data_2VWR
# 
_entry.id   2VWR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2VWR         
PDBE  EBI-36711    
WWPDB D_1290036711 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2VWR 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2008-06-26 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Roos, A.K.'          1  
'Guo, K.'             2  
'Burgess-Brown, N.'   3  
'Yue, W.W.'           4  
'Elkins, J.M.'        5  
'Pike, A.C.W.'        6  
'Filippakopoulos, P.' 7  
'Arrowsmith, C.H.'    8  
'Wikstom, M.'         9  
'Edwards, A.'         10 
'von Delft, F.'       11 
'Bountra, C.'         12 
'Doyle, D.'           13 
'Oppermann, U.'       14 
# 
_citation.id                        primary 
_citation.title                     'Crystal Structure of the Second Pdz Domain of the Human Numb-Binding Protein 2' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Roos, A.K.'          1  
primary 'Guo, K.'             2  
primary 'Burgess-Brown, N.'   3  
primary 'Yue, W.W.'           4  
primary 'Elkins, J.M.'        5  
primary 'Pike, A.C.W.'        6  
primary 'Filippakopoulos, P.' 7  
primary 'Arrowsmith, C.H.'    8  
primary 'Wikstom, M.'         9  
primary 'Edwards, A.'         10 
primary 'von Delft, F.'       11 
primary 'Bountra, C.'         12 
primary 'Doyle, D.'           13 
primary 'Oppermann, U.'       14 
# 
_cell.entry_id           2VWR 
_cell.length_a           63.773 
_cell.length_b           38.643 
_cell.length_c           38.186 
_cell.angle_alpha        90.00 
_cell.angle_beta         117.22 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2VWR 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'LIGAND OF NUMB PROTEIN X 2' 10310.739 1  ? YES 'PDZ DOMAIN, RESIDUES 336-424' ? 
2 water   nat water                        18.015    99 ? ?   ?                              ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'NUMB-BINDING PROTEIN 2, PDZ DOMAIN-CONTAINING RING FINGER PROTEIN 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMEILQVALHKRDSGEQLGIKLVRRTDEPGVFILDLLEGGLAAQDGRLSSNDRVLAINGHDLKYGTPELAAQIIQASGER
VNLTIARPGKPEIEL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMEILQVALHKRDSGEQLGIKLVRRTDEPGVFILDLLEGGLAAQDGRLSSNDRVLAINGHDLKYGTPELAAQIIQASGER
VNLTIARPGKPEIEL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  MET n 
1 3  GLU n 
1 4  ILE n 
1 5  LEU n 
1 6  GLN n 
1 7  VAL n 
1 8  ALA n 
1 9  LEU n 
1 10 HIS n 
1 11 LYS n 
1 12 ARG n 
1 13 ASP n 
1 14 SER n 
1 15 GLY n 
1 16 GLU n 
1 17 GLN n 
1 18 LEU n 
1 19 GLY n 
1 20 ILE n 
1 21 LYS n 
1 22 LEU n 
1 23 VAL n 
1 24 ARG n 
1 25 ARG n 
1 26 THR n 
1 27 ASP n 
1 28 GLU n 
1 29 PRO n 
1 30 GLY n 
1 31 VAL n 
1 32 PHE n 
1 33 ILE n 
1 34 LEU n 
1 35 ASP n 
1 36 LEU n 
1 37 LEU n 
1 38 GLU n 
1 39 GLY n 
1 40 GLY n 
1 41 LEU n 
1 42 ALA n 
1 43 ALA n 
1 44 GLN n 
1 45 ASP n 
1 46 GLY n 
1 47 ARG n 
1 48 LEU n 
1 49 SER n 
1 50 SER n 
1 51 ASN n 
1 52 ASP n 
1 53 ARG n 
1 54 VAL n 
1 55 LEU n 
1 56 ALA n 
1 57 ILE n 
1 58 ASN n 
1 59 GLY n 
1 60 HIS n 
1 61 ASP n 
1 62 LEU n 
1 63 LYS n 
1 64 TYR n 
1 65 GLY n 
1 66 THR n 
1 67 PRO n 
1 68 GLU n 
1 69 LEU n 
1 70 ALA n 
1 71 ALA n 
1 72 GLN n 
1 73 ILE n 
1 74 ILE n 
1 75 GLN n 
1 76 ALA n 
1 77 SER n 
1 78 GLY n 
1 79 GLU n 
1 80 ARG n 
1 81 VAL n 
1 82 ASN n 
1 83 LEU n 
1 84 THR n 
1 85 ILE n 
1 86 ALA n 
1 87 ARG n 
1 88 PRO n 
1 89 GLY n 
1 90 LYS n 
1 91 PRO n 
1 92 GLU n 
1 93 ILE n 
1 94 GLU n 
1 95 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              R3-PRARE2 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PNIC28-BSA4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2VWR       1 ? ? 2VWR   ? 
2 UNP LNX2_HUMAN 1 ? ? Q8N448 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2VWR A 1  ? 2  ? 2VWR   -1  ? 0   ? -1  0   
2 2 2VWR A 3  ? 91 ? Q8N448 336 ? 424 ? 336 424 
3 1 2VWR A 92 ? 95 ? 2VWR   425 ? 428 ? 425 428 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2VWR 
_struct_ref_seq_dif.mon_id                       LEU 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      5 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q8N448 
_struct_ref_seq_dif.db_mon_id                    PHE 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          338 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            338 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2VWR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.03 
_exptl_crystal.density_percent_sol   39.5 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.2 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '40% PEG 300, 0.1M CITRATE/PO4 PH 4.2' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2008-04-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00001 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             1.00001 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2VWR 
_reflns.observed_criterion_sigma_I   5.2 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             33.96 
_reflns.d_resolution_high            1.30 
_reflns.number_obs                   19996 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.0 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        16.00 
_reflns.B_iso_Wilson_estimate        10.30 
_reflns.pdbx_redundancy              5.4 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.30 
_reflns_shell.d_res_low              1.37 
_reflns_shell.percent_possible_all   88.9 
_reflns_shell.Rmerge_I_obs           0.24 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.20 
_reflns_shell.pdbx_redundancy        4.4 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2VWR 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     18972 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             33.96 
_refine.ls_d_res_high                            1.30 
_refine.ls_percent_reflns_obs                    97.8 
_refine.ls_R_factor_obs                          0.136 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.134 
_refine.ls_R_factor_R_free                       0.177 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  1024 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.972 
_refine.correlation_coeff_Fo_to_Fc_free          0.959 
_refine.B_iso_mean                               9.50 
_refine.aniso_B[1][1]                            -0.16000 
_refine.aniso_B[2][2]                            0.14000 
_refine.aniso_B[3][3]                            -0.02000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            -0.05000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRIES 2QG1 AND 2HE2' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.048 
_refine.pdbx_overall_ESU_R_Free                  0.049 
_refine.overall_SU_ML                            0.026 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             1.321 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        723 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             99 
_refine_hist.number_atoms_total               822 
_refine_hist.d_res_high                       1.30 
_refine_hist.d_res_low                        33.96 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011  0.022  ? 737  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002  0.020  ? 510  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.313  2.007  ? 995  'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.876  3.000  ? 1254 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.035  5.000  ? 94   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.281 24.545 ? 33   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       10.524 15.000 ? 139  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       11.507 15.000 ? 7    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.082  0.200  ? 118  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.021  ? 816  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 131  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  3.352  3.000  ? 471  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 4.562  5.000  ? 756  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  6.932  8.000  ? 266  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 9.761  11.000 ? 239  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.30 
_refine_ls_shell.d_res_low                        1.33 
_refine_ls_shell.number_reflns_R_work             1159 
_refine_ls_shell.R_factor_R_work                  0.1410 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.2160 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             70 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2VWR 
_struct.title                     'Crystal structure of the second pdz domain of numb-binding protein 2' 
_struct.pdbx_descriptor           'LIGAND OF NUMB PROTEIN X 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2VWR 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            
;PROTEIN-BINDING, METAL-BINDING, LIGAND OF NUMB PROTEIN, ZINC, LNX2_HUMAN, ZINC-FINGER, POLYMORPHISM, RING FINGER PROTEIN 1, CASP8 PROTEIN-BINDING, PROTEIN BINDING
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 40 ? GLY A 46 ? GLY A 373 GLY A 379 1 ? 7  
HELX_P HELX_P2 2 THR A 66 ? SER A 77 ? THR A 399 SER A 410 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 MET A 2  ? HIS A 10 ? MET A 0   HIS A 343 
AA 2 ARG A 80 ? PRO A 88 ? ARG A 413 PRO A 421 
AA 3 ARG A 53 ? ILE A 57 ? ARG A 386 ILE A 390 
AA 4 VAL A 31 ? LEU A 36 ? VAL A 364 LEU A 369 
AA 5 ILE A 20 ? ARG A 24 ? ILE A 353 ARG A 357 
AB 1 MET A 2  ? HIS A 10 ? MET A 0   HIS A 343 
AB 2 ARG A 80 ? PRO A 88 ? ARG A 413 PRO A 421 
AB 3 ARG A 53 ? ILE A 57 ? ARG A 386 ILE A 390 
AB 4 HIS A 60 ? ASP A 61 ? HIS A 393 ASP A 394 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 9  ? N LEU A 342 O VAL A 81 ? O VAL A 414 
AA 2 3 N ALA A 86 ? N ALA A 419 O ARG A 53 ? O ARG A 386 
AA 3 4 N VAL A 54 ? N VAL A 387 O VAL A 31 ? O VAL A 364 
AA 4 5 N LEU A 34 ? N LEU A 367 O LYS A 21 ? O LYS A 354 
AB 1 2 N LEU A 9  ? N LEU A 342 O VAL A 81 ? O VAL A 414 
AB 2 3 N ALA A 86 ? N ALA A 419 O ARG A 53 ? O ARG A 386 
AB 3 4 N ILE A 57 ? N ILE A 390 O HIS A 60 ? O HIS A 393 
# 
_database_PDB_matrix.entry_id          2VWR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2VWR 
_atom_sites.fract_transf_matrix[1][1]   0.015681 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.008066 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.025878 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.029449 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . SER A 1 1  ? 20.128 12.809 24.526  1.00 19.40 ? -1   SER A N   1 
ATOM   2   C CA  . SER A 1 1  ? 20.938 12.899 23.283  1.00 14.62 ? -1   SER A CA  1 
ATOM   3   C C   . SER A 1 1  ? 20.052 13.074 22.065  1.00 13.47 ? -1   SER A C   1 
ATOM   4   O O   . SER A 1 1  ? 18.834 12.879 22.117  1.00 15.69 ? -1   SER A O   1 
ATOM   5   C CB  . SER A 1 1  ? 21.786 11.646 23.101  1.00 17.49 ? -1   SER A CB  1 
ATOM   6   O OG  . SER A 1 1  ? 20.984 10.481 22.955  1.00 25.56 ? -1   SER A OG  1 
ATOM   7   N N   . MET A 1 2  ? 20.684 13.412 20.957  1.00 10.92 ? 0    MET A N   1 
ATOM   8   C CA  . MET A 1 2  ? 20.000 13.465 19.689  1.00 9.70  ? 0    MET A CA  1 
ATOM   9   C C   . MET A 1 2  ? 20.956 13.195 18.552  1.00 9.06  ? 0    MET A C   1 
ATOM   10  O O   . MET A 1 2  ? 22.158 13.370 18.682  1.00 13.20 ? 0    MET A O   1 
ATOM   11  C CB  . MET A 1 2  ? 19.319 14.815 19.493  1.00 12.91 ? 0    MET A CB  1 
ATOM   12  C CG  . MET A 1 2  ? 20.286 15.963 19.402  1.00 15.71 ? 0    MET A CG  1 
ATOM   13  S SD  . MET A 1 2  ? 19.467 17.568 19.366  1.00 19.52 ? 0    MET A SD  1 
ATOM   14  C CE  . MET A 1 2  ? 18.819 17.665 21.032  1.00 31.08 ? 0    MET A CE  1 
ATOM   15  N N   . GLU A 1 3  ? 20.384 12.759 17.442  1.00 7.47  ? 336  GLU A N   1 
ATOM   16  C CA  . GLU A 1 3  ? 21.090 12.632 16.203  1.00 7.61  ? 336  GLU A CA  1 
ATOM   17  C C   . GLU A 1 3  ? 20.689 13.781 15.297  1.00 8.80  ? 336  GLU A C   1 
ATOM   18  O O   . GLU A 1 3  ? 19.509 14.082 15.173  1.00 10.63 ? 336  GLU A O   1 
ATOM   19  C CB  . GLU A 1 3  ? 20.756 11.297 15.535  1.00 9.77  ? 336  GLU A CB  1 
ATOM   20  C CG  . GLU A 1 3  ? 21.552 11.077 14.264  1.00 14.79 ? 336  GLU A CG  1 
ATOM   21  C CD  . GLU A 1 3  ? 21.122 9.855  13.502  1.00 26.53 ? 336  GLU A CD  1 
ATOM   22  O OE1 . GLU A 1 3  ? 20.303 9.074  14.028  1.00 31.96 ? 336  GLU A OE1 1 
ATOM   23  O OE2 . GLU A 1 3  ? 21.613 9.684  12.363  1.00 32.73 ? 336  GLU A OE2 1 
ATOM   24  N N   . ILE A 1 4  ? 21.679 14.418 14.693  1.00 7.18  ? 337  ILE A N   1 
ATOM   25  C CA  . ILE A 1 4  ? 21.451 15.424 13.665  1.00 7.38  ? 337  ILE A CA  1 
ATOM   26  C C   . ILE A 1 4  ? 21.801 14.808 12.341  1.00 7.35  ? 337  ILE A C   1 
ATOM   27  O O   . ILE A 1 4  ? 22.895 14.249 12.178  1.00 9.86  ? 337  ILE A O   1 
ATOM   28  C CB  . ILE A 1 4  ? 22.306 16.675 13.857  1.00 9.41  ? 337  ILE A CB  1 
ATOM   29  C CG1 . ILE A 1 4  ? 22.197 17.198 15.271  1.00 12.88 ? 337  ILE A CG1 1 
ATOM   30  C CG2 . ILE A 1 4  ? 21.949 17.745 12.806  1.00 11.50 ? 337  ILE A CG2 1 
ATOM   31  C CD1 . ILE A 1 4  ? 20.874 17.635 15.639  1.00 14.81 ? 337  ILE A CD1 1 
ATOM   32  N N   . LEU A 1 5  ? 20.875 14.902 11.402  1.00 7.58  ? 338  LEU A N   1 
ATOM   33  C CA  . LEU A 1 5  ? 21.132 14.378 10.062  1.00 8.65  ? 338  LEU A CA  1 
ATOM   34  C C   . LEU A 1 5  ? 20.456 15.222 8.993   1.00 7.20  ? 338  LEU A C   1 
ATOM   35  O O   . LEU A 1 5  ? 19.584 16.031 9.280   1.00 8.46  ? 338  LEU A O   1 
ATOM   36  C CB  . LEU A 1 5  ? 20.731 12.925 9.943   1.00 13.90 ? 338  LEU A CB  1 
ATOM   37  C CG  . LEU A 1 5  ? 19.252 12.666 10.057  1.00 13.10 ? 338  LEU A CG  1 
ATOM   38  C CD1 . LEU A 1 5  ? 18.882 11.388 9.287   1.00 20.34 ? 338  LEU A CD1 1 
ATOM   39  C CD2 . LEU A 1 5  ? 18.772 12.562 11.493  1.00 19.29 ? 338  LEU A CD2 1 
ATOM   40  N N   . GLN A 1 6  ? 20.928 15.069 7.768   1.00 7.20  ? 339  GLN A N   1 
ATOM   41  C CA  . GLN A 1 6  ? 20.395 15.791 6.642   1.00 7.97  ? 339  GLN A CA  1 
ATOM   42  C C   . GLN A 1 6  ? 19.774 14.804 5.678   1.00 8.78  ? 339  GLN A C   1 
ATOM   43  O O   . GLN A 1 6  ? 20.362 13.773 5.376   1.00 12.62 ? 339  GLN A O   1 
ATOM   44  C CB  . GLN A 1 6  ? 21.472 16.631 5.956   1.00 11.22 ? 339  GLN A CB  1 
ATOM   45  C CG  . GLN A 1 6  ? 22.010 17.704 6.886   1.00 17.34 ? 339  GLN A CG  1 
ATOM   46  C CD  . GLN A 1 6  ? 22.853 18.757 6.211   1.00 25.58 ? 339  GLN A CD  1 
ATOM   47  O OE1 . GLN A 1 6  ? 22.673 19.078 5.034   1.00 22.54 ? 339  GLN A OE1 1 
ATOM   48  N NE2 . GLN A 1 6  ? 23.778 19.328 6.973   1.00 35.80 ? 339  GLN A NE2 1 
ATOM   49  N N   . VAL A 1 7  ? 18.567 15.128 5.237   1.00 6.69  ? 340  VAL A N   1 
ATOM   50  C CA  . VAL A 1 7  ? 17.825 14.314 4.312   1.00 6.49  ? 340  VAL A CA  1 
ATOM   51  C C   . VAL A 1 7  ? 17.450 15.146 3.110   1.00 6.92  ? 340  VAL A C   1 
ATOM   52  O O   . VAL A 1 7  ? 16.765 16.128 3.242   1.00 9.54  ? 340  VAL A O   1 
ATOM   53  C CB  . VAL A 1 7  ? 16.555 13.757 4.961   1.00 7.24  ? 340  VAL A CB  1 
ATOM   54  C CG1 . VAL A 1 7  ? 15.691 13.030 3.954   1.00 9.62  ? 340  VAL A CG1 1 
ATOM   55  C CG2 . VAL A 1 7  ? 16.911 12.821 6.122   1.00 9.31  ? 340  VAL A CG2 1 
ATOM   56  N N   . ALA A 1 8  ? 17.874 14.713 1.934   1.00 7.20  ? 341  ALA A N   1 
ATOM   57  C CA  . ALA A 1 8  ? 17.555 15.401 0.689   1.00 8.32  ? 341  ALA A CA  1 
ATOM   58  C C   . ALA A 1 8  ? 16.514 14.615 -0.079  1.00 7.94  ? 341  ALA A C   1 
ATOM   59  O O   . ALA A 1 8  ? 16.711 13.451 -0.375  1.00 12.11 ? 341  ALA A O   1 
ATOM   60  C CB  . ALA A 1 8  ? 18.823 15.574 -0.152  1.00 12.50 ? 341  ALA A CB  1 
ATOM   61  N N   . LEU A 1 9  ? 15.396 15.253 -0.365  1.00 7.05  ? 342  LEU A N   1 
ATOM   62  C CA  . LEU A 1 9  ? 14.331 14.704 -1.186  1.00 7.53  ? 342  LEU A CA  1 
ATOM   63  C C   . LEU A 1 9  ? 14.296 15.466 -2.509  1.00 6.69  ? 342  LEU A C   1 
ATOM   64  O O   . LEU A 1 9  ? 14.683 16.629 -2.573  1.00 9.96  ? 342  LEU A O   1 
ATOM   65  C CB  . LEU A 1 9  ? 12.989 14.824 -0.479  1.00 7.05  ? 342  LEU A CB  1 
ATOM   66  C CG  . LEU A 1 9  ? 12.915 14.175 0.902   1.00 6.94  ? 342  LEU A CG  1 
ATOM   67  C CD1 . LEU A 1 9  ? 11.557 14.422 1.532   1.00 10.28 ? 342  LEU A CD1 1 
ATOM   68  C CD2 . LEU A 1 9  ? 13.241 12.665 0.874   1.00 9.01  ? 342  LEU A CD2 1 
ATOM   69  N N   . HIS A 1 10 ? 13.820 14.806 -3.557  1.00 7.45  ? 343  HIS A N   1 
ATOM   70  C CA  . HIS A 1 10 ? 13.788 15.443 -4.867  1.00 8.58  ? 343  HIS A CA  1 
ATOM   71  C C   . HIS A 1 10 ? 12.402 15.443 -5.494  1.00 7.84  ? 343  HIS A C   1 
ATOM   72  O O   . HIS A 1 10 ? 11.834 14.379 -5.778  1.00 11.03 ? 343  HIS A O   1 
ATOM   73  C CB  . HIS A 1 10 ? 14.817 14.786 -5.773  1.00 10.46 ? 343  HIS A CB  1 
ATOM   74  C CG  . HIS A 1 10 ? 16.223 15.001 -5.303  1.00 12.40 ? 343  HIS A CG  1 
ATOM   75  N ND1 . HIS A 1 10 ? 16.996 16.053 -5.741  1.00 16.70 ? 343  HIS A ND1 1 
ATOM   76  C CD2 . HIS A 1 10 ? 16.965 14.349 -4.376  1.00 19.64 ? 343  HIS A CD2 1 
ATOM   77  C CE1 . HIS A 1 10 ? 18.175 16.010 -5.143  1.00 18.81 ? 343  HIS A CE1 1 
ATOM   78  N NE2 . HIS A 1 10 ? 18.179 14.989 -4.305  1.00 19.15 ? 343  HIS A NE2 1 
ATOM   79  N N   . LYS A 1 11 ? 11.837 16.643 -5.638  1.00 9.81  ? 344  LYS A N   1 
ATOM   80  C CA  . LYS A 1 11 ? 10.512 16.790 -6.253  1.00 10.04 ? 344  LYS A CA  1 
ATOM   81  C C   . LYS A 1 11 ? 10.588 16.474 -7.733  1.00 12.69 ? 344  LYS A C   1 
ATOM   82  O O   . LYS A 1 11 ? 11.432 17.042 -8.419  1.00 14.69 ? 344  LYS A O   1 
ATOM   83  C CB  . LYS A 1 11 ? 9.985  18.217 -6.073  1.00 12.34 ? 344  LYS A CB  1 
ATOM   84  C CG  . LYS A 1 11 ? 9.686  18.625 -4.623  1.00 12.62 ? 344  LYS A CG  1 
ATOM   85  C CD  . LYS A 1 11 ? 8.576  19.704 -4.546  1.00 31.05 ? 344  LYS A CD  1 
ATOM   86  C CE  . LYS A 1 11 ? 8.996  21.073 -5.051  1.00 24.45 ? 344  LYS A CE  1 
ATOM   87  N NZ  . LYS A 1 11 ? 8.322  22.218 -4.361  1.00 21.96 ? 344  LYS A NZ  1 
ATOM   88  N N   . ARG A 1 12 ? 9.704  15.604 -8.215  1.00 13.65 ? 345  ARG A N   1 
ATOM   89  C CA  . ARG A 1 12 ? 9.688  15.217 -9.636  1.00 17.02 ? 345  ARG A CA  1 
ATOM   90  C C   . ARG A 1 12 ? 8.948  16.257 -10.475 1.00 17.99 ? 345  ARG A C   1 
ATOM   91  O O   . ARG A 1 12 ? 9.156  16.335 -11.696 1.00 22.78 ? 345  ARG A O   1 
ATOM   92  C CB  . ARG A 1 12 ? 9.080  13.819 -9.812  1.00 18.82 ? 345  ARG A CB  1 
ATOM   93  C CG  . ARG A 1 12 ? 9.882  12.720 -9.103  1.00 23.83 ? 345  ARG A CG  1 
ATOM   94  C CD  . ARG A 1 12 ? 10.108 11.497 -9.984  1.00 35.96 ? 345  ARG A CD  1 
ATOM   95  N NE  . ARG A 1 12 ? 10.943 10.483 -9.336  1.00 41.80 ? 345  ARG A NE  1 
ATOM   96  C CZ  . ARG A 1 12 ? 11.421 9.393  -9.940  1.00 38.74 ? 345  ARG A CZ  1 
ATOM   97  N NH1 . ARG A 1 12 ? 11.158 9.156  -11.222 1.00 41.88 ? 345  ARG A NH1 1 
ATOM   98  N NH2 . ARG A 1 12 ? 12.172 8.530  -9.257  1.00 33.93 ? 345  ARG A NH2 1 
ATOM   99  N N   . ASP A 1 13 ? 8.081  17.035 -9.822  1.00 16.60 ? 346  ASP A N   1 
ATOM   100 C CA  . ASP A 1 13 ? 7.475  18.241 -10.404 1.00 17.38 ? 346  ASP A CA  1 
ATOM   101 C C   . ASP A 1 13 ? 7.449  19.320 -9.327  1.00 14.18 ? 346  ASP A C   1 
ATOM   102 O O   . ASP A 1 13 ? 7.531  19.010 -8.142  1.00 14.00 ? 346  ASP A O   1 
ATOM   103 C CB  . ASP A 1 13 ? 6.064  17.959 -10.970 1.00 19.09 ? 346  ASP A CB  1 
ATOM   104 C CG  . ASP A 1 13 ? 5.028  17.642 -9.898  1.00 19.81 ? 346  ASP A CG  1 
ATOM   105 O OD1 . ASP A 1 13 ? 4.382  18.582 -9.384  1.00 22.06 ? 346  ASP A OD1 1 
ATOM   106 O OD2 . ASP A 1 13 ? 4.810  16.436 -9.621  1.00 23.43 ? 346  ASP A OD2 1 
ATOM   107 N N   . SER A 1 14 ? 7.329  20.578 -9.725  1.00 13.19 ? 347  SER A N   1 
ATOM   108 C CA  . SER A 1 14 ? 7.384  21.702 -8.783  1.00 13.78 ? 347  SER A CA  1 
ATOM   109 C C   . SER A 1 14 ? 6.252  21.710 -7.764  1.00 11.76 ? 347  SER A C   1 
ATOM   110 O O   . SER A 1 14 ? 6.341  22.373 -6.725  1.00 14.54 ? 347  SER A O   1 
ATOM   111 C CB  . SER A 1 14 ? 7.433  23.044 -9.519  1.00 14.22 ? 347  SER A CB  1 
