data_2VZI
# 
_entry.id   2VZI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.307 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2VZI         
PDBE  EBI-37096    
WWPDB D_1290037096 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2VZG unspecified 
'CRYSTAL STRUCTURE OF THE C-TERMINAL CALPONIN HOMOLOGY DOMAIN OF ALPHA-PARVIN IN COMPLEX WITH PAXILLIN LD2 MOTIF' 
PDB 2VZD unspecified 
'CRYSTAL STRUCTURE OF THE C-TERMINAL CALPONIN HOMOLOGY DOMAIN OF ALPHA PARVIN IN COMPLEX WITH PAXILLIN LD1 MOTIF' 
PDB 1KL0 unspecified 'THEORETICAL MODEL OF THE FAT DOMAIN OF FOCAL ADHESIONKINASE COMPLEXED WITH PAXILLIN LD2 MOTIF' 
PDB 2VZC unspecified 'CRYSTAL STRUCTURE OF THE C-TERMINAL CALPONIN HOMOLOGY DOMAIN OF ALPHA PARVIN' 
PDB 1KKY unspecified 'THEORETICAL MODEL OF THE FAT DOMAIN OF FOCAL ADHESIONKINASE COMPLEXED WITH PAXILLIN LD2 MOTIF' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2VZI 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2008-08-01 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Lorenz, S.'      1 ? 
'Vakonakis, I.'   2 ? 
'Lowe, E.D.'      3 ? 
'Campbell, I.D.'  4 ? 
'Noble, M.E.M.'   5 ? 
'Hoellerer, M.K.' 6 ? 
# 
_citation.id                        primary 
_citation.title                     'Structural analysis of the interactions between paxillin LD motifs and alpha-parvin.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            16 
_citation.page_first                1521 
_citation.page_last                 1531 
_citation.year                      2008 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18940607 
_citation.pdbx_database_id_DOI      10.1016/j.str.2008.08.007 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lorenz, S.'      1 ? 
primary 'Vakonakis, I.'   2 ? 
primary 'Lowe, E.D.'      3 ? 
primary 'Campbell, I.D.'  4 ? 
primary 'Noble, M.E.'     5 ? 
primary 'Hoellerer, M.K.' 6 ? 
# 
_cell.entry_id           2VZI 
_cell.length_a           75.420 
_cell.length_b           94.600 
_cell.length_c           42.170 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2VZI 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Paxillin,Paxillin      2305.626  1  ? ? 
;PAXILLIN LD4 MOTIF, RESIDUES 262-277 AND 312-315 OF PAXILLIN ISOFORM BETA,PAXILLIN LD4 MOTIF, RESIDUES 262-277 AND 312-315 OF PAXILLIN ISOFORM BETA
;
? 
2 polymer     man Alpha-parvin           15155.380 1  ? ? 'C-TERMINAL CALPONIN HOMOLOGY DOMAIN, RESIDUES 242-372' ? 
3 non-polymer syn 'TETRAETHYLENE GLYCOL' 194.226   1  ? ? ? ? 
4 non-polymer syn 1,2-ETHANEDIOL         62.068    2  ? ? ? ? 
5 non-polymer syn 'TRIETHYLENE GLYCOL'   150.173   2  ? ? ? ? 
6 water       nat water                  18.015    39 ? ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        
'Actopaxin,CH-ILKBP,Calponin-like integrin-linked kinase-binding protein,Matrix-remodeling-associated protein 2' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no ATRELDELMASLSDFKFMAQ ATRELDELMASLSDFKFMAQ A ? 
2 'polypeptide(L)' no no 
;SGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFE
QKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVE
;
;SGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFE
QKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVE
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   THR n 
1 3   ARG n 
1 4   GLU n 
1 5   LEU n 
1 6   ASP n 
1 7   GLU n 
1 8   LEU n 
1 9   MET n 
1 10  ALA n 
1 11  SER n 
1 12  LEU n 
1 13  SER n 
1 14  ASP n 
1 15  PHE n 
1 16  LYS n 
1 17  PHE n 
1 18  MET n 
1 19  ALA n 
1 20  GLN n 
2 1   SER n 
2 2   GLY n 
2 3   ARG n 
2 4   HIS n 
2 5   GLU n 
2 6   ARG n 
2 7   ASP n 
2 8   ALA n 
2 9   PHE n 
2 10  ASP n 
2 11  THR n 
2 12  LEU n 
2 13  PHE n 
2 14  ASP n 
2 15  HIS n 
2 16  ALA n 
2 17  PRO n 
2 18  ASP n 
2 19  LYS n 
2 20  LEU n 
2 21  ASN n 
2 22  VAL n 
2 23  VAL n 
2 24  LYS n 
2 25  LYS n 
2 26  THR n 
2 27  LEU n 
2 28  ILE n 
2 29  THR n 
2 30  PHE n 
2 31  VAL n 
2 32  ASN n 
2 33  LYS n 
2 34  HIS n 
2 35  LEU n 
2 36  ASN n 
2 37  LYS n 
2 38  LEU n 
2 39  ASN n 
2 40  LEU n 
2 41  GLU n 
2 42  VAL n 
2 43  THR n 
2 44  GLU n 
2 45  LEU n 
2 46  GLU n 
2 47  THR n 
2 48  GLN n 
2 49  PHE n 
2 50  ALA n 
2 51  ASP n 
2 52  GLY n 
2 53  VAL n 
2 54  TYR n 
2 55  LEU n 
2 56  VAL n 
2 57  LEU n 
2 58  LEU n 
2 59  MET n 
2 60  GLY n 
2 61  LEU n 
2 62  LEU n 
2 63  GLU n 
2 64  GLY n 
2 65  TYR n 
2 66  PHE n 
2 67  VAL n 
2 68  PRO n 
2 69  LEU n 
2 70  HIS n 
2 71  SER n 
2 72  PHE n 
2 73  PHE n 
2 74  LEU n 
2 75  THR n 
2 76  PRO n 
2 77  ASP n 
2 78  SER n 
2 79  PHE n 
2 80  GLU n 
2 81  GLN n 
2 82  LYS n 
2 83  VAL n 
2 84  LEU n 
2 85  ASN n 
2 86  VAL n 
2 87  SER n 
2 88  PHE n 
2 89  ALA n 
2 90  PHE n 
2 91  GLU n 
2 92  LEU n 
2 93  MET n 
2 94  GLN n 
2 95  ASP n 
2 96  GLY n 
2 97  GLY n 
2 98  LEU n 
2 99  GLU n 
2 100 LYS n 
2 101 PRO n 
2 102 LYS n 
2 103 PRO n 
2 104 ARG n 
2 105 PRO n 
2 106 GLU n 
2 107 ASP n 
2 108 ILE n 
2 109 VAL n 
2 110 ASN n 
2 111 CYS n 
2 112 ASP n 
2 113 LEU n 
2 114 LYS n 
2 115 SER n 
2 116 THR n 
2 117 LEU n 
2 118 ARG n 
2 119 VAL n 
2 120 LEU n 
2 121 TYR n 
2 122 ASN n 
2 123 LEU n 
2 124 PHE n 
2 125 THR n 
2 126 LYS n 
2 127 TYR n 
2 128 ARG n 
2 129 ASN n 
2 130 VAL n 
2 131 GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1  16  Human ? PXN            ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21' 511693 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? PGEX-6P1 ? ? 
1 2 sample 'Biological sequence' 17 20  Human ? PXN            ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21' 511693 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? PGEX-6P1 ? ? 
