 46  46  46  ASP ASP B . n 
B 1 47  ILE 47  47  47  ILE ILE B . n 
B 1 48  TYR 48  48  48  TYR TYR B . n 
B 1 49  THR 49  49  49  THR THR B . n 
B 1 50  PHE 50  50  50  PHE PHE B . n 
B 1 51  ASP 51  51  51  ASP ASP B . n 
B 1 52  GLY 52  52  52  GLY GLY B . n 
B 1 53  ALA 53  53  53  ALA ALA B . n 
B 1 54  LEU 54  54  54  LEU LEU B . n 
B 1 55  ASN 55  55  55  ASN ASN B . n 
B 1 56  LYS 56  56  56  LYS LYS B . n 
B 1 57  SER 57  57  57  SER SER B . n 
B 1 58  THR 58  58  58  THR THR B . n 
B 1 59  VAL 59  59  59  VAL VAL B . n 
B 1 60  PRO 60  60  60  PRO PRO B . n 
B 1 61  THR 61  61  61  THR THR B . n 
B 1 62  ASP 62  62  62  ASP ASP B . n 
B 1 63  PHE 63  63  63  PHE PHE B . n 
B 1 64  SER 64  64  64  SER SER B . n 
B 1 65  SER 65  65  65  SER SER B . n 
B 1 66  ALA 66  66  66  ALA ALA B . n 
B 1 67  LYS 67  67  67  LYS LYS B . n 
B 1 68  ILE 68  68  68  ILE ILE B . n 
B 1 69  GLU 69  69  69  GLU GLU B . n 
B 1 70  VAL 70  70  70  VAL VAL B . n 
B 1 71  SER 71  71  71  SER SER B . n 
B 1 72  GLN 72  72  72  GLN GLN B . n 
B 1 73  LEU 73  73  73  LEU LEU B . n 
B 1 74  LEU 74  74  74  LEU LEU B . n 
B 1 75  LYS 75  75  75  LYS LYS B . n 
B 1 76  GLY 76  76  76  GLY GLY B . n 
B 1 77  ASP 77  77  77  ASP ASP B . n 
B 1 78  ALA 78  78  78  ALA ALA B . n 
B 1 79  SER 79  79  79  SER SER B . n 
B 1 80  LEU 80  80  80  LEU LEU B . n 
B 1 81  LYS 81  81  81  LYS LYS B . n 
B 1 82  MET 82  82  82  MET MET B . n 
B 1 83  ASP 83  83  83  ASP ASP B . n 
B 1 84  LYS 84  84  84  LYS LYS B . n 
B 1 85  SER 85  85  85  SER SER B . n 
B 1 86  ASP 86  86  86  ASP ASP B . n 
B 1 87  ALA 87  87  87  ALA ALA B . n 
B 1 88  VAL 88  88  88  VAL VAL B . n 
B 1 89  SER 89  89  89  SER SER B . n 
B 1 90  HIS 90  90  90  HIS HIS B . n 
B 1 91  THR 91  91  91  THR THR B . n 
B 1 92  GLY 92  92  92  GLY GLY B . n 
B 1 93  ASN 93  93  93  ASN ASN B . n 
B 1 94  TYR 94  94  94  TYR TYR B . n 
B 1 95  THR 95  95  95  THR THR B . n 
B 1 96  CYS 96  96  96  CYS CYS B . n 
B 1 97  GLU 97  97  97  GLU GLU B . n 
B 1 98  VAL 98  98  98  VAL VAL B . n 
B 1 99  THR 99  99  99  THR THR B . n 
B 1 100 GLU 100 100 100 GLU GLU B . n 
B 1 101 LEU 101 101 101 LEU LEU B . n 
B 1 102 THR 102 102 102 THR THR B . n 
B 1 103 ARG 103 103 103 ARG ARG B . n 
B 1 104 GLU 104 104 104 GLU GLU B . n 
B 1 105 GLY 105 105 105 GLY GLY B . n 
B 1 106 GLU 106 106 106 GLU GLU B . n 
B 1 107 THR 107 107 107 THR THR B . n 
B 1 108 ILE 108 108 108 ILE ILE B . n 
B 1 109 ILE 109 109 109 ILE ILE B . n 
B 1 110 GLU 110 110 110 GLU GLU B . n 
B 1 111 LEU 111 111 111 LEU LEU B . n 
B 1 112 LYS 112 112 112 LYS LYS B . n 
B 1 113 TYR 113 113 113 TYR TYR B . n 
B 1 114 ARG 114 114 114 ARG ARG B . n 
B 1 115 VAL 115 115 115 VAL VAL B . n 
B 1 116 VAL 116 116 ?   ?   ?   B . n 
B 1 117 SER 117 117 ?   ?   ?   B . n 
B 1 118 TRP 118 118 ?   ?   ?   B . n 
B 1 119 SER 119 119 ?   ?   ?   B . n 
B 1 120 THR 120 120 ?   ?   ?   B . n 
B 1 121 ARG 121 121 ?   ?   ?   B . n 
B 1 122 HIS 122 122 ?   ?   ?   B . n 
B 1 123 HIS 123 123 ?   ?   ?   B . n 
B 1 124 HIS 124 124 ?   ?   ?   B . n 
B 1 125 HIS 125 125 ?   ?   ?   B . n 
B 1 126 HIS 126 126 ?   ?   ?   B . n 
B 1 127 HIS 127 127 ?   ?   ?   B . n 
C 1 1   PCA 1   1   1   PCA PCA C . n 
C 1 2   LEU 2   2   2   LEU LEU C . n 
C 1 3   LEU 3   3   3   LEU LEU C . n 
C 1 4   PHE 4   4   4   PHE PHE C . n 
C 1 5   ASN 5   5   5   ASN ASN C . n 
C 1 6   LYS 6   6   6   LYS LYS C . n 
C 1 7   THR 7   7   7   THR THR C . n 
C 1 8   LYS 8   8   8   LYS LYS C . n 
C 1 9   SER 9   9   9   SER SER C . n 
C 1 10  VAL 10  10  10  VAL VAL C . n 
C 1 11  GLU 11  11  11  GLU GLU C . n 
C 1 12  PHE 12  12  12  PHE PHE C . n 
C 1 13  THR 13  13  13  THR THR C . n 
C 1 14  PHE 14  14  14  PHE PHE C . n 
C 1 15  GLY 15  15  15  GLY GLY C . n 
C 1 16  ASN 16  16  16  ASN ASN C . n 
C 1 17  ASP 17  17  17  ASP ASP C . n 
C 1 18  THR 18  18  18  THR THR C . n 
C 1 19  VAL 19  19  19  VAL VAL C . n 
C 1 20  VAL 20  20  20  VAL VAL C . n 
C 1 21  ILE 21  21  21  ILE ILE C . n 
C 1 22  PRO 22  22  22  PRO PRO C . n 
C 1 23  CYS 23  23  23  CYS CYS C . n 
C 1 24  PHE 24  24  24  PHE PHE C . n 
C 1 25  VAL 25  25  25  VAL VAL C . n 
C 1 26  THR 26  26  26  THR THR C . n 
C 1 27  ASN 27  27  27  ASN ASN C . n 
C 1 28  MET 28  28  28  MET MET C . n 
C 1 29  GLU 29  29  29  GLU GLU C . n 
C 1 30  ALA 30  30  30  ALA ALA C . n 
C 1 31  GLN 31  31  31  GLN GLN C . n 
C 1 32  ASN 32  32  32  ASN ASN C . n 
C 1 33  THR 33  33  33  THR THR C . n 
C 1 34  THR 34  34  34  THR THR C . n 
C 1 35  GLU 35  35  35  GLU GLU C . n 
C 1 36  VAL 36  36  36  VAL VAL C . n 
C 1 37  TYR 37  37  37  TYR TYR C . n 
C 1 38  VAL 38  38  38  VAL VAL C . n 
C 1 39  LYS 39  39  39  LYS LYS C . n 
C 1 40  TRP 40  40  40  TRP TRP C . n 
C 1 41  LYS 41  41  41  LYS LYS C . n 
C 1 42  PHE 42  42  42  PHE PHE C . n 