ATOM   112 O OG  . SER A 1 14 ? 6.243  23.269 -10.244 1.00 16.20 ? 347  SER A OG  1 
ATOM   113 N N   . GLY A 1 15 ? 5.172  20.998 -8.084  1.00 11.38 ? 348  GLY A N   1 
ATOM   114 C CA  . GLY A 1 15 ? 4.049  20.871 -7.180  1.00 10.63 ? 348  GLY A CA  1 
ATOM   115 C C   . GLY A 1 15 ? 3.987  19.585 -6.383  1.00 10.54 ? 348  GLY A C   1 
ATOM   116 O O   . GLY A 1 15 ? 2.994  19.372 -5.694  1.00 11.58 ? 348  GLY A O   1 
ATOM   117 N N   . GLU A 1 16 ? 5.011  18.735 -6.462  1.00 10.14 ? 349  GLU A N   1 
ATOM   118 C CA  . GLU A 1 16 ? 4.979  17.475 -5.723  1.00 10.90 ? 349  GLU A CA  1 
ATOM   119 C C   . GLU A 1 16 ? 5.094  17.732 -4.229  1.00 11.70 ? 349  GLU A C   1 
ATOM   120 O O   . GLU A 1 16 ? 5.900  18.539 -3.792  1.00 12.51 ? 349  GLU A O   1 
ATOM   121 C CB  . GLU A 1 16 ? 6.077  16.500 -6.154  1.00 11.37 ? 349  GLU A CB  1 
ATOM   122 C CG  . GLU A 1 16 ? 5.878  15.118 -5.509  1.00 13.41 ? 349  GLU A CG  1 
ATOM   123 C CD  . GLU A 1 16 ? 6.796  14.031 -6.016  1.00 14.39 ? 349  GLU A CD  1 
ATOM   124 O OE1 . GLU A 1 16 ? 7.821  14.327 -6.657  1.00 17.24 ? 349  GLU A OE1 1 
ATOM   125 O OE2 . GLU A 1 16 ? 6.498  12.847 -5.728  1.00 19.88 ? 349  GLU A OE2 1 
ATOM   126 N N   . GLN A 1 17 ? 4.285  17.037 -3.431  1.00 13.12 ? 350  GLN A N   1 
ATOM   127 C CA  . GLN A 1 17 ? 4.419  17.166 -1.988  1.00 13.43 ? 350  GLN A CA  1 
ATOM   128 C C   . GLN A 1 17 ? 5.510  16.223 -1.502  1.00 9.97  ? 350  GLN A C   1 
ATOM   129 O O   . GLN A 1 17 ? 5.923  15.294 -2.196  1.00 11.21 ? 350  GLN A O   1 
ATOM   130 C CB  . GLN A 1 17 ? 3.109  16.888 -1.274  1.00 17.00 ? 350  GLN A CB  1 
ATOM   131 C CG  A GLN A 1 17 ? 2.086  17.994 -1.457  0.50 13.19 ? 350  GLN A CG  1 
ATOM   132 C CD  A GLN A 1 17 ? 0.701  17.540 -1.069  0.50 12.56 ? 350  GLN A CD  1 
ATOM   133 O OE1 A GLN A 1 17 ? 0.216  16.501 -1.557  0.50 18.97 ? 350  GLN A OE1 1 
ATOM   134 N NE2 A GLN A 1 17 ? 0.049  18.301 -0.192  0.50 15.21 ? 350  GLN A NE2 1 
ATOM   135 N N   . LEU A 1 18 ? 5.980  16.475 -0.298  1.00 9.09  ? 351  LEU A N   1 
ATOM   136 C CA  . LEU A 1 18 ? 7.002  15.642 0.309   1.00 7.79  ? 351  LEU A CA  1 
ATOM   137 C C   . LEU A 1 18 ? 6.406  14.423 0.970   1.00 6.95  ? 351  LEU A C   1 
ATOM   138 O O   . LEU A 1 18 ? 7.112  13.436 1.174   1.00 7.83  ? 351  LEU A O   1 
ATOM   139 C CB  . LEU A 1 18 ? 7.785  16.430 1.341   1.00 10.03 ? 351  LEU A CB  1 
ATOM   140 C CG  . LEU A 1 18 ? 8.464  17.680 0.774   1.00 13.65 ? 351  LEU A CG  1 
ATOM   141 C CD1 . LEU A 1 18 ? 9.327  18.337 1.851   1.00 16.68 ? 351  LEU A CD1 1 
ATOM   142 C CD2 . LEU A 1 18 ? 9.285  17.333 -0.465  1.00 14.79 ? 351  LEU A CD2 1 
ATOM   143 N N   . GLY A 1 19 ? 5.127  14.475 1.336   1.00 6.45  ? 352  GLY A N   1 
ATOM   144 C CA  . GLY A 1 19 ? 4.529  13.361 2.072   1.00 5.80  ? 352  GLY A CA  1 
ATOM   145 C C   . GLY A 1 19 ? 4.856  13.345 3.551   1.00 5.53  ? 352  GLY A C   1 
ATOM   146 O O   . GLY A 1 19 ? 5.144  12.296 4.119   1.00 6.57  ? 352  GLY A O   1 
ATOM   147 N N   . ILE A 1 20 ? 4.790  14.519 4.179   1.00 6.22  ? 353  ILE A N   1 
ATOM   148 C CA  . ILE A 1 20 ? 5.150  14.697 5.587   1.00 6.82  ? 353  ILE A CA  1 
ATOM   149 C C   . ILE A 1 20 ? 4.027  15.459 6.274   1.00 6.99  ? 353  ILE A C   1 
ATOM   150 O O   . ILE A 1 20 ? 3.566  16.461 5.762   1.00 9.28  ? 353  ILE A O   1 
ATOM   151 C CB  . ILE A 1 20 ? 6.489  15.508 5.743   1.00 8.22  ? 353  ILE A CB  1 
ATOM   152 C CG1 . ILE A 1 20 ? 7.649  14.867 4.981   1.00 9.99  ? 353  ILE A CG1 1 
ATOM   153 C CG2 . ILE A 1 20 ? 6.832  15.684 7.223   1.00 12.01 ? 353  ILE A CG2 1 
ATOM   154 C CD1 . ILE A 1 20 ? 8.873  15.766 4.839   1.00 13.13 ? 353  ILE A CD1 1 
ATOM   155 N N   . LYS A 1 21 ? 3.586  14.957 7.413   1.00 7.07  ? 354  LYS A N   1 
ATOM   156 C CA  . LYS A 1 21 ? 2.690  15.683 8.288   1.00 6.19  ? 354  LYS A CA  1 
ATOM   157 C C   . LYS A 1 21 ? 3.510  16.425 9.341   1.00 8.23  ? 354  LYS A C   1 
ATOM   158 O O   . LYS A 1 21 ? 4.179  15.810 10.163  1.00 8.25  ? 354  LYS A O   1 
ATOM   159 C CB  . LYS A 1 21 ? 1.699  14.734 8.954   1.00 8.22  ? 354  LYS A CB  1 
ATOM   160 C CG  . LYS A 1 21 ? 0.953  13.836 7.994   1.00 15.14 ? 354  LYS A CG  1 
ATOM   161 C CD  . LYS A 1 21 ? -0.238 13.152 8.664   1.00 20.17 ? 354  LYS A CD  1 
ATOM   162 C CE  . LYS A 1 21 ? -0.766 11.971 7.851   1.00 17.14 ? 354  LYS A CE  1 
ATOM   163 N NZ  . LYS A 1 21 ? -1.781 11.169 8.587   1.00 23.82 ? 354  LYS A NZ  1 
ATOM   164 N N   . LEU A 1 22 ? 3.477  17.754 9.278   1.00 6.53  ? 355  LEU A N   1 
ATOM   165 C CA  . LEU A 1 22 ? 4.253  18.608 10.175  1.00 7.05  ? 355  LEU A CA  1 
ATOM   166 C C   . LEU A 1 22 ? 3.340  19.222 11.220  1.00 6.95  ? 355  LEU A C   1 
ATOM   167 O O   . LEU A 1 22 ? 2.267  19.693 10.894  1.00 8.65  ? 355  LEU A O   1 
ATOM   168 C CB  . LEU A 1 22 ? 4.977  19.717 9.405   1.00 9.04  ? 355  LEU A CB  1 
ATOM   169 C CG  . LEU A 1 22 ? 6.120  19.350 8.473   1.00 11.98 ? 355  LEU A CG  1 
ATOM   170 C CD1 . LEU A 1 22 ? 6.685  20.618 7.819   1.00 16.38 ? 355  LEU A CD1 1 
ATOM   171 C CD2 . LEU A 1 22 ? 7.190  18.609 9.229   1.00 12.08 ? 355  LEU A CD2 1 
ATOM   172 N N   . VAL A 1 23 ? 3.808  19.255 12.458  1.00 6.35  ? 356  VAL A N   1 
ATOM   173 C CA  . VAL A 1 23 ? 3.041  19.777 13.571  1.00 6.35  ? 356  VAL A CA  1 
ATOM   174 C C   . VAL A 1 23 ? 3.855  20.658 14.495  1.00 6.32  ? 356  VAL A C   1 
ATOM   175 O O   . VAL A 1 23 ? 5.072  20.554 14.588  1.00 7.02  ? 356  VAL A O   1 
ATOM   176 C CB  . VAL A 1 23 ? 2.419  18.631 14.430  1.00 7.14  ? 356  VAL A CB  1 
ATOM   177 C CG1 . VAL A 1 23 ? 1.471  17.776 13.574  1.00 10.40 ? 356  VAL A CG1 1 
ATOM   178 C CG2 . VAL A 1 23 ? 3.466  17.784 15.139  1.00 8.76  ? 356  VAL A CG2 1 
ATOM   179 N N   . ARG A 1 24 ? 3.147  21.542 15.177  1.00 6.06  ? 357  ARG A N   1 
ATOM   180 C CA  . ARG A 1 24 ? 3.667  22.214 16.353  1.00 6.42  ? 357  ARG A CA  1 
ATOM   181 C C   . ARG A 1 24 ? 3.277  21.419 17.588  1.00 7.93  ? 357  ARG A C   1 
ATOM   182 O O   . ARG A 1 24 ? 2.320  20.643 17.569  1.00 10.12 ? 357  ARG A O   1 
ATOM   183 C CB  . ARG A 1 24 ? 3.154  23.651 16.436  1.00 7.91  ? 357  ARG A CB  1 
ATOM   184 C CG  . ARG A 1 24 ? 1.670  23.812 16.738  1.00 8.11  ? 357  ARG A CG  1 
ATOM   185 C CD  . ARG A 1 24 ? 1.240  25.229 16.426  1.00 11.78 ? 357  ARG A CD  1 
ATOM   186 N NE  . ARG A 1 24 ? -0.147 25.442 16.818  1.00 11.84 ? 357  ARG A NE  1 
ATOM   187 C CZ  . ARG A 1 24 ? -0.924 26.419 16.356  1.00 13.32 ? 357  ARG A CZ  1 
ATOM   188 N NH1 . ARG A 1 24 ? -0.470 27.304 15.491  1.00 13.58 ? 357  ARG A NH1 1 
ATOM   189 N NH2 . ARG A 1 24 ? -2.176 26.505 16.774  1.00 15.33 ? 357  ARG A NH2 1 
ATOM   190 N N   . ARG A 1 25 ? 4.018  21.637 18.670  1.00 7.87  ? 358  ARG A N   1 
ATOM   191 C CA  . ARG A 1 25 ? 3.751  20.948 19.936  1.00 10.55 ? 358  ARG A CA  1 
ATOM   192 C C   . ARG A 1 25 ? 3.407  21.916 21.018  1.00 12.37 ? 358  ARG A C   1 
ATOM   193 O O   . ARG A 1 25 ? 3.895  23.032 21.024  1.00 12.41 ? 358  ARG A O   1 
ATOM   194 C CB  . ARG A 1 25 ? 4.972  20.177 20.387  1.00 11.13 ? 358  ARG A CB  1 
ATOM   195 C CG  . ARG A 1 25 ? 5.165  18.961 19.570  1.00 14.31 ? 358  ARG A CG  1 
ATOM   196 C CD  . ARG A 1 25 ? 6.317  18.166 20.053  1.00 14.64 ? 358  ARG A CD  1 
ATOM   197 N NE  . ARG A 1 25 ? 6.432  16.964 19.256  1.00 20.85 ? 358  ARG A NE  1 
ATOM   198 C CZ  . ARG A 1 25 ? 7.389  16.056 19.399  1.00 21.75 ? 358  ARG A CZ  1 
ATOM   199 N NH1 . ARG A 1 25 ? 8.324  16.190 20.332  1.00 26.11 ? 358  ARG A NH1 1 
ATOM   200 N NH2 . ARG A 1 25 ? 7.410  15.002 18.596  1.00 19.78 ? 358  ARG A NH2 1 
ATOM   201 N N   . THR A 1 26 ? 2.593  21.449 21.958  1.00 13.46 ? 359  THR A N   1 
ATOM   202 C CA  . THR A 1 26 ? 2.064  22.292 23.024  1.00 16.07 ? 359  THR A CA  1 
ATOM   203 C C   . THR A 1 26 ? 3.003  22.470 24.213  1.00 14.82 ? 359  THR A C   1 
ATOM   204 O O   . THR A 1 26 ? 2.719  23.286 25.078  1.00 19.95 ? 359  THR A O   1 
ATOM   205 C CB  . THR A 1 26 ? 0.724  21.742 23.541  1.00 15.98 ? 359  THR A CB  1 
ATOM   206 O OG1 . THR A 1 26 ? 0.901  20.365 23.892  1.00 20.67 ? 359  THR A OG1 1 
ATOM   207 C CG2 . THR A 1 26 ? -0.319 21.846 22.445  1.00 18.95 ? 359  THR A CG2 1 
ATOM   208 N N   . ASP A 1 27 ? 4.122  21.754 24.245  1.00 16.37 ? 360  ASP A N   1 
ATOM   209 C CA  . ASP A 1 27 ? 5.000  21.772 25.411  1.00 18.65 ? 360  ASP A CA  1 
ATOM   210 C C   . ASP A 1 27 ? 6.472  21.999 25.078  1.00 17.69 ? 360  ASP A C   1 
ATOM   211 O O   . ASP A 1 27 ? 7.320  21.926 25.961  1.00 20.53 ? 360  ASP A O   1 
ATOM   212 C CB  . ASP A 1 27 ? 4.850  20.464 26.181  1.00 23.44 ? 360  ASP A CB  1 
ATOM   213 C CG  . ASP A 1 27 ? 5.179  19.239 25.334  1.00 31.95 ? 360  ASP A CG  1 
ATOM   214 O OD1 . ASP A 1 27 ? 5.466  19.385 24.118  1.00 29.18 ? 360  ASP A OD1 1 
ATOM   215 O OD2 . ASP A 1 27 ? 5.137  18.121 25.887  1.00 45.79 ? 360  ASP A OD2 1 
ATOM   216 N N   . GLU A 1 28 ? 6.790  22.264 23.815  1.00 15.18 ? 361  GLU A N   1 
ATOM   217 C CA  . GLU A 1 28 ? 8.160  22.554 23.416  1.00 15.75 ? 361  GLU A CA  1 
ATOM   218 C C   . GLU A 1 28 ? 8.153  23.236 22.054  1.00 13.50 ? 361  GLU A C   1 
ATOM   219 O O   . GLU A 1 28 ? 7.240  23.042 21.248  1.00 11.92 ? 361  GLU A O   1 
ATOM   220 C CB  . GLU A 1 28 ? 8.999  21.268 23.355  1.00 17.87 ? 361  GLU A CB  1 
ATOM   221 C CG  . GLU A 1 28 ? 8.564  20.268 22.295  1.00 15.99 ? 361  GLU A CG  1 
ATOM   222 C CD  . GLU A 1 28 ? 9.431  19.010 22.286  1.00 17.81 ? 361  GLU A CD  1 
ATOM   223 O OE1 . GLU A 1 28 ? 10.659 19.146 22.161  1.00 25.99 ? 361  GLU A OE1 1 
ATOM   224 O OE2 . GLU A 1 28 ? 8.881  17.905 22.411  1.00 32.00 ? 361  GLU A OE2 1 
ATOM   225 N N   . PRO A 1 29 ? 9.178  24.036 21.791  1.00 11.31 ? 362  PRO A N   1 
ATOM   226 C CA  . PRO A 1 29 ? 9.234  24.766 20.542  1.00 9.48  ? 362  PRO A CA  1 
ATOM   227 C C   . PRO A 1 29 ? 9.672  23.871 19.401  1.00 10.21 ? 362  PRO A C   1 
ATOM   228 O O   . PRO A 1 29 ? 10.263 22.802 19.630  1.00 10.48 ? 362  PRO A O   1 
ATOM   229 C CB  . PRO A 1 29 ? 10.283 25.836 20.815  1.00 13.51 ? 362  PRO A CB  1 
ATOM   230 C CG  . PRO A 1 29 ? 11.215 25.168 21.786  1.00 13.32 ? 362  PRO A CG  1 
ATOM   231 C CD  . PRO A 1 29 ? 10.337 24.320 22.656  1.00 13.95 ? 362  PRO A CD  1 
ATOM   232 N N   . GLY A 1 30 ? 9.388  24.307 18.178  1.00 8.28  ? 363  GLY A N   1 
ATOM   233 C CA  . GLY A 1 30 ? 9.868  23.605 17.007  1.00 8.52  ? 363  GLY A CA  1 
ATOM   234 C C   . GLY A 1 30 ? 8.771  23.103 16.084  1.00 7.13  ? 363  GLY A C   1 
ATOM   235 O O   . GLY A 1 30 ? 7.579  23.153 16.414  1.00 7.59  ? 363  GLY A O   1 
ATOM   236 N N   . VAL A 1 31 ? 9.206  22.606 14.930  1.00 6.41  ? 364  VAL A N   1 
ATOM   237 C CA  . VAL A 1 31 ? 8.341  21.984 13.950  1.00 6.55  ? 364  VAL A CA  1 
ATOM   238 C C   . VAL A 1 31 ? 8.734  20.517 13.912  1.00 5.36  ? 364  VAL A C   1 
ATOM   239 O O   . VAL A 1 31 ? 9.921  20.186 13.789  1.00 6.15  ? 364  VAL A O   1 
ATOM   240 C CB  . VAL A 1 31 ? 8.562  22.633 12.560  1.00 9.09  ? 364  VAL A CB  1 
ATOM   241 C CG1 . VAL A 1 31 ? 7.696  21.998 11.538  1.00 11.32 ? 364  VAL A CG1 1 
ATOM   242 C CG2 . VAL A 1 31 ? 8.330  24.131 12.631  1.00 12.01 ? 364  VAL A CG2 1 
ATOM   243 N N   . PHE A 1 32 ? 7.745  19.636 14.012  1.00 5.13  ? 365  PHE A N   1 
ATOM   244 C CA  . PHE A 1 32 ? 7.985  18.206 14.179  1.00 6.39  ? 365  PHE A CA  1 
ATOM   245 C C   . PHE A 1 32 ? 7.260  17.401 13.145  1.00 6.13  ? 365  PHE A C   1 
ATOM   246 O O   . PHE A 1 32 ? 6.154  17.747 12.715  1.00 8.29  ? 365  PHE A O   1 
ATOM   247 C CB  . PHE A 1 32 ? 7.554  17.743 15.584  1.00 6.64  ? 365  PHE A CB  1 
ATOM   248 C CG  . PHE A 1 32 ? 8.328  18.414 16.676  1.00 6.56  ? 365  PHE A CG  1 
ATOM   249 C CD1 . PHE A 1 32 ? 9.453  17.844 17.194  1.00 6.87  ? 365  PHE A CD1 1 
ATOM   250 C CD2 . PHE A 1 32 ? 7.922  19.638 17.169  1.00 6.58  ? 365  PHE A CD2 1 
ATOM   251 C CE1 . PHE A 1 32 ? 10.178 18.486 18.181  1.00 8.33  ? 365  PHE A CE1 1 
ATOM   252 C CE2 . PHE A 1 32 ? 8.641  20.269 18.156  1.00 8.36  ? 365  PHE A CE2 1 
ATOM   253 C CZ  . PHE A 1 32 ? 9.765  19.681 18.653  1.00 8.49  ? 365  PHE A CZ  1 
ATOM   254 N N   . ILE A 1 33 ? 7.866  16.282 12.766  1.00 5.72  ? 366  ILE A N   1 
ATOM   255 C CA  . ILE A 1 33 ? 7.185  15.310 11.921  1.00 5.98  ? 366  ILE A CA  1 
ATOM   256 C C   . ILE A 1 33 ? 6.274  14.467 12.801  1.00 7.53  ? 366  ILE A C   1 
ATOM   257 O O   . ILE A 1 33 ? 6.726  13.828 13.751  1.00 8.02  ? 366  ILE A O   1 
ATOM   258 C CB  . ILE A 1 33 ? 8.192  14.401 11.195  1.00 6.56  ? 366  ILE A CB  1 
ATOM   259 C CG1 . ILE A 1 33 ? 9.084  15.265 10.320  1.00 7.81  ? 366  ILE A CG1 1 
ATOM   260 C CG2 . ILE A 1 33 ? 7.493  13.339 10.346  1.00 8.37  ? 366  ILE A CG2 1 
ATOM   261 C CD1 . ILE A 1 33 ? 10.065 14.515 9.462   1.00 9.96  ? 366  ILE A CD1 1 
ATOM   262 N N   . LEU A 1 34 ? 4.981  14.441 12.481  1.00 6.69  ? 367  LEU A N   1 
ATOM   263 C CA  . LEU A 1 34 ? 4.062  13.561 13.167  1.00 9.23  ? 367  LEU A CA  1 
ATOM   264 C C   . LEU A 1 34 ? 4.149  12.162 12.550  1.00 8.28  ? 367  LEU A C   1 
ATOM   265 O O   . LEU A 1 34 ? 4.259  11.163 13.265  1.00 9.20  ? 367  LEU A O   1 
ATOM   266 C CB  . LEU A 1 34 ? 2.651  14.122 13.100  1.00 9.63  ? 367  LEU A CB  1 
ATOM   267 C CG  . LEU A 1 34 ? 1.589  13.339 13.869  1.00 10.85 ? 367  LEU A CG  1 
ATOM   268 C CD1 . LEU A 1 34 ? 1.808  13.508 15.371  1.00 13.84 ? 367  LEU A CD1 1 
ATOM   269 C CD2 . LEU A 1 34 ? 0.192  13.819 13.461  1.00 17.22 ? 367  LEU A CD2 1 
ATOM   270 N N   . ASP A 1 35 ? 4.066  12.102 11.222  1.00 8.00  ? 368  ASP A N   1 
ATOM   271 C CA  . ASP A 1 35 ? 4.172  10.849 10.482  1.00 8.97  ? 368  ASP A CA  1 
ATOM   272 C C   . ASP A 1 35 ? 4.374  11.200 9.011   1.00 7.38  ? 368  ASP A C   1 
ATOM   273 O O   . ASP A 1 35 ? 4.342  12.361 8.636   1.00 7.85  ? 368  ASP A O   1 
ATOM   274 C CB  . ASP A 1 35 ? 2.937  9.975  10.701  1.00 15.92 ? 368  ASP A CB  1 
ATOM   275 C CG  . ASP A 1 35 ? 1.688  10.662 10.296  1.00 18.18 ? 368  ASP A CG  1 
ATOM   276 O OD1 . ASP A 1 35 ? 1.592  10.998 9.115   1.00 27.37 ? 368  ASP A OD1 1 
ATOM   277 O OD2 . ASP A 1 35 ? 0.793  10.869 11.145  1.00 37.45 ? 368  ASP A OD2 1 
ATOM   278 N N   . LEU A 1 36 ? 4.617  10.172 8.213   1.00 9.96  ? 369  LEU A N   1 
ATOM   279 C CA  . LEU A 1 36 ? 4.789  10.277 6.792   1.00 9.02  ? 369  LEU A CA  1 
ATOM   280 C C   . LEU A 1 36 ? 3.575  9.694  6.086   1.00 10.85 ? 369  LEU A C   1 
ATOM   281 O O   . LEU A 1 36 ? 2.923  8.753  6.590   1.00 16.71 ? 369  LEU A O   1 
ATOM   282 C CB  . LEU A 1 36 ? 6.040  9.523  6.346   1.00 9.54  ? 369  LEU A CB  1 
ATOM   283 C CG  . LEU A 1 36 ? 7.348  9.882  7.039   1.00 11.95 ? 369  LEU A CG  1 
ATOM   284 C CD1 . LEU A 1 36 ? 8.469  9.086  6.358   1.00 12.55 ? 369  LEU A CD1 1 
ATOM   285 C CD2 . LEU A 1 36 ? 7.634  11.373 6.998   1.00 10.74 ? 369  LEU A CD2 1 
ATOM   286 N N   . LEU A 1 37 ? 3.267  10.244 4.924   1.00 10.18 ? 370  LEU A N   1 
ATOM   287 C CA  . LEU A 1 37 ? 2.173  9.751  4.101   1.00 9.91  ? 370  LEU A CA  1 
ATOM   288 C C   . LEU A 1 37 ? 2.603  8.536  3.287   1.00 9.77  ? 370  LEU A C   1 
ATOM   289 O O   . LEU A 1 37 ? 3.694  8.497  2.729   1.00 9.19  ? 370  LEU A O   1 
ATOM   290 C CB  . LEU A 1 37 ? 1.680  10.825 3.129   1.00 11.13 ? 370  LEU A CB  1 
ATOM   291 C CG  A LEU A 1 37 ? 1.134  12.139 3.683   0.50 15.44 ? 370  LEU A CG  1 
ATOM   292 C CG  B LEU A 1 37 ? 0.968  12.064 3.714   0.50 17.99 ? 370  LEU A CG  1 
ATOM   293 C CD1 A LEU A 1 37 ? 0.485  12.974 2.576   0.50 17.87 ? 370  LEU A CD1 1 
ATOM   294 C CD1 B LEU A 1 37 ? 1.609  12.601 4.995   0.50 15.38 ? 370  LEU A CD1 1 
ATOM   295 C CD2 A LEU A 1 37 ? 0.158  11.845 4.773   0.50 17.28 ? 370  LEU A CD2 1 
ATOM   296 C CD2 B LEU A 1 37 ? 0.866  13.175 2.664   0.50 22.58 ? 370  LEU A CD2 1 
ATOM   297 N N   . GLU A 1 38 ? 1.707  7.561  3.187   1.00 12.24 ? 371  GLU A N   1 
ATOM   298 C CA  . GLU A 1 38 ? 1.930  6.353  2.392   1.00 14.34 ? 371  GLU A CA  1 
ATOM   299 C C   . GLU A 1 38 ? 2.369  6.686  0.979   1.00 13.82 ? 371  GLU A C   1 
ATOM   300 O O   . GLU A 1 38 ? 1.738  7.485  0.314   1.00 14.65 ? 371  GLU A O   1 
ATOM   301 C CB  . GLU A 1 38 ? 0.618  5.543  2.312   1.00 18.79 ? 371  GLU A CB  1 
ATOM   302 C CG  . GLU A 1 38 ? 0.785  4.168  1.682   1.00 22.16 ? 371  GLU A CG  1 
ATOM   303 C CD  . GLU A 1 38 ? -0.488 3.358  1.710   1.00 31.25 ? 371  GLU A CD  1 
ATOM   304 O OE1 . GLU A 1 38 ? -1.564 3.948  1.927   1.00 23.39 ? 371  GLU A OE1 1 
ATOM   305 O OE2 . GLU A 1 38 ? -0.412 2.128  1.508   1.00 44.28 ? 371  GLU A OE2 1 
ATOM   306 N N   . GLY A 1 39 ? 3.467  6.086  0.533   1.00 11.43 ? 372  GLY A N   1 
ATOM   307 C CA  . GLY A 1 39 ? 3.898  6.213  -0.864  1.00 14.98 ? 372  GLY A CA  1 
ATOM   308 C C   . GLY A 1 39 ? 4.490  7.564  -1.252  1.00 12.08 ? 372  GLY A C   1 
ATOM   309 O O   . GLY A 1 39 ? 4.870  7.772  -2.408  1.00 13.34 ? 372  GLY A O   1 
ATOM   310 N N   . GLY A 1 40 ? 4.612  8.482  -0.299  1.00 9.86  ? 373  GLY A N   1 
ATOM   311 C CA  . GLY A 1 40 ? 5.146  9.787  -0.608  1.00 9.55  ? 373  GLY A CA  1 
ATOM   312 C C   . GLY A 1 40 ? 6.653  9.766  -0.727  1.00 7.46  ? 373  GLY A C   1 
ATOM   313 O O   . GLY A 1 40 ? 7.303  8.764  -0.407  1.00 7.40  ? 373  GLY A O   1 
ATOM   314 N N   . LEU A 1 41 ? 7.222  10.891 -1.146  1.00 7.62  ? 374  LEU A N   1 
ATOM   315 C CA  . LEU A 1 41 ? 8.672  10.979 -1.316  1.00 8.00  ? 374  LEU A CA  1 
ATOM   316 C C   . LEU A 1 41 ? 9.398  10.637 -0.047  1.00 6.30  ? 374  LEU A C   1 
ATOM   317 O O   . LEU A 1 41 ? 10.426 9.958  -0.078  1.00 6.05  ? 374  LEU A O   1 
ATOM   318 C CB  . LEU A 1 41 ? 9.091  12.399 -1.714  1.00 10.73 ? 374  LEU A CB  1 
ATOM   319 C CG  . LEU A 1 41 ? 8.977  12.843 -3.153  1.00 14.71 ? 374  LEU A CG  1 
ATOM   320 C CD1 . LEU A 1 41 ? 9.439  14.280 -3.194  1.00 13.54 ? 374  LEU A CD1 1 
ATOM   321 C CD2 . LEU A 1 41 ? 9.823  11.953 -4.047  1.00 13.69 ? 374  LEU A CD2 1 
ATOM   322 N N   . ALA A 1 42 ? 8.923  11.169 1.076   1.00 6.10  ? 375  ALA A N   1 
ATOM   323 C CA  . ALA A 1 42 ? 9.617  10.951 2.343   1.00 5.50  ? 375  ALA A CA  1 
ATOM   324 C C   . ALA A 1 42 ? 9.603  9.484  2.750   1.00 6.00  ? 375  ALA A C   1 
ATOM   325 O O   . ALA A 1 42 ? 10.614 8.938  3.177   1.00 5.85  ? 375  ALA A O   1 
ATOM   326 C CB  . ALA A 1 42 ? 9.039  11.836 3.429   1.00 6.62  ? 375  ALA A CB  1 
ATOM   327 N N   . ALA A 1 43 ? 8.451  8.841  2.592   1.00 5.17  ? 376  ALA A N   1 
ATOM   328 C CA  . ALA A 1 43 ? 8.324  7.429  2.900   1.00 5.95  ? 376  ALA A CA  1 
ATOM   329 C C   . ALA A 1 43 ? 9.207  6.590  1.979   1.00 6.68  ? 376  ALA A C   1 
ATOM   330 O O   . ALA A 1 43 ? 9.846  5.647  2.421   1.00 7.67  ? 376  ALA A O   1 
ATOM   331 C CB  . ALA A 1 43 ? 6.877  6.965  2.811   1.00 8.50  ? 376  ALA A CB  1 
ATOM   332 N N   . GLN A 1 44 ? 9.239  6.927  0.693   1.00 6.75  ? 377  GLN A N   1 
ATOM   333 C CA  . GLN A 1 44 ? 10.080 6.208  -0.242  1.00 5.96  ? 377  GLN A CA  1 
ATOM   334 C C   . GLN A 1 44 ? 11.545 6.330  0.121   1.00 5.84  ? 377  GLN A C   1 
ATOM   335 O O   . GLN A 1 44 ? 12.322 5.375  -0.015  1.00 6.68  ? 377  GLN A O   1 
ATOM   336 C CB  . GLN A 1 44 ? 9.884  6.725  -1.657  1.00 6.18  ? 377  GLN A CB  1 
ATOM   337 C CG  . GLN A 1 44 ? 8.528  6.335  -2.259  1.00 8.92  ? 377  GLN A CG  1 
ATOM   338 C CD  . GLN A 1 44 ? 8.364  6.902  -3.633  1.00 11.62 ? 377  GLN A CD  1 
ATOM   339 O OE1 . GLN A 1 44 ? 9.187  6.663  -4.520  1.00 14.68 ? 377  GLN A OE1 1 
ATOM   340 N NE2 . GLN A 1 44 ? 7.314  7.675  -3.818  1.00 14.96 ? 377  GLN A NE2 1 
ATOM   341 N N   . ASP A 1 45 ? 11.944 7.519  0.550   1.00 5.19  ? 378  ASP A N   1 
ATOM   342 C CA  . ASP A 1 45 ? 13.315 7.747  0.941   1.00 5.40  ? 378  ASP A CA  1 
ATOM   343 C C   . ASP A 1 45 ? 13.687 6.947  2.180   1.00 6.21  ? 378  ASP A C   1 
ATOM   344 O O   . ASP A 1 45 ? 14.794 6.435  2.255   1.00 7.92  ? 378  ASP A O   1 
ATOM   345 C CB  . ASP A 1 45 ? 13.577 9.248  1.150   1.00 5.38  ? 378  ASP A CB  1 