2 1 sample 'Biological sequence' 1  131 Human ? 'PARVA, MXRA2' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21' 511693 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?        ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP PAXI_HUMAN  P49023 ? 1 ATRELDELMASLSDFK 262 
2 UNP PAXI_HUMAN  P49023 ? 1 FMAQ 312 
3 UNP PARVA_HUMAN Q9NVD7 ? 2 
;SGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFE
QKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVE
;
242 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2VZI A 1  ? 16  ? P49023 262 ? 277 ? 1   16  
2 2 2VZI A 17 ? 20  ? P49023 312 ? 315 ? 17  20  
3 3 2VZI B 1  ? 131 ? Q9NVD7 242 ? 372 ? 242 372 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE               ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE             ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'        ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE               ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL         'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE              ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'        ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE              ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                  ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE             ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                 ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE             ?                 'C5 H11 N O2 S'  149.211 
PG4 non-polymer         . 'TETRAETHYLENE GLYCOL' ?                 'C8 H18 O5'      194.226 
PGE non-polymer         . 'TRIETHYLENE GLYCOL'   ?                 'C6 H14 O4'      150.173 
PHE 'L-peptide linking' y PHENYLALANINE          ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                 ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE              ?                 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE               ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                 ?                 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2VZI 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.2 
_exptl_crystal.density_percent_sol   45 
_exptl_crystal.description           NONE 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            286 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.2 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '40%(W/V) PEG 300, 0.1M CITRATE PH 5.2' 
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2007-09-01 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(311), SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.976 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_wavelength             0.976 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2VZI 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             37.72 
_reflns.d_resolution_high            2.20 
_reflns.number_obs                   7929 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            0.12 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.70 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.5 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.32 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.63 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.20 
_reflns_shell.pdbx_redundancy        3.6 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2VZI 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     7558 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             58.93 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    99.2 
_refine.ls_R_factor_obs                          0.208 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.205 
_refine.ls_R_factor_R_free                       0.260 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.700 
_refine.ls_number_reflns_R_free                  369 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.937 
_refine.correlation_coeff_Fo_to_Fc_free          0.905 
_refine.B_iso_mean                               31.70 
_refine.aniso_B[1][1]                            1.41000 
_refine.aniso_B[2][2]                            -0.23000 
_refine.aniso_B[3][3]                            -1.18000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2VZC' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.396 
_refine.pdbx_overall_ESU_R_Free                  0.252 
_refine.overall_SU_ML                            0.203 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             15.117 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1128 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         41 
_refine_hist.number_atoms_solvent             39 
_refine_hist.number_atoms_total               1208 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        58.93 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.008  0.022  ? 1411 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.139  2.020  ? 1919 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.659  5.000  ? 180  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       30.610 24.746 ? 59   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.145 15.000 ? 264  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.377 15.000 ? 6    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.078  0.200  ? 217  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.020  ? 1063 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.188  0.200  ? 722  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.298  0.200  ? 977  'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.131  0.200  ? 70   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.161  0.200  ? 49   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.111  0.200  ? 7    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.366  1.500  ? 858  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.656  2.000  ? 1393 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.073  3.000  ? 596  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.593  4.500  ? 526  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.26 
_refine_ls_shell.number_reflns_R_work             571 
_refine_ls_shell.R_factor_R_work                  0.2450 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3500 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             22 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2VZI 
_struct.title                     
'Crystal structure of the C-terminal calponin homology domain of alpha- parvin in complex with paxillin LD4 motif' 
_struct.pdbx_descriptor           'PAXILLIN, ALPHA-PARVIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2VZI 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            
;CELL ADHESION, CELL MEMBRANE, METAL-BINDING, CALPONIN HOMOLOGY DOMAIN, CYTOSKELETON, CELL JUNCTION, ACTIN-BINDING, MEMBRANE, LD2 MOTIF, LIM DOMAIN, PHOSPHOPROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 4 ? 
G N N 5 ? 
H N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 1   ? SER A 13  ? ALA A 1   SER A 13  1 ? 13 
HELX_P HELX_P2 2 ASP B 7   ? ALA B 16  ? ASP B 248 ALA B 257 1 ? 10 
HELX_P HELX_P3 3 LYS B 19  ? ASN B 36  ? LYS B 260 ASN B 277 1 ? 18 
HELX_P HELX_P4 4 LYS B 37  ? ASN B 39  ? LYS B 278 ASN B 280 5 ? 3  
HELX_P HELX_P5 5 GLY B 52  ? GLY B 64  ? GLY B 293 GLY B 305 1 ? 13 
HELX_P HELX_P6 6 PRO B 68  ? PHE B 72  ? PRO B 309 PHE B 313 5 ? 5  
HELX_P HELX_P7 7 SER B 78  ? GLY B 96  ? SER B 319 GLY B 337 1 ? 19 
HELX_P HELX_P8 8 ARG B 104 ? ASN B 110 ? ARG B 345 ASN B 351 1 ? 7  
HELX_P HELX_P9 9 ASP B 112 ? TYR B 127 ? ASP B 353 TYR B 368 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE PG4 B 1373' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE PGE B 1377' 
AC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE EDO B 1374' 
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE PGE B 1375' 
AC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE EDO B 1376' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 ASN B 21  ? ASN B 262  . ? 4_555 ? 