C 1 43  LYS 43  43  43  LYS LYS C . n 
C 1 44  GLY 44  44  44  GLY GLY C . n 
C 1 45  ARG 45  45  45  ARG ARG C . n 
C 1 46  ASP 46  46  46  ASP ASP C . n 
C 1 47  ILE 47  47  47  ILE ILE C . n 
C 1 48  TYR 48  48  48  TYR TYR C . n 
C 1 49  THR 49  49  49  THR THR C . n 
C 1 50  PHE 50  50  50  PHE PHE C . n 
C 1 51  ASP 51  51  51  ASP ASP C . n 
C 1 52  GLY 52  52  52  GLY GLY C . n 
C 1 53  ALA 53  53  53  ALA ALA C . n 
C 1 54  LEU 54  54  54  LEU LEU C . n 
C 1 55  ASN 55  55  55  ASN ASN C . n 
C 1 56  LYS 56  56  56  LYS LYS C . n 
C 1 57  SER 57  57  57  SER SER C . n 
C 1 58  THR 58  58  58  THR THR C . n 
C 1 59  VAL 59  59  59  VAL VAL C . n 
C 1 60  PRO 60  60  60  PRO PRO C . n 
C 1 61  THR 61  61  61  THR THR C . n 
C 1 62  ASP 62  62  62  ASP ASP C . n 
C 1 63  PHE 63  63  63  PHE PHE C . n 
C 1 64  SER 64  64  64  SER SER C . n 
C 1 65  SER 65  65  65  SER SER C . n 
C 1 66  ALA 66  66  66  ALA ALA C . n 
C 1 67  LYS 67  67  67  LYS LYS C . n 
C 1 68  ILE 68  68  68  ILE ILE C . n 
C 1 69  GLU 69  69  69  GLU GLU C . n 
C 1 70  VAL 70  70  70  VAL VAL C . n 
C 1 71  SER 71  71  71  SER SER C . n 
C 1 72  GLN 72  72  72  GLN GLN C . n 
C 1 73  LEU 73  73  73  LEU LEU C . n 
C 1 74  LEU 74  74  74  LEU LEU C . n 
C 1 75  LYS 75  75  75  LYS LYS C . n 
C 1 76  GLY 76  76  76  GLY GLY C . n 
C 1 77  ASP 77  77  77  ASP ASP C . n 
C 1 78  ALA 78  78  78  ALA ALA C . n 
C 1 79  SER 79  79  79  SER SER C . n 
C 1 80  LEU 80  80  80  LEU LEU C . n 
C 1 81  LYS 81  81  81  LYS LYS C . n 
C 1 82  MET 82  82  82  MET MET C . n 
C 1 83  ASP 83  83  83  ASP ASP C . n 
C 1 84  LYS 84  84  84  LYS LYS C . n 
C 1 85  SER 85  85  85  SER SER C . n 
C 1 86  ASP 86  86  86  ASP ASP C . n 
C 1 87  ALA 87  87  87  ALA ALA C . n 
C 1 88  VAL 88  88  88  VAL VAL C . n 
C 1 89  SER 89  89  89  SER SER C . n 
C 1 90  HIS 90  90  90  HIS HIS C . n 
C 1 91  THR 91  91  91  THR THR C . n 
C 1 92  GLY 92  92  92  GLY GLY C . n 
C 1 93  ASN 93  93  93  ASN ASN C . n 
C 1 94  TYR 94  94  94  TYR TYR C . n 
C 1 95  THR 95  95  95  THR THR C . n 
C 1 96  CYS 96  96  96  CYS CYS C . n 
C 1 97  GLU 97  97  97  GLU GLU C . n 
C 1 98  VAL 98  98  98  VAL VAL C . n 
C 1 99  THR 99  99  99  THR THR C . n 
C 1 100 GLU 100 100 100 GLU GLU C . n 
C 1 101 LEU 101 101 101 LEU LEU C . n 
C 1 102 THR 102 102 102 THR THR C . n 
C 1 103 ARG 103 103 103 ARG ARG C . n 
C 1 104 GLU 104 104 104 GLU GLU C . n 
C 1 105 GLY 105 105 105 GLY GLY C . n 
C 1 106 GLU 106 106 106 GLU GLU C . n 
C 1 107 THR 107 107 107 THR THR C . n 
C 1 108 ILE 108 108 108 ILE ILE C . n 
C 1 109 ILE 109 109 109 ILE ILE C . n 
C 1 110 GLU 110 110 110 GLU GLU C . n 
C 1 111 LEU 111 111 111 LEU LEU C . n 
C 1 112 LYS 112 112 112 LYS LYS C . n 
C 1 113 TYR 113 113 113 TYR TYR C . n 
C 1 114 ARG 114 114 114 ARG ARG C . n 
C 1 115 VAL 115 115 115 VAL VAL C . n 
C 1 116 VAL 116 116 ?   ?   ?   C . n 
C 1 117 SER 117 117 ?   ?   ?   C . n 
C 1 118 TRP 118 118 ?   ?   ?   C . n 
C 1 119 SER 119 119 ?   ?   ?   C . n 
C 1 120 THR 120 120 ?   ?   ?   C . n 
C 1 121 ARG 121 121 ?   ?   ?   C . n 
C 1 122 HIS 122 122 ?   ?   ?   C . n 
C 1 123 HIS 123 123 ?   ?   ?   C . n 
C 1 124 HIS 124 124 ?   ?   ?   C . n 
C 1 125 HIS 125 125 ?   ?   ?   C . n 
C 1 126 HIS 126 126 ?   ?   ?   C . n 
C 1 127 HIS 127 127 ?   ?   ?   C . n 
D 1 1   PCA 1   1   1   PCA PCA D . n 
D 1 2   LEU 2   2   2   LEU LEU D . n 
D 1 3   LEU 3   3   3   LEU LEU D . n 
D 1 4   PHE 4   4   4   PHE PHE D . n 
D 1 5   ASN 5   5   5   ASN ASN D . n 
D 1 6   LYS 6   6   6   LYS LYS D . n 
D 1 7   THR 7   7   7   THR THR D . n 
D 1 8   LYS 8   8   8   LYS LYS D . n 
D 1 9   SER 9   9   9   SER SER D . n 
D 1 10  VAL 10  10  10  VAL VAL D . n 
D 1 11  GLU 11  11  11  GLU GLU D . n 
D 1 12  PHE 12  12  12  PHE PHE D . n 
D 1 13  THR 13  13  13  THR THR D . n 
D 1 14  PHE 14  14  14  PHE PHE D . n 
D 1 15  GLY 15  15  15  GLY GLY D . n 
D 1 16  ASN 16  16  16  ASN ASN D . n 
D 1 17  ASP 17  17  17  ASP ASP D . n 
D 1 18  THR 18  18  18  THR THR D . n 
D 1 19  VAL 19  19  19  VAL VAL D . n 
D 1 20  VAL 20  20  20  VAL VAL D . n 
D 1 21  ILE 21  21  21  ILE ILE D . n 
D 1 22  PRO 22  22  22  PRO PRO D . n 
D 1 23  CYS 23  23  23  CYS CYS D . n 
D 1 24  PHE 24  24  24  PHE PHE D . n 
D 1 25  VAL 25  25  25  VAL VAL D . n 
D 1 26  THR 26  26  26  THR THR D . n 
D 1 27  ASN 27  27  27  ASN ASN D . n 
D 1 28  MET 28  28  28  MET MET D . n 
D 1 29  GLU 29  29  29  GLU GLU D . n 
D 1 30  ALA 30  30  30  ALA ALA D . n 
D 1 31  GLN 31  31  31  GLN GLN D . n 
D 1 32  ASN 32  32  32  ASN ASN D . n 
D 1 33  THR 33  33  33  THR THR D . n 
D 1 34  THR 34  34  34  THR THR D . n 
D 1 35  GLU 35  35  35  GLU GLU D . n 
D 1 36  VAL 36  36  36  VAL VAL D . n 
D 1 37  TYR 37  37  37  TYR TYR D . n 
D 1 38  VAL 38  38  38  VAL VAL D . n 