ATOM   346 C CG  . ASP A 1 45 ? 14.928 9.517  1.707   1.00 7.25  ? 378  ASP A CG  1 
ATOM   347 O OD1 . ASP A 1 45 ? 15.893 9.620  0.899   1.00 7.92  ? 378  ASP A OD1 1 
ATOM   348 O OD2 . ASP A 1 45 ? 15.039 9.605  2.962   1.00 7.45  ? 378  ASP A OD2 1 
ATOM   349 N N   . GLY A 1 46 ? 12.777 6.884  3.146   1.00 6.05  ? 379  GLY A N   1 
ATOM   350 C CA  . GLY A 1 46 ? 12.890 6.010  4.303   1.00 8.24  ? 379  GLY A CA  1 
ATOM   351 C C   . GLY A 1 46 ? 13.464 6.635  5.554   1.00 8.42  ? 379  GLY A C   1 
ATOM   352 O O   . GLY A 1 46 ? 13.208 6.144  6.652   1.00 12.24 ? 379  GLY A O   1 
ATOM   353 N N   . ARG A 1 47 ? 14.251 7.704  5.407   1.00 6.54  ? 380  ARG A N   1 
ATOM   354 C CA  . ARG A 1 47 ? 15.018 8.218  6.545   1.00 8.04  ? 380  ARG A CA  1 
ATOM   355 C C   . ARG A 1 47 ? 14.197 8.973  7.569   1.00 8.63  ? 380  ARG A C   1 
ATOM   356 O O   . ARG A 1 47 ? 14.369 8.776  8.766   1.00 13.68 ? 380  ARG A O   1 
ATOM   357 C CB  . ARG A 1 47 ? 16.169 9.085  6.066   1.00 7.42  ? 380  ARG A CB  1 
ATOM   358 C CG  . ARG A 1 47 ? 17.222 8.284  5.355   1.00 9.19  ? 380  ARG A CG  1 
ATOM   359 C CD  . ARG A 1 47 ? 18.320 9.143  4.763   1.00 9.89  ? 380  ARG A CD  1 
ATOM   360 N NE  . ARG A 1 47 ? 17.874 9.848  3.578   1.00 8.34  ? 380  ARG A NE  1 
ATOM   361 C CZ  . ARG A 1 47 ? 18.629 10.670 2.865   1.00 7.37  ? 380  ARG A CZ  1 
ATOM   362 N NH1 . ARG A 1 47 ? 19.872 10.932 3.235   1.00 10.70 ? 380  ARG A NH1 1 
ATOM   363 N NH2 . ARG A 1 47 ? 18.144 11.253 1.797   1.00 8.55  ? 380  ARG A NH2 1 
ATOM   364 N N   . LEU A 1 48 ? 13.341 9.866  7.116   1.00 7.63  ? 381  LEU A N   1 
ATOM   365 C CA  . LEU A 1 48 ? 12.584 10.684 8.035   1.00 7.29  ? 381  LEU A CA  1 
ATOM   366 C C   . LEU A 1 48 ? 11.646 9.839  8.871   1.00 9.21  ? 381  LEU A C   1 
ATOM   367 O O   . LEU A 1 48 ? 11.231 8.751  8.454   1.00 11.25 ? 381  LEU A O   1 
ATOM   368 C CB  . LEU A 1 48 ? 11.816 11.766 7.291   1.00 7.30  ? 381  LEU A CB  1 
ATOM   369 C CG  . LEU A 1 48 ? 12.687 12.823 6.589   1.00 8.01  ? 381  LEU A CG  1 
ATOM   370 C CD1 . LEU A 1 48 ? 11.836 13.663 5.678   1.00 10.86 ? 381  LEU A CD1 1 
ATOM   371 C CD2 . LEU A 1 48 ? 13.434 13.710 7.580   1.00 9.67  ? 381  LEU A CD2 1 
ATOM   372 N N   . SER A 1 49 ? 11.325 10.343 10.062  1.00 7.94  ? 382  SER A N   1 
ATOM   373 C CA  . SER A 1 49 ? 10.576 9.586  11.039  1.00 8.89  ? 382  SER A CA  1 
ATOM   374 C C   . SER A 1 49 ? 9.708  10.456 11.922  1.00 7.68  ? 382  SER A C   1 
ATOM   375 O O   . SER A 1 49 ? 10.045 11.579 12.207  1.00 7.74  ? 382  SER A O   1 
ATOM   376 C CB  . SER A 1 49 ? 11.569 8.839  11.926  1.00 10.93 ? 382  SER A CB  1 
ATOM   377 O OG  . SER A 1 49 ? 10.887 7.933  12.776  1.00 14.79 ? 382  SER A OG  1 
ATOM   378 N N   . SER A 1 50 ? 8.643  9.859  12.435  1.00 7.02  ? 383  SER A N   1 
ATOM   379 C CA  . SER A 1 50 ? 7.847  10.451 13.491  1.00 7.93  ? 383  SER A CA  1 
ATOM   380 C C   . SER A 1 50 ? 8.764  10.917 14.610  1.00 6.25  ? 383  SER A C   1 
ATOM   381 O O   . SER A 1 50 ? 9.705  10.210 14.994  1.00 8.15  ? 383  SER A O   1 
ATOM   382 C CB  A SER A 1 50 ? 6.847  9.400  13.997  0.50 7.51  ? 383  SER A CB  1 
ATOM   383 C CB  B SER A 1 50 ? 6.831  9.449  14.047  0.50 7.96  ? 383  SER A CB  1 
ATOM   384 O OG  A SER A 1 50 ? 5.958  9.906  14.963  0.50 6.38  ? 383  SER A OG  1 
ATOM   385 O OG  B SER A 1 50 ? 7.493  8.347  14.647  0.50 13.69 ? 383  SER A OG  1 
ATOM   386 N N   . ASN A 1 51 ? 8.476  12.127 15.105  1.00 5.84  ? 384  ASN A N   1 
ATOM   387 C CA  . ASN A 1 51 ? 9.180  12.780 16.210  1.00 6.94  ? 384  ASN A CA  1 
ATOM   388 C C   . ASN A 1 51 ? 10.454 13.506 15.833  1.00 6.49  ? 384  ASN A C   1 
ATOM   389 O O   . ASN A 1 51 ? 11.045 14.165 16.682  1.00 8.19  ? 384  ASN A O   1 
ATOM   390 C CB  . ASN A 1 51 ? 9.345  11.845 17.409  1.00 8.16  ? 384  ASN A CB  1 
ATOM   391 C CG  . ASN A 1 51 ? 8.018  11.464 17.982  1.00 9.85  ? 384  ASN A CG  1 
ATOM   392 O OD1 . ASN A 1 51 ? 7.313  12.311 18.530  1.00 12.30 ? 384  ASN A OD1 1 
ATOM   393 N ND2 . ASN A 1 51 ? 7.642  10.213 17.832  1.00 9.84  ? 384  ASN A ND2 1 
ATOM   394 N N   . ASP A 1 52 ? 10.845 13.450 14.563  1.00 6.15  ? 385  ASP A N   1 
ATOM   395 C CA  . ASP A 1 52 ? 11.970 14.223 14.106  1.00 5.99  ? 385  ASP A CA  1 
ATOM   396 C C   . ASP A 1 52 ? 11.601 15.697 14.206  1.00 6.29  ? 385  ASP A C   1 
ATOM   397 O O   . ASP A 1 52 ? 10.491 16.107 13.839  1.00 6.95  ? 385  ASP A O   1 
ATOM   398 C CB  . ASP A 1 52 ? 12.290 13.888 12.648  1.00 6.83  ? 385  ASP A CB  1 
ATOM   399 C CG  . ASP A 1 52 ? 13.037 12.585 12.472  1.00 8.10  ? 385  ASP A CG  1 
ATOM   400 O OD1 . ASP A 1 52 ? 13.484 11.982 13.468  1.00 8.15  ? 385  ASP A OD1 1 
ATOM   401 O OD2 . ASP A 1 52 ? 13.210 12.189 11.298  1.00 8.89  ? 385  ASP A OD2 1 
ATOM   402 N N   . ARG A 1 53 ? 12.550 16.500 14.650  1.00 5.25  ? 386  ARG A N   1 
ATOM   403 C CA  . ARG A 1 53 ? 12.408 17.938 14.683  1.00 4.99  ? 386  ARG A CA  1 
ATOM   404 C C   . ARG A 1 53 ? 13.100 18.513 13.447  1.00 4.96  ? 386  ARG A C   1 
ATOM   405 O O   . ARG A 1 53 ? 14.246 18.205 13.173  1.00 6.86  ? 386  ARG A O   1 
ATOM   406 C CB  . ARG A 1 53 ? 13.041 18.529 15.935  1.00 6.14  ? 386  ARG A CB  1 
ATOM   407 C CG  . ARG A 1 53 ? 12.863 20.012 16.008  1.00 7.50  ? 386  ARG A CG  1 
ATOM   408 C CD  . ARG A 1 53 ? 13.501 20.585 17.212  1.00 8.27  ? 386  ARG A CD  1 
ATOM   409 N NE  . ARG A 1 53 ? 13.318 22.031 17.331  1.00 8.88  ? 386  ARG A NE  1 
ATOM   410 C CZ  . ARG A 1 53 ? 13.737 22.686 18.396  1.00 11.23 ? 386  ARG A CZ  1 
ATOM   411 N NH1 . ARG A 1 53 ? 14.346 22.016 19.366  1.00 16.53 ? 386  ARG A NH1 1 
ATOM   412 N NH2 . ARG A 1 53 ? 13.543 23.977 18.514  1.00 13.37 ? 386  ARG A NH2 1 
ATOM   413 N N   . VAL A 1 54 ? 12.379 19.326 12.678  1.00 5.73  ? 387  VAL A N   1 
ATOM   414 C CA  . VAL A 1 54 ? 12.946 19.961 11.493  1.00 6.02  ? 387  VAL A CA  1 
ATOM   415 C C   . VAL A 1 54 ? 13.643 21.257 11.915  1.00 5.20  ? 387  VAL A C   1 
ATOM   416 O O   . VAL A 1 54 ? 12.992 22.215 12.306  1.00 6.89  ? 387  VAL A O   1 
ATOM   417 C CB  . VAL A 1 54 ? 11.865 20.242 10.411  1.00 6.77  ? 387  VAL A CB  1 
ATOM   418 C CG1 . VAL A 1 54 ? 12.525 20.854 9.177   1.00 7.75  ? 387  VAL A CG1 1 
ATOM   419 C CG2 . VAL A 1 54 ? 11.100 18.960 10.023  1.00 9.25  ? 387  VAL A CG2 1 
ATOM   420 N N   . LEU A 1 55 ? 14.971 21.250 11.874  1.00 4.90  ? 388  LEU A N   1 
ATOM   421 C CA  . LEU A 1 55 ? 15.774 22.399 12.259  1.00 5.97  ? 388  LEU A CA  1 
ATOM   422 C C   . LEU A 1 55 ? 15.917 23.418 11.129  1.00 5.73  ? 388  LEU A C   1 
ATOM   423 O O   . LEU A 1 55 ? 16.055 24.599 11.409  1.00 6.02  ? 388  LEU A O   1 
ATOM   424 C CB  . LEU A 1 55 ? 17.164 21.952 12.706  1.00 6.50  ? 388  LEU A CB  1 
ATOM   425 C CG  . LEU A 1 55 ? 17.211 21.067 13.939  1.00 7.90  ? 388  LEU A CG  1 
ATOM   426 C CD1 . LEU A 1 55 ? 18.665 20.650 14.173  1.00 10.54 ? 388  LEU A CD1 1 
ATOM   427 C CD2 . LEU A 1 55 ? 16.639 21.761 15.161  1.00 12.65 ? 388  LEU A CD2 1 
ATOM   428 N N   . ALA A 1 56 ? 15.899 22.967 9.877   1.00 4.96  ? 389  ALA A N   1 
ATOM   429 C CA  . ALA A 1 56 ? 16.078 23.839 8.738   1.00 5.86  ? 389  ALA A CA  1 
ATOM   430 C C   . ALA A 1 56 ? 15.613 23.097 7.501   1.00 4.94  ? 389  ALA A C   1 
ATOM   431 O O   . ALA A 1 56 ? 15.630 21.863 7.462   1.00 5.30  ? 389  ALA A O   1 
ATOM   432 C CB  . ALA A 1 56 ? 17.559 24.243 8.565   1.00 7.39  ? 389  ALA A CB  1 
ATOM   433 N N   . ILE A 1 57 ? 15.205 23.857 6.494   1.00 4.78  ? 390  ILE A N   1 
ATOM   434 C CA  . ILE A 1 57 ? 14.911 23.339 5.159   1.00 5.74  ? 390  ILE A CA  1 
ATOM   435 C C   . ILE A 1 57 ? 15.615 24.249 4.162   1.00 5.48  ? 390  ILE A C   1 
ATOM   436 O O   . ILE A 1 57 ? 15.437 25.465 4.181   1.00 5.95  ? 390  ILE A O   1 
ATOM   437 C CB  . ILE A 1 57 ? 13.401 23.285 4.848   1.00 7.45  ? 390  ILE A CB  1 
ATOM   438 C CG1 . ILE A 1 57 ? 12.699 22.291 5.772   1.00 8.31  ? 390  ILE A CG1 1 
ATOM   439 C CG2 . ILE A 1 57 ? 13.155 22.833 3.436   1.00 7.99  ? 390  ILE A CG2 1 
ATOM   440 C CD1 . ILE A 1 57 ? 11.186 22.199 5.602   1.00 11.74 ? 390  ILE A CD1 1 
ATOM   441 N N   . ASN A 1 58 ? 16.488 23.659 3.347   1.00 5.37  ? 391  ASN A N   1 
ATOM   442 C CA  . ASN A 1 58 ? 17.202 24.406 2.311   1.00 5.56  ? 391  ASN A CA  1 
ATOM   443 C C   . ASN A 1 58 ? 17.968 25.593 2.877   1.00 5.61  ? 391  ASN A C   1 
ATOM   444 O O   . ASN A 1 58 ? 18.065 26.640 2.259   1.00 6.22  ? 391  ASN A O   1 
ATOM   445 C CB  . ASN A 1 58 ? 16.242 24.820 1.190   1.00 6.55  ? 391  ASN A CB  1 
ATOM   446 C CG  . ASN A 1 58 ? 15.844 23.658 0.321   1.00 5.43  ? 391  ASN A CG  1 
ATOM   447 O OD1 . ASN A 1 58 ? 16.462 22.598 0.393   1.00 7.68  ? 391  ASN A OD1 1 
ATOM   448 N ND2 . ASN A 1 58 ? 14.804 23.840 -0.499  1.00 9.08  ? 391  ASN A ND2 1 
ATOM   449 N N   . GLY A 1 59 ? 18.531 25.413 4.066   1.00 7.13  ? 392  GLY A N   1 
ATOM   450 C CA  . GLY A 1 59 ? 19.286 26.446 4.761   1.00 6.57  ? 392  GLY A CA  1 
ATOM   451 C C   . GLY A 1 59 ? 18.476 27.481 5.496   1.00 6.87  ? 392  GLY A C   1 
ATOM   452 O O   . GLY A 1 59 ? 19.058 28.366 6.131   1.00 10.12 ? 392  GLY A O   1 
ATOM   453 N N   . HIS A 1 60 ? 17.151 27.403 5.379   1.00 5.84  ? 393  HIS A N   1 
ATOM   454 C CA  . HIS A 1 60 ? 16.246 28.308 6.057   1.00 6.38  ? 393  HIS A CA  1 
ATOM   455 C C   . HIS A 1 60 ? 15.969 27.768 7.456   1.00 6.08  ? 393  HIS A C   1 
ATOM   456 O O   . HIS A 1 60 ? 15.431 26.677 7.615   1.00 7.61  ? 393  HIS A O   1 
ATOM   457 C CB  . HIS A 1 60 ? 14.923 28.422 5.291   1.00 7.41  ? 393  HIS A CB  1 
ATOM   458 C CG  . HIS A 1 60 ? 15.059 28.970 3.905   1.00 9.29  ? 393  HIS A CG  1 
ATOM   459 N ND1 . HIS A 1 60 ? 14.673 30.244 3.565   1.00 15.26 ? 393  HIS A ND1 1 
ATOM   460 C CD2 . HIS A 1 60 ? 15.508 28.403 2.762   1.00 11.08 ? 393  HIS A CD2 1 
ATOM   461 C CE1 . HIS A 1 60 ? 14.916 30.455 2.284   1.00 15.78 ? 393  HIS A CE1 1 
ATOM   462 N NE2 . HIS A 1 60 ? 15.439 29.353 1.773   1.00 10.90 ? 393  HIS A NE2 1 
ATOM   463 N N   . ASP A 1 61 ? 16.284 28.556 8.478   1.00 7.12  ? 394  ASP A N   1 
ATOM   464 C CA  . ASP A 1 61 ? 16.130 28.131 9.868   1.00 7.26  ? 394  ASP A CA  1 
ATOM   465 C C   . ASP A 1 61 ? 14.659 27.919 10.218  1.00 7.26  ? 394  ASP A C   1 
ATOM   466 O O   . ASP A 1 61 ? 13.821 28.778 9.948   1.00 9.44  ? 394  ASP A O   1 
ATOM   467 C CB  . ASP A 1 61 ? 16.723 29.213 10.787  1.00 9.51  ? 394  ASP A CB  1 
ATOM   468 C CG  . ASP A 1 61 ? 16.625 28.881 12.261  1.00 11.69 ? 394  ASP A CG  1 
ATOM   469 O OD1 . ASP A 1 61 ? 16.644 27.691 12.621  1.00 11.87 ? 394  ASP A OD1 1 
ATOM   470 O OD2 . ASP A 1 61 ? 16.534 29.843 13.051  1.00 19.75 ? 394  ASP A OD2 1 
ATOM   471 N N   . LEU A 1 62 ? 14.365 26.784 10.844  1.00 6.81  ? 395  LEU A N   1 
ATOM   472 C CA  . LEU A 1 62 ? 13.042 26.461 11.358  1.00 7.03  ? 395  LEU A CA  1 
ATOM   473 C C   . LEU A 1 62 ? 13.065 26.067 12.836  1.00 6.56  ? 395  LEU A C   1 
ATOM   474 O O   . LEU A 1 62 ? 12.072 25.571 13.367  1.00 7.03  ? 395  LEU A O   1 
ATOM   475 C CB  . LEU A 1 62 ? 12.435 25.351 10.511  1.00 8.04  ? 395  LEU A CB  1 
ATOM   476 C CG  . LEU A 1 62 ? 11.842 25.803 9.173   1.00 9.58  ? 395  LEU A CG  1 
ATOM   477 C CD1 . LEU A 1 62 ? 11.547 24.580 8.318   1.00 14.23 ? 395  LEU A CD1 1 
ATOM   478 C CD2 . LEU A 1 62 ? 10.558 26.562 9.377   1.00 11.51 ? 395  LEU A CD2 1 
ATOM   479 N N   . LYS A 1 63 ? 14.176 26.298 13.525  1.00 6.57  ? 396  LYS A N   1 
ATOM   480 C CA  . LYS A 1 63 ? 14.275 25.871 14.918  1.00 7.54  ? 396  LYS A CA  1 
ATOM   481 C C   . LYS A 1 63 ? 13.103 26.393 15.750  1.00 6.86  ? 396  LYS A C   1 
ATOM   482 O O   . LYS A 1 63 ? 12.524 25.652 16.546  1.00 7.88  ? 396  LYS A O   1 
ATOM   483 C CB  . LYS A 1 63 ? 15.603 26.320 15.527  1.00 9.50  ? 396  LYS A CB  1 
ATOM   484 C CG  . LYS A 1 63 ? 15.877 25.737 16.905  1.00 14.00 ? 396  LYS A CG  1 
ATOM   485 C CD  . LYS A 1 63 ? 17.286 25.997 17.394  1.00 18.24 ? 396  LYS A CD  1 
ATOM   486 C CE  . LYS A 1 63 ? 17.444 25.472 18.815  1.00 23.48 ? 396  LYS A CE  1 
ATOM   487 N N   . TYR A 1 64 ? 12.751 27.663 15.566  1.00 7.48  ? 397  TYR A N   1 
ATOM   488 C CA  . TYR A 1 64 ? 11.624 28.256 16.273  1.00 8.17  ? 397  TYR A CA  1 
ATOM   489 C C   . TYR A 1 64 ? 10.497 28.626 15.316  1.00 8.44  ? 397  TYR A C   1 
ATOM   490 O O   . TYR A 1 64 ? 9.719  29.543 15.565  1.00 11.33 ? 397  TYR A O   1 
ATOM   491 C CB  . TYR A 1 64 ? 12.093 29.470 17.089  1.00 11.09 ? 397  TYR A CB  1 
ATOM   492 C CG  . TYR A 1 64 ? 13.152 29.097 18.092  1.00 11.97 ? 397  TYR A CG  1 
ATOM   493 C CD1 . TYR A 1 64 ? 12.812 28.444 19.262  1.00 14.21 ? 397  TYR A CD1 1 
ATOM   494 C CD2 . TYR A 1 64 ? 14.501 29.305 17.825  1.00 15.02 ? 397  TYR A CD2 1 
ATOM   495 C CE1 . TYR A 1 64 ? 13.775 28.061 20.178  1.00 17.55 ? 397  TYR A CE1 1 
ATOM   496 C CE2 . TYR A 1 64 ? 15.471 28.924 18.736  1.00 20.96 ? 397  TYR A CE2 1 
ATOM   497 C CZ  . TYR A 1 64 ? 15.099 28.298 19.905  1.00 20.25 ? 397  TYR A CZ  1 
ATOM   498 O OH  . TYR A 1 64 ? 16.053 27.918 20.816  1.00 26.55 ? 397  TYR A OH  1 
ATOM   499 N N   . GLY A 1 65 ? 10.391 27.868 14.226  1.00 7.80  ? 398  GLY A N   1 
ATOM   500 C CA  . GLY A 1 65 ? 9.456  28.141 13.163  1.00 8.27  ? 398  GLY A CA  1 
ATOM   501 C C   . GLY A 1 65 ? 8.106  27.507 13.394  1.00 7.91  ? 398  GLY A C   1 
ATOM   502 O O   . GLY A 1 65 ? 7.804  27.015 14.472  1.00 7.59  ? 398  GLY A O   1 
ATOM   503 N N   . THR A 1 66 ? 7.300  27.515 12.346  1.00 9.49  ? 399  THR A N   1 
ATOM   504 C CA  . THR A 1 66 ? 5.936  27.018 12.364  1.00 9.40  ? 399  THR A CA  1 
ATOM   505 C C   . THR A 1 66 ? 5.689  26.091 11.183  1.00 9.04  ? 399  THR A C   1 
ATOM   506 O O   . THR A 1 66 ? 6.401  26.156 10.182  1.00 8.82  ? 399  THR A O   1 
ATOM   507 C CB  . THR A 1 66 ? 4.949  28.188 12.187  1.00 9.92  ? 399  THR A CB  1 
ATOM   508 O OG1 . THR A 1 66 ? 5.184  28.803 10.915  1.00 12.44 ? 399  THR A OG1 1 
ATOM   509 C CG2 . THR A 1 66 ? 5.102  29.213 13.287  1.00 13.80 ? 399  THR A CG2 1 
ATOM   510 N N   . PRO A 1 67 ? 4.658  25.244 11.275  1.00 9.53  ? 400  PRO A N   1 
ATOM   511 C CA  . PRO A 1 67 ? 4.247  24.481 10.100  1.00 8.74  ? 400  PRO A CA  1 
ATOM   512 C C   . PRO A 1 67 ? 3.988  25.364 8.877   1.00 9.67  ? 400  PRO A C   1 
ATOM   513 O O   . PRO A 1 67 ? 4.337  24.995 7.759   1.00 10.04 ? 400  PRO A O   1 
ATOM   514 C CB  . PRO A 1 67 ? 2.977  23.778 10.578  1.00 10.07 ? 400  PRO A CB  1 
ATOM   515 C CG  . PRO A 1 67 ? 3.200  23.593 12.032  1.00 11.46 ? 400  PRO A CG  1 
ATOM   516 C CD  . PRO A 1 67 ? 3.906  24.839 12.476  1.00 11.37 ? 400  PRO A CD  1 
ATOM   517 N N   . GLU A 1 68 ? 3.394  26.533 9.096   1.00 9.78  ? 401  GLU A N   1 
ATOM   518 C CA  . GLU A 1 68 ? 3.116  27.444 8.001   1.00 11.62 ? 401  GLU A CA  1 
ATOM   519 C C   . GLU A 1 68 ? 4.362  27.913 7.288   1.00 10.80 ? 401  GLU A C   1 
ATOM   520 O O   . GLU A 1 68 ? 4.391  27.980 6.050   1.00 13.59 ? 401  GLU A O   1 
ATOM   521 C CB  . GLU A 1 68 ? 2.371  28.680 8.504   1.00 15.78 ? 401  GLU A CB  1 
ATOM   522 C CG  . GLU A 1 68 ? 0.939  28.454 8.841   1.00 22.69 ? 401  GLU A CG  1 
ATOM   523 C CD  . GLU A 1 68 ? 0.730  27.530 10.025  1.00 38.18 ? 401  GLU A CD  1 
ATOM   524 O OE1 . GLU A 1 68 ? 1.509  27.567 11.019  1.00 30.10 ? 401  GLU A OE1 1 
ATOM   525 O OE2 . GLU A 1 68 ? -0.241 26.753 9.956   1.00 46.84 ? 401  GLU A OE2 1 
ATOM   526 N N   . LEU A 1 69 ? 5.377  28.283 8.060   1.00 10.10 ? 402  LEU A N   1 
ATOM   527 C CA  . LEU A 1 69 ? 6.635  28.728 7.469   1.00 10.16 ? 402  LEU A CA  1 
ATOM   528 C C   . LEU A 1 69 ? 7.287  27.576 6.700   1.00 9.38  ? 402  LEU A C   1 
ATOM   529 O O   . LEU A 1 69 ? 7.778  27.764 5.595   1.00 10.31 ? 402  LEU A O   1 
ATOM   530 C CB  . LEU A 1 69 ? 7.557  29.283 8.549   1.00 13.39 ? 402  LEU A CB  1 
ATOM   531 C CG  . LEU A 1 69 ? 8.913  29.806 8.085   1.00 13.91 ? 402  LEU A CG  1 
ATOM   532 C CD1 . LEU A 1 69 ? 8.763  30.875 7.002   1.00 16.82 ? 402  LEU A CD1 1 
ATOM   533 C CD2 . LEU A 1 69 ? 9.710  30.307 9.286   1.00 16.06 ? 402  LEU A CD2 1 
ATOM   534 N N   . ALA A 1 70 ? 7.282  26.382 7.275   1.00 9.22  ? 403  ALA A N   1 
ATOM   535 C CA  . ALA A 1 70 ? 7.801  25.207 6.554   1.00 8.31  ? 403  ALA A CA  1 
ATOM   536 C C   . ALA A 1 70 ? 7.056  24.999 5.230   1.00 8.63  ? 403  ALA A C   1 
ATOM   537 O O   . ALA A 1 70 ? 7.679  24.743 4.207   1.00 9.95  ? 403  ALA A O   1 
ATOM   538 C CB  . ALA A 1 70 ? 7.687  23.984 7.411   1.00 9.24  ? 403  ALA A CB  1 
ATOM   539 N N   . ALA A 1 71 ? 5.729  25.125 5.262   1.00 9.56  ? 404  ALA A N   1 
ATOM   540 C CA  . ALA A 1 71 ? 4.901  24.975 4.076   1.00 10.82 ? 404  ALA A CA  1 
ATOM   541 C C   . ALA A 1 71 ? 5.282  25.984 3.003   1.00 10.30 ? 404  ALA A C   1 
ATOM   542 O O   . ALA A 1 71 ? 5.370  25.639 1.841   1.00 11.75 ? 404  ALA A O   1 
ATOM   543 C CB  . ALA A 1 71 ? 3.435  25.119 4.431   1.00 12.69 ? 404  ALA A CB  1 
ATOM   544 N N   . GLN A 1 72 ? 5.506  27.233 3.406   1.00 11.39 ? 405  GLN A N   1 
ATOM   545 C CA  . GLN A 1 72 ? 5.878  28.302 2.476   1.00 12.45 ? 405  GLN A CA  1 
ATOM   546 C C   . GLN A 1 72 ? 7.207  27.962 1.806   1.00 12.12 ? 405  GLN A C   1 
ATOM   547 O O   . GLN A 1 72 ? 7.353  28.082 0.581   1.00 12.87 ? 405  GLN A O   1 
ATOM   548 C CB  . GLN A 1 72 ? 5.975  29.639 3.207   1.00 15.12 ? 405  GLN A CB  1 
ATOM   549 C CG  . GLN A 1 72 ? 4.633  30.242 3.569   1.00 26.64 ? 405  GLN A CG  1 
ATOM   550 C CD  . GLN A 1 72 ? 4.759  31.571 4.300   1.00 41.76 ? 405  GLN A CD  1 
ATOM   551 O OE1 . GLN A 1 72 ? 5.777  31.860 4.936   1.00 44.64 ? 405  GLN A OE1 1 
ATOM   552 N NE2 . GLN A 1 72 ? 3.713  32.385 4.216   1.00 48.57 ? 405  GLN A NE2 1 
ATOM   553 N N   . ILE A 1 73 ? 8.179  27.518 2.597   1.00 10.78 ? 406  ILE A N   1 
ATOM   554 C CA  . ILE A 1 73 ? 9.494  27.153 2.059   1.00 11.01 ? 406  ILE A CA  1 
ATOM   555 C C   . ILE A 1 73 ? 9.399  25.976 1.090   1.00 9.44  ? 406  ILE A C   1 
ATOM   556 O O   . ILE A 1 73 ? 9.934  26.028 -0.020  1.00 11.21 ? 406  ILE A O   1 
ATOM   557 C CB  . ILE A 1 73 ? 10.495 26.822 3.185   1.00 10.04 ? 406  ILE A CB  1 
ATOM   558 C CG1 . ILE A 1 73 ? 10.756 28.065 4.042   1.00 12.22 ? 406  ILE A CG1 1 
ATOM   559 C CG2 . ILE A 1 73 ? 11.806 26.269 2.626   1.00 11.05 ? 406  ILE A CG2 1 
ATOM   560 C CD1 . ILE A 1 73 ? 11.281 27.733 5.431   1.00 13.45 ? 406  ILE A CD1 1 
ATOM   561 N N   . ILE A 1 74 ? 8.672  24.931 1.481   1.00 9.74  ? 407  ILE A N   1 
ATOM   562 C CA  . ILE A 1 74 ? 8.569  23.728 0.661   1.00 9.95  ? 407  ILE A CA  1 
ATOM   563 C C   . ILE A 1 74 ? 7.825  24.010 -0.644  1.00 11.91 ? 407  ILE A C   1 
ATOM   564 O O   . ILE A 1 74 ? 8.246  23.557 -1.726  1.00 13.89 ? 407  ILE A O   1 
ATOM   565 C CB  . ILE A 1 74 ? 7.907  22.592 1.429   1.00 10.93 ? 407  ILE A CB  1 
ATOM   566 C CG1 . ILE A 1 74 ? 8.843  22.115 2.522   1.00 10.18 ? 407  ILE A CG1 1 
ATOM   567 C CG2 . ILE A 1 74 ? 7.582  21.426 0.509   1.00 12.72 ? 407  ILE A CG2 1 
ATOM   568 C CD1 . ILE A 1 74 ? 8.119  21.328 3.647   1.00 13.36 ? 407  ILE A CD1 1 
ATOM   569 N N   . GLN A 1 75 ? 6.741  24.780 -0.564  1.00 12.93 ? 408  GLN A N   1 
ATOM   570 C CA  . GLN A 1 75 ? 5.961  25.074 -1.768  1.00 13.68 ? 408  GLN A CA  1 
ATOM   571 C C   . GLN A 1 75 ? 6.746  25.917 -2.773  1.00 13.60 ? 408  GLN A C   1 
ATOM   572 O O   . GLN A 1 75 ? 6.574  25.734 -3.965  1.00 17.87 ? 408  GLN A O   1 
ATOM   573 C CB  . GLN A 1 75 ? 4.657  25.750 -1.402  1.00 16.16 ? 408  GLN A CB  1 
ATOM   574 C CG  . GLN A 1 75 ? 3.669  24.773 -0.769  1.00 18.38 ? 408  GLN A CG  1 
ATOM   575 C CD  . GLN A 1 75 ? 2.441  25.471 -0.235  1.00 26.27 ? 408  GLN A CD  1 
ATOM   576 O OE1 . GLN A 1 75 ? 2.313  26.691 -0.338  1.00 34.21 ? 408  GLN A OE1 1 
ATOM   577 N NE2 . GLN A 1 75 ? 1.530  24.705 0.337   1.00 29.94 ? 408  GLN A NE2 1 
ATOM   578 N N   . ALA A 1 76 ? 7.609  26.812 -2.296  1.00 10.43 ? 409  ALA A N   1 
ATOM   579 C CA  . ALA A 1 76 ? 8.437  27.639 -3.166  1.00 11.32 ? 409  ALA A CA  1 