2  AC1 7 ALA B 50  ? ALA B 291  . ? 1_555 ? 
3  AC1 7 ASP B 77  ? ASP B 318  . ? 1_555 ? 
4  AC1 7 SER B 78  ? SER B 319  . ? 1_555 ? 
5  AC1 7 PHE B 79  ? PHE B 320  . ? 1_555 ? 
6  AC1 7 LYS B 82  ? LYS B 323  . ? 1_555 ? 
7  AC1 7 VAL B 109 ? VAL B 350  . ? 1_555 ? 
8  AC2 4 ASP B 95  ? ASP B 336  . ? 1_555 ? 
9  AC2 4 TYR B 121 ? TYR B 362  . ? 6_545 ? 
10 AC2 4 ASN B 122 ? ASN B 363  . ? 6_545 ? 
11 AC2 4 THR B 125 ? THR B 366  . ? 6_545 ? 
12 AC3 7 PHE B 30  ? PHE B 271  . ? 1_555 ? 
13 AC3 7 LYS B 33  ? LYS B 274  . ? 1_555 ? 
14 AC3 7 HIS B 34  ? HIS B 275  . ? 1_555 ? 
15 AC3 7 TYR B 127 ? TYR B 368  . ? 1_555 ? 
16 AC3 7 ARG B 128 ? ARG B 369  . ? 1_555 ? 
17 AC3 7 VAL B 130 ? VAL B 371  . ? 1_555 ? 
18 AC3 7 HOH H .   ? HOH B 2037 . ? 1_555 ? 
19 AC4 6 GLN B 48  ? GLN B 289  . ? 1_555 ? 
20 AC4 6 ASP B 51  ? ASP B 292  . ? 1_555 ? 
21 AC4 6 VAL B 53  ? VAL B 294  . ? 1_555 ? 
22 AC4 6 TYR B 54  ? TYR B 295  . ? 1_555 ? 
23 AC4 6 LEU B 74  ? LEU B 315  . ? 1_555 ? 
24 AC4 6 THR B 75  ? THR B 316  . ? 3_555 ? 
25 AC5 7 MET B 93  ? MET B 334  . ? 1_555 ? 
26 AC5 7 PRO B 101 ? PRO B 342  . ? 1_555 ? 
27 AC5 7 VAL B 119 ? VAL B 360  . ? 1_555 ? 
28 AC5 7 ASN B 122 ? ASN B 363  . ? 1_555 ? 
29 AC5 7 LEU B 123 ? LEU B 364  . ? 1_555 ? 
30 AC5 7 HOH H .   ? HOH B 2038 . ? 1_555 ? 
31 AC5 7 HOH H .   ? HOH B 2039 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2VZI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2VZI 
_atom_sites.fract_transf_matrix[1][1]   0.013259 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010571 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.023714 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 1   ? 8.813  -12.912 -19.264 1.00 43.37 ? 1    ALA A N   1 
ATOM   2    C CA  . ALA A 1 1   ? 8.881  -12.805 -17.776 1.00 43.00 ? 1    ALA A CA  1 
ATOM   3    C C   . ALA A 1 1   ? 10.057 -13.595 -17.180 1.00 42.67 ? 1    ALA A C   1 
ATOM   4    O O   . ALA A 1 1   ? 11.064 -12.993 -16.788 1.00 42.59 ? 1    ALA A O   1 
ATOM   5    C CB  . ALA A 1 1   ? 7.550  -13.231 -17.139 1.00 43.07 ? 1    ALA A CB  1 
ATOM   6    N N   . THR A 1 2   ? 9.927  -14.927 -17.122 1.00 42.08 ? 2    THR A N   1 
ATOM   7    C CA  . THR A 1 2   ? 10.950 -15.792 -16.506 1.00 41.64 ? 2    THR A CA  1 
ATOM   8    C C   . THR A 1 2   ? 12.290 -15.830 -17.264 1.00 40.99 ? 2    THR A C   1 
ATOM   9    O O   . THR A 1 2   ? 13.335 -15.529 -16.676 1.00 41.02 ? 2    THR A O   1 
ATOM   10   C CB  . THR A 1 2   ? 10.407 -17.215 -16.199 1.00 41.79 ? 2    THR A CB  1 
ATOM   11   O OG1 . THR A 1 2   ? 9.570  -17.153 -15.036 1.00 42.09 ? 2    THR A OG1 1 
ATOM   12   C CG2 . THR A 1 2   ? 11.537 -18.196 -15.914 1.00 42.46 ? 2    THR A CG2 1 
ATOM   13   N N   . ARG A 1 3   ? 12.250 -16.168 -18.556 1.00 40.02 ? 3    ARG A N   1 
ATOM   14   C CA  . ARG A 1 3   ? 13.450 -16.177 -19.410 1.00 38.92 ? 3    ARG A CA  1 
ATOM   15   C C   . ARG A 1 3   ? 14.201 -14.849 -19.440 1.00 38.10 ? 3    ARG A C   1 
ATOM   16   O O   . ARG A 1 3   ? 15.432 -14.828 -19.505 1.00 37.90 ? 3    ARG A O   1 
ATOM   17   C CB  . ARG A 1 3   ? 13.100 -16.569 -20.847 1.00 39.09 ? 3    ARG A CB  1 
ATOM   18   C CG  . ARG A 1 3   ? 13.269 -18.040 -21.158 1.00 39.60 ? 3    ARG A CG  1 
ATOM   19   C CD  . ARG A 1 3   ? 13.915 -18.221 -22.522 1.00 41.23 ? 3    ARG A CD  1 
ATOM   20   N NE  . ARG A 1 3   ? 15.319 -17.816 -22.484 1.00 42.04 ? 3    ARG A NE  1 
ATOM   21   C CZ  . ARG A 1 3   ? 16.230 -18.143 -23.397 1.00 44.26 ? 3    ARG A CZ  1 
ATOM   22   N NH1 . ARG A 1 3   ? 15.894 -18.882 -24.451 1.00 45.17 ? 3    ARG A NH1 1 
ATOM   23   N NH2 . ARG A 1 3   ? 17.487 -17.727 -23.257 1.00 45.08 ? 3    ARG A NH2 1 
ATOM   24   N N   . GLU A 1 4   ? 13.453 -13.748 -19.410 1.00 36.92 ? 4    GLU A N   1 
ATOM   25   C CA  . GLU A 1 4   ? 14.025 -12.408 -19.508 1.00 36.02 ? 4    GLU A CA  1 
ATOM   26   C C   . GLU A 1 4   ? 14.879 -12.072 -18.281 1.00 35.01 ? 4    GLU A C   1 
ATOM   27   O O   . GLU A 1 4   ? 15.948 -11.452 -18.398 1.00 34.20 ? 4    GLU A O   1 
ATOM   28   C CB  . GLU A 1 4   ? 12.898 -11.389 -19.691 1.00 36.28 ? 4    GLU A CB  1 
ATOM   29   C CG  . GLU A 1 4   ? 13.306 -10.052 -20.285 1.00 36.40 ? 4    GLU A CG  1 
ATOM   30   C CD  . GLU A 1 4   ? 12.102 -9.141  -20.528 1.00 36.36 ? 4    GLU A CD  1 
ATOM   31   O OE1 . GLU A 1 4   ? 10.946 -9.603  -20.364 1.00 36.42 ? 4    GLU A OE1 1 
ATOM   32   O OE2 . GLU A 1 4   ? 12.315 -7.964  -20.879 1.00 36.50 ? 4    GLU A OE2 1 
ATOM   33   N N   . LEU A 1 5   ? 14.405 -12.488 -17.107 1.00 34.25 ? 5    LEU A N   1 
