data_2VWJ
# 
_entry.id   2VWJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2VWJ         
PDBE  EBI-36691    
WWPDB D_1290036691 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1WN7 unspecified 'CRYSTAL STRUCTURE OF ARCHAEAL FAMILY B DNA POLYMERASE MUTANT'                                              
PDB 1TGO unspecified 'THERMOSTABLE B TYPE DEOXYRIBONUCLEIC ACID POLYMERASE FROM THERMOCOCCUS GORGONARIUS'                        
PDB 2VWK unspecified 'URACIL RECOGNITION IN ARCHAEAL DNA POLYMERASES CAPTURED BY X-RAY CRYSTALLOGRAPHY. V93Q POLYMERASE VARIANT' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2VWJ 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2008-06-25 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Firbank, S.J.'  1 
'Wardle, J.'     2 
'Heslop, P.'     3 
'Lewis, R.J.'    4 
'Connolly, B.A.' 5 
# 
_citation.id                        primary 
_citation.title                     'Uracil Recognition in Archaeal DNA Polymerases Captured by X-Ray Crystallography.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            381 
_citation.page_first                529 
_citation.page_last                 ? 
_citation.year                      2008 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18614176 
_citation.pdbx_database_id_DOI      10.1016/J.JMB.2008.06.004 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Firbank, S.J.'  1 
primary 'Wardle, J.'     2 
primary 'Heslop, P.'     3 
primary 'Lewis, R.J.'    4 
primary 'Connolly, B.A.' 5 
# 
_cell.entry_id           2VWJ 
_cell.length_a           100.700 
_cell.length_b           161.910 
_cell.length_c           221.820 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2VWJ 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA POLYMERASE'                                                                    89936.305 1 2.7.7.7 YES ? ? 
2 polymer     syn 
;5'-D(*AP*AP*UP*GP*GP*AP*GP*AP*CP*GP *GP*CP*TP*TP*TP*TP*GP*CP*CP*GP*TP*GP*TP*C)-3'
;
8005.138  1 ?       ?   ? ? 
3 non-polymer syn 'POTASSIUM ION'                                                                     39.098    3 ?       ?   ? ? 
4 water       nat water                                                                               18.015    1 ?       ?   ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'TGO POLYMERASE DNA COMPLEX, TO POL' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MILDTDYITEDGKPVIRIFKKENGEFKIDYDRNFEPYIYALLKDDSAIEDVKKITAERHGTTVRVVRAEKVKKKFLGRPI
EVWKLYFTHPQDVPAIRDKIKEHPAVVDIYEYDIPFAKRYLIDKGLIPMEGDEELKMLAFDIETLYHEGEKFAEGPILMI
SYADEEGARVITWRNIDLPYVDVVSTEKEMIKRFLKVVKEKDPDVLITYNGDNFAFAYLKKRSEKLGVKFILGREGSEPK
IQRMGDRFAVEVKGRIHFDLYPVIRRTINLPTYTLEAVYEAIFGQPKEKVYAEEIAQAWETGEGLERVARYSMEDAKVTY
ELGKEFFPMEAQLSRLVGQSLWDVSRSSTGNLVEWFLLRKAYERNELAPNKPDERELARRRESYAGGYVKEPERGLWENI
VYLDFRSLYPSIIITHNVSPDTLNREGCEEYDVAPQVGHKFCKDFPGFIPSLLGDLLEERQKVKKKMKATIDPIEKKLLD
YRQRAIKILANSFYGYYGYAKARWYCKECAESVTAWGRQYIETTIREIEEKFGFKVLYADTDGFFATIPGADAETVKKKA
KEFLDYINAKLPGLLELEYEGFYKRGFFVTKKKYAVIDEEDKITTRGLEIVRRDWSEIAKETQARVLEAILKHGDVEEAV
RIVKEVTEKLSKYEVPPEKLVIYEQITRDLKDYKATGPHVAVAKRLAARGIKIRPGTVISYIVLKGSGRIGDRAIPFDEF
DPAKHKYDAEYYIENQVLPAVERILRAFGYRKEDLRYQKTRQVGLGAWLKPKT
;
;MILDTDYITEDGKPVIRIFKKENGEFKIDYDRNFEPYIYALLKDDSAIEDVKKITAERHGTTVRVVRAEKVKKKFLGRPI
EVWKLYFTHPQDVPAIRDKIKEHPAVVDIYEYDIPFAKRYLIDKGLIPMEGDEELKMLAFDIETLYHEGEKFAEGPILMI
SYADEEGARVITWRNIDLPYVDVVSTEKEMIKRFLKVVKEKDPDVLITYNGDNFAFAYLKKRSEKLGVKFILGREGSEPK
IQRMGDRFAVEVKGRIHFDLYPVIRRTINLPTYTLEAVYEAIFGQPKEKVYAEEIAQAWETGEGLERVARYSMEDAKVTY
ELGKEFFPMEAQLSRLVGQSLWDVSRSSTGNLVEWFLLRKAYERNELAPNKPDERELARRRESYAGGYVKEPERGLWENI
VYLDFRSLYPSIIITHNVSPDTLNREGCEEYDVAPQVGHKFCKDFPGFIPSLLGDLLEERQKVKKKMKATIDPIEKKLLD
YRQRAIKILANSFYGYYGYAKARWYCKECAESVTAWGRQYIETTIREIEEKFGFKVLYADTDGFFATIPGADAETVKKKA
KEFLDYINAKLPGLLELEYEGFYKRGFFVTKKKYAVIDEEDKITTRGLEIVRRDWSEIAKETQARVLEAILKHGDVEEAV
RIVKEVTEKLSKYEVPPEKLVIYEQITRDLKDYKATGPHVAVAKRLAARGIKIRPGTVISYIVLKGSGRIGDRAIPFDEF
DPAKHKYDAEYYIENQVLPAVERILRAFGYRKEDLRYQKTRQVGLGAWLKPKT
;
A ? 
2 polydeoxyribonucleotide no no 
;(DA)(DA)(DU)(DG)(DG)(DA)(DG)(DA)(DC)(DA)(DC)(DG)(DG)(DC)(DT)(DT)(DT)(DT)(DG)(DC)
(DC)(DG)(DT)(DG)(DT)(DC)
;
AAUGGAGACACGGCTTTTGCCGTGTC B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ILE n 
1 3   LEU n 
1 4   ASP n 
1 5   THR n 
1 6   ASP n 
1 7   TYR n 
1 8   ILE n 
1 9   THR n 
1 10  GLU n 
1 11  ASP n 
1 12  GLY n 
1 13  LYS n 
1 14  PRO n 
1 15  VAL n 
1 16  ILE n 
1 17  ARG n 
1 18  ILE n 
1 19  PHE n 
1 20  LYS n 
1 21  LYS n 
1 22  GLU n 
1 23  ASN n 
1 24  GLY n 
1 25  GLU n 
1 26  PHE n 
1 27  LYS n 
1 28  ILE n 
1 29  ASP n 
1 30  TYR n 
1 31  ASP n 
1 32  ARG n 
1 33  ASN n 
1 34  PHE n 
1 35  GLU n 
1 36  PRO n 
1 37  TYR n 
1 38  ILE n 
1 39  TYR n 
1 40  ALA n 
1 41  LEU n 
1 42  LEU n 
1 43  LYS n 
1 44  ASP n 
1 45  ASP n 
1 46  SER n 
1 47  ALA n 
1 48  ILE n 
1 49  GLU n 
1 50  ASP n 
1 51  VAL n 
1 52  LYS n 
1 53  LYS n 
1 54  ILE n 
1 55  THR n 
1 56  ALA n 
1 57  GLU n 
1 58  ARG n 
1 59  HIS n 
1 60  GLY n 
1 61  THR n 
1 62  THR n 
1 63  VAL n 
1 64  ARG n 
1 65  VAL n 
1 66  VAL n 
1 67  ARG n 
1 68  ALA n 
1 69  GLU n 
1 70  LYS n 
1 71  VAL n 
1 72  LYS n 
1 73  LYS n 
1 74  LYS n 
1 75  PHE n 
1 76  LEU n 
1 77  GLY n 
1 78  ARG n 
1 79  PRO n 
1 80  ILE n 
1 81  GLU n 
1 82  VAL n 
1 83  TRP n 
1 84  LYS n 
1 85  LEU n 
1 86  TYR n 
1 87  PHE n 
1 88  THR n 
1 89  HIS n 
1 90  PRO n 
1 91  GLN n 
1 92  ASP n 
1 93  VAL n 
1 94  PRO n 
1 95  ALA n 
1 96  ILE n 
1 97  ARG n 
1 98  ASP n 
1 99  LYS n 
1 100 ILE n 
1 101 LYS n 
1 102 GLU n 
1 103 HIS n 
1 104 PRO n 
1 105 ALA n 
1 106 VAL n 
1 107 VAL n 
1 108 ASP n 
1 109 ILE n 
1 110 TYR n 
1 111 GLU n 
1 112 TYR n 
1 113 ASP n 
1 114 ILE n 
1 115 PRO n 
1 116 PHE n 
1 117 ALA n 
1 118 LYS n 
1 119 ARG n 
1 120 TYR n 
1 121 LEU n 
1 122 ILE n 
1 123 ASP n 
1 124 LYS n 
1 125 GLY n 
1 126 LEU n 
1 127 ILE n 
1 128 PRO n 
1 129 MET n 
1 130 GLU n 
1 131 GLY n 
1 132 ASP n 
1 133 GLU n 
1 134 GLU n 
1 135 LEU n 
1 136 LYS n 
1 137 MET n 
1 138 LEU n 
1 139 ALA n 
1 140 PHE n 
1 141 ASP n 
1 142 ILE n 
1 143 GLU n 
1 144 THR n 
1 145 LEU n 
1 146 TYR n 
1 147 HIS n 
1 148 GLU n 
1 149 GLY n 
1 150 GLU n 
1 151 LYS n 
1 152 PHE n 
1 153 ALA n 
1 154 GLU n 
1 155 GLY n 
1 156 PRO n 
1 157 ILE n 
1 158 LEU n 
1 159 MET n 
1 160 ILE n 
1 161 SER n 
1 162 TYR n 
1 163 ALA n 
1 164 ASP n 
1 165 GLU n 
1 166 GLU n 
1 167 GLY n 
1 168 ALA n 
1 169 ARG n 
1 170 VAL n 
1 171 ILE n 
1 172 THR n 
1 173 TRP n 
1 174 ARG n 
1 175 ASN n 
1 176 ILE n 
1 177 ASP n 
1 178 LEU n 
1 179 PRO n 
1 180 TYR n 
1 181 VAL n 
1 182 ASP n 
1 183 VAL n 
1 184 VAL n 
1 185 SER n 
1 186 THR n 
1 187 GLU n 
1 188 LYS n 
1 189 GLU n 
1 190 MET n 
1 191 ILE n 
1 192 LYS n 
1 193 ARG n 
1 194 PHE n 
1 195 LEU n 
1 196 LYS n 
1 197 VAL n 
1 198 VAL n 
1 199 LYS n 
1 200 GLU n 
1 201 LYS n 
1 202 ASP n 
1 203 PRO n 
1 204 ASP n 
1 205 VAL n 
1 206 LEU n 
1 207 ILE n 
1 208 THR n 
1 209 TYR n 
1 210 ASN n 
1 211 GLY n 
1 212 ASP n 
1 213 ASN n 
1 214 PHE n 
1 215 ALA n 
1 216 PHE n 
1 217 ALA n 
1 218 TYR n 
1 219 LEU n 
1 220 LYS n 
1 221 LYS n 
1 222 ARG n 
1 223 SER n 
1 224 GLU n 
1 225 LYS n 
1 226 LEU n 
1 227 GLY n 
1 228 VAL n 
1 229 LYS n 
1 230 PHE n 
1 231 ILE n 
1 232 LEU n 
1 233 GLY n 
1 234 ARG n 
1 235 GLU n 
1 236 GLY n 
1 237 SER n 
1 238 GLU n 
1 239 PRO n 
1 240 LYS n 
1 241 ILE n 
1 242 GLN n 
1 243 ARG n 
1 244 MET n 
1 245 GLY n 
1 246 ASP n 
1 247 ARG n 
1 248 PHE n 
1 249 ALA n 
1 250 VAL n 
1 251 GLU n 
1 252 VAL n 
1 253 LYS n 
1 254 GLY n 
1 255 ARG n 
1 256 ILE n 
1 257 HIS n 
1 258 PHE n 
1 259 ASP n 
1 260 LEU n 
1 261 TYR n 
1 262 PRO n 
1 263 VAL n 
1 264 ILE n 
1 265 ARG n 
1 266 ARG n 
1 267 THR n 
1 268 ILE n 
1 269 ASN n 
1 270 LEU n 
1 271 PRO n 
1 272 THR n 
1 273 TYR n 
1 274 THR n 
1 275 LEU n 
1 276 GLU n 
1 277 ALA n 
1 278 VAL n 
1 279 TYR n 
1 280 GLU n 
1 281 ALA n 
1 282 ILE n 
1 283 PHE n 
1 284 GLY n 
1 285 GLN n 
1 286 PRO n 
1 287 LYS n 
1 288 GLU n 
1 289 LYS n 
1 290 VAL n 
1 291 TYR n 
1 292 ALA n 
1 293 GLU n 
1 294 GLU n 
1 295 ILE n 
1 296 ALA n 
1 297 GLN n 
1 298 ALA n 
1 299 TRP n 
1 300 GLU n 
1 301 THR n 
1 302 GLY n 
1 303 GLU n 
1 304 GLY n 
1 305 LEU n 
1 306 GLU n 
1 307 ARG n 
1 308 VAL n 
1 309 ALA n 
1 310 ARG n 
1 311 TYR n 
1 312 SER n 
1 313 MET n 
1 314 GLU n 
1 315 ASP n 
1 316 ALA n 
1 317 LYS n 
1 318 VAL n 
1 319 THR n 
1 320 TYR n 
1 321 GLU n 
1 322 LEU n 
1 323 GLY n 
1 324 LYS n 
1 325 GLU n 
1 326 PHE n 
1 327 PHE n 
1 328 PRO n 
1 329 MET n 
1 330 GLU n 
1 331 ALA n 
1 332 GLN n 
1 333 LEU n 
1 334 SER n 
1 335 ARG n 
1 336 LEU n 
1 337 VAL n 
1 338 GLY n 
1 339 GLN n 
1 340 SER n 
1 341 LEU n 
1 342 TRP n 
1 343 ASP n 
1 344 VAL n 
1 345 SER n 
1 346 ARG n 
1 347 SER n 
1 348 SER n 
1 349 THR n 
1 350 GLY n 
1 351 ASN n 
1 352 LEU n 
1 353 VAL n 
1 354 GLU n 
1 355 TRP n 
1 356 PHE n 
1 357 LEU n 
1 358 LEU n 
1 359 ARG n 
1 360 LYS n 
1 361 ALA n 
1 362 TYR n 
1 363 GLU n 
1 364 ARG n 
1 365 ASN n 
1 366 GLU n 
1 367 LEU n 
1 368 ALA n 
1 369 PRO n 
1 370 ASN n 
1 371 LYS n 
1 372 PRO n 
1 373 ASP n 
1 374 GLU n 
1 375 ARG n 
1 376 GLU n 
1 377 LEU n 
1 378 ALA n 
1 379 ARG n 
1 380 ARG n 
1 381 ARG n 
1 382 GLU n 
1 383 SER n 
1 384 TYR n 
1 385 ALA n 
1 386 GLY n 
1 387 GLY n 
1 388 TYR n 
1 389 VAL n 
1 390 LYS n 
1 391 GLU n 
1 392 PRO n 
1 393 GLU n 
1 394 ARG n 
1 395 GLY n 
1 396 LEU n 
1 397 TRP n 
1 398 GLU n 
1 399 ASN n 
1 400 ILE n 
1 401 VAL n 
1 402 TYR n 
1 403 LEU n 
1 404 ASP n 
1 405 PHE n 
1 406 ARG n 
1 407 SER n 
1 408 LEU n 
1 409 TYR n 
1 410 PRO n 
1 411 SER n 
1 412 ILE n 
1 413 ILE n 
1 414 ILE n 
1 415 THR n 
1 416 HIS n 
1 417 ASN n 
1 418 VAL n 
1 419 SER n 
1 420 PRO n 
1 421 ASP n 
1 422 THR n 
1 423 LEU n 
1 424 ASN n 
1 425 ARG n 
1 426 GLU n 
1 427 GLY n 
1 428 CYS n 
1 429 GLU n 
1 430 GLU n 
1 431 TYR n 
1 432 ASP n 
1 433 VAL n 
1 434 ALA n 
1 435 PRO n 
1 436 GLN n 
1 437 VAL n 
1 438 GLY n 
1 439 HIS n 
1 440 LYS n 
1 441 PHE n 
1 442 CYS n 
1 443 LYS n 
1 444 ASP n 
1 445 PHE n 
1 446 PRO n 
1 447 GLY n 
1 448 PHE n 
1 449 ILE n 
1 450 PRO n 
1 451 SER n 
1 452 LEU n 
1 453 LEU n 
1 454 GLY n 
1 455 ASP n 
1 456 LEU n 
1 457 LEU n 
1 458 GLU n 
1 459 GLU n 
1 460 ARG n 
1 461 GLN n 
1 462 LYS n 
1 463 VAL n 
1 464 LYS n 
1 465 LYS n 
1 466 LYS n 
1 467 MET n 
1 468 LYS n 
1 469 ALA n 
1 470 THR n 
1 471 ILE n 
1 472 ASP n 
1 473 PRO n 
1 474 ILE n 
1 475 GLU n 
1 476 LYS n 
1 477 LYS n 
1 478 LEU n 
1 479 LEU n 
1 480 ASP n 
1 481 TYR n 
1 482 ARG n 
1 483 GLN n 
1 484 ARG n 
1 485 ALA n 
1 486 ILE n 
1 487 LYS n 
1 488 ILE n 
1 489 LEU n 
1 490 ALA n 
1 491 ASN n 
1 492 SER n 
1 493 PHE n 
1 494 TYR n 
1 495 GLY n 
1 496 TYR n 
1 497 TYR n 
1 498 GLY n 
1 499 TYR n 
1 500 ALA n 
1 501 LYS n 
1 502 ALA n 
1 503 ARG n 
1 504 TRP n 
1 505 TYR n 
1 506 CYS n 
1 507 LYS n 
1 508 GLU n 
1 509 CYS n 
1 510 ALA n 
1 511 GLU n 
1 512 SER n 
1 513 VAL n 
1 514 THR n 
1 515 ALA n 
1 516 TRP n 
1 517 GLY n 
1 518 ARG n 
1 519 GLN n 
1 520 TYR n 
1 521 ILE n 
1 522 GLU n 
1 523 THR n 
1 524 THR n 
1 525 ILE n 
1 526 ARG n 
1 527 GLU n 
1 528 ILE n 
1 529 GLU n 
1 530 GLU n 
1 531 LYS n 
1 532 PHE n 
1 533 GLY n 
1 534 PHE n 
1 535 LYS n 
1 536 VAL n 
1 537 LEU n 
1 538 TYR n 
1 539 ALA n 
1 540 ASP n 
1 541 THR n 
1 542 ASP n 
1 543 GLY n 
1 544 PHE n 
1 545 PHE n 
1 546 ALA n 
1 547 THR n 
1 548 ILE n 
1 549 PRO n 
1 550 GLY n 
1 551 ALA n 
1 552 ASP n 
1 553 ALA n 
1 554 GLU n 
1 555 THR n 
1 556 VAL n 
1 557 LYS n 
1 558 LYS n 
1 559 LYS n 
1 560 ALA n 
1 561 LYS n 
1 562 GLU n 
1 563 PHE n 
1 564 LEU n 
1 565 ASP n 
1 566 TYR n 
1 567 ILE n 
1 568 ASN n 
1 569 ALA n 
1 570 LYS n 
1 571 LEU n 
1 572 PRO n 
1 573 GLY n 
1 574 LEU n 
1 575 LEU n 
1 576 GLU n 
1 577 LEU n 
1 578 GLU n 
1 579 TYR n 
1 580 GLU n 
1 581 GLY n 
1 582 PHE n 
1 583 TYR n 
1 584 LYS n 
1 585 ARG n 
1 586 GLY n 
1 587 PHE n 
1 588 PHE n 
1 589 VAL n 
1 590 THR n 
1 591 LYS n 
1 592 LYS n 
1 593 LYS n 
1 594 TYR n 
1 595 ALA n 
1 596 VAL n 
1 597 ILE n 
1 598 ASP n 
1 599 GLU n 
1 600 GLU n 
1 601 ASP n 
1 602 LYS n 
1 603 ILE n 
1 604 THR n 
1 605 THR n 
1 606 ARG n 
1 607 GLY n 
1 608 LEU n 
1 609 GLU n 
1 610 ILE n 
1 611 VAL n 
1 612 ARG n 
1 613 ARG n 
1 614 ASP n 
1 615 TRP n 
1 616 SER n 
1 617 GLU n 
1 618 ILE n 
1 619 ALA n 
1 620 LYS n 
1 621 GLU n 
1 622 THR n 
1 623 GLN n 
1 624 ALA n 
1 625 ARG n 
1 626 VAL n 
1 627 LEU n 
1 628 GLU n 
1 629 ALA n 
1 630 ILE n 
1 631 LEU n 
1 632 LYS n 
1 633 HIS n 
1 634 GLY n 
1 635 ASP n 
1 636 VAL n 
1 637 GLU n 
1 638 GLU n 
1 639 ALA n 
1 640 VAL n 
1 641 ARG n 
1 642 ILE n 
1 643 VAL n 
1 644 LYS n 
1 645 GLU n 
1 646 VAL n 
1 647 THR n 
1 648 GLU n 
1 649 LYS n 
1 650 LEU n 
1 651 SER n 
1 652 LYS n 
1 653 TYR n 
1 654 GLU n 
1 655 VAL n 
1 656 PRO n 
1 657 PRO n 
1 658 GLU n 
1 659 LYS n 
1 660 LEU n 
1 661 VAL n 
1 662 ILE n 
1 663 TYR n 
1 664 GLU n 
1 665 GLN n 
1 666 ILE n 
1 667 THR n 
1 668 ARG n 
1 669 ASP n 
1 670 LEU n 
1 671 LYS n 
1 672 ASP n 
1 673 TYR n 
1 674 LYS n 
1 675 ALA n 
1 676 THR n 
1 677 GLY n 
1 678 PRO n 
1 679 HIS n 
1 680 VAL n 
1 681 ALA n 
1 682 VAL n 
1 683 ALA n 
1 684 LYS n 
1 685 ARG n 
1 686 LEU n 
1 687 ALA n 
1 688 ALA n 
1 689 ARG n 
1 690 GLY n 
1 691 ILE n 
1 692 LYS n 
1 693 ILE n 
1 694 ARG n 
1 695 PRO n 
1 696 GLY n 
1 697 THR n 
1 698 VAL n 
1 699 ILE n 
1 700 SER n 
1 701 TYR n 
1 702 ILE n 
1 703 VAL n 
1 704 LEU n 
1 705 LYS n 
1 706 GLY n 
1 707 SER n 
1 708 GLY n 
1 709 ARG n 
1 710 ILE n 
1 711 GLY n 
1 712 ASP n 
1 713 ARG n 
1 714 ALA n 
1 715 ILE n 
1 716 PRO n 
1 717 PHE n 
1 718 ASP n 
1 719 GLU n 
1 720 PHE n 
1 721 ASP n 
1 722 PRO n 
1 723 ALA n 
1 724 LYS n 
1 725 HIS n 
1 726 LYS n 
1 727 TYR n 
1 728 ASP n 
1 729 ALA n 
1 730 GLU n 
1 731 TYR n 
1 732 TYR n 
1 733 ILE n 
1 734 GLU n 
1 735 ASN n 
1 736 GLN n 
1 737 VAL n 
1 738 LEU n 
1 739 PRO n 
1 740 ALA n 
1 741 VAL n 
1 742 GLU n 
1 743 ARG n 
1 744 ILE n 
1 745 LEU n 
1 746 ARG n 
1 747 ALA n 
1 748 PHE n 
1 749 GLY n 
1 750 TYR n 
1 751 ARG n 
1 752 LYS n 
1 753 GLU n 
1 754 ASP n 
1 755 LEU n 
1 756 ARG n 
1 757 TYR n 
1 758 GLN n 
1 759 LYS n 
1 760 THR n 
1 761 ARG n 
1 762 GLN n 
1 763 VAL n 
1 764 GLY n 
1 765 LEU n 
1 766 GLY n 
1 767 ALA n 
1 768 TRP n 
1 769 LEU n 
1 770 LYS n 
1 771 PRO n 
1 772 LYS n 
1 773 THR n 
2 1   DA  n 
2 2   DA  n 
2 3   DU  n 
2 4   DG  n 
2 5   DG  n 
2 6   DA  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DA  n 
2 11  DC  n 
2 12  DG  n 
2 13  DG  n 
2 14  DC  n 
2 15  DT  n 
2 16  DT  n 
2 17  DT  n 
2 18  DT  n 
2 19  DG  n 
2 20  DC  n 
2 21  DC  n 
2 22  DG  n 
2 23  DT  n 
2 24  DG  n 
2 25  DT  n 
2 26  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'THERMOCOCCUS GORGONARIUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     71997 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PET17B 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP DPOL_THEGO 1 ? ? P56689 ? 
2 PDB 2VWJ       2 ? ? 2VWJ   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2VWJ A 1 ? 773 ? P56689 1 ? 773 ? 1 773 
2 2 2VWJ B 1 ? 26  ? 2VWJ   0 ? 25  ? 0 25  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2VWJ LYS A 151 ? UNP P56689 GLU 151 conflict              151 1 
1 2VWJ ARG A 174 ? UNP P56689 LYS 174 conflict              174 2 
1 2VWJ ALA A 215 ? UNP P56689 ASP 215 'engineered mutation' 215 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
DU  'DNA linking'       y "2'-DEOXYURIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O8 P'  308.182 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
K   non-polymer         . 'POTASSIUM ION'                      ? 'K 1'             39.098  
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2VWJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.5 
_exptl_crystal.density_percent_sol   76 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.3 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.2M TRIPOTASSIUM CITRATE PH8.3, 20% PEG 3350' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                
'SI (111) DOUBLE CRYSTAL MONOCHROMATOR. KIRKPATRICK BAEZ BIMORPH MIRROR PAIR FOR HORIZONTAL AND VERTICAL FOCUSSING' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'DOUBLE CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9699 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04 
_diffrn_source.pdbx_wavelength             0.9699 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2VWJ 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.00 
_reflns.d_resolution_high            2.78 
_reflns.number_obs                   45193 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.7 
_reflns.pdbx_Rmerge_I_obs            0.10 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.10 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.5 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.78 
_reflns_shell.d_res_low              2.85 
_reflns_shell.percent_possible_all   98.9 
_reflns_shell.Rmerge_I_obs           0.44 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.20 
_reflns_shell.pdbx_redundancy        3.6 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2VWJ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     42895 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             67.73 
_refine.ls_d_res_high                            2.78 
_refine.ls_percent_reflns_obs                    98.3 
_refine.ls_R_factor_obs                          0.229 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.227 
_refine.ls_R_factor_R_free                       0.264 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  2296 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.914 
_refine.correlation_coeff_Fo_to_Fc_free          0.889 
_refine.B_iso_mean                               52.83 
_refine.aniso_B[1][1]                            -5.18000 
_refine.aniso_B[2][2]                            4.01000 
_refine.aniso_B[3][3]                            1.17000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1TGO' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.405 
_refine.pdbx_overall_ESU_R_Free                  0.294 
_refine.overall_SU_ML                            0.228 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             11.645 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6077 
_refine_hist.pdbx_number_atoms_nucleic_acid   478 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             1 
_refine_hist.number_atoms_total               6559 
_refine_hist.d_res_high                       2.78 
_refine_hist.d_res_low                        67.73 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011  0.022  ? 6751 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.407  2.062  ? 9235 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.219  5.000  ? 756  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       31.104 23.562 ? 292  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       19.830 15.000 ? 1081 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       22.260 15.000 ? 45   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.091  0.200  ? 1011 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 4943 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.232  0.200  ? 2858 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.315  0.200  ? 4530 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.164  0.200  ? 206  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.186  0.200  ? 19   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.276  0.200  ? 3    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.622  1.500  ? 3771 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.189  2.000  ? 6090 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.507  3.000  ? 3055 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.687  4.500  ? 3145 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.78 
_refine_ls_shell.d_res_low                        2.85 
_refine_ls_shell.number_reflns_R_work             3148 
_refine_ls_shell.R_factor_R_work                  0.3520 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3970 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             153 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2VWJ 
_struct.title                     'Uracil Recognition in Archaeal DNA Polymerases Captured by X-ray Crystallography.' 
_struct.pdbx_descriptor           'DNA POLYMERASE (E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2VWJ 
_struct_keywords.pdbx_keywords   'DNA REPLICATION' 
_struct_keywords.text            
;DNA REPLICATION, MULTIFUNCTIONAL ENZYME, NUCLEOTIDYLTRANSFERASE, DNA-DIRECTED DNA POLYMERASE, TRANSFERASE, EXONUCLEASE, DNA-BINDING, DNA POLYMERASE, URACIL, ARCHAEA, NUCLEASE, HYDROLASE, DNA REPAIR
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 47  ? LYS A 52  ? ALA A 47  LYS A 52  1 ? 6  
HELX_P HELX_P2  2  HIS A 89  ? GLN A 91  ? HIS A 89  GLN A 91  5 ? 3  
HELX_P HELX_P3  3  ASP A 92  ? HIS A 103 ? ASP A 92  HIS A 103 1 ? 12 
HELX_P HELX_P4  4  PRO A 115 ? LYS A 124 ? PRO A 115 LYS A 124 1 ? 10 
HELX_P HELX_P5  5  THR A 186 ? ASP A 202 ? THR A 186 ASP A 202 1 ? 17 
HELX_P HELX_P6  6  PHE A 214 ? LEU A 226 ? PHE A 214 LEU A 226 1 ? 13 
HELX_P HELX_P7  7  LEU A 260 ? ILE A 268 ? LEU A 260 ILE A 268 1 ? 9  
HELX_P HELX_P8  8  THR A 274 ? GLY A 284 ? THR A 274 GLY A 284 1 ? 11 
HELX_P HELX_P9  9  TYR A 291 ? GLY A 302 ? TYR A 291 GLY A 302 1 ? 12 
HELX_P HELX_P10 10 GLY A 304 ? GLY A 338 ? GLY A 304 GLY A 338 1 ? 35 
HELX_P HELX_P11 11 SER A 340 ? SER A 345 ? SER A 340 SER A 345 1 ? 6  
HELX_P HELX_P12 12 SER A 348 ? ARG A 364 ? SER A 348 ARG A 364 1 ? 17 
HELX_P HELX_P13 13 ASP A 373 ? SER A 383 ? ASP A 373 SER A 383 1 ? 11 
HELX_P HELX_P14 14 SER A 407 ? HIS A 416 ? SER A 407 HIS A 416 1 ? 10 
HELX_P HELX_P15 15 GLY A 447 ? MET A 467 ? GLY A 447 MET A 467 1 ? 21 
HELX_P HELX_P16 16 ASP A 472 ? ASN A 491 ? ASP A 472 ASN A 491 1 ? 20 
HELX_P HELX_P17 17 SER A 492 ? GLY A 498 ? SER A 492 GLY A 498 1 ? 7  
HELX_P HELX_P18 18 CYS A 506 ? LYS A 531 ? CYS A 506 LYS A 531 1 ? 26 
HELX_P HELX_P19 19 ASP A 552 ? LEU A 571 ? ASP A 552 LEU A 571 1 ? 20 
HELX_P HELX_P20 20 SER A 616 ? GLY A 634 ? SER A 616 GLY A 634 1 ? 19 
HELX_P HELX_P21 21 ASP A 635 ? LYS A 652 ? ASP A 635 LYS A 652 1 ? 18 
HELX_P HELX_P22 22 PRO A 656 ? VAL A 661 ? PRO A 656 VAL A 661 5 ? 6  
HELX_P HELX_P23 23 GLY A 677 ? ALA A 688 ? GLY A 677 ALA A 688 1 ? 12 
HELX_P HELX_P24 24 ILE A 710 ? ASP A 712 ? ILE A 710 ASP A 712 5 ? 3  
HELX_P HELX_P25 25 ASP A 718 ? PHE A 720 ? ASP A 718 PHE A 720 5 ? 3  
HELX_P HELX_P26 26 ASP A 728 ? ASN A 735 ? ASP A 728 ASN A 735 1 ? 8  
HELX_P HELX_P27 27 VAL A 741 ? ALA A 747 ? VAL A 741 ALA A 747 1 ? 7  
HELX_P HELX_P28 28 ARG A 751 ? ARG A 756 ? ARG A 751 ARG A 756 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? C K  .  K  ? ? ? 1_555 A GLY 573 O   ? ? A K  1758 A GLY 573  1_555 ? ? ? ? ? ? ?            2.577 ? 
metalc2  metalc ? ? C K  .  K  ? ? ? 1_555 F HOH .   O   ? ? A K  1758 A HOH 2001 1_555 ? ? ? ? ? ? ?            2.992 ? 
metalc3  metalc ? ? C K  .  K  ? ? ? 1_555 A ASN 568 O   ? ? A K  1758 A ASN 568  1_555 ? ? ? ? ? ? ?            2.666 ? 
metalc4  metalc ? ? C K  .  K  ? ? ? 1_555 A LEU 571 O   ? ? A K  1758 A LEU 571  1_555 ? ? ? ? ? ? ?            2.790 ? 
metalc5  metalc ? ? C K  .  K  ? ? ? 1_555 A LEU 575 O   ? ? A K  1758 A LEU 575  1_555 ? ? ? ? ? ? ?            2.880 ? 
metalc6  metalc ? ? D K  .  K  ? ? ? 1_555 A TRP 615 NE1 ? ? A K  1759 A TRP 615  1_555 ? ? ? ? ? ? ?            3.319 ? 
metalc7  metalc ? ? D K  .  K  ? ? ? 1_555 A TYR 663 O   ? ? A K  1759 A TYR 663  1_555 ? ? ? ? ? ? ?            2.689 ? 
metalc8  metalc ? ? D K  .  K  ? ? ? 1_555 A ARG 613 O   ? ? A K  1759 A ARG 613  1_555 ? ? ? ? ? ? ?            2.648 ? 
metalc9  metalc ? ? E K  .  K  ? ? ? 1_555 A LYS 101 O   ? ? A K  1760 A LYS 101  1_555 ? ? ? ? ? ? ?            2.850 ? 
metalc10 metalc ? ? E K  .  K  ? ? ? 1_555 A HIS 103 O   ? ? A K  1760 A HIS 103  1_555 ? ? ? ? ? ? ?            2.937 ? 
metalc11 metalc ? ? E K  .  K  ? ? ? 1_555 A VAL 106 O   ? ? A K  1760 A VAL 106  1_555 ? ? ? ? ? ? ?            2.709 ? 
hydrog1  hydrog ? ? B DG 7  N1 ? ? ? 1_555 B DC  26  N3  ? ? B DG 6    B DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DG 7  N2 ? ? ? 1_555 B DC  26  O2  ? ? B DG 6    B DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG 7  O6 ? ? ? 1_555 B DC  26  N4  ? ? B DG 6    B DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DA 8  N1 ? ? ? 1_555 B DT  25  N3  ? ? B DA 7    B DT  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DA 8  N6 ? ? ? 1_555 B DT  25  O4  ? ? B DA 7    B DT  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DC 9  N3 ? ? ? 1_555 B DG  24  N1  ? ? B DC 8    B DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DC 9  N4 ? ? ? 1_555 B DG  24  O6  ? ? B DC 8    B DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DC 9  O2 ? ? ? 1_555 B DG  24  N2  ? ? B DC 8    B DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA 10 N1 ? ? ? 1_555 B DT  23  N3  ? ? B DA 9    B DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DA 10 N6 ? ? ? 1_555 B DT  23  O4  ? ? B DA 9    B DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC 11 N3 ? ? ? 1_555 B DG  22  N1  ? ? B DC 10   B DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC 11 N4 ? ? ? 1_555 B DG  22  O6  ? ? B DC 10   B DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DC 11 O2 ? ? ? 1_555 B DG  22  N2  ? ? B DC 10   B DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG 12 N1 ? ? ? 1_555 B DC  21  N3  ? ? B DG 11   B DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG 12 N2 ? ? ? 1_555 B DC  21  O2  ? ? B DG 11   B DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DG 12 O6 ? ? ? 1_555 B DC  21  N4  ? ? B DG 11   B DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DG 13 N1 ? ? ? 1_555 B DC  20  N3  ? ? B DG 12   B DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DG 13 N2 ? ? ? 1_555 B DC  20  O2  ? ? B DG 12   B DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DG 13 O6 ? ? ? 1_555 B DC  20  N4  ? ? B DG 12   B DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DC 14 N3 ? ? ? 1_555 B DG  19  N1  ? ? B DC 13   B DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DC 14 N4 ? ? ? 1_555 B DG  19  O6  ? ? B DC 13   B DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DC 14 O2 ? ? ? 1_555 B DG  19  N2  ? ? B DC 13   B DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3 ? 
AB ? 5 ? 
AC ? 2 ? 
AD ? 6 ? 
AE ? 2 ? 
AF ? 6 ? 
AG ? 2 ? 
AH ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? parallel      
AC 1 2 ? anti-parallel 
AD 1 2 ? parallel      
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AD 4 5 ? parallel      
AD 5 6 ? parallel      
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AF 4 5 ? anti-parallel 
AF 5 6 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ILE A 2   ? GLU A 10  ? ILE A 2   GLU A 10  
AA 2 LYS A 13  ? GLU A 22  ? LYS A 13  GLU A 22  
AA 3 GLU A 25  ? ASP A 31  ? GLU A 25  ASP A 31  
AB 1 VAL A 106 ? TYR A 110 ? VAL A 106 TYR A 110 
AB 2 TYR A 37  ? LEU A 42  ? TYR A 37  LEU A 42  
AB 3 ARG A 78  ? TYR A 86  ? ARG A 78  TYR A 86  
AB 4 LYS A 70  ? PHE A 75  ? LYS A 70  PHE A 75  
AB 5 GLU A 366 ? LEU A 367 ? GLU A 366 LEU A 367 
AC 1 THR A 55  ? ARG A 58  ? THR A 55  ARG A 58  
AC 2 THR A 61  ? ARG A 64  ? THR A 61  ARG A 64  
AD 1 VAL A 181 ? VAL A 183 ? VAL A 181 VAL A 183 
AD 2 GLY A 167 ? THR A 172 ? GLY A 167 THR A 172 
AD 3 ILE A 157 ? ASP A 164 ? ILE A 157 ASP A 164 
AD 4 MET A 137 ? THR A 144 ? MET A 137 THR A 144 
AD 5 VAL A 205 ? THR A 208 ? VAL A 205 THR A 208 
AD 6 ILE A 256 ? ASP A 259 ? ILE A 256 ASP A 259 
AE 1 LYS A 240 ? ARG A 243 ? LYS A 240 ARG A 243 
AE 2 PHE A 248 ? GLU A 251 ? PHE A 248 GLU A 251 
AF 1 LYS A 535 ? ASP A 540 ? LYS A 535 ASP A 540 
AF 2 GLY A 543 ? THR A 547 ? GLY A 543 THR A 547 
AF 3 TRP A 397 ? ASP A 404 ? TRP A 397 ASP A 404 
AF 4 GLU A 578 ? THR A 590 ? GLU A 578 THR A 590 
AF 5 LYS A 593 ? ILE A 597 ? LYS A 593 ILE A 597 
AF 6 ILE A 603 ? ARG A 606 ? ILE A 603 ARG A 606 
AG 1 TYR A 431 ? VAL A 433 ? TYR A 431 VAL A 433 
AG 2 LYS A 440 ? CYS A 442 ? LYS A 440 CYS A 442 
AH 1 ILE A 662 ? GLN A 665 ? ILE A 662 GLN A 665 
AH 2 VAL A 698 ? VAL A 703 ? VAL A 698 VAL A 703 
AH 3 ALA A 714 ? PRO A 716 ? ALA A 714 PRO A 716 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLU A 10  ? N GLU A 10  O LYS A 13  ? O LYS A 13  
AA 2 3 N GLU A 22  ? N GLU A 22  O GLU A 25  ? O GLU A 25  
AB 1 2 N TYR A 110 ? N TYR A 110 O TYR A 39  ? O TYR A 39  
AB 2 3 N ALA A 40  ? N ALA A 40  O TRP A 83  ? O TRP A 83  
AB 3 4 N VAL A 82  ? N VAL A 82  O VAL A 71  ? O VAL A 71  
AB 4 5 O LYS A 74  ? O LYS A 74  N LEU A 367 ? N LEU A 367 
AC 1 2 N ARG A 58  ? N ARG A 58  O THR A 61  ? O THR A 61  
AD 1 2 N ASP A 182 ? N ASP A 182 O VAL A 170 ? O VAL A 170 
AD 2 3 N ILE A 171 ? N ILE A 171 O ILE A 160 ? O ILE A 160 
AD 3 4 N ALA A 163 ? N ALA A 163 O ALA A 139 ? O ALA A 139 
AD 4 5 N LEU A 138 ? N LEU A 138 O VAL A 205 ? O VAL A 205 
AD 5 6 N LEU A 206 ? N LEU A 206 O ILE A 256 ? O ILE A 256 
AE 1 2 N GLN A 242 ? N GLN A 242 O ALA A 249 ? O ALA A 249 
AF 1 2 N ASP A 540 ? N ASP A 540 O GLY A 543 ? O GLY A 543 
AF 2 3 N ALA A 546 ? N ALA A 546 O VAL A 401 ? O VAL A 401 
AF 3 4 N ASP A 404 ? N ASP A 404 O GLU A 578 ? O GLU A 578 
AF 4 5 N VAL A 589 ? N VAL A 589 O LYS A 593 ? O LYS A 593 
AF 5 6 N VAL A 596 ? N VAL A 596 O THR A 604 ? O THR A 604 
AG 1 2 N ASP A 432 ? N ASP A 432 O PHE A 441 ? O PHE A 441 
AH 1 2 N GLU A 664 ? N GLU A 664 O ILE A 699 ? O ILE A 699 
AH 2 3 N ILE A 702 ? N ILE A 702 O ILE A 715 ? O ILE A 715 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE K A1758' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE K A1759' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE K A1760' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 ASN A 568 ? ASN A 568  . ? 1_555 ? 
2  AC1 5 LEU A 571 ? LEU A 571  . ? 1_555 ? 
3  AC1 5 GLY A 573 ? GLY A 573  . ? 1_555 ? 
4  AC1 5 LEU A 575 ? LEU A 575  . ? 1_555 ? 
5  AC1 5 HOH F .   ? HOH A 2001 . ? 1_555 ? 
6  AC2 3 ARG A 613 ? ARG A 613  . ? 1_555 ? 
7  AC2 3 TRP A 615 ? TRP A 615  . ? 1_555 ? 
8  AC2 3 TYR A 663 ? TYR A 663  . ? 1_555 ? 
9  AC3 4 LYS A 101 ? LYS A 101  . ? 1_555 ? 
10 AC3 4 GLU A 102 ? GLU A 102  . ? 1_555 ? 
11 AC3 4 HIS A 103 ? HIS A 103  . ? 1_555 ? 
12 AC3 4 VAL A 106 ? VAL A 106  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2VWJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2VWJ 
_atom_sites.fract_transf_matrix[1][1]   0.009930 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006176 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004508 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
K 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . MET A 1 1   ? -16.531 0.407   21.242  1.00 37.63  ? 1    MET A N     1 
ATOM   2    C CA    . MET A 1 1   ? -17.464 1.531   20.967  1.00 37.21  ? 1    MET A CA    1 
ATOM   3    C C     . MET A 1 1   ? -16.682 2.717   20.487  1.00 37.21  ? 1    MET A C     1 
ATOM   4    O O     . MET A 1 1   ? -15.525 2.863   20.872  1.00 37.76  ? 1    MET A O     1 
ATOM   5    C CB    . MET A 1 1   ? -18.268 1.930   22.216  1.00 36.90  ? 1    MET A CB    1 
ATOM   6    C CG    . MET A 1 1   ? -17.511 2.012   23.516  1.00 36.66  ? 1    MET A CG    1 
ATOM   7    S SD    . MET A 1 1   ? -18.473 2.762   24.880  1.00 36.21  ? 1    MET A SD    1 
ATOM   8    C CE    . MET A 1 1   ? -19.934 1.746   24.946  1.00 36.81  ? 1    MET A CE    1 
ATOM   9    N N     . ILE A 1 2   ? -17.316 3.565   19.670  1.00 36.60  ? 2    ILE A N     1 
ATOM   10   C CA    . ILE A 1 2   ? -16.746 4.844   19.275  1.00 36.17  ? 2    ILE A CA    1 
ATOM   11   C C     . ILE A 1 2   ? -16.706 5.780   20.489  1.00 36.76  ? 2    ILE A C     1 
ATOM   12   O O     . ILE A 1 2   ? -17.718 5.945   21.180  1.00 36.84  ? 2    ILE A O     1 
ATOM   13   C CB    . ILE A 1 2   ? -17.567 5.485   18.150  1.00 35.94  ? 2    ILE A CB    1 
ATOM   14   C CG1   . ILE A 1 2   ? -17.554 4.592   16.906  1.00 35.33  ? 2    ILE A CG1   1 
ATOM   15   C CG2   . ILE A 1 2   ? -17.042 6.883   17.824  1.00 35.98  ? 2    ILE A CG2   1 
ATOM   16   C CD1   . ILE A 1 2   ? -18.465 5.066   15.758  1.00 34.17  ? 2    ILE A CD1   1 
ATOM   17   N N     . LEU A 1 3   ? -15.539 6.372   20.757  1.00 37.01  ? 3    LEU A N     1 
ATOM   18   C CA    . LEU A 1 3   ? -15.372 7.268   21.900  1.00 37.29  ? 3    LEU A CA    1 
ATOM   19   C C     . LEU A 1 3   ? -15.307 8.720   21.469  1.00 37.88  ? 3    LEU A C     1 
ATOM   20   O O     . LEU A 1 3   ? -15.785 9.603   22.169  1.00 37.82  ? 3    LEU A O     1 
ATOM   21   C CB    . LEU A 1 3   ? -14.121 6.933   22.704  1.00 36.78  ? 3    LEU A CB    1 
ATOM   22   C CG    . LEU A 1 3   ? -13.905 5.517   23.219  1.00 37.07  ? 3    LEU A CG    1 
ATOM   23   C CD1   . LEU A 1 3   ? -12.475 5.345   23.701  1.00 34.30  ? 3    LEU A CD1   1 
ATOM   24   C CD2   . LEU A 1 3   ? -14.890 5.205   24.333  1.00 37.78  ? 3    LEU A CD2   1 
ATOM   25   N N     . ASP A 1 4   ? -14.689 8.974   20.326  1.00 38.93  ? 4    ASP A N     1 
ATOM   26   C CA    . ASP A 1 4   ? -14.590 10.327  19.817  1.00 39.87  ? 4    ASP A CA    1 
ATOM   27   C C     . ASP A 1 4   ? -14.233 10.305  18.353  1.00 40.10  ? 4    ASP A C     1 
ATOM   28   O O     . ASP A 1 4   ? -13.884 9.264   17.800  1.00 39.55  ? 4    ASP A O     1 
ATOM   29   C CB    . ASP A 1 4   ? -13.543 11.125  20.589  1.00 40.41  ? 4    ASP A CB    1 
ATOM   30   C CG    . ASP A 1 4   ? -13.862 12.634  20.628  1.00 43.33  ? 4    ASP A CG    1 
ATOM   31   O OD1   . ASP A 1 4   ? -14.636 13.121  19.767  1.00 44.71  ? 4    ASP A OD1   1 
ATOM   32   O OD2   . ASP A 1 4   ? -13.349 13.337  21.540  1.00 46.44  ? 4    ASP A OD2   1 
ATOM   33   N N     . THR A 1 5   ? -14.352 11.462  17.721  1.00 40.97  ? 5    THR A N     1 
ATOM   34   C CA    . THR A 1 5   ? -13.859 11.642  16.372  1.00 42.62  ? 5    THR A CA    1 
ATOM   35   C C     . THR A 1 5   ? -13.201 13.010  16.258  1.00 43.48  ? 5    THR A C     1 
ATOM   36   O O     . THR A 1 5   ? -13.609 13.959  16.926  1.00 44.07  ? 5    THR A O     1 
ATOM   37   C CB    . THR A 1 5   ? -14.994 11.568  15.319  1.00 42.49  ? 5    THR A CB    1 
ATOM   38   O OG1   . THR A 1 5   ? -16.030 12.475  15.693  1.00 43.72  ? 5    THR A OG1   1 
ATOM   39   C CG2   . THR A 1 5   ? -15.578 10.165  15.199  1.00 41.63  ? 5    THR A CG2   1 
ATOM   40   N N     . ASP A 1 6   ? -12.175 13.097  15.415  1.00 44.71  ? 6    ASP A N     1 
ATOM   41   C CA    . ASP A 1 6   ? -11.608 14.370  14.970  1.00 45.69  ? 6    ASP A CA    1 
ATOM   42   C C     . ASP A 1 6   ? -11.033 14.196  13.572  1.00 46.81  ? 6    ASP A C     1 
ATOM   43   O O     . ASP A 1 6   ? -11.131 13.107  12.991  1.00 46.60  ? 6    ASP A O     1 
ATOM   44   C CB    . ASP A 1 6   ? -10.550 14.881  15.941  1.00 45.32  ? 6    ASP A CB    1 
ATOM   45   C CG    . ASP A 1 6   ? -9.240  14.096  15.876  1.00 46.18  ? 6    ASP A CG    1 
ATOM   46   O OD1   . ASP A 1 6   ? -9.142  13.045  15.189  1.00 45.58  ? 6    ASP A OD1   1 
ATOM   47   O OD2   . ASP A 1 6   ? -8.283  14.555  16.531  1.00 47.01  ? 6    ASP A OD2   1 
ATOM   48   N N     . TYR A 1 7   ? -10.455 15.269  13.026  1.00 48.64  ? 7    TYR A N     1 
ATOM   49   C CA    . TYR A 1 7   ? -9.683  15.180  11.776  1.00 50.09  ? 7    TYR A CA    1 
ATOM   50   C C     . TYR A 1 7   ? -8.284  15.767  11.924  1.00 51.35  ? 7    TYR A C     1 
ATOM   51   O O     . TYR A 1 7   ? -8.035  16.633  12.774  1.00 51.59  ? 7    TYR A O     1 
ATOM   52   C CB    . TYR A 1 7   ? -10.428 15.808  10.591  1.00 49.85  ? 7    TYR A CB    1 
ATOM   53   C CG    . TYR A 1 7   ? -10.353 17.312  10.505  1.00 50.14  ? 7    TYR A CG    1 
ATOM   54   C CD1   . TYR A 1 7   ? -9.338  17.935  9.786   1.00 50.44  ? 7    TYR A CD1   1 
ATOM   55   C CD2   . TYR A 1 7   ? -11.308 18.121  11.126  1.00 51.70  ? 7    TYR A CD2   1 
ATOM   56   C CE1   . TYR A 1 7   ? -9.259  19.331  9.693   1.00 50.97  ? 7    TYR A CE1   1 
ATOM   57   C CE2   . TYR A 1 7   ? -11.238 19.530  11.042  1.00 51.81  ? 7    TYR A CE2   1 
ATOM   58   C CZ    . TYR A 1 7   ? -10.205 20.120  10.321  1.00 51.45  ? 7    TYR A CZ    1 
ATOM   59   O OH    . TYR A 1 7   ? -10.113 21.490  10.207  1.00 51.55  ? 7    TYR A OH    1 
ATOM   60   N N     . ILE A 1 8   ? -7.365  15.270  11.104  1.00 52.94  ? 8    ILE A N     1 
ATOM   61   C CA    . ILE A 1 8   ? -6.041  15.885  10.965  1.00 54.21  ? 8    ILE A CA    1 
ATOM   62   C C     . ILE A 1 8   ? -5.740  16.162  9.505   1.00 55.40  ? 8    ILE A C     1 
ATOM   63   O O     . ILE A 1 8   ? -6.031  15.343  8.631   1.00 55.38  ? 8    ILE A O     1 
ATOM   64   C CB    . ILE A 1 8   ? -4.900  15.029  11.574  1.00 53.86  ? 8    ILE A CB    1 
ATOM   65   C CG1   . ILE A 1 8   ? -5.141  13.537  11.315  1.00 53.15  ? 8    ILE A CG1   1 
ATOM   66   C CG2   . ILE A 1 8   ? -4.773  15.333  13.055  1.00 53.68  ? 8    ILE A CG2   1 
ATOM   67   C CD1   . ILE A 1 8   ? -3.919  12.767  10.989  1.00 51.68  ? 8    ILE A CD1   1 
ATOM   68   N N     . THR A 1 9   ? -5.167  17.333  9.259   1.00 57.01  ? 9    THR A N     1 
ATOM   69   C CA    . THR A 1 9   ? -4.661  17.696  7.943   1.00 58.58  ? 9    THR A CA    1 
ATOM   70   C C     . THR A 1 9   ? -3.350  16.946  7.663   1.00 59.46  ? 9    THR A C     1 
ATOM   71   O O     . THR A 1 9   ? -2.474  16.873  8.531   1.00 59.36  ? 9    THR A O     1 
ATOM   72   C CB    . THR A 1 9   ? -4.387  19.212  7.888   1.00 58.58  ? 9    THR A CB    1 
ATOM   73   O OG1   . THR A 1 9   ? -5.412  19.911  8.610   1.00 58.86  ? 9    THR A OG1   1 
ATOM   74   C CG2   . THR A 1 9   ? -4.332  19.703  6.449   1.00 58.79  ? 9    THR A CG2   1 
ATOM   75   N N     . GLU A 1 10  ? -3.222  16.374  6.465   1.00 60.71  ? 10   GLU A N     1 
ATOM   76   C CA    . GLU A 1 10  ? -1.920  15.843  6.008   1.00 61.82  ? 10   GLU A CA    1 
ATOM   77   C C     . GLU A 1 10  ? -1.729  15.947  4.482   1.00 62.87  ? 10   GLU A C     1 
ATOM   78   O O     . GLU A 1 10  ? -2.499  15.363  3.691   1.00 62.91  ? 10   GLU A O     1 
ATOM   79   C CB    . GLU A 1 10  ? -1.628  14.433  6.551   1.00 61.22  ? 10   GLU A CB    1 
ATOM   80   C CG    . GLU A 1 10  ? -2.063  13.282  5.671   1.00 60.37  ? 10   GLU A CG    1 
ATOM   81   C CD    . GLU A 1 10  ? -1.936  11.973  6.398   1.00 60.04  ? 10   GLU A CD    1 
ATOM   82   O OE1   . GLU A 1 10  ? -1.266  11.978  7.456   1.00 59.62  ? 10   GLU A OE1   1 
ATOM   83   O OE2   . GLU A 1 10  ? -2.504  10.954  5.933   1.00 58.64  ? 10   GLU A OE2   1 
ATOM   84   N N     . ASP A 1 11  ? -0.682  16.691  4.103   1.00 63.93  ? 11   ASP A N     1 
ATOM   85   C CA    . ASP A 1 11  ? -0.424  17.100  2.711   1.00 65.09  ? 11   ASP A CA    1 
ATOM   86   C C     . ASP A 1 11  ? -1.563  17.993  2.202   1.00 65.05  ? 11   ASP A C     1 
ATOM   87   O O     . ASP A 1 11  ? -1.978  17.905  1.037   1.00 65.33  ? 11   ASP A O     1 
ATOM   88   C CB    . ASP A 1 11  ? -0.208  15.888  1.780   1.00 65.60  ? 11   ASP A CB    1 
ATOM   89   C CG    . ASP A 1 11  ? 0.917   14.952  2.251   1.00 67.39  ? 11   ASP A CG    1 
ATOM   90   O OD1   . ASP A 1 11  ? 2.017   15.444  2.630   1.00 68.80  ? 11   ASP A OD1   1 
ATOM   91   O OD2   . ASP A 1 11  ? 0.691   13.713  2.218   1.00 68.82  ? 11   ASP A OD2   1 
ATOM   92   N N     . GLY A 1 12  ? -2.065  18.839  3.102   1.00 64.91  ? 12   GLY A N     1 
ATOM   93   C CA    . GLY A 1 12  ? -3.190  19.725  2.819   1.00 64.63  ? 12   GLY A CA    1 
ATOM   94   C C     . GLY A 1 12  ? -4.566  19.068  2.801   1.00 64.36  ? 12   GLY A C     1 
ATOM   95   O O     . GLY A 1 12  ? -5.571  19.775  2.724   1.00 64.52  ? 12   GLY A O     1 
ATOM   96   N N     . LYS A 1 13  ? -4.613  17.730  2.857   1.00 63.93  ? 13   LYS A N     1 
ATOM   97   C CA    . LYS A 1 13  ? -5.872  16.947  2.810   1.00 63.41  ? 13   LYS A CA    1 
ATOM   98   C C     . LYS A 1 13  ? -6.361  16.490  4.214   1.00 63.09  ? 13   LYS A C     1 
ATOM   99   O O     . LYS A 1 13  ? -5.542  16.003  5.029   1.00 63.30  ? 13   LYS A O     1 
ATOM   100  C CB    . LYS A 1 13  ? -5.709  15.718  1.897   1.00 63.33  ? 13   LYS A CB    1 
ATOM   101  C CG    . LYS A 1 13  ? -5.672  16.041  0.414   1.00 63.60  ? 13   LYS A CG    1 
ATOM   102  C CD    . LYS A 1 13  ? -4.950  14.955  -0.373  1.00 64.16  ? 13   LYS A CD    1 
ATOM   103  N N     . PRO A 1 14  ? -7.692  16.630  4.496   1.00 62.09  ? 14   PRO A N     1 
ATOM   104  C CA    . PRO A 1 14  ? -8.300  16.239  5.778   1.00 60.88  ? 14   PRO A CA    1 
ATOM   105  C C     . PRO A 1 14  ? -8.379  14.725  5.970   1.00 59.69  ? 14   PRO A C     1 
ATOM   106  O O     . PRO A 1 14  ? -8.616  13.993  5.011   1.00 59.54  ? 14   PRO A O     1 
ATOM   107  C CB    . PRO A 1 14  ? -9.710  16.810  5.667   1.00 60.99  ? 14   PRO A CB    1 
ATOM   108  C CG    . PRO A 1 14  ? -10.002 16.763  4.215   1.00 61.26  ? 14   PRO A CG    1 
ATOM   109  C CD    . PRO A 1 14  ? -8.712  17.185  3.583   1.00 61.98  ? 14   PRO A CD    1 
ATOM   110  N N     . VAL A 1 15  ? -8.169  14.269  7.203   1.00 58.53  ? 15   VAL A N     1 
ATOM   111  C CA    . VAL A 1 15  ? -8.286  12.844  7.538   1.00 57.51  ? 15   VAL A CA    1 
ATOM   112  C C     . VAL A 1 15  ? -9.028  12.624  8.860   1.00 56.55  ? 15   VAL A C     1 
ATOM   113  O O     . VAL A 1 15  ? -8.655  13.162  9.911   1.00 56.56  ? 15   VAL A O     1 
ATOM   114  C CB    . VAL A 1 15  ? -6.923  12.112  7.616   1.00 57.73  ? 15   VAL A CB    1 
ATOM   115  C CG1   . VAL A 1 15  ? -7.121  10.620  7.340   1.00 57.67  ? 15   VAL A CG1   1 
ATOM   116  C CG2   . VAL A 1 15  ? -5.912  12.699  6.632   1.00 58.14  ? 15   VAL A CG2   1 
ATOM   117  N N     . ILE A 1 16  ? -10.073 11.812  8.791   1.00 54.98  ? 16   ILE A N     1 
ATOM   118  C CA    . ILE A 1 16  ? -10.925 11.559  9.930   1.00 53.23  ? 16   ILE A CA    1 
ATOM   119  C C     . ILE A 1 16  ? -10.299 10.450  10.757  1.00 52.24  ? 16   ILE A C     1 
ATOM   120  O O     . ILE A 1 16  ? -9.970  9.378   10.221  1.00 52.78  ? 16   ILE A O     1 
ATOM   121  C CB    . ILE A 1 16  ? -12.347 11.142  9.461   1.00 53.13  ? 16   ILE A CB    1 
ATOM   122  C CG1   . ILE A 1 16  ? -13.093 12.326  8.841   1.00 52.19  ? 16   ILE A CG1   1 
ATOM   123  C CG2   . ILE A 1 16  ? -13.153 10.541  10.593  1.00 53.38  ? 16   ILE A CG2   1 
ATOM   124  C CD1   . ILE A 1 16  ? -13.611 13.325  9.830   1.00 51.38  ? 16   ILE A CD1   1 
ATOM   125  N N     . ARG A 1 17  ? -10.120 10.714  12.050  1.00 50.25  ? 17   ARG A N     1 
ATOM   126  C CA    . ARG A 1 17  ? -9.807  9.662   13.014  1.00 48.36  ? 17   ARG A CA    1 
ATOM   127  C C     . ARG A 1 17  ? -11.045 9.309   13.840  1.00 47.28  ? 17   ARG A C     1 
ATOM   128  O O     . ARG A 1 17  ? -11.747 10.178  14.340  1.00 47.11  ? 17   ARG A O     1 
ATOM   129  C CB    . ARG A 1 17  ? -8.640  10.076  13.917  1.00 48.46  ? 17   ARG A CB    1 
ATOM   130  C CG    . ARG A 1 17  ? -7.355  10.410  13.140  1.00 47.77  ? 17   ARG A CG    1 
ATOM   131  C CD    . ARG A 1 17  ? -6.156  10.641  14.033  1.00 45.72  ? 17   ARG A CD    1 
ATOM   132  N NE    . ARG A 1 17  ? -6.319  11.851  14.832  1.00 45.67  ? 17   ARG A NE    1 
ATOM   133  C CZ    . ARG A 1 17  ? -5.482  12.253  15.787  1.00 45.07  ? 17   ARG A CZ    1 
ATOM   134  N NH1   . ARG A 1 17  ? -4.395  11.550  16.077  1.00 45.62  ? 17   ARG A NH1   1 
ATOM   135  N NH2   . ARG A 1 17  ? -5.733  13.365  16.467  1.00 44.56  ? 17   ARG A NH2   1 
ATOM   136  N N     . ILE A 1 18  ? -11.328 8.023   13.954  1.00 45.95  ? 18   ILE A N     1 
ATOM   137  C CA    . ILE A 1 18  ? -12.403 7.554   14.803  1.00 44.48  ? 18   ILE A CA    1 
ATOM   138  C C     . ILE A 1 18  ? -11.749 6.780   15.914  1.00 43.89  ? 18   ILE A C     1 
ATOM   139  O O     . ILE A 1 18  ? -11.139 5.759   15.653  1.00 44.07  ? 18   ILE A O     1 
ATOM   140  C CB    . ILE A 1 18  ? -13.374 6.627   14.044  1.00 44.23  ? 18   ILE A CB    1 
ATOM   141  C CG1   . ILE A 1 18  ? -14.021 7.372   12.879  1.00 44.14  ? 18   ILE A CG1   1 
ATOM   142  C CG2   . ILE A 1 18  ? -14.447 6.046   14.983  1.00 43.28  ? 18   ILE A CG2   1 
ATOM   143  C CD1   . ILE A 1 18  ? -13.411 7.038   11.528  1.00 45.04  ? 18   ILE A CD1   1 
ATOM   144  N N     . PHE A 1 19  ? -11.871 7.265   17.143  1.00 43.32  ? 19   PHE A N     1 
ATOM   145  C CA    . PHE A 1 19  ? -11.289 6.602   18.298  1.00 43.11  ? 19   PHE A CA    1 
ATOM   146  C C     . PHE A 1 19  ? -12.245 5.602   18.912  1.00 43.17  ? 19   PHE A C     1 
ATOM   147  O O     . PHE A 1 19  ? -13.364 5.945   19.297  1.00 43.22  ? 19   PHE A O     1 
ATOM   148  C CB    . PHE A 1 19  ? -10.876 7.628   19.325  1.00 42.98  ? 19   PHE A CB    1 
ATOM   149  C CG    . PHE A 1 19  ? -9.891  8.629   18.806  1.00 44.22  ? 19   PHE A CG    1 
ATOM   150  C CD1   . PHE A 1 19  ? -8.529  8.462   19.028  1.00 45.72  ? 19   PHE A CD1   1 
ATOM   151  C CD2   . PHE A 1 19  ? -10.315 9.736   18.097  1.00 45.25  ? 19   PHE A CD2   1 
ATOM   152  C CE1   . PHE A 1 19  ? -7.619  9.388   18.560  1.00 46.33  ? 19   PHE A CE1   1 
ATOM   153  C CE2   . PHE A 1 19  ? -9.402  10.669  17.616  1.00 46.55  ? 19   PHE A CE2   1 
ATOM   154  C CZ    . PHE A 1 19  ? -8.057  10.496  17.849  1.00 46.84  ? 19   PHE A CZ    1 
ATOM   155  N N     . LYS A 1 20  ? -11.799 4.353   18.987  1.00 43.27  ? 20   LYS A N     1 
ATOM   156  C CA    . LYS A 1 20  ? -12.631 3.261   19.477  1.00 43.19  ? 20   LYS A CA    1 
ATOM   157  C C     . LYS A 1 20  ? -11.963 2.557   20.643  1.00 43.56  ? 20   LYS A C     1 
ATOM   158  O O     . LYS A 1 20  ? -10.790 2.772   20.913  1.00 43.55  ? 20   LYS A O     1 
ATOM   159  C CB    . LYS A 1 20  ? -12.891 2.235   18.379  1.00 42.69  ? 20   LYS A CB    1 
ATOM   160  C CG    . LYS A 1 20  ? -13.391 2.790   17.087  1.00 42.89  ? 20   LYS A CG    1 
ATOM   161  C CD    . LYS A 1 20  ? -13.582 1.659   16.115  1.00 45.32  ? 20   LYS A CD    1 
ATOM   162  C CE    . LYS A 1 20  ? -14.507 2.027   14.969  1.00 47.86  ? 20   LYS A CE    1 
ATOM   163  N NZ    . LYS A 1 20  ? -15.000 0.761   14.336  1.00 50.48  ? 20   LYS A NZ    1 
ATOM   164  N N     . LYS A 1 21  ? -12.748 1.740   21.339  1.00 44.29  ? 21   LYS A N     1 
ATOM   165  C CA    . LYS A 1 21  ? -12.279 0.755   22.286  1.00 44.78  ? 21   LYS A CA    1 
ATOM   166  C C     . LYS A 1 21  ? -13.129 -0.482  22.019  1.00 46.05  ? 21   LYS A C     1 
ATOM   167  O O     . LYS A 1 21  ? -14.326 -0.461  22.269  1.00 46.26  ? 21   LYS A O     1 
ATOM   168  C CB    . LYS A 1 21  ? -12.498 1.253   23.701  1.00 44.28  ? 21   LYS A CB    1 
ATOM   169  C CG    . LYS A 1 21  ? -12.131 0.272   24.795  1.00 43.56  ? 21   LYS A CG    1 
ATOM   170  C CD    . LYS A 1 21  ? -10.657 0.373   25.201  1.00 43.04  ? 21   LYS A CD    1 
ATOM   171  C CE    . LYS A 1 21  ? -10.449 -0.199  26.585  1.00 43.00  ? 21   LYS A CE    1 
ATOM   172  N NZ    . LYS A 1 21  ? -11.446 -1.310  26.854  1.00 44.53  ? 21   LYS A NZ    1 
ATOM   173  N N     . GLU A 1 22  ? -12.524 -1.536  21.467  1.00 47.51  ? 22   GLU A N     1 
ATOM   174  C CA    . GLU A 1 22  ? -13.233 -2.800  21.167  1.00 48.76  ? 22   GLU A CA    1 
ATOM   175  C C     . GLU A 1 22  ? -12.499 -4.003  21.772  1.00 48.91  ? 22   GLU A C     1 
ATOM   176  O O     . GLU A 1 22  ? -11.315 -4.247  21.463  1.00 48.66  ? 22   GLU A O     1 
ATOM   177  C CB    . GLU A 1 22  ? -13.373 -3.026  19.654  1.00 49.04  ? 22   GLU A CB    1 
ATOM   178  C CG    . GLU A 1 22  ? -14.373 -2.162  18.887  1.00 50.80  ? 22   GLU A CG    1 
ATOM   179  C CD    . GLU A 1 22  ? -14.168 -2.293  17.366  1.00 54.34  ? 22   GLU A CD    1 
ATOM   180  O OE1   . GLU A 1 22  ? -13.414 -3.199  16.948  1.00 55.34  ? 22   GLU A OE1   1 
ATOM   181  O OE2   . GLU A 1 22  ? -14.738 -1.495  16.575  1.00 56.41  ? 22   GLU A OE2   1 
ATOM   182  N N     . ASN A 1 23  ? -13.219 -4.749  22.612  1.00 49.24  ? 23   ASN A N     1 
ATOM   183  C CA    . ASN A 1 23  ? -12.686 -5.905  23.353  1.00 49.69  ? 23   ASN A CA    1 
ATOM   184  C C     . ASN A 1 23  ? -11.383 -5.568  24.026  1.00 49.36  ? 23   ASN A C     1 
ATOM   185  O O     . ASN A 1 23  ? -10.331 -6.047  23.597  1.00 50.05  ? 23   ASN A O     1 
ATOM   186  C CB    . ASN A 1 23  ? -12.455 -7.107  22.432  1.00 49.95  ? 23   ASN A CB    1 
ATOM   187  C CG    . ASN A 1 23  ? -13.716 -7.569  21.755  1.00 51.93  ? 23   ASN A CG    1 
ATOM   188  O OD1   . ASN A 1 23  ? -14.718 -7.866  22.415  1.00 54.25  ? 23   ASN A OD1   1 
ATOM   189  N ND2   . ASN A 1 23  ? -13.681 -7.634  20.425  1.00 52.62  ? 23   ASN A ND2   1 
ATOM   190  N N     . GLY A 1 24  ? -11.437 -4.725  25.049  1.00 48.56  ? 24   GLY A N     1 
ATOM   191  C CA    . GLY A 1 24  ? -10.241 -4.352  25.788  1.00 47.72  ? 24   GLY A CA    1 
ATOM   192  C C     . GLY A 1 24  ? -9.130  -3.691  24.985  1.00 47.36  ? 24   GLY A C     1 
ATOM   193  O O     . GLY A 1 24  ? -8.081  -3.428  25.540  1.00 47.61  ? 24   GLY A O     1 
ATOM   194  N N     . GLU A 1 25  ? -9.334  -3.409  23.698  1.00 47.04  ? 25   GLU A N     1 
ATOM   195  C CA    . GLU A 1 25  ? -8.248  -2.835  22.891  1.00 47.58  ? 25   GLU A CA    1 
ATOM   196  C C     . GLU A 1 25  ? -8.555  -1.443  22.308  1.00 47.05  ? 25   GLU A C     1 
ATOM   197  O O     . GLU A 1 25  ? -9.482  -1.292  21.517  1.00 47.12  ? 25   GLU A O     1 
ATOM   198  C CB    . GLU A 1 25  ? -7.780  -3.798  21.754  1.00 48.16  ? 25   GLU A CB    1 
ATOM   199  C CG    . GLU A 1 25  ? -7.342  -5.270  22.132  1.00 50.42  ? 25   GLU A CG    1 
ATOM   200  C CD    . GLU A 1 25  ? -6.608  -5.416  23.503  1.00 53.76  ? 25   GLU A CD    1 
ATOM   201  O OE1   . GLU A 1 25  ? -5.596  -4.702  23.757  1.00 54.12  ? 25   GLU A OE1   1 
ATOM   202  O OE2   . GLU A 1 25  ? -7.057  -6.260  24.329  1.00 53.82  ? 25   GLU A OE2   1 
ATOM   203  N N     . PHE A 1 26  ? -7.765  -0.438  22.684  1.00 46.48  ? 26   PHE A N     1 
ATOM   204  C CA    . PHE A 1 26  ? -7.870  0.889   22.074  1.00 45.86  ? 26   PHE A CA    1 
ATOM   205  C C     . PHE A 1 26  ? -7.428  0.840   20.621  1.00 45.92  ? 26   PHE A C     1 
ATOM   206  O O     . PHE A 1 26  ? -6.436  0.199   20.328  1.00 46.20  ? 26   PHE A O     1 
ATOM   207  C CB    . PHE A 1 26  ? -7.020  1.928   22.823  1.00 45.34  ? 26   PHE A CB    1 
ATOM   208  C CG    . PHE A 1 26  ? -6.897  3.230   22.087  1.00 44.73  ? 26   PHE A CG    1 
ATOM   209  C CD1   . PHE A 1 26  ? -8.006  4.073   21.942  1.00 44.81  ? 26   PHE A CD1   1 
ATOM   210  C CD2   . PHE A 1 26  ? -5.701  3.595   21.484  1.00 43.84  ? 26   PHE A CD2   1 
ATOM   211  C CE1   . PHE A 1 26  ? -7.918  5.283   21.224  1.00 44.94  ? 26   PHE A CE1   1 
ATOM   212  C CE2   . PHE A 1 26  ? -5.595  4.801   20.756  1.00 44.73  ? 26   PHE A CE2   1 
ATOM   213  C CZ    . PHE A 1 26  ? -6.707  5.650   20.628  1.00 44.94  ? 26   PHE A CZ    1 
ATOM   214  N N     . LYS A 1 27  ? -8.141  1.519   19.718  1.00 46.21  ? 27   LYS A N     1 
ATOM   215  C CA    . LYS A 1 27  ? -7.703  1.648   18.308  1.00 46.62  ? 27   LYS A CA    1 
ATOM   216  C C     . LYS A 1 27  ? -8.247  2.873   17.555  1.00 47.02  ? 27   LYS A C     1 
ATOM   217  O O     . LYS A 1 27  ? -9.346  3.359   17.841  1.00 47.42  ? 27   LYS A O     1 
ATOM   218  C CB    . LYS A 1 27  ? -7.972  0.367   17.495  1.00 46.71  ? 27   LYS A CB    1 
ATOM   219  C CG    . LYS A 1 27  ? -9.422  0.081   17.174  1.00 46.24  ? 27   LYS A CG    1 
ATOM   220  C CD    . LYS A 1 27  ? -9.556  -0.766  15.895  1.00 48.22  ? 27   LYS A CD    1 
ATOM   221  N N     . ILE A 1 28  ? -7.485  3.331   16.566  1.00 46.93  ? 28   ILE A N     1 
ATOM   222  C CA    . ILE A 1 28  ? -7.814  4.525   15.823  1.00 47.12  ? 28   ILE A CA    1 
ATOM   223  C C     . ILE A 1 28  ? -8.088  4.164   14.363  1.00 47.86  ? 28   ILE A C     1 
ATOM   224  O O     . ILE A 1 28  ? -7.180  3.737   13.664  1.00 48.21  ? 28   ILE A O     1 
ATOM   225  C CB    . ILE A 1 28  ? -6.634  5.514   15.888  1.00 47.03  ? 28   ILE A CB    1 
ATOM   226  C CG1   . ILE A 1 28  ? -6.188  5.744   17.342  1.00 46.67  ? 28   ILE A CG1   1 
ATOM   227  C CG2   . ILE A 1 28  ? -6.958  6.827   15.141  1.00 47.21  ? 28   ILE A CG2   1 
ATOM   228  C CD1   . ILE A 1 28  ? -5.087  6.811   17.518  1.00 44.95  ? 28   ILE A CD1   1 
ATOM   229  N N     . ASP A 1 29  ? -9.318  4.322   13.887  1.00 48.50  ? 29   ASP A N     1 
ATOM   230  C CA    . ASP A 1 29  ? -9.577  4.060   12.474  1.00 49.86  ? 29   ASP A CA    1 
ATOM   231  C C     . ASP A 1 29  ? -9.440  5.336   11.653  1.00 50.56  ? 29   ASP A C     1 
ATOM   232  O O     . ASP A 1 29  ? -9.551  6.438   12.191  1.00 50.71  ? 29   ASP A O     1 
ATOM   233  C CB    . ASP A 1 29  ? -10.947 3.413   12.244  1.00 50.34  ? 29   ASP A CB    1 
ATOM   234  C CG    . ASP A 1 29  ? -10.996 1.942   12.669  1.00 51.55  ? 29   ASP A CG    1 
ATOM   235  O OD1   . ASP A 1 29  ? -9.946  1.250   12.673  1.00 52.14  ? 29   ASP A OD1   1 
ATOM   236  O OD2   . ASP A 1 29  ? -12.112 1.478   13.001  1.00 53.00  ? 29   ASP A OD2   1 
ATOM   237  N N     . TYR A 1 30  ? -9.191  5.195   10.353  1.00 51.39  ? 30   TYR A N     1 
ATOM   238  C CA    . TYR A 1 30  ? -8.942  6.366   9.518   1.00 52.20  ? 30   TYR A CA    1 
ATOM   239  C C     . TYR A 1 30  ? -9.894  6.455   8.344   1.00 53.36  ? 30   TYR A C     1 
ATOM   240  O O     . TYR A 1 30  ? -10.363 5.445   7.833   1.00 53.55  ? 30   TYR A O     1 
ATOM   241  C CB    . TYR A 1 30  ? -7.486  6.374   9.044   1.00 51.75  ? 30   TYR A CB    1 
ATOM   242  C CG    . TYR A 1 30  ? -6.497  6.543   10.181  1.00 50.66  ? 30   TYR A CG    1 
ATOM   243  C CD1   . TYR A 1 30  ? -6.082  5.442   10.949  1.00 48.76  ? 30   TYR A CD1   1 
ATOM   244  C CD2   . TYR A 1 30  ? -5.989  7.810   10.506  1.00 49.14  ? 30   TYR A CD2   1 
ATOM   245  C CE1   . TYR A 1 30  ? -5.187  5.600   12.011  1.00 48.26  ? 30   TYR A CE1   1 
ATOM   246  C CE2   . TYR A 1 30  ? -5.085  7.976   11.561  1.00 48.32  ? 30   TYR A CE2   1 
ATOM   247  C CZ    . TYR A 1 30  ? -4.689  6.867   12.309  1.00 48.58  ? 30   TYR A CZ    1 
ATOM   248  O OH    . TYR A 1 30  ? -3.802  7.029   13.358  1.00 49.44  ? 30   TYR A OH    1 
ATOM   249  N N     . ASP A 1 31  ? -10.204 7.673   7.933   1.00 55.05  ? 31   ASP A N     1 
ATOM   250  C CA    . ASP A 1 31  ? -11.001 7.864   6.730   1.00 56.99  ? 31   ASP A CA    1 
ATOM   251  C C     . ASP A 1 31  ? -10.447 9.059   5.945   1.00 57.93  ? 31   ASP A C     1 
ATOM   252  O O     . ASP A 1 31  ? -10.356 10.186  6.459   1.00 57.74  ? 31   ASP A O     1 
ATOM   253  C CB    . ASP A 1 31  ? -12.493 8.020   7.071   1.00 57.08  ? 31   ASP A CB    1 
ATOM   254  C CG    . ASP A 1 31  ? -13.420 7.745   5.878   1.00 58.26  ? 31   ASP A CG    1 
ATOM   255  O OD1   . ASP A 1 31  ? -12.998 7.895   4.702   1.00 59.29  ? 31   ASP A OD1   1 
ATOM   256  O OD2   . ASP A 1 31  ? -14.603 7.399   6.129   1.00 59.56  ? 31   ASP A OD2   1 
ATOM   257  N N     . ARG A 1 32  ? -10.049 8.777   4.705   1.00 59.15  ? 32   ARG A N     1 
ATOM   258  C CA    . ARG A 1 32  ? -9.436  9.774   3.827   1.00 60.39  ? 32   ARG A CA    1 
ATOM   259  C C     . ARG A 1 32  ? -10.418 10.173  2.705   1.00 61.03  ? 32   ARG A C     1 
ATOM   260  O O     . ARG A 1 32  ? -10.083 10.950  1.806   1.00 61.03  ? 32   ARG A O     1 
ATOM   261  C CB    . ARG A 1 32  ? -8.125  9.211   3.249   1.00 60.31  ? 32   ARG A CB    1 
ATOM   262  C CG    . ARG A 1 32  ? -7.495  8.110   4.123   1.00 60.88  ? 32   ARG A CG    1 
ATOM   263  C CD    . ARG A 1 32  ? -6.075  7.711   3.708   1.00 60.28  ? 32   ARG A CD    1 
ATOM   264  N NE    . ARG A 1 32  ? -5.394  7.050   4.821   1.00 59.49  ? 32   ARG A NE    1 
ATOM   265  C CZ    . ARG A 1 32  ? -4.482  7.627   5.610   1.00 58.84  ? 32   ARG A CZ    1 
ATOM   266  N NH1   . ARG A 1 32  ? -3.934  6.935   6.613   1.00 57.26  ? 32   ARG A NH1   1 
ATOM   267  N NH2   . ARG A 1 32  ? -4.109  8.890   5.397   1.00 57.70  ? 32   ARG A NH2   1 
ATOM   268  N N     . ASN A 1 33  ? -11.641 9.651   2.783   1.00 61.66  ? 33   ASN A N     1 
ATOM   269  C CA    . ASN A 1 33  ? -12.605 9.777   1.690   1.00 62.15  ? 33   ASN A CA    1 
ATOM   270  C C     . ASN A 1 33  ? -13.781 10.712  1.977   1.00 62.09  ? 33   ASN A C     1 
ATOM   271  O O     . ASN A 1 33  ? -14.639 10.934  1.113   1.00 62.08  ? 33   ASN A O     1 
ATOM   272  C CB    . ASN A 1 33  ? -13.109 8.389   1.294   1.00 62.45  ? 33   ASN A CB    1 
ATOM   273  C CG    . ASN A 1 33  ? -11.973 7.429   1.011   1.00 63.35  ? 33   ASN A CG    1 
ATOM   274  O OD1   . ASN A 1 33  ? -11.024 7.767   0.293   1.00 63.59  ? 33   ASN A OD1   1 
ATOM   275  N ND2   . ASN A 1 33  ? -12.052 6.228   1.582   1.00 64.00  ? 33   ASN A ND2   1 
ATOM   276  N N     . PHE A 1 34  ? -13.807 11.280  3.176   1.00 61.66  ? 34   PHE A N     1 
ATOM   277  C CA    . PHE A 1 34  ? -14.939 12.089  3.567   1.00 61.27  ? 34   PHE A CA    1 
ATOM   278  C C     . PHE A 1 34  ? -14.829 13.564  3.128   1.00 60.74  ? 34   PHE A C     1 
ATOM   279  O O     . PHE A 1 34  ? -14.004 14.312  3.645   1.00 60.72  ? 34   PHE A O     1 
ATOM   280  C CB    . PHE A 1 34  ? -15.197 11.940  5.075   1.00 61.59  ? 34   PHE A CB    1 
ATOM   281  C CG    . PHE A 1 34  ? -16.605 12.291  5.477   1.00 61.92  ? 34   PHE A CG    1 
ATOM   282  C CD1   . PHE A 1 34  ? -17.682 11.522  5.031   1.00 62.05  ? 34   PHE A CD1   1 
ATOM   283  C CD2   . PHE A 1 34  ? -16.854 13.401  6.273   1.00 61.94  ? 34   PHE A CD2   1 
ATOM   284  C CE1   . PHE A 1 34  ? -18.983 11.851  5.372   1.00 62.12  ? 34   PHE A CE1   1 
ATOM   285  C CE2   . PHE A 1 34  ? -18.147 13.736  6.619   1.00 62.54  ? 34   PHE A CE2   1 
ATOM   286  C CZ    . PHE A 1 34  ? -19.218 12.958  6.166   1.00 62.41  ? 34   PHE A CZ    1 
ATOM   287  N N     . GLU A 1 35  ? -15.673 13.976  2.181   1.00 60.08  ? 35   GLU A N     1 
ATOM   288  C CA    . GLU A 1 35  ? -15.648 15.355  1.681   1.00 59.76  ? 35   GLU A CA    1 
ATOM   289  C C     . GLU A 1 35  ? -16.512 16.323  2.494   1.00 59.14  ? 35   GLU A C     1 
ATOM   290  O O     . GLU A 1 35  ? -17.696 16.059  2.738   1.00 59.02  ? 35   GLU A O     1 
ATOM   291  C CB    . GLU A 1 35  ? -16.089 15.411  0.215   1.00 60.22  ? 35   GLU A CB    1 
ATOM   292  C CG    . GLU A 1 35  ? -15.010 15.094  -0.833  1.00 61.92  ? 35   GLU A CG    1 
ATOM   293  C CD    . GLU A 1 35  ? -15.559 14.268  -2.001  1.00 64.14  ? 35   GLU A CD    1 
ATOM   294  O OE1   . GLU A 1 35  ? -16.242 14.827  -2.893  1.00 64.78  ? 35   GLU A OE1   1 
ATOM   295  O OE2   . GLU A 1 35  ? -15.309 13.045  -2.022  1.00 65.05  ? 35   GLU A OE2   1 
ATOM   296  N N     . PRO A 1 36  ? -15.927 17.465  2.892   1.00 58.52  ? 36   PRO A N     1 
ATOM   297  C CA    . PRO A 1 36  ? -16.668 18.600  3.450   1.00 58.09  ? 36   PRO A CA    1 
ATOM   298  C C     . PRO A 1 36  ? -17.604 19.201  2.402   1.00 57.49  ? 36   PRO A C     1 
ATOM   299  O O     . PRO A 1 36  ? -17.341 19.080  1.210   1.00 57.77  ? 36   PRO A O     1 
ATOM   300  C CB    . PRO A 1 36  ? -15.563 19.613  3.783   1.00 58.15  ? 36   PRO A CB    1 
ATOM   301  C CG    . PRO A 1 36  ? -14.436 19.251  2.894   1.00 58.22  ? 36   PRO A CG    1 
ATOM   302  C CD    . PRO A 1 36  ? -14.486 17.749  2.819   1.00 58.56  ? 36   PRO A CD    1 
ATOM   303  N N     . TYR A 1 37  ? -18.689 19.833  2.833   1.00 56.61  ? 37   TYR A N     1 
ATOM   304  C CA    . TYR A 1 37  ? -19.644 20.397  1.894   1.00 55.72  ? 37   TYR A CA    1 
ATOM   305  C C     . TYR A 1 37  ? -20.588 21.375  2.557   1.00 55.21  ? 37   TYR A C     1 
ATOM   306  O O     . TYR A 1 37  ? -20.790 21.331  3.770   1.00 55.31  ? 37   TYR A O     1 
ATOM   307  C CB    . TYR A 1 37  ? -20.450 19.289  1.212   1.00 55.68  ? 37   TYR A CB    1 
ATOM   308  C CG    . TYR A 1 37  ? -21.272 18.480  2.165   1.00 55.70  ? 37   TYR A CG    1 
ATOM   309  C CD1   . TYR A 1 37  ? -22.442 19.001  2.707   1.00 56.15  ? 37   TYR A CD1   1 
ATOM   310  C CD2   . TYR A 1 37  ? -20.888 17.183  2.526   1.00 56.15  ? 37   TYR A CD2   1 
ATOM   311  C CE1   . TYR A 1 37  ? -23.208 18.266  3.598   1.00 56.77  ? 37   TYR A CE1   1 
ATOM   312  C CE2   . TYR A 1 37  ? -21.655 16.428  3.410   1.00 55.92  ? 37   TYR A CE2   1 
ATOM   313  C CZ    . TYR A 1 37  ? -22.813 16.985  3.945   1.00 56.18  ? 37   TYR A CZ    1 
ATOM   314  O OH    . TYR A 1 37  ? -23.598 16.286  4.823   1.00 56.39  ? 37   TYR A OH    1 
ATOM   315  N N     . ILE A 1 38  ? -21.150 22.268  1.751   1.00 54.55  ? 38   ILE A N     1 
ATOM   316  C CA    . ILE A 1 38  ? -22.281 23.063  2.182   1.00 54.25  ? 38   ILE A CA    1 
ATOM   317  C C     . ILE A 1 38  ? -23.420 22.962  1.167   1.00 54.30  ? 38   ILE A C     1 
ATOM   318  O O     . ILE A 1 38  ? -23.318 22.239  0.179   1.00 54.36  ? 38   ILE A O     1 
ATOM   319  C CB    . ILE A 1 38  ? -21.905 24.539  2.545   1.00 54.02  ? 38   ILE A CB    1 
ATOM   320  C CG1   . ILE A 1 38  ? -21.708 25.420  1.310   1.00 53.65  ? 38   ILE A CG1   1 
ATOM   321  C CG2   . ILE A 1 38  ? -20.691 24.577  3.466   1.00 53.74  ? 38   ILE A CG2   1 
ATOM   322  C CD1   . ILE A 1 38  ? -21.582 26.921  1.661   1.00 52.20  ? 38   ILE A CD1   1 
ATOM   323  N N     . TYR A 1 39  ? -24.523 23.642  1.453   1.00 54.32  ? 39   TYR A N     1 
ATOM   324  C CA    . TYR A 1 39  ? -25.639 23.702  0.540   1.00 54.43  ? 39   TYR A CA    1 
ATOM   325  C C     . TYR A 1 39  ? -25.887 25.146  0.141   1.00 55.57  ? 39   TYR A C     1 
ATOM   326  O O     . TYR A 1 39  ? -25.895 26.050  0.992   1.00 55.27  ? 39   TYR A O     1 
ATOM   327  C CB    . TYR A 1 39  ? -26.881 23.122  1.188   1.00 53.48  ? 39   TYR A CB    1 
ATOM   328  C CG    . TYR A 1 39  ? -26.825 21.635  1.388   1.00 51.74  ? 39   TYR A CG    1 
ATOM   329  C CD1   . TYR A 1 39  ? -26.986 20.772  0.316   1.00 50.06  ? 39   TYR A CD1   1 
ATOM   330  C CD2   . TYR A 1 39  ? -26.630 21.085  2.659   1.00 49.90  ? 39   TYR A CD2   1 
ATOM   331  C CE1   . TYR A 1 39  ? -26.951 19.388  0.495   1.00 50.03  ? 39   TYR A CE1   1 
ATOM   332  C CE2   . TYR A 1 39  ? -26.593 19.702  2.851   1.00 49.26  ? 39   TYR A CE2   1 
ATOM   333  C CZ    . TYR A 1 39  ? -26.750 18.859  1.762   1.00 49.63  ? 39   TYR A CZ    1 
ATOM   334  O OH    . TYR A 1 39  ? -26.713 17.487  1.917   1.00 50.52  ? 39   TYR A OH    1 
ATOM   335  N N     . ALA A 1 40  ? -26.069 25.353  -1.162  1.00 57.00  ? 40   ALA A N     1 
ATOM   336  C CA    . ALA A 1 40  ? -26.437 26.659  -1.691  1.00 58.54  ? 40   ALA A CA    1 
ATOM   337  C C     . ALA A 1 40  ? -27.761 26.583  -2.456  1.00 59.68  ? 40   ALA A C     1 
ATOM   338  O O     . ALA A 1 40  ? -28.012 25.615  -3.203  1.00 59.36  ? 40   ALA A O     1 
ATOM   339  C CB    . ALA A 1 40  ? -25.331 27.202  -2.570  1.00 58.36  ? 40   ALA A CB    1 
ATOM   340  N N     . LEU A 1 41  ? -28.600 27.599  -2.235  1.00 61.17  ? 41   LEU A N     1 
ATOM   341  C CA    . LEU A 1 41  ? -29.871 27.776  -2.949  1.00 62.92  ? 41   LEU A CA    1 
ATOM   342  C C     . LEU A 1 41  ? -29.753 28.852  -4.034  1.00 64.50  ? 41   LEU A C     1 
ATOM   343  O O     . LEU A 1 41  ? -29.401 30.012  -3.755  1.00 64.34  ? 41   LEU A O     1 
ATOM   344  C CB    . LEU A 1 41  ? -31.000 28.150  -1.977  1.00 62.57  ? 41   LEU A CB    1 
ATOM   345  C CG    . LEU A 1 41  ? -32.383 28.471  -2.571  1.00 61.83  ? 41   LEU A CG    1 
ATOM   346  C CD1   . LEU A 1 41  ? -33.124 27.205  -2.988  1.00 59.59  ? 41   LEU A CD1   1 
ATOM   347  C CD2   . LEU A 1 41  ? -33.226 29.298  -1.605  1.00 60.51  ? 41   LEU A CD2   1 
ATOM   348  N N     . LEU A 1 42  ? -30.085 28.461  -5.263  1.00 66.55  ? 42   LEU A N     1 
ATOM   349  C CA    . LEU A 1 42  ? -29.940 29.328  -6.439  1.00 68.55  ? 42   LEU A CA    1 
ATOM   350  C C     . LEU A 1 42  ? -31.273 29.826  -6.992  1.00 69.95  ? 42   LEU A C     1 
ATOM   351  O O     . LEU A 1 42  ? -32.264 29.089  -6.989  1.00 69.99  ? 42   LEU A O     1 
ATOM   352  C CB    . LEU A 1 42  ? -29.194 28.581  -7.553  1.00 68.33  ? 42   LEU A CB    1 
ATOM   353  C CG    . LEU A 1 42  ? -27.832 27.970  -7.214  1.00 68.33  ? 42   LEU A CG    1 
ATOM   354  C CD1   . LEU A 1 42  ? -27.237 27.337  -8.455  1.00 68.47  ? 42   LEU A CD1   1 
ATOM   355  C CD2   . LEU A 1 42  ? -26.876 29.000  -6.617  1.00 67.42  ? 42   LEU A CD2   1 
ATOM   356  N N     . LYS A 1 43  ? -31.276 31.072  -7.480  1.00 71.92  ? 43   LYS A N     1 
ATOM   357  C CA    . LYS A 1 43  ? -32.420 31.635  -8.217  1.00 73.54  ? 43   LYS A CA    1 
ATOM   358  C C     . LYS A 1 43  ? -32.695 30.800  -9.469  1.00 75.00  ? 43   LYS A C     1 
ATOM   359  O O     . LYS A 1 43  ? -33.811 30.325  -9.658  1.00 75.06  ? 43   LYS A O     1 
ATOM   360  C CB    . LYS A 1 43  ? -32.213 33.127  -8.540  1.00 73.11  ? 43   LYS A CB    1 
ATOM   361  C CG    . LYS A 1 43  ? -32.755 34.084  -7.460  1.00 73.14  ? 43   LYS A CG    1 
ATOM   362  C CD    . LYS A 1 43  ? -32.162 35.504  -7.530  1.00 72.10  ? 43   LYS A CD    1 
ATOM   363  N N     . ASP A 1 44  ? -31.673 30.593  -10.298 1.00 77.16  ? 44   ASP A N     1 
ATOM   364  C CA    . ASP A 1 44  ? -31.806 29.691  -11.449 1.00 79.39  ? 44   ASP A CA    1 
ATOM   365  C C     . ASP A 1 44  ? -30.694 28.647  -11.530 1.00 80.41  ? 44   ASP A C     1 
ATOM   366  O O     . ASP A 1 44  ? -29.509 28.949  -11.339 1.00 80.31  ? 44   ASP A O     1 
ATOM   367  C CB    . ASP A 1 44  ? -31.922 30.452  -12.791 1.00 79.82  ? 44   ASP A CB    1 
ATOM   368  C CG    . ASP A 1 44  ? -32.628 29.616  -13.886 1.00 81.08  ? 44   ASP A CG    1 
ATOM   369  O OD1   . ASP A 1 44  ? -31.985 29.259  -14.909 1.00 81.44  ? 44   ASP A OD1   1 
ATOM   370  O OD2   . ASP A 1 44  ? -33.829 29.302  -13.709 1.00 82.16  ? 44   ASP A OD2   1 
ATOM   371  N N     . ASP A 1 45  ? -31.115 27.427  -11.855 1.00 81.86  ? 45   ASP A N     1 
ATOM   372  C CA    . ASP A 1 45  ? -30.260 26.255  -11.969 1.00 83.36  ? 45   ASP A CA    1 
ATOM   373  C C     . ASP A 1 45  ? -29.106 26.391  -12.979 1.00 84.26  ? 45   ASP A C     1 
ATOM   374  O O     . ASP A 1 45  ? -28.282 25.477  -13.118 1.00 84.45  ? 45   ASP A O     1 
ATOM   375  C CB    . ASP A 1 45  ? -31.139 25.066  -12.355 1.00 83.55  ? 45   ASP A CB    1 
ATOM   376  C CG    . ASP A 1 45  ? -30.806 23.812  -11.566 1.00 84.70  ? 45   ASP A CG    1 
ATOM   377  O OD1   . ASP A 1 45  ? -31.081 23.789  -10.334 1.00 85.02  ? 45   ASP A OD1   1 
ATOM   378  O OD2   . ASP A 1 45  ? -30.284 22.850  -12.184 1.00 85.30  ? 45   ASP A OD2   1 
ATOM   379  N N     . SER A 1 46  ? -29.047 27.525  -13.678 1.00 85.46  ? 46   SER A N     1 
ATOM   380  C CA    . SER A 1 46  ? -28.064 27.744  -14.755 1.00 86.40  ? 46   SER A CA    1 
ATOM   381  C C     . SER A 1 46  ? -26.794 28.448  -14.271 1.00 86.89  ? 46   SER A C     1 
ATOM   382  O O     . SER A 1 46  ? -25.679 28.025  -14.610 1.00 87.10  ? 46   SER A O     1 
ATOM   383  C CB    . SER A 1 46  ? -28.685 28.534  -15.922 1.00 86.43  ? 46   SER A CB    1 
ATOM   384  O OG    . SER A 1 46  ? -28.687 29.932  -15.656 1.00 86.63  ? 46   SER A OG    1 
ATOM   385  N N     . ALA A 1 47  ? -26.974 29.518  -13.490 1.00 87.32  ? 47   ALA A N     1 
ATOM   386  C CA    . ALA A 1 47  ? -25.868 30.307  -12.942 1.00 87.68  ? 47   ALA A CA    1 
ATOM   387  C C     . ALA A 1 47  ? -24.877 29.469  -12.106 1.00 87.98  ? 47   ALA A C     1 
ATOM   388  O O     . ALA A 1 47  ? -23.932 30.010  -11.519 1.00 88.06  ? 47   ALA A O     1 
ATOM   389  C CB    . ALA A 1 47  ? -26.412 31.478  -12.134 1.00 87.59  ? 47   ALA A CB    1 
ATOM   390  N N     . ILE A 1 48  ? -25.092 28.151  -12.081 1.00 88.22  ? 48   ILE A N     1 
ATOM   391  C CA    . ILE A 1 48  ? -24.221 27.202  -11.380 1.00 88.54  ? 48   ILE A CA    1 
ATOM   392  C C     . ILE A 1 48  ? -22.751 27.339  -11.783 1.00 88.71  ? 48   ILE A C     1 
ATOM   393  O O     . ILE A 1 48  ? -21.858 27.191  -10.942 1.00 88.70  ? 48   ILE A O     1 
ATOM   394  C CB    . ILE A 1 48  ? -24.713 25.712  -11.543 1.00 88.58  ? 48   ILE A CB    1 
ATOM   395  C CG1   . ILE A 1 48  ? -23.903 24.743  -10.664 1.00 88.98  ? 48   ILE A CG1   1 
ATOM   396  C CG2   . ILE A 1 48  ? -24.678 25.250  -13.005 1.00 88.41  ? 48   ILE A CG2   1 
ATOM   397  C CD1   . ILE A 1 48  ? -23.912 25.061  -9.168  1.00 88.73  ? 48   ILE A CD1   1 
ATOM   398  N N     . GLU A 1 49  ? -22.520 27.644  -13.062 1.00 88.91  ? 49   GLU A N     1 
ATOM   399  C CA    . GLU A 1 49  ? -21.171 27.708  -13.638 1.00 88.86  ? 49   GLU A CA    1 
ATOM   400  C C     . GLU A 1 49  ? -20.372 28.891  -13.139 1.00 88.83  ? 49   GLU A C     1 
ATOM   401  O O     . GLU A 1 49  ? -19.151 28.799  -12.985 1.00 88.58  ? 49   GLU A O     1 
ATOM   402  C CB    . GLU A 1 49  ? -21.225 27.722  -15.168 1.00 88.85  ? 49   GLU A CB    1 
ATOM   403  C CG    . GLU A 1 49  ? -21.675 26.408  -15.780 1.00 88.91  ? 49   GLU A CG    1 
ATOM   404  C CD    . GLU A 1 49  ? -21.220 25.198  -14.981 1.00 89.23  ? 49   GLU A CD    1 
ATOM   405  O OE1   . GLU A 1 49  ? -20.123 25.232  -14.373 1.00 88.88  ? 49   GLU A OE1   1 
ATOM   406  O OE2   . GLU A 1 49  ? -21.976 24.209  -14.957 1.00 89.99  ? 49   GLU A OE2   1 
ATOM   407  N N     . ASP A 1 50  ? -21.075 29.995  -12.897 1.00 88.92  ? 50   ASP A N     1 
ATOM   408  C CA    . ASP A 1 50  ? -20.483 31.191  -12.319 1.00 89.15  ? 50   ASP A CA    1 
ATOM   409  C C     . ASP A 1 50  ? -20.072 30.894  -10.881 1.00 89.27  ? 50   ASP A C     1 
ATOM   410  O O     . ASP A 1 50  ? -19.037 31.370  -10.410 1.00 89.38  ? 50   ASP A O     1 
ATOM   411  C CB    . ASP A 1 50  ? -21.486 32.343  -12.355 1.00 89.20  ? 50   ASP A CB    1 
ATOM   412  C CG    . ASP A 1 50  ? -20.839 33.677  -12.692 1.00 89.41  ? 50   ASP A CG    1 
ATOM   413  O OD1   . ASP A 1 50  ? -20.011 34.177  -11.894 1.00 88.87  ? 50   ASP A OD1   1 
ATOM   414  O OD2   . ASP A 1 50  ? -21.178 34.232  -13.761 1.00 89.58  ? 50   ASP A OD2   1 
ATOM   415  N N     . VAL A 1 51  ? -20.884 30.083  -10.202 1.00 89.36  ? 51   VAL A N     1 
ATOM   416  C CA    . VAL A 1 51  ? -20.621 29.680  -8.821  1.00 89.28  ? 51   VAL A CA    1 
ATOM   417  C C     . VAL A 1 51  ? -19.565 28.563  -8.741  1.00 89.10  ? 51   VAL A C     1 
ATOM   418  O O     . VAL A 1 51  ? -18.583 28.703  -8.004  1.00 88.94  ? 51   VAL A O     1 
ATOM   419  C CB    . VAL A 1 51  ? -21.940 29.304  -8.067  1.00 89.50  ? 51   VAL A CB    1 
ATOM   420  C CG1   . VAL A 1 51  ? -21.645 28.740  -6.673  1.00 89.53  ? 51   VAL A CG1   1 
ATOM   421  C CG2   . VAL A 1 51  ? -22.874 30.523  -7.965  1.00 89.33  ? 51   VAL A CG2   1 
ATOM   422  N N     . LYS A 1 52  ? -19.762 27.480  -9.505  1.00 88.84  ? 52   LYS A N     1 
ATOM   423  C CA    . LYS A 1 52  ? -18.825 26.341  -9.561  1.00 88.69  ? 52   LYS A CA    1 
ATOM   424  C C     . LYS A 1 52  ? -17.397 26.801  -9.914  1.00 89.03  ? 52   LYS A C     1 
ATOM   425  O O     . LYS A 1 52  ? -16.535 25.987  -10.276 1.00 89.05  ? 52   LYS A O     1 
ATOM   426  C CB    . LYS A 1 52  ? -19.334 25.282  -10.558 1.00 88.46  ? 52   LYS A CB    1 
ATOM   427  C CG    . LYS A 1 52  ? -18.624 23.926  -10.503 1.00 88.00  ? 52   LYS A CG    1 
ATOM   428  C CD    . LYS A 1 52  ? -19.227 22.924  -11.482 1.00 87.25  ? 52   LYS A CD    1 
ATOM   429  N N     . LYS A 1 53  ? -17.164 28.112  -9.793  1.00 89.26  ? 53   LYS A N     1 
ATOM   430  C CA    . LYS A 1 53  ? -15.903 28.761  -10.169 1.00 89.43  ? 53   LYS A CA    1 
ATOM   431  C C     . LYS A 1 53  ? -15.542 29.915  -9.233  1.00 89.42  ? 53   LYS A C     1 
ATOM   432  O O     . LYS A 1 53  ? -14.642 30.701  -9.538  1.00 89.55  ? 53   LYS A O     1 
ATOM   433  C CB    . LYS A 1 53  ? -15.956 29.268  -11.621 1.00 89.44  ? 53   LYS A CB    1 
ATOM   434  N N     . ILE A 1 54  ? -16.242 30.024  -8.104  1.00 89.32  ? 54   ILE A N     1 
ATOM   435  C CA    . ILE A 1 54  ? -15.884 31.020  -7.086  1.00 89.18  ? 54   ILE A CA    1 
ATOM   436  C C     . ILE A 1 54  ? -14.615 30.563  -6.367  1.00 89.02  ? 54   ILE A C     1 
ATOM   437  O O     . ILE A 1 54  ? -14.276 29.366  -6.360  1.00 88.69  ? 54   ILE A O     1 
ATOM   438  C CB    . ILE A 1 54  ? -17.037 31.325  -6.065  1.00 89.27  ? 54   ILE A CB    1 
ATOM   439  C CG1   . ILE A 1 54  ? -18.326 31.717  -6.793  1.00 89.39  ? 54   ILE A CG1   1 
ATOM   440  C CG2   . ILE A 1 54  ? -16.642 32.456  -5.088  1.00 88.81  ? 54   ILE A CG2   1 
ATOM   441  C CD1   . ILE A 1 54  ? -19.542 31.842  -5.889  1.00 89.73  ? 54   ILE A CD1   1 
ATOM   442  N N     . THR A 1 55  ? -13.921 31.539  -5.782  1.00 89.02  ? 55   THR A N     1 
ATOM   443  C CA    . THR A 1 55  ? -12.613 31.342  -5.177  1.00 89.05  ? 55   THR A CA    1 
ATOM   444  C C     . THR A 1 55  ? -12.306 32.418  -4.134  1.00 89.14  ? 55   THR A C     1 
ATOM   445  O O     . THR A 1 55  ? -12.610 33.598  -4.326  1.00 89.06  ? 55   THR A O     1 
ATOM   446  C CB    . THR A 1 55  ? -11.509 31.327  -6.267  1.00 89.00  ? 55   THR A CB    1 
ATOM   447  O OG1   . THR A 1 55  ? -11.726 30.216  -7.149  1.00 88.72  ? 55   THR A OG1   1 
ATOM   448  C CG2   . THR A 1 55  ? -10.116 31.213  -5.657  1.00 89.20  ? 55   THR A CG2   1 
ATOM   449  N N     . ALA A 1 56  ? -11.720 31.985  -3.022  1.00 89.42  ? 56   ALA A N     1 
ATOM   450  C CA    . ALA A 1 56  ? -11.139 32.889  -2.033  1.00 89.66  ? 56   ALA A CA    1 
ATOM   451  C C     . ALA A 1 56  ? -9.798  32.347  -1.516  1.00 89.84  ? 56   ALA A C     1 
ATOM   452  O O     . ALA A 1 56  ? -9.523  31.141  -1.590  1.00 89.51  ? 56   ALA A O     1 
ATOM   453  C CB    . ALA A 1 56  ? -12.108 33.137  -0.894  1.00 89.63  ? 56   ALA A CB    1 
ATOM   454  N N     . GLU A 1 57  ? -8.970  33.257  -1.006  1.00 90.22  ? 57   GLU A N     1 
ATOM   455  C CA    . GLU A 1 57  ? -7.603  32.940  -0.594  1.00 90.52  ? 57   GLU A CA    1 
ATOM   456  C C     . GLU A 1 57  ? -7.449  33.078  0.927   1.00 90.70  ? 57   GLU A C     1 
ATOM   457  O O     . GLU A 1 57  ? -7.758  34.138  1.494   1.00 90.62  ? 57   GLU A O     1 
ATOM   458  C CB    . GLU A 1 57  ? -6.598  33.840  -1.340  1.00 90.35  ? 57   GLU A CB    1 
ATOM   459  N N     . ARG A 1 58  ? -6.995  31.996  1.574   1.00 90.88  ? 58   ARG A N     1 
ATOM   460  C CA    . ARG A 1 58  ? -6.705  31.982  3.025   1.00 90.92  ? 58   ARG A CA    1 
ATOM   461  C C     . ARG A 1 58  ? -5.475  31.131  3.370   1.00 90.85  ? 58   ARG A C     1 
ATOM   462  O O     . ARG A 1 58  ? -5.311  30.015  2.846   1.00 90.76  ? 58   ARG A O     1 
ATOM   463  C CB    . ARG A 1 58  ? -7.923  31.519  3.841   1.00 90.98  ? 58   ARG A CB    1 
ATOM   464  N N     . HIS A 1 59  ? -4.635  31.667  4.267   1.00 90.69  ? 59   HIS A N     1 
ATOM   465  C CA    . HIS A 1 59  ? -3.293  31.122  4.567   1.00 90.41  ? 59   HIS A CA    1 
ATOM   466  C C     . HIS A 1 59  ? -2.497  30.788  3.278   1.00 90.05  ? 59   HIS A C     1 
ATOM   467  O O     . HIS A 1 59  ? -2.042  29.650  3.081   1.00 90.06  ? 59   HIS A O     1 
ATOM   468  C CB    . HIS A 1 59  ? -3.367  29.927  5.546   1.00 90.39  ? 59   HIS A CB    1 
ATOM   469  N N     . GLY A 1 60  ? -2.372  31.793  2.403   1.00 89.45  ? 60   GLY A N     1 
ATOM   470  C CA    . GLY A 1 60  ? -1.594  31.706  1.162   1.00 88.88  ? 60   GLY A CA    1 
ATOM   471  C C     . GLY A 1 60  ? -2.220  30.958  -0.011  1.00 88.50  ? 60   GLY A C     1 
ATOM   472  O O     . GLY A 1 60  ? -2.248  31.458  -1.142  1.00 88.47  ? 60   GLY A O     1 
ATOM   473  N N     . THR A 1 61  ? -2.697  29.747  0.257   1.00 88.00  ? 61   THR A N     1 
ATOM   474  C CA    . THR A 1 61  ? -3.291  28.886  -0.765  1.00 87.40  ? 61   THR A CA    1 
ATOM   475  C C     . THR A 1 61  ? -4.704  29.360  -1.186  1.00 86.94  ? 61   THR A C     1 
ATOM   476  O O     . THR A 1 61  ? -5.493  29.810  -0.342  1.00 86.83  ? 61   THR A O     1 
ATOM   477  C CB    . THR A 1 61  ? -3.276  27.386  -0.302  1.00 87.56  ? 61   THR A CB    1 
ATOM   478  O OG1   . THR A 1 61  ? -3.980  26.572  -1.247  1.00 87.66  ? 61   THR A OG1   1 
ATOM   479  C CG2   . THR A 1 61  ? -3.884  27.205  1.108   1.00 86.97  ? 61   THR A CG2   1 
ATOM   480  N N     . THR A 1 62  ? -5.001  29.285  -2.491  1.00 86.26  ? 62   THR A N     1 
ATOM   481  C CA    . THR A 1 62  ? -6.348  29.620  -3.016  1.00 85.54  ? 62   THR A CA    1 
ATOM   482  C C     . THR A 1 62  ? -7.318  28.426  -3.004  1.00 84.69  ? 62   THR A C     1 
ATOM   483  O O     . THR A 1 62  ? -6.925  27.274  -3.236  1.00 84.48  ? 62   THR A O     1 
ATOM   484  C CB    . THR A 1 62  ? -6.348  30.305  -4.443  1.00 85.68  ? 62   THR A CB    1 
ATOM   485  O OG1   . THR A 1 62  ? -5.381  29.686  -5.301  1.00 86.16  ? 62   THR A OG1   1 
ATOM   486  C CG2   . THR A 1 62  ? -6.075  31.815  -4.350  1.00 85.36  ? 62   THR A CG2   1 
ATOM   487  N N     . VAL A 1 63  ? -8.589  28.732  -2.742  1.00 83.67  ? 63   VAL A N     1 
ATOM   488  C CA    . VAL A 1 63  ? -9.607  27.725  -2.461  1.00 82.49  ? 63   VAL A CA    1 
ATOM   489  C C     . VAL A 1 63  ? -10.694 27.706  -3.521  1.00 81.58  ? 63   VAL A C     1 
ATOM   490  O O     . VAL A 1 63  ? -11.364 28.713  -3.752  1.00 81.42  ? 63   VAL A O     1 
ATOM   491  C CB    . VAL A 1 63  ? -10.279 27.987  -1.099  1.00 82.55  ? 63   VAL A CB    1 
ATOM   492  C CG1   . VAL A 1 63  ? -11.286 26.899  -0.797  1.00 82.64  ? 63   VAL A CG1   1 
ATOM   493  C CG2   . VAL A 1 63  ? -9.239  28.084  0.010   1.00 82.65  ? 63   VAL A CG2   1 
ATOM   494  N N     . ARG A 1 64  ? -10.881 26.548  -4.143  1.00 80.47  ? 64   ARG A N     1 
ATOM   495  C CA    . ARG A 1 64  ? -11.909 26.386  -5.166  1.00 79.49  ? 64   ARG A CA    1 
ATOM   496  C C     . ARG A 1 64  ? -13.074 25.499  -4.683  1.00 78.59  ? 64   ARG A C     1 
ATOM   497  O O     . ARG A 1 64  ? -12.997 24.869  -3.626  1.00 78.23  ? 64   ARG A O     1 
ATOM   498  C CB    . ARG A 1 64  ? -11.286 25.840  -6.465  1.00 79.52  ? 64   ARG A CB    1 
ATOM   499  N N     . VAL A 1 65  ? -14.148 25.479  -5.468  1.00 77.49  ? 65   VAL A N     1 
ATOM   500  C CA    . VAL A 1 65  ? -15.297 24.619  -5.227  1.00 76.35  ? 65   VAL A CA    1 
ATOM   501  C C     . VAL A 1 65  ? -15.070 23.277  -5.929  1.00 75.94  ? 65   VAL A C     1 
ATOM   502  O O     . VAL A 1 65  ? -15.649 22.999  -6.979  1.00 75.88  ? 65   VAL A O     1 
ATOM   503  C CB    . VAL A 1 65  ? -16.611 25.285  -5.726  1.00 76.22  ? 65   VAL A CB    1 
ATOM   504  C CG1   . VAL A 1 65  ? -17.806 24.367  -5.505  1.00 76.03  ? 65   VAL A CG1   1 
ATOM   505  C CG2   . VAL A 1 65  ? -16.836 26.635  -5.042  1.00 75.68  ? 65   VAL A CG2   1 
ATOM   506  N N     . VAL A 1 66  ? -14.221 22.448  -5.336  1.00 75.39  ? 66   VAL A N     1 
ATOM   507  C CA    . VAL A 1 66  ? -13.872 21.124  -5.875  1.00 74.94  ? 66   VAL A CA    1 
ATOM   508  C C     . VAL A 1 66  ? -14.978 20.376  -6.635  1.00 74.65  ? 66   VAL A C     1 
ATOM   509  O O     . VAL A 1 66  ? -14.678 19.459  -7.399  1.00 74.77  ? 66   VAL A O     1 
ATOM   510  C CB    . VAL A 1 66  ? -13.309 20.209  -4.758  1.00 75.03  ? 66   VAL A CB    1 
ATOM   511  C CG1   . VAL A 1 66  ? -12.961 18.802  -5.283  1.00 74.77  ? 66   VAL A CG1   1 
ATOM   512  C CG2   . VAL A 1 66  ? -12.093 20.861  -4.126  1.00 75.37  ? 66   VAL A CG2   1 
ATOM   513  N N     . ARG A 1 67  ? -16.240 20.749  -6.422  1.00 74.23  ? 67   ARG A N     1 
ATOM   514  C CA    . ARG A 1 67  ? -17.376 20.073  -7.069  1.00 74.04  ? 67   ARG A CA    1 
ATOM   515  C C     . ARG A 1 67  ? -18.722 20.637  -6.605  1.00 74.04  ? 67   ARG A C     1 
ATOM   516  O O     . ARG A 1 67  ? -18.873 21.039  -5.452  1.00 74.23  ? 67   ARG A O     1 
ATOM   517  C CB    . ARG A 1 67  ? -17.339 18.553  -6.821  1.00 73.86  ? 67   ARG A CB    1 
ATOM   518  C CG    . ARG A 1 67  ? -18.259 17.740  -7.714  1.00 73.82  ? 67   ARG A CG    1 
ATOM   519  C CD    . ARG A 1 67  ? -17.963 16.262  -7.630  1.00 74.64  ? 67   ARG A CD    1 
ATOM   520  N NE    . ARG A 1 67  ? -17.936 15.804  -6.246  1.00 77.37  ? 67   ARG A NE    1 
ATOM   521  C CZ    . ARG A 1 67  ? -18.120 14.540  -5.865  1.00 79.13  ? 67   ARG A CZ    1 
ATOM   522  N NH1   . ARG A 1 67  ? -18.353 13.589  -6.765  1.00 79.70  ? 67   ARG A NH1   1 
ATOM   523  N NH2   . ARG A 1 67  ? -18.076 14.223  -4.577  1.00 79.20  ? 67   ARG A NH2   1 
ATOM   524  N N     . ALA A 1 68  ? -19.684 20.670  -7.527  1.00 73.78  ? 68   ALA A N     1 
ATOM   525  C CA    . ALA A 1 68  ? -21.082 20.960  -7.222  1.00 73.19  ? 68   ALA A CA    1 
ATOM   526  C C     . ALA A 1 68  ? -21.935 19.741  -7.598  1.00 72.86  ? 68   ALA A C     1 
ATOM   527  O O     . ALA A 1 68  ? -21.504 18.875  -8.377  1.00 72.86  ? 68   ALA A O     1 
ATOM   528  C CB    . ALA A 1 68  ? -21.550 22.210  -7.962  1.00 73.18  ? 68   ALA A CB    1 
ATOM   529  N N     . GLU A 1 69  ? -23.131 19.667  -7.017  1.00 72.24  ? 69   GLU A N     1 
ATOM   530  C CA    . GLU A 1 69  ? -24.075 18.578  -7.265  1.00 71.54  ? 69   GLU A CA    1 
ATOM   531  C C     . GLU A 1 69  ? -25.466 19.058  -6.858  1.00 70.97  ? 69   GLU A C     1 
ATOM   532  O O     . GLU A 1 69  ? -25.656 19.588  -5.749  1.00 70.98  ? 69   GLU A O     1 
ATOM   533  C CB    . GLU A 1 69  ? -23.672 17.325  -6.484  1.00 71.52  ? 69   GLU A CB    1 
ATOM   534  C CG    . GLU A 1 69  ? -24.455 16.073  -6.843  1.00 71.98  ? 69   GLU A CG    1 
ATOM   535  C CD    . GLU A 1 69  ? -24.174 14.892  -5.902  1.00 72.31  ? 69   GLU A CD    1 
ATOM   536  O OE1   . GLU A 1 69  ? -23.023 14.739  -5.427  1.00 72.62  ? 69   GLU A OE1   1 
ATOM   537  O OE2   . GLU A 1 69  ? -25.112 14.106  -5.650  1.00 71.76  ? 69   GLU A OE2   1 
ATOM   538  N N     . LYS A 1 70  ? -26.425 18.904  -7.771  1.00 70.06  ? 70   LYS A N     1 
ATOM   539  C CA    . LYS A 1 70  ? -27.796 19.351  -7.525  1.00 69.04  ? 70   LYS A CA    1 
ATOM   540  C C     . LYS A 1 70  ? -28.600 18.216  -6.904  1.00 68.15  ? 70   LYS A C     1 
ATOM   541  O O     . LYS A 1 70  ? -28.737 17.133  -7.498  1.00 67.99  ? 70   LYS A O     1 
ATOM   542  C CB    . LYS A 1 70  ? -28.462 19.825  -8.818  1.00 69.20  ? 70   LYS A CB    1 
ATOM   543  C CG    . LYS A 1 70  ? -29.740 20.625  -8.612  1.00 69.08  ? 70   LYS A CG    1 
ATOM   544  C CD    . LYS A 1 70  ? -30.701 20.371  -9.755  1.00 69.65  ? 70   LYS A CD    1 
ATOM   545  C CE    . LYS A 1 70  ? -32.097 20.880  -9.455  1.00 69.32  ? 70   LYS A CE    1 
ATOM   546  N NZ    . LYS A 1 70  ? -33.039 20.529  -10.559 1.00 68.68  ? 70   LYS A NZ    1 
ATOM   547  N N     . VAL A 1 71  ? -29.125 18.471  -5.708  1.00 66.80  ? 71   VAL A N     1 
ATOM   548  C CA    . VAL A 1 71  ? -29.816 17.435  -4.955  1.00 65.73  ? 71   VAL A CA    1 
ATOM   549  C C     . VAL A 1 71  ? -31.181 17.935  -4.468  1.00 64.92  ? 71   VAL A C     1 
ATOM   550  O O     . VAL A 1 71  ? -31.371 19.146  -4.226  1.00 64.78  ? 71   VAL A O     1 
ATOM   551  C CB    . VAL A 1 71  ? -28.905 16.860  -3.809  1.00 65.83  ? 71   VAL A CB    1 
ATOM   552  C CG1   . VAL A 1 71  ? -28.668 17.904  -2.714  1.00 65.56  ? 71   VAL A CG1   1 
ATOM   553  C CG2   . VAL A 1 71  ? -29.444 15.522  -3.255  1.00 65.30  ? 71   VAL A CG2   1 
ATOM   554  N N     . LYS A 1 72  ? -32.128 16.999  -4.377  1.00 63.65  ? 72   LYS A N     1 
ATOM   555  C CA    . LYS A 1 72  ? -33.490 17.299  -3.958  1.00 62.67  ? 72   LYS A CA    1 
ATOM   556  C C     . LYS A 1 72  ? -33.687 16.875  -2.503  1.00 61.92  ? 72   LYS A C     1 
ATOM   557  O O     . LYS A 1 72  ? -33.377 15.736  -2.115  1.00 61.89  ? 72   LYS A O     1 
ATOM   558  C CB    . LYS A 1 72  ? -34.515 16.616  -4.882  1.00 62.59  ? 72   LYS A CB    1 
ATOM   559  N N     . LYS A 1 73  ? -34.197 17.806  -1.701  1.00 60.61  ? 73   LYS A N     1 
ATOM   560  C CA    . LYS A 1 73  ? -34.407 17.573  -0.277  1.00 59.37  ? 73   LYS A CA    1 
ATOM   561  C C     . LYS A 1 73  ? -35.795 18.047  0.158   1.00 58.94  ? 73   LYS A C     1 
ATOM   562  O O     . LYS A 1 73  ? -36.637 18.403  -0.682  1.00 58.94  ? 73   LYS A O     1 
ATOM   563  C CB    . LYS A 1 73  ? -33.345 18.324  0.535   1.00 59.07  ? 73   LYS A CB    1 
ATOM   564  C CG    . LYS A 1 73  ? -31.912 17.905  0.286   1.00 57.50  ? 73   LYS A CG    1 
ATOM   565  C CD    . LYS A 1 73  ? -30.976 18.563  1.287   1.00 54.80  ? 73   LYS A CD    1 
ATOM   566  C CE    . LYS A 1 73  ? -29.908 17.587  1.765   1.00 52.35  ? 73   LYS A CE    1 
ATOM   567  N NZ    . LYS A 1 73  ? -30.456 16.452  2.531   1.00 49.06  ? 73   LYS A NZ    1 
ATOM   568  N N     . LYS A 1 74  ? -36.022 18.039  1.475   1.00 58.17  ? 74   LYS A N     1 
ATOM   569  C CA    . LYS A 1 74  ? -37.168 18.706  2.092   1.00 57.15  ? 74   LYS A CA    1 
ATOM   570  C C     . LYS A 1 74  ? -36.629 19.828  2.945   1.00 56.50  ? 74   LYS A C     1 
ATOM   571  O O     . LYS A 1 74  ? -35.640 19.644  3.639   1.00 56.39  ? 74   LYS A O     1 
ATOM   572  C CB    . LYS A 1 74  ? -37.970 17.765  3.003   1.00 57.05  ? 74   LYS A CB    1 
ATOM   573  C CG    . LYS A 1 74  ? -38.709 16.618  2.342   1.00 56.57  ? 74   LYS A CG    1 
ATOM   574  C CD    . LYS A 1 74  ? -37.889 15.344  2.452   1.00 58.33  ? 74   LYS A CD    1 
ATOM   575  C CE    . LYS A 1 74  ? -38.678 14.208  3.090   1.00 59.45  ? 74   LYS A CE    1 
ATOM   576  N NZ    . LYS A 1 74  ? -39.829 13.820  2.235   1.00 61.61  ? 74   LYS A NZ    1 
ATOM   577  N N     . PHE A 1 75  ? -37.281 20.983  2.886   1.00 55.86  ? 75   PHE A N     1 
ATOM   578  C CA    . PHE A 1 75  ? -37.069 22.056  3.848   1.00 55.24  ? 75   PHE A CA    1 
ATOM   579  C C     . PHE A 1 75  ? -38.387 22.303  4.560   1.00 55.56  ? 75   PHE A C     1 
ATOM   580  O O     . PHE A 1 75  ? -39.351 22.802  3.957   1.00 55.65  ? 75   PHE A O     1 
ATOM   581  C CB    . PHE A 1 75  ? -36.603 23.328  3.155   1.00 54.80  ? 75   PHE A CB    1 
ATOM   582  C CG    . PHE A 1 75  ? -36.228 24.428  4.101   1.00 54.06  ? 75   PHE A CG    1 
ATOM   583  C CD1   . PHE A 1 75  ? -34.985 24.433  4.727   1.00 53.33  ? 75   PHE A CD1   1 
ATOM   584  C CD2   . PHE A 1 75  ? -37.110 25.469  4.364   1.00 53.71  ? 75   PHE A CD2   1 
ATOM   585  C CE1   . PHE A 1 75  ? -34.635 25.454  5.611   1.00 52.88  ? 75   PHE A CE1   1 
ATOM   586  C CE2   . PHE A 1 75  ? -36.770 26.501  5.251   1.00 53.04  ? 75   PHE A CE2   1 
ATOM   587  C CZ    . PHE A 1 75  ? -35.533 26.490  5.872   1.00 53.15  ? 75   PHE A CZ    1 
ATOM   588  N N     . LEU A 1 76  ? -38.425 21.952  5.847   1.00 55.75  ? 76   LEU A N     1 
ATOM   589  C CA    . LEU A 1 76  ? -39.645 22.036  6.669   1.00 55.60  ? 76   LEU A CA    1 
ATOM   590  C C     . LEU A 1 76  ? -40.796 21.295  5.998   1.00 55.80  ? 76   LEU A C     1 
ATOM   591  O O     . LEU A 1 76  ? -41.899 21.819  5.860   1.00 55.85  ? 76   LEU A O     1 
ATOM   592  C CB    . LEU A 1 76  ? -40.025 23.491  6.963   1.00 55.27  ? 76   LEU A CB    1 
ATOM   593  C CG    . LEU A 1 76  ? -39.349 24.288  8.077   1.00 55.17  ? 76   LEU A CG    1 
ATOM   594  C CD1   . LEU A 1 76  ? -37.848 24.125  8.095   1.00 55.30  ? 76   LEU A CD1   1 
ATOM   595  C CD2   . LEU A 1 76  ? -39.698 25.765  7.909   1.00 55.84  ? 76   LEU A CD2   1 
ATOM   596  N N     . GLY A 1 77  ? -40.512 20.078  5.557   1.00 56.28  ? 77   GLY A N     1 
ATOM   597  C CA    . GLY A 1 77  ? -41.535 19.199  5.008   1.00 57.18  ? 77   GLY A CA    1 
ATOM   598  C C     . GLY A 1 77  ? -41.774 19.409  3.535   1.00 57.67  ? 77   GLY A C     1 
ATOM   599  O O     . GLY A 1 77  ? -41.954 18.443  2.786   1.00 57.51  ? 77   GLY A O     1 