D 1 39  LYS 39  39  39  LYS LYS D . n 
D 1 40  TRP 40  40  40  TRP TRP D . n 
D 1 41  LYS 41  41  41  LYS LYS D . n 
D 1 42  PHE 42  42  42  PHE PHE D . n 
D 1 43  LYS 43  43  43  LYS LYS D . n 
D 1 44  GLY 44  44  44  GLY GLY D . n 
D 1 45  ARG 45  45  45  ARG ARG D . n 
D 1 46  ASP 46  46  46  ASP ASP D . n 
D 1 47  ILE 47  47  47  ILE ILE D . n 
D 1 48  TYR 48  48  48  TYR TYR D . n 
D 1 49  THR 49  49  49  THR THR D . n 
D 1 50  PHE 50  50  50  PHE PHE D . n 
D 1 51  ASP 51  51  51  ASP ASP D . n 
D 1 52  GLY 52  52  52  GLY GLY D . n 
D 1 53  ALA 53  53  53  ALA ALA D . n 
D 1 54  LEU 54  54  54  LEU LEU D . n 
D 1 55  ASN 55  55  55  ASN ASN D . n 
D 1 56  LYS 56  56  56  LYS LYS D . n 
D 1 57  SER 57  57  57  SER SER D . n 
D 1 58  THR 58  58  58  THR THR D . n 
D 1 59  VAL 59  59  59  VAL VAL D . n 
D 1 60  PRO 60  60  60  PRO PRO D . n 
D 1 61  THR 61  61  61  THR THR D . n 
D 1 62  ASP 62  62  62  ASP ASP D . n 
D 1 63  PHE 63  63  63  PHE PHE D . n 
D 1 64  SER 64  64  64  SER SER D . n 
D 1 65  SER 65  65  65  SER SER D . n 
D 1 66  ALA 66  66  66  ALA ALA D . n 
D 1 67  LYS 67  67  67  LYS LYS D . n 
D 1 68  ILE 68  68  68  ILE ILE D . n 
D 1 69  GLU 69  69  69  GLU GLU D . n 
D 1 70  VAL 70  70  70  VAL VAL D . n 
D 1 71  SER 71  71  71  SER SER D . n 
D 1 72  GLN 72  72  72  GLN GLN D . n 
D 1 73  LEU 73  73  73  LEU LEU D . n 
D 1 74  LEU 74  74  74  LEU LEU D . n 
D 1 75  LYS 75  75  75  LYS LYS D . n 
D 1 76  GLY 76  76  76  GLY GLY D . n 
D 1 77  ASP 77  77  77  ASP ASP D . n 
D 1 78  ALA 78  78  78  ALA ALA D . n 
D 1 79  SER 79  79  79  SER SER D . n 
D 1 80  LEU 80  80  80  LEU LEU D . n 
D 1 81  LYS 81  81  81  LYS LYS D . n 
D 1 82  MET 82  82  82  MET MET D . n 
D 1 83  ASP 83  83  83  ASP ASP D . n 
D 1 84  LYS 84  84  84  LYS LYS D . n 
D 1 85  SER 85  85  85  SER SER D . n 
D 1 86  ASP 86  86  86  ASP ASP D . n 
D 1 87  ALA 87  87  87  ALA ALA D . n 
D 1 88  VAL 88  88  88  VAL VAL D . n 
D 1 89  SER 89  89  89  SER SER D . n 
D 1 90  HIS 90  90  90  HIS HIS D . n 
D 1 91  THR 91  91  91  THR THR D . n 
D 1 92  GLY 92  92  92  GLY GLY D . n 
D 1 93  ASN 93  93  93  ASN ASN D . n 
D 1 94  TYR 94  94  94  TYR TYR D . n 
D 1 95  THR 95  95  95  THR THR D . n 
D 1 96  CYS 96  96  96  CYS CYS D . n 
D 1 97  GLU 97  97  97  GLU GLU D . n 
D 1 98  VAL 98  98  98  VAL VAL D . n 
D 1 99  THR 99  99  99  THR THR D . n 
D 1 100 GLU 100 100 100 GLU GLU D . n 
D 1 101 LEU 101 101 101 LEU LEU D . n 
D 1 102 THR 102 102 102 THR THR D . n 
D 1 103 ARG 103 103 103 ARG ARG D . n 
D 1 104 GLU 104 104 104 GLU GLU D . n 
D 1 105 GLY 105 105 105 GLY GLY D . n 
D 1 106 GLU 106 106 106 GLU GLU D . n 
D 1 107 THR 107 107 107 THR THR D . n 
D 1 108 ILE 108 108 108 ILE ILE D . n 
D 1 109 ILE 109 109 109 ILE ILE D . n 
D 1 110 GLU 110 110 110 GLU GLU D . n 
D 1 111 LEU 111 111 111 LEU LEU D . n 
D 1 112 LYS 112 112 112 LYS LYS D . n 
D 1 113 TYR 113 113 113 TYR TYR D . n 
D 1 114 ARG 114 114 114 ARG ARG D . n 
D 1 115 VAL 115 115 115 VAL VAL D . n 
D 1 116 VAL 116 116 116 VAL VAL D . n 
D 1 117 SER 117 117 ?   ?   ?   D . n 
D 1 118 TRP 118 118 ?   ?   ?   D . n 
D 1 119 SER 119 119 ?   ?   ?   D . n 
D 1 120 THR 120 120 ?   ?   ?   D . n 
D 1 121 ARG 121 121 ?   ?   ?   D . n 
D 1 122 HIS 122 122 ?   ?   ?   D . n 
D 1 123 HIS 123 123 ?   ?   ?   D . n 
D 1 124 HIS 124 124 ?   ?   ?   D . n 
D 1 125 HIS 125 125 ?   ?   ?   D . n 
D 1 126 HIS 126 126 ?   ?   ?   D . n 
D 1 127 HIS 127 127 ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 NAG 1   1116 1116 NAG NAG A . 
F 2 NAG 1   1117 1117 NAG NAG A . 
G 2 NAG 1   1118 1118 NAG NAG A . 
H 2 NAG 1   1119 1119 NAG NAG A . 
I 3 MG  1   1120 1120 MG  MG  A . 
J 2 NAG 1   1116 1116 NAG NAG B . 
K 2 NAG 1   1117 1117 NAG NAG B . 
L 2 NAG 1   1116 1116 NAG NAG C . 
M 2 NAG 1   1117 1117 NAG NAG C . 
N 2 NAG 1   1118 1118 NAG NAG C . 
O 2 NAG 1   1119 1119 NAG NAG C . 
P 3 MG  1   1120 1120 MG  MG  C . 
Q 2 NAG 1   1117 1117 NAG NAG D . 
R 2 NAG 1   1118 1118 NAG NAG D . 
S 4 HOH 1   2001 2001 HOH HOH A . 
S 4 HOH 2   2002 2002 HOH HOH A . 
S 4 HOH 3   2003 2003 HOH HOH A . 
S 4 HOH 4   2004 2004 HOH HOH A . 
S 4 HOH 5   2005 2005 HOH HOH A . 
S 4 HOH 6   2006 2006 HOH HOH A . 
S 4 HOH 7   2007 2007 HOH HOH A . 
S 4 HOH 8   2008 2008 HOH HOH A . 
S 4 HOH 9   2009 2009 HOH HOH A . 
S 4 HOH 10  2010 2010 HOH HOH A . 
S 4 HOH 11  2011 2011 HOH HOH A . 
S 4 HOH 12  2012 2012 HOH HOH A . 
S 4 HOH 13  2013 2013 HOH HOH A . 
S 4 HOH 14  2014 2014 HOH HOH A . 
S 4 HOH 15  2015 2015 HOH HOH A . 
S 4 HOH 16  2016 2016 HOH HOH A . 
S 4 HOH 17  2017 2017 HOH HOH A . 
S 4 HOH 18  2018 2018 HOH HOH A . 
S 4 HOH 19  2019 2019 HOH HOH A . 
S 4 HOH 20  2020 2020 HOH HOH A . 
S 4 HOH 21  2021 2021 HOH HOH A . 
S 4 HOH 22  2022 2022 HOH HOH A . 
S 4 HOH 23  2023 2023 HOH HOH A . 