ATOM   34   C CA  . LEU A 1 5   ? 15.183 -12.335 -15.877 1.00 33.49 ? 5    LEU A CA  1 
ATOM   35   C C   . LEU A 1 5   ? 16.488 -13.133 -15.958 1.00 32.69 ? 5    LEU A C   1 
ATOM   36   O O   . LEU A 1 5   ? 17.557 -12.605 -15.652 1.00 32.18 ? 5    LEU A O   1 
ATOM   37   C CB  . LEU A 1 5   ? 14.369 -12.735 -14.636 1.00 33.32 ? 5    LEU A CB  1 
ATOM   38   C CG  . LEU A 1 5   ? 15.155 -12.834 -13.321 1.00 33.12 ? 5    LEU A CG  1 
ATOM   39   C CD1 . LEU A 1 5   ? 15.834 -11.513 -12.958 1.00 32.47 ? 5    LEU A CD1 1 
ATOM   40   C CD2 . LEU A 1 5   ? 14.271 -13.310 -12.179 1.00 33.79 ? 5    LEU A CD2 1 
ATOM   41   N N   . ASP A 1 6   ? 16.382 -14.395 -16.371 1.00 32.28 ? 6    ASP A N   1 
ATOM   42   C CA  . ASP A 1 6   ? 17.543 -15.276 -16.521 1.00 32.37 ? 6    ASP A CA  1 
ATOM   43   C C   . ASP A 1 6   ? 18.566 -14.736 -17.510 1.00 32.57 ? 6    ASP A C   1 
ATOM   44   O O   . ASP A 1 6   ? 19.768 -14.789 -17.250 1.00 32.79 ? 6    ASP A O   1 
ATOM   45   C CB  . ASP A 1 6   ? 17.104 -16.675 -16.943 1.00 32.23 ? 6    ASP A CB  1 
ATOM   46   C CG  . ASP A 1 6   ? 16.373 -17.405 -15.847 1.00 32.02 ? 6    ASP A CG  1 
ATOM   47   O OD1 . ASP A 1 6   ? 16.878 -17.447 -14.702 1.00 31.46 ? 6    ASP A OD1 1 
ATOM   48   O OD2 . ASP A 1 6   ? 15.291 -17.946 -16.134 1.00 33.46 ? 6    ASP A OD2 1 
ATOM   49   N N   . GLU A 1 7   ? 18.083 -14.209 -18.635 1.00 32.67 ? 7    GLU A N   1 
ATOM   50   C CA  . GLU A 1 7   ? 18.944 -13.605 -19.649 1.00 32.87 ? 7    GLU A CA  1 
ATOM   51   C C   . GLU A 1 7   ? 19.649 -12.362 -19.114 1.00 32.78 ? 7    GLU A C   1 
ATOM   52   O O   . GLU A 1 7   ? 20.865 -12.211 -19.277 1.00 32.78 ? 7    GLU A O   1 
ATOM   53   C CB  . GLU A 1 7   ? 18.145 -13.286 -20.917 1.00 32.91 ? 7    GLU A CB  1 
ATOM   54   C CG  . GLU A 1 7   ? 17.887 -14.513 -21.788 1.00 33.79 ? 7    GLU A CG  1 
ATOM   55   C CD  . GLU A 1 7   ? 19.125 -14.965 -22.554 1.00 34.72 ? 7    GLU A CD  1 
ATOM   56   O OE1 . GLU A 1 7   ? 19.749 -14.109 -23.226 1.00 35.06 ? 7    GLU A OE1 1 
ATOM   57   O OE2 . GLU A 1 7   ? 19.465 -16.172 -22.493 1.00 34.66 ? 7    GLU A OE2 1 
ATOM   58   N N   . LEU A 1 8   ? 18.887 -11.490 -18.458 1.00 32.76 ? 8    LEU A N   1 
ATOM   59   C CA  . LEU A 1 8   ? 19.437 -10.269 -17.878 1.00 32.89 ? 8    LEU A CA  1 
ATOM   60   C C   . LEU A 1 8   ? 20.573 -10.571 -16.896 1.00 32.87 ? 8    LEU A C   1 
ATOM   61   O O   . LEU A 1 8   ? 21.684 -10.064 -17.060 1.00 32.85 ? 8    LEU A O   1 
ATOM   62   C CB  . LEU A 1 8   ? 18.339 -9.434  -17.210 1.00 32.79 ? 8    LEU A CB  1 
ATOM   63   C CG  . LEU A 1 8   ? 18.800 -8.230  -16.382 1.00 32.89 ? 8    LEU A CG  1 
ATOM   64   C CD1 . LEU A 1 8   ? 19.348 -7.120  -17.263 1.00 32.79 ? 8    LEU A CD1 1 
ATOM   65   C CD2 . LEU A 1 8   ? 17.669 -7.724  -15.518 1.00 33.40 ? 8    LEU A CD2 1 
ATOM   66   N N   . MET A 1 9   ? 20.286 -11.415 -15.904 1.00 32.85 ? 9    MET A N   1 
ATOM   67   C CA  . MET A 1 9   ? 21.250 -11.800 -14.866 1.00 32.61 ? 9    MET A CA  1 
ATOM   68   C C   . MET A 1 9   ? 22.524 -12.408 -15.434 1.00 32.67 ? 9    MET A C   1 
ATOM   69   O O   . MET A 1 9   ? 23.619 -12.171 -14.916 1.00 32.81 ? 9    MET A O   1 
ATOM   70   C CB  . MET A 1 9   ? 20.605 -12.773 -13.877 1.00 32.44 ? 9    MET A CB  1 
ATOM   71   C CG  . MET A 1 9   ? 19.480 -12.158 -13.056 1.00 32.12 ? 9    MET A CG  1 
ATOM   72   S SD  . MET A 1 9   ? 19.889 -10.542 -12.359 1.00 31.14 ? 9    MET A SD  1 
ATOM   73   C CE  . MET A 1 9   ? 21.189 -10.994 -11.223 1.00 28.45 ? 9    MET A CE  1 
ATOM   74   N N   . ALA A 1 10  ? 22.368 -13.189 -16.500 1.00 32.56 ? 10   ALA A N   1 
ATOM   75   C CA  . ALA A 1 10  ? 23.491 -13.797 -17.206 1.00 32.51 ? 10   ALA A CA  1 
ATOM   76   C C   . ALA A 1 10  ? 24.355 -12.761 -17.938 1.00 32.46 ? 10   ALA A C   1 
ATOM   77   O O   . ALA A 1 10  ? 25.589 -12.850 -17.920 1.00 32.52 ? 10   ALA A O   1 
ATOM   78   C CB  . ALA A 1 10  ? 22.986 -14.860 -18.175 1.00 32.44 ? 10   ALA A CB  1 
ATOM   79   N N   . SER A 1 11  ? 23.711 -11.782 -18.571 1.00 32.21 ? 11   SER A N   1 
ATOM   80   C CA  . SER A 1 11  ? 24.430 -10.746 -19.310 1.00 32.32 ? 11   SER A CA  1 
ATOM   81   C C   . SER A 1 11  ? 25.131 -9.741  -18.385 1.00 32.39 ? 11   SER A C   1 
ATOM   82   O O   . SER A 1 11  ? 26.104 -9.094  -18.793 1.00 32.30 ? 11   SER A O   1 
ATOM   83   C CB  . SER A 1 11  ? 23.505 -10.027 -20.301 1.00 32.21 ? 11   SER A CB  1 
ATOM   84   O OG  . SER A 1 11  ? 22.555 -9.216  -19.631 1.00 32.36 ? 11   SER A OG  1 
ATOM   85   N N   . LEU A 1 12  ? 24.635 -9.612  -17.151 1.00 32.26 ? 12   LEU A N   1 
ATOM   86   C CA  . LEU A 1 12  ? 25.250 -8.734  -16.147 1.00 32.27 ? 12   LEU A CA  1 