ATOM   600  N N     . ARG A 1 78  ? -41.778 20.680  3.128   1.00 58.51  ? 78   ARG A N     1 
ATOM   601  C CA    . ARG A 1 78  ? -41.970 21.074  1.720   1.00 59.16  ? 78   ARG A CA    1 
ATOM   602  C C     . ARG A 1 78  ? -40.728 20.723  0.868   1.00 59.53  ? 78   ARG A C     1 
ATOM   603  O O     . ARG A 1 78  ? -39.593 20.864  1.348   1.00 59.65  ? 78   ARG A O     1 
ATOM   604  C CB    . ARG A 1 78  ? -42.327 22.567  1.627   1.00 58.99  ? 78   ARG A CB    1 
ATOM   605  C CG    . ARG A 1 78  ? -43.662 22.941  2.304   1.00 58.73  ? 78   ARG A CG    1 
ATOM   606  N N     . PRO A 1 79  ? -40.930 20.223  -0.376  1.00 59.69  ? 79   PRO A N     1 
ATOM   607  C CA    . PRO A 1 79  ? -39.752 19.857  -1.186  1.00 59.56  ? 79   PRO A CA    1 
ATOM   608  C C     . PRO A 1 79  ? -38.944 21.086  -1.563  1.00 59.40  ? 79   PRO A C     1 
ATOM   609  O O     . PRO A 1 79  ? -39.516 22.169  -1.727  1.00 59.26  ? 79   PRO A O     1 
ATOM   610  C CB    . PRO A 1 79  ? -40.352 19.196  -2.438  1.00 59.21  ? 79   PRO A CB    1 
ATOM   611  C CG    . PRO A 1 79  ? -41.764 18.884  -2.089  1.00 59.82  ? 79   PRO A CG    1 
ATOM   612  C CD    . PRO A 1 79  ? -42.185 19.941  -1.091  1.00 59.82  ? 79   PRO A CD    1 
ATOM   613  N N     . ILE A 1 80  ? -37.626 20.913  -1.659  1.00 59.35  ? 80   ILE A N     1 
ATOM   614  C CA    . ILE A 1 80  ? -36.722 21.978  -2.074  1.00 59.32  ? 80   ILE A CA    1 
ATOM   615  C C     . ILE A 1 80  ? -35.585 21.413  -2.927  1.00 59.97  ? 80   ILE A C     1 
ATOM   616  O O     . ILE A 1 80  ? -35.184 20.249  -2.767  1.00 59.74  ? 80   ILE A O     1 
ATOM   617  C CB    . ILE A 1 80  ? -36.180 22.797  -0.866  1.00 59.01  ? 80   ILE A CB    1 
ATOM   618  C CG1   . ILE A 1 80  ? -35.706 24.179  -1.329  1.00 58.50  ? 80   ILE A CG1   1 
ATOM   619  C CG2   . ILE A 1 80  ? -35.111 22.013  -0.097  1.00 58.35  ? 80   ILE A CG2   1 
ATOM   620  C CD1   . ILE A 1 80  ? -35.196 25.099  -0.224  1.00 57.39  ? 80   ILE A CD1   1 
ATOM   621  N N     . GLU A 1 81  ? -35.098 22.243  -3.850  1.00 60.83  ? 81   GLU A N     1 
ATOM   622  C CA    . GLU A 1 81  ? -33.957 21.900  -4.694  1.00 61.86  ? 81   GLU A CA    1 
ATOM   623  C C     . GLU A 1 81  ? -32.790 22.822  -4.419  1.00 61.96  ? 81   GLU A C     1 
ATOM   624  O O     . GLU A 1 81  ? -32.905 24.048  -4.582  1.00 61.70  ? 81   GLU A O     1 
ATOM   625  C CB    . GLU A 1 81  ? -34.331 21.958  -6.170  1.00 62.15  ? 81   GLU A CB    1 
ATOM   626  C CG    . GLU A 1 81  ? -35.020 20.690  -6.643  1.00 64.29  ? 81   GLU A CG    1 
ATOM   627  C CD    . GLU A 1 81  ? -35.291 20.694  -8.130  1.00 66.66  ? 81   GLU A CD    1 
ATOM   628  O OE1   . GLU A 1 81  ? -35.759 21.738  -8.639  1.00 68.22  ? 81   GLU A OE1   1 
ATOM   629  O OE2   . GLU A 1 81  ? -35.036 19.655  -8.788  1.00 67.66  ? 81   GLU A OE2   1 
ATOM   630  N N     . VAL A 1 82  ? -31.679 22.227  -3.975  1.00 62.10  ? 82   VAL A N     1 
ATOM   631  C CA    . VAL A 1 82  ? -30.466 22.994  -3.701  1.00 62.31  ? 82   VAL A CA    1 
ATOM   632  C C     . VAL A 1 82  ? -29.218 22.360  -4.274  1.00 62.71  ? 82   VAL A C     1 
ATOM   633  O O     . VAL A 1 82  ? -29.210 21.186  -4.692  1.00 62.62  ? 82   VAL A O     1 
ATOM   634  C CB    . VAL A 1 82  ? -30.214 23.262  -2.198  1.00 62.01  ? 82   VAL A CB    1 
ATOM   635  C CG1   . VAL A 1 82  ? -31.093 24.387  -1.693  1.00 61.98  ? 82   VAL A CG1   1 
ATOM   636  C CG2   . VAL A 1 82  ? -30.382 22.002  -1.383  1.00 62.01  ? 82   VAL A CG2   1 
ATOM   637  N N     . TRP A 1 83  ? -28.159 23.166  -4.249  1.00 63.08  ? 83   TRP A N     1 
ATOM   638  C CA    . TRP A 1 83  ? -26.867 22.796  -4.776  1.00 63.42  ? 83   TRP A CA    1 
ATOM   639  C C     . TRP A 1 83  ? -25.883 22.488  -3.648  1.00 62.70  ? 83   TRP A C     1 
ATOM   640  O O     . TRP A 1 83  ? -25.547 23.368  -2.839  1.00 62.28  ? 83   TRP A O     1 
ATOM   641  C CB    . TRP A 1 83  ? -26.363 23.915  -5.697  1.00 64.12  ? 83   TRP A CB    1 
ATOM   642  C CG    . TRP A 1 83  ? -27.024 23.875  -7.059  1.00 66.57  ? 83   TRP A CG    1 
ATOM   643  C CD1   . TRP A 1 83  ? -28.115 24.593  -7.471  1.00 67.83  ? 83   TRP A CD1   1 
ATOM   644  C CD2   . TRP A 1 83  ? -26.654 23.037  -8.166  1.00 68.73  ? 83   TRP A CD2   1 
ATOM   645  N NE1   . TRP A 1 83  ? -28.433 24.269  -8.768  1.00 68.90  ? 83   TRP A NE1   1 
ATOM   646  C CE2   . TRP A 1 83  ? -27.554 23.317  -9.220  1.00 69.33  ? 83   TRP A CE2   1 
ATOM   647  C CE3   . TRP A 1 83  ? -25.638 22.089  -8.373  1.00 69.39  ? 83   TRP A CE3   1 
ATOM   648  C CZ2   . TRP A 1 83  ? -27.472 22.680  -10.464 1.00 70.11  ? 83   TRP A CZ2   1 
ATOM   649  C CZ3   . TRP A 1 83  ? -25.554 21.456  -9.608  1.00 70.49  ? 83   TRP A CZ3   1 
ATOM   650  C CH2   . TRP A 1 83  ? -26.468 21.756  -10.640 1.00 71.14  ? 83   TRP A CH2   1 
ATOM   651  N N     . LYS A 1 84  ? -25.458 21.225  -3.600  1.00 62.12  ? 84   LYS A N     1 
ATOM   652  C CA    . LYS A 1 84  ? -24.484 20.741  -2.617  1.00 62.13  ? 84   LYS A CA    1 
ATOM   653  C C     . LYS A 1 84  ? -23.062 21.002  -3.095  1.00 62.12  ? 84   LYS A C     1 
ATOM   654  O O     . LYS A 1 84  ? -22.555 20.317  -3.983  1.00 62.33  ? 84   LYS A O     1 
ATOM   655  C CB    . LYS A 1 84  ? -24.675 19.245  -2.379  1.00 62.13  ? 84   LYS A CB    1 
ATOM   656  C CG    . LYS A 1 84  ? -23.824 18.631  -1.268  1.00 61.74  ? 84   LYS A CG    1 
ATOM   657  C CD    . LYS A 1 84  ? -24.011 17.102  -1.265  1.00 61.88  ? 84   LYS A CD    1 
ATOM   658  C CE    . LYS A 1 84  ? -23.351 16.412  -0.077  1.00 61.36  ? 84   LYS A CE    1 
ATOM   659  N NZ    . LYS A 1 84  ? -23.511 14.939  -0.189  1.00 60.62  ? 84   LYS A NZ    1 
ATOM   660  N N     . LEU A 1 85  ? -22.417 21.990  -2.495  1.00 61.97  ? 85   LEU A N     1 
ATOM   661  C CA    . LEU A 1 85  ? -21.099 22.409  -2.932  1.00 61.73  ? 85   LEU A CA    1 
ATOM   662  C C     . LEU A 1 85  ? -19.999 21.740  -2.107  1.00 62.02  ? 85   LEU A C     1 
ATOM   663  O O     . LEU A 1 85  ? -19.860 22.022  -0.914  1.00 62.20  ? 85   LEU A O     1 
ATOM   664  C CB    . LEU A 1 85  ? -20.985 23.936  -2.866  1.00 61.49  ? 85   LEU A CB    1 
ATOM   665  C CG    . LEU A 1 85  ? -22.083 24.740  -3.568  1.00 60.40  ? 85   LEU A CG    1 
ATOM   666  C CD1   . LEU A 1 85  ? -21.650 26.183  -3.708  1.00 59.40  ? 85   LEU A CD1   1 
ATOM   667  C CD2   . LEU A 1 85  ? -22.427 24.147  -4.932  1.00 59.72  ? 85   LEU A CD2   1 
ATOM   668  N N     . TYR A 1 86  ? -19.228 20.860  -2.755  1.00 61.99  ? 86   TYR A N     1 
ATOM   669  C CA    . TYR A 1 86  ? -18.105 20.152  -2.135  1.00 62.00  ? 86   TYR A CA    1 
ATOM   670  C C     . TYR A 1 86  ? -16.808 20.961  -1.990  1.00 61.98  ? 86   TYR A C     1 
ATOM   671  O O     . TYR A 1 86  ? -16.669 22.060  -2.537  1.00 62.00  ? 86   TYR A O     1 
ATOM   672  C CB    . TYR A 1 86  ? -17.812 18.905  -2.929  1.00 62.10  ? 86   TYR A CB    1 
ATOM   673  C CG    . TYR A 1 86  ? -18.825 17.815  -2.750  1.00 63.10  ? 86   TYR A CG    1 
ATOM   674  C CD1   . TYR A 1 86  ? -20.111 17.925  -3.283  1.00 63.58  ? 86   TYR A CD1   1 
ATOM   675  C CD2   . TYR A 1 86  ? -18.491 16.650  -2.065  1.00 63.73  ? 86   TYR A CD2   1 
ATOM   676  C CE1   . TYR A 1 86  ? -21.041 16.894  -3.124  1.00 63.93  ? 86   TYR A CE1   1 
ATOM   677  C CE2   . TYR A 1 86  ? -19.401 15.623  -1.904  1.00 63.70  ? 86   TYR A CE2   1 
ATOM   678  C CZ    . TYR A 1 86  ? -20.669 15.747  -2.433  1.00 64.01  ? 86   TYR A CZ    1 
ATOM   679  O OH    . TYR A 1 86  ? -21.556 14.715  -2.262  1.00 64.29  ? 86   TYR A OH    1 
ATOM   680  N N     . PHE A 1 87  ? -15.858 20.405  -1.242  1.00 61.93  ? 87   PHE A N     1 
ATOM   681  C CA    . PHE A 1 87  ? -14.576 21.068  -0.989  1.00 62.02  ? 87   PHE A CA    1 
ATOM   682  C C     . PHE A 1 87  ? -13.420 20.084  -0.782  1.00 62.35  ? 87   PHE A C     1 
ATOM   683  O O     . PHE A 1 87  ? -13.580 18.850  -0.917  1.00 62.44  ? 87   PHE A O     1 
ATOM   684  C CB    . PHE A 1 87  ? -14.672 22.031  0.203   1.00 61.66  ? 87   PHE A CB    1 
ATOM   685  C CG    . PHE A 1 87  ? -15.602 23.181  -0.027  1.00 61.94  ? 87   PHE A CG    1 
ATOM   686  C CD1   . PHE A 1 87  ? -16.912 23.140  0.446   1.00 62.34  ? 87   PHE A CD1   1 
ATOM   687  C CD2   . PHE A 1 87  ? -15.182 24.300  -0.735  1.00 61.69  ? 87   PHE A CD2   1 
ATOM   688  C CE1   . PHE A 1 87  ? -17.783 24.208  0.225   1.00 62.41  ? 87   PHE A CE1   1 
ATOM   689  C CE2   . PHE A 1 87  ? -16.039 25.366  -0.964  1.00 61.09  ? 87   PHE A CE2   1 
ATOM   690  C CZ    . PHE A 1 87  ? -17.342 25.322  -0.487  1.00 62.47  ? 87   PHE A CZ    1 
ATOM   691  N N     . THR A 1 88  ? -12.249 20.642  -0.479  1.00 62.29  ? 88   THR A N     1 
ATOM   692  C CA    . THR A 1 88  ? -11.090 19.819  -0.194  1.00 62.34  ? 88   THR A CA    1 
ATOM   693  C C     . THR A 1 88  ? -10.887 19.729  1.314   1.00 61.98  ? 88   THR A C     1 
ATOM   694  O O     . THR A 1 88  ? -10.849 18.631  1.864   1.00 61.61  ? 88   THR A O     1 
ATOM   695  C CB    . THR A 1 88  ? -9.814  20.249  -1.030  1.00 62.59  ? 88   THR A CB    1 
ATOM   696  O OG1   . THR A 1 88  ? -9.855  19.602  -2.317  1.00 63.03  ? 88   THR A OG1   1 
ATOM   697  C CG2   . THR A 1 88  ? -8.486  19.870  -0.333  1.00 61.98  ? 88   THR A CG2   1 
ATOM   698  N N     . HIS A 1 89  ? -10.799 20.875  1.981   1.00 61.80  ? 89   HIS A N     1 
ATOM   699  C CA    . HIS A 1 89  ? -10.490 20.881  3.407   1.00 61.70  ? 89   HIS A CA    1 
ATOM   700  C C     . HIS A 1 89  ? -11.540 21.646  4.208   1.00 61.59  ? 89   HIS A C     1 
ATOM   701  O O     . HIS A 1 89  ? -11.861 22.783  3.881   1.00 60.91  ? 89   HIS A O     1 
ATOM   702  C CB    . HIS A 1 89  ? -9.076  21.437  3.654   1.00 61.59  ? 89   HIS A CB    1 
ATOM   703  C CG    . HIS A 1 89  ? -8.596  21.312  5.074   1.00 60.87  ? 89   HIS A CG    1 
ATOM   704  N ND1   . HIS A 1 89  ? -8.903  22.238  6.052   1.00 59.48  ? 89   HIS A ND1   1 
ATOM   705  C CD2   . HIS A 1 89  ? -7.800  20.390  5.668   1.00 60.29  ? 89   HIS A CD2   1 
ATOM   706  C CE1   . HIS A 1 89  ? -8.330  21.884  7.188   1.00 59.75  ? 89   HIS A CE1   1 
ATOM   707  N NE2   . HIS A 1 89  ? -7.651  20.768  6.982   1.00 60.27  ? 89   HIS A NE2   1 
ATOM   708  N N     . PRO A 1 90  ? -12.077 21.002  5.261   1.00 61.83  ? 90   PRO A N     1 
ATOM   709  C CA    . PRO A 1 90  ? -13.009 21.567  6.215   1.00 62.03  ? 90   PRO A CA    1 
ATOM   710  C C     . PRO A 1 90  ? -12.813 23.056  6.353   1.00 62.31  ? 90   PRO A C     1 
ATOM   711  O O     . PRO A 1 90  ? -13.749 23.822  6.152   1.00 62.65  ? 90   PRO A O     1 
ATOM   712  C CB    . PRO A 1 90  ? -12.613 20.872  7.517   1.00 61.89  ? 90   PRO A CB    1 
ATOM   713  C CG    . PRO A 1 90  ? -12.071 19.535  7.075   1.00 61.89  ? 90   PRO A CG    1 
ATOM   714  C CD    . PRO A 1 90  ? -11.785 19.598  5.597   1.00 61.86  ? 90   PRO A CD    1 
ATOM   715  N N     . GLN A 1 91  ? -11.584 23.458  6.650   1.00 62.66  ? 91   GLN A N     1 
ATOM   716  C CA    . GLN A 1 91  ? -11.254 24.862  6.869   1.00 62.84  ? 91   GLN A CA    1 
ATOM   717  C C     . GLN A 1 91  ? -11.569 25.799  5.688   1.00 63.10  ? 91   GLN A C     1 
ATOM   718  O O     . GLN A 1 91  ? -11.645 27.010  5.877   1.00 63.15  ? 91   GLN A O     1 
ATOM   719  C CB    . GLN A 1 91  ? -9.794  24.993  7.314   1.00 62.59  ? 91   GLN A CB    1 
ATOM   720  C CG    . GLN A 1 91  ? -9.572  24.732  8.788   1.00 62.42  ? 91   GLN A CG    1 
ATOM   721  C CD    . GLN A 1 91  ? -9.841  25.970  9.637   1.00 63.14  ? 91   GLN A CD    1 
ATOM   722  O OE1   . GLN A 1 91  ? -10.972 26.444  9.732   1.00 62.71  ? 91   GLN A OE1   1 
ATOM   723  N NE2   . GLN A 1 91  ? -8.792  26.503  10.254  1.00 64.06  ? 91   GLN A NE2   1 
ATOM   724  N N     . ASP A 1 92  ? -11.757 25.245  4.487   1.00 63.57  ? 92   ASP A N     1 
ATOM   725  C CA    . ASP A 1 92  ? -12.163 26.025  3.309   1.00 64.07  ? 92   ASP A CA    1 
ATOM   726  C C     . ASP A 1 92  ? -13.459 26.785  3.553   1.00 64.52  ? 92   ASP A C     1 
ATOM   727  O O     . ASP A 1 92  ? -13.607 27.938  3.129   1.00 64.58  ? 92   ASP A O     1 
ATOM   728  C CB    . ASP A 1 92  ? -12.393 25.106  2.107   1.00 64.17  ? 92   ASP A CB    1 
ATOM   729  C CG    . ASP A 1 92  ? -11.108 24.669  1.443   1.00 64.42  ? 92   ASP A CG    1 
ATOM   730  O OD1   . ASP A 1 92  ? -10.039 25.188  1.829   1.00 64.80  ? 92   ASP A OD1   1 
ATOM   731  O OD2   . ASP A 1 92  ? -11.175 23.814  0.525   1.00 64.57  ? 92   ASP A OD2   1 
ATOM   732  N N     . VAL A 1 93  ? -14.389 26.112  4.237   1.00 64.73  ? 93   VAL A N     1 
ATOM   733  C CA    . VAL A 1 93  ? -15.760 26.567  4.415   1.00 64.70  ? 93   VAL A CA    1 
ATOM   734  C C     . VAL A 1 93  ? -15.896 27.965  5.061   1.00 65.22  ? 93   VAL A C     1 
ATOM   735  O O     . VAL A 1 93  ? -16.499 28.846  4.459   1.00 65.20  ? 93   VAL A O     1 
ATOM   736  C CB    . VAL A 1 93  ? -16.598 25.487  5.140   1.00 64.55  ? 93   VAL A CB    1 
ATOM   737  C CG1   . VAL A 1 93  ? -17.983 26.009  5.504   1.00 64.81  ? 93   VAL A CG1   1 
ATOM   738  C CG2   . VAL A 1 93  ? -16.706 24.246  4.277   1.00 63.88  ? 93   VAL A CG2   1 
ATOM   739  N N     . PRO A 1 94  ? -15.313 28.193  6.258   1.00 65.75  ? 94   PRO A N     1 
ATOM   740  C CA    . PRO A 1 94  ? -15.565 29.489  6.928   1.00 66.34  ? 94   PRO A CA    1 
ATOM   741  C C     . PRO A 1 94  ? -14.940 30.699  6.230   1.00 67.04  ? 94   PRO A C     1 
ATOM   742  O O     . PRO A 1 94  ? -14.971 31.809  6.777   1.00 67.00  ? 94   PRO A O     1 
ATOM   743  C CB    . PRO A 1 94  ? -14.926 29.304  8.313   1.00 66.15  ? 94   PRO A CB    1 
ATOM   744  C CG    . PRO A 1 94  ? -13.887 28.272  8.110   1.00 66.02  ? 94   PRO A CG    1 
ATOM   745  C CD    . PRO A 1 94  ? -14.412 27.337  7.052   1.00 65.64  ? 94   PRO A CD    1 
ATOM   746  N N     . ALA A 1 95  ? -14.384 30.467  5.039   1.00 67.85  ? 95   ALA A N     1 
ATOM   747  C CA    . ALA A 1 95  ? -13.641 31.474  4.283   1.00 68.52  ? 95   ALA A CA    1 
ATOM   748  C C     . ALA A 1 95  ? -14.309 31.778  2.944   1.00 68.99  ? 95   ALA A C     1 
ATOM   749  O O     . ALA A 1 95  ? -14.521 32.940  2.616   1.00 69.29  ? 95   ALA A O     1 
ATOM   750  C CB    . ALA A 1 95  ? -12.198 31.026  4.079   1.00 68.38  ? 95   ALA A CB    1 
ATOM   751  N N     . ILE A 1 96  ? -14.645 30.730  2.189   1.00 69.60  ? 96   ILE A N     1 
ATOM   752  C CA    . ILE A 1 96  ? -15.373 30.833  0.908   1.00 70.04  ? 96   ILE A CA    1 
ATOM   753  C C     . ILE A 1 96  ? -16.863 31.203  1.102   1.00 70.76  ? 96   ILE A C     1 
ATOM   754  O O     . ILE A 1 96  ? -17.535 31.657  0.171   1.00 70.98  ? 96   ILE A O     1 
ATOM   755  C CB    . ILE A 1 96  ? -15.249 29.497  0.113   1.00 69.92  ? 96   ILE A CB    1 
ATOM   756  C CG1   . ILE A 1 96  ? -15.402 29.737  -1.391  1.00 69.54  ? 96   ILE A CG1   1 
ATOM   757  C CG2   . ILE A 1 96  ? -16.220 28.428  0.655   1.00 69.09  ? 96   ILE A CG2   1 
ATOM   758  C CD1   . ILE A 1 96  ? -14.937 28.573  -2.270  1.00 68.78  ? 96   ILE A CD1   1 
ATOM   759  N N     . ARG A 1 97  ? -17.338 31.016  2.333   1.00 71.39  ? 97   ARG A N     1 
ATOM   760  C CA    . ARG A 1 97  ? -18.741 31.120  2.746   1.00 71.87  ? 97   ARG A CA    1 
ATOM   761  C C     . ARG A 1 97  ? -19.460 32.387  2.285   1.00 72.47  ? 97   ARG A C     1 
ATOM   762  O O     . ARG A 1 97  ? -20.327 32.334  1.408   1.00 72.62  ? 97   ARG A O     1 
ATOM   763  C CB    . ARG A 1 97  ? -18.783 31.062  4.271   1.00 71.69  ? 97   ARG A CB    1 
ATOM   764  C CG    . ARG A 1 97  ? -19.926 30.310  4.847   1.00 70.86  ? 97   ARG A CG    1 
ATOM   765  C CD    . ARG A 1 97  ? -19.529 29.761  6.200   1.00 70.41  ? 97   ARG A CD    1 
ATOM   766  N NE    . ARG A 1 97  ? -19.235 30.805  7.184   1.00 69.38  ? 97   ARG A NE    1 
ATOM   767  C CZ    . ARG A 1 97  ? -18.867 30.565  8.445   1.00 68.89  ? 97   ARG A CZ    1 
ATOM   768  N NH1   . ARG A 1 97  ? -18.740 29.316  8.900   1.00 67.36  ? 97   ARG A NH1   1 
ATOM   769  N NH2   . ARG A 1 97  ? -18.621 31.577  9.257   1.00 68.46  ? 97   ARG A NH2   1 
ATOM   770  N N     . ASP A 1 98  ? -19.087 33.515  2.887   1.00 73.00  ? 98   ASP A N     1 
ATOM   771  C CA    . ASP A 1 98  ? -19.759 34.795  2.680   1.00 73.61  ? 98   ASP A CA    1 
ATOM   772  C C     . ASP A 1 98  ? -19.615 35.286  1.248   1.00 74.07  ? 98   ASP A C     1 
ATOM   773  O O     . ASP A 1 98  ? -20.445 36.052  0.763   1.00 74.23  ? 98   ASP A O     1 
ATOM   774  C CB    . ASP A 1 98  ? -19.222 35.842  3.661   1.00 73.58  ? 98   ASP A CB    1 
ATOM   775  C CG    . ASP A 1 98  ? -18.996 35.275  5.057   1.00 73.73  ? 98   ASP A CG    1 
ATOM   776  O OD1   . ASP A 1 98  ? -19.486 34.164  5.337   1.00 74.26  ? 98   ASP A OD1   1 
ATOM   777  O OD2   . ASP A 1 98  ? -18.318 35.931  5.876   1.00 74.29  ? 98   ASP A OD2   1 
ATOM   778  N N     . LYS A 1 99  ? -18.562 34.831  0.577   1.00 74.51  ? 99   LYS A N     1 
ATOM   779  C CA    . LYS A 1 99  ? -18.385 35.114  -0.838  1.00 75.12  ? 99   LYS A CA    1 
ATOM   780  C C     . LYS A 1 99  ? -19.387 34.338  -1.713  1.00 75.40  ? 99   LYS A C     1 
ATOM   781  O O     . LYS A 1 99  ? -19.833 34.859  -2.741  1.00 75.69  ? 99   LYS A O     1 
ATOM   782  C CB    . LYS A 1 99  ? -16.930 34.868  -1.287  1.00 75.04  ? 99   LYS A CB    1 
ATOM   783  N N     . ILE A 1 100 ? -19.741 33.110  -1.318  1.00 75.51  ? 100  ILE A N     1 
ATOM   784  C CA    . ILE A 1 100 ? -20.767 32.350  -2.054  1.00 75.72  ? 100  ILE A CA    1 
ATOM   785  C C     . ILE A 1 100 ? -22.155 32.939  -1.799  1.00 76.15  ? 100  ILE A C     1 
ATOM   786  O O     . ILE A 1 100 ? -22.963 33.070  -2.725  1.00 76.01  ? 100  ILE A O     1 
ATOM   787  C CB    . ILE A 1 100 ? -20.745 30.831  -1.754  1.00 75.60  ? 100  ILE A CB    1 
ATOM   788  C CG1   . ILE A 1 100 ? -19.470 30.204  -2.317  1.00 75.22  ? 100  ILE A CG1   1 
ATOM   789  C CG2   . ILE A 1 100 ? -21.966 30.139  -2.365  1.00 75.14  ? 100  ILE A CG2   1 
ATOM   790  C CD1   . ILE A 1 100 ? -19.416 28.694  -2.234  1.00 74.99  ? 100  ILE A CD1   1 
ATOM   791  N N     . LYS A 1 101 ? -22.409 33.316  -0.548  1.00 76.68  ? 101  LYS A N     1 
ATOM   792  C CA    . LYS A 1 101 ? -23.657 33.976  -0.183  1.00 77.20  ? 101  LYS A CA    1 
ATOM   793  C C     . LYS A 1 101 ? -23.856 35.301  -0.939  1.00 77.73  ? 101  LYS A C     1 
ATOM   794  O O     . LYS A 1 101 ? -24.900 35.478  -1.576  1.00 77.99  ? 101  LYS A O     1 
ATOM   795  C CB    . LYS A 1 101 ? -23.750 34.198  1.328   1.00 77.00  ? 101  LYS A CB    1 
ATOM   796  C CG    . LYS A 1 101 ? -25.179 34.343  1.820   1.00 76.64  ? 101  LYS A CG    1 
ATOM   797  C CD    . LYS A 1 101 ? -25.301 35.438  2.874   1.00 76.00  ? 101  LYS A CD    1 
ATOM   798  C CE    . LYS A 1 101 ? -26.736 35.568  3.378   1.00 75.53  ? 101  LYS A CE    1 
ATOM   799  N NZ    . LYS A 1 101 ? -27.729 35.771  2.281   1.00 74.63  ? 101  LYS A NZ    1 
ATOM   800  N N     . GLU A 1 102 ? -22.864 36.204  -0.874  1.00 78.14  ? 102  GLU A N     1 
ATOM   801  C CA    . GLU A 1 102 ? -22.901 37.538  -1.533  1.00 78.56  ? 102  GLU A CA    1 
ATOM   802  C C     . GLU A 1 102 ? -23.294 37.547  -3.014  1.00 78.37  ? 102  GLU A C     1 
ATOM   803  O O     . GLU A 1 102 ? -24.052 38.417  -3.455  1.00 78.41  ? 102  GLU A O     1 
ATOM   804  C CB    . GLU A 1 102 ? -21.542 38.207  -1.460  1.00 78.99  ? 102  GLU A CB    1 
ATOM   805  C CG    . GLU A 1 102 ? -21.218 38.963  -0.206  1.00 80.23  ? 102  GLU A CG    1 
ATOM   806  C CD    . GLU A 1 102 ? -19.760 39.379  -0.223  1.00 82.11  ? 102  GLU A CD    1 
ATOM   807  O OE1   . GLU A 1 102 ? -19.054 38.993  -1.192  1.00 81.76  ? 102  GLU A OE1   1 
ATOM   808  O OE2   . GLU A 1 102 ? -19.320 40.081  0.714   1.00 83.49  ? 102  GLU A OE2   1 
ATOM   809  N N     . HIS A 1 103 ? -22.741 36.603  -3.774  1.00 78.02  ? 103  HIS A N     1 
ATOM   810  C CA    . HIS A 1 103 ? -23.095 36.380  -5.170  1.00 77.96  ? 103  HIS A CA    1 
ATOM   811  C C     . HIS A 1 103 ? -24.600 36.573  -5.409  1.00 77.69  ? 103  HIS A C     1 
ATOM   812  O O     . HIS A 1 103 ? -25.414 35.953  -4.716  1.00 78.04  ? 103  HIS A O     1 
ATOM   813  C CB    . HIS A 1 103 ? -22.706 34.956  -5.536  1.00 78.05  ? 103  HIS A CB    1 
ATOM   814  C CG    . HIS A 1 103 ? -22.737 34.678  -7.001  1.00 79.20  ? 103  HIS A CG    1 
ATOM   815  N ND1   . HIS A 1 103 ? -23.882 34.796  -7.758  1.00 80.17  ? 103  HIS A ND1   1 
ATOM   816  C CD2   . HIS A 1 103 ? -21.764 34.267  -7.848  1.00 80.21  ? 103  HIS A CD2   1 
ATOM   817  C CE1   . HIS A 1 103 ? -23.609 34.482  -9.012  1.00 81.19  ? 103  HIS A CE1   1 
ATOM   818  N NE2   . HIS A 1 103 ? -22.333 34.152  -9.093  1.00 80.74  ? 103  HIS A NE2   1 
ATOM   819  N N     . PRO A 1 104 ? -24.982 37.436  -6.377  1.00 77.20  ? 104  PRO A N     1 
ATOM   820  C CA    . PRO A 1 104 ? -26.409 37.729  -6.598  1.00 76.61  ? 104  PRO A CA    1 
ATOM   821  C C     . PRO A 1 104 ? -27.297 36.517  -7.006  1.00 75.91  ? 104  PRO A C     1 
ATOM   822  O O     . PRO A 1 104 ? -28.481 36.489  -6.647  1.00 75.62  ? 104  PRO A O     1 
ATOM   823  C CB    . PRO A 1 104 ? -26.389 38.824  -7.680  1.00 76.72  ? 104  PRO A CB    1 
ATOM   824  C CG    . PRO A 1 104 ? -25.073 38.684  -8.353  1.00 76.91  ? 104  PRO A CG    1 
ATOM   825  C CD    . PRO A 1 104 ? -24.117 38.189  -7.305  1.00 77.28  ? 104  PRO A CD    1 
ATOM   826  N N     . ALA A 1 105 ? -26.737 35.531  -7.718  1.00 74.95  ? 105  ALA A N     1 
ATOM   827  C CA    . ALA A 1 105 ? -27.491 34.315  -8.101  1.00 74.11  ? 105  ALA A CA    1 
ATOM   828  C C     . ALA A 1 105 ? -27.810 33.349  -6.930  1.00 73.72  ? 105  ALA A C     1 
ATOM   829  O O     . ALA A 1 105 ? -28.716 32.508  -7.025  1.00 73.58  ? 105  ALA A O     1 
ATOM   830  C CB    . ALA A 1 105 ? -26.786 33.577  -9.226  1.00 73.75  ? 105  ALA A CB    1 
ATOM   831  N N     . VAL A 1 106 ? -27.061 33.470  -5.835  1.00 73.06  ? 106  VAL A N     1 
ATOM   832  C CA    . VAL A 1 106 ? -27.276 32.645  -4.644  1.00 72.26  ? 106  VAL A CA    1 
ATOM   833  C C     . VAL A 1 106 ? -28.261 33.314  -3.685  1.00 71.56  ? 106  VAL A C     1 
ATOM   834  O O     . VAL A 1 106 ? -28.021 34.446  -3.217  1.00 71.15  ? 106  VAL A O     1 
ATOM   835  C CB    . VAL A 1 106 ? -25.947 32.347  -3.904  1.00 72.50  ? 106  VAL A CB    1 
ATOM   836  C CG1   . VAL A 1 106 ? -26.188 32.029  -2.420  1.00 72.77  ? 106  VAL A CG1   1 
ATOM   837  C CG2   . VAL A 1 106 ? -25.183 31.212  -4.592  1.00 72.44  ? 106  VAL A CG2   1 
ATOM   838  N N     . VAL A 1 107 ? -29.358 32.600  -3.403  1.00 70.48  ? 107  VAL A N     1 
ATOM   839  C CA    . VAL A 1 107 ? -30.409 33.053  -2.484  1.00 69.21  ? 107  VAL A CA    1 
ATOM   840  C C     . VAL A 1 107 ? -29.968 32.819  -1.048  1.00 68.02  ? 107  VAL A C     1 
ATOM   841  O O     . VAL A 1 107 ? -30.088 33.719  -0.194  1.00 67.48  ? 107  VAL A O     1 
ATOM   842  C CB    . VAL A 1 107 ? -31.753 32.306  -2.724  1.00 69.53  ? 107  VAL A CB    1 
ATOM   843  C CG1   . VAL A 1 107 ? -32.911 32.977  -1.949  1.00 69.10  ? 107  VAL A CG1   1 
ATOM   844  C CG2   . VAL A 1 107 ? -32.068 32.225  -4.218  1.00 69.81  ? 107  VAL A CG2   1 
ATOM   845  N N     . ASP A 1 108 ? -29.467 31.602  -0.799  1.00 66.54  ? 108  ASP A N     1 
ATOM   846  C CA    . ASP A 1 108 ? -28.955 31.231  0.519   1.00 64.92  ? 108  ASP A CA    1 
ATOM   847  C C     . ASP A 1 108 ? -28.080 29.982  0.592   1.00 63.73  ? 108  ASP A C     1 
ATOM   848  O O     . ASP A 1 108 ? -28.073 29.130  -0.314  1.00 63.25  ? 108  ASP A O     1 
ATOM   849  C CB    . ASP A 1 108 ? -30.098 31.097  1.519   1.00 65.06  ? 108  ASP A CB    1 
ATOM   850  C CG    . ASP A 1 108 ? -29.782 31.757  2.828   1.00 65.10  ? 108  ASP A CG    1 
ATOM   851  O OD1   . ASP A 1 108 ? -30.752 32.152  3.506   1.00 65.73  ? 108  ASP A OD1   1 
ATOM   852  O OD2   . ASP A 1 108 ? -28.574 31.895  3.165   1.00 63.68  ? 108  ASP A OD2   1 
ATOM   853  N N     . ILE A 1 109 ? -27.346 29.904  1.703   1.00 62.29  ? 109  ILE A N     1 
ATOM   854  C CA    . ILE A 1 109 ? -26.490 28.764  2.043   1.00 60.92  ? 109  ILE A CA    1 
ATOM   855  C C     . ILE A 1 109 ? -26.940 28.081  3.327   1.00 59.73  ? 109  ILE A C     1 
ATOM   856  O O     . ILE A 1 109 ? -27.523 28.712  4.208   1.00 59.38  ? 109  ILE A O     1 
ATOM   857  C CB    . ILE A 1 109 ? -25.023 29.178  2.213   1.00 60.94  ? 109  ILE A CB    1 
ATOM   858  C CG1   . ILE A 1 109 ? -24.940 30.567  2.873   1.00 60.51  ? 109  ILE A CG1   1 
ATOM   859  C CG2   . ILE A 1 109 ? -24.338 29.136  0.868   1.00 61.04  ? 109  ILE A CG2   1 
ATOM   860  C CD1   . ILE A 1 109 ? -23.783 30.738  3.816   1.00 59.50  ? 109  ILE A CD1   1 
ATOM   861  N N     . TYR A 1 110 ? -26.643 26.791  3.429   1.00 58.27  ? 110  TYR A N     1 
ATOM   862  C CA    . TYR A 1 110 ? -27.166 25.964  4.508   1.00 56.72  ? 110  TYR A CA    1 
ATOM   863  C C     . TYR A 1 110 ? -26.105 24.996  4.972   1.00 55.06  ? 110  TYR A C     1 
ATOM   864  O O     . TYR A 1 110 ? -25.259 24.587  4.185   1.00 55.25  ? 110  TYR A O     1 
ATOM   865  C CB    . TYR A 1 110 ? -28.386 25.177  4.012   1.00 57.29  ? 110  TYR A CB    1 
ATOM   866  C CG    . TYR A 1 110 ? -29.565 26.049  3.648   1.00 57.97  ? 110  TYR A CG    1 
ATOM   867  C CD1   . TYR A 1 110 ? -29.774 26.472  2.329   1.00 58.80  ? 110  TYR A CD1   1 
ATOM   868  C CD2   . TYR A 1 110 ? -30.463 26.471  4.625   1.00 58.45  ? 110  TYR A CD2   1 
ATOM   869  C CE1   . TYR A 1 110 ? -30.857 27.285  1.997   1.00 59.07  ? 110  TYR A CE1   1 
ATOM   870  C CE2   . TYR A 1 110 ? -31.542 27.279  4.308   1.00 59.14  ? 110  TYR A CE2   1 
ATOM   871  C CZ    . TYR A 1 110 ? -31.735 27.682  2.995   1.00 59.96  ? 110  TYR A CZ    1 
ATOM   872  O OH    . TYR A 1 110 ? -32.819 28.481  2.704   1.00 60.86  ? 110  TYR A OH    1 
ATOM   873  N N     . GLU A 1 111 ? -26.159 24.629  6.245   1.00 52.73  ? 111  GLU A N     1 
ATOM   874  C CA    . GLU A 1 111 ? -25.291 23.590  6.802   1.00 50.45  ? 111  GLU A CA    1 
ATOM   875  C C     . GLU A 1 111 ? -23.793 23.879  6.603   1.00 49.62  ? 111  GLU A C     1 
ATOM   876  O O     . GLU A 1 111 ? -23.018 23.044  6.115   1.00 49.18  ? 111  GLU A O     1 
ATOM   877  C CB    . GLU A 1 111 ? -25.718 22.213  6.293   1.00 49.91  ? 111  GLU A CB    1 
ATOM   878  C CG    . GLU A 1 111 ? -27.125 21.835  6.756   1.00 48.12  ? 111  GLU A CG    1 
ATOM   879  C CD    . GLU A 1 111 ? -27.463 20.384  6.505   1.00 46.29  ? 111  GLU A CD    1 
ATOM   880  O OE1   . GLU A 1 111 ? -26.514 19.604  6.272   1.00 47.52  ? 111  GLU A OE1   1 
ATOM   881  O OE2   . GLU A 1 111 ? -28.663 20.020  6.531   1.00 42.73  ? 111  GLU A OE2   1 
ATOM   882  N N     . TYR A 1 112 ? -23.414 25.083  7.026   1.00 48.57  ? 112  TYR A N     1 
ATOM   883  C CA    . TYR A 1 112 ? -22.087 25.643  6.810   1.00 47.52  ? 112  TYR A CA    1 
ATOM   884  C C     . TYR A 1 112 ? -21.377 25.958  8.126   1.00 47.52  ? 112  TYR A C     1 
ATOM   885  O O     . TYR A 1 112 ? -20.433 26.755  8.161   1.00 48.17  ? 112  TYR A O     1 
ATOM   886  C CB    . TYR A 1 112 ? -22.212 26.934  6.009   1.00 46.65  ? 112  TYR A CB    1 
ATOM   887  C CG    . TYR A 1 112 ? -23.149 27.949  6.629   1.00 45.60  ? 112  TYR A CG    1 
ATOM   888  C CD1   . TYR A 1 112 ? -22.791 28.655  7.788   1.00 43.28  ? 112  TYR A CD1   1 
ATOM   889  C CD2   . TYR A 1 112 ? -24.406 28.208  6.053   1.00 44.81  ? 112  TYR A CD2   1 
ATOM   890  C CE1   . TYR A 1 112 ? -23.661 29.587  8.360   1.00 42.70  ? 112  TYR A CE1   1 
ATOM   891  C CE2   . TYR A 1 112 ? -25.274 29.145  6.611   1.00 42.82  ? 112  TYR A CE2   1 
ATOM   892  C CZ    . TYR A 1 112 ? -24.897 29.824  7.759   1.00 42.45  ? 112  TYR A CZ    1 
ATOM   893  O OH    . TYR A 1 112 ? -25.758 30.736  8.309   1.00 43.25  ? 112  TYR A OH    1 
ATOM   894  N N     . ASP A 1 113 ? -21.848 25.370  9.217   1.00 46.74  ? 113  ASP A N     1 
ATOM   895  C CA    . ASP A 1 113 ? -21.200 25.572  10.505  1.00 45.95  ? 113  ASP A CA    1 
ATOM   896  C C     . ASP A 1 113 ? -21.248 24.298  11.345  1.00 45.16  ? 113  ASP A C     1 
ATOM   897  O O     . ASP A 1 113 ? -21.254 24.340  12.570  1.00 44.60  ? 113  ASP A O     1 
ATOM   898  C CB    . ASP A 1 113 ? -21.749 26.815  11.249  1.00 46.04  ? 113  ASP A CB    1 
ATOM   899  C CG    . ASP A 1 113 ? -23.264 26.778  11.451  1.00 46.79  ? 113  ASP A CG    1 
ATOM   900  O OD1   . ASP A 1 113 ? -23.927 25.924  10.823  1.00 47.94  ? 113  ASP A OD1   1 
ATOM   901  O OD2   . ASP A 1 113 ? -23.795 27.610  12.234  1.00 46.95  ? 113  ASP A OD2   1 
ATOM   902  N N     . ILE A 1 114 ? -21.254 23.164  10.657  1.00 44.39  ? 114  ILE A N     1 
ATOM   903  C CA    . ILE A 1 114 ? -21.285 21.879  11.314  1.00 44.00  ? 114  ILE A CA    1 
ATOM   904  C C     . ILE A 1 114 ? -19.860 21.377  11.371  1.00 43.76  ? 114  ILE A C     1 
ATOM   905  O O     . ILE A 1 114 ? -19.314 20.954  10.348  1.00 44.33  ? 114  ILE A O     1 
ATOM   906  C CB    . ILE A 1 114 ? -22.170 20.840  10.553  1.00 43.91  ? 114  ILE A CB    1 
ATOM   907  C CG1   . ILE A 1 114 ? -23.556 21.400  10.182  1.00 43.97  ? 114  ILE A CG1   1 
ATOM   908  C CG2   . ILE A 1 114 ? -22.310 19.572  11.355  1.00 43.90  ? 114  ILE A CG2   1 
ATOM   909  C CD1   . ILE A 1 114 ? -24.261 22.263  11.260  1.00 44.34  ? 114  ILE A CD1   1 
ATOM   910  N N     . PRO A 1 115 ? -19.240 21.426  12.556  1.00 43.21  ? 115  PRO A N     1 
ATOM   911  C CA    . PRO A 1 115 ? -17.910 20.856  12.743  1.00 42.84  ? 115  PRO A CA    1 
ATOM   912  C C     . PRO A 1 115 ? -17.701 19.546  11.997  1.00 42.76  ? 115  PRO A C     1 
ATOM   913  O O     . PRO A 1 115 ? -18.415 18.572  12.230  1.00 42.55  ? 115  PRO A O     1 
ATOM   914  C CB    . PRO A 1 115 ? -17.858 20.626  14.242  1.00 42.60  ? 115  PRO A CB    1 
ATOM   915  C CG    . PRO A 1 115 ? -18.607 21.786  14.777  1.00 43.03  ? 115  PRO A CG    1 
ATOM   916  C CD    . PRO A 1 115 ? -19.740 22.027  13.801  1.00 42.93  ? 115  PRO A CD    1 
ATOM   917  N N     . PHE A 1 116 ? -16.715 19.558  11.097  1.00 43.22  ? 116  PHE A N     1 
ATOM   918  C CA    . PHE A 1 116 ? -16.315 18.398  10.276  1.00 42.89  ? 116  PHE A CA    1 
ATOM   919  C C     . PHE A 1 116 ? -16.337 17.025  10.983  1.00 42.54  ? 116  PHE A C     1 
ATOM   920  O O     . PHE A 1 116 ? -16.869 16.066  10.434  1.00 42.72  ? 116  PHE A O     1 
ATOM   921  C CB    . PHE A 1 116 ? -14.956 18.646  9.590   1.00 42.82  ? 116  PHE A CB    1 
ATOM   922  C CG    . PHE A 1 116 ? -14.643 17.645  8.499   1.00 43.54  ? 116  PHE A CG    1 
ATOM   923  C CD1   . PHE A 1 116 ? -15.466 17.538  7.375   1.00 44.19  ? 116  PHE A CD1   1 
ATOM   924  C CD2   . PHE A 1 116 ? -13.541 16.801  8.601   1.00 42.67  ? 116  PHE A CD2   1 
ATOM   925  C CE1   . PHE A 1 116 ? -15.196 16.603  6.373   1.00 44.12  ? 116  PHE A CE1   1 
ATOM   926  C CE2   . PHE A 1 116 ? -13.266 15.876  7.614   1.00 42.48  ? 116  PHE A CE2   1 
ATOM   927  C CZ    . PHE A 1 116 ? -14.096 15.772  6.497   1.00 43.65  ? 116  PHE A CZ    1 
ATOM   928  N N     . ALA A 1 117 ? -15.782 16.924  12.184  1.00 42.03  ? 117  ALA A N     1 
ATOM   929  C CA    . ALA A 1 117 ? -15.767 15.633  12.873  1.00 42.43  ? 117  ALA A CA    1 
ATOM   930  C C     . ALA A 1 117 ? -17.161 15.193  13.341  1.00 42.67  ? 117  ALA A C     1 
ATOM   931  O O     . ALA A 1 117 ? -17.441 13.989  13.456  1.00 42.41  ? 117  ALA A O     1 
ATOM   932  C CB    . ALA A 1 117 ? -14.787 15.642  14.037  1.00 42.13  ? 117  ALA A CB    1 
ATOM   933  N N     . LYS A 1 118 ? -18.021 16.176  13.616  1.00 42.95  ? 118  LYS A N     1 
ATOM   934  C CA    . LYS A 1 118 ? -19.417 15.923  14.002  1.00 42.79  ? 118  LYS A CA    1 
ATOM   935  C C     . LYS A 1 118 ? -20.237 15.703  12.731  1.00 42.61  ? 118  LYS A C     1 
ATOM   936  O O     . LYS A 1 118 ? -21.106 14.826  12.675  1.00 42.80  ? 118  LYS A O     1 
ATOM   937  C CB    . LYS A 1 118 ? -19.978 17.073  14.849  1.00 42.42  ? 118  LYS A CB    1 
ATOM   938  C CG    . LYS A 1 118 ? -19.138 17.368  16.065  1.00 42.28  ? 118  LYS A CG    1 
ATOM   939  C CD    . LYS A 1 118 ? -19.670 18.511  16.901  1.00 44.26  ? 118  LYS A CD    1 
ATOM   940  C CE    . LYS A 1 118 ? -20.739 18.026  17.874  1.00 46.59  ? 118  LYS A CE    1 
ATOM   941  N NZ    . LYS A 1 118 ? -20.731 18.733  19.200  1.00 48.06  ? 118  LYS A NZ    1 
ATOM   942  N N     . ARG A 1 119 ? -19.932 16.478  11.699  1.00 42.23  ? 119  ARG A N     1 
ATOM   943  C CA    . ARG A 1 119 ? -20.535 16.244  10.400  1.00 42.32  ? 119  ARG A CA    1 
ATOM   944  C C     . ARG A 1 119 ? -20.362 14.760  10.006  1.00 42.41  ? 119  ARG A C     1 
ATOM   945  O O     . ARG A 1 119 ? -21.300 14.124  9.510   1.00 42.41  ? 119  ARG A O     1 
ATOM   946  C CB    . ARG A 1 119 ? -19.939 17.197  9.367   1.00 42.01  ? 119  ARG A CB    1 
ATOM   947  C CG    . ARG A 1 119 ? -20.262 16.871  7.944   1.00 41.69  ? 119  ARG A CG    1 
ATOM   948  C CD    . ARG A 1 119 ? -21.503 17.586  7.491   1.00 42.61  ? 119  ARG A CD    1 
ATOM   949  N NE    . ARG A 1 119 ? -22.687 16.761  7.705   1.00 42.03  ? 119  ARG A NE    1 
ATOM   950  C CZ    . ARG A 1 119 ? -23.925 17.237  7.794   1.00 41.11  ? 119  ARG A CZ    1 
ATOM   951  N NH1   . ARG A 1 119 ? -24.166 18.547  7.699   1.00 39.59  ? 119  ARG A NH1   1 
ATOM   952  N NH2   . ARG A 1 119 ? -24.922 16.390  7.993   1.00 40.94  ? 119  ARG A NH2   1 
ATOM   953  N N     . TYR A 1 120 ? -19.178 14.208  10.280  1.00 42.13  ? 120  TYR A N     1 
ATOM   954  C CA    . TYR A 1 120 ? -18.861 12.819  9.933   1.00 41.71  ? 120  TYR A CA    1 
ATOM   955  C C     . TYR A 1 120 ? -19.763 11.841  10.674  1.00 41.16  ? 120  TYR A C     1 
ATOM   956  O O     . TYR A 1 120 ? -20.263 10.877  10.079  1.00 41.15  ? 120  TYR A O     1 
ATOM   957  C CB    . TYR A 1 120 ? -17.368 12.508  10.202  1.00 42.29  ? 120  TYR A CB    1 
ATOM   958  C CG    . TYR A 1 120 ? -16.939 11.082  9.876   1.00 42.40  ? 120  TYR A CG    1 
ATOM   959  C CD1   . TYR A 1 120 ? -16.585 10.718  8.578   1.00 42.90  ? 120  TYR A CD1   1 
ATOM   960  C CD2   . TYR A 1 120 ? -16.890 10.104  10.866  1.00 43.06  ? 120  TYR A CD2   1 
ATOM   961  C CE1   . TYR A 1 120 ? -16.206 9.424   8.273   1.00 43.58  ? 120  TYR A CE1   1 
ATOM   962  C CE2   . TYR A 1 120 ? -16.506 8.799   10.572  1.00 43.59  ? 120  TYR A CE2   1 
ATOM   963  C CZ    . TYR A 1 120 ? -16.169 8.470   9.271   1.00 44.05  ? 120  TYR A CZ    1 
ATOM   964  O OH    . TYR A 1 120 ? -15.792 7.187   8.970   1.00 43.97  ? 120  TYR A OH    1 
ATOM   965  N N     . LEU A 1 121 ? -19.964 12.097  11.970  1.00 40.21  ? 121  LEU A N     1 
ATOM   966  C CA    . LEU A 1 121 ? -20.750 11.212  12.829  1.00 39.29  ? 121  LEU A CA    1 
ATOM   967  C C     . LEU A 1 121 ? -22.154 11.049  12.277  1.00 39.59  ? 121  LEU A C     1 
ATOM   968  O O     . LEU A 1 121 ? -22.669 9.926   12.156  1.00 39.68  ? 121  LEU A O     1 
ATOM   969  C CB    . LEU A 1 121 ? -20.777 11.727  14.271  1.00 38.57  ? 121  LEU A CB    1 
ATOM   970  C CG    . LEU A 1 121 ? -19.544 11.333  15.099  1.00 37.08  ? 121  LEU A CG    1 
ATOM   971  C CD1   . LEU A 1 121 ? -19.493 12.076  16.397  1.00 35.37  ? 121  LEU A CD1   1 
ATOM   972  C CD2   . LEU A 1 121 ? -19.484 9.842   15.360  1.00 35.32  ? 121  LEU A CD2   1 
ATOM   973  N N     . ILE A 1 122 ? -22.743 12.184  11.904  1.00 39.65  ? 122  ILE A N     1 
ATOM   974  C CA    . ILE A 1 122 ? -24.102 12.245  11.380  1.00 39.39  ? 122  ILE A CA    1 
ATOM   975  C C     . ILE A 1 122 ? -24.198 11.499  10.049  1.00 39.54  ? 122  ILE A C     1 
ATOM   976  O O     . ILE A 1 122 ? -24.968 10.554  9.928   1.00 39.41  ? 122  ILE A O     1 
ATOM   977  C CB    . ILE A 1 122 ? -24.577 13.726  11.239  1.00 39.25  ? 122  ILE A CB    1 
ATOM   978  C CG1   . ILE A 1 122 ? -24.647 14.399  12.614  1.00 38.71  ? 122  ILE A CG1   1 
ATOM   979  C CG2   . ILE A 1 122 ? -25.905 13.811  10.544  1.00 38.61  ? 122  ILE A CG2   1 
ATOM   980  C CD1   . ILE A 1 122 ? -24.741 15.912  12.582  1.00 36.99  ? 122  ILE A CD1   1 
ATOM   981  N N     . ASP A 1 123 ? -23.387 11.905  9.074   1.00 39.96  ? 123  ASP A N     1 
ATOM   982  C CA    . ASP A 1 123 ? -23.539 11.443  7.694   1.00 40.37  ? 123  ASP A CA    1 
ATOM   983  C C     . ASP A 1 123 ? -23.316 9.939   7.556   1.00 40.82  ? 123  ASP A C     1 
ATOM   984  O O     . ASP A 1 123 ? -24.083 9.262   6.875   1.00 41.25  ? 123  ASP A O     1 
ATOM   985  C CB    . ASP A 1 123 ? -22.604 12.194  6.760   1.00 40.35  ? 123  ASP A CB    1 
ATOM   986  C CG    . ASP A 1 123 ? -22.918 13.697  6.664   1.00 41.25  ? 123  ASP A CG    1 
ATOM   987  O OD1   . ASP A 1 123 ? -23.593 14.273  7.549   1.00 41.26  ? 123  ASP A OD1   1 
ATOM   988  O OD2   . ASP A 1 123 ? -22.446 14.317  5.687   1.00 42.71  ? 123  ASP A OD2   1 
ATOM   989  N N     . LYS A 1 124 ? -22.283 9.415   8.216   1.00 40.82  ? 124  LYS A N     1 
ATOM   990  C CA    . LYS A 1 124 ? -22.033 7.972   8.227   1.00 40.55  ? 124  LYS A CA    1 
ATOM   991  C C     . LYS A 1 124 ? -22.946 7.232   9.207   1.00 40.10  ? 124  LYS A C     1 
ATOM   992  O O     . LYS A 1 124 ? -22.765 6.030   9.436   1.00 40.47  ? 124  LYS A O     1 
ATOM   993  C CB    . LYS A 1 124 ? -20.566 7.674   8.562   1.00 40.66  ? 124  LYS A CB    1 
ATOM   994  C CG    . LYS A 1 124 ? -19.550 8.149   7.514   1.00 42.67  ? 124  LYS A CG    1 
ATOM   995  C CD    . LYS A 1 124 ? -19.325 7.148   6.357   1.00 45.05  ? 124  LYS A CD    1 
ATOM   996  C CE    . LYS A 1 124 ? -18.135 7.619   5.532   1.00 47.95  ? 124  LYS A CE    1 
ATOM   997  N NZ    . LYS A 1 124 ? -17.941 6.907   4.239   1.00 49.64  ? 124  LYS A NZ    1 
ATOM   998  N N     . GLY A 1 125 ? -23.908 7.944   9.795   1.00 39.18  ? 125  GLY A N     1 
ATOM   999  C CA    . GLY A 1 125 ? -24.772 7.373   10.837  1.00 38.27  ? 125  GLY A CA    1 
ATOM   1000 C C     . GLY A 1 125 ? -24.071 6.619   11.961  1.00 37.65  ? 125  GLY A C     1 
ATOM   1001 O O     . GLY A 1 125 ? -24.561 5.593   12.429  1.00 37.66  ? 125  GLY A O     1 
ATOM   1002 N N     . LEU A 1 126 ? -22.929 7.132   12.408  1.00 37.07  ? 126  LEU A N     1 
ATOM   1003 C CA    . LEU A 1 126 ? -22.175 6.496   13.485  1.00 36.41  ? 126  LEU A CA    1 
ATOM   1004 C C     . LEU A 1 126 ? -22.615 7.030   14.836  1.00 35.86  ? 126  LEU A C     1 
ATOM   1005 O O     . LEU A 1 126 ? -22.978 8.196   14.952  1.00 36.44  ? 126  LEU A O     1 
ATOM   1006 C CB    . LEU A 1 126 ? -20.676 6.685   13.251  1.00 36.54  ? 126  LEU A CB    1 
ATOM   1007 C CG    . LEU A 1 126 ? -20.141 5.871   12.046  1.00 36.65  ? 126  LEU A CG    1 
ATOM   1008 C CD1   . LEU A 1 126 ? -18.738 6.299   11.651  1.00 36.50  ? 126  LEU A CD1   1 
ATOM   1009 C CD2   . LEU A 1 126 ? -20.171 4.359   12.299  1.00 34.61  ? 126  LEU A CD2   1 
ATOM   1010 N N     . ILE A 1 127 ? -22.608 6.184   15.855  1.00 35.00  ? 127  ILE A N     1 
ATOM   1011 C CA    . ILE A 1 127 ? -23.153 6.562   17.160  1.00 34.23  ? 127  ILE A CA    1 
ATOM   1012 C C     . ILE A 1 127 ? -22.176 6.278   18.297  1.00 34.29  ? 127  ILE A C     1 
ATOM   1013 O O     . ILE A 1 127 ? -21.920 5.101   18.619  1.00 34.60  ? 127  ILE A O     1 
ATOM   1014 C CB    . ILE A 1 127 ? -24.491 5.814   17.460  1.00 33.84  ? 127  ILE A CB    1 
ATOM   1015 C CG1   . ILE A 1 127 ? -25.522 6.026   16.344  1.00 32.90  ? 127  ILE A CG1   1 
ATOM   1016 C CG2   . ILE A 1 127 ? -25.050 6.196   18.855  1.00 34.28  ? 127  ILE A CG2   1 
ATOM   1017 C CD1   . ILE A 1 127 ? -26.086 7.451   16.183  1.00 30.37  ? 127  ILE A CD1   1 
ATOM   1018 N N     . PRO A 1 128 ? -21.638 7.336   18.938  1.00 34.04  ? 128  PRO A N     1 
ATOM   1019 C CA    . PRO A 1 128 ? -20.725 7.098   20.065  1.00 34.07  ? 128  PRO A CA    1 
ATOM   1020 C C     . PRO A 1 128 ? -21.401 6.353   21.209  1.00 34.66  ? 128  PRO A C     1 
ATOM   1021 O O     . PRO A 1 128 ? -22.623 6.228   21.228  1.00 34.46  ? 128  PRO A O     1 
ATOM   1022 C CB    . PRO A 1 128 ? -20.313 8.502   20.489  1.00 33.68  ? 128  PRO A CB    1 
ATOM   1023 C CG    . PRO A 1 128 ? -20.543 9.339   19.287  1.00 33.24  ? 128  PRO A CG    1 
ATOM   1024 C CD    . PRO A 1 128 ? -21.782 8.771   18.660  1.00 33.84  ? 128  PRO A CD    1 
ATOM   1025 N N     . MET A 1 129 ? -20.592 5.818   22.121  1.00 35.76  ? 129  MET A N     1 
ATOM   1026 C CA    . MET A 1 129 ? -21.055 5.098   23.326  1.00 36.39  ? 129  MET A CA    1 
ATOM   1027 C C     . MET A 1 129 ? -22.067 3.956   23.162  1.00 37.79  ? 129  MET A C     1 
ATOM   1028 O O     . MET A 1 129 ? -22.844 3.708   24.069  1.00 38.35  ? 129  MET A O     1 
ATOM   1029 C CB    . MET A 1 129 ? -21.570 6.083   24.381  1.00 35.77  ? 129  MET A CB    1 
ATOM   1030 C CG    . MET A 1 129 ? -20.652 7.258   24.627  1.00 33.59  ? 129  MET A CG    1 
ATOM   1031 S SD    . MET A 1 129 ? -19.005 6.742   25.120  1.00 30.19  ? 129  MET A SD    1 
ATOM   1032 C CE    . MET A 1 129 ? -19.307 6.097   26.769  1.00 25.84  ? 129  MET A CE    1 
ATOM   1033 N N     . GLU A 1 130 ? -22.035 3.226   22.051  1.00 39.49  ? 130  GLU A N     1 
ATOM   1034 C CA    . GLU A 1 130 ? -22.885 2.034   21.910  1.00 41.08  ? 130  GLU A CA    1 
ATOM   1035 C C     . GLU A 1 130 ? -22.127 0.758   22.221  1.00 41.97  ? 130  GLU A C     1 
ATOM   1036 O O     . GLU A 1 130 ? -20.966 0.633   21.853  1.00 42.48  ? 130  GLU A O     1 
ATOM   1037 C CB    . GLU A 1 130 ? -23.365 1.906   20.479  1.00 41.30  ? 130  GLU A CB    1 
ATOM   1038 C CG    . GLU A 1 130 ? -24.304 2.963   20.045  1.00 42.84  ? 130  GLU A CG    1 
ATOM   1039 C CD    . GLU A 1 130 ? -25.289 2.435   19.041  1.00 46.46  ? 130  GLU A CD    1 
ATOM   1040 O OE1   . GLU A 1 130 ? -26.509 2.496   19.344  1.00 47.89  ? 130  GLU A OE1   1 
ATOM   1041 O OE2   . GLU A 1 130 ? -24.844 1.944   17.967  1.00 47.22  ? 130  GLU A OE2   1 
ATOM   1042 N N     . GLY A 1 131 ? -22.771 -0.216  22.854  1.00 42.83  ? 131  GLY A N     1 
ATOM   1043 C CA    . GLY A 1 131 ? -22.162 -1.550  22.940  1.00 43.45  ? 131  GLY A CA    1 
ATOM   1044 C C     . GLY A 1 131 ? -21.911 -2.016  24.348  1.00 43.97  ? 131  GLY A C     1 
ATOM   1045 O O     . GLY A 1 131 ? -22.279 -1.323  25.296  1.00 44.24  ? 131  GLY A O     1 
ATOM   1046 N N     . ASP A 1 132 ? -21.281 -3.186  24.483  1.00 44.57  ? 132  ASP A N     1 
ATOM   1047 C CA    . ASP A 1 132 ? -21.135 -3.863  25.789  1.00 44.84  ? 132  ASP A CA    1 
ATOM   1048 C C     . ASP A 1 132 ? -19.901 -3.403  26.593  1.00 44.94  ? 132  ASP A C     1 
ATOM   1049 O O     . ASP A 1 132 ? -19.924 -3.445  27.842  1.00 45.64  ? 132  ASP A O     1 
ATOM   1050 C CB    . ASP A 1 132 ? -21.137 -5.397  25.628  1.00 44.83  ? 132  ASP A CB    1 
ATOM   1051 N N     . GLU A 1 133 ? -18.861 -2.955  25.876  1.00 43.89  ? 133  GLU A N     1 
ATOM   1052 C CA    . GLU A 1 133 ? -17.564 -2.520  26.435  1.00 43.28  ? 133  GLU A CA    1 
ATOM   1053 C C     . GLU A 1 133 ? -17.559 -2.005  27.857  1.00 42.22  ? 133  GLU A C     1 
ATOM   1054 O O     . GLU A 1 133 ? -18.260 -1.062  28.154  1.00 42.28  ? 133  GLU A O     1 
ATOM   1055 C CB    . GLU A 1 133 ? -16.962 -1.422  25.562  1.00 43.30  ? 133  GLU A CB    1 
ATOM   1056 C CG    . GLU A 1 133 ? -16.516 -1.894  24.219  1.00 45.77  ? 133  GLU A CG    1 
ATOM   1057 C CD    . GLU A 1 133 ? -15.284 -2.779  24.301  1.00 49.10  ? 133  GLU A CD    1 
ATOM   1058 O OE1   . GLU A 1 133 ? -14.395 -2.501  25.135  1.00 51.52  ? 133  GLU A OE1   1 
ATOM   1059 O OE2   . GLU A 1 133 ? -15.205 -3.751  23.523  1.00 51.08  ? 133  GLU A OE2   1 
ATOM   1060 N N     . GLU A 1 134 ? -16.760 -2.624  28.724  1.00 41.50  ? 134  GLU A N     1 
ATOM   1061 C CA    . GLU A 1 134 ? -16.417 -2.045  30.025  1.00 40.78  ? 134  GLU A CA    1 
ATOM   1062 C C     . GLU A 1 134 ? -15.325 -0.968  29.838  1.00 40.08  ? 134  GLU A C     1 
ATOM   1063 O O     . GLU A 1 134 ? -14.139 -1.292  29.657  1.00 40.45  ? 134  GLU A O     1 
ATOM   1064 C CB    . GLU A 1 134 ? -15.928 -3.123  30.999  1.00 40.68  ? 134  GLU A CB    1 
ATOM   1065 C CG    . GLU A 1 134 ? -17.026 -3.880  31.714  1.00 42.06  ? 134  GLU A CG    1 
ATOM   1066 N N     . LEU A 1 135 ? -15.711 0.304   29.861  1.00 38.51  ? 135  LEU A N     1 
ATOM   1067 C CA    . LEU A 1 135 ? -14.712 1.364   29.795  1.00 36.93  ? 135  LEU A CA    1 
ATOM   1068 C C     . LEU A 1 135 ? -13.886 1.388   31.079  1.00 36.07  ? 135  LEU A C     1 
ATOM   1069 O O     . LEU A 1 135 ? -14.380 1.063   32.130  1.00 36.14  ? 135  LEU A O     1 
ATOM   1070 C CB    . LEU A 1 135 ? -15.368 2.705   29.526  1.00 36.52  ? 135  LEU A CB    1 
ATOM   1071 C CG    . LEU A 1 135 ? -16.086 2.796   28.185  1.00 35.97  ? 135  LEU A CG    1 
ATOM   1072 C CD1   . LEU A 1 135 ? -16.449 4.230   27.872  1.00 35.46  ? 135  LEU A CD1   1 
ATOM   1073 C CD2   . LEU A 1 135 ? -15.241 2.226   27.062  1.00 36.42  ? 135  LEU A CD2   1 
ATOM   1074 N N     . LYS A 1 136 ? -12.611 1.726   30.981  1.00 35.53  ? 136  LYS A N     1 
ATOM   1075 C CA    . LYS A 1 136 ? -11.746 1.752   32.157  1.00 34.96  ? 136  LYS A CA    1 
ATOM   1076 C C     . LYS A 1 136 ? -11.612 3.223   32.553  1.00 34.88  ? 136  LYS A C     1 
ATOM   1077 O O     . LYS A 1 136 ? -11.353 4.102   31.693  1.00 34.24  ? 136  LYS A O     1 
ATOM   1078 C CB    . LYS A 1 136 ? -10.387 1.081   31.844  1.00 34.75  ? 136  LYS A CB    1 
ATOM   1079 C CG    . LYS A 1 136 ? -9.289  1.227   32.879  1.00 33.78  ? 136  LYS A CG    1 
ATOM   1080 C CD    . LYS A 1 136 ? -8.993  -0.060  33.611  1.00 34.66  ? 136  LYS A CD    1 
ATOM   1081 C CE    . LYS A 1 136 ? -7.928  0.134   34.723  1.00 35.23  ? 136  LYS A CE    1 
ATOM   1082 N NZ    . LYS A 1 136 ? -8.351  1.082   35.847  1.00 33.77  ? 136  LYS A NZ    1 
ATOM   1083 N N     . MET A 1 137 ? -11.792 3.480   33.850  1.00 34.36  ? 137  MET A N     1 
ATOM   1084 C CA    . MET A 1 137 ? -12.005 4.840   34.335  1.00 34.43  ? 137  MET A CA    1 
ATOM   1085 C C     . MET A 1 137 ? -11.145 5.251   35.519  1.00 34.35  ? 137  MET A C     1 
ATOM   1086 O O     . MET A 1 137 ? -10.946 4.483   36.444  1.00 34.18  ? 137  MET A O     1 
ATOM   1087 C CB    . MET A 1 137 ? -13.479 5.013   34.682  1.00 34.43  ? 137  MET A CB    1 
ATOM   1088 C CG    . MET A 1 137 ? -14.356 4.934   33.452  1.00 34.77  ? 137  MET A CG    1 
ATOM   1089 S SD    . MET A 1 137 ? -16.073 5.398   33.653  1.00 34.85  ? 137  MET A SD    1 
ATOM   1090 C CE    . MET A 1 137 ? -16.055 6.279   35.194  1.00 36.61  ? 137  MET A CE    1 
ATOM   1091 N N     . LEU A 1 138 ? -10.659 6.487   35.500  1.00 34.61  ? 138  LEU A N     1 
ATOM   1092 C CA    . LEU A 1 138 ? -9.785  6.964   36.565  1.00 34.62  ? 138  LEU A CA    1 
ATOM   1093 C C     . LEU A 1 138 ? -10.172 8.372   36.993  1.00 35.27  ? 138  LEU A C     1 
ATOM   1094 O O     . LEU A 1 138 ? -10.255 9.285   36.171  1.00 35.48  ? 138  LEU A O     1 
ATOM   1095 C CB    . LEU A 1 138 ? -8.341  6.942   36.066  1.00 34.26  ? 138  LEU A CB    1 
ATOM   1096 C CG    . LEU A 1 138 ? -7.144  7.113   36.998  1.00 33.02  ? 138  LEU A CG    1 
ATOM   1097 C CD1   . LEU A 1 138 ? -7.071  5.985   37.960  1.00 30.62  ? 138  LEU A CD1   1 
ATOM   1098 C CD2   . LEU A 1 138 ? -5.862  7.194   36.177  1.00 31.55  ? 138  LEU A CD2   1 
ATOM   1099 N N     . ALA A 1 139 ? -10.416 8.551   38.276  1.00 36.02  ? 139  ALA A N     1 
ATOM   1100 C CA    . ALA A 1 139 ? -10.604 9.891   38.798  1.00 37.43  ? 139  ALA A CA    1 
ATOM   1101 C C     . ALA A 1 139 ? -9.263  10.413  39.284  1.00 38.43  ? 139  ALA A C     1 
ATOM   1102 O O     . ALA A 1 139 ? -8.446  9.634   39.800  1.00 38.43  ? 139  ALA A O     1 
ATOM   1103 C CB    . ALA A 1 139 ? -11.595 9.884   39.945  1.00 37.24  ? 139  ALA A CB    1 
ATOM   1104 N N     . PHE A 1 140 ? -9.045  11.723  39.137  1.00 39.42  ? 140  PHE A N     1 
ATOM   1105 C CA    . PHE A 1 140 ? -7.881  12.372  39.741  1.00 40.15  ? 140  PHE A CA    1 
ATOM   1106 C C     . PHE A 1 140 ? -8.107  13.797  40.247  1.00 41.66  ? 140  PHE A C     1 
ATOM   1107 O O     . PHE A 1 140 ? -8.905  14.547  39.707  1.00 41.84  ? 140  PHE A O     1 
ATOM   1108 C CB    . PHE A 1 140 ? -6.663  12.299  38.814  1.00 39.21  ? 140  PHE A CB    1 
ATOM   1109 C CG    . PHE A 1 140 ? -6.636  13.334  37.746  1.00 36.55  ? 140  PHE A CG    1 
ATOM   1110 C CD1   . PHE A 1 140 ? -5.979  14.529  37.941  1.00 34.66  ? 140  PHE A CD1   1 
ATOM   1111 C CD2   . PHE A 1 140 ? -7.232  13.104  36.521  1.00 36.03  ? 140  PHE A CD2   1 
ATOM   1112 C CE1   . PHE A 1 140 ? -5.932  15.498  36.931  1.00 32.50  ? 140  PHE A CE1   1 
ATOM   1113 C CE2   . PHE A 1 140 ? -7.187  14.075  35.502  1.00 33.38  ? 140  PHE A CE2   1 
ATOM   1114 C CZ    . PHE A 1 140 ? -6.536  15.264  35.721  1.00 31.45  ? 140  PHE A CZ    1 
ATOM   1115 N N     . ASP A 1 141 ? -7.378  14.145  41.299  1.00 43.78  ? 141  ASP A N     1 
ATOM   1116 C CA    . ASP A 1 141 ? -7.355  15.500  41.856  1.00 45.46  ? 141  ASP A CA    1 
ATOM   1117 C C     . ASP A 1 141 ? -5.921  15.923  42.272  1.00 46.65  ? 141  ASP A C     1 
ATOM   1118 O O     . ASP A 1 141 ? -5.032  15.075  42.493  1.00 46.92  ? 141  ASP A O     1 
ATOM   1119 C CB    . ASP A 1 141 ? -8.325  15.605  43.049  1.00 45.34  ? 141  ASP A CB    1 
ATOM   1120 C CG    . ASP A 1 141 ? -8.853  17.025  43.258  1.00 45.86  ? 141  ASP A CG    1 
ATOM   1121 O OD1   . ASP A 1 141 ? -8.526  17.917  42.441  1.00 45.03  ? 141  ASP A OD1   1 
ATOM   1122 O OD2   . ASP A 1 141 ? -9.600  17.251  44.238  1.00 46.17  ? 141  ASP A OD2   1 
ATOM   1123 N N     . ILE A 1 142 ? -5.700  17.232  42.366  1.00 47.67  ? 142  ILE A N     1 
ATOM   1124 C CA    . ILE A 1 142 ? -4.430  17.763  42.834  1.00 48.65  ? 142  ILE A CA    1 
ATOM   1125 C C     . ILE A 1 142 ? -4.711  18.650  44.028  1.00 50.40  ? 142  ILE A C     1 
ATOM   1126 O O     . ILE A 1 142 ? -5.817  19.160  44.169  1.00 50.64  ? 142  ILE A O     1 
ATOM   1127 C CB    . ILE A 1 142 ? -3.702  18.555  41.742  1.00 48.09  ? 142  ILE A CB    1 
ATOM   1128 C CG1   . ILE A 1 142 ? -4.412  19.882  41.455  1.00 46.91  ? 142  ILE A CG1   1 
ATOM   1129 C CG2   . ILE A 1 142 ? -3.566  17.717  40.465  1.00 47.64  ? 142  ILE A CG2   1 
ATOM   1130 C CD1   . ILE A 1 142 ? -3.580  20.861  40.644  1.00 45.35  ? 142  ILE A CD1   1 
ATOM   1131 N N     . GLU A 1 143 ? -3.727  18.801  44.908  1.00 52.68  ? 143  GLU A N     1 
ATOM   1132 C CA    . GLU A 1 143 ? -3.824  19.750  46.015  1.00 54.98  ? 143  GLU A CA    1 
ATOM   1133 C C     . GLU A 1 143 ? -2.603  20.653  45.990  1.00 55.99  ? 143  GLU A C     1 
ATOM   1134 O O     . GLU A 1 143 ? -1.482  20.159  46.077  1.00 56.49  ? 143  GLU A O     1 
ATOM   1135 C CB    . GLU A 1 143 ? -3.973  19.022  47.353  1.00 55.09  ? 143  GLU A CB    1 
ATOM   1136 C CG    . GLU A 1 143 ? -5.392  19.123  47.955  1.00 57.98  ? 143  GLU A CG    1 
ATOM   1137 C CD    . GLU A 1 143 ? -6.454  18.342  47.164  1.00 61.74  ? 143  GLU A CD    1 
ATOM   1138 O OE1   . GLU A 1 143 ? -6.324  17.097  47.088  1.00 62.36  ? 143  GLU A OE1   1 
ATOM   1139 O OE2   . GLU A 1 143 ? -7.415  18.974  46.627  1.00 63.34  ? 143  GLU A OE2   1 
ATOM   1140 N N     . THR A 1 144 ? -2.816  21.962  45.823  1.00 57.46  ? 144  THR A N     1 
ATOM   1141 C CA    . THR A 1 144 ? -1.705  22.907  45.581  1.00 59.01  ? 144  THR A CA    1 
ATOM   1142 C C     . THR A 1 144 ? -1.314  23.733  46.821  1.00 60.38  ? 144  THR A C     1 
ATOM   1143 O O     . THR A 1 144 ? -2.054  23.761  47.814  1.00 60.56  ? 144  THR A O     1 
ATOM   1144 C CB    . THR A 1 144 ? -1.939  23.859  44.330  1.00 58.82  ? 144  THR A CB    1 
ATOM   1145 O OG1   . THR A 1 144 ? -2.910  24.863  44.634  1.00 58.74  ? 144  THR A OG1   1 
ATOM   1146 C CG2   . THR A 1 144 ? -2.392  23.093  43.103  1.00 58.44  ? 144  THR A CG2   1 
ATOM   1147 N N     . LEU A 1 145 ? -0.133  24.366  46.760  1.00 62.04  ? 145  LEU A N     1 
ATOM   1148 C CA    . LEU A 1 145 ? 0.299   25.371  47.746  1.00 63.30  ? 145  LEU A CA    1 
ATOM   1149 C C     . LEU A 1 145 ? -0.135  26.776  47.303  1.00 64.09  ? 145  LEU A C     1 
ATOM   1150 O O     . LEU A 1 145 ? 0.288   27.267  46.252  1.00 64.07  ? 145  LEU A O     1 
ATOM   1151 C CB    . LEU A 1 145 ? 1.819   25.326  47.943  1.00 63.36  ? 145  LEU A CB    1 
ATOM   1152 C CG    . LEU A 1 145 ? 2.444   26.272  48.983  1.00 63.92  ? 145  LEU A CG    1 
ATOM   1153 C CD1   . LEU A 1 145 ? 1.816   26.087  50.358  1.00 63.85  ? 145  LEU A CD1   1 
ATOM   1154 C CD2   . LEU A 1 145 ? 3.957   26.079  49.064  1.00 63.74  ? 145  LEU A CD2   1 
ATOM   1155 N N     . TYR A 1 146 ? -0.972  27.413  48.119  1.00 65.20  ? 146  TYR A N     1 
ATOM   1156 C CA    . TYR A 1 146 ? -1.606  28.683  47.753  1.00 66.22  ? 146  TYR A CA    1 
ATOM   1157 C C     . TYR A 1 146 ? -1.354  29.792  48.769  1.00 66.72  ? 146  TYR A C     1 
ATOM   1158 O O     . TYR A 1 146 ? -1.417  29.567  49.988  1.00 66.94  ? 146  TYR A O     1 
ATOM   1159 C CB    . TYR A 1 146 ? -3.122  28.480  47.567  1.00 66.62  ? 146  TYR A CB    1 
ATOM   1160 C CG    . TYR A 1 146 ? -3.944  29.755  47.487  1.00 66.63  ? 146  TYR A CG    1 
ATOM   1161 C CD1   . TYR A 1 146 ? -4.011  30.497  46.294  1.00 66.55  ? 146  TYR A CD1   1 
ATOM   1162 C CD2   . TYR A 1 146 ? -4.663  30.211  48.600  1.00 67.18  ? 146  TYR A CD2   1 
ATOM   1163 C CE1   . TYR A 1 146 ? -4.764  31.664  46.212  1.00 67.28  ? 146  TYR A CE1   1 
ATOM   1164 C CE2   . TYR A 1 146 ? -5.420  31.380  48.536  1.00 68.23  ? 146  TYR A CE2   1 
ATOM   1165 C CZ    . TYR A 1 146 ? -5.468  32.104  47.337  1.00 68.47  ? 146  TYR A CZ    1 
ATOM   1166 O OH    . TYR A 1 146 ? -6.218  33.267  47.274  1.00 68.76  ? 146  TYR A OH    1 
ATOM   1167 N N     . HIS A 1 147 ? -1.067  30.984  48.246  1.00 67.28  ? 147  HIS A N     1 
ATOM   1168 C CA    . HIS A 1 147 ? -1.012  32.213  49.041  1.00 67.85  ? 147  HIS A CA    1 
ATOM   1169 C C     . HIS A 1 147 ? -1.693  33.331  48.267  1.00 67.91  ? 147  HIS A C     1 
ATOM   1170 O O     . HIS A 1 147 ? -1.418  33.549  47.080  1.00 67.41  ? 147  HIS A O     1 
ATOM   1171 C CB    . HIS A 1 147 ? 0.431   32.603  49.421  1.00 67.94  ? 147  HIS A CB    1 
ATOM   1172 C CG    . HIS A 1 147 ? 1.149   31.556  50.215  1.00 68.79  ? 147  HIS A CG    1 
ATOM   1173 N ND1   . HIS A 1 147 ? 2.183   30.806  49.695  1.00 69.66  ? 147  HIS A ND1   1 
ATOM   1174 C CD2   . HIS A 1 147 ? 0.959   31.110  51.482  1.00 69.83  ? 147  HIS A CD2   1 
ATOM   1175 C CE1   . HIS A 1 147 ? 2.607   29.950  50.611  1.00 70.67  ? 147  HIS A CE1   1 
ATOM   1176 N NE2   . HIS A 1 147 ? 1.880   30.113  51.704  1.00 70.67  ? 147  HIS A NE2   1 
ATOM   1177 N N     . GLU A 1 148 ? -2.586  34.025  48.962  1.00 68.32  ? 148  GLU A N     1 
ATOM   1178 C CA    . GLU A 1 148 ? -3.369  35.105  48.388  1.00 68.88  ? 148  GLU A CA    1 
ATOM   1179 C C     . GLU A 1 148 ? -2.563  36.037  47.505  1.00 69.01  ? 148  GLU A C     1 
ATOM   1180 O O     . GLU A 1 148 ? -1.523  36.552  47.920  1.00 69.24  ? 148  GLU A O     1 
ATOM   1181 C CB    . GLU A 1 148 ? -4.002  35.925  49.498  1.00 68.98  ? 148  GLU A CB    1 
ATOM   1182 C CG    . GLU A 1 148 ? -5.154  35.232  50.182  1.00 70.49  ? 148  GLU A CG    1 
ATOM   1183 C CD    . GLU A 1 148 ? -6.282  36.185  50.527  1.00 71.93  ? 148  GLU A CD    1 
ATOM   1184 O OE1   . GLU A 1 148 ? -7.344  35.674  50.951  1.00 72.41  ? 148  GLU A OE1   1 
ATOM   1185 O OE2   . GLU A 1 148 ? -6.111  37.428  50.364  1.00 71.82  ? 148  GLU A OE2   1 
ATOM   1186 N N     . GLY A 1 149 ? -3.047  36.249  46.287  1.00 69.16  ? 149  GLY A N     1 
ATOM   1187 C CA    . GLY A 1 149 ? -2.483  37.271  45.411  1.00 69.33  ? 149  GLY A CA    1 
ATOM   1188 C C     . GLY A 1 149 ? -1.436  36.790  44.430  1.00 69.54  ? 149  GLY A C     1 
ATOM   1189 O O     . GLY A 1 149 ? -1.030  37.549  43.544  1.00 69.54  ? 149  GLY A O     1 
ATOM   1190 N N     . GLU A 1 150 ? -0.994  35.540  44.584  1.00 69.59  ? 150  GLU A N     1 
ATOM   1191 C CA    . GLU A 1 150 ? -0.022  34.949  43.669  1.00 69.82  ? 150  GLU A CA    1 
ATOM   1192 C C     . GLU A 1 150 ? -0.594  34.873  42.265  1.00 69.64  ? 150  GLU A C     1 
ATOM   1193 O O     . GLU A 1 150 ? -1.800  34.682  42.100  1.00 69.60  ? 150  GLU A O     1 
ATOM   1194 C CB    . GLU A 1 150 ? 0.340   33.539  44.109  1.00 70.04  ? 150  GLU A CB    1 
ATOM   1195 C CG    . GLU A 1 150 ? 1.349   33.443  45.222  1.00 71.36  ? 150  GLU A CG    1 
ATOM   1196 C CD    . GLU A 1 150 ? 1.382   32.047  45.846  1.00 74.38  ? 150  GLU A CD    1 
ATOM   1197 O OE1   . GLU A 1 150 ? 1.952   31.928  46.954  1.00 75.15  ? 150  GLU A OE1   1 
ATOM   1198 O OE2   . GLU A 1 150 ? 0.834   31.072  45.247  1.00 74.74  ? 150  GLU A OE2   1 
ATOM   1199 N N     . LYS A 1 151 ? 0.274   35.026  41.263  1.00 69.53  ? 151  LYS A N     1 
ATOM   1200 C CA    . LYS A 1 151 ? -0.080  34.733  39.873  1.00 69.41  ? 151  LYS A CA    1 
ATOM   1201 C C     . LYS A 1 151 ? -0.496  33.253  39.771  1.00 69.50  ? 151  LYS A C     1 
ATOM   1202 O O     . LYS A 1 151 ? -0.080  32.412  40.586  1.00 69.62  ? 151  LYS A O     1 
ATOM   1203 C CB    . LYS A 1 151 ? 1.082   35.056  38.919  1.00 69.17  ? 151  LYS A CB    1 
ATOM   1204 N N     . PHE A 1 152 ? -1.340  32.942  38.792  1.00 69.36  ? 152  PHE A N     1 
ATOM   1205 C CA    . PHE A 1 152 ? -1.844  31.586  38.631  1.00 68.96  ? 152  PHE A CA    1 
ATOM   1206 C C     . PHE A 1 152 ? -0.700  30.572  38.560  1.00 68.61  ? 152  PHE A C     1 
ATOM   1207 O O     . PHE A 1 152 ? 0.236   30.739  37.773  1.00 68.37  ? 152  PHE A O     1 
ATOM   1208 C CB    . PHE A 1 152 ? -2.759  31.476  37.402  1.00 68.75  ? 152  PHE A CB    1 
ATOM   1209 C CG    . PHE A 1 152 ? -3.255  30.080  37.150  1.00 68.64  ? 152  PHE A CG    1 
ATOM   1210 C CD1   . PHE A 1 152 ? -4.052  29.429  38.094  1.00 68.12  ? 152  PHE A CD1   1 
ATOM   1211 C CD2   . PHE A 1 152 ? -2.911  29.408  35.977  1.00 68.78  ? 152  PHE A CD2   1 
ATOM   1212 C CE1   . PHE A 1 152 ? -4.500  28.137  37.874  1.00 68.05  ? 152  PHE A CE1   1 
ATOM   1213 C CE2   . PHE A 1 152 ? -3.358  28.108  35.741  1.00 68.10  ? 152  PHE A CE2   1 
ATOM   1214 C CZ    . PHE A 1 152 ? -4.149  27.472  36.691  1.00 68.48  ? 152  PHE A CZ    1 
ATOM   1215 N N     . ALA A 1 153 ? -0.788  29.549  39.414  1.00 68.47  ? 153  ALA A N     1 
ATOM   1216 C CA    . ALA A 1 153 ? 0.154   28.412  39.454  1.00 68.46  ? 153  ALA A CA    1 
ATOM   1217 C C     . ALA A 1 153 ? 1.602   28.781  39.793  1.00 68.37  ? 153  ALA A C     1 
ATOM   1218 O O     . ALA A 1 153 ? 2.544   28.063  39.431  1.00 68.27  ? 153  ALA A O     1 
ATOM   1219 C CB    . ALA A 1 153 ? 0.085   27.571  38.155  1.00 68.41  ? 153  ALA A CB    1 
ATOM   1220 N N     . GLU A 1 154 ? 1.773   29.899  40.493  1.00 68.23  ? 154  GLU A N     1 
ATOM   1221 C CA    . GLU A 1 154 ? 3.081   30.274  41.016  1.00 67.89  ? 154  GLU A CA    1 
ATOM   1222 C C     . GLU A 1 154 ? 3.475   29.274  42.092  1.00 67.01  ? 154  GLU A C     1 
ATOM   1223 O O     . GLU A 1 154 ? 4.594   28.755  42.068  1.00 67.03  ? 154  GLU A O     1 
ATOM   1224 C CB    . GLU A 1 154 ? 3.061   31.692  41.575  1.00 68.21  ? 154  GLU A CB    1 
ATOM   1225 C CG    . GLU A 1 154 ? 4.430   32.226  41.905  1.00 70.38  ? 154  GLU A CG    1 
ATOM   1226 C CD    . GLU A 1 154 ? 4.626   33.659  41.430  1.00 74.16  ? 154  GLU A CD    1 
ATOM   1227 O OE1   . GLU A 1 154 ? 3.830   34.146  40.580  1.00 75.22  ? 154  GLU A OE1   1 
ATOM   1228 O OE2   . GLU A 1 154 ? 5.596   34.297  41.899  1.00 75.38  ? 154  GLU A OE2   1 
ATOM   1229 N N     . GLY A 1 155 ? 2.546   29.002  43.017  1.00 65.83  ? 155  GLY A N     1 
ATOM   1230 C CA    . GLY A 1 155 ? 2.709   27.938  44.007  1.00 64.39  ? 155  GLY A CA    1 
ATOM   1231 C C     . GLY A 1 155 ? 2.907   26.564  43.369  1.00 63.28  ? 155  GLY A C     1 
ATOM   1232 O O     . GLY A 1 155 ? 2.425   26.306  42.266  1.00 63.15  ? 155  GLY A O     1 
ATOM   1233 N N     . PRO A 1 156 ? 3.656   25.678  44.044  1.00 62.30  ? 156  PRO A N     1 
ATOM   1234 C CA    . PRO A 1 156 ? 3.802   24.334  43.525  1.00 61.27  ? 156  PRO A CA    1 
ATOM   1235 C C     . PRO A 1 156 ? 2.590   23.467  43.850  1.00 60.54  ? 156  PRO A C     1 
ATOM   1236 O O     . PRO A 1 156 ? 1.864   23.745  44.819  1.00 60.40  ? 156  PRO A O     1 
ATOM   1237 C CB    . PRO A 1 156 ? 5.023   23.816  44.281  1.00 61.22  ? 156  PRO A CB    1 
ATOM   1238 C CG    . PRO A 1 156 ? 4.991   24.514  45.576  1.00 61.11  ? 156  PRO A CG    1 
ATOM   1239 C CD    . PRO A 1 156 ? 4.424   25.876  45.291  1.00 62.25  ? 156  PRO A CD    1 
ATOM   1240 N N     . ILE A 1 157 ? 2.379   22.431  43.036  1.00 59.35  ? 157  ILE A N     1 
ATOM   1241 C CA    . ILE A 1 157 ? 1.482   21.337  43.408  1.00 58.15  ? 157  ILE A CA    1 
ATOM   1242 C C     . ILE A 1 157 ? 2.161   20.583  44.538  1.00 57.20  ? 157  ILE A C     1 
ATOM   1243 O O     . ILE A 1 157 ? 3.372   20.450  44.550  1.00 56.73  ? 157  ILE A O     1 
ATOM   1244 C CB    . ILE A 1 157 ? 1.226   20.352  42.238  1.00 58.10  ? 157  ILE A CB    1 
ATOM   1245 C CG1   . ILE A 1 157 ? 0.758   21.094  40.991  1.00 57.56  ? 157  ILE A CG1   1 
ATOM   1246 C CG2   . ILE A 1 157 ? 0.200   19.295  42.638  1.00 58.20  ? 157  ILE A CG2   1 
ATOM   1247 C CD1   . ILE A 1 157 ? 1.049   20.369  39.713  1.00 56.10  ? 157  ILE A CD1   1 
ATOM   1248 N N     . LEU A 1 158 ? 1.382   20.092  45.483  1.00 56.40  ? 158  LEU A N     1 
ATOM   1249 C CA    . LEU A 1 158 ? 1.948   19.394  46.613  1.00 55.91  ? 158  LEU A CA    1 
ATOM   1250 C C     . LEU A 1 158 ? 1.666   17.910  46.531  1.00 55.48  ? 158  LEU A C     1 
ATOM   1251 O O     . LEU A 1 158 ? 2.478   17.096  46.960  1.00 55.54  ? 158  LEU A O     1 
ATOM   1252 C CB    . LEU A 1 158 ? 1.409   19.976  47.924  1.00 55.92  ? 158  LEU A CB    1 
ATOM   1253 C CG    . LEU A 1 158 ? 1.557   21.498  48.114  1.00 56.37  ? 158  LEU A CG    1 
ATOM   1254 C CD1   . LEU A 1 158 ? 0.936   21.941  49.436  1.00 55.92  ? 158  LEU A CD1   1 
ATOM   1255 C CD2   . LEU A 1 158 ? 3.012   21.993  48.006  1.00 56.15  ? 158  LEU A CD2   1 
ATOM   1256 N N     . MET A 1 159 ? 0.500   17.568  45.992  1.00 55.12  ? 159  MET A N     1 
ATOM   1257 C CA    . MET A 1 159 ? 0.060   16.172  45.861  1.00 54.50  ? 159  MET A CA    1 
ATOM   1258 C C     . MET A 1 159 ? -0.813  16.007  44.620  1.00 53.41  ? 159  MET A C     1 
ATOM   1259 O O     . MET A 1 159 ? -1.532  16.925  44.215  1.00 53.51  ? 159  MET A O     1 
ATOM   1260 C CB    . MET A 1 159 ? -0.740  15.686  47.084  1.00 54.69  ? 159  MET A CB    1 
ATOM   1261 C CG    . MET A 1 159 ? -0.411  16.321  48.434  1.00 56.35  ? 159  MET A CG    1 
ATOM   1262 S SD    . MET A 1 159 ? -1.327  15.487  49.763  1.00 61.12  ? 159  MET A SD    1 
ATOM   1263 C CE    . MET A 1 159 ? -0.658  16.250  51.242  1.00 61.06  ? 159  MET A CE    1 
ATOM   1264 N N     . ILE A 1 160 ? -0.737  14.823  44.027  1.00 51.95  ? 160  ILE A N     1 
ATOM   1265 C CA    . ILE A 1 160 ? -1.635  14.410  42.967  1.00 50.19  ? 160  ILE A CA    1 
ATOM   1266 C C     . ILE A 1 160 ? -2.263  13.113  43.453  1.00 49.41  ? 160  ILE A C     1 
ATOM   1267 O O     . ILE A 1 160 ? -1.556  12.210  43.882  1.00 49.19  ? 160  ILE A O     1 
ATOM   1268 C CB    . ILE A 1 160 ? -0.875  14.162  41.686  1.00 49.97  ? 160  ILE A CB    1 
ATOM   1269 C CG1   . ILE A 1 160 ? -0.255  15.458  41.177  1.00 49.15  ? 160  ILE A CG1   1 
ATOM   1270 C CG2   . ILE A 1 160 ? -1.791  13.600  40.642  1.00 50.64  ? 160  ILE A CG2   1 
ATOM   1271 C CD1   . ILE A 1 160 ? 0.649   15.243  39.993  1.00 48.39  ? 160  ILE A CD1   1 
ATOM   1272 N N     . SER A 1 161 ? -3.591  13.043  43.428  1.00 48.57  ? 161  SER A N     1 
ATOM   1273 C CA    . SER A 1 161 ? -4.321  11.883  43.944  1.00 47.38  ? 161  SER A CA    1 
ATOM   1274 C C     . SER A 1 161 ? -5.135  11.258  42.833  1.00 47.09  ? 161  SER A C     1 
ATOM   1275 O O     . SER A 1 161 ? -5.625  11.956  41.940  1.00 46.86  ? 161  SER A O     1 
ATOM   1276 C CB    . SER A 1 161 ? -5.247  12.305  45.073  1.00 47.28  ? 161  SER A CB    1 
ATOM   1277 O OG    . SER A 1 161 ? -6.094  13.364  44.660  1.00 46.45  ? 161  SER A OG    1 
ATOM   1278 N N     . TYR A 1 162 ? -5.273  9.941   42.872  1.00 46.35  ? 162  TYR A N     1 
ATOM   1279 C CA    . TYR A 1 162 ? -6.076  9.269   41.875  1.00 46.08  ? 162  TYR A CA    1 
ATOM   1280 C C     . TYR A 1 162 ? -6.802  8.101   42.497  1.00 45.62  ? 162  TYR A C     1 
ATOM   1281 O O     . TYR A 1 162 ? -6.349  7.552   43.505  1.00 45.68  ? 162  TYR A O     1 
ATOM   1282 C CB    . TYR A 1 162 ? -5.222  8.828   40.679  1.00 46.47  ? 162  TYR A CB    1 
ATOM   1283 C CG    . TYR A 1 162 ? -4.161  7.817   41.018  1.00 47.25  ? 162  TYR A CG    1 
ATOM   1284 C CD1   . TYR A 1 162 ? -4.397  6.462   40.835  1.00 48.30  ? 162  TYR A CD1   1 
ATOM   1285 C CD2   . TYR A 1 162 ? -2.919  8.210   41.529  1.00 47.32  ? 162  TYR A CD2   1 
ATOM   1286 C CE1   . TYR A 1 162 ? -3.435  5.518   41.159  1.00 49.41  ? 162  TYR A CE1   1 
ATOM   1287 C CE2   . TYR A 1 162 ? -1.947  7.272   41.850  1.00 48.15  ? 162  TYR A CE2   1 
ATOM   1288 C CZ    . TYR A 1 162 ? -2.213  5.924   41.665  1.00 49.21  ? 162  TYR A CZ    1 
ATOM   1289 O OH    . TYR A 1 162 ? -1.276  4.961   41.966  1.00 48.93  ? 162  TYR A OH    1 
ATOM   1290 N N     . ALA A 1 163 ? -7.934  7.727   41.900  1.00 45.02  ? 163  ALA A N     1 
ATOM   1291 C CA    . ALA A 1 163 ? -8.727  6.587   42.391  1.00 44.25  ? 163  ALA A CA    1 
ATOM   1292 C C     . ALA A 1 163 ? -9.481  5.878   41.281  1.00 43.46  ? 163  ALA A C     1 
ATOM   1293 O O     . ALA A 1 163 ? -9.866  6.501   40.293  1.00 43.16  ? 163  ALA A O     1 
ATOM   1294 C CB    . ALA A 1 163 ? -9.698  7.031   43.494  1.00 44.25  ? 163  ALA A CB    1 
ATOM   1295 N N     . ASP A 1 164 ? -9.655  4.570   41.451  1.00 43.01  ? 164  ASP A N     1 
ATOM   1296 C CA    . ASP A 1 164 ? -10.491 3.754   40.570  1.00 43.26  ? 164  ASP A CA    1 
ATOM   1297 C C     . ASP A 1 164 ? -10.941 2.456   41.249  1.00 43.54  ? 164  ASP A C     1 
ATOM   1298 O O     . ASP A 1 164 ? -10.872 2.340   42.485  1.00 43.40  ? 164  ASP A O     1 
ATOM   1299 C CB    . ASP A 1 164 ? -9.845  3.504   39.191  1.00 42.93  ? 164  ASP A CB    1 
ATOM   1300 C CG    . ASP A 1 164 ? -8.509  2.765   39.260  1.00 43.33  ? 164  ASP A CG    1 
ATOM   1301 O OD1   . ASP A 1 164 ? -8.019  2.438   40.368  1.00 43.72  ? 164  ASP A OD1   1 
ATOM   1302 O OD2   . ASP A 1 164 ? -7.942  2.512   38.165  1.00 43.00  ? 164  ASP A OD2   1 
ATOM   1303 N N     . GLU A 1 165 ? -11.395 1.491   40.451  1.00 43.69  ? 165  GLU A N     1 
ATOM   1304 C CA    . GLU A 1 165 ? -11.958 0.267   40.991  1.00 44.53  ? 165  GLU A CA    1 
ATOM   1305 C C     . GLU A 1 165 ? -11.006 -0.406  41.987  1.00 45.17  ? 165  GLU A C     1 
ATOM   1306 O O     . GLU A 1 165 ? -11.444 -1.080  42.917  1.00 45.02  ? 165  GLU A O     1 
ATOM   1307 C CB    . GLU A 1 165 ? -12.355 -0.690  39.869  1.00 44.46  ? 165  GLU A CB    1 
ATOM   1308 C CG    . GLU A 1 165 ? -11.215 -1.431  39.206  1.00 45.90  ? 165  GLU A CG    1 
ATOM   1309 C CD    . GLU A 1 165 ? -10.596 -0.651  38.072  1.00 48.68  ? 165  GLU A CD    1 
ATOM   1310 O OE1   . GLU A 1 165 ? -11.099 0.457   37.780  1.00 48.32  ? 165  GLU A OE1   1 
ATOM   1311 O OE2   . GLU A 1 165 ? -9.608  -1.148  37.466  1.00 49.74  ? 165  GLU A OE2   1 
ATOM   1312 N N     . GLU A 1 166 ? -9.704  -0.191  41.795  1.00 45.98  ? 166  GLU A N     1 
ATOM   1313 C CA    . GLU A 1 166 ? -8.682  -0.756  42.668  1.00 46.18  ? 166  GLU A CA    1 
ATOM   1314 C C     . GLU A 1 166 ? -8.410  0.044   43.911  1.00 46.75  ? 166  GLU A C     1 
ATOM   1315 O O     . GLU A 1 166 ? -7.689  -0.432  44.775  1.00 47.34  ? 166  GLU A O     1 
ATOM   1316 C CB    . GLU A 1 166 ? -7.374  -0.925  41.935  1.00 45.73  ? 166  GLU A CB    1 
ATOM   1317 C CG    . GLU A 1 166 ? -7.298  -2.187  41.144  1.00 46.10  ? 166  GLU A CG    1 
ATOM   1318 C CD    . GLU A 1 166 ? -6.251  -2.083  40.070  1.00 46.94  ? 166  GLU A CD    1 
ATOM   1319 O OE1   . GLU A 1 166 ? -5.257  -1.347  40.293  1.00 45.34  ? 166  GLU A OE1   1 
ATOM   1320 O OE2   . GLU A 1 166 ? -6.445  -2.703  38.994  1.00 48.60  ? 166  GLU A OE2   1 
ATOM   1321 N N     . GLY A 1 167 ? -8.952  1.249   44.015  1.00 47.20  ? 167  GLY A N     1 
ATOM   1322 C CA    . GLY A 1 167 ? -8.748  2.039   45.224  1.00 48.07  ? 167  GLY A CA    1 
ATOM   1323 C C     . GLY A 1 167 ? -8.131  3.393   44.957  1.00 48.95  ? 167  GLY A C     1 
ATOM   1324 O O     . GLY A 1 167 ? -7.928  3.791   43.802  1.00 49.01  ? 167  GLY A O     1 
ATOM   1325 N N     . ALA A 1 168 ? -7.834  4.110   46.029  1.00 49.69  ? 168  ALA A N     1 
ATOM   1326 C CA    . ALA A 1 168 ? -7.256  5.442   45.905  1.00 50.91  ? 168  ALA A CA    1 
ATOM   1327 C C     . ALA A 1 168 ? -5.808  5.459   46.402  1.00 51.53  ? 168  ALA A C     1 
ATOM   1328 O O     . ALA A 1 168 ? -5.408  4.604   47.205  1.00 51.67  ? 168  ALA A O     1 
ATOM   1329 C CB    . ALA A 1 168 ? -8.116  6.481   46.659  1.00 50.90  ? 168  ALA A CB    1 
ATOM   1330 N N     . ARG A 1 169 ? -5.028  6.419   45.905  1.00 52.05  ? 169  ARG A N     1 
ATOM   1331 C CA    . ARG A 1 169 ? -3.638  6.587   46.308  1.00 52.72  ? 169  ARG A CA    1 
ATOM   1332 C C     . ARG A 1 169 ? -3.284  8.060   46.201  1.00 52.98  ? 169  ARG A C     1 
ATOM   1333 O O     . ARG A 1 169 ? -3.982  8.819   45.534  1.00 53.17  ? 169  ARG A O     1 
ATOM   1334 C CB    . ARG A 1 169 ? -2.697  5.749   45.430  1.00 53.12  ? 169  ARG A CB    1 
ATOM   1335 C CG    . ARG A 1 169 ? -2.951  4.233   45.458  1.00 54.81  ? 169  ARG A CG    1 
ATOM   1336 C CD    . ARG A 1 169 ? -1.790  3.397   44.892  1.00 57.95  ? 169  ARG A CD    1 
ATOM   1337 N NE    . ARG A 1 169 ? -0.663  3.346   45.824  1.00 60.99  ? 169  ARG A NE    1 
ATOM   1338 C CZ    . ARG A 1 169 ? -0.661  2.682   46.984  1.00 62.87  ? 169  ARG A CZ    1 
ATOM   1339 N NH1   . ARG A 1 169 ? -1.727  1.991   47.381  1.00 62.78  ? 169  ARG A NH1   1 
ATOM   1340 N NH2   . ARG A 1 169 ? 0.416   2.717   47.762  1.00 64.01  ? 169  ARG A NH2   1 
ATOM   1341 N N     . VAL A 1 170 ? -2.209  8.466   46.870  1.00 53.54  ? 170  VAL A N     1 
ATOM   1342 C CA    . VAL A 1 170 ? -1.674  9.827   46.732  1.00 53.99  ? 170  VAL A CA    1 
ATOM   1343 C C     . VAL A 1 170 ? -0.190  9.788   46.321  1.00 54.64  ? 170  VAL A C     1 
ATOM   1344 O O     . VAL A 1 170 ? 0.549   8.905   46.744  1.00 54.64  ? 170  VAL A O     1 
ATOM   1345 C CB    . VAL A 1 170 ? -1.860  10.630  48.035  1.00 53.71  ? 170  VAL A CB    1 
ATOM   1346 C CG1   . VAL A 1 170 ? -1.228  12.016  47.933  1.00 53.81  ? 170  VAL A CG1   1 
ATOM   1347 C CG2   . VAL A 1 170 ? -3.324  10.748  48.370  1.00 53.40  ? 170  VAL A CG2   1 
ATOM   1348 N N     . ILE A 1 171 ? 0.220   10.729  45.473  1.00 55.71  ? 171  ILE A N     1 
ATOM   1349 C CA    . ILE A 1 171 ? 1.622   10.908  45.088  1.00 56.83  ? 171  ILE A CA    1 
ATOM   1350 C C     . ILE A 1 171 ? 2.110   12.260  45.620  1.00 58.32  ? 171  ILE A C     1 
ATOM   1351 O O     . ILE A 1 171 ? 1.611   13.320  45.209  1.00 58.04  ? 171  ILE A O     1 
ATOM   1352 C CB    . ILE A 1 171 ? 1.813   10.903  43.545  1.00 56.60  ? 171  ILE A CB    1 
ATOM   1353 C CG1   . ILE A 1 171 ? 1.127   9.697   42.889  1.00 55.19  ? 171  ILE A CG1   1 
ATOM   1354 C CG2   . ILE A 1 171 ? 3.305   10.990  43.173  1.00 56.07  ? 171  ILE A CG2   1 
ATOM   1355 C CD1   . ILE A 1 171 ? 1.050   9.787   41.373  1.00 52.15  ? 171  ILE A CD1   1 
ATOM   1356 N N     . THR A 1 172 ? 3.088   12.224  46.528  1.00 60.07  ? 172  THR A N     1 
ATOM   1357 C CA    . THR A 1 172 ? 3.605   13.454  47.143  1.00 61.59  ? 172  THR A CA    1 
ATOM   1358 C C     . THR A 1 172 ? 5.124   13.450  47.316  1.00 62.89  ? 172  THR A C     1 
ATOM   1359 O O     . THR A 1 172 ? 5.732   12.394  47.528  1.00 63.49  ? 172  THR A O     1 
ATOM   1360 C CB    . THR A 1 172 ? 2.904   13.738  48.502  1.00 61.55  ? 172  THR A CB    1 
ATOM   1361 O OG1   . THR A 1 172 ? 3.141   15.095  48.905  1.00 61.44  ? 172  THR A OG1   1 
ATOM   1362 C CG2   . THR A 1 172 ? 3.361   12.752  49.591  1.00 61.12  ? 172  THR A CG2   1 
ATOM   1363 N N     . TRP A 1 173 ? 5.728   14.632  47.233  1.00 64.18  ? 173  TRP A N     1 
ATOM   1364 C CA    . TRP A 1 173 ? 7.175   14.765  47.386  1.00 65.76  ? 173  TRP A CA    1 
ATOM   1365 C C     . TRP A 1 173 ? 7.565   15.263  48.774  1.00 66.19  ? 173  TRP A C     1 
ATOM   1366 O O     . TRP A 1 173 ? 8.096   16.368  48.935  1.00 66.45  ? 173  TRP A O     1 
ATOM   1367 C CB    . TRP A 1 173 ? 7.754   15.670  46.302  1.00 66.18  ? 173  TRP A CB    1 
ATOM   1368 C CG    . TRP A 1 173 ? 7.063   16.999  46.161  1.00 68.75  ? 173  TRP A CG    1 
ATOM   1369 C CD1   . TRP A 1 173 ? 5.801   17.212  45.707  1.00 69.94  ? 173  TRP A CD1   1 
ATOM   1370 C CD2   . TRP A 1 173 ? 7.603   18.299  46.464  1.00 71.01  ? 173  TRP A CD2   1 
ATOM   1371 N NE1   . TRP A 1 173 ? 5.515   18.551  45.706  1.00 71.12  ? 173  TRP A NE1   1 
ATOM   1372 C CE2   . TRP A 1 173 ? 6.601   19.245  46.164  1.00 71.13  ? 173  TRP A CE2   1 
ATOM   1373 C CE3   . TRP A 1 173 ? 8.835   18.753  46.958  1.00 71.52  ? 173  TRP A CE3   1 
ATOM   1374 C CZ2   . TRP A 1 173 ? 6.785   20.622  46.341  1.00 71.28  ? 173  TRP A CZ2   1 
ATOM   1375 C CZ3   . TRP A 1 173 ? 9.016   20.122  47.133  1.00 71.77  ? 173  TRP A CZ3   1 
ATOM   1376 C CH2   . TRP A 1 173 ? 7.992   21.040  46.825  1.00 71.46  ? 173  TRP A CH2   1 
ATOM   1377 N N     . ARG A 1 174 ? 7.289   14.425  49.770  1.00 66.75  ? 174  ARG A N     1 
ATOM   1378 C CA    . ARG A 1 174 ? 7.510   14.723  51.185  1.00 67.39  ? 174  ARG A CA    1 
ATOM   1379 C C     . ARG A 1 174 ? 7.129   13.436  51.888  1.00 67.91  ? 174  ARG A C     1 
ATOM   1380 O O     . ARG A 1 174 ? 6.061   12.884  51.640  1.00 68.12  ? 174  ARG A O     1 
ATOM   1381 C CB    . ARG A 1 174 ? 6.624   15.881  51.678  1.00 67.21  ? 174  ARG A CB    1 
ATOM   1382 C CG    . ARG A 1 174 ? 6.920   16.382  53.093  1.00 67.26  ? 174  ARG A CG    1 
ATOM   1383 N N     . ASN A 1 175 ? 8.008   12.944  52.748  1.00 68.66  ? 175  ASN A N     1 
ATOM   1384 C CA    . ASN A 1 175 ? 7.734   11.700  53.440  1.00 69.13  ? 175  ASN A CA    1 
ATOM   1385 C C     . ASN A 1 175 ? 6.508   11.799  54.348  1.00 69.26  ? 175  ASN A C     1 
ATOM   1386 O O     . ASN A 1 175 ? 6.475   12.594  55.291  1.00 69.33  ? 175  ASN A O     1 
ATOM   1387 C CB    . ASN A 1 175 ? 8.958   11.209  54.207  1.00 69.21  ? 175  ASN A CB    1 
ATOM   1388 C CG    . ASN A 1 175 ? 8.861   9.737   54.567  1.00 69.78  ? 175  ASN A CG    1 
ATOM   1389 O OD1   . ASN A 1 175 ? 7.957   9.019   54.119  1.00 70.27  ? 175  ASN A OD1   1 
ATOM   1390 N ND2   . ASN A 1 175 ? 9.796   9.278   55.387  1.00 70.86  ? 175  ASN A ND2   1 
ATOM   1391 N N     . ILE A 1 176 ? 5.489   11.014  54.006  1.00 69.40  ? 176  ILE A N     1 
ATOM   1392 C CA    . ILE A 1 176 ? 4.277   10.854  54.818  1.00 69.36  ? 176  ILE A CA    1 
ATOM   1393 C C     . ILE A 1 176 ? 4.062   9.351   54.919  1.00 69.38  ? 176  ILE A C     1 
ATOM   1394 O O     . ILE A 1 176 ? 4.409   8.609   53.990  1.00 69.29  ? 176  ILE A O     1 
ATOM   1395 C CB    . ILE A 1 176 ? 3.047   11.576  54.189  1.00 69.36  ? 176  ILE A CB    1 
ATOM   1396 C CG1   . ILE A 1 176 ? 3.238   13.093  54.252  1.00 69.01  ? 176  ILE A CG1   1 
ATOM   1397 C CG2   . ILE A 1 176 ? 1.752   11.195  54.903  1.00 68.97  ? 176  ILE A CG2   1 
ATOM   1398 C CD1   . ILE A 1 176 ? 2.614   13.832  53.108  1.00 69.05  ? 176  ILE A CD1   1 
ATOM   1399 N N     . ASP A 1 177 ? 3.507   8.901   56.040  1.00 69.30  ? 177  ASP A N     1 
ATOM   1400 C CA    . ASP A 1 177 ? 3.538   7.477   56.336  1.00 69.26  ? 177  ASP A CA    1 
ATOM   1401 C C     . ASP A 1 177 ? 2.199   6.736   56.310  1.00 68.80  ? 177  ASP A C     1 
ATOM   1402 O O     . ASP A 1 177 ? 1.799   6.103   57.292  1.00 69.08  ? 177  ASP A O     1 
ATOM   1403 C CB    . ASP A 1 177 ? 4.279   7.230   57.646  1.00 69.61  ? 177  ASP A CB    1 
ATOM   1404 C CG    . ASP A 1 177 ? 4.916   5.870   57.680  1.00 70.76  ? 177  ASP A CG    1 
ATOM   1405 O OD1   . ASP A 1 177 ? 6.105   5.763   57.296  1.00 72.22  ? 177  ASP A OD1   1 
ATOM   1406 O OD2   . ASP A 1 177 ? 4.213   4.905   58.048  1.00 72.29  ? 177  ASP A OD2   1 
ATOM   1407 N N     . LEU A 1 178 ? 1.521   6.784   55.172  1.00 67.88  ? 178  LEU A N     1 
ATOM   1408 C CA    . LEU A 1 178 ? 0.277   6.045   55.032  1.00 66.98  ? 178  LEU A CA    1 
ATOM   1409 C C     . LEU A 1 178 ? 0.335   5.017   53.891  1.00 66.35  ? 178  LEU A C     1 
ATOM   1410 O O     . LEU A 1 178 ? 1.063   5.220   52.912  1.00 66.62  ? 178  LEU A O     1 
ATOM   1411 C CB    . LEU A 1 178 ? -0.884  7.022   54.892  1.00 67.12  ? 178  LEU A CB    1 
ATOM   1412 C CG    . LEU A 1 178 ? -1.211  7.746   56.206  1.00 67.08  ? 178  LEU A CG    1 
ATOM   1413 C CD1   . LEU A 1 178 ? -1.690  9.163   55.938  1.00 67.17  ? 178  LEU A CD1   1 
ATOM   1414 C CD2   . LEU A 1 178 ? -2.230  6.964   57.045  1.00 66.66  ? 178  LEU A CD2   1 
ATOM   1415 N N     . PRO A 1 179 ? -0.409  3.897   54.024  1.00 65.43  ? 179  PRO A N     1 
ATOM   1416 C CA    . PRO A 1 179 ? -0.322  2.753   53.092  1.00 64.64  ? 179  PRO A CA    1 
ATOM   1417 C C     . PRO A 1 179 ? -0.762  3.034   51.651  1.00 63.88  ? 179  PRO A C     1 
ATOM   1418 O O     . PRO A 1 179 ? -0.555  2.195   50.767  1.00 64.05  ? 179  PRO A O     1 
ATOM   1419 C CB    . PRO A 1 179 ? -1.258  1.713   53.722  1.00 64.86  ? 179  PRO A CB    1 
ATOM   1420 C CG    . PRO A 1 179 ? -2.204  2.516   54.560  1.00 65.25  ? 179  PRO A CG    1 
ATOM   1421 C CD    . PRO A 1 179 ? -1.387  3.650   55.101  1.00 65.28  ? 179  PRO A CD    1 
ATOM   1422 N N     . TYR A 1 180 ? -1.364  4.196   51.420  1.00 62.65  ? 180  TYR A N     1 
ATOM   1423 C CA    . TYR A 1 180 ? -1.848  4.562   50.102  1.00 61.36  ? 180  TYR A CA    1 
ATOM   1424 C C     . TYR A 1 180 ? -1.128  5.801   49.544  1.00 61.39  ? 180  TYR A C     1 
ATOM   1425 O O     . TYR A 1 180 ? -1.487  6.323   48.480  1.00 61.76  ? 180  TYR A O     1 
ATOM   1426 C CB    . TYR A 1 180 ? -3.362  4.773   50.150  1.00 60.77  ? 180  TYR A CB    1 
ATOM   1427 C CG    . TYR A 1 180 ? -3.851  5.739   51.217  1.00 59.28  ? 180  TYR A CG    1 
ATOM   1428 C CD1   . TYR A 1 180 ? -4.523  5.271   52.347  1.00 57.79  ? 180  TYR A CD1   1 
ATOM   1429 C CD2   . TYR A 1 180 ? -3.661  7.121   51.087  1.00 57.87  ? 180  TYR A CD2   1 
ATOM   1430 C CE1   . TYR A 1 180 ? -4.990  6.141   53.329  1.00 57.08  ? 180  TYR A CE1   1 
ATOM   1431 C CE2   . TYR A 1 180 ? -4.120  8.003   52.064  1.00 58.18  ? 180  TYR A CE2   1 
ATOM   1432 C CZ    . TYR A 1 180 ? -4.789  7.504   53.187  1.00 58.05  ? 180  TYR A CZ    1 
ATOM   1433 O OH    . TYR A 1 180 ? -5.252  8.371   54.164  1.00 58.71  ? 180  TYR A OH    1 
ATOM   1434 N N     . VAL A 1 181 ? -0.116  6.278   50.264  1.00 60.76  ? 181  VAL A N     1 
ATOM   1435 C CA    . VAL A 1 181 ? 0.710   7.381   49.784  1.00 60.02  ? 181  VAL A CA    1 
ATOM   1436 C C     . VAL A 1 181 ? 1.968   6.814   49.117  1.00 60.05  ? 181  VAL A C     1 
ATOM   1437 O O     . VAL A 1 181 ? 2.603   5.902   49.644  1.00 60.30  ? 181  VAL A O     1 
ATOM   1438 C CB    . VAL A 1 181 ? 1.102   8.315   50.937  1.00 59.76  ? 181  VAL A CB    1 
ATOM   1439 C CG1   . VAL A 1 181 ? 1.827   9.543   50.420  1.00 59.43  ? 181  VAL A CG1   1 
ATOM   1440 C CG2   . VAL A 1 181 ? -0.120  8.721   51.718  1.00 59.60  ? 181  VAL A CG2   1 
ATOM   1441 N N     . ASP A 1 182 ? 2.309   7.334   47.948  1.00 59.67  ? 182  ASP A N     1 
ATOM   1442 C CA    . ASP A 1 182 ? 3.560   6.996   47.303  1.00 59.49  ? 182  ASP A CA    1 
ATOM   1443 C C     . ASP A 1 182 ? 4.491   8.194   47.406  1.00 59.77  ? 182  ASP A C     1 
ATOM   1444 O O     . ASP A 1 182 ? 4.276   9.224   46.741  1.00 60.05  ? 182  ASP A O     1 
ATOM   1445 C CB    . ASP A 1 182 ? 3.331   6.632   45.841  1.00 59.20  ? 182  ASP A CB    1 
ATOM   1446 C CG    . ASP A 1 182 ? 2.403   5.462   45.678  1.00 59.58  ? 182  ASP A CG    1 
ATOM   1447 O OD1   . ASP A 1 182 ? 1.628   5.470   44.695  1.00 60.20  ? 182  ASP A OD1   1 
ATOM   1448 O OD2   . ASP A 1 182 ? 2.437   4.545   46.530  1.00 58.80  ? 182  ASP A OD2   1 
ATOM   1449 N N     . VAL A 1 183 ? 5.513   8.075   48.250  1.00 59.62  ? 183  VAL A N     1 
ATOM   1450 C CA    . VAL A 1 183 ? 6.474   9.153   48.392  1.00 59.61  ? 183  VAL A CA    1 
ATOM   1451 C C     . VAL A 1 183 ? 7.450   9.074   47.247  1.00 59.56  ? 183  VAL A C     1 
ATOM   1452 O O     . VAL A 1 183 ? 7.950   8.000   46.910  1.00 59.57  ? 183  VAL A O     1 
ATOM   1453 C CB    . VAL A 1 183 ? 7.252   9.108   49.717  1.00 59.76  ? 183  VAL A CB    1 
ATOM   1454 C CG1   . VAL A 1 183 ? 8.054   10.400  49.903  1.00 59.34  ? 183  VAL A CG1   1 
ATOM   1455 C CG2   . VAL A 1 183 ? 6.304   8.879   50.906  1.00 60.50  ? 183  VAL A CG2   1 
ATOM   1456 N N     . VAL A 1 184 ? 7.687   10.224  46.636  1.00 59.45  ? 184  VAL A N     1 
ATOM   1457 C CA    . VAL A 1 184 ? 8.722   10.372  45.639  1.00 59.47  ? 184  VAL A CA    1 
ATOM   1458 C C     . VAL A 1 184 ? 9.568   11.612  46.049  1.00 59.35  ? 184  VAL A C     1 
ATOM   1459 O O     . VAL A 1 184 ? 9.275   12.241  47.070  1.00 59.31  ? 184  VAL A O     1 
ATOM   1460 C CB    . VAL A 1 184 ? 8.096   10.404  44.216  1.00 59.43  ? 184  VAL A CB    1 
ATOM   1461 C CG1   . VAL A 1 184 ? 7.517   11.786  43.878  1.00 59.64  ? 184  VAL A CG1   1 
ATOM   1462 C CG2   . VAL A 1 184 ? 9.095   9.914   43.167  1.00 60.62  ? 184  VAL A CG2   1 
ATOM   1463 N N     . SER A 1 185 ? 10.614  11.952  45.297  1.00 59.19  ? 185  SER A N     1 
ATOM   1464 C CA    . SER A 1 185 ? 11.576  12.951  45.769  1.00 59.00  ? 185  SER A CA    1 
ATOM   1465 C C     . SER A 1 185 ? 11.154  14.415  45.562  1.00 59.10  ? 185  SER A C     1 
ATOM   1466 O O     . SER A 1 185 ? 11.302  15.227  46.478  1.00 59.25  ? 185  SER A O     1 
ATOM   1467 C CB    . SER A 1 185 ? 12.970  12.693  45.189  1.00 58.75  ? 185  SER A CB    1 
ATOM   1468 O OG    . SER A 1 185 ? 13.093  13.260  43.895  1.00 58.83  ? 185  SER A OG    1 
ATOM   1469 N N     . THR A 1 186 ? 10.651  14.765  44.379  1.00 58.90  ? 186  THR A N     1 
ATOM   1470 C CA    . THR A 1 186 ? 10.269  16.159  44.119  1.00 59.08  ? 186  THR A CA    1 
ATOM   1471 C C     . THR A 1 186 ? 8.944   16.311  43.378  1.00 59.08  ? 186  THR A C     1 
ATOM   1472 O O     . THR A 1 186 ? 8.289   15.325  43.030  1.00 59.58  ? 186  THR A O     1 
ATOM   1473 C CB    . THR A 1 186 ? 11.345  16.943  43.346  1.00 59.21  ? 186  THR A CB    1 
ATOM   1474 O OG1   . THR A 1 186 ? 11.586  16.316  42.077  1.00 59.74  ? 186  THR A OG1   1 
ATOM   1475 C CG2   . THR A 1 186 ? 12.634  17.035  44.150  1.00 59.08  ? 186  THR A CG2   1 
ATOM   1476 N N     . GLU A 1 187 ? 8.538   17.557  43.151  1.00 58.54  ? 187  GLU A N     1 
ATOM   1477 C CA    . GLU A 1 187 ? 7.288   17.794  42.463  1.00 57.59  ? 187  GLU A CA    1 
ATOM   1478 C C     . GLU A 1 187 ? 7.468   17.362  41.011  1.00 56.54  ? 187  GLU A C     1 
ATOM   1479 O O     . GLU A 1 187 ? 6.577   16.750  40.436  1.00 56.66  ? 187  GLU A O     1 
ATOM   1480 C CB    . GLU A 1 187 ? 6.771   19.236  42.662  1.00 57.64  ? 187  GLU A CB    1 
ATOM   1481 C CG    . GLU A 1 187 ? 6.863   20.182  41.482  1.00 58.96  ? 187  GLU A CG    1 
ATOM   1482 C CD    . GLU A 1 187 ? 5.818   21.310  41.529  1.00 62.14  ? 187  GLU A CD    1 
ATOM   1483 O OE1   . GLU A 1 187 ? 4.854   21.235  42.321  1.00 63.48  ? 187  GLU A OE1   1 
ATOM   1484 O OE2   . GLU A 1 187 ? 5.945   22.282  40.757  1.00 63.67  ? 187  GLU A OE2   1 
ATOM   1485 N N     . LYS A 1 188 ? 8.644   17.607  40.446  1.00 55.41  ? 188  LYS A N     1 
ATOM   1486 C CA    . LYS A 1 188 ? 8.902   17.151  39.088  1.00 54.32  ? 188  LYS A CA    1 
ATOM   1487 C C     . LYS A 1 188 ? 8.716   15.635  38.983  1.00 53.77  ? 188  LYS A C     1 
ATOM   1488 O O     . LYS A 1 188 ? 8.283   15.123  37.946  1.00 53.35  ? 188  LYS A O     1 
ATOM   1489 C CB    . LYS A 1 188 ? 10.295  17.558  38.603  1.00 54.20  ? 188  LYS A CB    1 
ATOM   1490 C CG    . LYS A 1 188 ? 10.497  17.309  37.109  1.00 53.85  ? 188  LYS A CG    1 
ATOM   1491 C CD    . LYS A 1 188 ? 11.937  17.379  36.640  1.00 53.48  ? 188  LYS A CD    1 
ATOM   1492 C CE    . LYS A 1 188 ? 12.001  17.073  35.144  1.00 53.98  ? 188  LYS A CE    1 
ATOM   1493 N NZ    . LYS A 1 188 ? 13.334  17.329  34.531  1.00 54.32  ? 188  LYS A NZ    1 
ATOM   1494 N N     . GLU A 1 189 ? 9.043   14.927  40.060  1.00 53.03  ? 189  GLU A N     1 
ATOM   1495 C CA    . GLU A 1 189 ? 8.908   13.474  40.081  1.00 52.82  ? 189  GLU A CA    1 
ATOM   1496 C C     . GLU A 1 189 ? 7.469   13.046  40.332  1.00 51.83  ? 189  GLU A C     1 
ATOM   1497 O O     . GLU A 1 189 ? 6.991   12.064  39.759  1.00 51.61  ? 189  GLU A O     1 
ATOM   1498 C CB    . GLU A 1 189 ? 9.839   12.841  41.127  1.00 53.28  ? 189  GLU A CB    1 
ATOM   1499 C CG    . GLU A 1 189 ? 11.285  12.675  40.691  1.00 55.69  ? 189  GLU A CG    1 
ATOM   1500 C CD    . GLU A 1 189 ? 11.421  12.100  39.284  1.00 59.72  ? 189  GLU A CD    1 
ATOM   1501 O OE1   . GLU A 1 189 ? 11.619  10.869  39.163  1.00 62.01  ? 189  GLU A OE1   1 
ATOM   1502 O OE2   . GLU A 1 189 ? 11.321  12.872  38.297  1.00 61.28  ? 189  GLU A OE2   1 
ATOM   1503 N N     . MET A 1 190 ? 6.794   13.788  41.206  1.00 50.69  ? 190  MET A N     1 
ATOM   1504 C CA    . MET A 1 190 ? 5.379   13.596  41.468  1.00 49.40  ? 190  MET A CA    1 
ATOM   1505 C C     . MET A 1 190 ? 4.581   13.583  40.158  1.00 48.40  ? 190  MET A C     1 
ATOM   1506 O O     . MET A 1 190 ? 3.873   12.621  39.856  1.00 48.38  ? 190  MET A O     1 
ATOM   1507 C CB    . MET A 1 190 ? 4.890   14.716  42.363  1.00 49.27  ? 190  MET A CB    1 
ATOM   1508 C CG    . MET A 1 190 ? 3.432   14.630  42.696  1.00 49.60  ? 190  MET A CG    1 
ATOM   1509 S SD    . MET A 1 190 ? 2.949   15.928  43.841  1.00 50.44  ? 190  MET A SD    1 
ATOM   1510 C CE    . MET A 1 190 ? 3.354   17.377  42.853  1.00 49.30  ? 190  MET A CE    1 
ATOM   1511 N N     . ILE A 1 191 ? 4.724   14.648  39.381  1.00 46.86  ? 191  ILE A N     1 
ATOM   1512 C CA    . ILE A 1 191 ? 4.034   14.776  38.117  1.00 45.49  ? 191  ILE A CA    1 
ATOM   1513 C C     . ILE A 1 191 ? 4.353   13.596  37.211  1.00 45.06  ? 191  ILE A C     1 
ATOM   1514 O O     . ILE A 1 191 ? 3.445   12.897  36.761  1.00 44.86  ? 191  ILE A O     1 
ATOM   1515 C CB    . ILE A 1 191 ? 4.356   16.127  37.460  1.00 45.28  ? 191  ILE A CB    1 
ATOM   1516 C CG1   . ILE A 1 191 ? 3.883   17.250  38.384  1.00 44.71  ? 191  ILE A CG1   1 
ATOM   1517 C CG2   . ILE A 1 191 ? 3.736   16.232  36.061  1.00 45.11  ? 191  ILE A CG2   1 
ATOM   1518 C CD1   . ILE A 1 191 ? 4.320   18.627  37.978  1.00 45.78  ? 191  ILE A CD1   1 
ATOM   1519 N N     . LYS A 1 192 ? 5.644   13.361  36.983  1.00 44.69  ? 192  LYS A N     1 
ATOM   1520 C CA    . LYS A 1 192 ? 6.117   12.304  36.083  1.00 44.19  ? 192  LYS A CA    1 
ATOM   1521 C C     . LYS A 1 192 ? 5.561   10.941  36.448  1.00 43.28  ? 192  LYS A C     1 
ATOM   1522 O O     . LYS A 1 192 ? 5.274   10.138  35.565  1.00 43.17  ? 192  LYS A O     1 
ATOM   1523 C CB    . LYS A 1 192 ? 7.647   12.259  36.033  1.00 44.49  ? 192  LYS A CB    1 
ATOM   1524 C CG    . LYS A 1 192 ? 8.248   13.104  34.912  1.00 46.48  ? 192  LYS A CG    1 