S 4 HOH 24  2024 2024 HOH HOH A . 
S 4 HOH 25  2025 2025 HOH HOH A . 
S 4 HOH 26  2026 2026 HOH HOH A . 
S 4 HOH 27  2027 2027 HOH HOH A . 
S 4 HOH 28  2028 2028 HOH HOH A . 
S 4 HOH 29  2029 2029 HOH HOH A . 
S 4 HOH 30  2030 2030 HOH HOH A . 
S 4 HOH 31  2031 2031 HOH HOH A . 
S 4 HOH 32  2032 2032 HOH HOH A . 
S 4 HOH 33  2033 2033 HOH HOH A . 
S 4 HOH 34  2034 2034 HOH HOH A . 
S 4 HOH 35  2035 2035 HOH HOH A . 
S 4 HOH 36  2036 2036 HOH HOH A . 
S 4 HOH 37  2037 2037 HOH HOH A . 
S 4 HOH 38  2038 2038 HOH HOH A . 
S 4 HOH 39  2039 2039 HOH HOH A . 
S 4 HOH 40  2040 2040 HOH HOH A . 
S 4 HOH 41  2041 2041 HOH HOH A . 
S 4 HOH 42  2042 2042 HOH HOH A . 
S 4 HOH 43  2043 2043 HOH HOH A . 
S 4 HOH 44  2044 2044 HOH HOH A . 
S 4 HOH 45  2045 2045 HOH HOH A . 
S 4 HOH 46  2046 2046 HOH HOH A . 
S 4 HOH 47  2047 2047 HOH HOH A . 
S 4 HOH 48  2048 2048 HOH HOH A . 
S 4 HOH 49  2049 2049 HOH HOH A . 
S 4 HOH 50  2050 2050 HOH HOH A . 
S 4 HOH 51  2051 2051 HOH HOH A . 
S 4 HOH 52  2052 2052 HOH HOH A . 
S 4 HOH 53  2053 2053 HOH HOH A . 
S 4 HOH 54  2054 2054 HOH HOH A . 
S 4 HOH 55  2055 2055 HOH HOH A . 
S 4 HOH 56  2056 2056 HOH HOH A . 
S 4 HOH 57  2057 2057 HOH HOH A . 
S 4 HOH 58  2058 2058 HOH HOH A . 
S 4 HOH 59  2059 2059 HOH HOH A . 
S 4 HOH 60  2060 2060 HOH HOH A . 
S 4 HOH 61  2061 2061 HOH HOH A . 
S 4 HOH 62  2062 2062 HOH HOH A . 
S 4 HOH 63  2063 2063 HOH HOH A . 
S 4 HOH 64  2064 2064 HOH HOH A . 
S 4 HOH 65  2065 2065 HOH HOH A . 
S 4 HOH 66  2066 2066 HOH HOH A . 
S 4 HOH 67  2067 2067 HOH HOH A . 
S 4 HOH 68  2068 2068 HOH HOH A . 
S 4 HOH 69  2069 2069 HOH HOH A . 
S 4 HOH 70  2070 2070 HOH HOH A . 
S 4 HOH 71  2071 2071 HOH HOH A . 
S 4 HOH 72  2072 2072 HOH HOH A . 
S 4 HOH 73  2073 2073 HOH HOH A . 
S 4 HOH 74  2074 2074 HOH HOH A . 
S 4 HOH 75  2075 2075 HOH HOH A . 
S 4 HOH 76  2076 2076 HOH HOH A . 
S 4 HOH 77  2077 2077 HOH HOH A . 
S 4 HOH 78  2078 2078 HOH HOH A . 
S 4 HOH 79  2079 2079 HOH HOH A . 
S 4 HOH 80  2080 2080 HOH HOH A . 
S 4 HOH 81  2081 2081 HOH HOH A . 
S 4 HOH 82  2082 2082 HOH HOH A . 
T 4 HOH 1   2001 2001 HOH HOH B . 
T 4 HOH 2   2002 2002 HOH HOH B . 
T 4 HOH 3   2003 2003 HOH HOH B . 
T 4 HOH 4   2004 2004 HOH HOH B . 
T 4 HOH 5   2005 2005 HOH HOH B . 
T 4 HOH 6   2006 2006 HOH HOH B . 
T 4 HOH 7   2007 2007 HOH HOH B . 
T 4 HOH 8   2008 2008 HOH HOH B . 
T 4 HOH 9   2009 2009 HOH HOH B . 
T 4 HOH 10  2010 2010 HOH HOH B . 
T 4 HOH 11  2011 2011 HOH HOH B . 
T 4 HOH 12  2012 2012 HOH HOH B . 
T 4 HOH 13  2013 2013 HOH HOH B . 
T 4 HOH 14  2014 2014 HOH HOH B . 
T 4 HOH 15  2015 2015 HOH HOH B . 
T 4 HOH 16  2016 2016 HOH HOH B . 
T 4 HOH 17  2017 2017 HOH HOH B . 
T 4 HOH 18  2018 2018 HOH HOH B . 
T 4 HOH 19  2019 2019 HOH HOH B . 
T 4 HOH 20  2020 2020 HOH HOH B . 
T 4 HOH 21  2021 2021 HOH HOH B . 
T 4 HOH 22  2022 2022 HOH HOH B . 
T 4 HOH 23  2023 2023 HOH HOH B . 
T 4 HOH 24  2024 2024 HOH HOH B . 
T 4 HOH 25  2025 2025 HOH HOH B . 
T 4 HOH 26  2026 2026 HOH HOH B . 
T 4 HOH 27  2027 2027 HOH HOH B . 
T 4 HOH 28  2028 2028 HOH HOH B . 
T 4 HOH 29  2029 2029 HOH HOH B . 
T 4 HOH 30  2030 2030 HOH HOH B . 
T 4 HOH 31  2031 2031 HOH HOH B . 
T 4 HOH 32  2032 2032 HOH HOH B . 
T 4 HOH 33  2033 2033 HOH HOH B . 
T 4 HOH 34  2034 2034 HOH HOH B . 
T 4 HOH 35  2035 2035 HOH HOH B . 
T 4 HOH 36  2036 2036 HOH HOH B . 
T 4 HOH 37  2037 2037 HOH HOH B . 
T 4 HOH 38  2038 2038 HOH HOH B . 
T 4 HOH 39  2039 2039 HOH HOH B . 
T 4 HOH 40  2040 2040 HOH HOH B . 
T 4 HOH 41  2041 2041 HOH HOH B . 
T 4 HOH 42  2042 2042 HOH HOH B . 
T 4 HOH 43  2043 2043 HOH HOH B . 
T 4 HOH 44  2044 2044 HOH HOH B . 
T 4 HOH 45  2045 2045 HOH HOH B . 
T 4 HOH 46  2046 2046 HOH HOH B . 
T 4 HOH 47  2047 2047 HOH HOH B . 
T 4 HOH 48  2048 2048 HOH HOH B . 
T 4 HOH 49  2049 2049 HOH HOH B . 
T 4 HOH 50  2050 2050 HOH HOH B . 
T 4 HOH 51  2051 2051 HOH HOH B . 
T 4 HOH 52  2052 2052 HOH HOH B . 
T 4 HOH 53  2053 2053 HOH HOH B . 
T 4 HOH 54  2054 2054 HOH HOH B . 
T 4 HOH 55  2055 2055 HOH HOH B . 
T 4 HOH 56  2056 2056 HOH HOH B . 
T 4 HOH 57  2057 2057 HOH HOH B . 
T 4 HOH 58  2058 2058 HOH HOH B . 
T 4 HOH 59  2059 2059 HOH HOH B . 
T 4 HOH 60  2060 2060 HOH HOH B . 
T 4 HOH 61  2061 2061 HOH HOH B . 
T 4 HOH 62  2062 2062 HOH HOH B . 
T 4 HOH 63  2063 2063 HOH HOH B . 
T 4 HOH 64  2064 2064 HOH HOH B . 
T 4 HOH 65  2065 2065 HOH HOH B . 
T 4 HOH 66  2066 2066 HOH HOH B . 
T 4 HOH 67  2067 2067 HOH HOH B . 