ATOM   87   C C   . LEU A 1 12  ? 26.425 -9.412  -15.439 1.00 32.46 ? 12   LEU A C   1 
ATOM   88   O O   . LEU A 1 12  ? 27.229 -8.748  -14.775 1.00 32.44 ? 12   LEU A O   1 
ATOM   89   C CB  . LEU A 1 12  ? 24.215 -8.267  -15.118 1.00 32.20 ? 12   LEU A CB  1 
ATOM   90   C CG  . LEU A 1 12  ? 23.009 -7.450  -15.596 1.00 32.05 ? 12   LEU A CG  1 
ATOM   91   C CD1 . LEU A 1 12  ? 21.958 -7.449  -14.515 1.00 31.92 ? 12   LEU A CD1 1 
ATOM   92   C CD2 . LEU A 1 12  ? 23.379 -6.022  -16.001 1.00 31.65 ? 12   LEU A CD2 1 
ATOM   93   N N   . SER A 1 13  ? 26.515 -10.733 -15.593 1.00 32.67 ? 13   SER A N   1 
ATOM   94   C CA  . SER A 1 13  ? 27.577 -11.535 -14.985 1.00 32.78 ? 13   SER A CA  1 
ATOM   95   C C   . SER A 1 13  ? 28.777 -11.693 -15.919 1.00 32.78 ? 13   SER A C   1 
ATOM   96   O O   . SER A 1 13  ? 29.178 -10.753 -16.609 1.00 32.83 ? 13   SER A O   1 
ATOM   97   C CB  . SER A 1 13  ? 27.039 -12.914 -14.584 1.00 32.83 ? 13   SER A CB  1 
ATOM   98   O OG  . SER A 1 13  ? 25.889 -12.805 -13.758 1.00 32.97 ? 13   SER A OG  1 
ATOM   99   N N   . ARG B 2 6   ? 31.306 -7.922  -5.303  1.00 42.25 ? 247  ARG B N   1 
ATOM   100  C CA  . ARG B 2 6   ? 30.486 -7.287  -6.376  1.00 42.13 ? 247  ARG B CA  1 
ATOM   101  C C   . ARG B 2 6   ? 29.899 -8.340  -7.311  1.00 41.58 ? 247  ARG B C   1 
ATOM   102  O O   . ARG B 2 6   ? 30.583 -8.846  -8.217  1.00 41.79 ? 247  ARG B O   1 
ATOM   103  C CB  . ARG B 2 6   ? 31.310 -6.265  -7.180  1.00 42.49 ? 247  ARG B CB  1 
ATOM   104  C CG  . ARG B 2 6   ? 31.797 -5.048  -6.389  1.00 44.14 ? 247  ARG B CG  1 
ATOM   105  C CD  . ARG B 2 6   ? 30.642 -4.203  -5.841  1.00 46.14 ? 247  ARG B CD  1 
ATOM   106  N NE  . ARG B 2 6   ? 31.134 -2.980  -5.207  1.00 47.90 ? 247  ARG B NE  1 
ATOM   107  C CZ  . ARG B 2 6   ? 30.375 -2.080  -4.584  1.00 48.23 ? 247  ARG B CZ  1 
ATOM   108  N NH1 . ARG B 2 6   ? 30.944 -1.003  -4.050  1.00 48.29 ? 247  ARG B NH1 1 
ATOM   109  N NH2 . ARG B 2 6   ? 29.057 -2.245  -4.493  1.00 47.50 ? 247  ARG B NH2 1 
ATOM   110  N N   . ASP B 2 7   ? 28.630 -8.663  -7.088  1.00 40.53 ? 248  ASP B N   1 
ATOM   111  C CA  . ASP B 2 7   ? 27.922 -9.613  -7.940  1.00 39.76 ? 248  ASP B CA  1 
ATOM   112  C C   . ASP B 2 7   ? 27.117 -8.893  -9.036  1.00 38.84 ? 248  ASP B C   1 
ATOM   113  O O   . ASP B 2 7   ? 27.287 -7.686  -9.256  1.00 38.63 ? 248  ASP B O   1 
ATOM   114  C CB  . ASP B 2 7   ? 27.033 -10.545 -7.090  1.00 39.92 ? 248  ASP B CB  1 
ATOM   115  C CG  . ASP B 2 7   ? 25.991 -9.792  -6.263  1.00 40.70 ? 248  ASP B CG  1 
ATOM   116  O OD1 . ASP B 2 7   ? 25.893 -8.555  -6.386  1.00 40.59 ? 248  ASP B OD1 1 
ATOM   117  O OD2 . ASP B 2 7   ? 25.260 -10.446 -5.483  1.00 42.72 ? 248  ASP B OD2 1 
ATOM   118  N N   . ALA B 2 8   ? 26.241 -9.638  -9.707  1.00 37.72 ? 249  ALA B N   1 
ATOM   119  C CA  . ALA B 2 8   ? 25.410 -9.096  -10.777 1.00 36.87 ? 249  ALA B CA  1 
ATOM   120  C C   . ALA B 2 8   ? 24.371 -8.079  -10.280 1.00 36.21 ? 249  ALA B C   1 
ATOM   121  O O   . ALA B 2 8   ? 23.930 -7.215  -11.044 1.00 36.29 ? 249  ALA B O   1 
ATOM   122  C CB  . ALA B 2 8   ? 24.740 -10.222 -11.552 1.00 36.66 ? 249  ALA B CB  1 
ATOM   123  N N   . PHE B 2 9   ? 23.984 -8.180  -9.010  1.00 35.12 ? 250  PHE B N   1 
ATOM   124  C CA  . PHE B 2 9   ? 23.069 -7.206  -8.419  1.00 34.32 ? 250  PHE B CA  1 
ATOM   125  C C   . PHE B 2 9   ? 23.702 -5.826  -8.241  1.00 33.91 ? 250  PHE B C   1 
ATOM   126  O O   . PHE B 2 9   ? 23.029 -4.809  -8.417  1.00 33.97 ? 250  PHE B O   1 
ATOM   127  C CB  . PHE B 2 9   ? 22.422 -7.748  -7.137  1.00 34.09 ? 250  PHE B CB  1 
ATOM   128  C CG  . PHE B 2 9   ? 21.397 -8.820  -7.405  1.00 33.42 ? 250  PHE B CG  1 
ATOM   129  C CD1 . PHE B 2 9   ? 20.146 -8.490  -7.916  1.00 32.67 ? 250  PHE B CD1 1 
ATOM   130  C CD2 . PHE B 2 9   ? 21.699 -10.160 -7.203  1.00 32.73 ? 250  PHE B CD2 1 
ATOM   131  C CE1 . PHE B 2 9   ? 19.208 -9.478  -8.195  1.00 32.02 ? 250  PHE B CE1 1 
ATOM   132  C CE2 . PHE B 2 9   ? 20.763 -11.149 -7.476  1.00 32.06 ? 250  PHE B CE2 1 
ATOM   133  C CZ  . PHE B 2 9   ? 19.523 -10.808 -7.976  1.00 32.18 ? 250  PHE B CZ  1 
ATOM   134  N N   . ASP B 2 10  ? 24.999 -5.793  -7.939  1.00 33.36 ? 251  ASP B N   1 
ATOM   135  C CA  . ASP B 2 10  ? 25.750 -4.541  -7.920  1.00 33.05 ? 251  ASP B CA  1 
ATOM   136  C C   . ASP B 2 10  ? 25.865 -3.975  -9.330  1.00 32.57 ? 251  ASP B C   1 
ATOM   137  O O   . ASP B 2 10  ? 25.725 -2.771  -9.519  1.00 32.55 ? 251  ASP B O   1 
ATOM   138  C CB  . ASP B 2 10  ? 27.140 -4.731  -7.307  1.00 33.33 ? 251  ASP B CB  1 