ATOM   1525 C CD    . LYS A 1 192 ? 9.768   13.253  35.058  1.00 49.13  ? 192  LYS A CD    1 
ATOM   1526 C CE    . LYS A 1 192 ? 10.552  12.278  34.173  1.00 50.21  ? 192  LYS A CE    1 
ATOM   1527 N NZ    . LYS A 1 192 ? 12.028  12.533  34.222  1.00 51.67  ? 192  LYS A NZ    1 
ATOM   1528 N N     . ARG A 1 193 ? 5.403   10.699  37.745  1.00 42.43  ? 193  ARG A N     1 
ATOM   1529 C CA    . ARG A 1 193 ? 4.823   9.463   38.241  1.00 42.13  ? 193  ARG A CA    1 
ATOM   1530 C C     . ARG A 1 193 ? 3.321   9.380   37.940  1.00 42.05  ? 193  ARG A C     1 
ATOM   1531 O O     . ARG A 1 193 ? 2.845   8.349   37.418  1.00 41.85  ? 193  ARG A O     1 
ATOM   1532 C CB    . ARG A 1 193 ? 5.073   9.323   39.742  1.00 42.33  ? 193  ARG A CB    1 
ATOM   1533 C CG    . ARG A 1 193 ? 4.515   8.061   40.350  1.00 43.08  ? 193  ARG A CG    1 
ATOM   1534 C CD    . ARG A 1 193 ? 5.050   6.765   39.698  1.00 45.87  ? 193  ARG A CD    1 
ATOM   1535 N NE    . ARG A 1 193 ? 4.919   5.699   40.681  1.00 48.67  ? 193  ARG A NE    1 
ATOM   1536 C CZ    . ARG A 1 193 ? 5.732   5.567   41.725  1.00 49.53  ? 193  ARG A CZ    1 
ATOM   1537 N NH1   . ARG A 1 193 ? 6.753   6.407   41.878  1.00 51.35  ? 193  ARG A NH1   1 
ATOM   1538 N NH2   . ARG A 1 193 ? 5.533   4.606   42.610  1.00 48.84  ? 193  ARG A NH2   1 
ATOM   1539 N N     . PHE A 1 194 ? 2.587   10.455  38.276  1.00 41.32  ? 194  PHE A N     1 
ATOM   1540 C CA    . PHE A 1 194 ? 1.208   10.618  37.821  1.00 40.66  ? 194  PHE A CA    1 
ATOM   1541 C C     . PHE A 1 194 ? 1.080   10.290  36.337  1.00 40.25  ? 194  PHE A C     1 
ATOM   1542 O O     . PHE A 1 194 ? 0.274   9.444   35.968  1.00 40.75  ? 194  PHE A O     1 
ATOM   1543 C CB    . PHE A 1 194 ? 0.633   12.023  38.106  1.00 40.81  ? 194  PHE A CB    1 
ATOM   1544 C CG    . PHE A 1 194 ? -0.782  12.203  37.604  1.00 39.90  ? 194  PHE A CG    1 
ATOM   1545 C CD1   . PHE A 1 194 ? -1.824  11.440  38.131  1.00 39.66  ? 194  PHE A CD1   1 
ATOM   1546 C CD2   . PHE A 1 194 ? -1.065  13.092  36.584  1.00 39.66  ? 194  PHE A CD2   1 
ATOM   1547 C CE1   . PHE A 1 194 ? -3.120  11.573  37.661  1.00 39.40  ? 194  PHE A CE1   1 
ATOM   1548 C CE2   . PHE A 1 194 ? -2.365  13.242  36.103  1.00 39.59  ? 194  PHE A CE2   1 
ATOM   1549 C CZ    . PHE A 1 194 ? -3.394  12.482  36.642  1.00 39.70  ? 194  PHE A CZ    1 
ATOM   1550 N N     . LEU A 1 195 ? 1.888   10.932  35.499  1.00 39.26  ? 195  LEU A N     1 
ATOM   1551 C CA    . LEU A 1 195 ? 1.888   10.638  34.071  1.00 38.96  ? 195  LEU A CA    1 
ATOM   1552 C C     . LEU A 1 195 ? 2.107   9.164   33.747  1.00 38.76  ? 195  LEU A C     1 
ATOM   1553 O O     . LEU A 1 195 ? 1.586   8.646   32.755  1.00 38.40  ? 195  LEU A O     1 
ATOM   1554 C CB    . LEU A 1 195 ? 2.927   11.496  33.342  1.00 38.97  ? 195  LEU A CB    1 
ATOM   1555 C CG    . LEU A 1 195 ? 2.629   12.998  33.254  1.00 39.61  ? 195  LEU A CG    1 
ATOM   1556 C CD1   . LEU A 1 195 ? 3.560   13.646  32.247  1.00 40.88  ? 195  LEU A CD1   1 
ATOM   1557 C CD2   . LEU A 1 195 ? 1.175   13.262  32.858  1.00 39.11  ? 195  LEU A CD2   1 
ATOM   1558 N N     . LYS A 1 196 ? 2.883   8.492   34.583  1.00 38.87  ? 196  LYS A N     1 
ATOM   1559 C CA    . LYS A 1 196 ? 3.224   7.102   34.328  1.00 39.61  ? 196  LYS A CA    1 
ATOM   1560 C C     . LYS A 1 196 ? 2.002   6.255   34.694  1.00 39.32  ? 196  LYS A C     1 
ATOM   1561 O O     . LYS A 1 196 ? 1.579   5.387   33.928  1.00 39.12  ? 196  LYS A O     1 
ATOM   1562 C CB    . LYS A 1 196 ? 4.475   6.705   35.134  1.00 39.98  ? 196  LYS A CB    1 
ATOM   1563 C CG    . LYS A 1 196 ? 5.136   5.396   34.731  1.00 41.77  ? 196  LYS A CG    1 
ATOM   1564 C CD    . LYS A 1 196 ? 6.535   5.294   35.339  1.00 45.74  ? 196  LYS A CD    1 
ATOM   1565 C CE    . LYS A 1 196 ? 6.894   3.846   35.709  1.00 48.77  ? 196  LYS A CE    1 
ATOM   1566 N NZ    . LYS A 1 196 ? 7.747   3.747   36.960  1.00 49.97  ? 196  LYS A NZ    1 
ATOM   1567 N N     . VAL A 1 197 ? 1.418   6.553   35.854  1.00 38.82  ? 197  VAL A N     1 
ATOM   1568 C CA    . VAL A 1 197 ? 0.219   5.883   36.313  1.00 38.39  ? 197  VAL A CA    1 
ATOM   1569 C C     . VAL A 1 197 ? -0.893  5.961   35.259  1.00 38.49  ? 197  VAL A C     1 
ATOM   1570 O O     . VAL A 1 197 ? -1.589  4.959   34.986  1.00 38.50  ? 197  VAL A O     1 
ATOM   1571 C CB    . VAL A 1 197 ? -0.264  6.482   37.627  1.00 38.15  ? 197  VAL A CB    1 
ATOM   1572 C CG1   . VAL A 1 197 ? -1.701  6.044   37.915  1.00 38.60  ? 197  VAL A CG1   1 
ATOM   1573 C CG2   . VAL A 1 197 ? 0.662   6.072   38.754  1.00 38.29  ? 197  VAL A CG2   1 
ATOM   1574 N N     . VAL A 1 198 ? -1.051  7.139   34.656  1.00 38.00  ? 198  VAL A N     1 
ATOM   1575 C CA    . VAL A 1 198 ? -2.062  7.285   33.636  1.00 37.85  ? 198  VAL A CA    1 
ATOM   1576 C C     . VAL A 1 198 ? -1.653  6.458   32.426  1.00 38.23  ? 198  VAL A C     1 
ATOM   1577 O O     . VAL A 1 198 ? -2.463  5.688   31.910  1.00 38.39  ? 198  VAL A O     1 
ATOM   1578 C CB    . VAL A 1 198 ? -2.414  8.753   33.305  1.00 37.57  ? 198  VAL A CB    1 
ATOM   1579 C CG1   . VAL A 1 198 ? -3.425  8.814   32.178  1.00 36.69  ? 198  VAL A CG1   1 
ATOM   1580 C CG2   . VAL A 1 198 ? -3.003  9.426   34.523  1.00 37.06  ? 198  VAL A CG2   1 
ATOM   1581 N N     . LYS A 1 199 ? -0.393  6.563   32.007  1.00 38.54  ? 199  LYS A N     1 
ATOM   1582 C CA    . LYS A 1 199 ? 0.054   5.792   30.833  1.00 39.00  ? 199  LYS A CA    1 
ATOM   1583 C C     . LYS A 1 199 ? -0.176  4.276   30.986  1.00 38.62  ? 199  LYS A C     1 
ATOM   1584 O O     . LYS A 1 199 ? -0.583  3.620   30.030  1.00 38.40  ? 199  LYS A O     1 
ATOM   1585 C CB    . LYS A 1 199 ? 1.521   6.072   30.475  1.00 39.34  ? 199  LYS A CB    1 
ATOM   1586 C CG    . LYS A 1 199 ? 1.862   5.650   29.048  1.00 40.88  ? 199  LYS A CG    1 
ATOM   1587 C CD    . LYS A 1 199 ? 3.355   5.595   28.762  1.00 44.42  ? 199  LYS A CD    1 
ATOM   1588 C CE    . LYS A 1 199 ? 3.577   4.991   27.359  1.00 47.46  ? 199  LYS A CE    1 
ATOM   1589 N NZ    . LYS A 1 199 ? 5.014   4.953   26.891  1.00 48.41  ? 199  LYS A NZ    1 
ATOM   1590 N N     . GLU A 1 200 ? 0.078   3.753   32.192  1.00 38.03  ? 200  GLU A N     1 
ATOM   1591 C CA    . GLU A 1 200 ? 0.020   2.323   32.477  1.00 37.45  ? 200  GLU A CA    1 
ATOM   1592 C C     . GLU A 1 200 ? -1.407  1.803   32.602  1.00 36.74  ? 200  GLU A C     1 
ATOM   1593 O O     . GLU A 1 200 ? -1.766  0.807   31.962  1.00 36.40  ? 200  GLU A O     1 
ATOM   1594 C CB    . GLU A 1 200 ? 0.815   1.993   33.737  1.00 37.66  ? 200  GLU A CB    1 
ATOM   1595 C CG    . GLU A 1 200 ? 2.321   1.840   33.487  1.00 39.86  ? 200  GLU A CG    1 
ATOM   1596 C CD    . GLU A 1 200 ? 3.149   1.753   34.771  1.00 42.72  ? 200  GLU A CD    1 
ATOM   1597 O OE1   . GLU A 1 200 ? 4.380   1.562   34.669  1.00 44.75  ? 200  GLU A OE1   1 
ATOM   1598 O OE2   . GLU A 1 200 ? 2.579   1.889   35.880  1.00 45.22  ? 200  GLU A OE2   1 
ATOM   1599 N N     . LYS A 1 201 ? -2.208  2.479   33.431  1.00 35.78  ? 201  LYS A N     1 
ATOM   1600 C CA    . LYS A 1 201 ? -3.622  2.164   33.597  1.00 34.21  ? 201  LYS A CA    1 
ATOM   1601 C C     . LYS A 1 201 ? -4.445  2.396   32.323  1.00 33.98  ? 201  LYS A C     1 
ATOM   1602 O O     . LYS A 1 201 ? -5.549  1.870   32.197  1.00 34.31  ? 201  LYS A O     1 
ATOM   1603 C CB    . LYS A 1 201 ? -4.208  2.974   34.740  1.00 33.64  ? 201  LYS A CB    1 
ATOM   1604 C CG    . LYS A 1 201 ? -3.722  2.556   36.107  1.00 32.66  ? 201  LYS A CG    1 
ATOM   1605 C CD    . LYS A 1 201 ? -4.465  3.334   37.168  1.00 30.69  ? 201  LYS A CD    1 
ATOM   1606 C CE    . LYS A 1 201 ? -3.978  3.055   38.576  1.00 29.81  ? 201  LYS A CE    1 
ATOM   1607 N NZ    . LYS A 1 201 ? -4.874  2.147   39.330  1.00 29.74  ? 201  LYS A NZ    1 
ATOM   1608 N N     . ASP A 1 202 ? -3.907  3.178   31.388  1.00 33.27  ? 202  ASP A N     1 
ATOM   1609 C CA    . ASP A 1 202 ? -4.575  3.491   30.131  1.00 32.94  ? 202  ASP A CA    1 
ATOM   1610 C C     . ASP A 1 202 ? -6.111  3.714   30.237  1.00 32.85  ? 202  ASP A C     1 
ATOM   1611 O O     . ASP A 1 202 ? -6.859  3.034   29.548  1.00 33.81  ? 202  ASP A O     1 
ATOM   1612 C CB    . ASP A 1 202 ? -4.247  2.387   29.106  1.00 32.42  ? 202  ASP A CB    1 
ATOM   1613 C CG    . ASP A 1 202 ? -4.481  2.825   27.655  1.00 33.98  ? 202  ASP A CG    1 
ATOM   1614 O OD1   . ASP A 1 202 ? -4.463  4.050   27.379  1.00 35.21  ? 202  ASP A OD1   1 
ATOM   1615 O OD2   . ASP A 1 202 ? -4.687  1.942   26.782  1.00 34.03  ? 202  ASP A OD2   1 
ATOM   1616 N N     . PRO A 1 203 ? -6.599  4.658   31.082  1.00 32.58  ? 203  PRO A N     1 
ATOM   1617 C CA    . PRO A 1 203 ? -8.064  4.734   31.195  1.00 32.41  ? 203  PRO A CA    1 
ATOM   1618 C C     . PRO A 1 203 ? -8.734  5.320   29.946  1.00 32.71  ? 203  PRO A C     1 
ATOM   1619 O O     . PRO A 1 203 ? -8.114  6.108   29.210  1.00 32.65  ? 203  PRO A O     1 
ATOM   1620 C CB    . PRO A 1 203 ? -8.279  5.669   32.381  1.00 31.61  ? 203  PRO A CB    1 
ATOM   1621 C CG    . PRO A 1 203 ? -7.141  6.533   32.367  1.00 31.84  ? 203  PRO A CG    1 
ATOM   1622 C CD    . PRO A 1 203 ? -5.966  5.686   31.925  1.00 32.84  ? 203  PRO A CD    1 
ATOM   1623 N N     . ASP A 1 204 ? -9.978  4.915   29.692  1.00 32.71  ? 204  ASP A N     1 
ATOM   1624 C CA    . ASP A 1 204 ? -10.759 5.512   28.606  1.00 32.42  ? 204  ASP A CA    1 
ATOM   1625 C C     . ASP A 1 204 ? -11.340 6.843   29.065  1.00 32.01  ? 204  ASP A C     1 
ATOM   1626 O O     . ASP A 1 204 ? -11.531 7.759   28.275  1.00 31.73  ? 204  ASP A O     1 
ATOM   1627 C CB    . ASP A 1 204 ? -11.863 4.569   28.193  1.00 32.31  ? 204  ASP A CB    1 
ATOM   1628 C CG    . ASP A 1 204 ? -11.323 3.241   27.700  1.00 33.93  ? 204  ASP A CG    1 
ATOM   1629 O OD1   . ASP A 1 204 ? -10.736 3.243   26.591  1.00 32.78  ? 204  ASP A OD1   1 
ATOM   1630 O OD2   . ASP A 1 204 ? -11.478 2.209   28.424  1.00 34.78  ? 204  ASP A OD2   1 
ATOM   1631 N N     . VAL A 1 205 ? -11.584 6.945   30.366  1.00 31.81  ? 205  VAL A N     1 
ATOM   1632 C CA    . VAL A 1 205 ? -12.157 8.136   30.948  1.00 31.55  ? 205  VAL A CA    1 
ATOM   1633 C C     . VAL A 1 205 ? -11.262 8.607   32.062  1.00 31.98  ? 205  VAL A C     1 
ATOM   1634 O O     . VAL A 1 205 ? -10.985 7.842   33.022  1.00 32.18  ? 205  VAL A O     1 
ATOM   1635 C CB    . VAL A 1 205 ? -13.556 7.857   31.596  1.00 31.53  ? 205  VAL A CB    1 
ATOM   1636 C CG1   . VAL A 1 205 ? -14.182 9.137   32.107  1.00 29.66  ? 205  VAL A CG1   1 
ATOM   1637 C CG2   . VAL A 1 205 ? -14.500 7.115   30.639  1.00 30.99  ? 205  VAL A CG2   1 
ATOM   1638 N N     . LEU A 1 206 ? -10.832 9.862   31.954  1.00 31.87  ? 206  LEU A N     1 
ATOM   1639 C CA    . LEU A 1 206 ? -10.314 10.581  33.113  1.00 32.30  ? 206  LEU A CA    1 
ATOM   1640 C C     . LEU A 1 206 ? -11.404 11.465  33.699  1.00 32.68  ? 206  LEU A C     1 
ATOM   1641 O O     . LEU A 1 206 ? -12.002 12.276  32.983  1.00 32.71  ? 206  LEU A O     1 
ATOM   1642 C CB    . LEU A 1 206 ? -9.141  11.447  32.710  1.00 32.37  ? 206  LEU A CB    1 
ATOM   1643 C CG    . LEU A 1 206 ? -7.864  10.713  32.383  1.00 32.30  ? 206  LEU A CG    1 
ATOM   1644 C CD1   . LEU A 1 206 ? -7.022  11.655  31.557  1.00 34.15  ? 206  LEU A CD1   1 
ATOM   1645 C CD2   . LEU A 1 206 ? -7.174  10.330  33.669  1.00 31.74  ? 206  LEU A CD2   1 
ATOM   1646 N N     . ILE A 1 207 ? -11.645 11.316  34.992  1.00 33.30  ? 207  ILE A N     1 
ATOM   1647 C CA    . ILE A 1 207 ? -12.719 12.022  35.674  1.00 34.60  ? 207  ILE A CA    1 
ATOM   1648 C C     . ILE A 1 207 ? -12.170 13.092  36.597  1.00 35.80  ? 207  ILE A C     1 
ATOM   1649 O O     . ILE A 1 207 ? -11.433 12.812  37.552  1.00 36.13  ? 207  ILE A O     1 
ATOM   1650 C CB    . ILE A 1 207 ? -13.563 11.067  36.544  1.00 34.68  ? 207  ILE A CB    1 
ATOM   1651 C CG1   . ILE A 1 207 ? -14.075 9.885   35.719  1.00 34.66  ? 207  ILE A CG1   1 
ATOM   1652 C CG2   . ILE A 1 207 ? -14.726 11.814  37.200  1.00 34.53  ? 207  ILE A CG2   1 
ATOM   1653 C CD1   . ILE A 1 207 ? -14.457 8.717   36.562  1.00 33.37  ? 207  ILE A CD1   1 
ATOM   1654 N N     . THR A 1 208 ? -12.554 14.328  36.331  1.00 37.26  ? 208  THR A N     1 
ATOM   1655 C CA    . THR A 1 208 ? -12.156 15.432  37.196  1.00 37.97  ? 208  THR A CA    1 
ATOM   1656 C C     . THR A 1 208 ? -13.385 16.081  37.782  1.00 38.98  ? 208  THR A C     1 
ATOM   1657 O O     . THR A 1 208 ? -14.513 15.683  37.503  1.00 39.42  ? 208  THR A O     1 
ATOM   1658 C CB    . THR A 1 208 ? -11.354 16.492  36.426  1.00 37.62  ? 208  THR A CB    1 
ATOM   1659 O OG1   . THR A 1 208 ? -12.156 17.050  35.385  1.00 35.59  ? 208  THR A OG1   1 
ATOM   1660 C CG2   . THR A 1 208 ? -10.156 15.848  35.795  1.00 38.01  ? 208  THR A CG2   1 
ATOM   1661 N N     . TYR A 1 209 ? -13.144 17.076  38.616  1.00 40.13  ? 209  TYR A N     1 
ATOM   1662 C CA    . TYR A 1 209 ? -14.169 17.971  39.072  1.00 40.56  ? 209  TYR A CA    1 
ATOM   1663 C C     . TYR A 1 209 ? -13.659 19.394  38.820  1.00 40.27  ? 209  TYR A C     1 
ATOM   1664 O O     . TYR A 1 209 ? -12.886 19.950  39.594  1.00 39.48  ? 209  TYR A O     1 
ATOM   1665 C CB    . TYR A 1 209 ? -14.532 17.713  40.541  1.00 41.19  ? 209  TYR A CB    1 
ATOM   1666 C CG    . TYR A 1 209 ? -15.740 18.544  40.956  1.00 43.99  ? 209  TYR A CG    1 
ATOM   1667 C CD1   . TYR A 1 209 ? -17.051 18.057  40.813  1.00 44.75  ? 209  TYR A CD1   1 
ATOM   1668 C CD2   . TYR A 1 209 ? -15.573 19.844  41.433  1.00 45.69  ? 209  TYR A CD2   1 
ATOM   1669 C CE1   . TYR A 1 209 ? -18.149 18.837  41.165  1.00 45.35  ? 209  TYR A CE1   1 
ATOM   1670 C CE2   . TYR A 1 209 ? -16.662 20.633  41.778  1.00 46.69  ? 209  TYR A CE2   1 
ATOM   1671 C CZ    . TYR A 1 209 ? -17.941 20.130  41.646  1.00 46.29  ? 209  TYR A CZ    1 
ATOM   1672 O OH    . TYR A 1 209 ? -18.983 20.950  42.010  1.00 44.69  ? 209  TYR A OH    1 
ATOM   1673 N N     . ASN A 1 210 ? -14.089 19.956  37.695  1.00 40.69  ? 210  ASN A N     1 
ATOM   1674 C CA    . ASN A 1 210 ? -13.685 21.293  37.261  1.00 41.06  ? 210  ASN A CA    1 
ATOM   1675 C C     . ASN A 1 210 ? -12.277 21.293  36.688  1.00 41.28  ? 210  ASN A C     1 
ATOM   1676 O O     . ASN A 1 210 ? -11.606 22.329  36.666  1.00 41.56  ? 210  ASN A O     1 
ATOM   1677 C CB    . ASN A 1 210 ? -13.831 22.317  38.409  1.00 41.07  ? 210  ASN A CB    1 
ATOM   1678 C CG    . ASN A 1 210 ? -13.745 23.777  37.934  1.00 40.99  ? 210  ASN A CG    1 
ATOM   1679 O OD1   . ASN A 1 210 ? -14.101 24.134  36.791  1.00 38.34  ? 210  ASN A OD1   1 
ATOM   1680 N ND2   . ASN A 1 210 ? -13.264 24.625  38.826  1.00 40.87  ? 210  ASN A ND2   1 
ATOM   1681 N N     . GLY A 1 211 ? -11.840 20.128  36.210  1.00 41.50  ? 211  GLY A N     1 
ATOM   1682 C CA    . GLY A 1 211 ? -10.519 19.980  35.617  1.00 41.48  ? 211  GLY A CA    1 
ATOM   1683 C C     . GLY A 1 211 ? -10.392 20.915  34.438  1.00 41.76  ? 211  GLY A C     1 
ATOM   1684 O O     . GLY A 1 211 ? -9.301  21.337  34.075  1.00 41.99  ? 211  GLY A O     1 
ATOM   1685 N N     . ASP A 1 212 ? -11.531 21.260  33.855  1.00 42.29  ? 212  ASP A N     1 
ATOM   1686 C CA    . ASP A 1 212 ? -11.585 22.187  32.736  1.00 42.65  ? 212  ASP A CA    1 
ATOM   1687 C C     . ASP A 1 212 ? -11.021 23.562  33.064  1.00 43.66  ? 212  ASP A C     1 
ATOM   1688 O O     . ASP A 1 212 ? -10.522 24.252  32.172  1.00 43.81  ? 212  ASP A O     1 
ATOM   1689 C CB    . ASP A 1 212 ? -13.021 22.324  32.242  1.00 42.01  ? 212  ASP A CB    1 
ATOM   1690 C CG    . ASP A 1 212 ? -13.374 21.304  31.198  1.00 41.23  ? 212  ASP A CG    1 
ATOM   1691 O OD1   . ASP A 1 212 ? -12.514 20.470  30.837  1.00 41.25  ? 212  ASP A OD1   1 
ATOM   1692 O OD2   . ASP A 1 212 ? -14.516 21.345  30.711  1.00 40.58  ? 212  ASP A OD2   1 
ATOM   1693 N N     . ASN A 1 213 ? -11.097 23.965  34.332  1.00 44.76  ? 213  ASN A N     1 
ATOM   1694 C CA    . ASN A 1 213 ? -10.686 25.306  34.686  1.00 46.31  ? 213  ASN A CA    1 
ATOM   1695 C C     . ASN A 1 213 ? -9.514  25.411  35.621  1.00 47.41  ? 213  ASN A C     1 
ATOM   1696 O O     . ASN A 1 213 ? -8.774  26.393  35.560  1.00 48.11  ? 213  ASN A O     1 
ATOM   1697 C CB    . ASN A 1 213 ? -11.864 26.114  35.189  1.00 46.43  ? 213  ASN A CB    1 
ATOM   1698 C CG    . ASN A 1 213 ? -12.819 26.444  34.079  1.00 47.58  ? 213  ASN A CG    1 
ATOM   1699 O OD1   . ASN A 1 213 ? -13.969 26.037  34.119  1.00 49.58  ? 213  ASN A OD1   1 
ATOM   1700 N ND2   . ASN A 1 213 ? -12.329 27.126  33.038  1.00 48.03  ? 213  ASN A ND2   1 
ATOM   1701 N N     . PHE A 1 214 ? -9.331  24.392  36.453  1.00 48.26  ? 214  PHE A N     1 
ATOM   1702 C CA    . PHE A 1 214 ? -8.245  24.352  37.422  1.00 49.04  ? 214  PHE A CA    1 
ATOM   1703 C C     . PHE A 1 214 ? -7.148  23.319  37.067  1.00 49.41  ? 214  PHE A C     1 
ATOM   1704 O O     . PHE A 1 214 ? -6.198  23.642  36.338  1.00 49.57  ? 214  PHE A O     1 
ATOM   1705 C CB    . PHE A 1 214 ? -8.838  24.096  38.803  1.00 49.09  ? 214  PHE A CB    1 
ATOM   1706 C CG    . PHE A 1 214 ? -7.852  24.164  39.924  1.00 50.50  ? 214  PHE A CG    1 
ATOM   1707 C CD1   . PHE A 1 214 ? -7.165  25.349  40.204  1.00 51.92  ? 214  PHE A CD1   1 
ATOM   1708 C CD2   . PHE A 1 214 ? -7.650  23.054  40.744  1.00 51.47  ? 214  PHE A CD2   1 
ATOM   1709 C CE1   . PHE A 1 214 ? -6.267  25.420  41.270  1.00 52.03  ? 214  PHE A CE1   1 
ATOM   1710 C CE2   . PHE A 1 214 ? -6.757  23.108  41.820  1.00 52.18  ? 214  PHE A CE2   1 
ATOM   1711 C CZ    . PHE A 1 214 ? -6.060  24.292  42.082  1.00 52.32  ? 214  PHE A CZ    1 
ATOM   1712 N N     . ALA A 1 215 ? -7.308  22.087  37.570  1.00 49.56  ? 215  ALA A N     1 
ATOM   1713 C CA    . ALA A 1 215 ? -6.285  21.031  37.529  1.00 49.12  ? 215  ALA A CA    1 
ATOM   1714 C C     . ALA A 1 215 ? -5.451  20.957  36.254  1.00 49.17  ? 215  ALA A C     1 
ATOM   1715 O O     . ALA A 1 215 ? -4.238  21.082  36.317  1.00 49.42  ? 215  ALA A O     1 
ATOM   1716 C CB    . ALA A 1 215 ? -6.897  19.679  37.861  1.00 48.98  ? 215  ALA A CB    1 
ATOM   1717 N N     . PHE A 1 216 ? -6.079  20.774  35.102  1.00 49.47  ? 216  PHE A N     1 
ATOM   1718 C CA    . PHE A 1 216 ? -5.323  20.705  33.842  1.00 50.16  ? 216  PHE A CA    1 
ATOM   1719 C C     . PHE A 1 216 ? -4.475  21.934  33.514  1.00 50.93  ? 216  PHE A C     1 
ATOM   1720 O O     . PHE A 1 216 ? -3.373  21.795  32.994  1.00 51.27  ? 216  PHE A O     1 
ATOM   1721 C CB    . PHE A 1 216 ? -6.218  20.358  32.650  1.00 49.67  ? 216  PHE A CB    1 
ATOM   1722 C CG    . PHE A 1 216 ? -6.505  18.908  32.532  1.00 49.11  ? 216  PHE A CG    1 
ATOM   1723 C CD1   . PHE A 1 216 ? -5.618  18.070  31.871  1.00 48.53  ? 216  PHE A CD1   1 
ATOM   1724 C CD2   . PHE A 1 216 ? -7.656  18.366  33.100  1.00 48.52  ? 216  PHE A CD2   1 
ATOM   1725 C CE1   . PHE A 1 216 ? -5.866  16.707  31.768  1.00 48.47  ? 216  PHE A CE1   1 
ATOM   1726 C CE2   . PHE A 1 216 ? -7.921  17.007  33.007  1.00 48.17  ? 216  PHE A CE2   1 
ATOM   1727 C CZ    . PHE A 1 216 ? -7.020  16.170  32.335  1.00 49.03  ? 216  PHE A CZ    1 
ATOM   1728 N N     . ALA A 1 217 ? -4.989  23.126  33.795  1.00 51.99  ? 217  ALA A N     1 
ATOM   1729 C CA    . ALA A 1 217 ? -4.240  24.351  33.536  1.00 52.99  ? 217  ALA A CA    1 
ATOM   1730 C C     . ALA A 1 217 ? -3.088  24.507  34.541  1.00 53.86  ? 217  ALA A C     1 
ATOM   1731 O O     . ALA A 1 217 ? -1.993  24.971  34.185  1.00 53.65  ? 217  ALA A O     1 
ATOM   1732 C CB    . ALA A 1 217 ? -5.156  25.563  33.563  1.00 52.82  ? 217  ALA A CB    1 
ATOM   1733 N N     . TYR A 1 218 ? -3.335  24.111  35.788  1.00 54.71  ? 218  TYR A N     1 
ATOM   1734 C CA    . TYR A 1 218 ? -2.290  24.122  36.801  1.00 55.69  ? 218  TYR A CA    1 
ATOM   1735 C C     . TYR A 1 218 ? -1.138  23.221  36.344  1.00 55.80  ? 218  TYR A C     1 
ATOM   1736 O O     . TYR A 1 218 ? -0.031  23.700  36.073  1.00 55.96  ? 218  TYR A O     1 
ATOM   1737 C CB    . TYR A 1 218 ? -2.832  23.664  38.154  1.00 56.20  ? 218  TYR A CB    1 
ATOM   1738 C CG    . TYR A 1 218 ? -2.149  24.352  39.295  1.00 57.87  ? 218  TYR A CG    1 
ATOM   1739 C CD1   . TYR A 1 218 ? -0.960  23.846  39.838  1.00 59.80  ? 218  TYR A CD1   1 
ATOM   1740 C CD2   . TYR A 1 218 ? -2.672  25.539  39.823  1.00 59.17  ? 218  TYR A CD2   1 
ATOM   1741 C CE1   . TYR A 1 218 ? -0.308  24.517  40.905  1.00 61.07  ? 218  TYR A CE1   1 
ATOM   1742 C CE2   . TYR A 1 218 ? -2.042  26.210  40.884  1.00 60.24  ? 218  TYR A CE2   1 
ATOM   1743 C CZ    . TYR A 1 218 ? -0.861  25.704  41.420  1.00 60.97  ? 218  TYR A CZ    1 
ATOM   1744 O OH    . TYR A 1 218 ? -0.252  26.382  42.460  1.00 59.64  ? 218  TYR A OH    1 
ATOM   1745 N N     . LEU A 1 219 ? -1.422  21.925  36.223  1.00 55.79  ? 219  LEU A N     1 
ATOM   1746 C CA    . LEU A 1 219 ? -0.463  20.956  35.706  1.00 55.71  ? 219  LEU A CA    1 
ATOM   1747 C C     . LEU A 1 219 ? 0.247   21.432  34.440  1.00 55.94  ? 219  LEU A C     1 
ATOM   1748 O O     . LEU A 1 219 ? 1.421   21.140  34.272  1.00 56.22  ? 219  LEU A O     1 
ATOM   1749 C CB    . LEU A 1 219 ? -1.133  19.608  35.446  1.00 55.35  ? 219  LEU A CB    1 
ATOM   1750 C CG    . LEU A 1 219 ? -1.766  18.929  36.652  1.00 54.79  ? 219  LEU A CG    1 
ATOM   1751 C CD1   . LEU A 1 219 ? -2.883  18.039  36.186  1.00 55.48  ? 219  LEU A CD1   1 
ATOM   1752 C CD2   . LEU A 1 219 ? -0.754  18.138  37.432  1.00 53.53  ? 219  LEU A CD2   1 
ATOM   1753 N N     . LYS A 1 220 ? -0.444  22.164  33.562  1.00 56.21  ? 220  LYS A N     1 
ATOM   1754 C CA    . LYS A 1 220 ? 0.189   22.666  32.343  1.00 56.45  ? 220  LYS A CA    1 
ATOM   1755 C C     . LYS A 1 220 ? 1.316   23.631  32.683  1.00 56.63  ? 220  LYS A C     1 
ATOM   1756 O O     . LYS A 1 220 ? 2.452   23.447  32.236  1.00 56.77  ? 220  LYS A O     1 
ATOM   1757 C CB    . LYS A 1 220 ? -0.805  23.328  31.384  1.00 56.31  ? 220  LYS A CB    1 
ATOM   1758 C CG    . LYS A 1 220 ? -0.102  24.029  30.224  1.00 57.56  ? 220  LYS A CG    1 
ATOM   1759 C CD    . LYS A 1 220 ? -0.908  24.080  28.934  1.00 59.99  ? 220  LYS A CD    1 
ATOM   1760 C CE    . LYS A 1 220 ? 0.035   23.871  27.727  1.00 62.35  ? 220  LYS A CE    1 
ATOM   1761 N NZ    . LYS A 1 220 ? -0.486  24.379  26.413  1.00 62.23  ? 220  LYS A NZ    1 
ATOM   1762 N N     . LYS A 1 221 ? 0.999   24.646  33.480  1.00 56.76  ? 221  LYS A N     1 
ATOM   1763 C CA    . LYS A 1 221 ? 1.951   25.703  33.773  1.00 57.01  ? 221  LYS A CA    1 
ATOM   1764 C C     . LYS A 1 221 ? 3.144   25.133  34.558  1.00 57.32  ? 221  LYS A C     1 
ATOM   1765 O O     . LYS A 1 221 ? 4.294   25.491  34.273  1.00 57.48  ? 221  LYS A O     1 
ATOM   1766 C CB    . LYS A 1 221 ? 1.272   26.867  34.512  1.00 56.94  ? 221  LYS A CB    1 
ATOM   1767 C CG    . LYS A 1 221 ? 1.934   28.222  34.307  1.00 56.89  ? 221  LYS A CG    1 
ATOM   1768 N N     . ARG A 1 222 ? 2.871   24.238  35.513  1.00 57.20  ? 222  ARG A N     1 
ATOM   1769 C CA    . ARG A 1 222 ? 3.930   23.561  36.283  1.00 57.35  ? 222  ARG A CA    1 
ATOM   1770 C C     . ARG A 1 222 ? 4.836   22.705  35.404  1.00 57.28  ? 222  ARG A C     1 
ATOM   1771 O O     . ARG A 1 222 ? 6.057   22.762  35.522  1.00 57.29  ? 222  ARG A O     1 
ATOM   1772 C CB    . ARG A 1 222 ? 3.347   22.687  37.394  1.00 57.46  ? 222  ARG A CB    1 
ATOM   1773 C CG    . ARG A 1 222 ? 2.476   23.424  38.395  1.00 58.13  ? 222  ARG A CG    1 
ATOM   1774 C CD    . ARG A 1 222 ? 3.272   23.900  39.570  1.00 58.88  ? 222  ARG A CD    1 
ATOM   1775 N NE    . ARG A 1 222 ? 4.211   24.922  39.134  1.00 60.37  ? 222  ARG A NE    1 
ATOM   1776 C CZ    . ARG A 1 222 ? 5.176   25.445  39.884  1.00 59.95  ? 222  ARG A CZ    1 
ATOM   1777 N NH1   . ARG A 1 222 ? 5.348   25.064  41.148  1.00 59.10  ? 222  ARG A NH1   1 
ATOM   1778 N NH2   . ARG A 1 222 ? 5.970   26.358  39.349  1.00 59.98  ? 222  ARG A NH2   1 
ATOM   1779 N N     . SER A 1 223 ? 4.238   21.916  34.520  1.00 57.24  ? 223  SER A N     1 
ATOM   1780 C CA    . SER A 1 223 ? 5.005   21.118  33.571  1.00 57.44  ? 223  SER A CA    1 
ATOM   1781 C C     . SER A 1 223 ? 5.885   21.946  32.650  1.00 57.33  ? 223  SER A C     1 
ATOM   1782 O O     . SER A 1 223 ? 6.857   21.431  32.128  1.00 57.19  ? 223  SER A O     1 
ATOM   1783 C CB    . SER A 1 223 ? 4.084   20.247  32.728  1.00 57.47  ? 223  SER A CB    1 
ATOM   1784 O OG    . SER A 1 223 ? 3.352   19.367  33.557  1.00 58.59  ? 223  SER A OG    1 
ATOM   1785 N N     . GLU A 1 224 ? 5.527   23.209  32.425  1.00 57.66  ? 224  GLU A N     1 
ATOM   1786 C CA    . GLU A 1 224 ? 6.386   24.132  31.666  1.00 58.08  ? 224  GLU A CA    1 
ATOM   1787 C C     . GLU A 1 224 ? 7.532   24.678  32.527  1.00 57.39  ? 224  GLU A C     1 
ATOM   1788 O O     . GLU A 1 224 ? 8.670   24.776  32.058  1.00 57.45  ? 224  GLU A O     1 
ATOM   1789 C CB    . GLU A 1 224 ? 5.578   25.266  31.012  1.00 58.41  ? 224  GLU A CB    1 
ATOM   1790 C CG    . GLU A 1 224 ? 5.254   25.005  29.531  1.00 61.17  ? 224  GLU A CG    1 
ATOM   1791 C CD    . GLU A 1 224 ? 3.919   25.623  29.079  1.00 65.00  ? 224  GLU A CD    1 
ATOM   1792 O OE1   . GLU A 1 224 ? 3.555   26.709  29.601  1.00 66.58  ? 224  GLU A OE1   1 
ATOM   1793 O OE2   . GLU A 1 224 ? 3.234   25.023  28.202  1.00 65.31  ? 224  GLU A OE2   1 
ATOM   1794 N N     . LYS A 1 225 ? 7.226   25.005  33.784  1.00 56.58  ? 225  LYS A N     1 
ATOM   1795 C CA    . LYS A 1 225 ? 8.225   25.462  34.742  1.00 55.65  ? 225  LYS A CA    1 
ATOM   1796 C C     . LYS A 1 225 ? 9.310   24.420  34.951  1.00 55.24  ? 225  LYS A C     1 
ATOM   1797 O O     . LYS A 1 225 ? 10.468  24.777  35.089  1.00 55.62  ? 225  LYS A O     1 
ATOM   1798 C CB    . LYS A 1 225 ? 7.588   25.816  36.086  1.00 55.39  ? 225  LYS A CB    1 
ATOM   1799 C CG    . LYS A 1 225 ? 6.720   27.054  36.049  1.00 55.38  ? 225  LYS A CG    1 
ATOM   1800 N N     . LEU A 1 226 ? 8.947   23.140  34.957  1.00 54.58  ? 226  LEU A N     1 
ATOM   1801 C CA    . LEU A 1 226 ? 9.914   22.074  35.260  1.00 53.96  ? 226  LEU A CA    1 
ATOM   1802 C C     . LEU A 1 226 ? 10.310  21.185  34.065  1.00 53.75  ? 226  LEU A C     1 
ATOM   1803 O O     . LEU A 1 226 ? 10.920  20.121  34.250  1.00 53.81  ? 226  LEU A O     1 
ATOM   1804 C CB    . LEU A 1 226 ? 9.418   21.213  36.421  1.00 53.64  ? 226  LEU A CB    1 
ATOM   1805 C CG    . LEU A 1 226 ? 8.706   21.934  37.563  1.00 53.86  ? 226  LEU A CG    1 
ATOM   1806 C CD1   . LEU A 1 226 ? 8.281   20.936  38.615  1.00 53.24  ? 226  LEU A CD1   1 
ATOM   1807 C CD2   . LEU A 1 226 ? 9.557   23.042  38.176  1.00 53.62  ? 226  LEU A CD2   1 
ATOM   1808 N N     . GLY A 1 227 ? 9.990   21.629  32.849  1.00 53.29  ? 227  GLY A N     1 
ATOM   1809 C CA    . GLY A 1 227 ? 10.301  20.872  31.632  1.00 52.99  ? 227  GLY A CA    1 
ATOM   1810 C C     . GLY A 1 227 ? 9.885   19.407  31.694  1.00 52.90  ? 227  GLY A C     1 
ATOM   1811 O O     . GLY A 1 227 ? 10.686  18.514  31.420  1.00 52.99  ? 227  GLY A O     1 
ATOM   1812 N N     . VAL A 1 228 ? 8.636   19.166  32.095  1.00 52.69  ? 228  VAL A N     1 
ATOM   1813 C CA    . VAL A 1 228 ? 7.990   17.858  31.980  1.00 52.00  ? 228  VAL A CA    1 
ATOM   1814 C C     . VAL A 1 228 ? 7.125   17.917  30.726  1.00 52.02  ? 228  VAL A C     1 
ATOM   1815 O O     . VAL A 1 228 ? 6.267   18.789  30.619  1.00 52.08  ? 228  VAL A O     1 
ATOM   1816 C CB    . VAL A 1 228 ? 7.103   17.549  33.211  1.00 51.36  ? 228  VAL A CB    1 
ATOM   1817 C CG1   . VAL A 1 228 ? 6.231   16.370  32.950  1.00 51.18  ? 228  VAL A CG1   1 
ATOM   1818 C CG2   . VAL A 1 228 ? 7.945   17.269  34.401  1.00 50.82  ? 228  VAL A CG2   1 
ATOM   1819 N N     . LYS A 1 229 ? 7.370   17.027  29.765  1.00 52.24  ? 229  LYS A N     1 
ATOM   1820 C CA    . LYS A 1 229 ? 6.444   16.872  28.635  1.00 52.32  ? 229  LYS A CA    1 
ATOM   1821 C C     . LYS A 1 229 ? 5.182   16.232  29.223  1.00 52.35  ? 229  LYS A C     1 
ATOM   1822 O O     . LYS A 1 229 ? 5.181   15.051  29.606  1.00 52.50  ? 229  LYS A O     1 
ATOM   1823 C CB    . LYS A 1 229 ? 7.027   16.003  27.504  1.00 52.50  ? 229  LYS A CB    1 
ATOM   1824 C CG    . LYS A 1 229 ? 8.488   16.286  27.110  1.00 52.74  ? 229  LYS A CG    1 
ATOM   1825 N N     . PHE A 1 230 ? 4.131   17.042  29.345  1.00 52.11  ? 230  PHE A N     1 
ATOM   1826 C CA    . PHE A 1 230 ? 2.881   16.629  29.982  1.00 51.58  ? 230  PHE A CA    1 
ATOM   1827 C C     . PHE A 1 230 ? 2.062   15.862  28.961  1.00 50.98  ? 230  PHE A C     1 
ATOM   1828 O O     . PHE A 1 230 ? 1.286   16.436  28.213  1.00 51.36  ? 230  PHE A O     1 
ATOM   1829 C CB    . PHE A 1 230 ? 2.136   17.864  30.475  1.00 51.75  ? 230  PHE A CB    1 
ATOM   1830 C CG    . PHE A 1 230 ? 0.965   17.568  31.353  1.00 52.32  ? 230  PHE A CG    1 
ATOM   1831 C CD1   . PHE A 1 230 ? 1.096   16.755  32.468  1.00 53.34  ? 230  PHE A CD1   1 
ATOM   1832 C CD2   . PHE A 1 230 ? -0.266  18.160  31.100  1.00 53.89  ? 230  PHE A CD2   1 
ATOM   1833 C CE1   . PHE A 1 230 ? 0.001   16.493  33.306  1.00 53.75  ? 230  PHE A CE1   1 
ATOM   1834 C CE2   . PHE A 1 230 ? -1.364  17.910  31.934  1.00 54.50  ? 230  PHE A CE2   1 
ATOM   1835 C CZ    . PHE A 1 230 ? -1.226  17.066  33.036  1.00 53.46  ? 230  PHE A CZ    1 
ATOM   1836 N N     . ILE A 1 231 ? 2.277   14.559  28.900  1.00 50.11  ? 231  ILE A N     1 
ATOM   1837 C CA    . ILE A 1 231 ? 1.676   13.749  27.861  1.00 49.16  ? 231  ILE A CA    1 
ATOM   1838 C C     . ILE A 1 231 ? 0.602   12.885  28.498  1.00 48.41  ? 231  ILE A C     1 
ATOM   1839 O O     . ILE A 1 231 ? 0.925   11.972  29.262  1.00 48.77  ? 231  ILE A O     1 
ATOM   1840 C CB    . ILE A 1 231 ? 2.723   12.832  27.189  1.00 49.17  ? 231  ILE A CB    1 
ATOM   1841 C CG1   . ILE A 1 231 ? 3.850   13.644  26.528  1.00 49.32  ? 231  ILE A CG1   1 
ATOM   1842 C CG2   . ILE A 1 231 ? 2.052   11.896  26.204  1.00 49.15  ? 231  ILE A CG2   1 
ATOM   1843 C CD1   . ILE A 1 231 ? 3.453   14.381  25.254  1.00 49.48  ? 231  ILE A CD1   1 
ATOM   1844 N N     . LEU A 1 232 ? -0.666  13.181  28.211  1.00 47.07  ? 232  LEU A N     1 
ATOM   1845 C CA    . LEU A 1 232 ? -1.758  12.318  28.667  1.00 45.64  ? 232  LEU A CA    1 
ATOM   1846 C C     . LEU A 1 232 ? -2.513  11.654  27.521  1.00 45.25  ? 232  LEU A C     1 
ATOM   1847 O O     . LEU A 1 232 ? -3.157  10.637  27.736  1.00 44.90  ? 232  LEU A O     1 
ATOM   1848 C CB    . LEU A 1 232 ? -2.717  13.057  29.586  1.00 45.23  ? 232  LEU A CB    1 
ATOM   1849 C CG    . LEU A 1 232 ? -2.259  13.361  31.009  1.00 44.60  ? 232  LEU A CG    1 
ATOM   1850 C CD1   . LEU A 1 232 ? -3.206  14.346  31.617  1.00 44.61  ? 232  LEU A CD1   1 
ATOM   1851 C CD2   . LEU A 1 232 ? -2.166  12.140  31.898  1.00 43.80  ? 232  LEU A CD2   1 
ATOM   1852 N N     . GLY A 1 233 ? -2.411  12.214  26.311  1.00 45.01  ? 233  GLY A N     1 
ATOM   1853 C CA    . GLY A 1 233 ? -3.071  11.659  25.116  1.00 44.84  ? 233  GLY A CA    1 
ATOM   1854 C C     . GLY A 1 233 ? -2.691  10.214  24.865  1.00 44.85  ? 233  GLY A C     1 
ATOM   1855 O O     . GLY A 1 233 ? -1.640  9.768   25.304  1.00 45.11  ? 233  GLY A O     1 
ATOM   1856 N N     . ARG A 1 234 ? -3.544  9.465   24.181  1.00 44.65  ? 234  ARG A N     1 
ATOM   1857 C CA    . ARG A 1 234 ? -3.214  8.080   23.847  1.00 44.64  ? 234  ARG A CA    1 
ATOM   1858 C C     . ARG A 1 234 ? -2.323  8.010   22.617  1.00 45.55  ? 234  ARG A C     1 
ATOM   1859 O O     . ARG A 1 234 ? -1.744  6.969   22.302  1.00 45.33  ? 234  ARG A O     1 
ATOM   1860 C CB    . ARG A 1 234 ? -4.473  7.263   23.607  1.00 44.08  ? 234  ARG A CB    1 
ATOM   1861 C CG    . ARG A 1 234 ? -4.960  6.552   24.825  1.00 41.93  ? 234  ARG A CG    1 
ATOM   1862 C CD    . ARG A 1 234 ? -6.193  5.783   24.490  1.00 38.39  ? 234  ARG A CD    1 
ATOM   1863 N NE    . ARG A 1 234 ? -6.532  4.874   25.572  1.00 36.78  ? 234  ARG A NE    1 
ATOM   1864 C CZ    . ARG A 1 234 ? -7.757  4.418   25.809  1.00 35.54  ? 234  ARG A CZ    1 
ATOM   1865 N NH1   . ARG A 1 234 ? -8.772  4.807   25.050  1.00 33.37  ? 234  ARG A NH1   1 
ATOM   1866 N NH2   . ARG A 1 234 ? -7.968  3.592   26.825  1.00 34.29  ? 234  ARG A NH2   1 
ATOM   1867 N N     . GLU A 1 235 ? -2.235  9.123   21.909  1.00 46.54  ? 235  GLU A N     1 
ATOM   1868 C CA    . GLU A 1 235 ? -1.393  9.185   20.741  1.00 47.81  ? 235  GLU A CA    1 
ATOM   1869 C C     . GLU A 1 235 ? -0.213  10.132  21.029  1.00 48.38  ? 235  GLU A C     1 
ATOM   1870 O O     . GLU A 1 235 ? 0.319   10.795  20.138  1.00 48.49  ? 235  GLU A O     1 
ATOM   1871 C CB    . GLU A 1 235 ? -2.249  9.492   19.483  1.00 48.19  ? 235  GLU A CB    1 
ATOM   1872 C CG    . GLU A 1 235 ? -2.601  10.964  19.073  1.00 49.07  ? 235  GLU A CG    1 
ATOM   1873 C CD    . GLU A 1 235 ? -2.767  11.965  20.209  1.00 50.75  ? 235  GLU A CD    1 
ATOM   1874 O OE1   . GLU A 1 235 ? -2.819  11.583  21.409  1.00 50.58  ? 235  GLU A OE1   1 
ATOM   1875 O OE2   . GLU A 1 235 ? -2.831  13.171  19.875  1.00 51.92  ? 235  GLU A OE2   1 
ATOM   1876 N N     . GLY A 1 236 ? 0.173   10.170  22.307  1.00 48.95  ? 236  GLY A N     1 
ATOM   1877 C CA    . GLY A 1 236 ? 1.323   10.933  22.786  1.00 49.59  ? 236  GLY A CA    1 
ATOM   1878 C C     . GLY A 1 236 ? 1.206   12.422  22.548  1.00 50.17  ? 236  GLY A C     1 
ATOM   1879 O O     . GLY A 1 236 ? 1.803   12.945  21.623  1.00 50.61  ? 236  GLY A O     1 
ATOM   1880 N N     . SER A 1 237 ? 0.415   13.102  23.369  1.00 50.81  ? 237  SER A N     1 
ATOM   1881 C CA    . SER A 1 237 ? 0.172   14.541  23.218  1.00 50.97  ? 237  SER A CA    1 
ATOM   1882 C C     . SER A 1 237 ? -0.378  15.096  24.507  1.00 51.29  ? 237  SER A C     1 
ATOM   1883 O O     . SER A 1 237 ? -0.814  14.345  25.380  1.00 51.33  ? 237  SER A O     1 
ATOM   1884 C CB    . SER A 1 237 ? -0.791  14.845  22.065  1.00 50.90  ? 237  SER A CB    1 
ATOM   1885 O OG    . SER A 1 237 ? -2.054  14.253  22.278  1.00 50.72  ? 237  SER A OG    1 
ATOM   1886 N N     . GLU A 1 238 ? -0.346  16.415  24.629  1.00 51.98  ? 238  GLU A N     1 
ATOM   1887 C CA    . GLU A 1 238 ? -0.743  17.057  25.867  1.00 52.93  ? 238  GLU A CA    1 
ATOM   1888 C C     . GLU A 1 238 ? -2.211  17.461  25.815  1.00 52.90  ? 238  GLU A C     1 
ATOM   1889 O O     . GLU A 1 238 ? -2.768  17.636  24.736  1.00 52.62  ? 238  GLU A O     1 
ATOM   1890 C CB    . GLU A 1 238 ? 0.097   18.306  26.154  1.00 53.20  ? 238  GLU A CB    1 
ATOM   1891 C CG    . GLU A 1 238 ? 1.400   18.472  25.400  1.00 55.38  ? 238  GLU A CG    1 
ATOM   1892 C CD    . GLU A 1 238 ? 1.931   19.904  25.538  1.00 58.72  ? 238  GLU A CD    1 
ATOM   1893 O OE1   . GLU A 1 238 ? 2.329   20.280  26.671  1.00 59.47  ? 238  GLU A OE1   1 
ATOM   1894 O OE2   . GLU A 1 238 ? 1.921   20.653  24.525  1.00 58.57  ? 238  GLU A OE2   1 
ATOM   1895 N N     . PRO A 1 239 ? -2.837  17.626  26.988  1.00 53.30  ? 239  PRO A N     1 
ATOM   1896 C CA    . PRO A 1 239 ? -4.183  18.159  27.065  1.00 54.07  ? 239  PRO A CA    1 
ATOM   1897 C C     . PRO A 1 239 ? -4.376  19.386  26.168  1.00 55.04  ? 239  PRO A C     1 
ATOM   1898 O O     . PRO A 1 239 ? -3.592  20.324  26.235  1.00 55.47  ? 239  PRO A O     1 
ATOM   1899 C CB    . PRO A 1 239 ? -4.299  18.551  28.531  1.00 53.85  ? 239  PRO A CB    1 
ATOM   1900 C CG    . PRO A 1 239 ? -3.449  17.581  29.225  1.00 53.16  ? 239  PRO A CG    1 
ATOM   1901 C CD    . PRO A 1 239 ? -2.306  17.299  28.323  1.00 53.10  ? 239  PRO A CD    1 
ATOM   1902 N N     . LYS A 1 240 ? -5.402  19.355  25.324  1.00 56.01  ? 240  LYS A N     1 
ATOM   1903 C CA    . LYS A 1 240 ? -5.729  20.464  24.445  1.00 57.24  ? 240  LYS A CA    1 
ATOM   1904 C C     . LYS A 1 240 ? -6.730  21.418  25.089  1.00 57.78  ? 240  LYS A C     1 
ATOM   1905 O O     . LYS A 1 240 ? -7.924  21.125  25.103  1.00 57.92  ? 240  LYS A O     1 
ATOM   1906 C CB    . LYS A 1 240 ? -6.315  19.908  23.152  1.00 57.34  ? 240  LYS A CB    1 
ATOM   1907 C CG    . LYS A 1 240 ? -6.465  20.928  22.033  1.00 59.02  ? 240  LYS A CG    1 
ATOM   1908 C CD    . LYS A 1 240 ? -6.864  20.241  20.736  1.00 61.12  ? 240  LYS A CD    1 
ATOM   1909 C CE    . LYS A 1 240 ? -7.259  21.248  19.671  1.00 62.76  ? 240  LYS A CE    1 
ATOM   1910 N NZ    . LYS A 1 240 ? -8.193  20.615  18.688  1.00 64.63  ? 240  LYS A NZ    1 
ATOM   1911 N N     . ILE A 1 241 ? -6.252  22.555  25.600  1.00 58.71  ? 241  ILE A N     1 
ATOM   1912 C CA    . ILE A 1 241 ? -7.131  23.567  26.220  1.00 59.85  ? 241  ILE A CA    1 
ATOM   1913 C C     . ILE A 1 241 ? -7.911  24.401  25.201  1.00 60.87  ? 241  ILE A C     1 
ATOM   1914 O O     . ILE A 1 241 ? -7.334  25.086  24.373  1.00 61.05  ? 241  ILE A O     1 
ATOM   1915 C CB    . ILE A 1 241 ? -6.393  24.486  27.203  1.00 59.60  ? 241  ILE A CB    1 
ATOM   1916 C CG1   . ILE A 1 241 ? -5.644  23.634  28.247  1.00 60.11  ? 241  ILE A CG1   1 
ATOM   1917 C CG2   . ILE A 1 241 ? -7.392  25.422  27.860  1.00 59.35  ? 241  ILE A CG2   1 
ATOM   1918 C CD1   . ILE A 1 241 ? -5.047  24.389  29.441  1.00 60.08  ? 241  ILE A CD1   1 
ATOM   1919 N N     . GLN A 1 242 ? -9.236  24.336  25.292  1.00 62.42  ? 242  GLN A N     1 
ATOM   1920 C CA    . GLN A 1 242 ? -10.134 24.822  24.243  1.00 63.82  ? 242  GLN A CA    1 
ATOM   1921 C C     . GLN A 1 242 ? -11.097 25.863  24.804  1.00 64.42  ? 242  GLN A C     1 
ATOM   1922 O O     . GLN A 1 242 ? -11.555 25.734  25.939  1.00 64.38  ? 242  GLN A O     1 
ATOM   1923 C CB    . GLN A 1 242 ? -10.921 23.650  23.661  1.00 63.75  ? 242  GLN A CB    1 
ATOM   1924 C CG    . GLN A 1 242 ? -11.234 23.800  22.202  1.00 65.89  ? 242  GLN A CG    1 
ATOM   1925 C CD    . GLN A 1 242 ? -11.274 22.471  21.466  1.00 68.21  ? 242  GLN A CD    1 
ATOM   1926 O OE1   . GLN A 1 242 ? -12.113 22.271  20.582  1.00 70.01  ? 242  GLN A OE1   1 
ATOM   1927 N NE2   . GLN A 1 242 ? -10.366 21.558  21.821  1.00 67.91  ? 242  GLN A NE2   1 
ATOM   1928 N N     . ARG A 1 243 ? -11.389 26.895  24.013  1.00 65.33  ? 243  ARG A N     1 
ATOM   1929 C CA    . ARG A 1 243 ? -12.245 27.995  24.463  1.00 66.16  ? 243  ARG A CA    1 
ATOM   1930 C C     . ARG A 1 243 ? -13.668 27.750  23.948  1.00 66.73  ? 243  ARG A C     1 
ATOM   1931 O O     . ARG A 1 243 ? -13.892 27.667  22.735  1.00 66.42  ? 243  ARG A O     1 
ATOM   1932 C CB    . ARG A 1 243 ? -11.680 29.352  24.001  1.00 66.16  ? 243  ARG A CB    1 
ATOM   1933 C CG    . ARG A 1 243 ? -11.640 30.437  25.088  1.00 65.86  ? 243  ARG A CG    1 
ATOM   1934 N N     . MET A 1 244 ? -14.620 27.612  24.876  1.00 67.70  ? 244  MET A N     1 
ATOM   1935 C CA    . MET A 1 244 ? -16.001 27.204  24.530  1.00 68.54  ? 244  MET A CA    1 
ATOM   1936 C C     . MET A 1 244 ? -16.991 28.363  24.328  1.00 68.68  ? 244  MET A C     1 
ATOM   1937 O O     . MET A 1 244 ? -18.199 28.142  24.191  1.00 68.71  ? 244  MET A O     1 
ATOM   1938 C CB    . MET A 1 244 ? -16.559 26.224  25.573  1.00 68.79  ? 244  MET A CB    1 
ATOM   1939 C CG    . MET A 1 244 ? -16.291 24.738  25.275  1.00 69.17  ? 244  MET A CG    1 
ATOM   1940 S SD    . MET A 1 244 ? -17.610 23.631  25.867  1.00 69.86  ? 244  MET A SD    1 
ATOM   1941 C CE    . MET A 1 244 ? -17.833 24.076  27.613  1.00 67.41  ? 244  MET A CE    1 
ATOM   1942 N N     . GLY A 1 245 ? -16.457 29.582  24.260  1.00 68.72  ? 245  GLY A N     1 
ATOM   1943 C CA    . GLY A 1 245 ? -17.238 30.801  24.348  1.00 68.30  ? 245  GLY A CA    1 
ATOM   1944 C C     . GLY A 1 245 ? -16.833 31.457  25.656  1.00 68.16  ? 245  GLY A C     1 
ATOM   1945 O O     . GLY A 1 245 ? -15.783 32.111  25.730  1.00 68.49  ? 245  GLY A O     1 
ATOM   1946 N N     . ASP A 1 246 ? -17.639 31.242  26.697  1.00 67.54  ? 246  ASP A N     1 
ATOM   1947 C CA    . ASP A 1 246 ? -17.451 31.906  27.996  1.00 66.78  ? 246  ASP A CA    1 
ATOM   1948 C C     . ASP A 1 246 ? -16.365 31.234  28.845  1.00 66.15  ? 246  ASP A C     1 
ATOM   1949 O O     . ASP A 1 246 ? -15.510 31.917  29.428  1.00 66.40  ? 246  ASP A O     1 
ATOM   1950 C CB    . ASP A 1 246 ? -18.783 32.001  28.766  1.00 66.77  ? 246  ASP A CB    1 
ATOM   1951 N N     . ARG A 1 247 ? -16.393 29.904  28.915  1.00 64.99  ? 247  ARG A N     1 
ATOM   1952 C CA    . ARG A 1 247 ? -15.376 29.163  29.688  1.00 63.66  ? 247  ARG A CA    1 
ATOM   1953 C C     . ARG A 1 247 ? -14.445 28.313  28.802  1.00 62.33  ? 247  ARG A C     1 
ATOM   1954 O O     . ARG A 1 247 ? -14.563 28.308  27.550  1.00 62.14  ? 247  ARG A O     1 
ATOM   1955 C CB    . ARG A 1 247 ? -15.998 28.334  30.847  1.00 63.92  ? 247  ARG A CB    1 
ATOM   1956 C CG    . ARG A 1 247 ? -17.308 27.574  30.518  1.00 63.86  ? 247  ARG A CG    1 
ATOM   1957 N N     . PHE A 1 248 ? -13.514 27.632  29.477  1.00 60.10  ? 248  PHE A N     1 
ATOM   1958 C CA    . PHE A 1 248 ? -12.559 26.729  28.852  1.00 57.94  ? 248  PHE A CA    1 
ATOM   1959 C C     . PHE A 1 248 ? -13.001 25.290  29.044  1.00 55.99  ? 248  PHE A C     1 
ATOM   1960 O O     . PHE A 1 248 ? -13.712 24.967  29.990  1.00 55.94  ? 248  PHE A O     1 
ATOM   1961 C CB    . PHE A 1 248 ? -11.169 26.876  29.491  1.00 58.45  ? 248  PHE A CB    1 
ATOM   1962 C CG    . PHE A 1 248 ? -10.608 28.273  29.449  1.00 59.92  ? 248  PHE A CG    1 
ATOM   1963 C CD1   . PHE A 1 248 ? -10.710 29.111  30.563  1.00 60.84  ? 248  PHE A CD1   1 
ATOM   1964 C CD2   . PHE A 1 248 ? -9.956  28.747  28.306  1.00 61.12  ? 248  PHE A CD2   1 
ATOM   1965 C CE1   . PHE A 1 248 ? -10.190 30.407  30.526  1.00 61.56  ? 248  PHE A CE1   1 
ATOM   1966 C CE2   . PHE A 1 248 ? -9.432  30.043  28.262  1.00 61.40  ? 248  PHE A CE2   1 
ATOM   1967 C CZ    . PHE A 1 248 ? -9.548  30.872  29.372  1.00 61.28  ? 248  PHE A CZ    1 
ATOM   1968 N N     . ALA A 1 249 ? -12.551 24.424  28.149  1.00 53.67  ? 249  ALA A N     1 
ATOM   1969 C CA    . ALA A 1 249 ? -12.715 22.993  28.297  1.00 51.42  ? 249  ALA A CA    1 
ATOM   1970 C C     . ALA A 1 249 ? -11.426 22.306  27.865  1.00 49.94  ? 249  ALA A C     1 
ATOM   1971 O O     . ALA A 1 249 ? -10.779 22.735  26.917  1.00 49.33  ? 249  ALA A O     1 
ATOM   1972 C CB    . ALA A 1 249 ? -13.890 22.506  27.474  1.00 51.39  ? 249  ALA A CB    1 
ATOM   1973 N N     . VAL A 1 250 ? -11.061 21.239  28.569  1.00 48.45  ? 250  VAL A N     1 
ATOM   1974 C CA    . VAL A 1 250 ? -9.824  20.507  28.297  1.00 46.89  ? 250  VAL A CA    1 
ATOM   1975 C C     . VAL A 1 250 ? -10.074 19.104  27.773  1.00 45.55  ? 250  VAL A C     1 
ATOM   1976 O O     . VAL A 1 250 ? -10.807 18.324  28.357  1.00 45.64  ? 250  VAL A O     1 
ATOM   1977 C CB    . VAL A 1 250 ? -8.946  20.394  29.551  1.00 47.25  ? 250  VAL A CB    1 
ATOM   1978 C CG1   . VAL A 1 250 ? -7.627  19.692  29.204  1.00 47.17  ? 250  VAL A CG1   1 
ATOM   1979 C CG2   . VAL A 1 250 ? -8.717  21.779  30.185  1.00 46.54  ? 250  VAL A CG2   1 
ATOM   1980 N N     . GLU A 1 251 ? -9.406  18.792  26.685  1.00 44.15  ? 251  GLU A N     1 
ATOM   1981 C CA    . GLU A 1 251 ? -9.562  17.548  25.967  1.00 43.19  ? 251  GLU A CA    1 
ATOM   1982 C C     . GLU A 1 251 ? -8.284  16.684  26.124  1.00 41.93  ? 251  GLU A C     1 
ATOM   1983 O O     . GLU A 1 251 ? -7.179  17.211  26.143  1.00 42.44  ? 251  GLU A O     1 
ATOM   1984 C CB    . GLU A 1 251 ? -9.744  17.943  24.519  1.00 43.24  ? 251  GLU A CB    1 
ATOM   1985 C CG    . GLU A 1 251 ? -10.314 16.915  23.640  1.00 45.85  ? 251  GLU A CG    1 
ATOM   1986 C CD    . GLU A 1 251 ? -11.118 17.535  22.510  1.00 49.33  ? 251  GLU A CD    1 
ATOM   1987 O OE1   . GLU A 1 251 ? -10.575 18.422  21.781  1.00 48.73  ? 251  GLU A OE1   1 
ATOM   1988 O OE2   . GLU A 1 251 ? -12.306 17.130  22.373  1.00 51.29  ? 251  GLU A OE2   1 
ATOM   1989 N N     . VAL A 1 252 ? -8.419  15.371  26.256  1.00 40.00  ? 252  VAL A N     1 
ATOM   1990 C CA    . VAL A 1 252 ? -7.263  14.473  26.288  1.00 37.77  ? 252  VAL A CA    1 
ATOM   1991 C C     . VAL A 1 252 ? -7.447  13.501  25.130  1.00 37.09  ? 252  VAL A C     1 
ATOM   1992 O O     . VAL A 1 252 ? -8.306  12.624  25.184  1.00 36.81  ? 252  VAL A O     1 
ATOM   1993 C CB    . VAL A 1 252 ? -7.192  13.704  27.624  1.00 37.54  ? 252  VAL A CB    1 
ATOM   1994 C CG1   . VAL A 1 252 ? -6.092  12.694  27.607  1.00 36.91  ? 252  VAL A CG1   1 
ATOM   1995 C CG2   . VAL A 1 252 ? -7.022  14.636  28.798  1.00 36.59  ? 252  VAL A CG2   1 
ATOM   1996 N N     . LYS A 1 253 ? -6.666  13.659  24.069  1.00 36.62  ? 253  LYS A N     1 
ATOM   1997 C CA    . LYS A 1 253 ? -6.913  12.877  22.839  1.00 36.30  ? 253  LYS A CA    1 
ATOM   1998 C C     . LYS A 1 253 ? -6.942  11.353  23.000  1.00 35.81  ? 253  LYS A C     1 
ATOM   1999 O O     . LYS A 1 253 ? -6.068  10.758  23.632  1.00 35.91  ? 253  LYS A O     1 
ATOM   2000 C CB    . LYS A 1 253 ? -5.954  13.284  21.722  1.00 36.21  ? 253  LYS A CB    1 
ATOM   2001 C CG    . LYS A 1 253 ? -6.443  14.488  20.911  1.00 37.46  ? 253  LYS A CG    1 
ATOM   2002 C CD    . LYS A 1 253 ? -7.774  14.193  20.226  1.00 38.45  ? 253  LYS A CD    1 
ATOM   2003 C CE    . LYS A 1 253 ? -8.176  15.270  19.218  1.00 39.94  ? 253  LYS A CE    1 
ATOM   2004 N NZ    . LYS A 1 253 ? -8.686  16.523  19.818  1.00 41.21  ? 253  LYS A NZ    1 
ATOM   2005 N N     . GLY A 1 254 ? -7.965  10.726  22.432  1.00 35.48  ? 254  GLY A N     1 
ATOM   2006 C CA    . GLY A 1 254 ? -8.109  9.275   22.518  1.00 34.56  ? 254  GLY A CA    1 
ATOM   2007 C C     . GLY A 1 254 ? -8.713  8.791   23.819  1.00 34.06  ? 254  GLY A C     1 
ATOM   2008 O O     . GLY A 1 254 ? -8.974  7.594   23.968  1.00 34.06  ? 254  GLY A O     1 
ATOM   2009 N N     . ARG A 1 255 ? -8.913  9.716   24.763  1.00 33.36  ? 255  ARG A N     1 
ATOM   2010 C CA    . ARG A 1 255 ? -9.642  9.450   26.015  1.00 32.56  ? 255  ARG A CA    1 
ATOM   2011 C C     . ARG A 1 255 ? -10.896 10.311  26.138  1.00 32.16  ? 255  ARG A C     1 
ATOM   2012 O O     . ARG A 1 255 ? -11.232 11.095  25.249  1.00 32.46  ? 255  ARG A O     1 
ATOM   2013 C CB    . ARG A 1 255 ? -8.754  9.706   27.222  1.00 32.63  ? 255  ARG A CB    1 
ATOM   2014 C CG    . ARG A 1 255 ? -7.442  8.928   27.202  1.00 33.41  ? 255  ARG A CG    1 
ATOM   2015 C CD    . ARG A 1 255 ? -6.705  9.071   28.516  1.00 34.09  ? 255  ARG A CD    1 
ATOM   2016 N NE    . ARG A 1 255 ? -5.299  8.767   28.314  1.00 37.12  ? 255  ARG A NE    1 
ATOM   2017 C CZ    . ARG A 1 255 ? -4.773  7.546   28.330  1.00 38.61  ? 255  ARG A CZ    1 
ATOM   2018 N NH1   . ARG A 1 255 ? -5.516  6.473   28.563  1.00 41.80  ? 255  ARG A NH1   1 
ATOM   2019 N NH2   . ARG A 1 255 ? -3.491  7.397   28.105  1.00 39.03  ? 255  ARG A NH2   1 
ATOM   2020 N N     . ILE A 1 256 ? -11.604 10.165  27.248  1.00 31.24  ? 256  ILE A N     1 
ATOM   2021 C CA    . ILE A 1 256 ? -12.726 11.045  27.522  1.00 29.91  ? 256  ILE A CA    1 
ATOM   2022 C C     . ILE A 1 256 ? -12.441 11.810  28.811  1.00 29.04  ? 256  ILE A C     1 
ATOM   2023 O O     . ILE A 1 256 ? -12.432 11.234  29.906  1.00 28.12  ? 256  ILE A O     1 
ATOM   2024 C CB    . ILE A 1 256 ? -14.042 10.261  27.629  1.00 30.02  ? 256  ILE A CB    1 
ATOM   2025 C CG1   . ILE A 1 256 ? -14.395 9.609   26.294  1.00 29.40  ? 256  ILE A CG1   1 
ATOM   2026 C CG2   . ILE A 1 256 ? -15.174 11.184  28.039  1.00 30.48  ? 256  ILE A CG2   1 
ATOM   2027 C CD1   . ILE A 1 256 ? -15.412 8.482   26.432  1.00 28.27  ? 256  ILE A CD1   1 
ATOM   2028 N N     . HIS A 1 257 ? -12.168 13.104  28.690  1.00 28.53  ? 257  HIS A N     1 
ATOM   2029 C CA    . HIS A 1 257 ? -12.096 13.887  29.915  1.00 28.46  ? 257  HIS A CA    1 
ATOM   2030 C C     . HIS A 1 257 ? -13.516 14.179  30.362  1.00 28.66  ? 257  HIS A C     1 
ATOM   2031 O O     . HIS A 1 257 ? -14.237 14.891  29.693  1.00 28.55  ? 257  HIS A O     1 
ATOM   2032 C CB    . HIS A 1 257 ? -11.272 15.180  29.800  1.00 27.75  ? 257  HIS A CB    1 
ATOM   2033 C CG    . HIS A 1 257 ? -11.384 16.051  31.008  1.00 26.04  ? 257  HIS A CG    1 
ATOM   2034 N ND1   . HIS A 1 257 ? -11.391 17.431  30.939  1.00 25.82  ? 257  HIS A ND1   1 
ATOM   2035 C CD2   . HIS A 1 257 ? -11.560 15.734  32.317  1.00 25.09  ? 257  HIS A CD2   1 
ATOM   2036 C CE1   . HIS A 1 257 ? -11.559 17.925  32.158  1.00 26.48  ? 257  HIS A CE1   1 
ATOM   2037 N NE2   . HIS A 1 257 ? -11.669 16.916  33.012  1.00 25.20  ? 257  HIS A NE2   1 
ATOM   2038 N N     . PHE A 1 258 ? -13.907 13.596  31.484  1.00 28.88  ? 258  PHE A N     1 
ATOM   2039 C CA    . PHE A 1 258 ? -15.248 13.756  31.999  1.00 29.09  ? 258  PHE A CA    1 
ATOM   2040 C C     . PHE A 1 258 ? -15.190 14.699  33.169  1.00 29.99  ? 258  PHE A C     1 
ATOM   2041 O O     . PHE A 1 258 ? -14.790 14.346  34.291  1.00 29.53  ? 258  PHE A O     1 
ATOM   2042 C CB    . PHE A 1 258 ? -15.814 12.414  32.423  1.00 28.58  ? 258  PHE A CB    1 
ATOM   2043 C CG    . PHE A 1 258 ? -17.216 12.472  32.910  1.00 28.46  ? 258  PHE A CG    1 
ATOM   2044 C CD1   . PHE A 1 258 ? -18.201 13.137  32.181  1.00 28.91  ? 258  PHE A CD1   1 
ATOM   2045 C CD2   . PHE A 1 258 ? -17.574 11.829  34.082  1.00 28.33  ? 258  PHE A CD2   1 
ATOM   2046 C CE1   . PHE A 1 258 ? -19.507 13.169  32.630  1.00 27.93  ? 258  PHE A CE1   1 
ATOM   2047 C CE2   . PHE A 1 258 ? -18.887 11.857  34.540  1.00 27.90  ? 258  PHE A CE2   1 
ATOM   2048 C CZ    . PHE A 1 258 ? -19.851 12.519  33.809  1.00 28.86  ? 258  PHE A CZ    1 
ATOM   2049 N N     . ASP A 1 259 ? -15.576 15.928  32.891  1.00 31.37  ? 259  ASP A N     1 
ATOM   2050 C CA    . ASP A 1 259 ? -15.576 16.926  33.924  1.00 32.78  ? 259  ASP A CA    1 
ATOM   2051 C C     . ASP A 1 259 ? -16.925 16.917  34.605  1.00 33.62  ? 259  ASP A C     1 
ATOM   2052 O O     . ASP A 1 259 ? -17.942 17.238  34.011  1.00 33.84  ? 259  ASP A O     1 
ATOM   2053 C CB    . ASP A 1 259 ? -15.263 18.291  33.323  1.00 32.35  ? 259  ASP A CB    1 
ATOM   2054 C CG    . ASP A 1 259 ? -14.986 19.326  34.367  1.00 33.06  ? 259  ASP A CG    1 
ATOM   2055 O OD1   . ASP A 1 259 ? -15.356 19.137  35.564  1.00 31.08  ? 259  ASP A OD1   1 
ATOM   2056 O OD2   . ASP A 1 259 ? -14.388 20.348  33.976  1.00 36.27  ? 259  ASP A OD2   1 
ATOM   2057 N N     . LEU A 1 260 ? -16.921 16.560  35.871  1.00 35.47  ? 260  LEU A N     1 
ATOM   2058 C CA    . LEU A 1 260 ? -18.158 16.411  36.623  1.00 37.44  ? 260  LEU A CA    1 
ATOM   2059 C C     . LEU A 1 260 ? -18.926 17.704  36.866  1.00 39.54  ? 260  LEU A C     1 
ATOM   2060 O O     . LEU A 1 260 ? -20.153 17.683  36.953  1.00 40.45  ? 260  LEU A O     1 
ATOM   2061 C CB    . LEU A 1 260 ? -17.877 15.733  37.961  1.00 36.61  ? 260  LEU A CB    1 
ATOM   2062 C CG    . LEU A 1 260 ? -17.730 14.229  37.871  1.00 35.38  ? 260  LEU A CG    1 
ATOM   2063 C CD1   . LEU A 1 260 ? -17.180 13.744  39.148  1.00 34.63  ? 260  LEU A CD1   1 
ATOM   2064 C CD2   . LEU A 1 260 ? -19.085 13.591  37.596  1.00 34.83  ? 260  LEU A CD2   1 
ATOM   2065 N N     . TYR A 1 261 ? -18.209 18.816  36.995  1.00 41.85  ? 261  TYR A N     1 
ATOM   2066 C CA    . TYR A 1 261 ? -18.804 20.075  37.447  1.00 43.58  ? 261  TYR A CA    1 
ATOM   2067 C C     . TYR A 1 261 ? -19.889 20.611  36.521  1.00 44.33  ? 261  TYR A C     1 
ATOM   2068 O O     . TYR A 1 261 ? -20.964 20.937  36.994  1.00 44.72  ? 261  TYR A O     1 
ATOM   2069 C CB    . TYR A 1 261 ? -17.732 21.144  37.696  1.00 44.49  ? 261  TYR A CB    1 
ATOM   2070 C CG    . TYR A 1 261 ? -18.290 22.509  38.022  1.00 45.03  ? 261  TYR A CG    1 
ATOM   2071 C CD1   . TYR A 1 261 ? -18.678 22.831  39.331  1.00 46.19  ? 261  TYR A CD1   1 
ATOM   2072 C CD2   . TYR A 1 261 ? -18.433 23.483  37.017  1.00 45.96  ? 261  TYR A CD2   1 
ATOM   2073 C CE1   . TYR A 1 261 ? -19.185 24.102  39.640  1.00 48.47  ? 261  TYR A CE1   1 
ATOM   2074 C CE2   . TYR A 1 261 ? -18.949 24.746  37.298  1.00 47.27  ? 261  TYR A CE2   1 
ATOM   2075 C CZ    . TYR A 1 261 ? -19.322 25.056  38.612  1.00 49.14  ? 261  TYR A CZ    1 
ATOM   2076 O OH    . TYR A 1 261 ? -19.830 26.311  38.897  1.00 48.47  ? 261  TYR A OH    1 
ATOM   2077 N N     . PRO A 1 262 ? -19.617 20.732  35.211  1.00 45.00  ? 262  PRO A N     1 
ATOM   2078 C CA    . PRO A 1 262 ? -20.762 21.118  34.381  1.00 45.79  ? 262  PRO A CA    1 
ATOM   2079 C C     . PRO A 1 262 ? -21.946 20.113  34.408  1.00 46.91  ? 262  PRO A C     1 
ATOM   2080 O O     . PRO A 1 262 ? -23.089 20.530  34.241  1.00 47.77  ? 262  PRO A O     1 
ATOM   2081 C CB    . PRO A 1 262 ? -20.162 21.257  32.973  1.00 45.35  ? 262  PRO A CB    1 
ATOM   2082 C CG    . PRO A 1 262 ? -18.863 20.542  33.016  1.00 44.96  ? 262  PRO A CG    1 
ATOM   2083 C CD    . PRO A 1 262 ? -18.377 20.587  34.427  1.00 44.83  ? 262  PRO A CD    1 
ATOM   2084 N N     . VAL A 1 263 ? -21.697 18.825  34.640  1.00 47.76  ? 263  VAL A N     1 
ATOM   2085 C CA    . VAL A 1 263 ? -22.792 17.853  34.704  1.00 49.00  ? 263  VAL A CA    1 
ATOM   2086 C C     . VAL A 1 263 ? -23.630 18.026  35.965  1.00 50.10  ? 263  VAL A C     1 
ATOM   2087 O O     . VAL A 1 263 ? -24.846 18.099  35.896  1.00 50.17  ? 263  VAL A O     1 
ATOM   2088 C CB    . VAL A 1 263 ? -22.295 16.389  34.561  1.00 49.07  ? 263  VAL A CB    1 
ATOM   2089 C CG1   . VAL A 1 263 ? -23.387 15.387  34.945  1.00 48.79  ? 263  VAL A CG1   1 
ATOM   2090 C CG2   . VAL A 1 263 ? -21.784 16.132  33.134  1.00 48.62  ? 263  VAL A CG2   1 
ATOM   2091 N N     . ILE A 1 264 ? -22.977 18.103  37.114  1.00 51.86  ? 264  ILE A N     1 
ATOM   2092 C CA    . ILE A 1 264 ? -23.678 18.288  38.383  1.00 53.56  ? 264  ILE A CA    1 
ATOM   2093 C C     . ILE A 1 264 ? -24.374 19.650  38.469  1.00 55.11  ? 264  ILE A C     1 
ATOM   2094 O O     . ILE A 1 264 ? -25.435 19.764  39.078  1.00 55.62  ? 264  ILE A O     1 
ATOM   2095 C CB    . ILE A 1 264 ? -22.728 18.063  39.584  1.00 53.36  ? 264  ILE A CB    1 
ATOM   2096 C CG1   . ILE A 1 264 ? -22.547 16.560  39.812  1.00 53.58  ? 264  ILE A CG1   1 
ATOM   2097 C CG2   . ILE A 1 264 ? -23.271 18.698  40.857  1.00 52.48  ? 264  ILE A CG2   1 
ATOM   2098 C CD1   . ILE A 1 264 ? -21.107 16.123  39.891  1.00 53.99  ? 264  ILE A CD1   1 
ATOM   2099 N N     . ARG A 1 265 ? -23.791 20.672  37.847  1.00 56.71  ? 265  ARG A N     1 
ATOM   2100 C CA    . ARG A 1 265 ? -24.335 22.029  37.919  1.00 58.36  ? 265  ARG A CA    1 
ATOM   2101 C C     . ARG A 1 265 ? -25.591 22.163  37.065  1.00 59.13  ? 265  ARG A C     1 
ATOM   2102 O O     . ARG A 1 265 ? -26.479 22.940  37.389  1.00 59.68  ? 265  ARG A O     1 
ATOM   2103 C CB    . ARG A 1 265 ? -23.275 23.065  37.526  1.00 58.58  ? 265  ARG A CB    1 
ATOM   2104 C CG    . ARG A 1 265 ? -23.801 24.462  37.263  1.00 60.69  ? 265  ARG A CG    1 
ATOM   2105 C CD    . ARG A 1 265 ? -22.735 25.540  37.526  1.00 64.53  ? 265  ARG A CD    1 
ATOM   2106 N NE    . ARG A 1 265 ? -23.264 26.896  37.345  1.00 66.55  ? 265  ARG A NE    1 
ATOM   2107 C CZ    . ARG A 1 265 ? -24.299 27.399  38.023  1.00 67.98  ? 265  ARG A CZ    1 
ATOM   2108 N NH1   . ARG A 1 265 ? -24.704 28.640  37.783  1.00 69.07  ? 265  ARG A NH1   1 
ATOM   2109 N NH2   . ARG A 1 265 ? -24.944 26.669  38.931  1.00 67.45  ? 265  ARG A NH2   1 
ATOM   2110 N N     . ARG A 1 266 ? -25.653 21.417  35.968  1.00 59.92  ? 266  ARG A N     1 
ATOM   2111 C CA    . ARG A 1 266 ? -26.890 21.285  35.205  1.00 60.32  ? 266  ARG A CA    1 
ATOM   2112 C C     . ARG A 1 266 ? -27.918 20.465  35.967  1.00 60.66  ? 266  ARG A C     1 
ATOM   2113 O O     . ARG A 1 266 ? -29.087 20.785  35.912  1.00 61.00  ? 266  ARG A O     1 
ATOM   2114 C CB    . ARG A 1 266 ? -26.637 20.602  33.864  1.00 60.38  ? 266  ARG A CB    1 
ATOM   2115 C CG    . ARG A 1 266 ? -26.578 21.511  32.677  1.00 60.37  ? 266  ARG A CG    1 
ATOM   2116 C CD    . ARG A 1 266 ? -26.576 20.689  31.404  1.00 61.80  ? 266  ARG A CD    1 
ATOM   2117 N NE    . ARG A 1 266 ? -25.317 19.964  31.244  1.00 64.60  ? 266  ARG A NE    1 
ATOM   2118 C CZ    . ARG A 1 266 ? -25.208 18.643  31.107  1.00 67.54  ? 266  ARG A CZ    1 
ATOM   2119 N NH1   . ARG A 1 266 ? -24.004 18.112  30.976  1.00 67.94  ? 266  ARG A NH1   1 
ATOM   2120 N NH2   . ARG A 1 266 ? -26.290 17.848  31.087  1.00 69.69  ? 266  ARG A NH2   1 
ATOM   2121 N N     . THR A 1 267 ? -27.484 19.410  36.659  1.00 61.25  ? 267  THR A N     1 
ATOM   2122 C CA    . THR A 1 267 ? -28.399 18.431  37.262  1.00 61.78  ? 267  THR A CA    1 
ATOM   2123 C C     . THR A 1 267 ? -29.120 18.942  38.490  1.00 62.34  ? 267  THR A C     1 
ATOM   2124 O O     . THR A 1 267 ? -30.316 18.728  38.615  1.00 62.31  ? 267  THR A O     1 
ATOM   2125 C CB    . THR A 1 267 ? -27.695 17.093  37.613  1.00 61.62  ? 267  THR A CB    1 
ATOM   2126 O OG1   . THR A 1 267 ? -27.472 16.348  36.417  1.00 62.04  ? 267  THR A OG1   1 
ATOM   2127 C CG2   . THR A 1 267 ? -28.552 16.236  38.537  1.00 61.07  ? 267  THR A CG2   1 
ATOM   2128 N N     . ILE A 1 268 ? -28.397 19.590  39.400  1.00 63.45  ? 268  ILE A N     1 
ATOM   2129 C CA    . ILE A 1 268 ? -28.978 19.982  40.693  1.00 64.60  ? 268  ILE A CA    1 
ATOM   2130 C C     . ILE A 1 268 ? -28.832 21.455  41.059  1.00 65.50  ? 268  ILE A C     1 
ATOM   2131 O O     . ILE A 1 268 ? -27.853 22.115  40.695  1.00 65.42  ? 268  ILE A O     1 
ATOM   2132 C CB    . ILE A 1 268 ? -28.520 19.077  41.889  1.00 64.27  ? 268  ILE A CB    1 
ATOM   2133 C CG1   . ILE A 1 268 ? -27.021 19.185  42.135  1.00 64.70  ? 268  ILE A CG1   1 
ATOM   2134 C CG2   . ILE A 1 268 ? -28.903 17.623  41.659  1.00 64.23  ? 268  ILE A CG2   1 
ATOM   2135 C CD1   . ILE A 1 268 ? -26.590 18.635  43.485  1.00 65.46  ? 268  ILE A CD1   1 
ATOM   2136 N N     . ASN A 1 269 ? -29.854 21.956  41.753  1.00 66.94  ? 269  ASN A N     1 
ATOM   2137 C CA    . ASN A 1 269 ? -29.840 23.278  42.375  1.00 68.03  ? 269  ASN A CA    1 
ATOM   2138 C C     . ASN A 1 269 ? -29.103 23.248  43.705  1.00 68.37  ? 269  ASN A C     1 
ATOM   2139 O O     . ASN A 1 269 ? -29.263 22.325  44.509  1.00 68.15  ? 269  ASN A O     1 
ATOM   2140 C CB    . ASN A 1 269 ? -31.262 23.800  42.580  1.00 68.20  ? 269  ASN A CB    1 
ATOM   2141 C CG    . ASN A 1 269 ? -31.567 25.020  41.730  1.00 69.47  ? 269  ASN A CG    1 
ATOM   2142 O OD1   . ASN A 1 269 ? -30.661 25.644  41.167  1.00 69.52  ? 269  ASN A OD1   1 
ATOM   2143 N ND2   . ASN A 1 269 ? -32.855 25.381  41.649  1.00 70.70  ? 269  ASN A ND2   1 
ATOM   2144 N N     . LEU A 1 270 ? -28.291 24.270  43.926  1.00 69.00  ? 270  LEU A N     1 
ATOM   2145 C CA    . LEU A 1 270 ? -27.476 24.337  45.118  1.00 69.77  ? 270  LEU A CA    1 
ATOM   2146 C C     . LEU A 1 270 ? -26.934 25.760  45.289  1.00 70.08  ? 270  LEU A C     1 
ATOM   2147 O O     . LEU A 1 270 ? -26.712 26.468  44.296  1.00 70.00  ? 270  LEU A O     1 
ATOM   2148 C CB    . LEU A 1 270 ? -26.341 23.309  45.021  1.00 70.02  ? 270  LEU A CB    1 
ATOM   2149 C CG    . LEU A 1 270 ? -26.001 22.406  46.218  1.00 70.72  ? 270  LEU A CG    1 
ATOM   2150 C CD1   . LEU A 1 270 ? -27.224 21.820  46.951  1.00 69.99  ? 270  LEU A CD1   1 
ATOM   2151 C CD2   . LEU A 1 270 ? -25.088 21.289  45.726  1.00 71.67  ? 270  LEU A CD2   1 
ATOM   2152 N N     . PRO A 1 271 ? -26.747 26.197  46.553  1.00 70.44  ? 271  PRO A N     1 
ATOM   2153 C CA    . PRO A 1 271 ? -26.235 27.555  46.797  1.00 70.64  ? 271  PRO A CA    1 
ATOM   2154 C C     . PRO A 1 271 ? -24.764 27.742  46.421  1.00 70.85  ? 271  PRO A C     1 
ATOM   2155 O O     . PRO A 1 271 ? -24.323 28.864  46.169  1.00 71.00  ? 271  PRO A O     1 
ATOM   2156 C CB    . PRO A 1 271 ? -26.398 27.715  48.314  1.00 70.71  ? 271  PRO A CB    1 
ATOM   2157 C CG    . PRO A 1 271 ? -26.338 26.297  48.852  1.00 70.64  ? 271  PRO A CG    1 
ATOM   2158 C CD    . PRO A 1 271 ? -27.029 25.470  47.812  1.00 70.32  ? 271  PRO A CD    1 
ATOM   2159 N N     . THR A 1 272 ? -24.021 26.643  46.362  1.00 71.13  ? 272  THR A N     1 
ATOM   2160 C CA    . THR A 1 272 ? -22.571 26.708  46.492  1.00 71.18  ? 272  THR A CA    1 
ATOM   2161 C C     . THR A 1 272 ? -21.752 25.984  45.393  1.00 71.02  ? 272  THR A C     1 
ATOM   2162 O O     . THR A 1 272 ? -20.960 26.629  44.679  1.00 71.14  ? 272  THR A O     1 
ATOM   2163 C CB    . THR A 1 272 ? -22.160 26.256  47.928  1.00 71.32  ? 272  THR A CB    1 
ATOM   2164 O OG1   . THR A 1 272 ? -20.743 26.051  47.988  1.00 71.86  ? 272  THR A OG1   1 
ATOM   2165 C CG2   . THR A 1 272 ? -22.925 24.974  48.370  1.00 70.82  ? 272  THR A CG2   1 
ATOM   2166 N N     . TYR A 1 273 ? -21.950 24.667  45.263  1.00 70.46  ? 273  TYR A N     1 
ATOM   2167 C CA    . TYR A 1 273 ? -21.192 23.794  44.322  1.00 69.83  ? 273  TYR A CA    1 
ATOM   2168 C C     . TYR A 1 273 ? -19.710 23.551  44.670  1.00 69.07  ? 273  TYR A C     1 
ATOM   2169 O O     . TYR A 1 273 ? -18.846 23.659  43.803  1.00 69.31  ? 273  TYR A O     1 
ATOM   2170 C CB    . TYR A 1 273 ? -21.343 24.227  42.837  1.00 69.71  ? 273  TYR A CB    1 
ATOM   2171 C CG    . TYR A 1 273 ? -22.778 24.284  42.324  1.00 70.13  ? 273  TYR A CG    1 
ATOM   2172 C CD1   . TYR A 1 273 ? -23.544 23.125  42.178  1.00 69.78  ? 273  TYR A CD1   1 
ATOM   2173 C CD2   . TYR A 1 273 ? -23.364 25.504  41.975  1.00 70.34  ? 273  TYR A CD2   1 
ATOM   2174 C CE1   . TYR A 1 273 ? -24.864 23.187  41.709  1.00 70.14  ? 273  TYR A CE1   1 
ATOM   2175 C CE2   . TYR A 1 273 ? -24.678 25.575  41.508  1.00 69.89  ? 273  TYR A CE2   1 
ATOM   2176 C CZ    . TYR A 1 273 ? -25.421 24.417  41.373  1.00 69.69  ? 273  TYR A CZ    1 
ATOM   2177 O OH    . TYR A 1 273 ? -26.713 24.490  40.906  1.00 68.32  ? 273  TYR A OH    1 
ATOM   2178 N N     . THR A 1 274 ? -19.423 23.224  45.930  1.00 68.19  ? 274  THR A N     1 
ATOM   2179 C CA    . THR A 1 274 ? -18.099 22.724  46.311  1.00 67.15  ? 274  THR A CA    1 
ATOM   2180 C C     . THR A 1 274 ? -18.133 21.221  46.134  1.00 66.73  ? 274  THR A C     1 
ATOM   2181 O O     . THR A 1 274 ? -19.215 20.636  46.054  1.00 66.82  ? 274  THR A O     1 
ATOM   2182 C CB    . THR A 1 274 ? -17.746 22.981  47.801  1.00 67.14  ? 274  THR A CB    1 
ATOM   2183 O OG1   . THR A 1 274 ? -18.634 22.232  48.648  1.00 66.52  ? 274  THR A OG1   1 
ATOM   2184 C CG2   . THR A 1 274 ? -17.780 24.465  48.147  1.00 66.42  ? 274  THR A CG2   1 
ATOM   2185 N N     . LEU A 1 275 ? -16.963 20.587  46.109  1.00 65.70  ? 275  LEU A N     1 
ATOM   2186 C CA    . LEU A 1 275 ? -16.923 19.134  46.118  1.00 64.70  ? 275  LEU A CA    1 
ATOM   2187 C C     . LEU A 1 275 ? -17.647 18.532  47.323  1.00 64.18  ? 275  LEU A C     1 
ATOM   2188 O O     . LEU A 1 275 ? -18.366 17.549  47.174  1.00 64.43  ? 275  LEU A O     1 
ATOM   2189 C CB    . LEU A 1 275 ? -15.491 18.597  46.028  1.00 64.57  ? 275  LEU A CB    1 
ATOM   2190 C CG    . LEU A 1 275 ? -15.412 17.141  45.543  1.00 63.98  ? 275  LEU A CG    1 
ATOM   2191 C CD1   . LEU A 1 275 ? -15.602 17.059  44.040  1.00 63.46  ? 275  LEU A CD1   1 
ATOM   2192 C CD2   . LEU A 1 275 ? -14.116 16.495  45.949  1.00 63.30  ? 275  LEU A CD2   1 
ATOM   2193 N N     . GLU A 1 276 ? -17.478 19.111  48.506  1.00 63.57  ? 276  GLU A N     1 
ATOM   2194 C CA    . GLU A 1 276 ? -18.090 18.531  49.711  1.00 63.11  ? 276  GLU A CA    1 
ATOM   2195 C C     . GLU A 1 276 ? -19.598 18.790  49.813  1.00 62.91  ? 276  GLU A C     1 
ATOM   2196 O O     . GLU A 1 276 ? -20.331 17.998  50.432  1.00 62.74  ? 276  GLU A O     1 
ATOM   2197 C CB    . GLU A 1 276 ? -17.354 18.939  50.993  1.00 63.05  ? 276  GLU A CB    1 
ATOM   2198 C CG    . GLU A 1 276 ? -16.461 20.159  50.859  1.00 62.88  ? 276  GLU A CG    1 
ATOM   2199 C CD    . GLU A 1 276 ? -15.190 19.868  50.075  1.00 62.17  ? 276  GLU A CD    1 
ATOM   2200 O OE1   . GLU A 1 276 ? -14.648 18.746  50.218  1.00 61.61  ? 276  GLU A OE1   1 
ATOM   2201 O OE2   . GLU A 1 276 ? -14.741 20.762  49.321  1.00 61.50  ? 276  GLU A OE2   1 
ATOM   2202 N N     . ALA A 1 277 ? -20.059 19.879  49.192  1.00 62.38  ? 277  ALA A N     1 
ATOM   2203 C CA    . ALA A 1 277 ? -21.499 20.106  49.030  1.00 61.99  ? 277  ALA A CA    1 
ATOM   2204 C C     . ALA A 1 277 ? -22.111 19.065  48.086  1.00 61.83  ? 277  ALA A C     1 
ATOM   2205 O O     . ALA A 1 277 ? -23.091 18.391  48.436  1.00 62.10  ? 277  ALA A O     1 
ATOM   2206 C CB    . ALA A 1 277 ? -21.776 21.512  48.527  1.00 61.87  ? 277  ALA A CB    1 
ATOM   2207 N N     . VAL A 1 278 ? -21.521 18.933  46.899  1.00 61.36  ? 278  VAL A N     1 
ATOM   2208 C CA    . VAL A 1 278 ? -22.011 18.019  45.872  1.00 61.12  ? 278  VAL A CA    1 
ATOM   2209 C C     . VAL A 1 278 ? -22.069 16.582  46.390  1.00 61.34  ? 278  VAL A C     1 
ATOM   2210 O O     . VAL A 1 278 ? -23.102 15.921  46.289  1.00 61.09  ? 278  VAL A O     1 
ATOM   2211 C CB    . VAL A 1 278 ? -21.141 18.099  44.610  1.00 60.93  ? 278  VAL A CB    1 
ATOM   2212 C CG1   . VAL A 1 278 ? -21.530 17.030  43.617  1.00 60.75  ? 278  VAL A CG1   1 
ATOM   2213 C CG2   . VAL A 1 278 ? -21.261 19.477  43.980  1.00 61.19  ? 278  VAL A CG2   1 
ATOM   2214 N N     . TYR A 1 279 ? -20.967 16.119  46.971  1.00 61.63  ? 279  TYR A N     1 
ATOM   2215 C CA    . TYR A 1 279 ? -20.896 14.776  47.488  1.00 61.94  ? 279  TYR A CA    1 
ATOM   2216 C C     . TYR A 1 279 ? -21.998 14.532  48.483  1.00 63.00  ? 279  TYR A C     1 
ATOM   2217 O O     . TYR A 1 279 ? -22.574 13.448  48.498  1.00 63.12  ? 279  TYR A O     1 
ATOM   2218 C CB    . TYR A 1 279 ? -19.562 14.513  48.164  1.00 61.29  ? 279  TYR A CB    1 
ATOM   2219 C CG    . TYR A 1 279 ? -19.442 13.100  48.698  1.00 60.64  ? 279  TYR A CG    1 
ATOM   2220 C CD1   . TYR A 1 279 ? -19.313 12.015  47.833  1.00 60.19  ? 279  TYR A CD1   1 
ATOM   2221 C CD2   . TYR A 1 279 ? -19.459 12.842  50.065  1.00 60.00  ? 279  TYR A CD2   1 
ATOM   2222 C CE1   . TYR A 1 279 ? -19.197 10.701  48.321  1.00 59.20  ? 279  TYR A CE1   1 
ATOM   2223 C CE2   . TYR A 1 279 ? -19.338 11.529  50.562  1.00 59.37  ? 279  TYR A CE2   1 
ATOM   2224 C CZ    . TYR A 1 279 ? -19.209 10.474  49.679  1.00 58.62  ? 279  TYR A CZ    1 
ATOM   2225 O OH    . TYR A 1 279 ? -19.095 9.196   50.151  1.00 58.81  ? 279  TYR A OH    1 
ATOM   2226 N N     . GLU A 1 280 ? -22.279 15.537  49.314  1.00 64.32  ? 280  GLU A N     1 
ATOM   2227 C CA    . GLU A 1 280 ? -23.288 15.420  50.373  1.00 65.61  ? 280  GLU A CA    1 
ATOM   2228 C C     . GLU A 1 280 ? -24.705 15.322  49.803  1.00 66.01  ? 280  GLU A C     1 
ATOM   2229 O O     . GLU A 1 280 ? -25.451 14.383  50.127  1.00 66.01  ? 280  GLU A O     1 
ATOM   2230 C CB    . GLU A 1 280 ? -23.176 16.590  51.359  1.00 66.05  ? 280  GLU A CB    1 
ATOM   2231 C CG    . GLU A 1 280 ? -24.201 16.576  52.509  1.00 67.69  ? 280  GLU A CG    1 
ATOM   2232 C CD    . GLU A 1 280 ? -23.589 16.979  53.850  1.00 70.21  ? 280  GLU A CD    1 
ATOM   2233 O OE1   . GLU A 1 280 ? -22.935 18.048  53.929  1.00 69.91  ? 280  GLU A OE1   1 
ATOM   2234 O OE2   . GLU A 1 280 ? -23.759 16.213  54.828  1.00 71.55  ? 280  GLU A OE2   1 
ATOM   2235 N N     . ALA A 1 281 ? -25.054 16.291  48.954  1.00 66.41  ? 281  ALA A N     1 
ATOM   2236 C CA    . ALA A 1 281 ? -26.351 16.347  48.295  1.00 66.77  ? 281  ALA A CA    1 
ATOM   2237 C C     . ALA A 1 281 ? -26.730 15.021  47.629  1.00 67.27  ? 281  ALA A C     1 
ATOM   2238 O O     . ALA A 1 281 ? -27.882 14.584  47.727  1.00 67.74  ? 281  ALA A O     1 
ATOM   2239 C CB    . ALA A 1 281 ? -26.366 17.474  47.280  1.00 66.63  ? 281  ALA A CB    1 
ATOM   2240 N N     . ILE A 1 282 ? -25.751 14.381  46.980  1.00 67.60  ? 282  ILE A N     1 
ATOM   2241 C CA    . ILE A 1 282 ? -25.959 13.171  46.178  1.00 67.80  ? 282  ILE A CA    1 
ATOM   2242 C C     . ILE A 1 282 ? -25.847 11.870  46.988  1.00 68.76  ? 282  ILE A C     1 
ATOM   2243 O O     . ILE A 1 282 ? -26.596 10.918  46.770  1.00 68.74  ? 282  ILE A O     1 
ATOM   2244 C CB    . ILE A 1 282 ? -24.943 13.115  45.008  1.00 67.42  ? 282  ILE A CB    1 
ATOM   2245 C CG1   . ILE A 1 282 ? -24.965 14.410  44.182  1.00 66.69  ? 282  ILE A CG1   1 
ATOM   2246 C CG2   . ILE A 1 282 ? -25.159 11.884  44.143  1.00 67.19  ? 282  ILE A CG2   1 
ATOM   2247 C CD1   . ILE A 1 282 ? -26.208 14.635  43.329  1.00 66.19  ? 282  ILE A CD1   1 
ATOM   2248 N N     . PHE A 1 283 ? -24.907 11.825  47.920  1.00 69.93  ? 283  PHE A N     1 
ATOM   2249 C CA    . PHE A 1 283 ? -24.614 10.580  48.607  1.00 71.30  ? 283  PHE A CA    1 
ATOM   2250 C C     . PHE A 1 283 ? -25.037 10.516  50.080  1.00 72.31  ? 283  PHE A C     1 
ATOM   2251 O O     . PHE A 1 283 ? -25.017 9.429   50.676  1.00 72.20  ? 283  PHE A O     1 
ATOM   2252 C CB    . PHE A 1 283 ? -23.129 10.241  48.463  1.00 71.40  ? 283  PHE A CB    1 
ATOM   2253 C CG    . PHE A 1 283 ? -22.835 9.237   47.385  1.00 72.08  ? 283  PHE A CG    1 
ATOM   2254 C CD1   . PHE A 1 283 ? -22.889 7.865   47.662  1.00 72.88  ? 283  PHE A CD1   1 
ATOM   2255 C CD2   . PHE A 1 283 ? -22.490 9.655   46.100  1.00 72.17  ? 283  PHE A CD2   1 
ATOM   2256 C CE1   . PHE A 1 283 ? -22.607 6.922   46.671  1.00 73.73  ? 283  PHE A CE1   1 
ATOM   2257 C CE2   . PHE A 1 283 ? -22.211 8.727   45.104  1.00 73.01  ? 283  PHE A CE2   1 
ATOM   2258 C CZ    . PHE A 1 283 ? -22.268 7.353   45.388  1.00 73.48  ? 283  PHE A CZ    1 
ATOM   2259 N N     . GLY A 1 284 ? -25.408 11.659  50.664  1.00 73.38  ? 284  GLY A N     1 
ATOM   2260 C CA    . GLY A 1 284 ? -25.819 11.696  52.066  1.00 75.06  ? 284  GLY A CA    1 
ATOM   2261 C C     . GLY A 1 284 ? -24.783 12.283  53.007  1.00 76.47  ? 284  GLY A C     1 
ATOM   2262 O O     . GLY A 1 284 ? -24.947 13.417  53.471  1.00 76.84  ? 284  GLY A O     1 
ATOM   2263 N N     . GLN A 1 285 ? -23.720 11.523  53.288  1.00 77.61  ? 285  GLN A N     1 
ATOM   2264 C CA    . GLN A 1 285 ? -22.643 11.940  54.221  1.00 78.96  ? 285  GLN A CA    1 
ATOM   2265 C C     . GLN A 1 285 ? -21.919 13.247  53.857  1.00 79.46  ? 285  GLN A C     1 
ATOM   2266 O O     . GLN A 1 285 ? -21.887 13.645  52.687  1.00 79.44  ? 285  GLN A O     1 
ATOM   2267 C CB    . GLN A 1 285 ? -21.596 10.832  54.375  1.00 79.02  ? 285  GLN A CB    1 
ATOM   2268 C CG    . GLN A 1 285 ? -22.048 9.655   55.204  1.00 80.58  ? 285  GLN A CG    1 
ATOM   2269 C CD    . GLN A 1 285 ? -22.910 8.695   54.415  1.00 82.23  ? 285  GLN A CD    1 
ATOM   2270 O OE1   . GLN A 1 285 ? -23.939 9.081   53.851  1.00 82.83  ? 285  GLN A OE1   1 
ATOM   2271 N NE2   . GLN A 1 285 ? -22.496 7.432   54.371  1.00 82.98  ? 285  GLN A NE2   1 
ATOM   2272 N N     . PRO A 1 286 ? -21.335 13.927  54.862  1.00 80.04  ? 286  PRO A N     1 
ATOM   2273 C CA    . PRO A 1 286 ? -20.525 15.087  54.496  1.00 80.32  ? 286  PRO A CA    1 
ATOM   2274 C C     . PRO A 1 286 ? -19.079 14.685  54.210  1.00 80.56  ? 286  PRO A C     1 
ATOM   2275 O O     . PRO A 1 286 ? -18.684 13.531  54.447  1.00 80.20  ? 286  PRO A O     1 
ATOM   2276 C CB    . PRO A 1 286 ? -20.616 16.000  55.731  1.00 80.27  ? 286  PRO A CB    1 
ATOM   2277 C CG    . PRO A 1 286 ? -21.148 15.113  56.867  1.00 80.34  ? 286  PRO A CG    1 
ATOM   2278 C CD    . PRO A 1 286 ? -21.373 13.720  56.323  1.00 80.09  ? 286  PRO A CD    1 
ATOM   2279 N N     . LYS A 1 287 ? -18.318 15.637  53.679  1.00 80.95  ? 287  LYS A N     1 
ATOM   2280 C CA    . LYS A 1 287 ? -16.905 15.445  53.400  1.00 81.35  ? 287  LYS A CA    1 
ATOM   2281 C C     . LYS A 1 287 ? -16.133 16.524  54.142  1.00 81.72  ? 287  LYS A C     1 
ATOM   2282 O O     . LYS A 1 287 ? -16.290 17.724  53.864  1.00 81.90  ? 287  LYS A O     1 
ATOM   2283 C CB    . LYS A 1 287 ? -16.631 15.514  51.893  1.00 81.34  ? 287  LYS A CB    1 
ATOM   2284 C CG    . LYS A 1 287 ? -15.255 15.003  51.473  1.00 81.07  ? 287  LYS A CG    1 
ATOM   2285 C CD    . LYS A 1 287 ? -15.031 15.180  49.978  1.00 80.07  ? 287  LYS A CD    1 
ATOM   2286 C CE    . LYS A 1 287 ? -13.572 15.014  49.617  1.00 79.73  ? 287  LYS A CE    1 
ATOM   2287 N NZ    . LYS A 1 287 ? -12.737 16.081  50.242  1.00 79.76  ? 287  LYS A NZ    1 
ATOM   2288 N N     . GLU A 1 288 ? -15.311 16.091  55.096  1.00 81.90  ? 288  GLU A N     1 
ATOM   2289 C CA    . GLU A 1 288 ? -14.566 17.008  55.943  1.00 81.95  ? 288  GLU A CA    1 
ATOM   2290 C C     . GLU A 1 288 ? -13.580 17.798  55.081  1.00 81.38  ? 288  GLU A C     1 
ATOM   2291 O O     . GLU A 1 288 ? -12.556 17.269  54.655  1.00 81.42  ? 288  GLU A O     1 
ATOM   2292 C CB    . GLU A 1 288 ? -13.871 16.235  57.073  1.00 82.28  ? 288  GLU A CB    1 
ATOM   2293 C CG    . GLU A 1 288 ? -13.716 17.021  58.393  1.00 83.97  ? 288  GLU A CG    1 
ATOM   2294 C CD    . GLU A 1 288 ? -12.275 17.493  58.665  1.00 85.99  ? 288  GLU A CD    1 
ATOM   2295 O OE1   . GLU A 1 288 ? -11.387 17.282  57.802  1.00 86.81  ? 288  GLU A OE1   1 
ATOM   2296 O OE2   . GLU A 1 288 ? -12.028 18.072  59.750  1.00 85.81  ? 288  GLU A OE2   1 
ATOM   2297 N N     . LYS A 1 289 ? -13.927 19.050  54.786  1.00 80.77  ? 289  LYS A N     1 
ATOM   2298 C CA    . LYS A 1 289 ? -13.041 19.928  54.021  1.00 80.25  ? 289  LYS A CA    1 
ATOM   2299 C C     . LYS A 1 289 ? -11.778 20.239  54.836  1.00 80.29  ? 289  LYS A C     1 
ATOM   2300 O O     . LYS A 1 289 ? -11.801 20.247  56.073  1.00 80.24  ? 289  LYS A O     1 
ATOM   2301 C CB    . LYS A 1 289 ? -13.777 21.214  53.582  1.00 79.92  ? 289  LYS A CB    1 
ATOM   2302 C CG    . LYS A 1 289 ? -12.909 22.346  52.983  1.00 78.85  ? 289  LYS A CG    1 
ATOM   2303 C CD    . LYS A 1 289 ? -12.418 22.071  51.561  1.00 76.62  ? 289  LYS A CD    1 
ATOM   2304 N N     . VAL A 1 290 ? -10.676 20.444  54.122  1.00 80.17  ? 290  VAL A N     1 
ATOM   2305 C CA    . VAL A 1 290 ? -9.423  20.913  54.701  1.00 80.01  ? 290  VAL A CA    1 
ATOM   2306 C C     . VAL A 1 290 ? -8.970  22.100  53.850  1.00 80.11  ? 290  VAL A C     1 
ATOM   2307 O O     . VAL A 1 290 ? -8.686  21.939  52.665  1.00 80.11  ? 290  VAL A O     1 
ATOM   2308 C CB    . VAL A 1 290 ? -8.358  19.792  54.721  1.00 79.87  ? 290  VAL A CB    1 
ATOM   2309 C CG1   . VAL A 1 290 ? -6.993  20.351  55.091  1.00 79.77  ? 290  VAL A CG1   1 
ATOM   2310 C CG2   . VAL A 1 290 ? -8.767  18.671  55.677  1.00 79.23  ? 290  VAL A CG2   1 
ATOM   2311 N N     . TYR A 1 291 ? -8.922  23.285  54.456  1.00 80.31  ? 291  TYR A N     1 
ATOM   2312 C CA    . TYR A 1 291 ? -8.754  24.547  53.716  1.00 80.57  ? 291  TYR A CA    1 
ATOM   2313 C C     . TYR A 1 291 ? -7.322  24.825  53.279  1.00 80.50  ? 291  TYR A C     1 
ATOM   2314 O O     . TYR A 1 291 ? -6.401  24.150  53.729  1.00 80.47  ? 291  TYR A O     1 
ATOM   2315 C CB    . TYR A 1 291 ? -9.301  25.725  54.535  1.00 80.80  ? 291  TYR A CB    1 
ATOM   2316 C CG    . TYR A 1 291 ? -10.807 25.706  54.689  1.00 81.41  ? 291  TYR A CG    1 
ATOM   2317 C CD1   . TYR A 1 291 ? -11.631 26.412  53.802  1.00 81.46  ? 291  TYR A CD1   1 
ATOM   2318 C CD2   . TYR A 1 291 ? -11.413 24.971  55.718  1.00 82.18  ? 291  TYR A CD2   1 
ATOM   2319 C CE1   . TYR A 1 291 ? -13.026 26.389  53.939  1.00 81.84  ? 291  TYR A CE1   1 
ATOM   2320 C CE2   . TYR A 1 291 ? -12.807 24.942  55.864  1.00 82.50  ? 291  TYR A CE2   1 
ATOM   2321 C CZ    . TYR A 1 291 ? -13.604 25.651  54.973  1.00 82.02  ? 291  TYR A CZ    1 
ATOM   2322 O OH    . TYR A 1 291 ? -14.972 25.617  55.125  1.00 81.51  ? 291  TYR A OH    1 
ATOM   2323 N N     . ALA A 1 292 ? -7.154  25.830  52.414  1.00 80.72  ? 292  ALA A N     1 
ATOM   2324 C CA    . ALA A 1 292 ? -5.854  26.197  51.828  1.00 81.12  ? 292  ALA A CA    1 
ATOM   2325 C C     . ALA A 1 292 ? -4.831  26.731  52.844  1.00 81.51  ? 292  ALA A C     1 
ATOM   2326 O O     . ALA A 1 292 ? -3.695  26.255  52.894  1.00 81.53  ? 292  ALA A O     1 
ATOM   2327 C CB    . ALA A 1 292 ? -6.042  27.187  50.671  1.00 80.93  ? 292  ALA A CB    1 
ATOM   2328 N N     . GLU A 1 293 ? -5.239  27.714  53.646  1.00 82.04  ? 293  GLU A N     1 
ATOM   2329 C CA    . GLU A 1 293 ? -4.401  28.262  54.721  1.00 82.48  ? 293  GLU A CA    1 
ATOM   2330 C C     . GLU A 1 293 ? -4.018  27.174  55.735  1.00 82.62  ? 293  GLU A C     1 
ATOM   2331 O O     . GLU A 1 293 ? -2.953  27.227  56.346  1.00 82.76  ? 293  GLU A O     1 
ATOM   2332 C CB    . GLU A 1 293 ? -5.124  29.419  55.431  1.00 82.60  ? 293  GLU A CB    1 
ATOM   2333 C CG    . GLU A 1 293 ? -5.234  30.734  54.624  1.00 83.37  ? 293  GLU A CG    1 
ATOM   2334 C CD    . GLU A 1 293 ? -6.274  30.698  53.490  1.00 83.89  ? 293  GLU A CD    1 
ATOM   2335 O OE1   . GLU A 1 293 ? -7.272  29.942  53.602  1.00 83.02  ? 293  GLU A OE1   1 
ATOM   2336 O OE2   . GLU A 1 293 ? -6.088  31.439  52.488  1.00 84.17  ? 293  GLU A OE2   1 
ATOM   2337 N N     . GLU A 1 294 ? -4.902  26.194  55.899  1.00 82.73  ? 294  GLU A N     1 
ATOM   2338 C CA    . GLU A 1 294 ? -4.696  25.057  56.783  1.00 82.97  ? 294  GLU A CA    1 
ATOM   2339 C C     . GLU A 1 294 ? -3.726  24.052  56.155  1.00 83.14  ? 294  GLU A C     1 
ATOM   2340 O O     . GLU A 1 294 ? -3.084  23.269  56.869  1.00 83.07  ? 294  GLU A O     1 
ATOM   2341 C CB    . GLU A 1 294 ? -6.052  24.407  57.061  1.00 83.04  ? 294  GLU A CB    1 
ATOM   2342 C CG    . GLU A 1 294 ? -6.067  23.248  58.048  1.00 83.77  ? 294  GLU A CG    1 
ATOM   2343 C CD    . GLU A 1 294 ? -7.454  22.594  58.161  1.00 85.39  ? 294  GLU A CD    1 
ATOM   2344 O OE1   . GLU A 1 294 ? -8.462  23.212  57.728  1.00 85.61  ? 294  GLU A OE1   1 
ATOM   2345 O OE2   . GLU A 1 294 ? -7.535  21.456  58.685  1.00 85.38  ? 294  GLU A OE2   1 
ATOM   2346 N N     . ILE A 1 295 ? -3.635  24.087  54.819  1.00 83.36  ? 295  ILE A N     1 
ATOM   2347 C CA    . ILE A 1 295 ? -2.740  23.215  54.033  1.00 83.51  ? 295  ILE A CA    1 
ATOM   2348 C C     . ILE A 1 295 ? -1.319  23.761  54.030  1.00 83.88  ? 295  ILE A C     1 
ATOM   2349 O O     . ILE A 1 295 ? -0.384  23.046  54.391  1.00 83.72  ? 295  ILE A O     1 
ATOM   2350 C CB    . ILE A 1 295 ? -3.242  23.020  52.565  1.00 83.33  ? 295  ILE A CB    1 
ATOM   2351 C CG1   . ILE A 1 295 ? -4.267  21.887  52.496  1.00 83.27  ? 295  ILE A CG1   1 
ATOM   2352 C CG2   . ILE A 1 295 ? -2.092  22.724  51.607  1.00 82.72  ? 295  ILE A CG2   1 
ATOM   2353 C CD1   . ILE A 1 295 ? -5.065  21.847  51.196  1.00 83.20  ? 295  ILE A CD1   1 
ATOM   2354 N N     . ALA A 1 296 ? -1.175  25.029  53.629  1.00 84.45  ? 296  ALA A N     1 
ATOM   2355 C CA    . ALA A 1 296 ? 0.113   25.735  53.601  1.00 84.87  ? 296  ALA A CA    1 
ATOM   2356 C C     . ALA A 1 296 ? 0.842   25.623  54.945  1.00 85.34  ? 296  ALA A C     1 
ATOM   2357 O O     . ALA A 1 296 ? 2.068   25.506  54.987  1.00 85.25  ? 296  ALA A O     1 
ATOM   2358 C CB    . ALA A 1 296 ? -0.093  27.198  53.209  1.00 84.75  ? 296  ALA A CB    1 
ATOM   2359 N N     . GLN A 1 297 ? 0.062   25.651  56.028  1.00 85.93  ? 297  GLN A N     1 
ATOM   2360 C CA    . GLN A 1 297 ? 0.518   25.341  57.383  1.00 86.43  ? 297  GLN A CA    1 
ATOM   2361 C C     . GLN A 1 297 ? 1.225   23.990  57.441  1.00 86.42  ? 297  GLN A C     1 
ATOM   2362 O O     . GLN A 1 297 ? 2.447   23.943  57.472  1.00 86.55  ? 297  GLN A O     1 
ATOM   2363 C CB    . GLN A 1 297 ? -0.675  25.323  58.343  1.00 86.68  ? 297  GLN A CB    1 
ATOM   2364 C CG    . GLN A 1 297 ? -0.327  25.644  59.787  1.00 87.64  ? 297  GLN A CG    1 
ATOM   2365 C CD    . GLN A 1 297 ? -0.141  27.135  60.022  1.00 89.16  ? 297  GLN A CD    1 
ATOM   2366 O OE1   . GLN A 1 297 ? -0.454  27.959  59.155  1.00 89.87  ? 297  GLN A OE1   1 
ATOM   2367 N NE2   . GLN A 1 297 ? 0.369   27.489  61.200  1.00 89.45  ? 297  GLN A NE2   1 
ATOM   2368 N N     . ALA A 1 298 ? 0.452   22.904  57.433  1.00 86.50  ? 298  ALA A N     1 
ATOM   2369 C CA    . ALA A 1 298 ? 0.979   21.532  57.559  1.00 86.69  ? 298  ALA A CA    1 
ATOM   2370 C C     . ALA A 1 298 ? 2.206   21.209  56.687  1.00 86.71  ? 298  ALA A C     1 
ATOM   2371 O O     . ALA A 1 298 ? 2.975   20.292  56.996  1.00 86.68  ? 298  ALA A O     1 
ATOM   2372 C CB    . ALA A 1 298 ? -0.131  20.516  57.304  1.00 86.81  ? 298  ALA A CB    1 
ATOM   2373 N N     . TRP A 1 299 ? 2.370   21.965  55.602  1.00 86.57  ? 299  TRP A N     1 
ATOM   2374 C CA    . TRP A 1 299 ? 3.491   21.803  54.687  1.00 86.38  ? 299  TRP A CA    1 
ATOM   2375 C C     . TRP A 1 299 ? 4.704   22.537  55.235  1.00 86.49  ? 299  TRP A C     1 
ATOM   2376 O O     . TRP A 1 299 ? 5.767   21.940  55.402  1.00 86.54  ? 299  TRP A O     1 
ATOM   2377 C CB    . TRP A 1 299 ? 3.119   22.355  53.313  1.00 86.18  ? 299  TRP A CB    1 
ATOM   2378 C CG    . TRP A 1 299 ? 4.077   22.003  52.226  1.00 85.75  ? 299  TRP A CG    1 
ATOM   2379 C CD1   . TRP A 1 299 ? 4.956   22.844  51.608  1.00 85.60  ? 299  TRP A CD1   1 
ATOM   2380 C CD2   . TRP A 1 299 ? 4.247   20.718  51.608  1.00 85.25  ? 299  TRP A CD2   1 
ATOM   2381 N NE1   . TRP A 1 299 ? 5.668   22.164  50.648  1.00 84.98  ? 299  TRP A NE1   1 
ATOM   2382 C CE2   . TRP A 1 299 ? 5.254   20.858  50.626  1.00 84.93  ? 299  TRP A CE2   1 
ATOM   2383 C CE3   . TRP A 1 299 ? 3.645   19.463  51.786  1.00 85.17  ? 299  TRP A CE3   1 
ATOM   2384 C CZ2   . TRP A 1 299 ? 5.676   19.787  49.821  1.00 84.84  ? 299  TRP A CZ2   1 
ATOM   2385 C CZ3   . TRP A 1 299 ? 4.067   18.397  50.982  1.00 84.78  ? 299  TRP A CZ3   1 
ATOM   2386 C CH2   . TRP A 1 299 ? 5.072   18.569  50.014  1.00 84.55  ? 299  TRP A CH2   1 
ATOM   2387 N N     . GLU A 1 300 ? 4.523   23.830  55.517  1.00 86.58  ? 300  GLU A N     1 
ATOM   2388 C CA    . GLU A 1 300 ? 5.574   24.706  56.058  1.00 86.58  ? 300  GLU A CA    1 
ATOM   2389 C C     . GLU A 1 300 ? 5.969   24.357  57.500  1.00 86.23  ? 300  GLU A C     1 
ATOM   2390 O O     . GLU A 1 300 ? 7.122   24.520  57.874  1.00 86.25  ? 300  GLU A O     1 
ATOM   2391 C CB    . GLU A 1 300 ? 5.172   26.184  55.922  1.00 86.71  ? 300  GLU A CB    1 
ATOM   2392 C CG    . GLU A 1 300 ? 5.172   26.685  54.457  1.00 87.92  ? 300  GLU A CG    1 
ATOM   2393 C CD    . GLU A 1 300 ? 4.129   27.777  54.160  1.00 89.39  ? 300  GLU A CD    1 
ATOM   2394 O OE1   . GLU A 1 300 ? 4.033   28.221  52.987  1.00 88.98  ? 300  GLU A OE1   1 
ATOM   2395 O OE2   . GLU A 1 300 ? 3.400   28.188  55.092  1.00 90.55  ? 300  GLU A OE2   1 
ATOM   2396 N N     . THR A 1 301 ? 5.015   23.872  58.292  1.00 85.93  ? 301  THR A N     1 
ATOM   2397 C CA    . THR A 1 301 ? 5.302   23.280  59.598  1.00 85.63  ? 301  THR A CA    1 
ATOM   2398 C C     . THR A 1 301 ? 5.932   21.907  59.406  1.00 85.39  ? 301  THR A C     1 
ATOM   2399 O O     . THR A 1 301 ? 7.055   21.672  59.836  1.00 85.18  ? 301  THR A O     1 
ATOM   2400 C CB    . THR A 1 301 ? 4.015   23.110  60.458  1.00 85.76  ? 301  THR A CB    1 
ATOM   2401 O OG1   . THR A 1 301 ? 3.475   24.396  60.784  1.00 86.01  ? 301  THR A OG1   1 
ATOM   2402 C CG2   . THR A 1 301 ? 4.298   22.338  61.760  1.00 85.70  ? 301  THR A CG2   1 
ATOM   2403 N N     . GLY A 1 302 ? 5.200   21.016  58.744  1.00 85.28  ? 302  GLY A N     1 
ATOM   2404 C CA    . GLY A 1 302 ? 5.547   19.604  58.696  1.00 85.09  ? 302  GLY A CA    1 
ATOM   2405 C C     . GLY A 1 302 ? 4.715   18.812  59.691  1.00 85.13  ? 302  GLY A C     1 
ATOM   2406 O O     . GLY A 1 302 ? 4.899   17.603  59.829  1.00 85.20  ? 302  GLY A O     1 
ATOM   2407 N N     . GLU A 1 303 ? 3.804   19.494  60.388  1.00 85.13  ? 303  GLU A N     1 
ATOM   2408 C CA    . GLU A 1 303 ? 2.909   18.850  61.362  1.00 85.04  ? 303  GLU A CA    1 
ATOM   2409 C C     . GLU A 1 303 ? 1.471   18.774  60.832  1.00 84.94  ? 303  GLU A C     1 
ATOM   2410 O O     . GLU A 1 303 ? 0.976   19.723  60.209  1.00 84.85  ? 303  GLU A O     1 
ATOM   2411 N N     . GLY A 1 304 ? 0.809   17.646  61.085  1.00 84.67  ? 304  GLY A N     1 
ATOM   2412 C CA    . GLY A 1 304 ? -0.544  17.401  60.570  1.00 84.39  ? 304  GLY A CA    1 
ATOM   2413 C C     . GLY A 1 304 ? -0.645  17.211  59.056  1.00 84.12  ? 304  GLY A C     1 
ATOM   2414 O O     . GLY A 1 304 ? -1.632  17.619  58.436  1.00 84.15  ? 304  GLY A O     1 
ATOM   2415 N N     . LEU A 1 305 ? 0.378   16.600  58.461  1.00 83.79  ? 305  LEU A N     1 
ATOM   2416 C CA    . LEU A 1 305 ? 0.354   16.215  57.046  1.00 83.49  ? 305  LEU A CA    1 
ATOM   2417 C C     . LEU A 1 305 ? -0.488  14.966  56.789  1.00 83.15  ? 305  LEU A C     1 
ATOM   2418 O O     . LEU A 1 305 ? -0.998  14.782  55.682  1.00 82.94  ? 305  LEU A O     1 
ATOM   2419 C CB    . LEU A 1 305 ? 1.769   15.986  56.504  1.00 83.52  ? 305  LEU A CB    1 
ATOM   2420 C CG    . LEU A 1 305 ? 2.541   17.179  55.937  1.00 84.14  ? 305  LEU A CG    1 
ATOM   2421 C CD1   . LEU A 1 305 ? 3.924   16.741  55.437  1.00 84.92  ? 305  LEU A CD1   1 
ATOM   2422 C CD2   . LEU A 1 305 ? 1.768   17.890  54.828  1.00 84.05  ? 305  LEU A CD2   1 
ATOM   2423 N N     . GLU A 1 306 ? -0.619  14.112  57.807  1.00 82.77  ? 306  GLU A N     1 
ATOM   2424 C CA    . GLU A 1 306 ? -1.413  12.886  57.702  1.00 82.30  ? 306  GLU A CA    1 
ATOM   2425 C C     . GLU A 1 306 ? -2.906  13.185  57.526  1.00 81.50  ? 306  GLU A C     1 
ATOM   2426 O O     . GLU A 1 306 ? -3.621  12.447  56.834  1.00 81.37  ? 306  GLU A O     1 
ATOM   2427 C CB    . GLU A 1 306 ? -1.168  11.963  58.896  1.00 82.55  ? 306  GLU A CB    1 
ATOM   2428 C CG    . GLU A 1 306 ? 0.159   11.210  58.813  1.00 84.44  ? 306  GLU A CG    1 
ATOM   2429 C CD    . GLU A 1 306 ? 0.128   9.845   59.509  1.00 87.02  ? 306  GLU A CD    1 
ATOM   2430 O OE1   . GLU A 1 306 ? -0.961  9.432   59.976  1.00 87.65  ? 306  GLU A OE1   1 
ATOM   2431 O OE2   . GLU A 1 306 ? 1.197   9.181   59.579  1.00 87.54  ? 306  GLU A OE2   1 
ATOM   2432 N N     . ARG A 1 307 ? -3.364  14.272  58.146  1.00 80.29  ? 307  ARG A N     1 
ATOM   2433 C CA    . ARG A 1 307 ? -4.681  14.825  57.855  1.00 78.99  ? 307  ARG A CA    1 
ATOM   2434 C C     . ARG A 1 307 ? -4.733  15.230  56.373  1.00 77.99  ? 307  ARG A C     1 
ATOM   2435 O O     . ARG A 1 307 ? -5.490  14.638  55.603  1.00 78.09  ? 307  ARG A O     1 
ATOM   2436 C CB    . ARG A 1 307 ? -4.980  16.006  58.791  1.00 79.23  ? 307  ARG A CB    1 
ATOM   2437 C CG    . ARG A 1 307 ? -6.307  16.734  58.589  1.00 79.22  ? 307  ARG A CG    1 
ATOM   2438 C CD    . ARG A 1 307 ? -6.475  17.769  59.702  1.00 80.36  ? 307  ARG A CD    1 
ATOM   2439 N NE    . ARG A 1 307 ? -7.417  18.835  59.369  1.00 80.45  ? 307  ARG A NE    1 
ATOM   2440 C CZ    . ARG A 1 307 ? -8.727  18.786  59.601  1.00 80.45  ? 307  ARG A CZ    1 
ATOM   2441 N NH1   . ARG A 1 307 ? -9.497  19.816  59.260  1.00 80.06  ? 307  ARG A NH1   1 
ATOM   2442 N NH2   . ARG A 1 307 ? -9.269  17.712  60.166  1.00 80.22  ? 307  ARG A NH2   1 
ATOM   2443 N N     . VAL A 1 308 ? -3.891  16.185  55.967  1.00 76.38  ? 308  VAL A N     1 
ATOM   2444 C CA    . VAL A 1 308 ? -3.929  16.748  54.606  1.00 74.88  ? 308  VAL A CA    1 
ATOM   2445 C C     . VAL A 1 308 ? -3.907  15.686  53.491  1.00 73.81  ? 308  VAL A C     1 
ATOM   2446 O O     . VAL A 1 308 ? -4.483  15.891  52.426  1.00 73.76  ? 308  VAL A O     1 
ATOM   2447 C CB    . VAL A 1 308 ? -2.822  17.821  54.380  1.00 74.89  ? 308  VAL A CB    1 
ATOM   2448 C CG1   . VAL A 1 308 ? -2.934  18.451  53.006  1.00 74.49  ? 308  VAL A CG1   1 
ATOM   2449 C CG2   . VAL A 1 308 ? -2.926  18.907  55.421  1.00 75.25  ? 308  VAL A CG2   1 