T 4 HOH 68  2068 2068 HOH HOH B . 
T 4 HOH 69  2069 2069 HOH HOH B . 
T 4 HOH 70  2070 2070 HOH HOH B . 
T 4 HOH 71  2071 2071 HOH HOH B . 
T 4 HOH 72  2072 2072 HOH HOH B . 
T 4 HOH 73  2073 2073 HOH HOH B . 
T 4 HOH 74  2074 2074 HOH HOH B . 
T 4 HOH 75  2075 2075 HOH HOH B . 
T 4 HOH 76  2076 2076 HOH HOH B . 
T 4 HOH 77  2077 2077 HOH HOH B . 
T 4 HOH 78  2078 2078 HOH HOH B . 
T 4 HOH 79  2079 2079 HOH HOH B . 
T 4 HOH 80  2080 2080 HOH HOH B . 
T 4 HOH 81  2081 2081 HOH HOH B . 
T 4 HOH 82  2082 2082 HOH HOH B . 
T 4 HOH 83  2083 2083 HOH HOH B . 
T 4 HOH 84  2084 2084 HOH HOH B . 
T 4 HOH 85  2085 2085 HOH HOH B . 
T 4 HOH 86  2086 2086 HOH HOH B . 
T 4 HOH 87  2087 2087 HOH HOH B . 
T 4 HOH 88  2088 2088 HOH HOH B . 
T 4 HOH 89  2089 2089 HOH HOH B . 
T 4 HOH 90  2090 2090 HOH HOH B . 
T 4 HOH 91  2091 2091 HOH HOH B . 
T 4 HOH 92  2092 2092 HOH HOH B . 
T 4 HOH 93  2093 2093 HOH HOH B . 
T 4 HOH 94  2094 2094 HOH HOH B . 
T 4 HOH 95  2095 2095 HOH HOH B . 
T 4 HOH 96  2096 2096 HOH HOH B . 
T 4 HOH 97  2097 2097 HOH HOH B . 
T 4 HOH 98  2098 2098 HOH HOH B . 
T 4 HOH 99  2099 2099 HOH HOH B . 
T 4 HOH 100 2100 2100 HOH HOH B . 
T 4 HOH 101 2101 2101 HOH HOH B . 
T 4 HOH 102 2102 2102 HOH HOH B . 
T 4 HOH 103 2103 2103 HOH HOH B . 
T 4 HOH 104 2104 2104 HOH HOH B . 
U 4 HOH 1   2001 2001 HOH HOH C . 
U 4 HOH 2   2002 2002 HOH HOH C . 
U 4 HOH 3   2003 2003 HOH HOH C . 
U 4 HOH 4   2004 2004 HOH HOH C . 
U 4 HOH 5   2005 2005 HOH HOH C . 
U 4 HOH 6   2006 2006 HOH HOH C . 
U 4 HOH 7   2007 2007 HOH HOH C . 
U 4 HOH 8   2008 2008 HOH HOH C . 
U 4 HOH 9   2009 2009 HOH HOH C . 
U 4 HOH 10  2010 2010 HOH HOH C . 
U 4 HOH 11  2011 2011 HOH HOH C . 
U 4 HOH 12  2012 2012 HOH HOH C . 
U 4 HOH 13  2013 2013 HOH HOH C . 
U 4 HOH 14  2014 2014 HOH HOH C . 
U 4 HOH 15  2015 2015 HOH HOH C . 
U 4 HOH 16  2016 2016 HOH HOH C . 
U 4 HOH 17  2017 2017 HOH HOH C . 
U 4 HOH 18  2018 2018 HOH HOH C . 
U 4 HOH 19  2019 2019 HOH HOH C . 
U 4 HOH 20  2020 2020 HOH HOH C . 
U 4 HOH 21  2021 2021 HOH HOH C . 
U 4 HOH 22  2022 2022 HOH HOH C . 
U 4 HOH 23  2023 2023 HOH HOH C . 
U 4 HOH 24  2024 2024 HOH HOH C . 
U 4 HOH 25  2025 2025 HOH HOH C . 
U 4 HOH 26  2026 2026 HOH HOH C . 
U 4 HOH 27  2027 2027 HOH HOH C . 
U 4 HOH 28  2028 2028 HOH HOH C . 
U 4 HOH 29  2029 2029 HOH HOH C . 
U 4 HOH 30  2030 2030 HOH HOH C . 
U 4 HOH 31  2031 2031 HOH HOH C . 
U 4 HOH 32  2032 2032 HOH HOH C . 
U 4 HOH 33  2033 2033 HOH HOH C . 
U 4 HOH 34  2034 2034 HOH HOH C . 
U 4 HOH 35  2035 2035 HOH HOH C . 
U 4 HOH 36  2036 2036 HOH HOH C . 
U 4 HOH 37  2037 2037 HOH HOH C . 
U 4 HOH 38  2038 2038 HOH HOH C . 
U 4 HOH 39  2039 2039 HOH HOH C . 
U 4 HOH 40  2040 2040 HOH HOH C . 
U 4 HOH 41  2041 2041 HOH HOH C . 
U 4 HOH 42  2042 2042 HOH HOH C . 
U 4 HOH 43  2043 2043 HOH HOH C . 
U 4 HOH 44  2044 2044 HOH HOH C . 
U 4 HOH 45  2045 2045 HOH HOH C . 
U 4 HOH 46  2046 2046 HOH HOH C . 
U 4 HOH 47  2047 2047 HOH HOH C . 
U 4 HOH 48  2048 2048 HOH HOH C . 
U 4 HOH 49  2049 2049 HOH HOH C . 
U 4 HOH 50  2050 2050 HOH HOH C . 
U 4 HOH 51  2051 2051 HOH HOH C . 
U 4 HOH 52  2052 2052 HOH HOH C . 
U 4 HOH 53  2053 2053 HOH HOH C . 
U 4 HOH 54  2054 2054 HOH HOH C . 
U 4 HOH 55  2055 2055 HOH HOH C . 
U 4 HOH 56  2056 2056 HOH HOH C . 
U 4 HOH 57  2057 2057 HOH HOH C . 
U 4 HOH 58  2058 2058 HOH HOH C . 
U 4 HOH 59  2059 2059 HOH HOH C . 
U 4 HOH 60  2060 2060 HOH HOH C . 
U 4 HOH 61  2061 2061 HOH HOH C . 
U 4 HOH 62  2062 2062 HOH HOH C . 
U 4 HOH 63  2063 2063 HOH HOH C . 
U 4 HOH 64  2064 2064 HOH HOH C . 
U 4 HOH 65  2065 2065 HOH HOH C . 
U 4 HOH 66  2066 2066 HOH HOH C . 
U 4 HOH 67  2067 2067 HOH HOH C . 
U 4 HOH 68  2068 2068 HOH HOH C . 
U 4 HOH 69  2069 2069 HOH HOH C . 
U 4 HOH 70  2070 2070 HOH HOH C . 
U 4 HOH 71  2071 2071 HOH HOH C . 
U 4 HOH 72  2072 2072 HOH HOH C . 
U 4 HOH 73  2073 2073 HOH HOH C . 
U 4 HOH 74  2074 2074 HOH HOH C . 
U 4 HOH 75  2075 2075 HOH HOH C . 
U 4 HOH 76  2076 2076 HOH HOH C . 
U 4 HOH 77  2077 2077 HOH HOH C . 
U 4 HOH 78  2078 2078 HOH HOH C . 
U 4 HOH 79  2079 2079 HOH HOH C . 
U 4 HOH 80  2080 2080 HOH HOH C . 
U 4 HOH 81  2081 2081 HOH HOH C . 
U 4 HOH 82  2082 2082 HOH HOH C . 
U 4 HOH 83  2083 2083 HOH HOH C . 
U 4 HOH 84  2084 2084 HOH HOH C . 
U 4 HOH 85  2085 2085 HOH HOH C . 
U 4 HOH 86  2086 2086 HOH HOH C . 
U 4 HOH 87  2087 2087 HOH HOH C . 
U 4 HOH 88  2088 2088 HOH HOH C . 
U 4 HOH 89  2089 2089 HOH HOH C . 