ATOM   580 C C   . ALA A 1 76 ? 9.748  26.982 -3.584  1.00 11.10 ? 409  ALA A C   1 
ATOM   581 O O   . ALA A 1 76 ? 10.468 27.561 -4.377  1.00 13.90 ? 409  ALA A O   1 
ATOM   582 C CB  . ALA A 1 76 ? 8.707  28.987 -2.509  1.00 13.58 ? 409  ALA A CB  1 
ATOM   583 N N   . SER A 1 77 ? 10.065 25.793 -3.059  1.00 9.06  ? 410  SER A N   1 
ATOM   584 C CA  . SER A 1 77 ? 11.372 25.165 -3.256  1.00 9.49  ? 410  SER A CA  1 
ATOM   585 C C   . SER A 1 77 ? 11.592 24.786 -4.692  1.00 10.15 ? 410  SER A C   1 
ATOM   586 O O   . SER A 1 77 ? 10.639 24.562 -5.437  1.00 14.75 ? 410  SER A O   1 
ATOM   587 C CB  A SER A 1 77 ? 11.469 23.906 -2.429  0.50 9.76  ? 410  SER A CB  1 
ATOM   588 C CB  B SER A 1 77 ? 11.508 23.890 -2.388  0.50 10.54 ? 410  SER A CB  1 
ATOM   589 O OG  A SER A 1 77 ? 10.601 22.959 -2.991  0.50 13.23 ? 410  SER A OG  1 
ATOM   590 O OG  B SER A 1 77 ? 12.763 23.204 -2.554  0.50 9.51  ? 410  SER A OG  1 
ATOM   591 N N   . GLY A 1 78 ? 12.861 24.707 -5.079  1.00 7.78  ? 411  GLY A N   1 
ATOM   592 C CA  . GLY A 1 78 ? 13.221 24.044 -6.296  1.00 9.54  ? 411  GLY A CA  1 
ATOM   593 C C   . GLY A 1 78 ? 13.129 22.543 -6.113  1.00 8.94  ? 411  GLY A C   1 
ATOM   594 O O   . GLY A 1 78 ? 12.615 22.045 -5.120  1.00 10.77 ? 411  GLY A O   1 
ATOM   595 N N   . GLU A 1 79 ? 13.674 21.791 -7.049  1.00 9.79  ? 412  GLU A N   1 
ATOM   596 C CA  . GLU A 1 79 ? 13.501 20.344 -7.016  1.00 9.89  ? 412  GLU A CA  1 
ATOM   597 C C   . GLU A 1 79 ? 14.129 19.674 -5.794  1.00 9.48  ? 412  GLU A C   1 
ATOM   598 O O   . GLU A 1 79 ? 13.577 18.718 -5.290  1.00 11.29 ? 412  GLU A O   1 
ATOM   599 C CB  . GLU A 1 79 ? 13.953 19.685 -8.320  1.00 16.21 ? 412  GLU A CB  1 
ATOM   600 C CG  . GLU A 1 79 ? 15.398 19.861 -8.639  1.00 16.42 ? 412  GLU A CG  1 
ATOM   601 C CD  . GLU A 1 79 ? 16.323 18.856 -7.970  1.00 22.12 ? 412  GLU A CD  1 
ATOM   602 O OE1 . GLU A 1 79 ? 15.852 17.773 -7.589  1.00 22.98 ? 412  GLU A OE1 1 
ATOM   603 O OE2 . GLU A 1 79 ? 17.531 19.158 -7.834  1.00 30.49 ? 412  GLU A OE2 1 
ATOM   604 N N   . ARG A 1 80 ? 15.251 20.178 -5.304  1.00 8.87  ? 413  ARG A N   1 
ATOM   605 C CA  . ARG A 1 80 ? 15.911 19.591 -4.148  1.00 8.68  ? 413  ARG A CA  1 
ATOM   606 C C   . ARG A 1 80 ? 15.411 20.246 -2.878  1.00 8.11  ? 413  ARG A C   1 
ATOM   607 O O   . ARG A 1 80 ? 15.445 21.473 -2.722  1.00 9.37  ? 413  ARG A O   1 
ATOM   608 C CB  . ARG A 1 80 ? 17.430 19.716 -4.256  1.00 11.07 ? 413  ARG A CB  1 
ATOM   609 C CG  . ARG A 1 80 ? 18.176 19.033 -3.108  1.00 13.32 ? 413  ARG A CG  1 
ATOM   610 C CD  . ARG A 1 80 ? 19.682 19.112 -3.324  1.00 24.79 ? 413  ARG A CD  1 
ATOM   611 N NE  . ARG A 1 80 ? 20.448 18.479 -2.245  1.00 27.84 ? 413  ARG A NE  1 
ATOM   612 C CZ  . ARG A 1 80 ? 20.993 19.118 -1.207  1.00 36.19 ? 413  ARG A CZ  1 
ATOM   613 N NH1 . ARG A 1 80 ? 20.863 20.433 -1.054  1.00 33.72 ? 413  ARG A NH1 1 
ATOM   614 N NH2 . ARG A 1 80 ? 21.671 18.426 -0.295  1.00 41.41 ? 413  ARG A NH2 1 
ATOM   615 N N   . VAL A 1 81 ? 14.959 19.401 -1.963  1.00 6.86  ? 414  VAL A N   1 
ATOM   616 C CA  . VAL A 1 81 ? 14.513 19.835 -0.643  1.00 6.31  ? 414  VAL A CA  1 
ATOM   617 C C   . VAL A 1 81 ? 15.382 19.116 0.383   1.00 6.33  ? 414  VAL A C   1 
ATOM   618 O O   . VAL A 1 81 ? 15.236 17.909 0.611   1.00 8.05  ? 414  VAL A O   1 
ATOM   619 C CB  . VAL A 1 81 ? 13.028 19.562 -0.396  1.00 7.85  ? 414  VAL A CB  1 
ATOM   620 C CG1 . VAL A 1 81 ? 12.610 20.149 0.932   1.00 9.26  ? 414  VAL A CG1 1 
ATOM   621 C CG2 . VAL A 1 81 ? 12.177 20.137 -1.532  1.00 10.85 ? 414  VAL A CG2 1 
ATOM   622 N N   . ASN A 1 82 ? 16.280 19.870 0.997   1.00 5.57  ? 415  ASN A N   1 
ATOM   623 C CA  . ASN A 1 82 ? 17.158 19.331 2.032   1.00 5.84  ? 415  ASN A CA  1 
ATOM   624 C C   . ASN A 1 82 ? 16.603 19.693 3.400   1.00 5.43  ? 415  ASN A C   1 
ATOM   625 O O   . ASN A 1 82 ? 16.397 20.860 3.676   1.00 9.69  ? 415  ASN A O   1 
ATOM   626 C CB  . ASN A 1 82 ? 18.579 19.900 1.896   1.00 8.13  ? 415  ASN A CB  1 
ATOM   627 C CG  . ASN A 1 82 ? 19.516 19.209 2.822   1.00 12.01 ? 415  ASN A CG  1 
ATOM   628 O OD1 . ASN A 1 82 ? 19.750 18.001 2.675   1.00 16.43 ? 415  ASN A OD1 1 
ATOM   629 N ND2 . ASN A 1 82 ? 19.968 19.910 3.861   1.00 16.19 ? 415  ASN A ND2 1 
ATOM   630 N N   . LEU A 1 83 ? 16.354 18.700 4.242   1.00 5.52  ? 416  LEU A N   1 
ATOM   631 C CA  . LEU A 1 83 ? 15.875 18.917 5.599   1.00 5.39  ? 416  LEU A CA  1 
ATOM   632 C C   . LEU A 1 83 ? 16.980 18.565 6.561   1.00 5.82  ? 416  LEU A C   1 
ATOM   633 O O   . LEU A 1 83 ? 17.545 17.489 6.480   1.00 8.00  ? 416  LEU A O   1 
ATOM   634 C CB  . LEU A 1 83 ? 14.653 18.038 5.889   1.00 6.63  ? 416  LEU A CB  1 
ATOM   635 C CG  . LEU A 1 83 ? 13.448 18.253 4.967   1.00 7.62  ? 416  LEU A CG  1 
ATOM   636 C CD1 . LEU A 1 83 ? 13.437 17.282 3.780   1.00 10.23 ? 416  LEU A CD1 1 
ATOM   637 C CD2 . LEU A 1 83 ? 12.167 18.112 5.799   1.00 11.84 ? 416  LEU A CD2 1 
ATOM   638 N N   . THR A 1 84 ? 17.279 19.480 7.477   1.00 5.80  ? 417  THR A N   1 
ATOM   639 C CA  . THR A 1 84 ? 18.161 19.195 8.594   1.00 5.83  ? 417  THR A CA  1 
ATOM   640 C C   . THR A 1 84 ? 17.285 18.858 9.778   1.00 5.81  ? 417  THR A C   1 
ATOM   641 O O   . THR A 1 84 ? 16.420 19.644 10.181  1.00 6.34  ? 417  THR A O   1 
ATOM   642 C CB  . THR A 1 84 ? 19.072 20.384 8.934   1.00 7.22  ? 417  THR A CB  1 
ATOM   643 O OG1 . THR A 1 84 ? 19.806 20.767 7.757   1.00 11.03 ? 417  THR A OG1 1 
ATOM   644 C CG2 . THR A 1 84 ? 20.050 20.060 10.048  1.00 9.42  ? 417  THR A CG2 1 
ATOM   645 N N   . ILE A 1 85 ? 17.508 17.664 10.320  1.00 4.76  ? 418  ILE A N   1 
ATOM   646 C CA  . ILE A 1 85 ? 16.683 17.063 11.339  1.00 6.86  ? 418  ILE A CA  1 
ATOM   647 C C   . ILE A 1 85 ? 17.431 16.795 12.632  1.00 6.23  ? 418  ILE A C   1 
ATOM   648 O O   . ILE A 1 85 ? 18.594 16.410 12.577  1.00 6.95  ? 418  ILE A O   1 
ATOM   649 C CB  . ILE A 1 85 ? 16.266 15.653 10.761  1.00 14.19 ? 418  ILE A CB  1 
ATOM   650 C CG1 . ILE A 1 85 ? 15.517 15.810 9.448   1.00 13.77 ? 418  ILE A CG1 1 
ATOM   651 C CG2 . ILE A 1 85 ? 15.551 14.836 11.763  1.00 17.42 ? 418  ILE A CG2 1 
ATOM   652 C CD1 . ILE A 1 85 ? 14.351 16.566 9.612   1.00 10.45 ? 418  ILE A CD1 1 
ATOM   653 N N   . ALA A 1 86 ? 16.739 16.976 13.757  1.00 6.25  ? 419  ALA A N   1 
ATOM   654 C CA  . ALA A 1 86 ? 17.190 16.463 15.050  1.00 6.59  ? 419  ALA A CA  1 
ATOM   655 C C   . ALA A 1 86 ? 16.266 15.319 15.464  1.00 6.81  ? 419  ALA A C   1 
ATOM   656 O O   . ALA A 1 86 ? 15.051 15.490 15.528  1.00 8.22  ? 419  ALA A O   1 
ATOM   657 C CB  . ALA A 1 86 ? 17.200 17.563 16.105  1.00 8.55  ? 419  ALA A CB  1 
ATOM   658 N N   . ARG A 1 87 ? 16.864 14.166 15.753  1.00 7.51  ? 420  ARG A N   1 
ATOM   659 C CA  . ARG A 1 87 ? 16.141 12.966 16.135  1.00 8.14  ? 420  ARG A CA  1 
ATOM   660 C C   . ARG A 1 87 ? 16.500 12.689 17.593  1.00 7.99  ? 420  ARG A C   1 
ATOM   661 O O   . ARG A 1 87 ? 17.564 12.158 17.886  1.00 8.23  ? 420  ARG A O   1 
ATOM   662 C CB  . ARG A 1 87 ? 16.548 11.809 15.238  1.00 8.42  ? 420  ARG A CB  1 
ATOM   663 C CG  . ARG A 1 87 ? 15.882 10.496 15.579  1.00 9.40  ? 420  ARG A CG  1 
ATOM   664 C CD  . ARG A 1 87 ? 16.088 9.500  14.466  1.00 10.06 ? 420  ARG A CD  1 
ATOM   665 N NE  . ARG A 1 87 ? 15.444 9.990  13.256  1.00 8.90  ? 420  ARG A NE  1 
ATOM   666 C CZ  . ARG A 1 87 ? 15.734 9.569  12.031  1.00 11.27 ? 420  ARG A CZ  1 
ATOM   667 N NH1 . ARG A 1 87 ? 16.620 8.604  11.820  1.00 12.83 ? 420  ARG A NH1 1 
ATOM   668 N NH2 . ARG A 1 87 ? 15.145 10.122 11.007  1.00 11.16 ? 420  ARG A NH2 1 
ATOM   669 N N   . PRO A 1 88 ? 15.638 13.098 18.531  1.00 10.73 ? 421  PRO A N   1 
ATOM   670 C CA  . PRO A 1 88 ? 16.030 12.918 19.925  1.00 10.69 ? 421  PRO A CA  1 
ATOM   671 C C   . PRO A 1 88 ? 15.854 11.499 20.425  1.00 10.66 ? 421  PRO A C   1 
ATOM   672 O O   . PRO A 1 88 ? 15.081 10.700 19.871  1.00 14.66 ? 421  PRO A O   1 
ATOM   673 C CB  . PRO A 1 88 ? 15.102 13.869 20.685  1.00 14.27 ? 421  PRO A CB  1 
ATOM   674 C CG  . PRO A 1 88 ? 14.609 14.838 19.670  1.00 18.94 ? 421  PRO A CG  1 
ATOM   675 C CD  . PRO A 1 88 ? 14.509 14.034 18.416  1.00 14.24 ? 421  PRO A CD  1 
ATOM   676 N N   . GLY A 1 89 ? 16.590 11.193 21.476  1.00 10.65 ? 422  GLY A N   1 
ATOM   677 C CA  . GLY A 1 89 ? 16.292 10.059 22.300  1.00 14.39 ? 422  GLY A CA  1 
ATOM   678 C C   . GLY A 1 89 ? 16.821 8.730  21.823  1.00 12.94 ? 422  GLY A C   1 
ATOM   679 O O   . GLY A 1 89 ? 17.450 8.599  20.778  1.00 16.65 ? 422  GLY A O   1 
ATOM   680 N N   . LYS A 1 90 ? 16.595 7.725  22.648  1.00 13.32 ? 423  LYS A N   1 
ATOM   681 C CA  . LYS A 1 90 ? 17.063 6.385  22.376  1.00 11.77 ? 423  LYS A CA  1 
ATOM   682 C C   . LYS A 1 90 ? 16.058 5.637  21.500  1.00 10.89 ? 423  LYS A C   1 
ATOM   683 O O   . LYS A 1 90 ? 14.853 5.785  21.671  1.00 14.13 ? 423  LYS A O   1 
ATOM   684 C CB  . LYS A 1 90 ? 17.224 5.631  23.701  1.00 13.46 ? 423  LYS A CB  1 
ATOM   685 C CG  . LYS A 1 90 ? 18.208 6.274  24.672  1.00 15.32 ? 423  LYS A CG  1 
ATOM   686 C CD  . LYS A 1 90 ? 18.301 5.467  25.954  1.00 14.96 ? 423  LYS A CD  1 
ATOM   687 C CE  . LYS A 1 90 ? 19.261 6.115  26.964  1.00 15.66 ? 423  LYS A CE  1 
ATOM   688 N NZ  . LYS A 1 90 ? 19.404 5.284  28.187  1.00 22.41 ? 423  LYS A NZ  1 
ATOM   689 N N   . PRO A 1 91 ? 16.552 4.802  20.591  1.00 9.91  ? 424  PRO A N   1 
ATOM   690 C CA  . PRO A 1 91 ? 15.651 4.023  19.745  1.00 12.24 ? 424  PRO A CA  1 
ATOM   691 C C   . PRO A 1 91 ? 15.025 2.841  20.462  1.00 9.07  ? 424  PRO A C   1 
ATOM   692 O O   . PRO A 1 91 ? 14.020 2.324  20.007  1.00 9.13  ? 424  PRO A O   1 
ATOM   693 C CB  . PRO A 1 91 ? 16.556 3.534  18.608  1.00 15.51 ? 424  PRO A CB  1 
ATOM   694 C CG  . PRO A 1 91 ? 17.917 3.641  19.116  1.00 15.26 ? 424  PRO A CG  1 
ATOM   695 C CD  . PRO A 1 91 ? 17.936 4.756  20.099  1.00 12.95 ? 424  PRO A CD  1 
ATOM   696 N N   . GLU A 1 92 ? 15.643 2.418  21.560  1.00 7.37  ? 425  GLU A N   1 
ATOM   697 C CA  . GLU A 1 92 ? 15.206 1.255  22.324  1.00 7.95  ? 425  GLU A CA  1 
ATOM   698 C C   . GLU A 1 92 ? 15.405 1.564  23.788  1.00 8.05  ? 425  GLU A C   1 
ATOM   699 O O   . GLU A 1 92 ? 16.476 2.010  24.200  1.00 9.27  ? 425  GLU A O   1 
ATOM   700 C CB  . GLU A 1 92 ? 16.009 -0.003 21.975  1.00 10.27 ? 425  GLU A CB  1 
ATOM   701 C CG  . GLU A 1 92 ? 15.660 -1.161 22.901  1.00 14.89 ? 425  GLU A CG  1 
ATOM   702 C CD  . GLU A 1 92 ? 16.260 -2.480 22.466  1.00 18.63 ? 425  GLU A CD  1 
ATOM   703 O OE1 . GLU A 1 92 ? 17.066 -2.497 21.502  1.00 29.25 ? 425  GLU A OE1 1 
ATOM   704 O OE2 . GLU A 1 92 ? 15.921 -3.515 23.099  1.00 20.57 ? 425  GLU A OE2 1 
ATOM   705 N N   . ILE A 1 93 ? 14.387 1.273  24.590  1.00 8.17  ? 426  ILE A N   1 
ATOM   706 C CA  . ILE A 1 93 ? 14.469 1.437  26.046  1.00 8.79  ? 426  ILE A CA  1 
ATOM   707 C C   . ILE A 1 93 ? 13.839 0.215  26.685  1.00 8.69  ? 426  ILE A C   1 
ATOM   708 O O   . ILE A 1 93 ? 12.716 -0.158 26.382  1.00 8.14  ? 426  ILE A O   1 
ATOM   709 C CB  . ILE A 1 93 ? 13.775 2.735  26.554  1.00 9.36  ? 426  ILE A CB  1 
ATOM   710 C CG1 . ILE A 1 93 ? 14.392 3.978  25.905  1.00 12.22 ? 426  ILE A CG1 1 
ATOM   711 C CG2 . ILE A 1 93 ? 13.850 2.873  28.091  1.00 13.41 ? 426  ILE A CG2 1 
ATOM   712 C CD1 . ILE A 1 93 ? 13.736 5.273  26.334  1.00 14.74 ? 426  ILE A CD1 1 
ATOM   713 N N   . GLU A 1 94 ? 14.587 -0.408 27.588  1.00 8.99  ? 427  GLU A N   1 
ATOM   714 C CA  . GLU A 1 94 ? 14.057 -1.493 28.389  1.00 8.22  ? 427  GLU A CA  1 
ATOM   715 C C   . GLU A 1 94 ? 13.584 -0.886 29.689  1.00 8.96  ? 427  GLU A C   1 
ATOM   716 O O   . GLU A 1 94 ? 14.327 -0.151 30.370  1.00 11.67 ? 427  GLU A O   1 
ATOM   717 C CB  . GLU A 1 94 ? 15.122 -2.569 28.575  1.00 11.04 ? 427  GLU A CB  1 
ATOM   718 C CG  . GLU A 1 94 ? 15.738 -2.924 27.220  1.00 16.67 ? 427  GLU A CG  1 
ATOM   719 C CD  . GLU A 1 94 ? 16.767 -4.011 27.276  1.00 16.35 ? 427  GLU A CD  1 
ATOM   720 O OE1 . GLU A 1 94 ? 16.762 -4.808 28.236  1.00 19.51 ? 427  GLU A OE1 1 
ATOM   721 O OE2 . GLU A 1 94 ? 17.608 -4.048 26.330  1.00 22.62 ? 427  GLU A OE2 1 
ATOM   722 N N   . LEU A 1 95 ? 12.324 -1.163 30.007  1.00 11.21 ? 428  LEU A N   1 
ATOM   723 C CA  . LEU A 1 95 ? 11.677 -0.524 31.139  1.00 14.71 ? 428  LEU A CA  1 
ATOM   724 C C   . LEU A 1 95 ? 10.696 -1.450 31.825  1.00 17.18 ? 428  LEU A C   1 
ATOM   725 O O   . LEU A 1 95 ? 10.717 -2.674 31.585  1.00 14.01 ? 428  LEU A O   1 
ATOM   726 C CB  . LEU A 1 95 ? 10.988 0.768  30.675  1.00 20.18 ? 428  LEU A CB  1 
ATOM   727 C CG  . LEU A 1 95 ? 10.244 0.748  29.337  1.00 20.27 ? 428  LEU A CG  1 
ATOM   728 C CD1 . LEU A 1 95 ? 9.020  -0.139 29.452  1.00 23.09 ? 428  LEU A CD1 1 
ATOM   729 C CD2 . LEU A 1 95 ? 9.858  2.172  28.859  1.00 23.60 ? 428  LEU A CD2 1 
ATOM   730 O OXT . LEU A 1 95 ? 9.915  -0.965 32.662  1.00 21.45 ? 428  LEU A OXT 1 
HETATM 731 O O   . HOH B 2 .  ? 22.453 13.738 26.342  1.00 12.54 ? 2001 HOH A O   1 
HETATM 732 O O   . HOH B 2 .  ? 18.897 10.024 24.953  1.00 34.74 ? 2002 HOH A O   1 
HETATM 733 O O   . HOH B 2 .  ? 20.460 10.331 20.354  1.00 31.05 ? 2003 HOH A O   1 
HETATM 734 O O   . HOH B 2 .  ? 19.504 15.711 23.895  1.00 35.33 ? 2004 HOH A O   1 
HETATM 735 O O   . HOH B 2 .  ? 21.804 16.840 24.331  1.00 29.08 ? 2005 HOH A O   1 
HETATM 736 O O   . HOH B 2 .  ? 2.781  12.259 -0.561  1.00 22.00 ? 2006 HOH A O   1 
HETATM 737 O O   . HOH B 2 .  ? 7.155  3.879  0.376   1.00 29.73 ? 2007 HOH A O   1 
HETATM 738 O O   . HOH B 2 .  ? 7.988  13.204 22.724  1.00 31.11 ? 2008 HOH A O   1 
HETATM 739 O O   . HOH B 2 .  ? 17.742 32.883 10.016  1.00 27.48 ? 2009 HOH A O   1 
HETATM 740 O O   . HOH B 2 .  ? 10.731 31.959 12.459  1.00 23.40 ? 2010 HOH A O   1 
HETATM 741 O O   . HOH B 2 .  ? 7.870  27.286 -7.978  1.00 36.99 ? 2011 HOH A O   1 
HETATM 742 O O   . HOH B 2 .  ? 11.907 26.873 -8.664  1.00 22.74 ? 2012 HOH A O   1 
HETATM 743 O O   . HOH B 2 .  ? 11.326 23.947 -9.591  1.00 30.04 ? 2013 HOH A O   1 
HETATM 744 O O   . HOH B 2 .  ? 18.296 6.986  13.632  1.00 28.58 ? 2014 HOH A O   1 
HETATM 745 O O   . HOH B 2 .  ? 21.125 11.251 6.076   1.00 30.61 ? 2015 HOH A O   1 
HETATM 746 O O   . HOH B 2 .  ? 20.803 15.526 -3.085  1.00 31.72 ? 2016 HOH A O   1 
HETATM 747 O O   . HOH B 2 .  ? 12.593 11.822 -6.215  1.00 18.39 ? 2017 HOH A O   1 
HETATM 748 O O   . HOH B 2 .  ? 13.632 11.917 -3.472  1.00 10.68 ? 2018 HOH A O   1 
HETATM 749 O O   . HOH B 2 .  ? 13.980 16.066 -9.308  1.00 30.71 ? 2019 HOH A O   1 
HETATM 750 O O   . HOH B 2 .  ? 10.705 19.647 -9.449  1.00 23.13 ? 2020 HOH A O   1 
HETATM 751 O O   . HOH B 2 .  ? 7.964  21.167 -12.513 1.00 29.47 ? 2021 HOH A O   1 
HETATM 752 O O   . HOH B 2 .  ? 4.258  21.775 -11.321 1.00 13.03 ? 2022 HOH A O   1 
HETATM 753 O O   . HOH B 2 .  ? 6.579  25.352 -12.015 1.00 22.39 ? 2023 HOH A O   1 
HETATM 754 O O   . HOH B 2 .  ? 2.683  21.714 -3.621  1.00 21.68 ? 2024 HOH A O   1 
HETATM 755 O O   . HOH B 2 .  ? 3.962  12.375 -4.890  1.00 25.53 ? 2025 HOH A O   1 
HETATM 756 O O   . HOH B 2 .  ? 5.294  21.117 -2.363  1.00 21.20 ? 2026 HOH A O   1 
HETATM 757 O O   . HOH B 2 .  ? 5.128  12.713 -2.102  1.00 14.14 ? 2027 HOH A O   1 
HETATM 758 O O   . HOH B 2 .  ? -3.323 9.881  5.795   1.00 30.66 ? 2028 HOH A O   1 
HETATM 759 O O   . HOH B 2 .  ? -1.108 23.906 19.090  1.00 22.53 ? 2029 HOH A O   1 
HETATM 760 O O   . HOH B 2 .  ? 2.384  27.987 14.973  1.00 19.63 ? 2030 HOH A O   1 
HETATM 761 O O   . HOH B 2 .  ? -0.269 21.227 18.651  1.00 26.38 ? 2031 HOH A O   1 
HETATM 762 O O   . HOH B 2 .  ? 1.788  17.912 18.283  1.00 25.45 ? 2032 HOH A O   1 
HETATM 763 O O   . HOH B 2 .  ? 3.099  25.045 19.480  1.00 26.64 ? 2033 HOH A O   1 
HETATM 764 O O   . HOH B 2 .  ? 5.615  14.716 16.428  1.00 24.95 ? 2034 HOH A O   1 
HETATM 765 O O   . HOH B 2 .  ? 4.334  25.039 22.807  1.00 19.14 ? 2035 HOH A O   1 
HETATM 766 O O   . HOH B 2 .  ? 3.699  15.959 18.167  1.00 22.95 ? 2036 HOH A O   1 
HETATM 767 O O   . HOH B 2 .  ? 1.795  18.602 21.453  1.00 24.31 ? 2037 HOH A O   1 
HETATM 768 O O   . HOH B 2 .  ? 1.959  22.316 27.762  1.00 19.11 ? 2038 HOH A O   1 
HETATM 769 O O   . HOH B 2 .  ? 11.931 21.434 21.442  1.00 19.72 ? 2039 HOH A O   1 
HETATM 770 O O   . HOH B 2 .  ? 11.786 16.877 20.935  1.00 26.16 ? 2040 HOH A O   1 
HETATM 771 O O   . HOH B 2 .  ? 6.200  23.391 18.780  1.00 8.76  ? 2041 HOH A O   1 
HETATM 772 O O   . HOH B 2 .  ? -0.054 8.548  7.246   1.00 30.88 ? 2042 HOH A O   1 
HETATM 773 O O   . HOH B 2 .  ? 5.891  7.556  9.719   1.00 17.00 ? 2043 HOH A O   1 
HETATM 774 O O   . HOH B 2 .  ? 5.882  10.151 2.463   1.00 6.38  ? 2044 HOH A O   1 
HETATM 775 O O   . HOH B 2 .  ? -1.019 8.089  4.344   1.00 22.01 ? 2045 HOH A O   1 
HETATM 776 O O   . HOH B 2 .  ? 1.305  9.932  -0.585  1.00 27.86 ? 2046 HOH A O   1 
HETATM 777 O O   . HOH B 2 .  ? 4.796  3.976  2.064   1.00 21.95 ? 2047 HOH A O   1 
HETATM 778 O O   . HOH B 2 .  ? 11.298 3.321  -1.745  1.00 16.32 ? 2048 HOH A O   1 
HETATM 779 O O   . HOH B 2 .  ? 10.395 4.106  -4.264  1.00 18.08 ? 2049 HOH A O   1 
HETATM 780 O O   . HOH B 2 .  ? 12.745 10.348 4.345   1.00 6.94  ? 2050 HOH A O   1 
HETATM 781 O O   . HOH B 2 .  ? 16.346 4.745  3.894   1.00 8.46  ? 2051 HOH A O   1 
HETATM 782 O O   . HOH B 2 .  ? 20.486 11.283 -0.589  1.00 15.01 ? 2052 HOH A O   1 
HETATM 783 O O   . HOH B 2 .  ? 20.740 13.110 1.565   1.00 24.85 ? 2053 HOH A O   1 
HETATM 784 O O   . HOH B 2 .  ? 13.788 6.346  10.019  1.00 15.06 ? 2054 HOH A O   1 
HETATM 785 O O   . HOH B 2 .  ? 13.905 6.424  13.028  1.00 20.98 ? 2055 HOH A O   1 
HETATM 786 O O   . HOH B 2 .  ? 12.718 8.183  15.267  1.00 18.94 ? 2056 HOH A O   1 
HETATM 787 O O   . HOH B 2 .  ? 5.185  12.114 16.231  1.00 24.51 ? 2057 HOH A O   1 
HETATM 788 O O   . HOH B 2 .  ? 7.670  7.176  11.427  1.00 16.84 ? 2058 HOH A O   1 
HETATM 789 O O   . HOH B 2 .  ? 5.883  7.549  16.657  1.00 10.06 ? 2059 HOH A O   1 
HETATM 790 O O   . HOH B 2 .  ? 9.763  8.017  17.254  1.00 12.37 ? 2060 HOH A O   1 
HETATM 791 O O   . HOH B 2 .  ? 10.726 14.983 19.281  1.00 18.57 ? 2061 HOH A O   1 
HETATM 792 O O   . HOH B 2 .  ? 6.174  12.047 21.042  1.00 17.03 ? 2062 HOH A O   1 
HETATM 793 O O   . HOH B 2 .  ? 12.397 10.815 15.548  1.00 11.90 ? 2063 HOH A O   1 
HETATM 794 O O   . HOH B 2 .  ? 14.851 24.397 21.381  1.00 19.71 ? 2064 HOH A O   1 
HETATM 795 O O   . HOH B 2 .  ? 13.702 18.878 20.347  1.00 30.61 ? 2065 HOH A O   1 
HETATM 796 O O   . HOH B 2 .  ? 12.071 23.063 14.714  1.00 7.15  ? 2066 HOH A O   1 
HETATM 797 O O   . HOH B 2 .  ? 18.714 25.560 12.159  1.00 30.00 ? 2067 HOH A O   1 
HETATM 798 O O   . HOH B 2 .  ? 18.462 22.521 -1.713  1.00 16.87 ? 2068 HOH A O   1 
HETATM 799 O O   . HOH B 2 .  ? 14.128 26.529 -1.137  1.00 14.72 ? 2069 HOH A O   1 
HETATM 800 O O   . HOH B 2 .  ? 19.484 29.118 2.166   1.00 7.72  ? 2070 HOH A O   1 
HETATM 801 O O   . HOH B 2 .  ? 21.802 28.454 6.313   1.00 27.81 ? 2071 HOH A O   1 
HETATM 802 O O   . HOH B 2 .  ? 12.826 31.349 5.593   1.00 20.90 ? 2072 HOH A O   1 
HETATM 803 O O   . HOH B 2 .  ? 12.055 29.782 11.859  1.00 15.63 ? 2073 HOH A O   1 
HETATM 804 O O   . HOH B 2 .  ? 17.270 31.177 8.041   1.00 17.32 ? 2074 HOH A O   1 
HETATM 805 O O   . HOH B 2 .  ? 17.628 29.754 15.572  1.00 33.11 ? 2075 HOH A O   1 
HETATM 806 O O   . HOH B 2 .  ? 13.781 30.894 8.041   1.00 26.66 ? 2076 HOH A O   1 
HETATM 807 O O   . HOH B 2 .  ? 13.834 29.679 13.925  1.00 16.73 ? 2077 HOH A O   1 
HETATM 808 O O   . HOH B 2 .  ? 5.961  25.207 15.392  1.00 9.54  ? 2078 HOH A O   1 
HETATM 809 O O   . HOH B 2 .  ? 2.055  31.081 11.114  1.00 27.09 ? 2079 HOH A O   1 
HETATM 810 O O   . HOH B 2 .  ? -1.733 28.050 8.306   1.00 30.41 ? 2080 HOH A O   1 
HETATM 811 O O   . HOH B 2 .  ? 2.006  28.605 4.486   1.00 29.00 ? 2081 HOH A O   1 
HETATM 812 O O   . HOH B 2 .  ? 5.497  29.567 -0.894  1.00 23.25 ? 2082 HOH A O   1 
HETATM 813 O O   . HOH B 2 .  ? 11.845 27.843 -0.781  1.00 11.99 ? 2083 HOH A O   1 
HETATM 814 O O   . HOH B 2 .  ? 8.138  25.476 -6.249  1.00 24.81 ? 2084 HOH A O   1 