ATOM   139  C CG  . ASP B 2 10  ? 27.086 -5.091  -5.828  1.00 34.10 ? 251  ASP B CG  1 
ATOM   140  O OD1 . ASP B 2 10  ? 26.492 -4.327  -5.034  1.00 35.03 ? 251  ASP B OD1 1 
ATOM   141  O OD2 . ASP B 2 10  ? 27.647 -6.142  -5.462  1.00 35.66 ? 251  ASP B OD2 1 
ATOM   142  N N   . THR B 2 11  ? 26.107 -4.845  -10.312 1.00 31.95 ? 252  THR B N   1 
ATOM   143  C CA  . THR B 2 11  ? 26.137 -4.436  -11.724 1.00 31.41 ? 252  THR B CA  1 
ATOM   144  C C   . THR B 2 11  ? 24.777 -3.885  -12.156 1.00 31.10 ? 252  THR B C   1 
ATOM   145  O O   . THR B 2 11  ? 24.717 -2.879  -12.857 1.00 31.03 ? 252  THR B O   1 
ATOM   146  C CB  . THR B 2 11  ? 26.551 -5.594  -12.668 1.00 31.31 ? 252  THR B CB  1 
ATOM   147  O OG1 . THR B 2 11  ? 27.770 -6.184  -12.204 1.00 31.01 ? 252  THR B OG1 1 
ATOM   148  C CG2 . THR B 2 11  ? 26.752 -5.085  -14.100 1.00 31.17 ? 252  THR B CG2 1 
ATOM   149  N N   A LEU B 2 12  ? 23.700 -4.550  -11.740 0.54 30.92 ? 253  LEU B N   1 
ATOM   150  N N   B LEU B 2 12  ? 23.709 -4.558  -11.725 0.46 30.97 ? 253  LEU B N   1 
ATOM   151  C CA  A LEU B 2 12  ? 22.344 -4.124  -12.077 0.54 30.79 ? 253  LEU B CA  1 
ATOM   152  C CA  B LEU B 2 12  ? 22.333 -4.170  -12.023 0.46 30.88 ? 253  LEU B CA  1 
ATOM   153  C C   A LEU B 2 12  ? 22.039 -2.715  -11.574 0.54 30.69 ? 253  LEU B C   1 
ATOM   154  C C   B LEU B 2 12  ? 22.044 -2.740  -11.570 0.46 30.74 ? 253  LEU B C   1 
ATOM   155  O O   A LEU B 2 12  ? 21.606 -1.870  -12.344 0.54 30.74 ? 253  LEU B O   1 
ATOM   156  O O   B LEU B 2 12  ? 21.634 -1.908  -12.368 0.46 30.79 ? 253  LEU B O   1 
ATOM   157  C CB  A LEU B 2 12  ? 21.307 -5.116  -11.535 0.54 30.95 ? 253  LEU B CB  1 
ATOM   158  C CB  B LEU B 2 12  ? 21.353 -5.130  -11.330 0.46 31.03 ? 253  LEU B CB  1 
ATOM   159  C CG  A LEU B 2 12  ? 19.825 -4.865  -11.851 0.54 30.89 ? 253  LEU B CG  1 
ATOM   160  C CG  B LEU B 2 12  ? 20.069 -5.629  -12.011 0.46 31.22 ? 253  LEU B CG  1 
ATOM   161  C CD1 A LEU B 2 12  ? 19.527 -4.978  -13.347 0.54 29.69 ? 253  LEU B CD1 1 
ATOM   162  C CD1 B LEU B 2 12  ? 19.078 -6.080  -10.950 0.46 31.15 ? 253  LEU B CD1 1 
ATOM   163  C CD2 A LEU B 2 12  ? 18.962 -5.831  -11.061 0.54 30.75 ? 253  LEU B CD2 1 
ATOM   164  C CD2 B LEU B 2 12  ? 19.425 -4.604  -12.944 0.46 30.82 ? 253  LEU B CD2 1 
ATOM   165  N N   . PHE B 2 13  ? 22.272 -2.468  -10.288 1.00 30.71 ? 254  PHE B N   1 
ATOM   166  C CA  . PHE B 2 13  ? 21.962 -1.164  -9.686  1.00 30.36 ? 254  PHE B CA  1 
ATOM   167  C C   . PHE B 2 13  ? 22.864 -0.036  -10.177 1.00 30.44 ? 254  PHE B C   1 
ATOM   168  O O   . PHE B 2 13  ? 22.408 1.095   -10.351 1.00 30.55 ? 254  PHE B O   1 
ATOM   169  C CB  . PHE B 2 13  ? 22.000 -1.254  -8.158  1.00 30.02 ? 254  PHE B CB  1 
ATOM   170  C CG  . PHE B 2 13  ? 20.773 -1.877  -7.553  1.00 29.50 ? 254  PHE B CG  1 
ATOM   171  C CD1 . PHE B 2 13  ? 19.925 -1.126  -6.751  1.00 29.92 ? 254  PHE B CD1 1 
ATOM   172  C CD2 . PHE B 2 13  ? 20.464 -3.215  -7.782  1.00 29.08 ? 254  PHE B CD2 1 
ATOM   173  C CE1 . PHE B 2 13  ? 18.791 -1.701  -6.177  1.00 29.78 ? 254  PHE B CE1 1 
ATOM   174  C CE2 . PHE B 2 13  ? 19.334 -3.801  -7.228  1.00 28.62 ? 254  PHE B CE2 1 
ATOM   175  C CZ  . PHE B 2 13  ? 18.495 -3.046  -6.423  1.00 30.01 ? 254  PHE B CZ  1 
ATOM   176  N N   . ASP B 2 14  ? 24.134 -0.346  -10.415 1.00 30.45 ? 255  ASP B N   1 
ATOM   177  C CA  . ASP B 2 14  ? 25.092 0.660   -10.861 1.00 30.44 ? 255  ASP B CA  1 
ATOM   178  C C   . ASP B 2 14  ? 24.978 0.944   -12.360 1.00 30.42 ? 255  ASP B C   1 
ATOM   179  O O   . ASP B 2 14  ? 25.063 2.103   -12.788 1.00 30.24 ? 255  ASP B O   1 
ATOM   180  C CB  . ASP B 2 14  ? 26.529 0.230   -10.538 1.00 30.60 ? 255  ASP B CB  1 
ATOM   181  C CG  . ASP B 2 14  ? 26.777 0.004   -9.044  1.00 31.80 ? 255  ASP B CG  1 
ATOM   182  O OD1 . ASP B 2 14  ? 25.819 -0.139  -8.244  1.00 33.31 ? 255  ASP B OD1 1 
ATOM   183  O OD2 . ASP B 2 14  ? 27.966 -0.061  -8.673  1.00 33.28 ? 255  ASP B OD2 1 
ATOM   184  N N   . HIS B 2 15  ? 24.791 -0.111  -13.155 1.00 30.30 ? 256  HIS B N   1 
ATOM   185  C CA  . HIS B 2 15  ? 24.966 -0.015  -14.612 1.00 30.33 ? 256  HIS B CA  1 
ATOM   186  C C   . HIS B 2 15  ? 23.711 -0.244  -15.469 1.00 30.01 ? 256  HIS B C   1 
ATOM   187  O O   . HIS B 2 15  ? 23.645 0.237   -16.591 1.00 30.15 ? 256  HIS B O   1 
ATOM   188  C CB  . HIS B 2 15  ? 26.115 -0.923  -15.076 1.00 30.50 ? 256  HIS B CB  1 
ATOM   189  C CG  . HIS B 2 15  ? 27.441 -0.584  -14.464 1.00 30.98 ? 256  HIS B CG  1 
ATOM   190  N ND1 . HIS B 2 15  ? 28.218 0.467   -14.906 1.00 30.96 ? 256  HIS B ND1 1 