U 4 HOH 90  2090 2090 HOH HOH C . 
U 4 HOH 91  2091 2091 HOH HOH C . 
U 4 HOH 92  2092 2092 HOH HOH C . 
U 4 HOH 93  2093 2093 HOH HOH C . 
U 4 HOH 94  2094 2094 HOH HOH C . 
U 4 HOH 95  2095 2095 HOH HOH C . 
U 4 HOH 96  2096 2096 HOH HOH C . 
U 4 HOH 97  2097 2097 HOH HOH C . 
U 4 HOH 98  2098 2098 HOH HOH C . 
U 4 HOH 99  2099 2099 HOH HOH C . 
U 4 HOH 100 2100 2100 HOH HOH C . 
U 4 HOH 101 2101 2101 HOH HOH C . 
U 4 HOH 102 2102 2102 HOH HOH C . 
U 4 HOH 103 2103 2103 HOH HOH C . 
U 4 HOH 104 2104 2104 HOH HOH C . 
U 4 HOH 105 2105 2105 HOH HOH C . 
U 4 HOH 106 2106 2106 HOH HOH C . 
U 4 HOH 107 2107 2107 HOH HOH C . 
U 4 HOH 108 2108 2108 HOH HOH C . 
U 4 HOH 109 2109 2109 HOH HOH C . 
U 4 HOH 110 2110 2110 HOH HOH C . 
U 4 HOH 111 2111 2111 HOH HOH C . 
U 4 HOH 112 2112 2112 HOH HOH C . 
U 4 HOH 113 2113 2113 HOH HOH C . 
U 4 HOH 114 2114 2114 HOH HOH C . 
U 4 HOH 115 2115 2115 HOH HOH C . 
U 4 HOH 116 2116 2116 HOH HOH C . 
U 4 HOH 117 2117 2117 HOH HOH C . 
U 4 HOH 118 2118 2118 HOH HOH C . 
U 4 HOH 119 2119 2119 HOH HOH C . 
U 4 HOH 120 2120 2120 HOH HOH C . 
U 4 HOH 121 2121 2121 HOH HOH C . 
U 4 HOH 122 2122 2122 HOH HOH C . 
U 4 HOH 123 2123 2123 HOH HOH C . 
U 4 HOH 124 2124 2124 HOH HOH C . 
V 4 HOH 1   2001 2001 HOH HOH D . 
V 4 HOH 2   2002 2002 HOH HOH D . 
V 4 HOH 3   2003 2003 HOH HOH D . 
V 4 HOH 4   2004 2004 HOH HOH D . 
V 4 HOH 5   2005 2005 HOH HOH D . 
V 4 HOH 6   2006 2006 HOH HOH D . 
V 4 HOH 7   2007 2007 HOH HOH D . 
V 4 HOH 8   2008 2008 HOH HOH D . 
V 4 HOH 9   2009 2009 HOH HOH D . 
V 4 HOH 10  2010 2010 HOH HOH D . 
V 4 HOH 11  2011 2011 HOH HOH D . 
V 4 HOH 12  2012 2012 HOH HOH D . 
V 4 HOH 13  2013 2013 HOH HOH D . 
V 4 HOH 14  2014 2014 HOH HOH D . 
V 4 HOH 15  2015 2015 HOH HOH D . 
V 4 HOH 16  2016 2016 HOH HOH D . 
V 4 HOH 17  2017 2017 HOH HOH D . 
V 4 HOH 18  2018 2018 HOH HOH D . 
V 4 HOH 19  2019 2019 HOH HOH D . 
V 4 HOH 20  2020 2020 HOH HOH D . 
V 4 HOH 21  2021 2021 HOH HOH D . 
V 4 HOH 22  2022 2022 HOH HOH D . 
V 4 HOH 23  2023 2023 HOH HOH D . 
V 4 HOH 24  2024 2024 HOH HOH D . 
V 4 HOH 25  2025 2025 HOH HOH D . 
V 4 HOH 26  2026 2026 HOH HOH D . 
V 4 HOH 27  2027 2027 HOH HOH D . 
V 4 HOH 28  2028 2028 HOH HOH D . 
V 4 HOH 29  2029 2029 HOH HOH D . 
V 4 HOH 30  2030 2030 HOH HOH D . 
V 4 HOH 31  2031 2031 HOH HOH D . 
V 4 HOH 32  2032 2032 HOH HOH D . 
V 4 HOH 33  2033 2033 HOH HOH D . 
V 4 HOH 34  2034 2034 HOH HOH D . 
V 4 HOH 35  2035 2035 HOH HOH D . 
V 4 HOH 36  2036 2036 HOH HOH D . 
V 4 HOH 37  2037 2037 HOH HOH D . 
V 4 HOH 38  2038 2038 HOH HOH D . 
V 4 HOH 39  2039 2039 HOH HOH D . 
V 4 HOH 40  2040 2040 HOH HOH D . 
V 4 HOH 41  2041 2041 HOH HOH D . 
V 4 HOH 42  2042 2042 HOH HOH D . 
V 4 HOH 43  2043 2043 HOH HOH D . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1  A ASN 16 A ASN 16 ? ASN 'GLYCOSYLATION SITE' 
2  A ASN 32 A ASN 32 ? ASN 'GLYCOSYLATION SITE' 
3  A ASN 55 A ASN 55 ? ASN 'GLYCOSYLATION SITE' 
4  A ASN 93 A ASN 93 ? ASN 'GLYCOSYLATION SITE' 
5  B ASN 16 B ASN 16 ? ASN 'GLYCOSYLATION SITE' 
6  B ASN 93 B ASN 93 ? ASN 'GLYCOSYLATION SITE' 
7  C ASN 16 C ASN 16 ? ASN 'GLYCOSYLATION SITE' 
8  C ASN 32 C ASN 32 ? ASN 'GLYCOSYLATION SITE' 
9  C ASN 55 C ASN 55 ? ASN 'GLYCOSYLATION SITE' 
10 C ASN 93 C ASN 93 ? ASN 'GLYCOSYLATION SITE' 
11 D ASN 16 D ASN 16 ? ASN 'GLYCOSYLATION SITE' 
12 D ASN 32 D ASN 32 ? ASN 'GLYCOSYLATION SITE' 
13 A PCA 1  A PCA 1  ? GLU 'PYROGLUTAMIC ACID'  
14 B PCA 1  B PCA 1  ? GLU 'PYROGLUTAMIC ACID'  
15 C PCA 1  C PCA 1  ? GLU 'PYROGLUTAMIC ACID'  
16 D PCA 1  D PCA 1  ? GLU 'PYROGLUTAMIC ACID'  
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS dimeric 2 
2 author_and_software_defined_assembly PQS dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,G,H,I,J,K,S,T 
2 1 C,D,L,M,N,O,P,Q,R,U,V 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5900  ? 
1 MORE         -34.8 ? 
1 'SSA (A^2)'  15350 ? 
2 'ABSA (A^2)' 6270  ? 
2 MORE         -33.3 ? 
2 'SSA (A^2)'  15230 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     2037 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   S 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O ? S HOH . ? A HOH 2077 ? 1_555 MG ? I MG . ? A MG 1120 ? 1_555 O ? S HOH . ? A HOH 2078 ? 1_555 175.9 ? 