HETATM 815 O O   . HOH B 2 .  ? 1.792  21.783 0.313   1.00 32.21 ? 2085 HOH A O   1 
HETATM 816 O O   . HOH B 2 .  ? 10.657 28.394 -6.886  1.00 21.31 ? 2086 HOH A O   1 
HETATM 817 O O   . HOH B 2 .  ? 15.769 24.104 -8.755  1.00 10.16 ? 2087 HOH A O   1 
HETATM 818 O O   . HOH B 2 .  ? 10.475 22.007 -7.832  1.00 21.45 ? 2088 HOH A O   1 
HETATM 819 O O   . HOH B 2 .  ? 13.897 22.906 -9.928  1.00 22.94 ? 2089 HOH A O   1 
HETATM 820 O O   . HOH B 2 .  ? 16.689 22.761 -6.188  1.00 12.28 ? 2090 HOH A O   1 
HETATM 821 O O   . HOH B 2 .  ? 21.676 16.143 2.236   1.00 25.37 ? 2091 HOH A O   1 
HETATM 822 O O   . HOH B 2 .  ? 18.857 22.543 5.576   1.00 8.17  ? 2092 HOH A O   1 
HETATM 823 O O   . HOH B 2 .  ? 17.339 7.590  9.157   1.00 15.02 ? 2093 HOH A O   1 
HETATM 824 O O   . HOH B 2 .  ? 12.826 11.058 18.363  1.00 18.13 ? 2094 HOH A O   1 
HETATM 825 O O   . HOH B 2 .  ? 18.184 9.517  18.434  1.00 15.32 ? 2095 HOH A O   1 
HETATM 826 O O   . HOH B 2 .  ? 17.034 4.774  29.152  1.00 23.16 ? 2096 HOH A O   1 
HETATM 827 O O   . HOH B 2 .  ? 17.304 -5.508 22.751  1.00 26.54 ? 2097 HOH A O   1 
HETATM 828 O O   . HOH B 2 .  ? 14.740 2.260  31.798  1.00 20.00 ? 2098 HOH A O   1 
HETATM 829 O O   . HOH B 2 .  ? 10.088 1.508  33.862  1.00 25.74 ? 2099 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1   N N   . SER A 1  ? 0.2000 0.3802 0.1567 -0.0892 0.0109  -0.0190 -1   SER A N   
2   C CA  . SER A 1  ? 0.1874 0.2383 0.1295 -0.0723 -0.0254 -0.0119 -1   SER A CA  
3   C C   . SER A 1  ? 0.1179 0.2464 0.1475 -0.0552 -0.0106 0.0067  -1   SER A C   
4   O O   . SER A 1  ? 0.1347 0.3145 0.1469 -0.0750 -0.0061 0.0099  -1   SER A O   
5   C CB  . SER A 1  ? 0.2230 0.2389 0.2025 -0.0573 -0.0400 0.0116  -1   SER A CB  
6   O OG  . SER A 1  ? 0.3726 0.2679 0.3307 -0.0705 -0.0813 0.0272  -1   SER A OG  
7   N N   . MET A 2  ? 0.0934 0.1911 0.1304 -0.0364 -0.0109 -0.0112 0    MET A N   
8   C CA  . MET A 2  ? 0.0772 0.1638 0.1273 -0.0205 -0.0273 -0.0350 0    MET A CA  
9   C C   . MET A 2  ? 0.0803 0.1432 0.1207 -0.0234 -0.0125 -0.0092 0    MET A C   
10  O O   . MET A 2  ? 0.0632 0.2699 0.1681 -0.0274 -0.0220 -0.0614 0    MET A O   
11  C CB  . MET A 2  ? 0.1213 0.2074 0.1617 -0.0076 -0.0028 -0.0334 0    MET A CB  
12  C CG  . MET A 2  ? 0.2096 0.1621 0.2250 -0.0253 -0.0046 -0.0213 0    MET A CG  
13  S SD  . MET A 2  ? 0.3089 0.1932 0.2395 0.0060  -0.0740 -0.0271 0    MET A SD  
14  C CE  . MET A 2  ? 0.4509 0.3883 0.3418 0.0019  0.0477  -0.0379 0    MET A CE  
15  N N   . GLU A 3  ? 0.0695 0.1116 0.1028 -0.0310 -0.0314 0.0084  336  GLU A N   
16  C CA  . GLU A 3  ? 0.0640 0.1158 0.1093 0.0131  -0.0068 0.0032  336  GLU A CA  
17  C C   . GLU A 3  ? 0.0979 0.1415 0.0946 0.0093  0.0009  0.0488  336  GLU A C   
18  O O   . GLU A 3  ? 0.0656 0.1634 0.1746 0.0169  -0.0013 0.0710  336  GLU A O   
19  C CB  . GLU A 3  ? 0.1085 0.1148 0.1476 0.0102  -0.0451 0.0181  336  GLU A CB  
20  C CG  . GLU A 3  ? 0.1888 0.1907 0.1822 0.0206  -0.0162 0.0078  336  GLU A CG  
21  C CD  . GLU A 3  ? 0.3834 0.2910 0.3335 -0.0165 -0.0237 -0.0349 336  GLU A CD  
22  O OE1 . GLU A 3  ? 0.4070 0.3496 0.4576 0.0047  0.0133  0.0088  336  GLU A OE1 
23  O OE2 . GLU A 3  ? 0.5226 0.3604 0.3602 -0.0044 0.0268  -0.0171 336  GLU A OE2 
24  N N   . ILE A 4  ? 0.0694 0.1255 0.0779 0.0103  -0.0256 0.0212  337  ILE A N   
25  C CA  . ILE A 4  ? 0.0687 0.1204 0.0911 -0.0041 -0.0067 0.0109  337  ILE A CA  
26  C C   . ILE A 4  ? 0.0829 0.1047 0.0914 0.0220  -0.0181 0.0264  337  ILE A C   
27  O O   . ILE A 4  ? 0.0883 0.1410 0.1452 0.0555  -0.0009 0.0142  337  ILE A O   
28  C CB  . ILE A 4  ? 0.0911 0.1440 0.1222 -0.0015 -0.0272 0.0226  337  ILE A CB  
29  C CG1 . ILE A 4  ? 0.2244 0.1254 0.1395 -0.0483 -0.0359 0.0314  337  ILE A CG1 
30  C CG2 . ILE A 4  ? 0.1168 0.1519 0.1681 -0.0044 -0.0373 0.0575  337  ILE A CG2 
31  C CD1 . ILE A 4  ? 0.1746 0.2068 0.1811 -0.0209 -0.0178 -0.0132 337  ILE A CD1 
32  N N   . LEU A 5  ? 0.1018 0.1169 0.0690 0.0390  -0.0136 0.0070  338  LEU A N   
33  C CA  . LEU A 5  ? 0.1395 0.1050 0.0841 0.0298  -0.0234 0.0092  338  LEU A CA  
34  C C   . LEU A 5  ? 0.0644 0.1199 0.0890 0.0072  -0.0014 0.0075  338  LEU A C   
35  O O   . LEU A 5  ? 0.0912 0.1265 0.1037 0.0534  0.0082  0.0044  338  LEU A O   
36  C CB  . LEU A 5  ? 0.2569 0.1538 0.1172 0.0248  -0.0361 -0.0053 338  LEU A CB  
37  C CG  . LEU A 5  ? 0.1609 0.1245 0.2122 0.0175  -0.0098 -0.0010 338  LEU A CG  
38  C CD1 . LEU A 5  ? 0.3022 0.2536 0.2167 0.0014  -0.0282 -0.0631 338  LEU A CD1 
39  C CD2 . LEU A 5  ? 0.2423 0.2558 0.2346 -0.0240 -0.0002 -0.0161 338  LEU A CD2 
40  N N   . GLN A 6  ? 0.0849 0.1088 0.0798 0.0288  0.0103  -0.0122 339  GLN A N   
41  C CA  . GLN A 6  ? 0.1158 0.1275 0.0595 0.0086  -0.0116 -0.0077 339  GLN A CA  
42  C C   . GLN A 6  ? 0.1153 0.1051 0.1131 0.0095  0.0059  -0.0230 339  GLN A C   
43  O O   . GLN A 6  ? 0.1081 0.1688 0.2022 0.0570  -0.0500 -0.0838 339  GLN A O   
44  C CB  . GLN A 6  ? 0.1778 0.1748 0.0734 -0.0114 -0.0136 0.0276  339  GLN A CB  
45  C CG  . GLN A 6  ? 0.2560 0.2577 0.1451 -0.0376 -0.0459 -0.0378 339  GLN A CG  
46  C CD  . GLN A 6  ? 0.3483 0.3334 0.2899 -0.0520 -0.0186 0.0064  339  GLN A CD  
47  O OE1 . GLN A 6  ? 0.2170 0.2987 0.3407 -0.0350 -0.0117 0.0347  339  GLN A OE1 
48  N NE2 . GLN A 6  ? 0.4632 0.5110 0.3858 -0.0568 -0.0973 0.0069  339  GLN A NE2 
49  N N   . VAL A 7  ? 0.0864 0.0885 0.0792 0.0071  -0.0093 -0.0195 340  VAL A N   
50  C CA  . VAL A 7  ? 0.0978 0.0651 0.0837 0.0230  0.0117  -0.0337 340  VAL A CA  
51  C C   . VAL A 7  ? 0.1191 0.0611 0.0827 0.0032  -0.0058 -0.0340 340  VAL A C   
52  O O   . VAL A 7  ? 0.1843 0.0841 0.0940 0.0252  -0.0059 -0.0104 340  VAL A O   
53  C CB  . VAL A 7  ? 0.0947 0.0842 0.0959 0.0010  0.0196  -0.0118 340  VAL A CB  
54  C CG1 . VAL A 7  ? 0.1278 0.1209 0.1168 0.0016  0.0000  -0.0384 340  VAL A CG1 
55  C CG2 . VAL A 7  ? 0.1465 0.1074 0.0996 0.0109  -0.0010 0.0439  340  VAL A CG2 
56  N N   . ALA A 8  ? 0.1052 0.0688 0.0994 0.0289  0.0045  -0.0101 341  ALA A N   
57  C CA  . ALA A 8  ? 0.0967 0.1190 0.1004 -0.0010 -0.0009 -0.0002 341  ALA A CA  
58  C C   . ALA A 8  ? 0.1206 0.0847 0.0962 0.0036  0.0002  0.0016  341  ALA A C   
59  O O   . ALA A 8  ? 0.1667 0.1377 0.1555 0.0702  -0.0500 -0.0752 341  ALA A O   
60  C CB  . ALA A 8  ? 0.1211 0.2422 0.1115 -0.0521 0.0221  0.0316  341  ALA A CB  
61  N N   . LEU A 9  ? 0.0946 0.0771 0.0959 0.0032  0.0021  -0.0150 342  LEU A N   
62  C CA  . LEU A 9  ? 0.1251 0.0778 0.0829 -0.0061 -0.0108 -0.0142 342  LEU A CA  
63  C C   . LEU A 9  ? 0.1174 0.0504 0.0862 -0.0029 0.0080  -0.0147 342  LEU A C   
64  O O   . LEU A 9  ? 0.2021 0.0796 0.0966 -0.0307 -0.0144 -0.0159 342  LEU A O   
65  C CB  . LEU A 9  ? 0.1215 0.0473 0.0990 -0.0187 -0.0243 0.0030  342  LEU A CB  
66  C CG  . LEU A 9  ? 0.0844 0.0874 0.0918 -0.0110 -0.0150 0.0096  342  LEU A CG  
67  C CD1 . LEU A 9  ? 0.1085 0.1591 0.1229 0.0018  -0.0032 -0.0136 342  LEU A CD1 
68  C CD2 . LEU A 9  ? 0.1396 0.0608 0.1417 -0.0270 -0.0212 0.0034  342  LEU A CD2 
69  N N   . HIS A 10 ? 0.1189 0.0856 0.0783 -0.0279 -0.0044 0.0041  343  HIS A N   
70  C CA  . HIS A 10 ? 0.1409 0.1125 0.0724 -0.0062 -0.0007 0.0054  343  HIS A CA  
71  C C   . HIS A 10 ? 0.1064 0.1106 0.0806 0.0087  -0.0051 0.0021  343  HIS A C   
72  O O   . HIS A 10 ? 0.1895 0.1166 0.1128 -0.0387 -0.0149 0.0042  343  HIS A O   
73  C CB  . HIS A 10 ? 0.1631 0.1218 0.1124 0.0050  0.0033  -0.0134 343  HIS A CB  
74  C CG  . HIS A 10 ? 0.1281 0.1796 0.1634 0.0282  0.0178  -0.0213 343  HIS A CG  
75  N ND1 . HIS A 10 ? 0.1592 0.2588 0.2164 -0.0112 0.0245  0.0086  343  HIS A ND1 
76  C CD2 . HIS A 10 ? 0.2595 0.2439 0.2426 0.0236  -0.0265 0.0218  343  HIS A CD2 
77  C CE1 . HIS A 10 ? 0.1643 0.2208 0.3295 -0.0199 -0.0251 -0.0410 343  HIS A CE1 
78  N NE2 . HIS A 10 ? 0.2033 0.2692 0.2551 0.0393  -0.0265 -0.0460 343  HIS A NE2 
79  N N   . LYS A 11 ? 0.1166 0.1097 0.1464 -0.0257 -0.0175 0.0022  344  LYS A N   
80  C CA  . LYS A 11 ? 0.1107 0.1637 0.1069 -0.0193 -0.0196 0.0252  344  LYS A CA  
81  C C   . LYS A 11 ? 0.1251 0.1776 0.1793 -0.0056 0.0037  0.0136  344  LYS A C   
82  O O   . LYS A 11 ? 0.1441 0.2381 0.1760 -0.0404 0.0107  0.0451  344  LYS A O   
83  C CB  . LYS A 11 ? 0.1089 0.1669 0.1929 0.0121  0.0297  0.0617  344  LYS A CB  
84  C CG  . LYS A 11 ? 0.1064 0.2207 0.1521 -0.0003 -0.0067 0.0306  344  LYS A CG  
85  C CD  . LYS A 11 ? 0.3743 0.3797 0.4256 0.0702  0.0176  0.0005  344  LYS A CD  
86  C CE  . LYS A 11 ? 0.3448 0.3468 0.2371 0.0634  -0.0043 -0.0605 344  LYS A CE  
87  N NZ  . LYS A 11 ? 0.2487 0.2113 0.3742 0.0374  -0.0753 -0.0886 344  LYS A NZ  
88  N N   . ARG A 12 ? 0.1587 0.2204 0.1393 -0.0329 -0.0048 0.0247  345  ARG A N   
89  C CA  . ARG A 12 ? 0.2031 0.2433 0.2002 -0.0162 -0.0140 0.0204  345  ARG A CA  
90  C C   . ARG A 12 ? 0.2527 0.2799 0.1507 0.0080  -0.0181 0.0014  345  ARG A C   
91  O O   . ARG A 12 ? 0.3474 0.3805 0.1375 0.0032  -0.0415 0.0026  345  ARG A O   
92  C CB  . ARG A 12 ? 0.2537 0.2817 0.1796 -0.0071 -0.0460 -0.0064 345  ARG A CB  
93  C CG  . ARG A 12 ? 0.3141 0.2991 0.2921 -0.0168 -0.0272 0.0094  345  ARG A CG  
94  C CD  . ARG A 12 ? 0.4665 0.4237 0.4759 0.0089  -0.0027 -0.0272 345  ARG A CD  
95  N NE  . ARG A 12 ? 0.5440 0.5130 0.5310 0.0230  -0.0159 0.0124  345  ARG A NE  
96  C CZ  . ARG A 12 ? 0.4871 0.4934 0.4911 0.0194  0.0029  0.0157  345  ARG A CZ  
97  N NH1 . ARG A 12 ? 0.5104 0.5609 0.5200 -0.0011 -0.0035 -0.0108 345  ARG A NH1 
98  N NH2 . ARG A 12 ? 0.3862 0.4764 0.4265 0.0124  0.0063  -0.0155 345  ARG A NH2 
99  N N   . ASP A 13 ? 0.1967 0.2573 0.1767 0.0230  -0.0190 0.0430  346  ASP A N   
100 C CA  . ASP A 13 ? 0.2186 0.2630 0.1785 0.0047  -0.0392 0.0476  346  ASP A CA  
101 C C   . ASP A 13 ? 0.1639 0.1794 0.1955 0.0336  -0.0370 0.0638  346  ASP A C   
102 O O   . ASP A 13 ? 0.1393 0.2591 0.1333 -0.0198 -0.0384 0.0779  346  ASP A O   
103 C CB  . ASP A 13 ? 0.2314 0.2970 0.1967 0.0223  -0.0533 0.0408  346  ASP A CB  
104 C CG  . ASP A 13 ? 0.2746 0.2723 0.2058 -0.0096 -0.0583 -0.0152 346  ASP A CG  
105 O OD1 . ASP A 13 ? 0.2281 0.3016 0.3084 -0.0362 -0.0738 -0.0037 346  ASP A OD1 
106 O OD2 . ASP A 13 ? 0.2784 0.2461 0.3655 0.0026  -0.0883 0.0266  346  ASP A OD2 
107 N N   . SER A 14 ? 0.1122 0.2154 0.1733 -0.0017 -0.0122 0.0961  347  SER A N   
108 C CA  . SER A 14 ? 0.1315 0.1970 0.1950 -0.0095 -0.0229 0.0575  347  SER A CA  
109 C C   . SER A 14 ? 0.1192 0.1740 0.1536 -0.0272 -0.0413 0.0426  347  SER A C   
110 O O   . SER A 14 ? 0.1279 0.2252 0.1992 -0.0294 -0.0303 0.0610  347  SER A O   
111 C CB  . SER A 14 ? 0.1567 0.2098 0.1737 -0.0225 -0.0089 0.0556  347  SER A CB  
112 O OG  . SER A 14 ? 0.1150 0.2762 0.2240 -0.0376 -0.0423 0.0959  347  SER A OG  
113 N N   . GLY A 15 ? 0.1115 0.1764 0.1443 -0.0322 -0.0546 0.0913  348  GLY A N   
114 C CA  . GLY A 15 ? 0.1081 0.1690 0.1266 -0.0321 -0.0162 0.0896  348  GLY A CA  
115 C C   . GLY A 15 ? 0.0908 0.1732 0.1362 -0.0241 -0.0274 0.0954  348  GLY A C   
116 O O   . GLY A 15 ? 0.0646 0.1975 0.1776 -0.0342 -0.0303 0.1053  348  GLY A O   
117 N N   . GLU A 16 ? 0.0797 0.1715 0.1341 -0.0279 -0.0352 0.0905  349  GLU A N   
118 C CA  . GLU A 16 ? 0.0899 0.1498 0.1742 -0.0302 -0.0381 0.0752  349  GLU A CA  
119 C C   . GLU A 16 ? 0.0803 0.2059 0.1583 0.0000  -0.0006 0.0791  349  GLU A C   
120 O O   . GLU A 16 ? 0.0976 0.2537 0.1239 0.0007  -0.0085 0.0780  349  GLU A O   
121 C CB  . GLU A 16 ? 0.1283 0.1543 0.1493 -0.0160 -0.0374 0.0639  349  GLU A CB  
122 C CG  . GLU A 16 ? 0.1453 0.1667 0.1973 -0.0319 -0.0580 0.0582  349  GLU A CG  
123 C CD  . GLU A 16 ? 0.1584 0.1919 0.1965 -0.0526 -0.0511 -0.0031 349  GLU A CD  
124 O OE1 . GLU A 16 ? 0.1718 0.2273 0.2560 -0.0344 -0.0028 0.0193  349  GLU A OE1 
125 O OE2 . GLU A 16 ? 0.2210 0.1894 0.3447 -0.0459 -0.0563 0.0153  349  GLU A OE2 
126 N N   . GLN A 17 ? 0.0915 0.2159 0.1912 0.0436  0.0098  0.1238  350  GLN A N   
127 C CA  . GLN A 17 ? 0.1250 0.1860 0.1993 0.0487  0.0303  0.0910  350  GLN A CA  
128 C C   . GLN A 17 ? 0.1062 0.1077 0.1646 0.0322  0.0149  0.0624  350  GLN A C   
129 O O   . GLN A 17 ? 0.1370 0.1491 0.1395 0.0382  -0.0047 0.0586  350  GLN A O   
130 C CB  . GLN A 17 ? 0.1483 0.2518 0.2456 0.0177  0.0104  0.0854  350  GLN A CB  
131 C CG  A GLN A 17 ? 0.1197 0.2621 0.1191 0.0343  -0.0465 0.0233  350  GLN A CG  
132 C CD  A GLN A 17 ? 0.1702 0.1834 0.1236 0.0524  0.0309  0.0218  350  GLN A CD  
133 O OE1 A GLN A 17 ? 0.2693 0.3129 0.1386 0.0206  0.0214  0.0147  350  GLN A OE1 
134 N NE2 A GLN A 17 ? 0.1815 0.2313 0.1650 0.0304  0.0008  -0.0248 350  GLN A NE2 
135 N N   . LEU A 18 ? 0.1163 0.0653 0.1636 0.0090  0.0308  -0.0082 351  LEU A N   
136 C CA  . LEU A 18 ? 0.1007 0.0866 0.1085 0.0316  0.0099  0.0254  351  LEU A CA  
137 C C   . LEU A 18 ? 0.0863 0.0964 0.0813 0.0074  -0.0101 0.0032  351  LEU A C   
138 O O   . LEU A 18 ? 0.0904 0.0908 0.1163 0.0444  -0.0067 0.0000  351  LEU A O   
139 C CB  . LEU A 18 ? 0.1229 0.1186 0.1392 0.0016  0.0417  -0.0147 351  LEU A CB  
140 C CG  . LEU A 18 ? 0.1454 0.1227 0.2505 -0.0389 0.0501  0.0123  351  LEU A CG  
141 C CD1 . LEU A 18 ? 0.1786 0.1771 0.2781 -0.0199 0.0277  -0.0751 351  LEU A CD1 
142 C CD2 . LEU A 18 ? 0.1684 0.1654 0.2278 -0.0389 0.0461  0.0511  351  LEU A CD2 
143 N N   . GLY A 19 ? 0.0786 0.0679 0.0984 0.0158  -0.0002 0.0075  352  GLY A N   
144 C CA  . GLY A 19 ? 0.0777 0.0732 0.0695 0.0250  -0.0055 0.0028  352  GLY A CA  
145 C C   . GLY A 19 ? 0.0680 0.0629 0.0790 0.0150  -0.0211 -0.0042 352  GLY A C   
146 O O   . GLY A 19 ? 0.0913 0.0617 0.0964 0.0127  -0.0116 0.0109  352  GLY A O   
147 N N   . ILE A 20 ? 0.1056 0.0425 0.0879 0.0058  -0.0004 -0.0019 353  ILE A N   
148 C CA  . ILE A 20 ? 0.0946 0.0703 0.0940 0.0189  0.0008  -0.0159 353  ILE A CA  
149 C C   . ILE A 20 ? 0.1180 0.0676 0.0797 0.0091  0.0066  -0.0181 353  ILE A C   
150 O O   . ILE A 20 ? 0.1470 0.0715 0.1339 0.0298  0.0055  0.0087  353  ILE A O   
151 C CB  . ILE A 20 ? 0.1118 0.0936 0.1067 0.0113  -0.0166 -0.0190 353  ILE A CB  
152 C CG1 . ILE A 20 ? 0.0950 0.1495 0.1348 0.0300  0.0130  -0.0442 353  ILE A CG1 
153 C CG2 . ILE A 20 ? 0.1951 0.1467 0.1143 -0.0216 -0.0055 -0.0369 353  ILE A CG2 
154 C CD1 . ILE A 20 ? 0.0974 0.1728 0.2285 -0.0122 0.0033  -0.0311 353  ILE A CD1 
155 N N   . LYS A 21 ? 0.0861 0.0932 0.0893 0.0322  -0.0084 0.0026  354  LYS A N   
156 C CA  . LYS A 21 ? 0.0801 0.0885 0.0663 0.0201  -0.0232 -0.0049 354  LYS A CA  
157 C C   . LYS A 21 ? 0.0667 0.1423 0.1035 0.0322  0.0009  -0.0061 354  LYS A C   
158 O O   . LYS A 21 ? 0.1022 0.0936 0.1175 0.0199  -0.0097 -0.0099 354  LYS A O   
159 C CB  . LYS A 21 ? 0.0924 0.1290 0.0907 0.0478  0.0045  -0.0150 354  LYS A CB  
160 C CG  . LYS A 21 ? 0.1487 0.2688 0.1578 0.0032  -0.0048 0.0032  354  LYS A CG  
161 C CD  . LYS A 21 ? 0.2308 0.2782 0.2570 -0.0496 0.0517  -0.0073 354  LYS A CD  
162 C CE  . LYS A 21 ? 0.1904 0.2075 0.2532 -0.0114 -0.0296 -0.0079 354  LYS A CE  
163 N NZ  . LYS A 21 ? 0.3456 0.2846 0.2745 -0.0096 0.0314  0.0239  354  LYS A NZ  
164 N N   . LEU A 22 ? 0.0967 0.1041 0.0472 0.0235  0.0002  -0.0209 355  LEU A N   
165 C CA  . LEU A 22 ? 0.0837 0.1093 0.0747 0.0129  0.0082  -0.0121 355  LEU A CA  
166 C C   . LEU A 22 ? 0.1049 0.0944 0.0645 0.0159  -0.0155 -0.0172 355  LEU A C   
167 O O   . LEU A 22 ? 0.1132 0.1380 0.0774 0.0521  -0.0127 -0.0156 355  LEU A O   
168 C CB  . LEU A 22 ? 0.1059 0.1280 0.1092 -0.0054 -0.0187 -0.0291 355  LEU A CB  
169 C CG  . LEU A 22 ? 0.1814 0.1398 0.1339 -0.0302 0.0334  -0.0189 355  LEU A CG  
170 C CD1 . LEU A 22 ? 0.2545 0.1647 0.2031 -0.0612 0.0776  0.0239  355  LEU A CD1 
171 C CD2 . LEU A 22 ? 0.1044 0.1743 0.1800 0.0398  0.0135  -0.0421 355  LEU A CD2 
172 N N   . VAL A 23 ? 0.0564 0.1081 0.0767 0.0118  -0.0083 -0.0290 356  VAL A N   
173 C CA  . VAL A 23 ? 0.0549 0.1117 0.0745 0.0105  0.0092  -0.0342 356  VAL A CA  
174 C C   . VAL A 23 ? 0.0646 0.1005 0.0749 0.0451  0.0001  0.0011  356  VAL A C   
175 O O   . VAL A 23 ? 0.0566 0.1152 0.0949 0.0262  0.0036  -0.0329 356  VAL A O   
176 C CB  . VAL A 23 ? 0.0757 0.1074 0.0880 0.0357  -0.0009 -0.0135 356  VAL A CB  
177 C CG1 . VAL A 23 ? 0.1145 0.1207 0.1599 0.0026  -0.0412 -0.0229 356  VAL A CG1 
178 C CG2 . VAL A 23 ? 0.0844 0.1081 0.1403 0.0262  -0.0139 -0.0095 356  VAL A CG2 
179 N N   . ARG A 24 ? 0.0455 0.0884 0.0964 0.0240  -0.0061 -0.0165 357  ARG A N   
180 C CA  . ARG A 24 ? 0.0716 0.0878 0.0843 -0.0056 0.0040  -0.0240 357  ARG A CA  
181 C C   . ARG A 24 ? 0.0948 0.1058 0.1006 0.0015  0.0089  -0.0228 357  ARG A C   
182 O O   . ARG A 24 ? 0.1053 0.1630 0.1162 -0.0327 0.0094  -0.0296 357  ARG A O   
183 C CB  . ARG A 24 ? 0.0951 0.1120 0.0933 -0.0077 0.0012  -0.0556 357  ARG A CB  
184 C CG  . ARG A 24 ? 0.0974 0.1114 0.0991 -0.0050 0.0024  -0.0234 357  ARG A CG  
185 C CD  . ARG A 24 ? 0.1276 0.1502 0.1697 0.0130  0.0433  -0.0456 357  ARG A CD  
186 N NE  . ARG A 24 ? 0.1329 0.1521 0.1647 0.0328  0.0192  -0.0467 357  ARG A NE  
187 C CZ  . ARG A 24 ? 0.1950 0.1528 0.1582 0.0167  0.0061  -0.0491 357  ARG A CZ  
188 N NH1 . ARG A 24 ? 0.1809 0.1386 0.1963 0.0604  -0.0403 -0.0218 357  ARG A NH1 
189 N NH2 . ARG A 24 ? 0.1523 0.1648 0.2654 0.0409  -0.0095 -0.0618 357  ARG A NH2 
190 N N   . ARG A 25 ? 0.0775 0.1375 0.0838 -0.0039 -0.0158 -0.0025 358  ARG A N   
191 C CA  . ARG A 25 ? 0.1282 0.1705 0.1021 -0.0063 0.0137  0.0083  358  ARG A CA  
192 C C   . ARG A 25 ? 0.1616 0.2218 0.0865 0.0052  -0.0071 0.0043  358  ARG A C   
193 O O   . ARG A 25 ? 0.1595 0.1917 0.1203 0.0127  0.0199  -0.0218 358  ARG A O   
194 C CB  . ARG A 25 ? 0.1176 0.1857 0.1196 0.0083  0.0056  0.0217  358  ARG A CB  
195 C CG  . ARG A 25 ? 0.1775 0.1847 0.1816 0.0209  0.0421  0.0184  358  ARG A CG  
196 C CD  . ARG A 25 ? 0.1939 0.2282 0.1339 0.0053  0.0477  0.0380  358  ARG A CD  
197 N NE  . ARG A 25 ? 0.3362 0.2754 0.1805 0.0165  0.0297  0.0089  358  ARG A NE  
198 C CZ  . ARG A 25 ? 0.3016 0.2705 0.2542 0.0830  0.0143  0.0025  358  ARG A CZ  
199 N NH1 . ARG A 25 ? 0.3482 0.3512 0.2925 0.0243  -0.0093 -0.0281 358  ARG A NH1 
200 N NH2 . ARG A 25 ? 0.3398 0.1340 0.2776 -0.0342 0.0562  -0.0155 358  ARG A NH2 
201 N N   . THR A 26 ? 0.1753 0.2029 0.1331 -0.0026 0.0221  0.0204  359  THR A N   
202 C CA  . THR A 26 ? 0.1707 0.2866 0.1531 0.0196  0.0247  0.0147  359  THR A CA  
203 C C   . THR A 26 ? 0.1677 0.2417 0.1537 0.0016  0.0434  -0.0075 359  THR A C   
204 O O   . THR A 26 ? 0.2888 0.3339 0.1352 0.0130  0.0296  -0.0570 359  THR A O   
205 C CB  . THR A 26 ? 0.1965 0.2479 0.1626 -0.0011 0.0649  0.0206  359  THR A CB  
206 O OG1 . THR A 26 ? 0.3108 0.2423 0.2322 0.0219  0.0654  0.0301  359  THR A OG1 
207 C CG2 . THR A 26 ? 0.2115 0.3235 0.1849 0.0097  -0.0122 -0.0063 359  THR A CG2 
208 N N   . ASP A 27 ? 0.2198 0.3047 0.0975 0.0281  0.0045  0.0092  360  ASP A N   
209 C CA  . ASP A 27 ? 0.2438 0.3086 0.1562 0.0165  -0.0194 0.0173  360  ASP A CA  
210 C C   . ASP A 27 ? 0.2262 0.3265 0.1193 0.0070  -0.0132 -0.0128 360  ASP A C   
211 O O   . ASP A 27 ? 0.2223 0.3893 0.1682 0.0588  -0.0430 -0.0146 360  ASP A O   
212 C CB  . ASP A 27 ? 0.3056 0.3300 0.2550 -0.0134 -0.0233 0.0375  360  ASP A CB  
213 C CG  . ASP A 27 ? 0.4028 0.4435 0.3674 0.0220  0.0144  -0.0134 360  ASP A CG  
214 O OD1 . ASP A 27 ? 0.3199 0.4474 0.3412 0.0514  -0.0181 0.0325  360  ASP A OD1 
215 O OD2 . ASP A 27 ? 0.6034 0.5236 0.6125 0.0195  -0.0217 0.0520  360  ASP A OD2 
216 N N   . GLU A 28 ? 0.1687 0.3073 0.1008 0.0029  -0.0301 -0.0007 361  GLU A N   
217 C CA  . GLU A 28 ? 0.2015 0.2654 0.1314 0.0116  -0.0234 -0.0138 361  GLU A CA  
218 C C   . GLU A 28 ? 0.1844 0.2126 0.1158 0.0313  -0.0134 -0.0323 361  GLU A C   
219 O O   . GLU A 28 ? 0.1273 0.2219 0.1037 0.0229  -0.0194 -0.0164 361  GLU A O   
220 C CB  . GLU A 28 ? 0.2249 0.2711 0.1827 -0.0059 0.0074  0.0160  361  GLU A CB  
221 C CG  . GLU A 28 ? 0.2156 0.2012 0.1904 0.0512  -0.0142 0.0229  361  GLU A CG  