ATOM   2450 N N     . ALA A 1 309 ? -3.270  14.550  53.742  1.00 72.35  ? 309  ALA A N     1 
ATOM   2451 C CA    . ALA A 1 309 ? -3.243  13.483  52.750  1.00 70.99  ? 309  ALA A CA    1 
ATOM   2452 C C     . ALA A 1 309 ? -4.571  12.710  52.680  1.00 69.97  ? 309  ALA A C     1 
ATOM   2453 O O     . ALA A 1 309 ? -4.979  12.284  51.590  1.00 70.21  ? 309  ALA A O     1 
ATOM   2454 C CB    . ALA A 1 309 ? -2.066  12.547  52.987  1.00 71.02  ? 309  ALA A CB    1 
ATOM   2455 N N     . ARG A 1 310 ? -5.236  12.528  53.824  1.00 68.16  ? 310  ARG A N     1 
ATOM   2456 C CA    . ARG A 1 310 ? -6.567  11.911  53.864  1.00 66.38  ? 310  ARG A CA    1 
ATOM   2457 C C     . ARG A 1 310 ? -7.521  12.723  52.975  1.00 65.38  ? 310  ARG A C     1 
ATOM   2458 O O     . ARG A 1 310 ? -8.355  12.167  52.262  1.00 65.04  ? 310  ARG A O     1 
ATOM   2459 C CB    . ARG A 1 310 ? -7.093  11.853  55.308  1.00 66.38  ? 310  ARG A CB    1 
ATOM   2460 C CG    . ARG A 1 310 ? -7.893  10.609  55.673  1.00 65.62  ? 310  ARG A CG    1 
ATOM   2461 N N     . TYR A 1 311 ? -7.370  14.044  53.007  1.00 64.14  ? 311  TYR A N     1 
ATOM   2462 C CA    . TYR A 1 311 ? -8.199  14.944  52.213  1.00 63.08  ? 311  TYR A CA    1 
ATOM   2463 C C     . TYR A 1 311 ? -8.000  14.695  50.713  1.00 62.45  ? 311  TYR A C     1 
ATOM   2464 O O     . TYR A 1 311 ? -8.970  14.511  49.978  1.00 62.44  ? 311  TYR A O     1 
ATOM   2465 C CB    . TYR A 1 311 ? -7.912  16.403  52.591  1.00 62.99  ? 311  TYR A CB    1 
ATOM   2466 C CG    . TYR A 1 311 ? -8.651  17.434  51.772  1.00 62.43  ? 311  TYR A CG    1 
ATOM   2467 C CD1   . TYR A 1 311 ? -10.023 17.625  51.925  1.00 62.55  ? 311  TYR A CD1   1 
ATOM   2468 C CD2   . TYR A 1 311 ? -7.972  18.232  50.852  1.00 62.74  ? 311  TYR A CD2   1 
ATOM   2469 C CE1   . TYR A 1 311 ? -10.707 18.580  51.170  1.00 62.98  ? 311  TYR A CE1   1 
ATOM   2470 C CE2   . TYR A 1 311 ? -8.643  19.192  50.095  1.00 63.42  ? 311  TYR A CE2   1 
ATOM   2471 C CZ    . TYR A 1 311 ? -10.011 19.359  50.258  1.00 63.50  ? 311  TYR A CZ    1 
ATOM   2472 O OH    . TYR A 1 311 ? -10.678 20.299  49.500  1.00 64.19  ? 311  TYR A OH    1 
ATOM   2473 N N     . SER A 1 312 ? -6.744  14.670  50.272  1.00 61.45  ? 312  SER A N     1 
ATOM   2474 C CA    . SER A 1 312 ? -6.414  14.355  48.883  1.00 60.36  ? 312  SER A CA    1 
ATOM   2475 C C     . SER A 1 312 ? -6.868  12.947  48.434  1.00 59.86  ? 312  SER A C     1 
ATOM   2476 O O     . SER A 1 312 ? -7.404  12.817  47.324  1.00 59.79  ? 312  SER A O     1 
ATOM   2477 C CB    . SER A 1 312 ? -4.919  14.568  48.606  1.00 60.30  ? 312  SER A CB    1 
ATOM   2478 O OG    . SER A 1 312 ? -4.646  14.631  47.215  1.00 59.72  ? 312  SER A OG    1 
ATOM   2479 N N     . MET A 1 313 ? -6.682  11.909  49.265  1.00 58.66  ? 313  MET A N     1 
ATOM   2480 C CA    . MET A 1 313 ? -7.137  10.559  48.861  1.00 58.02  ? 313  MET A CA    1 
ATOM   2481 C C     . MET A 1 313 ? -8.663  10.482  48.742  1.00 57.58  ? 313  MET A C     1 
ATOM   2482 O O     . MET A 1 313 ? -9.191  9.705   47.942  1.00 57.71  ? 313  MET A O     1 
ATOM   2483 C CB    . MET A 1 313 ? -6.572  9.420   49.736  1.00 57.76  ? 313  MET A CB    1 
ATOM   2484 C CG    . MET A 1 313 ? -7.441  8.945   50.898  1.00 58.35  ? 313  MET A CG    1 
ATOM   2485 S SD    . MET A 1 313 ? -8.836  7.867   50.483  1.00 60.89  ? 313  MET A SD    1 
ATOM   2486 C CE    . MET A 1 313 ? -8.159  6.205   50.690  1.00 61.07  ? 313  MET A CE    1 
ATOM   2487 N N     . GLU A 1 314 ? -9.360  11.296  49.534  1.00 56.76  ? 314  GLU A N     1 
ATOM   2488 C CA    . GLU A 1 314 ? -10.812 11.359  49.478  1.00 55.73  ? 314  GLU A CA    1 
ATOM   2489 C C     . GLU A 1 314 ? -11.320 12.184  48.292  1.00 54.54  ? 314  GLU A C     1 
ATOM   2490 O O     . GLU A 1 314 ? -12.275 11.775  47.644  1.00 54.54  ? 314  GLU A O     1 
ATOM   2491 C CB    . GLU A 1 314 ? -11.375 11.876  50.790  1.00 56.03  ? 314  GLU A CB    1 
ATOM   2492 C CG    . GLU A 1 314 ? -11.357 10.844  51.893  1.00 58.00  ? 314  GLU A CG    1 
ATOM   2493 C CD    . GLU A 1 314 ? -12.021 11.347  53.169  1.00 61.16  ? 314  GLU A CD    1 
ATOM   2494 O OE1   . GLU A 1 314 ? -12.626 12.447  53.128  1.00 61.71  ? 314  GLU A OE1   1 
ATOM   2495 O OE2   . GLU A 1 314 ? -11.942 10.641  54.211  1.00 62.39  ? 314  GLU A OE2   1 
ATOM   2496 N N     . ASP A 1 315 ? -10.684 13.321  47.998  1.00 53.04  ? 315  ASP A N     1 
ATOM   2497 C CA    . ASP A 1 315 ? -10.994 14.080  46.774  1.00 51.92  ? 315  ASP A CA    1 
ATOM   2498 C C     . ASP A 1 315 ? -11.031 13.141  45.569  1.00 51.22  ? 315  ASP A C     1 
ATOM   2499 O O     . ASP A 1 315 ? -11.913 13.229  44.711  1.00 51.11  ? 315  ASP A O     1 
ATOM   2500 C CB    . ASP A 1 315 ? -9.958  15.177  46.504  1.00 51.73  ? 315  ASP A CB    1 
ATOM   2501 C CG    . ASP A 1 315 ? -10.262 16.497  47.220  1.00 51.41  ? 315  ASP A CG    1 
ATOM   2502 O OD1   . ASP A 1 315 ? -11.303 16.643  47.909  1.00 49.47  ? 315  ASP A OD1   1 
ATOM   2503 O OD2   . ASP A 1 315 ? -9.424  17.410  47.079  1.00 50.81  ? 315  ASP A OD2   1 
ATOM   2504 N N     . ALA A 1 316 ? -10.067 12.227  45.526  1.00 50.26  ? 316  ALA A N     1 
ATOM   2505 C CA    . ALA A 1 316 ? -9.957  11.293  44.431  1.00 48.95  ? 316  ALA A CA    1 
ATOM   2506 C C     . ALA A 1 316 ? -11.022 10.234  44.548  1.00 48.28  ? 316  ALA A C     1 
ATOM   2507 O O     . ALA A 1 316 ? -11.639 9.889   43.549  1.00 48.48  ? 316  ALA A O     1 
ATOM   2508 C CB    . ALA A 1 316 ? -8.582  10.667  44.403  1.00 49.04  ? 316  ALA A CB    1 
ATOM   2509 N N     . LYS A 1 317 ? -11.246 9.727   45.762  1.00 47.44  ? 317  LYS A N     1 
ATOM   2510 C CA    . LYS A 1 317 ? -12.171 8.611   45.966  1.00 46.80  ? 317  LYS A CA    1 
ATOM   2511 C C     . LYS A 1 317 ? -13.602 9.038   45.665  1.00 46.06  ? 317  LYS A C     1 
ATOM   2512 O O     . LYS A 1 317 ? -14.369 8.347   44.970  1.00 46.18  ? 317  LYS A O     1 
ATOM   2513 C CB    . LYS A 1 317 ? -12.086 8.075   47.388  1.00 46.71  ? 317  LYS A CB    1 
ATOM   2514 C CG    . LYS A 1 317 ? -12.590 6.655   47.460  1.00 48.13  ? 317  LYS A CG    1 
ATOM   2515 C CD    . LYS A 1 317 ? -12.803 6.188   48.878  1.00 51.22  ? 317  LYS A CD    1 
ATOM   2516 C CE    . LYS A 1 317 ? -12.974 4.678   48.888  1.00 52.61  ? 317  LYS A CE    1 
ATOM   2517 N NZ    . LYS A 1 317 ? -13.902 4.268   49.968  1.00 55.11  ? 317  LYS A NZ    1 
ATOM   2518 N N     . VAL A 1 318 ? -13.932 10.194  46.222  1.00 44.81  ? 318  VAL A N     1 
ATOM   2519 C CA    . VAL A 1 318 ? -15.178 10.881  45.998  1.00 43.10  ? 318  VAL A CA    1 
ATOM   2520 C C     . VAL A 1 318 ? -15.383 11.203  44.505  1.00 42.08  ? 318  VAL A C     1 
ATOM   2521 O O     . VAL A 1 318 ? -16.419 10.837  43.935  1.00 42.25  ? 318  VAL A O     1 
ATOM   2522 C CB    . VAL A 1 318 ? -15.213 12.132  46.901  1.00 42.96  ? 318  VAL A CB    1 
ATOM   2523 C CG1   . VAL A 1 318 ? -15.965 13.291  46.267  1.00 43.29  ? 318  VAL A CG1   1 
ATOM   2524 C CG2   . VAL A 1 318 ? -15.778 11.760  48.244  1.00 42.12  ? 318  VAL A CG2   1 
ATOM   2525 N N     . THR A 1 319 ? -14.404 11.855  43.873  1.00 40.23  ? 319  THR A N     1 
ATOM   2526 C CA    . THR A 1 319 ? -14.528 12.191  42.455  1.00 38.53  ? 319  THR A CA    1 
ATOM   2527 C C     . THR A 1 319 ? -14.830 10.940  41.618  1.00 38.10  ? 319  THR A C     1 
ATOM   2528 O O     . THR A 1 319 ? -15.623 11.014  40.663  1.00 37.92  ? 319  THR A O     1 
ATOM   2529 C CB    . THR A 1 319 ? -13.319 13.004  41.923  1.00 38.10  ? 319  THR A CB    1 
ATOM   2530 O OG1   . THR A 1 319 ? -13.167 14.184  42.718  1.00 37.49  ? 319  THR A OG1   1 
ATOM   2531 C CG2   . THR A 1 319 ? -13.516 13.439  40.471  1.00 36.98  ? 319  THR A CG2   1 
ATOM   2532 N N     . TYR A 1 320 ? -14.249 9.795   41.996  1.00 37.23  ? 320  TYR A N     1 
ATOM   2533 C CA    . TYR A 1 320 ? -14.495 8.548   41.266  1.00 36.68  ? 320  TYR A CA    1 
ATOM   2534 C C     . TYR A 1 320 ? -15.941 8.127   41.429  1.00 37.42  ? 320  TYR A C     1 
ATOM   2535 O O     . TYR A 1 320 ? -16.626 7.852   40.445  1.00 37.67  ? 320  TYR A O     1 
ATOM   2536 C CB    . TYR A 1 320 ? -13.547 7.420   41.687  1.00 35.56  ? 320  TYR A CB    1 
ATOM   2537 C CG    . TYR A 1 320 ? -13.812 6.079   41.001  1.00 34.21  ? 320  TYR A CG    1 
ATOM   2538 C CD1   . TYR A 1 320 ? -13.585 5.909   39.630  1.00 30.98  ? 320  TYR A CD1   1 
ATOM   2539 C CD2   . TYR A 1 320 ? -14.268 4.980   41.729  1.00 32.01  ? 320  TYR A CD2   1 
ATOM   2540 C CE1   . TYR A 1 320 ? -13.817 4.696   39.003  1.00 29.69  ? 320  TYR A CE1   1 
ATOM   2541 C CE2   . TYR A 1 320 ? -14.503 3.751   41.106  1.00 31.56  ? 320  TYR A CE2   1 
ATOM   2542 C CZ    . TYR A 1 320 ? -14.285 3.614   39.739  1.00 31.12  ? 320  TYR A CZ    1 
ATOM   2543 O OH    . TYR A 1 320 ? -14.538 2.395   39.111  1.00 30.25  ? 320  TYR A OH    1 
ATOM   2544 N N     . GLU A 1 321 ? -16.419 8.090   42.666  1.00 38.26  ? 321  GLU A N     1 
ATOM   2545 C CA    . GLU A 1 321 ? -17.789 7.634   42.915  1.00 39.19  ? 321  GLU A CA    1 
ATOM   2546 C C     . GLU A 1 321 ? -18.843 8.508   42.229  1.00 38.38  ? 321  GLU A C     1 
ATOM   2547 O O     . GLU A 1 321 ? -19.794 7.986   41.665  1.00 38.51  ? 321  GLU A O     1 
ATOM   2548 C CB    . GLU A 1 321 ? -18.067 7.515   44.408  1.00 39.95  ? 321  GLU A CB    1 
ATOM   2549 C CG    . GLU A 1 321 ? -17.371 6.340   45.083  1.00 43.25  ? 321  GLU A CG    1 
ATOM   2550 C CD    . GLU A 1 321 ? -17.217 6.577   46.575  1.00 47.35  ? 321  GLU A CD    1 
ATOM   2551 O OE1   . GLU A 1 321 ? -18.166 7.141   47.178  1.00 49.53  ? 321  GLU A OE1   1 
ATOM   2552 O OE2   . GLU A 1 321 ? -16.153 6.214   47.136  1.00 48.15  ? 321  GLU A OE2   1 
ATOM   2553 N N     . LEU A 1 322 ? -18.665 9.824   42.279  1.00 37.60  ? 322  LEU A N     1 
ATOM   2554 C CA    . LEU A 1 322 ? -19.515 10.737  41.526  1.00 37.27  ? 322  LEU A CA    1 
ATOM   2555 C C     . LEU A 1 322 ? -19.494 10.440  40.028  1.00 36.59  ? 322  LEU A C     1 
ATOM   2556 O O     . LEU A 1 322 ? -20.552 10.376  39.398  1.00 36.80  ? 322  LEU A O     1 
ATOM   2557 C CB    . LEU A 1 322 ? -19.108 12.187  41.761  1.00 37.50  ? 322  LEU A CB    1 
ATOM   2558 C CG    . LEU A 1 322 ? -19.509 12.746  43.120  1.00 39.04  ? 322  LEU A CG    1 
ATOM   2559 C CD1   . LEU A 1 322 ? -18.562 13.881  43.476  1.00 40.69  ? 322  LEU A CD1   1 
ATOM   2560 C CD2   . LEU A 1 322 ? -20.990 13.202  43.146  1.00 39.29  ? 322  LEU A CD2   1 
ATOM   2561 N N     . GLY A 1 323 ? -18.298 10.262  39.463  1.00 35.41  ? 323  GLY A N     1 
ATOM   2562 C CA    . GLY A 1 323 ? -18.159 9.848   38.068  1.00 33.99  ? 323  GLY A CA    1 
ATOM   2563 C C     . GLY A 1 323 ? -19.003 8.630   37.734  1.00 33.20  ? 323  GLY A C     1 
ATOM   2564 O O     . GLY A 1 323 ? -19.780 8.649   36.792  1.00 32.45  ? 323  GLY A O     1 
ATOM   2565 N N     . LYS A 1 324 ? -18.858 7.581   38.533  1.00 32.98  ? 324  LYS A N     1 
ATOM   2566 C CA    . LYS A 1 324 ? -19.605 6.351   38.354  1.00 33.14  ? 324  LYS A CA    1 
ATOM   2567 C C     . LYS A 1 324 ? -21.129 6.536   38.441  1.00 33.08  ? 324  LYS A C     1 
ATOM   2568 O O     . LYS A 1 324 ? -21.879 5.791   37.808  1.00 33.15  ? 324  LYS A O     1 
ATOM   2569 C CB    . LYS A 1 324 ? -19.166 5.319   39.385  1.00 33.46  ? 324  LYS A CB    1 
ATOM   2570 C CG    . LYS A 1 324 ? -17.943 4.482   39.021  1.00 35.32  ? 324  LYS A CG    1 
ATOM   2571 C CD    . LYS A 1 324 ? -18.119 3.037   39.562  1.00 38.97  ? 324  LYS A CD    1 
ATOM   2572 C CE    . LYS A 1 324 ? -18.093 2.970   41.128  1.00 40.46  ? 324  LYS A CE    1 
ATOM   2573 N NZ    . LYS A 1 324 ? -18.818 1.805   41.706  1.00 40.25  ? 324  LYS A NZ    1 
ATOM   2574 N N     . GLU A 1 325 ? -21.590 7.504   39.228  1.00 32.67  ? 325  GLU A N     1 
ATOM   2575 C CA    . GLU A 1 325 ? -23.009 7.815   39.270  1.00 32.92  ? 325  GLU A CA    1 
ATOM   2576 C C     . GLU A 1 325 ? -23.466 8.573   38.027  1.00 32.35  ? 325  GLU A C     1 
ATOM   2577 O O     . GLU A 1 325 ? -24.486 8.217   37.430  1.00 32.72  ? 325  GLU A O     1 
ATOM   2578 C CB    . GLU A 1 325 ? -23.367 8.619   40.520  1.00 33.69  ? 325  GLU A CB    1 
ATOM   2579 C CG    . GLU A 1 325 ? -24.879 8.733   40.790  1.00 36.82  ? 325  GLU A CG    1 
ATOM   2580 C CD    . GLU A 1 325 ? -25.565 7.372   41.039  1.00 41.65  ? 325  GLU A CD    1 
ATOM   2581 O OE1   . GLU A 1 325 ? -24.928 6.427   41.605  1.00 41.85  ? 325  GLU A OE1   1 
ATOM   2582 O OE2   . GLU A 1 325 ? -26.752 7.260   40.656  1.00 42.68  ? 325  GLU A OE2   1 
ATOM   2583 N N     . PHE A 1 326 ? -22.699 9.585   37.619  1.00 31.19  ? 326  PHE A N     1 
ATOM   2584 C CA    . PHE A 1 326 ? -23.116 10.495  36.557  1.00 30.28  ? 326  PHE A CA    1 
ATOM   2585 C C     . PHE A 1 326 ? -22.785 10.045  35.127  1.00 29.47  ? 326  PHE A C     1 
ATOM   2586 O O     . PHE A 1 326 ? -23.481 10.410  34.174  1.00 29.12  ? 326  PHE A O     1 
ATOM   2587 C CB    . PHE A 1 326 ? -22.611 11.904  36.867  1.00 30.52  ? 326  PHE A CB    1 
ATOM   2588 C CG    . PHE A 1 326 ? -23.390 12.567  37.968  1.00 32.14  ? 326  PHE A CG    1 
ATOM   2589 C CD1   . PHE A 1 326 ? -23.126 12.275  39.300  1.00 32.38  ? 326  PHE A CD1   1 
ATOM   2590 C CD2   . PHE A 1 326 ? -24.438 13.438  37.673  1.00 33.15  ? 326  PHE A CD2   1 
ATOM   2591 C CE1   . PHE A 1 326 ? -23.867 12.852  40.317  1.00 31.62  ? 326  PHE A CE1   1 
ATOM   2592 C CE2   . PHE A 1 326 ? -25.185 14.003  38.689  1.00 33.23  ? 326  PHE A CE2   1 
ATOM   2593 C CZ    . PHE A 1 326 ? -24.894 13.710  40.015  1.00 32.16  ? 326  PHE A CZ    1 
ATOM   2594 N N     . PHE A 1 327 ? -21.745 9.229   34.984  1.00 28.44  ? 327  PHE A N     1 
ATOM   2595 C CA    . PHE A 1 327 ? -21.333 8.769   33.670  1.00 27.36  ? 327  PHE A CA    1 
ATOM   2596 C C     . PHE A 1 327 ? -22.461 8.083   32.915  1.00 27.77  ? 327  PHE A C     1 
ATOM   2597 O O     . PHE A 1 327 ? -22.760 8.481   31.787  1.00 28.55  ? 327  PHE A O     1 
ATOM   2598 C CB    . PHE A 1 327 ? -20.105 7.861   33.737  1.00 26.59  ? 327  PHE A CB    1 
ATOM   2599 C CG    . PHE A 1 327 ? -19.373 7.758   32.441  1.00 24.48  ? 327  PHE A CG    1 
ATOM   2600 C CD1   . PHE A 1 327 ? -18.433 8.719   32.084  1.00 23.26  ? 327  PHE A CD1   1 
ATOM   2601 C CD2   . PHE A 1 327 ? -19.635 6.720   31.562  1.00 22.40  ? 327  PHE A CD2   1 
ATOM   2602 C CE1   . PHE A 1 327 ? -17.767 8.636   30.876  1.00 22.24  ? 327  PHE A CE1   1 
ATOM   2603 C CE2   . PHE A 1 327 ? -18.971 6.620   30.360  1.00 20.69  ? 327  PHE A CE2   1 
ATOM   2604 C CZ    . PHE A 1 327 ? -18.033 7.572   30.009  1.00 21.90  ? 327  PHE A CZ    1 
ATOM   2605 N N     . PRO A 1 328 ? -23.120 7.076   33.531  1.00 27.53  ? 328  PRO A N     1 
ATOM   2606 C CA    . PRO A 1 328 ? -24.051 6.275   32.728  1.00 27.58  ? 328  PRO A CA    1 
ATOM   2607 C C     . PRO A 1 328 ? -25.203 7.067   32.153  1.00 27.70  ? 328  PRO A C     1 
ATOM   2608 O O     . PRO A 1 328 ? -25.772 6.666   31.140  1.00 28.51  ? 328  PRO A O     1 
ATOM   2609 C CB    . PRO A 1 328 ? -24.566 5.210   33.698  1.00 27.71  ? 328  PRO A CB    1 
ATOM   2610 C CG    . PRO A 1 328 ? -23.702 5.310   34.920  1.00 27.65  ? 328  PRO A CG    1 
ATOM   2611 C CD    . PRO A 1 328 ? -23.083 6.654   34.943  1.00 27.29  ? 328  PRO A CD    1 
ATOM   2612 N N     . MET A 1 329 ? -25.531 8.190   32.780  1.00 28.05  ? 329  MET A N     1 
ATOM   2613 C CA    . MET A 1 329 ? -26.528 9.121   32.239  1.00 28.19  ? 329  MET A CA    1 
ATOM   2614 C C     . MET A 1 329 ? -26.005 9.874   31.014  1.00 27.47  ? 329  MET A C     1 
ATOM   2615 O O     . MET A 1 329 ? -26.692 9.951   30.001  1.00 27.52  ? 329  MET A O     1 
ATOM   2616 C CB    . MET A 1 329 ? -27.000 10.094  33.321  1.00 28.90  ? 329  MET A CB    1 
ATOM   2617 C CG    . MET A 1 329 ? -27.806 11.298  32.815  1.00 32.01  ? 329  MET A CG    1 
ATOM   2618 S SD    . MET A 1 329 ? -29.500 10.883  32.354  1.00 38.30  ? 329  MET A SD    1 
ATOM   2619 C CE    . MET A 1 329 ? -30.071 10.156  33.914  1.00 36.07  ? 329  MET A CE    1 
ATOM   2620 N N     . GLU A 1 330 ? -24.796 10.424  31.102  1.00 26.75  ? 330  GLU A N     1 
ATOM   2621 C CA    . GLU A 1 330 ? -24.225 11.160  29.982  1.00 26.33  ? 330  GLU A CA    1 
ATOM   2622 C C     . GLU A 1 330 ? -23.952 10.211  28.830  1.00 26.68  ? 330  GLU A C     1 
ATOM   2623 O O     . GLU A 1 330 ? -24.135 10.543  27.654  1.00 26.69  ? 330  GLU A O     1 
ATOM   2624 C CB    . GLU A 1 330 ? -22.950 11.882  30.403  1.00 26.53  ? 330  GLU A CB    1 
ATOM   2625 C CG    . GLU A 1 330 ? -23.163 12.944  31.477  1.00 25.89  ? 330  GLU A CG    1 
ATOM   2626 C CD    . GLU A 1 330 ? -24.330 13.864  31.153  1.00 27.09  ? 330  GLU A CD    1 
ATOM   2627 O OE1   . GLU A 1 330 ? -25.226 14.023  32.024  1.00 26.89  ? 330  GLU A OE1   1 
ATOM   2628 O OE2   . GLU A 1 330 ? -24.358 14.407  30.021  1.00 27.52  ? 330  GLU A OE2   1 
ATOM   2629 N N     . ALA A 1 331 ? -23.542 9.003   29.179  1.00 26.84  ? 331  ALA A N     1 
ATOM   2630 C CA    . ALA A 1 331 ? -23.409 7.943   28.204  1.00 26.85  ? 331  ALA A CA    1 
ATOM   2631 C C     . ALA A 1 331 ? -24.740 7.684   27.463  1.00 26.95  ? 331  ALA A C     1 
ATOM   2632 O O     . ALA A 1 331 ? -24.752 7.480   26.233  1.00 27.34  ? 331  ALA A O     1 
ATOM   2633 C CB    . ALA A 1 331 ? -22.895 6.678   28.894  1.00 26.73  ? 331  ALA A CB    1 
ATOM   2634 N N     . GLN A 1 332 ? -25.861 7.680   28.182  1.00 26.20  ? 332  GLN A N     1 
ATOM   2635 C CA    . GLN A 1 332 ? -27.117 7.479   27.482  1.00 26.58  ? 332  GLN A CA    1 
ATOM   2636 C C     . GLN A 1 332 ? -27.476 8.658   26.566  1.00 26.37  ? 332  GLN A C     1 
ATOM   2637 O O     . GLN A 1 332 ? -27.851 8.454   25.396  1.00 26.57  ? 332  GLN A O     1 
ATOM   2638 C CB    . GLN A 1 332 ? -28.247 7.173   28.445  1.00 27.05  ? 332  GLN A CB    1 
ATOM   2639 C CG    . GLN A 1 332 ? -28.155 5.788   29.049  1.00 28.99  ? 332  GLN A CG    1 
ATOM   2640 C CD    . GLN A 1 332 ? -28.549 4.679   28.086  1.00 31.16  ? 332  GLN A CD    1 
ATOM   2641 O OE1   . GLN A 1 332 ? -28.956 4.918   26.938  1.00 31.30  ? 332  GLN A OE1   1 
ATOM   2642 N NE2   . GLN A 1 332 ? -28.436 3.449   28.560  1.00 32.28  ? 332  GLN A NE2   1 
ATOM   2643 N N     . LEU A 1 333 ? -27.332 9.879   27.078  1.00 25.51  ? 333  LEU A N     1 
ATOM   2644 C CA    . LEU A 1 333 ? -27.539 11.054  26.260  1.00 25.30  ? 333  LEU A CA    1 
ATOM   2645 C C     . LEU A 1 333 ? -26.644 11.072  24.992  1.00 25.78  ? 333  LEU A C     1 
ATOM   2646 O O     . LEU A 1 333 ? -27.092 11.458  23.888  1.00 25.32  ? 333  LEU A O     1 
ATOM   2647 C CB    . LEU A 1 333 ? -27.413 12.312  27.110  1.00 24.90  ? 333  LEU A CB    1 
ATOM   2648 C CG    . LEU A 1 333 ? -28.535 12.513  28.158  1.00 24.55  ? 333  LEU A CG    1 
ATOM   2649 C CD1   . LEU A 1 333 ? -28.253 13.697  29.057  1.00 22.58  ? 333  LEU A CD1   1 
ATOM   2650 C CD2   . LEU A 1 333 ? -29.932 12.663  27.541  1.00 22.29  ? 333  LEU A CD2   1 
ATOM   2651 N N     . SER A 1 334 ? -25.409 10.598  25.129  1.00 26.22  ? 334  SER A N     1 
ATOM   2652 C CA    . SER A 1 334 ? -24.513 10.509  23.985  1.00 26.95  ? 334  SER A CA    1 
ATOM   2653 C C     . SER A 1 334 ? -25.054 9.576   22.916  1.00 27.43  ? 334  SER A C     1 
ATOM   2654 O O     . SER A 1 334 ? -25.084 9.953   21.738  1.00 27.38  ? 334  SER A O     1 
ATOM   2655 C CB    . SER A 1 334 ? -23.110 10.094  24.410  1.00 27.34  ? 334  SER A CB    1 
ATOM   2656 O OG    . SER A 1 334 ? -22.618 10.979  25.421  1.00 28.45  ? 334  SER A OG    1 
ATOM   2657 N N     . ARG A 1 335 ? -25.512 8.385   23.308  1.00 27.59  ? 335  ARG A N     1 
ATOM   2658 C CA    . ARG A 1 335 ? -26.093 7.453   22.333  1.00 28.75  ? 335  ARG A CA    1 
ATOM   2659 C C     . ARG A 1 335 ? -27.291 8.039   21.615  1.00 28.78  ? 335  ARG A C     1 
ATOM   2660 O O     . ARG A 1 335 ? -27.513 7.779   20.428  1.00 28.93  ? 335  ARG A O     1 
ATOM   2661 C CB    . ARG A 1 335 ? -26.554 6.175   23.022  1.00 29.46  ? 335  ARG A CB    1 
ATOM   2662 C CG    . ARG A 1 335 ? -25.408 5.298   23.483  1.00 33.29  ? 335  ARG A CG    1 
ATOM   2663 C CD    . ARG A 1 335 ? -25.837 4.148   24.343  1.00 36.61  ? 335  ARG A CD    1 
ATOM   2664 N NE    . ARG A 1 335 ? -26.929 3.380   23.760  1.00 42.52  ? 335  ARG A NE    1 
ATOM   2665 C CZ    . ARG A 1 335 ? -27.565 2.412   24.422  1.00 46.25  ? 335  ARG A CZ    1 
ATOM   2666 N NH1   . ARG A 1 335 ? -27.198 2.111   25.669  1.00 45.81  ? 335  ARG A NH1   1 
ATOM   2667 N NH2   . ARG A 1 335 ? -28.569 1.749   23.852  1.00 48.14  ? 335  ARG A NH2   1 
ATOM   2668 N N     . LEU A 1 336 ? -28.085 8.805   22.359  1.00 28.73  ? 336  LEU A N     1 
ATOM   2669 C CA    . LEU A 1 336 ? -29.403 9.221   21.923  1.00 28.23  ? 336  LEU A CA    1 
ATOM   2670 C C     . LEU A 1 336 ? -29.217 10.345  20.922  1.00 28.80  ? 336  LEU A C     1 
ATOM   2671 O O     . LEU A 1 336 ? -29.872 10.364  19.882  1.00 29.14  ? 336  LEU A O     1 
ATOM   2672 C CB    . LEU A 1 336 ? -30.179 9.685   23.138  1.00 27.88  ? 336  LEU A CB    1 
ATOM   2673 C CG    . LEU A 1 336 ? -31.511 9.164   23.700  1.00 27.07  ? 336  LEU A CG    1 
ATOM   2674 C CD1   . LEU A 1 336 ? -31.941 7.772   23.312  1.00 24.04  ? 336  LEU A CD1   1 
ATOM   2675 C CD2   . LEU A 1 336 ? -31.424 9.287   25.203  1.00 25.08  ? 336  LEU A CD2   1 
ATOM   2676 N N     . VAL A 1 337 ? -28.284 11.253  21.218  1.00 28.76  ? 337  VAL A N     1 
ATOM   2677 C CA    . VAL A 1 337 ? -28.020 12.420  20.374  1.00 28.48  ? 337  VAL A CA    1 
ATOM   2678 C C     . VAL A 1 337 ? -27.083 12.074  19.227  1.00 29.09  ? 337  VAL A C     1 
ATOM   2679 O O     . VAL A 1 337 ? -27.109 12.708  18.159  1.00 29.74  ? 337  VAL A O     1 
ATOM   2680 C CB    . VAL A 1 337 ? -27.399 13.555  21.209  1.00 28.41  ? 337  VAL A CB    1 
ATOM   2681 C CG1   . VAL A 1 337 ? -26.811 14.624  20.321  1.00 27.64  ? 337  VAL A CG1   1 
ATOM   2682 C CG2   . VAL A 1 337 ? -28.441 14.156  22.172  1.00 27.85  ? 337  VAL A CG2   1 
ATOM   2683 N N     . GLY A 1 338 ? -26.221 11.090  19.468  1.00 29.45  ? 338  GLY A N     1 
ATOM   2684 C CA    . GLY A 1 338 ? -25.264 10.627  18.476  1.00 29.44  ? 338  GLY A CA    1 
ATOM   2685 C C     . GLY A 1 338 ? -24.020 11.483  18.387  1.00 29.92  ? 338  GLY A C     1 
ATOM   2686 O O     . GLY A 1 338 ? -23.472 11.659  17.298  1.00 30.10  ? 338  GLY A O     1 
ATOM   2687 N N     . GLN A 1 339 ? -23.564 11.999  19.528  1.00 30.02  ? 339  GLN A N     1 
ATOM   2688 C CA    . GLN A 1 339 ? -22.357 12.824  19.595  1.00 30.28  ? 339  GLN A CA    1 
ATOM   2689 C C     . GLN A 1 339 ? -21.477 12.375  20.753  1.00 30.40  ? 339  GLN A C     1 
ATOM   2690 O O     . GLN A 1 339 ? -21.933 11.664  21.632  1.00 30.72  ? 339  GLN A O     1 
ATOM   2691 C CB    . GLN A 1 339 ? -22.717 14.299  19.731  1.00 30.36  ? 339  GLN A CB    1 
ATOM   2692 C CG    . GLN A 1 339 ? -23.428 14.901  18.500  1.00 32.70  ? 339  GLN A CG    1 
ATOM   2693 C CD    . GLN A 1 339 ? -22.597 14.820  17.224  1.00 35.65  ? 339  GLN A CD    1 
ATOM   2694 O OE1   . GLN A 1 339 ? -21.377 14.998  17.243  1.00 38.04  ? 339  GLN A OE1   1 
ATOM   2695 N NE2   . GLN A 1 339 ? -23.256 14.541  16.110  1.00 36.58  ? 339  GLN A NE2   1 
ATOM   2696 N N     . SER A 1 340 ? -20.207 12.766  20.733  1.00 30.55  ? 340  SER A N     1 
ATOM   2697 C CA    . SER A 1 340 ? -19.249 12.333  21.735  1.00 30.42  ? 340  SER A CA    1 
ATOM   2698 C C     . SER A 1 340 ? -19.648 12.758  23.149  1.00 30.17  ? 340  SER A C     1 
ATOM   2699 O O     . SER A 1 340 ? -20.196 13.837  23.359  1.00 30.20  ? 340  SER A O     1 
ATOM   2700 C CB    . SER A 1 340 ? -17.891 12.941  21.415  1.00 30.63  ? 340  SER A CB    1 
ATOM   2701 O OG    . SER A 1 340 ? -17.806 14.257  21.940  1.00 32.02  ? 340  SER A OG    1 
ATOM   2702 N N     . LEU A 1 341 ? -19.334 11.920  24.123  1.00 29.95  ? 341  LEU A N     1 
ATOM   2703 C CA    . LEU A 1 341 ? -19.680 12.200  25.506  1.00 29.85  ? 341  LEU A CA    1 
ATOM   2704 C C     . LEU A 1 341 ? -18.914 13.415  25.991  1.00 30.17  ? 341  LEU A C     1 
ATOM   2705 O O     . LEU A 1 341 ? -19.280 14.045  26.975  1.00 29.49  ? 341  LEU A O     1 
ATOM   2706 C CB    . LEU A 1 341 ? -19.353 10.992  26.369  1.00 29.40  ? 341  LEU A CB    1 
ATOM   2707 C CG    . LEU A 1 341 ? -19.922 10.934  27.775  1.00 29.58  ? 341  LEU A CG    1 
ATOM   2708 C CD1   . LEU A 1 341 ? -20.086 9.488   28.140  1.00 30.03  ? 341  LEU A CD1   1 
ATOM   2709 C CD2   . LEU A 1 341 ? -19.030 11.648  28.788  1.00 29.83  ? 341  LEU A CD2   1 
ATOM   2710 N N     . TRP A 1 342 ? -17.840 13.746  25.286  1.00 31.34  ? 342  TRP A N     1 
ATOM   2711 C CA    . TRP A 1 342 ? -17.071 14.917  25.655  1.00 32.10  ? 342  TRP A CA    1 
ATOM   2712 C C     . TRP A 1 342 ? -17.892 16.164  25.344  1.00 32.29  ? 342  TRP A C     1 
ATOM   2713 O O     . TRP A 1 342 ? -17.898 17.109  26.142  1.00 31.92  ? 342  TRP A O     1 
ATOM   2714 C CB    . TRP A 1 342 ? -15.709 14.954  24.967  1.00 32.00  ? 342  TRP A CB    1 
ATOM   2715 C CG    . TRP A 1 342 ? -14.863 16.069  25.492  1.00 32.69  ? 342  TRP A CG    1 
ATOM   2716 C CD1   . TRP A 1 342 ? -13.962 15.999  26.508  1.00 33.48  ? 342  TRP A CD1   1 
ATOM   2717 C CD2   . TRP A 1 342 ? -14.863 17.436  25.045  1.00 33.70  ? 342  TRP A CD2   1 
ATOM   2718 N NE1   . TRP A 1 342 ? -13.392 17.232  26.722  1.00 33.96  ? 342  TRP A NE1   1 
ATOM   2719 C CE2   . TRP A 1 342 ? -13.932 18.133  25.842  1.00 33.68  ? 342  TRP A CE2   1 
ATOM   2720 C CE3   . TRP A 1 342 ? -15.571 18.139  24.049  1.00 34.26  ? 342  TRP A CE3   1 
ATOM   2721 C CZ2   . TRP A 1 342 ? -13.673 19.494  25.672  1.00 33.45  ? 342  TRP A CZ2   1 
ATOM   2722 C CZ3   . TRP A 1 342 ? -15.318 19.491  23.872  1.00 32.99  ? 342  TRP A CZ3   1 
ATOM   2723 C CH2   . TRP A 1 342 ? -14.371 20.156  24.684  1.00 34.85  ? 342  TRP A CH2   1 
ATOM   2724 N N     . ASP A 1 343 ? -18.587 16.142  24.202  1.00 32.62  ? 343  ASP A N     1 
ATOM   2725 C CA    . ASP A 1 343 ? -19.521 17.218  23.829  1.00 33.46  ? 343  ASP A CA    1 
ATOM   2726 C C     . ASP A 1 343 ? -20.787 17.170  24.663  1.00 33.30  ? 343  ASP A C     1 
ATOM   2727 O O     . ASP A 1 343 ? -21.141 18.151  25.334  1.00 33.85  ? 343  ASP A O     1 
ATOM   2728 C CB    . ASP A 1 343 ? -19.894 17.168  22.344  1.00 33.73  ? 343  ASP A CB    1 
ATOM   2729 C CG    . ASP A 1 343 ? -18.748 17.568  21.443  1.00 36.57  ? 343  ASP A CG    1 
ATOM   2730 O OD1   . ASP A 1 343 ? -17.985 18.482  21.816  1.00 41.28  ? 343  ASP A OD1   1 
ATOM   2731 O OD2   . ASP A 1 343 ? -18.590 16.975  20.359  1.00 39.27  ? 343  ASP A OD2   1 
ATOM   2732 N N     . VAL A 1 344 ? -21.467 16.028  24.628  1.00 32.60  ? 344  VAL A N     1 
ATOM   2733 C CA    . VAL A 1 344 ? -22.768 15.909  25.269  1.00 31.78  ? 344  VAL A CA    1 
ATOM   2734 C C     . VAL A 1 344 ? -22.696 16.373  26.734  1.00 31.93  ? 344  VAL A C     1 
ATOM   2735 O O     . VAL A 1 344 ? -23.464 17.232  27.138  1.00 32.11  ? 344  VAL A O     1 
ATOM   2736 C CB    . VAL A 1 344 ? -23.350 14.488  25.097  1.00 31.38  ? 344  VAL A CB    1 
ATOM   2737 C CG1   . VAL A 1 344 ? -24.570 14.289  25.925  1.00 30.22  ? 344  VAL A CG1   1 
ATOM   2738 C CG2   . VAL A 1 344 ? -23.656 14.224  23.653  1.00 30.50  ? 344  VAL A CG2   1 
ATOM   2739 N N     . SER A 1 345 ? -21.739 15.869  27.503  1.00 32.17  ? 345  SER A N     1 
ATOM   2740 C CA    . SER A 1 345 ? -21.660 16.206  28.929  1.00 32.49  ? 345  SER A CA    1 
ATOM   2741 C C     . SER A 1 345 ? -21.384 17.700  29.180  1.00 32.88  ? 345  SER A C     1 
ATOM   2742 O O     . SER A 1 345 ? -21.502 18.180  30.300  1.00 32.61  ? 345  SER A O     1 
ATOM   2743 C CB    . SER A 1 345 ? -20.598 15.359  29.615  1.00 31.87  ? 345  SER A CB    1 
ATOM   2744 O OG    . SER A 1 345 ? -19.350 15.668  29.059  1.00 31.76  ? 345  SER A OG    1 
ATOM   2745 N N     . ARG A 1 346 ? -21.021 18.428  28.133  1.00 33.55  ? 346  ARG A N     1 
ATOM   2746 C CA    . ARG A 1 346 ? -20.751 19.848  28.261  1.00 34.27  ? 346  ARG A CA    1 
ATOM   2747 C C     . ARG A 1 346 ? -21.832 20.711  27.614  1.00 34.64  ? 346  ARG A C     1 
ATOM   2748 O O     . ARG A 1 346 ? -21.712 21.928  27.614  1.00 35.03  ? 346  ARG A O     1 
ATOM   2749 C CB    . ARG A 1 346 ? -19.359 20.186  27.702  1.00 34.20  ? 346  ARG A CB    1 
ATOM   2750 C CG    . ARG A 1 346 ? -18.257 20.150  28.782  1.00 35.46  ? 346  ARG A CG    1 
ATOM   2751 C CD    . ARG A 1 346 ? -16.834 20.071  28.203  1.00 37.82  ? 346  ARG A CD    1 
ATOM   2752 N NE    . ARG A 1 346 ? -16.276 18.713  28.168  1.00 40.88  ? 346  ARG A NE    1 
ATOM   2753 C CZ    . ARG A 1 346 ? -15.483 18.191  29.103  1.00 41.02  ? 346  ARG A CZ    1 
ATOM   2754 N NH1   . ARG A 1 346 ? -15.131 18.877  30.170  1.00 41.15  ? 346  ARG A NH1   1 
ATOM   2755 N NH2   . ARG A 1 346 ? -15.037 16.967  28.971  1.00 42.63  ? 346  ARG A NH2   1 
ATOM   2756 N N     . SER A 1 347 ? -22.887 20.078  27.096  1.00 34.93  ? 347  SER A N     1 
ATOM   2757 C CA    . SER A 1 347 ? -23.962 20.755  26.361  1.00 35.17  ? 347  SER A CA    1 
ATOM   2758 C C     . SER A 1 347 ? -25.104 21.201  27.253  1.00 35.08  ? 347  SER A C     1 
ATOM   2759 O O     . SER A 1 347 ? -25.383 20.579  28.279  1.00 35.52  ? 347  SER A O     1 
ATOM   2760 C CB    . SER A 1 347 ? -24.548 19.816  25.303  1.00 35.59  ? 347  SER A CB    1 
ATOM   2761 O OG    . SER A 1 347 ? -23.830 19.864  24.070  1.00 37.51  ? 347  SER A OG    1 
ATOM   2762 N N     . SER A 1 348 ? -25.782 22.271  26.855  1.00 34.83  ? 348  SER A N     1 
ATOM   2763 C CA    . SER A 1 348 ? -27.093 22.588  27.427  1.00 34.52  ? 348  SER A CA    1 
ATOM   2764 C C     . SER A 1 348 ? -28.114 21.680  26.732  1.00 34.77  ? 348  SER A C     1 
ATOM   2765 O O     . SER A 1 348 ? -27.836 21.128  25.652  1.00 35.11  ? 348  SER A O     1 
ATOM   2766 C CB    . SER A 1 348 ? -27.442 24.039  27.174  1.00 34.14  ? 348  SER A CB    1 
ATOM   2767 O OG    . SER A 1 348 ? -27.473 24.266  25.781  1.00 33.81  ? 348  SER A OG    1 
ATOM   2768 N N     . THR A 1 349 ? -29.284 21.515  27.340  1.00 34.53  ? 349  THR A N     1 
ATOM   2769 C CA    . THR A 1 349 ? -30.309 20.662  26.761  1.00 34.26  ? 349  THR A CA    1 
ATOM   2770 C C     . THR A 1 349 ? -30.777 21.270  25.467  1.00 34.38  ? 349  THR A C     1 
ATOM   2771 O O     . THR A 1 349 ? -31.122 20.561  24.527  1.00 33.55  ? 349  THR A O     1 
ATOM   2772 C CB    . THR A 1 349 ? -31.531 20.615  27.630  1.00 34.41  ? 349  THR A CB    1 
ATOM   2773 O OG1   . THR A 1 349 ? -32.029 21.955  27.782  1.00 34.25  ? 349  THR A OG1   1 
ATOM   2774 C CG2   . THR A 1 349 ? -31.221 19.968  28.985  1.00 33.75  ? 349  THR A CG2   1 
ATOM   2775 N N     . GLY A 1 350 ? -30.810 22.600  25.428  1.00 35.06  ? 350  GLY A N     1 
ATOM   2776 C CA    . GLY A 1 350 ? -31.194 23.293  24.201  1.00 36.11  ? 350  GLY A CA    1 
ATOM   2777 C C     . GLY A 1 350 ? -30.350 22.700  23.098  1.00 36.60  ? 350  GLY A C     1 
ATOM   2778 O O     . GLY A 1 350 ? -30.819 22.369  21.997  1.00 36.73  ? 350  GLY A O     1 
ATOM   2779 N N     . ASN A 1 351 ? -29.091 22.516  23.449  1.00 36.93  ? 351  ASN A N     1 
ATOM   2780 C CA    . ASN A 1 351 ? -28.103 22.084  22.515  1.00 37.24  ? 351  ASN A CA    1 
ATOM   2781 C C     . ASN A 1 351 ? -28.101 20.593  22.184  1.00 36.16  ? 351  ASN A C     1 
ATOM   2782 O O     . ASN A 1 351 ? -27.624 20.207  21.117  1.00 36.06  ? 351  ASN A O     1 
ATOM   2783 C CB    . ASN A 1 351 ? -26.750 22.521  23.036  1.00 38.28  ? 351  ASN A CB    1 
ATOM   2784 C CG    . ASN A 1 351 ? -26.013 23.295  22.023  1.00 41.08  ? 351  ASN A CG    1 
ATOM   2785 O OD1   . ASN A 1 351 ? -25.439 22.718  21.097  1.00 45.13  ? 351  ASN A OD1   1 
ATOM   2786 N ND2   . ASN A 1 351 ? -26.067 24.614  22.135  1.00 42.21  ? 351  ASN A ND2   1 
ATOM   2787 N N     . LEU A 1 352 ? -28.604 19.763  23.095  1.00 34.70  ? 352  LEU A N     1 
ATOM   2788 C CA    . LEU A 1 352 ? -28.796 18.353  22.801  1.00 34.10  ? 352  LEU A CA    1 
ATOM   2789 C C     . LEU A 1 352 ? -29.908 18.155  21.782  1.00 33.92  ? 352  LEU A C     1 
ATOM   2790 O O     . LEU A 1 352 ? -29.776 17.368  20.843  1.00 33.95  ? 352  LEU A O     1 
ATOM   2791 C CB    . LEU A 1 352 ? -29.161 17.577  24.057  1.00 33.95  ? 352  LEU A CB    1 
ATOM   2792 C CG    . LEU A 1 352 ? -28.193 17.545  25.232  1.00 34.25  ? 352  LEU A CG    1 
ATOM   2793 C CD1   . LEU A 1 352 ? -28.899 16.908  26.392  1.00 34.12  ? 352  LEU A CD1   1 
ATOM   2794 C CD2   . LEU A 1 352 ? -26.892 16.815  24.916  1.00 33.48  ? 352  LEU A CD2   1 
ATOM   2795 N N     . VAL A 1 353 ? -31.018 18.852  21.995  1.00 33.65  ? 353  VAL A N     1 
ATOM   2796 C CA    . VAL A 1 353 ? -32.135 18.823  21.077  1.00 33.55  ? 353  VAL A CA    1 
ATOM   2797 C C     . VAL A 1 353 ? -31.615 19.169  19.678  1.00 33.93  ? 353  VAL A C     1 
ATOM   2798 O O     . VAL A 1 353 ? -31.894 18.447  18.714  1.00 34.20  ? 353  VAL A O     1 
ATOM   2799 C CB    . VAL A 1 353 ? -33.283 19.803  21.518  1.00 33.72  ? 353  VAL A CB    1 
ATOM   2800 C CG1   . VAL A 1 353 ? -34.393 19.862  20.468  1.00 33.05  ? 353  VAL A CG1   1 
ATOM   2801 C CG2   . VAL A 1 353 ? -33.867 19.394  22.862  1.00 33.21  ? 353  VAL A CG2   1 
ATOM   2802 N N     . GLU A 1 354 ? -30.849 20.259  19.580  1.00 33.90  ? 354  GLU A N     1 
ATOM   2803 C CA    . GLU A 1 354 ? -30.279 20.718  18.319  1.00 34.10  ? 354  GLU A CA    1 
ATOM   2804 C C     . GLU A 1 354 ? -29.465 19.636  17.560  1.00 34.10  ? 354  GLU A C     1 
ATOM   2805 O O     . GLU A 1 354 ? -29.685 19.398  16.358  1.00 33.96  ? 354  GLU A O     1 
ATOM   2806 C CB    . GLU A 1 354 ? -29.406 21.923  18.601  1.00 34.12  ? 354  GLU A CB    1 
ATOM   2807 C CG    . GLU A 1 354 ? -28.915 22.630  17.368  1.00 36.30  ? 354  GLU A CG    1 
ATOM   2808 C CD    . GLU A 1 354 ? -29.829 23.756  16.965  1.00 40.58  ? 354  GLU A CD    1 
ATOM   2809 O OE1   . GLU A 1 354 ? -30.981 23.452  16.577  1.00 43.58  ? 354  GLU A OE1   1 
ATOM   2810 O OE2   . GLU A 1 354 ? -29.403 24.940  17.034  1.00 40.72  ? 354  GLU A OE2   1 
ATOM   2811 N N     . TRP A 1 355 ? -28.529 18.990  18.260  1.00 33.82  ? 355  TRP A N     1 
ATOM   2812 C CA    . TRP A 1 355 ? -27.731 17.923  17.656  1.00 33.97  ? 355  TRP A CA    1 
ATOM   2813 C C     . TRP A 1 355 ? -28.557 16.691  17.331  1.00 33.71  ? 355  TRP A C     1 
ATOM   2814 O O     . TRP A 1 355 ? -28.381 16.074  16.282  1.00 33.92  ? 355  TRP A O     1 
ATOM   2815 C CB    . TRP A 1 355 ? -26.465 17.602  18.488  1.00 34.10  ? 355  TRP A CB    1 
ATOM   2816 C CG    . TRP A 1 355 ? -25.456 18.657  18.233  1.00 35.09  ? 355  TRP A CG    1 
ATOM   2817 C CD1   . TRP A 1 355 ? -25.198 19.745  19.008  1.00 35.30  ? 355  TRP A CD1   1 
ATOM   2818 C CD2   . TRP A 1 355 ? -24.650 18.798  17.058  1.00 36.53  ? 355  TRP A CD2   1 
ATOM   2819 N NE1   . TRP A 1 355 ? -24.260 20.539  18.409  1.00 36.09  ? 355  TRP A NE1   1 
ATOM   2820 C CE2   . TRP A 1 355 ? -23.907 19.989  17.207  1.00 36.36  ? 355  TRP A CE2   1 
ATOM   2821 C CE3   . TRP A 1 355 ? -24.469 18.022  15.897  1.00 36.50  ? 355  TRP A CE3   1 
ATOM   2822 C CZ2   . TRP A 1 355 ? -22.988 20.425  16.248  1.00 35.84  ? 355  TRP A CZ2   1 
ATOM   2823 C CZ3   . TRP A 1 355 ? -23.559 18.460  14.938  1.00 36.11  ? 355  TRP A CZ3   1 
ATOM   2824 C CH2   . TRP A 1 355 ? -22.833 19.651  15.122  1.00 36.00  ? 355  TRP A CH2   1 
ATOM   2825 N N     . PHE A 1 356 ? -29.457 16.334  18.232  1.00 33.55  ? 356  PHE A N     1 
ATOM   2826 C CA    . PHE A 1 356 ? -30.406 15.274  17.967  1.00 33.42  ? 356  PHE A CA    1 
ATOM   2827 C C     . PHE A 1 356 ? -31.117 15.542  16.647  1.00 33.51  ? 356  PHE A C     1 
ATOM   2828 O O     . PHE A 1 356 ? -31.078 14.708  15.733  1.00 33.36  ? 356  PHE A O     1 
ATOM   2829 C CB    . PHE A 1 356 ? -31.413 15.194  19.102  1.00 33.16  ? 356  PHE A CB    1 
ATOM   2830 C CG    . PHE A 1 356 ? -32.430 14.118  18.930  1.00 33.19  ? 356  PHE A CG    1 
ATOM   2831 C CD1   . PHE A 1 356 ? -32.137 12.806  19.278  1.00 32.05  ? 356  PHE A CD1   1 
ATOM   2832 C CD2   . PHE A 1 356 ? -33.705 14.416  18.444  1.00 34.09  ? 356  PHE A CD2   1 
ATOM   2833 C CE1   . PHE A 1 356 ? -33.097 11.797  19.139  1.00 32.18  ? 356  PHE A CE1   1 
ATOM   2834 C CE2   . PHE A 1 356 ? -34.675 13.396  18.294  1.00 33.00  ? 356  PHE A CE2   1 
ATOM   2835 C CZ    . PHE A 1 356 ? -34.360 12.095  18.647  1.00 31.79  ? 356  PHE A CZ    1 
ATOM   2836 N N     . LEU A 1 357 ? -31.742 16.719  16.557  1.00 33.68  ? 357  LEU A N     1 
ATOM   2837 C CA    . LEU A 1 357 ? -32.486 17.138  15.363  1.00 33.71  ? 357  LEU A CA    1 
ATOM   2838 C C     . LEU A 1 357 ? -31.608 17.125  14.113  1.00 34.18  ? 357  LEU A C     1 
ATOM   2839 O O     . LEU A 1 357 ? -32.030 16.640  13.058  1.00 34.24  ? 357  LEU A O     1 
ATOM   2840 C CB    . LEU A 1 357 ? -33.124 18.520  15.560  1.00 33.15  ? 357  LEU A CB    1 
ATOM   2841 C CG    . LEU A 1 357 ? -34.291 18.609  16.536  1.00 31.40  ? 357  LEU A CG    1 
ATOM   2842 C CD1   . LEU A 1 357 ? -34.817 20.014  16.566  1.00 30.77  ? 357  LEU A CD1   1 
ATOM   2843 C CD2   . LEU A 1 357 ? -35.377 17.638  16.138  1.00 29.92  ? 357  LEU A CD2   1 
ATOM   2844 N N     . LEU A 1 358 ? -30.384 17.639  14.246  1.00 34.44  ? 358  LEU A N     1 
ATOM   2845 C CA    . LEU A 1 358 ? -29.454 17.664  13.129  1.00 34.48  ? 358  LEU A CA    1 
ATOM   2846 C C     . LEU A 1 358 ? -29.202 16.269  12.574  1.00 34.69  ? 358  LEU A C     1 
ATOM   2847 O O     . LEU A 1 358 ? -29.210 16.089  11.362  1.00 35.19  ? 358  LEU A O     1 
ATOM   2848 C CB    . LEU A 1 358 ? -28.164 18.416  13.474  1.00 34.25  ? 358  LEU A CB    1 
ATOM   2849 C CG    . LEU A 1 358 ? -28.208 19.919  13.159  1.00 34.12  ? 358  LEU A CG    1 
ATOM   2850 C CD1   . LEU A 1 358 ? -27.051 20.684  13.769  1.00 33.47  ? 358  LEU A CD1   1 
ATOM   2851 C CD2   . LEU A 1 358 ? -28.209 20.129  11.670  1.00 33.74  ? 358  LEU A CD2   1 
ATOM   2852 N N     . ARG A 1 359 ? -29.028 15.281  13.442  1.00 34.92  ? 359  ARG A N     1 
ATOM   2853 C CA    . ARG A 1 359 ? -28.875 13.906  12.989  1.00 35.56  ? 359  ARG A CA    1 
ATOM   2854 C C     . ARG A 1 359 ? -30.130 13.404  12.275  1.00 36.68  ? 359  ARG A C     1 
ATOM   2855 O O     . ARG A 1 359 ? -30.053 12.828  11.181  1.00 37.03  ? 359  ARG A O     1 
ATOM   2856 C CB    . ARG A 1 359 ? -28.569 12.980  14.161  1.00 35.42  ? 359  ARG A CB    1 
ATOM   2857 C CG    . ARG A 1 359 ? -28.598 11.505  13.802  1.00 34.36  ? 359  ARG A CG    1 
ATOM   2858 C CD    . ARG A 1 359 ? -28.004 10.674  14.899  1.00 35.28  ? 359  ARG A CD    1 
ATOM   2859 N NE    . ARG A 1 359 ? -26.627 11.072  15.171  1.00 37.31  ? 359  ARG A NE    1 
ATOM   2860 C CZ    . ARG A 1 359 ? -25.542 10.529  14.609  1.00 38.13  ? 359  ARG A CZ    1 
ATOM   2861 N NH1   . ARG A 1 359 ? -25.651 9.531   13.737  1.00 37.79  ? 359  ARG A NH1   1 
ATOM   2862 N NH2   . ARG A 1 359 ? -24.334 10.979  14.939  1.00 38.07  ? 359  ARG A NH2   1 
ATOM   2863 N N     . LYS A 1 360 ? -31.289 13.608  12.896  1.00 37.50  ? 360  LYS A N     1 
ATOM   2864 C CA    . LYS A 1 360 ? -32.506 12.995  12.391  1.00 38.01  ? 360  LYS A CA    1 
ATOM   2865 C C     . LYS A 1 360 ? -32.886 13.670  11.099  1.00 38.78  ? 360  LYS A C     1 
ATOM   2866 O O     . LYS A 1 360 ? -33.362 13.013  10.167  1.00 38.84  ? 360  LYS A O     1 
ATOM   2867 C CB    . LYS A 1 360 ? -33.632 13.093  13.406  1.00 37.68  ? 360  LYS A CB    1 
ATOM   2868 C CG    . LYS A 1 360 ? -33.389 12.299  14.661  1.00 37.58  ? 360  LYS A CG    1 
ATOM   2869 C CD    . LYS A 1 360 ? -33.587 10.833  14.463  1.00 36.39  ? 360  LYS A CD    1 
ATOM   2870 C CE    . LYS A 1 360 ? -33.416 10.134  15.781  1.00 37.04  ? 360  LYS A CE    1 
ATOM   2871 N NZ    . LYS A 1 360 ? -33.219 8.678   15.588  1.00 39.05  ? 360  LYS A NZ    1 
ATOM   2872 N N     . ALA A 1 361 ? -32.660 14.985  11.061  1.00 39.58  ? 361  ALA A N     1 
ATOM   2873 C CA    . ALA A 1 361 ? -32.814 15.784  9.857   1.00 40.30  ? 361  ALA A CA    1 
ATOM   2874 C C     . ALA A 1 361 ? -32.134 15.076  8.687   1.00 40.92  ? 361  ALA A C     1 
ATOM   2875 O O     . ALA A 1 361 ? -32.744 14.891  7.635   1.00 41.07  ? 361  ALA A O     1 
ATOM   2876 C CB    . ALA A 1 361 ? -32.232 17.187  10.066  1.00 40.05  ? 361  ALA A CB    1 
ATOM   2877 N N     . TYR A 1 362 ? -30.890 14.645  8.894   1.00 41.59  ? 362  TYR A N     1 
ATOM   2878 C CA    . TYR A 1 362 ? -30.133 13.923  7.873   1.00 42.43  ? 362  TYR A CA    1 
ATOM   2879 C C     . TYR A 1 362 ? -30.787 12.573  7.539   1.00 42.95  ? 362  TYR A C     1 
ATOM   2880 O O     . TYR A 1 362 ? -31.075 12.275  6.378   1.00 42.70  ? 362  TYR A O     1 
ATOM   2881 C CB    . TYR A 1 362 ? -28.664 13.741  8.301   1.00 42.48  ? 362  TYR A CB    1 
ATOM   2882 C CG    . TYR A 1 362 ? -27.784 13.168  7.217   1.00 41.97  ? 362  TYR A CG    1 
ATOM   2883 C CD1   . TYR A 1 362 ? -27.054 14.008  6.366   1.00 42.48  ? 362  TYR A CD1   1 
ATOM   2884 C CD2   . TYR A 1 362 ? -27.702 11.790  7.026   1.00 41.94  ? 362  TYR A CD2   1 
ATOM   2885 C CE1   . TYR A 1 362 ? -26.258 13.486  5.352   1.00 43.14  ? 362  TYR A CE1   1 
ATOM   2886 C CE2   . TYR A 1 362 ? -26.912 11.248  6.024   1.00 42.69  ? 362  TYR A CE2   1 
ATOM   2887 C CZ    . TYR A 1 362 ? -26.194 12.096  5.190   1.00 43.76  ? 362  TYR A CZ    1 
ATOM   2888 O OH    . TYR A 1 362 ? -25.416 11.546  4.203   1.00 43.73  ? 362  TYR A OH    1 
ATOM   2889 N N     . GLU A 1 363 ? -31.034 11.771  8.568   1.00 43.92  ? 363  GLU A N     1 
ATOM   2890 C CA    . GLU A 1 363 ? -31.724 10.489  8.405   1.00 44.61  ? 363  GLU A CA    1 
ATOM   2891 C C     . GLU A 1 363 ? -32.911 10.582  7.441   1.00 44.45  ? 363  GLU A C     1 
ATOM   2892 O O     . GLU A 1 363 ? -33.222 9.632   6.736   1.00 44.48  ? 363  GLU A O     1 
ATOM   2893 C CB    . GLU A 1 363 ? -32.190 9.969   9.766   1.00 44.83  ? 363  GLU A CB    1 
ATOM   2894 C CG    . GLU A 1 363 ? -31.060 9.533   10.699  1.00 46.91  ? 363  GLU A CG    1 
ATOM   2895 C CD    . GLU A 1 363 ? -31.564 8.799   11.939  1.00 50.40  ? 363  GLU A CD    1 
ATOM   2896 O OE1   . GLU A 1 363 ? -32.743 8.357   11.948  1.00 51.66  ? 363  GLU A OE1   1 
ATOM   2897 O OE2   . GLU A 1 363 ? -30.781 8.666   12.910  1.00 51.58  ? 363  GLU A OE2   1 
ATOM   2898 N N     . ARG A 1 364 ? -33.543 11.749  7.401   1.00 44.59  ? 364  ARG A N     1 
ATOM   2899 C CA    . ARG A 1 364 ? -34.780 11.946  6.658   1.00 44.66  ? 364  ARG A CA    1 
ATOM   2900 C C     . ARG A 1 364 ? -34.592 12.896  5.484   1.00 44.78  ? 364  ARG A C     1 
ATOM   2901 O O     . ARG A 1 364 ? -35.572 13.452  4.968   1.00 44.77  ? 364  ARG A O     1 
ATOM   2902 C CB    . ARG A 1 364 ? -35.869 12.494  7.585   1.00 44.70  ? 364  ARG A CB    1 
ATOM   2903 C CG    . ARG A 1 364 ? -36.165 11.642  8.803   1.00 45.04  ? 364  ARG A CG    1 
ATOM   2904 C CD    . ARG A 1 364 ? -37.407 12.150  9.481   1.00 46.38  ? 364  ARG A CD    1 
ATOM   2905 N NE    . ARG A 1 364 ? -37.894 11.216  10.497  1.00 47.52  ? 364  ARG A NE    1 
ATOM   2906 C CZ    . ARG A 1 364 ? -39.103 11.283  11.061  1.00 46.46  ? 364  ARG A CZ    1 
ATOM   2907 N NH1   . ARG A 1 364 ? -39.963 12.233  10.717  1.00 45.45  ? 364  ARG A NH1   1 
ATOM   2908 N NH2   . ARG A 1 364 ? -39.454 10.396  11.975  1.00 46.36  ? 364  ARG A NH2   1 
ATOM   2909 N N     . ASN A 1 365 ? -33.335 13.096  5.075   1.00 44.77  ? 365  ASN A N     1 
ATOM   2910 C CA    . ASN A 1 365 ? -33.017 13.924  3.904   1.00 44.62  ? 365  ASN A CA    1 
ATOM   2911 C C     . ASN A 1 365 ? -33.707 15.278  4.048   1.00 44.26  ? 365  ASN A C     1 
ATOM   2912 O O     . ASN A 1 365 ? -34.431 15.738  3.178   1.00 44.42  ? 365  ASN A O     1 
ATOM   2913 C CB    . ASN A 1 365 ? -33.419 13.180  2.613   1.00 44.80  ? 365  ASN A CB    1 
ATOM   2914 C CG    . ASN A 1 365 ? -33.383 14.064  1.378   1.00 45.99  ? 365  ASN A CG    1 
ATOM   2915 O OD1   . ASN A 1 365 ? -32.593 15.010  1.284   1.00 46.66  ? 365  ASN A OD1   1 
ATOM   2916 N ND2   . ASN A 1 365 ? -34.257 13.765  0.423   1.00 47.72  ? 365  ASN A ND2   1 
ATOM   2917 N N     . GLU A 1 366 ? -33.489 15.903  5.188   1.00 43.92  ? 366  GLU A N     1 
ATOM   2918 C CA    . GLU A 1 366 ? -34.238 17.070  5.548   1.00 43.94  ? 366  GLU A CA    1 
ATOM   2919 C C     . GLU A 1 366 ? -33.235 18.173  5.822   1.00 43.59  ? 366  GLU A C     1 
ATOM   2920 O O     . GLU A 1 366 ? -32.469 18.109  6.769   1.00 43.86  ? 366  GLU A O     1 
ATOM   2921 C CB    . GLU A 1 366 ? -35.107 16.733  6.760   1.00 44.00  ? 366  GLU A CB    1 
ATOM   2922 C CG    . GLU A 1 366 ? -35.887 17.882  7.328   1.00 45.77  ? 366  GLU A CG    1 
ATOM   2923 C CD    . GLU A 1 366 ? -37.253 18.044  6.708   1.00 47.49  ? 366  GLU A CD    1 
ATOM   2924 O OE1   . GLU A 1 366 ? -37.814 17.049  6.218   1.00 48.30  ? 366  GLU A OE1   1 
ATOM   2925 O OE2   . GLU A 1 366 ? -37.775 19.176  6.728   1.00 49.16  ? 366  GLU A OE2   1 
ATOM   2926 N N     . LEU A 1 367 ? -33.210 19.163  4.944   1.00 43.57  ? 367  LEU A N     1 
ATOM   2927 C CA    . LEU A 1 367 ? -32.302 20.288  5.057   1.00 43.60  ? 367  LEU A CA    1 
ATOM   2928 C C     . LEU A 1 367 ? -32.597 21.061  6.336   1.00 43.66  ? 367  LEU A C     1 
ATOM   2929 O O     . LEU A 1 367 ? -33.762 21.352  6.636   1.00 43.84  ? 367  LEU A O     1 
ATOM   2930 C CB    . LEU A 1 367 ? -32.427 21.216  3.831   1.00 43.77  ? 367  LEU A CB    1 
ATOM   2931 C CG    . LEU A 1 367 ? -31.386 22.350  3.705   1.00 44.47  ? 367  LEU A CG    1 
ATOM   2932 C CD1   . LEU A 1 367 ? -30.135 21.841  3.013   1.00 44.51  ? 367  LEU A CD1   1 
ATOM   2933 C CD2   . LEU A 1 367 ? -31.943 23.558  2.970   1.00 44.68  ? 367  LEU A CD2   1 
ATOM   2934 N N     . ALA A 1 368 ? -31.540 21.380  7.080   1.00 43.49  ? 368  ALA A N     1 
ATOM   2935 C CA    . ALA A 1 368 ? -31.655 22.083  8.343   1.00 43.68  ? 368  ALA A CA    1 
ATOM   2936 C C     . ALA A 1 368 ? -31.728 23.576  8.136   1.00 44.20  ? 368  ALA A C     1 
ATOM   2937 O O     . ALA A 1 368 ? -30.949 24.122  7.385   1.00 44.00  ? 368  ALA A O     1 
ATOM   2938 C CB    . ALA A 1 368 ? -30.486 21.755  9.225   1.00 43.10  ? 368  ALA A CB    1 
ATOM   2939 N N     . PRO A 1 369 ? -32.669 24.243  8.814   1.00 45.21  ? 369  PRO A N     1 
ATOM   2940 C CA    . PRO A 1 369 ? -32.676 25.689  8.998   1.00 46.34  ? 369  PRO A CA    1 
ATOM   2941 C C     . PRO A 1 369 ? -31.295 26.194  9.404   1.00 47.71  ? 369  PRO A C     1 
ATOM   2942 O O     . PRO A 1 369 ? -30.492 25.420  9.938   1.00 48.62  ? 369  PRO A O     1 
ATOM   2943 C CB    . PRO A 1 369 ? -33.609 25.871  10.197  1.00 46.12  ? 369  PRO A CB    1 
ATOM   2944 C CG    . PRO A 1 369 ? -34.525 24.733  10.153  1.00 45.58  ? 369  PRO A CG    1 
ATOM   2945 C CD    . PRO A 1 369 ? -33.838 23.603  9.443   1.00 45.27  ? 369  PRO A CD    1 
ATOM   2946 N N     . ASN A 1 370 ? -31.014 27.476  9.180   1.00 48.82  ? 370  ASN A N     1 
ATOM   2947 C CA    . ASN A 1 370 ? -29.767 28.065  9.688   1.00 49.91  ? 370  ASN A CA    1 
ATOM   2948 C C     . ASN A 1 370 ? -30.012 28.714  11.022  1.00 50.77  ? 370  ASN A C     1 
ATOM   2949 O O     . ASN A 1 370 ? -31.152 28.889  11.414  1.00 51.02  ? 370  ASN A O     1 
ATOM   2950 C CB    . ASN A 1 370 ? -29.155 29.069  8.706   1.00 49.37  ? 370  ASN A CB    1 
ATOM   2951 C CG    . ASN A 1 370 ? -28.587 28.398  7.470   1.00 49.50  ? 370  ASN A CG    1 
ATOM   2952 O OD1   . ASN A 1 370 ? -27.902 27.364  7.548   1.00 49.75  ? 370  ASN A OD1   1 
ATOM   2953 N ND2   . ASN A 1 370 ? -28.880 28.977  6.312   1.00 49.27  ? 370  ASN A ND2   1 
ATOM   2954 N N     . LYS A 1 371 ? -28.942 29.046  11.728  1.00 52.31  ? 371  LYS A N     1 
ATOM   2955 C CA    . LYS A 1 371 ? -29.059 29.769  12.979  1.00 53.85  ? 371  LYS A CA    1 
ATOM   2956 C C     . LYS A 1 371 ? -29.644 31.135  12.685  1.00 55.06  ? 371  LYS A C     1 
ATOM   2957 O O     . LYS A 1 371 ? -29.704 31.541  11.531  1.00 55.05  ? 371  LYS A O     1 
ATOM   2958 C CB    . LYS A 1 371 ? -27.688 29.928  13.622  1.00 54.05  ? 371  LYS A CB    1 
ATOM   2959 C CG    . LYS A 1 371 ? -27.378 28.922  14.702  1.00 54.32  ? 371  LYS A CG    1 
ATOM   2960 C CD    . LYS A 1 371 ? -25.897 28.623  14.712  1.00 54.30  ? 371  LYS A CD    1 
ATOM   2961 C CE    . LYS A 1 371 ? -25.487 27.895  15.964  1.00 54.92  ? 371  LYS A CE    1 
ATOM   2962 N NZ    . LYS A 1 371 ? -24.246 27.122  15.684  1.00 55.87  ? 371  LYS A NZ    1 
ATOM   2963 N N     . PRO A 1 372 ? -30.107 31.842  13.721  1.00 56.43  ? 372  PRO A N     1 
ATOM   2964 C CA    . PRO A 1 372 ? -30.555 33.206  13.461  1.00 57.83  ? 372  PRO A CA    1 
ATOM   2965 C C     . PRO A 1 372 ? -29.393 34.157  13.144  1.00 59.25  ? 372  PRO A C     1 
ATOM   2966 O O     . PRO A 1 372 ? -28.354 34.107  13.811  1.00 59.35  ? 372  PRO A O     1 
ATOM   2967 C CB    . PRO A 1 372 ? -31.216 33.605  14.785  1.00 57.74  ? 372  PRO A CB    1 
ATOM   2968 C CG    . PRO A 1 372 ? -30.531 32.747  15.820  1.00 57.09  ? 372  PRO A CG    1 
ATOM   2969 C CD    . PRO A 1 372 ? -30.283 31.450  15.131  1.00 56.36  ? 372  PRO A CD    1 
ATOM   2970 N N     . ASP A 1 373 ? -29.561 35.021  12.144  1.00 60.95  ? 373  ASP A N     1 
ATOM   2971 C CA    . ASP A 1 373 ? -28.630 36.144  11.989  1.00 62.61  ? 373  ASP A CA    1 
ATOM   2972 C C     . ASP A 1 373 ? -28.812 37.106  13.165  1.00 63.64  ? 373  ASP A C     1 
ATOM   2973 O O     . ASP A 1 373 ? -29.719 36.925  13.992  1.00 63.95  ? 373  ASP A O     1 
ATOM   2974 C CB    . ASP A 1 373 ? -28.819 36.871  10.657  1.00 62.63  ? 373  ASP A CB    1 
ATOM   2975 C CG    . ASP A 1 373 ? -30.106 37.680  10.599  1.00 63.64  ? 373  ASP A CG    1 
ATOM   2976 O OD1   . ASP A 1 373 ? -30.405 38.462  11.536  1.00 63.67  ? 373  ASP A OD1   1 
ATOM   2977 O OD2   . ASP A 1 373 ? -30.816 37.541  9.585   1.00 65.11  ? 373  ASP A OD2   1 
ATOM   2978 N N     . GLU A 1 374 ? -27.966 38.132  13.224  1.00 64.86  ? 374  GLU A N     1 
ATOM   2979 C CA    . GLU A 1 374 ? -27.913 39.043  14.373  1.00 65.87  ? 374  GLU A CA    1 
ATOM   2980 C C     . GLU A 1 374 ? -29.218 39.831  14.607  1.00 66.57  ? 374  GLU A C     1 
ATOM   2981 O O     . GLU A 1 374 ? -29.562 40.112  15.763  1.00 66.60  ? 374  GLU A O     1 
ATOM   2982 C CB    . GLU A 1 374 ? -26.692 39.975  14.278  1.00 65.66  ? 374  GLU A CB    1 
ATOM   2983 N N     . ARG A 1 375 ? -29.943 40.171  13.534  1.00 67.47  ? 375  ARG A N     1 
ATOM   2984 C CA    . ARG A 1 375 ? -31.210 40.917  13.679  1.00 68.63  ? 375  ARG A CA    1 
ATOM   2985 C C     . ARG A 1 375 ? -32.406 39.998  13.887  1.00 68.81  ? 375  ARG A C     1 
ATOM   2986 O O     . ARG A 1 375 ? -33.264 40.274  14.740  1.00 68.89  ? 375  ARG A O     1 
ATOM   2987 C CB    . ARG A 1 375 ? -31.477 41.885  12.518  1.00 69.01  ? 375  ARG A CB    1 
ATOM   2988 C CG    . ARG A 1 375 ? -32.558 42.928  12.866  1.00 70.78  ? 375  ARG A CG    1 
ATOM   2989 C CD    . ARG A 1 375 ? -32.737 43.984  11.780  1.00 74.43  ? 375  ARG A CD    1 
ATOM   2990 N NE    . ARG A 1 375 ? -33.462 43.473  10.611  1.00 76.52  ? 375  ARG A NE    1 
ATOM   2991 C CZ    . ARG A 1 375 ? -34.143 44.228  9.745   1.00 77.30  ? 375  ARG A CZ    1 
ATOM   2992 N NH1   . ARG A 1 375 ? -34.210 45.549  9.904   1.00 77.60  ? 375  ARG A NH1   1 
ATOM   2993 N NH2   . ARG A 1 375 ? -34.769 43.657  8.719   1.00 76.74  ? 375  ARG A NH2   1 
ATOM   2994 N N     . GLU A 1 376 ? -32.454 38.917  13.103  1.00 68.96  ? 376  GLU A N     1 
ATOM   2995 C CA    . GLU A 1 376 ? -33.412 37.829  13.321  1.00 68.91  ? 376  GLU A CA    1 
ATOM   2996 C C     . GLU A 1 376 ? -33.333 37.277  14.752  1.00 68.82  ? 376  GLU A C     1 
ATOM   2997 O O     . GLU A 1 376 ? -34.358 36.907  15.315  1.00 68.62  ? 376  GLU A O     1 
ATOM   2998 C CB    . GLU A 1 376 ? -33.237 36.721  12.267  1.00 68.98  ? 376  GLU A CB    1 
ATOM   2999 C CG    . GLU A 1 376 ? -34.179 35.499  12.395  1.00 69.01  ? 376  GLU A CG    1 
ATOM   3000 C CD    . GLU A 1 376 ? -35.640 35.853  12.680  1.00 68.69  ? 376  GLU A CD    1 
ATOM   3001 O OE1   . GLU A 1 376 ? -36.133 36.884  12.170  1.00 68.66  ? 376  GLU A OE1   1 
ATOM   3002 O OE2   . GLU A 1 376 ? -36.297 35.086  13.418  1.00 68.04  ? 376  GLU A OE2   1 
ATOM   3003 N N     . LEU A 1 377 ? -32.132 37.248  15.336  1.00 68.88  ? 377  LEU A N     1 
ATOM   3004 C CA    . LEU A 1 377 ? -31.982 36.901  16.743  1.00 69.12  ? 377  LEU A CA    1 
ATOM   3005 C C     . LEU A 1 377 ? -32.754 37.890  17.594  1.00 69.54  ? 377  LEU A C     1 
ATOM   3006 O O     . LEU A 1 377 ? -33.757 37.522  18.193  1.00 69.67  ? 377  LEU A O     1 
ATOM   3007 C CB    . LEU A 1 377 ? -30.514 36.860  17.188  1.00 69.11  ? 377  LEU A CB    1 
ATOM   3008 C CG    . LEU A 1 377 ? -30.084 35.844  18.277  1.00 69.21  ? 377  LEU A CG    1 
ATOM   3009 C CD1   . LEU A 1 377 ? -28.622 36.017  18.683  1.00 68.79  ? 377  LEU A CD1   1 
ATOM   3010 C CD2   . LEU A 1 377 ? -30.957 35.839  19.536  1.00 68.60  ? 377  LEU A CD2   1 
ATOM   3011 N N     . ALA A 1 378 ? -32.300 39.145  17.624  1.00 70.29  ? 378  ALA A N     1 
ATOM   3012 C CA    . ALA A 1 378 ? -32.881 40.189  18.502  1.00 70.77  ? 378  ALA A CA    1 
ATOM   3013 C C     . ALA A 1 378 ? -34.404 40.347  18.367  1.00 70.94  ? 378  ALA A C     1 
ATOM   3014 O O     . ALA A 1 378 ? -35.107 40.604  19.358  1.00 70.88  ? 378  ALA A O     1 
ATOM   3015 C CB    . ALA A 1 378 ? -32.181 41.525  18.287  1.00 70.55  ? 378  ALA A CB    1 
ATOM   3016 N N     . ARG A 1 379 ? -34.894 40.179  17.139  1.00 71.11  ? 379  ARG A N     1 
ATOM   3017 C CA    . ARG A 1 379 ? -36.327 40.138  16.858  1.00 71.52  ? 379  ARG A CA    1 
ATOM   3018 C C     . ARG A 1 379 ? -37.027 39.057  17.715  1.00 71.40  ? 379  ARG A C     1 
ATOM   3019 O O     . ARG A 1 379 ? -38.061 39.327  18.330  1.00 71.46  ? 379  ARG A O     1 
ATOM   3020 C CB    . ARG A 1 379 ? -36.556 39.888  15.361  1.00 71.69  ? 379  ARG A CB    1 
ATOM   3021 C CG    . ARG A 1 379 ? -37.787 40.564  14.757  1.00 73.01  ? 379  ARG A CG    1 
ATOM   3022 C CD    . ARG A 1 379 ? -38.468 39.630  13.764  1.00 75.08  ? 379  ARG A CD    1 
ATOM   3023 N NE    . ARG A 1 379 ? -38.889 38.408  14.451  1.00 77.07  ? 379  ARG A NE    1 
ATOM   3024 C CZ    . ARG A 1 379 ? -39.021 37.209  13.888  1.00 77.83  ? 379  ARG A CZ    1 
ATOM   3025 N NH1   . ARG A 1 379 ? -38.778 37.033  12.594  1.00 78.08  ? 379  ARG A NH1   1 
ATOM   3026 N NH2   . ARG A 1 379 ? -39.400 36.176  14.634  1.00 78.14  ? 379  ARG A NH2   1 
ATOM   3027 N N     . ARG A 1 380 ? -36.449 37.851  17.762  1.00 71.20  ? 380  ARG A N     1 
ATOM   3028 C CA    . ARG A 1 380 ? -36.978 36.752  18.581  1.00 70.95  ? 380  ARG A CA    1 
ATOM   3029 C C     . ARG A 1 380 ? -36.903 37.094  20.058  1.00 72.06  ? 380  ARG A C     1 
ATOM   3030 O O     . ARG A 1 380 ? -37.886 36.967  20.782  1.00 72.01  ? 380  ARG A O     1 
ATOM   3031 C CB    . ARG A 1 380 ? -36.207 35.453  18.340  1.00 70.03  ? 380  ARG A CB    1 
ATOM   3032 C CG    . ARG A 1 380 ? -36.352 34.866  16.962  1.00 66.58  ? 380  ARG A CG    1 
ATOM   3033 C CD    . ARG A 1 380 ? -35.323 33.785  16.733  1.00 59.94  ? 380  ARG A CD    1 
ATOM   3034 N NE    . ARG A 1 380 ? -35.451 33.200  15.404  1.00 55.70  ? 380  ARG A NE    1 
ATOM   3035 C CZ    . ARG A 1 380 ? -34.869 32.071  15.016  1.00 52.65  ? 380  ARG A CZ    1 
ATOM   3036 N NH1   . ARG A 1 380 ? -34.109 31.385  15.856  1.00 52.08  ? 380  ARG A NH1   1 
ATOM   3037 N NH2   . ARG A 1 380 ? -35.052 31.625  13.787  1.00 50.02  ? 380  ARG A NH2   1 
ATOM   3038 N N     . ARG A 1 381 ? -35.726 37.536  20.490  1.00 73.45  ? 381  ARG A N     1 
ATOM   3039 C CA    . ARG A 1 381 ? -35.446 37.770  21.900  1.00 74.95  ? 381  ARG A CA    1 
ATOM   3040 C C     . ARG A 1 381 ? -36.426 38.765  22.527  1.00 75.75  ? 381  ARG A C     1 
ATOM   3041 O O     . ARG A 1 381 ? -36.747 38.661  23.714  1.00 76.02  ? 381  ARG A O     1 
ATOM   3042 C CB    . ARG A 1 381 ? -33.985 38.205  22.088  1.00 75.11  ? 381  ARG A CB    1 
ATOM   3043 C CG    . ARG A 1 381 ? -33.478 38.168  23.536  1.00 76.14  ? 381  ARG A CG    1 
ATOM   3044 C CD    . ARG A 1 381 ? -31.973 38.362  23.592  1.00 77.54  ? 381  ARG A CD    1 
ATOM   3045 N NE    . ARG A 1 381 ? -31.258 37.092  23.436  1.00 79.14  ? 381  ARG A NE    1 
ATOM   3046 C CZ    . ARG A 1 381 ? -30.129 36.925  22.745  1.00 79.07  ? 381  ARG A CZ    1 
ATOM   3047 N NH1   . ARG A 1 381 ? -29.570 37.944  22.097  1.00 79.53  ? 381  ARG A NH1   1 
ATOM   3048 N NH2   . ARG A 1 381 ? -29.565 35.724  22.683  1.00 78.24  ? 381  ARG A NH2   1 
ATOM   3049 N N     . GLU A 1 382 ? -36.917 39.710  21.727  1.00 76.78  ? 382  GLU A N     1 
ATOM   3050 C CA    . GLU A 1 382 ? -37.904 40.682  22.219  1.00 77.88  ? 382  GLU A CA    1 
ATOM   3051 C C     . GLU A 1 382 ? -39.302 40.073  22.348  1.00 77.99  ? 382  GLU A C     1 
ATOM   3052 O O     . GLU A 1 382 ? -40.155 40.597  23.064  1.00 78.15  ? 382  GLU A O     1 
ATOM   3053 C CB    . GLU A 1 382 ? -37.950 41.937  21.330  1.00 78.16  ? 382  GLU A CB    1 
ATOM   3054 C CG    . GLU A 1 382 ? -38.664 41.755  19.988  1.00 79.24  ? 382  GLU A CG    1 
ATOM   3055 C CD    . GLU A 1 382 ? -38.811 43.060  19.224  1.00 81.08  ? 382  GLU A CD    1 
ATOM   3056 O OE1   . GLU A 1 382 ? -39.105 44.089  19.873  1.00 82.28  ? 382  GLU A OE1   1 
ATOM   3057 O OE2   . GLU A 1 382 ? -38.637 43.062  17.981  1.00 81.09  ? 382  GLU A OE2   1 
ATOM   3058 N N     . SER A 1 383 ? -39.513 38.961  21.649  1.00 78.26  ? 383  SER A N     1 
ATOM   3059 C CA    . SER A 1 383 ? -40.809 38.301  21.551  1.00 78.13  ? 383  SER A CA    1 
ATOM   3060 C C     . SER A 1 383 ? -40.893 37.152  22.546  1.00 78.19  ? 383  SER A C     1 
ATOM   3061 O O     . SER A 1 383 ? -41.358 36.068  22.210  1.00 78.49  ? 383  SER A O     1 
ATOM   3062 C CB    . SER A 1 383 ? -40.999 37.789  20.118  1.00 78.05  ? 383  SER A CB    1 
ATOM   3063 O OG    . SER A 1 383 ? -42.125 36.944  20.004  1.00 78.04  ? 383  SER A OG    1 
ATOM   3064 N N     . TYR A 1 384 ? -40.444 37.389  23.774  1.00 78.24  ? 384  TYR A N     1 
ATOM   3065 C CA    . TYR A 1 384 ? -40.384 36.325  24.777  1.00 78.36  ? 384  TYR A CA    1 
ATOM   3066 C C     . TYR A 1 384 ? -41.611 36.253  25.696  1.00 77.55  ? 384  TYR A C     1 
ATOM   3067 O O     . TYR A 1 384 ? -42.092 37.280  26.188  1.00 77.70  ? 384  TYR A O     1 
ATOM   3068 C CB    . TYR A 1 384 ? -39.101 36.438  25.615  1.00 79.17  ? 384  TYR A CB    1 
ATOM   3069 C CG    . TYR A 1 384 ? -38.995 35.388  26.708  1.00 80.67  ? 384  TYR A CG    1 
ATOM   3070 C CD1   . TYR A 1 384 ? -38.639 34.062  26.401  1.00 82.21  ? 384  TYR A CD1   1 
ATOM   3071 C CD2   . TYR A 1 384 ? -39.264 35.713  28.048  1.00 81.83  ? 384  TYR A CD2   1 
ATOM   3072 C CE1   . TYR A 1 384 ? -38.545 33.086  27.406  1.00 82.83  ? 384  TYR A CE1   1 
ATOM   3073 C CE2   . TYR A 1 384 ? -39.174 34.749  29.061  1.00 82.62  ? 384  TYR A CE2   1 
ATOM   3074 C CZ    . TYR A 1 384 ? -38.814 33.438  28.732  1.00 83.20  ? 384  TYR A CZ    1 
ATOM   3075 O OH    . TYR A 1 384 ? -38.724 32.481  29.722  1.00 82.61  ? 384  TYR A OH    1 
ATOM   3076 N N     . ALA A 1 385 ? -42.099 35.032  25.921  1.00 76.31  ? 385  ALA A N     1 
ATOM   3077 C CA    . ALA A 1 385 ? -43.120 34.763  26.943  1.00 74.90  ? 385  ALA A CA    1 
ATOM   3078 C C     . ALA A 1 385 ? -42.780 33.487  27.724  1.00 73.75  ? 385  ALA A C     1 
ATOM   3079 O O     . ALA A 1 385 ? -42.148 32.570  27.181  1.00 73.66  ? 385  ALA A O     1 
ATOM   3080 C CB    . ALA A 1 385 ? -44.511 34.661  26.311  1.00 75.02  ? 385  ALA A CB    1 
ATOM   3081 N N     . GLY A 1 386 ? -43.197 33.443  28.993  1.00 72.22  ? 386  GLY A N     1 
ATOM   3082 C CA    . GLY A 1 386 ? -42.924 32.307  29.880  1.00 70.00  ? 386  GLY A CA    1 
ATOM   3083 C C     . GLY A 1 386 ? -43.970 31.197  29.831  1.00 68.51  ? 386  GLY A C     1 
ATOM   3084 O O     . GLY A 1 386 ? -44.571 30.925  28.778  1.00 68.38  ? 386  GLY A O     1 
ATOM   3085 N N     . GLY A 1 387 ? -44.184 30.557  30.982  1.00 66.87  ? 387  GLY A N     1 
ATOM   3086 C CA    . GLY A 1 387 ? -45.082 29.411  31.101  1.00 64.32  ? 387  GLY A CA    1 
ATOM   3087 C C     . GLY A 1 387 ? -46.204 29.619  32.101  1.00 62.79  ? 387  GLY A C     1 
ATOM   3088 O O     . GLY A 1 387 ? -46.619 30.752  32.364  1.00 62.85  ? 387  GLY A O     1 
ATOM   3089 N N     . TYR A 1 388 ? -46.696 28.519  32.661  1.00 61.06  ? 388  TYR A N     1 
ATOM   3090 C CA    . TYR A 1 388 ? -47.867 28.563  33.527  1.00 59.30  ? 388  TYR A CA    1 
ATOM   3091 C C     . TYR A 1 388 ? -47.540 29.231  34.866  1.00 58.80  ? 388  TYR A C     1 
ATOM   3092 O O     . TYR A 1 388 ? -46.606 28.824  35.562  1.00 58.62  ? 388  TYR A O     1 
ATOM   3093 C CB    . TYR A 1 388 ? -48.478 27.154  33.708  1.00 58.51  ? 388  TYR A CB    1 
ATOM   3094 C CG    . TYR A 1 388 ? -49.651 27.101  34.666  1.00 56.81  ? 388  TYR A CG    1 
ATOM   3095 C CD1   . TYR A 1 388 ? -49.501 26.579  35.942  1.00 55.60  ? 388  TYR A CD1   1 
ATOM   3096 C CD2   . TYR A 1 388 ? -50.908 27.597  34.301  1.00 55.77  ? 388  TYR A CD2   1 
ATOM   3097 C CE1   . TYR A 1 388 ? -50.566 26.545  36.837  1.00 55.51  ? 388  TYR A CE1   1 
ATOM   3098 C CE2   . TYR A 1 388 ? -51.982 27.574  35.188  1.00 55.23  ? 388  TYR A CE2   1 
ATOM   3099 C CZ    . TYR A 1 388 ? -51.802 27.043  36.454  1.00 55.44  ? 388  TYR A CZ    1 
ATOM   3100 O OH    . TYR A 1 388 ? -52.846 26.998  37.343  1.00 55.61  ? 388  TYR A OH    1 
ATOM   3101 N N     . VAL A 1 389 ? -48.311 30.272  35.196  1.00 58.34  ? 389  VAL A N     1 
ATOM   3102 C CA    . VAL A 1 389 ? -48.256 30.937  36.514  1.00 57.68  ? 389  VAL A CA    1 
ATOM   3103 C C     . VAL A 1 389 ? -49.534 30.715  37.321  1.00 57.03  ? 389  VAL A C     1 
ATOM   3104 O O     . VAL A 1 389 ? -50.619 30.541  36.751  1.00 57.12  ? 389  VAL A O     1 
ATOM   3105 C CB    . VAL A 1 389 ? -48.013 32.461  36.400  1.00 57.76  ? 389  VAL A CB    1 
ATOM   3106 C CG1   . VAL A 1 389 ? -46.580 32.746  35.954  1.00 57.56  ? 389  VAL A CG1   1 
ATOM   3107 C CG2   . VAL A 1 389 ? -49.053 33.126  35.458  1.00 57.92  ? 389  VAL A CG2   1 
ATOM   3108 N N     . LYS A 1 390 ? -49.389 30.727  38.643  1.00 56.05  ? 390  LYS A N     1 
ATOM   3109 C CA    . LYS A 1 390 ? -50.511 30.604  39.568  1.00 55.16  ? 390  LYS A CA    1 
ATOM   3110 C C     . LYS A 1 390 ? -50.140 31.172  40.941  1.00 54.69  ? 390  LYS A C     1 
ATOM   3111 O O     . LYS A 1 390 ? -49.041 30.944  41.445  1.00 54.61  ? 390  LYS A O     1 
ATOM   3112 C CB    . LYS A 1 390 ? -50.987 29.145  39.680  1.00 55.09  ? 390  LYS A CB    1 
ATOM   3113 C CG    . LYS A 1 390 ? -51.564 28.775  41.048  1.00 55.10  ? 390  LYS A CG    1 
ATOM   3114 C CD    . LYS A 1 390 ? -52.827 27.943  40.957  1.00 55.32  ? 390  LYS A CD    1 
ATOM   3115 C CE    . LYS A 1 390 ? -53.403 27.707  42.354  1.00 56.08  ? 390  LYS A CE    1 
ATOM   3116 N NZ    . LYS A 1 390 ? -54.811 27.235  42.291  1.00 54.67  ? 390  LYS A NZ    1 
ATOM   3117 N N     . GLU A 1 391 ? -51.059 31.918  41.545  1.00 54.14  ? 391  GLU A N     1 
ATOM   3118 C CA    . GLU A 1 391 ? -50.815 32.458  42.882  1.00 53.35  ? 391  GLU A CA    1 
ATOM   3119 C C     . GLU A 1 391 ? -50.831 31.350  43.927  1.00 52.25  ? 391  GLU A C     1 
ATOM   3120 O O     . GLU A 1 391 ? -51.630 30.418  43.828  1.00 52.62  ? 391  GLU A O     1 
ATOM   3121 C CB    . GLU A 1 391 ? -51.826 33.553  43.223  1.00 53.62  ? 391  GLU A CB    1 
ATOM   3122 C CG    . GLU A 1 391 ? -51.712 34.794  42.346  1.00 54.44  ? 391  GLU A CG    1 
ATOM   3123 C CD    . GLU A 1 391 ? -50.301 35.360  42.311  1.00 56.53  ? 391  GLU A CD    1 
ATOM   3124 O OE1   . GLU A 1 391 ? -49.683 35.549  43.399  1.00 56.80  ? 391  GLU A OE1   1 
ATOM   3125 O OE2   . GLU A 1 391 ? -49.815 35.614  41.183  1.00 56.95  ? 391  GLU A OE2   1 
ATOM   3126 N N     . PRO A 1 392 ? -49.908 31.414  44.891  1.00 51.02  ? 392  PRO A N     1 
ATOM   3127 C CA    . PRO A 1 392 ? -49.818 30.462  45.987  1.00 50.52  ? 392  PRO A CA    1 
ATOM   3128 C C     . PRO A 1 392 ? -50.684 30.741  47.229  1.00 50.20  ? 392  PRO A C     1 
ATOM   3129 O O     . PRO A 1 392 ? -51.054 31.872  47.506  1.00 50.09  ? 392  PRO A O     1 
ATOM   3130 C CB    . PRO A 1 392 ? -48.353 30.563  46.382  1.00 50.55  ? 392  PRO A CB    1 
ATOM   3131 C CG    . PRO A 1 392 ? -48.015 31.976  46.132  1.00 50.22  ? 392  PRO A CG    1 
ATOM   3132 C CD    . PRO A 1 392 ? -48.805 32.387  44.927  1.00 50.78  ? 392  PRO A CD    1 
ATOM   3133 N N     . GLU A 1 393 ? -50.970 29.684  47.972  1.00 49.86  ? 393  GLU A N     1 
ATOM   3134 C CA    . GLU A 1 393 ? -51.559 29.774  49.288  1.00 49.94  ? 393  GLU A CA    1 
ATOM   3135 C C     . GLU A 1 393 ? -50.536 30.273  50.279  1.00 49.42  ? 393  GLU A C     1 
ATOM   3136 O O     . GLU A 1 393 ? -49.389 29.855  50.221  1.00 50.02  ? 393  GLU A O     1 
ATOM   3137 C CB    . GLU A 1 393 ? -51.995 28.379  49.741  1.00 50.37  ? 393  GLU A CB    1 
ATOM   3138 C CG    . GLU A 1 393 ? -53.146 27.814  48.944  1.00 51.66  ? 393  GLU A CG    1 
ATOM   3139 C CD    . GLU A 1 393 ? -54.400 28.622  49.135  1.00 52.75  ? 393  GLU A CD    1 
ATOM   3140 O OE1   . GLU A 1 393 ? -55.055 28.452  50.186  1.00 53.36  ? 393  GLU A OE1   1 
ATOM   3141 O OE2   . GLU A 1 393 ? -54.717 29.432  48.236  1.00 54.01  ? 393  GLU A OE2   1 
ATOM   3142 N N     . ARG A 1 394 ? -50.951 31.136  51.202  1.00 48.73  ? 394  ARG A N     1 
ATOM   3143 C CA    . ARG A 1 394 ? -50.108 31.557  52.326  1.00 48.27  ? 394  ARG A CA    1 
ATOM   3144 C C     . ARG A 1 394 ? -50.053 30.413  53.331  1.00 46.89  ? 394  ARG A C     1 
ATOM   3145 O O     . ARG A 1 394 ? -50.816 29.462  53.210  1.00 46.95  ? 394  ARG A O     1 
ATOM   3146 C CB    . ARG A 1 394 ? -50.689 32.818  52.979  1.00 48.96  ? 394  ARG A CB    1 
ATOM   3147 C CG    . ARG A 1 394 ? -50.721 34.036  52.034  1.00 52.72  ? 394  ARG A CG    1 
ATOM   3148 C CD    . ARG A 1 394 ? -51.803 35.073  52.390  1.00 57.59  ? 394  ARG A CD    1 
ATOM   3149 N NE    . ARG A 1 394 ? -51.461 35.831  53.595  1.00 61.14  ? 394  ARG A NE    1 
ATOM   3150 C CZ    . ARG A 1 394 ? -52.119 35.742  54.749  1.00 62.77  ? 394  ARG A CZ    1 
ATOM   3151 N NH1   . ARG A 1 394 ? -53.173 34.935  54.857  1.00 63.60  ? 394  ARG A NH1   1 
ATOM   3152 N NH2   . ARG A 1 394 ? -51.733 36.469  55.792  1.00 63.12  ? 394  ARG A NH2   1 
ATOM   3153 N N     . GLY A 1 395 ? -49.144 30.484  54.296  1.00 45.33  ? 395  GLY A N     1 
ATOM   3154 C CA    . GLY A 1 395 ? -49.180 29.571  55.430  1.00 43.94  ? 395  GLY A CA    1 
ATOM   3155 C C     . GLY A 1 395 ? -48.356 28.316  55.299  1.00 43.10  ? 395  GLY A C     1 
ATOM   3156 O O     . GLY A 1 395 ? -47.873 28.009  54.222  1.00 43.11  ? 395  GLY A O     1 
ATOM   3157 N N     . LEU A 1 396 ? -48.210 27.592  56.409  1.00 42.68  ? 396  LEU A N     1 
ATOM   3158 C CA    . LEU A 1 396 ? -47.389 26.386  56.477  1.00 42.28  ? 396  LEU A CA    1 
ATOM   3159 C C     . LEU A 1 396 ? -48.247 25.120  56.448  1.00 42.04  ? 396  LEU A C     1 
ATOM   3160 O O     . LEU A 1 396 ? -49.005 24.835  57.381  1.00 42.16  ? 396  LEU A O     1 
ATOM   3161 C CB    . LEU A 1 396 ? -46.500 26.393  57.728  1.00 42.42  ? 396  LEU A CB    1 
ATOM   3162 C CG    . LEU A 1 396 ? -45.753 25.073  58.000  1.00 43.78  ? 396  LEU A CG    1 
ATOM   3163 C CD1   . LEU A 1 396 ? -44.489 24.921  57.125  1.00 45.75  ? 396  LEU A CD1   1 
ATOM   3164 C CD2   . LEU A 1 396 ? -45.415 24.862  59.470  1.00 43.39  ? 396  LEU A CD2   1 
ATOM   3165 N N     . TRP A 1 397 ? -48.088 24.350  55.378  1.00 41.49  ? 397  TRP A N     1 
ATOM   3166 C CA    . TRP A 1 397 ? -48.928 23.201  55.098  1.00 40.96  ? 397  TRP A CA    1 
ATOM   3167 C C     . TRP A 1 397 ? -48.219 21.908  55.438  1.00 41.01  ? 397  TRP A C     1 
ATOM   3168 O O     . TRP A 1 397 ? -47.021 21.905  55.552  1.00 41.33  ? 397  TRP A O     1 
ATOM   3169 C CB    . TRP A 1 397 ? -49.290 23.221  53.631  1.00 40.59  ? 397  TRP A CB    1 
ATOM   3170 C CG    . TRP A 1 397 ? -50.069 24.427  53.242  1.00 39.41  ? 397  TRP A CG    1 
ATOM   3171 C CD1   . TRP A 1 397 ? -49.581 25.575  52.712  1.00 38.46  ? 397  TRP A CD1   1 
ATOM   3172 C CD2   . TRP A 1 397 ? -51.483 24.602  53.348  1.00 39.05  ? 397  TRP A CD2   1 
ATOM   3173 N NE1   . TRP A 1 397 ? -50.597 26.463  52.468  1.00 38.42  ? 397  TRP A NE1   1 
ATOM   3174 C CE2   . TRP A 1 397 ? -51.780 25.896  52.855  1.00 39.02  ? 397  TRP A CE2   1 
ATOM   3175 C CE3   . TRP A 1 397 ? -52.533 23.791  53.809  1.00 38.34  ? 397  TRP A CE3   1 
ATOM   3176 C CZ2   . TRP A 1 397 ? -53.090 26.398  52.789  1.00 38.75  ? 397  TRP A CZ2   1 
ATOM   3177 C CZ3   . TRP A 1 397 ? -53.834 24.291  53.764  1.00 37.74  ? 397  TRP A CZ3   1 
ATOM   3178 C CH2   . TRP A 1 397 ? -54.101 25.589  53.257  1.00 38.49  ? 397  TRP A CH2   1 
ATOM   3179 N N     . GLU A 1 398 ? -48.959 20.814  55.600  1.00 41.29  ? 398  GLU A N     1 
ATOM   3180 C CA    . GLU A 1 398 ? -48.362 19.526  55.951  1.00 41.80  ? 398  GLU A CA    1 
ATOM   3181 C C     . GLU A 1 398 ? -48.645 18.434  54.931  1.00 41.51  ? 398  GLU A C     1 
ATOM   3182 O O     . GLU A 1 398 ? -49.612 18.531  54.160  1.00 41.71  ? 398  GLU A O     1 
ATOM   3183 C CB    . GLU A 1 398 ? -48.804 19.068  57.331  1.00 41.90  ? 398  GLU A CB    1 
ATOM   3184 C CG    . GLU A 1 398 ? -48.311 19.995  58.404  1.00 46.17  ? 398  GLU A CG    1 
ATOM   3185 C CD    . GLU A 1 398 ? -47.865 19.272  59.650  1.00 51.39  ? 398  GLU A CD    1 
ATOM   3186 O OE1   . GLU A 1 398 ? -46.767 18.653  59.637  1.00 52.76  ? 398  GLU A OE1   1 
ATOM   3187 O OE2   . GLU A 1 398 ? -48.616 19.340  60.652  1.00 53.74  ? 398  GLU A OE2   1 
ATOM   3188 N N     . ASN A 1 399 ? -47.787 17.406  54.934  1.00 40.86  ? 399  ASN A N     1 
ATOM   3189 C CA    . ASN A 1 399 ? -47.898 16.251  54.038  1.00 39.90  ? 399  ASN A CA    1 
ATOM   3190 C C     . ASN A 1 399 ? -48.231 16.626  52.610  1.00 39.16  ? 399  ASN A C     1 
ATOM   3191 O O     . ASN A 1 399 ? -49.363 16.405  52.154  1.00 39.40  ? 399  ASN A O     1 
ATOM   3192 C CB    . ASN A 1 399 ? -48.957 15.298  54.559  1.00 40.01  ? 399  ASN A CB    1 
ATOM   3193 C CG    . ASN A 1 399 ? -48.708 14.906  55.972  1.00 40.29  ? 399  ASN A CG    1 
ATOM   3194 O OD1   . ASN A 1 399 ? -47.612 14.474  56.315  1.00 39.27  ? 399  ASN A OD1   1 
ATOM   3195 N ND2   . ASN A 1 399 ? -49.727 15.044  56.813  1.00 41.32  ? 399  ASN A ND2   1 
ATOM   3196 N N     . ILE A 1 400 ? -47.241 17.185  51.921  1.00 37.84  ? 400  ILE A N     1 
ATOM   3197 C CA    . ILE A 1 400 ? -47.414 17.755  50.596  1.00 36.52  ? 400  ILE A CA    1 
ATOM   3198 C C     . ILE A 1 400 ? -46.820 16.845  49.535  1.00 35.56  ? 400  ILE A C     1 
ATOM   3199 O O     . ILE A 1 400 ? -45.695 16.384  49.687  1.00 35.68  ? 400  ILE A O     1 
ATOM   3200 C CB    . ILE A 1 400 ? -46.673 19.098  50.490  1.00 36.57  ? 400  ILE A CB    1 
ATOM   3201 C CG1   . ILE A 1 400 ? -46.828 19.916  51.768  1.00 35.88  ? 400  ILE A CG1   1 
ATOM   3202 C CG2   . ILE A 1 400 ? -47.150 19.880  49.266  1.00 37.31  ? 400  ILE A CG2   1 
ATOM   3203 C CD1   . ILE A 1 400 ? -46.102 21.223  51.704  1.00 35.44  ? 400  ILE A CD1   1 
ATOM   3204 N N     . VAL A 1 401 ? -47.561 16.605  48.457  1.00 34.21  ? 401  VAL A N     1 
ATOM   3205 C CA    . VAL A 1 401 ? -47.013 15.875  47.311  1.00 32.83  ? 401  VAL A CA    1 
ATOM   3206 C C     . VAL A 1 401 ? -46.656 16.838  46.194  1.00 32.48  ? 401  VAL A C     1 
ATOM   3207 O O     . VAL A 1 401 ? -47.253 17.920  46.054  1.00 32.41  ? 401  VAL A O     1 
ATOM   3208 C CB    . VAL A 1 401 ? -47.972 14.799  46.750  1.00 32.63  ? 401  VAL A CB    1 
ATOM   3209 C CG1   . VAL A 1 401 ? -48.258 13.730  47.797  1.00 32.52  ? 401  VAL A CG1   1 
ATOM   3210 C CG2   . VAL A 1 401 ? -49.259 15.422  46.256  1.00 31.57  ? 401  VAL A CG2   1 
ATOM   3211 N N     . TYR A 1 402 ? -45.668 16.445  45.406  1.00 31.40  ? 402  TYR A N     1 
ATOM   3212 C CA    . TYR A 1 402 ? -45.291 17.220  44.267  1.00 30.60  ? 402  TYR A CA    1 
ATOM   3213 C C     . TYR A 1 402 ? -45.574 16.413  43.007  1.00 31.10  ? 402  TYR A C     1 
ATOM   3214 O O     . TYR A 1 402 ? -45.184 15.244  42.913  1.00 32.02  ? 402  TYR A O     1 
ATOM   3215 C CB    . TYR A 1 402 ? -43.815 17.585  44.329  1.00 29.46  ? 402  TYR A CB    1 
ATOM   3216 C CG    . TYR A 1 402 ? -43.447 18.440  43.156  1.00 28.48  ? 402  TYR A CG    1 
ATOM   3217 C CD1   . TYR A 1 402 ? -43.783 19.787  43.134  1.00 27.23  ? 402  TYR A CD1   1 
ATOM   3218 C CD2   . TYR A 1 402 ? -42.818 17.897  42.039  1.00 26.17  ? 402  TYR A CD2   1 
ATOM   3219 C CE1   . TYR A 1 402 ? -43.483 20.587  42.039  1.00 27.90  ? 402  TYR A CE1   1 
ATOM   3220 C CE2   . TYR A 1 402 ? -42.506 18.685  40.942  1.00 27.04  ? 402  TYR A CE2   1 
ATOM   3221 C CZ    . TYR A 1 402 ? -42.845 20.035  40.944  1.00 28.00  ? 402  TYR A CZ    1 
ATOM   3222 O OH    . TYR A 1 402 ? -42.543 20.844  39.862  1.00 28.62  ? 402  TYR A OH    1 
ATOM   3223 N N     . LEU A 1 403 ? -46.222 17.028  42.026  1.00 30.68  ? 403  LEU A N     1 
ATOM   3224 C CA    . LEU A 1 403 ? -46.504 16.337  40.789  1.00 30.68  ? 403  LEU A CA    1 
ATOM   3225 C C     . LEU A 1 403 ? -45.950 17.110  39.604  1.00 30.90  ? 403  LEU A C     1 
ATOM   3226 O O     . LEU A 1 403 ? -46.061 18.326  39.558  1.00 31.49  ? 403  LEU A O     1 
ATOM   3227 C CB    . LEU A 1 403 ? -48.009 16.092  40.619  1.00 30.79  ? 403  LEU A CB    1 
ATOM   3228 C CG    . LEU A 1 403 ? -48.861 15.370  41.671  1.00 30.79  ? 403  LEU A CG    1 
ATOM   3229 C CD1   . LEU A 1 403 ? -50.222 15.133  41.102  1.00 30.03  ? 403  LEU A CD1   1 
ATOM   3230 C CD2   . LEU A 1 403 ? -48.257 14.047  42.100  1.00 32.76  ? 403  LEU A CD2   1 
ATOM   3231 N N     . ASP A 1 404 ? -45.407 16.382  38.630  1.00 30.90  ? 404  ASP A N     1 
ATOM   3232 C CA    . ASP A 1 404 ? -44.572 16.930  37.576  1.00 30.89  ? 404  ASP A CA    1 
ATOM   3233 C C     . ASP A 1 404 ? -45.342 17.096  36.274  1.00 30.46  ? 404  ASP A C     1 
ATOM   3234 O O     . ASP A 1 404 ? -45.946 16.137  35.794  1.00 30.74  ? 404  ASP A O     1 
ATOM   3235 C CB    . ASP A 1 404 ? -43.403 15.952  37.374  1.00 31.53  ? 404  ASP A CB    1 
ATOM   3236 C CG    . ASP A 1 404 ? -42.298 16.473  36.424  1.00 32.90  ? 404  ASP A CG    1 
ATOM   3237 O OD1   . ASP A 1 404 ? -42.393 17.607  35.869  1.00 32.96  ? 404  ASP A OD1   1 
ATOM   3238 O OD2   . ASP A 1 404 ? -41.318 15.700  36.238  1.00 32.84  ? 404  ASP A OD2   1 
ATOM   3239 N N     . PHE A 1 405 ? -45.287 18.296  35.693  1.00 29.65  ? 405  PHE A N     1 
ATOM   3240 C CA    . PHE A 1 405 ? -45.924 18.584  34.411  1.00 29.39  ? 405  PHE A CA    1 
ATOM   3241 C C     . PHE A 1 405 ? -45.005 18.359  33.231  1.00 29.58  ? 405  PHE A C     1 
ATOM   3242 O O     . PHE A 1 405 ? -45.462 18.327  32.088  1.00 29.99  ? 405  PHE A O     1 
ATOM   3243 C CB    . PHE A 1 405 ? -46.406 20.038  34.318  1.00 29.44  ? 405  PHE A CB    1 
ATOM   3244 C CG    . PHE A 1 405 ? -47.411 20.424  35.355  1.00 30.27  ? 405  PHE A CG    1 
ATOM   3245 C CD1   . PHE A 1 405 ? -47.424 21.705  35.864  1.00 29.85  ? 405  PHE A CD1   1 
ATOM   3246 C CD2   . PHE A 1 405 ? -48.356 19.510  35.820  1.00 32.11  ? 405  PHE A CD2   1 
ATOM   3247 C CE1   . PHE A 1 405 ? -48.354 22.079  36.825  1.00 30.99  ? 405  PHE A CE1   1 
ATOM   3248 C CE2   . PHE A 1 405 ? -49.292 19.881  36.782  1.00 32.73  ? 405  PHE A CE2   1 
ATOM   3249 C CZ    . PHE A 1 405 ? -49.289 21.168  37.291  1.00 30.56  ? 405  PHE A CZ    1 
ATOM   3250 N N     . ARG A 1 406 ? -43.709 18.239  33.468  1.00 29.34  ? 406  ARG A N     1 
ATOM   3251 C CA    . ARG A 1 406 ? -42.784 18.345  32.342  1.00 29.09  ? 406  ARG A CA    1 
ATOM   3252 C C     . ARG A 1 406 ? -43.076 17.364  31.223  1.00 28.94  ? 406  ARG A C     1 
ATOM   3253 O O     . ARG A 1 406 ? -42.799 17.646  30.052  1.00 29.37  ? 406  ARG A O     1 
ATOM   3254 C CB    . ARG A 1 406 ? -41.323 18.263  32.797  1.00 28.95  ? 406  ARG A CB    1 
ATOM   3255 C CG    . ARG A 1 406 ? -40.856 19.530  33.489  1.00 29.09  ? 406  ARG A CG    1 
ATOM   3256 C CD    . ARG A 1 406 ? -39.658 19.329  34.388  1.00 29.73  ? 406  ARG A CD    1 
ATOM   3257 N NE    . ARG A 1 406 ? -39.744 18.098  35.174  1.00 31.26  ? 406  ARG A NE    1 
ATOM   3258 C CZ    . ARG A 1 406 ? -38.726 17.569  35.849  1.00 30.82  ? 406  ARG A CZ    1 
ATOM   3259 N NH1   . ARG A 1 406 ? -37.559 18.171  35.860  1.00 30.67  ? 406  ARG A NH1   1 
ATOM   3260 N NH2   . ARG A 1 406 ? -38.873 16.441  36.526  1.00 32.53  ? 406  ARG A NH2   1 
ATOM   3261 N N     . SER A 1 407 ? -43.637 16.212  31.560  1.00 28.70  ? 407  SER A N     1 
ATOM   3262 C CA    . SER A 1 407 ? -43.850 15.209  30.517  1.00 28.57  ? 407  SER A CA    1 
ATOM   3263 C C     . SER A 1 407 ? -45.092 15.507  29.694  1.00 29.16  ? 407  SER A C     1 
ATOM   3264 O O     . SER A 1 407 ? -45.226 14.997  28.588  1.00 29.90  ? 407  SER A O     1 
ATOM   3265 C CB    . SER A 1 407 ? -43.831 13.786  31.072  1.00 27.90  ? 407  SER A CB    1 
ATOM   3266 O OG    . SER A 1 407 ? -42.492 13.425  31.378  1.00 26.84  ? 407  SER A OG    1 
ATOM   3267 N N     . LEU A 1 408 ? -45.988 16.340  30.218  1.00 29.34  ? 408  LEU A N     1 
ATOM   3268 C CA    . LEU A 1 408 ? -47.152 16.787  29.469  1.00 29.68  ? 408  LEU A CA    1 
ATOM   3269 C C     . LEU A 1 408 ? -46.759 17.398  28.133  1.00 29.87  ? 408  LEU A C     1 
ATOM   3270 O O     . LEU A 1 408 ? -47.338 17.078  27.097  1.00 30.49  ? 408  LEU A O     1 
ATOM   3271 C CB    . LEU A 1 408 ? -47.937 17.817  30.272  1.00 29.97  ? 408  LEU A CB    1 
ATOM   3272 C CG    . LEU A 1 408 ? -49.279 17.459  30.915  1.00 30.95  ? 408  LEU A CG    1 
ATOM   3273 C CD1   . LEU A 1 408 ? -49.381 16.012  31.449  1.00 31.35  ? 408  LEU A CD1   1 
ATOM   3274 C CD2   . LEU A 1 408 ? -49.614 18.464  31.996  1.00 30.96  ? 408  LEU A CD2   1 
ATOM   3275 N N     . TYR A 1 409 ? -45.749 18.256  28.148  1.00 29.67  ? 409  TYR A N     1 
ATOM   3276 C CA    . TYR A 1 409 ? -45.432 19.047  26.975  1.00 29.17  ? 409  TYR A CA    1 
ATOM   3277 C C     . TYR A 1 409 ? -45.047 18.264  25.728  1.00 28.91  ? 409  TYR A C     1 
ATOM   3278 O O     . TYR A 1 409 ? -45.606 18.506  24.673  1.00 29.22  ? 409  TYR A O     1 
ATOM   3279 C CB    . TYR A 1 409 ? -44.399 20.100  27.327  1.00 29.46  ? 409  TYR A CB    1 
ATOM   3280 C CG    . TYR A 1 409 ? -44.835 21.013  28.454  1.00 29.04  ? 409  TYR A CG    1 
ATOM   3281 C CD1   . TYR A 1 409 ? -45.939 21.856  28.316  1.00 30.49  ? 409  TYR A CD1   1 
ATOM   3282 C CD2   . TYR A 1 409 ? -44.156 21.026  29.648  1.00 28.21  ? 409  TYR A CD2   1 
ATOM   3283 C CE1   . TYR A 1 409 ? -46.331 22.699  29.341  1.00 29.39  ? 409  TYR A CE1   1 
ATOM   3284 C CE2   . TYR A 1 409 ? -44.526 21.852  30.668  1.00 29.17  ? 409  TYR A CE2   1 
ATOM   3285 C CZ    . TYR A 1 409 ? -45.606 22.691  30.517  1.00 30.61  ? 409  TYR A CZ    1 
ATOM   3286 O OH    . TYR A 1 409 ? -45.945 23.523  31.556  1.00 31.62  ? 409  TYR A OH    1 
ATOM   3287 N N     . PRO A 1 410 ? -44.121 17.305  25.831  1.00 28.74  ? 410  PRO A N     1 
ATOM   3288 C CA    . PRO A 1 410 ? -43.856 16.543  24.618  1.00 28.97  ? 410  PRO A CA    1 
ATOM   3289 C C     . PRO A 1 410 ? -45.069 15.698  24.177  1.00 29.50  ? 410  PRO A C     1 
ATOM   3290 O O     . PRO A 1 410 ? -45.275 15.525  22.980  1.00 29.77  ? 410  PRO A O     1 
ATOM   3291 C CB    . PRO A 1 410 ? -42.703 15.633  25.025  1.00 28.67  ? 410  PRO A CB    1 
ATOM   3292 C CG    . PRO A 1 410 ? -42.821 15.497  26.462  1.00 28.47  ? 410  PRO A CG    1 
ATOM   3293 C CD    . PRO A 1 410 ? -43.314 16.818  26.957  1.00 28.76  ? 410  PRO A CD    1 
ATOM   3294 N N     . SER A 1 411 ? -45.867 15.194  25.120  1.00 29.55  ? 411  SER A N     1 
ATOM   3295 C CA    . SER A 1 411 ? -47.132 14.555  24.768  1.00 30.45  ? 411  SER A CA    1 
ATOM   3296 C C     . SER A 1 411 ? -48.068 15.496  23.985  1.00 30.94  ? 411  SER A C     1 
ATOM   3297 O O     . SER A 1 411 ? -48.640 15.112  22.952  1.00 31.74  ? 411  SER A O     1 
ATOM   3298 C CB    . SER A 1 411 ? -47.843 14.062  26.009  1.00 30.60  ? 411  SER A CB    1 
ATOM   3299 O OG    . SER A 1 411 ? -47.002 13.231  26.786  1.00 33.16  ? 411  SER A OG    1 
ATOM   3300 N N     . ILE A 1 412 ? -48.233 16.720  24.476  1.00 30.51  ? 412  ILE A N     1 
ATOM   3301 C CA    . ILE A 1 412 ? -48.964 17.731  23.743  1.00 30.07  ? 412  ILE A CA    1 
ATOM   3302 C C     . ILE A 1 412 ? -48.410 17.912  22.318  1.00 30.56  ? 412  ILE A C     1 
ATOM   3303 O O     . ILE A 1 412 ? -49.174 18.028  21.372  1.00 30.85  ? 412  ILE A O     1 
ATOM   3304 C CB    . ILE A 1 412 ? -48.942 19.078  24.498  1.00 29.89  ? 412  ILE A CB    1 
ATOM   3305 C CG1   . ILE A 1 412 ? -49.733 18.966  25.788  1.00 28.82  ? 412  ILE A CG1   1 
ATOM   3306 C CG2   . ILE A 1 412 ? -49.457 20.236  23.620  1.00 28.22  ? 412  ILE A CG2   1 
ATOM   3307 C CD1   . ILE A 1 412 ? -49.455 20.116  26.745  1.00 30.71  ? 412  ILE A CD1   1 
ATOM   3308 N N     . ILE A 1 413 ? -47.092 17.936  22.159  1.00 30.83  ? 413  ILE A N     1 
ATOM   3309 C CA    . ILE A 1 413 ? -46.528 18.211  20.850  1.00 31.47  ? 413  ILE A CA    1 
ATOM   3310 C C     . ILE A 1 413 ? -46.886 17.066  19.937  1.00 31.61  ? 413  ILE A C     1 
ATOM   3311 O O     . ILE A 1 413 ? -47.245 17.263  18.785  1.00 31.59  ? 413  ILE A O     1 
ATOM   3312 C CB    . ILE A 1 413 ? -45.010 18.397  20.899  1.00 31.75  ? 413  ILE A CB    1 
ATOM   3313 C CG1   . ILE A 1 413 ? -44.664 19.726  21.591  1.00 32.76  ? 413  ILE A CG1   1 
ATOM   3314 C CG2   . ILE A 1 413 ? -44.447 18.410  19.497  1.00 31.50  ? 413  ILE A CG2   1 
ATOM   3315 C CD1   . ILE A 1 413 ? -43.323 19.747  22.303  1.00 32.62  ? 413  ILE A CD1   1 
ATOM   3316 N N     . ILE A 1 414 ? -46.817 15.860  20.474  1.00 31.97  ? 414  ILE A N     1 
ATOM   3317 C CA    . ILE A 1 414 ? -47.249 14.696  19.731  1.00 32.32  ? 414  ILE A CA    1 
ATOM   3318 C C     . ILE A 1 414 ? -48.745 14.746  19.481  1.00 32.80  ? 414  ILE A C     1 
ATOM   3319 O O     . ILE A 1 414 ? -49.171 14.623  18.346  1.00 33.54  ? 414  ILE A O     1 
ATOM   3320 C CB    . ILE A 1 414 ? -46.895 13.387  20.443  1.00 32.23  ? 414  ILE A CB    1 
ATOM   3321 C CG1   . ILE A 1 414 ? -45.385 13.305  20.659  1.00 31.14  ? 414  ILE A CG1   1 
ATOM   3322 C CG2   . ILE A 1 414 ? -47.412 12.191  19.629  1.00 31.36  ? 414  ILE A CG2   1 
ATOM   3323 C CD1   . ILE A 1 414 ? -44.993 12.335  21.713  1.00 31.11  ? 414  ILE A CD1   1 
ATOM   3324 N N     . THR A 1 415 ? -49.532 14.952  20.531  1.00 33.16  ? 415  THR A N     1 
ATOM   3325 C CA    . THR A 1 415 ? -50.986 14.827  20.430  1.00 33.45  ? 415  THR A CA    1 
ATOM   3326 C C     . THR A 1 415 ? -51.635 15.829  19.517  1.00 33.23  ? 415  THR A C     1 
ATOM   3327 O O     . THR A 1 415 ? -52.532 15.453  18.763  1.00 33.69  ? 415  THR A O     1 
ATOM   3328 C CB    . THR A 1 415 ? -51.666 14.859  21.790  1.00 33.62  ? 415  THR A CB    1 
ATOM   3329 O OG1   . THR A 1 415 ? -51.293 13.671  22.489  1.00 35.21  ? 415  THR A OG1   1 
ATOM   3330 C CG2   . THR A 1 415 ? -53.183 14.870  21.646  1.00 33.23  ? 415  THR A CG2   1 
ATOM   3331 N N     . HIS A 1 416 ? -51.192 17.083  19.569  1.00 32.66  ? 416  HIS A N     1 
ATOM   3332 C CA    . HIS A 1 416 ? -51.737 18.102  18.673  1.00 31.84  ? 416  HIS A CA    1 
ATOM   3333 C C     . HIS A 1 416 ? -50.823 18.364  17.504  1.00 32.04  ? 416  HIS A C     1 
ATOM   3334 O O     . HIS A 1 416 ? -51.034 19.301  16.741  1.00 32.31  ? 416  HIS A O     1 
ATOM   3335 C CB    . HIS A 1 416 ? -52.078 19.369  19.430  1.00 31.28  ? 416  HIS A CB    1 
ATOM   3336 C CG    . HIS A 1 416 ? -53.060 19.136  20.520  1.00 31.06  ? 416  HIS A CG    1 
ATOM   3337 N ND1   . HIS A 1 416 ? -54.399 18.927  20.276  1.00 30.35  ? 416  HIS A ND1   1 
ATOM   3338 C CD2   . HIS A 1 416 ? -52.897 19.006  21.855  1.00 31.41  ? 416  HIS A CD2   1 
ATOM   3339 C CE1   . HIS A 1 416 ? -55.026 18.708  21.418  1.00 29.37  ? 416  HIS A CE1   1 
ATOM   3340 N NE2   . HIS A 1 416 ? -54.139 18.757  22.394  1.00 30.56  ? 416  HIS A NE2   1 
ATOM   3341 N N     . ASN A 1 417 ? -49.819 17.513  17.335  1.00 32.31  ? 417  ASN A N     1 
ATOM   3342 C CA    . ASN A 1 417 ? -48.975 17.571  16.136  1.00 32.89  ? 417  ASN A CA    1 
ATOM   3343 C C     . ASN A 1 417 ? -48.346 18.933  15.934  1.00 32.80  ? 417  ASN A C     1 
ATOM   3344 O O     . ASN A 1 417 ? -48.404 19.482  14.856  1.00 33.26  ? 417  ASN A O     1 
ATOM   3345 C CB    . ASN A 1 417 ? -49.790 17.214  14.895  1.00 32.65  ? 417  ASN A CB    1 
ATOM   3346 C CG    . ASN A 1 417 ? -48.953 16.570  13.809  1.00 33.92  ? 417  ASN A CG    1 
ATOM   3347 O OD1   . ASN A 1 417 ? -48.137 15.667  14.073  1.00 34.10  ? 417  ASN A OD1   1 
ATOM   3348 N ND2   . ASN A 1 417 ? -49.171 17.006  12.565  1.00 34.44  ? 417  ASN A ND2   1 
ATOM   3349 N N     . VAL A 1 418 ? -47.757 19.479  16.979  1.00 33.17  ? 418  VAL A N     1 
ATOM   3350 C CA    . VAL A 1 418 ? -47.245 20.828  16.930  1.00 33.91  ? 418  VAL A CA    1 
ATOM   3351 C C     . VAL A 1 418 ? -45.847 20.867  16.315  1.00 35.07  ? 418  VAL A C     1 
ATOM   3352 O O     . VAL A 1 418 ? -44.882 20.433  16.947  1.00 35.44  ? 418  VAL A O     1 
ATOM   3353 C CB    . VAL A 1 418 ? -47.181 21.432  18.345  1.00 33.78  ? 418  VAL A CB    1 
ATOM   3354 C CG1   . VAL A 1 418 ? -46.678 22.843  18.274  1.00 32.47  ? 418  VAL A CG1   1 
ATOM   3355 C CG2   . VAL A 1 418 ? -48.556 21.366  19.034  1.00 33.30  ? 418  VAL A CG2   1 
ATOM   3356 N N     . SER A 1 419 ? -45.721 21.375  15.093  1.00 36.02  ? 419  SER A N     1 
ATOM   3357 C CA    . SER A 1 419 ? -44.392 21.626  14.544  1.00 37.56  ? 419  SER A CA    1 
ATOM   3358 C C     . SER A 1 419 ? -44.419 22.597  13.376  1.00 38.91  ? 419  SER A C     1 
ATOM   3359 O O     . SER A 1 419 ? -45.436 22.713  12.702  1.00 39.37  ? 419  SER A O     1 
ATOM   3360 C CB    . SER A 1 419 ? -43.685 20.328  14.151  1.00 37.42  ? 419  SER A CB    1 
ATOM   3361 O OG    . SER A 1 419 ? -44.053 19.923  12.860  1.00 37.75  ? 419  SER A OG    1 
ATOM   3362 N N     . PRO A 1 420 ? -43.298 23.309  13.141  1.00 40.17  ? 420  PRO A N     1 
ATOM   3363 C CA    . PRO A 1 420 ? -43.166 24.311  12.077  1.00 40.75  ? 420  PRO A CA    1 
ATOM   3364 C C     . PRO A 1 420 ? -43.634 23.856  10.698  1.00 41.31  ? 420  PRO A C     1 
ATOM   3365 O O     . PRO A 1 420 ? -44.184 24.673  9.950   1.00 41.51  ? 420  PRO A O     1 
ATOM   3366 C CB    . PRO A 1 420 ? -41.659 24.615  12.052  1.00 40.71  ? 420  PRO A CB    1 
ATOM   3367 C CG    . PRO A 1 420 ? -41.018 23.555  12.923  1.00 40.88  ? 420  PRO A CG    1 
ATOM   3368 C CD    . PRO A 1 420 ? -42.058 23.219  13.931  1.00 40.51  ? 420  PRO A CD    1 
ATOM   3369 N N     . ASP A 1 421 ? -43.428 22.579  10.371  1.00 41.61  ? 421  ASP A N     1 
ATOM   3370 C CA    . ASP A 1 421 ? -43.889 22.019  9.092   1.00 41.93  ? 421  ASP A CA    1 
ATOM   3371 C C     . ASP A 1 421 ? -45.377 21.668  9.061   1.00 42.50  ? 421  ASP A C     1 
ATOM   3372 O O     . ASP A 1 421 ? -45.894 21.305  8.005   1.00 42.66  ? 421  ASP A O     1 
ATOM   3373 C CB    . ASP A 1 421 ? -43.089 20.776  8.740   1.00 41.99  ? 421  ASP A CB    1 
ATOM   3374 C CG    . ASP A 1 421 ? -43.028 19.794  9.874   1.00 42.00  ? 421  ASP A CG    1 
ATOM   3375 O OD1   . ASP A 1 421 ? -43.107 20.241  11.030  1.00 43.26  ? 421  ASP A OD1   1 