2  O ? S HOH . ? A HOH 2077 ? 1_555 MG ? I MG . ? A MG 1120 ? 1_555 O ? S HOH . ? A HOH 2079 ? 1_555 87.5  ? 
3  O ? S HOH . ? A HOH 2078 ? 1_555 MG ? I MG . ? A MG 1120 ? 1_555 O ? S HOH . ? A HOH 2079 ? 1_555 93.1  ? 
4  O ? S HOH . ? A HOH 2077 ? 1_555 MG ? I MG . ? A MG 1120 ? 1_555 O ? S HOH . ? A HOH 2080 ? 1_555 93.5  ? 
5  O ? S HOH . ? A HOH 2078 ? 1_555 MG ? I MG . ? A MG 1120 ? 1_555 O ? S HOH . ? A HOH 2080 ? 1_555 90.5  ? 
6  O ? S HOH . ? A HOH 2079 ? 1_555 MG ? I MG . ? A MG 1120 ? 1_555 O ? S HOH . ? A HOH 2080 ? 1_555 88.4  ? 
7  O ? S HOH . ? A HOH 2077 ? 1_555 MG ? I MG . ? A MG 1120 ? 1_555 O ? S HOH . ? A HOH 2081 ? 1_555 90.2  ? 
8  O ? S HOH . ? A HOH 2078 ? 1_555 MG ? I MG . ? A MG 1120 ? 1_555 O ? S HOH . ? A HOH 2081 ? 1_555 85.7  ? 
9  O ? S HOH . ? A HOH 2079 ? 1_555 MG ? I MG . ? A MG 1120 ? 1_555 O ? S HOH . ? A HOH 2081 ? 1_555 92.1  ? 
10 O ? S HOH . ? A HOH 2080 ? 1_555 MG ? I MG . ? A MG 1120 ? 1_555 O ? S HOH . ? A HOH 2081 ? 1_555 176.2 ? 
11 O ? S HOH . ? A HOH 2077 ? 1_555 MG ? I MG . ? A MG 1120 ? 1_555 O ? S HOH . ? A HOH 2082 ? 1_555 92.1  ? 
12 O ? S HOH . ? A HOH 2078 ? 1_555 MG ? I MG . ? A MG 1120 ? 1_555 O ? S HOH . ? A HOH 2082 ? 1_555 87.6  ? 
13 O ? S HOH . ? A HOH 2079 ? 1_555 MG ? I MG . ? A MG 1120 ? 1_555 O ? S HOH . ? A HOH 2082 ? 1_555 175.9 ? 
14 O ? S HOH . ? A HOH 2080 ? 1_555 MG ? I MG . ? A MG 1120 ? 1_555 O ? S HOH . ? A HOH 2082 ? 1_555 87.5  ? 
15 O ? S HOH . ? A HOH 2081 ? 1_555 MG ? I MG . ? A MG 1120 ? 1_555 O ? S HOH . ? A HOH 2082 ? 1_555 92.0  ? 
16 O ? U HOH . ? C HOH 2119 ? 1_555 MG ? P MG . ? C MG 1120 ? 1_555 O ? U HOH . ? C HOH 2120 ? 1_555 178.3 ? 
17 O ? U HOH . ? C HOH 2119 ? 1_555 MG ? P MG . ? C MG 1120 ? 1_555 O ? U HOH . ? C HOH 2121 ? 1_555 87.5  ? 
18 O ? U HOH . ? C HOH 2120 ? 1_555 MG ? P MG . ? C MG 1120 ? 1_555 O ? U HOH . ? C HOH 2121 ? 1_555 93.4  ? 
19 O ? U HOH . ? C HOH 2119 ? 1_555 MG ? P MG . ? C MG 1120 ? 1_555 O ? U HOH . ? C HOH 2122 ? 1_555 91.3  ? 
20 O ? U HOH . ? C HOH 2120 ? 1_555 MG ? P MG . ? C MG 1120 ? 1_555 O ? U HOH . ? C HOH 2122 ? 1_555 87.2  ? 
21 O ? U HOH . ? C HOH 2121 ? 1_555 MG ? P MG . ? C MG 1120 ? 1_555 O ? U HOH . ? C HOH 2122 ? 1_555 90.5  ? 
22 O ? U HOH . ? C HOH 2119 ? 1_555 MG ? P MG . ? C MG 1120 ? 1_555 O ? U HOH . ? C HOH 2123 ? 1_555 90.7  ? 
23 O ? U HOH . ? C HOH 2120 ? 1_555 MG ? P MG . ? C MG 1120 ? 1_555 O ? U HOH . ? C HOH 2123 ? 1_555 90.8  ? 
24 O ? U HOH . ? C HOH 2121 ? 1_555 MG ? P MG . ? C MG 1120 ? 1_555 O ? U HOH . ? C HOH 2123 ? 1_555 87.9  ? 
25 O ? U HOH . ? C HOH 2122 ? 1_555 MG ? P MG . ? C MG 1120 ? 1_555 O ? U HOH . ? C HOH 2123 ? 1_555 177.4 ? 
26 O ? U HOH . ? C HOH 2119 ? 1_555 MG ? P MG . ? C MG 1120 ? 1_555 O ? U HOH . ? C HOH 2124 ? 1_555 87.5  ? 
27 O ? U HOH . ? C HOH 2120 ? 1_555 MG ? P MG . ? C MG 1120 ? 1_555 O ? U HOH . ? C HOH 2124 ? 1_555 91.6  ? 
28 O ? U HOH . ? C HOH 2121 ? 1_555 MG ? P MG . ? C MG 1120 ? 1_555 O ? U HOH . ? C HOH 2124 ? 1_555 175.0 ? 
29 O ? U HOH . ? C HOH 2122 ? 1_555 MG ? P MG . ? C MG 1120 ? 1_555 O ? U HOH . ? C HOH 2124 ? 1_555 89.9  ? 
30 O ? U HOH . ? C HOH 2123 ? 1_555 MG ? P MG . ? C MG 1120 ? 1_555 O ? U HOH . ? C HOH 2124 ? 1_555 91.9  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-08-12 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-04-03 
5 'Structure model' 2 0 2020-03-11 
6 'Structure model' 2 1 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 6 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Version format compliance' 
3  4 'Structure model' 'Data collection'           
4  4 'Structure model' 'Derived calculations'      
5  4 'Structure model' Other                       
6  4 'Structure model' 'Source and taxonomy'       
7  5 'Structure model' 'Data collection'           
8  5 'Structure model' Other                       
9  5 'Structure model' 'Polymer sequence'          
10 6 'Structure model' 'Data collection'           
11 6 'Structure model' 'Derived calculations'      
12 6 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' entity_src_gen            
2  4 'Structure model' pdbx_database_proc        
3  4 'Structure model' pdbx_database_status      
4  4 'Structure model' struct_conn               
5  5 'Structure model' chem_comp                 
6  5 'Structure model' entity_poly               
7  5 'Structure model' pdbx_database_status      
8  6 'Structure model' chem_comp                 
9  6 'Structure model' entity                    
10 6 'Structure model' pdbx_chem_comp_identifier 
11 6 'Structure model' pdbx_entity_nonpoly       
12 6 'Structure model' pdbx_struct_conn_angle    
13 6 'Structure model' struct_conn               
14 6 'Structure model' struct_site               
15 6 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_entity_src_gen.pdbx_host_org_cell_line'     
2  4 'Structure model' '_pdbx_database_status.recvd_author_approval' 
3  4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
4  5 'Structure model' '_chem_comp.type'                             
5  5 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can'   
6  5 'Structure model' '_pdbx_database_status.status_code_sf'        
7  6 'Structure model' '_chem_comp.name'                             
8  6 'Structure model' '_entity.pdbx_description'                    
9  6 'Structure model' '_pdbx_entity_nonpoly.name'                   
10 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
11 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
12 6 'Structure model' '_pdbx_struct_conn_angle.value'               
13 6 'Structure model' '_struct_conn.conn_type_id'                   
14 6 'Structure model' '_struct_conn.id'                             
15 6 'Structure model' '_struct_conn.pdbx_dist_value'                
16 6 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
17 6 'Structure model' '_struct_conn.pdbx_role'                      
18 6 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
19 6 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
20 6 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
21 6 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
22 6 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
23 6 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
24 6 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
25 6 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
26 6 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
27 6 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
28 6 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
29 6 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
30 6 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
31 6 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 5.3517  -36.9360 20.4823 -0.1980 -0.1319 -0.0712 -0.0630 0.0384  -0.0633 7.3743  3.6883  2.6814  
1.8284   0.4405  0.9978   -0.0172 0.1094  -0.5437 0.0634  -0.0433 0.0915  0.1989  -0.2981 0.0605  
'X-RAY DIFFRACTION' 2 ? refined 26.3216 -7.5475  41.2028 0.1369  -0.1832 -0.1737 -0.1732 0.0352  0.0199  14.8474 23.2528 9.1519  
17.4682  10.2800 14.4387  0.6887  -0.6872 0.5712  1.5321  -0.9897 0.6256  0.5558  -0.5237 0.3010  
'X-RAY DIFFRACTION' 3 ? refined 30.4424 -8.3877  34.3321 -0.1206 -0.2026 -0.1667 -0.0652 -0.0179 0.0042  2.3665  6.1029  2.4037  
2.1208   0.8551  0.8227   0.1638  -0.1475 -0.0388 0.4664  -0.2482 -0.1528 -0.1123 -0.1177 0.0844  
'X-RAY DIFFRACTION' 4 ? refined 8.2322  -36.8520 12.5952 -0.2332 -0.0132 -0.0672 -0.0801 0.0906  -0.1600 14.4008 21.4441 10.5476 
15.2660  10.8060 12.8670  -0.1032 0.7086  -0.6953 -0.4737 0.2510  -0.1347 0.0499  -0.0077 -0.1478 
'X-RAY DIFFRACTION' 5 ? refined 42.1736 0.6398   14.0996 -0.1704 -0.2042 -0.1882 0.0344  0.0214  0.0108  4.3001  4.2933  1.7118  
-1.6607  0.2255  -0.6805  0.1450  0.1344  0.0503  -0.0431 -0.0968 -0.0690 0.0108  0.0567  -0.0482 
'X-RAY DIFFRACTION' 6 ? refined 15.7436 31.1458  3.9436  0.1111  0.0344  -0.1419 0.2551  0.0094  0.0304  16.7554 23.0595 5.9056  
-18.2883 7.9958  -11.1822 -0.5244 -0.4559 0.0653  0.7686  0.7445  0.5412  -0.7255 -0.7020 -0.2201 
'X-RAY DIFFRACTION' 7 ? refined 19.4941 28.6316  -2.6344 0.0732  0.2197  -0.1474 0.2405  0.0152  0.0667  9.9259  10.5664 3.6604  
-8.2921  3.4921  -5.2178  0.5960  1.3724  0.0928  -0.6637 -0.5994 0.1420  -0.0342 -0.0314 0.0034  
'X-RAY DIFFRACTION' 8 ? refined 44.0700 3.7364   5.5193  -0.1141 -0.1402 -0.1127 0.0595  0.0636  0.0594  15.8131 21.1371 4.1742  
-18.0176 5.8780  -7.1184  0.3104  0.7379  0.8698  -0.4489 -0.6610 -1.0930 -0.0789 0.1259  0.3506  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1 A 1    ? ? A 100  ? ? ? ? 