ATOM   191  C CD2 . HIS B 2 15  ? 28.128 -1.158  -13.447 1.00 31.24 ? 256  HIS B CD2 1 
ATOM   192  C CE1 . HIS B 2 15  ? 29.326 0.526   -14.189 1.00 31.18 ? 256  HIS B CE1 1 
ATOM   193  N NE2 . HIS B 2 15  ? 29.296 -0.447  -13.296 1.00 32.26 ? 256  HIS B NE2 1 
ATOM   194  N N   . ALA B 2 16  ? 22.728 -0.977  -14.946 1.00 29.81 ? 257  ALA B N   1 
ATOM   195  C CA  . ALA B 2 16  ? 21.484 -1.241  -15.686 1.00 29.31 ? 257  ALA B CA  1 
ATOM   196  C C   . ALA B 2 16  ? 20.216 -1.078  -14.832 1.00 28.79 ? 257  ALA B C   1 
ATOM   197  O O   . ALA B 2 16  ? 19.337 -1.944  -14.874 1.00 28.55 ? 257  ALA B O   1 
ATOM   198  C CB  . ALA B 2 16  ? 21.529 -2.642  -16.308 1.00 29.34 ? 257  ALA B CB  1 
ATOM   199  N N   . PRO B 2 17  ? 20.103 0.038   -14.071 1.00 28.42 ? 258  PRO B N   1 
ATOM   200  C CA  . PRO B 2 17  ? 19.001 0.185   -13.099 1.00 28.14 ? 258  PRO B CA  1 
ATOM   201  C C   . PRO B 2 17  ? 17.611 0.324   -13.733 1.00 27.92 ? 258  PRO B C   1 
ATOM   202  O O   . PRO B 2 17  ? 16.603 0.136   -13.043 1.00 27.67 ? 258  PRO B O   1 
ATOM   203  C CB  . PRO B 2 17  ? 19.372 1.457   -12.334 1.00 28.06 ? 258  PRO B CB  1 
ATOM   204  C CG  . PRO B 2 17  ? 20.230 2.225   -13.267 1.00 28.23 ? 258  PRO B CG  1 
ATOM   205  C CD  . PRO B 2 17  ? 20.974 1.230   -14.090 1.00 28.28 ? 258  PRO B CD  1 
ATOM   206  N N   . ASP B 2 18  ? 17.568 0.633   -15.031 1.00 27.64 ? 259  ASP B N   1 
ATOM   207  C CA  . ASP B 2 18  ? 16.312 0.659   -15.788 1.00 27.76 ? 259  ASP B CA  1 
ATOM   208  C C   . ASP B 2 18  ? 15.747 -0.737  -16.081 1.00 28.14 ? 259  ASP B C   1 
ATOM   209  O O   . ASP B 2 18  ? 14.641 -0.866  -16.601 1.00 28.14 ? 259  ASP B O   1 
ATOM   210  C CB  . ASP B 2 18  ? 16.443 1.487   -17.079 1.00 27.53 ? 259  ASP B CB  1 
ATOM   211  C CG  . ASP B 2 18  ? 17.553 0.998   -18.007 1.00 27.01 ? 259  ASP B CG  1 
ATOM   212  O OD1 . ASP B 2 18  ? 18.536 0.384   -17.555 1.00 26.10 ? 259  ASP B OD1 1 
ATOM   213  O OD2 . ASP B 2 18  ? 17.448 1.270   -19.215 1.00 27.72 ? 259  ASP B OD2 1 
ATOM   214  N N   . LYS B 2 19  ? 16.505 -1.772  -15.724 1.00 28.58 ? 260  LYS B N   1 
ATOM   215  C CA  . LYS B 2 19  ? 16.071 -3.159  -15.887 1.00 29.21 ? 260  LYS B CA  1 
ATOM   216  C C   . LYS B 2 19  ? 15.559 -3.762  -14.578 1.00 29.94 ? 260  LYS B C   1 
ATOM   217  O O   . LYS B 2 19  ? 15.178 -4.937  -14.538 1.00 30.01 ? 260  LYS B O   1 
ATOM   218  C CB  . LYS B 2 19  ? 17.212 -4.019  -16.444 1.00 28.98 ? 260  LYS B CB  1 
ATOM   219  C CG  . LYS B 2 19  ? 17.781 -3.548  -17.781 1.00 28.42 ? 260  LYS B CG  1 
ATOM   220  C CD  . LYS B 2 19  ? 16.784 -3.746  -18.912 1.00 28.34 ? 260  LYS B CD  1 
ATOM   221  C CE  . LYS B 2 19  ? 17.392 -3.370  -20.259 1.00 27.95 ? 260  LYS B CE  1 
ATOM   222  N NZ  . LYS B 2 19  ? 17.432 -1.895  -20.445 1.00 27.53 ? 260  LYS B NZ  1 
ATOM   223  N N   . LEU B 2 20  ? 15.552 -2.963  -13.511 1.00 30.87 ? 261  LEU B N   1 
ATOM   224  C CA  . LEU B 2 20  ? 15.092 -3.439  -12.199 1.00 31.88 ? 261  LEU B CA  1 
ATOM   225  C C   . LEU B 2 20  ? 13.644 -3.908  -12.215 1.00 32.37 ? 261  LEU B C   1 
ATOM   226  O O   . LEU B 2 20  ? 13.303 -4.878  -11.543 1.00 32.62 ? 261  LEU B O   1 
ATOM   227  C CB  . LEU B 2 20  ? 15.297 -2.382  -11.107 1.00 31.97 ? 261  LEU B CB  1 
ATOM   228  C CG  . LEU B 2 20  ? 16.539 -2.570  -10.227 1.00 32.90 ? 261  LEU B CG  1 
ATOM   229  C CD1 . LEU B 2 20  ? 16.786 -1.368  -9.353  1.00 33.96 ? 261  LEU B CD1 1 
ATOM   230  C CD2 . LEU B 2 20  ? 16.403 -3.805  -9.364  1.00 32.22 ? 261  LEU B CD2 1 
ATOM   231  N N   . ASN B 2 21  ? 12.800 -3.232  -12.992 1.00 33.02 ? 262  ASN B N   1 
ATOM   232  C CA  . ASN B 2 21  ? 11.388 -3.590  -13.075 1.00 33.66 ? 262  ASN B CA  1 
ATOM   233  C C   . ASN B 2 21  ? 11.161 -5.007  -13.584 1.00 34.02 ? 262  ASN B C   1 
ATOM   234  O O   . ASN B 2 21  ? 10.247 -5.682  -13.123 1.00 34.84 ? 262  ASN B O   1 
ATOM   235  C CB  . ASN B 2 21  ? 10.605 -2.580  -13.919 1.00 33.93 ? 262  ASN B CB  1 
ATOM   236  C CG  . ASN B 2 21  ? 9.952  -1.485  -13.077 1.00 34.36 ? 262  ASN B CG  1 
ATOM   237  O OD1 . ASN B 2 21  ? 10.108 -1.425  -11.852 1.00 33.63 ? 262  ASN B OD1 1 
ATOM   238  N ND2 . ASN B 2 21  ? 9.213  -0.608  -13.746 1.00 35.36 ? 262  ASN B ND2 1 
ATOM   239  N N   . VAL B 2 22  ? 12.003 -5.454  -14.514 1.00 34.08 ? 263  VAL B N   1 
ATOM   240  C CA  . VAL B 2 22  ? 11.959 -6.832  -15.021 1.00 34.02 ? 263  VAL B CA  1 
ATOM   241  C C   . VAL B 2 22  ? 12.207 -7.836  -13.889 1.00 33.81 ? 263  VAL B C   1 
ATOM   242  O O   . VAL B 2 22  ? 11.499 -8.844  -13.767 1.00 33.73 ? 263  VAL B O   1 