ATOM   3376 O OD2   . ASP A 1 421 ? -42.905 18.583  9.618   1.00 41.88  ? 421  ASP A OD2   1 
ATOM   3377 N N     . THR A 1 422 ? -46.057 21.734  10.206  1.00 43.03  ? 422  THR A N     1 
ATOM   3378 C CA    . THR A 1 422 ? -47.509 21.546  10.235  1.00 43.99  ? 422  THR A CA    1 
ATOM   3379 C C     . THR A 1 422 ? -48.247 22.853  10.569  1.00 45.17  ? 422  THR A C     1 
ATOM   3380 O O     . THR A 1 422 ? -49.458 22.973  10.346  1.00 45.19  ? 422  THR A O     1 
ATOM   3381 C CB    . THR A 1 422 ? -47.961 20.422  11.204  1.00 43.68  ? 422  THR A CB    1 
ATOM   3382 O OG1   . THR A 1 422 ? -47.517 20.721  12.527  1.00 44.20  ? 422  THR A OG1   1 
ATOM   3383 C CG2   . THR A 1 422 ? -47.427 19.069  10.789  1.00 42.68  ? 422  THR A CG2   1 
ATOM   3384 N N     . LEU A 1 423 ? -47.514 23.828  11.101  1.00 46.53  ? 423  LEU A N     1 
ATOM   3385 C CA    . LEU A 1 423 ? -48.075 25.143  11.379  1.00 47.96  ? 423  LEU A CA    1 
ATOM   3386 C C     . LEU A 1 423 ? -48.723 25.709  10.139  1.00 49.36  ? 423  LEU A C     1 
ATOM   3387 O O     . LEU A 1 423 ? -48.136 25.659  9.054   1.00 49.40  ? 423  LEU A O     1 
ATOM   3388 C CB    . LEU A 1 423 ? -46.999 26.117  11.852  1.00 47.68  ? 423  LEU A CB    1 
ATOM   3389 C CG    . LEU A 1 423 ? -47.483 27.554  12.013  1.00 46.85  ? 423  LEU A CG    1 
ATOM   3390 C CD1   . LEU A 1 423 ? -48.516 27.636  13.103  1.00 46.53  ? 423  LEU A CD1   1 
ATOM   3391 C CD2   . LEU A 1 423 ? -46.330 28.461  12.331  1.00 48.01  ? 423  LEU A CD2   1 
ATOM   3392 N N     . ASN A 1 424 ? -49.942 26.223  10.322  1.00 51.25  ? 424  ASN A N     1 
ATOM   3393 C CA    . ASN A 1 424 ? -50.724 26.918  9.282   1.00 52.74  ? 424  ASN A CA    1 
ATOM   3394 C C     . ASN A 1 424 ? -50.511 26.405  7.854   1.00 53.86  ? 424  ASN A C     1 
ATOM   3395 O O     . ASN A 1 424 ? -50.224 27.189  6.945   1.00 54.27  ? 424  ASN A O     1 
ATOM   3396 C CB    . ASN A 1 424 ? -50.464 28.436  9.334   1.00 52.71  ? 424  ASN A CB    1 
ATOM   3397 C CG    . ASN A 1 424 ? -50.986 29.094  10.615  1.00 52.77  ? 424  ASN A CG    1 
ATOM   3398 O OD1   . ASN A 1 424 ? -52.067 28.763  11.123  1.00 51.88  ? 424  ASN A OD1   1 
ATOM   3399 N ND2   . ASN A 1 424 ? -50.216 30.051  11.130  1.00 52.58  ? 424  ASN A ND2   1 
ATOM   3400 N N     . ARG A 1 425 ? -50.616 25.094  7.656   1.00 55.14  ? 425  ARG A N     1 
ATOM   3401 C CA    . ARG A 1 425 ? -50.513 24.544  6.311   1.00 56.42  ? 425  ARG A CA    1 
ATOM   3402 C C     . ARG A 1 425 ? -51.857 24.660  5.625   1.00 57.03  ? 425  ARG A C     1 
ATOM   3403 O O     . ARG A 1 425 ? -52.885 24.295  6.205   1.00 57.46  ? 425  ARG A O     1 
ATOM   3404 C CB    . ARG A 1 425 ? -50.056 23.091  6.343   1.00 56.41  ? 425  ARG A CB    1 
ATOM   3405 C CG    . ARG A 1 425 ? -48.558 22.944  6.491   1.00 58.27  ? 425  ARG A CG    1 
ATOM   3406 C CD    . ARG A 1 425 ? -47.824 23.458  5.245   1.00 60.28  ? 425  ARG A CD    1 
ATOM   3407 N NE    . ARG A 1 425 ? -46.845 22.494  4.742   1.00 61.32  ? 425  ARG A NE    1 
ATOM   3408 C CZ    . ARG A 1 425 ? -47.156 21.304  4.224   1.00 61.03  ? 425  ARG A CZ    1 
ATOM   3409 N NH1   . ARG A 1 425 ? -46.198 20.501  3.790   1.00 60.02  ? 425  ARG A NH1   1 
ATOM   3410 N NH2   . ARG A 1 425 ? -48.425 20.910  4.149   1.00 61.41  ? 425  ARG A NH2   1 
ATOM   3411 N N     . GLU A 1 426 ? -51.851 25.181  4.400   1.00 57.57  ? 426  GLU A N     1 
ATOM   3412 C CA    . GLU A 1 426 ? -53.086 25.343  3.630   1.00 57.94  ? 426  GLU A CA    1 
ATOM   3413 C C     . GLU A 1 426 ? -53.609 23.995  3.089   1.00 57.64  ? 426  GLU A C     1 
ATOM   3414 O O     . GLU A 1 426 ? -52.838 23.104  2.763   1.00 57.20  ? 426  GLU A O     1 
ATOM   3415 C CB    . GLU A 1 426 ? -52.903 26.401  2.526   1.00 58.20  ? 426  GLU A CB    1 
ATOM   3416 C CG    . GLU A 1 426 ? -52.830 27.871  3.080   1.00 59.68  ? 426  GLU A CG    1 
ATOM   3417 C CD    . GLU A 1 426 ? -51.769 28.770  2.379   1.00 59.98  ? 426  GLU A CD    1 
ATOM   3418 O OE1   . GLU A 1 426 ? -51.694 28.775  1.126   0.50 59.39  ? 426  GLU A OE1   1 
ATOM   3419 O OE2   . GLU A 1 426 ? -51.022 29.475  3.095   0.50 58.44  ? 426  GLU A OE2   1 
ATOM   3420 N N     . GLY A 1 427 ? -54.929 23.846  3.074   1.00 57.54  ? 427  GLY A N     1 
ATOM   3421 C CA    . GLY A 1 427 ? -55.581 22.726  2.417   1.00 57.39  ? 427  GLY A CA    1 
ATOM   3422 C C     . GLY A 1 427 ? -55.562 21.376  3.101   1.00 57.53  ? 427  GLY A C     1 
ATOM   3423 O O     . GLY A 1 427 ? -55.419 20.357  2.423   1.00 57.58  ? 427  GLY A O     1 
ATOM   3424 N N     . CYS A 1 428 ? -55.740 21.356  4.424   1.00 57.53  ? 428  CYS A N     1 
ATOM   3425 C CA    . CYS A 1 428 ? -55.777 20.100  5.186   1.00 57.47  ? 428  CYS A CA    1 
ATOM   3426 C C     . CYS A 1 428 ? -57.182 19.608  5.540   1.00 57.44  ? 428  CYS A C     1 
ATOM   3427 O O     . CYS A 1 428 ? -58.126 20.403  5.676   1.00 57.16  ? 428  CYS A O     1 
ATOM   3428 C CB    . CYS A 1 428 ? -54.977 20.219  6.477   1.00 57.50  ? 428  CYS A CB    1 
ATOM   3429 S SG    . CYS A 1 428 ? -53.307 20.771  6.253   1.00 58.06  ? 428  CYS A SG    1 
ATOM   3430 N N     . GLU A 1 429 ? -57.280 18.287  5.710   1.00 57.07  ? 429  GLU A N     1 
ATOM   3431 C CA    . GLU A 1 429 ? -58.487 17.595  6.160   1.00 56.81  ? 429  GLU A CA    1 
ATOM   3432 C C     . GLU A 1 429 ? -58.857 18.014  7.594   1.00 56.22  ? 429  GLU A C     1 
ATOM   3433 O O     . GLU A 1 429 ? -59.997 18.364  7.875   1.00 56.27  ? 429  GLU A O     1 
ATOM   3434 C CB    . GLU A 1 429 ? -58.228 16.085  6.124   1.00 56.96  ? 429  GLU A CB    1 
ATOM   3435 C CG    . GLU A 1 429 ? -59.426 15.210  5.927   1.00 58.95  ? 429  GLU A CG    1 
ATOM   3436 C CD    . GLU A 1 429 ? -59.492 14.607  4.524   1.00 61.97  ? 429  GLU A CD    1 
ATOM   3437 O OE1   . GLU A 1 429 ? -58.504 14.708  3.755   1.00 61.57  ? 429  GLU A OE1   1 
ATOM   3438 O OE2   . GLU A 1 429 ? -60.549 14.019  4.192   1.00 63.68  ? 429  GLU A OE2   1 
ATOM   3439 N N     . GLU A 1 430 ? -57.876 17.977  8.498   1.00 55.69  ? 430  GLU A N     1 
ATOM   3440 C CA    . GLU A 1 430 ? -58.109 18.216  9.928   1.00 54.55  ? 430  GLU A CA    1 
ATOM   3441 C C     . GLU A 1 430 ? -57.105 19.190  10.539  1.00 52.97  ? 430  GLU A C     1 
ATOM   3442 O O     . GLU A 1 430 ? -55.985 19.323  10.072  1.00 52.75  ? 430  GLU A O     1 
ATOM   3443 C CB    . GLU A 1 430 ? -58.085 16.890  10.695  1.00 54.95  ? 430  GLU A CB    1 
ATOM   3444 C CG    . GLU A 1 430 ? -59.005 15.808  10.130  1.00 57.25  ? 430  GLU A CG    1 
ATOM   3445 C CD    . GLU A 1 430 ? -60.486 16.023  10.476  1.00 61.04  ? 430  GLU A CD    1 
ATOM   3446 O OE1   . GLU A 1 430 ? -60.903 17.167  10.796  1.00 61.87  ? 430  GLU A OE1   1 
ATOM   3447 O OE2   . GLU A 1 430 ? -61.240 15.024  10.426  1.00 62.36  ? 430  GLU A OE2   1 
ATOM   3448 N N     . TYR A 1 431 ? -57.539 19.881  11.579  1.00 51.44  ? 431  TYR A N     1 
ATOM   3449 C CA    . TYR A 1 431 ? -56.688 20.796  12.307  1.00 50.08  ? 431  TYR A CA    1 
ATOM   3450 C C     . TYR A 1 431 ? -56.909 20.673  13.804  1.00 49.13  ? 431  TYR A C     1 
ATOM   3451 O O     . TYR A 1 431 ? -58.006 20.319  14.273  1.00 49.33  ? 431  TYR A O     1 
ATOM   3452 C CB    . TYR A 1 431 ? -56.962 22.246  11.905  1.00 50.22  ? 431  TYR A CB    1 
ATOM   3453 C CG    . TYR A 1 431 ? -56.483 22.628  10.532  1.00 50.54  ? 431  TYR A CG    1 
ATOM   3454 C CD1   . TYR A 1 431 ? -55.206 23.140  10.339  1.00 51.28  ? 431  TYR A CD1   1 
ATOM   3455 C CD2   . TYR A 1 431 ? -57.319 22.492  9.424   1.00 51.24  ? 431  TYR A CD2   1 
ATOM   3456 C CE1   . TYR A 1 431 ? -54.763 23.504  9.057   1.00 52.90  ? 431  TYR A CE1   1 
ATOM   3457 C CE2   . TYR A 1 431 ? -56.899 22.847  8.145   1.00 51.92  ? 431  TYR A CE2   1 
ATOM   3458 C CZ    . TYR A 1 431 ? -55.623 23.358  7.964   1.00 52.72  ? 431  TYR A CZ    1 
ATOM   3459 O OH    . TYR A 1 431 ? -55.204 23.699  6.697   1.00 50.66  ? 431  TYR A OH    1 
ATOM   3460 N N     . ASP A 1 432 ? -55.849 20.954  14.551  1.00 47.54  ? 432  ASP A N     1 
ATOM   3461 C CA    . ASP A 1 432 ? -55.973 21.243  15.952  1.00 45.61  ? 432  ASP A CA    1 
ATOM   3462 C C     . ASP A 1 432 ? -55.676 22.709  16.075  1.00 44.66  ? 432  ASP A C     1 
ATOM   3463 O O     . ASP A 1 432 ? -54.817 23.244  15.367  1.00 44.19  ? 432  ASP A O     1 
ATOM   3464 C CB    . ASP A 1 432 ? -54.999 20.412  16.762  1.00 45.57  ? 432  ASP A CB    1 
ATOM   3465 C CG    . ASP A 1 432 ? -55.465 18.997  16.941  1.00 44.55  ? 432  ASP A CG    1 
ATOM   3466 O OD1   . ASP A 1 432 ? -56.359 18.583  16.200  1.00 44.48  ? 432  ASP A OD1   1 
ATOM   3467 O OD2   . ASP A 1 432 ? -54.937 18.282  17.814  1.00 45.28  ? 432  ASP A OD2   1 
ATOM   3468 N N     . VAL A 1 433 ? -56.415 23.364  16.952  1.00 43.73  ? 433  VAL A N     1 
ATOM   3469 C CA    . VAL A 1 433 ? -56.295 24.802  17.098  1.00 43.41  ? 433  VAL A CA    1 
ATOM   3470 C C     . VAL A 1 433 ? -55.955 25.108  18.542  1.00 43.42  ? 433  VAL A C     1 
ATOM   3471 O O     . VAL A 1 433 ? -56.669 24.701  19.451  1.00 43.41  ? 433  VAL A O     1 
ATOM   3472 C CB    . VAL A 1 433 ? -57.589 25.560  16.628  1.00 43.30  ? 433  VAL A CB    1 
ATOM   3473 C CG1   . VAL A 1 433 ? -57.442 27.069  16.829  1.00 42.07  ? 433  VAL A CG1   1 
ATOM   3474 C CG2   . VAL A 1 433 ? -57.903 25.241  15.149  1.00 42.17  ? 433  VAL A CG2   1 
ATOM   3475 N N     . ALA A 1 434 ? -54.847 25.807  18.755  1.00 43.38  ? 434  ALA A N     1 
ATOM   3476 C CA    . ALA A 1 434 ? -54.418 26.093  20.109  1.00 43.57  ? 434  ALA A CA    1 
ATOM   3477 C C     . ALA A 1 434 ? -55.427 26.987  20.832  1.00 43.68  ? 434  ALA A C     1 
ATOM   3478 O O     . ALA A 1 434 ? -55.926 27.957  20.272  1.00 43.69  ? 434  ALA A O     1 
ATOM   3479 C CB    . ALA A 1 434 ? -53.044 26.714  20.106  1.00 43.57  ? 434  ALA A CB    1 
ATOM   3480 N N     . PRO A 1 435 ? -55.743 26.653  22.082  1.00 43.88  ? 435  PRO A N     1 
ATOM   3481 C CA    . PRO A 1 435 ? -56.632 27.502  22.856  1.00 44.02  ? 435  PRO A CA    1 
ATOM   3482 C C     . PRO A 1 435 ? -56.102 28.930  22.981  1.00 44.58  ? 435  PRO A C     1 
ATOM   3483 O O     . PRO A 1 435 ? -54.884 29.146  22.988  1.00 44.47  ? 435  PRO A O     1 
ATOM   3484 C CB    . PRO A 1 435 ? -56.635 26.834  24.224  1.00 43.75  ? 435  PRO A CB    1 
ATOM   3485 C CG    . PRO A 1 435 ? -56.338 25.420  23.941  1.00 44.17  ? 435  PRO A CG    1 
ATOM   3486 C CD    . PRO A 1 435 ? -55.318 25.467  22.841  1.00 43.91  ? 435  PRO A CD    1 
ATOM   3487 N N     . GLN A 1 436 ? -57.028 29.890  23.060  1.00 45.02  ? 436  GLN A N     1 
ATOM   3488 C CA    . GLN A 1 436 ? -56.721 31.297  23.318  1.00 45.27  ? 436  GLN A CA    1 
ATOM   3489 C C     . GLN A 1 436 ? -55.930 31.979  22.209  1.00 45.33  ? 436  GLN A C     1 
ATOM   3490 O O     . GLN A 1 436 ? -56.179 33.124  21.880  1.00 45.91  ? 436  GLN A O     1 
ATOM   3491 C CB    . GLN A 1 436 ? -56.015 31.478  24.680  1.00 45.48  ? 436  GLN A CB    1 
ATOM   3492 C CG    . GLN A 1 436 ? -56.931 31.249  25.912  1.00 45.93  ? 436  GLN A CG    1 
ATOM   3493 N N     . VAL A 1 437 ? -54.986 31.282  21.611  1.00 45.37  ? 437  VAL A N     1 
ATOM   3494 C CA    . VAL A 1 437 ? -53.973 31.970  20.841  1.00 44.98  ? 437  VAL A CA    1 
ATOM   3495 C C     . VAL A 1 437 ? -54.032 31.590  19.365  1.00 44.88  ? 437  VAL A C     1 
ATOM   3496 O O     . VAL A 1 437 ? -53.392 32.218  18.532  1.00 45.47  ? 437  VAL A O     1 
ATOM   3497 C CB    . VAL A 1 437 ? -52.580 31.771  21.503  1.00 44.89  ? 437  VAL A CB    1 
ATOM   3498 C CG1   . VAL A 1 437 ? -51.902 30.487  21.018  1.00 44.76  ? 437  VAL A CG1   1 
ATOM   3499 C CG2   . VAL A 1 437 ? -51.716 32.987  21.304  1.00 45.34  ? 437  VAL A CG2   1 
ATOM   3500 N N     . GLY A 1 438 ? -54.787 30.545  19.054  1.00 44.50  ? 438  GLY A N     1 
ATOM   3501 C CA    . GLY A 1 438 ? -55.314 30.358  17.709  1.00 44.45  ? 438  GLY A CA    1 
ATOM   3502 C C     . GLY A 1 438 ? -54.544 29.648  16.614  1.00 44.60  ? 438  GLY A C     1 
ATOM   3503 O O     . GLY A 1 438 ? -55.066 29.478  15.507  1.00 45.08  ? 438  GLY A O     1 
ATOM   3504 N N     . HIS A 1 439 ? -53.324 29.209  16.882  1.00 44.42  ? 439  HIS A N     1 
ATOM   3505 C CA    . HIS A 1 439 ? -52.519 28.609  15.816  1.00 44.28  ? 439  HIS A CA    1 
ATOM   3506 C C     . HIS A 1 439 ? -53.079 27.267  15.339  1.00 44.33  ? 439  HIS A C     1 
ATOM   3507 O O     . HIS A 1 439 ? -53.469 26.418  16.143  1.00 44.32  ? 439  HIS A O     1 
ATOM   3508 C CB    . HIS A 1 439 ? -51.059 28.504  16.243  1.00 44.21  ? 439  HIS A CB    1 
ATOM   3509 C CG    . HIS A 1 439 ? -50.492 29.790  16.769  1.00 45.22  ? 439  HIS A CG    1 
ATOM   3510 N ND1   . HIS A 1 439 ? -50.306 30.904  15.977  1.00 44.43  ? 439  HIS A ND1   1 
ATOM   3511 C CD2   . HIS A 1 439 ? -50.071 30.139  18.012  1.00 45.54  ? 439  HIS A CD2   1 
ATOM   3512 C CE1   . HIS A 1 439 ? -49.795 31.880  16.709  1.00 45.03  ? 439  HIS A CE1   1 
ATOM   3513 N NE2   . HIS A 1 439 ? -49.639 31.442  17.946  1.00 44.61  ? 439  HIS A NE2   1 
ATOM   3514 N N     . LYS A 1 440 ? -53.154 27.091  14.027  1.00 44.45  ? 440  LYS A N     1 
ATOM   3515 C CA    . LYS A 1 440 ? -53.708 25.868  13.464  1.00 44.95  ? 440  LYS A CA    1 
ATOM   3516 C C     . LYS A 1 440 ? -52.579 24.888  13.148  1.00 44.55  ? 440  LYS A C     1 
ATOM   3517 O O     . LYS A 1 440 ? -51.573 25.269  12.535  1.00 44.49  ? 440  LYS A O     1 
ATOM   3518 C CB    . LYS A 1 440 ? -54.494 26.155  12.174  1.00 45.35  ? 440  LYS A CB    1 
ATOM   3519 C CG    . LYS A 1 440 ? -55.349 27.450  12.132  1.00 48.33  ? 440  LYS A CG    1 
ATOM   3520 C CD    . LYS A 1 440 ? -55.433 28.079  10.681  1.00 51.65  ? 440  LYS A CD    1 
ATOM   3521 C CE    . LYS A 1 440 ? -56.314 27.261  9.684   1.00 53.38  ? 440  LYS A CE    1 
ATOM   3522 N NZ    . LYS A 1 440 ? -55.728 27.181  8.292   1.00 52.82  ? 440  LYS A NZ    1 
ATOM   3523 N N     . PHE A 1 441 ? -52.742 23.627  13.548  1.00 43.92  ? 441  PHE A N     1 
ATOM   3524 C CA    . PHE A 1 441 ? -51.782 22.596  13.150  1.00 43.32  ? 441  PHE A CA    1 
ATOM   3525 C C     . PHE A 1 441 ? -52.411 21.499  12.296  1.00 43.49  ? 441  PHE A C     1 
ATOM   3526 O O     . PHE A 1 441 ? -53.390 20.852  12.681  1.00 43.41  ? 441  PHE A O     1 
ATOM   3527 C CB    . PHE A 1 441 ? -50.999 22.037  14.355  1.00 42.88  ? 441  PHE A CB    1 
ATOM   3528 C CG    . PHE A 1 441 ? -50.135 23.061  15.019  1.00 41.98  ? 441  PHE A CG    1 
ATOM   3529 C CD1   . PHE A 1 441 ? -48.855 23.325  14.546  1.00 42.77  ? 441  PHE A CD1   1 
ATOM   3530 C CD2   . PHE A 1 441 ? -50.618 23.807  16.088  1.00 40.63  ? 441  PHE A CD2   1 
ATOM   3531 C CE1   . PHE A 1 441 ? -48.071 24.320  15.143  1.00 42.41  ? 441  PHE A CE1   1 
ATOM   3532 C CE2   . PHE A 1 441 ? -49.848 24.782  16.692  1.00 39.07  ? 441  PHE A CE2   1 
ATOM   3533 C CZ    . PHE A 1 441 ? -48.583 25.048  16.224  1.00 40.70  ? 441  PHE A CZ    1 
ATOM   3534 N N     . CYS A 1 442 ? -51.838 21.304  11.118  1.00 43.57  ? 442  CYS A N     1 
ATOM   3535 C CA    . CYS A 1 442 ? -52.294 20.269  10.223  1.00 44.05  ? 442  CYS A CA    1 
ATOM   3536 C C     . CYS A 1 442 ? -52.277 18.922  10.930  1.00 43.45  ? 442  CYS A C     1 
ATOM   3537 O O     . CYS A 1 442 ? -51.396 18.661  11.730  1.00 43.75  ? 442  CYS A O     1 
ATOM   3538 C CB    . CYS A 1 442 ? -51.377 20.212  9.016   1.00 43.99  ? 442  CYS A CB    1 
ATOM   3539 S SG    . CYS A 1 442 ? -51.710 18.765  7.999   1.00 48.67  ? 442  CYS A SG    1 
ATOM   3540 N N     . LYS A 1 443 ? -53.228 18.052  10.630  1.00 43.22  ? 443  LYS A N     1 
ATOM   3541 C CA    . LYS A 1 443 ? -53.197 16.733  11.238  1.00 43.12  ? 443  LYS A CA    1 
ATOM   3542 C C     . LYS A 1 443 ? -53.146 15.590  10.251  1.00 43.50  ? 443  LYS A C     1 
ATOM   3543 O O     . LYS A 1 443 ? -53.254 14.431  10.637  1.00 43.35  ? 443  LYS A O     1 
ATOM   3544 C CB    . LYS A 1 443 ? -54.335 16.563  12.221  1.00 42.78  ? 443  LYS A CB    1 
ATOM   3545 C CG    . LYS A 1 443 ? -54.145 17.406  13.466  1.00 43.47  ? 443  LYS A CG    1 
ATOM   3546 C CD    . LYS A 1 443 ? -54.736 16.716  14.660  1.00 44.47  ? 443  LYS A CD    1 
ATOM   3547 C CE    . LYS A 1 443 ? -53.711 15.849  15.344  1.00 44.68  ? 443  LYS A CE    1 
ATOM   3548 N NZ    . LYS A 1 443 ? -54.430 14.984  16.300  1.00 46.15  ? 443  LYS A NZ    1 
ATOM   3549 N N     . ASP A 1 444 ? -52.927 15.909  8.982   1.00 44.19  ? 444  ASP A N     1 
ATOM   3550 C CA    . ASP A 1 444 ? -52.975 14.901  7.929   1.00 44.99  ? 444  ASP A CA    1 
ATOM   3551 C C     . ASP A 1 444 ? -51.825 13.900  7.963   1.00 45.35  ? 444  ASP A C     1 
ATOM   3552 O O     . ASP A 1 444 ? -52.044 12.693  7.840   1.00 45.75  ? 444  ASP A O     1 
ATOM   3553 C CB    . ASP A 1 444 ? -53.154 15.569  6.565   1.00 45.08  ? 444  ASP A CB    1 
ATOM   3554 C CG    . ASP A 1 444 ? -54.541 16.172  6.416   1.00 46.56  ? 444  ASP A CG    1 
ATOM   3555 O OD1   . ASP A 1 444 ? -55.373 15.907  7.313   1.00 47.19  ? 444  ASP A OD1   1 
ATOM   3556 O OD2   . ASP A 1 444 ? -54.812 16.911  5.443   1.00 47.76  ? 444  ASP A OD2   1 
ATOM   3557 N N     . PHE A 1 445 ? -50.611 14.410  8.156   1.00 45.73  ? 445  PHE A N     1 
ATOM   3558 C CA    . PHE A 1 445 ? -49.393 13.600  8.276   1.00 45.53  ? 445  PHE A CA    1 
ATOM   3559 C C     . PHE A 1 445 ? -48.719 13.953  9.606   1.00 44.80  ? 445  PHE A C     1 
ATOM   3560 O O     . PHE A 1 445 ? -48.892 15.066  10.106  1.00 44.79  ? 445  PHE A O     1 
ATOM   3561 C CB    . PHE A 1 445 ? -48.455 13.942  7.127   1.00 45.97  ? 445  PHE A CB    1 
ATOM   3562 C CG    . PHE A 1 445 ? -48.227 15.425  6.963   1.00 48.27  ? 445  PHE A CG    1 
ATOM   3563 C CD1   . PHE A 1 445 ? -47.162 16.066  7.627   1.00 50.66  ? 445  PHE A CD1   1 
ATOM   3564 C CD2   . PHE A 1 445 ? -49.086 16.191  6.173   1.00 49.52  ? 445  PHE A CD2   1 
ATOM   3565 C CE1   . PHE A 1 445 ? -46.944 17.462  7.494   1.00 51.95  ? 445  PHE A CE1   1 
ATOM   3566 C CE2   . PHE A 1 445 ? -48.884 17.583  6.029   1.00 51.87  ? 445  PHE A CE2   1 
ATOM   3567 C CZ    . PHE A 1 445 ? -47.809 18.225  6.693   1.00 52.53  ? 445  PHE A CZ    1 
ATOM   3568 N N     . PRO A 1 446 ? -47.965 13.013  10.204  1.00 44.11  ? 446  PRO A N     1 
ATOM   3569 C CA    . PRO A 1 446 ? -47.210 13.448  11.378  1.00 43.26  ? 446  PRO A CA    1 
ATOM   3570 C C     . PRO A 1 446 ? -46.121 14.467  10.995  1.00 42.18  ? 446  PRO A C     1 
ATOM   3571 O O     . PRO A 1 446 ? -45.436 14.293  9.996   1.00 42.15  ? 446  PRO A O     1 
ATOM   3572 C CB    . PRO A 1 446 ? -46.595 12.142  11.901  1.00 43.12  ? 446  PRO A CB    1 
ATOM   3573 C CG    . PRO A 1 446 ? -46.577 11.233  10.737  1.00 43.50  ? 446  PRO A CG    1 
ATOM   3574 C CD    . PRO A 1 446 ? -47.762 11.581  9.919   1.00 44.05  ? 446  PRO A CD    1 
ATOM   3575 N N     . GLY A 1 447 ? -45.990 15.535  11.769  1.00 41.11  ? 447  GLY A N     1 
ATOM   3576 C CA    . GLY A 1 447 ? -44.905 16.490  11.560  1.00 39.66  ? 447  GLY A CA    1 
ATOM   3577 C C     . GLY A 1 447 ? -43.556 15.981  12.038  1.00 38.74  ? 447  GLY A C     1 
ATOM   3578 O O     . GLY A 1 447 ? -43.471 15.026  12.821  1.00 38.57  ? 447  GLY A O     1 
ATOM   3579 N N     . PHE A 1 448 ? -42.499 16.644  11.582  1.00 37.73  ? 448  PHE A N     1 
ATOM   3580 C CA    . PHE A 1 448 ? -41.121 16.268  11.899  1.00 36.88  ? 448  PHE A CA    1 
ATOM   3581 C C     . PHE A 1 448 ? -40.873 15.988  13.399  1.00 36.69  ? 448  PHE A C     1 
ATOM   3582 O O     . PHE A 1 448 ? -40.534 14.850  13.794  1.00 36.56  ? 448  PHE A O     1 
ATOM   3583 C CB    . PHE A 1 448 ? -40.186 17.363  11.392  1.00 36.81  ? 448  PHE A CB    1 
ATOM   3584 C CG    . PHE A 1 448 ? -38.720 17.058  11.559  1.00 36.34  ? 448  PHE A CG    1 
ATOM   3585 C CD1   . PHE A 1 448 ? -38.174 15.883  11.077  1.00 36.46  ? 448  PHE A CD1   1 
ATOM   3586 C CD2   . PHE A 1 448 ? -37.880 17.979  12.149  1.00 35.49  ? 448  PHE A CD2   1 
ATOM   3587 C CE1   . PHE A 1 448 ? -36.829 15.627  11.204  1.00 36.18  ? 448  PHE A CE1   1 
ATOM   3588 C CE2   . PHE A 1 448 ? -36.529 17.725  12.277  1.00 35.13  ? 448  PHE A CE2   1 
ATOM   3589 C CZ    . PHE A 1 448 ? -36.004 16.553  11.811  1.00 35.39  ? 448  PHE A CZ    1 
ATOM   3590 N N     . ILE A 1 449 ? -41.046 17.025  14.222  1.00 35.47  ? 449  ILE A N     1 
ATOM   3591 C CA    . ILE A 1 449 ? -40.739 16.934  15.644  1.00 34.14  ? 449  ILE A CA    1 
ATOM   3592 C C     . ILE A 1 449 ? -41.741 16.046  16.431  1.00 33.82  ? 449  ILE A C     1 
ATOM   3593 O O     . ILE A 1 449 ? -41.311 15.234  17.254  1.00 33.96  ? 449  ILE A O     1 
ATOM   3594 C CB    . ILE A 1 449 ? -40.500 18.348  16.237  1.00 33.79  ? 449  ILE A CB    1 
ATOM   3595 C CG1   . ILE A 1 449 ? -39.122 18.830  15.785  1.00 34.07  ? 449  ILE A CG1   1 
ATOM   3596 C CG2   . ILE A 1 449 ? -40.610 18.358  17.742  1.00 32.18  ? 449  ILE A CG2   1 
ATOM   3597 C CD1   . ILE A 1 449 ? -38.936 20.335  15.770  1.00 34.19  ? 449  ILE A CD1   1 
ATOM   3598 N N     . PRO A 1 450 ? -43.059 16.158  16.165  1.00 33.09  ? 450  PRO A N     1 
ATOM   3599 C CA    . PRO A 1 450 ? -43.961 15.212  16.828  1.00 32.92  ? 450  PRO A CA    1 
ATOM   3600 C C     . PRO A 1 450 ? -43.615 13.737  16.518  1.00 32.91  ? 450  PRO A C     1 
ATOM   3601 O O     . PRO A 1 450 ? -43.576 12.889  17.417  1.00 32.66  ? 450  PRO A O     1 
ATOM   3602 C CB    . PRO A 1 450 ? -45.331 15.595  16.266  1.00 32.75  ? 450  PRO A CB    1 
ATOM   3603 C CG    . PRO A 1 450 ? -45.173 17.029  15.847  1.00 32.84  ? 450  PRO A CG    1 
ATOM   3604 C CD    . PRO A 1 450 ? -43.799 17.105  15.314  1.00 32.91  ? 450  PRO A CD    1 
ATOM   3605 N N     . SER A 1 451 ? -43.354 13.464  15.245  1.00 32.77  ? 451  SER A N     1 
ATOM   3606 C CA    . SER A 1 451 ? -42.829 12.201  14.756  1.00 32.31  ? 451  SER A CA    1 
ATOM   3607 C C     . SER A 1 451 ? -41.700 11.602  15.630  1.00 32.07  ? 451  SER A C     1 
ATOM   3608 O O     . SER A 1 451 ? -41.765 10.453  16.050  1.00 32.33  ? 451  SER A O     1 
ATOM   3609 C CB    . SER A 1 451 ? -42.323 12.482  13.348  1.00 32.31  ? 451  SER A CB    1 
ATOM   3610 O OG    . SER A 1 451 ? -42.004 11.314  12.649  1.00 34.76  ? 451  SER A OG    1 
ATOM   3611 N N     . LEU A 1 452 ? -40.658 12.383  15.908  1.00 31.75  ? 452  LEU A N     1 
ATOM   3612 C CA    . LEU A 1 452 ? -39.493 11.887  16.657  1.00 30.51  ? 452  LEU A CA    1 
ATOM   3613 C C     . LEU A 1 452 ? -39.770 11.755  18.160  1.00 29.80  ? 452  LEU A C     1 
ATOM   3614 O O     . LEU A 1 452 ? -39.220 10.873  18.842  1.00 29.94  ? 452  LEU A O     1 
ATOM   3615 C CB    . LEU A 1 452 ? -38.293 12.808  16.427  1.00 30.34  ? 452  LEU A CB    1 
ATOM   3616 C CG    . LEU A 1 452 ? -37.911 13.151  14.980  1.00 30.39  ? 452  LEU A CG    1 
ATOM   3617 C CD1   . LEU A 1 452 ? -37.153 14.494  14.914  1.00 30.23  ? 452  LEU A CD1   1 
ATOM   3618 C CD2   . LEU A 1 452 ? -37.108 12.024  14.284  1.00 28.70  ? 452  LEU A CD2   1 
ATOM   3619 N N     . LEU A 1 453 ? -40.598 12.648  18.689  1.00 28.63  ? 453  LEU A N     1 
ATOM   3620 C CA    . LEU A 1 453 ? -40.966 12.547  20.089  1.00 27.87  ? 453  LEU A CA    1 
ATOM   3621 C C     . LEU A 1 453 ? -41.801 11.296  20.303  1.00 27.92  ? 453  LEU A C     1 
ATOM   3622 O O     . LEU A 1 453 ? -41.569 10.563  21.264  1.00 28.67  ? 453  LEU A O     1 
ATOM   3623 C CB    . LEU A 1 453 ? -41.680 13.806  20.593  1.00 27.42  ? 453  LEU A CB    1 
ATOM   3624 C CG    . LEU A 1 453 ? -40.845 15.074  20.755  1.00 25.96  ? 453  LEU A CG    1 
ATOM   3625 C CD1   . LEU A 1 453 ? -41.750 16.253  20.990  1.00 25.30  ? 453  LEU A CD1   1 
ATOM   3626 C CD2   . LEU A 1 453 ? -39.868 14.928  21.900  1.00 24.97  ? 453  LEU A CD2   1 
ATOM   3627 N N     . GLY A 1 454 ? -42.745 11.035  19.396  1.00 27.46  ? 454  GLY A N     1 
ATOM   3628 C CA    . GLY A 1 454 ? -43.469 9.769   19.376  1.00 26.94  ? 454  GLY A CA    1 
ATOM   3629 C C     . GLY A 1 454 ? -42.541 8.572   19.518  1.00 27.17  ? 454  GLY A C     1 
ATOM   3630 O O     . GLY A 1 454 ? -42.793 7.655   20.321  1.00 27.09  ? 454  GLY A O     1 
ATOM   3631 N N     . ASP A 1 455 ? -41.439 8.579   18.774  1.00 27.04  ? 455  ASP A N     1 
ATOM   3632 C CA    . ASP A 1 455 ? -40.477 7.501   18.917  1.00 27.12  ? 455  ASP A CA    1 
ATOM   3633 C C     . ASP A 1 455 ? -39.768 7.507   20.270  1.00 27.53  ? 455  ASP A C     1 
ATOM   3634 O O     . ASP A 1 455 ? -39.627 6.446   20.918  1.00 27.91  ? 455  ASP A O     1 
ATOM   3635 C CB    . ASP A 1 455 ? -39.498 7.504   17.775  1.00 27.11  ? 455  ASP A CB    1 
ATOM   3636 C CG    . ASP A 1 455 ? -40.162 7.222   16.442  1.00 28.49  ? 455  ASP A CG    1 
ATOM   3637 O OD1   . ASP A 1 455 ? -41.238 6.590   16.408  1.00 30.48  ? 455  ASP A OD1   1 
ATOM   3638 O OD2   . ASP A 1 455 ? -39.601 7.624   15.405  1.00 31.05  ? 455  ASP A OD2   1 
ATOM   3639 N N     . LEU A 1 456 ? -39.352 8.677   20.743  1.00 27.37  ? 456  LEU A N     1 
ATOM   3640 C CA    . LEU A 1 456 ? -38.685 8.679   22.048  1.00 27.70  ? 456  LEU A CA    1 
ATOM   3641 C C     . LEU A 1 456 ? -39.593 8.189   23.166  1.00 27.43  ? 456  LEU A C     1 
ATOM   3642 O O     . LEU A 1 456 ? -39.166 7.441   24.036  1.00 26.77  ? 456  LEU A O     1 
ATOM   3643 C CB    . LEU A 1 456 ? -38.129 10.052  22.411  1.00 27.91  ? 456  LEU A CB    1 
ATOM   3644 C CG    . LEU A 1 456 ? -36.948 10.565  21.605  1.00 27.87  ? 456  LEU A CG    1 
ATOM   3645 C CD1   . LEU A 1 456 ? -36.727 12.041  21.954  1.00 27.99  ? 456  LEU A CD1   1 
ATOM   3646 C CD2   . LEU A 1 456 ? -35.714 9.715   21.852  1.00 25.50  ? 456  LEU A CD2   1 
ATOM   3647 N N     . LEU A 1 457 ? -40.845 8.606   23.146  1.00 27.99  ? 457  LEU A N     1 
ATOM   3648 C CA    . LEU A 1 457 ? -41.724 8.251   24.241  1.00 29.42  ? 457  LEU A CA    1 
ATOM   3649 C C     . LEU A 1 457 ? -42.083 6.775   24.201  1.00 30.29  ? 457  LEU A C     1 
ATOM   3650 O O     . LEU A 1 457 ? -42.092 6.112   25.239  1.00 29.86  ? 457  LEU A O     1 
ATOM   3651 C CB    . LEU A 1 457 ? -42.950 9.164   24.303  1.00 29.45  ? 457  LEU A CB    1 
ATOM   3652 C CG    . LEU A 1 457 ? -42.672 10.646  24.650  1.00 30.11  ? 457  LEU A CG    1 
ATOM   3653 C CD1   . LEU A 1 457 ? -43.969 11.306  25.111  1.00 30.16  ? 457  LEU A CD1   1 
ATOM   3654 C CD2   . LEU A 1 457 ? -41.551 10.848  25.725  1.00 28.26  ? 457  LEU A CD2   1 
ATOM   3655 N N     . GLU A 1 458 ? -42.310 6.252   22.997  1.00 31.61  ? 458  GLU A N     1 
ATOM   3656 C CA    . GLU A 1 458 ? -42.536 4.831   22.814  1.00 33.34  ? 458  GLU A CA    1 
ATOM   3657 C C     . GLU A 1 458 ? -41.373 4.030   23.407  1.00 33.22  ? 458  GLU A C     1 
ATOM   3658 O O     . GLU A 1 458 ? -41.568 3.142   24.243  1.00 32.91  ? 458  GLU A O     1 
ATOM   3659 C CB    . GLU A 1 458 ? -42.666 4.537   21.330  1.00 34.28  ? 458  GLU A CB    1 
ATOM   3660 C CG    . GLU A 1 458 ? -43.277 3.188   20.978  1.00 39.12  ? 458  GLU A CG    1 
ATOM   3661 C CD    . GLU A 1 458 ? -43.809 3.176   19.538  1.00 48.42  ? 458  GLU A CD    1 
ATOM   3662 O OE1   . GLU A 1 458 ? -43.726 2.100   18.884  1.00 51.41  ? 458  GLU A OE1   1 
ATOM   3663 O OE2   . GLU A 1 458 ? -44.301 4.251   19.053  1.00 51.39  ? 458  GLU A OE2   1 
ATOM   3664 N N     . GLU A 1 459 ? -40.163 4.367   22.962  1.00 33.45  ? 459  GLU A N     1 
ATOM   3665 C CA    . GLU A 1 459 ? -38.927 3.818   23.506  1.00 33.21  ? 459  GLU A CA    1 
ATOM   3666 C C     . GLU A 1 459 ? -38.907 3.910   25.047  1.00 32.67  ? 459  GLU A C     1 
ATOM   3667 O O     . GLU A 1 459 ? -38.633 2.916   25.708  1.00 33.18  ? 459  GLU A O     1 
ATOM   3668 C CB    . GLU A 1 459 ? -37.722 4.477   22.787  1.00 33.58  ? 459  GLU A CB    1 
ATOM   3669 C CG    . GLU A 1 459 ? -36.274 4.215   23.278  1.00 35.56  ? 459  GLU A CG    1 
ATOM   3670 C CD    . GLU A 1 459 ? -35.889 2.759   23.395  1.00 39.79  ? 459  GLU A CD    1 
ATOM   3671 O OE1   . GLU A 1 459 ? -36.748 1.896   23.139  1.00 42.62  ? 459  GLU A OE1   1 
ATOM   3672 O OE2   . GLU A 1 459 ? -34.721 2.469   23.769  1.00 41.18  ? 459  GLU A OE2   1 
ATOM   3673 N N     . ARG A 1 460 ? -39.254 5.053   25.630  1.00 31.88  ? 460  ARG A N     1 
ATOM   3674 C CA    . ARG A 1 460 ? -39.250 5.150   27.085  1.00 31.86  ? 460  ARG A CA    1 
ATOM   3675 C C     . ARG A 1 460 ? -40.189 4.132   27.738  1.00 32.60  ? 460  ARG A C     1 
ATOM   3676 O O     . ARG A 1 460 ? -39.867 3.528   28.757  1.00 31.89  ? 460  ARG A O     1 
ATOM   3677 C CB    . ARG A 1 460 ? -39.598 6.573   27.562  1.00 31.66  ? 460  ARG A CB    1 
ATOM   3678 C CG    . ARG A 1 460 ? -39.337 6.792   29.051  1.00 28.53  ? 460  ARG A CG    1 
ATOM   3679 C CD    . ARG A 1 460 ? -39.840 8.107   29.539  1.00 26.94  ? 460  ARG A CD    1 
ATOM   3680 N NE    . ARG A 1 460 ? -39.655 8.236   30.988  1.00 28.18  ? 460  ARG A NE    1 
ATOM   3681 C CZ    . ARG A 1 460 ? -40.331 9.077   31.780  1.00 27.22  ? 460  ARG A CZ    1 
ATOM   3682 N NH1   . ARG A 1 460 ? -41.249 9.897   31.281  1.00 25.37  ? 460  ARG A NH1   1 
ATOM   3683 N NH2   . ARG A 1 460 ? -40.091 9.099   33.085  1.00 26.93  ? 460  ARG A NH2   1 
ATOM   3684 N N     . GLN A 1 461 ? -41.361 3.965   27.132  1.00 34.17  ? 461  GLN A N     1 
ATOM   3685 C CA    . GLN A 1 461 ? -42.417 3.084   27.639  1.00 35.05  ? 461  GLN A CA    1 
ATOM   3686 C C     . GLN A 1 461 ? -41.939 1.643   27.588  1.00 34.98  ? 461  GLN A C     1 
ATOM   3687 O O     . GLN A 1 461 ? -42.175 0.866   28.519  1.00 35.19  ? 461  GLN A O     1 
ATOM   3688 C CB    . GLN A 1 461 ? -43.704 3.278   26.827  1.00 35.05  ? 461  GLN A CB    1 
ATOM   3689 C CG    . GLN A 1 461 ? -45.010 3.104   27.628  1.00 39.42  ? 461  GLN A CG    1 
ATOM   3690 C CD    . GLN A 1 461 ? -45.205 4.137   28.785  1.00 43.43  ? 461  GLN A CD    1 
ATOM   3691 O OE1   . GLN A 1 461 ? -44.591 4.035   29.868  1.00 42.70  ? 461  GLN A OE1   1 
ATOM   3692 N NE2   . GLN A 1 461 ? -46.100 5.108   28.557  1.00 44.79  ? 461  GLN A NE2   1 
ATOM   3693 N N     . LYS A 1 462 ? -41.234 1.316   26.513  1.00 35.11  ? 462  LYS A N     1 
ATOM   3694 C CA    . LYS A 1 462 ? -40.667 0.002   26.310  1.00 36.19  ? 462  LYS A CA    1 
ATOM   3695 C C     . LYS A 1 462 ? -39.658 -0.315  27.409  1.00 35.87  ? 462  LYS A C     1 
ATOM   3696 O O     . LYS A 1 462 ? -39.639 -1.422  27.966  1.00 36.07  ? 462  LYS A O     1 
ATOM   3697 C CB    . LYS A 1 462 ? -40.010 -0.043  24.932  1.00 36.86  ? 462  LYS A CB    1 
ATOM   3698 C CG    . LYS A 1 462 ? -39.564 -1.413  24.461  1.00 40.60  ? 462  LYS A CG    1 
ATOM   3699 C CD    . LYS A 1 462 ? -38.690 -1.305  23.180  1.00 45.68  ? 462  LYS A CD    1 
ATOM   3700 C CE    . LYS A 1 462 ? -37.702 -2.492  23.059  1.00 47.21  ? 462  LYS A CE    1 
ATOM   3701 N NZ    . LYS A 1 462 ? -36.307 -2.035  22.765  1.00 48.53  ? 462  LYS A NZ    1 
ATOM   3702 N N     . VAL A 1 463 ? -38.833 0.675   27.730  1.00 35.67  ? 463  VAL A N     1 
ATOM   3703 C CA    . VAL A 1 463 ? -37.775 0.509   28.729  1.00 35.30  ? 463  VAL A CA    1 
ATOM   3704 C C     . VAL A 1 463 ? -38.408 0.342   30.101  1.00 35.83  ? 463  VAL A C     1 
ATOM   3705 O O     . VAL A 1 463 ? -38.063 -0.577  30.835  1.00 36.12  ? 463  VAL A O     1 
ATOM   3706 C CB    . VAL A 1 463 ? -36.763 1.691   28.697  1.00 34.70  ? 463  VAL A CB    1 
ATOM   3707 C CG1   . VAL A 1 463 ? -35.750 1.601   29.812  1.00 33.73  ? 463  VAL A CG1   1 
ATOM   3708 C CG2   . VAL A 1 463 ? -36.044 1.716   27.380  1.00 34.01  ? 463  VAL A CG2   1 
ATOM   3709 N N     . LYS A 1 464 ? -39.366 1.212   30.412  1.00 36.43  ? 464  LYS A N     1 
ATOM   3710 C CA    . LYS A 1 464 ? -40.032 1.221   31.700  1.00 36.76  ? 464  LYS A CA    1 
ATOM   3711 C C     . LYS A 1 464 ? -40.709 -0.091  32.030  1.00 37.54  ? 464  LYS A C     1 
ATOM   3712 O O     . LYS A 1 464 ? -40.788 -0.453  33.200  1.00 37.71  ? 464  LYS A O     1 
ATOM   3713 C CB    . LYS A 1 464 ? -41.024 2.375   31.784  1.00 36.26  ? 464  LYS A CB    1 
ATOM   3714 C CG    . LYS A 1 464 ? -40.533 3.479   32.668  1.00 35.28  ? 464  LYS A CG    1 
ATOM   3715 C CD    . LYS A 1 464 ? -41.473 4.642   32.647  1.00 34.92  ? 464  LYS A CD    1 
ATOM   3716 C CE    . LYS A 1 464 ? -41.302 5.518   33.895  1.00 36.37  ? 464  LYS A CE    1 
ATOM   3717 N N     . LYS A 1 465 ? -41.177 -0.796  31.000  1.00 38.50  ? 465  LYS A N     1 
ATOM   3718 C CA    . LYS A 1 465 ? -41.816 -2.096  31.160  1.00 39.64  ? 465  LYS A CA    1 
ATOM   3719 C C     . LYS A 1 465 ? -40.762 -3.167  31.384  1.00 40.12  ? 465  LYS A C     1 
ATOM   3720 O O     . LYS A 1 465 ? -40.912 -4.029  32.262  1.00 40.41  ? 465  LYS A O     1 
ATOM   3721 C CB    . LYS A 1 465 ? -42.674 -2.431  29.935  1.00 40.09  ? 465  LYS A CB    1 
ATOM   3722 C CG    . LYS A 1 465 ? -42.872 -3.940  29.672  1.00 41.71  ? 465  LYS A CG    1 
ATOM   3723 C CD    . LYS A 1 465 ? -43.870 -4.226  28.533  1.00 43.00  ? 465  LYS A CD    1 
ATOM   3724 C CE    . LYS A 1 465 ? -45.287 -4.395  29.054  1.00 44.17  ? 465  LYS A CE    1 
ATOM   3725 N NZ    . LYS A 1 465 ? -46.072 -5.252  28.122  1.00 45.66  ? 465  LYS A NZ    1 
ATOM   3726 N N     . LYS A 1 466 ? -39.691 -3.108  30.595  1.00 40.47  ? 466  LYS A N     1 
ATOM   3727 C CA    . LYS A 1 466 ? -38.551 -3.991  30.793  1.00 40.77  ? 466  LYS A CA    1 
ATOM   3728 C C     . LYS A 1 466 ? -38.009 -3.903  32.220  1.00 40.61  ? 466  LYS A C     1 
ATOM   3729 O O     . LYS A 1 466 ? -37.592 -4.903  32.769  1.00 40.63  ? 466  LYS A O     1 
ATOM   3730 C CB    . LYS A 1 466 ? -37.472 -3.650  29.790  1.00 41.21  ? 466  LYS A CB    1 
ATOM   3731 C CG    . LYS A 1 466 ? -36.656 -4.842  29.299  1.00 44.13  ? 466  LYS A CG    1 
ATOM   3732 C CD    . LYS A 1 466 ? -36.240 -4.672  27.804  1.00 48.23  ? 466  LYS A CD    1 
ATOM   3733 C CE    . LYS A 1 466 ? -35.377 -3.404  27.534  1.00 49.46  ? 466  LYS A CE    1 
ATOM   3734 N NZ    . LYS A 1 466 ? -35.527 -2.878  26.127  1.00 51.90  ? 466  LYS A NZ    1 
ATOM   3735 N N     . MET A 1 467 ? -38.030 -2.715  32.825  1.00 40.72  ? 467  MET A N     1 
ATOM   3736 C CA    . MET A 1 467 ? -37.628 -2.554  34.228  1.00 41.02  ? 467  MET A CA    1 
ATOM   3737 C C     . MET A 1 467 ? -38.539 -3.352  35.167  1.00 41.79  ? 467  MET A C     1 
ATOM   3738 O O     . MET A 1 467 ? -38.132 -3.741  36.279  1.00 42.07  ? 467  MET A O     1 
ATOM   3739 C CB    . MET A 1 467 ? -37.690 -1.099  34.685  1.00 40.68  ? 467  MET A CB    1 
ATOM   3740 C CG    . MET A 1 467 ? -36.901 -0.082  33.900  1.00 40.38  ? 467  MET A CG    1 
ATOM   3741 S SD    . MET A 1 467 ? -36.515 1.370   34.908  1.00 38.41  ? 467  MET A SD    1 
ATOM   3742 C CE    . MET A 1 467 ? -38.125 1.958   35.493  1.00 43.29  ? 467  MET A CE    1 
ATOM   3743 N N     . LYS A 1 468 ? -39.783 -3.568  34.748  1.00 41.94  ? 468  LYS A N     1 
ATOM   3744 C CA    . LYS A 1 468 ? -40.713 -4.285  35.596  1.00 42.22  ? 468  LYS A CA    1 
ATOM   3745 C C     . LYS A 1 468 ? -40.514 -5.777  35.485  1.00 42.39  ? 468  LYS A C     1 
ATOM   3746 O O     . LYS A 1 468 ? -40.818 -6.507  36.403  1.00 42.37  ? 468  LYS A O     1 
ATOM   3747 C CB    . LYS A 1 468 ? -42.143 -3.895  35.280  1.00 42.21  ? 468  LYS A CB    1 
ATOM   3748 C CG    . LYS A 1 468 ? -42.622 -2.765  36.138  1.00 42.62  ? 468  LYS A CG    1 
ATOM   3749 C CD    . LYS A 1 468 ? -44.034 -2.377  35.780  1.00 45.40  ? 468  LYS A CD    1 
ATOM   3750 C CE    . LYS A 1 468 ? -44.171 -2.102  34.292  1.00 46.28  ? 468  LYS A CE    1 
ATOM   3751 N NZ    . LYS A 1 468 ? -45.459 -1.432  34.028  1.00 47.75  ? 468  LYS A NZ    1 
ATOM   3752 N N     . ALA A 1 469 ? -39.976 -6.224  34.364  1.00 42.82  ? 469  ALA A N     1 
ATOM   3753 C CA    . ALA A 1 469 ? -39.654 -7.625  34.201  1.00 43.74  ? 469  ALA A CA    1 
ATOM   3754 C C     . ALA A 1 469 ? -38.244 -8.007  34.678  1.00 44.68  ? 469  ALA A C     1 
ATOM   3755 O O     . ALA A 1 469 ? -37.693 -9.018  34.232  1.00 44.89  ? 469  ALA A O     1 
ATOM   3756 C CB    . ALA A 1 469 ? -39.838 -8.018  32.754  1.00 43.60  ? 469  ALA A CB    1 
ATOM   3757 N N     . THR A 1 470 ? -37.639 -7.211  35.555  1.00 45.80  ? 470  THR A N     1 
ATOM   3758 C CA    . THR A 1 470 ? -36.295 -7.543  36.042  1.00 47.25  ? 470  THR A CA    1 
ATOM   3759 C C     . THR A 1 470 ? -36.186 -7.316  37.533  1.00 48.03  ? 470  THR A C     1 
ATOM   3760 O O     . THR A 1 470 ? -36.592 -6.259  38.031  1.00 48.21  ? 470  THR A O     1 
ATOM   3761 C CB    . THR A 1 470 ? -35.167 -6.712  35.370  1.00 47.24  ? 470  THR A CB    1 
ATOM   3762 O OG1   . THR A 1 470 ? -35.247 -5.359  35.824  1.00 48.09  ? 470  THR A OG1   1 
ATOM   3763 C CG2   . THR A 1 470 ? -35.220 -6.762  33.823  1.00 47.26  ? 470  THR A CG2   1 
ATOM   3764 N N     . ILE A 1 471 ? -35.623 -8.299  38.240  1.00 49.03  ? 471  ILE A N     1 
ATOM   3765 C CA    . ILE A 1 471 ? -35.427 -8.183  39.698  1.00 49.79  ? 471  ILE A CA    1 
ATOM   3766 C C     . ILE A 1 471 ? -33.966 -7.777  40.051  1.00 49.37  ? 471  ILE A C     1 
ATOM   3767 O O     . ILE A 1 471 ? -33.708 -7.124  41.077  1.00 48.97  ? 471  ILE A O     1 
ATOM   3768 C CB    . ILE A 1 471 ? -35.979 -9.464  40.466  1.00 50.24  ? 471  ILE A CB    1 
ATOM   3769 C CG1   . ILE A 1 471 ? -35.885 -9.313  42.005  1.00 51.74  ? 471  ILE A CG1   1 
ATOM   3770 C CG2   . ILE A 1 471 ? -35.323 -10.773 39.947  1.00 50.61  ? 471  ILE A CG2   1 
ATOM   3771 C CD1   . ILE A 1 471 ? -36.946 -8.369  42.672  1.00 52.95  ? 471  ILE A CD1   1 
ATOM   3772 N N     . ASP A 1 472 ? -33.039 -8.122  39.154  1.00 49.35  ? 472  ASP A N     1 
ATOM   3773 C CA    . ASP A 1 472 ? -31.617 -7.761  39.279  1.00 49.39  ? 472  ASP A CA    1 
ATOM   3774 C C     . ASP A 1 472 ? -31.401 -6.234  39.351  1.00 49.26  ? 472  ASP A C     1 
ATOM   3775 O O     . ASP A 1 472 ? -31.559 -5.542  38.339  1.00 49.67  ? 472  ASP A O     1 
ATOM   3776 C CB    . ASP A 1 472 ? -30.815 -8.365  38.112  1.00 49.08  ? 472  ASP A CB    1 
ATOM   3777 C CG    . ASP A 1 472 ? -29.397 -7.826  38.036  1.00 49.73  ? 472  ASP A CG    1 
ATOM   3778 O OD1   . ASP A 1 472 ? -28.810 -7.531  39.099  1.00 50.07  ? 472  ASP A OD1   1 
ATOM   3779 O OD2   . ASP A 1 472 ? -28.861 -7.692  36.915  1.00 50.35  ? 472  ASP A OD2   1 
ATOM   3780 N N     . PRO A 1 473 ? -30.978 -5.706  40.522  1.00 48.91  ? 473  PRO A N     1 
ATOM   3781 C CA    . PRO A 1 473 ? -31.001 -4.244  40.666  1.00 48.47  ? 473  PRO A CA    1 
ATOM   3782 C C     . PRO A 1 473 ? -29.910 -3.569  39.850  1.00 48.02  ? 473  PRO A C     1 
ATOM   3783 O O     . PRO A 1 473 ? -30.002 -2.369  39.597  1.00 48.10  ? 473  PRO A O     1 
ATOM   3784 C CB    . PRO A 1 473 ? -30.767 -4.007  42.167  1.00 48.38  ? 473  PRO A CB    1 
ATOM   3785 C CG    . PRO A 1 473 ? -30.664 -5.362  42.793  1.00 48.89  ? 473  PRO A CG    1 
ATOM   3786 C CD    . PRO A 1 473 ? -30.396 -6.359  41.705  1.00 48.92  ? 473  PRO A CD    1 
ATOM   3787 N N     . ILE A 1 474 ? -28.903 -4.336  39.437  1.00 47.25  ? 474  ILE A N     1 
ATOM   3788 C CA    . ILE A 1 474 ? -27.849 -3.817  38.586  1.00 46.90  ? 474  ILE A CA    1 
ATOM   3789 C C     . ILE A 1 474 ? -28.427 -3.574  37.183  1.00 46.42  ? 474  ILE A C     1 
ATOM   3790 O O     . ILE A 1 474 ? -28.250 -2.498  36.597  1.00 46.18  ? 474  ILE A O     1 
ATOM   3791 C CB    . ILE A 1 474 ? -26.558 -4.748  38.547  1.00 47.18  ? 474  ILE A CB    1 
ATOM   3792 C CG1   . ILE A 1 474 ? -26.268 -5.434  39.906  1.00 48.54  ? 474  ILE A CG1   1 
ATOM   3793 C CG2   . ILE A 1 474 ? -25.327 -3.991  38.058  1.00 46.11  ? 474  ILE A CG2   1 
ATOM   3794 C CD1   . ILE A 1 474 ? -25.819 -4.526  41.065  1.00 50.73  ? 474  ILE A CD1   1 
ATOM   3795 N N     . GLU A 1 475 ? -29.128 -4.561  36.644  1.00 45.95  ? 475  GLU A N     1 
ATOM   3796 C CA    . GLU A 1 475 ? -29.710 -4.384  35.323  1.00 45.82  ? 475  GLU A CA    1 
ATOM   3797 C C     . GLU A 1 475 ? -30.863 -3.413  35.364  1.00 44.96  ? 475  GLU A C     1 
ATOM   3798 O O     . GLU A 1 475 ? -31.105 -2.680  34.403  1.00 44.67  ? 475  GLU A O     1 
ATOM   3799 C CB    . GLU A 1 475 ? -30.161 -5.702  34.720  1.00 46.27  ? 475  GLU A CB    1 
ATOM   3800 C CG    . GLU A 1 475 ? -29.275 -6.136  33.559  1.00 49.69  ? 475  GLU A CG    1 
ATOM   3801 C CD    . GLU A 1 475 ? -29.438 -5.247  32.305  1.00 53.43  ? 475  GLU A CD    1 
ATOM   3802 O OE1   . GLU A 1 475 ? -30.553 -4.691  32.075  1.00 52.91  ? 475  GLU A OE1   1 
ATOM   3803 O OE2   . GLU A 1 475 ? -28.442 -5.126  31.545  1.00 54.50  ? 475  GLU A OE2   1 
ATOM   3804 N N     . LYS A 1 476 ? -31.574 -3.412  36.487  1.00 43.89  ? 476  LYS A N     1 
ATOM   3805 C CA    . LYS A 1 476 ? -32.654 -2.475  36.688  1.00 42.54  ? 476  LYS A CA    1 
ATOM   3806 C C     . LYS A 1 476 ? -32.113 -1.050  36.687  1.00 41.59  ? 476  LYS A C     1 
ATOM   3807 O O     . LYS A 1 476 ? -32.687 -0.186  36.039  1.00 41.69  ? 476  LYS A O     1 
ATOM   3808 C CB    . LYS A 1 476 ? -33.426 -2.788  37.968  1.00 42.58  ? 476  LYS A CB    1 
ATOM   3809 C CG    . LYS A 1 476 ? -34.793 -2.126  38.029  1.00 43.15  ? 476  LYS A CG    1 
ATOM   3810 C CD    . LYS A 1 476 ? -35.452 -2.349  39.368  1.00 44.40  ? 476  LYS A CD    1 
ATOM   3811 C CE    . LYS A 1 476 ? -36.584 -3.346  39.273  1.00 44.73  ? 476  LYS A CE    1 
ATOM   3812 N NZ    . LYS A 1 476 ? -37.834 -2.636  38.948  1.00 45.00  ? 476  LYS A NZ    1 
ATOM   3813 N N     . LYS A 1 477 ? -31.000 -0.806  37.379  1.00 40.54  ? 477  LYS A N     1 
ATOM   3814 C CA    . LYS A 1 477 ? -30.411 0.548   37.424  1.00 39.44  ? 477  LYS A CA    1 
ATOM   3815 C C     . LYS A 1 477 ? -29.984 1.012   36.044  1.00 39.09  ? 477  LYS A C     1 
ATOM   3816 O O     . LYS A 1 477 ? -30.111 2.181   35.700  1.00 39.11  ? 477  LYS A O     1 
ATOM   3817 C CB    . LYS A 1 477 ? -29.214 0.628   38.377  1.00 38.98  ? 477  LYS A CB    1 
ATOM   3818 C CG    . LYS A 1 477 ? -28.897 2.044   38.785  1.00 37.99  ? 477  LYS A CG    1 
ATOM   3819 C CD    . LYS A 1 477 ? -27.800 2.147   39.796  1.00 37.61  ? 477  LYS A CD    1 
ATOM   3820 C CE    . LYS A 1 477 ? -27.295 3.586   39.795  1.00 40.00  ? 477  LYS A CE    1 
ATOM   3821 N NZ    . LYS A 1 477 ? -26.302 3.908   40.861  1.00 41.80  ? 477  LYS A NZ    1 
ATOM   3822 N N     . LEU A 1 478 ? -29.499 0.073   35.251  1.00 38.73  ? 478  LEU A N     1 
ATOM   3823 C CA    . LEU A 1 478 ? -28.919 0.391   33.975  1.00 38.66  ? 478  LEU A CA    1 
ATOM   3824 C C     . LEU A 1 478 ? -30.012 0.822   33.014  1.00 37.88  ? 478  LEU A C     1 
ATOM   3825 O O     . LEU A 1 478 ? -29.874 1.818   32.297  1.00 38.57  ? 478  LEU A O     1 
ATOM   3826 C CB    . LEU A 1 478 ? -28.160 -0.823  33.454  1.00 39.24  ? 478  LEU A CB    1 
ATOM   3827 C CG    . LEU A 1 478 ? -26.818 -0.484  32.799  1.00 42.39  ? 478  LEU A CG    1 
ATOM   3828 C CD1   . LEU A 1 478 ? -25.761 -1.575  33.098  1.00 41.46  ? 478  LEU A CD1   1 
ATOM   3829 C CD2   . LEU A 1 478 ? -26.982 -0.134  31.235  1.00 44.92  ? 478  LEU A CD2   1 
ATOM   3830 N N     . LEU A 1 479 ? -31.115 0.085   33.033  1.00 36.63  ? 479  LEU A N     1 
ATOM   3831 C CA    . LEU A 1 479 ? -32.289 0.433   32.256  1.00 35.23  ? 479  LEU A CA    1 
ATOM   3832 C C     . LEU A 1 479 ? -32.867 1.773   32.730  1.00 34.34  ? 479  LEU A C     1 
ATOM   3833 O O     . LEU A 1 479 ? -33.265 2.602   31.915  1.00 33.60  ? 479  LEU A O     1 
ATOM   3834 C CB    . LEU A 1 479 ? -33.321 -0.705  32.314  1.00 35.18  ? 479  LEU A CB    1 
ATOM   3835 C CG    . LEU A 1 479 ? -32.913 -1.903  31.439  1.00 34.97  ? 479  LEU A CG    1 
ATOM   3836 C CD1   . LEU A 1 479 ? -33.672 -3.179  31.785  1.00 35.69  ? 479  LEU A CD1   1 
ATOM   3837 C CD2   . LEU A 1 479 ? -33.100 -1.585  29.979  1.00 34.31  ? 479  LEU A CD2   1 
ATOM   3838 N N     . ASP A 1 480 ? -32.856 1.991   34.048  1.00 33.41  ? 480  ASP A N     1 
ATOM   3839 C CA    . ASP A 1 480 ? -33.352 3.227   34.631  1.00 32.40  ? 480  ASP A CA    1 
ATOM   3840 C C     . ASP A 1 480 ? -32.629 4.440   34.064  1.00 32.47  ? 480  ASP A C     1 
ATOM   3841 O O     . ASP A 1 480 ? -33.256 5.467   33.817  1.00 31.96  ? 480  ASP A O     1 
ATOM   3842 C CB    . ASP A 1 480 ? -33.237 3.207   36.137  1.00 31.97  ? 480  ASP A CB    1 
ATOM   3843 C CG    . ASP A 1 480 ? -33.904 4.410   36.783  1.00 31.51  ? 480  ASP A CG    1 
ATOM   3844 O OD1   . ASP A 1 480 ? -35.109 4.604   36.571  1.00 30.51  ? 480  ASP A OD1   1 
ATOM   3845 O OD2   . ASP A 1 480 ? -33.234 5.168   37.510  1.00 31.57  ? 480  ASP A OD2   1 
ATOM   3846 N N     . TYR A 1 481 ? -31.320 4.309   33.827  1.00 32.53  ? 481  TYR A N     1 
ATOM   3847 C CA    . TYR A 1 481 ? -30.548 5.370   33.165  1.00 32.01  ? 481  TYR A CA    1 
ATOM   3848 C C     . TYR A 1 481 ? -31.137 5.745   31.791  1.00 31.91  ? 481  TYR A C     1 
ATOM   3849 O O     . TYR A 1 481 ? -31.408 6.912   31.536  1.00 32.02  ? 481  TYR A O     1 
ATOM   3850 C CB    . TYR A 1 481 ? -29.069 4.995   33.063  1.00 31.82  ? 481  TYR A CB    1 
ATOM   3851 C CG    . TYR A 1 481 ? -28.287 5.242   34.328  1.00 31.45  ? 481  TYR A CG    1 
ATOM   3852 C CD1   . TYR A 1 481 ? -28.132 6.536   34.824  1.00 31.79  ? 481  TYR A CD1   1 
ATOM   3853 C CD2   . TYR A 1 481 ? -27.693 4.185   35.032  1.00 31.35  ? 481  TYR A CD2   1 
ATOM   3854 C CE1   . TYR A 1 481 ? -27.411 6.790   35.988  1.00 31.66  ? 481  TYR A CE1   1 
ATOM   3855 C CE2   . TYR A 1 481 ? -26.974 4.422   36.211  1.00 31.02  ? 481  TYR A CE2   1 
ATOM   3856 C CZ    . TYR A 1 481 ? -26.837 5.732   36.672  1.00 32.05  ? 481  TYR A CZ    1 
ATOM   3857 O OH    . TYR A 1 481 ? -26.151 6.003   37.826  1.00 32.94  ? 481  TYR A OH    1 
ATOM   3858 N N     . ARG A 1 482 ? -31.355 4.741   30.939  1.00 31.41  ? 482  ARG A N     1 
ATOM   3859 C CA    . ARG A 1 482 ? -31.934 4.905   29.603  1.00 30.91  ? 482  ARG A CA    1 
ATOM   3860 C C     . ARG A 1 482 ? -33.301 5.612   29.654  1.00 30.16  ? 482  ARG A C     1 
ATOM   3861 O O     . ARG A 1 482 ? -33.598 6.514   28.881  1.00 30.47  ? 482  ARG A O     1 
ATOM   3862 C CB    . ARG A 1 482 ? -32.071 3.506   28.978  1.00 31.18  ? 482  ARG A CB    1 
ATOM   3863 C CG    . ARG A 1 482 ? -32.788 3.407   27.660  1.00 32.00  ? 482  ARG A CG    1 
ATOM   3864 C CD    . ARG A 1 482 ? -31.819 3.263   26.529  1.00 35.85  ? 482  ARG A CD    1 
ATOM   3865 N NE    . ARG A 1 482 ? -32.477 3.427   25.229  1.00 40.24  ? 482  ARG A NE    1 
ATOM   3866 C CZ    . ARG A 1 482 ? -31.958 4.108   24.195  1.00 42.56  ? 482  ARG A CZ    1 
ATOM   3867 N NH1   . ARG A 1 482 ? -30.763 4.699   24.297  1.00 43.61  ? 482  ARG A NH1   1 
ATOM   3868 N NH2   . ARG A 1 482 ? -32.638 4.210   23.053  1.00 42.36  ? 482  ARG A NH2   1 
ATOM   3869 N N     . GLN A 1 483 ? -34.120 5.181   30.589  1.00 29.37  ? 483  GLN A N     1 
ATOM   3870 C CA    . GLN A 1 483 ? -35.456 5.687   30.799  1.00 28.42  ? 483  GLN A CA    1 
ATOM   3871 C C     . GLN A 1 483 ? -35.465 7.183   31.187  1.00 28.29  ? 483  GLN A C     1 
ATOM   3872 O O     . GLN A 1 483 ? -36.347 7.935   30.768  1.00 27.98  ? 483  GLN A O     1 
ATOM   3873 C CB    . GLN A 1 483 ? -36.061 4.832   31.900  1.00 27.85  ? 483  GLN A CB    1 
ATOM   3874 C CG    . GLN A 1 483 ? -37.418 5.175   32.312  1.00 27.63  ? 483  GLN A CG    1 
ATOM   3875 C CD    . GLN A 1 483 ? -37.475 6.154   33.474  1.00 27.73  ? 483  GLN A CD    1 
ATOM   3876 O OE1   . GLN A 1 483 ? -38.161 7.182   33.375  1.00 27.83  ? 483  GLN A OE1   1 
ATOM   3877 N NE2   . GLN A 1 483 ? -36.794 5.834   34.588  1.00 23.43  ? 483  GLN A NE2   1 
ATOM   3878 N N     . ARG A 1 484 ? -34.490 7.601   31.990  1.00 27.77  ? 484  ARG A N     1 
ATOM   3879 C CA    . ARG A 1 484 ? -34.451 8.964   32.509  1.00 27.70  ? 484  ARG A CA    1 
ATOM   3880 C C     . ARG A 1 484 ? -33.802 9.900   31.485  1.00 27.84  ? 484  ARG A C     1 
ATOM   3881 O O     . ARG A 1 484 ? -34.212 11.078  31.334  1.00 27.86  ? 484  ARG A O     1 
ATOM   3882 C CB    . ARG A 1 484 ? -33.738 9.011   33.853  1.00 27.29  ? 484  ARG A CB    1 
ATOM   3883 C CG    . ARG A 1 484 ? -34.489 8.244   34.947  1.00 29.36  ? 484  ARG A CG    1 
ATOM   3884 C CD    . ARG A 1 484 ? -33.600 7.748   36.077  1.00 29.31  ? 484  ARG A CD    1 
ATOM   3885 N NE    . ARG A 1 484 ? -32.860 8.865   36.612  1.00 33.79  ? 484  ARG A NE    1 
ATOM   3886 C CZ    . ARG A 1 484 ? -31.591 8.831   37.006  1.00 36.10  ? 484  ARG A CZ    1 
ATOM   3887 N NH1   . ARG A 1 484 ? -30.885 7.699   36.961  1.00 37.12  ? 484  ARG A NH1   1 
ATOM   3888 N NH2   . ARG A 1 484 ? -31.028 9.946   37.459  1.00 36.00  ? 484  ARG A NH2   1 
ATOM   3889 N N     . ALA A 1 485 ? -32.818 9.366   30.761  1.00 27.14  ? 485  ALA A N     1 
ATOM   3890 C CA    . ALA A 1 485 ? -32.193 10.117  29.698  1.00 27.15  ? 485  ALA A CA    1 
ATOM   3891 C C     . ALA A 1 485 ? -33.266 10.539  28.688  1.00 27.32  ? 485  ALA A C     1 
ATOM   3892 O O     . ALA A 1 485 ? -33.378 11.729  28.352  1.00 27.90  ? 485  ALA A O     1 
ATOM   3893 C CB    . ALA A 1 485 ? -31.114 9.318   29.036  1.00 26.86  ? 485  ALA A CB    1 
ATOM   3894 N N     . ILE A 1 486 ? -34.085 9.585   28.245  1.00 26.54  ? 486  ILE A N     1 
ATOM   3895 C CA    . ILE A 1 486 ? -35.146 9.907   27.305  1.00 25.75  ? 486  ILE A CA    1 
ATOM   3896 C C     . ILE A 1 486 ? -36.058 10.994  27.885  1.00 25.28  ? 486  ILE A C     1 
ATOM   3897 O O     . ILE A 1 486 ? -36.394 11.975  27.201  1.00 25.11  ? 486  ILE A O     1 
ATOM   3898 C CB    . ILE A 1 486 ? -35.952 8.665   26.856  1.00 25.51  ? 486  ILE A CB    1 
ATOM   3899 C CG1   . ILE A 1 486 ? -35.022 7.646   26.191  1.00 26.83  ? 486  ILE A CG1   1 
ATOM   3900 C CG2   . ILE A 1 486 ? -36.937 9.087   25.828  1.00 25.75  ? 486  ILE A CG2   1 
ATOM   3901 C CD1   . ILE A 1 486 ? -35.626 6.272   25.860  1.00 25.82  ? 486  ILE A CD1   1 
ATOM   3902 N N     . LYS A 1 487 ? -36.439 10.847  29.151  1.00 24.47  ? 487  LYS A N     1 
ATOM   3903 C CA    . LYS A 1 487 ? -37.265 11.877  29.752  1.00 24.09  ? 487  LYS A CA    1 
ATOM   3904 C C     . LYS A 1 487 ? -36.556 13.247  29.650  1.00 23.73  ? 487  LYS A C     1 
ATOM   3905 O O     . LYS A 1 487 ? -37.122 14.180  29.104  1.00 23.22  ? 487  LYS A O     1 
ATOM   3906 C CB    . LYS A 1 487 ? -37.648 11.539  31.186  1.00 23.99  ? 487  LYS A CB    1 
ATOM   3907 C CG    . LYS A 1 487 ? -38.453 12.628  31.842  1.00 23.29  ? 487  LYS A CG    1 
ATOM   3908 C CD    . LYS A 1 487 ? -38.837 12.218  33.240  1.00 24.57  ? 487  LYS A CD    1 
ATOM   3909 C CE    . LYS A 1 487 ? -39.496 13.389  33.949  1.00 26.27  ? 487  LYS A CE    1 
ATOM   3910 N NZ    . LYS A 1 487 ? -40.047 12.907  35.231  1.00 30.00  ? 487  LYS A NZ    1 
ATOM   3911 N N     . ILE A 1 488 ? -35.307 13.332  30.109  1.00 23.27  ? 488  ILE A N     1 
ATOM   3912 C CA    . ILE A 1 488 ? -34.511 14.546  29.955  1.00 23.21  ? 488  ILE A CA    1 
ATOM   3913 C C     . ILE A 1 488 ? -34.541 15.102  28.512  1.00 24.01  ? 488  ILE A C     1 
ATOM   3914 O O     . ILE A 1 488 ? -34.856 16.287  28.299  1.00 23.88  ? 488  ILE A O     1 
ATOM   3915 C CB    . ILE A 1 488 ? -33.067 14.334  30.465  1.00 22.93  ? 488  ILE A CB    1 
ATOM   3916 C CG1   . ILE A 1 488 ? -33.037 14.519  31.976  1.00 22.79  ? 488  ILE A CG1   1 
ATOM   3917 C CG2   . ILE A 1 488 ? -32.091 15.326  29.841  1.00 21.68  ? 488  ILE A CG2   1 
ATOM   3918 C CD1   . ILE A 1 488 ? -32.080 13.558  32.675  1.00 22.62  ? 488  ILE A CD1   1 
ATOM   3919 N N     . LEU A 1 489 ? -34.251 14.248  27.529  1.00 24.53  ? 489  LEU A N     1 
ATOM   3920 C CA    . LEU A 1 489 ? -34.175 14.693  26.153  1.00 25.17  ? 489  LEU A CA    1 
ATOM   3921 C C     . LEU A 1 489 ? -35.520 15.194  25.660  1.00 26.16  ? 489  LEU A C     1 
ATOM   3922 O O     . LEU A 1 489 ? -35.609 16.327  25.166  1.00 26.04  ? 489  LEU A O     1 
ATOM   3923 C CB    . LEU A 1 489 ? -33.679 13.586  25.251  1.00 25.02  ? 489  LEU A CB    1 
ATOM   3924 C CG    . LEU A 1 489 ? -33.556 13.941  23.764  1.00 26.02  ? 489  LEU A CG    1 
ATOM   3925 C CD1   . LEU A 1 489 ? -32.725 15.203  23.539  1.00 24.34  ? 489  LEU A CD1   1 
ATOM   3926 C CD2   . LEU A 1 489 ? -32.951 12.753  22.994  1.00 26.30  ? 489  LEU A CD2   1 
ATOM   3927 N N     . ALA A 1 490 ? -36.559 14.353  25.817  1.00 26.92  ? 490  ALA A N     1 
ATOM   3928 C CA    . ALA A 1 490 ? -37.916 14.659  25.338  1.00 27.06  ? 490  ALA A CA    1 
ATOM   3929 C C     . ALA A 1 490 ? -38.408 15.961  25.943  1.00 28.02  ? 490  ALA A C     1 
ATOM   3930 O O     . ALA A 1 490 ? -38.930 16.838  25.233  1.00 28.65  ? 490  ALA A O     1 
ATOM   3931 C CB    . ALA A 1 490 ? -38.837 13.567  25.681  1.00 26.21  ? 490  ALA A CB    1 
ATOM   3932 N N     . ASN A 1 491 ? -38.203 16.093  27.254  1.00 28.12  ? 491  ASN A N     1 
ATOM   3933 C CA    . ASN A 1 491 ? -38.631 17.262  27.974  1.00 28.30  ? 491  ASN A CA    1 
ATOM   3934 C C     . ASN A 1 491 ? -37.854 18.522  27.680  1.00 29.10  ? 491  ASN A C     1 
ATOM   3935 O O     . ASN A 1 491 ? -38.142 19.563  28.255  1.00 30.35  ? 491  ASN A O     1 
ATOM   3936 C CB    . ASN A 1 491 ? -38.617 17.002  29.470  1.00 27.98  ? 491  ASN A CB    1 
ATOM   3937 C CG    . ASN A 1 491 ? -39.677 16.024  29.891  1.00 26.77  ? 491  ASN A CG    1 
ATOM   3938 O OD1   . ASN A 1 491 ? -40.427 15.496  29.069  1.00 24.57  ? 491  ASN A OD1   1 
ATOM   3939 N ND2   . ASN A 1 491 ? -39.735 15.762  31.176  1.00 26.57  ? 491  ASN A ND2   1 
ATOM   3940 N N     . SER A 1 492 ? -36.880 18.468  26.790  1.00 29.28  ? 492  SER A N     1 
ATOM   3941 C CA    . SER A 1 492 ? -36.194 19.692  26.438  1.00 29.35  ? 492  SER A CA    1 
ATOM   3942 C C     . SER A 1 492 ? -36.763 20.374  25.206  1.00 29.87  ? 492  SER A C     1 
ATOM   3943 O O     . SER A 1 492 ? -36.272 21.435  24.806  1.00 30.93  ? 492  SER A O     1 
ATOM   3944 C CB    . SER A 1 492 ? -34.726 19.414  26.237  1.00 29.05  ? 492  SER A CB    1 
ATOM   3945 O OG    . SER A 1 492 ? -34.184 18.967  27.453  1.00 30.15  ? 492  SER A OG    1 
ATOM   3946 N N     . PHE A 1 493 ? -37.786 19.789  24.596  1.00 29.81  ? 493  PHE A N     1 
ATOM   3947 C CA    . PHE A 1 493 ? -38.266 20.306  23.328  1.00 29.80  ? 493  PHE A CA    1 
ATOM   3948 C C     . PHE A 1 493 ? -39.116 21.548  23.523  1.00 30.37  ? 493  PHE A C     1 
ATOM   3949 O O     . PHE A 1 493 ? -39.129 22.436  22.684  1.00 30.77  ? 493  PHE A O     1 
ATOM   3950 C CB    . PHE A 1 493 ? -39.040 19.244  22.579  1.00 29.29  ? 493  PHE A CB    1 
ATOM   3951 C CG    . PHE A 1 493 ? -38.172 18.331  21.765  1.00 28.92  ? 493  PHE A CG    1 
ATOM   3952 C CD1   . PHE A 1 493 ? -37.446 17.308  22.364  1.00 27.53  ? 493  PHE A CD1   1 
ATOM   3953 C CD2   . PHE A 1 493 ? -38.098 18.469  20.390  1.00 27.45  ? 493  PHE A CD2   1 
ATOM   3954 C CE1   . PHE A 1 493 ? -36.665 16.453  21.590  1.00 26.61  ? 493  PHE A CE1   1 
ATOM   3955 C CE2   . PHE A 1 493 ? -37.314 17.610  19.627  1.00 26.26  ? 493  PHE A CE2   1 
ATOM   3956 C CZ    . PHE A 1 493 ? -36.600 16.601  20.227  1.00 24.24  ? 493  PHE A CZ    1 
ATOM   3957 N N     . TYR A 1 494 ? -39.821 21.617  24.640  1.00 30.70  ? 494  TYR A N     1 
ATOM   3958 C CA    . TYR A 1 494 ? -40.678 22.758  24.904  1.00 30.60  ? 494  TYR A CA    1 
ATOM   3959 C C     . TYR A 1 494 ? -39.857 24.063  24.969  1.00 30.83  ? 494  TYR A C     1 
ATOM   3960 O O     . TYR A 1 494 ? -40.142 25.004  24.211  1.00 31.22  ? 494  TYR A O     1 
ATOM   3961 C CB    . TYR A 1 494 ? -41.536 22.481  26.151  1.00 30.26  ? 494  TYR A CB    1 
ATOM   3962 C CG    . TYR A 1 494 ? -42.420 23.603  26.651  1.00 29.67  ? 494  TYR A CG    1 
ATOM   3963 C CD1   . TYR A 1 494 ? -42.969 24.561  25.786  1.00 29.84  ? 494  TYR A CD1   1 
ATOM   3964 C CD2   . TYR A 1 494 ? -42.758 23.670  28.002  1.00 29.33  ? 494  TYR A CD2   1 
ATOM   3965 C CE1   . TYR A 1 494 ? -43.796 25.584  26.276  1.00 29.68  ? 494  TYR A CE1   1 
ATOM   3966 C CE2   . TYR A 1 494 ? -43.578 24.672  28.496  1.00 29.66  ? 494  TYR A CE2   1 
ATOM   3967 C CZ    . TYR A 1 494 ? -44.094 25.624  27.631  1.00 30.11  ? 494  TYR A CZ    1 
ATOM   3968 O OH    . TYR A 1 494 ? -44.899 26.607  28.155  1.00 31.46  ? 494  TYR A OH    1 
ATOM   3969 N N     . GLY A 1 495 ? -38.830 24.098  25.825  1.00 30.79  ? 495  GLY A N     1 
ATOM   3970 C CA    . GLY A 1 495 ? -37.957 25.258  25.961  1.00 30.46  ? 495  GLY A CA    1 
ATOM   3971 C C     . GLY A 1 495 ? -37.251 25.511  24.649  1.00 31.44  ? 495  GLY A C     1 
ATOM   3972 O O     . GLY A 1 495 ? -37.124 26.652  24.201  1.00 31.59  ? 495  GLY A O     1 
ATOM   3973 N N     . TYR A 1 496 ? -36.816 24.440  23.999  1.00 32.11  ? 496  TYR A N     1 
ATOM   3974 C CA    . TYR A 1 496 ? -36.147 24.579  22.719  1.00 33.09  ? 496  TYR A CA    1 
ATOM   3975 C C     . TYR A 1 496 ? -36.973 25.328  21.663  1.00 33.79  ? 496  TYR A C     1 
ATOM   3976 O O     . TYR A 1 496 ? -36.416 26.077  20.884  1.00 34.42  ? 496  TYR A O     1 
ATOM   3977 C CB    . TYR A 1 496 ? -35.713 23.217  22.174  1.00 33.35  ? 496  TYR A CB    1 
ATOM   3978 C CG    . TYR A 1 496 ? -35.080 23.302  20.803  1.00 33.76  ? 496  TYR A CG    1 
ATOM   3979 C CD1   . TYR A 1 496 ? -33.709 23.542  20.660  1.00 34.53  ? 496  TYR A CD1   1 
ATOM   3980 C CD2   . TYR A 1 496 ? -35.853 23.155  19.650  1.00 33.10  ? 496  TYR A CD2   1 
ATOM   3981 C CE1   . TYR A 1 496 ? -33.114 23.627  19.399  1.00 34.96  ? 496  TYR A CE1   1 
ATOM   3982 C CE2   . TYR A 1 496 ? -35.277 23.234  18.391  1.00 34.74  ? 496  TYR A CE2   1 
ATOM   3983 C CZ    . TYR A 1 496 ? -33.903 23.473  18.270  1.00 35.71  ? 496  TYR A CZ    1 
ATOM   3984 O OH    . TYR A 1 496 ? -33.336 23.561  17.017  1.00 35.57  ? 496  TYR A OH    1 
ATOM   3985 N N     . TYR A 1 497 ? -38.280 25.107  21.607  1.00 34.37  ? 497  TYR A N     1 
ATOM   3986 C CA    . TYR A 1 497 ? -39.082 25.681  20.538  1.00 35.53  ? 497  TYR A CA    1 
ATOM   3987 C C     . TYR A 1 497 ? -39.022 27.208  20.527  1.00 36.86  ? 497  TYR A C     1 
ATOM   3988 O O     . TYR A 1 497 ? -38.911 27.813  19.454  1.00 36.61  ? 497  TYR A O     1 
ATOM   3989 C CB    . TYR A 1 497 ? -40.534 25.218  20.632  1.00 35.25  ? 497  TYR A CB    1 
ATOM   3990 C CG    . TYR A 1 497 ? -40.929 24.146  19.645  1.00 34.49  ? 497  TYR A CG    1 
ATOM   3991 C CD1   . TYR A 1 497 ? -40.487 24.183  18.321  1.00 33.79  ? 497  TYR A CD1   1 
ATOM   3992 C CD2   . TYR A 1 497 ? -41.788 23.128  20.023  1.00 33.88  ? 497  TYR A CD2   1 
ATOM   3993 C CE1   . TYR A 1 497 ? -40.877 23.207  17.407  1.00 35.04  ? 497  TYR A CE1   1 
ATOM   3994 C CE2   . TYR A 1 497 ? -42.187 22.140  19.124  1.00 35.19  ? 497  TYR A CE2   1 
ATOM   3995 C CZ    . TYR A 1 497 ? -41.735 22.181  17.816  1.00 35.46  ? 497  TYR A CZ    1 
ATOM   3996 O OH    . TYR A 1 497 ? -42.136 21.192  16.938  1.00 33.68  ? 497  TYR A OH    1 
ATOM   3997 N N     . GLY A 1 498 ? -39.097 27.808  21.723  1.00 38.06  ? 498  GLY A N     1 
ATOM   3998 C CA    . GLY A 1 498 ? -38.962 29.249  21.903  1.00 39.70  ? 498  GLY A CA    1 
ATOM   3999 C C     . GLY A 1 498 ? -37.565 29.651  22.384  1.00 41.40  ? 498  GLY A C     1 
ATOM   4000 O O     . GLY A 1 498 ? -37.411 30.590  23.185  1.00 41.46  ? 498  GLY A O     1 
ATOM   4001 N N     . TYR A 1 499 ? -36.542 28.944  21.900  1.00 42.36  ? 499  TYR A N     1 
ATOM   4002 C CA    . TYR A 1 499 ? -35.159 29.243  22.247  1.00 43.30  ? 499  TYR A CA    1 
ATOM   4003 C C     . TYR A 1 499 ? -34.541 30.070  21.150  1.00 43.67  ? 499  TYR A C     1 
ATOM   4004 O O     . TYR A 1 499 ? -34.238 29.546  20.078  1.00 43.77  ? 499  TYR A O     1 
ATOM   4005 C CB    . TYR A 1 499 ? -34.374 27.955  22.403  1.00 43.99  ? 499  TYR A CB    1 
ATOM   4006 C CG    . TYR A 1 499 ? -32.879 28.107  22.612  1.00 45.01  ? 499  TYR A CG    1 
ATOM   4007 C CD1   . TYR A 1 499 ? -32.361 29.035  23.536  1.00 45.54  ? 499  TYR A CD1   1 
ATOM   4008 C CD2   . TYR A 1 499 ? -31.978 27.274  21.921  1.00 45.45  ? 499  TYR A CD2   1 
ATOM   4009 C CE1   . TYR A 1 499 ? -30.982 29.147  23.739  1.00 47.10  ? 499  TYR A CE1   1 
ATOM   4010 C CE2   . TYR A 1 499 ? -30.600 27.365  22.118  1.00 45.97  ? 499  TYR A CE2   1 
ATOM   4011 C CZ    . TYR A 1 499 ? -30.105 28.303  23.025  1.00 47.95  ? 499  TYR A CZ    1 
ATOM   4012 O OH    . TYR A 1 499 ? -28.739 28.395  23.223  1.00 48.44  ? 499  TYR A OH    1 
ATOM   4013 N N     . ALA A 1 500 ? -34.328 31.353  21.442  1.00 43.98  ? 500  ALA A N     1 
ATOM   4014 C CA    . ALA A 1 500 ? -33.926 32.337  20.441  1.00 43.88  ? 500  ALA A CA    1 
ATOM   4015 C C     . ALA A 1 500 ? -32.814 31.876  19.468  1.00 43.94  ? 500  ALA A C     1 
ATOM   4016 O O     . ALA A 1 500 ? -32.942 32.093  18.263  1.00 44.26  ? 500  ALA A O     1 
ATOM   4017 C CB    . ALA A 1 500 ? -33.571 33.623  21.111  1.00 44.03  ? 500  ALA A CB    1 
ATOM   4018 N N     . LYS A 1 501 ? -31.768 31.214  19.971  1.00 43.48  ? 501  LYS A N     1 
ATOM   4019 C CA    . LYS A 1 501 ? -30.654 30.737  19.129  1.00 43.30  ? 501  LYS A CA    1 
ATOM   4020 C C     . LYS A 1 501 ? -30.958 29.467  18.318  1.00 42.92  ? 501  LYS A C     1 
ATOM   4021 O O     . LYS A 1 501 ? -30.108 29.003  17.549  1.00 43.08  ? 501  LYS A O     1 
ATOM   4022 C CB    . LYS A 1 501 ? -29.409 30.480  19.989  1.00 43.63  ? 501  LYS A CB    1 
ATOM   4023 C CG    . LYS A 1 501 ? -28.424 31.654  20.086  1.00 45.36  ? 501  LYS A CG    1 
ATOM   4024 C CD    . LYS A 1 501 ? -27.502 31.548  21.328  1.00 46.71  ? 501  LYS A CD    1 
ATOM   4025 N N     . ALA A 1 502 ? -32.156 28.909  18.485  1.00 42.18  ? 502  ALA A N     1 
ATOM   4026 C CA    . ALA A 1 502 ? -32.492 27.596  17.933  1.00 41.54  ? 502  ALA A CA    1 
ATOM   4027 C C     . ALA A 1 502 ? -32.692 27.602  16.435  1.00 41.27  ? 502  ALA A C     1 
ATOM   4028 O O     . ALA A 1 502 ? -33.281 28.534  15.889  1.00 41.29  ? 502  ALA A O     1 
ATOM   4029 C CB    . ALA A 1 502 ? -33.731 27.047  18.612  1.00 41.65  ? 502  ALA A CB    1 
ATOM   4030 N N     . ARG A 1 503 ? -32.222 26.551  15.769  1.00 40.81  ? 503  ARG A N     1 
ATOM   4031 C CA    . ARG A 1 503 ? -32.429 26.446  14.331  1.00 40.60  ? 503  ARG A CA    1 
ATOM   4032 C C     . ARG A 1 503 ? -33.894 26.234  14.016  1.00 40.57  ? 503  ARG A C     1 
ATOM   4033 O O     . ARG A 1 503 ? -34.455 26.944  13.200  1.00 40.70  ? 503  ARG A O     1 
ATOM   4034 C CB    . ARG A 1 503 ? -31.582 25.348  13.707  1.00 40.36  ? 503  ARG A CB    1 
ATOM   4035 C CG    . ARG A 1 503 ? -30.113 25.570  13.904  1.00 41.59  ? 503  ARG A CG    1 
ATOM   4036 C CD    . ARG A 1 503 ? -29.323 24.336  13.574  1.00 43.37  ? 503  ARG A CD    1 
ATOM   4037 N NE    . ARG A 1 503 ? -28.802 24.417  12.225  1.00 44.70  ? 503  ARG A NE    1 
ATOM   4038 C CZ    . ARG A 1 503 ? -27.514 24.562  11.936  1.00 46.21  ? 503  ARG A CZ    1 
ATOM   4039 N NH1   . ARG A 1 503 ? -26.599 24.630  12.903  1.00 45.82  ? 503  ARG A NH1   1 
ATOM   4040 N NH2   . ARG A 1 503 ? -27.139 24.632  10.667  1.00 47.23  ? 503  ARG A NH2   1 
ATOM   4041 N N     . TRP A 1 504 ? -34.512 25.251  14.669  1.00 40.65  ? 504  TRP A N     1 
ATOM   4042 C CA    . TRP A 1 504 ? -35.916 24.932  14.436  1.00 40.05  ? 504  TRP A CA    1 
ATOM   4043 C C     . TRP A 1 504 ? -36.813 25.717  15.399  1.00 40.46  ? 504  TRP A C     1 
ATOM   4044 O O     . TRP A 1 504 ? -37.812 25.191  15.893  1.00 40.24  ? 504  TRP A O     1 
ATOM   4045 C CB    . TRP A 1 504 ? -36.155 23.438  14.586  1.00 39.48  ? 504  TRP A CB    1 
ATOM   4046 C CG    . TRP A 1 504 ? -35.829 22.613  13.399  1.00 37.92  ? 504  TRP A CG    1 
ATOM   4047 C CD1   . TRP A 1 504 ? -36.665 22.292  12.371  1.00 37.34  ? 504  TRP A CD1   1 
ATOM   4048 C CD2   . TRP A 1 504 ? -34.596 21.935  13.138  1.00 37.55  ? 504  TRP A CD2   1 
ATOM   4049 N NE1   . TRP A 1 504 ? -36.028 21.465  11.469  1.00 35.91  ? 504  TRP A NE1   1 
ATOM   4050 C CE2   . TRP A 1 504 ? -34.753 21.234  11.913  1.00 36.67  ? 504  TRP A CE2   1 
ATOM   4051 C CE3   . TRP A 1 504 ? -33.367 21.854  13.813  1.00 37.08  ? 504  TRP A CE3   1 
ATOM   4052 C CZ2   . TRP A 1 504 ? -33.722 20.470  11.342  1.00 36.05  ? 504  TRP A CZ2   1 
ATOM   4053 C CZ3   . TRP A 1 504 ? -32.348 21.083  13.251  1.00 36.68  ? 504  TRP A CZ3   1 
ATOM   4054 C CH2   . TRP A 1 504 ? -32.537 20.394  12.028  1.00 35.94  ? 504  TRP A CH2   1 
ATOM   4055 N N     . TYR A 1 505 ? -36.438 26.974  15.661  1.00 41.00  ? 505  TYR A N     1 
ATOM   4056 C CA    . TYR A 1 505 ? -37.246 27.912  16.445  1.00 41.44  ? 505  TYR A CA    1 
ATOM   4057 C C     . TYR A 1 505 ? -38.596 28.104  15.780  1.00 42.18  ? 505  TYR A C     1 
ATOM   4058 O O     . TYR A 1 505 ? -38.732 27.985  14.555  1.00 41.89  ? 505  TYR A O     1 
ATOM   4059 C CB    . TYR A 1 505 ? -36.525 29.258  16.583  1.00 41.17  ? 505  TYR A CB    1 
ATOM   4060 C CG    . TYR A 1 505 ? -37.327 30.402  17.208  1.00 40.70  ? 505  TYR A CG    1 
ATOM   4061 C CD1   . TYR A 1 505 ? -37.306 30.621  18.595  1.00 40.00  ? 505  TYR A CD1   1 
ATOM   4062 C CD2   . TYR A 1 505 ? -38.071 31.285  16.411  1.00 39.02  ? 505  TYR A CD2   1 
ATOM   4063 C CE1   . TYR A 1 505 ? -38.023 31.669  19.183  1.00 39.54  ? 505  TYR A CE1   1 
ATOM   4064 C CE2   . TYR A 1 505 ? -38.789 32.341  16.983  1.00 40.07  ? 505  TYR A CE2   1 
ATOM   4065 C CZ    . TYR A 1 505 ? -38.758 32.534  18.374  1.00 41.06  ? 505  TYR A CZ    1 
ATOM   4066 O OH    . TYR A 1 505 ? -39.462 33.587  18.958  1.00 41.70  ? 505  TYR A OH    1 
ATOM   4067 N N     . CYS A 1 506 ? -39.592 28.377  16.611  1.00 43.25  ? 506  CYS A N     1 
ATOM   4068 C CA    . CYS A 1 506 ? -40.939 28.617  16.149  1.00 44.79  ? 506  CYS A CA    1 
ATOM   4069 C C     . CYS A 1 506 ? -41.740 29.180  17.300  1.00 45.41  ? 506  CYS A C     1 
ATOM   4070 O O     . CYS A 1 506 ? -42.121 28.436  18.221  1.00 46.08  ? 506  CYS A O     1 
ATOM   4071 C CB    . CYS A 1 506 ? -41.586 27.315  15.683  1.00 44.88  ? 506  CYS A CB    1 
ATOM   4072 S SG    . CYS A 1 506 ? -43.107 27.583  14.788  1.00 46.64  ? 506  CYS A SG    1 
ATOM   4073 N N     . LYS A 1 507 ? -42.000 30.486  17.255  1.00 45.74  ? 507  LYS A N     1 
ATOM   4074 C CA    . LYS A 1 507 ? -42.752 31.131  18.326  1.00 46.00  ? 507  LYS A CA    1 
ATOM   4075 C C     . LYS A 1 507 ? -44.153 30.504  18.450  1.00 45.56  ? 507  LYS A C     1 
ATOM   4076 O O     . LYS A 1 507 ? -44.621 30.197  19.567  1.00 44.94  ? 507  LYS A O     1 
ATOM   4077 C CB    . LYS A 1 507 ? -42.832 32.652  18.108  1.00 46.41  ? 507  LYS A CB    1 
ATOM   4078 C CG    . LYS A 1 507 ? -43.129 33.443  19.388  1.00 47.28  ? 507  LYS A CG    1 
ATOM   4079 C CD    . LYS A 1 507 ? -43.877 34.729  19.055  1.00 49.51  ? 507  LYS A CD    1 
ATOM   4080 N N     . GLU A 1 508 ? -44.796 30.293  17.298  1.00 44.96  ? 508  GLU A N     1 
ATOM   4081 C CA    . GLU A 1 508 ? -46.158 29.741  17.273  1.00 44.95  ? 508  GLU A CA    1 
ATOM   4082 C C     . GLU A 1 508 ? -46.241 28.391  17.977  1.00 44.27  ? 508  GLU A C     1 
ATOM   4083 O O     . GLU A 1 508 ? -47.160 28.177  18.766  1.00 44.46  ? 508  GLU A O     1 
ATOM   4084 C CB    . GLU A 1 508 ? -46.743 29.659  15.855  1.00 45.17  ? 508  GLU A CB    1 
ATOM   4085 C CG    . GLU A 1 508 ? -46.880 30.990  15.137  1.00 45.78  ? 508  GLU A CG    1 
ATOM   4086 C CD    . GLU A 1 508 ? -45.568 31.455  14.544  1.00 48.51  ? 508  GLU A CD    1 
ATOM   4087 O OE1   . GLU A 1 508 ? -44.541 30.763  14.751  1.00 49.95  ? 508  GLU A OE1   1 
ATOM   4088 O OE2   . GLU A 1 508 ? -45.557 32.508  13.868  1.00 49.32  ? 508  GLU A OE2   1 
ATOM   4089 N N     . CYS A 1 509 ? -45.274 27.505  17.721  1.00 43.15  ? 509  CYS A N     1 
ATOM   4090 C CA    . CYS A 1 509 ? -45.201 26.238  18.441  1.00 41.95  ? 509  CYS A CA    1 
ATOM   4091 C C     . CYS A 1 509 ? -45.088 26.413  19.966  1.00 41.37  ? 509  CYS A C     1 
ATOM   4092 O O     . CYS A 1 509 ? -45.799 25.757  20.720  1.00 40.97  ? 509  CYS A O     1 
ATOM   4093 C CB    . CYS A 1 509 ? -44.066 25.385  17.901  1.00 41.92  ? 509  CYS A CB    1 
ATOM   4094 S SG    . CYS A 1 509 ? -44.258 24.870  16.161  1.00 43.06  ? 509  CYS A SG    1 
ATOM   4095 N N     . ALA A 1 510 ? -44.223 27.316  20.423  1.00 41.02  ? 510  ALA A N     1 
ATOM   4096 C CA    . ALA A 1 510 ? -44.014 27.511  21.869  1.00 40.68  ? 510  ALA A CA    1 
ATOM   4097 C C     . ALA A 1 510 ? -45.270 28.020  22.595  1.00 40.77  ? 510  ALA A C     1 
ATOM   4098 O O     . ALA A 1 510 ? -45.701 27.440  23.613  1.00 40.56  ? 510  ALA A O     1 
ATOM   4099 C CB    . ALA A 1 510 ? -42.833 28.441  22.120  1.00 40.69  ? 510  ALA A CB    1 
ATOM   4100 N N     . GLU A 1 511 ? -45.844 29.107  22.061  1.00 40.37  ? 511  GLU A N     1 
ATOM   4101 C CA    . GLU A 1 511 ? -47.120 29.643  22.522  1.00 39.52  ? 511  GLU A CA    1 
ATOM   4102 C C     . GLU A 1 511 ? -48.198 28.563  22.522  1.00 38.18  ? 511  GLU A C     1 
ATOM   4103 O O     . GLU A 1 511 ? -48.889 28.372  23.521  1.00 37.91  ? 511  GLU A O     1 
ATOM   4104 C CB    . GLU A 1 511 ? -47.547 30.784  21.610  1.00 40.33  ? 511  GLU A CB    1 
ATOM   4105 C CG    . GLU A 1 511 ? -46.970 32.144  21.966  1.00 42.53  ? 511  GLU A CG    1 
ATOM   4106 C CD    . GLU A 1 511 ? -47.090 33.128  20.819  1.00 46.41  ? 511  GLU A CD    1 
ATOM   4107 O OE1   . GLU A 1 511 ? -47.858 32.856  19.848  1.00 46.08  ? 511  GLU A OE1   1 
ATOM   4108 O OE2   . GLU A 1 511 ? -46.401 34.175  20.891  1.00 49.29  ? 511  GLU A OE2   1 
ATOM   4109 N N     . SER A 1 512 ? -48.315 27.854  21.399  1.00 36.69  ? 512  SER A N     1 
ATOM   4110 C CA    . SER A 1 512 ? -49.255 26.747  21.252  1.00 35.55  ? 512  SER A CA    1 
ATOM   4111 C C     . SER A 1 512 ? -49.080 25.681  22.330  1.00 34.99  ? 512  SER A C     1 
ATOM   4112 O O     . SER A 1 512 ? -50.054 25.215  22.911  1.00 34.82  ? 512  SER A O     1 
ATOM   4113 C CB    . SER A 1 512 ? -49.118 26.114  19.874  1.00 35.40  ? 512  SER A CB    1 
ATOM   4114 O OG    . SER A 1 512 ? -49.567 26.993  18.852  1.00 36.04  ? 512  SER A OG    1 
ATOM   4115 N N     . VAL A 1 513 ? -47.838 25.300  22.603  1.00 34.27  ? 513  VAL A N     1 
ATOM   4116 C CA    . VAL A 1 513 ? -47.588 24.325  23.633  1.00 33.59  ? 513  VAL A CA    1 
ATOM   4117 C C     . VAL A 1 513 ? -47.938 24.936  24.980  1.00 33.95  ? 513  VAL A C     1 
ATOM   4118 O O     . VAL A 1 513 ? -48.463 24.240  25.860  1.00 34.14  ? 513  VAL A O     1 
ATOM   4119 C CB    . VAL A 1 513 ? -46.148 23.822  23.593  1.00 33.69  ? 513  VAL A CB    1 
ATOM   4120 C CG1   . VAL A 1 513 ? -45.862 22.844  24.745  1.00 32.60  ? 513  VAL A CG1   1 
ATOM   4121 C CG2   . VAL A 1 513 ? -45.883 23.164  22.259  1.00 33.17  ? 513  VAL A CG2   1 
ATOM   4122 N N     . THR A 1 514 ? -47.698 26.239  25.140  1.00 33.79  ? 514  THR A N     1 
ATOM   4123 C CA    . THR A 1 514 ? -48.023 26.884  26.417  1.00 33.92  ? 514  THR A CA    1 
ATOM   4124 C C     . THR A 1 514 ? -49.531 26.910  26.666  1.00 34.06  ? 514  THR A C     1 
ATOM   4125 O O     . THR A 1 514 ? -49.985 26.684  27.812  1.00 34.02  ? 514  THR A O     1 
ATOM   4126 C CB    . THR A 1 514 ? -47.438 28.308  26.542  1.00 34.22  ? 514  THR A CB    1 
ATOM   4127 O OG1   . THR A 1 514 ? -46.030 28.278  26.245  1.00 34.73  ? 514  THR A OG1   1 
ATOM   4128 C CG2   . THR A 1 514 ? -47.674 28.876  27.952  1.00 32.46  ? 514  THR A CG2   1 
ATOM   4129 N N     . ALA A 1 515 ? -50.297 27.150  25.595  1.00 33.65  ? 515  ALA A N     1 
ATOM   4130 C CA    . ALA A 1 515 ? -51.747 27.262  25.720  1.00 33.53  ? 515  ALA A CA    1 
ATOM   4131 C C     . ALA A 1 515 ? -52.344 25.900  26.007  1.00 33.51  ? 515  ALA A C     1 
ATOM   4132 O O     . ALA A 1 515 ? -53.018 25.715  27.027  1.00 34.52  ? 515  ALA A O     1 
ATOM   4133 C CB    . ALA A 1 515 ? -52.353 27.866  24.502  1.00 33.61  ? 515  ALA A CB    1 
ATOM   4134 N N     . TRP A 1 516 ? -52.074 24.923  25.156  1.00 32.66  ? 516  TRP A N     1 
ATOM   4135 C CA    . TRP A 1 516 ? -52.547 23.586  25.458  1.00 32.24  ? 516  TRP A CA    1 
ATOM   4136 C C     . TRP A 1 516 ? -52.146 23.155  26.885  1.00 32.75  ? 516  TRP A C     1 
ATOM   4137 O O     . TRP A 1 516 ? -52.915 22.485  27.592  1.00 32.14  ? 516  TRP A O     1 
ATOM   4138 C CB    . TRP A 1 516 ? -52.084 22.611  24.394  1.00 31.73  ? 516  TRP A CB    1 
ATOM   4139 C CG    . TRP A 1 516 ? -53.102 22.424  23.286  1.00 31.24  ? 516  TRP A CG    1 
ATOM   4140 C CD1   . TRP A 1 516 ? -54.392 21.969  23.427  1.00 29.75  ? 516  TRP A CD1   1 
ATOM   4141 C CD2   . TRP A 1 516 ? -52.908 22.645  21.873  1.00 29.11  ? 516  TRP A CD2   1 
ATOM   4142 N NE1   . TRP A 1 516 ? -55.005 21.909  22.198  1.00 29.74  ? 516  TRP A NE1   1 
ATOM   4143 C CE2   . TRP A 1 516 ? -54.125 22.313  21.228  1.00 29.07  ? 516  TRP A CE2   1 
ATOM   4144 C CE3   . TRP A 1 516 ? -51.832 23.091  21.095  1.00 28.16  ? 516  TRP A CE3   1 
ATOM   4145 C CZ2   . TRP A 1 516 ? -54.295 22.408  19.833  1.00 28.44  ? 516  TRP A CZ2   1 
ATOM   4146 C CZ3   . TRP A 1 516 ? -52.005 23.196  19.688  1.00 28.45  ? 516  TRP A CZ3   1 
ATOM   4147 C CH2   . TRP A 1 516 ? -53.224 22.848  19.083  1.00 28.08  ? 516  TRP A CH2   1 
ATOM   4148 N N     . GLY A 1 517 ? -50.961 23.596  27.315  1.00 33.19  ? 517  GLY A N     1 
ATOM   4149 C CA    . GLY A 1 517 ? -50.481 23.313  28.653  1.00 33.92  ? 517  GLY A CA    1 
ATOM   4150 C C     . GLY A 1 517 ? -51.395 23.883  29.724  1.00 34.72  ? 517  GLY A C     1 
ATOM   4151 O O     . GLY A 1 517 ? -51.831 23.157  30.640  1.00 34.47  ? 517  GLY A O     1 
ATOM   4152 N N     . ARG A 1 518 ? -51.676 25.188  29.603  1.00 35.16  ? 518  ARG A N     1 
ATOM   4153 C CA    . ARG A 1 518 ? -52.559 25.924  30.525  1.00 35.34  ? 518  ARG A CA    1 
ATOM   4154 C C     . ARG A 1 518 ? -53.876 25.148  30.687  1.00 34.75  ? 518  ARG A C     1 
ATOM   4155 O O     . ARG A 1 518 ? -54.340 24.901  31.815  1.00 34.77  ? 518  ARG A O     1 
ATOM   4156 C CB    . ARG A 1 518 ? -52.798 27.370  30.011  1.00 35.84  ? 518  ARG A CB    1 
ATOM   4157 C CG    . ARG A 1 518 ? -53.667 28.251  30.904  1.00 37.73  ? 518  ARG A CG    1 
ATOM   4158 C CD    . ARG A 1 518 ? -53.149 29.682  31.007  1.00 43.74  ? 518  ARG A CD    1 
ATOM   4159 N NE    . ARG A 1 518 ? -53.471 30.248  32.327  1.00 48.75  ? 518  ARG A NE    1 
ATOM   4160 C CZ    . ARG A 1 518 ? -52.586 30.690  33.235  1.00 50.99  ? 518  ARG A CZ    1 
ATOM   4161 N NH1   . ARG A 1 518 ? -51.268 30.679  32.995  1.00 50.75  ? 518  ARG A NH1   1 
ATOM   4162 N NH2   . ARG A 1 518 ? -53.029 31.158  34.408  1.00 51.43  ? 518  ARG A NH2   1 
ATOM   4163 N N     . GLN A 1 519 ? -54.436 24.731  29.555  1.00 33.56  ? 519  GLN A N     1 
ATOM   4164 C CA    . GLN A 1 519 ? -55.658 23.963  29.553  1.00 33.22  ? 519  GLN A CA    1 
ATOM   4165 C C     . GLN A 1 519 ? -55.577 22.640  30.334  1.00 32.71  ? 519  GLN A C     1 
ATOM   4166 O O     . GLN A 1 519 ? -56.405 22.383  31.211  1.00 31.73  ? 519  GLN A O     1 
ATOM   4167 C CB    . GLN A 1 519 ? -56.097 23.697  28.124  1.00 33.46  ? 519  GLN A CB    1 
ATOM   4168 C CG    . GLN A 1 519 ? -57.459 23.086  28.071  1.00 35.06  ? 519  GLN A CG    1 
ATOM   4169 C CD    . GLN A 1 519 ? -57.799 22.530  26.732  1.00 36.86  ? 519  GLN A CD    1 
ATOM   4170 O OE1   . GLN A 1 519 ? -57.979 23.270  25.752  1.00 38.63  ? 519  GLN A OE1   1 
ATOM   4171 N NE2   . GLN A 1 519 ? -57.919 21.217  26.673  1.00 36.96  ? 519  GLN A NE2   1 
ATOM   4172 N N     . TYR A 1 520 ? -54.592 21.804  30.008  1.00 32.81  ? 520  TYR A N     1 
ATOM   4173 C CA    . TYR A 1 520 ? -54.481 20.502  30.653  1.00 33.15  ? 520  TYR A CA    1 
ATOM   4174 C C     . TYR A 1 520 ? -54.078 20.616  32.117  1.00 33.69  ? 520  TYR A C     1 
ATOM   4175 O O     . TYR A 1 520 ? -54.550 19.822  32.973  1.00 33.33  ? 520  TYR A O     1 
ATOM   4176 C CB    . TYR A 1 520 ? -53.534 19.580  29.902  1.00 33.21  ? 520  TYR A CB    1 
ATOM   4177 C CG    . TYR A 1 520 ? -54.010 19.266  28.513  1.00 33.41  ? 520  TYR A CG    1 
ATOM   4178 C CD1   . TYR A 1 520 ? -55.251 18.664  28.298  1.00 33.33  ? 520  TYR A CD1   1 
ATOM   4179 C CD2   . TYR A 1 520 ? -53.230 19.570  27.411  1.00 33.41  ? 520  TYR A CD2   1 
ATOM   4180 C CE1   . TYR A 1 520 ? -55.693 18.378  27.021  1.00 31.96  ? 520  TYR A CE1   1 
ATOM   4181 C CE2   . TYR A 1 520 ? -53.668 19.290  26.126  1.00 34.02  ? 520  TYR A CE2   1 
ATOM   4182 C CZ    . TYR A 1 520 ? -54.899 18.694  25.947  1.00 33.18  ? 520  TYR A CZ    1 
ATOM   4183 O OH    . TYR A 1 520 ? -55.325 18.416  24.678  1.00 34.78  ? 520  TYR A OH    1 
ATOM   4184 N N     . ILE A 1 521 ? -53.243 21.620  32.410  1.00 33.86  ? 521  ILE A N     1 
ATOM   4185 C CA    . ILE A 1 521 ? -52.850 21.885  33.790  1.00 34.29  ? 521  ILE A CA    1 
ATOM   4186 C C     . ILE A 1 521 ? -54.091 22.324  34.558  1.00 34.88  ? 521  ILE A C     1 
ATOM   4187 O O     . ILE A 1 521 ? -54.397 21.781  35.644  1.00 34.52  ? 521  ILE A O     1 
ATOM   4188 C CB    . ILE A 1 521 ? -51.702 22.929  33.896  1.00 34.57  ? 521  ILE A CB    1 
ATOM   4189 C CG1   . ILE A 1 521 ? -50.381 22.339  33.359  1.00 35.00  ? 521  ILE A CG1   1 
ATOM   4190 C CG2   . ILE A 1 521 ? -51.496 23.377  35.338  1.00 33.27  ? 521  ILE A CG2   1 
ATOM   4191 C CD1   . ILE A 1 521 ? -49.253 23.372  33.204  1.00 34.75  ? 521  ILE A CD1   1 
ATOM   4192 N N     . GLU A 1 522 ? -54.829 23.273  33.971  1.00 35.28  ? 522  GLU A N     1 
ATOM   4193 C CA    . GLU A 1 522 ? -56.042 23.755  34.615  1.00 35.94  ? 522  GLU A CA    1 
ATOM   4194 C C     . GLU A 1 522 ? -57.035 22.635  34.885  1.00 35.62  ? 522  GLU A C     1 
ATOM   4195 O O     . GLU A 1 522 ? -57.616 22.574  35.972  1.00 36.01  ? 522  GLU A O     1 
ATOM   4196 C CB    . GLU A 1 522 ? -56.660 24.932  33.872  1.00 36.11  ? 522  GLU A CB    1 
ATOM   4197 C CG    . GLU A 1 522 ? -56.425 26.251  34.624  1.00 39.14  ? 522  GLU A CG    1 
ATOM   4198 C CD    . GLU A 1 522 ? -56.102 27.432  33.717  1.00 43.02  ? 522  GLU A CD    1 
ATOM   4199 O OE1   . GLU A 1 522 ? -56.545 27.441  32.542  1.00 43.78  ? 522  GLU A OE1   1 
ATOM   4200 O OE2   . GLU A 1 522 ? -55.401 28.360  34.194  1.00 45.06  ? 522  GLU A OE2   1 
ATOM   4201 N N     . THR A 1 523 ? -57.180 21.728  33.922  1.00 35.02  ? 523  THR A N     1 
ATOM   4202 C CA    . THR A 1 523 ? -58.040 20.574  34.083  1.00 34.43  ? 523  THR A CA    1 
ATOM   4203 C C     . THR A 1 523 ? -57.579 19.722  35.258  1.00 34.65  ? 523  THR A C     1 
ATOM   4204 O O     . THR A 1 523 ? -58.369 19.418  36.148  1.00 34.63  ? 523  THR A O     1 
ATOM   4205 C CB    . THR A 1 523 ? -58.078 19.743  32.800  1.00 34.34  ? 523  THR A CB    1 
ATOM   4206 O OG1   . THR A 1 523 ? -58.747 20.496  31.786  1.00 34.42  ? 523  THR A OG1   1 
ATOM   4207 C CG2   . THR A 1 523 ? -58.801 18.413  33.010  1.00 33.34  ? 523  THR A CG2   1 
ATOM   4208 N N     . THR A 1 524 ? -56.302 19.349  35.259  1.00 34.62  ? 524  THR A N     1 
ATOM   4209 C CA    . THR A 1 524 ? -55.730 18.552  36.340  1.00 34.74  ? 524  THR A CA    1 
ATOM   4210 C C     . THR A 1 524 ? -56.019 19.183  37.702  1.00 35.00  ? 524  THR A C     1 
ATOM   4211 O O     . THR A 1 524 ? -56.465 18.503  38.643  1.00 35.06  ? 524  THR A O     1 
ATOM   4212 C CB    . THR A 1 524 ? -54.198 18.404  36.160  1.00 34.89  ? 524  THR A CB    1 
ATOM   4213 O OG1   . THR A 1 524 ? -53.926 17.987  34.822  1.00 34.69  ? 524  THR A OG1   1 
ATOM   4214 C CG2   . THR A 1 524 ? -53.632 17.384  37.122  1.00 34.58  ? 524  THR A CG2   1 
ATOM   4215 N N     . ILE A 1 525 ? -55.759 20.485  37.805  1.00 35.09  ? 525  ILE A N     1 
ATOM   4216 C CA    . ILE A 1 525 ? -55.992 21.207  39.054  1.00 35.35  ? 525  ILE A CA    1 
ATOM   4217 C C     . ILE A 1 525 ? -57.461 21.093  39.492  1.00 35.71  ? 525  ILE A C     1 
ATOM   4218 O O     . ILE A 1 525 ? -57.747 20.684  40.623  1.00 35.47  ? 525  ILE A O     1 
ATOM   4219 C CB    . ILE A 1 525 ? -55.468 22.681  38.981  1.00 35.23  ? 525  ILE A CB    1 
ATOM   4220 C CG1   . ILE A 1 525 ? -53.939 22.689  39.057  1.00 33.74  ? 525  ILE A CG1   1 
ATOM   4221 C CG2   . ILE A 1 525 ? -56.013 23.506  40.119  1.00 34.73  ? 525  ILE A CG2   1 
ATOM   4222 C CD1   . ILE A 1 525 ? -53.294 23.874  38.425  1.00 31.54  ? 525  ILE A CD1   1 
ATOM   4223 N N     . ARG A 1 526 ? -58.379 21.396  38.576  1.00 36.66  ? 526  ARG A N     1 
ATOM   4224 C CA    . ARG A 1 526 ? -59.812 21.279  38.842  1.00 38.12  ? 526  ARG A CA    1 
ATOM   4225 C C     . ARG A 1 526 ? -60.197 19.882  39.272  1.00 38.17  ? 526  ARG A C     1 
ATOM   4226 O O     . ARG A 1 526 ? -61.058 19.715  40.121  1.00 38.72  ? 526  ARG A O     1 
ATOM   4227 C CB    . ARG A 1 526 ? -60.624 21.640  37.612  1.00 38.73  ? 526  ARG A CB    1 
ATOM   4228 C CG    . ARG A 1 526 ? -62.039 22.154  37.924  1.00 42.56  ? 526  ARG A CG    1 
ATOM   4229 C CD    . ARG A 1 526 ? -62.685 22.830  36.704  1.00 48.79  ? 526  ARG A CD    1 
ATOM   4230 N NE    . ARG A 1 526 ? -61.762 22.908  35.561  1.00 53.79  ? 526  ARG A NE    1 
ATOM   4231 C CZ    . ARG A 1 526 ? -61.594 23.972  34.770  1.00 57.15  ? 526  ARG A CZ    1 
ATOM   4232 N NH1   . ARG A 1 526 ? -62.279 25.100  34.987  1.00 59.14  ? 526  ARG A NH1   1 
ATOM   4233 N NH2   . ARG A 1 526 ? -60.725 23.912  33.758  1.00 57.05  ? 526  ARG A NH2   1 
ATOM   4234 N N     . GLU A 1 527 ? -59.560 18.877  38.690  1.00 38.19  ? 527  GLU A N     1 
ATOM   4235 C CA    . GLU A 1 527 ? -59.902 17.507  38.989  1.00 38.27  ? 527  GLU A CA    1 
ATOM   4236 C C     . GLU A 1 527 ? -59.468 17.103  40.387  1.00 38.29  ? 527  GLU A C     1 
ATOM   4237 O O     . GLU A 1 527 ? -60.262 16.551  41.160  1.00 38.17  ? 527  GLU A O     1 
ATOM   4238 C CB    . GLU A 1 527 ? -59.289 16.581  37.953  1.00 38.64  ? 527  GLU A CB    1 
ATOM   4239 C CG    . GLU A 1 527 ? -59.905 16.700  36.559  1.00 39.89  ? 527  GLU A CG    1 
ATOM   4240 C CD    . GLU A 1 527 ? -61.258 16.035  36.463  1.00 42.42  ? 527  GLU A CD    1 
ATOM   4241 O OE1   . GLU A 1 527 ? -61.797 15.606  37.515  1.00 42.36  ? 527  GLU A OE1   1 
ATOM   4242 O OE2   . GLU A 1 527 ? -61.774 15.928  35.325  1.00 44.41  ? 527  GLU A OE2   1 
ATOM   4243 N N     . ILE A 1 528 ? -58.215 17.396  40.718  1.00 38.40  ? 528  ILE A N     1 
ATOM   4244 C CA    . ILE A 1 528 ? -57.660 17.013  42.020  1.00 38.40  ? 528  ILE A CA    1 
ATOM   4245 C C     . ILE A 1 528 ? -58.349 17.741  43.185  1.00 38.93  ? 528  ILE A C     1 
ATOM   4246 O O     . ILE A 1 528 ? -58.449 17.216  44.309  1.00 38.57  ? 528  ILE A O     1 
ATOM   4247 C CB    . ILE A 1 528 ? -56.136 17.224  42.070  1.00 37.94  ? 528  ILE A CB    1 
ATOM   4248 C CG1   . ILE A 1 528 ? -55.517 16.321  43.146  1.00 36.90  ? 528  ILE A CG1   1 
ATOM   4249 C CG2   . ILE A 1 528 ? -55.815 18.699  42.255  1.00 37.47  ? 528  ILE A CG2   1 
ATOM   4250 C CD1   . ILE A 1 528 ? -53.991 16.219  43.107  1.00 35.61  ? 528  ILE A CD1   1 
ATOM   4251 N N     . GLU A 1 529 ? -58.824 18.951  42.900  1.00 39.46  ? 529  GLU A N     1 
ATOM   4252 C CA    . GLU A 1 529 ? -59.527 19.726  43.900  1.00 40.37  ? 529  GLU A CA    1 
ATOM   4253 C C     . GLU A 1 529 ? -60.950 19.191  44.080  1.00 40.77  ? 529  GLU A C     1 
ATOM   4254 O O     . GLU A 1 529 ? -61.267 18.595  45.126  1.00 40.62  ? 529  GLU A O     1 
ATOM   4255 C CB    . GLU A 1 529 ? -59.490 21.218  43.563  1.00 40.25  ? 529  GLU A CB    1 
ATOM   4256 C CG    . GLU A 1 529 ? -58.300 21.892  44.183  1.00 41.32  ? 529  GLU A CG    1 
ATOM   4257 C CD    . GLU A 1 529 ? -58.133 23.342  43.780  1.00 43.33  ? 529  GLU A CD    1 
ATOM   4258 O OE1   . GLU A 1 529 ? -58.767 23.747  42.782  1.00 43.81  ? 529  GLU A OE1   1 
ATOM   4259 O OE2   . GLU A 1 529 ? -57.361 24.069  44.468  1.00 43.70  ? 529  GLU A OE2   1 
ATOM   4260 N N     . GLU A 1 530 ? -61.776 19.371  43.049  1.00 41.03  ? 530  GLU A N     1 
ATOM   4261 C CA    . GLU A 1 530 ? -63.155 18.902  43.064  1.00 41.69  ? 530  GLU A CA    1 
ATOM   4262 C C     . GLU A 1 530 ? -63.291 17.410  43.393  1.00 41.56  ? 530  GLU A C     1 
ATOM   4263 O O     . GLU A 1 530 ? -64.006 17.057  44.333  1.00 41.90  ? 530  GLU A O     1 
ATOM   4264 C CB    . GLU A 1 530 ? -63.860 19.236  41.747  1.00 41.98  ? 530  GLU A CB    1 
ATOM   4265 C CG    . GLU A 1 530 ? -64.410 20.662  41.682  1.00 44.41  ? 530  GLU A CG    1 
ATOM   4266 C CD    . GLU A 1 530 ? -64.688 21.111  40.250  1.00 49.88  ? 530  GLU A CD    1 
ATOM   4267 O OE1   . GLU A 1 530 ? -65.077 20.253  39.408  1.00 51.57  ? 530  GLU A OE1   1 
ATOM   4268 O OE2   . GLU A 1 530 ? -64.510 22.324  39.958  1.00 52.12  ? 530  GLU A OE2   1 
ATOM   4269 N N     . LYS A 1 531 ? -62.593 16.544  42.663  1.00 41.04  ? 531  LYS A N     1 
ATOM   4270 C CA    . LYS A 1 531 ? -62.813 15.111  42.818  1.00 40.70  ? 531  LYS A CA    1 
ATOM   4271 C C     . LYS A 1 531 ? -61.951 14.414  43.864  1.00 40.25  ? 531  LYS A C     1 
ATOM   4272 O O     . LYS A 1 531 ? -62.218 13.265  44.232  1.00 40.67  ? 531  LYS A O     1 
ATOM   4273 C CB    . LYS A 1 531 ? -62.711 14.394  41.465  1.00 41.31  ? 531  LYS A CB    1 
ATOM   4274 C CG    . LYS A 1 531 ? -64.034 14.300  40.731  1.00 41.50  ? 531  LYS A CG    1 
ATOM   4275 C CD    . LYS A 1 531 ? -63.897 14.678  39.276  1.00 41.59  ? 531  LYS A CD    1 
ATOM   4276 C CE    . LYS A 1 531 ? -65.206 15.270  38.761  1.00 42.41  ? 531  LYS A CE    1 
ATOM   4277 N NZ    . LYS A 1 531 ? -65.215 15.414  37.273  1.00 43.13  ? 531  LYS A NZ    1 
ATOM   4278 N N     . PHE A 1 532 ? -60.919 15.064  44.370  1.00 39.37  ? 532  PHE A N     1 
ATOM   4279 C CA    . PHE A 1 532 ? -60.142 14.365  45.392  1.00 38.53  ? 532  PHE A CA    1 
ATOM   4280 C C     . PHE A 1 532 ? -59.902 15.142  46.674  1.00 38.24  ? 532  PHE A C     1 
ATOM   4281 O O     . PHE A 1 532 ? -59.249 14.639  47.582  1.00 38.22  ? 532  PHE A O     1 
ATOM   4282 C CB    . PHE A 1 532 ? -58.826 13.841  44.809  1.00 38.59  ? 532  PHE A CB    1 
ATOM   4283 C CG    . PHE A 1 532 ? -59.000 12.714  43.823  1.00 37.18  ? 532  PHE A CG    1 
ATOM   4284 C CD1   . PHE A 1 532 ? -59.481 12.956  42.532  1.00 36.18  ? 532  PHE A CD1   1 
ATOM   4285 C CD2   . PHE A 1 532 ? -58.674 11.409  44.181  1.00 35.05  ? 532  PHE A CD2   1 
ATOM   4286 C CE1   . PHE A 1 532 ? -59.639 11.903  41.613  1.00 34.89  ? 532  PHE A CE1   1 
ATOM   4287 C CE2   . PHE A 1 532 ? -58.823 10.358  43.273  1.00 32.97  ? 532  PHE A CE2   1 
ATOM   4288 C CZ    . PHE A 1 532 ? -59.304 10.605  41.989  1.00 33.21  ? 532  PHE A CZ    1 
ATOM   4289 N N     . GLY A 1 533 ? -60.427 16.363  46.744  1.00 37.82  ? 533  GLY A N     1 
ATOM   4290 C CA    . GLY A 1 533 ? -60.272 17.203  47.923  1.00 37.31  ? 533  GLY A CA    1 
ATOM   4291 C C     . GLY A 1 533 ? -58.849 17.658  48.230  1.00 37.31  ? 533  GLY A C     1 
ATOM   4292 O O     . GLY A 1 533 ? -58.519 17.930  49.381  1.00 37.75  ? 533  GLY A O     1 
ATOM   4293 N N     . PHE A 1 534 ? -57.985 17.722  47.222  1.00 36.86  ? 534  PHE A N     1 
ATOM   4294 C CA    . PHE A 1 534 ? -56.660 18.294  47.423  1.00 36.28  ? 534  PHE A CA    1 
ATOM   4295 C C     . PHE A 1 534 ? -56.763 19.817  47.357  1.00 36.09  ? 534  PHE A C     1 
ATOM   4296 O O     . PHE A 1 534 ? -57.652 20.346  46.684  1.00 36.00  ? 534  PHE A O     1 
ATOM   4297 C CB    . PHE A 1 534 ? -55.672 17.778  46.370  1.00 36.05  ? 534  PHE A CB    1 
ATOM   4298 C CG    . PHE A 1 534 ? -55.045 16.467  46.725  1.00 35.70  ? 534  PHE A CG    1 
ATOM   4299 C CD1   . PHE A 1 534 ? -55.726 15.264  46.503  1.00 35.56  ? 534  PHE A CD1   1 
ATOM   4300 C CD2   . PHE A 1 534 ? -53.783 16.423  47.292  1.00 34.18  ? 534  PHE A CD2   1 