222 C CD  . GLU A 28 ? 0.1829 0.2659 0.2276 0.0237  -0.0546 0.0762  361  GLU A CD  
223 O OE1 . GLU A 28 ? 0.2575 0.3047 0.4253 0.1308  -0.0355 -0.0014 361  GLU A OE1 
224 O OE2 . GLU A 28 ? 0.4521 0.3043 0.4594 0.0187  -0.0415 -0.0168 361  GLU A OE2 
225 N N   . PRO A 29 ? 0.1292 0.1774 0.1229 0.0425  -0.0355 -0.0625 362  PRO A N   
226 C CA  . PRO A 29 ? 0.1233 0.1145 0.1222 0.0218  0.0030  -0.0271 362  PRO A CA  
227 C C   . PRO A 29 ? 0.1141 0.1282 0.1454 0.0250  -0.0301 -0.0373 362  PRO A C   
228 O O   . PRO A 29 ? 0.1237 0.1539 0.1204 0.0125  -0.0250 -0.0515 362  PRO A O   
229 C CB  . PRO A 29 ? 0.1578 0.1544 0.2009 0.0265  -0.0244 -0.0371 362  PRO A CB  
230 C CG  . PRO A 29 ? 0.2028 0.1674 0.1357 0.0258  -0.0262 -0.0529 362  PRO A CG  
231 C CD  . PRO A 29 ? 0.1770 0.2064 0.1466 0.0344  -0.0440 -0.0642 362  PRO A CD  
232 N N   . GLY A 30 ? 0.0942 0.1043 0.1161 0.0346  0.0004  -0.0350 363  GLY A N   
233 C CA  . GLY A 30 ? 0.0880 0.1085 0.1269 0.0061  0.0110  -0.0407 363  GLY A CA  
234 C C   . GLY A 30 ? 0.0802 0.1013 0.0892 -0.0014 0.0097  0.0013  363  GLY A C   
235 O O   . GLY A 30 ? 0.0813 0.1154 0.0914 0.0055  0.0166  -0.0473 363  GLY A O   
236 N N   . VAL A 31 ? 0.0782 0.0976 0.0678 0.0052  0.0087  -0.0253 364  VAL A N   
237 C CA  . VAL A 31 ? 0.0554 0.0950 0.0983 0.0111  0.0082  -0.0120 364  VAL A CA  
238 C C   . VAL A 31 ? 0.0588 0.0891 0.0557 0.0088  0.0017  -0.0171 364  VAL A C   
239 O O   . VAL A 31 ? 0.0379 0.1026 0.0931 0.0016  0.0032  -0.0021 364  VAL A O   
240 C CB  . VAL A 31 ? 0.1685 0.0781 0.0986 0.0542  -0.0389 -0.0196 364  VAL A CB  
241 C CG1 . VAL A 31 ? 0.1874 0.1066 0.1358 -0.0297 -0.0412 -0.0232 364  VAL A CG1 
242 C CG2 . VAL A 31 ? 0.1798 0.1331 0.1434 0.0553  0.0014  -0.0132 364  VAL A CG2 
243 N N   . PHE A 32 ? 0.0345 0.0766 0.0837 0.0055  0.0071  -0.0003 365  PHE A N   
244 C CA  . PHE A 32 ? 0.0500 0.1213 0.0712 0.0030  0.0083  -0.0122 365  PHE A CA  
245 C C   . PHE A 32 ? 0.0651 0.0862 0.0815 0.0010  0.0093  -0.0221 365  PHE A C   
246 O O   . PHE A 32 ? 0.0678 0.1294 0.1178 0.0312  -0.0116 -0.0449 365  PHE A O   
247 C CB  . PHE A 32 ? 0.0596 0.1061 0.0866 -0.0029 -0.0126 -0.0112 365  PHE A CB  
248 C CG  . PHE A 32 ? 0.0843 0.1044 0.0605 -0.0088 0.0017  -0.0031 365  PHE A CG  
249 C CD1 . PHE A 32 ? 0.0841 0.1069 0.0699 0.0001  0.0050  0.0043  365  PHE A CD1 
250 C CD2 . PHE A 32 ? 0.0986 0.0732 0.0781 0.0175  0.0063  -0.0075 365  PHE A CD2 
251 C CE1 . PHE A 32 ? 0.0682 0.1504 0.0977 0.0087  -0.0058 -0.0040 365  PHE A CE1 
252 C CE2 . PHE A 32 ? 0.1234 0.1046 0.0893 0.0252  0.0091  -0.0488 365  PHE A CE2 
253 C CZ  . PHE A 32 ? 0.1096 0.1376 0.0753 -0.0175 0.0108  -0.0188 365  PHE A CZ  
254 N N   . ILE A 33 ? 0.0441 0.0941 0.0787 0.0093  -0.0056 -0.0196 366  ILE A N   
255 C CA  . ILE A 33 ? 0.0597 0.1049 0.0624 0.0069  -0.0168 -0.0007 366  ILE A CA  
256 C C   . ILE A 33 ? 0.0916 0.1076 0.0868 -0.0155 -0.0087 0.0070  366  ILE A C   
257 O O   . ILE A 33 ? 0.0782 0.1121 0.1141 0.0160  -0.0038 0.0093  366  ILE A O   
258 C CB  . ILE A 33 ? 0.0616 0.1139 0.0735 0.0321  0.0044  -0.0205 366  ILE A CB  
259 C CG1 . ILE A 33 ? 0.0757 0.1487 0.0721 0.0006  0.0072  -0.0236 366  ILE A CG1 
260 C CG2 . ILE A 33 ? 0.1170 0.1104 0.0907 0.0056  -0.0058 -0.0477 366  ILE A CG2 
261 C CD1 . ILE A 33 ? 0.0871 0.1745 0.1166 0.0145  0.0294  -0.0486 366  ILE A CD1 
262 N N   . LEU A 34 ? 0.0710 0.1129 0.0701 -0.0116 -0.0006 0.0023  367  LEU A N   
263 C CA  . LEU A 34 ? 0.1083 0.1419 0.1005 0.0017  -0.0044 0.0103  367  LEU A CA  
264 C C   . LEU A 34 ? 0.0918 0.1388 0.0839 -0.0149 0.0239  0.0242  367  LEU A C   
265 O O   . LEU A 34 ? 0.1054 0.1202 0.1236 -0.0174 0.0059  0.0290  367  LEU A O   
266 C CB  . LEU A 34 ? 0.0662 0.1423 0.1570 -0.0195 0.0095  0.0009  367  LEU A CB  
267 C CG  . LEU A 34 ? 0.1061 0.1251 0.1808 -0.0124 0.0268  -0.0222 367  LEU A CG  
268 C CD1 . LEU A 34 ? 0.1863 0.1859 0.1536 -0.0213 0.0357  -0.0057 367  LEU A CD1 
269 C CD2 . LEU A 34 ? 0.0898 0.2921 0.2721 -0.0296 0.0292  -0.0240 367  LEU A CD2 
270 N N   . ASP A 35 ? 0.1193 0.0987 0.0859 0.0056  0.0184  0.0049  368  ASP A N   
271 C CA  . ASP A 35 ? 0.1326 0.1233 0.0849 0.0097  0.0169  0.0144  368  ASP A CA  
272 C C   . ASP A 35 ? 0.0973 0.1034 0.0795 -0.0028 -0.0185 0.0132  368  ASP A C   
273 O O   . ASP A 35 ? 0.1111 0.0780 0.1091 0.0074  -0.0137 0.0168  368  ASP A O   
274 C CB  . ASP A 35 ? 0.2383 0.2056 0.1607 -0.0336 0.0279  -0.0185 368  ASP A CB  
275 C CG  . ASP A 35 ? 0.1937 0.2760 0.2207 -0.0752 -0.0024 -0.0359 368  ASP A CG  
276 O OD1 . ASP A 35 ? 0.3306 0.3891 0.3202 0.0023  0.0130  0.0439  368  ASP A OD1 
277 O OD2 . ASP A 35 ? 0.4194 0.5732 0.4300 0.0458  0.0693  -0.0034 368  ASP A OD2 
278 N N   . LEU A 36 ? 0.1732 0.0872 0.1179 0.0088  0.0119  -0.0007 369  LEU A N   
279 C CA  . LEU A 36 ? 0.1545 0.0918 0.0961 -0.0282 0.0208  0.0009  369  LEU A CA  
280 C C   . LEU A 36 ? 0.1459 0.1166 0.1495 -0.0493 0.0064  0.0004  369  LEU A C   
281 O O   . LEU A 36 ? 0.2673 0.1867 0.1809 -0.1220 -0.0257 0.0319  369  LEU A O   
282 C CB  . LEU A 36 ? 0.1746 0.1026 0.0853 0.0089  0.0065  0.0046  369  LEU A CB  
283 C CG  . LEU A 36 ? 0.1589 0.1428 0.1521 0.0268  -0.0025 -0.0067 369  LEU A CG  
284 C CD1 . LEU A 36 ? 0.1748 0.1692 0.1328 0.0380  0.0107  -0.0237 369  LEU A CD1 
285 C CD2 . LEU A 36 ? 0.1462 0.1491 0.1127 -0.0163 0.0224  -0.0318 369  LEU A CD2 
286 N N   . LEU A 37 ? 0.1290 0.1040 0.1535 -0.0198 0.0000  -0.0118 370  LEU A N   
287 C CA  . LEU A 37 ? 0.0765 0.1541 0.1456 -0.0334 0.0065  -0.0226 370  LEU A CA  
288 C C   . LEU A 37 ? 0.1110 0.1086 0.1513 -0.0192 0.0086  -0.0131 370  LEU A C   
289 O O   . LEU A 37 ? 0.0958 0.1060 0.1473 0.0008  -0.0028 -0.0192 370  LEU A O   
290 C CB  . LEU A 37 ? 0.1293 0.1508 0.1426 0.0182  -0.0159 -0.0389 370  LEU A CB  
291 C CG  A LEU A 37 ? 0.1723 0.1789 0.2351 0.0502  -0.0147 -0.0142 370  LEU A CG  
292 C CG  B LEU A 37 ? 0.2276 0.1954 0.2603 0.0344  -0.0184 -0.0427 370  LEU A CG  
293 C CD1 A LEU A 37 ? 0.1830 0.2455 0.2502 0.0341  -0.0314 0.0015  370  LEU A CD1 
294 C CD1 B LEU A 37 ? 0.1909 0.2037 0.1898 0.0134  0.0101  -0.0410 370  LEU A CD1 
295 C CD2 A LEU A 37 ? 0.2152 0.2220 0.2193 0.0288  0.0289  -0.0334 370  LEU A CD2 
296 C CD2 B LEU A 37 ? 0.2743 0.3056 0.2777 0.0218  0.0100  0.0011  370  LEU A CD2 
297 N N   . GLU A 38 ? 0.1124 0.1468 0.2058 -0.0498 0.0209  -0.0333 371  GLU A N   
298 C CA  . GLU A 38 ? 0.1829 0.1225 0.2392 -0.0511 0.0213  -0.0442 371  GLU A CA  
299 C C   . GLU A 38 ? 0.1749 0.1303 0.2196 -0.0255 -0.0175 -0.0470 371  GLU A C   
300 O O   . GLU A 38 ? 0.1203 0.2307 0.2056 -0.0369 -0.0226 -0.0435 371  GLU A O   
301 C CB  . GLU A 38 ? 0.2428 0.1977 0.2731 -0.0494 0.0105  -0.0254 371  GLU A CB  
302 C CG  . GLU A 38 ? 0.2914 0.2140 0.3363 -0.0443 0.0008  -0.0054 371  GLU A CG  
303 C CD  . GLU A 38 ? 0.3025 0.3807 0.5039 -0.0534 0.0187  -0.0068 371  GLU A CD  
304 O OE1 . GLU A 38 ? 0.2875 0.1814 0.4197 -0.0547 -0.0092 0.0456  371  GLU A OE1 
305 O OE2 . GLU A 38 ? 0.5866 0.4614 0.6344 0.0120  0.0258  -0.0271 371  GLU A OE2 
306 N N   . GLY A 39 ? 0.1492 0.1002 0.1848 -0.0329 -0.0011 -0.0284 372  GLY A N   
307 C CA  . GLY A 39 ? 0.1689 0.1879 0.2121 -0.0041 0.0188  -0.0429 372  GLY A CA  
308 C C   . GLY A 39 ? 0.1072 0.1755 0.1762 -0.0087 0.0146  -0.0232 372  GLY A C   
309 O O   . GLY A 39 ? 0.1095 0.2517 0.1454 -0.0267 -0.0091 -0.0497 372  GLY A O   
310 N N   . GLY A 40 ? 0.0832 0.1731 0.1182 0.0000  -0.0253 -0.0138 373  GLY A N   
311 C CA  . GLY A 40 ? 0.0958 0.1463 0.1207 0.0039  0.0012  0.0050  373  GLY A CA  
312 C C   . GLY A 40 ? 0.0972 0.0894 0.0967 0.0102  -0.0082 -0.0110 373  GLY A C   
313 O O   . GLY A 40 ? 0.1031 0.0751 0.1028 0.0132  -0.0039 0.0042  373  GLY A O   
314 N N   . LEU A 41 ? 0.1210 0.0855 0.0830 0.0233  -0.0168 0.0082  374  LEU A N   
315 C CA  . LEU A 41 ? 0.1134 0.1018 0.0888 0.0255  0.0324  0.0010  374  LEU A CA  
316 C C   . LEU A 41 ? 0.1229 0.0290 0.0873 0.0062  0.0185  0.0152  374  LEU A C   
317 O O   . LEU A 41 ? 0.0915 0.0321 0.1060 0.0181  0.0190  -0.0058 374  LEU A O   
318 C CB  . LEU A 41 ? 0.1878 0.1190 0.1006 0.0059  0.0042  0.0007  374  LEU A CB  
319 C CG  . LEU A 41 ? 0.1995 0.1665 0.1929 -0.0160 0.0101  -0.0114 374  LEU A CG  
320 C CD1 . LEU A 41 ? 0.2481 0.0796 0.1866 -0.0225 0.0942  0.0454  374  LEU A CD1 
321 C CD2 . LEU A 41 ? 0.2884 0.1179 0.1135 0.0089  0.0442  -0.0031 374  LEU A CD2 
322 N N   . ALA A 42 ? 0.0585 0.0781 0.0950 0.0221  0.0242  -0.0093 375  ALA A N   
323 C CA  . ALA A 42 ? 0.0599 0.0625 0.0865 0.0125  0.0124  0.0014  375  ALA A CA  
324 C C   . ALA A 42 ? 0.0715 0.0795 0.0768 0.0022  0.0150  -0.0041 375  ALA A C   
325 O O   . ALA A 42 ? 0.0607 0.0817 0.0797 0.0176  0.0100  -0.0066 375  ALA A O   
326 C CB  . ALA A 42 ? 0.0868 0.0667 0.0977 0.0085  0.0296  -0.0237 375  ALA A CB  
327 N N   . ALA A 43 ? 0.0496 0.0718 0.0750 0.0101  0.0062  0.0133  376  ALA A N   
328 C CA  . ALA A 43 ? 0.1022 0.0491 0.0748 -0.0028 0.0340  0.0053  376  ALA A CA  
329 C C   . ALA A 43 ? 0.0902 0.0915 0.0718 -0.0190 0.0310  0.0040  376  ALA A C   
330 O O   . ALA A 43 ? 0.1072 0.0667 0.1172 0.0141  0.0127  0.0157  376  ALA A O   
331 C CB  . ALA A 43 ? 0.0803 0.0961 0.1466 -0.0200 0.0431  0.0030  376  ALA A CB  
332 N N   . GLN A 44 ? 0.1100 0.0641 0.0823 -0.0019 0.0145  0.0058  377  GLN A N   
333 C CA  . GLN A 44 ? 0.0732 0.0479 0.1052 0.0039  0.0149  -0.0157 377  GLN A CA  
334 C C   . GLN A 44 ? 0.0681 0.0769 0.0765 0.0011  0.0014  0.0001  377  GLN A C   
335 O O   . GLN A 44 ? 0.0735 0.0717 0.1086 0.0160  0.0154  0.0009  377  GLN A O   
336 C CB  . GLN A 44 ? 0.1049 0.0618 0.0678 -0.0035 0.0152  -0.0080 377  GLN A CB  
337 C CG  . GLN A 44 ? 0.1193 0.1008 0.1186 -0.0032 0.0009  -0.0382 377  GLN A CG  
338 C CD  . GLN A 44 ? 0.0838 0.2303 0.1272 0.0197  0.0028  -0.0216 377  GLN A CD  
339 O OE1 . GLN A 44 ? 0.1196 0.2917 0.1463 0.0301  0.0075  -0.0335 377  GLN A OE1 
340 N NE2 . GLN A 44 ? 0.1473 0.2624 0.1584 0.0700  -0.0183 -0.0293 377  GLN A NE2 
341 N N   . ASP A 45 ? 0.0802 0.0562 0.0606 0.0056  -0.0066 -0.0101 378  ASP A N   
342 C CA  . ASP A 45 ? 0.0758 0.0744 0.0547 0.0189  -0.0197 -0.0165 378  ASP A CA  
343 C C   . ASP A 45 ? 0.0611 0.0869 0.0879 0.0079  -0.0200 -0.0108 378  ASP A C   
344 O O   . ASP A 45 ? 0.1005 0.1096 0.0908 0.0378  -0.0177 0.0066  378  ASP A O   
345 C CB  . ASP A 45 ? 0.0559 0.0651 0.0832 -0.0028 0.0030  -0.0221 378  ASP A CB  
346 C CG  . ASP A 45 ? 0.0983 0.0924 0.0845 0.0233  0.0003  -0.0217 378  ASP A CG  
347 O OD1 . ASP A 45 ? 0.0779 0.1316 0.0912 0.0033  0.0095  -0.0349 378  ASP A OD1 
348 O OD2 . ASP A 45 ? 0.0860 0.1130 0.0839 0.0071  0.0013  -0.0119 378  ASP A OD2 
349 N N   . GLY A 46 ? 0.0849 0.0687 0.0763 0.0099  0.0028  0.0073  379  GLY A N   
350 C CA  . GLY A 46 ? 0.1265 0.1047 0.0815 0.0054  -0.0169 -0.0074 379  GLY A CA  
351 C C   . GLY A 46 ? 0.1587 0.0710 0.0900 -0.0019 -0.0025 0.0070  379  GLY A C   
352 O O   . GLY A 46 ? 0.2430 0.1357 0.0863 -0.0415 -0.0281 0.0353  379  GLY A O   
353 N N   . ARG A 47 ? 0.1086 0.0875 0.0524 0.0007  -0.0096 0.0014  380  ARG A N   
354 C CA  . ARG A 47 ? 0.1274 0.0871 0.0909 0.0246  -0.0168 0.0026  380  ARG A CA  
355 C C   . ARG A 47 ? 0.1385 0.0780 0.1112 0.0168  -0.0073 -0.0040 380  ARG A C   
356 O O   . ARG A 47 ? 0.3130 0.1274 0.0790 0.0490  -0.0366 -0.0035 380  ARG A O   
357 C CB  . ARG A 47 ? 0.1214 0.0835 0.0770 0.0155  -0.0370 -0.0048 380  ARG A CB  
358 C CG  . ARG A 47 ? 0.1263 0.1356 0.0871 0.0264  -0.0266 0.0129  380  ARG A CG  
359 C CD  . ARG A 47 ? 0.1208 0.1287 0.1259 0.0236  -0.0010 -0.0260 380  ARG A CD  
360 N NE  . ARG A 47 ? 0.0910 0.1132 0.1124 0.0201  0.0041  -0.0219 380  ARG A NE  
361 C CZ  . ARG A 47 ? 0.0806 0.0636 0.1358 0.0309  0.0032  -0.0323 380  ARG A CZ  
362 N NH1 . ARG A 47 ? 0.0549 0.1208 0.2306 0.0116  -0.0152 -0.0365 380  ARG A NH1 
363 N NH2 . ARG A 47 ? 0.0965 0.0982 0.1302 0.0114  0.0053  -0.0242 380  ARG A NH2 
364 N N   . LEU A 48 ? 0.1356 0.0895 0.0647 0.0042  0.0256  -0.0146 381  LEU A N   
365 C CA  . LEU A 48 ? 0.1059 0.0925 0.0784 -0.0116 0.0136  -0.0334 381  LEU A CA  
366 C C   . LEU A 48 ? 0.1428 0.0988 0.1083 -0.0058 0.0383  -0.0172 381  LEU A C   
367 O O   . LEU A 48 ? 0.1837 0.1191 0.1244 -0.0395 0.0631  -0.0212 381  LEU A O   
368 C CB  . LEU A 48 ? 0.1052 0.0796 0.0924 0.0052  0.0358  -0.0501 381  LEU A CB  
369 C CG  . LEU A 48 ? 0.0919 0.1199 0.0924 -0.0134 0.0559  -0.0140 381  LEU A CG  
370 C CD1 . LEU A 48 ? 0.1463 0.1397 0.1265 -0.0341 -0.0108 0.0272  381  LEU A CD1 
371 C CD2 . LEU A 48 ? 0.1502 0.1342 0.0828 -0.0269 0.0073  -0.0174 381  LEU A CD2 
372 N N   . SER A 49 ? 0.1114 0.0927 0.0974 -0.0231 0.0478  -0.0066 382  SER A N   
373 C CA  . SER A 49 ? 0.1203 0.1059 0.1113 -0.0177 0.0365  0.0117  382  SER A CA  
374 C C   . SER A 49 ? 0.0939 0.1124 0.0854 -0.0074 0.0260  0.0263  382  SER A C   
375 O O   . SER A 49 ? 0.0996 0.1042 0.0900 -0.0197 0.0128  0.0101  382  SER A O   
376 C CB  . SER A 49 ? 0.1525 0.1197 0.1429 0.0051  0.0590  0.0241  382  SER A CB  
377 O OG  . SER A 49 ? 0.2082 0.1805 0.1731 -0.0049 0.0466  0.0509  382  SER A OG  
378 N N   . SER A 50 ? 0.0918 0.1010 0.0736 -0.0315 0.0337  0.0006  383  SER A N   
379 C CA  . SER A 50 ? 0.0979 0.1261 0.0770 -0.0061 0.0039  0.0321  383  SER A CA  
380 C C   . SER A 50 ? 0.0651 0.1022 0.0700 -0.0041 0.0304  0.0241  383  SER A C   
381 O O   . SER A 50 ? 0.0953 0.1090 0.1051 0.0059  0.0094  0.0109  383  SER A O   
382 C CB  A SER A 50 ? 0.0801 0.1152 0.0899 -0.0191 0.0196  0.0192  383  SER A CB  
383 C CB  B SER A 50 ? 0.0913 0.1211 0.0899 -0.0184 0.0224  0.0136  383  SER A CB  
384 O OG  A SER A 50 ? 0.0691 0.0849 0.0883 -0.0294 0.0131  -0.0072 383  SER A OG  
385 O OG  B SER A 50 ? 0.1707 0.1439 0.2055 -0.0215 0.0078  0.0452  383  SER A OG  
386 N N   . ASN A 51 ? 0.0656 0.0792 0.0770 0.0026  0.0124  0.0152  384  ASN A N   
387 C CA  . ASN A 51 ? 0.0931 0.0944 0.0760 -0.0104 0.0180  0.0230  384  ASN A CA  
388 C C   . ASN A 51 ? 0.0746 0.1005 0.0711 0.0020  0.0218  0.0214  384  ASN A C   
389 O O   . ASN A 51 ? 0.1060 0.1163 0.0887 -0.0312 0.0035  0.0046  384  ASN A O   
390 C CB  . ASN A 51 ? 0.1332 0.0994 0.0775 -0.0141 0.0155  -0.0046 384  ASN A CB  
391 C CG  . ASN A 51 ? 0.1165 0.1667 0.0909 -0.0175 0.0326  0.0146  384  ASN A CG  
392 O OD1 . ASN A 51 ? 0.1734 0.1466 0.1473 -0.0282 0.0480  0.0224  384  ASN A OD1 
393 N ND2 . ASN A 51 ? 0.1590 0.0887 0.1260 -0.0233 0.0141  0.0148  384  ASN A ND2 
394 N N   . ASP A 52 ? 0.0627 0.1004 0.0705 -0.0152 0.0084  0.0146  385  ASP A N   
395 C CA  . ASP A 52 ? 0.0575 0.0825 0.0873 -0.0176 -0.0002 -0.0075 385  ASP A CA  
396 C C   . ASP A 52 ? 0.0594 0.1094 0.0702 -0.0058 0.0064  0.0039  385  ASP A C   
397 O O   . ASP A 52 ? 0.0639 0.0920 0.1082 -0.0075 -0.0154 0.0089  385  ASP A O   
398 C CB  . ASP A 52 ? 0.0605 0.1119 0.0871 -0.0099 0.0081  0.0074  385  ASP A CB  
399 C CG  . ASP A 52 ? 0.0872 0.1415 0.0790 -0.0222 -0.0034 -0.0117 385  ASP A CG  
400 O OD1 . ASP A 52 ? 0.0963 0.1179 0.0952 -0.0013 -0.0057 -0.0006 385  ASP A OD1 
401 O OD2 . ASP A 52 ? 0.0915 0.1266 0.1194 -0.0209 0.0095  -0.0159 385  ASP A OD2 
402 N N   . ARG A 53 ? 0.0511 0.0666 0.0816 -0.0036 -0.0067 0.0051  386  ARG A N   
403 C CA  . ARG A 53 ? 0.0575 0.0808 0.0511 -0.0068 -0.0114 0.0151  386  ARG A CA  
404 C C   . ARG A 53 ? 0.0688 0.0627 0.0567 0.0013  0.0054  0.0110  386  ARG A C   
405 O O   . ARG A 53 ? 0.0467 0.1023 0.1115 0.0295  0.0095  0.0287  386  ARG A O   
406 C CB  . ARG A 53 ? 0.0847 0.0785 0.0701 -0.0064 0.0109  0.0085  386  ARG A CB  
407 C CG  . ARG A 53 ? 0.1056 0.0920 0.0873 -0.0151 -0.0270 -0.0020 386  ARG A CG  
408 C CD  . ARG A 53 ? 0.1120 0.0739 0.1280 0.0011  -0.0264 0.0061  386  ARG A CD  
409 N NE  . ARG A 53 ? 0.1008 0.1019 0.1344 -0.0005 -0.0290 -0.0178 386  ARG A NE  
410 C CZ  . ARG A 53 ? 0.2262 0.0994 0.1011 0.0090  -0.0486 0.0015  386  ARG A CZ  
411 N NH1 . ARG A 53 ? 0.3421 0.1073 0.1786 0.0361  -0.1375 -0.0332 386  ARG A NH1 
412 N NH2 . ARG A 53 ? 0.2141 0.1228 0.1710 0.0288  -0.0618 -0.0341 386  ARG A NH2 
413 N N   . VAL A 54 ? 0.0483 0.0883 0.0809 0.0170  0.0114  0.0411  387  VAL A N   
414 C CA  . VAL A 54 ? 0.0688 0.0696 0.0903 0.0190  0.0209  0.0035  387  VAL A CA  
415 C C   . VAL A 54 ? 0.0688 0.0552 0.0734 0.0065  0.0117  -0.0028 387  VAL A C   
416 O O   . VAL A 54 ? 0.0910 0.0806 0.0900 0.0134  0.0327  0.0025  387  VAL A O   
417 C CB  . VAL A 54 ? 0.0596 0.1204 0.0770 0.0172  -0.0120 0.0253  387  VAL A CB  
418 C CG1 . VAL A 54 ? 0.1197 0.1050 0.0699 -0.0178 0.0141  0.0293  387  VAL A CG1 
419 C CG2 . VAL A 54 ? 0.0697 0.1578 0.1237 -0.0487 -0.0097 0.0363  387  VAL A CG2 
420 N N   . LEU A 55 ? 0.0554 0.0578 0.0727 0.0138  -0.0012 0.0027  388  LEU A N   
421 C CA  . LEU A 55 ? 0.0749 0.0755 0.0764 -0.0044 0.0047  -0.0100 388  LEU A CA  
422 C C   . LEU A 55 ? 0.0712 0.0836 0.0629 -0.0050 0.0120  -0.0045 388  LEU A C   
423 O O   . LEU A 55 ? 0.0776 0.0638 0.0873 0.0059  0.0017  -0.0129 388  LEU A O   
424 C CB  . LEU A 55 ? 0.0708 0.0969 0.0791 -0.0009 -0.0167 0.0033  388  LEU A CB  
425 C CG  . LEU A 55 ? 0.1101 0.0813 0.1086 -0.0135 -0.0324 0.0314  388  LEU A CG  
426 C CD1 . LEU A 55 ? 0.1294 0.1402 0.1308 0.0394  -0.0247 0.0565  388  LEU A CD1 
427 C CD2 . LEU A 55 ? 0.1707 0.2141 0.0957 0.0062  -0.0010 0.0179  388  LEU A CD2 
428 N N   . ALA A 56 ? 0.0797 0.0534 0.0553 0.0010  0.0065  0.0112  389  ALA A N   
429 C CA  . ALA A 56 ? 0.0832 0.0711 0.0684 -0.0086 -0.0070 -0.0036 389  ALA A CA  
430 C C   . ALA A 56 ? 0.0486 0.0649 0.0742 -0.0017 0.0063  0.0035  389  ALA A C   
431 O O   . ALA A 56 ? 0.0829 0.0480 0.0703 -0.0032 0.0014  0.0155  389  ALA A O   
432 C CB  . ALA A 56 ? 0.0718 0.0942 0.1145 -0.0275 0.0185  0.0156  389  ALA A CB  
433 N N   . ILE A 57 ? 0.0805 0.0503 0.0508 0.0219  0.0031  0.0154  390  ILE A N   
434 C CA  . ILE A 57 ? 0.0988 0.0638 0.0553 -0.0092 0.0076  0.0062  390  ILE A CA  
435 C C   . ILE A 57 ? 0.0934 0.0504 0.0643 -0.0062 -0.0052 0.0086  390  ILE A C   
436 O O   . ILE A 57 ? 0.1011 0.0501 0.0746 0.0089  0.0044  0.0068  390  ILE A O   
437 C CB  . ILE A 57 ? 0.0918 0.1240 0.0672 0.0172  -0.0018 0.0131  390  ILE A CB  
438 C CG1 . ILE A 57 ? 0.0847 0.1701 0.0609 -0.0404 0.0049  0.0491  390  ILE A CG1 
439 C CG2 . ILE A 57 ? 0.1314 0.0994 0.0727 -0.0239 -0.0149 0.0234  390  ILE A CG2 
440 C CD1 . ILE A 57 ? 0.0915 0.2318 0.1225 -0.0186 -0.0202 0.0283  390  ILE A CD1 
441 N N   . ASN A 58 ? 0.0977 0.0401 0.0659 0.0008  0.0190  0.0043  391  ASN A N   
442 C CA  . ASN A 58 ? 0.1013 0.0501 0.0597 -0.0126 -0.0051 0.0092  391  ASN A CA  
443 C C   . ASN A 58 ? 0.0761 0.0798 0.0570 -0.0159 -0.0059 -0.0147 391  ASN A C   
444 O O   . ASN A 58 ? 0.0889 0.0609 0.0863 -0.0239 0.0073  0.0180  391  ASN A O   
445 C CB  . ASN A 58 ? 0.0882 0.0614 0.0991 -0.0413 0.0264  0.0062  391  ASN A CB  
446 C CG  . ASN A 58 ? 0.0842 0.0485 0.0734 -0.0114 0.0056  0.0060  391  ASN A CG  
447 O OD1 . ASN A 58 ? 0.1651 0.0465 0.0801 -0.0344 -0.0129 0.0027  391  ASN A OD1 
448 N ND2 . ASN A 58 ? 0.1218 0.1299 0.0932 -0.0457 -0.0147 0.0260  391  ASN A ND2 
449 N N   . GLY A 59 ? 0.1225 0.0717 0.0765 0.0160  -0.0061 -0.0177 392  GLY A N   
450 C CA  . GLY A 59 ? 0.0890 0.0797 0.0808 0.0082  -0.0086 -0.0351 392  GLY A CA  
451 C C   . GLY A 59 ? 0.0704 0.0833 0.1072 0.0165  0.0045  -0.0126 392  GLY A C   
452 O O   . GLY A 59 ? 0.1090 0.1354 0.1399 0.0000  -0.0032 -0.0684 392  GLY A O   
453 N N   . HIS A 60 ? 0.0947 0.0533 0.0738 0.0147  0.0056  -0.0028 393  HIS A N   
454 C CA  . HIS A 60 ? 0.1011 0.0612 0.0800 -0.0021 0.0150  -0.0002 393  HIS A CA  
455 C C   . HIS A 60 ? 0.1051 0.0592 0.0667 0.0114  0.0052  -0.0089 393  HIS A C   
456 O O   . HIS A 60 ? 0.1399 0.0524 0.0966 -0.0141 0.0266  -0.0046 393  HIS A O   
457 C CB  . HIS A 60 ? 0.0992 0.0889 0.0934 0.0093  0.0282  -0.0007 393  HIS A CB  
458 C CG  . HIS A 60 ? 0.1186 0.1128 0.1214 -0.0087 0.0307  0.0047  393  HIS A CG  