'X-RAY DIFFRACTION' 2  1 A 1001 ? ? A 1100 ? ? ? ? 
'X-RAY DIFFRACTION' 3  2 A 101  ? ? A 120  ? ? ? ? 
'X-RAY DIFFRACTION' 4  3 B 1    ? ? B 100  ? ? ? ? 
'X-RAY DIFFRACTION' 5  3 B 1000 ? ? B 1100 ? ? ? ? 
'X-RAY DIFFRACTION' 6  4 B 101  ? ? B 120  ? ? ? ? 
'X-RAY DIFFRACTION' 7  5 C 1    ? ? C 100  ? ? ? ? 
'X-RAY DIFFRACTION' 8  5 C 1000 ? ? C 1100 ? ? ? ? 
'X-RAY DIFFRACTION' 9  6 C 101  ? ? C 120  ? ? ? ? 
'X-RAY DIFFRACTION' 10 7 D 1    ? ? D 100  ? ? ? ? 
'X-RAY DIFFRACTION' 11 8 D 101  ? ? D 120  ? ? ? ? 
'X-RAY DIFFRACTION' 12 8 D 1000 ? ? D 1100 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0019 ? 1 
MOSFLM 'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
MOLREP phasing          .        ? 4 
# 
_pdbx_database_remark.id     650 
_pdbx_database_remark.text   
;
HELIX
DETERMINATION METHOD: AUTHOR PROVIDED.
;
# 
_pdbx_entry_details.entry_id                 2VSC 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         
;RESIDUE NUMBERING IS FOR MATURE PROTEIN (LACKING N-
TERMINAL 18 AMINO ACID SIGNAL SEQUENCE).  RESIDUE 1 (GLN)
CYCLISES TO FORM A PYROGLUTAMIC ACID.  RESIDUE 15 WAS
MUTATED FROM CYS TO GLY.
;
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            D 
_pdbx_validate_rmsd_bond.auth_comp_id_1            SER 
_pdbx_validate_rmsd_bond.auth_seq_id_1             85 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            D 
_pdbx_validate_rmsd_bond.auth_comp_id_2            SER 
_pdbx_validate_rmsd_bond.auth_seq_id_2             85 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.593 
_pdbx_validate_rmsd_bond.bond_target_value         1.418 
_pdbx_validate_rmsd_bond.bond_deviation            0.175 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.013 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             C 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              103 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             C 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              103 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             C 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              103 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                117.14 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            -3.16 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER B 71 ? ? -59.86  -9.69 
2 1 ASN D 55 ? ? 38.62   49.09 
3 1 PHE D 63 ? ? -110.52 67.27 
4 1 HIS D 90 ? ? -141.73 49.55 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2008 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.39 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A VAL 116 ? A VAL 116 
2  1 Y 1 A SER 117 ? A SER 117 
3  1 Y 1 A TRP 118 ? A TRP 118 
4  1 Y 1 A SER 119 ? A SER 119 
5  1 Y 1 A THR 120 ? A THR 120 
6  1 Y 1 A ARG 121 ? A ARG 121 
7  1 Y 1 A HIS 122 ? A HIS 122 
8  1 Y 1 A HIS 123 ? A HIS 123 
9  1 Y 1 A HIS 124 ? A HIS 124 
10 1 Y 1 A HIS 125 ? A HIS 125 
11 1 Y 1 A HIS 126 ? A HIS 126 
12 1 Y 1 A HIS 127 ? A HIS 127 
13 1 Y 1 B VAL 116 ? B VAL 116 
14 1 Y 1 B SER 117 ? B SER 117 
15 1 Y 1 B TRP 118 ? B TRP 118 
16 1 Y 1 B SER 119 ? B SER 119 
17 1 Y 1 B THR 120 ? B THR 120 
18 1 Y 1 B ARG 121 ? B ARG 121 
19 1 Y 1 B HIS 122 ? B HIS 122 
20 1 Y 1 B HIS 123 ? B HIS 123 
21 1 Y 1 B HIS 124 ? B HIS 124 
22 1 Y 1 B HIS 125 ? B HIS 125 
23 1 Y 1 B HIS 126 ? B HIS 126 
24 1 Y 1 B HIS 127 ? B HIS 127 
25 1 Y 1 C VAL 116 ? C VAL 116 
26 1 Y 1 C SER 117 ? C SER 117 
27 1 Y 1 C TRP 118 ? C TRP 118 
28 1 Y 1 C SER 119 ? C SER 119 
29 1 Y 1 C THR 120 ? C THR 120 
30 1 Y 1 C ARG 121 ? C ARG 121 
31 1 Y 1 C HIS 122 ? C HIS 122 
32 1 Y 1 C HIS 123 ? C HIS 123 
33 1 Y 1 C HIS 124 ? C HIS 124 
34 1 Y 1 C HIS 125 ? C HIS 125 
35 1 Y 1 C HIS 126 ? C HIS 126 
36 1 Y 1 C HIS 127 ? C HIS 127 
37 1 Y 1 D SER 117 ? D SER 117 
38 1 Y 1 D TRP 118 ? D TRP 118 
39 1 Y 1 D SER 119 ? D SER 119 
40 1 Y 1 D THR 120 ? D THR 120 
41 1 Y 1 D ARG 121 ? D ARG 121 
42 1 Y 1 D HIS 122 ? D HIS 122 
43 1 Y 1 D HIS 123 ? D HIS 123 
44 1 Y 1 D HIS 124 ? D HIS 124 
45 1 Y 1 D HIS 125 ? D HIS 125 
46 1 Y 1 D HIS 126 ? D HIS 126 
47 1 Y 1 D HIS 127 ? D HIS 127 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
3 'MAGNESIUM ION'                          MG  
4 water                                    HOH 
#