ATOM   4301 C CE1   . PHE A 1 534 ? -55.153 14.037  46.858  1.00 33.80  ? 534  PHE A CE1   1 
ATOM   4302 C CE2   . PHE A 1 534 ? -53.207 15.196  47.646  1.00 34.42  ? 534  PHE A CE2   1 
ATOM   4303 C CZ    . PHE A 1 534 ? -53.898 14.003  47.423  1.00 33.41  ? 534  PHE A CZ    1 
ATOM   4304 N N     . LYS A 1 535 ? -55.874 20.514  48.058  1.00 35.49  ? 535  LYS A N     1 
ATOM   4305 C CA    . LYS A 1 535 ? -55.738 21.947  47.873  1.00 35.47  ? 535  LYS A CA    1 
ATOM   4306 C C     . LYS A 1 535 ? -54.420 22.119  47.151  1.00 34.94  ? 535  LYS A C     1 
ATOM   4307 O O     . LYS A 1 535 ? -53.428 21.495  47.533  1.00 34.77  ? 535  LYS A O     1 
ATOM   4308 C CB    . LYS A 1 535 ? -55.734 22.661  49.229  1.00 35.95  ? 535  LYS A CB    1 
ATOM   4309 C CG    . LYS A 1 535 ? -55.690 24.180  49.187  1.00 38.35  ? 535  LYS A CG    1 
ATOM   4310 C CD    . LYS A 1 535 ? -57.025 24.776  48.755  1.00 45.14  ? 535  LYS A CD    1 
ATOM   4311 C CE    . LYS A 1 535 ? -57.527 25.829  49.767  1.00 47.54  ? 535  LYS A CE    1 
ATOM   4312 N NZ    . LYS A 1 535 ? -57.664 25.248  51.155  1.00 48.43  ? 535  LYS A NZ    1 
ATOM   4313 N N     . VAL A 1 536 ? -54.403 22.924  46.092  1.00 34.49  ? 536  VAL A N     1 
ATOM   4314 C CA    . VAL A 1 536 ? -53.164 23.131  45.330  1.00 33.99  ? 536  VAL A CA    1 
ATOM   4315 C C     . VAL A 1 536 ? -52.402 24.344  45.859  1.00 33.95  ? 536  VAL A C     1 
ATOM   4316 O O     . VAL A 1 536 ? -52.855 25.490  45.742  1.00 34.02  ? 536  VAL A O     1 
ATOM   4317 C CB    . VAL A 1 536 ? -53.420 23.275  43.829  1.00 34.18  ? 536  VAL A CB    1 
ATOM   4318 C CG1   . VAL A 1 536 ? -52.142 23.697  43.099  1.00 33.47  ? 536  VAL A CG1   1 
ATOM   4319 C CG2   . VAL A 1 536 ? -53.997 21.979  43.253  1.00 33.53  ? 536  VAL A CG2   1 
ATOM   4320 N N     . LEU A 1 537 ? -51.234 24.078  46.429  1.00 33.48  ? 537  LEU A N     1 
ATOM   4321 C CA    . LEU A 1 537 ? -50.519 25.083  47.189  1.00 32.98  ? 537  LEU A CA    1 
ATOM   4322 C C     . LEU A 1 537 ? -49.704 26.015  46.303  1.00 32.91  ? 537  LEU A C     1 
ATOM   4323 O O     . LEU A 1 537 ? -49.625 27.222  46.558  1.00 33.09  ? 537  LEU A O     1 
ATOM   4324 C CB    . LEU A 1 537 ? -49.655 24.400  48.239  1.00 32.72  ? 537  LEU A CB    1 
ATOM   4325 C CG    . LEU A 1 537 ? -50.511 23.479  49.111  1.00 32.88  ? 537  LEU A CG    1 
ATOM   4326 C CD1   . LEU A 1 537 ? -49.683 22.617  50.065  1.00 32.35  ? 537  LEU A CD1   1 
ATOM   4327 C CD2   . LEU A 1 537 ? -51.521 24.304  49.874  1.00 31.48  ? 537  LEU A CD2   1 
ATOM   4328 N N     . TYR A 1 538 ? -49.127 25.464  45.244  1.00 32.35  ? 538  TYR A N     1 
ATOM   4329 C CA    . TYR A 1 538 ? -48.241 26.212  44.371  1.00 32.21  ? 538  TYR A CA    1 
ATOM   4330 C C     . TYR A 1 538 ? -48.260 25.473  43.052  1.00 32.23  ? 538  TYR A C     1 
ATOM   4331 O O     . TYR A 1 538 ? -48.298 24.238  43.051  1.00 32.09  ? 538  TYR A O     1 
ATOM   4332 C CB    . TYR A 1 538 ? -46.819 26.206  44.969  1.00 32.20  ? 538  TYR A CB    1 
ATOM   4333 C CG    . TYR A 1 538 ? -45.714 26.731  44.066  1.00 32.14  ? 538  TYR A CG    1 
ATOM   4334 C CD1   . TYR A 1 538 ? -45.271 28.054  44.158  1.00 32.14  ? 538  TYR A CD1   1 
ATOM   4335 C CD2   . TYR A 1 538 ? -45.100 25.896  43.138  1.00 31.22  ? 538  TYR A CD2   1 
ATOM   4336 C CE1   . TYR A 1 538 ? -44.248 28.532  43.334  1.00 32.18  ? 538  TYR A CE1   1 
ATOM   4337 C CE2   . TYR A 1 538 ? -44.096 26.359  42.312  1.00 32.63  ? 538  TYR A CE2   1 
ATOM   4338 C CZ    . TYR A 1 538 ? -43.664 27.673  42.413  1.00 33.17  ? 538  TYR A CZ    1 
ATOM   4339 O OH    . TYR A 1 538 ? -42.655 28.099  41.579  1.00 32.14  ? 538  TYR A OH    1 
ATOM   4340 N N     . ALA A 1 539 ? -48.239 26.205  41.937  1.00 32.07  ? 539  ALA A N     1 
ATOM   4341 C CA    . ALA A 1 539 ? -48.105 25.564  40.641  1.00 32.29  ? 539  ALA A CA    1 
ATOM   4342 C C     . ALA A 1 539 ? -47.445 26.466  39.654  1.00 32.93  ? 539  ALA A C     1 
ATOM   4343 O O     . ALA A 1 539 ? -47.957 27.556  39.388  1.00 33.05  ? 539  ALA A O     1 
ATOM   4344 C CB    . ALA A 1 539 ? -49.432 25.154  40.121  1.00 32.15  ? 539  ALA A CB    1 
ATOM   4345 N N     . ASP A 1 540 ? -46.315 26.019  39.107  1.00 33.51  ? 540  ASP A N     1 
ATOM   4346 C CA    . ASP A 1 540 ? -45.654 26.749  38.016  1.00 34.38  ? 540  ASP A CA    1 
ATOM   4347 C C     . ASP A 1 540 ? -45.622 25.915  36.762  1.00 34.68  ? 540  ASP A C     1 
ATOM   4348 O O     . ASP A 1 540 ? -46.321 24.919  36.660  1.00 34.87  ? 540  ASP A O     1 
ATOM   4349 C CB    . ASP A 1 540 ? -44.230 27.205  38.378  1.00 34.52  ? 540  ASP A CB    1 
ATOM   4350 C CG    . ASP A 1 540 ? -43.321 26.067  38.830  1.00 35.74  ? 540  ASP A CG    1 
ATOM   4351 O OD1   . ASP A 1 540 ? -42.242 26.383  39.358  1.00 37.71  ? 540  ASP A OD1   1 
ATOM   4352 O OD2   . ASP A 1 540 ? -43.648 24.869  38.674  1.00 38.20  ? 540  ASP A OD2   1 
ATOM   4353 N N     . THR A 1 541 ? -44.771 26.313  35.829  1.00 35.22  ? 541  THR A N     1 
ATOM   4354 C CA    . THR A 1 541 ? -44.603 25.632  34.552  1.00 35.21  ? 541  THR A CA    1 
ATOM   4355 C C     . THR A 1 541 ? -44.253 24.151  34.662  1.00 35.12  ? 541  THR A C     1 
ATOM   4356 O O     . THR A 1 541 ? -44.587 23.379  33.760  1.00 35.25  ? 541  THR A O     1 
ATOM   4357 C CB    . THR A 1 541 ? -43.506 26.324  33.700  1.00 35.65  ? 541  THR A CB    1 
ATOM   4358 O OG1   . THR A 1 541 ? -43.551 25.826  32.360  1.00 37.62  ? 541  THR A OG1   1 
ATOM   4359 C CG2   . THR A 1 541 ? -42.084 26.094  34.292  1.00 34.85  ? 541  THR A CG2   1 
ATOM   4360 N N     . ASP A 1 542 ? -43.570 23.717  35.716  1.00 34.85  ? 542  ASP A N     1 
ATOM   4361 C CA    . ASP A 1 542 ? -43.218 22.296  35.692  1.00 35.44  ? 542  ASP A CA    1 
ATOM   4362 C C     . ASP A 1 542 ? -43.864 21.369  36.701  1.00 34.86  ? 542  ASP A C     1 
ATOM   4363 O O     . ASP A 1 542 ? -43.610 20.172  36.694  1.00 35.84  ? 542  ASP A O     1 
ATOM   4364 C CB    . ASP A 1 542 ? -41.704 21.987  35.472  1.00 36.29  ? 542  ASP A CB    1 
ATOM   4365 C CG    . ASP A 1 542 ? -40.771 23.069  35.976  1.00 37.76  ? 542  ASP A CG    1 
ATOM   4366 O OD1   . ASP A 1 542 ? -40.910 23.462  37.146  1.00 41.13  ? 542  ASP A OD1   1 
ATOM   4367 O OD2   . ASP A 1 542 ? -39.880 23.500  35.204  1.00 37.94  ? 542  ASP A OD2   1 
ATOM   4368 N N     . GLY A 1 543 ? -44.748 21.889  37.526  1.00 34.01  ? 543  GLY A N     1 
ATOM   4369 C CA    . GLY A 1 543 ? -45.412 21.033  38.483  1.00 32.59  ? 543  GLY A CA    1 
ATOM   4370 C C     . GLY A 1 543 ? -46.212 21.852  39.461  1.00 31.91  ? 543  GLY A C     1 
ATOM   4371 O O     . GLY A 1 543 ? -46.250 23.103  39.354  1.00 31.50  ? 543  GLY A O     1 
ATOM   4372 N N     . PHE A 1 544 ? -46.865 21.137  40.379  1.00 30.50  ? 544  PHE A N     1 
ATOM   4373 C CA    . PHE A 1 544 ? -47.615 21.741  41.438  1.00 30.03  ? 544  PHE A CA    1 
ATOM   4374 C C     . PHE A 1 544 ? -47.443 20.930  42.699  1.00 29.86  ? 544  PHE A C     1 
ATOM   4375 O O     . PHE A 1 544 ? -47.087 19.748  42.646  1.00 29.79  ? 544  PHE A O     1 
ATOM   4376 C CB    . PHE A 1 544 ? -49.095 21.937  41.061  1.00 30.28  ? 544  PHE A CB    1 
ATOM   4377 C CG    . PHE A 1 544 ? -49.921 20.660  41.002  1.00 32.03  ? 544  PHE A CG    1 
ATOM   4378 C CD1   . PHE A 1 544 ? -50.042 19.943  39.827  1.00 33.34  ? 544  PHE A CD1   1 
ATOM   4379 C CD2   . PHE A 1 544 ? -50.629 20.215  42.105  1.00 33.08  ? 544  PHE A CD2   1 
ATOM   4380 C CE1   . PHE A 1 544 ? -50.809 18.783  39.766  1.00 33.50  ? 544  PHE A CE1   1 
ATOM   4381 C CE2   . PHE A 1 544 ? -51.404 19.055  42.045  1.00 33.83  ? 544  PHE A CE2   1 
ATOM   4382 C CZ    . PHE A 1 544 ? -51.491 18.343  40.869  1.00 33.80  ? 544  PHE A CZ    1 
ATOM   4383 N N     . PHE A 1 545 ? -47.646 21.588  43.837  1.00 29.23  ? 545  PHE A N     1 
ATOM   4384 C CA    . PHE A 1 545 ? -47.580 20.942  45.137  1.00 28.66  ? 545  PHE A CA    1 
ATOM   4385 C C     . PHE A 1 545 ? -49.024 20.949  45.583  1.00 29.04  ? 545  PHE A C     1 
ATOM   4386 O O     . PHE A 1 545 ? -49.757 21.864  45.221  1.00 29.53  ? 545  PHE A O     1 
ATOM   4387 C CB    . PHE A 1 545 ? -46.771 21.769  46.152  1.00 28.00  ? 545  PHE A CB    1 
ATOM   4388 C CG    . PHE A 1 545 ? -45.303 21.938  45.832  1.00 25.62  ? 545  PHE A CG    1 
ATOM   4389 C CD1   . PHE A 1 545 ? -44.875 22.843  44.858  1.00 25.30  ? 545  PHE A CD1   1 
ATOM   4390 C CD2   . PHE A 1 545 ? -44.341 21.275  46.580  1.00 24.11  ? 545  PHE A CD2   1 
ATOM   4391 C CE1   . PHE A 1 545 ? -43.511 23.033  44.602  1.00 23.80  ? 545  PHE A CE1   1 
ATOM   4392 C CE2   . PHE A 1 545 ? -42.973 21.465  46.339  1.00 22.97  ? 545  PHE A CE2   1 
ATOM   4393 C CZ    . PHE A 1 545 ? -42.561 22.345  45.349  1.00 21.98  ? 545  PHE A CZ    1 
ATOM   4394 N N     . ALA A 1 546 ? -49.445 19.948  46.351  1.00 29.39  ? 546  ALA A N     1 
ATOM   4395 C CA    . ALA A 1 546 ? -50.810 19.899  46.858  1.00 29.89  ? 546  ALA A CA    1 
ATOM   4396 C C     . ALA A 1 546 ? -50.869 19.039  48.109  1.00 30.93  ? 546  ALA A C     1 
ATOM   4397 O O     . ALA A 1 546 ? -49.960 18.247  48.372  1.00 31.06  ? 546  ALA A O     1 
ATOM   4398 C CB    . ALA A 1 546 ? -51.754 19.371  45.803  1.00 29.33  ? 546  ALA A CB    1 
ATOM   4399 N N     . THR A 1 547 ? -51.919 19.230  48.900  1.00 32.14  ? 547  THR A N     1 
ATOM   4400 C CA    . THR A 1 547 ? -52.189 18.379  50.036  1.00 33.57  ? 547  THR A CA    1 
ATOM   4401 C C     . THR A 1 547 ? -53.693 18.273  50.242  1.00 34.69  ? 547  THR A C     1 
ATOM   4402 O O     . THR A 1 547 ? -54.460 19.023  49.615  1.00 34.37  ? 547  THR A O     1 
ATOM   4403 C CB    . THR A 1 547 ? -51.505 18.906  51.312  1.00 33.71  ? 547  THR A CB    1 
ATOM   4404 O OG1   . THR A 1 547 ? -51.554 17.908  52.338  1.00 34.31  ? 547  THR A OG1   1 
ATOM   4405 C CG2   . THR A 1 547 ? -52.169 20.178  51.828  1.00 34.27  ? 547  THR A CG2   1 
ATOM   4406 N N     . ILE A 1 548 ? -54.097 17.317  51.088  1.00 36.29  ? 548  ILE A N     1 
ATOM   4407 C CA    . ILE A 1 548 ? -55.440 17.293  51.681  1.00 38.00  ? 548  ILE A CA    1 
ATOM   4408 C C     . ILE A 1 548 ? -55.384 18.014  53.040  1.00 39.00  ? 548  ILE A C     1 
ATOM   4409 O O     . ILE A 1 548 ? -54.778 17.491  53.987  1.00 39.26  ? 548  ILE A O     1 
ATOM   4410 C CB    . ILE A 1 548 ? -55.974 15.847  51.980  1.00 38.41  ? 548  ILE A CB    1 
ATOM   4411 C CG1   . ILE A 1 548 ? -55.835 14.868  50.797  1.00 38.24  ? 548  ILE A CG1   1 
ATOM   4412 C CG2   . ILE A 1 548 ? -57.410 15.916  52.497  1.00 38.52  ? 548  ILE A CG2   1 
ATOM   4413 C CD1   . ILE A 1 548 ? -56.982 14.894  49.843  1.00 38.42  ? 548  ILE A CD1   1 
ATOM   4414 N N     . PRO A 1 549 ? -55.999 19.216  53.147  1.00 39.97  ? 549  PRO A N     1 
ATOM   4415 C CA    . PRO A 1 549 ? -56.191 19.862  54.438  1.00 40.64  ? 549  PRO A CA    1 
ATOM   4416 C C     . PRO A 1 549 ? -56.473 18.853  55.537  1.00 41.42  ? 549  PRO A C     1 
ATOM   4417 O O     . PRO A 1 549 ? -57.390 18.052  55.416  1.00 42.03  ? 549  PRO A O     1 
ATOM   4418 C CB    . PRO A 1 549 ? -57.431 20.700  54.192  1.00 40.52  ? 549  PRO A CB    1 
ATOM   4419 C CG    . PRO A 1 549 ? -57.245 21.167  52.774  1.00 40.23  ? 549  PRO A CG    1 
ATOM   4420 C CD    . PRO A 1 549 ? -56.534 20.055  52.056  1.00 39.98  ? 549  PRO A CD    1 
ATOM   4421 N N     . GLY A 1 550 ? -55.659 18.854  56.578  1.00 42.05  ? 550  GLY A N     1 
ATOM   4422 C CA    . GLY A 1 550 ? -55.929 18.009  57.720  1.00 42.91  ? 550  GLY A CA    1 
ATOM   4423 C C     . GLY A 1 550 ? -55.637 16.526  57.613  1.00 43.68  ? 550  GLY A C     1 
ATOM   4424 O O     . GLY A 1 550 ? -55.672 15.835  58.628  1.00 44.14  ? 550  GLY A O     1 
ATOM   4425 N N     . ALA A 1 551 ? -55.352 16.003  56.426  1.00 44.29  ? 551  ALA A N     1 
ATOM   4426 C CA    . ALA A 1 551 ? -55.093 14.559  56.325  1.00 45.15  ? 551  ALA A CA    1 
ATOM   4427 C C     . ALA A 1 551 ? -53.693 14.192  56.799  1.00 45.75  ? 551  ALA A C     1 
ATOM   4428 O O     . ALA A 1 551 ? -52.838 15.060  56.953  1.00 46.25  ? 551  ALA A O     1 
ATOM   4429 C CB    . ALA A 1 551 ? -55.311 14.075  54.923  1.00 45.36  ? 551  ALA A CB    1 
ATOM   4430 N N     . ASP A 1 552 ? -53.452 12.910  57.034  1.00 46.37  ? 552  ASP A N     1 
ATOM   4431 C CA    . ASP A 1 552 ? -52.123 12.470  57.443  1.00 47.25  ? 552  ASP A CA    1 
ATOM   4432 C C     . ASP A 1 552 ? -51.318 11.882  56.267  1.00 47.67  ? 552  ASP A C     1 
ATOM   4433 O O     . ASP A 1 552 ? -51.851 11.651  55.178  1.00 47.77  ? 552  ASP A O     1 
ATOM   4434 C CB    . ASP A 1 552 ? -52.214 11.480  58.610  1.00 47.38  ? 552  ASP A CB    1 
ATOM   4435 C CG    . ASP A 1 552 ? -52.965 10.217  58.239  1.00 48.23  ? 552  ASP A CG    1 
ATOM   4436 O OD1   . ASP A 1 552 ? -52.314 9.191   57.966  1.00 51.03  ? 552  ASP A OD1   1 
ATOM   4437 O OD2   . ASP A 1 552 ? -54.206 10.254  58.185  1.00 48.71  ? 552  ASP A OD2   1 
ATOM   4438 N N     . ALA A 1 553 ? -50.035 11.627  56.504  1.00 48.06  ? 553  ALA A N     1 
ATOM   4439 C CA    . ALA A 1 553 ? -49.123 11.247  55.439  1.00 48.47  ? 553  ALA A CA    1 
ATOM   4440 C C     . ALA A 1 553 ? -49.564 10.012  54.637  1.00 49.02  ? 553  ALA A C     1 
ATOM   4441 O O     . ALA A 1 553 ? -49.600 10.067  53.403  1.00 49.39  ? 553  ALA A O     1 
ATOM   4442 C CB    . ALA A 1 553 ? -47.709 11.091  55.977  1.00 48.31  ? 553  ALA A CB    1 
ATOM   4443 N N     . GLU A 1 554 ? -49.903 8.912   55.318  1.00 49.39  ? 554  GLU A N     1 
ATOM   4444 C CA    . GLU A 1 554 ? -50.332 7.685   54.623  1.00 49.65  ? 554  GLU A CA    1 
ATOM   4445 C C     . GLU A 1 554 ? -51.530 7.960   53.726  1.00 49.57  ? 554  GLU A C     1 
ATOM   4446 O O     . GLU A 1 554 ? -51.509 7.604   52.546  1.00 49.33  ? 554  GLU A O     1 
ATOM   4447 C CB    . GLU A 1 554 ? -50.652 6.562   55.606  1.00 49.80  ? 554  GLU A CB    1 
ATOM   4448 C CG    . GLU A 1 554 ? -49.434 6.087   56.399  1.00 51.10  ? 554  GLU A CG    1 
ATOM   4449 N N     . THR A 1 555 ? -52.549 8.621   54.288  1.00 49.46  ? 555  THR A N     1 
ATOM   4450 C CA    . THR A 1 555 ? -53.737 9.041   53.543  1.00 49.40  ? 555  THR A CA    1 
ATOM   4451 C C     . THR A 1 555 ? -53.356 9.797   52.266  1.00 49.49  ? 555  THR A C     1 
ATOM   4452 O O     . THR A 1 555 ? -53.629 9.326   51.151  1.00 49.66  ? 555  THR A O     1 
ATOM   4453 C CB    . THR A 1 555 ? -54.634 9.970   54.385  1.00 49.59  ? 555  THR A CB    1 
ATOM   4454 O OG1   . THR A 1 555 ? -54.588 9.573   55.760  1.00 50.19  ? 555  THR A OG1   1 
ATOM   4455 C CG2   . THR A 1 555 ? -56.070 9.953   53.877  1.00 48.62  ? 555  THR A CG2   1 
ATOM   4456 N N     . VAL A 1 556 ? -52.714 10.958  52.438  1.00 49.02  ? 556  VAL A N     1 
ATOM   4457 C CA    . VAL A 1 556 ? -52.373 11.839  51.320  1.00 48.19  ? 556  VAL A CA    1 
ATOM   4458 C C     . VAL A 1 556 ? -51.691 11.070  50.204  1.00 47.81  ? 556  VAL A C     1 
ATOM   4459 O O     . VAL A 1 556 ? -52.054 11.222  49.046  1.00 47.46  ? 556  VAL A O     1 
ATOM   4460 C CB    . VAL A 1 556 ? -51.511 13.032  51.772  1.00 48.05  ? 556  VAL A CB    1 
ATOM   4461 C CG1   . VAL A 1 556 ? -50.741 13.606  50.618  1.00 48.02  ? 556  VAL A CG1   1 
ATOM   4462 C CG2   . VAL A 1 556 ? -52.392 14.118  52.377  1.00 48.53  ? 556  VAL A CG2   1 
ATOM   4463 N N     . LYS A 1 557 ? -50.732 10.224  50.568  1.00 47.66  ? 557  LYS A N     1 
ATOM   4464 C CA    . LYS A 1 557 ? -49.970 9.452   49.586  1.00 47.88  ? 557  LYS A CA    1 
ATOM   4465 C C     . LYS A 1 557 ? -50.853 8.465   48.811  1.00 47.97  ? 557  LYS A C     1 
ATOM   4466 O O     . LYS A 1 557 ? -50.813 8.445   47.576  1.00 47.98  ? 557  LYS A O     1 
ATOM   4467 C CB    . LYS A 1 557 ? -48.795 8.717   50.243  1.00 47.96  ? 557  LYS A CB    1 
ATOM   4468 C CG    . LYS A 1 557 ? -47.683 9.608   50.756  1.00 48.20  ? 557  LYS A CG    1 
ATOM   4469 C CD    . LYS A 1 557 ? -46.586 8.779   51.378  1.00 48.38  ? 557  LYS A CD    1 
ATOM   4470 C CE    . LYS A 1 557 ? -45.742 9.600   52.327  1.00 48.53  ? 557  LYS A CE    1 
ATOM   4471 N NZ    . LYS A 1 557 ? -44.638 8.772   52.886  1.00 47.94  ? 557  LYS A NZ    1 
ATOM   4472 N N     . LYS A 1 558 ? -51.629 7.655   49.539  1.00 47.56  ? 558  LYS A N     1 
ATOM   4473 C CA    . LYS A 1 558 ? -52.605 6.748   48.952  1.00 47.21  ? 558  LYS A CA    1 
ATOM   4474 C C     . LYS A 1 558 ? -53.499 7.520   47.982  1.00 46.95  ? 558  LYS A C     1 
ATOM   4475 O O     . LYS A 1 558 ? -53.645 7.151   46.820  1.00 47.06  ? 558  LYS A O     1 
ATOM   4476 C CB    . LYS A 1 558 ? -53.454 6.117   50.060  1.00 47.43  ? 558  LYS A CB    1 
ATOM   4477 C CG    . LYS A 1 558 ? -53.928 4.686   49.795  1.00 47.91  ? 558  LYS A CG    1 
ATOM   4478 N N     . LYS A 1 559 ? -54.062 8.619   48.462  1.00 46.68  ? 559  LYS A N     1 
ATOM   4479 C CA    . LYS A 1 559 ? -54.971 9.436   47.677  1.00 46.53  ? 559  LYS A CA    1 
ATOM   4480 C C     . LYS A 1 559 ? -54.284 10.080  46.469  1.00 46.04  ? 559  LYS A C     1 
ATOM   4481 O O     . LYS A 1 559 ? -54.905 10.237  45.422  1.00 46.51  ? 559  LYS A O     1 
ATOM   4482 C CB    . LYS A 1 559 ? -55.598 10.507  48.575  1.00 46.86  ? 559  LYS A CB    1 
ATOM   4483 C CG    . LYS A 1 559 ? -57.129 10.524  48.604  1.00 49.00  ? 559  LYS A CG    1 
ATOM   4484 C CD    . LYS A 1 559 ? -57.745 9.173   49.070  1.00 52.45  ? 559  LYS A CD    1 
ATOM   4485 C CE    . LYS A 1 559 ? -59.278 9.282   49.243  1.00 54.32  ? 559  LYS A CE    1 
ATOM   4486 N NZ    . LYS A 1 559 ? -60.052 8.275   48.439  1.00 53.93  ? 559  LYS A NZ    1 
ATOM   4487 N N     . ALA A 1 560 ? -53.011 10.451  46.603  1.00 45.25  ? 560  ALA A N     1 
ATOM   4488 C CA    . ALA A 1 560 ? -52.281 11.061  45.496  1.00 44.21  ? 560  ALA A CA    1 
ATOM   4489 C C     . ALA A 1 560 ? -52.104 10.054  44.372  1.00 44.11  ? 560  ALA A C     1 
ATOM   4490 O O     . ALA A 1 560 ? -52.323 10.370  43.207  1.00 44.22  ? 560  ALA A O     1 
ATOM   4491 C CB    . ALA A 1 560 ? -50.963 11.565  45.954  1.00 43.84  ? 560  ALA A CB    1 
ATOM   4492 N N     . LYS A 1 561 ? -51.739 8.827   44.728  1.00 44.09  ? 561  LYS A N     1 
ATOM   4493 C CA    . LYS A 1 561 ? -51.543 7.755   43.742  1.00 43.92  ? 561  LYS A CA    1 
ATOM   4494 C C     . LYS A 1 561 ? -52.836 7.444   43.017  1.00 42.88  ? 561  LYS A C     1 
ATOM   4495 O O     . LYS A 1 561 ? -52.852 7.324   41.791  1.00 42.65  ? 561  LYS A O     1 
ATOM   4496 C CB    . LYS A 1 561 ? -50.928 6.490   44.375  1.00 44.54  ? 561  LYS A CB    1 
ATOM   4497 C CG    . LYS A 1 561 ? -49.587 6.777   45.091  1.00 47.04  ? 561  LYS A CG    1 
ATOM   4498 C CD    . LYS A 1 561 ? -48.479 5.737   44.864  1.00 50.63  ? 561  LYS A CD    1 
ATOM   4499 C CE    . LYS A 1 561 ? -47.087 6.354   45.206  1.00 52.24  ? 561  LYS A CE    1 
ATOM   4500 N NZ    . LYS A 1 561 ? -45.923 5.405   45.083  1.00 52.08  ? 561  LYS A NZ    1 
ATOM   4501 N N     . GLU A 1 562 ? -53.929 7.353   43.768  1.00 41.96  ? 562  GLU A N     1 
ATOM   4502 C CA    . GLU A 1 562 ? -55.241 7.154   43.154  1.00 41.02  ? 562  GLU A CA    1 
ATOM   4503 C C     . GLU A 1 562 ? -55.538 8.218   42.130  1.00 39.99  ? 562  GLU A C     1 
ATOM   4504 O O     . GLU A 1 562 ? -56.064 7.917   41.063  1.00 40.46  ? 562  GLU A O     1 
ATOM   4505 C CB    . GLU A 1 562 ? -56.347 7.128   44.189  1.00 41.20  ? 562  GLU A CB    1 
ATOM   4506 C CG    . GLU A 1 562 ? -56.531 5.771   44.804  1.00 42.71  ? 562  GLU A CG    1 
ATOM   4507 C CD    . GLU A 1 562 ? -57.273 5.832   46.124  1.00 45.44  ? 562  GLU A CD    1 
ATOM   4508 O OE1   . GLU A 1 562 ? -58.279 6.590   46.214  1.00 46.61  ? 562  GLU A OE1   1 
ATOM   4509 O OE2   . GLU A 1 562 ? -56.841 5.114   47.062  1.00 44.98  ? 562  GLU A OE2   1 
ATOM   4510 N N     . PHE A 1 563 ? -55.193 9.462   42.445  1.00 38.68  ? 563  PHE A N     1 
ATOM   4511 C CA    . PHE A 1 563 ? -55.438 10.549  41.511  1.00 37.06  ? 563  PHE A CA    1 
ATOM   4512 C C     . PHE A 1 563 ? -54.572 10.431  40.252  1.00 36.95  ? 563  PHE A C     1 
ATOM   4513 O O     . PHE A 1 563 ? -54.986 10.834  39.160  1.00 36.28  ? 563  PHE A O     1 
ATOM   4514 C CB    . PHE A 1 563 ? -55.244 11.910  42.170  1.00 36.20  ? 563  PHE A CB    1 
ATOM   4515 C CG    . PHE A 1 563 ? -55.293 13.029  41.199  1.00 32.59  ? 563  PHE A CG    1 
ATOM   4516 C CD1   . PHE A 1 563 ? -56.493 13.404  40.638  1.00 29.54  ? 563  PHE A CD1   1 
ATOM   4517 C CD2   . PHE A 1 563 ? -54.132 13.661  40.799  1.00 29.09  ? 563  PHE A CD2   1 
ATOM   4518 C CE1   . PHE A 1 563 ? -56.558 14.428  39.711  1.00 29.99  ? 563  PHE A CE1   1 
ATOM   4519 C CE2   . PHE A 1 563 ? -54.175 14.674  39.870  1.00 30.30  ? 563  PHE A CE2   1 
ATOM   4520 C CZ    . PHE A 1 563 ? -55.395 15.068  39.318  1.00 30.29  ? 563  PHE A CZ    1 
ATOM   4521 N N     . LEU A 1 564 ? -53.367 9.897   40.418  1.00 36.99  ? 564  LEU A N     1 
ATOM   4522 C CA    . LEU A 1 564 ? -52.466 9.723   39.294  1.00 37.46  ? 564  LEU A CA    1 
ATOM   4523 C C     . LEU A 1 564 ? -53.051 8.804   38.253  1.00 38.00  ? 564  LEU A C     1 
ATOM   4524 O O     . LEU A 1 564 ? -52.965 9.109   37.061  1.00 38.37  ? 564  LEU A O     1 
ATOM   4525 C CB    . LEU A 1 564 ? -51.151 9.137   39.732  1.00 37.30  ? 564  LEU A CB    1 
ATOM   4526 C CG    . LEU A 1 564 ? -49.960 10.055  39.849  1.00 37.88  ? 564  LEU A CG    1 
ATOM   4527 C CD1   . LEU A 1 564 ? -48.805 9.086   39.980  1.00 40.36  ? 564  LEU A CD1   1 
ATOM   4528 C CD2   . LEU A 1 564 ? -49.784 10.972  38.641  1.00 37.83  ? 564  LEU A CD2   1 
ATOM   4529 N N     . ASP A 1 565 ? -53.635 7.683   38.698  1.00 37.89  ? 565  ASP A N     1 
ATOM   4530 C CA    . ASP A 1 565 ? -54.302 6.766   37.790  1.00 37.88  ? 565  ASP A CA    1 
ATOM   4531 C C     . ASP A 1 565 ? -55.487 7.424   37.138  1.00 36.73  ? 565  ASP A C     1 
ATOM   4532 O O     . ASP A 1 565 ? -55.646 7.374   35.910  1.00 36.71  ? 565  ASP A O     1 
ATOM   4533 C CB    . ASP A 1 565 ? -54.733 5.507   38.508  1.00 38.96  ? 565  ASP A CB    1 
ATOM   4534 C CG    . ASP A 1 565 ? -53.645 4.451   38.495  1.00 44.24  ? 565  ASP A CG    1 
ATOM   4535 O OD1   . ASP A 1 565 ? -52.599 4.668   39.178  1.00 47.01  ? 565  ASP A OD1   1 
ATOM   4536 O OD2   . ASP A 1 565 ? -53.821 3.422   37.772  1.00 49.04  ? 565  ASP A OD2   1 
ATOM   4537 N N     . TYR A 1 566 ? -56.312 8.067   37.953  1.00 35.23  ? 566  TYR A N     1 
ATOM   4538 C CA    . TYR A 1 566 ? -57.493 8.690   37.418  1.00 34.07  ? 566  TYR A CA    1 
ATOM   4539 C C     . TYR A 1 566 ? -57.090 9.698   36.337  1.00 33.58  ? 566  TYR A C     1 
ATOM   4540 O O     . TYR A 1 566 ? -57.514 9.566   35.193  1.00 33.25  ? 566  TYR A O     1 
ATOM   4541 C CB    . TYR A 1 566 ? -58.356 9.288   38.528  1.00 34.09  ? 566  TYR A CB    1 
ATOM   4542 C CG    . TYR A 1 566 ? -59.365 10.266  38.009  1.00 35.19  ? 566  TYR A CG    1 
ATOM   4543 C CD1   . TYR A 1 566 ? -60.648 9.860   37.655  1.00 36.09  ? 566  TYR A CD1   1 
ATOM   4544 C CD2   . TYR A 1 566 ? -59.029 11.611  37.838  1.00 36.08  ? 566  TYR A CD2   1 
ATOM   4545 C CE1   . TYR A 1 566 ? -61.573 10.778  37.148  1.00 36.25  ? 566  TYR A CE1   1 
ATOM   4546 C CE2   . TYR A 1 566 ? -59.941 12.525  37.334  1.00 36.64  ? 566  TYR A CE2   1 
ATOM   4547 C CZ    . TYR A 1 566 ? -61.202 12.105  36.986  1.00 36.43  ? 566  TYR A CZ    1 
ATOM   4548 O OH    . TYR A 1 566 ? -62.084 13.032  36.488  1.00 36.72  ? 566  TYR A OH    1 
ATOM   4549 N N     . ILE A 1 567 ? -56.234 10.669  36.673  1.00 33.00  ? 567  ILE A N     1 
ATOM   4550 C CA    . ILE A 1 567 ? -55.941 11.739  35.725  1.00 32.08  ? 567  ILE A CA    1 
ATOM   4551 C C     . ILE A 1 567 ? -55.135 11.249  34.532  1.00 32.47  ? 567  ILE A C     1 
ATOM   4552 O O     . ILE A 1 567 ? -55.339 11.749  33.414  1.00 32.34  ? 567  ILE A O     1 
ATOM   4553 C CB    . ILE A 1 567 ? -55.328 13.015  36.368  1.00 31.59  ? 567  ILE A CB    1 
ATOM   4554 C CG1   . ILE A 1 567 ? -55.516 14.202  35.447  1.00 29.90  ? 567  ILE A CG1   1 
ATOM   4555 C CG2   . ILE A 1 567 ? -53.864 12.878  36.644  1.00 31.57  ? 567  ILE A CG2   1 
ATOM   4556 C CD1   . ILE A 1 567 ? -56.914 14.752  35.477  1.00 27.74  ? 567  ILE A CD1   1 
ATOM   4557 N N     . ASN A 1 568 ? -54.241 10.280  34.760  1.00 32.52  ? 568  ASN A N     1 
ATOM   4558 C CA    . ASN A 1 568 ? -53.446 9.720   33.668  1.00 33.25  ? 568  ASN A CA    1 
ATOM   4559 C C     . ASN A 1 568 ? -54.312 8.956   32.674  1.00 33.99  ? 568  ASN A C     1 
ATOM   4560 O O     . ASN A 1 568 ? -54.043 8.999   31.469  1.00 34.20  ? 568  ASN A O     1 
ATOM   4561 C CB    . ASN A 1 568 ? -52.324 8.809   34.173  1.00 33.45  ? 568  ASN A CB    1 
ATOM   4562 C CG    . ASN A 1 568 ? -51.109 9.579   34.683  1.00 33.92  ? 568  ASN A CG    1 
ATOM   4563 O OD1   . ASN A 1 568 ? -50.941 10.769  34.416  1.00 35.53  ? 568  ASN A OD1   1 
ATOM   4564 N ND2   . ASN A 1 568 ? -50.254 8.891   35.422  1.00 32.63  ? 568  ASN A ND2   1 
ATOM   4565 N N     . ALA A 1 569 ? -55.343 8.265   33.170  1.00 34.54  ? 569  ALA A N     1 
ATOM   4566 C CA    . ALA A 1 569 ? -56.305 7.586   32.314  1.00 34.94  ? 569  ALA A CA    1 
ATOM   4567 C C     . ALA A 1 569 ? -57.268 8.556   31.610  1.00 35.78  ? 569  ALA A C     1 
ATOM   4568 O O     . ALA A 1 569 ? -57.628 8.347   30.444  1.00 36.04  ? 569  ALA A O     1 
ATOM   4569 C CB    . ALA A 1 569 ? -57.065 6.593   33.110  1.00 35.19  ? 569  ALA A CB    1 
ATOM   4570 N N     . LYS A 1 570 ? -57.668 9.620   32.312  1.00 36.21  ? 570  LYS A N     1 
ATOM   4571 C CA    . LYS A 1 570 ? -58.631 10.580  31.781  1.00 36.58  ? 570  LYS A CA    1 
ATOM   4572 C C     . LYS A 1 570 ? -58.080 11.563  30.766  1.00 36.58  ? 570  LYS A C     1 
ATOM   4573 O O     . LYS A 1 570 ? -58.778 11.901  29.817  1.00 36.40  ? 570  LYS A O     1 
ATOM   4574 C CB    . LYS A 1 570 ? -59.301 11.374  32.907  1.00 37.33  ? 570  LYS A CB    1 
ATOM   4575 C CG    . LYS A 1 570 ? -60.407 12.301  32.377  1.00 38.59  ? 570  LYS A CG    1 
ATOM   4576 C CD    . LYS A 1 570 ? -61.320 12.879  33.433  1.00 40.98  ? 570  LYS A CD    1 
ATOM   4577 C CE    . LYS A 1 570 ? -62.694 13.127  32.807  1.00 42.35  ? 570  LYS A CE    1 
ATOM   4578 N NZ    . LYS A 1 570 ? -63.318 14.393  33.291  1.00 44.92  ? 570  LYS A NZ    1 
ATOM   4579 N N     . LEU A 1 571 ? -56.870 12.074  30.989  1.00 36.77  ? 571  LEU A N     1 
ATOM   4580 C CA    . LEU A 1 571 ? -56.304 13.065  30.088  1.00 37.13  ? 571  LEU A CA    1 
ATOM   4581 C C     . LEU A 1 571 ? -56.117 12.419  28.719  1.00 38.10  ? 571  LEU A C     1 
ATOM   4582 O O     . LEU A 1 571 ? -55.723 11.252  28.657  1.00 38.11  ? 571  LEU A O     1 
ATOM   4583 C CB    . LEU A 1 571 ? -54.969 13.573  30.621  1.00 36.85  ? 571  LEU A CB    1 
ATOM   4584 C CG    . LEU A 1 571 ? -54.920 14.657  31.699  1.00 36.44  ? 571  LEU A CG    1 
ATOM   4585 C CD1   . LEU A 1 571 ? -53.503 15.046  31.910  1.00 35.18  ? 571  LEU A CD1   1 
ATOM   4586 C CD2   . LEU A 1 571 ? -55.713 15.891  31.329  1.00 35.05  ? 571  LEU A CD2   1 
ATOM   4587 N N     . PRO A 1 572 ? -56.368 13.167  27.619  1.00 38.98  ? 572  PRO A N     1 
ATOM   4588 C CA    . PRO A 1 572 ? -56.324 12.609  26.245  1.00 39.50  ? 572  PRO A CA    1 
ATOM   4589 C C     . PRO A 1 572 ? -54.998 11.967  25.873  1.00 39.92  ? 572  PRO A C     1 
ATOM   4590 O O     . PRO A 1 572 ? -53.938 12.511  26.208  1.00 39.99  ? 572  PRO A O     1 
ATOM   4591 C CB    . PRO A 1 572 ? -56.533 13.844  25.342  1.00 39.34  ? 572  PRO A CB    1 
ATOM   4592 C CG    . PRO A 1 572 ? -56.208 15.008  26.197  1.00 39.16  ? 572  PRO A CG    1 
ATOM   4593 C CD    . PRO A 1 572 ? -56.668 14.609  27.589  1.00 39.03  ? 572  PRO A CD    1 
ATOM   4594 N N     . GLY A 1 573 ? -55.076 10.814  25.197  1.00 40.41  ? 573  GLY A N     1 
ATOM   4595 C CA    . GLY A 1 573 ? -53.926 10.206  24.519  1.00 40.33  ? 573  GLY A CA    1 
ATOM   4596 C C     . GLY A 1 573 ? -52.741 9.959   25.422  1.00 40.62  ? 573  GLY A C     1 
ATOM   4597 O O     . GLY A 1 573 ? -52.872 9.353   26.488  1.00 40.39  ? 573  GLY A O     1 
ATOM   4598 N N     . LEU A 1 574 ? -51.582 10.463  25.022  1.00 40.78  ? 574  LEU A N     1 
ATOM   4599 C CA    . LEU A 1 574 ? -50.340 10.130  25.717  1.00 40.84  ? 574  LEU A CA    1 
ATOM   4600 C C     . LEU A 1 574 ? -49.970 11.008  26.904  1.00 40.72  ? 574  LEU A C     1 
ATOM   4601 O O     . LEU A 1 574 ? -48.912 10.816  27.491  1.00 40.60  ? 574  LEU A O     1 
ATOM   4602 C CB    . LEU A 1 574 ? -49.190 10.111  24.721  1.00 41.18  ? 574  LEU A CB    1 
ATOM   4603 C CG    . LEU A 1 574 ? -48.502 8.768   24.438  1.00 41.95  ? 574  LEU A CG    1 
ATOM   4604 C CD1   . LEU A 1 574 ? -49.453 7.562   24.262  1.00 42.93  ? 574  LEU A CD1   1 
ATOM   4605 C CD2   . LEU A 1 574 ? -47.606 8.942   23.225  1.00 42.87  ? 574  LEU A CD2   1 
ATOM   4606 N N     . LEU A 1 575 ? -50.843 11.948  27.264  1.00 40.68  ? 575  LEU A N     1 
ATOM   4607 C CA    . LEU A 1 575 ? -50.559 12.934  28.312  1.00 40.55  ? 575  LEU A CA    1 
ATOM   4608 C C     . LEU A 1 575 ? -50.615 12.336  29.701  1.00 40.76  ? 575  LEU A C     1 
ATOM   4609 O O     . LEU A 1 575 ? -51.569 11.650  30.064  1.00 40.40  ? 575  LEU A O     1 
ATOM   4610 C CB    . LEU A 1 575 ? -51.531 14.114  28.225  1.00 40.58  ? 575  LEU A CB    1 
ATOM   4611 C CG    . LEU A 1 575 ? -51.403 15.131  27.091  1.00 39.99  ? 575  LEU A CG    1 
ATOM   4612 C CD1   . LEU A 1 575 ? -51.418 14.468  25.736  1.00 39.15  ? 575  LEU A CD1   1 
ATOM   4613 C CD2   . LEU A 1 575 ? -52.536 16.119  27.186  1.00 38.75  ? 575  LEU A CD2   1 
ATOM   4614 N N     . GLU A 1 576 ? -49.602 12.632  30.503  1.00 41.38  ? 576  GLU A N     1 
ATOM   4615 C CA    . GLU A 1 576 ? -49.455 11.945  31.767  1.00 41.58  ? 576  GLU A CA    1 
ATOM   4616 C C     . GLU A 1 576 ? -48.718 12.816  32.745  1.00 40.94  ? 576  GLU A C     1 
ATOM   4617 O O     . GLU A 1 576 ? -47.679 13.361  32.409  1.00 41.44  ? 576  GLU A O     1 
ATOM   4618 C CB    . GLU A 1 576 ? -48.640 10.698  31.503  1.00 41.97  ? 576  GLU A CB    1 
ATOM   4619 C CG    . GLU A 1 576 ? -49.030 9.488   32.279  1.00 44.82  ? 576  GLU A CG    1 
ATOM   4620 C CD    . GLU A 1 576 ? -49.136 8.274   31.376  1.00 47.71  ? 576  GLU A CD    1 
ATOM   4621 O OE1   . GLU A 1 576 ? -49.391 8.470   30.165  1.00 48.58  ? 576  GLU A OE1   1 
ATOM   4622 O OE2   . GLU A 1 576 ? -48.982 7.138   31.873  1.00 48.02  ? 576  GLU A OE2   1 
ATOM   4623 N N     . LEU A 1 577 ? -49.257 12.948  33.948  1.00 40.50  ? 577  LEU A N     1 
ATOM   4624 C CA    . LEU A 1 577 ? -48.526 13.510  35.077  1.00 40.29  ? 577  LEU A CA    1 
ATOM   4625 C C     . LEU A 1 577 ? -47.592 12.457  35.666  1.00 40.31  ? 577  LEU A C     1 
ATOM   4626 O O     . LEU A 1 577 ? -47.712 11.296  35.343  1.00 40.55  ? 577  LEU A O     1 
ATOM   4627 C CB    . LEU A 1 577 ? -49.501 13.961  36.156  1.00 40.18  ? 577  LEU A CB    1 
ATOM   4628 C CG    . LEU A 1 577 ? -49.963 15.408  36.165  1.00 39.87  ? 577  LEU A CG    1 
ATOM   4629 C CD1   . LEU A 1 577 ? -50.688 15.737  34.904  1.00 41.27  ? 577  LEU A CD1   1 
ATOM   4630 C CD2   . LEU A 1 577 ? -50.867 15.606  37.340  1.00 39.44  ? 577  LEU A CD2   1 
ATOM   4631 N N     . GLU A 1 578 ? -46.666 12.876  36.523  1.00 40.78  ? 578  GLU A N     1 
ATOM   4632 C CA    . GLU A 1 578 ? -45.733 11.984  37.200  1.00 41.55  ? 578  GLU A CA    1 
ATOM   4633 C C     . GLU A 1 578 ? -45.574 12.413  38.652  1.00 41.98  ? 578  GLU A C     1 
ATOM   4634 O O     . GLU A 1 578 ? -45.645 13.595  38.974  1.00 41.87  ? 578  GLU A O     1 
ATOM   4635 C CB    . GLU A 1 578 ? -44.372 11.962  36.496  1.00 41.58  ? 578  GLU A CB    1 
ATOM   4636 C CG    . GLU A 1 578 ? -44.374 11.120  35.228  1.00 43.75  ? 578  GLU A CG    1 
ATOM   4637 C CD    . GLU A 1 578 ? -43.003 10.963  34.566  1.00 46.21  ? 578  GLU A CD    1 
ATOM   4638 O OE1   . GLU A 1 578 ? -42.833 11.409  33.400  1.00 44.32  ? 578  GLU A OE1   1 
ATOM   4639 O OE2   . GLU A 1 578 ? -42.107 10.367  35.210  1.00 48.41  ? 578  GLU A OE2   1 
ATOM   4640 N N     . TYR A 1 579 ? -45.357 11.442  39.527  1.00 42.73  ? 579  TYR A N     1 
ATOM   4641 C CA    . TYR A 1 579 ? -45.271 11.699  40.950  1.00 43.73  ? 579  TYR A CA    1 
ATOM   4642 C C     . TYR A 1 579 ? -43.820 11.920  41.322  1.00 44.09  ? 579  TYR A C     1 
ATOM   4643 O O     . TYR A 1 579 ? -43.095 10.957  41.460  1.00 44.40  ? 579  TYR A O     1 
ATOM   4644 C CB    . TYR A 1 579 ? -45.810 10.480  41.683  1.00 44.01  ? 579  TYR A CB    1 
ATOM   4645 C CG    . TYR A 1 579 ? -45.790 10.570  43.180  1.00 45.55  ? 579  TYR A CG    1 
ATOM   4646 C CD1   . TYR A 1 579 ? -46.821 11.204  43.876  1.00 46.98  ? 579  TYR A CD1   1 
ATOM   4647 C CD2   . TYR A 1 579 ? -44.760 9.993   43.916  1.00 47.70  ? 579  TYR A CD2   1 
ATOM   4648 C CE1   . TYR A 1 579 ? -46.809 11.286  45.276  1.00 47.43  ? 579  TYR A CE1   1 
ATOM   4649 C CE2   . TYR A 1 579 ? -44.743 10.068  45.323  1.00 49.01  ? 579  TYR A CE2   1 
ATOM   4650 C CZ    . TYR A 1 579 ? -45.771 10.715  45.987  1.00 47.37  ? 579  TYR A CZ    1 
ATOM   4651 O OH    . TYR A 1 579 ? -45.752 10.779  47.354  1.00 46.24  ? 579  TYR A OH    1 
ATOM   4652 N N     . GLU A 1 580 ? -43.394 13.172  41.495  1.00 44.50  ? 580  GLU A N     1 
ATOM   4653 C CA    . GLU A 1 580 ? -41.978 13.479  41.704  1.00 44.79  ? 580  GLU A CA    1 
ATOM   4654 C C     . GLU A 1 580 ? -41.583 13.783  43.132  1.00 44.39  ? 580  GLU A C     1 
ATOM   4655 O O     . GLU A 1 580 ? -40.614 14.510  43.327  1.00 44.34  ? 580  GLU A O     1 
ATOM   4656 C CB    . GLU A 1 580 ? -41.550 14.682  40.860  1.00 45.61  ? 580  GLU A CB    1 
ATOM   4657 C CG    . GLU A 1 580 ? -41.266 14.414  39.380  1.00 49.39  ? 580  GLU A CG    1 
ATOM   4658 C CD    . GLU A 1 580 ? -40.115 13.445  39.155  1.00 54.21  ? 580  GLU A CD    1 
ATOM   4659 O OE1   . GLU A 1 580 ? -40.377 12.345  38.592  1.00 54.76  ? 580  GLU A OE1   1 
ATOM   4660 O OE2   . GLU A 1 580 ? -38.965 13.781  39.550  1.00 56.36  ? 580  GLU A OE2   1 
ATOM   4661 N N     . GLY A 1 581 ? -42.312 13.267  44.125  1.00 44.33  ? 581  GLY A N     1 
ATOM   4662 C CA    . GLY A 1 581 ? -41.910 13.441  45.543  1.00 44.04  ? 581  GLY A CA    1 
ATOM   4663 C C     . GLY A 1 581 ? -42.928 13.895  46.591  1.00 43.61  ? 581  GLY A C     1 
ATOM   4664 O O     . GLY A 1 581 ? -43.979 14.425  46.258  1.00 43.88  ? 581  GLY A O     1 
ATOM   4665 N N     . PHE A 1 582 ? -42.585 13.688  47.865  1.00 43.35  ? 582  PHE A N     1 
ATOM   4666 C CA    . PHE A 1 582 ? -43.433 14.026  49.021  1.00 43.17  ? 582  PHE A CA    1 
ATOM   4667 C C     . PHE A 1 582 ? -42.658 14.811  50.087  1.00 42.69  ? 582  PHE A C     1 
ATOM   4668 O O     . PHE A 1 582 ? -41.498 14.534  50.316  1.00 42.65  ? 582  PHE A O     1 
ATOM   4669 C CB    . PHE A 1 582 ? -43.990 12.748  49.631  1.00 43.23  ? 582  PHE A CB    1 
ATOM   4670 C CG    . PHE A 1 582 ? -44.684 12.940  50.957  1.00 44.54  ? 582  PHE A CG    1 
ATOM   4671 C CD1   . PHE A 1 582 ? -46.038 13.273  51.012  1.00 45.84  ? 582  PHE A CD1   1 
ATOM   4672 C CD2   . PHE A 1 582 ? -43.997 12.748  52.153  1.00 45.48  ? 582  PHE A CD2   1 
ATOM   4673 C CE1   . PHE A 1 582 ? -46.691 13.422  52.232  1.00 45.66  ? 582  PHE A CE1   1 
ATOM   4674 C CE2   . PHE A 1 582 ? -44.644 12.901  53.384  1.00 45.53  ? 582  PHE A CE2   1 
ATOM   4675 C CZ    . PHE A 1 582 ? -45.995 13.232  53.420  1.00 45.76  ? 582  PHE A CZ    1 
ATOM   4676 N N     . TYR A 1 583 ? -43.310 15.768  50.746  1.00 42.48  ? 583  TYR A N     1 
ATOM   4677 C CA    . TYR A 1 583 ? -42.645 16.652  51.719  1.00 42.31  ? 583  TYR A CA    1 
ATOM   4678 C C     . TYR A 1 583 ? -43.454 16.816  53.007  1.00 42.55  ? 583  TYR A C     1 
ATOM   4679 O O     . TYR A 1 583 ? -44.670 17.007  52.938  1.00 42.89  ? 583  TYR A O     1 
ATOM   4680 C CB    . TYR A 1 583 ? -42.370 18.026  51.098  1.00 41.95  ? 583  TYR A CB    1 
ATOM   4681 C CG    . TYR A 1 583 ? -41.552 17.951  49.836  1.00 40.92  ? 583  TYR A CG    1 
ATOM   4682 C CD1   . TYR A 1 583 ? -40.167 17.965  49.890  1.00 39.42  ? 583  TYR A CD1   1 
ATOM   4683 C CD2   . TYR A 1 583 ? -42.162 17.849  48.595  1.00 39.47  ? 583  TYR A CD2   1 
ATOM   4684 C CE1   . TYR A 1 583 ? -39.412 17.884  48.756  1.00 38.86  ? 583  TYR A CE1   1 
ATOM   4685 C CE2   . TYR A 1 583 ? -41.410 17.765  47.447  1.00 39.67  ? 583  TYR A CE2   1 
ATOM   4686 C CZ    . TYR A 1 583 ? -40.033 17.780  47.534  1.00 39.38  ? 583  TYR A CZ    1 
ATOM   4687 O OH    . TYR A 1 583 ? -39.264 17.697  46.396  1.00 40.73  ? 583  TYR A OH    1 
ATOM   4688 N N     . LYS A 1 584 ? -42.773 16.732  54.162  1.00 42.39  ? 584  LYS A N     1 
ATOM   4689 C CA    . LYS A 1 584 ? -43.390 16.795  55.497  1.00 41.96  ? 584  LYS A CA    1 
ATOM   4690 C C     . LYS A 1 584 ? -44.148 18.096  55.708  1.00 41.67  ? 584  LYS A C     1 
ATOM   4691 O O     . LYS A 1 584 ? -45.316 18.086  56.092  1.00 41.79  ? 584  LYS A O     1 
ATOM   4692 C CB    . LYS A 1 584 ? -42.328 16.677  56.581  1.00 42.15  ? 584  LYS A CB    1 
ATOM   4693 C CG    . LYS A 1 584 ? -42.370 15.419  57.417  1.00 43.94  ? 584  LYS A CG    1 
ATOM   4694 C CD    . LYS A 1 584 ? -41.304 15.464  58.549  1.00 46.70  ? 584  LYS A CD    1 
ATOM   4695 N N     . ARG A 1 585 ? -43.482 19.218  55.487  1.00 40.84  ? 585  ARG A N     1 
ATOM   4696 C CA    . ARG A 1 585 ? -44.195 20.476  55.422  1.00 40.43  ? 585  ARG A CA    1 
ATOM   4697 C C     . ARG A 1 585 ? -43.491 21.416  54.479  1.00 39.68  ? 585  ARG A C     1 
ATOM   4698 O O     . ARG A 1 585 ? -42.423 21.083  53.956  1.00 39.45  ? 585  ARG A O     1 
ATOM   4699 C CB    . ARG A 1 585 ? -44.461 21.106  56.806  1.00 41.09  ? 585  ARG A CB    1 
ATOM   4700 C CG    . ARG A 1 585 ? -43.350 21.101  57.816  1.00 42.42  ? 585  ARG A CG    1 
ATOM   4701 C CD    . ARG A 1 585 ? -43.911 21.223  59.237  1.00 46.52  ? 585  ARG A CD    1 
ATOM   4702 N NE    . ARG A 1 585 ? -42.969 20.594  60.161  1.00 51.41  ? 585  ARG A NE    1 
ATOM   4703 C CZ    . ARG A 1 585 ? -42.990 19.308  60.528  1.00 53.18  ? 585  ARG A CZ    1 
ATOM   4704 N NH1   . ARG A 1 585 ? -43.944 18.490  60.095  1.00 54.09  ? 585  ARG A NH1   1 
ATOM   4705 N NH2   . ARG A 1 585 ? -42.051 18.836  61.343  1.00 53.51  ? 585  ARG A NH2   1 
ATOM   4706 N N     . GLY A 1 586 ? -44.106 22.567  54.232  1.00 38.53  ? 586  GLY A N     1 
ATOM   4707 C CA    . GLY A 1 586 ? -43.563 23.510  53.273  1.00 37.89  ? 586  GLY A CA    1 
ATOM   4708 C C     . GLY A 1 586 ? -44.404 24.753  53.230  1.00 37.49  ? 586  GLY A C     1 
ATOM   4709 O O     . GLY A 1 586 ? -45.518 24.751  53.733  1.00 37.87  ? 586  GLY A O     1 
ATOM   4710 N N     . PHE A 1 587 ? -43.865 25.820  52.653  1.00 36.87  ? 587  PHE A N     1 
ATOM   4711 C CA    . PHE A 1 587 ? -44.608 27.055  52.484  1.00 36.67  ? 587  PHE A CA    1 
ATOM   4712 C C     . PHE A 1 587 ? -44.175 27.736  51.200  1.00 36.52  ? 587  PHE A C     1 
ATOM   4713 O O     . PHE A 1 587 ? -43.103 27.456  50.690  1.00 36.80  ? 587  PHE A O     1 
ATOM   4714 C CB    . PHE A 1 587 ? -44.459 27.976  53.701  1.00 37.17  ? 587  PHE A CB    1 
ATOM   4715 C CG    . PHE A 1 587 ? -43.091 28.608  53.854  1.00 37.72  ? 587  PHE A CG    1 
ATOM   4716 C CD1   . PHE A 1 587 ? -42.767 29.796  53.176  1.00 37.74  ? 587  PHE A CD1   1 
ATOM   4717 C CD2   . PHE A 1 587 ? -42.146 28.044  54.713  1.00 37.06  ? 587  PHE A CD2   1 
ATOM   4718 C CE1   . PHE A 1 587 ? -41.519 30.381  53.321  1.00 36.42  ? 587  PHE A CE1   1 
ATOM   4719 C CE2   . PHE A 1 587 ? -40.898 28.622  54.865  1.00 36.06  ? 587  PHE A CE2   1 
ATOM   4720 C CZ    . PHE A 1 587 ? -40.585 29.791  54.168  1.00 37.01  ? 587  PHE A CZ    1 
ATOM   4721 N N     . PHE A 1 588 ? -45.007 28.622  50.675  1.00 36.26  ? 588  PHE A N     1 
ATOM   4722 C CA    . PHE A 1 588 ? -44.874 29.030  49.301  1.00 36.40  ? 588  PHE A CA    1 
ATOM   4723 C C     . PHE A 1 588 ? -45.081 30.529  49.233  1.00 37.65  ? 588  PHE A C     1 
ATOM   4724 O O     . PHE A 1 588 ? -46.173 31.025  49.478  1.00 38.42  ? 588  PHE A O     1 
ATOM   4725 C CB    . PHE A 1 588 ? -45.873 28.233  48.424  1.00 36.01  ? 588  PHE A CB    1 
ATOM   4726 C CG    . PHE A 1 588 ? -45.729 26.737  48.571  1.00 33.56  ? 588  PHE A CG    1 
ATOM   4727 C CD1   . PHE A 1 588 ? -46.390 26.060  49.589  1.00 31.05  ? 588  PHE A CD1   1 
ATOM   4728 C CD2   . PHE A 1 588 ? -44.875 26.020  47.734  1.00 32.92  ? 588  PHE A CD2   1 
ATOM   4729 C CE1   . PHE A 1 588 ? -46.213 24.696  49.783  1.00 31.10  ? 588  PHE A CE1   1 
ATOM   4730 C CE2   . PHE A 1 588 ? -44.683 24.655  47.900  1.00 31.97  ? 588  PHE A CE2   1 
ATOM   4731 C CZ    . PHE A 1 588 ? -45.364 23.983  48.938  1.00 32.26  ? 588  PHE A CZ    1 
ATOM   4732 N N     . VAL A 1 589 ? -44.021 31.250  48.895  1.00 38.71  ? 589  VAL A N     1 
ATOM   4733 C CA    . VAL A 1 589 ? -43.980 32.698  49.066  1.00 39.76  ? 589  VAL A CA    1 
ATOM   4734 C C     . VAL A 1 589 ? -44.570 33.504  47.910  1.00 40.54  ? 589  VAL A C     1 
ATOM   4735 O O     . VAL A 1 589 ? -45.373 34.392  48.153  1.00 40.98  ? 589  VAL A O     1 
ATOM   4736 C CB    . VAL A 1 589 ? -42.538 33.182  49.427  1.00 39.66  ? 589  VAL A CB    1 
ATOM   4737 C CG1   . VAL A 1 589 ? -42.488 34.701  49.648  1.00 39.65  ? 589  VAL A CG1   1 
ATOM   4738 C CG2   . VAL A 1 589 ? -42.050 32.446  50.661  1.00 39.09  ? 589  VAL A CG2   1 
ATOM   4739 N N     . THR A 1 590 ? -44.144 33.243  46.678  1.00 41.62  ? 590  THR A N     1 
ATOM   4740 C CA    . THR A 1 590 ? -44.727 33.912  45.501  1.00 42.82  ? 590  THR A CA    1 
ATOM   4741 C C     . THR A 1 590 ? -44.823 32.938  44.337  1.00 43.69  ? 590  THR A C     1 
ATOM   4742 O O     . THR A 1 590 ? -44.511 31.748  44.486  1.00 44.10  ? 590  THR A O     1 
ATOM   4743 C CB    . THR A 1 590 ? -43.890 35.099  45.000  1.00 42.79  ? 590  THR A CB    1 
ATOM   4744 O OG1   . THR A 1 590 ? -42.782 34.618  44.216  1.00 43.40  ? 590  THR A OG1   1 
ATOM   4745 C CG2   . THR A 1 590 ? -43.381 35.933  46.150  1.00 43.14  ? 590  THR A CG2   1 
ATOM   4746 N N     . LYS A 1 591 ? -45.238 33.453  43.179  1.00 44.26  ? 591  LYS A N     1 
ATOM   4747 C CA    . LYS A 1 591 ? -45.255 32.700  41.924  1.00 44.62  ? 591  LYS A CA    1 
ATOM   4748 C C     . LYS A 1 591 ? -44.054 31.765  41.736  1.00 44.70  ? 591  LYS A C     1 
ATOM   4749 O O     . LYS A 1 591 ? -44.174 30.720  41.072  1.00 45.13  ? 591  LYS A O     1 
ATOM   4750 C CB    . LYS A 1 591 ? -45.217 33.669  40.755  1.00 44.80  ? 591  LYS A CB    1 
ATOM   4751 C CG    . LYS A 1 591 ? -46.525 34.271  40.341  1.00 46.37  ? 591  LYS A CG    1 
ATOM   4752 C CD    . LYS A 1 591 ? -46.311 35.135  39.087  1.00 49.36  ? 591  LYS A CD    1 
ATOM   4753 C CE    . LYS A 1 591 ? -45.143 36.118  39.268  1.00 51.12  ? 591  LYS A CE    1 
ATOM   4754 N NZ    . LYS A 1 591 ? -45.205 37.277  38.320  1.00 53.70  ? 591  LYS A NZ    1 
ATOM   4755 N N     . LYS A 1 592 ? -42.902 32.148  42.301  1.00 43.91  ? 592  LYS A N     1 
ATOM   4756 C CA    . LYS A 1 592 ? -41.624 31.552  41.920  1.00 43.07  ? 592  LYS A CA    1 
ATOM   4757 C C     . LYS A 1 592 ? -40.781 31.019  43.076  1.00 42.35  ? 592  LYS A C     1 
ATOM   4758 O O     . LYS A 1 592 ? -39.744 30.388  42.829  1.00 42.61  ? 592  LYS A O     1 
ATOM   4759 C CB    . LYS A 1 592 ? -40.794 32.578  41.122  1.00 43.40  ? 592  LYS A CB    1 
ATOM   4760 C CG    . LYS A 1 592 ? -41.454 33.119  39.844  1.00 43.95  ? 592  LYS A CG    1 
ATOM   4761 N N     . LYS A 1 593 ? -41.202 31.281  44.320  1.00 41.33  ? 593  LYS A N     1 
ATOM   4762 C CA    . LYS A 1 593 ? -40.349 31.042  45.506  1.00 40.13  ? 593  LYS A CA    1 
ATOM   4763 C C     . LYS A 1 593 ? -41.069 30.265  46.589  1.00 39.21  ? 593  LYS A C     1 
ATOM   4764 O O     . LYS A 1 593 ? -42.230 30.548  46.866  1.00 38.83  ? 593  LYS A O     1 
ATOM   4765 C CB    . LYS A 1 593 ? -39.857 32.363  46.106  1.00 40.04  ? 593  LYS A CB    1 
ATOM   4766 C CG    . LYS A 1 593 ? -39.547 33.432  45.084  1.00 41.01  ? 593  LYS A CG    1 
ATOM   4767 C CD    . LYS A 1 593 ? -39.028 34.708  45.705  1.00 42.59  ? 593  LYS A CD    1 
ATOM   4768 C CE    . LYS A 1 593 ? -38.063 35.391  44.745  1.00 43.89  ? 593  LYS A CE    1 
ATOM   4769 N NZ    . LYS A 1 593 ? -38.233 36.868  44.765  1.00 45.83  ? 593  LYS A NZ    1 
ATOM   4770 N N     . TYR A 1 594 ? -40.362 29.315  47.211  1.00 38.26  ? 594  TYR A N     1 
ATOM   4771 C CA    . TYR A 1 594 ? -40.911 28.445  48.262  1.00 37.50  ? 594  TYR A CA    1 
ATOM   4772 C C     . TYR A 1 594 ? -39.817 27.708  49.037  1.00 37.67  ? 594  TYR A C     1 
ATOM   4773 O O     . TYR A 1 594 ? -38.648 27.752  48.670  1.00 37.93  ? 594  TYR A O     1 
ATOM   4774 C CB    . TYR A 1 594 ? -41.845 27.392  47.657  1.00 37.43  ? 594  TYR A CB    1 
ATOM   4775 C CG    . TYR A 1 594 ? -41.210 26.548  46.573  1.00 35.56  ? 594  TYR A CG    1 
ATOM   4776 C CD1   . TYR A 1 594 ? -40.428 25.451  46.885  1.00 33.64  ? 594  TYR A CD1   1 
ATOM   4777 C CD2   . TYR A 1 594 ? -41.391 26.870  45.231  1.00 36.08  ? 594  TYR A CD2   1 
ATOM   4778 C CE1   . TYR A 1 594 ? -39.841 24.694  45.890  1.00 34.91  ? 594  TYR A CE1   1 
ATOM   4779 C CE2   . TYR A 1 594 ? -40.810 26.117  44.220  1.00 35.86  ? 594  TYR A CE2   1 
ATOM   4780 C CZ    . TYR A 1 594 ? -40.037 25.029  44.555  1.00 36.11  ? 594  TYR A CZ    1 
ATOM   4781 O OH    . TYR A 1 594 ? -39.460 24.283  43.543  1.00 38.02  ? 594  TYR A OH    1 
ATOM   4782 N N     . ALA A 1 595 ? -40.221 27.003  50.092  1.00 37.51  ? 595  ALA A N     1 
ATOM   4783 C CA    . ALA A 1 595 ? -39.340 26.143  50.863  1.00 37.22  ? 595  ALA A CA    1 
ATOM   4784 C C     . ALA A 1 595 ? -40.132 24.942  51.371  1.00 37.70  ? 595  ALA A C     1 
ATOM   4785 O O     . ALA A 1 595 ? -41.270 25.078  51.823  1.00 37.23  ? 595  ALA A O     1 
ATOM   4786 C CB    . ALA A 1 595 ? -38.761 26.894  52.010  1.00 37.11  ? 595  ALA A CB    1 
ATOM   4787 N N     . VAL A 1 596 ? -39.513 23.768  51.285  1.00 38.27  ? 596  VAL A N     1 
ATOM   4788 C CA    . VAL A 1 596 ? -40.135 22.504  51.641  1.00 39.04  ? 596  VAL A CA    1 
ATOM   4789 C C     . VAL A 1 596 ? -39.091 21.646  52.333  1.00 40.05  ? 596  VAL A C     1 
ATOM   4790 O O     . VAL A 1 596 ? -37.902 21.814  52.087  1.00 40.52  ? 596  VAL A O     1 
ATOM   4791 C CB    . VAL A 1 596 ? -40.658 21.741  50.387  1.00 38.95  ? 596  VAL A CB    1 
ATOM   4792 C CG1   . VAL A 1 596 ? -41.801 22.488  49.725  1.00 37.91  ? 596  VAL A CG1   1 
ATOM   4793 C CG2   . VAL A 1 596 ? -39.528 21.483  49.382  1.00 38.37  ? 596  VAL A CG2   1 
ATOM   4794 N N     . ILE A 1 597 ? -39.534 20.725  53.177  1.00 41.09  ? 597  ILE A N     1 
ATOM   4795 C CA    . ILE A 1 597 ? -38.641 19.832  53.893  1.00 42.75  ? 597  ILE A CA    1 
ATOM   4796 C C     . ILE A 1 597 ? -39.152 18.387  53.789  1.00 43.95  ? 597  ILE A C     1 
ATOM   4797 O O     . ILE A 1 597 ? -40.352 18.138  53.931  1.00 44.35  ? 597  ILE A O     1 
ATOM   4798 C CB    . ILE A 1 597 ? -38.477 20.280  55.379  1.00 42.98  ? 597  ILE A CB    1 
ATOM   4799 C CG1   . ILE A 1 597 ? -37.338 19.511  56.062  1.00 43.23  ? 597  ILE A CG1   1 
ATOM   4800 C CG2   . ILE A 1 597 ? -39.800 20.152  56.162  1.00 42.73  ? 597  ILE A CG2   1 
ATOM   4801 C CD1   . ILE A 1 597 ? -37.120 19.877  57.514  1.00 43.05  ? 597  ILE A CD1   1 
ATOM   4802 N N     . ASP A 1 598 ? -38.259 17.437  53.526  1.00 45.42  ? 598  ASP A N     1 
ATOM   4803 C CA    . ASP A 1 598 ? -38.699 16.066  53.266  1.00 47.01  ? 598  ASP A CA    1 
ATOM   4804 C C     . ASP A 1 598 ? -38.720 15.221  54.519  1.00 48.31  ? 598  ASP A C     1 
ATOM   4805 O O     . ASP A 1 598 ? -38.575 15.736  55.622  1.00 48.81  ? 598  ASP A O     1 
ATOM   4806 C CB    . ASP A 1 598 ? -37.854 15.397  52.191  1.00 47.03  ? 598  ASP A CB    1 
ATOM   4807 C CG    . ASP A 1 598 ? -36.372 15.440  52.496  1.00 47.71  ? 598  ASP A CG    1 
ATOM   4808 O OD1   . ASP A 1 598 ? -35.953 15.080  53.622  1.00 47.52  ? 598  ASP A OD1   1 
ATOM   4809 O OD2   . ASP A 1 598 ? -35.625 15.827  51.574  1.00 48.68  ? 598  ASP A OD2   1 
ATOM   4810 N N     . GLU A 1 599 ? -38.902 13.917  54.349  1.00 49.88  ? 599  GLU A N     1 
ATOM   4811 C CA    . GLU A 1 599 ? -39.070 13.023  55.494  1.00 51.38  ? 599  GLU A CA    1 
ATOM   4812 C C     . GLU A 1 599 ? -37.743 12.592  56.118  1.00 52.25  ? 599  GLU A C     1 
ATOM   4813 O O     . GLU A 1 599 ? -37.711 11.768  57.036  1.00 52.42  ? 599  GLU A O     1 
ATOM   4814 C CB    . GLU A 1 599 ? -39.875 11.803  55.091  1.00 51.23  ? 599  GLU A CB    1 
ATOM   4815 C CG    . GLU A 1 599 ? -41.315 12.105  54.848  1.00 52.06  ? 599  GLU A CG    1 
ATOM   4816 C CD    . GLU A 1 599 ? -42.058 10.882  54.375  1.00 53.21  ? 599  GLU A CD    1 
ATOM   4817 O OE1   . GLU A 1 599 ? -41.703 10.347  53.286  1.00 52.27  ? 599  GLU A OE1   1 
ATOM   4818 O OE2   . GLU A 1 599 ? -42.992 10.465  55.102  1.00 52.74  ? 599  GLU A OE2   1 
ATOM   4819 N N     . GLU A 1 600 ? -36.648 13.140  55.608  1.00 53.02  ? 600  GLU A N     1 
ATOM   4820 C CA    . GLU A 1 600 ? -35.352 12.873  56.192  1.00 54.02  ? 600  GLU A CA    1 
ATOM   4821 C C     . GLU A 1 600 ? -34.774 14.194  56.718  1.00 53.78  ? 600  GLU A C     1 
ATOM   4822 O O     . GLU A 1 600 ? -33.652 14.241  57.231  1.00 54.26  ? 600  GLU A O     1 
ATOM   4823 C CB    . GLU A 1 600 ? -34.451 12.144  55.188  1.00 54.24  ? 600  GLU A CB    1 
ATOM   4824 C CG    . GLU A 1 600 ? -35.166 10.944  54.527  1.00 57.68  ? 600  GLU A CG    1 
ATOM   4825 C CD    . GLU A 1 600 ? -34.227 9.796   54.134  1.00 62.29  ? 600  GLU A CD    1 
ATOM   4826 O OE1   . GLU A 1 600 ? -33.062 10.079  53.779  1.00 64.13  ? 600  GLU A OE1   1 
ATOM   4827 O OE2   . GLU A 1 600 ? -34.652 8.607   54.171  1.00 63.78  ? 600  GLU A OE2   1 
ATOM   4828 N N     . ASP A 1 601 ? -35.586 15.250  56.620  1.00 53.07  ? 601  ASP A N     1 
ATOM   4829 C CA    . ASP A 1 601 ? -35.275 16.597  57.130  1.00 52.23  ? 601  ASP A CA    1 
ATOM   4830 C C     . ASP A 1 601 ? -34.409 17.493  56.252  1.00 51.08  ? 601  ASP A C     1 
ATOM   4831 O O     . ASP A 1 601 ? -33.994 18.556  56.696  1.00 50.70  ? 601  ASP A O     1 
ATOM   4832 C CB    . ASP A 1 601 ? -34.733 16.556  58.562  1.00 52.61  ? 601  ASP A CB    1 
ATOM   4833 C CG    . ASP A 1 601 ? -35.842 16.601  59.602  1.00 54.71  ? 601  ASP A CG    1 
ATOM   4834 O OD1   . ASP A 1 601 ? -37.039 16.638  59.222  1.00 56.75  ? 601  ASP A OD1   1 
ATOM   4835 O OD2   . ASP A 1 601 ? -35.518 16.610  60.809  1.00 56.86  ? 601  ASP A OD2   1 
ATOM   4836 N N     . LYS A 1 602 ? -34.159 17.081  55.011  1.00 50.11  ? 602  LYS A N     1 
ATOM   4837 C CA    . LYS A 1 602 ? -33.418 17.930  54.070  1.00 49.10  ? 602  LYS A CA    1 
ATOM   4838 C C     . LYS A 1 602 ? -34.308 19.068  53.572  1.00 48.33  ? 602  LYS A C     1 
ATOM   4839 O O     . LYS A 1 602 ? -35.245 18.856  52.805  1.00 48.75  ? 602  LYS A O     1 
ATOM   4840 C CB    . LYS A 1 602 ? -32.831 17.125  52.893  1.00 48.66  ? 602  LYS A CB    1 
ATOM   4841 N N     . ILE A 1 603 ? -34.023 20.272  54.039  1.00 47.11  ? 603  ILE A N     1 
ATOM   4842 C CA    . ILE A 1 603 ? -34.666 21.462  53.507  1.00 46.23  ? 603  ILE A CA    1 
ATOM   4843 C C     . ILE A 1 603 ? -34.239 21.691  52.056  1.00 45.60  ? 603  ILE A C     1 
ATOM   4844 O O     . ILE A 1 603 ? -33.118 21.372  51.688  1.00 45.49  ? 603  ILE A O     1 
ATOM   4845 C CB    . ILE A 1 603 ? -34.336 22.685  54.388  1.00 46.23  ? 603  ILE A CB    1 
ATOM   4846 C CG1   . ILE A 1 603 ? -34.924 22.465  55.785  1.00 46.88  ? 603  ILE A CG1   1 
ATOM   4847 C CG2   . ILE A 1 603 ? -34.854 23.979  53.774  1.00 44.89  ? 603  ILE A CG2   1 
ATOM   4848 C CD1   . ILE A 1 603 ? -34.169 23.160  56.900  1.00 48.96  ? 603  ILE A CD1   1 
ATOM   4849 N N     . THR A 1 604 ? -35.151 22.229  51.250  1.00 45.02  ? 604  THR A N     1 
ATOM   4850 C CA    . THR A 1 604 ? -34.916 22.582  49.851  1.00 44.49  ? 604  THR A CA    1 
ATOM   4851 C C     . THR A 1 604 ? -35.568 23.935  49.681  1.00 44.12  ? 604  THR A C     1 
ATOM   4852 O O     . THR A 1 604 ? -36.689 24.116  50.139  1.00 44.27  ? 604  THR A O     1 
ATOM   4853 C CB    . THR A 1 604 ? -35.662 21.596  48.901  1.00 44.71  ? 604  THR A CB    1 
ATOM   4854 O OG1   . THR A 1 604 ? -35.448 20.237  49.321  1.00 44.91  ? 604  THR A OG1   1 
ATOM   4855 C CG2   . THR A 1 604 ? -35.249 21.775  47.440  1.00 43.90  ? 604  THR A CG2   1 
ATOM   4856 N N     . THR A 1 605 ? -34.898 24.886  49.037  1.00 43.73  ? 605  THR A N     1 
ATOM   4857 C CA    . THR A 1 605 ? -35.510 26.213  48.806  1.00 43.45  ? 605  THR A CA    1 
ATOM   4858 C C     . THR A 1 605 ? -35.514 26.594  47.326  1.00 43.41  ? 605  THR A C     1 
ATOM   4859 O O     . THR A 1 605 ? -34.919 25.901  46.515  1.00 43.65  ? 605  THR A O     1 
ATOM   4860 C CB    . THR A 1 605 ? -34.864 27.370  49.682  1.00 43.42  ? 605  THR A CB    1 
ATOM   4861 O OG1   . THR A 1 605 ? -33.910 28.139  48.920  1.00 43.22  ? 605  THR A OG1   1 
ATOM   4862 C CG2   . THR A 1 605 ? -34.213 26.821  50.939  1.00 42.98  ? 605  THR A CG2   1 
ATOM   4863 N N     . ARG A 1 606 ? -36.194 27.685  46.980  1.00 43.36  ? 606  ARG A N     1 
ATOM   4864 C CA    . ARG A 1 606 ? -36.142 28.236  45.634  1.00 43.73  ? 606  ARG A CA    1 
ATOM   4865 C C     . ARG A 1 606 ? -36.416 29.718  45.714  1.00 43.89  ? 606  ARG A C     1 
ATOM   4866 O O     . ARG A 1 606 ? -37.464 30.128  46.208  1.00 44.23  ? 606  ARG A O     1 
ATOM   4867 C CB    . ARG A 1 606 ? -37.201 27.591  44.740  1.00 43.98  ? 606  ARG A CB    1 
ATOM   4868 C CG    . ARG A 1 606 ? -36.858 27.534  43.258  1.00 45.05  ? 606  ARG A CG    1 
ATOM   4869 C CD    . ARG A 1 606 ? -35.872 26.356  42.970  1.00 47.76  ? 606  ARG A CD    1 
ATOM   4870 N NE    . ARG A 1 606 ? -36.250 25.488  41.846  1.00 48.39  ? 606  ARG A NE    1 
ATOM   4871 C CZ    . ARG A 1 606 ? -37.054 25.812  40.829  1.00 48.25  ? 606  ARG A CZ    1 
ATOM   4872 N NH1   . ARG A 1 606 ? -37.600 27.024  40.724  1.00 47.36  ? 606  ARG A NH1   1 
ATOM   4873 N NH2   . ARG A 1 606 ? -37.302 24.906  39.889  1.00 49.25  ? 606  ARG A NH2   1 
ATOM   4874 N N     . GLY A 1 607 ? -35.474 30.517  45.231  1.00 43.96  ? 607  GLY A N     1 
ATOM   4875 C CA    . GLY A 1 607 ? -35.621 31.972  45.177  1.00 44.03  ? 607  GLY A CA    1 
ATOM   4876 C C     . GLY A 1 607 ? -35.606 32.662  46.527  1.00 44.34  ? 607  GLY A C     1 
ATOM   4877 O O     . GLY A 1 607 ? -36.087 33.796  46.657  1.00 44.05  ? 607  GLY A O     1 
ATOM   4878 N N     . LEU A 1 608 ? -35.059 31.980  47.533  1.00 44.61  ? 608  LEU A N     1 
ATOM   4879 C CA    . LEU A 1 608 ? -35.084 32.492  48.898  1.00 45.06  ? 608  LEU A CA    1 
ATOM   4880 C C     . LEU A 1 608 ? -33.689 32.651  49.489  1.00 46.13  ? 608  LEU A C     1 
ATOM   4881 O O     . LEU A 1 608 ? -33.453 33.556  50.278  1.00 46.13  ? 608  LEU A O     1 
ATOM   4882 C CB    . LEU A 1 608 ? -35.905 31.580  49.799  1.00 44.37  ? 608  LEU A CB    1 
ATOM   4883 C CG    . LEU A 1 608 ? -37.411 31.535  49.612  1.00 43.52  ? 608  LEU A CG    1 
ATOM   4884 C CD1   . LEU A 1 608 ? -37.984 30.588  50.638  1.00 42.49  ? 608  LEU A CD1   1 
ATOM   4885 C CD2   . LEU A 1 608 ? -38.051 32.912  49.720  1.00 42.27  ? 608  LEU A CD2   1 
ATOM   4886 N N     . GLU A 1 609 ? -32.779 31.747  49.123  1.00 47.24  ? 609  GLU A N     1 
ATOM   4887 C CA    . GLU A 1 609 ? -31.381 31.799  49.540  1.00 47.70  ? 609  GLU A CA    1 
ATOM   4888 C C     . GLU A 1 609 ? -30.784 33.213  49.357  1.00 47.66  ? 609  GLU A C     1 
ATOM   4889 O O     . GLU A 1 609 ? -31.128 33.929  48.405  1.00 47.26  ? 609  GLU A O     1 
ATOM   4890 C CB    . GLU A 1 609 ? -30.599 30.801  48.692  1.00 48.04  ? 609  GLU A CB    1 
ATOM   4891 C CG    . GLU A 1 609 ? -29.483 30.087  49.417  1.00 50.54  ? 609  GLU A CG    1 
ATOM   4892 C CD    . GLU A 1 609 ? -29.931 28.812  50.105  1.00 53.71  ? 609  GLU A CD    1 
ATOM   4893 O OE1   . GLU A 1 609 ? -31.147 28.501  50.116  1.00 55.95  ? 609  GLU A OE1   1 
ATOM   4894 O OE2   . GLU A 1 609 ? -29.053 28.112  50.650  1.00 54.54  ? 609  GLU A OE2   1 
ATOM   4895 N N     . ILE A 1 610 ? -29.907 33.624  50.277  1.00 47.73  ? 610  ILE A N     1 
ATOM   4896 C CA    . ILE A 1 610 ? -29.095 34.827  50.036  1.00 47.57  ? 610  ILE A CA    1 
ATOM   4897 C C     . ILE A 1 610 ? -28.182 34.553  48.829  1.00 47.63  ? 610  ILE A C     1 
ATOM   4898 O O     . ILE A 1 610 ? -27.513 33.521  48.763  1.00 47.55  ? 610  ILE A O     1 
ATOM   4899 C CB    . ILE A 1 610 ? -28.246 35.235  51.266  1.00 47.36  ? 610  ILE A CB    1 
ATOM   4900 C CG1   . ILE A 1 610 ? -29.150 35.652  52.422  1.00 46.34  ? 610  ILE A CG1   1 
ATOM   4901 C CG2   . ILE A 1 610 ? -27.291 36.379  50.904  1.00 47.00  ? 610  ILE A CG2   1 
ATOM   4902 C CD1   . ILE A 1 610 ? -28.450 35.672  53.749  1.00 44.83  ? 610  ILE A CD1   1 
ATOM   4903 N N     . VAL A 1 611 ? -28.166 35.455  47.862  1.00 47.39  ? 611  VAL A N     1 
ATOM   4904 C CA    . VAL A 1 611 ? -27.386 35.180  46.656  1.00 47.06  ? 611  VAL A CA    1 
ATOM   4905 C C     . VAL A 1 611 ? -26.335 36.236  46.353  1.00 46.62  ? 611  VAL A C     1 
ATOM   4906 O O     . VAL A 1 611 ? -25.459 36.016  45.513  1.00 46.63  ? 611  VAL A O     1 
ATOM   4907 C CB    . VAL A 1 611 ? -28.292 34.955  45.419  1.00 47.31  ? 611  VAL A CB    1 
ATOM   4908 C CG1   . VAL A 1 611 ? -29.117 33.689  45.606  1.00 47.43  ? 611  VAL A CG1   1 
ATOM   4909 C CG2   . VAL A 1 611 ? -29.179 36.199  45.130  1.00 47.08  ? 611  VAL A CG2   1 
ATOM   4910 N N     . ARG A 1 612 ? -26.433 37.368  47.053  1.00 46.07  ? 612  ARG A N     1 
ATOM   4911 C CA    . ARG A 1 612 ? -25.542 38.515  46.871  1.00 45.14  ? 612  ARG A CA    1 
ATOM   4912 C C     . ARG A 1 612 ? -24.085 38.174  47.149  1.00 44.76  ? 612  ARG A C     1 
ATOM   4913 O O     . ARG A 1 612 ? -23.792 37.301  47.977  1.00 43.81  ? 612  ARG A O     1 
ATOM   4914 C CB    . ARG A 1 612 ? -25.992 39.673  47.771  1.00 45.09  ? 612  ARG A CB    1 
ATOM   4915 C CG    . ARG A 1 612 ? -25.726 39.439  49.255  1.00 44.42  ? 612  ARG A CG    1 
ATOM   4916 C CD    . ARG A 1 612 ? -26.498 40.368  50.126  1.00 43.16  ? 612  ARG A CD    1 
ATOM   4917 N NE    . ARG A 1 612 ? -26.074 41.753  49.980  1.00 43.22  ? 612  ARG A NE    1 
ATOM   4918 C CZ    . ARG A 1 612 ? -26.523 42.743  50.748  1.00 42.73  ? 612  ARG A CZ    1 
ATOM   4919 N NH1   . ARG A 1 612 ? -27.405 42.479  51.705  1.00 40.97  ? 612  ARG A NH1   1 
ATOM   4920 N NH2   . ARG A 1 612 ? -26.088 43.987  50.569  1.00 42.57  ? 612  ARG A NH2   1 
ATOM   4921 N N     . ARG A 1 613 ? -23.185 38.884  46.468  1.00 45.12  ? 613  ARG A N     1 
ATOM   4922 C CA    . ARG A 1 613 ? -21.740 38.685  46.648  1.00 46.04  ? 613  ARG A CA    1 
ATOM   4923 C C     . ARG A 1 613 ? -21.245 39.143  48.012  1.00 45.71  ? 613  ARG A C     1 
ATOM   4924 O O     . ARG A 1 613 ? -20.408 38.472  48.621  1.00 45.94  ? 613  ARG A O     1 
ATOM   4925 C CB    . ARG A 1 613 ? -20.936 39.436  45.604  1.00 46.67  ? 613  ARG A CB    1 
ATOM   4926 C CG    . ARG A 1 613 ? -21.390 39.285  44.181  1.00 49.45  ? 613  ARG A CG    1 
ATOM   4927 C CD    . ARG A 1 613 ? -20.298 39.853  43.299  1.00 53.59  ? 613  ARG A CD    1 
ATOM   4928 N NE    . ARG A 1 613 ? -20.827 40.547  42.131  1.00 57.17  ? 613  ARG A NE    1 
ATOM   4929 C CZ    . ARG A 1 613 ? -21.307 41.788  42.141  1.00 58.95  ? 613  ARG A CZ    1 
ATOM   4930 N NH1   . ARG A 1 613 ? -21.345 42.492  43.273  1.00 59.74  ? 613  ARG A NH1   1 
ATOM   4931 N NH2   . ARG A 1 613 ? -21.757 42.322  41.012  1.00 59.72  ? 613  ARG A NH2   1 
ATOM   4932 N N     . ASP A 1 614 ? -21.761 40.285  48.474  1.00 45.11  ? 614  ASP A N     1 
ATOM   4933 C CA    . ASP A 1 614 ? -21.331 40.931  49.714  1.00 44.23  ? 614  ASP A CA    1 
ATOM   4934 C C     . ASP A 1 614 ? -22.160 40.492  50.903  1.00 43.42  ? 614  ASP A C     1 
ATOM   4935 O O     . ASP A 1 614 ? -22.764 41.324  51.587  1.00 43.81  ? 614  ASP A O     1 
ATOM   4936 C CB    . ASP A 1 614 ? -21.406 42.459  49.565  1.00 44.40  ? 614  ASP A CB    1 
ATOM   4937 C CG    . ASP A 1 614 ? -22.781 42.952  49.105  1.00 45.73  ? 614  ASP A CG    1 
ATOM   4938 O OD1   . ASP A 1 614 ? -23.658 42.125  48.773  1.00 47.56  ? 614  ASP A OD1   1 
ATOM   4939 O OD2   . ASP A 1 614 ? -22.992 44.182  49.071  1.00 47.41  ? 614  ASP A OD2   1 
ATOM   4940 N N     . TRP A 1 615 ? -22.201 39.193  51.161  1.00 42.09  ? 615  TRP A N     1 
ATOM   4941 C CA    . TRP A 1 615 ? -23.051 38.694  52.238  1.00 41.22  ? 615  TRP A CA    1 
ATOM   4942 C C     . TRP A 1 615 ? -22.308 38.726  53.581  1.00 41.05  ? 615  TRP A C     1 
ATOM   4943 O O     . TRP A 1 615 ? -21.150 39.088  53.611  1.00 41.36  ? 615  TRP A O     1 
ATOM   4944 C CB    . TRP A 1 615 ? -23.575 37.299  51.901  1.00 40.39  ? 615  TRP A CB    1 
ATOM   4945 C CG    . TRP A 1 615 ? -22.504 36.316  51.618  1.00 38.66  ? 615  TRP A CG    1 
ATOM   4946 C CD1   . TRP A 1 615 ? -21.844 36.134  50.426  1.00 37.73  ? 615  TRP A CD1   1 
ATOM   4947 C CD2   . TRP A 1 615 ? -21.962 35.356  52.528  1.00 36.71  ? 615  TRP A CD2   1 
ATOM   4948 N NE1   . TRP A 1 615 ? -20.913 35.127  50.550  1.00 35.18  ? 615  TRP A NE1   1 
ATOM   4949 C CE2   . TRP A 1 615 ? -20.970 34.625  51.825  1.00 35.52  ? 615  TRP A CE2   1 
ATOM   4950 C CE3   . TRP A 1 615 ? -22.211 35.044  53.871  1.00 37.31  ? 615  TRP A CE3   1 
ATOM   4951 C CZ2   . TRP A 1 615 ? -20.233 33.592  52.421  1.00 35.08  ? 615  TRP A CZ2   1 
ATOM   4952 C CZ3   . TRP A 1 615 ? -21.478 34.005  54.468  1.00 37.98  ? 615  TRP A CZ3   1 
ATOM   4953 C CH2   . TRP A 1 615 ? -20.500 33.290  53.734  1.00 36.07  ? 615  TRP A CH2   1 
ATOM   4954 N N     . SER A 1 616 ? -22.983 38.387  54.679  1.00 40.71  ? 616  SER A N     1 
ATOM   4955 C CA    . SER A 1 616 ? -22.353 38.286  55.979  1.00 40.64  ? 616  SER A CA    1 
ATOM   4956 C C     . SER A 1 616 ? -22.919 37.108  56.748  1.00 40.70  ? 616  SER A C     1 
ATOM   4957 O O     . SER A 1 616 ? -24.110 36.849  56.676  1.00 41.12  ? 616  SER A O     1 
ATOM   4958 C CB    . SER A 1 616 ? -22.564 39.569  56.793  1.00 41.19  ? 616  SER A CB    1 
ATOM   4959 O OG    . SER A 1 616 ? -23.942 39.857  57.012  1.00 41.74  ? 616  SER A OG    1 
ATOM   4960 N N     . GLU A 1 617 ? -22.059 36.411  57.489  1.00 40.51  ? 617  GLU A N     1 
ATOM   4961 C CA    . GLU A 1 617 ? -22.435 35.297  58.344  1.00 40.07  ? 617  GLU A CA    1 
ATOM   4962 C C     . GLU A 1 617 ? -23.742 35.599  59.069  1.00 40.07  ? 617  GLU A C     1 
ATOM   4963 O O     . GLU A 1 617 ? -24.665 34.781  59.039  1.00 40.12  ? 617  GLU A O     1 
ATOM   4964 C CB    . GLU A 1 617 ? -21.315 34.995  59.355  1.00 40.26  ? 617  GLU A CB    1 
ATOM   4965 C CG    . GLU A 1 617 ? -21.385 33.611  60.057  1.00 40.56  ? 617  GLU A CG    1 
ATOM   4966 N N     . ILE A 1 618 ? -23.840 36.779  59.695  1.00 40.00  ? 618  ILE A N     1 
ATOM   4967 C CA    . ILE A 1 618 ? -25.022 37.096  60.521  1.00 39.20  ? 618  ILE A CA    1 
ATOM   4968 C C     . ILE A 1 618 ? -26.296 37.001  59.674  1.00 39.33  ? 618  ILE A C     1 
ATOM   4969 O O     . ILE A 1 618 ? -27.255 36.340  60.074  1.00 39.68  ? 618  ILE A O     1 
ATOM   4970 C CB    . ILE A 1 618 ? -24.883 38.450  61.313  1.00 38.90  ? 618  ILE A CB    1 
ATOM   4971 C CG1   . ILE A 1 618 ? -25.823 38.505  62.528  1.00 37.03  ? 618  ILE A CG1   1 
ATOM   4972 C CG2   . ILE A 1 618 ? -25.036 39.673  60.395  1.00 38.29  ? 618  ILE A CG2   1 
ATOM   4973 C CD1   . ILE A 1 618 ? -25.923 37.225  63.341  1.00 34.33  ? 618  ILE A CD1   1 
ATOM   4974 N N     . ALA A 1 619 ? -26.278 37.603  58.489  1.00 38.94  ? 619  ALA A N     1 
ATOM   4975 C CA    . ALA A 1 619 ? -27.377 37.436  57.546  1.00 39.25  ? 619  ALA A CA    1 
ATOM   4976 C C     . ALA A 1 619 ? -27.657 35.969  57.238  1.00 39.32  ? 619  ALA A C     1 
ATOM   4977 O O     . ALA A 1 619 ? -28.775 35.528  57.383  1.00 39.22  ? 619  ALA A O     1 
ATOM   4978 C CB    . ALA A 1 619 ? -27.115 38.215  56.260  1.00 39.46  ? 619  ALA A CB    1 
ATOM   4979 N N     . LYS A 1 620 ? -26.637 35.219  56.830  1.00 40.07  ? 620  LYS A N     1 
ATOM   4980 C CA    . LYS A 1 620 ? -26.821 33.823  56.466  1.00 40.96  ? 620  LYS A CA    1 
ATOM   4981 C C     . LYS A 1 620 ? -27.241 32.981  57.670  1.00 41.74  ? 620  LYS A C     1 
ATOM   4982 O O     . LYS A 1 620 ? -28.142 32.140  57.565  1.00 41.69  ? 620  LYS A O     1 
ATOM   4983 C CB    . LYS A 1 620 ? -25.574 33.235  55.773  1.00 41.01  ? 620  LYS A CB    1 
ATOM   4984 C CG    . LYS A 1 620 ? -25.504 33.466  54.246  1.00 41.40  ? 620  LYS A CG    1 
ATOM   4985 C CD    . LYS A 1 620 ? -24.512 32.527  53.557  1.00 41.37  ? 620  LYS A CD    1 
ATOM   4986 N N     . GLU A 1 621 ? -26.614 33.224  58.814  1.00 42.66  ? 621  GLU A N     1 
ATOM   4987 C CA    . GLU A 1 621 ? -26.879 32.422  60.001  1.00 44.03  ? 621  GLU A CA    1 
ATOM   4988 C C     . GLU A 1 621 ? -28.349 32.535  60.419  1.00 44.36  ? 621  GLU A C     1 
ATOM   4989 O O     . GLU A 1 621 ? -28.969 31.550  60.850  1.00 44.61  ? 621  GLU A O     1 
ATOM   4990 C CB    . GLU A 1 621 ? -25.972 32.849  61.154  1.00 44.03  ? 621  GLU A CB    1 
ATOM   4991 C CG    . GLU A 1 621 ? -26.062 31.923  62.361  1.00 47.29  ? 621  GLU A CG    1 
ATOM   4992 C CD    . GLU A 1 621 ? -25.566 32.571  63.664  1.00 52.08  ? 621  GLU A CD    1 
ATOM   4993 O OE1   . GLU A 1 621 ? -26.244 33.489  64.195  1.00 52.98  ? 621  GLU A OE1   1 
ATOM   4994 O OE2   . GLU A 1 621 ? -24.497 32.148  64.166  1.00 54.03  ? 621  GLU A OE2   1 
ATOM   4995 N N     . THR A 1 622 ? -28.904 33.737  60.275  1.00 44.28  ? 622  THR A N     1 
ATOM   4996 C CA    . THR A 1 622 ? -30.225 34.026  60.807  1.00 44.13  ? 622  THR A CA    1 
ATOM   4997 C C     . THR A 1 622 ? -31.302 33.411  59.912  1.00 44.27  ? 622  THR A C     1 
ATOM   4998 O O     . THR A 1 622 ? -32.273 32.825  60.411  1.00 44.41  ? 622  THR A O     1 
ATOM   4999 C CB    . THR A 1 622 ? -30.417 35.539  60.986  1.00 43.96  ? 622  THR A CB    1 
ATOM   5000 O OG1   . THR A 1 622 ? -29.358 36.043  61.800  1.00 43.52  ? 622  THR A OG1   1 
ATOM   5001 C CG2   . THR A 1 622 ? -31.729 35.850  61.669  1.00 43.95  ? 622  THR A CG2   1 
ATOM   5002 N N     . GLN A 1 623 ? -31.114 33.518  58.597  1.00 43.91  ? 623  GLN A N     1 
ATOM   5003 C CA    . GLN A 1 623 ? -32.046 32.922  57.654  1.00 43.65  ? 623  GLN A CA    1 
ATOM   5004 C C     . GLN A 1 623 ? -32.090 31.416  57.877  1.00 43.35  ? 623  GLN A C     1 
ATOM   5005 O O     . GLN A 1 623 ? -33.145 30.842  58.064  1.00 43.39  ? 623  GLN A O     1 
ATOM   5006 C CB    . GLN A 1 623 ? -31.652 33.257  56.230  1.00 43.50  ? 623  GLN A CB    1 
ATOM   5007 C CG    . GLN A 1 623 ? -32.712 32.924  55.200  1.00 44.33  ? 623  GLN A CG    1 
ATOM   5008 C CD    . GLN A 1 623 ? -32.097 32.632  53.841  1.00 45.35  ? 623  GLN A CD    1 
ATOM   5009 O OE1   . GLN A 1 623 ? -31.383 31.639  53.675  1.00 47.32  ? 623  GLN A OE1   1 
ATOM   5010 N NE2   . GLN A 1 623 ? -32.347 33.501  52.873  1.00 43.42  ? 623  GLN A NE2   1 
ATOM   5011 N N     . ALA A 1 624 ? -30.926 30.794  57.912  1.00 43.44  ? 624  ALA A N     1 
ATOM   5012 C CA    . ALA A 1 624 ? -30.805 29.377  58.205  1.00 43.37  ? 624  ALA A CA    1 
ATOM   5013 C C     . ALA A 1 624 ? -31.599 28.990  59.445  1.00 43.66  ? 624  ALA A C     1 
ATOM   5014 O O     . ALA A 1 624 ? -32.292 27.966  59.466  1.00 43.79  ? 624  ALA A O     1 
ATOM   5015 C CB    . ALA A 1 624 ? -29.341 29.020  58.394  1.00 43.15  ? 624  ALA A CB    1 
ATOM   5016 N N     . ARG A 1 625 ? -31.488 29.809  60.484  1.00 43.92  ? 625  ARG A N     1 
ATOM   5017 C CA    . ARG A 1 625 ? -32.105 29.495  61.759  1.00 44.24  ? 625  ARG A CA    1 
ATOM   5018 C C     . ARG A 1 625 ? -33.623 29.605  61.669  1.00 44.38  ? 625  ARG A C     1 
ATOM   5019 O O     . ARG A 1 625 ? -34.344 28.765  62.224  1.00 44.69  ? 625  ARG A O     1 
ATOM   5020 C CB    . ARG A 1 625 ? -31.552 30.414  62.834  1.00 44.34  ? 625  ARG A CB    1 
ATOM   5021 C CG    . ARG A 1 625 ? -30.066 30.212  63.074  1.00 45.54  ? 625  ARG A CG    1 
ATOM   5022 C CD    . ARG A 1 625 ? -29.620 30.854  64.367  1.00 46.50  ? 625  ARG A CD    1 
ATOM   5023 N NE    . ARG A 1 625 ? -30.369 30.294  65.488  1.00 47.45  ? 625  ARG A NE    1 
ATOM   5024 C CZ    . ARG A 1 625 ? -30.794 30.998  66.533  1.00 46.80  ? 625  ARG A CZ    1 
ATOM   5025 N NH1   . ARG A 1 625 ? -30.545 32.307  66.602  1.00 43.03  ? 625  ARG A NH1   1 
ATOM   5026 N NH2   . ARG A 1 625 ? -31.484 30.380  67.495  1.00 47.32  ? 625  ARG A NH2   1 
ATOM   5027 N N     . VAL A 1 626 ? -34.091 30.637  60.960  1.00 44.22  ? 626  VAL A N     1 
ATOM   5028 C CA    . VAL A 1 626 ? -35.510 30.847  60.675  1.00 44.13  ? 626  VAL A CA    1 
ATOM   5029 C C     . VAL A 1 626 ? -36.156 29.648  59.954  1.00 44.13  ? 626  VAL A C     1 
ATOM   5030 O O     . VAL A 1 626 ? -37.172 29.115  60.417  1.00 43.93  ? 626  VAL A O     1 
ATOM   5031 C CB    . VAL A 1 626 ? -35.712 32.133  59.852  1.00 44.27  ? 626  VAL A CB    1 
ATOM   5032 C CG1   . VAL A 1 626 ? -37.088 32.162  59.241  1.00 44.53  ? 626  VAL A CG1   1 
ATOM   5033 C CG2   . VAL A 1 626 ? -35.509 33.346  60.719  1.00 43.34  ? 626  VAL A CG2   1 
ATOM   5034 N N     . LEU A 1 627 ? -35.547 29.224  58.839  1.00 44.05  ? 627  LEU A N     1 
ATOM   5035 C CA    . LEU A 1 627 ? -36.054 28.108  58.025  1.00 43.66  ? 627  LEU A CA    1 
ATOM   5036 C C     . LEU A 1 627 ? -36.146 26.843  58.832  1.00 44.48  ? 627  LEU A C     1 
ATOM   5037 O O     . LEU A 1 627 ? -37.150 26.158  58.772  1.00 44.99  ? 627  LEU A O     1 
ATOM   5038 C CB    . LEU A 1 627 ? -35.215 27.875  56.769  1.00 42.66  ? 627  LEU A CB    1 
ATOM   5039 C CG    . LEU A 1 627 ? -35.164 28.997  55.735  1.00 40.71  ? 627  LEU A CG    1 
ATOM   5040 C CD1   . LEU A 1 627 ? -34.156 28.662  54.721  1.00 38.70  ? 627  LEU A CD1   1 
ATOM   5041 C CD2   . LEU A 1 627 ? -36.512 29.283  55.067  1.00 39.32  ? 627  LEU A CD2   1 
ATOM   5042 N N     . GLU A 1 628 ? -35.110 26.549  59.604  1.00 45.57  ? 628  GLU A N     1 
ATOM   5043 C CA    . GLU A 1 628 ? -35.109 25.401  60.500  1.00 46.93  ? 628  GLU A CA    1 
ATOM   5044 C C     . GLU A 1 628 ? -36.266 25.494  61.493  1.00 46.94  ? 628  GLU A C     1 
ATOM   5045 O O     . GLU A 1 628 ? -36.911 24.492  61.823  1.00 46.91  ? 628  GLU A O     1 
ATOM   5046 C CB    . GLU A 1 628 ? -33.781 25.354  61.247  1.00 47.47  ? 628  GLU A CB    1 
ATOM   5047 C CG    . GLU A 1 628 ? -33.512 24.071  62.020  1.00 51.44  ? 628  GLU A CG    1 
ATOM   5048 C CD    . GLU A 1 628 ? -32.448 24.257  63.112  1.00 57.42  ? 628  GLU A CD    1 
ATOM   5049 O OE1   . GLU A 1 628 ? -31.538 25.115  62.953  1.00 59.61  ? 628  GLU A OE1   1 
ATOM   5050 O OE2   . GLU A 1 628 ? -32.524 23.541  64.141  1.00 60.04  ? 628  GLU A OE2   1 
ATOM   5051 N N     . ALA A 1 629 ? -36.527 26.710  61.967  1.00 47.30  ? 629  ALA A N     1 
ATOM   5052 C CA    . ALA A 1 629 ? -37.558 26.932  62.974  1.00 47.41  ? 629  ALA A CA    1 
ATOM   5053 C C     . ALA A 1 629 ? -38.915 26.612  62.369  1.00 47.45  ? 629  ALA A C     1 
ATOM   5054 O O     . ALA A 1 629 ? -39.702 25.838  62.945  1.00 47.11  ? 629  ALA A O     1 
ATOM   5055 C CB    . ALA A 1 629 ? -37.515 28.371  63.467  1.00 47.43  ? 629  ALA A CB    1 
ATOM   5056 N N     . ILE A 1 630 ? -39.150 27.201  61.191  1.00 47.35  ? 630  ILE A N     1 
ATOM   5057 C CA    . ILE A 1 630 ? -40.377 27.000  60.430  1.00 47.41  ? 630  ILE A CA    1 
ATOM   5058 C C     . ILE A 1 630 ? -40.540 25.563  59.918  1.00 47.82  ? 630  ILE A C     1 
ATOM   5059 O O     . ILE A 1 630 ? -41.534 24.917  60.207  1.00 47.50  ? 630  ILE A O     1 
ATOM   5060 C CB    . ILE A 1 630 ? -40.482 27.978  59.249  1.00 47.07  ? 630  ILE A CB    1 
ATOM   5061 C CG1   . ILE A 1 630 ? -40.690 29.409  59.748  1.00 46.22  ? 630  ILE A CG1   1 
ATOM   5062 C CG2   . ILE A 1 630 ? -41.619 27.572  58.332  1.00 47.12  ? 630  ILE A CG2   1 
ATOM   5063 C CD1   . ILE A 1 630 ? -40.473 30.475  58.675  1.00 44.76  ? 630  ILE A CD1   1 
ATOM   5064 N N     . LEU A 1 631 ? -39.561 25.059  59.175  1.00 48.64  ? 631  LEU A N     1 
ATOM   5065 C CA    . LEU A 1 631 ? -39.745 23.792  58.465  1.00 49.28  ? 631  LEU A CA    1 
ATOM   5066 C C     . LEU A 1 631 ? -39.527 22.561  59.319  1.00 50.01  ? 631  LEU A C     1 
ATOM   5067 O O     . LEU A 1 631 ? -40.277 21.603  59.204  1.00 50.04  ? 631  LEU A O     1 
ATOM   5068 C CB    . LEU A 1 631 ? -38.904 23.745  57.188  1.00 48.96  ? 631  LEU A CB    1 
ATOM   5069 C CG    . LEU A 1 631 ? -39.223 24.876  56.199  1.00 48.41  ? 631  LEU A CG    1 
ATOM   5070 C CD1   . LEU A 1 631 ? -38.170 24.951  55.106  1.00 47.49  ? 631  LEU A CD1   1 
ATOM   5071 C CD2   . LEU A 1 631 ? -40.637 24.740  55.609  1.00 46.89  ? 631  LEU A CD2   1 
ATOM   5072 N N     . LYS A 1 632 ? -38.525 22.594  60.188  1.00 51.19  ? 632  LYS A N     1 
ATOM   5073 C CA    . LYS A 1 632 ? -38.156 21.413  60.978  1.00 52.63  ? 632  LYS A CA    1 
ATOM   5074 C C     . LYS A 1 632 ? -39.011 21.280  62.256  1.00 53.38  ? 632  LYS A C     1 
ATOM   5075 O O     . LYS A 1 632 ? -39.413 20.172  62.627  1.00 53.65  ? 632  LYS A O     1 
ATOM   5076 C CB    . LYS A 1 632 ? -36.666 21.472  61.310  1.00 52.76  ? 632  LYS A CB    1 
ATOM   5077 C CG    . LYS A 1 632 ? -35.957 20.160  61.589  1.00 53.92  ? 632  LYS A CG    1 
ATOM   5078 C CD    . LYS A 1 632 ? -34.449 20.461  61.776  1.00 56.28  ? 632  LYS A CD    1 
ATOM   5079 C CE    . LYS A 1 632 ? -33.682 19.351  62.499  1.00 57.18  ? 632  LYS A CE    1 
ATOM   5080 N NZ    . LYS A 1 632 ? -33.093 18.374  61.530  1.00 58.45  ? 632  LYS A NZ    1 
ATOM   5081 N N     . HIS A 1 633 ? -39.299 22.404  62.913  1.00 53.96  ? 633  HIS A N     1 
ATOM   5082 C CA    . HIS A 1 633 ? -40.076 22.382  64.154  1.00 54.42  ? 633  HIS A CA    1 
ATOM   5083 C C     . HIS A 1 633 ? -41.469 22.986  63.990  1.00 54.44  ? 633  HIS A C     1 
ATOM   5084 O O     . HIS A 1 633 ? -42.238 23.068  64.950  1.00 54.51  ? 633  HIS A O     1 
ATOM   5085 C CB    . HIS A 1 633 ? -39.312 23.084  65.277  1.00 54.57  ? 633  HIS A CB    1 
ATOM   5086 C CG    . HIS A 1 633 ? -37.912 22.593  65.443  1.00 55.87  ? 633  HIS A CG    1 
ATOM   5087 N ND1   . HIS A 1 633 ? -37.619 21.293  65.799  1.00 56.93  ? 633  HIS A ND1   1 
ATOM   5088 C CD2   . HIS A 1 633 ? -36.721 23.219  65.285  1.00 57.66  ? 633  HIS A CD2   1 
ATOM   5089 C CE1   . HIS A 1 633 ? -36.308 21.138  65.858  1.00 57.20  ? 633  HIS A CE1   1 
ATOM   5090 N NE2   . HIS A 1 633 ? -35.739 22.292  65.554  1.00 58.45  ? 633  HIS A NE2   1 
ATOM   5091 N N     . GLY A 1 634 ? -41.793 23.398  62.769  1.00 54.41  ? 634  GLY A N     1 
ATOM   5092 C CA    . GLY A 1 634 ? -43.096 23.975  62.468  1.00 54.05  ? 634  GLY A CA    1 
ATOM   5093 C C     . GLY A 1 634 ? -43.485 25.026  63.475  1.00 53.99  ? 634  GLY A C     1 
ATOM   5094 O O     . GLY A 1 634 ? -44.508 24.895  64.118  1.00 54.56  ? 634  GLY A O     1 
ATOM   5095 N N     . ASP A 1 635 ? -42.674 26.069  63.620  1.00 53.99  ? 635  ASP A N     1 
ATOM   5096 C CA    . ASP A 1 635 ? -42.867 27.034  64.707  1.00 53.84  ? 635  ASP A CA    1 
ATOM   5097 C C     . ASP A 1 635 ? -42.513 28.455  64.291  1.00 53.45  ? 635  ASP A C     1 
ATOM   5098 O O     . ASP A 1 635 ? -41.417 28.937  64.562  1.00 53.57  ? 635  ASP A O     1 
ATOM   5099 C CB    . ASP A 1 635 ? -42.044 26.605  65.925  1.00 53.96  ? 635  ASP A CB    1 
ATOM   5100 C CG    . ASP A 1 635 ? -42.285 27.476  67.146  1.00 54.91  ? 635  ASP A CG    1 
ATOM   5101 O OD1   . ASP A 1 635 ? -42.989 28.517  67.053  1.00 56.18  ? 635  ASP A OD1   1 
ATOM   5102 O OD2   . ASP A 1 635 ? -41.744 27.111  68.212  1.00 55.28  ? 635  ASP A OD2   1 
ATOM   5103 N N     . VAL A 1 636 ? -43.462 29.124  63.653  1.00 53.05  ? 636  VAL A N     1 
ATOM   5104 C CA    . VAL A 1 636 ? -43.232 30.430  63.060  1.00 52.88  ? 636  VAL A CA    1 
ATOM   5105 C C     . VAL A 1 636 ? -42.878 31.496  64.089  1.00 53.50  ? 636  VAL A C     1 
ATOM   5106 O O     . VAL A 1 636 ? -42.094 32.408  63.807  1.00 53.47  ? 636  VAL A O     1 
ATOM   5107 C CB    . VAL A 1 636 ? -44.458 30.856  62.262  1.00 52.60  ? 636  VAL A CB    1 
ATOM   5108 C CG1   . VAL A 1 636 ? -44.225 32.177  61.518  1.00 51.93  ? 636  VAL A CG1   1 
ATOM   5109 C CG2   . VAL A 1 636 ? -44.806 29.759  61.301  1.00 52.57  ? 636  VAL A CG2   1 
ATOM   5110 N N     . GLU A 1 637 ? -43.452 31.380  65.282  1.00 54.21  ? 637  GLU A N     1 
ATOM   5111 C CA    . GLU A 1 637 ? -43.223 32.366  66.330  1.00 54.76  ? 637  GLU A CA    1 
ATOM   5112 C C     . GLU A 1 637 ? -41.793 32.350  66.850  1.00 54.40  ? 637  GLU A C     1 
ATOM   5113 O O     . GLU A 1 637 ? -41.211 33.407  67.105  1.00 54.16  ? 637  GLU A O     1 
ATOM   5114 C CB    . GLU A 1 637 ? -44.249 32.224  67.451  1.00 55.19  ? 637  GLU A CB    1 
ATOM   5115 C CG    . GLU A 1 637 ? -45.485 33.086  67.186  1.00 57.77  ? 637  GLU A CG    1 
ATOM   5116 C CD    . GLU A 1 637 ? -46.666 32.762  68.096  1.00 61.36  ? 637  GLU A CD    1 
ATOM   5117 O OE1   . GLU A 1 637 ? -46.509 31.922  69.024  1.00 63.18  ? 637  GLU A OE1   1 
ATOM   5118 O OE2   . GLU A 1 637 ? -47.758 33.348  67.872  1.00 61.51  ? 637  GLU A OE2   1 
ATOM   5119 N N     . GLU A 1 638 ? -41.231 31.152  66.982  1.00 54.29  ? 638  GLU A N     1 
ATOM   5120 C CA    . GLU A 1 638 ? -39.802 31.007  67.262  1.00 54.47  ? 638  GLU A CA    1 
ATOM   5121 C C     . GLU A 1 638 ? -38.939 31.720  66.220  1.00 53.91  ? 638  GLU A C     1 
ATOM   5122 O O     . GLU A 1 638 ? -37.998 32.437  66.568  1.00 54.08  ? 638  GLU A O     1 
ATOM   5123 C CB    . GLU A 1 638 ? -39.398 29.528  67.370  1.00 54.73  ? 638  GLU A CB    1 
ATOM   5124 C CG    . GLU A 1 638 ? -37.937 29.285  67.783  1.00 56.60  ? 638  GLU A CG    1 
ATOM   5125 C CD    . GLU A 1 638 ? -37.497 30.039  69.053  1.00 60.40  ? 638  GLU A CD    1 
ATOM   5126 O OE1   . GLU A 1 638 ? -36.300 29.934  69.402  1.00 61.63  ? 638  GLU A OE1   1 
ATOM   5127 O OE2   . GLU A 1 638 ? -38.319 30.736  69.709  1.00 62.12  ? 638  GLU A OE2   1 
ATOM   5128 N N     . ALA A 1 639 ? -39.267 31.528  64.946  1.00 53.15  ? 639  ALA A N     1 
ATOM   5129 C CA    . ALA A 1 639 ? -38.528 32.172  63.877  1.00 52.53  ? 639  ALA A CA    1 
ATOM   5130 C C     . ALA A 1 639 ? -38.585 33.686  64.022  1.00 51.98  ? 639  ALA A C     1 
ATOM   5131 O O     . ALA A 1 639 ? -37.626 34.385  63.692  1.00 52.05  ? 639  ALA A O     1 
ATOM   5132 C CB    . ALA A 1 639 ? -39.056 31.739  62.532  1.00 52.77  ? 639  ALA A CB    1 
ATOM   5133 N N     . VAL A 1 640 ? -39.703 34.185  64.536  1.00 51.34  ? 640  VAL A N     1 
ATOM   5134 C CA    . VAL A 1 640 ? -39.854 35.614  64.808  1.00 50.67  ? 640  VAL A CA    1 
ATOM   5135 C C     . VAL A 1 640 ? -39.081 36.046  66.063  1.00 50.44  ? 640  VAL A C     1 
ATOM   5136 O O     . VAL A 1 640 ? -38.485 37.119  66.075  1.00 50.23  ? 640  VAL A O     1 
ATOM   5137 C CB    . VAL A 1 640 ? -41.332 36.011  64.900  1.00 50.39  ? 640  VAL A CB    1 
ATOM   5138 C CG1   . VAL A 1 640 ? -41.475 37.479  65.221  1.00 50.51  ? 640  VAL A CG1   1 
ATOM   5139 C CG2   . VAL A 1 640 ? -42.013 35.707  63.592  1.00 50.09  ? 640  VAL A CG2   1 
ATOM   5140 N N     . ARG A 1 641 ? -39.088 35.207  67.102  1.00 50.15  ? 641  ARG A N     1 
ATOM   5141 C CA    . ARG A 1 641 ? -38.306 35.469  68.302  1.00 50.19  ? 641  ARG A CA    1 
ATOM   5142 C C     . ARG A 1 641 ? -36.840 35.618  67.914  1.00 50.25  ? 641  ARG A C     1 
ATOM   5143 O O     . ARG A 1 641 ? -36.176 36.591  68.312  1.00 50.91  ? 641  ARG A O     1 
ATOM   5144 C CB    . ARG A 1 641 ? -38.467 34.358  69.341  1.00 50.22  ? 641  ARG A CB    1 
ATOM   5145 C CG    . ARG A 1 641 ? -38.104 34.801  70.756  1.00 51.38  ? 641  ARG A CG    1 
ATOM   5146 C CD    . ARG A 1 641 ? -37.934 33.634  71.767  1.00 54.18  ? 641  ARG A CD    1 
ATOM   5147 N NE    . ARG A 1 641 ? -36.981 32.587  71.352  1.00 55.24  ? 641  ARG A NE    1 
ATOM   5148 C CZ    . ARG A 1 641 ? -35.655 32.736  71.206  1.00 55.19  ? 641  ARG A CZ    1 
ATOM   5149 N NH1   . ARG A 1 641 ? -35.041 33.909  71.412  1.00 53.93  ? 641  ARG A NH1   1 
ATOM   5150 N NH2   . ARG A 1 641 ? -34.929 31.690  70.836  1.00 53.96  ? 641  ARG A NH2   1 
ATOM   5151 N N     . ILE A 1 642 ? -36.359 34.671  67.107  1.00 49.62  ? 642  ILE A N     1 
ATOM   5152 C CA    . ILE A 1 642 ? -34.975 34.638  66.642  1.00 48.69  ? 642  ILE A CA    1 
ATOM   5153 C C     . ILE A 1 642 ? -34.573 35.898  65.858  1.00 48.56  ? 642  ILE A C     1 
ATOM   5154 O O     . ILE A 1 642 ? -33.510 36.475  66.105  1.00 48.52  ? 642  ILE A O     1 
ATOM   5155 C CB    . ILE A 1 642 ? -34.721 33.373  65.818  1.00 48.44  ? 642  ILE A CB    1 
ATOM   5156 C CG1   . ILE A 1 642 ? -34.709 32.153  66.743  1.00 48.14  ? 642  ILE A CG1   1 
ATOM   5157 C CG2   . ILE A 1 642 ? -33.410 33.487  65.042  1.00 48.29  ? 642  ILE A CG2   1 
ATOM   5158 C CD1   . ILE A 1 642 ? -34.988 30.828  66.063  1.00 46.74  ? 642  ILE A CD1   1 
ATOM   5159 N N     . VAL A 1 643 ? -35.415 36.333  64.932  1.00 48.16  ? 643  VAL A N     1 
ATOM   5160 C CA    . VAL A 1 643 ? -35.066 37.494  64.136  1.00 48.48  ? 643  VAL A CA    1 
ATOM   5161 C C     . VAL A 1 643 ? -34.990 38.731  65.019  1.00 49.22  ? 643  VAL A C     1 
ATOM   5162 O O     . VAL A 1 643 ? -34.078 39.551  64.877  1.00 49.12  ? 643  VAL A O     1 
ATOM   5163 C CB    . VAL A 1 643 ? -36.039 37.722  62.965  1.00 48.29  ? 643  VAL A CB    1 
ATOM   5164 C CG1   . VAL A 1 643 ? -35.707 39.013  62.220  1.00 47.17  ? 643  VAL A CG1   1 
ATOM   5165 C CG2   . VAL A 1 643 ? -35.980 36.560  62.023  1.00 47.86  ? 643  VAL A CG2   1 
ATOM   5166 N N     . LYS A 1 644 ? -35.948 38.847  65.936  1.00 50.15  ? 644  LYS A N     1 
ATOM   5167 C CA    . LYS A 1 644 ? -36.027 39.986  66.849  1.00 50.80  ? 644  LYS A CA    1 
ATOM   5168 C C     . LYS A 1 644 ? -34.785 40.055  67.722  1.00 50.81  ? 644  LYS A C     1 
ATOM   5169 O O     . LYS A 1 644 ? -34.176 41.125  67.870  1.00 50.75  ? 644  LYS A O     1 
ATOM   5170 C CB    . LYS A 1 644 ? -37.261 39.874  67.739  1.00 51.03  ? 644  LYS A CB    1 
ATOM   5171 C CG    . LYS A 1 644 ? -38.405 40.729  67.285  1.00 53.21  ? 644  LYS A CG    1 
ATOM   5172 C CD    . LYS A 1 644 ? -39.286 41.122  68.466  1.00 55.90  ? 644  LYS A CD    1 
ATOM   5173 C CE    . LYS A 1 644 ? -39.864 42.509  68.219  1.00 58.19  ? 644  LYS A CE    1 
ATOM   5174 N NZ    . LYS A 1 644 ? -40.853 42.932  69.248  1.00 61.03  ? 644  LYS A NZ    1 
ATOM   5175 N N     . GLU A 1 645 ? -34.426 38.899  68.290  1.00 50.64  ? 645  GLU A N     1 
ATOM   5176 C CA    . GLU A 1 645 ? -33.290 38.776  69.179  1.00 50.77  ? 645  GLU A CA    1 
ATOM   5177 C C     . GLU A 1 645 ? -32.011 39.198  68.463  1.00 50.80  ? 645  GLU A C     1 
ATOM   5178 O O     . GLU A 1 645 ? -31.171 39.899  69.033  1.00 51.41  ? 645  GLU A O     1 
ATOM   5179 C CB    . GLU A 1 645 ? -33.182 37.344  69.689  1.00 50.75  ? 645  GLU A CB    1 
ATOM   5180 C CG    . GLU A 1 645 ? -31.940 37.069  70.503  1.00 52.25  ? 645  GLU A CG    1 
ATOM   5181 C CD    . GLU A 1 645 ? -31.946 35.686  71.107  1.00 55.82  ? 645  GLU A CD    1 
ATOM   5182 O OE1   . GLU A 1 645 ? -31.563 35.549  72.298  1.00 57.31  ? 645  GLU A OE1   1 
ATOM   5183 O OE2   . GLU A 1 645 ? -32.341 34.732  70.397  1.00 57.53  ? 645  GLU A OE2   1 
ATOM   5184 N N     . VAL A 1 646 ? -31.878 38.791  67.207  1.00 50.28  ? 646  VAL A N     1 
ATOM   5185 C CA    . VAL A 1 646 ? -30.728 39.181  66.419  1.00 49.84  ? 646  VAL A CA    1 
ATOM   5186 C C     . VAL A 1 646 ? -30.705 40.691  66.152  1.00 49.80  ? 646  VAL A C     1 
ATOM   5187 O O     . VAL A 1 646 ? -29.647 41.295  66.190  1.00 49.92  ? 646  VAL A O     1 
ATOM   5188 C CB    . VAL A 1 646 ? -30.608 38.329  65.111  1.00 49.91  ? 646  VAL A CB    1 
ATOM   5189 C CG1   . VAL A 1 646 ? -29.664 38.974  64.082  1.00 48.69  ? 646  VAL A CG1   1 
ATOM   5190 C CG2   . VAL A 1 646 ? -30.153 36.911  65.454  1.00 49.43  ? 646  VAL A CG2   1 
ATOM   5191 N N     . THR A 1 647 ? -31.853 41.310  65.893  1.00 49.81  ? 647  THR A N     1 
ATOM   5192 C CA    . THR A 1 647 ? -31.857 42.762  65.626  1.00 49.99  ? 647  THR A CA    1 
ATOM   5193 C C     . THR A 1 647 ? -31.558 43.569  66.884  1.00 50.08  ? 647  THR A C     1 
ATOM   5194 O O     . THR A 1 647 ? -30.956 44.651  66.813  1.00 49.75  ? 647  THR A O     1 
ATOM   5195 C CB    . THR A 1 647 ? -33.183 43.257  65.061  1.00 49.80  ? 647  THR A CB    1 
ATOM   5196 O OG1   . THR A 1 647 ? -34.255 42.572  65.719  1.00 49.67  ? 647  THR A OG1   1 
ATOM   5197 C CG2   . THR A 1 647 ? -33.236 43.013  63.559  1.00 50.02  ? 647  THR A CG2   1 
ATOM   5198 N N     . GLU A 1 648 ? -32.001 43.029  68.021  1.00 49.98  ? 648  GLU A N     1 
ATOM   5199 C CA    . GLU A 1 648 ? -31.733 43.595  69.328  1.00 49.85  ? 648  GLU A CA    1 
ATOM   5200 C C     . GLU A 1 648 ? -30.237 43.554  69.625  1.00 49.60  ? 648  GLU A C     1 
ATOM   5201 O O     . GLU A 1 648 ? -29.597 44.612  69.831  1.00 49.37  ? 648  GLU A O     1 
ATOM   5202 C CB    . GLU A 1 648 ? -32.498 42.818  70.390  1.00 49.92  ? 648  GLU A CB    1 
ATOM   5203 C CG    . GLU A 1 648 ? -31.951 43.011  71.784  1.00 50.97  ? 648  GLU A CG    1 
ATOM   5204 C CD    . GLU A 1 648 ? -32.982 42.783  72.850  1.00 52.31  ? 648  GLU A CD    1 
ATOM   5205 O OE1   . GLU A 1 648 ? -32.983 43.548  73.833  1.00 53.40  ? 648  GLU A OE1   1 
ATOM   5206 O OE2   . GLU A 1 648 ? -33.795 41.851  72.708  1.00 53.72  ? 648  GLU A OE2   1 
ATOM   5207 N N     . LYS A 1 649 ? -29.701 42.329  69.639  1.00 49.04  ? 649  LYS A N     1 
ATOM   5208 C CA    . LYS A 1 649 ? -28.288 42.081  69.886  1.00 48.80  ? 649  LYS A CA    1 
ATOM   5209 C C     . LYS A 1 649 ? -27.431 42.954  68.983  1.00 48.94  ? 649  LYS A C     1 
ATOM   5210 O O     . LYS A 1 649 ? -26.409 43.469  69.405  1.00 49.02  ? 649  LYS A O     1 
ATOM   5211 C CB    . LYS A 1 649 ? -27.958 40.614  69.662  1.00 48.31  ? 649  LYS A CB    1 
ATOM   5212 C CG    . LYS A 1 649 ? -28.189 39.703  70.851  1.00 48.35  ? 649  LYS A CG    1 
ATOM   5213 C CD    . LYS A 1 649 ? -27.882 38.253  70.440  1.00 50.26  ? 649  LYS A CD    1 
ATOM   5214 C CE    . LYS A 1 649 ? -27.031 37.469  71.461  1.00 51.37  ? 649  LYS A CE    1 
ATOM   5215 N NZ    . LYS A 1 649 ? -27.807 36.462  72.250  1.00 50.79  ? 649  LYS A NZ    1 
ATOM   5216 N N     . LEU A 1 650 ? -27.868 43.136  67.746  1.00 49.39  ? 650  LEU A N     1 
ATOM   5217 C CA    . LEU A 1 650 ? -27.128 43.939  66.788  1.00 50.14  ? 650  LEU A CA    1 
ATOM   5218 C C     . LEU A 1 650 ? -27.006 45.376  67.258  1.00 50.86  ? 650  LEU A C     1 
ATOM   5219 O O     . LEU A 1 650 ? -25.899 45.905  67.359  1.00 51.09  ? 650  LEU A O     1 
ATOM   5220 C CB    . LEU A 1 650 ? -27.772 43.896  65.387  1.00 50.17  ? 650  LEU A CB    1 
ATOM   5221 C CG    . LEU A 1 650 ? -27.377 42.854  64.327  1.00 49.46  ? 650  LEU A CG    1 
ATOM   5222 C CD1   . LEU A 1 650 ? -27.943 43.264  62.980  1.00 49.02  ? 650  LEU A CD1   1 
ATOM   5223 C CD2   . LEU A 1 650 ? -25.875 42.685  64.204  1.00 48.87  ? 650  LEU A CD2   1 
ATOM   5224 N N     . SER A 1 651 ? -28.149 45.993  67.558  1.00 51.82  ? 651  SER A N     1 
ATOM   5225 C CA    . SER A 1 651 ? -28.223 47.412  67.953  1.00 52.30  ? 651  SER A CA    1 