459 N ND1 . HIS A 60 ? 0.3067 0.1212 0.1517 0.0234  0.0240  0.0015  393  HIS A ND1 
460 C CD2 . HIS A 60 ? 0.2216 0.0734 0.1258 0.0440  0.0101  -0.0066 393  HIS A CD2 
461 C CE1 . HIS A 60 ? 0.3193 0.1857 0.0945 0.0582  0.0427  0.0402  393  HIS A CE1 
462 N NE2 . HIS A 60 ? 0.1586 0.1740 0.0812 -0.0108 -0.0048 0.0322  393  HIS A NE2 
463 N N   . ASP A 61 ? 0.1329 0.0647 0.0730 -0.0148 0.0156  -0.0032 394  ASP A N   
464 C CA  . ASP A 61 ? 0.1214 0.0714 0.0830 -0.0005 0.0187  0.0039  394  ASP A CA  
465 C C   . ASP A 61 ? 0.1077 0.0742 0.0937 0.0024  0.0112  -0.0236 394  ASP A C   
466 O O   . ASP A 61 ? 0.1485 0.0848 0.1253 0.0384  0.0433  0.0082  394  ASP A O   
467 C CB  . ASP A 61 ? 0.1465 0.1156 0.0990 -0.0302 0.0019  -0.0008 394  ASP A CB  
468 C CG  . ASP A 61 ? 0.1845 0.1388 0.1207 -0.0167 -0.0177 -0.0412 394  ASP A CG  
469 O OD1 . ASP A 61 ? 0.1732 0.1373 0.1402 -0.0399 0.0045  0.0130  394  ASP A OD1 
470 O OD2 . ASP A 61 ? 0.3940 0.2025 0.1539 -0.0397 -0.0094 -0.0472 394  ASP A OD2 
471 N N   . LEU A 62 ? 0.0999 0.0811 0.0776 0.0023  0.0244  0.0081  395  LEU A N   
472 C CA  . LEU A 62 ? 0.1167 0.0758 0.0745 0.0278  -0.0036 0.0000  395  LEU A CA  
473 C C   . LEU A 62 ? 0.0884 0.0704 0.0902 0.0164  0.0033  0.0014  395  LEU A C   
474 O O   . LEU A 62 ? 0.0905 0.0831 0.0931 0.0089  0.0215  0.0026  395  LEU A O   
475 C CB  . LEU A 62 ? 0.1169 0.1003 0.0881 0.0088  0.0133  -0.0082 395  LEU A CB  
476 C CG  . LEU A 62 ? 0.1441 0.1374 0.0824 0.0139  0.0010  -0.0089 395  LEU A CG  
477 C CD1 . LEU A 62 ? 0.2023 0.1485 0.1895 0.0251  -0.0099 -0.0343 395  LEU A CD1 
478 C CD2 . LEU A 62 ? 0.1500 0.1672 0.1200 0.0928  -0.0097 -0.0391 395  LEU A CD2 
479 N N   . LYS A 63 ? 0.0757 0.1066 0.0673 0.0108  0.0162  0.0080  396  LYS A N   
480 C CA  . LYS A 63 ? 0.0973 0.1137 0.0753 0.0048  0.0183  0.0025  396  LYS A CA  
481 C C   . LYS A 63 ? 0.0963 0.0852 0.0790 -0.0101 0.0030  -0.0049 396  LYS A C   
482 O O   . LYS A 63 ? 0.0980 0.1249 0.0762 -0.0032 0.0135  0.0135  396  LYS A O   
483 C CB  . LYS A 63 ? 0.1127 0.1694 0.0786 -0.0226 -0.0069 0.0109  396  LYS A CB  
484 C CG  . LYS A 63 ? 0.1559 0.2372 0.1387 0.0023  -0.0001 0.0017  396  LYS A CG  
485 C CD  . LYS A 63 ? 0.1888 0.2874 0.2166 0.0186  -0.0406 0.0087  396  LYS A CD  
486 C CE  . LYS A 63 ? 0.2520 0.4040 0.2358 0.0171  -0.0556 0.0416  396  LYS A CE  
487 N N   . TYR A 64 ? 0.0931 0.0982 0.0926 0.0003  0.0237  -0.0244 397  TYR A N   
488 C CA  . TYR A 64 ? 0.1106 0.1065 0.0931 -0.0015 0.0236  -0.0153 397  TYR A CA  
489 C C   . TYR A 64 ? 0.1231 0.0988 0.0986 0.0150  0.0213  0.0154  397  TYR A C   
490 O O   . TYR A 64 ? 0.1211 0.1337 0.1754 0.0359  0.0141  -0.0566 397  TYR A O   
491 C CB  . TYR A 64 ? 0.1534 0.1350 0.1328 0.0061  0.0233  -0.0648 397  TYR A CB  
492 C CG  . TYR A 64 ? 0.1481 0.1370 0.1695 0.0022  0.0043  -0.0571 397  TYR A CG  
493 C CD1 . TYR A 64 ? 0.1621 0.2435 0.1341 -0.0035 0.0188  -0.0616 397  TYR A CD1 
494 C CD2 . TYR A 64 ? 0.1798 0.2378 0.1530 0.0152  0.0061  -0.0228 397  TYR A CD2 
495 C CE1 . TYR A 64 ? 0.2574 0.2664 0.1427 -0.0272 -0.0166 -0.0256 397  TYR A CE1 
496 C CE2 . TYR A 64 ? 0.1984 0.3333 0.2645 -0.0010 -0.0274 -0.0098 397  TYR A CE2 
497 C CZ  . TYR A 64 ? 0.2421 0.3383 0.1887 -0.0006 -0.0747 -0.0308 397  TYR A CZ  
498 O OH  . TYR A 64 ? 0.2360 0.4860 0.2865 0.0375  -0.1178 -0.0307 397  TYR A OH  
499 N N   . GLY A 65 ? 0.0949 0.1000 0.1011 0.0102  0.0059  -0.0180 398  GLY A N   
500 C CA  . GLY A 65 ? 0.0988 0.1145 0.1006 0.0070  0.0172  0.0045  398  GLY A CA  
501 C C   . GLY A 65 ? 0.0988 0.1144 0.0871 0.0186  0.0200  -0.0026 398  GLY A C   
502 O O   . GLY A 65 ? 0.1018 0.1041 0.0822 -0.0028 0.0182  -0.0136 398  GLY A O   
503 N N   . THR A 66 ? 0.0874 0.1686 0.1045 -0.0095 0.0036  0.0251  399  THR A N   
504 C CA  . THR A 66 ? 0.0919 0.1585 0.1066 0.0156  0.0086  0.0157  399  THR A CA  
505 C C   . THR A 66 ? 0.0800 0.1546 0.1086 0.0070  -0.0017 0.0093  399  THR A C   
506 O O   . THR A 66 ? 0.1052 0.1438 0.0862 0.0037  0.0019  0.0338  399  THR A O   
507 C CB  . THR A 66 ? 0.0929 0.1520 0.1317 0.0131  0.0026  -0.0195 399  THR A CB  
508 O OG1 . THR A 66 ? 0.1246 0.2064 0.1414 0.0386  -0.0035 0.0143  399  THR A OG1 
509 C CG2 . THR A 66 ? 0.1431 0.2113 0.1697 0.0334  0.0065  -0.0619 399  THR A CG2 
510 N N   . PRO A 67 ? 0.0835 0.1617 0.1166 0.0025  0.0145  0.0054  400  PRO A N   
511 C CA  . PRO A 67 ? 0.0919 0.1327 0.1072 -0.0192 0.0108  0.0232  400  PRO A CA  
512 C C   . PRO A 67 ? 0.0757 0.1600 0.1317 0.0219  0.0067  0.0287  400  PRO A C   
513 O O   . PRO A 67 ? 0.1034 0.1753 0.1025 0.0151  0.0189  0.0240  400  PRO A O   
514 C CB  . PRO A 67 ? 0.1075 0.1562 0.1187 -0.0014 0.0149  0.0246  400  PRO A CB  
515 C CG  . PRO A 67 ? 0.1295 0.2029 0.1028 -0.0540 0.0221  0.0054  400  PRO A CG  
516 C CD  . PRO A 67 ? 0.1117 0.2005 0.1196 -0.0305 0.0218  0.0085  400  PRO A CD  
517 N N   . GLU A 68 ? 0.0949 0.1774 0.0991 0.0256  -0.0096 -0.0032 401  GLU A N   
518 C CA  . GLU A 68 ? 0.0963 0.1901 0.1550 0.0477  -0.0056 0.0072  401  GLU A CA  
519 C C   . GLU A 68 ? 0.0987 0.1705 0.1409 0.0091  -0.0217 0.0273  401  GLU A C   
520 O O   . GLU A 68 ? 0.1592 0.1985 0.1586 0.0474  -0.0312 0.0427  401  GLU A O   
521 C CB  . GLU A 68 ? 0.1862 0.1872 0.2259 0.0624  -0.0097 0.0282  401  GLU A CB  
522 C CG  . GLU A 68 ? 0.2229 0.2712 0.3680 0.0857  -0.0056 -0.0535 401  GLU A CG  
523 C CD  . GLU A 68 ? 0.4955 0.5201 0.4351 -0.0009 0.0121  0.0200  401  GLU A CD  
524 O OE1 . GLU A 68 ? 0.2031 0.4731 0.4673 -0.0192 0.0678  -0.1657 401  GLU A OE1 
525 O OE2 . GLU A 68 ? 0.5636 0.6264 0.5896 -0.0444 -0.0017 -0.0239 401  GLU A OE2 
526 N N   . LEU A 69 ? 0.1203 0.1336 0.1298 0.0309  -0.0044 0.0117  402  LEU A N   
527 C CA  . LEU A 69 ? 0.1303 0.0983 0.1571 0.0172  -0.0095 0.0363  402  LEU A CA  
528 C C   . LEU A 69 ? 0.1264 0.1352 0.0945 0.0146  -0.0013 0.0368  402  LEU A C   
529 O O   . LEU A 69 ? 0.1331 0.1349 0.1237 0.0228  0.0119  0.0342  402  LEU A O   
530 C CB  . LEU A 69 ? 0.1883 0.1543 0.1662 0.0133  0.0063  0.0306  402  LEU A CB  
531 C CG  . LEU A 69 ? 0.1554 0.1905 0.1826 -0.0096 0.0080  0.0288  402  LEU A CG  
532 C CD1 . LEU A 69 ? 0.1946 0.1961 0.2483 -0.0275 0.0105  0.0697  402  LEU A CD1 
533 C CD2 . LEU A 69 ? 0.2160 0.1983 0.1958 -0.0150 -0.0276 -0.0060 402  LEU A CD2 
534 N N   . ALA A 70 ? 0.1014 0.1231 0.1258 0.0269  0.0011  0.0258  403  ALA A N   
535 C CA  . ALA A 70 ? 0.0779 0.1312 0.1064 -0.0042 0.0076  0.0356  403  ALA A CA  
536 C C   . ALA A 70 ? 0.0702 0.1228 0.1349 -0.0072 0.0047  0.0418  403  ALA A C   
537 O O   . ALA A 70 ? 0.1155 0.1362 0.1263 0.0059  0.0377  0.0349  403  ALA A O   
538 C CB  . ALA A 70 ? 0.1170 0.0851 0.1489 0.0125  0.0194  0.0422  403  ALA A CB  
539 N N   . ALA A 71 ? 0.0809 0.1512 0.1310 0.0175  -0.0073 0.0399  404  ALA A N   
540 C CA  . ALA A 71 ? 0.1239 0.1579 0.1289 -0.0118 -0.0113 0.0302  404  ALA A CA  
541 C C   . ALA A 71 ? 0.0836 0.1698 0.1376 -0.0009 -0.0038 0.0217  404  ALA A C   
542 O O   . ALA A 71 ? 0.1160 0.2206 0.1095 -0.0255 -0.0149 0.0480  404  ALA A O   
543 C CB  . ALA A 71 ? 0.0792 0.2177 0.1849 -0.0112 -0.0069 0.0293  404  ALA A CB  
544 N N   . GLN A 72 ? 0.1411 0.1571 0.1342 -0.0004 -0.0124 0.0488  405  GLN A N   
545 C CA  . GLN A 72 ? 0.1560 0.1731 0.1438 0.0031  -0.0173 0.0572  405  GLN A CA  
546 C C   . GLN A 72 ? 0.1210 0.1999 0.1395 0.0060  -0.0006 0.0576  405  GLN A C   
547 O O   . GLN A 72 ? 0.1238 0.2304 0.1344 -0.0093 0.0000  0.0668  405  GLN A O   
548 C CB  . GLN A 72 ? 0.1905 0.1946 0.1891 -0.0009 0.0049  0.0785  405  GLN A CB  
549 C CG  . GLN A 72 ? 0.2941 0.3818 0.3362 0.0177  0.0280  0.0204  405  GLN A CG  
550 C CD  . GLN A 72 ? 0.5557 0.4866 0.5443 0.0108  -0.0055 -0.0423 405  GLN A CD  
551 O OE1 . GLN A 72 ? 0.5396 0.5590 0.5974 0.0101  -0.0156 -0.0307 405  GLN A OE1 
552 N NE2 . GLN A 72 ? 0.6047 0.5847 0.6559 0.0482  -0.0126 -0.0025 405  GLN A NE2 
553 N N   . ILE A 73 ? 0.1281 0.1647 0.1167 0.0010  -0.0107 0.0478  406  ILE A N   
554 C CA  . ILE A 73 ? 0.1319 0.1644 0.1217 -0.0184 0.0144  0.0522  406  ILE A CA  
555 C C   . ILE A 73 ? 0.0850 0.1756 0.0979 -0.0209 -0.0082 0.0438  406  ILE A C   
556 O O   . ILE A 73 ? 0.1162 0.2093 0.1003 -0.0448 0.0078  0.0379  406  ILE A O   
557 C CB  . ILE A 73 ? 0.1105 0.1429 0.1281 -0.0184 -0.0110 0.0385  406  ILE A CB  
558 C CG1 . ILE A 73 ? 0.1362 0.1598 0.1681 -0.0015 0.0165  0.0358  406  ILE A CG1 
559 C CG2 . ILE A 73 ? 0.1258 0.1631 0.1307 -0.0147 -0.0022 0.0513  406  ILE A CG2 
560 C CD1 . ILE A 73 ? 0.1422 0.2380 0.1306 -0.0299 -0.0347 0.0302  406  ILE A CD1 
561 N N   . ILE A 74 ? 0.0919 0.1648 0.1131 -0.0196 0.0050  0.0358  407  ILE A N   
562 C CA  . ILE A 74 ? 0.0642 0.1890 0.1248 -0.0328 0.0063  0.0225  407  ILE A CA  
563 C C   . ILE A 74 ? 0.0864 0.2030 0.1628 -0.0356 0.0080  0.0282  407  ILE A C   
564 O O   . ILE A 74 ? 0.1210 0.2748 0.1319 -0.0830 -0.0058 0.0295  407  ILE A O   
565 C CB  . ILE A 74 ? 0.0910 0.1936 0.1306 -0.0281 0.0070  0.0247  407  ILE A CB  
566 C CG1 . ILE A 74 ? 0.1208 0.1421 0.1239 -0.0279 -0.0112 0.0242  407  ILE A CG1 
567 C CG2 . ILE A 74 ? 0.1869 0.1635 0.1329 -0.0632 -0.0436 0.0068  407  ILE A CG2 
568 C CD1 . ILE A 74 ? 0.1565 0.1655 0.1852 0.0346  0.0361  0.0220  407  ILE A CD1 
569 N N   . GLN A 75 ? 0.0816 0.2763 0.1332 -0.0469 -0.0088 0.0522  408  GLN A N   
570 C CA  . GLN A 75 ? 0.1151 0.2812 0.1236 -0.0630 -0.0361 0.0377  408  GLN A CA  
571 C C   . GLN A 75 ? 0.1095 0.2542 0.1528 -0.0626 -0.0069 0.0401  408  GLN A C   
572 O O   . GLN A 75 ? 0.1929 0.3734 0.1126 -0.1171 -0.0326 0.0356  408  GLN A O   
573 C CB  . GLN A 75 ? 0.1523 0.2683 0.1933 -0.0141 -0.0527 0.0694  408  GLN A CB  
574 C CG  . GLN A 75 ? 0.2352 0.2878 0.1753 -0.0415 -0.0197 0.0265  408  GLN A CG  
575 C CD  . GLN A 75 ? 0.3021 0.3507 0.3450 0.0261  -0.0065 -0.0205 408  GLN A CD  
576 O OE1 . GLN A 75 ? 0.4548 0.3457 0.4992 -0.0086 -0.0173 0.0262  408  GLN A OE1 
577 N NE2 . GLN A 75 ? 0.3619 0.3411 0.4342 -0.0355 0.0072  -0.0013 408  GLN A NE2 
578 N N   . ALA A 76 ? 0.0822 0.2022 0.1117 -0.0160 0.0006  0.0322  409  ALA A N   
579 C CA  . ALA A 76 ? 0.1106 0.1924 0.1270 0.0034  -0.0069 0.0507  409  ALA A CA  
580 C C   . ALA A 76 ? 0.0986 0.2019 0.1211 -0.0053 -0.0256 0.0569  409  ALA A C   
581 O O   . ALA A 76 ? 0.1167 0.2300 0.1814 -0.0229 -0.0026 0.0947  409  ALA A O   
582 C CB  . ALA A 76 ? 0.1594 0.1581 0.1983 -0.0214 -0.0071 0.0526  409  ALA A CB  
583 N N   . SER A 77 ? 0.0688 0.1531 0.1221 -0.0379 0.0049  0.0211  410  SER A N   
584 C CA  . SER A 77 ? 0.1039 0.1485 0.1081 -0.0323 0.0096  0.0083  410  SER A CA  
585 C C   . SER A 77 ? 0.1077 0.1738 0.1038 -0.0283 -0.0115 0.0272  410  SER A C   
586 O O   . SER A 77 ? 0.1057 0.3440 0.1104 -0.0287 -0.0297 -0.0096 410  SER A O   
587 C CB  A SER A 77 ? 0.1123 0.1470 0.1115 0.0211  -0.0017 0.0104  410  SER A CB  
588 C CB  B SER A 77 ? 0.1256 0.1536 0.1210 0.0064  0.0076  0.0044  410  SER A CB  
589 O OG  A SER A 77 ? 0.1850 0.1255 0.1921 -0.0141 -0.0235 0.0394  410  SER A OG  
590 O OG  B SER A 77 ? 0.1358 0.1239 0.1013 -0.0351 -0.0118 -0.0236 410  SER A OG  
591 N N   . GLY A 78 ? 0.0822 0.0996 0.1138 -0.0286 0.0145  0.0148  411  GLY A N   
592 C CA  . GLY A 78 ? 0.1423 0.1139 0.1063 -0.0336 0.0132  0.0148  411  GLY A CA  
593 C C   . GLY A 78 ? 0.1201 0.1093 0.1102 -0.0410 -0.0109 0.0149  411  GLY A C   
594 O O   . GLY A 78 ? 0.1693 0.1092 0.1304 -0.0500 0.0281  -0.0058 411  GLY A O   
595 N N   . GLU A 79 ? 0.1589 0.1218 0.0912 -0.0213 0.0031  0.0146  412  GLU A N   
596 C CA  . GLU A 79 ? 0.1608 0.1154 0.0992 -0.0011 -0.0209 -0.0001 412  GLU A CA  
597 C C   . GLU A 79 ? 0.1287 0.1284 0.1031 -0.0196 -0.0001 -0.0033 412  GLU A C   
598 O O   . GLU A 79 ? 0.1490 0.1047 0.1750 -0.0396 -0.0159 0.0412  412  GLU A O   
599 C CB  . GLU A 79 ? 0.3043 0.1653 0.1461 0.0319  0.0101  0.0166  412  GLU A CB  
600 C CG  . GLU A 79 ? 0.2460 0.1947 0.1831 -0.0408 -0.0030 -0.0026 412  GLU A CG  
601 C CD  . GLU A 79 ? 0.3336 0.2234 0.2835 0.0172  0.0389  -0.0097 412  GLU A CD  
602 O OE1 . GLU A 79 ? 0.3526 0.2106 0.3096 -0.0181 0.0870  0.0202  412  GLU A OE1 
603 O OE2 . GLU A 79 ? 0.3589 0.4525 0.3469 0.0225  0.0287  -0.0207 412  GLU A OE2 
604 N N   . ARG A 80 ? 0.1432 0.1014 0.0922 -0.0330 0.0181  0.0130  413  ARG A N   
605 C CA  . ARG A 80 ? 0.1275 0.1065 0.0959 -0.0301 0.0105  0.0168  413  ARG A CA  
606 C C   . ARG A 80 ? 0.1320 0.0868 0.0894 0.0044  -0.0115 0.0142  413  ARG A C   
607 O O   . ARG A 80 ? 0.2005 0.0627 0.0925 -0.0270 -0.0151 0.0033  413  ARG A O   
608 C CB  . ARG A 80 ? 0.1799 0.1324 0.1079 -0.0033 0.0209  0.0341  413  ARG A CB  
609 C CG  . ARG A 80 ? 0.1321 0.2061 0.1678 0.0045  0.0356  0.0587  413  ARG A CG  
610 C CD  . ARG A 80 ? 0.2530 0.3735 0.3153 0.0264  0.0335  0.0050  413  ARG A CD  
611 N NE  . ARG A 80 ? 0.2788 0.4323 0.3467 0.0200  -0.0183 0.0237  413  ARG A NE  
612 C CZ  . ARG A 80 ? 0.4480 0.4660 0.4611 -0.0163 -0.0059 -0.0145 413  ARG A CZ  
613 N NH1 . ARG A 80 ? 0.4004 0.4306 0.4499 -0.0130 0.0062  0.0084  413  ARG A NH1 
614 N NH2 . ARG A 80 ? 0.4872 0.5793 0.5069 0.0031  -0.0048 0.0341  413  ARG A NH2 
615 N N   . VAL A 81 ? 0.1273 0.0600 0.0733 -0.0258 -0.0019 0.0094  414  VAL A N   
616 C CA  . VAL A 81 ? 0.0958 0.0581 0.0857 -0.0326 -0.0236 0.0098  414  VAL A CA  
617 C C   . VAL A 81 ? 0.1017 0.0764 0.0624 -0.0211 -0.0141 0.0109  414  VAL A C   
618 O O   . VAL A 81 ? 0.1469 0.0658 0.0931 -0.0167 -0.0303 0.0138  414  VAL A O   
619 C CB  . VAL A 81 ? 0.0962 0.0989 0.1031 -0.0317 -0.0013 0.0175  414  VAL A CB  
620 C CG1 . VAL A 81 ? 0.1118 0.1138 0.1261 -0.0056 0.0116  0.0190  414  VAL A CG1 
621 C CG2 . VAL A 81 ? 0.1082 0.1801 0.1238 -0.0114 -0.0190 0.0542  414  VAL A CG2 
622 N N   . ASN A 82 ? 0.0885 0.0667 0.0562 -0.0155 -0.0127 0.0063  415  ASN A N   
623 C CA  . ASN A 82 ? 0.1060 0.0572 0.0585 -0.0240 0.0027  -0.0035 415  ASN A CA  
624 C C   . ASN A 82 ? 0.0849 0.0543 0.0671 -0.0126 -0.0044 0.0040  415  ASN A C   
625 O O   . ASN A 82 ? 0.2347 0.0337 0.0994 -0.0038 0.0629  0.0078  415  ASN A O   
626 C CB  . ASN A 82 ? 0.1217 0.1066 0.0805 -0.0295 -0.0001 -0.0048 415  ASN A CB  
627 C CG  . ASN A 82 ? 0.1452 0.1728 0.1382 0.0076  -0.0179 -0.0149 415  ASN A CG  
628 O OD1 . ASN A 82 ? 0.1944 0.1939 0.2358 0.0396  -0.0187 -0.0355 415  ASN A OD1 
629 N ND2 . ASN A 82 ? 0.1964 0.1683 0.2503 -0.0232 -0.0814 0.0102  415  ASN A ND2 
630 N N   . LEU A 83 ? 0.1174 0.0349 0.0573 0.0058  -0.0013 0.0009  416  LEU A N   
631 C CA  . LEU A 83 ? 0.0954 0.0669 0.0424 0.0074  -0.0136 -0.0199 416  LEU A CA  
632 C C   . LEU A 83 ? 0.0849 0.0628 0.0733 -0.0055 -0.0010 0.0089  416  LEU A C   
633 O O   . LEU A 83 ? 0.1350 0.0733 0.0956 0.0357  -0.0457 -0.0091 416  LEU A O   
634 C CB  . LEU A 83 ? 0.0910 0.0933 0.0673 0.0130  0.0081  -0.0012 416  LEU A CB  
635 C CG  . LEU A 83 ? 0.1411 0.0702 0.0782 -0.0436 -0.0247 0.0003  416  LEU A CG  
636 C CD1 . LEU A 83 ? 0.1553 0.1012 0.1321 -0.0101 -0.0083 0.0029  416  LEU A CD1 
637 C CD2 . LEU A 83 ? 0.1137 0.1765 0.1596 -0.0329 -0.0078 0.0177  416  LEU A CD2 
638 N N   . THR A 84 ? 0.0638 0.0942 0.0623 -0.0028 -0.0108 0.0009  417  THR A N   
639 C CA  . THR A 84 ? 0.0479 0.0878 0.0855 0.0071  0.0054  0.0029  417  THR A CA  
640 C C   . THR A 84 ? 0.0629 0.0982 0.0594 -0.0129 -0.0144 0.0157  417  THR A C   
641 O O   . THR A 84 ? 0.0812 0.0715 0.0879 0.0328  0.0056  -0.0117 417  THR A O   
642 C CB  . THR A 84 ? 0.0827 0.1137 0.0777 -0.0099 0.0069  -0.0023 417  THR A CB  
643 O OG1 . THR A 84 ? 0.1140 0.1943 0.1107 -0.0807 0.0166  0.0007  417  THR A OG1 
644 C CG2 . THR A 84 ? 0.0832 0.1695 0.1051 -0.0215 -0.0116 0.0088  417  THR A CG2 
645 N N   . ILE A 85 ? 0.0659 0.0688 0.0461 0.0112  0.0026  0.0099  418  ILE A N   
646 C CA  . ILE A 85 ? 0.0812 0.1007 0.0785 -0.0191 -0.0249 0.0122  418  ILE A CA  
647 C C   . ILE A 85 ? 0.0882 0.0875 0.0607 0.0087  -0.0028 0.0093  418  ILE A C   
648 O O   . ILE A 85 ? 0.0614 0.1194 0.0832 0.0240  0.0003  0.0120  418  ILE A O   
649 C CB  . ILE A 85 ? 0.2062 0.2367 0.0960 -0.0699 -0.0753 0.0308  418  ILE A CB  
650 C CG1 . ILE A 85 ? 0.1644 0.1965 0.1621 -0.0612 -0.0303 0.0473  418  ILE A CG1 
651 C CG2 . ILE A 85 ? 0.1954 0.1945 0.2717 -0.0867 -0.0152 0.0340  418  ILE A CG2 
652 C CD1 . ILE A 85 ? 0.1062 0.1637 0.1269 0.0297  -0.0261 0.0400  418  ILE A CD1 
653 N N   . ALA A 86 ? 0.0599 0.1003 0.0772 0.0303  -0.0121 -0.0034 419  ALA A N   
654 C CA  . ALA A 86 ? 0.0644 0.1101 0.0759 0.0209  -0.0086 0.0264  419  ALA A CA  
655 C C   . ALA A 86 ? 0.0488 0.1221 0.0876 0.0253  -0.0036 0.0036  419  ALA A C   
656 O O   . ALA A 86 ? 0.0598 0.1204 0.1318 0.0251  -0.0059 0.0357  419  ALA A O   
657 C CB  . ALA A 86 ? 0.0945 0.1308 0.0996 0.0056  -0.0068 -0.0207 419  ALA A CB  
658 N N   . ARG A 87 ? 0.0713 0.1045 0.1094 0.0202  -0.0131 0.0204  420  ARG A N   
659 C CA  . ARG A 87 ? 0.0649 0.1383 0.1062 0.0237  -0.0230 0.0232  420  ARG A CA  
660 C C   . ARG A 87 ? 0.1136 0.0853 0.1044 -0.0093 -0.0130 0.0386  420  ARG A C   
661 O O   . ARG A 87 ? 0.0883 0.1236 0.1009 -0.0211 -0.0396 0.0331  420  ARG A O   
662 C CB  . ARG A 87 ? 0.0806 0.1450 0.0943 0.0074  -0.0132 0.0116  420  ARG A CB  
663 C CG  . ARG A 87 ? 0.1120 0.1522 0.0927 0.0207  -0.0344 0.0112  420  ARG A CG  
664 C CD  . ARG A 87 ? 0.1228 0.1298 0.1295 0.0006  -0.0265 -0.0211 420  ARG A CD  
665 N NE  . ARG A 87 ? 0.0975 0.1467 0.0938 0.0096  -0.0141 -0.0138 420  ARG A NE  
666 C CZ  . ARG A 87 ? 0.1106 0.1674 0.1501 -0.0011 -0.0231 -0.0440 420  ARG A CZ  
667 N NH1 . ARG A 87 ? 0.1493 0.1870 0.1510 0.0653  -0.0205 -0.0137 420  ARG A NH1 
668 N NH2 . ARG A 87 ? 0.1182 0.1891 0.1165 0.0189  -0.0322 -0.0359 420  ARG A NH2 
669 N N   . PRO A 88 ? 0.1241 0.1791 0.1044 0.0251  -0.0042 0.0353  421  PRO A N   
670 C CA  . PRO A 88 ? 0.1416 0.1540 0.1102 -0.0001 -0.0005 -0.0043 421  PRO A CA  
671 C C   . PRO A 88 ? 0.1249 0.1247 0.1551 -0.0196 -0.0297 0.0155  421  PRO A C   
672 O O   . PRO A 88 ? 0.1671 0.1644 0.2252 -0.0347 -0.0696 -0.0083 421  PRO A O   
673 C CB  . PRO A 88 ? 0.2268 0.2059 0.1094 0.0070  0.0357  -0.0037 421  PRO A CB  
674 C CG  . PRO A 88 ? 0.2512 0.2343 0.2341 0.0385  0.0074  -0.0075 421  PRO A CG  
675 C CD  . PRO A 88 ? 0.1836 0.2116 0.1456 0.0519  0.0175  0.0296  421  PRO A CD  
676 N N   . GLY A 89 ? 0.1448 0.1463 0.1132 -0.0373 -0.0189 0.0325  422  GLY A N   
677 C CA  . GLY A 89 ? 0.2044 0.1945 0.1479 -0.0243 -0.0032 0.0566  422  GLY A CA  
678 C C   . GLY A 89 ? 0.1546 0.1839 0.1529 -0.0319 -0.0253 0.0289  422  GLY A C   
679 O O   . GLY A 89 ? 0.2976 0.1600 0.1748 0.0163  -0.0102 0.0466  422  GLY A O   
680 N N   . LYS A 90 ? 0.1373 0.1598 0.2088 -0.0246 -0.0343 0.0500  423  LYS A N   
681 C CA  . LYS A 90 ? 0.1298 0.1500 0.1674 -0.0370 -0.0295 0.0163  423  LYS A CA  
682 C C   . LYS A 90 ? 0.1209 0.1343 0.1585 -0.0440 -0.0354 0.0458  423  LYS A C   
683 O O   . LYS A 90 ? 0.1071 0.1962 0.2334 -0.0378 -0.0377 0.0730  423  LYS A O   
684 C CB  . LYS A 90 ? 0.1548 0.1624 0.1940 -0.0240 -0.0552 0.0447  423  LYS A CB  
685 C CG  . LYS A 90 ? 0.1160 0.2076 0.2583 -0.0302 -0.0541 0.0265  423  LYS A CG  
686 C CD  . LYS A 90 ? 0.1521 0.2213 0.1950 -0.0335 -0.0453 0.0201  423  LYS A CD  
687 C CE  . LYS A 90 ? 0.1289 0.1872 0.2787 -0.0564 -0.0220 -0.0207 423  LYS A CE  
688 N NZ  . LYS A 90 ? 0.3119 0.3052 0.2342 -0.0542 -0.0471 -0.0119 423  LYS A NZ  
689 N N   . PRO A 91 ? 0.1015 0.1715 0.1034 -0.0539 -0.0328 0.0633  424  PRO A N   
690 C CA  . PRO A 91 ? 0.1253 0.2199 0.1197 -0.0531 -0.0414 0.0493  424  PRO A CA  
691 C C   . PRO A 91 ? 0.0903 0.1547 0.0995 -0.0146 -0.0254 0.0312  424  PRO A C   
692 O O   . PRO A 91 ? 0.0840 0.1743 0.0884 -0.0329 -0.0146 0.0472  424  PRO A O   
693 C CB  . PRO A 91 ? 0.1599 0.2481 0.1813 -0.0743 -0.0133 0.0277  424  PRO A CB  
694 C CG  . PRO A 91 ? 0.1289 0.2438 0.2068 -0.0245 0.0065  0.0289  424  PRO A CG  
695 C CD  . PRO A 91 ? 0.1486 0.2074 0.1360 -0.0653 0.0017  0.0841  424  PRO A CD  
696 N N   . GLU A 92 ? 0.0665 0.1331 0.0804 -0.0306 -0.0130 0.0283  425  GLU A N   