ATOM   5226 C C     . SER A 1 651 ? -27.593 47.704  69.331  1.00 52.65  ? 651  SER A C     1 
ATOM   5227 O O     . SER A 1 651 ? -27.140 48.828  69.583  1.00 52.64  ? 651  SER A O     1 
ATOM   5228 C CB    . SER A 1 651 ? -29.667 47.936  67.859  1.00 52.19  ? 651  SER A CB    1 
ATOM   5229 O OG    . SER A 1 651 ? -30.613 46.920  68.162  1.00 52.27  ? 651  SER A OG    1 
ATOM   5230 N N     . LYS A 1 652 ? -27.554 46.682  70.192  1.00 52.76  ? 652  LYS A N     1 
ATOM   5231 C CA    . LYS A 1 652 ? -26.809 46.734  71.449  1.00 52.86  ? 652  LYS A CA    1 
ATOM   5232 C C     . LYS A 1 652 ? -25.403 46.121  71.324  1.00 52.96  ? 652  LYS A C     1 
ATOM   5233 O O     . LYS A 1 652 ? -24.962 45.395  72.222  1.00 53.16  ? 652  LYS A O     1 
ATOM   5234 C CB    . LYS A 1 652 ? -27.564 45.971  72.543  1.00 52.94  ? 652  LYS A CB    1 
ATOM   5235 C CG    . LYS A 1 652 ? -28.877 46.571  73.029  1.00 53.36  ? 652  LYS A CG    1 
ATOM   5236 C CD    . LYS A 1 652 ? -29.169 45.998  74.418  1.00 54.05  ? 652  LYS A CD    1 
ATOM   5237 C CE    . LYS A 1 652 ? -30.628 45.614  74.635  1.00 52.93  ? 652  LYS A CE    1 
ATOM   5238 N NZ    . LYS A 1 652 ? -30.656 44.583  75.716  1.00 52.36  ? 652  LYS A NZ    1 
ATOM   5239 N N     . TYR A 1 653 ? -24.714 46.392  70.215  1.00 52.91  ? 653  TYR A N     1 
ATOM   5240 C CA    . TYR A 1 653 ? -23.352 45.858  69.928  1.00 52.82  ? 653  TYR A CA    1 
ATOM   5241 C C     . TYR A 1 653 ? -22.901 44.576  70.655  1.00 53.28  ? 653  TYR A C     1 
ATOM   5242 O O     . TYR A 1 653 ? -21.780 44.527  71.165  1.00 53.16  ? 653  TYR A O     1 
ATOM   5243 C CB    . TYR A 1 653 ? -22.280 46.957  70.097  1.00 52.21  ? 653  TYR A CB    1 
ATOM   5244 C CG    . TYR A 1 653 ? -22.664 48.254  69.438  1.00 50.88  ? 653  TYR A CG    1 
ATOM   5245 C CD1   . TYR A 1 653 ? -22.338 48.500  68.108  1.00 50.44  ? 653  TYR A CD1   1 
ATOM   5246 C CD2   . TYR A 1 653 ? -23.383 49.222  70.130  1.00 48.98  ? 653  TYR A CD2   1 
ATOM   5247 C CE1   . TYR A 1 653 ? -22.708 49.684  67.482  1.00 50.12  ? 653  TYR A CE1   1 
ATOM   5248 C CE2   . TYR A 1 653 ? -23.753 50.409  69.522  1.00 49.40  ? 653  TYR A CE2   1 
ATOM   5249 C CZ    . TYR A 1 653 ? -23.416 50.634  68.198  1.00 50.62  ? 653  TYR A CZ    1 
ATOM   5250 O OH    . TYR A 1 653 ? -23.783 51.813  67.581  1.00 52.74  ? 653  TYR A OH    1 
ATOM   5251 N N     . GLU A 1 654 ? -23.749 43.544  70.686  1.00 53.82  ? 654  GLU A N     1 
ATOM   5252 C CA    . GLU A 1 654 ? -23.357 42.254  71.281  1.00 54.54  ? 654  GLU A CA    1 
ATOM   5253 C C     . GLU A 1 654 ? -23.389 41.098  70.284  1.00 54.51  ? 654  GLU A C     1 
ATOM   5254 O O     . GLU A 1 654 ? -23.617 39.932  70.677  1.00 54.68  ? 654  GLU A O     1 
ATOM   5255 C CB    . GLU A 1 654 ? -24.238 41.879  72.464  1.00 54.86  ? 654  GLU A CB    1 
ATOM   5256 C CG    . GLU A 1 654 ? -24.831 43.033  73.205  1.00 56.96  ? 654  GLU A CG    1 
ATOM   5257 C CD    . GLU A 1 654 ? -26.138 42.657  73.844  1.00 60.19  ? 654  GLU A CD    1 
ATOM   5258 O OE1   . GLU A 1 654 ? -26.496 41.444  73.775  1.00 60.27  ? 654  GLU A OE1   1 
ATOM   5259 O OE2   . GLU A 1 654 ? -26.795 43.572  74.410  1.00 60.84  ? 654  GLU A OE2   1 
ATOM   5260 N N     . VAL A 1 655 ? -23.185 41.416  69.002  1.00 54.17  ? 655  VAL A N     1 
ATOM   5261 C CA    . VAL A 1 655 ? -22.971 40.382  67.982  1.00 53.61  ? 655  VAL A CA    1 
ATOM   5262 C C     . VAL A 1 655 ? -21.479 40.394  67.615  1.00 53.23  ? 655  VAL A C     1 
ATOM   5263 O O     . VAL A 1 655 ? -20.973 41.402  67.091  1.00 52.99  ? 655  VAL A O     1 
ATOM   5264 C CB    . VAL A 1 655 ? -23.913 40.532  66.734  1.00 53.40  ? 655  VAL A CB    1 
ATOM   5265 C CG1   . VAL A 1 655 ? -23.479 39.623  65.608  1.00 53.49  ? 655  VAL A CG1   1 
ATOM   5266 C CG2   . VAL A 1 655 ? -25.334 40.191  67.100  1.00 52.97  ? 655  VAL A CG2   1 
ATOM   5267 N N     . PRO A 1 656 ? -20.773 39.292  67.948  1.00 52.75  ? 656  PRO A N     1 
ATOM   5268 C CA    . PRO A 1 656 ? -19.364 39.101  67.648  1.00 52.80  ? 656  PRO A CA    1 
ATOM   5269 C C     . PRO A 1 656 ? -19.019 39.708  66.297  1.00 52.85  ? 656  PRO A C     1 
ATOM   5270 O O     . PRO A 1 656 ? -19.495 39.228  65.274  1.00 53.12  ? 656  PRO A O     1 
ATOM   5271 C CB    . PRO A 1 656 ? -19.214 37.577  67.607  1.00 52.67  ? 656  PRO A CB    1 
ATOM   5272 C CG    . PRO A 1 656 ? -20.380 37.031  68.388  1.00 52.57  ? 656  PRO A CG    1 
ATOM   5273 C CD    . PRO A 1 656 ? -21.326 38.151  68.698  1.00 52.62  ? 656  PRO A CD    1 
ATOM   5274 N N     . PRO A 1 657 ? -18.203 40.772  66.290  1.00 52.74  ? 657  PRO A N     1 
ATOM   5275 C CA    . PRO A 1 657 ? -17.916 41.491  65.050  1.00 52.50  ? 657  PRO A CA    1 
ATOM   5276 C C     . PRO A 1 657 ? -17.439 40.604  63.905  1.00 52.07  ? 657  PRO A C     1 
ATOM   5277 O O     . PRO A 1 657 ? -17.574 40.993  62.743  1.00 52.04  ? 657  PRO A O     1 
ATOM   5278 C CB    . PRO A 1 657 ? -16.820 42.488  65.459  1.00 52.41  ? 657  PRO A CB    1 
ATOM   5279 C CG    . PRO A 1 657 ? -16.309 41.990  66.765  1.00 53.01  ? 657  PRO A CG    1 
ATOM   5280 C CD    . PRO A 1 657 ? -17.497 41.371  67.430  1.00 52.72  ? 657  PRO A CD    1 
ATOM   5281 N N     . GLU A 1 658 ? -16.890 39.432  64.224  1.00 51.77  ? 658  GLU A N     1 
ATOM   5282 C CA    . GLU A 1 658 ? -16.471 38.480  63.188  1.00 51.72  ? 658  GLU A CA    1 
ATOM   5283 C C     . GLU A 1 658 ? -17.638 38.240  62.238  1.00 50.75  ? 658  GLU A C     1 
ATOM   5284 O O     . GLU A 1 658 ? -17.505 38.439  61.034  1.00 50.61  ? 658  GLU A O     1 
ATOM   5285 C CB    . GLU A 1 658 ? -15.979 37.145  63.783  1.00 52.35  ? 658  GLU A CB    1 
ATOM   5286 C CG    . GLU A 1 658 ? -14.662 37.221  64.577  1.00 54.75  ? 658  GLU A CG    1 
ATOM   5287 C CD    . GLU A 1 658 ? -14.838 37.880  65.950  1.00 59.37  ? 658  GLU A CD    1 
ATOM   5288 O OE1   . GLU A 1 658 ? -14.170 38.915  66.209  1.00 60.53  ? 658  GLU A OE1   1 
ATOM   5289 O OE2   . GLU A 1 658 ? -15.664 37.377  66.756  1.00 60.83  ? 658  GLU A OE2   1 
ATOM   5290 N N     . LYS A 1 659 ? -18.790 37.883  62.805  1.00 49.64  ? 659  LYS A N     1 
ATOM   5291 C CA    . LYS A 1 659 ? -20.007 37.591  62.045  1.00 48.74  ? 659  LYS A CA    1 
ATOM   5292 C C     . LYS A 1 659 ? -20.499 38.708  61.131  1.00 48.28  ? 659  LYS A C     1 
ATOM   5293 O O     . LYS A 1 659 ? -21.487 38.526  60.406  1.00 48.44  ? 659  LYS A O     1 
ATOM   5294 C CB    . LYS A 1 659 ? -21.127 37.164  62.987  1.00 48.65  ? 659  LYS A CB    1 
ATOM   5295 C CG    . LYS A 1 659 ? -20.917 35.788  63.589  1.00 49.07  ? 659  LYS A CG    1 
ATOM   5296 C CD    . LYS A 1 659 ? -21.963 35.478  64.651  1.00 50.70  ? 659  LYS A CD    1 
ATOM   5297 C CE    . LYS A 1 659 ? -21.873 34.022  65.101  1.00 51.39  ? 659  LYS A CE    1 
ATOM   5298 N NZ    . LYS A 1 659 ? -22.943 33.681  66.076  1.00 52.29  ? 659  LYS A NZ    1 
ATOM   5299 N N     . LEU A 1 660 ? -19.799 39.842  61.135  1.00 47.51  ? 660  LEU A N     1 
ATOM   5300 C CA    . LEU A 1 660 ? -20.189 40.982  60.315  1.00 46.90  ? 660  LEU A CA    1 
ATOM   5301 C C     . LEU A 1 660 ? -19.236 41.254  59.185  1.00 46.64  ? 660  LEU A C     1 
ATOM   5302 O O     . LEU A 1 660 ? -19.445 42.196  58.396  1.00 46.34  ? 660  LEU A O     1 
ATOM   5303 C CB    . LEU A 1 660 ? -20.331 42.245  61.159  1.00 47.12  ? 660  LEU A CB    1 
ATOM   5304 C CG    . LEU A 1 660 ? -21.215 42.121  62.398  1.00 48.03  ? 660  LEU A CG    1 
ATOM   5305 C CD1   . LEU A 1 660 ? -21.196 43.433  63.127  1.00 47.13  ? 660  LEU A CD1   1 
ATOM   5306 C CD2   . LEU A 1 660 ? -22.645 41.711  62.041  1.00 47.83  ? 660  LEU A CD2   1 
ATOM   5307 N N     . VAL A 1 661 ? -18.183 40.446  59.101  1.00 46.54  ? 661  VAL A N     1 
ATOM   5308 C CA    . VAL A 1 661 ? -17.220 40.622  58.024  1.00 46.40  ? 661  VAL A CA    1 
ATOM   5309 C C     . VAL A 1 661 ? -17.764 40.113  56.677  1.00 46.72  ? 661  VAL A C     1 
ATOM   5310 O O     . VAL A 1 661 ? -18.422 39.061  56.590  1.00 46.32  ? 661  VAL A O     1 
ATOM   5311 C CB    . VAL A 1 661 ? -15.839 40.004  58.331  1.00 46.51  ? 661  VAL A CB    1 
ATOM   5312 C CG1   . VAL A 1 661 ? -14.769 40.736  57.515  1.00 46.08  ? 661  VAL A CG1   1 
ATOM   5313 C CG2   . VAL A 1 661 ? -15.515 40.080  59.827  1.00 45.67  ? 661  VAL A CG2   1 
ATOM   5314 N N     . ILE A 1 662 ? -17.479 40.909  55.650  1.00 47.07  ? 662  ILE A N     1 
ATOM   5315 C CA    . ILE A 1 662 ? -17.826 40.668  54.260  1.00 47.14  ? 662  ILE A CA    1 
ATOM   5316 C C     . ILE A 1 662 ? -16.534 40.413  53.489  1.00 47.64  ? 662  ILE A C     1 
ATOM   5317 O O     . ILE A 1 662 ? -15.632 41.262  53.485  1.00 47.51  ? 662  ILE A O     1 
ATOM   5318 C CB    . ILE A 1 662 ? -18.493 41.925  53.669  1.00 46.84  ? 662  ILE A CB    1 
ATOM   5319 C CG1   . ILE A 1 662 ? -19.777 42.262  54.437  1.00 47.41  ? 662  ILE A CG1   1 
ATOM   5320 C CG2   . ILE A 1 662 ? -18.769 41.744  52.206  1.00 47.01  ? 662  ILE A CG2   1 
ATOM   5321 C CD1   . ILE A 1 662 ? -20.513 43.502  53.936  1.00 46.83  ? 662  ILE A CD1   1 
ATOM   5322 N N     . TYR A 1 663 ? -16.451 39.245  52.842  1.00 48.34  ? 663  TYR A N     1 
ATOM   5323 C CA    . TYR A 1 663 ? -15.280 38.834  52.048  1.00 48.46  ? 663  TYR A CA    1 
ATOM   5324 C C     . TYR A 1 663 ? -15.533 39.080  50.583  1.00 49.22  ? 663  TYR A C     1 
ATOM   5325 O O     . TYR A 1 663 ? -16.280 38.363  49.960  1.00 50.10  ? 663  TYR A O     1 
ATOM   5326 C CB    . TYR A 1 663 ? -14.953 37.362  52.313  1.00 47.75  ? 663  TYR A CB    1 
ATOM   5327 C CG    . TYR A 1 663 ? -14.629 37.147  53.767  1.00 47.90  ? 663  TYR A CG    1 
ATOM   5328 C CD1   . TYR A 1 663 ? -13.342 37.416  54.270  1.00 48.41  ? 663  TYR A CD1   1 
ATOM   5329 C CD2   . TYR A 1 663 ? -15.613 36.749  54.668  1.00 48.04  ? 663  TYR A CD2   1 
ATOM   5330 C CE1   . TYR A 1 663 ? -13.039 37.264  55.634  1.00 48.17  ? 663  TYR A CE1   1 
ATOM   5331 C CE2   . TYR A 1 663 ? -15.325 36.592  56.035  1.00 48.72  ? 663  TYR A CE2   1 
ATOM   5332 C CZ    . TYR A 1 663 ? -14.038 36.851  56.507  1.00 49.85  ? 663  TYR A CZ    1 
ATOM   5333 O OH    . TYR A 1 663 ? -13.762 36.692  57.849  1.00 50.73  ? 663  TYR A OH    1 
ATOM   5334 N N     . GLU A 1 664 ? -14.963 40.124  50.025  1.00 50.35  ? 664  GLU A N     1 
ATOM   5335 C CA    . GLU A 1 664 ? -15.069 40.313  48.596  1.00 51.75  ? 664  GLU A CA    1 
ATOM   5336 C C     . GLU A 1 664 ? -13.689 40.389  47.982  1.00 53.01  ? 664  GLU A C     1 
ATOM   5337 O O     . GLU A 1 664 ? -12.736 40.834  48.623  1.00 53.28  ? 664  GLU A O     1 
ATOM   5338 C CB    . GLU A 1 664 ? -15.889 41.534  48.256  1.00 51.67  ? 664  GLU A CB    1 
ATOM   5339 C CG    . GLU A 1 664 ? -17.363 41.314  48.346  1.00 52.56  ? 664  GLU A CG    1 
ATOM   5340 C CD    . GLU A 1 664 ? -18.122 42.414  47.645  1.00 54.92  ? 664  GLU A CD    1 
ATOM   5341 O OE1   . GLU A 1 664 ? -18.180 43.535  48.209  1.00 54.51  ? 664  GLU A OE1   1 
ATOM   5342 O OE2   . GLU A 1 664 ? -18.648 42.157  46.527  1.00 55.89  ? 664  GLU A OE2   1 
ATOM   5343 N N     . GLN A 1 665 ? -13.602 39.972  46.724  1.00 54.45  ? 665  GLN A N     1 
ATOM   5344 C CA    . GLN A 1 665 ? -12.344 39.605  46.093  1.00 55.70  ? 665  GLN A CA    1 
ATOM   5345 C C     . GLN A 1 665 ? -11.961 40.599  45.008  1.00 56.07  ? 665  GLN A C     1 
ATOM   5346 O O     . GLN A 1 665 ? -12.831 41.202  44.383  1.00 56.47  ? 665  GLN A O     1 
ATOM   5347 C CB    . GLN A 1 665 ? -12.501 38.221  45.484  1.00 55.90  ? 665  GLN A CB    1 
ATOM   5348 C CG    . GLN A 1 665 ? -11.403 37.260  45.853  1.00 58.48  ? 665  GLN A CG    1 
ATOM   5349 C CD    . GLN A 1 665 ? -10.906 36.463  44.652  1.00 61.45  ? 665  GLN A CD    1 
ATOM   5350 O OE1   . GLN A 1 665 ? -10.993 36.923  43.501  1.00 61.84  ? 665  GLN A OE1   1 
ATOM   5351 N NE2   . GLN A 1 665 ? -10.371 35.264  44.915  1.00 61.11  ? 665  GLN A NE2   1 
ATOM   5352 N N     . ILE A 1 666 ? -10.667 40.778  44.776  1.00 56.58  ? 666  ILE A N     1 
ATOM   5353 C CA    . ILE A 1 666 ? -10.233 41.717  43.746  1.00 57.15  ? 666  ILE A CA    1 
ATOM   5354 C C     . ILE A 1 666 ? -9.934  40.978  42.432  1.00 57.96  ? 666  ILE A C     1 
ATOM   5355 O O     . ILE A 1 666 ? -9.395  39.869  42.448  1.00 57.97  ? 666  ILE A O     1 
ATOM   5356 C CB    . ILE A 1 666 ? -9.042  42.568  44.233  1.00 56.77  ? 666  ILE A CB    1 
ATOM   5357 C CG1   . ILE A 1 666 ? -9.445  43.397  45.455  1.00 56.17  ? 666  ILE A CG1   1 
ATOM   5358 C CG2   . ILE A 1 666 ? -8.524  43.483  43.116  1.00 56.96  ? 666  ILE A CG2   1 
ATOM   5359 C CD1   . ILE A 1 666 ? -10.243 44.689  45.139  1.00 54.87  ? 666  ILE A CD1   1 
ATOM   5360 N N     . THR A 1 667 ? -10.298 41.583  41.302  1.00 59.01  ? 667  THR A N     1 
ATOM   5361 C CA    . THR A 1 667 ? -10.181 40.906  40.003  1.00 59.99  ? 667  THR A CA    1 
ATOM   5362 C C     . THR A 1 667 ? -9.204  41.543  39.008  1.00 61.36  ? 667  THR A C     1 
ATOM   5363 O O     . THR A 1 667 ? -8.916  40.935  37.976  1.00 61.56  ? 667  THR A O     1 
ATOM   5364 C CB    . THR A 1 667 ? -11.562 40.730  39.293  1.00 59.74  ? 667  THR A CB    1 
ATOM   5365 O OG1   . THR A 1 667 ? -12.011 41.987  38.771  1.00 58.64  ? 667  THR A OG1   1 
ATOM   5366 C CG2   . THR A 1 667 ? -12.614 40.142  40.235  1.00 58.57  ? 667  THR A CG2   1 
ATOM   5367 N N     . ARG A 1 668 ? -8.711  42.752  39.302  1.00 62.69  ? 668  ARG A N     1 
ATOM   5368 C CA    . ARG A 1 668 ? -7.829  43.491  38.374  1.00 64.19  ? 668  ARG A CA    1 
ATOM   5369 C C     . ARG A 1 668 ? -6.988  44.551  39.080  1.00 64.92  ? 668  ARG A C     1 
ATOM   5370 O O     . ARG A 1 668 ? -7.288  44.927  40.210  1.00 65.55  ? 668  ARG A O     1 
ATOM   5371 C CB    . ARG A 1 668 ? -8.649  44.231  37.312  1.00 64.20  ? 668  ARG A CB    1 
ATOM   5372 C CG    . ARG A 1 668 ? -10.124 43.926  37.327  1.00 65.36  ? 668  ARG A CG    1 
ATOM   5373 C CD    . ARG A 1 668 ? -10.916 44.968  36.569  1.00 67.64  ? 668  ARG A CD    1 
ATOM   5374 N NE    . ARG A 1 668 ? -12.301 44.537  36.416  1.00 68.36  ? 668  ARG A NE    1 
ATOM   5375 C CZ    . ARG A 1 668 ? -13.298 45.325  36.037  1.00 69.12  ? 668  ARG A CZ    1 
ATOM   5376 N NH1   . ARG A 1 668 ? -13.074 46.608  35.772  1.00 69.69  ? 668  ARG A NH1   1 
ATOM   5377 N NH2   . ARG A 1 668 ? -14.523 44.827  35.930  1.00 69.56  ? 668  ARG A NH2   1 
ATOM   5378 N N     . ASP A 1 669 ? -5.961  45.056  38.397  1.00 65.46  ? 669  ASP A N     1 
ATOM   5379 C CA    . ASP A 1 669 ? -5.275  46.268  38.836  1.00 66.12  ? 669  ASP A CA    1 
ATOM   5380 C C     . ASP A 1 669 ? -6.321  47.336  39.106  1.00 66.31  ? 669  ASP A C     1 
ATOM   5381 O O     . ASP A 1 669 ? -7.114  47.674  38.225  1.00 66.50  ? 669  ASP A O     1 
ATOM   5382 C CB    . ASP A 1 669 ? -4.298  46.780  37.764  1.00 66.31  ? 669  ASP A CB    1 
ATOM   5383 C CG    . ASP A 1 669 ? -3.179  45.787  37.450  1.00 67.00  ? 669  ASP A CG    1 
ATOM   5384 O OD1   . ASP A 1 669 ? -2.244  46.178  36.717  1.00 67.47  ? 669  ASP A OD1   1 
ATOM   5385 O OD2   . ASP A 1 669 ? -3.229  44.624  37.921  1.00 67.02  ? 669  ASP A OD2   1 
ATOM   5386 N N     . LEU A 1 670 ? -6.325  47.863  40.324  1.00 66.46  ? 670  LEU A N     1 
ATOM   5387 C CA    . LEU A 1 670 ? -7.291  48.887  40.719  1.00 66.51  ? 670  LEU A CA    1 
ATOM   5388 C C     . LEU A 1 670 ? -7.435  50.014  39.691  1.00 66.77  ? 670  LEU A C     1 
ATOM   5389 O O     . LEU A 1 670 ? -8.517  50.579  39.522  1.00 66.70  ? 670  LEU A O     1 
ATOM   5390 C CB    . LEU A 1 670 ? -6.908  49.470  42.074  1.00 66.37  ? 670  LEU A CB    1 
ATOM   5391 C CG    . LEU A 1 670 ? -6.703  48.498  43.228  1.00 65.68  ? 670  LEU A CG    1 
ATOM   5392 C CD1   . LEU A 1 670 ? -6.166  49.273  44.409  1.00 64.97  ? 670  LEU A CD1   1 
ATOM   5393 C CD2   . LEU A 1 670 ? -7.996  47.773  43.576  1.00 64.76  ? 670  LEU A CD2   1 
ATOM   5394 N N     . LYS A 1 671 ? -6.330  50.338  39.022  1.00 67.17  ? 671  LYS A N     1 
ATOM   5395 C CA    . LYS A 1 671 ? -6.327  51.289  37.917  1.00 67.56  ? 671  LYS A CA    1 
ATOM   5396 C C     . LYS A 1 671 ? -7.480  50.940  36.967  1.00 67.82  ? 671  LYS A C     1 
ATOM   5397 O O     . LYS A 1 671 ? -8.345  51.781  36.703  1.00 67.79  ? 671  LYS A O     1 
ATOM   5398 C CB    . LYS A 1 671 ? -4.974  51.243  37.184  1.00 67.62  ? 671  LYS A CB    1 
ATOM   5399 C CG    . LYS A 1 671 ? -4.577  52.535  36.482  1.00 67.47  ? 671  LYS A CG    1 
ATOM   5400 N N     . ASP A 1 672 ? -7.508  49.683  36.512  1.00 67.87  ? 672  ASP A N     1 
ATOM   5401 C CA    . ASP A 1 672 ? -8.480  49.209  35.509  1.00 67.90  ? 672  ASP A CA    1 
ATOM   5402 C C     . ASP A 1 672 ? -9.961  49.364  35.850  1.00 67.50  ? 672  ASP A C     1 
ATOM   5403 O O     . ASP A 1 672 ? -10.756 49.608  34.945  1.00 67.70  ? 672  ASP A O     1 
ATOM   5404 C CB    . ASP A 1 672 ? -8.198  47.759  35.104  1.00 68.05  ? 672  ASP A CB    1 
ATOM   5405 C CG    . ASP A 1 672 ? -6.955  47.633  34.253  1.00 68.84  ? 672  ASP A CG    1 
ATOM   5406 O OD1   . ASP A 1 672 ? -6.450  48.675  33.779  1.00 69.52  ? 672  ASP A OD1   1 
ATOM   5407 O OD2   . ASP A 1 672 ? -6.481  46.496  34.055  1.00 70.04  ? 672  ASP A OD2   1 
ATOM   5408 N N     . TYR A 1 673 ? -10.332 49.199  37.122  1.00 66.85  ? 673  TYR A N     1 
ATOM   5409 C CA    . TYR A 1 673 ? -11.732 49.345  37.537  1.00 66.17  ? 673  TYR A CA    1 
ATOM   5410 C C     . TYR A 1 673 ? -12.305 50.667  37.039  1.00 66.07  ? 673  TYR A C     1 
ATOM   5411 O O     . TYR A 1 673 ? -11.697 51.729  37.243  1.00 66.28  ? 673  TYR A O     1 
ATOM   5412 C CB    . TYR A 1 673 ? -11.870 49.297  39.051  1.00 65.60  ? 673  TYR A CB    1 
ATOM   5413 C CG    . TYR A 1 673 ? -11.913 47.923  39.661  1.00 65.31  ? 673  TYR A CG    1 
ATOM   5414 C CD1   . TYR A 1 673 ? -10.742 47.184  39.862  1.00 65.69  ? 673  TYR A CD1   1 
ATOM   5415 C CD2   . TYR A 1 673 ? -13.114 47.372  40.085  1.00 64.31  ? 673  TYR A CD2   1 
ATOM   5416 C CE1   . TYR A 1 673 ? -10.777 45.911  40.460  1.00 64.27  ? 673  TYR A CE1   1 
ATOM   5417 C CE2   . TYR A 1 673 ? -13.156 46.111  40.680  1.00 63.43  ? 673  TYR A CE2   1 
ATOM   5418 C CZ    . TYR A 1 673 ? -11.989 45.391  40.867  1.00 63.04  ? 673  TYR A CZ    1 
ATOM   5419 O OH    . TYR A 1 673 ? -12.037 44.153  41.455  1.00 62.92  ? 673  TYR A OH    1 
ATOM   5420 N N     . LYS A 1 674 ? -13.461 50.592  36.374  1.00 65.65  ? 674  LYS A N     1 
ATOM   5421 C CA    . LYS A 1 674 ? -14.144 51.776  35.836  1.00 64.91  ? 674  LYS A CA    1 
ATOM   5422 C C     . LYS A 1 674 ? -15.108 52.358  36.873  1.00 64.37  ? 674  LYS A C     1 
ATOM   5423 O O     . LYS A 1 674 ? -15.559 53.494  36.736  1.00 64.14  ? 674  LYS A O     1 
ATOM   5424 C CB    . LYS A 1 674 ? -14.878 51.451  34.516  1.00 65.03  ? 674  LYS A CB    1 
ATOM   5425 C CG    . LYS A 1 674 ? -13.991 51.409  33.269  1.00 64.59  ? 674  LYS A CG    1 
ATOM   5426 N N     . ALA A 1 675 ? -15.414 51.567  37.902  1.00 63.73  ? 675  ALA A N     1 
ATOM   5427 C CA    . ALA A 1 675 ? -16.306 51.972  38.992  1.00 63.13  ? 675  ALA A CA    1 
ATOM   5428 C C     . ALA A 1 675 ? -15.885 51.324  40.329  1.00 62.85  ? 675  ALA A C     1 
ATOM   5429 O O     . ALA A 1 675 ? -15.255 50.250  40.353  1.00 63.04  ? 675  ALA A O     1 
ATOM   5430 C CB    . ALA A 1 675 ? -17.747 51.635  38.650  1.00 63.05  ? 675  ALA A CB    1 
ATOM   5431 N N     . THR A 1 676 ? -16.241 51.973  41.437  1.00 61.89  ? 676  THR A N     1 
ATOM   5432 C CA    . THR A 1 676 ? -15.656 51.640  42.729  1.00 60.76  ? 676  THR A CA    1 
ATOM   5433 C C     . THR A 1 676 ? -16.707 51.271  43.771  1.00 59.95  ? 676  THR A C     1 
ATOM   5434 O O     . THR A 1 676 ? -17.331 52.149  44.370  1.00 59.97  ? 676  THR A O     1 
ATOM   5435 C CB    . THR A 1 676 ? -14.772 52.815  43.246  1.00 60.89  ? 676  THR A CB    1 
ATOM   5436 O OG1   . THR A 1 676 ? -13.909 53.271  42.196  1.00 60.87  ? 676  THR A OG1   1 
ATOM   5437 C CG2   . THR A 1 676 ? -13.922 52.395  44.433  1.00 60.61  ? 676  THR A CG2   1 
ATOM   5438 N N     . GLY A 1 677 ? -16.889 49.970  43.992  1.00 58.91  ? 677  GLY A N     1 
ATOM   5439 C CA    . GLY A 1 677 ? -17.714 49.484  45.095  1.00 57.68  ? 677  GLY A CA    1 
ATOM   5440 C C     . GLY A 1 677 ? -16.997 49.681  46.421  1.00 57.02  ? 677  GLY A C     1 
ATOM   5441 O O     . GLY A 1 677 ? -15.882 50.204  46.450  1.00 56.72  ? 677  GLY A O     1 
ATOM   5442 N N     . PRO A 1 678 ? -17.623 49.251  47.532  1.00 56.47  ? 678  PRO A N     1 
ATOM   5443 C CA    . PRO A 1 678 ? -17.009 49.333  48.867  1.00 55.84  ? 678  PRO A CA    1 
ATOM   5444 C C     . PRO A 1 678 ? -15.641 48.624  48.936  1.00 55.16  ? 678  PRO A C     1 
ATOM   5445 O O     . PRO A 1 678 ? -14.604 49.272  49.143  1.00 54.84  ? 678  PRO A O     1 
ATOM   5446 C CB    . PRO A 1 678 ? -18.025 48.614  49.769  1.00 55.92  ? 678  PRO A CB    1 
ATOM   5447 C CG    . PRO A 1 678 ? -19.304 48.706  49.036  1.00 56.19  ? 678  PRO A CG    1 
ATOM   5448 C CD    . PRO A 1 678 ? -18.962 48.642  47.583  1.00 56.33  ? 678  PRO A CD    1 
ATOM   5449 N N     . HIS A 1 679 ? -15.650 47.305  48.746  1.00 54.25  ? 679  HIS A N     1 
ATOM   5450 C CA    . HIS A 1 679 ? -14.434 46.496  48.825  1.00 53.14  ? 679  HIS A CA    1 
ATOM   5451 C C     . HIS A 1 679 ? -13.323 47.011  47.903  1.00 52.51  ? 679  HIS A C     1 
ATOM   5452 O O     . HIS A 1 679 ? -12.145 46.769  48.152  1.00 52.80  ? 679  HIS A O     1 
ATOM   5453 C CB    . HIS A 1 679 ? -14.744 45.014  48.566  1.00 52.95  ? 679  HIS A CB    1 
ATOM   5454 C CG    . HIS A 1 679 ? -14.618 44.596  47.136  1.00 52.60  ? 679  HIS A CG    1 
ATOM   5455 N ND1   . HIS A 1 679 ? -15.179 45.305  46.098  1.00 53.23  ? 679  HIS A ND1   1 
ATOM   5456 C CD2   . HIS A 1 679 ? -14.020 43.520  46.576  1.00 52.96  ? 679  HIS A CD2   1 
ATOM   5457 C CE1   . HIS A 1 679 ? -14.913 44.694  44.957  1.00 53.07  ? 679  HIS A CE1   1 
ATOM   5458 N NE2   . HIS A 1 679 ? -14.217 43.605  45.220  1.00 53.15  ? 679  HIS A NE2   1 
ATOM   5459 N N     . VAL A 1 680 ? -13.709 47.733  46.857  1.00 51.44  ? 680  VAL A N     1 
ATOM   5460 C CA    . VAL A 1 680 ? -12.755 48.357  45.947  1.00 50.12  ? 680  VAL A CA    1 
ATOM   5461 C C     . VAL A 1 680 ? -12.280 49.693  46.502  1.00 49.47  ? 680  VAL A C     1 
ATOM   5462 O O     . VAL A 1 680 ? -11.172 50.127  46.206  1.00 49.19  ? 680  VAL A O     1 
ATOM   5463 C CB    . VAL A 1 680 ? -13.371 48.560  44.555  1.00 49.96  ? 680  VAL A CB    1 
ATOM   5464 C CG1   . VAL A 1 680 ? -12.386 49.222  43.601  1.00 49.62  ? 680  VAL A CG1   1 
ATOM   5465 C CG2   . VAL A 1 680 ? -13.826 47.236  44.002  1.00 49.84  ? 680  VAL A CG2   1 
ATOM   5466 N N     . ALA A 1 681 ? -13.125 50.350  47.296  1.00 48.88  ? 681  ALA A N     1 
ATOM   5467 C CA    . ALA A 1 681 ? -12.752 51.632  47.900  1.00 48.14  ? 681  ALA A CA    1 
ATOM   5468 C C     . ALA A 1 681 ? -11.867 51.403  49.130  1.00 47.52  ? 681  ALA A C     1 
ATOM   5469 O O     . ALA A 1 681 ? -10.918 52.150  49.349  1.00 47.05  ? 681  ALA A O     1 
ATOM   5470 C CB    . ALA A 1 681 ? -13.988 52.467  48.239  1.00 47.93  ? 681  ALA A CB    1 
ATOM   5471 N N     . VAL A 1 682 ? -12.178 50.365  49.911  1.00 46.72  ? 682  VAL A N     1 
ATOM   5472 C CA    . VAL A 1 682 ? -11.305 49.913  50.985  1.00 46.20  ? 682  VAL A CA    1 
ATOM   5473 C C     . VAL A 1 682 ? -9.910  49.634  50.446  1.00 46.76  ? 682  VAL A C     1 
ATOM   5474 O O     . VAL A 1 682 ? -8.920  50.218  50.925  1.00 47.25  ? 682  VAL A O     1 
ATOM   5475 C CB    . VAL A 1 682 ? -11.815 48.629  51.614  1.00 45.68  ? 682  VAL A CB    1 
ATOM   5476 C CG1   . VAL A 1 682 ? -10.864 48.137  52.675  1.00 44.44  ? 682  VAL A CG1   1 
ATOM   5477 C CG2   . VAL A 1 682 ? -13.164 48.855  52.200  1.00 46.06  ? 682  VAL A CG2   1 
ATOM   5478 N N     . ALA A 1 683 ? -9.848  48.744  49.451  1.00 46.94  ? 683  ALA A N     1 
ATOM   5479 C CA    . ALA A 1 683 ? -8.600  48.304  48.833  1.00 47.03  ? 683  ALA A CA    1 
ATOM   5480 C C     . ALA A 1 683 ? -7.853  49.470  48.212  1.00 47.47  ? 683  ALA A C     1 
ATOM   5481 O O     . ALA A 1 683 ? -6.643  49.607  48.399  1.00 47.66  ? 683  ALA A O     1 
ATOM   5482 C CB    . ALA A 1 683 ? -8.867  47.236  47.794  1.00 46.74  ? 683  ALA A CB    1 
ATOM   5483 N N     . LYS A 1 684 ? -8.582  50.315  47.487  1.00 47.86  ? 684  LYS A N     1 
ATOM   5484 C CA    . LYS A 1 684 ? -8.004  51.480  46.826  1.00 48.24  ? 684  LYS A CA    1 
ATOM   5485 C C     . LYS A 1 684 ? -7.219  52.355  47.804  1.00 48.26  ? 684  LYS A C     1 
ATOM   5486 O O     . LYS A 1 684 ? -6.164  52.891  47.453  1.00 48.40  ? 684  LYS A O     1 
ATOM   5487 C CB    . LYS A 1 684 ? -9.104  52.302  46.161  1.00 48.40  ? 684  LYS A CB    1 
ATOM   5488 C CG    . LYS A 1 684 ? -8.762  52.771  44.780  1.00 49.38  ? 684  LYS A CG    1 
ATOM   5489 C CD    . LYS A 1 684 ? -9.999  52.939  43.914  1.00 51.29  ? 684  LYS A CD    1 
ATOM   5490 C CE    . LYS A 1 684 ? -9.602  53.386  42.511  1.00 53.23  ? 684  LYS A CE    1 
ATOM   5491 N NZ    . LYS A 1 684 ? -10.779 53.788  41.699  1.00 54.02  ? 684  LYS A NZ    1 
ATOM   5492 N N     . ARG A 1 685 ? -7.719  52.490  49.028  1.00 48.12  ? 685  ARG A N     1 
ATOM   5493 C CA    . ARG A 1 685 ? -7.045  53.353  49.983  1.00 48.51  ? 685  ARG A CA    1 
ATOM   5494 C C     . ARG A 1 685 ? -5.923  52.634  50.743  1.00 48.40  ? 685  ARG A C     1 
ATOM   5495 O O     . ARG A 1 685 ? -4.934  53.264  51.162  1.00 48.67  ? 685  ARG A O     1 
ATOM   5496 C CB    . ARG A 1 685 ? -8.021  54.152  50.875  1.00 48.40  ? 685  ARG A CB    1 
ATOM   5497 C CG    . ARG A 1 685 ? -8.732  53.396  51.965  1.00 49.34  ? 685  ARG A CG    1 
ATOM   5498 C CD    . ARG A 1 685 ? -9.678  54.332  52.748  1.00 51.15  ? 685  ARG A CD    1 
ATOM   5499 N NE    . ARG A 1 685 ? -10.803 54.820  51.939  1.00 52.50  ? 685  ARG A NE    1 
ATOM   5500 C CZ    . ARG A 1 685 ? -12.055 54.347  52.011  1.00 52.95  ? 685  ARG A CZ    1 
ATOM   5501 N NH1   . ARG A 1 685 ? -12.360 53.364  52.871  1.00 51.34  ? 685  ARG A NH1   1 
ATOM   5502 N NH2   . ARG A 1 685 ? -13.005 54.864  51.222  1.00 51.17  ? 685  ARG A NH2   1 
ATOM   5503 N N     . LEU A 1 686 ? -6.057  51.315  50.881  1.00 47.77  ? 686  LEU A N     1 
ATOM   5504 C CA    . LEU A 1 686 ? -4.917  50.485  51.269  1.00 46.86  ? 686  LEU A CA    1 
ATOM   5505 C C     . LEU A 1 686 ? -3.745  50.685  50.281  1.00 46.99  ? 686  LEU A C     1 
ATOM   5506 O O     . LEU A 1 686 ? -2.604  50.869  50.691  1.00 47.17  ? 686  LEU A O     1 
ATOM   5507 C CB    . LEU A 1 686 ? -5.315  49.006  51.355  1.00 46.12  ? 686  LEU A CB    1 
ATOM   5508 C CG    . LEU A 1 686 ? -6.150  48.515  52.537  1.00 44.24  ? 686  LEU A CG    1 
ATOM   5509 C CD1   . LEU A 1 686 ? -6.321  47.013  52.505  1.00 40.77  ? 686  LEU A CD1   1 
ATOM   5510 C CD2   . LEU A 1 686 ? -5.494  48.915  53.822  1.00 43.86  ? 686  LEU A CD2   1 
ATOM   5511 N N     . ALA A 1 687 ? -4.029  50.671  48.981  1.00 47.07  ? 687  ALA A N     1 
ATOM   5512 C CA    . ALA A 1 687 ? -2.977  50.817  47.977  1.00 47.12  ? 687  ALA A CA    1 
ATOM   5513 C C     . ALA A 1 687 ? -2.357  52.208  48.022  1.00 47.40  ? 687  ALA A C     1 
ATOM   5514 O O     . ALA A 1 687 ? -1.160  52.362  47.768  1.00 47.65  ? 687  ALA A O     1 
ATOM   5515 C CB    . ALA A 1 687 ? -3.499  50.522  46.595  1.00 46.73  ? 687  ALA A CB    1 
ATOM   5516 N N     . ALA A 1 688 ? -3.164  53.217  48.357  1.00 47.47  ? 688  ALA A N     1 
ATOM   5517 C CA    . ALA A 1 688 ? -2.675  54.600  48.399  1.00 47.14  ? 688  ALA A CA    1 
ATOM   5518 C C     . ALA A 1 688 ? -1.611  54.732  49.486  1.00 47.15  ? 688  ALA A C     1 
ATOM   5519 O O     . ALA A 1 688 ? -0.890  55.725  49.548  1.00 47.14  ? 688  ALA A O     1 
ATOM   5520 C CB    . ALA A 1 688 ? -3.820  55.571  48.637  1.00 46.99  ? 688  ALA A CB    1 
ATOM   5521 N N     . ARG A 1 689 ? -1.515  53.704  50.326  1.00 47.02  ? 689  ARG A N     1 
ATOM   5522 C CA    . ARG A 1 689 ? -0.559  53.671  51.419  1.00 46.97  ? 689  ARG A CA    1 
ATOM   5523 C C     . ARG A 1 689 ? 0.476   52.601  51.169  1.00 47.03  ? 689  ARG A C     1 
ATOM   5524 O O     . ARG A 1 689 ? 1.176   52.168  52.094  1.00 46.25  ? 689  ARG A O     1 
ATOM   5525 C CB    . ARG A 1 689 ? -1.274  53.422  52.739  1.00 47.16  ? 689  ARG A CB    1 
ATOM   5526 C CG    . ARG A 1 689 ? -2.206  54.543  53.120  1.00 46.45  ? 689  ARG A CG    1 
ATOM   5527 C CD    . ARG A 1 689 ? -2.572  54.444  54.559  1.00 45.83  ? 689  ARG A CD    1 
ATOM   5528 N NE    . ARG A 1 689 ? -3.572  53.412  54.851  1.00 45.46  ? 689  ARG A NE    1 
ATOM   5529 C CZ    . ARG A 1 689 ? -3.340  52.351  55.621  1.00 44.93  ? 689  ARG A CZ    1 
ATOM   5530 N NH1   . ARG A 1 689 ? -4.298  51.469  55.864  1.00 44.03  ? 689  ARG A NH1   1 
ATOM   5531 N NH2   . ARG A 1 689 ? -2.142  52.171  56.153  1.00 45.19  ? 689  ARG A NH2   1 
ATOM   5532 N N     . GLY A 1 690 ? 0.550   52.191  49.899  1.00 47.47  ? 690  GLY A N     1 
ATOM   5533 C CA    . GLY A 1 690 ? 1.547   51.245  49.398  1.00 47.67  ? 690  GLY A CA    1 
ATOM   5534 C C     . GLY A 1 690 ? 1.387   49.820  49.892  1.00 47.92  ? 690  GLY A C     1 
ATOM   5535 O O     . GLY A 1 690 ? 2.348   49.060  49.902  1.00 48.07  ? 690  GLY A O     1 
ATOM   5536 N N     . ILE A 1 691 ? 0.186   49.439  50.308  1.00 48.08  ? 691  ILE A N     1 
ATOM   5537 C CA    . ILE A 1 691 ? -0.023  48.061  50.702  1.00 48.58  ? 691  ILE A CA    1 
ATOM   5538 C C     . ILE A 1 691 ? -0.271  47.213  49.446  1.00 49.34  ? 691  ILE A C     1 
ATOM   5539 O O     . ILE A 1 691 ? -0.812  47.700  48.437  1.00 49.40  ? 691  ILE A O     1 
ATOM   5540 C CB    . ILE A 1 691 ? -1.096  47.934  51.814  1.00 48.55  ? 691  ILE A CB    1 
ATOM   5541 C CG1   . ILE A 1 691 ? -0.550  48.581  53.093  1.00 48.30  ? 691  ILE A CG1   1 
ATOM   5542 C CG2   . ILE A 1 691 ? -1.486  46.456  52.075  1.00 48.61  ? 691  ILE A CG2   1 
ATOM   5543 C CD1   . ILE A 1 691 ? -1.509  48.656  54.263  1.00 48.21  ? 691  ILE A CD1   1 
ATOM   5544 N N     . LYS A 1 692 ? 0.188   45.963  49.504  1.00 50.09  ? 692  LYS A N     1 
ATOM   5545 C CA    . LYS A 1 692 ? 0.118   45.034  48.386  1.00 50.63  ? 692  LYS A CA    1 
ATOM   5546 C C     . LYS A 1 692 ? -1.313  44.661  48.081  1.00 50.91  ? 692  LYS A C     1 
ATOM   5547 O O     . LYS A 1 692 ? -1.955  43.954  48.856  1.00 50.82  ? 692  LYS A O     1 
ATOM   5548 C CB    . LYS A 1 692 ? 0.898   43.764  48.717  1.00 50.86  ? 692  LYS A CB    1 
ATOM   5549 C CG    . LYS A 1 692 ? 1.029   42.779  47.563  1.00 51.87  ? 692  LYS A CG    1 
ATOM   5550 C CD    . LYS A 1 692 ? 1.416   41.394  48.069  1.00 53.09  ? 692  LYS A CD    1 
ATOM   5551 C CE    . LYS A 1 692 ? 1.810   40.514  46.900  1.00 55.08  ? 692  LYS A CE    1 
ATOM   5552 N NZ    . LYS A 1 692 ? 1.678   39.057  47.206  1.00 56.38  ? 692  LYS A NZ    1 
ATOM   5553 N N     . ILE A 1 693 ? -1.808  45.146  46.949  1.00 51.52  ? 693  ILE A N     1 
ATOM   5554 C CA    . ILE A 1 693 ? -3.116  44.744  46.458  1.00 52.35  ? 693  ILE A CA    1 
ATOM   5555 C C     . ILE A 1 693 ? -3.002  44.223  45.025  1.00 52.61  ? 693  ILE A C     1 
ATOM   5556 O O     . ILE A 1 693 ? -2.592  44.956  44.132  1.00 52.59  ? 693  ILE A O     1 
ATOM   5557 C CB    . ILE A 1 693 ? -4.186  45.880  46.632  1.00 52.40  ? 693  ILE A CB    1 
ATOM   5558 C CG1   . ILE A 1 693 ? -5.175  45.530  47.748  1.00 52.38  ? 693  ILE A CG1   1 
ATOM   5559 C CG2   . ILE A 1 693 ? -5.033  46.039  45.390  1.00 52.73  ? 693  ILE A CG2   1 
ATOM   5560 C CD1   . ILE A 1 693 ? -4.603  45.446  49.134  1.00 51.54  ? 693  ILE A CD1   1 
ATOM   5561 N N     . ARG A 1 694 ? -3.343  42.947  44.831  1.00 53.18  ? 694  ARG A N     1 
ATOM   5562 C CA    . ARG A 1 694 ? -3.261  42.280  43.515  1.00 53.72  ? 694  ARG A CA    1 
ATOM   5563 C C     . ARG A 1 694 ? -4.565  41.546  43.188  1.00 53.25  ? 694  ARG A C     1 
ATOM   5564 O O     . ARG A 1 694 ? -5.299  41.157  44.102  1.00 53.35  ? 694  ARG A O     1 
ATOM   5565 C CB    . ARG A 1 694 ? -2.138  41.231  43.498  1.00 53.94  ? 694  ARG A CB    1 
ATOM   5566 C CG    . ARG A 1 694 ? -0.755  41.712  43.888  1.00 56.50  ? 694  ARG A CG    1 
ATOM   5567 C CD    . ARG A 1 694 ? 0.062   42.307  42.731  1.00 61.49  ? 694  ARG A CD    1 
ATOM   5568 N NE    . ARG A 1 694 ? 1.460   42.476  43.154  1.00 65.46  ? 694  ARG A NE    1 
ATOM   5569 C CZ    . ARG A 1 694 ? 2.411   41.540  43.031  1.00 67.35  ? 694  ARG A CZ    1 
ATOM   5570 N NH1   . ARG A 1 694 ? 2.135   40.365  42.466  1.00 67.22  ? 694  ARG A NH1   1 
ATOM   5571 N NH2   . ARG A 1 694 ? 3.650   41.779  43.467  1.00 67.97  ? 694  ARG A NH2   1 
ATOM   5572 N N     . PRO A 1 695 ? -4.859  41.346  41.885  1.00 52.82  ? 695  PRO A N     1 
ATOM   5573 C CA    . PRO A 1 695 ? -5.927  40.396  41.494  1.00 52.08  ? 695  PRO A CA    1 
ATOM   5574 C C     . PRO A 1 695 ? -5.819  39.100  42.287  1.00 51.11  ? 695  PRO A C     1 
ATOM   5575 O O     . PRO A 1 695 ? -4.773  38.472  42.278  1.00 51.25  ? 695  PRO A O     1 
ATOM   5576 C CB    . PRO A 1 695 ? -5.662  40.136  40.001  1.00 51.95  ? 695  PRO A CB    1 
ATOM   5577 C CG    . PRO A 1 695 ? -4.463  41.021  39.614  1.00 52.57  ? 695  PRO A CG    1 
ATOM   5578 C CD    . PRO A 1 695 ? -4.257  42.017  40.716  1.00 52.99  ? 695  PRO A CD    1 
ATOM   5579 N N     . GLY A 1 696 ? -6.876  38.735  42.998  1.00 50.38  ? 696  GLY A N     1 
ATOM   5580 C CA    . GLY A 1 696 ? -6.858  37.557  43.858  1.00 49.91  ? 696  GLY A CA    1 
ATOM   5581 C C     . GLY A 1 696 ? -6.881  37.900  45.338  1.00 49.93  ? 696  GLY A C     1 
ATOM   5582 O O     . GLY A 1 696 ? -7.095  37.015  46.188  1.00 49.74  ? 696  GLY A O     1 
ATOM   5583 N N     . THR A 1 697 ? -6.648  39.183  45.646  1.00 49.66  ? 697  THR A N     1 
ATOM   5584 C CA    . THR A 1 697 ? -6.664  39.685  47.028  1.00 49.33  ? 697  THR A CA    1 
ATOM   5585 C C     . THR A 1 697 ? -8.092  39.752  47.587  1.00 49.10  ? 697  THR A C     1 
ATOM   5586 O O     . THR A 1 697 ? -8.982  40.388  47.001  1.00 48.71  ? 697  THR A O     1 
ATOM   5587 C CB    . THR A 1 697 ? -5.981  41.085  47.158  1.00 49.43  ? 697  THR A CB    1 
ATOM   5588 O OG1   . THR A 1 697 ? -4.664  41.043  46.590  1.00 49.17  ? 697  THR A OG1   1 
ATOM   5589 C CG2   . THR A 1 697 ? -5.909  41.541  48.626  1.00 48.60  ? 697  THR A CG2   1 
ATOM   5590 N N     . VAL A 1 698 ? -8.280  39.095  48.727  1.00 48.72  ? 698  VAL A N     1 
ATOM   5591 C CA    . VAL A 1 698 ? -9.558  39.060  49.410  1.00 48.88  ? 698  VAL A CA    1 
ATOM   5592 C C     . VAL A 1 698 ? -9.669  40.177  50.467  1.00 48.78  ? 698  VAL A C     1 
ATOM   5593 O O     . VAL A 1 698 ? -9.152  40.043  51.594  1.00 48.82  ? 698  VAL A O     1 
ATOM   5594 C CB    . VAL A 1 698 ? -9.793  37.669  50.071  1.00 49.11  ? 698  VAL A CB    1 
ATOM   5595 C CG1   . VAL A 1 698 ? -11.072 37.653  50.909  1.00 49.10  ? 698  VAL A CG1   1 
ATOM   5596 C CG2   . VAL A 1 698 ? -9.841  36.581  49.025  1.00 49.51  ? 698  VAL A CG2   1 
ATOM   5597 N N     . ILE A 1 699 ? -10.349 41.265  50.091  1.00 48.17  ? 699  ILE A N     1 
ATOM   5598 C CA    . ILE A 1 699 ? -10.755 42.327  51.012  1.00 47.52  ? 699  ILE A CA    1 
ATOM   5599 C C     . ILE A 1 699 ? -11.754 41.806  52.047  1.00 47.95  ? 699  ILE A C     1 
ATOM   5600 O O     . ILE A 1 699 ? -12.724 41.156  51.708  1.00 48.35  ? 699  ILE A O     1 
ATOM   5601 C CB    . ILE A 1 699 ? -11.404 43.468  50.250  1.00 47.03  ? 699  ILE A CB    1 
ATOM   5602 C CG1   . ILE A 1 699 ? -10.491 43.939  49.113  1.00 47.18  ? 699  ILE A CG1   1 
ATOM   5603 C CG2   . ILE A 1 699 ? -11.756 44.598  51.176  1.00 45.98  ? 699  ILE A CG2   1 
ATOM   5604 C CD1   . ILE A 1 699 ? -9.013  43.998  49.471  1.00 47.48  ? 699  ILE A CD1   1 
ATOM   5605 N N     . SER A 1 700 ? -11.513 42.093  53.315  1.00 48.25  ? 700  SER A N     1 
ATOM   5606 C CA    . SER A 1 700 ? -12.368 41.609  54.367  1.00 48.58  ? 700  SER A CA    1 
ATOM   5607 C C     . SER A 1 700 ? -12.707 42.811  55.218  1.00 48.59  ? 700  SER A C     1 
ATOM   5608 O O     . SER A 1 700 ? -11.853 43.281  55.958  1.00 49.04  ? 700  SER A O     1 
ATOM   5609 C CB    . SER A 1 700 ? -11.600 40.594  55.193  1.00 48.88  ? 700  SER A CB    1 
ATOM   5610 O OG    . SER A 1 700 ? -10.746 39.839  54.355  1.00 50.62  ? 700  SER A OG    1 
ATOM   5611 N N     . TYR A 1 701 ? -13.941 43.308  55.119  1.00 48.48  ? 701  TYR A N     1 
ATOM   5612 C CA    . TYR A 1 701 ? -14.293 44.591  55.734  1.00 48.43  ? 701  TYR A CA    1 
ATOM   5613 C C     . TYR A 1 701 ? -15.499 44.562  56.663  1.00 48.45  ? 701  TYR A C     1 
ATOM   5614 O O     . TYR A 1 701 ? -16.306 43.643  56.583  1.00 48.88  ? 701  TYR A O     1 
ATOM   5615 C CB    . TYR A 1 701 ? -14.478 45.666  54.664  1.00 48.39  ? 701  TYR A CB    1 
ATOM   5616 C CG    . TYR A 1 701 ? -15.566 45.383  53.662  1.00 48.81  ? 701  TYR A CG    1 
ATOM   5617 C CD1   . TYR A 1 701 ? -16.864 45.875  53.848  1.00 49.04  ? 701  TYR A CD1   1 
ATOM   5618 C CD2   . TYR A 1 701 ? -15.298 44.645  52.510  1.00 48.23  ? 701  TYR A CD2   1 
ATOM   5619 C CE1   . TYR A 1 701 ? -17.868 45.636  52.908  1.00 49.40  ? 701  TYR A CE1   1 
ATOM   5620 C CE2   . TYR A 1 701 ? -16.285 44.391  51.573  1.00 48.94  ? 701  TYR A CE2   1 
ATOM   5621 C CZ    . TYR A 1 701 ? -17.573 44.886  51.771  1.00 50.38  ? 701  TYR A CZ    1 
ATOM   5622 O OH    . TYR A 1 701 ? -18.550 44.621  50.828  1.00 49.47  ? 701  TYR A OH    1 
ATOM   5623 N N     . ILE A 1 702 ? -15.571 45.537  57.576  1.00 48.44  ? 702  ILE A N     1 
ATOM   5624 C CA    . ILE A 1 702 ? -16.797 45.854  58.314  1.00 48.51  ? 702  ILE A CA    1 
ATOM   5625 C C     . ILE A 1 702 ? -17.326 47.220  57.864  1.00 49.41  ? 702  ILE A C     1 
ATOM   5626 O O     . ILE A 1 702 ? -16.560 48.077  57.414  1.00 49.86  ? 702  ILE A O     1 
ATOM   5627 C CB    . ILE A 1 702 ? -16.604 45.912  59.831  1.00 47.85  ? 702  ILE A CB    1 
ATOM   5628 C CG1   . ILE A 1 702 ? -16.184 44.583  60.392  1.00 48.06  ? 702  ILE A CG1   1 
ATOM   5629 C CG2   . ILE A 1 702 ? -17.914 46.117  60.500  1.00 47.49  ? 702  ILE A CG2   1 
ATOM   5630 C CD1   . ILE A 1 702 ? -16.782 44.329  61.798  1.00 46.80  ? 702  ILE A CD1   1 
ATOM   5631 N N     . VAL A 1 703 ? -18.636 47.418  57.979  1.00 50.46  ? 703  VAL A N     1 
ATOM   5632 C CA    . VAL A 1 703 ? -19.239 48.734  57.794  1.00 51.40  ? 703  VAL A CA    1 
ATOM   5633 C C     . VAL A 1 703 ? -19.373 49.388  59.170  1.00 52.33  ? 703  VAL A C     1 
ATOM   5634 O O     . VAL A 1 703 ? -19.803 48.741  60.147  1.00 52.57  ? 703  VAL A O     1 
ATOM   5635 C CB    . VAL A 1 703 ? -20.605 48.644  57.071  1.00 51.20  ? 703  VAL A CB    1 
ATOM   5636 C CG1   . VAL A 1 703 ? -21.253 50.002  56.962  1.00 51.25  ? 703  VAL A CG1   1 
ATOM   5637 C CG2   . VAL A 1 703 ? -20.425 48.085  55.678  1.00 51.12  ? 703  VAL A CG2   1 
ATOM   5638 N N     . LEU A 1 704 ? -18.987 50.661  59.255  1.00 53.30  ? 704  LEU A N     1 
ATOM   5639 C CA    . LEU A 1 704 ? -19.031 51.374  60.529  1.00 54.20  ? 704  LEU A CA    1 
ATOM   5640 C C     . LEU A 1 704 ? -20.116 52.424  60.528  1.00 55.10  ? 704  LEU A C     1 
ATOM   5641 O O     . LEU A 1 704 ? -20.568 52.854  59.457  1.00 54.31  ? 704  LEU A O     1 
ATOM   5642 C CB    . LEU A 1 704 ? -17.689 52.020  60.848  1.00 53.97  ? 704  LEU A CB    1 
ATOM   5643 C CG    . LEU A 1 704 ? -16.448 51.157  61.039  1.00 53.73  ? 704  LEU A CG    1 
ATOM   5644 C CD1   . LEU A 1 704 ? -15.275 52.101  61.248  1.00 53.97  ? 704  LEU A CD1   1 
ATOM   5645 C CD2   . LEU A 1 704 ? -16.575 50.166  62.200  1.00 52.25  ? 704  LEU A CD2   1 
ATOM   5646 N N     . LYS A 1 705 ? -20.521 52.825  61.740  1.00 56.73  ? 705  LYS A N     1 
ATOM   5647 C CA    . LYS A 1 705 ? -21.579 53.824  61.930  1.00 58.35  ? 705  LYS A CA    1 
ATOM   5648 C C     . LYS A 1 705 ? -21.176 55.221  61.406  1.00 59.34  ? 705  LYS A C     1 
ATOM   5649 O O     . LYS A 1 705 ? -20.136 55.772  61.780  1.00 58.84  ? 705  LYS A O     1 
ATOM   5650 C CB    . LYS A 1 705 ? -22.028 53.872  63.397  1.00 58.37  ? 705  LYS A CB    1 
ATOM   5651 C CG    . LYS A 1 705 ? -22.962 55.051  63.681  1.00 59.87  ? 705  LYS A CG    1 
ATOM   5652 C CD    . LYS A 1 705 ? -23.747 54.938  64.977  1.00 60.76  ? 705  LYS A CD    1 
ATOM   5653 C CE    . LYS A 1 705 ? -24.858 55.985  64.952  1.00 61.74  ? 705  LYS A CE    1 
ATOM   5654 N NZ    . LYS A 1 705 ? -25.862 55.789  66.026  1.00 63.61  ? 705  LYS A NZ    1 
ATOM   5655 N N     . GLY A 1 706 ? -22.004 55.774  60.526  1.00 60.68  ? 706  GLY A N     1 
ATOM   5656 C CA    . GLY A 1 706 ? -21.688 57.042  59.875  1.00 62.60  ? 706  GLY A CA    1 
ATOM   5657 C C     . GLY A 1 706 ? -22.659 57.358  58.752  1.00 64.15  ? 706  GLY A C     1 
ATOM   5658 O O     . GLY A 1 706 ? -23.716 56.717  58.618  1.00 64.13  ? 706  GLY A O     1 
ATOM   5659 N N     . SER A 1 707 ? -22.296 58.340  57.931  1.00 65.68  ? 707  SER A N     1 
ATOM   5660 C CA    . SER A 1 707 ? -23.208 58.833  56.889  1.00 67.18  ? 707  SER A CA    1 
ATOM   5661 C C     . SER A 1 707 ? -22.741 58.549  55.448  1.00 67.60  ? 707  SER A C     1 
ATOM   5662 O O     . SER A 1 707 ? -21.572 58.189  55.202  1.00 67.88  ? 707  SER A O     1 
ATOM   5663 C CB    . SER A 1 707 ? -23.488 60.340  57.088  1.00 67.49  ? 707  SER A CB    1 
ATOM   5664 O OG    . SER A 1 707 ? -24.590 60.780  56.292  1.00 68.38  ? 707  SER A OG    1 
ATOM   5665 N N     . GLY A 1 708 ? -23.670 58.717  54.505  1.00 67.88  ? 708  GLY A N     1 
ATOM   5666 C CA    . GLY A 1 708 ? -23.355 58.626  53.079  1.00 67.89  ? 708  GLY A CA    1 
ATOM   5667 C C     . GLY A 1 708 ? -22.989 57.220  52.633  1.00 67.74  ? 708  GLY A C     1 
ATOM   5668 O O     . GLY A 1 708 ? -23.527 56.234  53.156  1.00 67.83  ? 708  GLY A O     1 
ATOM   5669 N N     . ARG A 1 709 ? -22.055 57.134  51.683  1.00 67.09  ? 709  ARG A N     1 
ATOM   5670 C CA    . ARG A 1 709 ? -21.752 55.885  50.986  1.00 66.21  ? 709  ARG A CA    1 
ATOM   5671 C C     . ARG A 1 709 ? -21.224 54.784  51.902  1.00 65.59  ? 709  ARG A C     1 
ATOM   5672 O O     . ARG A 1 709 ? -20.622 55.065  52.946  1.00 65.65  ? 709  ARG A O     1 
ATOM   5673 C CB    . ARG A 1 709 ? -20.775 56.150  49.845  1.00 66.29  ? 709  ARG A CB    1 
ATOM   5674 C CG    . ARG A 1 709 ? -21.438 56.573  48.530  1.00 66.42  ? 709  ARG A CG    1 
ATOM   5675 C CD    . ARG A 1 709 ? -20.529 57.457  47.684  1.00 66.19  ? 709  ARG A CD    1 
ATOM   5676 N NE    . ARG A 1 709 ? -19.133 57.364  48.110  1.00 66.78  ? 709  ARG A NE    1 
ATOM   5677 C CZ    . ARG A 1 709 ? -18.136 58.103  47.630  1.00 66.85  ? 709  ARG A CZ    1 
ATOM   5678 N NH1   . ARG A 1 709 ? -18.348 59.005  46.683  1.00 66.77  ? 709  ARG A NH1   1 
ATOM   5679 N NH2   . ARG A 1 709 ? -16.914 57.929  48.099  1.00 67.23  ? 709  ARG A NH2   1 
ATOM   5680 N N     . ILE A 1 710 ? -21.477 53.535  51.511  1.00 64.54  ? 710  ILE A N     1 
ATOM   5681 C CA    . ILE A 1 710 ? -20.968 52.375  52.240  1.00 63.80  ? 710  ILE A CA    1 
ATOM   5682 C C     . ILE A 1 710 ? -19.444 52.262  52.068  1.00 62.99  ? 710  ILE A C     1 
ATOM   5683 O O     . ILE A 1 710 ? -18.733 51.794  52.961  1.00 62.97  ? 710  ILE A O     1 
ATOM   5684 C CB    . ILE A 1 710 ? -21.720 51.057  51.853  1.00 64.04  ? 710  ILE A CB    1 
ATOM   5685 C CG1   . ILE A 1 710 ? -23.026 50.917  52.648  1.00 64.52  ? 710  ILE A CG1   1 
ATOM   5686 C CG2   . ILE A 1 710 ? -20.890 49.820  52.158  1.00 63.47  ? 710  ILE A CG2   1 
ATOM   5687 C CD1   . ILE A 1 710 ? -24.236 51.624  52.039  1.00 65.51  ? 710  ILE A CD1   1 
ATOM   5688 N N     . GLY A 1 711 ? -18.946 52.722  50.927  1.00 61.87  ? 711  GLY A N     1 
ATOM   5689 C CA    . GLY A 1 711 ? -17.511 52.789  50.699  1.00 60.58  ? 711  GLY A CA    1 
ATOM   5690 C C     . GLY A 1 711 ? -16.781 53.662  51.706  1.00 59.56  ? 711  GLY A C     1 
ATOM   5691 O O     . GLY A 1 711 ? -15.749 53.255  52.258  1.00 59.71  ? 711  GLY A O     1 
ATOM   5692 N N     . ASP A 1 712 ? -17.325 54.853  51.959  1.00 58.24  ? 712  ASP A N     1 
ATOM   5693 C CA    . ASP A 1 712 ? -16.677 55.834  52.834  1.00 56.85  ? 712  ASP A CA    1 
ATOM   5694 C C     . ASP A 1 712 ? -16.541 55.377  54.287  1.00 55.77  ? 712  ASP A C     1 
ATOM   5695 O O     . ASP A 1 712 ? -15.723 55.929  55.018  1.00 56.15  ? 712  ASP A O     1 
ATOM   5696 C CB    . ASP A 1 712 ? -17.386 57.199  52.790  1.00 57.17  ? 712  ASP A CB    1 
ATOM   5697 C CG    . ASP A 1 712 ? -17.633 57.704  51.364  1.00 57.80  ? 712  ASP A CG    1 
ATOM   5698 O OD1   . ASP A 1 712 ? -18.750 58.211  51.080  1.00 57.68  ? 712  ASP A OD1   1 
ATOM   5699 O OD2   . ASP A 1 712 ? -16.714 57.591  50.525  1.00 58.86  ? 712  ASP A OD2   1 
ATOM   5700 N N     . ARG A 1 713 ? -17.307 54.375  54.715  1.00 53.98  ? 713  ARG A N     1 
ATOM   5701 C CA    . ARG A 1 713 ? -17.226 53.959  56.123  1.00 52.28  ? 713  ARG A CA    1 
ATOM   5702 C C     . ARG A 1 713 ? -16.988 52.481  56.356  1.00 50.91  ? 713  ARG A C     1 
ATOM   5703 O O     . ARG A 1 713 ? -17.200 51.971  57.452  1.00 50.28  ? 713  ARG A O     1 
ATOM   5704 C CB    . ARG A 1 713 ? -18.444 54.449  56.913  1.00 52.76  ? 713  ARG A CB    1 
ATOM   5705 C CG    . ARG A 1 713 ? -19.789 53.964  56.393  1.00 52.61  ? 713  ARG A CG    1 
ATOM   5706 C CD    . ARG A 1 713 ? -20.911 54.691  57.109  1.00 52.11  ? 713  ARG A CD    1 
ATOM   5707 N NE    . ARG A 1 713 ? -22.159 53.939  57.071  1.00 52.43  ? 713  ARG A NE    1 
ATOM   5708 C CZ    . ARG A 1 713 ? -22.920 53.801  55.988  1.00 52.26  ? 713  ARG A CZ    1 
ATOM   5709 N NH1   . ARG A 1 713 ? -22.564 54.364  54.835  1.00 52.45  ? 713  ARG A NH1   1 
ATOM   5710 N NH2   . ARG A 1 713 ? -24.036 53.088  56.056  1.00 51.62  ? 713  ARG A NH2   1 
ATOM   5711 N N     . ALA A 1 714 ? -16.541 51.797  55.315  1.00 49.89  ? 714  ALA A N     1 
ATOM   5712 C CA    . ALA A 1 714 ? -16.102 50.409  55.436  1.00 48.85  ? 714  ALA A CA    1 
ATOM   5713 C C     . ALA A 1 714 ? -14.610 50.344  55.757  1.00 48.04  ? 714  ALA A C     1 
ATOM   5714 O O     . ALA A 1 714 ? -13.787 50.986  55.081  1.00 47.87  ? 714  ALA A O     1 
ATOM   5715 C CB    . ALA A 1 714 ? -16.393 49.663  54.158  1.00 48.82  ? 714  ALA A CB    1 
ATOM   5716 N N     . ILE A 1 715 ? -14.253 49.581  56.784  1.00 46.79  ? 715  ILE A N     1 
ATOM   5717 C CA    . ILE A 1 715 ? -12.841 49.446  57.137  1.00 46.30  ? 715  ILE A CA    1 
ATOM   5718 C C     . ILE A 1 715 ? -12.402 47.984  57.113  1.00 45.79  ? 715  ILE A C     1 
ATOM   5719 O O     . ILE A 1 715 ? -13.212 47.104  57.343  1.00 46.16  ? 715  ILE A O     1 
ATOM   5720 C CB    . ILE A 1 715 ? -12.505 50.094  58.521  1.00 46.18  ? 715  ILE A CB    1 
ATOM   5721 C CG1   . ILE A 1 715 ? -13.187 49.333  59.649  1.00 46.27  ? 715  ILE A CG1   1 
ATOM   5722 C CG2   . ILE A 1 715 ? -12.854 51.595  58.531  1.00 45.66  ? 715  ILE A CG2   1 
ATOM   5723 C CD1   . ILE A 1 715 ? -12.483 49.424  60.970  1.00 48.19  ? 715  ILE A CD1   1 
ATOM   5724 N N     . PRO A 1 716 ? -11.121 47.720  56.821  1.00 45.29  ? 716  PRO A N     1 
ATOM   5725 C CA    . PRO A 1 716 ? -10.557 46.378  56.921  1.00 45.13  ? 716  PRO A CA    1 
ATOM   5726 C C     . PRO A 1 716 ? -10.780 45.764  58.289  1.00 45.40  ? 716  PRO A C     1 
ATOM   5727 O O     . PRO A 1 716 ? -10.544 46.427  59.294  1.00 45.47  ? 716  PRO A O     1 
ATOM   5728 C CB    . PRO A 1 716 ? -9.064  46.627  56.742  1.00 44.85  ? 716  PRO A CB    1 
ATOM   5729 C CG    . PRO A 1 716 ? -8.983  47.838  55.927  1.00 44.74  ? 716  PRO A CG    1 
ATOM   5730 C CD    . PRO A 1 716 ? -10.132 48.696  56.336  1.00 45.13  ? 716  PRO A CD    1 
ATOM   5731 N N     . PHE A 1 717 ? -11.212 44.511  58.345  1.00 45.92  ? 717  PHE A N     1 
ATOM   5732 C CA    . PHE A 1 717 ? -11.428 43.867  59.634  1.00 47.09  ? 717  PHE A CA    1 
ATOM   5733 C C     . PHE A 1 717 ? -10.131 43.837  60.484  1.00 48.56  ? 717  PHE A C     1 
ATOM   5734 O O     . PHE A 1 717 ? -10.167 43.973  61.723  1.00 48.72  ? 717  PHE A O     1 
ATOM   5735 C CB    . PHE A 1 717 ? -12.058 42.476  59.475  1.00 46.52  ? 717  PHE A CB    1 
ATOM   5736 C CG    . PHE A 1 717 ? -12.437 41.844  60.782  1.00 45.83  ? 717  PHE A CG    1 
ATOM   5737 C CD1   . PHE A 1 717 ? -13.339 42.475  61.638  1.00 45.92  ? 717  PHE A CD1   1 
ATOM   5738 C CD2   . PHE A 1 717 ? -11.860 40.648  61.187  1.00 45.49  ? 717  PHE A CD2   1 
ATOM   5739 C CE1   . PHE A 1 717 ? -13.681 41.907  62.891  1.00 46.90  ? 717  PHE A CE1   1 
ATOM   5740 C CE2   . PHE A 1 717 ? -12.185 40.063  62.432  1.00 46.50  ? 717  PHE A CE2   1 
ATOM   5741 C CZ    . PHE A 1 717 ? -13.103 40.693  63.289  1.00 46.41  ? 717  PHE A CZ    1 
ATOM   5742 N N     . ASP A 1 718 ? -8.996  43.665  59.802  1.00 50.10  ? 718  ASP A N     1 
ATOM   5743 C CA    . ASP A 1 718 ? -7.659  43.935  60.349  1.00 51.53  ? 718  ASP A CA    1 
ATOM   5744 C C     . ASP A 1 718 ? -7.580  45.150  61.260  1.00 51.85  ? 718  ASP A C     1 
ATOM   5745 O O     . ASP A 1 718 ? -7.054  45.068  62.369  1.00 51.96  ? 718  ASP A O     1 
ATOM   5746 C CB    . ASP A 1 718 ? -6.717  44.227  59.199  1.00 51.86  ? 718  ASP A CB    1 
ATOM   5747 C CG    . ASP A 1 718 ? -5.871  43.066  58.855  1.00 55.31  ? 718  ASP A CG    1 
ATOM   5748 O OD1   . ASP A 1 718 ? -6.300  41.901  59.098  1.00 58.23  ? 718  ASP A OD1   1 
ATOM   5749 O OD2   . ASP A 1 718 ? -4.758  43.324  58.341  1.00 59.97  ? 718  ASP A OD2   1 
ATOM   5750 N N     . GLU A 1 719 ? -8.089  46.276  60.756  1.00 52.02  ? 719  GLU A N     1 
ATOM   5751 C CA    . GLU A 1 719 ? -7.982  47.577  61.402  1.00 52.18  ? 719  GLU A CA    1 
ATOM   5752 C C     . GLU A 1 719 ? -9.139  47.898  62.352  1.00 52.58  ? 719  GLU A C     1 
ATOM   5753 O O     . GLU A 1 719 ? -9.265  49.033  62.818  1.00 52.75  ? 719  GLU A O     1 
ATOM   5754 C CB    . GLU A 1 719 ? -7.860  48.668  60.334  1.00 51.95  ? 719  GLU A CB    1 
ATOM   5755 C CG    . GLU A 1 719 ? -6.707  48.428  59.373  1.00 51.77  ? 719  GLU A CG    1 
ATOM   5756 C CD    . GLU A 1 719 ? -6.592  49.481  58.283  1.00 51.95  ? 719  GLU A CD    1 
ATOM   5757 O OE1   . GLU A 1 719 ? -7.200  50.573  58.412  1.00 51.10  ? 719  GLU A OE1   1 
ATOM   5758 O OE2   . GLU A 1 719 ? -5.882  49.206  57.287  1.00 52.23  ? 719  GLU A OE2   1 
ATOM   5759 N N     . PHE A 1 720 ? -9.973  46.904  62.642  1.00 52.94  ? 720  PHE A N     1 
ATOM   5760 C CA    . PHE A 1 720 ? -11.150 47.115  63.469  1.00 53.24  ? 720  PHE A CA    1 
ATOM   5761 C C     . PHE A 1 720 ? -10.836 46.918  64.947  1.00 54.19  ? 720  PHE A C     1 
ATOM   5762 O O     . PHE A 1 720 ? -10.440 45.815  65.361  1.00 54.55  ? 720  PHE A O     1 
ATOM   5763 C CB    . PHE A 1 720 ? -12.263 46.158  63.040  1.00 53.08  ? 720  PHE A CB    1 
ATOM   5764 C CG    . PHE A 1 720 ? -13.432 46.122  63.981  1.00 51.31  ? 720  PHE A CG    1 
ATOM   5765 C CD1   . PHE A 1 720 ? -14.487 47.026  63.835  1.00 49.34  ? 720  PHE A CD1   1 
ATOM   5766 C CD2   . PHE A 1 720 ? -13.481 45.193  65.013  1.00 49.26  ? 720  PHE A CD2   1 
ATOM   5767 C CE1   . PHE A 1 720 ? -15.564 47.012  64.706  1.00 47.24  ? 720  PHE A CE1   1 
ATOM   5768 C CE2   . PHE A 1 720 ? -14.554 45.178  65.893  1.00 49.17  ? 720  PHE A CE2   1 
ATOM   5769 C CZ    . PHE A 1 720 ? -15.600 46.090  65.739  1.00 47.61  ? 720  PHE A CZ    1 
ATOM   5770 N N     . ASP A 1 721 ? -11.029 47.973  65.744  1.00 54.67  ? 721  ASP A N     1 
ATOM   5771 C CA    . ASP A 1 721 ? -10.866 47.864  67.187  1.00 55.49  ? 721  ASP A CA    1 
ATOM   5772 C C     . ASP A 1 721 ? -12.228 47.830  67.856  1.00 55.61  ? 721  ASP A C     1 
ATOM   5773 O O     . ASP A 1 721 ? -12.944 48.836  67.819  1.00 55.87  ? 721  ASP A O     1 
ATOM   5774 C CB    . ASP A 1 721 ? -10.045 49.035  67.730  1.00 55.93  ? 721  ASP A CB    1 
ATOM   5775 C CG    . ASP A 1 721 ? -9.639  48.857  69.213  1.00 57.80  ? 721  ASP A CG    1 
ATOM   5776 O OD1   . ASP A 1 721 ? -9.868  47.786  69.835  1.00 57.83  ? 721  ASP A OD1   1 
ATOM   5777 O OD2   . ASP A 1 721 ? -9.076  49.829  69.763  1.00 61.20  ? 721  ASP A OD2   1 
ATOM   5778 N N     . PRO A 1 722 ? -12.597 46.677  68.467  1.00 55.68  ? 722  PRO A N     1 
ATOM   5779 C CA    . PRO A 1 722 ? -13.880 46.561  69.189  1.00 55.81  ? 722  PRO A CA    1 
ATOM   5780 C C     . PRO A 1 722 ? -14.071 47.737  70.147  1.00 56.04  ? 722  PRO A C     1 
ATOM   5781 O O     . PRO A 1 722 ? -15.121 48.405  70.129  1.00 55.90  ? 722  PRO A O     1 
ATOM   5782 C CB    . PRO A 1 722 ? -13.738 45.247  69.980  1.00 55.61  ? 722  PRO A CB    1 
ATOM   5783 C CG    . PRO A 1 722 ? -12.308 44.805  69.804  1.00 55.57  ? 722  PRO A CG    1 
ATOM   5784 C CD    . PRO A 1 722 ? -11.837 45.418  68.518  1.00 55.55  ? 722  PRO A CD    1 
ATOM   5785 N N     . ALA A 1 723 ? -13.025 47.985  70.943  1.00 56.06  ? 723  ALA A N     1 
ATOM   5786 C CA    . ALA A 1 723 ? -12.966 49.081  71.902  1.00 55.55  ? 723  ALA A CA    1 
ATOM   5787 C C     . ALA A 1 723 ? -13.202 50.476  71.284  1.00 55.03  ? 723  ALA A C     1 
ATOM   5788 O O     . ALA A 1 723 ? -13.972 51.258  71.820  1.00 55.01  ? 723  ALA A O     1 
ATOM   5789 C CB    . ALA A 1 723 ? -11.642 49.018  72.673  1.00 55.50  ? 723  ALA A CB    1 
ATOM   5790 N N     . LYS A 1 724 ? -12.578 50.784  70.155  1.00 54.67  ? 724  LYS A N     1 
ATOM   5791 C CA    . LYS A 1 724 ? -12.703 52.144  69.590  1.00 54.80  ? 724  LYS A CA    1 
ATOM   5792 C C     . LYS A 1 724 ? -13.874 52.307  68.595  1.00 54.71  ? 724  LYS A C     1 
ATOM   5793 O O     . LYS A 1 724 ? -14.640 53.278  68.658  1.00 54.74  ? 724  LYS A O     1 
ATOM   5794 C CB    . LYS A 1 724 ? -11.372 52.625  68.966  1.00 54.16  ? 724  LYS A CB    1 
ATOM   5795 N N     . HIS A 1 725 ? -14.007 51.349  67.683  1.00 54.65  ? 725  HIS A N     1 
ATOM   5796 C CA    . HIS A 1 725 ? -14.949 51.450  66.575  1.00 54.23  ? 725  HIS A CA    1 
ATOM   5797 C C     . HIS A 1 725 ? -16.356 50.946  66.907  1.00 54.18  ? 725  HIS A C     1 
ATOM   5798 O O     . HIS A 1 725 ? -16.531 50.070  67.767  1.00 53.87  ? 725  HIS A O     1 
ATOM   5799 C CB    . HIS A 1 725 ? -14.412 50.666  65.397  1.00 54.13  ? 725  HIS A CB    1 
ATOM   5800 C CG    . HIS A 1 725 ? -13.148 51.216  64.830  1.00 54.51  ? 725  HIS A CG    1 
ATOM   5801 N ND1   . HIS A 1 725 ? -11.941 50.558  64.932  1.00 54.92  ? 725  HIS A ND1   1 
ATOM   5802 C CD2   . HIS A 1 725 ? -12.903 52.354  64.134  1.00 54.93  ? 725  HIS A CD2   1 
ATOM   5803 C CE1   . HIS A 1 725 ? -11.008 51.267  64.321  1.00 55.13  ? 725  HIS A CE1   1 
ATOM   5804 N NE2   . HIS A 1 725 ? -11.564 52.362  63.831  1.00 54.59  ? 725  HIS A NE2   1 
ATOM   5805 N N     . LYS A 1 726 ? -17.346 51.501  66.204  1.00 54.13  ? 726  LYS A N     1 
ATOM   5806 C CA    . LYS A 1 726 ? -18.760 51.091  66.343  1.00 54.11  ? 726  LYS A CA    1 
ATOM   5807 C C     . LYS A 1 726 ? -19.383 50.638  65.003  1.00 53.09  ? 726  LYS A C     1 
ATOM   5808 O O     . LYS A 1 726 ? -19.525 51.444  64.051  1.00 52.36  ? 726  LYS A O     1 
ATOM   5809 C CB    . LYS A 1 726 ? -19.607 52.225  66.984  1.00 54.54  ? 726  LYS A CB    1 
ATOM   5810 C CG    . LYS A 1 726 ? -19.269 52.572  68.465  1.00 56.24  ? 726  LYS A CG    1 
ATOM   5811 C CD    . LYS A 1 726 ? -19.973 51.661  69.521  1.00 58.68  ? 726  LYS A CD    1 
ATOM   5812 C CE    . LYS A 1 726 ? -19.110 50.455  69.960  1.00 59.77  ? 726  LYS A CE    1 
ATOM   5813 N NZ    . LYS A 1 726 ? -17.852 50.835  70.726  1.00 61.48  ? 726  LYS A NZ    1 
ATOM   5814 N N     . TYR A 1 727 ? -19.764 49.358  64.925  1.00 52.24  ? 727  TYR A N     1 
ATOM   5815 C CA    . TYR A 1 727 ? -20.371 48.860  63.664  1.00 51.57  ? 727  TYR A CA    1 
ATOM   5816 C C     . TYR A 1 727 ? -21.730 49.479  63.324  1.00 51.43  ? 727  TYR A C     1 
ATOM   5817 O O     . TYR A 1 727 ? -22.512 49.833  64.222  1.00 51.98  ? 727  TYR A O     1 
ATOM   5818 C CB    . TYR A 1 727 ? -20.393 47.335  63.544  1.00 50.59  ? 727  TYR A CB    1 
ATOM   5819 C CG    . TYR A 1 727 ? -21.136 46.524  64.582  1.00 49.15  ? 727  TYR A CG    1 
ATOM   5820 C CD1   . TYR A 1 727 ? -22.520 46.386  64.547  1.00 49.03  ? 727  TYR A CD1   1 
ATOM   5821 C CD2   . TYR A 1 727 ? -20.441 45.796  65.533  1.00 49.06  ? 727  TYR A CD2   1 
ATOM   5822 C CE1   . TYR A 1 727 ? -23.199 45.570  65.480  1.00 48.08  ? 727  TYR A CE1   1 
ATOM   5823 C CE2   . TYR A 1 727 ? -21.101 44.981  66.467  1.00 48.63  ? 727  TYR A CE2   1 
ATOM   5824 C CZ    . TYR A 1 727 ? -22.476 44.873  66.439  1.00 48.58  ? 727  TYR A CZ    1 
ATOM   5825 O OH    . TYR A 1 727 ? -23.109 44.064  67.373  1.00 49.06  ? 727  TYR A OH    1 
ATOM   5826 N N     . ASP A 1 728 ? -21.994 49.615  62.033  1.00 50.50  ? 728  ASP A N     1 
ATOM   5827 C CA    . ASP A 1 728 ? -23.233 50.209  61.571  1.00 50.44  ? 728  ASP A CA    1 
ATOM   5828 C C     . ASP A 1 728 ? -24.442 49.273  61.717  1.00 50.58  ? 728  ASP A C     1 
ATOM   5829 O O     . ASP A 1 728 ? -24.972 48.789  60.718  1.00 50.65  ? 728  ASP A O     1 
ATOM   5830 C CB    . ASP A 1 728 ? -23.061 50.613  60.115  1.00 50.31  ? 728  ASP A CB    1 
ATOM   5831 C CG    . ASP A 1 728 ? -24.097 51.602  59.657  1.00 51.03  ? 728  ASP A CG    1 
ATOM   5832 O OD1   . ASP A 1 728 ? -25.200 51.651  60.260  1.00 52.10  ? 728  ASP A OD1   1 
ATOM   5833 O OD2   . ASP A 1 728 ? -23.800 52.332  58.685  1.00 51.04  ? 728  ASP A OD2   1 
ATOM   5834 N N     . ALA A 1 729 ? -24.878 49.025  62.955  1.00 50.85  ? 729  ALA A N     1 
ATOM   5835 C CA    . ALA A 1 729 ? -26.042 48.155  63.240  1.00 50.95  ? 729  ALA A CA    1 
ATOM   5836 C C     . ALA A 1 729 ? -27.308 48.470  62.407  1.00 51.10  ? 729  ALA A C     1 
ATOM   5837 O O     . ALA A 1 729 ? -28.095 47.568  62.089  1.00 51.25  ? 729  ALA A O     1 
ATOM   5838 C CB    . ALA A 1 729 ? -26.362 48.135  64.739  1.00 50.59  ? 729  ALA A CB    1 
ATOM   5839 N N     . GLU A 1 730 ? -27.498 49.732  62.033  1.00 51.11  ? 730  GLU A N     1 
ATOM   5840 C CA    . GLU A 1 730 ? -28.592 50.072  61.125  1.00 51.13  ? 730  GLU A CA    1 
ATOM   5841 C C     . GLU A 1 730 ? -28.415 49.380  59.773  1.00 50.53  ? 730  GLU A C     1 
ATOM   5842 O O     . GLU A 1 730 ? -29.356 48.800  59.252  1.00 50.88  ? 730  GLU A O     1 
ATOM   5843 C CB    . GLU A 1 730 ? -28.724 51.583  60.945  1.00 51.60  ? 730  GLU A CB    1 
ATOM   5844 C CG    . GLU A 1 730 ? -30.058 52.025  60.343  1.00 53.55  ? 730  GLU A CG    1 
ATOM   5845 C CD    . GLU A 1 730 ? -31.255 51.780  61.273  1.00 56.41  ? 730  GLU A CD    1 
ATOM   5846 O OE1   . GLU A 1 730 ? -31.067 51.290  62.435  1.00 56.16  ? 730  GLU A OE1   1 
ATOM   5847 O OE2   . GLU A 1 730 ? -32.390 52.092  60.822  1.00 56.18  ? 730  GLU A OE2   1 
ATOM   5848 N N     . TYR A 1 731 ? -27.203 49.433  59.223  1.00 49.67  ? 731  TYR A N     1 
ATOM   5849 C CA    . TYR A 1 731 ? -26.855 48.695  58.000  1.00 48.34  ? 731  TYR A CA    1 
ATOM   5850 C C     . TYR A 1 731 ? -27.070 47.182  58.134  1.00 47.90  ? 731  TYR A C     1 
ATOM   5851 O O     . TYR A 1 731 ? -27.639 46.536  57.246  1.00 47.42  ? 731  TYR A O     1 
ATOM   5852 C CB    . TYR A 1 731 ? -25.400 48.979  57.603  1.00 47.56  ? 731  TYR A CB    1 
ATOM   5853 C CG    . TYR A 1 731 ? -24.884 48.147  56.445  1.00 46.24  ? 731  TYR A CG    1 
ATOM   5854 C CD1   . TYR A 1 731 ? -24.987 48.613  55.123  1.00 45.48  ? 731  TYR A CD1   1 
ATOM   5855 C CD2   . TYR A 1 731 ? -24.290 46.904  56.667  1.00 43.88  ? 731  TYR A CD2   1 
ATOM   5856 C CE1   . TYR A 1 731 ? -24.521 47.858  54.056  1.00 44.71  ? 731  TYR A CE1   1 
ATOM   5857 C CE2   . TYR A 1 731 ? -23.813 46.147  55.613  1.00 44.14  ? 731  TYR A CE2   1 
ATOM   5858 C CZ    . TYR A 1 731 ? -23.930 46.628  54.310  1.00 45.08  ? 731  TYR A CZ    1 
ATOM   5859 O OH    . TYR A 1 731 ? -23.455 45.876  53.263  1.00 45.96  ? 731  TYR A OH    1 
ATOM   5860 N N     . TYR A 1 732 ? -26.607 46.615  59.236  1.00 47.38  ? 732  TYR A N     1 
ATOM   5861 C CA    . TYR A 1 732 ? -26.629 45.171  59.350  1.00 47.42  ? 732  TYR A CA    1 
ATOM   5862 C C     . TYR A 1 732 ? -28.055 44.643  59.504  1.00 47.36  ? 732  TYR A C     1 
ATOM   5863 O O     . TYR A 1 732 ? -28.400 43.607  58.927  1.00 47.20  ? 732  TYR A O     1 
ATOM   5864 C CB    . TYR A 1 732 ? -25.664 44.695  60.432  1.00 47.26  ? 732  TYR A CB    1 
ATOM   5865 C CG    . TYR A 1 732 ? -24.228 44.719  59.930  1.00 48.73  ? 732  TYR A CG    1 
ATOM   5866 C CD1   . TYR A 1 732 ? -23.431 45.877  60.025  1.00 48.64  ? 732  TYR A CD1   1 
ATOM   5867 C CD2   . TYR A 1 732 ? -23.672 43.598  59.326  1.00 48.64  ? 732  TYR A CD2   1 
ATOM   5868 C CE1   . TYR A 1 732 ? -22.114 45.894  59.541  1.00 47.87  ? 732  TYR A CE1   1 
ATOM   5869 C CE2   . TYR A 1 732 ? -22.374 43.614  58.847  1.00 49.16  ? 732  TYR A CE2   1 
ATOM   5870 C CZ    . TYR A 1 732 ? -21.598 44.752  58.954  1.00 48.60  ? 732  TYR A CZ    1 
ATOM   5871 O OH    . TYR A 1 732 ? -20.319 44.712  58.458  1.00 47.45  ? 732  TYR A OH    1 
ATOM   5872 N N     . ILE A 1 733 ? -28.882 45.398  60.232  1.00 46.94  ? 733  ILE A N     1 
ATOM   5873 C CA    . ILE A 1 733 ? -30.308 45.102  60.365  1.00 46.44  ? 733  ILE A CA    1 
ATOM   5874 C C     . ILE A 1 733 ? -31.093 45.352  59.070  1.00 46.07  ? 733  ILE A C     1 
ATOM   5875 O O     . ILE A 1 733 ? -31.739 44.439  58.583  1.00 45.97  ? 733  ILE A O     1 
ATOM   5876 C CB    . ILE A 1 733 ? -30.951 45.900  61.520  1.00 46.57  ? 733  ILE A CB    1 
ATOM   5877 C CG1   . ILE A 1 733 ? -30.522 45.315  62.868  1.00 46.84  ? 733  ILE A CG1   1 
ATOM   5878 C CG2   . ILE A 1 733 ? -32.458 45.872  61.398  1.00 46.25  ? 733  ILE A CG2   1 
ATOM   5879 C CD1   . ILE A 1 733 ? -30.562 46.277  64.024  1.00 44.76  ? 733  ILE A CD1   1 
ATOM   5880 N N     . GLU A 1 734 ? -31.030 46.569  58.526  1.00 45.43  ? 734  GLU A N     1 
ATOM   5881 C CA    . GLU A 1 734 ? -31.863 46.955  57.388  1.00 45.40  ? 734  GLU A CA    1 
ATOM   5882 C C     . GLU A 1 734 ? -31.343 46.473  56.055  1.00 44.94  ? 734  GLU A C     1 
ATOM   5883 O O     . GLU A 1 734 ? -32.120 46.036  55.232  1.00 45.53  ? 734  GLU A O     1 
ATOM   5884 C CB    . GLU A 1 734 ? -32.096 48.479  57.302  1.00 45.69  ? 734  GLU A CB    1 
ATOM   5885 C CG    . GLU A 1 734 ? -32.857 49.119  58.474  1.00 47.42  ? 734  GLU A CG    1 
ATOM   5886 C CD    . GLU A 1 734 ? -34.187 48.433  58.794  1.00 50.16  ? 734  GLU A CD    1 
ATOM   5887 O OE1   . GLU A 1 734 ? -34.970 48.190  57.843  1.00 50.12  ? 734  GLU A OE1   1 
ATOM   5888 O OE2   . GLU A 1 734 ? -34.444 48.144  59.997  1.00 49.95  ? 734  GLU A OE2   1 
ATOM   5889 N N     . ASN A 1 735 ? -30.044 46.597  55.813  1.00 44.63  ? 735  ASN A N     1 
ATOM   5890 C CA    . ASN A 1 735 ? -29.464 46.206  54.521  1.00 43.74  ? 735  ASN A CA    1 
ATOM   5891 C C     . ASN A 1 735 ? -29.135 44.722  54.480  1.00 43.26  ? 735  ASN A C     1 
ATOM   5892 O O     . ASN A 1 735 ? -29.292 44.093  53.445  1.00 43.00  ? 735  ASN A O     1 
ATOM   5893 C CB    . ASN A 1 735 ? -28.228 47.059  54.185  1.00 43.69  ? 735  ASN A CB    1 
ATOM   5894 C CG    . ASN A 1 735 ? -27.533 46.638  52.887  1.00 43.41  ? 735  ASN A CG    1 
ATOM   5895 O OD1   . ASN A 1 735 ? -27.029 45.528  52.769  1.00 44.52  ? 735  ASN A OD1   1 
ATOM   5896 N ND2   . ASN A 1 735 ? -27.467 47.545  51.931  1.00 42.42  ? 735  ASN A ND2   1 
ATOM   5897 N N     . GLN A 1 736 ? -28.719 44.162  55.611  1.00 42.76  ? 736  GLN A N     1 
ATOM   5898 C CA    . GLN A 1 736 ? -28.211 42.797  55.617  1.00 42.71  ? 736  GLN A CA    1 
ATOM   5899 C C     . GLN A 1 736 ? -29.133 41.711  56.155  1.00 42.57  ? 736  GLN A C     1 
ATOM   5900 O O     . GLN A 1 736 ? -29.543 40.860  55.388  1.00 43.50  ? 736  GLN A O     1 
ATOM   5901 C CB    . GLN A 1 736 ? -26.847 42.729  56.298  1.00 42.64  ? 736  GLN A CB    1 
ATOM   5902 C CG    . GLN A 1 736 ? -25.769 43.385  55.469  1.00 42.53  ? 736  GLN A CG    1 
ATOM   5903 C CD    . GLN A 1 736 ? -24.949 42.398  54.690  1.00 42.80  ? 736  GLN A CD    1 
ATOM   5904 O OE1   . GLN A 1 736 ? -24.762 41.252  55.117  1.00 42.50  ? 736  GLN A OE1   1 
ATOM   5905 N NE2   . GLN A 1 736 ? -24.428 42.838  53.546  1.00 42.61  ? 736  GLN A NE2   1 
ATOM   5906 N N     . VAL A 1 737 ? -29.426 41.713  57.451  1.00 41.80  ? 737  VAL A N     1 
ATOM   5907 C CA    . VAL A 1 737 ? -30.218 40.656  58.058  1.00 41.36  ? 737  VAL A CA    1 
ATOM   5908 C C     . VAL A 1 737 ? -31.700 40.635  57.651  1.00 41.65  ? 737  VAL A C     1 
ATOM   5909 O O     . VAL A 1 737 ? -32.290 39.567  57.527  1.00 42.07  ? 737  VAL A O     1 
ATOM   5910 C CB    . VAL A 1 737 ? -30.170 40.719  59.596  1.00 41.38  ? 737  VAL A CB    1 
ATOM   5911 C CG1   . VAL A 1 737 ? -31.144 39.709  60.213  1.00 40.70  ? 737  VAL A CG1   1 
ATOM   5912 C CG2   . VAL A 1 737 ? -28.762 40.477  60.100  1.00 41.15  ? 737  VAL A CG2   1 
ATOM   5913 N N     . LEU A 1 738 ? -32.336 41.785  57.488  1.00 41.44  ? 738  LEU A N     1 
ATOM   5914 C CA    . LEU A 1 738 ? -33.787 41.734  57.363  1.00 41.14  ? 738  LEU A CA    1 
ATOM   5915 C C     . LEU A 1 738 ? -34.219 41.370  55.959  1.00 41.64  ? 738  LEU A C     1 
ATOM   5916 O O     . LEU A 1 738 ? -35.083 40.495  55.808  1.00 42.27  ? 738  LEU A O     1 
ATOM   5917 C CB    . LEU A 1 738 ? -34.505 42.984  57.893  1.00 40.56  ? 738  LEU A CB    1 
ATOM   5918 C CG    . LEU A 1 738 ? -34.646 43.185  59.409  1.00 38.87  ? 738  LEU A CG    1 
ATOM   5919 C CD1   . LEU A 1 738 ? -35.502 44.395  59.657  1.00 36.73  ? 738  LEU A CD1   1 
ATOM   5920 C CD2   . LEU A 1 738 ? -35.209 41.981  60.168  1.00 37.99  ? 738  LEU A CD2   1 
ATOM   5921 N N     . PRO A 1 739 ? -33.603 41.986  54.922  1.00 41.43  ? 739  PRO A N     1 
ATOM   5922 C CA    . PRO A 1 739 ? -33.952 41.535  53.563  1.00 41.60  ? 739  PRO A CA    1 
ATOM   5923 C C     . PRO A 1 739 ? -33.803 40.015  53.353  1.00 41.80  ? 739  PRO A C     1 
ATOM   5924 O O     . PRO A 1 739 ? -34.464 39.464  52.512  1.00 42.04  ? 739  PRO A O     1 
ATOM   5925 C CB    . PRO A 1 739 ? -32.976 42.309  52.673  1.00 41.23  ? 739  PRO A CB    1 
ATOM   5926 C CG    . PRO A 1 739 ? -32.671 43.523  53.446  1.00 40.72  ? 739  PRO A CG    1 
ATOM   5927 C CD    . PRO A 1 739 ? -32.609 43.068  54.886  1.00 40.87  ? 739  PRO A CD    1 
ATOM   5928 N N     . ALA A 1 740 ? -32.968 39.357  54.139  1.00 42.36  ? 740  ALA A N     1 
ATOM   5929 C CA    . ALA A 1 740 ? -32.746 37.931  54.031  1.00 43.38  ? 740  ALA A CA    1 
ATOM   5930 C C     . ALA A 1 740 ? -33.916 37.080  54.520  1.00 44.44  ? 740  ALA A C     1 
ATOM   5931 O O     . ALA A 1 740 ? -33.962 35.869  54.266  1.00 44.27  ? 740  ALA A O     1 
ATOM   5932 C CB    . ALA A 1 740 ? -31.505 37.570  54.826  1.00 43.43  ? 740  ALA A CB    1 
ATOM   5933 N N     . VAL A 1 741 ? -34.848 37.702  55.239  1.00 45.60  ? 741  VAL A N     1 
ATOM   5934 C CA    . VAL A 1 741 ? -35.815 36.950  56.051  1.00 46.64  ? 741  VAL A CA    1 
ATOM   5935 C C     . VAL A 1 741 ? -37.244 37.535  55.971  1.00 47.49  ? 741  VAL A C     1 
ATOM   5936 O O     . VAL A 1 741 ? -38.221 36.917  56.398  1.00 47.18  ? 741  VAL A O     1 
ATOM   5937 C CB    . VAL A 1 741 ? -35.289 36.839  57.517  1.00 46.23  ? 741  VAL A CB    1 
ATOM   5938 C CG1   . VAL A 1 741 ? -35.520 38.132  58.283  1.00 46.57  ? 741  VAL A CG1   1 
ATOM   5939 C CG2   . VAL A 1 741 ? -35.900 35.656  58.242  1.00 46.56  ? 741  VAL A CG2   1 
ATOM   5940 N N     . GLU A 1 742 ? -37.325 38.724  55.383  1.00 48.90  ? 742  GLU A N     1 
ATOM   5941 C CA    . GLU A 1 742 ? -38.527 39.544  55.309  1.00 50.19  ? 742  GLU A CA    1 
ATOM   5942 C C     . GLU A 1 742 ? -39.630 38.892  54.486  1.00 50.12  ? 742  GLU A C     1 
ATOM   5943 O O     . GLU A 1 742 ? -40.764 38.751  54.952  1.00 50.27  ? 742  GLU A O     1 
ATOM   5944 C CB    . GLU A 1 742 ? -38.146 40.902  54.704  1.00 50.67  ? 742  GLU A CB    1 
ATOM   5945 C CG    . GLU A 1 742 ? -39.208 41.985  54.830  1.00 54.83  ? 742  GLU A CG    1 
ATOM   5946 C CD    . GLU A 1 742 ? -39.896 42.242  53.500  1.00 60.45  ? 742  GLU A CD    1 
ATOM   5947 O OE1   . GLU A 1 742 ? -39.182 42.093  52.466  1.00 61.89  ? 742  GLU A OE1   1 
ATOM   5948 O OE2   . GLU A 1 742 ? -41.122 42.582  53.490  1.00 61.65  ? 742  GLU A OE2   1 
ATOM   5949 N N     . ARG A 1 743 ? -39.280 38.515  53.255  1.00 50.26  ? 743  ARG A N     1 
ATOM   5950 C CA    . ARG A 1 743 ? -40.160 37.782  52.350  1.00 49.81  ? 743  ARG A CA    1 
ATOM   5951 C C     . ARG A 1 743 ? -40.708 36.487  52.983  1.00 49.03  ? 743  ARG A C     1 
ATOM   5952 O O     . ARG A 1 743 ? -41.904 36.213  52.920  1.00 48.98  ? 743  ARG A O     1 
ATOM   5953 C CB    . ARG A 1 743 ? -39.428 37.503  51.031  1.00 49.99  ? 743  ARG A CB    1 
ATOM   5954 C CG    . ARG A 1 743 ? -39.728 38.490  49.920  1.00 52.27  ? 743  ARG A CG    1 
ATOM   5955 C CD    . ARG A 1 743 ? -41.193 38.345  49.483  1.00 57.86  ? 743  ARG A CD    1 
ATOM   5956 N NE    . ARG A 1 743 ? -41.592 39.185  48.348  1.00 61.10  ? 743  ARG A NE    1 
ATOM   5957 C CZ    . ARG A 1 743 ? -42.867 39.393  48.005  1.00 64.53  ? 743  ARG A CZ    1 
ATOM   5958 N NH1   . ARG A 1 743 ? -43.847 38.824  48.715  1.00 66.08  ? 743  ARG A NH1   1 
ATOM   5959 N NH2   . ARG A 1 743 ? -43.179 40.167  46.964  1.00 65.15  ? 743  ARG A NH2   1 
ATOM   5960 N N     . ILE A 1 744 ? -39.842 35.714  53.619  1.00 48.16  ? 744  ILE A N     1 
ATOM   5961 C CA    . ILE A 1 744 ? -40.275 34.514  54.316  1.00 47.85  ? 744  ILE A CA    1 
ATOM   5962 C C     . ILE A 1 744 ? -41.367 34.808  55.344  1.00 48.15  ? 744  ILE A C     1 
ATOM   5963 O O     . ILE A 1 744 ? -42.384 34.122  55.410  1.00 48.11  ? 744  ILE A O     1 
ATOM   5964 C CB    . ILE A 1 744 ? -39.085 33.818  55.009  1.00 47.60  ? 744  ILE A CB    1 
ATOM   5965 C CG1   . ILE A 1 744 ? -38.089 33.312  53.971  1.00 46.70  ? 744  ILE A CG1   1 
ATOM   5966 C CG2   . ILE A 1 744 ? -39.555 32.681  55.892  1.00 47.41  ? 744  ILE A CG2   1 
ATOM   5967 C CD1   . ILE A 1 744 ? -36.756 32.973  54.540  1.00 45.60  ? 744  ILE A CD1   1 
ATOM   5968 N N     . LEU A 1 745 ? -41.158 35.837  56.146  1.00 48.81  ? 745  LEU A N     1 
ATOM   5969 C CA    . LEU A 1 745 ? -42.005 36.053  57.309  1.00 49.25  ? 745  LEU A CA    1 
ATOM   5970 C C     . LEU A 1 745 ? -43.252 36.913  57.048  1.00 50.23  ? 745  LEU A C     1 
ATOM   5971 O O     . LEU A 1 745 ? -44.236 36.816  57.789  1.00 50.28  ? 745  LEU A O     1 
ATOM   5972 C CB    . LEU A 1 745 ? -41.176 36.591  58.469  1.00 48.57  ? 745  LEU A CB    1 
ATOM   5973 C CG    . LEU A 1 745 ? -40.240 35.577  59.120  1.00 47.07  ? 745  LEU A CG    1 
ATOM   5974 C CD1   . LEU A 1 745 ? -39.344 36.251  60.139  1.00 44.63  ? 745  LEU A CD1   1 
ATOM   5975 C CD2   . LEU A 1 745 ? -41.035 34.478  59.773  1.00 46.28  ? 745  LEU A CD2   1 
ATOM   5976 N N     . ARG A 1 746 ? -43.208 37.751  56.012  1.00 51.23  ? 746  ARG A N     1 
ATOM   5977 C CA    . ARG A 1 746 ? -44.400 38.461  55.563  1.00 52.53  ? 746  ARG A CA    1 
ATOM   5978 C C     . ARG A 1 746 ? -45.435 37.423  55.108  1.00 53.35  ? 746  ARG A C     1 
ATOM   5979 O O     . ARG A 1 746 ? -46.626 37.538  55.410  1.00 53.74  ? 746  ARG A O     1 
ATOM   5980 C CB    . ARG A 1 746 ? -44.056 39.472  54.460  1.00 52.70  ? 746  ARG A CB    1 
ATOM   5981 C CG    . ARG A 1 746 ? -45.054 39.566  53.294  1.00 54.43  ? 746  ARG A CG    1 
ATOM   5982 C CD    . ARG A 1 746 ? -44.919 40.862  52.487  1.00 57.81  ? 746  ARG A CD    1 
ATOM   5983 N NE    . ARG A 1 746 ? -43.536 41.127  52.081  1.00 61.26  ? 746  ARG A NE    1 
ATOM   5984 C CZ    . ARG A 1 746 ? -43.169 41.623  50.896  1.00 62.18  ? 746  ARG A CZ    1 
ATOM   5985 N NH1   . ARG A 1 746 ? -44.082 41.901  49.970  1.00 62.87  ? 746  ARG A NH1   1 
ATOM   5986 N NH2   . ARG A 1 746 ? -41.882 41.823  50.626  1.00 61.73  ? 746  ARG A NH2   1 
ATOM   5987 N N     . ALA A 1 747 ? -44.964 36.386  54.416  1.00 53.78  ? 747  ALA A N     1 
ATOM   5988 C CA    . ALA A 1 747 ? -45.801 35.248  54.073  1.00 53.89  ? 747  ALA A CA    1 
ATOM   5989 C C     . ALA A 1 747 ? -46.676 34.785  55.240  1.00 53.98  ? 747  ALA A C     1 
ATOM   5990 O O     . ALA A 1 747 ? -47.799 34.365  55.019  1.00 54.71  ? 747  ALA A O     1 
ATOM   5991 C CB    . ALA A 1 747 ? -44.949 34.090  53.555  1.00 53.92  ? 747  ALA A CB    1 
ATOM   5992 N N     . PHE A 1 748 ? -46.181 34.863  56.471  1.00 53.65  ? 748  PHE A N     1 
ATOM   5993 C CA    . PHE A 1 748 ? -46.988 34.447  57.612  1.00 53.45  ? 748  PHE A CA    1 
ATOM   5994 C C     . PHE A 1 748 ? -47.717 35.603  58.292  1.00 53.67  ? 748  PHE A C     1 
ATOM   5995 O O     . PHE A 1 748 ? -48.253 35.458  59.397  1.00 53.28  ? 748  PHE A O     1 
ATOM   5996 C CB    . PHE A 1 748 ? -46.142 33.678  58.600  1.00 53.18  ? 748  PHE A CB    1 
ATOM   5997 C CG    . PHE A 1 748 ? -45.572 32.422  58.039  1.00 53.62  ? 748  PHE A CG    1 
ATOM   5998 C CD1   . PHE A 1 748 ? -44.391 32.448  57.299  1.00 54.62  ? 748  PHE A CD1   1 
ATOM   5999 C CD2   . PHE A 1 748 ? -46.202 31.205  58.248  1.00 53.49  ? 748  PHE A CD2   1 
ATOM   6000 C CE1   . PHE A 1 748 ? -43.846 31.271  56.780  1.00 54.39  ? 748  PHE A CE1   1 
ATOM   6001 C CE2   . PHE A 1 748 ? -45.669 30.024  57.735  1.00 53.32  ? 748  PHE A CE2   1 
ATOM   6002 C CZ    . PHE A 1 748 ? -44.490 30.058  57.001  1.00 53.94  ? 748  PHE A CZ    1 
ATOM   6003 N N     . GLY A 1 749 ? -47.745 36.745  57.609  1.00 53.93  ? 749  GLY A N     1 
ATOM   6004 C CA    . GLY A 1 749 ? -48.460 37.914  58.080  1.00 54.54  ? 749  GLY A CA    1 
ATOM   6005 C C     . GLY A 1 749 ? -47.624 38.946  58.817  1.00 55.28  ? 749  GLY A C     1 
ATOM   6006 O O     . GLY A 1 749 ? -48.108 40.047  59.081  1.00 55.65  ? 749  GLY A O     1 
ATOM   6007 N N     . TYR A 1 750 ? -46.380 38.615  59.165  1.00 55.59  ? 750  TYR A N     1 
ATOM   6008 C CA    . TYR A 1 750 ? -45.546 39.549  59.926  1.00 55.86  ? 750  TYR A CA    1 
ATOM   6009 C C     . TYR A 1 750 ? -44.990 40.666  59.054  1.00 56.75  ? 750  TYR A C     1 
ATOM   6010 O O     . TYR A 1 750 ? -44.624 40.436  57.903  1.00 56.92  ? 750  TYR A O     1 
ATOM   6011 C CB    . TYR A 1 750 ? -44.428 38.814  60.632  1.00 54.98  ? 750  TYR A CB    1 
ATOM   6012 C CG    . TYR A 1 750 ? -44.939 37.800  61.601  1.00 53.57  ? 750  TYR A CG    1 
ATOM   6013 C CD1   . TYR A 1 750 ? -45.286 36.526  61.170  1.00 52.24  ? 750  TYR A CD1   1 
ATOM   6014 C CD2   . TYR A 1 750 ? -45.090 38.105  62.953  1.00 51.49  ? 750  TYR A CD2   1 
ATOM   6015 C CE1   . TYR A 1 750 ? -45.763 35.567  62.060  1.00 51.72  ? 750  TYR A CE1   1 
ATOM   6016 C CE2   . TYR A 1 750 ? -45.575 37.148  63.855  1.00 51.02  ? 750  TYR A CE2   1 
ATOM   6017 C CZ    . TYR A 1 750 ? -45.908 35.881  63.393  1.00 51.31  ? 750  TYR A CZ    1 
ATOM   6018 O OH    . TYR A 1 750 ? -46.384 34.911  64.241  1.00 53.07  ? 750  TYR A OH    1 
ATOM   6019 N N     . ARG A 1 751 ? -44.956 41.872  59.614  1.00 57.76  ? 751  ARG A N     1 
ATOM   6020 C CA    . ARG A 1 751 ? -44.466 43.064  58.923  1.00 58.90  ? 751  ARG A CA    1 
ATOM   6021 C C     . ARG A 1 751 ? -42.991 43.282  59.309  1.00 59.71  ? 751  ARG A C     1 
ATOM   6022 O O     . ARG A 1 751 ? -42.514 42.664  60.285  1.00 59.67  ? 751  ARG A O     1 
ATOM   6023 C CB    . ARG A 1 751 ? -45.325 44.266  59.339  1.00 58.91  ? 751  ARG A CB    1 
ATOM   6024 C CG    . ARG A 1 751 ? -45.587 45.284  58.244  1.00 59.47  ? 751  ARG A CG    1 
ATOM   6025 N N     . LYS A 1 752 ? -42.259 44.130  58.571  1.00 60.43  ? 752  LYS A N     1 
ATOM   6026 C CA    . LYS A 1 752 ? -40.863 44.427  58.960  1.00 61.43  ? 752  LYS A CA    1 
ATOM   6027 C C     . LYS A 1 752 ? -40.855 44.916  60.406  1.00 62.23  ? 752  LYS A C     1 
ATOM   6028 O O     . LYS A 1 752 ? -40.224 44.293  61.273  1.00 62.58  ? 752  LYS A O     1 
ATOM   6029 C CB    . LYS A 1 752 ? -40.183 45.449  58.039  1.00 61.27  ? 752  LYS A CB    1 
ATOM   6030 N N     . GLU A 1 753 ? -41.611 45.996  60.648  1.00 62.72  ? 753  GLU A N     1 
ATOM   6031 C CA    . GLU A 1 753 ? -41.845 46.583  61.972  1.00 62.93  ? 753  GLU A CA    1 
ATOM   6032 C C     . GLU A 1 753 ? -41.867 45.572  63.134  1.00 62.65  ? 753  GLU A C     1 
ATOM   6033 O O     . GLU A 1 753 ? -41.385 45.883  64.209  1.00 62.62  ? 753  GLU A O     1 
ATOM   6034 C CB    . GLU A 1 753 ? -43.155 47.396  61.972  1.00 63.45  ? 753  GLU A CB    1 
ATOM   6035 C CG    . GLU A 1 753 ? -43.566 48.082  60.627  1.00 65.42  ? 753  GLU A CG    1 
ATOM   6036 C CD    . GLU A 1 753 ? -45.122 48.171  60.399  1.00 69.26  ? 753  GLU A CD    1 
ATOM   6037 O OE1   . GLU A 1 753 ? -45.931 47.891  61.330  1.00 68.77  ? 753  GLU A OE1   1 
ATOM   6038 O OE2   . GLU A 1 753 ? -45.543 48.517  59.264  1.00 70.49  ? 753  GLU A OE2   1 
ATOM   6039 N N     . ASP A 1 754 ? -42.417 44.374  62.918  1.00 62.62  ? 754  ASP A N     1 
ATOM   6040 C CA    . ASP A 1 754 ? -42.523 43.333  63.968  1.00 62.72  ? 754  ASP A CA    1 
ATOM   6041 C C     . ASP A 1 754 ? -41.226 42.621  64.290  1.00 62.54  ? 754  ASP A C     1 
ATOM   6042 O O     . ASP A 1 754 ? -41.095 41.986  65.342  1.00 62.36  ? 754  ASP A O     1 
ATOM   6043 C CB    . ASP A 1 754 ? -43.487 42.232  63.545  1.00 63.03  ? 754  ASP A CB    1 
ATOM   6044 C CG    . ASP A 1 754 ? -44.897 42.712  63.411  1.00 64.06  ? 754  ASP A CG    1 
ATOM   6045 O OD1   . ASP A 1 754 ? -45.712 42.361  64.293  1.00 64.62  ? 754  ASP A OD1   1 
ATOM   6046 O OD2   . ASP A 1 754 ? -45.183 43.429  62.422  1.00 65.59  ? 754  ASP A OD2   1 
ATOM   6047 N N     . LEU A 1 755 ? -40.297 42.676  63.345  1.00 62.40  ? 755  LEU A N     1 
ATOM   6048 C CA    . LEU A 1 755 ? -39.050 41.933  63.431  1.00 62.05  ? 755  LEU A CA    1 
ATOM   6049 C C     . LEU A 1 755 ? -37.955 42.820  63.991  1.00 62.21  ? 755  LEU A C     1 
ATOM   6050 O O     . LEU A 1 755 ? -36.994 42.329  64.602  1.00 62.08  ? 755  LEU A O     1 
ATOM   6051 C CB    . LEU A 1 755 ? -38.676 41.398  62.049  1.00 61.69  ? 755  LEU A CB    1 
ATOM   6052 C CG    . LEU A 1 755 ? -39.749 40.464  61.490  1.00 60.51  ? 755  LEU A CG    1 
ATOM   6053 C CD1   . LEU A 1 755 ? -39.498 40.137  60.030  1.00 59.30  ? 755  LEU A CD1   1 
ATOM   6054 C CD2   . LEU A 1 755 ? -39.835 39.211  62.348  1.00 58.60  ? 755  LEU A CD2   1 
ATOM   6055 N N     . ARG A 1 756 ? -38.142 44.126  63.785  1.00 62.21  ? 756  ARG A N     1 
ATOM   6056 C CA    . ARG A 1 756 ? -37.271 45.183  64.273  1.00 62.52  ? 756  ARG A CA    1 
ATOM   6057 C C     . ARG A 1 756 ? -37.251 45.281  65.820  1.00 62.94  ? 756  ARG A C     1 
ATOM   6058 O O     . ARG A 1 756 ? -37.822 44.432  66.520  1.00 62.99  ? 756  ARG A O     1 
ATOM   6059 C CB    . ARG A 1 756 ? -37.724 46.489  63.639  1.00 62.33  ? 756  ARG A CB    1 
ATOM   6060 C CG    . ARG A 1 756 ? -36.606 47.318  63.076  1.00 63.26  ? 756  ARG A CG    1 
ATOM   6061 C CD    . ARG A 1 756 ? -37.161 48.406  62.190  1.00 64.91  ? 756  ARG A CD    1 
ATOM   6062 N NE    . ARG A 1 756 ? -37.095 48.082  60.763  1.00 66.49  ? 756  ARG A NE    1 
ATOM   6063 C CZ    . ARG A 1 756 ? -37.882 48.615  59.824  1.00 67.04  ? 756  ARG A CZ    1 
ATOM   6064 N NH1   . ARG A 1 756 ? -37.732 48.263  58.557  1.00 67.03  ? 756  ARG A NH1   1 
ATOM   6065 N NH2   . ARG A 1 756 ? -38.835 49.487  60.141  1.00 67.50  ? 756  ARG A NH2   1 
ATOM   6066 N N     . TYR A 1 757 ? -36.587 46.300  66.365  1.00 63.52  ? 757  TYR A N     1 
ATOM   6067 C CA    . TYR A 1 757 ? -36.438 46.393  67.830  1.00 64.01  ? 757  TYR A CA    1 
ATOM   6068 C C     . TYR A 1 757 ? -36.599 47.792  68.435  1.00 63.84  ? 757  TYR A C     1 
ATOM   6069 O O     . TYR A 1 757 ? -35.945 48.741  68.017  1.00 63.78  ? 757  TYR A O     1 
ATOM   6070 C CB    . TYR A 1 757 ? -35.114 45.762  68.249  1.00 64.31  ? 757  TYR A CB    1 
ATOM   6071 C CG    . TYR A 1 757 ? -34.763 45.920  69.704  1.00 65.02  ? 757  TYR A CG    1 
ATOM   6072 C CD1   . TYR A 1 757 ? -35.319 45.079  70.676  1.00 65.34  ? 757  TYR A CD1   1 
ATOM   6073 C CD2   . TYR A 1 757 ? -33.849 46.895  70.110  1.00 65.57  ? 757  TYR A CD2   1 
ATOM   6074 C CE1   . TYR A 1 757 ? -34.981 45.215  72.013  1.00 64.85  ? 757  TYR A CE1   1 
ATOM   6075 C CE2   . TYR A 1 757 ? -33.502 47.042  71.445  1.00 65.64  ? 757  TYR A CE2   1 
ATOM   6076 C CZ    . TYR A 1 757 ? -34.069 46.200  72.393  1.00 65.78  ? 757  TYR A CZ    1 
ATOM   6077 O OH    . TYR A 1 757 ? -33.709 46.353  73.717  1.00 65.86  ? 757  TYR A OH    1 
ATOM   6078 P P     . DA  B 2 1   ? -8.687  23.700  14.423  1.00 119.82 ? 0    DA  B P     1 
ATOM   6079 O OP1   . DA  B 2 1   ? -9.572  24.740  15.018  1.00 119.84 ? 0    DA  B OP1   1 
ATOM   6080 O OP2   . DA  B 2 1   ? -8.966  23.133  13.076  1.00 119.57 ? 0    DA  B OP2   1 
ATOM   6081 O "O5'" . DA  B 2 1   ? -8.460  22.521  15.496  1.00 117.54 ? 0    DA  B "O5'" 1 
ATOM   6082 C "C5'" . DA  B 2 1   ? -7.970  21.251  15.088  1.00 115.14 ? 0    DA  B "C5'" 1 
ATOM   6083 C "C4'" . DA  B 2 1   ? -9.133  20.362  14.685  1.00 113.46 ? 0    DA  B "C4'" 1 
ATOM   6084 O "O4'" . DA  B 2 1   ? -8.609  19.076  14.267  1.00 113.46 ? 0    DA  B "O4'" 1 
ATOM   6085 C "C3'" . DA  B 2 1   ? -10.150 20.067  15.790  1.00 112.08 ? 0    DA  B "C3'" 1 
ATOM   6086 O "O3'" . DA  B 2 1   ? -11.265 20.985  15.787  1.00 109.22 ? 0    DA  B "O3'" 1 
ATOM   6087 C "C2'" . DA  B 2 1   ? -10.578 18.635  15.470  1.00 112.56 ? 0    DA  B "C2'" 1 
ATOM   6088 C "C1'" . DA  B 2 1   ? -9.230  18.063  15.039  1.00 113.10 ? 0    DA  B "C1'" 1 
ATOM   6089 P P     . DA  B 2 2   ? -11.892 21.495  17.184  1.00 106.94 ? 1    DA  B P     1 
ATOM   6090 O OP1   . DA  B 2 2   ? -11.460 22.906  17.358  1.00 107.48 ? 1    DA  B OP1   1 
ATOM   6091 O OP2   . DA  B 2 2   ? -11.541 20.495  18.225  1.00 107.25 ? 1    DA  B OP2   1 
ATOM   6092 O "O5'" . DA  B 2 2   ? -13.498 21.453  17.034  1.00 102.27 ? 1    DA  B "O5'" 1 
ATOM   6093 C "C5'" . DA  B 2 2   ? -14.192 21.215  15.802  1.00 93.91  ? 1    DA  B "C5'" 1 
ATOM   6094 C "C4'" . DA  B 2 2   ? -14.478 22.518  15.062  1.00 86.98  ? 1    DA  B "C4'" 1 
ATOM   6095 O "O4'" . DA  B 2 2   ? -14.497 23.635  15.986  1.00 86.55  ? 1    DA  B "O4'" 1 
ATOM   6096 C "C3'" . DA  B 2 2   ? -13.472 22.862  13.962  1.00 81.09  ? 1    DA  B "C3'" 1 
ATOM   6097 O "O3'" . DA  B 2 2   ? -14.140 23.214  12.773  1.00 70.77  ? 1    DA  B "O3'" 1 
ATOM   6098 C "C2'" . DA  B 2 2   ? -12.723 24.057  14.509  1.00 83.39  ? 1    DA  B "C2'" 1 
ATOM   6099 C "C1'" . DA  B 2 2   ? -13.781 24.697  15.398  1.00 86.73  ? 1    DA  B "C1'" 1 
ATOM   6100 N N9    . DA  B 2 2   ? -13.223 25.542  16.453  1.00 88.69  ? 1    DA  B N9    1 
ATOM   6101 C C8    . DA  B 2 2   ? -13.555 25.540  17.793  1.00 88.97  ? 1    DA  B C8    1 
ATOM   6102 N N7    . DA  B 2 2   ? -12.887 26.431  18.495  1.00 89.67  ? 1    DA  B N7    1 
ATOM   6103 C C5    . DA  B 2 2   ? -12.062 27.062  17.550  1.00 90.05  ? 1    DA  B C5    1 
ATOM   6104 C C6    . DA  B 2 2   ? -11.098 28.108  17.628  1.00 89.78  ? 1    DA  B C6    1 
ATOM   6105 N N6    . DA  B 2 2   ? -10.787 28.730  18.776  1.00 88.62  ? 1    DA  B N6    1 
ATOM   6106 N N1    . DA  B 2 2   ? -10.463 28.492  16.479  1.00 89.63  ? 1    DA  B N1    1 
ATOM   6107 C C2    . DA  B 2 2   ? -10.755 27.886  15.318  1.00 88.56  ? 1    DA  B C2    1 
ATOM   6108 N N3    . DA  B 2 2   ? -11.636 26.904  15.126  1.00 88.75  ? 1    DA  B N3    1 
ATOM   6109 C C4    . DA  B 2 2   ? -12.258 26.528  16.279  1.00 89.53  ? 1    DA  B C4    1 
ATOM   6110 P P     . DU  B 2 3   ? -13.850 22.342  11.477  1.00 63.40  ? 2    DU  B P     1 
ATOM   6111 O OP1   . DU  B 2 3   ? -14.440 20.998  11.514  1.00 63.09  ? 2    DU  B OP1   1 
ATOM   6112 O OP2   . DU  B 2 3   ? -12.423 22.484  11.185  1.00 65.20  ? 2    DU  B OP2   1 
ATOM   6113 O "O5'" . DU  B 2 3   ? -14.626 23.160  10.392  1.00 61.44  ? 2    DU  B "O5'" 1 
ATOM   6114 C "C5'" . DU  B 2 3   ? -14.465 24.556  10.387  1.00 57.94  ? 2    DU  B "C5'" 1 
ATOM   6115 C "C4'" . DU  B 2 3   ? -15.725 25.177  9.825   1.00 54.88  ? 2    DU  B "C4'" 1 
ATOM   6116 O "O4'" . DU  B 2 3   ? -16.216 24.425  8.684   1.00 51.84  ? 2    DU  B "O4'" 1 
ATOM   6117 C "C3'" . DU  B 2 3   ? -16.856 25.188  10.815  1.00 54.16  ? 2    DU  B "C3'" 1 
ATOM   6118 O "O3'" . DU  B 2 3   ? -17.413 26.443  10.697  1.00 59.43  ? 2    DU  B "O3'" 1 
ATOM   6119 C "C2'" . DU  B 2 3   ? -17.773 24.062  10.358  1.00 51.23  ? 2    DU  B "C2'" 1 
ATOM   6120 C "C1'" . DU  B 2 3   ? -17.575 24.127  8.854   1.00 47.46  ? 2    DU  B "C1'" 1 
ATOM   6121 N N1    . DU  B 2 3   ? -17.830 22.870  8.122   1.00 44.84  ? 2    DU  B N1    1 
ATOM   6122 C C2    . DU  B 2 3   ? -19.124 22.615  7.646   1.00 43.44  ? 2    DU  B C2    1 
ATOM   6123 O O2    . DU  B 2 3   ? -20.005 23.462  7.878   1.00 43.59  ? 2    DU  B O2    1 
ATOM   6124 N N3    . DU  B 2 3   ? -19.359 21.464  6.951   1.00 41.49  ? 2    DU  B N3    1 
ATOM   6125 C C4    . DU  B 2 3   ? -18.358 20.603  6.742   1.00 41.43  ? 2    DU  B C4    1 
ATOM   6126 O O4    . DU  B 2 3   ? -18.605 19.480  6.077   1.00 41.47  ? 2    DU  B O4    1 
ATOM   6127 C C5    . DU  B 2 3   ? -17.033 20.853  7.218   1.00 42.96  ? 2    DU  B C5    1 
ATOM   6128 C C6    . DU  B 2 3   ? -16.811 21.991  7.896   1.00 43.13  ? 2    DU  B C6    1 
ATOM   6129 P P     . DG  B 2 4   ? -17.319 27.317  12.003  1.00 64.70  ? 3    DG  B P     1 
ATOM   6130 O OP1   . DG  B 2 4   ? -18.279 28.436  11.932  1.00 64.94  ? 3    DG  B OP1   1 
ATOM   6131 O OP2   . DG  B 2 4   ? -15.875 27.540  12.176  1.00 66.01  ? 3    DG  B OP2   1 
ATOM   6132 O "O5'" . DG  B 2 4   ? -17.791 26.311  13.150  1.00 72.72  ? 3    DG  B "O5'" 1 
ATOM   6133 C "C5'" . DG  B 2 4   ? -18.425 26.791  14.314  1.00 84.45  ? 3    DG  B "C5'" 1 
ATOM   6134 C "C4'" . DG  B 2 4   ? -17.480 26.877  15.500  1.00 93.87  ? 3    DG  B "C4'" 1 
ATOM   6135 O "O4'" . DG  B 2 4   ? -16.201 27.485  15.148  1.00 97.38  ? 3    DG  B "O4'" 1 
ATOM   6136 C "C3'" . DG  B 2 4   ? -17.976 27.799  16.600  1.00 98.77  ? 3    DG  B "C3'" 1 
ATOM   6137 O "O3'" . DG  B 2 4   ? -18.976 27.195  17.428  1.00 103.45 ? 3    DG  B "O3'" 1 
ATOM   6138 C "C2'" . DG  B 2 4   ? -16.685 28.022  17.391  1.00 100.29 ? 3    DG  B "C2'" 1 
ATOM   6139 C "C1'" . DG  B 2 4   ? -15.577 27.963  16.336  1.00 100.90 ? 3    DG  B "C1'" 1 
ATOM   6140 N N9    . DG  B 2 4   ? -14.882 29.251  16.161  1.00 102.73 ? 3    DG  B N9    1 
ATOM   6141 C C8    . DG  B 2 4   ? -14.801 30.010  15.013  1.00 103.87 ? 3    DG  B C8    1 
ATOM   6142 N N7    . DG  B 2 4   ? -14.120 31.117  15.158  1.00 104.88 ? 3    DG  B N7    1 
ATOM   6143 C C5    . DG  B 2 4   ? -13.709 31.111  16.494  1.00 105.19 ? 3    DG  B C5    1 
ATOM   6144 C C6    . DG  B 2 4   ? -12.932 32.066  17.243  1.00 105.58 ? 3    DG  B C6    1 
ATOM   6145 O O6    . DG  B 2 4   ? -12.432 33.148  16.862  1.00 104.10 ? 3    DG  B O6    1 
ATOM   6146 N N1    . DG  B 2 4   ? -12.750 31.663  18.579  1.00 105.61 ? 3    DG  B N1    1 
ATOM   6147 C C2    . DG  B 2 4   ? -13.256 30.492  19.120  1.00 105.15 ? 3    DG  B C2    1 
ATOM   6148 N N2    . DG  B 2 4   ? -12.978 30.271  20.412  1.00 104.48 ? 3    DG  B N2    1 
ATOM   6149 N N3    . DG  B 2 4   ? -13.979 29.599  18.435  1.00 104.61 ? 3    DG  B N3    1 
ATOM   6150 C C4    . DG  B 2 4   ? -14.174 29.962  17.128  1.00 104.38 ? 3    DG  B C4    1 
ATOM   6151 P P     . DG  B 2 5   ? -20.469 26.875  16.947  1.00 107.24 ? 4    DG  B P     1 