697 C CA  . GLU A 92 ? 0.0556 0.1338 0.1126 -0.0236 -0.0038 0.0439  425  GLU A CA  
698 C C   . GLU A 92 ? 0.0664 0.1681 0.0713 -0.0116 -0.0185 0.0513  425  GLU A C   
699 O O   . GLU A 92 ? 0.0685 0.1743 0.1094 -0.0247 -0.0216 0.0489  425  GLU A O   
700 C CB  . GLU A 92 ? 0.1064 0.1574 0.1262 -0.0152 0.0048  0.0313  425  GLU A CB  
701 C CG  . GLU A 92 ? 0.1600 0.1781 0.2275 -0.0479 0.0083  0.0006  425  GLU A CG  
702 C CD  . GLU A 92 ? 0.2508 0.1857 0.2712 0.0256  -0.0284 0.0155  425  GLU A CD  
703 O OE1 . GLU A 92 ? 0.3659 0.3721 0.3732 0.0287  0.0480  -0.0069 425  GLU A OE1 
704 O OE2 . GLU A 92 ? 0.2381 0.2563 0.2870 -0.0116 0.0136  0.0884  425  GLU A OE2 
705 N N   . ILE A 93 ? 0.0569 0.1688 0.0847 -0.0307 -0.0233 0.0583  426  ILE A N   
706 C CA  . ILE A 93 ? 0.0546 0.1959 0.0834 -0.0379 -0.0219 0.0561  426  ILE A CA  
707 C C   . ILE A 93 ? 0.0856 0.1609 0.0835 -0.0290 -0.0290 0.0443  426  ILE A C   
708 O O   . ILE A 93 ? 0.0644 0.1464 0.0984 -0.0227 -0.0356 0.0338  426  ILE A O   
709 C CB  . ILE A 93 ? 0.0961 0.1864 0.0730 -0.0341 -0.0244 0.0462  426  ILE A CB  
710 C CG1 . ILE A 93 ? 0.1005 0.2191 0.1446 -0.0455 -0.0181 0.0456  426  ILE A CG1 
711 C CG2 . ILE A 93 ? 0.2090 0.1724 0.1278 -0.0315 -0.0403 0.0312  426  ILE A CG2 
712 C CD1 . ILE A 93 ? 0.1735 0.2114 0.1750 -0.0018 -0.0081 0.0265  426  ILE A CD1 
713 N N   . GLU A 94 ? 0.0701 0.1703 0.1009 -0.0240 -0.0154 0.0504  427  GLU A N   
714 C CA  . GLU A 94 ? 0.0734 0.1335 0.1054 0.0186  -0.0229 0.0376  427  GLU A CA  
715 C C   . GLU A 94 ? 0.0979 0.1128 0.1297 -0.0101 -0.0081 0.0210  427  GLU A C   
716 O O   . GLU A 94 ? 0.1231 0.2036 0.1165 -0.0163 -0.0223 0.0130  427  GLU A O   
717 C CB  . GLU A 94 ? 0.1229 0.1651 0.1312 -0.0162 -0.0130 0.0248  427  GLU A CB  
718 C CG  . GLU A 94 ? 0.1560 0.3193 0.1580 0.0684  -0.0225 -0.0337 427  GLU A CG  
719 C CD  . GLU A 94 ? 0.2367 0.2124 0.1719 0.0470  -0.0315 -0.0793 427  GLU A CD  
720 O OE1 . GLU A 94 ? 0.1769 0.1327 0.4315 0.0097  0.1128  0.1118  427  GLU A OE1 
721 O OE2 . GLU A 94 ? 0.2941 0.3351 0.2300 0.0177  0.0498  -0.0603 427  GLU A OE2 
722 N N   . LEU A 95 ? 0.1257 0.1124 0.1875 -0.0019 0.0328  -0.0035 428  LEU A N   
723 C CA  . LEU A 95 ? 0.1857 0.1336 0.2395 -0.0299 0.0712  -0.0170 428  LEU A CA  
724 C C   . LEU A 95 ? 0.2265 0.1519 0.2741 -0.0582 0.0930  -0.0426 428  LEU A C   
725 O O   . LEU A 95 ? 0.2104 0.1166 0.2051 -0.0613 0.0695  -0.0439 428  LEU A O   
726 C CB  . LEU A 95 ? 0.2717 0.1497 0.3450 -0.0054 0.0983  -0.0172 428  LEU A CB  
727 C CG  . LEU A 95 ? 0.2091 0.1481 0.4127 0.0568  0.0243  -0.0003 428  LEU A CG  
728 C CD1 . LEU A 95 ? 0.2366 0.1990 0.4415 -0.0241 0.0149  -0.0087 428  LEU A CD1 
729 C CD2 . LEU A 95 ? 0.2476 0.1960 0.4527 0.0415  -0.0324 0.0071  428  LEU A CD2 
730 O OXT . LEU A 95 ? 0.2820 0.1989 0.3341 -0.1076 0.1353  -0.0886 428  LEU A OXT 
731 O O   . HOH B .  ? 0.1327 0.2516 0.0919 -0.1240 -0.0168 0.0080  2001 HOH A O   
732 O O   . HOH B .  ? 0.4364 0.4039 0.4795 -0.0472 -0.0180 0.0488  2002 HOH A O   
733 O O   . HOH B .  ? 0.4080 0.3634 0.4084 -0.0598 -0.0605 0.0012  2003 HOH A O   
734 O O   . HOH B .  ? 0.4854 0.4649 0.3918 0.0119  -0.0280 0.0086  2004 HOH A O   
735 O O   . HOH B .  ? 0.3351 0.3650 0.4048 -0.0490 0.0044  0.0323  2005 HOH A O   
736 O O   . HOH B .  ? 0.2109 0.3200 0.3048 0.0105  -0.0072 -0.0594 2006 HOH A O   
737 O O   . HOH B .  ? 0.3299 0.3367 0.4627 -0.0655 0.0551  -0.0155 2007 HOH A O   
738 O O   . HOH B .  ? 0.4044 0.4019 0.3756 0.0502  0.0175  0.0417  2008 HOH A O   
739 O O   . HOH B .  ? 0.4889 0.2339 0.3212 -0.0391 0.0280  -0.1020 2009 HOH A O   
740 O O   . HOH B .  ? 0.2916 0.2187 0.3786 0.0162  0.0397  -0.0372 2010 HOH A O   
741 O O   . HOH B .  ? 0.4293 0.4889 0.4873 -0.0144 -0.0102 0.0094  2011 HOH A O   
742 O O   . HOH B .  ? 0.2264 0.2834 0.3542 -0.0352 0.0024  0.0463  2012 HOH A O   
743 O O   . HOH B .  ? 0.2989 0.4307 0.4117 -0.0523 -0.0306 0.0207  2013 HOH A O   
744 O O   . HOH B .  ? 0.3833 0.3758 0.3266 0.1274  0.0009  -0.0080 2014 HOH A O   
745 O O   . HOH B .  ? 0.3072 0.3727 0.4829 0.0699  -0.0514 -0.0056 2015 HOH A O   
746 O O   . HOH B .  ? 0.3471 0.4787 0.3793 0.0185  0.0309  -0.0108 2016 HOH A O   
747 O O   . HOH B .  ? 0.4254 0.0913 0.1820 -0.0048 0.0655  0.0109  2017 HOH A O   
748 O O   . HOH B .  ? 0.1691 0.0891 0.1473 -0.0106 0.0219  0.0153  2018 HOH A O   
749 O O   . HOH B .  ? 0.3844 0.3339 0.4484 0.0800  0.0690  0.0234  2019 HOH A O   
750 O O   . HOH B .  ? 0.3068 0.2818 0.2901 -0.0113 -0.0010 0.0973  2020 HOH A O   
751 O O   . HOH B .  ? 0.3999 0.4797 0.2399 0.0071  -0.0126 0.0704  2021 HOH A O   
752 O O   . HOH B .  ? 0.1202 0.2192 0.1556 -0.0258 -0.0054 0.0633  2022 HOH A O   
753 O O   . HOH B .  ? 0.2437 0.2846 0.3223 -0.0253 0.0023  0.1022  2023 HOH A O   
754 O O   . HOH B .  ? 0.2732 0.2849 0.2656 0.0314  -0.0561 -0.0301 2024 HOH A O   
755 O O   . HOH B .  ? 0.2605 0.2620 0.4475 0.0417  0.0233  -0.0171 2025 HOH A O   
756 O O   . HOH B .  ? 0.3033 0.1932 0.3087 -0.0847 -0.1061 0.0466  2026 HOH A O   
757 O O   . HOH B .  ? 0.2271 0.1175 0.1923 0.0455  -0.0674 0.0177  2027 HOH A O   
758 O O   . HOH B .  ? 0.4248 0.2671 0.4727 0.0120  0.0144  0.0312  2028 HOH A O   
759 O O   . HOH B .  ? 0.3323 0.2885 0.2349 0.0039  0.0416  0.0293  2029 HOH A O   
760 O O   . HOH B .  ? 0.1724 0.2314 0.3420 0.0270  0.0071  0.1284  2030 HOH A O   
761 O O   . HOH B .  ? 0.2468 0.4010 0.3542 -0.0055 0.0566  0.0314  2031 HOH A O   
762 O O   . HOH B .  ? 0.3392 0.3470 0.2807 0.0131  -0.0080 -0.0027 2032 HOH A O   
763 O O   . HOH B .  ? 0.4982 0.2795 0.2342 0.0142  -0.0124 0.0056  2033 HOH A O   
764 O O   . HOH B .  ? 0.3771 0.3151 0.2556 -0.0138 -0.0244 0.0151  2034 HOH A O   
765 O O   . HOH B .  ? 0.2991 0.1866 0.2413 -0.0154 -0.0298 0.0298  2035 HOH A O   
766 O O   . HOH B .  ? 0.3380 0.2474 0.2866 0.0287  -0.0151 0.0370  2036 HOH A O   
767 O O   . HOH B .  ? 0.3575 0.2742 0.2917 -0.0822 0.0957  0.0306  2037 HOH A O   
768 O O   . HOH B .  ? 0.2579 0.2048 0.2634 0.0323  0.0967  0.0368  2038 HOH A O   
769 O O   . HOH B .  ? 0.2274 0.2854 0.2365 0.0625  -0.0256 -0.0394 2039 HOH A O   
770 O O   . HOH B .  ? 0.3784 0.2933 0.3220 0.0684  -0.0820 -0.0136 2040 HOH A O   
771 O O   . HOH B .  ? 0.0760 0.1671 0.0896 -0.0007 -0.0133 -0.0097 2041 HOH A O   
772 O O   . HOH B .  ? 0.4042 0.3851 0.3837 -0.0820 0.0400  0.0264  2042 HOH A O   
773 O O   . HOH B .  ? 0.2480 0.1147 0.2831 0.0362  0.0861  0.0931  2043 HOH A O   
774 O O   . HOH B .  ? 0.0620 0.0735 0.1067 0.0029  -0.0044 0.0001  2044 HOH A O   
775 O O   . HOH B .  ? 0.1779 0.2714 0.3869 -0.0509 0.0955  -0.0715 2045 HOH A O   
776 O O   . HOH B .  ? 0.2612 0.2571 0.5403 -0.0260 -0.1104 0.0678  2046 HOH A O   
777 O O   . HOH B .  ? 0.3004 0.1314 0.4021 -0.0331 -0.0361 0.0174  2047 HOH A O   
778 O O   . HOH B .  ? 0.1365 0.1081 0.3754 0.0111  -0.0075 -0.0773 2048 HOH A O   
779 O O   . HOH B .  ? 0.1560 0.2617 0.2690 -0.0224 0.0212  -0.0757 2049 HOH A O   
780 O O   . HOH B .  ? 0.1050 0.0876 0.0709 0.0211  0.0050  -0.0093 2050 HOH A O   
781 O O   . HOH B .  ? 0.1308 0.1060 0.0844 0.0271  -0.0136 -0.0184 2051 HOH A O   
782 O O   . HOH B .  ? 0.2108 0.2117 0.1475 0.0049  0.0540  0.0155  2052 HOH A O   
783 O O   . HOH B .  ? 0.2588 0.2585 0.4266 0.0127  -0.0028 0.0508  2053 HOH A O   
784 O O   . HOH B .  ? 0.2032 0.1705 0.1985 0.0442  0.0378  0.0405  2054 HOH A O   
785 O O   . HOH B .  ? 0.2941 0.2689 0.2340 0.0010  0.0501  0.0279  2055 HOH A O   
786 O O   . HOH B .  ? 0.2049 0.2714 0.2432 -0.0230 0.0021  0.0822  2056 HOH A O   
787 O O   . HOH B .  ? 0.3144 0.3473 0.2693 -0.0043 0.0084  0.0565  2057 HOH A O   
788 O O   . HOH B .  ? 0.1778 0.0845 0.3772 -0.0561 0.0522  0.0220  2058 HOH A O   
789 O O   . HOH B .  ? 0.1416 0.1262 0.1142 -0.0070 0.0227  -0.0266 2059 HOH A O   
790 O O   . HOH B .  ? 0.1889 0.1327 0.1482 -0.0219 0.0238  0.0211  2060 HOH A O   
791 O O   . HOH B .  ? 0.3289 0.2045 0.1721 0.0323  0.0114  -0.0144 2061 HOH A O   
792 O O   . HOH B .  ? 0.2540 0.2001 0.1928 -0.0553 0.0626  -0.0177 2062 HOH A O   
793 O O   . HOH B .  ? 0.1045 0.1950 0.1524 -0.0050 -0.0056 0.0504  2063 HOH A O   
794 O O   . HOH B .  ? 0.2887 0.2210 0.2389 0.0521  -0.0806 -0.0585 2064 HOH A O   
795 O O   . HOH B .  ? 0.5458 0.3133 0.3039 0.0214  -0.0755 0.0107  2065 HOH A O   
796 O O   . HOH B .  ? 0.0906 0.0923 0.0886 -0.0022 0.0009  -0.0064 2066 HOH A O   
797 O O   . HOH B .  ? 0.3146 0.3683 0.4566 0.0052  -0.0133 -0.0369 2067 HOH A O   
798 O O   . HOH B .  ? 0.2325 0.2082 0.2003 -0.0221 0.0263  -0.0354 2068 HOH A O   
799 O O   . HOH B .  ? 0.1296 0.1465 0.2830 -0.0198 -0.0129 0.0801  2069 HOH A O   
800 O O   . HOH B .  ? 0.1337 0.0796 0.0797 -0.0243 0.0203  -0.0094 2070 HOH A O   
801 O O   . HOH B .  ? 0.2754 0.4229 0.3581 0.0135  -0.0371 0.0009  2071 HOH A O   
802 O O   . HOH B .  ? 0.3245 0.2011 0.2683 0.0379  0.0572  0.0127  2072 HOH A O   
803 O O   . HOH B .  ? 0.2212 0.1966 0.1758 0.0310  0.0513  -0.0070 2073 HOH A O   
804 O O   . HOH B .  ? 0.3930 0.1074 0.1574 -0.0939 0.0588  0.0051  2074 HOH A O   
805 O O   . HOH B .  ? 0.4293 0.4028 0.4260 -0.0684 0.0098  -0.0190 2075 HOH A O   
806 O O   . HOH B .  ? 0.4129 0.2767 0.3232 0.0690  0.0522  0.0904  2076 HOH A O   
807 O O   . HOH B .  ? 0.2801 0.1166 0.2387 -0.0208 0.0771  0.0110  2077 HOH A O   
808 O O   . HOH B .  ? 0.1208 0.1256 0.1160 0.0216  0.0123  -0.0229 2078 HOH A O   
809 O O   . HOH B .  ? 0.3790 0.3790 0.2713 -0.0124 0.0120  -0.0751 2079 HOH A O   
810 O O   . HOH B .  ? 0.4927 0.3869 0.2758 0.0280  0.0479  0.0050  2080 HOH A O   
811 O O   . HOH B .  ? 0.3908 0.3631 0.3478 0.0520  -0.0514 0.0341  2081 HOH A O   
812 O O   . HOH B .  ? 0.2266 0.3867 0.2698 0.0848  -0.0102 0.1219  2082 HOH A O   
813 O O   . HOH B .  ? 0.1682 0.1452 0.1421 -0.0155 0.0419  0.0303  2083 HOH A O   
814 O O   . HOH B .  ? 0.2782 0.3750 0.2891 -0.0506 -0.0467 0.0009  2084 HOH A O   
815 O O   . HOH B .  ? 0.3269 0.4779 0.4188 -0.0192 0.0531  -0.0040 2085 HOH A O   
816 O O   . HOH B .  ? 0.3010 0.2940 0.2146 -0.0304 -0.0002 0.0807  2086 HOH A O   
817 O O   . HOH B .  ? 0.1515 0.1506 0.0839 0.0364  0.0492  0.0315  2087 HOH A O   
818 O O   . HOH B .  ? 0.1511 0.3596 0.3041 0.0135  -0.0709 0.0041  2088 HOH A O   
819 O O   . HOH B .  ? 0.2418 0.3496 0.2801 -0.0305 0.0436  0.0058  2089 HOH A O   
820 O O   . HOH B .  ? 0.1989 0.1145 0.1531 -0.0483 0.0282  0.0120  2090 HOH A O   
821 O O   . HOH B .  ? 0.2843 0.3995 0.2798 0.1494  -0.0081 -0.0338 2091 HOH A O   
822 O O   . HOH B .  ? 0.1219 0.1106 0.0778 0.0309  0.0229  0.0235  2092 HOH A O   
823 O O   . HOH B .  ? 0.2154 0.2040 0.1511 0.0396  -0.0312 -0.0323 2093 HOH A O   
824 O O   . HOH B .  ? 0.2084 0.2214 0.2591 -0.0169 -0.0208 0.0059  2094 HOH A O   
825 O O   . HOH B .  ? 0.1890 0.1602 0.2327 0.0247  0.0444  0.0582  2095 HOH A O   
826 O O   . HOH B .  ? 0.3051 0.3336 0.2410 -0.0472 -0.0812 0.0219  2096 HOH A O   
827 O O   . HOH B .  ? 0.2713 0.4147 0.3222 -0.0335 -0.0194 -0.0203 2097 HOH A O   
828 O O   . HOH B .  ? 0.2710 0.2930 0.1956 0.0416  -0.0399 -0.0607 2098 HOH A O   
829 O O   . HOH B .  ? 0.3460 0.2587 0.3730 -0.0223 -0.0142 -0.0811 2099 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  SER 1  -1  -1  SER SER A . n 
A 1 2  MET 2  0   0   MET MET A . n 
A 1 3  GLU 3  336 336 GLU GLU A . n 
A 1 4  ILE 4  337 337 ILE ILE A . n 
A 1 5  LEU 5  338 338 LEU LEU A . n 
A 1 6  GLN 6  339 339 GLN GLN A . n 
A 1 7  VAL 7  340 340 VAL VAL A . n 
A 1 8  ALA 8  341 341 ALA ALA A . n 
A 1 9  LEU 9  342 342 LEU LEU A . n 
A 1 10 HIS 10 343 343 HIS HIS A . n 
A 1 11 LYS 11 344 344 LYS LYS A . n 
A 1 12 ARG 12 345 345 ARG ARG A . n 
A 1 13 ASP 13 346 346 ASP ASP A . n 
A 1 14 SER 14 347 347 SER SER A . n 
A 1 15 GLY 15 348 348 GLY GLY A . n 
A 1 16 GLU 16 349 349 GLU GLU A . n 
A 1 17 GLN 17 350 350 GLN GLN A . n 
A 1 18 LEU 18 351 351 LEU LEU A . n 
A 1 19 GLY 19 352 352 GLY GLY A . n 
A 1 20 ILE 20 353 353 ILE ILE A . n 
A 1 21 LYS 21 354 354 LYS LYS A . n 
A 1 22 LEU 22 355 355 LEU LEU A . n 
A 1 23 VAL 23 356 356 VAL VAL A . n 
A 1 24 ARG 24 357 357 ARG ARG A . n 
A 1 25 ARG 25 358 358 ARG ARG A . n 
A 1 26 THR 26 359 359 THR THR A . n 
A 1 27 ASP 27 360 360 ASP ASP A . n 
A 1 28 GLU 28 361 361 GLU GLU A . n 
A 1 29 PRO 29 362 362 PRO PRO A . n 
A 1 30 GLY 30 363 363 GLY GLY A . n 
A 1 31 VAL 31 364 364 VAL VAL A . n 
A 1 32 PHE 32 365 365 PHE PHE A . n 
A 1 33 ILE 33 366 366 ILE ILE A . n 
A 1 34 LEU 34 367 367 LEU LEU A . n 
A 1 35 ASP 35 368 368 ASP ASP A . n 
A 1 36 LEU 36 369 369 LEU LEU A . n 
A 1 37 LEU 37 370 370 LEU LEU A . n 
A 1 38 GLU 38 371 371 GLU GLU A . n 
A 1 39 GLY 39 372 372 GLY GLY A . n 
A 1 40 GLY 40 373 373 GLY GLY A . n 
A 1 41 LEU 41 374 374 LEU LEU A . n 
A 1 42 ALA 42 375 375 ALA ALA A . n 
A 1 43 ALA 43 376 376 ALA ALA A . n 
A 1 44 GLN 44 377 377 GLN GLN A . n 
A 1 45 ASP 45 378 378 ASP ASP A . n 
A 1 46 GLY 46 379 379 GLY GLY A . n 
A 1 47 ARG 47 380 380 ARG ARG A . n 
A 1 48 LEU 48 381 381 LEU LEU A . n 
A 1 49 SER 49 382 382 SER SER A . n 
A 1 50 SER 50 383 383 SER SER A . n 
A 1 51 ASN 51 384 384 ASN ASN A . n 
A 1 52 ASP 52 385 385 ASP ASP A . n 
A 1 53 ARG 53 386 386 ARG ARG A . n 
A 1 54 VAL 54 387 387 VAL VAL A . n 
A 1 55 LEU 55 388 388 LEU LEU A . n 
A 1 56 ALA 56 389 389 ALA ALA A . n 
A 1 57 ILE 57 390 390 ILE ILE A . n 
A 1 58 ASN 58 391 391 ASN ASN A . n 
A 1 59 GLY 59 392 392 GLY GLY A . n 
A 1 60 HIS 60 393 393 HIS HIS A . n 
A 1 61 ASP 61 394 394 ASP ASP A . n 
A 1 62 LEU 62 395 395 LEU LEU A . n 
A 1 63 LYS 63 396 396 LYS LYS A . n 
A 1 64 TYR 64 397 397 TYR TYR A . n 
A 1 65 GLY 65 398 398 GLY GLY A . n 
A 1 66 THR 66 399 399 THR THR A . n 
A 1 67 PRO 67 400 400 PRO PRO A . n 
A 1 68 GLU 68 401 401 GLU GLU A . n 
A 1 69 LEU 69 402 402 LEU LEU A . n 
A 1 70 ALA 70 403 403 ALA ALA A . n 
A 1 71 ALA 71 404 404 ALA ALA A . n 
A 1 72 GLN 72 405 405 GLN GLN A . n 
A 1 73 ILE 73 406 406 ILE ILE A . n 
A 1 74 ILE 74 407 407 ILE ILE A . n 
A 1 75 GLN 75 408 408 GLN GLN A . n 
A 1 76 ALA 76 409 409 ALA ALA A . n 
A 1 77 SER 77 410 410 SER SER A . n 
A 1 78 GLY 78 411 411 GLY GLY A . n 
A 1 79 GLU 79 412 412 GLU GLU A . n 
A 1 80 ARG 80 413 413 ARG ARG A . n 
A 1 81 VAL 81 414 414 VAL VAL A . n 
A 1 82 ASN 82 415 415 ASN ASN A . n 
A 1 83 LEU 83 416 416 LEU LEU A . n 
A 1 84 THR 84 417 417 THR THR A . n 
A 1 85 ILE 85 418 418 ILE ILE A . n 
A 1 86 ALA 86 419 419 ALA ALA A . n 
A 1 87 ARG 87 420 420 ARG ARG A . n 
A 1 88 PRO 88 421 421 PRO PRO A . n 
A 1 89 GLY 89 422 422 GLY GLY A . n 
A 1 90 LYS 90 423 423 LYS LYS A . n 
A 1 91 PRO 91 424 424 PRO PRO A . n 
A 1 92 GLU 92 425 425 GLU GLU A . n 
A 1 93 ILE 93 426 426 ILE ILE A . n 
A 1 94 GLU 94 427 427 GLU GLU A . n 
A 1 95 LEU 95 428 428 LEU LEU A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  2001 2001 HOH HOH A . 
B 2 HOH 2  2002 2002 HOH HOH A . 
B 2 HOH 3  2003 2003 HOH HOH A . 
B 2 HOH 4  2004 2004 HOH HOH A . 
B 2 HOH 5  2005 2005 HOH HOH A . 
B 2 HOH 6  2006 2006 HOH HOH A . 
B 2 HOH 7  2007 2007 HOH HOH A . 
B 2 HOH 8  2008 2008 HOH HOH A . 
B 2 HOH 9  2009 2009 HOH HOH A . 
B 2 HOH 10 2010 2010 HOH HOH A . 
B 2 HOH 11 2011 2011 HOH HOH A . 
B 2 HOH 12 2012 2012 HOH HOH A . 
B 2 HOH 13 2013 2013 HOH HOH A . 
B 2 HOH 14 2014 2014 HOH HOH A . 
B 2 HOH 15 2015 2015 HOH HOH A . 
B 2 HOH 16 2016 2016 HOH HOH A . 
B 2 HOH 17 2017 2017 HOH HOH A . 
B 2 HOH 18 2018 2018 HOH HOH A . 
B 2 HOH 19 2019 2019 HOH HOH A . 
B 2 HOH 20 2020 2020 HOH HOH A . 
B 2 HOH 21 2021 2021 HOH HOH A . 
B 2 HOH 22 2022 2022 HOH HOH A . 
B 2 HOH 23 2023 2023 HOH HOH A . 
B 2 HOH 24 2024 2024 HOH HOH A . 
B 2 HOH 25 2025 2025 HOH HOH A . 
B 2 HOH 26 2026 2026 HOH HOH A . 
B 2 HOH 27 2027 2027 HOH HOH A . 
B 2 HOH 28 2028 2028 HOH HOH A . 
B 2 HOH 29 2029 2029 HOH HOH A . 
B 2 HOH 30 2030 2030 HOH HOH A . 
B 2 HOH 31 2031 2031 HOH HOH A . 
B 2 HOH 32 2032 2032 HOH HOH A . 
B 2 HOH 33 2033 2033 HOH HOH A . 
B 2 HOH 34 2034 2034 HOH HOH A . 
B 2 HOH 35 2035 2035 HOH HOH A . 
B 2 HOH 36 2036 2036 HOH HOH A . 
B 2 HOH 37 2037 2037 HOH HOH A . 
B 2 HOH 38 2038 2038 HOH HOH A . 
B 2 HOH 39 2039 2039 HOH HOH A . 
B 2 HOH 40 2040 2040 HOH HOH A . 
B 2 HOH 41 2041 2041 HOH HOH A . 
B 2 HOH 42 2042 2042 HOH HOH A . 
B 2 HOH 43 2043 2043 HOH HOH A . 
B 2 HOH 44 2044 2044 HOH HOH A . 
B 2 HOH 45 2045 2045 HOH HOH A . 
B 2 HOH 46 2046 2046 HOH HOH A . 
B 2 HOH 47 2047 2047 HOH HOH A . 
B 2 HOH 48 2048 2048 HOH HOH A . 
B 2 HOH 49 2049 2049 HOH HOH A . 
B 2 HOH 50 2050 2050 HOH HOH A . 
B 2 HOH 51 2051 2051 HOH HOH A . 
B 2 HOH 52 2052 2052 HOH HOH A . 
B 2 HOH 53 2053 2053 HOH HOH A . 
B 2 HOH 54 2054 2054 HOH HOH A . 
B 2 HOH 55 2055 2055 HOH HOH A . 
B 2 HOH 56 2056 2056 HOH HOH A . 
B 2 HOH 57 2057 2057 HOH HOH A . 
B 2 HOH 58 2058 2058 HOH HOH A . 
B 2 HOH 59 2059 2059 HOH HOH A . 
B 2 HOH 60 2060 2060 HOH HOH A . 
B 2 HOH 61 2061 2061 HOH HOH A . 
B 2 HOH 62 2062 2062 HOH HOH A . 
B 2 HOH 63 2063 2063 HOH HOH A . 
B 2 HOH 64 2064 2064 HOH HOH A . 
B 2 HOH 65 2065 2065 HOH HOH A . 
B 2 HOH 66 2066 2066 HOH HOH A . 
B 2 HOH 67 2067 2067 HOH HOH A . 
B 2 HOH 68 2068 2068 HOH HOH A . 
B 2 HOH 69 2069 2069 HOH HOH A . 
B 2 HOH 70 2070 2070 HOH HOH A . 
B 2 HOH 71 2071 2071 HOH HOH A . 
B 2 HOH 72 2072 2072 HOH HOH A . 
B 2 HOH 73 2073 2073 HOH HOH A . 
B 2 HOH 74 2074 2074 HOH HOH A . 
B 2 HOH 75 2075 2075 HOH HOH A . 
B 2 HOH 76 2076 2076 HOH HOH A . 
B 2 HOH 77 2077 2077 HOH HOH A . 
B 2 HOH 78 2078 2078 HOH HOH A . 
B 2 HOH 79 2079 2079 HOH HOH A . 
B 2 HOH 80 2080 2080 HOH HOH A . 
B 2 HOH 81 2081 2081 HOH HOH A . 
B 2 HOH 82 2082 2082 HOH HOH A . 
B 2 HOH 83 2083 2083 HOH HOH A . 
B 2 HOH 84 2084 2084 HOH HOH A . 
B 2 HOH 85 2085 2085 HOH HOH A . 
B 2 HOH 86 2086 2086 HOH HOH A . 
B 2 HOH 87 2087 2087 HOH HOH A . 
B 2 HOH 88 2088 2088 HOH HOH A . 
B 2 HOH 89 2089 2089 HOH HOH A . 
B 2 HOH 90 2090 2090 HOH HOH A . 
B 2 HOH 91 2091 2091 HOH HOH A . 
B 2 HOH 92 2092 2092 HOH HOH A . 
B 2 HOH 93 2093 2093 HOH HOH A . 
B 2 HOH 94 2094 2094 HOH HOH A . 
B 2 HOH 95 2095 2095 HOH HOH A . 
B 2 HOH 96 2096 2096 HOH HOH A . 
B 2 HOH 97 2097 2097 HOH HOH A . 
B 2 HOH 98 2098 2098 HOH HOH A . 
B 2 HOH 99 2099 2099 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-09-16 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-01-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' audit_author    
2 4 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_audit_author.name'    
2 4 'Structure model' '_citation_author.name' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.4.0066 ? 1 
MOSFLM 'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
PHASER phasing          .        ? 4 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;
SHEET
THE SHEET STRUCTURE OF THIS MOLECULE IS BIFURCATED. IN
ORDER TO REPRESENT THIS FEATURE IN THE SHEET RECORDS BELOW,
TWO SHEETS ARE DEFINED.
;
# 
_pdbx_entry_details.entry_id             2VWR 
_pdbx_entry_details.compound_details     'ENGINEERED RESIDUE IN CHAIN A, PHE 338 TO LEU' 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'A POINT MUTATION F338L OCCURED DURING CLONING' 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASN 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     384 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             83.06 
_pdbx_validate_torsion.psi             -2.34 
# 
_pdbx_unobs_or_zero_occ_atoms.id               1 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id     LYS 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id      396 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id     NZ 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id     ? 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id    A 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id    LYS 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id     63 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id    NZ 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#