ATOM   6152 O OP1   . DG  B 2 5   ? -20.444 25.412  16.707  1.00 106.79 ? 4    DG  B OP1   1 
ATOM   6153 O OP2   . DG  B 2 5   ? -20.869 27.821  15.875  1.00 107.08 ? 4    DG  B OP2   1 
ATOM   6154 O "O5'" . DG  B 2 5   ? -21.401 27.213  18.218  1.00 110.10 ? 4    DG  B "O5'" 1 
ATOM   6155 C "C5'" . DG  B 2 5   ? -21.750 28.557  18.566  1.00 114.58 ? 4    DG  B "C5'" 1 
ATOM   6156 C "C4'" . DG  B 2 5   ? -20.630 29.122  19.417  1.00 118.49 ? 4    DG  B "C4'" 1 
ATOM   6157 O "O4'" . DG  B 2 5   ? -19.783 29.978  18.618  1.00 120.16 ? 4    DG  B "O4'" 1 
ATOM   6158 C "C3'" . DG  B 2 5   ? -20.982 30.019  20.598  1.00 120.34 ? 4    DG  B "C3'" 1 
ATOM   6159 O "O3'" . DG  B 2 5   ? -21.348 29.239  21.758  1.00 121.78 ? 4    DG  B "O3'" 1 
ATOM   6160 C "C2'" . DG  B 2 5   ? -19.673 30.806  20.797  1.00 121.09 ? 4    DG  B "C2'" 1 
ATOM   6161 C "C1'" . DG  B 2 5   ? -18.836 30.445  19.558  1.00 121.87 ? 4    DG  B "C1'" 1 
ATOM   6162 N N9    . DG  B 2 5   ? -17.958 31.461  18.945  1.00 122.86 ? 4    DG  B N9    1 
ATOM   6163 C C8    . DG  B 2 5   ? -17.296 31.312  17.745  1.00 123.10 ? 4    DG  B C8    1 
ATOM   6164 N N7    . DG  B 2 5   ? -16.563 32.330  17.398  1.00 123.37 ? 4    DG  B N7    1 
ATOM   6165 C C5    . DG  B 2 5   ? -16.735 33.226  18.440  1.00 123.76 ? 4    DG  B C5    1 
ATOM   6166 C C6    . DG  B 2 5   ? -16.178 34.518  18.612  1.00 124.00 ? 4    DG  B C6    1 
ATOM   6167 O O6    . DG  B 2 5   ? -15.402 35.114  17.842  1.00 123.23 ? 4    DG  B O6    1 
ATOM   6168 N N1    . DG  B 2 5   ? -16.608 35.111  19.813  1.00 124.21 ? 4    DG  B N1    1 
ATOM   6169 C C2    . DG  B 2 5   ? -17.469 34.522  20.727  1.00 123.88 ? 4    DG  B C2    1 
ATOM   6170 N N2    . DG  B 2 5   ? -17.784 35.225  21.827  1.00 123.21 ? 4    DG  B N2    1 
ATOM   6171 N N3    . DG  B 2 5   ? -17.991 33.310  20.567  1.00 123.88 ? 4    DG  B N3    1 
ATOM   6172 C C4    . DG  B 2 5   ? -17.588 32.714  19.407  1.00 123.65 ? 4    DG  B C4    1 
ATOM   6173 P P     . DA  B 2 6   ? -22.560 29.663  22.739  1.00 122.41 ? 5    DA  B P     1 
ATOM   6174 O OP1   . DA  B 2 6   ? -22.463 28.858  23.986  1.00 121.56 ? 5    DA  B OP1   1 
ATOM   6175 O OP2   . DA  B 2 6   ? -23.812 29.625  21.947  1.00 122.32 ? 5    DA  B OP2   1 
ATOM   6176 O "O5'" . DA  B 2 6   ? -22.270 31.214  23.042  1.00 122.16 ? 5    DA  B "O5'" 1 
ATOM   6177 C "C5'" . DA  B 2 6   ? -21.322 31.660  24.015  1.00 121.94 ? 5    DA  B "C5'" 1 
ATOM   6178 C "C4'" . DA  B 2 6   ? -21.355 33.175  24.098  1.00 121.70 ? 5    DA  B "C4'" 1 
ATOM   6179 O "O4'" . DA  B 2 6   ? -20.923 33.766  22.841  1.00 121.78 ? 5    DA  B "O4'" 1 
ATOM   6180 C "C3'" . DA  B 2 6   ? -22.736 33.774  24.330  1.00 121.63 ? 5    DA  B "C3'" 1 
ATOM   6181 O "O3'" . DA  B 2 6   ? -23.144 33.570  25.710  1.00 121.21 ? 5    DA  B "O3'" 1 
ATOM   6182 C "C2'" . DA  B 2 6   ? -22.450 35.214  23.898  1.00 121.63 ? 5    DA  B "C2'" 1 
ATOM   6183 C "C1'" . DA  B 2 6   ? -21.636 34.972  22.626  1.00 121.50 ? 5    DA  B "C1'" 1 
ATOM   6184 P P     . DG  B 2 7   ? -24.457 34.199  26.409  1.00 121.30 ? 6    DG  B P     1 
ATOM   6185 O OP1   . DG  B 2 7   ? -25.036 35.250  25.536  1.00 120.92 ? 6    DG  B OP1   1 
ATOM   6186 O OP2   . DG  B 2 7   ? -24.027 34.568  27.774  1.00 121.57 ? 6    DG  B OP2   1 
ATOM   6187 O "O5'" . DG  B 2 7   ? -25.526 32.996  26.541  1.00 121.58 ? 6    DG  B "O5'" 1 
ATOM   6188 C "C5'" . DG  B 2 7   ? -25.544 32.050  27.635  1.00 120.72 ? 6    DG  B "C5'" 1 
ATOM   6189 C "C4'" . DG  B 2 7   ? -26.588 32.290  28.736  1.00 120.31 ? 6    DG  B "C4'" 1 
ATOM   6190 O "O4'" . DG  B 2 7   ? -25.889 32.350  30.011  1.00 120.48 ? 6    DG  B "O4'" 1 
ATOM   6191 C "C3'" . DG  B 2 7   ? -27.482 33.542  28.719  1.00 119.93 ? 6    DG  B "C3'" 1 
ATOM   6192 O "O3'" . DG  B 2 7   ? -28.809 33.219  29.223  1.00 118.92 ? 6    DG  B "O3'" 1 
ATOM   6193 C "C2'" . DG  B 2 7   ? -26.727 34.509  29.633  1.00 120.09 ? 6    DG  B "C2'" 1 
ATOM   6194 C "C1'" . DG  B 2 7   ? -26.200 33.555  30.699  1.00 120.35 ? 6    DG  B "C1'" 1 
ATOM   6195 N N9    . DG  B 2 7   ? -24.998 34.021  31.396  1.00 120.23 ? 6    DG  B N9    1 
ATOM   6196 C C8    . DG  B 2 7   ? -24.113 34.983  30.961  1.00 119.86 ? 6    DG  B C8    1 
ATOM   6197 N N7    . DG  B 2 7   ? -23.123 35.193  31.779  1.00 119.97 ? 6    DG  B N7    1 
ATOM   6198 C C5    . DG  B 2 7   ? -23.360 34.313  32.832  1.00 120.32 ? 6    DG  B C5    1 
ATOM   6199 C C6    . DG  B 2 7   ? -22.616 34.089  34.023  1.00 120.35 ? 6    DG  B C6    1 
ATOM   6200 O O6    . DG  B 2 7   ? -21.570 34.646  34.382  1.00 120.47 ? 6    DG  B O6    1 
ATOM   6201 N N1    . DG  B 2 7   ? -23.189 33.111  34.840  1.00 120.02 ? 6    DG  B N1    1 
ATOM   6202 C C2    . DG  B 2 7   ? -24.345 32.430  34.539  1.00 119.77 ? 6    DG  B C2    1 
ATOM   6203 N N2    . DG  B 2 7   ? -24.737 31.529  35.449  1.00 119.66 ? 6    DG  B N2    1 
ATOM   6204 N N3    . DG  B 2 7   ? -25.056 32.627  33.427  1.00 119.79 ? 6    DG  B N3    1 
ATOM   6205 C C4    . DG  B 2 7   ? -24.512 33.580  32.615  1.00 120.17 ? 6    DG  B C4    1 
ATOM   6206 P P     . DA  B 2 8   ? -29.860 34.263  29.872  1.00 117.75 ? 7    DA  B P     1 
ATOM   6207 O OP1   . DA  B 2 8   ? -31.218 33.772  29.540  1.00 117.63 ? 7    DA  B OP1   1 
ATOM   6208 O OP2   . DA  B 2 8   ? -29.473 35.652  29.529  1.00 117.60 ? 7    DA  B OP2   1 
ATOM   6209 O "O5'" . DA  B 2 8   ? -29.636 34.099  31.442  1.00 116.56 ? 7    DA  B "O5'" 1 
ATOM   6210 C "C5'" . DA  B 2 8   ? -30.369 33.135  32.178  1.00 115.25 ? 7    DA  B "C5'" 1 
ATOM   6211 C "C4'" . DA  B 2 8   ? -30.297 33.480  33.651  1.00 114.48 ? 7    DA  B "C4'" 1 
ATOM   6212 O "O4'" . DA  B 2 8   ? -28.928 33.779  34.035  1.00 114.23 ? 7    DA  B "O4'" 1 
ATOM   6213 C "C3'" . DA  B 2 8   ? -31.122 34.688  34.083  1.00 114.16 ? 7    DA  B "C3'" 1 
ATOM   6214 O "O3'" . DA  B 2 8   ? -31.806 34.295  35.281  1.00 113.58 ? 7    DA  B "O3'" 1 
ATOM   6215 C "C2'" . DA  B 2 8   ? -30.077 35.791  34.292  1.00 113.72 ? 7    DA  B "C2'" 1 
ATOM   6216 C "C1'" . DA  B 2 8   ? -28.904 34.962  34.810  1.00 113.27 ? 7    DA  B "C1'" 1 
ATOM   6217 N N9    . DA  B 2 8   ? -27.576 35.571  34.692  1.00 112.96 ? 7    DA  B N9    1 
ATOM   6218 C C8    . DA  B 2 8   ? -27.047 36.239  33.614  1.00 112.61 ? 7    DA  B C8    1 
ATOM   6219 N N7    . DA  B 2 8   ? -25.819 36.670  33.799  1.00 112.16 ? 7    DA  B N7    1 
ATOM   6220 C C5    . DA  B 2 8   ? -25.517 36.252  35.088  1.00 112.30 ? 7    DA  B C5    1 
ATOM   6221 C C6    . DA  B 2 8   ? -24.364 36.394  35.895  1.00 111.82 ? 7    DA  B C6    1 
ATOM   6222 N N6    . DA  B 2 8   ? -23.262 37.027  35.481  1.00 111.96 ? 7    DA  B N6    1 
ATOM   6223 N N1    . DA  B 2 8   ? -24.386 35.862  37.142  1.00 111.52 ? 7    DA  B N1    1 
ATOM   6224 C C2    . DA  B 2 8   ? -25.492 35.227  37.560  1.00 111.50 ? 7    DA  B C2    1 
ATOM   6225 N N3    . DA  B 2 8   ? -26.635 35.030  36.896  1.00 112.17 ? 7    DA  B N3    1 
ATOM   6226 C C4    . DA  B 2 8   ? -26.586 35.570  35.656  1.00 112.60 ? 7    DA  B C4    1 
ATOM   6227 P P     . DC  B 2 9   ? -32.837 35.230  36.073  1.00 112.75 ? 8    DC  B P     1 
ATOM   6228 O OP1   . DC  B 2 9   ? -33.728 34.348  36.862  1.00 112.54 ? 8    DC  B OP1   1 
ATOM   6229 O OP2   . DC  B 2 9   ? -33.403 36.235  35.139  1.00 112.52 ? 8    DC  B OP2   1 
ATOM   6230 O "O5'" . DC  B 2 9   ? -31.872 35.992  37.094  1.00 112.34 ? 8    DC  B "O5'" 1 
ATOM   6231 C "C5'" . DC  B 2 9   ? -31.062 35.287  38.048  1.00 110.84 ? 8    DC  B "C5'" 1 
ATOM   6232 C "C4'" . DC  B 2 9   ? -30.422 36.273  39.017  1.00 109.43 ? 8    DC  B "C4'" 1 
ATOM   6233 O "O4'" . DC  B 2 9   ? -29.128 36.712  38.520  1.00 109.21 ? 8    DC  B "O4'" 1 
ATOM   6234 C "C3'" . DC  B 2 9   ? -31.244 37.539  39.261  1.00 108.57 ? 8    DC  B "C3'" 1 
ATOM   6235 O "O3'" . DC  B 2 9   ? -31.288 37.810  40.654  1.00 107.43 ? 8    DC  B "O3'" 1 
ATOM   6236 C "C2'" . DC  B 2 9   ? -30.508 38.631  38.485  1.00 108.47 ? 8    DC  B "C2'" 1 
ATOM   6237 C "C1'" . DC  B 2 9   ? -29.063 38.130  38.531  1.00 108.54 ? 8    DC  B "C1'" 1 
ATOM   6238 N N1    . DC  B 2 9   ? -28.182 38.619  37.403  1.00 107.97 ? 8    DC  B N1    1 
ATOM   6239 C C2    . DC  B 2 9   ? -26.785 38.697  37.577  1.00 107.37 ? 8    DC  B C2    1 
ATOM   6240 O O2    . DC  B 2 9   ? -26.265 38.365  38.652  1.00 106.46 ? 8    DC  B O2    1 
ATOM   6241 N N3    . DC  B 2 9   ? -26.023 39.144  36.542  1.00 107.51 ? 8    DC  B N3    1 
ATOM   6242 C C4    . DC  B 2 9   ? -26.590 39.499  35.382  1.00 107.68 ? 8    DC  B C4    1 
ATOM   6243 N N4    . DC  B 2 9   ? -25.788 39.928  34.401  1.00 107.81 ? 8    DC  B N4    1 
ATOM   6244 C C5    . DC  B 2 9   ? -28.004 39.428  35.184  1.00 107.85 ? 8    DC  B C5    1 
ATOM   6245 C C6    . DC  B 2 9   ? -28.750 38.988  36.208  1.00 107.84 ? 8    DC  B C6    1 
ATOM   6246 P P     . DA  B 2 10  ? -32.596 38.449  41.317  1.00 105.66 ? 9    DA  B P     1 
ATOM   6247 O OP1   . DA  B 2 10  ? -33.628 37.392  41.386  1.00 105.83 ? 9    DA  B OP1   1 
ATOM   6248 O OP2   . DA  B 2 10  ? -32.874 39.733  40.621  1.00 104.98 ? 9    DA  B OP2   1 
ATOM   6249 O "O5'" . DA  B 2 10  ? -32.098 38.711  42.816  1.00 104.58 ? 9    DA  B "O5'" 1 
ATOM   6250 C "C5'" . DA  B 2 10  ? -31.968 40.030  43.315  1.00 103.06 ? 9    DA  B "C5'" 1 
ATOM   6251 C "C4'" . DA  B 2 10  ? -30.522 40.491  43.457  1.00 101.61 ? 9    DA  B "C4'" 1 
ATOM   6252 O "O4'" . DA  B 2 10  ? -29.733 40.358  42.234  1.00 101.07 ? 9    DA  B "O4'" 1 
ATOM   6253 C "C3'" . DA  B 2 10  ? -30.445 41.965  43.833  1.00 100.80 ? 9    DA  B "C3'" 1 
ATOM   6254 O "O3'" . DA  B 2 10  ? -29.497 42.126  44.864  1.00 99.94  ? 9    DA  B "O3'" 1 
ATOM   6255 C "C2'" . DA  B 2 10  ? -29.985 42.636  42.545  1.00 100.43 ? 9    DA  B "C2'" 1 
ATOM   6256 C "C1'" . DA  B 2 10  ? -29.033 41.570  42.023  1.00 100.17 ? 9    DA  B "C1'" 1 
ATOM   6257 N N9    . DA  B 2 10  ? -28.681 41.762  40.619  1.00 99.74  ? 9    DA  B N9    1 
ATOM   6258 C C8    . DA  B 2 10  ? -29.530 41.833  39.549  1.00 99.84  ? 9    DA  B C8    1 
ATOM   6259 N N7    . DA  B 2 10  ? -28.934 42.024  38.396  1.00 99.53  ? 9    DA  B N7    1 
ATOM   6260 C C5    . DA  B 2 10  ? -27.594 42.092  38.732  1.00 99.66  ? 9    DA  B C5    1 
ATOM   6261 C C6    . DA  B 2 10  ? -26.427 42.284  37.960  1.00 99.65  ? 9    DA  B C6    1 
ATOM   6262 N N6    . DA  B 2 10  ? -26.441 42.450  36.635  1.00 99.89  ? 9    DA  B N6    1 
ATOM   6263 N N1    . DA  B 2 10  ? -25.238 42.298  38.602  1.00 99.47  ? 9    DA  B N1    1 
ATOM   6264 C C2    . DA  B 2 10  ? -25.224 42.132  39.933  1.00 99.35  ? 9    DA  B C2    1 
ATOM   6265 N N3    . DA  B 2 10  ? -26.252 41.947  40.764  1.00 99.39  ? 9    DA  B N3    1 
ATOM   6266 C C4    . DA  B 2 10  ? -27.420 41.936  40.098  1.00 99.62  ? 9    DA  B C4    1 
ATOM   6267 P P     . DC  B 2 11  ? -29.954 42.043  46.387  1.00 98.36  ? 10   DC  B P     1 
ATOM   6268 O OP1   . DC  B 2 11  ? -29.997 40.600  46.743  1.00 97.72  ? 10   DC  B OP1   1 
ATOM   6269 O OP2   . DC  B 2 11  ? -31.132 42.940  46.515  1.00 98.36  ? 10   DC  B OP2   1 
ATOM   6270 O "O5'" . DC  B 2 11  ? -28.739 42.738  47.179  1.00 97.95  ? 10   DC  B "O5'" 1 
ATOM   6271 C "C5'" . DC  B 2 11  ? -28.387 44.101  46.925  1.00 96.14  ? 10   DC  B "C5'" 1 
ATOM   6272 C "C4'" . DC  B 2 11  ? -26.956 44.228  46.426  1.00 94.84  ? 10   DC  B "C4'" 1 
ATOM   6273 O "O4'" . DC  B 2 11  ? -26.802 43.722  45.071  1.00 94.83  ? 10   DC  B "O4'" 1 
ATOM   6274 C "C3'" . DC  B 2 11  ? -26.480 45.667  46.379  1.00 93.44  ? 10   DC  B "C3'" 1 
ATOM   6275 O "O3'" . DC  B 2 11  ? -25.890 45.951  47.635  1.00 90.58  ? 10   DC  B "O3'" 1 
ATOM   6276 C "C2'" . DC  B 2 11  ? -25.463 45.688  45.240  1.00 94.22  ? 10   DC  B "C2'" 1 
ATOM   6277 C "C1'" . DC  B 2 11  ? -25.901 44.535  44.340  1.00 95.11  ? 10   DC  B "C1'" 1 
ATOM   6278 N N1    . DC  B 2 11  ? -26.527 44.969  43.036  1.00 96.19  ? 10   DC  B N1    1 
ATOM   6279 C C2    . DC  B 2 11  ? -25.705 45.192  41.917  1.00 96.56  ? 10   DC  B C2    1 
ATOM   6280 O O2    . DC  B 2 11  ? -24.484 45.028  42.027  1.00 96.43  ? 10   DC  B O2    1 
ATOM   6281 N N3    . DC  B 2 11  ? -26.274 45.582  40.737  1.00 96.91  ? 10   DC  B N3    1 
ATOM   6282 C C4    . DC  B 2 11  ? -27.603 45.746  40.645  1.00 96.64  ? 10   DC  B C4    1 
ATOM   6283 N N4    . DC  B 2 11  ? -28.108 46.132  39.469  1.00 95.59  ? 10   DC  B N4    1 
ATOM   6284 C C5    . DC  B 2 11  ? -28.463 45.534  41.771  1.00 96.63  ? 10   DC  B C5    1 
ATOM   6285 C C6    . DC  B 2 11  ? -27.887 45.152  42.926  1.00 96.72  ? 10   DC  B C6    1 
ATOM   6286 P P     . DG  B 2 12  ? -26.278 47.276  48.432  1.00 87.50  ? 11   DG  B P     1 
ATOM   6287 O OP1   . DG  B 2 12  ? -26.104 46.983  49.874  1.00 86.68  ? 11   DG  B OP1   1 
ATOM   6288 O OP2   . DG  B 2 12  ? -27.567 47.775  47.911  1.00 88.01  ? 11   DG  B OP2   1 
ATOM   6289 O "O5'" . DG  B 2 12  ? -25.169 48.307  47.927  1.00 87.22  ? 11   DG  B "O5'" 1 
ATOM   6290 C "C5'" . DG  B 2 12  ? -23.787 47.997  48.032  1.00 87.20  ? 11   DG  B "C5'" 1 
ATOM   6291 C "C4'" . DG  B 2 12  ? -22.957 48.962  47.205  1.00 87.42  ? 11   DG  B "C4'" 1 
ATOM   6292 O "O4'" . DG  B 2 12  ? -23.219 48.787  45.789  1.00 87.19  ? 11   DG  B "O4'" 1 
ATOM   6293 C "C3'" . DG  B 2 12  ? -23.169 50.445  47.503  1.00 87.95  ? 11   DG  B "C3'" 1 
ATOM   6294 O "O3'" . DG  B 2 12  ? -21.889 51.066  47.554  1.00 88.34  ? 11   DG  B "O3'" 1 
ATOM   6295 C "C2'" . DG  B 2 12  ? -24.025 50.951  46.339  1.00 87.77  ? 11   DG  B "C2'" 1 
ATOM   6296 C "C1'" . DG  B 2 12  ? -23.707 49.984  45.205  1.00 87.63  ? 11   DG  B "C1'" 1 
ATOM   6297 N N9    . DG  B 2 12  ? -24.856 49.607  44.383  1.00 87.46  ? 11   DG  B N9    1 
ATOM   6298 C C8    . DG  B 2 12  ? -26.104 49.222  44.812  1.00 87.85  ? 11   DG  B C8    1 
ATOM   6299 N N7    . DG  B 2 12  ? -26.923 48.915  43.844  1.00 87.75  ? 11   DG  B N7    1 
ATOM   6300 C C5    . DG  B 2 12  ? -26.169 49.102  42.697  1.00 87.65  ? 11   DG  B C5    1 
ATOM   6301 C C6    . DG  B 2 12  ? -26.517 48.924  41.332  1.00 88.00  ? 11   DG  B C6    1 
ATOM   6302 O O6    . DG  B 2 12  ? -27.601 48.568  40.853  1.00 88.90  ? 11   DG  B O6    1 
ATOM   6303 N N1    . DG  B 2 12  ? -25.464 49.218  40.472  1.00 87.48  ? 11   DG  B N1    1 
ATOM   6304 C C2    . DG  B 2 12  ? -24.222 49.635  40.892  1.00 87.72  ? 11   DG  B C2    1 
ATOM   6305 N N2    . DG  B 2 12  ? -23.325 49.875  39.926  1.00 88.06  ? 11   DG  B N2    1 
ATOM   6306 N N3    . DG  B 2 12  ? -23.877 49.805  42.166  1.00 87.38  ? 11   DG  B N3    1 
ATOM   6307 C C4    . DG  B 2 12  ? -24.896 49.521  43.013  1.00 87.37  ? 11   DG  B C4    1 
ATOM   6308 P P     . DG  B 2 13  ? -21.640 52.570  48.017  1.00 88.46  ? 12   DG  B P     1 
ATOM   6309 O OP1   . DG  B 2 13  ? -20.224 52.632  48.428  1.00 89.78  ? 12   DG  B OP1   1 
ATOM   6310 O OP2   . DG  B 2 13  ? -22.671 52.944  49.005  1.00 88.98  ? 12   DG  B OP2   1 
ATOM   6311 O "O5'" . DG  B 2 13  ? -21.820 53.405  46.662  1.00 89.95  ? 12   DG  B "O5'" 1 
ATOM   6312 C "C5'" . DG  B 2 13  ? -20.911 53.153  45.595  1.00 93.43  ? 12   DG  B "C5'" 1 
ATOM   6313 C "C4'" . DG  B 2 13  ? -21.295 53.805  44.278  1.00 96.57  ? 12   DG  B "C4'" 1 
ATOM   6314 O "O4'" . DG  B 2 13  ? -22.308 53.021  43.585  1.00 97.32  ? 12   DG  B "O4'" 1 
ATOM   6315 C "C3'" . DG  B 2 13  ? -21.813 55.239  44.387  1.00 98.86  ? 12   DG  B "C3'" 1 
ATOM   6316 O "O3'" . DG  B 2 13  ? -20.980 56.100  43.591  1.00 101.90 ? 12   DG  B "O3'" 1 
ATOM   6317 C "C2'" . DG  B 2 13  ? -23.243 55.149  43.852  1.00 98.69  ? 12   DG  B "C2'" 1 
ATOM   6318 C "C1'" . DG  B 2 13  ? -23.212 53.911  42.953  1.00 98.03  ? 12   DG  B "C1'" 1 
ATOM   6319 N N9    . DG  B 2 13  ? -24.536 53.294  42.751  1.00 97.94  ? 12   DG  B N9    1 
ATOM   6320 C C8    . DG  B 2 13  ? -25.432 52.913  43.730  1.00 97.71  ? 12   DG  B C8    1 
ATOM   6321 N N7    . DG  B 2 13  ? -26.539 52.397  43.271  1.00 97.55  ? 12   DG  B N7    1 
ATOM   6322 C C5    . DG  B 2 13  ? -26.385 52.439  41.888  1.00 97.72  ? 12   DG  B C5    1 
ATOM   6323 C C6    . DG  B 2 13  ? -27.270 52.018  40.851  1.00 97.64  ? 12   DG  B C6    1 
ATOM   6324 O O6    . DG  B 2 13  ? -28.395 51.507  40.953  1.00 97.87  ? 12   DG  B O6    1 
ATOM   6325 N N1    . DG  B 2 13  ? -26.736 52.233  39.579  1.00 97.48  ? 12   DG  B N1    1 
ATOM   6326 C C2    . DG  B 2 13  ? -25.499 52.791  39.336  1.00 97.42  ? 12   DG  B C2    1 
ATOM   6327 N N2    . DG  B 2 13  ? -25.160 52.918  38.044  1.00 97.29  ? 12   DG  B N2    1 
ATOM   6328 N N3    . DG  B 2 13  ? -24.661 53.193  40.295  1.00 97.49  ? 12   DG  B N3    1 
ATOM   6329 C C4    . DG  B 2 13  ? -25.158 52.990  41.549  1.00 97.72  ? 12   DG  B C4    1 
ATOM   6330 P P     . DC  B 2 14  ? -20.888 57.693  43.771  1.00 103.75 ? 13   DC  B P     1 
ATOM   6331 O OP1   . DC  B 2 14  ? -19.465 58.031  43.984  1.00 103.31 ? 13   DC  B OP1   1 
ATOM   6332 O OP2   . DC  B 2 14  ? -21.897 58.122  44.769  1.00 103.00 ? 13   DC  B OP2   1 
ATOM   6333 O "O5'" . DC  B 2 14  ? -21.324 58.228  42.316  1.00 106.97 ? 13   DC  B "O5'" 1 
ATOM   6334 C "C5'" . DC  B 2 14  ? -20.727 57.752  41.082  1.00 111.37 ? 13   DC  B "C5'" 1 
ATOM   6335 C "C4'" . DC  B 2 14  ? -21.681 57.777  39.881  1.00 114.89 ? 13   DC  B "C4'" 1 
ATOM   6336 O "O4'" . DC  B 2 14  ? -22.796 56.868  40.099  1.00 115.14 ? 13   DC  B "O4'" 1 
ATOM   6337 C "C3'" . DC  B 2 14  ? -22.312 59.130  39.516  1.00 117.67 ? 13   DC  B "C3'" 1 
ATOM   6338 O "O3'" . DC  B 2 14  ? -22.321 59.353  38.098  1.00 121.70 ? 13   DC  B "O3'" 1 
ATOM   6339 C "C2'" . DC  B 2 14  ? -23.741 59.001  40.035  1.00 116.89 ? 13   DC  B "C2'" 1 
ATOM   6340 C "C1'" . DC  B 2 14  ? -23.992 57.532  39.732  1.00 115.92 ? 13   DC  B "C1'" 1 
ATOM   6341 N N1    . DC  B 2 14  ? -25.187 56.941  40.431  1.00 115.89 ? 13   DC  B N1    1 
ATOM   6342 C C2    . DC  B 2 14  ? -26.073 56.133  39.692  1.00 115.91 ? 13   DC  B C2    1 
ATOM   6343 O O2    . DC  B 2 14  ? -25.861 55.910  38.490  1.00 115.86 ? 13   DC  B O2    1 
ATOM   6344 N N3    . DC  B 2 14  ? -27.155 55.603  40.321  1.00 115.92 ? 13   DC  B N3    1 
ATOM   6345 C C4    . DC  B 2 14  ? -27.374 55.850  41.619  1.00 115.98 ? 13   DC  B C4    1 
ATOM   6346 N N4    . DC  B 2 14  ? -28.461 55.291  42.170  1.00 115.92 ? 13   DC  B N4    1 
ATOM   6347 C C5    . DC  B 2 14  ? -26.489 56.674  42.391  1.00 115.62 ? 13   DC  B C5    1 
ATOM   6348 C C6    . DC  B 2 14  ? -25.423 57.192  41.761  1.00 115.57 ? 13   DC  B C6    1 
ATOM   6349 P P     . DT  B 2 15  ? -22.407 60.823  37.450  1.00 125.15 ? 14   DT  B P     1 
ATOM   6350 O OP1   . DT  B 2 15  ? -22.922 60.646  36.076  1.00 125.23 ? 14   DT  B OP1   1 
ATOM   6351 O OP2   . DT  B 2 15  ? -21.086 61.462  37.645  1.00 125.14 ? 14   DT  B OP2   1 
ATOM   6352 O "O5'" . DT  B 2 15  ? -23.506 61.645  38.294  1.00 128.07 ? 14   DT  B "O5'" 1 
ATOM   6353 C "C5'" . DT  B 2 15  ? -23.705 63.050  38.042  1.00 132.70 ? 14   DT  B "C5'" 1 
ATOM   6354 C "C4'" . DT  B 2 15  ? -25.167 63.447  37.832  1.00 136.29 ? 14   DT  B "C4'" 1 
ATOM   6355 O "O4'" . DT  B 2 15  ? -25.263 64.902  37.774  1.00 136.63 ? 14   DT  B "O4'" 1 
ATOM   6356 C "C3'" . DT  B 2 15  ? -25.858 62.912  36.567  1.00 138.48 ? 14   DT  B "C3'" 1 
ATOM   6357 O "O3'" . DT  B 2 15  ? -26.646 61.715  36.858  1.00 141.48 ? 14   DT  B "O3'" 1 
ATOM   6358 C "C2'" . DT  B 2 15  ? -26.738 64.086  36.121  1.00 138.02 ? 14   DT  B "C2'" 1 
ATOM   6359 C "C1'" . DT  B 2 15  ? -25.979 65.312  36.624  1.00 137.14 ? 14   DT  B "C1'" 1 
ATOM   6360 P P     . DT  B 2 16  ? -26.913 60.498  35.823  1.00 143.41 ? 15   DT  B P     1 
ATOM   6361 O OP1   . DT  B 2 16  ? -26.203 59.297  36.331  1.00 143.16 ? 15   DT  B OP1   1 
ATOM   6362 O OP2   . DT  B 2 16  ? -26.608 60.980  34.456  1.00 143.31 ? 15   DT  B OP2   1 
ATOM   6363 O "O5'" . DT  B 2 16  ? -28.506 60.274  35.931  1.00 144.39 ? 15   DT  B "O5'" 1 
ATOM   6364 C "C5'" . DT  B 2 16  ? -29.083 59.059  36.435  1.00 146.39 ? 15   DT  B "C5'" 1 
ATOM   6365 C "C4'" . DT  B 2 16  ? -30.298 59.332  37.312  1.00 148.17 ? 15   DT  B "C4'" 1 
ATOM   6366 O "O4'" . DT  B 2 16  ? -31.468 59.512  36.471  1.00 148.44 ? 15   DT  B "O4'" 1 
ATOM   6367 C "C3'" . DT  B 2 16  ? -30.685 58.207  38.272  1.00 149.42 ? 15   DT  B "C3'" 1 
ATOM   6368 O "O3'" . DT  B 2 16  ? -29.867 58.207  39.494  1.00 151.09 ? 15   DT  B "O3'" 1 
ATOM   6369 C "C2'" . DT  B 2 16  ? -32.191 58.436  38.442  1.00 149.15 ? 15   DT  B "C2'" 1 
ATOM   6370 C "C1'" . DT  B 2 16  ? -32.592 58.856  37.031  1.00 148.73 ? 15   DT  B "C1'" 1 
ATOM   6371 P P     . DT  B 2 17  ? -30.252 58.788  40.953  1.00 152.52 ? 16   DT  B P     1 
ATOM   6372 O OP1   . DT  B 2 17  ? -30.882 60.117  40.754  1.00 152.79 ? 16   DT  B OP1   1 
ATOM   6373 O OP2   . DT  B 2 17  ? -29.026 58.701  41.786  1.00 152.10 ? 16   DT  B OP2   1 
ATOM   6374 O "O5'" . DT  B 2 17  ? -31.337 57.753  41.550  1.00 152.96 ? 16   DT  B "O5'" 1 
ATOM   6375 C "C5'" . DT  B 2 17  ? -32.392 58.174  42.452  1.00 153.36 ? 16   DT  B "C5'" 1 
ATOM   6376 C "C4'" . DT  B 2 17  ? -33.393 57.057  42.737  1.00 153.61 ? 16   DT  B "C4'" 1 
ATOM   6377 O "O4'" . DT  B 2 17  ? -33.210 56.563  44.092  1.00 153.67 ? 16   DT  B "O4'" 1 
ATOM   6378 C "C3'" . DT  B 2 17  ? -34.874 57.435  42.703  1.00 153.65 ? 16   DT  B "C3'" 1 
ATOM   6379 O "O3'" . DT  B 2 17  ? -35.417 57.596  41.347  1.00 153.86 ? 16   DT  B "O3'" 1 
ATOM   6380 C "C2'" . DT  B 2 17  ? -35.506 56.322  43.543  1.00 153.51 ? 16   DT  B "C2'" 1 
ATOM   6381 C "C1'" . DT  B 2 17  ? -34.446 56.113  44.624  1.00 153.42 ? 16   DT  B "C1'" 1 
ATOM   6382 P P     . DT  B 2 18  ? -35.825 56.460  40.267  1.00 153.82 ? 17   DT  B P     1 
ATOM   6383 O OP1   . DT  B 2 18  ? -35.112 55.205  40.607  1.00 153.87 ? 17   DT  B OP1   1 
ATOM   6384 O OP2   . DT  B 2 18  ? -35.608 57.069  38.926  1.00 153.49 ? 17   DT  B OP2   1 
ATOM   6385 O "O5'" . DT  B 2 18  ? -37.411 56.235  40.489  1.00 152.67 ? 17   DT  B "O5'" 1 
ATOM   6386 C "C5'" . DT  B 2 18  ? -38.343 56.012  39.399  1.00 150.97 ? 17   DT  B "C5'" 1 
ATOM   6387 C "C4'" . DT  B 2 18  ? -39.299 54.846  39.647  1.00 149.75 ? 17   DT  B "C4'" 1 
ATOM   6388 O "O4'" . DT  B 2 18  ? -40.507 55.315  40.301  1.00 149.31 ? 17   DT  B "O4'" 1 
ATOM   6389 C "C3'" . DT  B 2 18  ? -39.793 54.101  38.403  1.00 149.07 ? 17   DT  B "C3'" 1 
ATOM   6390 O "O3'" . DT  B 2 18  ? -38.844 53.077  38.007  1.00 148.24 ? 17   DT  B "O3'" 1 
ATOM   6391 C "C2'" . DT  B 2 18  ? -41.120 53.508  38.879  1.00 148.92 ? 17   DT  B "C2'" 1 
ATOM   6392 C "C1'" . DT  B 2 18  ? -41.613 54.522  39.910  1.00 149.05 ? 17   DT  B "C1'" 1 
ATOM   6393 P P     . DG  B 2 19  ? -38.812 52.347  36.566  1.00 147.30 ? 18   DG  B P     1 
ATOM   6394 O OP1   . DG  B 2 19  ? -39.963 52.850  35.778  1.00 147.51 ? 18   DG  B OP1   1 
ATOM   6395 O OP2   . DG  B 2 19  ? -38.674 50.894  36.826  1.00 147.09 ? 18   DG  B OP2   1 
ATOM   6396 O "O5'" . DG  B 2 19  ? -37.443 52.849  35.877  1.00 145.76 ? 18   DG  B "O5'" 1 
ATOM   6397 C "C5'" . DG  B 2 19  ? -36.658 52.013  35.004  1.00 143.26 ? 18   DG  B "C5'" 1 
ATOM   6398 C "C4'" . DG  B 2 19  ? -35.617 52.812  34.219  1.00 141.82 ? 18   DG  B "C4'" 1 
ATOM   6399 O "O4'" . DG  B 2 19  ? -34.987 53.829  35.052  1.00 141.83 ? 18   DG  B "O4'" 1 
ATOM   6400 C "C3'" . DG  B 2 19  ? -34.476 51.989  33.623  1.00 140.56 ? 18   DG  B "C3'" 1 
ATOM   6401 O "O3'" . DG  B 2 19  ? -34.172 52.428  32.286  1.00 138.36 ? 18   DG  B "O3'" 1 
ATOM   6402 C "C2'" . DG  B 2 19  ? -33.317 52.224  34.591  1.00 141.14 ? 18   DG  B "C2'" 1 
ATOM   6403 C "C1'" . DG  B 2 19  ? -33.593 53.601  35.185  1.00 141.89 ? 18   DG  B "C1'" 1 
ATOM   6404 N N9    . DG  B 2 19  ? -33.190 53.664  36.598  1.00 142.47 ? 18   DG  B N9    1 
ATOM   6405 C C8    . DG  B 2 19  ? -33.953 53.301  37.687  1.00 142.58 ? 18   DG  B C8    1 
ATOM   6406 N N7    . DG  B 2 19  ? -33.350 53.442  38.836  1.00 142.58 ? 18   DG  B N7    1 
ATOM   6407 C C5    . DG  B 2 19  ? -32.091 53.928  38.503  1.00 142.72 ? 18   DG  B C5    1 
ATOM   6408 C C6    . DG  B 2 19  ? -30.991 54.274  39.341  1.00 142.59 ? 18   DG  B C6    1 
ATOM   6409 O O6    . DG  B 2 19  ? -30.914 54.220  40.579  1.00 142.14 ? 18   DG  B O6    1 
ATOM   6410 N N1    . DG  B 2 19  ? -29.893 54.725  38.605  1.00 142.54 ? 18   DG  B N1    1 
ATOM   6411 C C2    . DG  B 2 19  ? -29.861 54.831  37.232  1.00 142.54 ? 18   DG  B C2    1 
ATOM   6412 N N2    . DG  B 2 19  ? -28.716 55.286  36.703  1.00 142.43 ? 18   DG  B N2    1 
ATOM   6413 N N3    . DG  B 2 19  ? -30.884 54.513  36.437  1.00 142.77 ? 18   DG  B N3    1 
ATOM   6414 C C4    . DG  B 2 19  ? -31.972 54.067  37.129  1.00 142.73 ? 18   DG  B C4    1 
ATOM   6415 P P     . DC  B 2 20  ? -32.952 51.842  31.408  1.00 136.87 ? 19   DC  B P     1 
ATOM   6416 O OP1   . DC  B 2 20  ? -33.370 51.836  29.986  1.00 136.70 ? 19   DC  B OP1   1 
ATOM   6417 O OP2   . DC  B 2 20  ? -32.472 50.576  32.014  1.00 136.67 ? 19   DC  B OP2   1 
ATOM   6418 O "O5'" . DC  B 2 20  ? -31.822 52.969  31.630  1.00 135.31 ? 19   DC  B "O5'" 1 
ATOM   6419 C "C5'" . DC  B 2 20  ? -30.829 53.303  30.641  1.00 131.74 ? 19   DC  B "C5'" 1 
ATOM   6420 C "C4'" . DC  B 2 20  ? -29.413 53.357  31.215  1.00 129.14 ? 19   DC  B "C4'" 1 
ATOM   6421 O "O4'" . DC  B 2 20  ? -29.396 53.265  32.671  1.00 128.69 ? 19   DC  B "O4'" 1 
ATOM   6422 C "C3'" . DC  B 2 20  ? -28.496 52.228  30.756  1.00 127.71 ? 19   DC  B "C3'" 1 
ATOM   6423 O "O3'" . DC  B 2 20  ? -27.154 52.714  30.653  1.00 125.57 ? 19   DC  B "O3'" 1 
ATOM   6424 C "C2'" . DC  B 2 20  ? -28.632 51.216  31.890  1.00 127.64 ? 19   DC  B "C2'" 1 
ATOM   6425 C "C1'" . DC  B 2 20  ? -28.569 52.179  33.068  1.00 127.82 ? 19   DC  B "C1'" 1 
ATOM   6426 N N1    . DC  B 2 20  ? -29.006 51.629  34.406  1.00 127.62 ? 19   DC  B N1    1 
ATOM   6427 C C2    . DC  B 2 20  ? -28.428 52.134  35.592  1.00 127.40 ? 19   DC  B C2    1 
ATOM   6428 O O2    . DC  B 2 20  ? -27.564 53.025  35.537  1.00 126.67 ? 19   DC  B O2    1 
ATOM   6429 N N3    . DC  B 2 20  ? -28.839 51.624  36.789  1.00 127.43 ? 19   DC  B N3    1 
ATOM   6430 C C4    . DC  B 2 20  ? -29.771 50.661  36.832  1.00 127.34 ? 19   DC  B C4    1 
ATOM   6431 N N4    . DC  B 2 20  ? -30.138 50.199  38.031  1.00 127.25 ? 19   DC  B N4    1 
ATOM   6432 C C5    . DC  B 2 20  ? -30.369 50.135  35.643  1.00 127.30 ? 19   DC  B C5    1 
ATOM   6433 C C6    . DC  B 2 20  ? -29.960 50.641  34.468  1.00 127.39 ? 19   DC  B C6    1 
ATOM   6434 P P     . DC  B 2 21  ? -26.124 52.177  29.543  1.00 123.81 ? 20   DC  B P     1 
ATOM   6435 O OP1   . DC  B 2 21  ? -24.894 52.993  29.645  1.00 123.72 ? 20   DC  B OP1   1 
ATOM   6436 O OP2   . DC  B 2 21  ? -26.839 52.128  28.248  1.00 124.21 ? 20   DC  B OP2   1 
ATOM   6437 O "O5'" . DC  B 2 21  ? -25.802 50.658  29.961  1.00 121.84 ? 20   DC  B "O5'" 1 
ATOM   6438 C "C5'" . DC  B 2 21  ? -25.492 50.254  31.297  1.00 118.28 ? 20   DC  B "C5'" 1 
ATOM   6439 C "C4'" . DC  B 2 21  ? -24.289 50.990  31.874  1.00 115.39 ? 20   DC  B "C4'" 1 
ATOM   6440 O "O4'" . DC  B 2 21  ? -24.538 51.430  33.238  1.00 114.60 ? 20   DC  B "O4'" 1 
ATOM   6441 C "C3'" . DC  B 2 21  ? -23.025 50.156  31.938  1.00 113.20 ? 20   DC  B "C3'" 1 
ATOM   6442 O "O3'" . DC  B 2 21  ? -21.907 51.010  31.827  1.00 110.30 ? 20   DC  B "O3'" 1 
ATOM   6443 C "C2'" . DC  B 2 21  ? -23.107 49.537  33.324  1.00 113.76 ? 20   DC  B "C2'" 1 
ATOM   6444 C "C1'" . DC  B 2 21  ? -23.880 50.567  34.146  1.00 114.13 ? 20   DC  B "C1'" 1 
ATOM   6445 N N1    . DC  B 2 21  ? -24.888 49.935  35.063  1.00 114.03 ? 20   DC  B N1    1 
ATOM   6446 C C2    . DC  B 2 21  ? -24.737 50.070  36.455  1.00 113.87 ? 20   DC  B C2    1 
ATOM   6447 O O2    . DC  B 2 21  ? -23.781 50.711  36.916  1.00 112.98 ? 20   DC  B O2    1 
ATOM   6448 N N3    . DC  B 2 21  ? -25.664 49.486  37.263  1.00 114.21 ? 20   DC  B N3    1 
ATOM   6449 C C4    . DC  B 2 21  ? -26.686 48.794  36.738  1.00 114.10 ? 20   DC  B C4    1 
ATOM   6450 N N4    . DC  B 2 21  ? -27.562 48.241  37.580  1.00 114.12 ? 20   DC  B N4    1 
ATOM   6451 C C5    . DC  B 2 21  ? -26.858 48.638  35.329  1.00 113.89 ? 20   DC  B C5    1 
ATOM   6452 C C6    . DC  B 2 21  ? -25.943 49.219  34.544  1.00 113.91 ? 20   DC  B C6    1 
ATOM   6453 P P     . DG  B 2 22  ? -20.459 50.431  31.464  1.00 108.23 ? 21   DG  B P     1 
ATOM   6454 O OP1   . DG  B 2 22  ? -19.676 51.573  30.936  1.00 107.75 ? 21   DG  B OP1   1 
ATOM   6455 O OP2   . DG  B 2 22  ? -20.619 49.185  30.675  1.00 107.89 ? 21   DG  B OP2   1 
ATOM   6456 O "O5'" . DG  B 2 22  ? -19.855 49.997  32.884  1.00 106.20 ? 21   DG  B "O5'" 1 
ATOM   6457 C "C5'" . DG  B 2 22  ? -19.639 50.923  33.965  1.00 102.27 ? 21   DG  B "C5'" 1 
ATOM   6458 C "C4'" . DG  B 2 22  ? -19.161 50.169  35.198  1.00 99.12  ? 21   DG  B "C4'" 1 
ATOM   6459 O "O4'" . DG  B 2 22  ? -20.294 49.616  35.927  1.00 97.99  ? 21   DG  B "O4'" 1 
ATOM   6460 C "C3'" . DG  B 2 22  ? -18.218 49.001  34.894  1.00 97.18  ? 21   DG  B "C3'" 1 
ATOM   6461 O "O3'" . DG  B 2 22  ? -17.050 49.126  35.733  1.00 95.28  ? 21   DG  B "O3'" 1 
ATOM   6462 C "C2'" . DG  B 2 22  ? -19.084 47.753  35.111  1.00 96.47  ? 21   DG  B "C2'" 1 
ATOM   6463 C "C1'" . DG  B 2 22  ? -20.101 48.229  36.146  1.00 96.22  ? 21   DG  B "C1'" 1 
ATOM   6464 N N9    . DG  B 2 22  ? -21.399 47.559  36.075  1.00 95.49  ? 21   DG  B N9    1 
ATOM   6465 C C8    . DG  B 2 22  ? -22.078 47.178  34.942  1.00 94.78  ? 21   DG  B C8    1 
ATOM   6466 N N7    . DG  B 2 22  ? -23.220 46.596  35.184  1.00 94.94  ? 21   DG  B N7    1 
ATOM   6467 C C5    . DG  B 2 22  ? -23.318 46.579  36.573  1.00 95.00  ? 21   DG  B C5    1 
ATOM   6468 C C6    . DG  B 2 22  ? -24.342 46.071  37.431  1.00 94.49  ? 21   DG  B C6    1 
ATOM   6469 O O6    . DG  B 2 22  ? -25.409 45.517  37.134  1.00 94.48  ? 21   DG  B O6    1 
ATOM   6470 N N1    . DG  B 2 22  ? -24.035 46.252  38.780  1.00 94.45  ? 21   DG  B N1    1 
ATOM   6471 C C2    . DG  B 2 22  ? -22.884 46.852  39.245  1.00 94.47  ? 21   DG  B C2    1 
ATOM   6472 N N2    . DG  B 2 22  ? -22.761 46.942  40.574  1.00 94.01  ? 21   DG  B N2    1 
ATOM   6473 N N3    . DG  B 2 22  ? -21.922 47.339  38.460  1.00 95.01  ? 21   DG  B N3    1 
ATOM   6474 C C4    . DG  B 2 22  ? -22.197 47.171  37.135  1.00 95.32  ? 21   DG  B C4    1 
ATOM   6475 P P     . DT  B 2 23  ? -16.202 47.897  36.308  1.00 93.64  ? 22   DT  B P     1 
ATOM   6476 O OP1   . DT  B 2 23  ? -14.920 48.426  36.820  1.00 93.10  ? 22   DT  B OP1   1 
ATOM   6477 O OP2   . DT  B 2 23  ? -16.199 46.805  35.310  1.00 94.08  ? 22   DT  B OP2   1 
ATOM   6478 O "O5'" . DT  B 2 23  ? -17.097 47.429  37.543  1.00 93.74  ? 22   DT  B "O5'" 1 
ATOM   6479 C "C5'" . DT  B 2 23  ? -16.618 46.408  38.379  1.00 93.68  ? 22   DT  B "C5'" 1 
ATOM   6480 C "C4'" . DT  B 2 23  ? -17.729 45.526  38.894  1.00 93.52  ? 22   DT  B "C4'" 1 
ATOM   6481 O "O4'" . DT  B 2 23  ? -18.902 45.574  38.063  1.00 93.65  ? 22   DT  B "O4'" 1 
ATOM   6482 C "C3'" . DT  B 2 23  ? -17.376 44.059  38.872  1.00 93.97  ? 22   DT  B "C3'" 1 
ATOM   6483 O "O3'" . DT  B 2 23  ? -16.671 43.798  40.055  1.00 95.23  ? 22   DT  B "O3'" 1 
ATOM   6484 C "C2'" . DT  B 2 23  ? -18.745 43.394  38.915  1.00 94.14  ? 22   DT  B "C2'" 1 
ATOM   6485 C "C1'" . DT  B 2 23  ? -19.707 44.520  38.547  1.00 94.20  ? 22   DT  B "C1'" 1 
ATOM   6486 N N1    . DT  B 2 23  ? -20.761 44.120  37.542  1.00 94.54  ? 22   DT  B N1    1 
ATOM   6487 C C2    . DT  B 2 23  ? -21.999 43.692  38.001  1.00 94.19  ? 22   DT  B C2    1 
ATOM   6488 O O2    . DT  B 2 23  ? -22.289 43.626  39.178  1.00 93.32  ? 22   DT  B O2    1 
ATOM   6489 N N3    . DT  B 2 23  ? -22.900 43.345  37.018  1.00 94.47  ? 22   DT  B N3    1 
ATOM   6490 C C4    . DT  B 2 23  ? -22.694 43.386  35.645  1.00 94.95  ? 22   DT  B C4    1 
ATOM   6491 O O4    . DT  B 2 23  ? -23.574 43.055  34.853  1.00 95.09  ? 22   DT  B O4    1 
ATOM   6492 C C5    . DT  B 2 23  ? -21.378 43.836  35.221  1.00 94.98  ? 22   DT  B C5    1 
ATOM   6493 C C7    . DT  B 2 23  ? -21.022 43.923  33.760  1.00 94.29  ? 22   DT  B C7    1 
ATOM   6494 C C6    . DT  B 2 23  ? -20.489 44.175  36.178  1.00 94.98  ? 22   DT  B C6    1 
ATOM   6495 P P     . DG  B 2 24  ? -15.232 43.093  40.091  1.00 96.06  ? 23   DG  B P     1 
ATOM   6496 O OP1   . DG  B 2 24  ? -14.487 43.685  41.229  1.00 96.06  ? 23   DG  B OP1   1 
ATOM   6497 O OP2   . DG  B 2 24  ? -14.655 43.032  38.720  1.00 95.50  ? 23   DG  B OP2   1 
ATOM   6498 O "O5'" . DG  B 2 24  ? -15.602 41.615  40.544  1.00 95.50  ? 23   DG  B "O5'" 1 
ATOM   6499 C "C5'" . DG  B 2 24  ? -16.316 41.378  41.745  1.00 94.56  ? 23   DG  B "C5'" 1 
ATOM   6500 C "C4'" . DG  B 2 24  ? -17.196 40.178  41.490  1.00 94.64  ? 23   DG  B "C4'" 1 
ATOM   6501 O "O4'" . DG  B 2 24  ? -18.220 40.530  40.531  1.00 94.44  ? 23   DG  B "O4'" 1 
ATOM   6502 C "C3'" . DG  B 2 24  ? -16.485 38.976  40.866  1.00 94.93  ? 23   DG  B "C3'" 1 
ATOM   6503 O "O3'" . DG  B 2 24  ? -16.991 37.811  41.494  1.00 95.30  ? 23   DG  B "O3'" 1 
ATOM   6504 C "C2'" . DG  B 2 24  ? -16.877 39.030  39.389  1.00 94.49  ? 23   DG  B "C2'" 1 
ATOM   6505 C "C1'" . DG  B 2 24  ? -18.321 39.429  39.651  1.00 94.19  ? 23   DG  B "C1'" 1 
ATOM   6506 N N9    . DG  B 2 24  ? -19.170 39.767  38.516  1.00 94.08  ? 23   DG  B N9    1 
ATOM   6507 C C8    . DG  B 2 24  ? -18.838 40.349  37.312  1.00 93.61  ? 23   DG  B C8    1 
ATOM   6508 N N7    . DG  B 2 24  ? -19.872 40.513  36.528  1.00 93.55  ? 23   DG  B N7    1 
ATOM   6509 C C5    . DG  B 2 24  ? -20.944 40.008  37.258  1.00 93.61  ? 23   DG  B C5    1 
ATOM   6510 C C6    . DG  B 2 24  ? -22.316 39.909  36.934  1.00 93.30  ? 23   DG  B C6    1 
ATOM   6511 O O6    . DG  B 2 24  ? -22.865 40.267  35.886  1.00 93.02  ? 23   DG  B O6    1 
ATOM   6512 N N1    . DG  B 2 24  ? -23.061 39.327  37.969  1.00 93.64  ? 23   DG  B N1    1 
ATOM   6513 C C2    . DG  B 2 24  ? -22.546 38.892  39.175  1.00 93.45  ? 23   DG  B C2    1 
ATOM   6514 N N2    . DG  B 2 24  ? -23.400 38.359  40.063  1.00 93.10  ? 23   DG  B N2    1 
ATOM   6515 N N3    . DG  B 2 24  ? -21.260 38.980  39.486  1.00 93.51  ? 23   DG  B N3    1 
ATOM   6516 C C4    . DG  B 2 24  ? -20.526 39.544  38.487  1.00 93.81  ? 23   DG  B C4    1 
ATOM   6517 P P     . DT  B 2 25  ? -15.996 36.640  41.911  1.00 95.31  ? 24   DT  B P     1 
ATOM   6518 O OP1   . DT  B 2 25  ? -15.202 37.097  43.083  1.00 95.51  ? 24   DT  B OP1   1 
ATOM   6519 O OP2   . DT  B 2 25  ? -15.321 36.234  40.654  1.00 95.11  ? 24   DT  B OP2   1 
ATOM   6520 O "O5'" . DT  B 2 25  ? -16.992 35.462  42.369  1.00 95.55  ? 24   DT  B "O5'" 1 
ATOM   6521 C "C5'" . DT  B 2 25  ? -17.552 35.415  43.688  1.00 95.39  ? 24   DT  B "C5'" 1 
ATOM   6522 C "C4'" . DT  B 2 25  ? -19.056 35.229  43.622  1.00 95.84  ? 24   DT  B "C4'" 1 
ATOM   6523 O "O4'" . DT  B 2 25  ? -19.626 36.087  42.607  1.00 95.98  ? 24   DT  B "O4'" 1 
ATOM   6524 C "C3'" . DT  B 2 25  ? -19.496 33.843  43.201  1.00 95.87  ? 24   DT  B "C3'" 1 
ATOM   6525 O "O3'" . DT  B 2 25  ? -19.561 33.022  44.342  1.00 95.83  ? 24   DT  B "O3'" 1 
ATOM   6526 C "C2'" . DT  B 2 25  ? -20.889 34.074  42.624  1.00 96.16  ? 24   DT  B "C2'" 1 
ATOM   6527 C "C1'" . DT  B 2 25  ? -20.801 35.493  42.086  1.00 96.19  ? 24   DT  B "C1'" 1 
ATOM   6528 N N1    . DT  B 2 25  ? -20.788 35.592  40.591  1.00 96.15  ? 24   DT  B N1    1 
ATOM   6529 C C2    . DT  B 2 25  ? -21.987 35.519  39.898  1.00 96.13  ? 24   DT  B C2    1 
ATOM   6530 O O2    . DT  B 2 25  ? -23.075 35.362  40.432  1.00 95.99  ? 24   DT  B O2    1 
ATOM   6531 N N3    . DT  B 2 25  ? -21.860 35.641  38.535  1.00 95.74  ? 24   DT  B N3    1 
ATOM   6532 C C4    . DT  B 2 25  ? -20.686 35.823  37.823  1.00 95.46  ? 24   DT  B C4    1 
ATOM   6533 O O4    . DT  B 2 25  ? -20.688 35.917  36.603  1.00 95.25  ? 24   DT  B O4    1 
ATOM   6534 C C5    . DT  B 2 25  ? -19.471 35.887  38.604  1.00 95.51  ? 24   DT  B C5    1 
ATOM   6535 C C7    . DT  B 2 25  ? -18.133 36.074  37.945  1.00 95.38  ? 24   DT  B C7    1 
ATOM   6536 C C6    . DT  B 2 25  ? -19.581 35.772  39.934  1.00 95.75  ? 24   DT  B C6    1 
ATOM   6537 P P     . DC  B 2 26  ? -19.578 31.438  44.149  1.00 96.21  ? 25   DC  B P     1 
ATOM   6538 O OP1   . DC  B 2 26  ? -19.528 30.817  45.499  1.00 95.76  ? 25   DC  B OP1   1 
ATOM   6539 O OP2   . DC  B 2 26  ? -18.584 31.119  43.091  1.00 95.39  ? 25   DC  B OP2   1 
ATOM   6540 O "O5'" . DC  B 2 26  ? -21.021 31.143  43.521  1.00 96.65  ? 25   DC  B "O5'" 1 
ATOM   6541 C "C5'" . DC  B 2 26  ? -22.182 30.926  44.319  1.00 96.35  ? 25   DC  B "C5'" 1 
ATOM   6542 C "C4'" . DC  B 2 26  ? -23.319 30.499  43.407  1.00 96.30  ? 25   DC  B "C4'" 1 
ATOM   6543 O "O4'" . DC  B 2 26  ? -23.277 31.270  42.175  1.00 96.17  ? 25   DC  B "O4'" 1 
ATOM   6544 C "C3'" . DC  B 2 26  ? -23.297 29.030  42.997  1.00 96.22  ? 25   DC  B "C3'" 1 
ATOM   6545 O "O3'" . DC  B 2 26  ? -24.604 28.482  43.197  1.00 96.37  ? 25   DC  B "O3'" 1 
ATOM   6546 C "C2'" . DC  B 2 26  ? -22.855 29.038  41.528  1.00 95.64  ? 25   DC  B "C2'" 1 
ATOM   6547 C "C1'" . DC  B 2 26  ? -23.309 30.415  41.048  1.00 95.13  ? 25   DC  B "C1'" 1 
ATOM   6548 N N1    . DC  B 2 26  ? -22.476 31.066  39.980  1.00 94.99  ? 25   DC  B N1    1 
ATOM   6549 C C2    . DC  B 2 26  ? -23.099 31.522  38.803  1.00 95.01  ? 25   DC  B C2    1 
ATOM   6550 O O2    . DC  B 2 26  ? -24.318 31.365  38.658  1.00 95.23  ? 25   DC  B O2    1 
ATOM   6551 N N3    . DC  B 2 26  ? -22.347 32.122  37.838  1.00 94.66  ? 25   DC  B N3    1 
ATOM   6552 C C4    . DC  B 2 26  ? -21.032 32.278  38.021  1.00 94.17  ? 25   DC  B C4    1 
ATOM   6553 N N4    . DC  B 2 26  ? -20.340 32.871  37.045  1.00 93.51  ? 25   DC  B N4    1 
ATOM   6554 C C5    . DC  B 2 26  ? -20.377 31.828  39.213  1.00 94.42  ? 25   DC  B C5    1 
ATOM   6555 C C6    . DC  B 2 26  ? -21.126 31.238  40.157  1.00 94.56  ? 25   DC  B C6    1 
HETATM 6556 K K     . K   C 3 .   ? -53.413 9.721   28.981  1.00 34.21  ? 1758 K   A K     1 
HETATM 6557 K K     . K   D 3 .   ? -18.400 36.866  49.256  1.00 68.79  ? 1759 K   A K     1 
HETATM 6558 K K     . K   E 3 .   ? -27.151 36.925  -2.557  1.00 76.44  ? 1760 K   A K     1 
HETATM 6559 O O     . HOH F 4 .   ? -51.993 7.098   28.748  1.00 38.68  ? 2001 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   ILE 2   2   2   ILE ILE A . n 
A 1 3   LEU 3   3   3   LEU LEU A . n 
A 1 4   ASP 4   4   4   ASP ASP A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   ASP 6   6   6   ASP ASP A . n 
A 1 7   TYR 7   7   7   TYR TYR A . n 
A 1 8   ILE 8   8   8   ILE ILE A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  GLU 10  10  10  GLU GLU A . n 
A 1 11  ASP 11  11  11  ASP ASP A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  LYS 13  13  13  LYS LYS A . n 
A 1 14  PRO 14  14  14  PRO PRO A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  ILE 16  16  16  ILE ILE A . n 
A 1 17  ARG 17  17  17  ARG ARG A . n 
A 1 18  ILE 18  18  18  ILE ILE A . n 
A 1 19  PHE 19  19  19  PHE PHE A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  ASN 23  23  23  ASN ASN A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  PHE 26  26  26  PHE PHE A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  ILE 28  28  28  ILE ILE A . n 
A 1 29  ASP 29  29  29  ASP ASP A . n 
A 1 30  TYR 30  30  30  TYR TYR A . n 
A 1 31  ASP 31  31  31  ASP ASP A . n 
A 1 32  ARG 32  32  32  ARG ARG A . n 
A 1 33  ASN 33  33  33  ASN ASN A . n 
A 1 34  PHE 34  34  34  PHE PHE A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  TYR 37  37  37  TYR TYR A . n 
A 1 38  ILE 38  38  38  ILE ILE A . n 
A 1 39  TYR 39  39  39  TYR TYR A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  ASP 44  44  44  ASP ASP A . n 
A 1 45  ASP 45  45  45  ASP ASP A . n 
A 1 46  SER 46  46  46  SER SER A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  ILE 48  48  48  ILE ILE A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  ASP 50  50  50  ASP ASP A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  ILE 54  54  54  ILE ILE A . n 
A 1 55  THR 55  55  55  THR THR A . n 
A 1 56  ALA 56  56  56  ALA ALA A . n 
A 1 57  GLU 57  57  57  GLU GLU A . n 
A 1 58  ARG 58  58  58  ARG ARG A . n 
A 1 59  HIS 59  59  59  HIS HIS A . n 
A 1 60  GLY 60  60  60  GLY GLY A . n 
A 1 61  THR 61  61  61  THR THR A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  VAL 63  63  63  VAL VAL A . n 
A 1 64  ARG 64  64  64  ARG ARG A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  LYS 70  70  70  LYS LYS A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  LYS 72  72  72  LYS LYS A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  LYS 74  74  74  LYS LYS A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  ARG 78  78  78  ARG ARG A . n 
A 1 79  PRO 79  79  79  PRO PRO A . n 
A 1 80  ILE 80  80  80  ILE ILE A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  VAL 82  82  82  VAL VAL A . n 
A 1 83  TRP 83  83  83  TRP TRP A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  TYR 86  86  86  TYR TYR A . n 
A 1 87  PHE 87  87  87  PHE PHE A . n 
A 1 88  THR 88  88  88  THR THR A . n 
A 1 89  HIS 89  89  89  HIS HIS A . n 
A 1 90  PRO 90  90  90  PRO PRO A . n 
A 1 91  GLN 91  91  91  GLN GLN A . n 
A 1 92  ASP 92  92  92  ASP ASP A . n 
A 1 93  VAL 93  93  93  VAL VAL A . n 
A 1 94  PRO 94  94  94  PRO PRO A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  ARG 97  97  97  ARG ARG A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 GLU 102 102 102 GLU GLU A . n 
A 1 103 HIS 103 103 103 HIS HIS A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 VAL 107 107 107 VAL VAL A . n 
A 1 108 ASP 108 108 108 ASP ASP A . n 
A 1 109 ILE 109 109 109 ILE ILE A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 TYR 112 112 112 TYR TYR A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 ILE 114 114 114 ILE ILE A . n 
A 1 115 PRO 115 115 115 PRO PRO A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 TYR 120 120 120 TYR TYR A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 ILE 122 122 122 ILE ILE A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 LYS 124 124 124 LYS LYS A . n 
A 1 125 GLY 125 125 125 GLY GLY A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 ILE 127 127 127 ILE ILE A . n 
A 1 128 PRO 128 128 128 PRO PRO A . n 
A 1 129 MET 129 129 129 MET MET A . n 
A 1 130 GLU 130 130 130 GLU GLU A . n 
A 1 131 GLY 131 131 131 GLY GLY A . n 
A 1 132 ASP 132 132 132 ASP ASP A . n 
A 1 133 GLU 133 133 133 GLU GLU A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 LYS 136 136 136 LYS LYS A . n 
A 1 137 MET 137 137 137 MET MET A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 PHE 140 140 140 PHE PHE A . n 
A 1 141 ASP 141 141 141 ASP ASP A . n 
A 1 142 ILE 142 142 142 ILE ILE A . n 
A 1 143 GLU 143 143 143 GLU GLU A . n 
A 1 144 THR 144 144 144 THR THR A . n 
A 1 145 LEU 145 145 145 LEU LEU A . n 
A 1 146 TYR 146 146 146 TYR TYR A . n 
A 1 147 HIS 147 147 147 HIS HIS A . n 
A 1 148 GLU 148 148 148 GLU GLU A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 GLU 150 150 150 GLU GLU A . n 
A 1 151 LYS 151 151 151 LYS LYS A . n 
A 1 152 PHE 152 152 152 PHE PHE A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 GLU 154 154 154 GLU GLU A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 PRO 156 156 156 PRO PRO A . n 
A 1 157 ILE 157 157 157 ILE ILE A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 MET 159 159 159 MET MET A . n 
A 1 160 ILE 160 160 160 ILE ILE A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 TYR 162 162 162 TYR TYR A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 ASP 164 164 164 ASP ASP A . n 
A 1 165 GLU 165 165 165 GLU GLU A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 GLY 167 167 167 GLY GLY A . n 
A 1 168 ALA 168 168 168 ALA ALA A . n 
A 1 169 ARG 169 169 169 ARG ARG A . n 
A 1 170 VAL 170 170 170 VAL VAL A . n 
A 1 171 ILE 171 171 171 ILE ILE A . n 
A 1 172 THR 172 172 172 THR THR A . n 
A 1 173 TRP 173 173 173 TRP TRP A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 ASN 175 175 175 ASN ASN A . n 
A 1 176 ILE 176 176 176 ILE ILE A . n 
A 1 177 ASP 177 177 177 ASP ASP A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 PRO 179 179 179 PRO PRO A . n 
A 1 180 TYR 180 180 180 TYR TYR A . n 
A 1 181 VAL 181 181 181 VAL VAL A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 VAL 184 184 184 VAL VAL A . n 
A 1 185 SER 185 185 185 SER SER A . n 
A 1 186 THR 186 186 186 THR THR A . n 
A 1 187 GLU 187 187 187 GLU GLU A . n 
A 1 188 LYS 188 188 188 LYS LYS A . n 
A 1 189 GLU 189 189 189 GLU GLU A . n 
A 1 190 MET 190 190 190 MET MET A . n 
A 1 191 ILE 191 191 191 ILE ILE A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 ARG 193 193 193 ARG ARG A . n 
A 1 194 PHE 194 194 194 PHE PHE A . n 
A 1 195 LEU 195 195 195 LEU LEU A . n 
A 1 196 LYS 196 196 196 LYS LYS A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 VAL 198 198 198 VAL VAL A . n 
A 1 199 LYS 199 199 199 LYS LYS A . n 
A 1 200 GLU 200 200 200 GLU GLU A . n 
A 1 201 LYS 201 201 201 LYS LYS A . n 
A 1 202 ASP 202 202 202 ASP ASP A . n 
A 1 203 PRO 203 203 203 PRO PRO A . n 
A 1 204 ASP 204 204 204 ASP ASP A . n 
A 1 205 VAL 205 205 205 VAL VAL A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 ILE 207 207 207 ILE ILE A . n 
A 1 208 THR 208 208 208 THR THR A . n 
A 1 209 TYR 209 209 209 TYR TYR A . n 
A 1 210 ASN 210 210 210 ASN ASN A . n 
A 1 211 GLY 211 211 211 GLY GLY A . n 
A 1 212 ASP 212 212 212 ASP ASP A . n 
A 1 213 ASN 213 213 213 ASN ASN A . n 
A 1 214 PHE 214 214 214 PHE PHE A . n 
A 1 215 ALA 215 215 215 ALA ALA A . n 
A 1 216 PHE 216 216 216 PHE PHE A . n 
A 1 217 ALA 217 217 217 ALA ALA A . n 
A 1 218 TYR 218 218 218 TYR TYR A . n 
A 1 219 LEU 219 219 219 LEU LEU A . n 
A 1 220 LYS 220 220 220 LYS LYS A . n 
A 1 221 LYS 221 221 221 LYS LYS A . n 
A 1 222 ARG 222 222 222 ARG ARG A . n 
A 1 223 SER 223 223 223 SER SER A . n 
A 1 224 GLU 224 224 224 GLU GLU A . n 
A 1 225 LYS 225 225 225 LYS LYS A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 VAL 228 228 228 VAL VAL A . n 
A 1 229 LYS 229 229 229 LYS LYS A . n 
A 1 230 PHE 230 230 230 PHE PHE A . n 
A 1 231 ILE 231 231 231 ILE ILE A . n 
A 1 232 LEU 232 232 232 LEU LEU A . n 
A 1 233 GLY 233 233 233 GLY GLY A . n 
A 1 234 ARG 234 234 234 ARG ARG A . n 
A 1 235 GLU 235 235 235 GLU GLU A . n 
A 1 236 GLY 236 236 236 GLY GLY A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 GLU 238 238 238 GLU GLU A . n 
A 1 239 PRO 239 239 239 PRO PRO A . n 
A 1 240 LYS 240 240 240 LYS LYS A . n 
A 1 241 ILE 241 241 241 ILE ILE A . n 
A 1 242 GLN 242 242 242 GLN GLN A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 MET 244 244 244 MET MET A . n 
A 1 245 GLY 245 245 245 GLY GLY A . n 
A 1 246 ASP 246 246 246 ASP ASP A . n 
A 1 247 ARG 247 247 247 ARG ARG A . n 
A 1 248 PHE 248 248 248 PHE PHE A . n 
A 1 249 ALA 249 249 249 ALA ALA A . n 
A 1 250 VAL 250 250 250 VAL VAL A . n 
A 1 251 GLU 251 251 251 GLU GLU A . n 
A 1 252 VAL 252 252 252 VAL VAL A . n 
A 1 253 LYS 253 253 253 LYS LYS A . n 
A 1 254 GLY 254 254 254 GLY GLY A . n 
A 1 255 ARG 255 255 255 ARG ARG A . n 
A 1 256 ILE 256 256 256 ILE ILE A . n 
A 1 257 HIS 257 257 257 HIS HIS A . n 
A 1 258 PHE 258 258 258 PHE PHE A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 LEU 260 260 260 LEU LEU A . n 
A 1 261 TYR 261 261 261 TYR TYR A . n 
A 1 262 PRO 262 262 262 PRO PRO A . n 
A 1 263 VAL 263 263 263 VAL VAL A . n 
A 1 264 ILE 264 264 264 ILE ILE A . n 
A 1 265 ARG 265 265 265 ARG ARG A . n 
A 1 266 ARG 266 266 266 ARG ARG A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 ILE 268 268 268 ILE ILE A . n 
A 1 269 ASN 269 269 269 ASN ASN A . n 
A 1 270 LEU 270 270 270 LEU LEU A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 THR 272 272 272 THR THR A . n 
A 1 273 TYR 273 273 273 TYR TYR A . n 
A 1 274 THR 274 274 274 THR THR A . n 
A 1 275 LEU 275 275 275 LEU LEU A . n 
A 1 276 GLU 276 276 276 GLU GLU A . n 
A 1 277 ALA 277 277 277 ALA ALA A . n 
A 1 278 VAL 278 278 278 VAL VAL A . n 
A 1 279 TYR 279 279 279 TYR TYR A . n 
A 1 280 GLU 280 280 280 GLU GLU A . n 
A 1 281 ALA 281 281 281 ALA ALA A . n 
A 1 282 ILE 282 282 282 ILE ILE A . n 
A 1 283 PHE 283 283 283 PHE PHE A . n 
A 1 284 GLY 284 284 284 GLY GLY A . n 
A 1 285 GLN 285 285 285 GLN GLN A . n 
A 1 286 PRO 286 286 286 PRO PRO A . n 
A 1 287 LYS 287 287 287 LYS LYS A . n 
A 1 288 GLU 288 288 288 GLU GLU A . n 
A 1 289 LYS 289 289 289 LYS LYS A . n 
A 1 290 VAL 290 290 290 VAL VAL A . n 
A 1 291 TYR 291 291 291 TYR TYR A . n 
A 1 292 ALA 292 292 292 ALA ALA A . n 
A 1 293 GLU 293 293 293 GLU GLU A . n 
A 1 294 GLU 294 294 294 GLU GLU A . n 
A 1 295 ILE 295 295 295 ILE ILE A . n 
A 1 296 ALA 296 296 296 ALA ALA A . n 
A 1 297 GLN 297 297 297 GLN GLN A . n 
A 1 298 ALA 298 298 298 ALA ALA A . n 
A 1 299 TRP 299 299 299 TRP TRP A . n 
A 1 300 GLU 300 300 300 GLU GLU A . n 
A 1 301 THR 301 301 301 THR THR A . n 
A 1 302 GLY 302 302 302 GLY GLY A . n 
A 1 303 GLU 303 303 303 GLU GLU A . n 
A 1 304 GLY 304 304 304 GLY GLY A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 ARG 307 307 307 ARG ARG A . n 
A 1 308 VAL 308 308 308 VAL VAL A . n 
A 1 309 ALA 309 309 309 ALA ALA A . n 
A 1 310 ARG 310 310 310 ARG ARG A . n 
A 1 311 TYR 311 311 311 TYR TYR A . n 
A 1 312 SER 312 312 312 SER SER A . n 
A 1 313 MET 313 313 313 MET MET A . n 
A 1 314 GLU 314 314 314 GLU GLU A . n 
A 1 315 ASP 315 315 315 ASP ASP A . n 
A 1 316 ALA 316 316 316 ALA ALA A . n 
A 1 317 LYS 317 317 317 LYS LYS A . n 
A 1 318 VAL 318 318 318 VAL VAL A . n 
A 1 319 THR 319 319 319 THR THR A . n 
A 1 320 TYR 320 320 320 TYR TYR A . n 
A 1 321 GLU 321 321 321 GLU GLU A . n 
A 1 322 LEU 322 322 322 LEU LEU A . n 
A 1 323 GLY 323 323 323 GLY GLY A . n 
A 1 324 LYS 324 324 324 LYS LYS A . n 
A 1 325 GLU 325 325 325 GLU GLU A . n 
A 1 326 PHE 326 326 326 PHE PHE A . n 
A 1 327 PHE 327 327 327 PHE PHE A . n 
A 1 328 PRO 328 328 328 PRO PRO A . n 
A 1 329 MET 329 329 329 MET MET A . n 
A 1 330 GLU 330 330 330 GLU GLU A . n 
A 1 331 ALA 331 331 331 ALA ALA A . n 
A 1 332 GLN 332 332 332 GLN GLN A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 SER 334 334 334 SER SER A . n 
A 1 335 ARG 335 335 335 ARG ARG A . n 
A 1 336 LEU 336 336 336 LEU LEU A . n 
A 1 337 VAL 337 337 337 VAL VAL A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 GLN 339 339 339 GLN GLN A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LEU 341 341 341 LEU LEU A . n 
A 1 342 TRP 342 342 342 TRP TRP A . n 
A 1 343 ASP 343 343 343 ASP ASP A . n 
A 1 344 VAL 344 344 344 VAL VAL A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 ARG 346 346 346 ARG ARG A . n 
A 1 347 SER 347 347 347 SER SER A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 THR 349 349 349 THR THR A . n 
A 1 350 GLY 350 350 350 GLY GLY A . n 
A 1 351 ASN 351 351 351 ASN ASN A . n 
A 1 352 LEU 352 352 352 LEU LEU A . n 
A 1 353 VAL 353 353 353 VAL VAL A . n 
A 1 354 GLU 354 354 354 GLU GLU A . n 
A 1 355 TRP 355 355 355 TRP TRP A . n 
A 1 356 PHE 356 356 356 PHE PHE A . n 
A 1 357 LEU 357 357 357 LEU LEU A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 ARG 359 359 359 ARG ARG A . n 
A 1 360 LYS 360 360 360 LYS LYS A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 TYR 362 362 362 TYR TYR A . n 
A 1 363 GLU 363 363 363 GLU GLU A . n 
A 1 364 ARG 364 364 364 ARG ARG A . n 
A 1 365 ASN 365 365 365 ASN ASN A . n 
A 1 366 GLU 366 366 366 GLU GLU A . n 
A 1 367 LEU 367 367 367 LEU LEU A . n 
A 1 368 ALA 368 368 368 ALA ALA A . n 
A 1 369 PRO 369 369 369 PRO PRO A . n 
A 1 370 ASN 370 370 370 ASN ASN A . n 
A 1 371 LYS 371 371 371 LYS LYS A . n 
A 1 372 PRO 372 372 372 PRO PRO A . n 
A 1 373 ASP 373 373 373 ASP ASP A . n 
A 1 374 GLU 374 374 374 GLU GLU A . n 
A 1 375 ARG 375 375 375 ARG ARG A . n 
A 1 376 GLU 376 376 376 GLU GLU A . n 
A 1 377 LEU 377 377 377 LEU LEU A . n 
A 1 378 ALA 378 378 378 ALA ALA A . n 
A 1 379 ARG 379 379 379 ARG ARG A . n 
A 1 380 ARG 380 380 380 ARG ARG A . n 
A 1 381 ARG 381 381 381 ARG ARG A . n 
A 1 382 GLU 382 382 382 GLU GLU A . n 
A 1 383 SER 383 383 383 SER SER A . n 
A 1 384 TYR 384 384 384 TYR TYR A . n 
A 1 385 ALA 385 385 385 ALA ALA A . n 
A 1 386 GLY 386 386 386 GLY GLY A . n 
A 1 387 GLY 387 387 387 GLY GLY A . n 
A 1 388 TYR 388 388 388 TYR TYR A . n 
A 1 389 VAL 389 389 389 VAL VAL A . n 
A 1 390 LYS 390 390 390 LYS LYS A . n 
A 1 391 GLU 391 391 391 GLU GLU A . n 
A 1 392 PRO 392 392 392 PRO PRO A . n 
A 1 393 GLU 393 393 393 GLU GLU A . n 
A 1 394 ARG 394 394 394 ARG ARG A . n 
A 1 395 GLY 395 395 395 GLY GLY A . n 
A 1 396 LEU 396 396 396 LEU LEU A . n 
A 1 397 TRP 397 397 397 TRP TRP A . n 
A 1 398 GLU 398 398 398 GLU GLU A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 ILE 400 400 400 ILE ILE A . n 
A 1 401 VAL 401 401 401 VAL VAL A . n 
A 1 402 TYR 402 402 402 TYR TYR A . n 
A 1 403 LEU 403 403 403 LEU LEU A . n 
A 1 404 ASP 404 404 404 ASP ASP A . n 
A 1 405 PHE 405 405 405 PHE PHE A . n 
A 1 406 ARG 406 406 406 ARG ARG A . n 
A 1 407 SER 407 407 407 SER SER A . n 
A 1 408 LEU 408 408 408 LEU LEU A . n 
A 1 409 TYR 409 409 409 TYR TYR A . n 
A 1 410 PRO 410 410 410 PRO PRO A . n 
A 1 411 SER 411 411 411 SER SER A . n 
A 1 412 ILE 412 412 412 ILE ILE A . n 
A 1 413 ILE 413 413 413 ILE ILE A . n 
A 1 414 ILE 414 414 414 ILE ILE A . n 
A 1 415 THR 415 415 415 THR THR A . n 
A 1 416 HIS 416 416 416 HIS HIS A . n 
A 1 417 ASN 417 417 417 ASN ASN A . n 
A 1 418 VAL 418 418 418 VAL VAL A . n 
A 1 419 SER 419 419 419 SER SER A . n 
A 1 420 PRO 420 420 420 PRO PRO A . n 
A 1 421 ASP 421 421 421 ASP ASP A . n 
A 1 422 THR 422 422 422 THR THR A . n 
A 1 423 LEU 423 423 423 LEU LEU A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 ARG 425 425 425 ARG ARG A . n 
A 1 426 GLU 426 426 426 GLU GLU A . n 
A 1 427 GLY 427 427 427 GLY GLY A . n 
A 1 428 CYS 428 428 428 CYS CYS A . n 
A 1 429 GLU 429 429 429 GLU GLU A . n 
A 1 430 GLU 430 430 430 GLU GLU A . n 
A 1 431 TYR 431 431 431 TYR TYR A . n 
A 1 432 ASP 432 432 432 ASP ASP A . n 
A 1 433 VAL 433 433 433 VAL VAL A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 PRO 435 435 435 PRO PRO A . n 
A 1 436 GLN 436 436 436 GLN GLN A . n 
A 1 437 VAL 437 437 437 VAL VAL A . n 
A 1 438 GLY 438 438 438 GLY GLY A . n 
A 1 439 HIS 439 439 439 HIS HIS A . n 
A 1 440 LYS 440 440 440 LYS LYS A . n 
A 1 441 PHE 441 441 441 PHE PHE A . n 
A 1 442 CYS 442 442 442 CYS CYS A . n 
A 1 443 LYS 443 443 443 LYS LYS A . n 
A 1 444 ASP 444 444 444 ASP ASP A . n 
A 1 445 PHE 445 445 445 PHE PHE A . n 
A 1 446 PRO 446 446 446 PRO PRO A . n 
A 1 447 GLY 447 447 447 GLY GLY A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 ILE 449 449 449 ILE ILE A . n 
A 1 450 PRO 450 450 450 PRO PRO A . n 
A 1 451 SER 451 451 451 SER SER A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 LEU 453 453 453 LEU LEU A . n 
A 1 454 GLY 454 454 454 GLY GLY A . n 
A 1 455 ASP 455 455 455 ASP ASP A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 LEU 457 457 457 LEU LEU A . n 
A 1 458 GLU 458 458 458 GLU GLU A . n 
A 1 459 GLU 459 459 459 GLU GLU A . n 
A 1 460 ARG 460 460 460 ARG ARG A . n 
A 1 461 GLN 461 461 461 GLN GLN A . n 
A 1 462 LYS 462 462 462 LYS LYS A . n 
A 1 463 VAL 463 463 463 VAL VAL A . n 
A 1 464 LYS 464 464 464 LYS LYS A . n 
A 1 465 LYS 465 465 465 LYS LYS A . n 
A 1 466 LYS 466 466 466 LYS LYS A . n 
A 1 467 MET 467 467 467 MET MET A . n 
A 1 468 LYS 468 468 468 LYS LYS A . n 
A 1 469 ALA 469 469 469 ALA ALA A . n 
A 1 470 THR 470 470 470 THR THR A . n 
A 1 471 ILE 471 471 471 ILE ILE A . n 
A 1 472 ASP 472 472 472 ASP ASP A . n 
A 1 473 PRO 473 473 473 PRO PRO A . n 
A 1 474 ILE 474 474 474 ILE ILE A . n 
A 1 475 GLU 475 475 475 GLU GLU A . n 
A 1 476 LYS 476 476 476 LYS LYS A . n 
A 1 477 LYS 477 477 477 LYS LYS A . n 
A 1 478 LEU 478 478 478 LEU LEU A . n 
A 1 479 LEU 479 479 479 LEU LEU A . n 
A 1 480 ASP 480 480 480 ASP ASP A . n 
A 1 481 TYR 481 481 481 TYR TYR A . n 
A 1 482 ARG 482 482 482 ARG ARG A . n 
A 1 483 GLN 483 483 483 GLN GLN A . n 
A 1 484 ARG 484 484 484 ARG ARG A . n 
A 1 485 ALA 485 485 485 ALA ALA A . n 
A 1 486 ILE 486 486 486 ILE ILE A . n 
A 1 487 LYS 487 487 487 LYS LYS A . n 
A 1 488 ILE 488 488 488 ILE ILE A . n 
A 1 489 LEU 489 489 489 LEU LEU A . n 
A 1 490 ALA 490 490 490 ALA ALA A . n 
A 1 491 ASN 491 491 491 ASN ASN A . n 
A 1 492 SER 492 492 492 SER SER A . n 
A 1 493 PHE 493 493 493 PHE PHE A . n 
A 1 494 TYR 494 494 494 TYR TYR A . n 
A 1 495 GLY 495 495 495 GLY GLY A . n 
A 1 496 TYR 496 496 496 TYR TYR A . n 
A 1 497 TYR 497 497 497 TYR TYR A . n 
A 1 498 GLY 498 498 498 GLY GLY A . n 
A 1 499 TYR 499 499 499 TYR TYR A . n 
A 1 500 ALA 500 500 500 ALA ALA A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 ALA 502 502 502 ALA ALA A . n 
A 1 503 ARG 503 503 503 ARG ARG A . n 
A 1 504 TRP 504 504 504 TRP TRP A . n 
A 1 505 TYR 505 505 505 TYR TYR A . n 
A 1 506 CYS 506 506 506 CYS CYS A . n 
A 1 507 LYS 507 507 507 LYS LYS A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 CYS 509 509 509 CYS CYS A . n 
A 1 510 ALA 510 510 510 ALA ALA A . n 
A 1 511 GLU 511 511 511 GLU GLU A . n 
A 1 512 SER 512 512 512 SER SER A . n 
A 1 513 VAL 513 513 513 VAL VAL A . n 
A 1 514 THR 514 514 514 THR THR A . n 
A 1 515 ALA 515 515 515 ALA ALA A . n 
A 1 516 TRP 516 516 516 TRP TRP A . n 
A 1 517 GLY 517 517 517 GLY GLY A . n 
A 1 518 ARG 518 518 518 ARG ARG A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 TYR 520 520 520 TYR TYR A . n 
A 1 521 ILE 521 521 521 ILE ILE A . n 
A 1 522 GLU 522 522 522 GLU GLU A . n 
A 1 523 THR 523 523 523 THR THR A . n 
A 1 524 THR 524 524 524 THR THR A . n 
A 1 525 ILE 525 525 525 ILE ILE A . n 
A 1 526 ARG 526 526 526 ARG ARG A . n 
A 1 527 GLU 527 527 527 GLU GLU A . n 
A 1 528 ILE 528 528 528 ILE ILE A . n 
A 1 529 GLU 529 529 529 GLU GLU A . n 
A 1 530 GLU 530 530 530 GLU GLU A . n 
A 1 531 LYS 531 531 531 LYS LYS A . n 
A 1 532 PHE 532 532 532 PHE PHE A . n 
A 1 533 GLY 533 533 533 GLY GLY A . n 
A 1 534 PHE 534 534 534 PHE PHE A . n 
A 1 535 LYS 535 535 535 LYS LYS A . n 
A 1 536 VAL 536 536 536 VAL VAL A . n 
A 1 537 LEU 537 537 537 LEU LEU A . n 
A 1 538 TYR 538 538 538 TYR TYR A . n 
A 1 539 ALA 539 539 539 ALA ALA A . n 
A 1 540 ASP 540 540 540 ASP ASP A . n 
A 1 541 THR 541 541 541 THR THR A . n 
A 1 542 ASP 542 542 542 ASP ASP A . n 
A 1 543 GLY 543 543 543 GLY GLY A . n 
A 1 544 PHE 544 544 544 PHE PHE A . n 
A 1 545 PHE 545 545 545 PHE PHE A . n 
A 1 546 ALA 546 546 546 ALA ALA A . n 
A 1 547 THR 547 547 547 THR THR A . n 
A 1 548 ILE 548 548 548 ILE ILE A . n 
A 1 549 PRO 549 549 549 PRO PRO A . n 
A 1 550 GLY 550 550 550 GLY GLY A . n 
A 1 551 ALA 551 551 551 ALA ALA A . n 
A 1 552 ASP 552 552 552 ASP ASP A . n 
A 1 553 ALA 553 553 553 ALA ALA A . n 
A 1 554 GLU 554 554 554 GLU GLU A . n 
A 1 555 THR 555 555 555 THR THR A . n 
A 1 556 VAL 556 556 556 VAL VAL A . n 
A 1 557 LYS 557 557 557 LYS LYS A . n 
A 1 558 LYS 558 558 558 LYS LYS A . n 
A 1 559 LYS 559 559 559 LYS LYS A . n 
A 1 560 ALA 560 560 560 ALA ALA A . n 
A 1 561 LYS 561 561 561 LYS LYS A . n 
A 1 562 GLU 562 562 562 GLU GLU A . n 
A 1 563 PHE 563 563 563 PHE PHE A . n 
A 1 564 LEU 564 564 564 LEU LEU A . n 
A 1 565 ASP 565 565 565 ASP ASP A . n 
A 1 566 TYR 566 566 566 TYR TYR A . n 
A 1 567 ILE 567 567 567 ILE ILE A . n 
A 1 568 ASN 568 568 568 ASN ASN A . n 
A 1 569 ALA 569 569 569 ALA ALA A . n 
A 1 570 LYS 570 570 570 LYS LYS A . n 
A 1 571 LEU 571 571 571 LEU LEU A . n 
A 1 572 PRO 572 572 572 PRO PRO A . n 
A 1 573 GLY 573 573 573 GLY GLY A . n 
A 1 574 LEU 574 574 574 LEU LEU A . n 
A 1 575 LEU 575 575 575 LEU LEU A . n 
A 1 576 GLU 576 576 576 GLU GLU A . n 
A 1 577 LEU 577 577 577 LEU LEU A . n 
A 1 578 GLU 578 578 578 GLU GLU A . n 
A 1 579 TYR 579 579 579 TYR TYR A . n 
A 1 580 GLU 580 580 580 GLU GLU A . n 
A 1 581 GLY 581 581 581 GLY GLY A . n 
A 1 582 PHE 582 582 582 PHE PHE A . n 
A 1 583 TYR 583 583 583 TYR TYR A . n 
A 1 584 LYS 584 584 584 LYS LYS A . n 
A 1 585 ARG 585 585 585 ARG ARG A . n 
A 1 586 GLY 586 586 586 GLY GLY A . n 
A 1 587 PHE 587 587 587 PHE PHE A . n 
A 1 588 PHE 588 588 588 PHE PHE A . n 
A 1 589 VAL 589 589 589 VAL VAL A . n 
A 1 590 THR 590 590 590 THR THR A . n 
A 1 591 LYS 591 591 591 LYS LYS A . n 
A 1 592 LYS 592 592 592 LYS LYS A . n 
A 1 593 LYS 593 593 593 LYS LYS A . n 
A 1 594 TYR 594 594 594 TYR TYR A . n 
A 1 595 ALA 595 595 595 ALA ALA A . n 
A 1 596 VAL 596 596 596 VAL VAL A . n 
A 1 597 ILE 597 597 597 ILE ILE A . n 
A 1 598 ASP 598 598 598 ASP ASP A . n 
A 1 599 GLU 599 599 599 GLU GLU A . n 
A 1 600 GLU 600 600 600 GLU GLU A . n 
A 1 601 ASP 601 601 601 ASP ASP A . n 
A 1 602 LYS 602 602 602 LYS LYS A . n 
A 1 603 ILE 603 603 603 ILE ILE A . n 
A 1 604 THR 604 604 604 THR THR A . n 
A 1 605 THR 605 605 605 THR THR A . n 
A 1 606 ARG 606 606 606 ARG ARG A . n 
A 1 607 GLY 607 607 607 GLY GLY A . n 
A 1 608 LEU 608 608 608 LEU LEU A . n 
A 1 609 GLU 609 609 609 GLU GLU A . n 
A 1 610 ILE 610 610 610 ILE ILE A . n 
A 1 611 VAL 611 611 611 VAL VAL A . n 
A 1 612 ARG 612 612 612 ARG ARG A . n 
A 1 613 ARG 613 613 613 ARG ARG A . n 
A 1 614 ASP 614 614 614 ASP ASP A . n 
A 1 615 TRP 615 615 615 TRP TRP A . n 
A 1 616 SER 616 616 616 SER SER A . n 
A 1 617 GLU 617 617 617 GLU GLU A . n 
A 1 618 ILE 618 618 618 ILE ILE A . n 
A 1 619 ALA 619 619 619 ALA ALA A . n 
A 1 620 LYS 620 620 620 LYS LYS A . n 
A 1 621 GLU 621 621 621 GLU GLU A . n 
A 1 622 THR 622 622 622 THR THR A . n 
A 1 623 GLN 623 623 623 GLN GLN A . n 
A 1 624 ALA 624 624 624 ALA ALA A . n 
A 1 625 ARG 625 625 625 ARG ARG A . n 
A 1 626 VAL 626 626 626 VAL VAL A . n 
A 1 627 LEU 627 627 627 LEU LEU A . n 
A 1 628 GLU 628 628 628 GLU GLU A . n 
A 1 629 ALA 629 629 629 ALA ALA A . n 
A 1 630 ILE 630 630 630 ILE ILE A . n 
A 1 631 LEU 631 631 631 LEU LEU A . n 
A 1 632 LYS 632 632 632 LYS LYS A . n 
A 1 633 HIS 633 633 633 HIS HIS A . n 
A 1 634 GLY 634 634 634 GLY GLY A . n 
A 1 635 ASP 635 635 635 ASP ASP A . n 
A 1 636 VAL 636 636 636 VAL VAL A . n 
A 1 637 GLU 637 637 637 GLU GLU A . n 
A 1 638 GLU 638 638 638 GLU GLU A . n 
A 1 639 ALA 639 639 639 ALA ALA A . n 
A 1 640 VAL 640 640 640 VAL VAL A . n 
A 1 641 ARG 641 641 641 ARG ARG A . n 
A 1 642 ILE 642 642 642 ILE ILE A . n 
A 1 643 VAL 643 643 643 VAL VAL A . n 
A 1 644 LYS 644 644 644 LYS LYS A . n 
A 1 645 GLU 645 645 645 GLU GLU A . n 
A 1 646 VAL 646 646 646 VAL VAL A . n 
A 1 647 THR 647 647 647 THR THR A . n 
A 1 648 GLU 648 648 648 GLU GLU A . n 
A 1 649 LYS 649 649 649 LYS LYS A . n 
A 1 650 LEU 650 650 650 LEU LEU A . n 
A 1 651 SER 651 651 651 SER SER A . n 
A 1 652 LYS 652 652 652 LYS LYS A . n 
A 1 653 TYR 653 653 653 TYR TYR A . n 
A 1 654 GLU 654 654 654 GLU GLU A . n 
A 1 655 VAL 655 655 655 VAL VAL A . n 
A 1 656 PRO 656 656 656 PRO PRO A . n 
A 1 657 PRO 657 657 657 PRO PRO A . n 
A 1 658 GLU 658 658 658 GLU GLU A . n 
A 1 659 LYS 659 659 659 LYS LYS A . n 
A 1 660 LEU 660 660 660 LEU LEU A . n 
A 1 661 VAL 661 661 661 VAL VAL A . n 
A 1 662 ILE 662 662 662 ILE ILE A . n 
A 1 663 TYR 663 663 663 TYR TYR A . n 
A 1 664 GLU 664 664 664 GLU GLU A . n 
A 1 665 GLN 665 665 665 GLN GLN A . n 
A 1 666 ILE 666 666 666 ILE ILE A . n 
A 1 667 THR 667 667 667 THR THR A . n 
A 1 668 ARG 668 668 668 ARG ARG A . n 
A 1 669 ASP 669 669 669 ASP ASP A . n 
A 1 670 LEU 670 670 670 LEU LEU A . n 
A 1 671 LYS 671 671 671 LYS LYS A . n 
A 1 672 ASP 672 672 672 ASP ASP A . n 
A 1 673 TYR 673 673 673 TYR TYR A . n 
A 1 674 LYS 674 674 674 LYS LYS A . n 
A 1 675 ALA 675 675 675 ALA ALA A . n 
A 1 676 THR 676 676 676 THR THR A . n 
A 1 677 GLY 677 677 677 GLY GLY A . n 
A 1 678 PRO 678 678 678 PRO PRO A . n 
A 1 679 HIS 679 679 679 HIS HIS A . n 
A 1 680 VAL 680 680 680 VAL VAL A . n 
A 1 681 ALA 681 681 681 ALA ALA A . n 
A 1 682 VAL 682 682 682 VAL VAL A . n 
A 1 683 ALA 683 683 683 ALA ALA A . n 
A 1 684 LYS 684 684 684 LYS LYS A . n 
A 1 685 ARG 685 685 685 ARG ARG A . n 
A 1 686 LEU 686 686 686 LEU LEU A . n 
A 1 687 ALA 687 687 687 ALA ALA A . n 
A 1 688 ALA 688 688 688 ALA ALA A . n 
A 1 689 ARG 689 689 689 ARG ARG A . n 
A 1 690 GLY 690 690 690 GLY GLY A . n 
A 1 691 ILE 691 691 691 ILE ILE A . n 
A 1 692 LYS 692 692 692 LYS LYS A . n 
A 1 693 ILE 693 693 693 ILE ILE A . n 
A 1 694 ARG 694 694 694 ARG ARG A . n 
A 1 695 PRO 695 695 695 PRO PRO A . n 
A 1 696 GLY 696 696 696 GLY GLY A . n 
A 1 697 THR 697 697 697 THR THR A . n 
A 1 698 VAL 698 698 698 VAL VAL A . n 
A 1 699 ILE 699 699 699 ILE ILE A . n 
A 1 700 SER 700 700 700 SER SER A . n 
A 1 701 TYR 701 701 701 TYR TYR A . n 
A 1 702 ILE 702 702 702 ILE ILE A . n 
A 1 703 VAL 703 703 703 VAL VAL A . n 
A 1 704 LEU 704 704 704 LEU LEU A . n 
A 1 705 LYS 705 705 705 LYS LYS A . n 
A 1 706 GLY 706 706 706 GLY GLY A . n 
A 1 707 SER 707 707 707 SER SER A . n 
A 1 708 GLY 708 708 708 GLY GLY A . n 
A 1 709 ARG 709 709 709 ARG ARG A . n 
A 1 710 ILE 710 710 710 ILE ILE A . n 
A 1 711 GLY 711 711 711 GLY GLY A . n 
A 1 712 ASP 712 712 712 ASP ASP A . n 
A 1 713 ARG 713 713 713 ARG ARG A . n 
A 1 714 ALA 714 714 714 ALA ALA A . n 
A 1 715 ILE 715 715 715 ILE ILE A . n 
A 1 716 PRO 716 716 716 PRO PRO A . n 
A 1 717 PHE 717 717 717 PHE PHE A . n 
A 1 718 ASP 718 718 718 ASP ASP A . n 
A 1 719 GLU 719 719 719 GLU GLU A . n 
A 1 720 PHE 720 720 720 PHE PHE A . n 
A 1 721 ASP 721 721 721 ASP ASP A . n 
A 1 722 PRO 722 722 722 PRO PRO A . n 
A 1 723 ALA 723 723 723 ALA ALA A . n 
A 1 724 LYS 724 724 724 LYS LYS A . n 
A 1 725 HIS 725 725 725 HIS HIS A . n 
A 1 726 LYS 726 726 726 LYS LYS A . n 
A 1 727 TYR 727 727 727 TYR TYR A . n 
A 1 728 ASP 728 728 728 ASP ASP A . n 
A 1 729 ALA 729 729 729 ALA ALA A . n 
A 1 730 GLU 730 730 730 GLU GLU A . n 
A 1 731 TYR 731 731 731 TYR TYR A . n 
A 1 732 TYR 732 732 732 TYR TYR A . n 
A 1 733 ILE 733 733 733 ILE ILE A . n 
A 1 734 GLU 734 734 734 GLU GLU A . n 
A 1 735 ASN 735 735 735 ASN ASN A . n 
A 1 736 GLN 736 736 736 GLN GLN A . n 
A 1 737 VAL 737 737 737 VAL VAL A . n 
A 1 738 LEU 738 738 738 LEU LEU A . n 
A 1 739 PRO 739 739 739 PRO PRO A . n 
A 1 740 ALA 740 740 740 ALA ALA A . n 
A 1 741 VAL 741 741 741 VAL VAL A . n 
A 1 742 GLU 742 742 742 GLU GLU A . n 
A 1 743 ARG 743 743 743 ARG ARG A . n 
A 1 744 ILE 744 744 744 ILE ILE A . n 
A 1 745 LEU 745 745 745 LEU LEU A . n 
A 1 746 ARG 746 746 746 ARG ARG A . n 
A 1 747 ALA 747 747 747 ALA ALA A . n 
A 1 748 PHE 748 748 748 PHE PHE A . n 
A 1 749 GLY 749 749 749 GLY GLY A . n 
A 1 750 TYR 750 750 750 TYR TYR A . n 
A 1 751 ARG 751 751 751 ARG ARG A . n 
A 1 752 LYS 752 752 752 LYS LYS A . n 
A 1 753 GLU 753 753 753 GLU GLU A . n 
A 1 754 ASP 754 754 754 ASP ASP A . n 
A 1 755 LEU 755 755 755 LEU LEU A . n 
A 1 756 ARG 756 756 756 ARG ARG A . n 
A 1 757 TYR 757 757 757 TYR TYR A . n 
A 1 758 GLN 758 758 ?   ?   ?   A . n 
A 1 759 LYS 759 759 ?   ?   ?   A . n 
A 1 760 THR 760 760 ?   ?   ?   A . n 
A 1 761 ARG 761 761 ?   ?   ?   A . n 
A 1 762 GLN 762 762 ?   ?   ?   A . n 
A 1 763 VAL 763 763 ?   ?   ?   A . n 
A 1 764 GLY 764 764 ?   ?   ?   A . n 
A 1 765 LEU 765 765 ?   ?   ?   A . n 
A 1 766 GLY 766 766 ?   ?   ?   A . n 
A 1 767 ALA 767 767 ?   ?   ?   A . n 
A 1 768 TRP 768 768 ?   ?   ?   A . n 
A 1 769 LEU 769 769 ?   ?   ?   A . n 
A 1 770 LYS 770 770 ?   ?   ?   A . n 
A 1 771 PRO 771 771 ?   ?   ?   A . n 
A 1 772 LYS 772 772 ?   ?   ?   A . n 
A 1 773 THR 773 773 ?   ?   ?   A . n 
B 2 1   DA  1   0   0   DA  DA  B . n 
B 2 2   DA  2   1   1   DA  DA  B . n 
B 2 3   DU  3   2   2   DU  DU  B . n 
B 2 4   DG  4   3   3   DG  DG  B . n 
B 2 5   DG  5   4   4   DG  DG  B . n 
B 2 6   DA  6   5   5   DA  DA  B . n 
B 2 7   DG  7   6   6   DG  DG  B . n 
B 2 8   DA  8   7   7   DA  DA  B . n 
B 2 9   DC  9   8   8   DC  DC  B . n 
B 2 10  DA  10  9   9   DA  DA  B . n 
B 2 11  DC  11  10  10  DC  DC  B . n 
B 2 12  DG  12  11  11  DG  DG  B . n 
B 2 13  DG  13  12  12  DG  DG  B . n 
B 2 14  DC  14  13  13  DC  DC  B . n 
B 2 15  DT  15  14  14  DT  DT  B . n 
B 2 16  DT  16  15  15  DT  DT  B . n 
B 2 17  DT  17  16  16  DT  DT  B . n 
B 2 18  DT  18  17  17  DT  DT  B . n 
B 2 19  DG  19  18  18  DG  DG  B . n 
B 2 20  DC  20  19  19  DC  DC  B . n 
B 2 21  DC  21  20  20  DC  DC  B . n 
B 2 22  DG  22  21  21  DG  DG  B . n 
B 2 23  DT  23  22  22  DT  DT  B . n 
B 2 24  DG  24  23  23  DG  DG  B . n 
B 2 25  DT  25  24  24  DT  DT  B . n 
B 2 26  DC  26  25  25  DC  DC  B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 K   1 1758 1758 K   K   A . 
D 3 K   1 1759 1759 K   K   A . 
E 3 K   1 1760 1760 K   K   A . 
F 4 HOH 1 2001 2001 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3670  ? 
1 MORE         -10.1 ? 
1 'SSA (A^2)'  37090 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A GLY 573 ? A GLY 573  ? 1_555 K ? C K . ? A K 1758 ? 1_555 O ? F HOH .   ? A HOH 2001 ? 1_555 72.5  ? 
2  O   ? A GLY 573 ? A GLY 573  ? 1_555 K ? C K . ? A K 1758 ? 1_555 O ? A ASN 568 ? A ASN 568  ? 1_555 156.0 ? 
3  O   ? F HOH .   ? A HOH 2001 ? 1_555 K ? C K . ? A K 1758 ? 1_555 O ? A ASN 568 ? A ASN 568  ? 1_555 87.0  ? 
4  O   ? A GLY 573 ? A GLY 573  ? 1_555 K ? C K . ? A K 1758 ? 1_555 O ? A LEU 571 ? A LEU 571  ? 1_555 98.0  ? 
5  O   ? F HOH .   ? A HOH 2001 ? 1_555 K ? C K . ? A K 1758 ? 1_555 O ? A LEU 571 ? A LEU 571  ? 1_555 149.9 ? 
6  O   ? A ASN 568 ? A ASN 568  ? 1_555 K ? C K . ? A K 1758 ? 1_555 O ? A LEU 571 ? A LEU 571  ? 1_555 93.5  ? 
7  O   ? A GLY 573 ? A GLY 573  ? 1_555 K ? C K . ? A K 1758 ? 1_555 O ? A LEU 575 ? A LEU 575  ? 1_555 109.0 ? 
8  O   ? F HOH .   ? A HOH 2001 ? 1_555 K ? C K . ? A K 1758 ? 1_555 O ? A LEU 575 ? A LEU 575  ? 1_555 108.2 ? 
9  O   ? A ASN 568 ? A ASN 568  ? 1_555 K ? C K . ? A K 1758 ? 1_555 O ? A LEU 575 ? A LEU 575  ? 1_555 89.0  ? 
10 O   ? A LEU 571 ? A LEU 571  ? 1_555 K ? C K . ? A K 1758 ? 1_555 O ? A LEU 575 ? A LEU 575  ? 1_555 101.9 ? 
11 NE1 ? A TRP 615 ? A TRP 615  ? 1_555 K ? D K . ? A K 1759 ? 1_555 O ? A TYR 663 ? A TYR 663  ? 1_555 141.9 ? 
12 NE1 ? A TRP 615 ? A TRP 615  ? 1_555 K ? D K . ? A K 1759 ? 1_555 O ? A ARG 613 ? A ARG 613  ? 1_555 80.6  ? 
13 O   ? A TYR 663 ? A TYR 663  ? 1_555 K ? D K . ? A K 1759 ? 1_555 O ? A ARG 613 ? A ARG 613  ? 1_555 108.8 ? 
14 O   ? A LYS 101 ? A LYS 101  ? 1_555 K ? E K . ? A K 1760 ? 1_555 O ? A HIS 103 ? A HIS 103  ? 1_555 67.5  ? 
15 O   ? A LYS 101 ? A LYS 101  ? 1_555 K ? E K . ? A K 1760 ? 1_555 O ? A VAL 106 ? A VAL 106  ? 1_555 82.7  ? 
16 O   ? A HIS 103 ? A HIS 103  ? 1_555 K ? E K . ? A K 1760 ? 1_555 O ? A VAL 106 ? A VAL 106  ? 1_555 73.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-07-22 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0019 ? 1 
MOSFLM 'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
PHASER phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id             2VWJ 
_pdbx_entry_details.compound_details     'ENGINEERED RESIDUE IN CHAIN A, ASP 215 TO ALA' 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'MUTATION OF D215 TO ALANINE TO REMOVE EXONUCLEASE ACTIVITY.' 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OG 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   SER 
_pdbx_validate_close_contact.auth_seq_id_1    419 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   OD1 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   ASP 
_pdbx_validate_close_contact.auth_seq_id_2    421 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.08 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 "O3'" B DU 2 ? ? "C3'" B DU 2 ? ? 1.378 1.419 -0.041 0.006 N 
2 1 C4    B DU 2 ? ? O4    B DU 2 ? ? 1.328 1.232 0.096  0.008 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CA    A LEU 336 ? ? CB    A LEU 336 ? ? CG    A LEU 336 ? ? 129.32 115.30 14.02 2.30 N 
2  1 N1    B DU  2   ? ? C2    B DU  2   ? ? N3    B DU  2   ? ? 119.02 114.90 4.12  0.60 N 
3  1 C2    B DU  2   ? ? N3    B DU  2   ? ? C4    B DU  2   ? ? 119.59 127.00 -7.41 0.60 N 
4  1 N3    B DU  2   ? ? C4    B DU  2   ? ? C5    B DU  2   ? ? 121.95 114.60 7.35  0.60 N 
5  1 N1    B DU  2   ? ? C2    B DU  2   ? ? O2    B DU  2   ? ? 117.80 122.80 -5.00 0.70 N 
6  1 C5    B DU  2   ? ? C4    B DU  2   ? ? O4    B DU  2   ? ? 119.13 125.90 -6.77 0.60 N 
7  1 "O4'" B DG  3   ? ? "C4'" B DG  3   ? ? "C3'" B DG  3   ? ? 102.01 104.50 -2.49 0.40 N 
8  1 "O4'" B DG  3   ? ? "C1'" B DG  3   ? ? N9    B DG  3   ? ? 113.63 108.30 5.33  0.30 N 
9  1 "C1'" B DG  4   ? ? "O4'" B DG  4   ? ? "C4'" B DG  4   ? ? 102.75 110.10 -7.35 1.00 N 
10 1 "O4'" B DG  4   ? ? "C1'" B DG  4   ? ? N9    B DG  4   ? ? 110.47 108.30 2.17  0.30 N 
11 1 "O4'" B DC  8   ? ? "C1'" B DC  8   ? ? N1    B DC  8   ? ? 110.11 108.30 1.81  0.30 N 
12 1 "O4'" B DA  9   ? ? "C1'" B DA  9   ? ? N9    B DA  9   ? ? 112.03 108.30 3.73  0.30 N 
13 1 "O4'" B DC  10  ? ? "C1'" B DC  10  ? ? N1    B DC  10  ? ? 110.29 108.30 1.99  0.30 N 
14 1 "O4'" B DG  12  ? ? "C1'" B DG  12  ? ? N9    B DG  12  ? ? 111.78 108.30 3.48  0.30 N 
15 1 "O4'" B DC  13  ? ? "C1'" B DC  13  ? ? N1    B DC  13  ? ? 111.47 108.30 3.17  0.30 N 
16 1 "C3'" B DT  15  ? ? "O3'" B DT  15  ? ? P     B DT  16  ? ? 128.13 119.70 8.43  1.20 Y 
17 1 "C3'" B DT  16  ? ? "O3'" B DT  16  ? ? P     B DT  17  ? ? 129.16 119.70 9.46  1.20 Y 
18 1 "O4'" B DG  18  ? ? "C1'" B DG  18  ? ? N9    B DG  18  ? ? 110.64 108.30 2.34  0.30 N 
19 1 "O4'" B DC  19  ? ? "C1'" B DC  19  ? ? N1    B DC  19  ? ? 110.92 108.30 2.62  0.30 N 
20 1 "C1'" B DT  22  ? ? "O4'" B DT  22  ? ? "C4'" B DT  22  ? ? 104.01 110.10 -6.09 1.00 N 
21 1 "O4'" B DT  22  ? ? "C1'" B DT  22  ? ? N1    B DT  22  ? ? 111.56 108.30 3.26  0.30 N 
22 1 "C3'" B DG  23  ? ? "C2'" B DG  23  ? ? "C1'" B DG  23  ? ? 94.95  102.40 -7.45 0.80 N 
23 1 "O4'" B DG  23  ? ? "C1'" B DG  23  ? ? N9    B DG  23  ? ? 110.24 108.30 1.94  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 45  ? ? -57.65  -2.98   
2  1 ALA A 47  ? ? -56.79  5.06    
3  1 LYS A 52  ? ? -54.62  15.41   
4  1 LYS A 53  ? ? -144.49 11.86   
5  1 VAL A 66  ? ? -33.20  -19.80  
6  1 ARG A 67  ? ? 176.92  145.33  
7  1 PRO A 90  ? ? -28.49  -54.21  
8  1 PRO A 94  ? ? -68.57  7.39    
9  1 ARG A 97  ? ? -49.11  -71.07  
10 1 HIS A 103 ? ? -37.90  126.14  
11 1 ASP A 113 ? ? -144.21 29.82   
12 1 PRO A 115 ? ? -38.81  119.92  
13 1 GLU A 133 ? ? -26.16  122.67  
14 1 TRP A 173 ? ? -101.06 65.78   
15 1 ARG A 174 ? ? -176.40 128.98  
16 1 ASP A 177 ? ? -112.08 58.14   
17 1 ASP A 202 ? ? 38.41   56.50   
18 1 PHE A 214 ? ? -109.08 -90.79  
19 1 THR A 272 ? ? -129.21 -60.15  
20 1 GLN A 297 ? ? -52.63  -77.48  
21 1 PRO A 369 ? ? -45.88  158.01  
22 1 SER A 383 ? ? -97.64  44.25   
23 1 ASN A 399 ? ? 43.42   73.03   
24 1 ASN A 424 ? ? 32.84   50.44   
25 1 GLN A 436 ? ? 65.87   -38.63  
26 1 TRP A 504 ? ? -91.13  38.13   
27 1 CYS A 506 ? ? -168.06 104.78  
28 1 ASP A 540 ? ? -116.94 -163.52 
29 1 PRO A 549 ? ? -35.67  122.85  
30 1 LYS A 591 ? ? -38.34  -30.58  
31 1 ASP A 601 ? ? 82.22   9.70    
32 1 ASP A 614 ? ? -91.89  57.13   
33 1 LYS A 652 ? ? -95.34  41.04   
34 1 TYR A 653 ? ? 22.21   47.11   
35 1 PRO A 656 ? ? -36.27  113.05  
36 1 LYS A 659 ? ? -56.87  -1.49   
37 1 GLN A 736 ? ? -103.51 -67.96  
38 1 GLU A 753 ? ? -32.42  -37.10  
39 1 ARG A 756 ? ? -65.08  -173.59 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A LYS 13  ? CE  ? A LYS 13  CE  
2   1 Y 1 A LYS 13  ? NZ  ? A LYS 13  NZ  
3   1 Y 1 A LYS 27  ? CE  ? A LYS 27  CE  
4   1 Y 1 A LYS 27  ? NZ  ? A LYS 27  NZ  
5   1 Y 1 A LYS 43  ? CE  ? A LYS 43  CE  
6   1 Y 1 A LYS 43  ? NZ  ? A LYS 43  NZ  
7   1 Y 1 A LYS 52  ? CE  ? A LYS 52  CE  
8   1 Y 1 A LYS 52  ? NZ  ? A LYS 52  NZ  
9   1 Y 1 A LYS 53  ? CG  ? A LYS 53  CG  
10  1 Y 1 A LYS 53  ? CD  ? A LYS 53  CD  
11  1 Y 1 A LYS 53  ? CE  ? A LYS 53  CE  
12  1 Y 1 A LYS 53  ? NZ  ? A LYS 53  NZ  
13  1 Y 1 A GLU 57  ? CG  ? A GLU 57  CG  
14  1 Y 1 A GLU 57  ? CD  ? A GLU 57  CD  
15  1 Y 1 A GLU 57  ? OE1 ? A GLU 57  OE1 
16  1 Y 1 A GLU 57  ? OE2 ? A GLU 57  OE2 
17  1 Y 1 A ARG 58  ? CG  ? A ARG 58  CG  
18  1 Y 1 A ARG 58  ? CD  ? A ARG 58  CD  
19  1 Y 1 A ARG 58  ? NE  ? A ARG 58  NE  
20  1 Y 1 A ARG 58  ? CZ  ? A ARG 58  CZ  
21  1 Y 1 A ARG 58  ? NH1 ? A ARG 58  NH1 
22  1 Y 1 A ARG 58  ? NH2 ? A ARG 58  NH2 
23  1 Y 1 A HIS 59  ? CG  ? A HIS 59  CG  
24  1 Y 1 A HIS 59  ? ND1 ? A HIS 59  ND1 
25  1 Y 1 A HIS 59  ? CD2 ? A HIS 59  CD2 
26  1 Y 1 A HIS 59  ? CE1 ? A HIS 59  CE1 
27  1 Y 1 A HIS 59  ? NE2 ? A HIS 59  NE2 
28  1 Y 1 A ARG 64  ? CG  ? A ARG 64  CG  
29  1 Y 1 A ARG 64  ? CD  ? A ARG 64  CD  
30  1 Y 1 A ARG 64  ? NE  ? A ARG 64  NE  
31  1 Y 1 A ARG 64  ? CZ  ? A ARG 64  CZ  
32  1 Y 1 A ARG 64  ? NH1 ? A ARG 64  NH1 
33  1 Y 1 A ARG 64  ? NH2 ? A ARG 64  NH2 
34  1 Y 1 A LYS 72  ? CG  ? A LYS 72  CG  
35  1 Y 1 A LYS 72  ? CD  ? A LYS 72  CD  
36  1 Y 1 A LYS 72  ? CE  ? A LYS 72  CE  
37  1 Y 1 A LYS 72  ? NZ  ? A LYS 72  NZ  
38  1 Y 1 A ARG 78  ? CD  ? A ARG 78  CD  
39  1 Y 1 A ARG 78  ? NE  ? A ARG 78  NE  
40  1 Y 1 A ARG 78  ? CZ  ? A ARG 78  CZ  
41  1 Y 1 A ARG 78  ? NH1 ? A ARG 78  NH1 
42  1 Y 1 A ARG 78  ? NH2 ? A ARG 78  NH2 
43  1 Y 1 A LYS 99  ? CG  ? A LYS 99  CG  
44  1 Y 1 A LYS 99  ? CD  ? A LYS 99  CD  
45  1 Y 1 A LYS 99  ? CE  ? A LYS 99  CE  
46  1 Y 1 A LYS 99  ? NZ  ? A LYS 99  NZ  
47  1 Y 1 A ASP 132 ? CG  ? A ASP 132 CG  
48  1 Y 1 A ASP 132 ? OD1 ? A ASP 132 OD1 
49  1 Y 1 A ASP 132 ? OD2 ? A ASP 132 OD2 
50  1 Y 1 A GLU 134 ? CD  ? A GLU 134 CD  
51  1 Y 1 A GLU 134 ? OE1 ? A GLU 134 OE1 
52  1 Y 1 A GLU 134 ? OE2 ? A GLU 134 OE2 
53  1 Y 1 A LYS 151 ? CG  ? A LYS 151 CG  
54  1 Y 1 A LYS 151 ? CD  ? A LYS 151 CD  
55  1 Y 1 A LYS 151 ? CE  ? A LYS 151 CE  
56  1 Y 1 A LYS 151 ? NZ  ? A LYS 151 NZ  
57  1 Y 1 A ARG 174 ? CD  ? A ARG 174 CD  
58  1 Y 1 A ARG 174 ? NE  ? A ARG 174 NE  
59  1 Y 1 A ARG 174 ? CZ  ? A ARG 174 CZ  
60  1 Y 1 A ARG 174 ? NH1 ? A ARG 174 NH1 
61  1 Y 1 A ARG 174 ? NH2 ? A ARG 174 NH2 
62  1 Y 1 A LYS 221 ? CD  ? A LYS 221 CD  
63  1 Y 1 A LYS 221 ? CE  ? A LYS 221 CE  
64  1 Y 1 A LYS 221 ? NZ  ? A LYS 221 NZ  
65  1 Y 1 A LYS 225 ? CD  ? A LYS 225 CD  
66  1 Y 1 A LYS 225 ? CE  ? A LYS 225 CE  
67  1 Y 1 A LYS 225 ? NZ  ? A LYS 225 NZ  
68  1 Y 1 A LYS 229 ? CD  ? A LYS 229 CD  
69  1 Y 1 A LYS 229 ? CE  ? A LYS 229 CE  
70  1 Y 1 A LYS 229 ? NZ  ? A LYS 229 NZ  
71  1 Y 1 A ARG 243 ? CD  ? A ARG 243 CD  
72  1 Y 1 A ARG 243 ? NE  ? A ARG 243 NE  
73  1 Y 1 A ARG 243 ? CZ  ? A ARG 243 CZ  
74  1 Y 1 A ARG 243 ? NH1 ? A ARG 243 NH1 
75  1 Y 1 A ARG 243 ? NH2 ? A ARG 243 NH2 
76  1 Y 1 A ASP 246 ? CG  ? A ASP 246 CG  
77  1 Y 1 A ASP 246 ? OD1 ? A ASP 246 OD1 
78  1 Y 1 A ASP 246 ? OD2 ? A ASP 246 OD2 
79  1 Y 1 A ARG 247 ? CD  ? A ARG 247 CD  
80  1 Y 1 A ARG 247 ? NE  ? A ARG 247 NE  
81  1 Y 1 A ARG 247 ? CZ  ? A ARG 247 CZ  
82  1 Y 1 A ARG 247 ? NH1 ? A ARG 247 NH1 
83  1 Y 1 A ARG 247 ? NH2 ? A ARG 247 NH2 
84  1 Y 1 A LYS 289 ? CE  ? A LYS 289 CE  
85  1 Y 1 A LYS 289 ? NZ  ? A LYS 289 NZ  
86  1 Y 1 A GLU 303 ? CB  ? A GLU 303 CB  
87  1 Y 1 A GLU 303 ? CG  ? A GLU 303 CG  
88  1 Y 1 A GLU 303 ? CD  ? A GLU 303 CD  
89  1 Y 1 A GLU 303 ? OE1 ? A GLU 303 OE1 
90  1 Y 1 A GLU 303 ? OE2 ? A GLU 303 OE2 
91  1 Y 1 A ARG 310 ? CD  ? A ARG 310 CD  
92  1 Y 1 A ARG 310 ? NE  ? A ARG 310 NE  
93  1 Y 1 A ARG 310 ? CZ  ? A ARG 310 CZ  
94  1 Y 1 A ARG 310 ? NH1 ? A ARG 310 NH1 
95  1 Y 1 A ARG 310 ? NH2 ? A ARG 310 NH2 
96  1 Y 1 A GLU 374 ? CG  ? A GLU 374 CG  
97  1 Y 1 A GLU 374 ? CD  ? A GLU 374 CD  
98  1 Y 1 A GLU 374 ? OE1 ? A GLU 374 OE1 
99  1 Y 1 A GLU 374 ? OE2 ? A GLU 374 OE2 
100 1 Y 1 A GLN 436 ? CD  ? A GLN 436 CD  
101 1 Y 1 A GLN 436 ? OE1 ? A GLN 436 OE1 
102 1 Y 1 A GLN 436 ? NE2 ? A GLN 436 NE2 
103 1 Y 1 A LYS 464 ? NZ  ? A LYS 464 NZ  
104 1 Y 1 A LYS 501 ? CE  ? A LYS 501 CE  
105 1 Y 1 A LYS 501 ? NZ  ? A LYS 501 NZ  
106 1 Y 1 A LYS 507 ? CE  ? A LYS 507 CE  
107 1 Y 1 A LYS 507 ? NZ  ? A LYS 507 NZ  
108 1 Y 1 A GLU 554 ? CD  ? A GLU 554 CD  
109 1 Y 1 A GLU 554 ? OE1 ? A GLU 554 OE1 
110 1 Y 1 A GLU 554 ? OE2 ? A GLU 554 OE2 
111 1 Y 1 A LYS 558 ? CD  ? A LYS 558 CD  
112 1 Y 1 A LYS 558 ? CE  ? A LYS 558 CE  
113 1 Y 1 A LYS 558 ? NZ  ? A LYS 558 NZ  
114 1 Y 1 A LYS 584 ? CE  ? A LYS 584 CE  
115 1 Y 1 A LYS 584 ? NZ  ? A LYS 584 NZ  
116 1 Y 1 A LYS 592 ? CD  ? A LYS 592 CD  
117 1 Y 1 A LYS 592 ? CE  ? A LYS 592 CE  
118 1 Y 1 A LYS 592 ? NZ  ? A LYS 592 NZ  
119 1 Y 1 A LYS 602 ? CG  ? A LYS 602 CG  
120 1 Y 1 A LYS 602 ? CD  ? A LYS 602 CD  
121 1 Y 1 A LYS 602 ? CE  ? A LYS 602 CE  
122 1 Y 1 A LYS 602 ? NZ  ? A LYS 602 NZ  
123 1 Y 1 A GLU 617 ? CD  ? A GLU 617 CD  
124 1 Y 1 A GLU 617 ? OE1 ? A GLU 617 OE1 
125 1 Y 1 A GLU 617 ? OE2 ? A GLU 617 OE2 
126 1 Y 1 A LYS 620 ? CE  ? A LYS 620 CE  
127 1 Y 1 A LYS 620 ? NZ  ? A LYS 620 NZ  
128 1 Y 1 A LYS 671 ? CD  ? A LYS 671 CD  
129 1 Y 1 A LYS 671 ? CE  ? A LYS 671 CE  
130 1 Y 1 A LYS 671 ? NZ  ? A LYS 671 NZ  
131 1 Y 1 A LYS 674 ? CD  ? A LYS 674 CD  
132 1 Y 1 A LYS 674 ? CE  ? A LYS 674 CE  
133 1 Y 1 A LYS 674 ? NZ  ? A LYS 674 NZ  
134 1 Y 1 A LYS 724 ? CG  ? A LYS 724 CG  
135 1 Y 1 A LYS 724 ? CD  ? A LYS 724 CD  
136 1 Y 1 A LYS 724 ? CE  ? A LYS 724 CE  
137 1 Y 1 A LYS 724 ? NZ  ? A LYS 724 NZ  
138 1 Y 1 A ARG 751 ? CD  ? A ARG 751 CD  
139 1 Y 1 A ARG 751 ? NE  ? A ARG 751 NE  
140 1 Y 1 A ARG 751 ? CZ  ? A ARG 751 CZ  
141 1 Y 1 A ARG 751 ? NH1 ? A ARG 751 NH1 
142 1 Y 1 A ARG 751 ? NH2 ? A ARG 751 NH2 
143 1 Y 1 A LYS 752 ? CG  ? A LYS 752 CG  
144 1 Y 1 A LYS 752 ? CD  ? A LYS 752 CD  
145 1 Y 1 A LYS 752 ? CE  ? A LYS 752 CE  
146 1 Y 1 A LYS 752 ? NZ  ? A LYS 752 NZ  
147 1 Y 1 B DA  0   ? N9  ? B DA  1   N9  
148 1 Y 1 B DA  0   ? C8  ? B DA  1   C8  
149 1 Y 1 B DA  0   ? N7  ? B DA  1   N7  
150 1 Y 1 B DA  0   ? C5  ? B DA  1   C5  
151 1 Y 1 B DA  0   ? C6  ? B DA  1   C6  
152 1 Y 1 B DA  0   ? N6  ? B DA  1   N6  
153 1 Y 1 B DA  0   ? N1  ? B DA  1   N1  
154 1 Y 1 B DA  0   ? C2  ? B DA  1   C2  
155 1 Y 1 B DA  0   ? N3  ? B DA  1   N3  
156 1 Y 1 B DA  0   ? C4  ? B DA  1   C4  
157 1 Y 1 B DA  5   ? N9  ? B DA  6   N9  
158 1 Y 1 B DA  5   ? C8  ? B DA  6   C8  
159 1 Y 1 B DA  5   ? N7  ? B DA  6   N7  
160 1 Y 1 B DA  5   ? C5  ? B DA  6   C5  
161 1 Y 1 B DA  5   ? C6  ? B DA  6   C6  
162 1 Y 1 B DA  5   ? N6  ? B DA  6   N6  
163 1 Y 1 B DA  5   ? N1  ? B DA  6   N1  
164 1 Y 1 B DA  5   ? C2  ? B DA  6   C2  
165 1 Y 1 B DA  5   ? N3  ? B DA  6   N3  
166 1 Y 1 B DA  5   ? C4  ? B DA  6   C4  
167 1 Y 1 B DT  14  ? N1  ? B DT  15  N1  
168 1 Y 1 B DT  14  ? C2  ? B DT  15  C2  
169 1 Y 1 B DT  14  ? O2  ? B DT  15  O2  
170 1 Y 1 B DT  14  ? N3  ? B DT  15  N3  
171 1 Y 1 B DT  14  ? C4  ? B DT  15  C4  
172 1 Y 1 B DT  14  ? O4  ? B DT  15  O4  
173 1 Y 1 B DT  14  ? C5  ? B DT  15  C5  
174 1 Y 1 B DT  14  ? C7  ? B DT  15  C7  
175 1 Y 1 B DT  14  ? C6  ? B DT  15  C6  
176 1 Y 1 B DT  15  ? N1  ? B DT  16  N1  
177 1 Y 1 B DT  15  ? C2  ? B DT  16  C2  
178 1 Y 1 B DT  15  ? O2  ? B DT  16  O2  
179 1 Y 1 B DT  15  ? N3  ? B DT  16  N3  
180 1 Y 1 B DT  15  ? C4  ? B DT  16  C4  
181 1 Y 1 B DT  15  ? O4  ? B DT  16  O4  
182 1 Y 1 B DT  15  ? C5  ? B DT  16  C5  
183 1 Y 1 B DT  15  ? C7  ? B DT  16  C7  
184 1 Y 1 B DT  15  ? C6  ? B DT  16  C6  
185 1 Y 1 B DT  16  ? N1  ? B DT  17  N1  
186 1 Y 1 B DT  16  ? C2  ? B DT  17  C2  
187 1 Y 1 B DT  16  ? O2  ? B DT  17  O2  
188 1 Y 1 B DT  16  ? N3  ? B DT  17  N3  
189 1 Y 1 B DT  16  ? C4  ? B DT  17  C4  
190 1 Y 1 B DT  16  ? O4  ? B DT  17  O4  
191 1 Y 1 B DT  16  ? C5  ? B DT  17  C5  
192 1 Y 1 B DT  16  ? C7  ? B DT  17  C7  
193 1 Y 1 B DT  16  ? C6  ? B DT  17  C6  
194 1 Y 1 B DT  17  ? N1  ? B DT  18  N1  
195 1 Y 1 B DT  17  ? C2  ? B DT  18  C2  
196 1 Y 1 B DT  17  ? O2  ? B DT  18  O2  
197 1 Y 1 B DT  17  ? N3  ? B DT  18  N3  
198 1 Y 1 B DT  17  ? C4  ? B DT  18  C4  
199 1 Y 1 B DT  17  ? O4  ? B DT  18  O4  
200 1 Y 1 B DT  17  ? C5  ? B DT  18  C5  
201 1 Y 1 B DT  17  ? C7  ? B DT  18  C7  
202 1 Y 1 B DT  17  ? C6  ? B DT  18  C6  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLN 758 ? A GLN 758 
2  1 Y 1 A LYS 759 ? A LYS 759 
3  1 Y 1 A THR 760 ? A THR 760 
4  1 Y 1 A ARG 761 ? A ARG 761 
5  1 Y 1 A GLN 762 ? A GLN 762 
6  1 Y 1 A VAL 763 ? A VAL 763 
7  1 Y 1 A GLY 764 ? A GLY 764 
8  1 Y 1 A LEU 765 ? A LEU 765 
9  1 Y 1 A GLY 766 ? A GLY 766 
10 1 Y 1 A ALA 767 ? A ALA 767 
11 1 Y 1 A TRP 768 ? A TRP 768 
12 1 Y 1 A LEU 769 ? A LEU 769 
13 1 Y 1 A LYS 770 ? A LYS 770 
14 1 Y 1 A PRO 771 ? A PRO 771 
15 1 Y 1 A LYS 772 ? A LYS 772 
16 1 Y 1 A THR 773 ? A THR 773 
# 
_ndb_struct_conf_na.entry_id   2VWJ 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 7  1_555 B DC 26 1_555 0.443  0.316  -0.049 -1.422 -23.988 2.087  1 B_DG6:DC25_B  B 6  ? B 25 ? 19 1 
1 B DA 8  1_555 B DT 25 1_555 -0.014 -0.179 0.639  -0.237 -23.115 -8.070 2 B_DA7:DT24_B  B 7  ? B 24 ? 20 1 
1 B DC 9  1_555 B DG 24 1_555 1.083  -0.031 -0.409 3.855  3.714   -0.992 3 B_DC8:DG23_B  B 8  ? B 23 ? 19 1 
1 B DA 10 1_555 B DT 23 1_555 -0.582 0.028  -0.135 11.695 -12.483 8.366  4 B_DA9:DT22_B  B 9  ? B 22 ? 20 1 
1 B DC 11 1_555 B DG 22 1_555 0.655  0.058  0.349  4.685  -36.691 7.700  5 B_DC10:DG21_B B 10 ? B 21 ? 19 1 
1 B DG 12 1_555 B DC 21 1_555 0.255  0.242  -0.271 1.025  -15.754 1.926  6 B_DG11:DC20_B B 11 ? B 20 ? 19 1 
1 B DG 13 1_555 B DC 20 1_555 -0.332 0.520  -0.542 -6.166 -20.864 3.734  7 B_DG12:DC19_B B 12 ? B 19 ? 19 1 
1 B DC 14 1_555 B DG 19 1_555 0.035  0.312  -0.797 19.453 -11.101 -4.548 8 B_DC13:DG18_B B 13 ? B 18 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 7  1_555 B DC 26 1_555 B DA 8  1_555 B DT 25 1_555 -0.262 -0.280 3.188 -8.119 14.816  34.040 -2.278 -0.609 2.823 23.593  
12.928  37.890 1 BB_DG6DA7:DT24DC25_BB   B 6  ? B 25 ? B 7  ? B 24 ? 
1 B DA 8  1_555 B DT 25 1_555 B DC 9  1_555 B DG 24 1_555 1.390  -0.052 3.337 8.597  -5.658  41.208 0.541  -0.990 3.522 -7.891  
-11.991 42.419 2 BB_DA7DC8:DG23DT24_BB   B 7  ? B 24 ? B 8  ? B 23 ? 
1 B DC 9  1_555 B DG 24 1_555 B DA 10 1_555 B DT 23 1_555 0.029  0.829  3.267 -1.487 18.940  17.396 -4.096 -0.533 2.825 47.748  
3.748   25.706 3 BB_DC8DA9:DT22DG23_BB   B 8  ? B 23 ? B 9  ? B 22 ? 
1 B DA 10 1_555 B DT 23 1_555 B DC 11 1_555 B DG 22 1_555 -1.046 0.030  3.519 -1.720 -4.424  39.222 0.608  1.329  3.536 -6.561  
2.551   39.497 4 BB_DA9DC10:DG21DT22_BB  B 9  ? B 22 ? B 10 ? B 21 ? 
1 B DC 11 1_555 B DG 22 1_555 B DG 12 1_555 B DC 21 1_555 -0.402 0.804  3.349 4.839  16.820  35.605 -0.938 1.206  3.310 25.682  
-7.389  39.549 5 BB_DC10DG11:DC20DG21_BB B 10 ? B 21 ? B 11 ? B 20 ? 
1 B DG 12 1_555 B DC 21 1_555 B DG 13 1_555 B DC 20 1_555 0.081  -0.516 3.343 -0.619 9.974   26.232 -3.408 -0.313 2.949 21.030  
1.305   28.040 6 BB_DG11DG12:DC19DC20_BB B 11 ? B 20 ? B 12 ? B 19 ? 
1 B DG 13 1_555 B DC 20 1_555 B DC 14 1_555 B DG 19 1_555 0.229  0.459  2.875 -1.831 -10.240 39.405 1.636  -0.504 2.666 -14.873 
2.660   40.702 7 BB_DG12DC13:DG18DC19_BB B 12 ? B 19 ? B 13 ? B 18 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'POTASSIUM ION' K   
4 water           HOH 
#