ATOM   243  C CB  . VAL B 2 22  ? 13.008 -7.071  -16.152 1.00 33.93 ? 263  VAL B CB  1 
ATOM   244  C CG1 . VAL B 2 22  ? 12.973 -8.518  -16.636 1.00 34.08 ? 263  VAL B CG1 1 
ATOM   245  C CG2 . VAL B 2 22  ? 12.797 -6.117  -17.307 1.00 33.47 ? 263  VAL B CG2 1 
ATOM   246  N N   . VAL B 2 23  ? 13.225 -7.553  -13.081 1.00 33.49 ? 264  VAL B N   1 
ATOM   247  C CA  . VAL B 2 23  ? 13.583 -8.393  -11.938 1.00 33.44 ? 264  VAL B CA  1 
ATOM   248  C C   . VAL B 2 23  ? 12.463 -8.412  -10.890 1.00 33.25 ? 264  VAL B C   1 
ATOM   249  O O   . VAL B 2 23  ? 12.042 -9.485  -10.446 1.00 33.40 ? 264  VAL B O   1 
ATOM   250  C CB  . VAL B 2 23  ? 14.928 -7.947  -11.296 1.00 33.55 ? 264  VAL B CB  1 
ATOM   251  C CG1 . VAL B 2 23  ? 15.325 -8.883  -10.163 1.00 33.91 ? 264  VAL B CG1 1 
ATOM   252  C CG2 . VAL B 2 23  ? 16.022 -7.906  -12.329 1.00 32.91 ? 264  VAL B CG2 1 
ATOM   253  N N   A LYS B 2 24  ? 11.988 -7.226  -10.515 0.45 33.17 ? 265  LYS B N   1 
ATOM   254  N N   B LYS B 2 24  ? 12.006 -7.219  -10.522 0.23 33.20 ? 265  LYS B N   1 
ATOM   255  N N   C LYS B 2 24  ? 11.955 -7.233  -10.534 0.32 33.25 ? 265  LYS B N   1 
ATOM   256  C CA  A LYS B 2 24  ? 10.904 -7.063  -9.544  0.45 33.31 ? 265  LYS B CA  1 
ATOM   257  C CA  B LYS B 2 24  ? 11.083 -7.022  -9.413  0.23 33.23 ? 265  LYS B CA  1 
ATOM   258  C CA  C LYS B 2 24  ? 10.868 -7.109  -9.559  0.32 33.38 ? 265  LYS B CA  1 
ATOM   259  C C   A LYS B 2 24  ? 9.667  -7.872  -9.929  0.45 33.29 ? 265  LYS B C   1 
ATOM   260  C C   B LYS B 2 24  ? 9.669  -7.510  -9.712  0.23 33.24 ? 265  LYS B C   1 
ATOM   261  C C   C LYS B 2 24  ? 9.557  -7.768  -10.014 0.32 33.43 ? 265  LYS B C   1 
ATOM   262  O O   A LYS B 2 24  ? 9.273  -8.801  -9.223  0.45 33.16 ? 265  LYS B O   1 
ATOM   263  O O   B LYS B 2 24  ? 8.890  -7.739  -8.795  0.23 33.25 ? 265  LYS B O   1 
ATOM   264  O O   C LYS B 2 24  ? 8.923  -8.486  -9.243  0.32 33.47 ? 265  LYS B O   1 
ATOM   265  C CB  A LYS B 2 24  ? 10.530 -5.584  -9.413  0.45 33.26 ? 265  LYS B CB  1 
ATOM   266  C CB  B LYS B 2 24  ? 11.082 -5.549  -8.986  0.23 33.14 ? 265  LYS B CB  1 
ATOM   267  C CB  C LYS B 2 24  ? 10.645 -5.640  -9.173  0.32 33.30 ? 265  LYS B CB  1 
ATOM   268  C CG  A LYS B 2 24  ? 11.587 -4.725  -8.736  0.45 33.56 ? 265  LYS B CG  1 
ATOM   269  C CG  B LYS B 2 24  ? 12.355 -5.132  -8.248  0.23 33.13 ? 265  LYS B CG  1 
ATOM   270  C CG  C LYS B 2 24  ? 11.623 -5.131  -8.114  0.32 33.32 ? 265  LYS B CG  1 
ATOM   271  C CD  A LYS B 2 24  ? 11.476 -3.261  -9.156  0.45 34.15 ? 265  LYS B CD  1 
ATOM   272  C CD  B LYS B 2 24  ? 12.714 -3.665  -8.466  0.23 32.99 ? 265  LYS B CD  1 
ATOM   273  C CD  C LYS B 2 24  ? 11.268 -3.738  -7.593  0.32 33.38 ? 265  LYS B CD  1 
ATOM   274  C CE  A LYS B 2 24  ? 10.405 -2.513  -8.376  0.45 34.43 ? 265  LYS B CE  1 
ATOM   275  C CE  B LYS B 2 24  ? 11.957 -2.738  -7.530  0.23 32.76 ? 265  LYS B CE  1 
ATOM   276  C CE  C LYS B 2 24  ? 12.006 -2.637  -8.346  0.32 33.79 ? 265  LYS B CE  1 
ATOM   277  N NZ  A LYS B 2 24  ? 10.247 -1.120  -8.881  0.45 34.68 ? 265  LYS B NZ  1 
ATOM   278  N NZ  B LYS B 2 24  ? 12.426 -1.325  -7.639  0.23 32.63 ? 265  LYS B NZ  1 
ATOM   279  N NZ  C LYS B 2 24  ? 11.954 -1.328  -7.629  0.32 33.68 ? 265  LYS B NZ  1 
ATOM   280  N N   A LYS B 2 25  ? 9.070  -7.512  -11.062 0.45 33.21 ? 266  LYS B N   1 
ATOM   281  N N   B LYS B 2 25  ? 9.347  -7.687  -10.989 0.23 33.23 ? 266  LYS B N   1 
ATOM   282  N N   C LYS B 2 25  ? 9.172  -7.536  -11.267 0.32 33.40 ? 266  LYS B N   1 
ATOM   283  C CA  A LYS B 2 25  ? 7.900  -8.215  -11.587 0.45 33.17 ? 266  LYS B CA  1 
ATOM   284  C CA  B LYS B 2 25  ? 8.035  -8.205  -11.375 0.23 33.21 ? 266  LYS B CA  1 
ATOM   285  C CA  C LYS B 2 25  ? 7.968  -8.145  -11.856 0.32 33.39 ? 266  LYS B CA  1 
ATOM   286  C C   A LYS B 2 25  ? 8.046  -9.742  -11.555 0.45 33.15 ? 266  LYS B C   1 
ATOM   287  C C   B LYS B 2 25  ? 8.051  -9.728  -11.560 0.23 33.13 ? 266  LYS B C   1 
ATOM   288  C C   C LYS B 2 25  ? 7.991  -9.680  -11.787 0.32 33.26 ? 266  LYS B C   1 
ATOM   289  O O   A LYS B 2 25  ? 7.160  -10.442 -11.046 0.45 33.16 ? 266  LYS B O   1 
ATOM   290  O O   B LYS B 2 25  ? 7.077  -10.408 -11.219 0.23 33.14 ? 266  LYS B O   1 
ATOM   291  O O   C LYS B 2 25  ? 6.985  -10.318 -11.458 0.32 33.28 ? 266  LYS B O   1 
ATOM   292  C CB  A LYS B 2 25  ? 7.591  -7.735  -13.014 0.45 33.12 ? 266  LYS B CB  1 
ATOM   293  C CB  B LYS B 2 25  ? 7.536  -7.513  -12.644 0.23 33.21 ? 266  LYS B CB  1 
ATOM   294  C CB  C LYS B 2 25  ? 7.833  -7.698  -13.320 0.32 33.37 ? 266  LYS B CB  1 
ATOM   295  C CG  A LYS B 2 25  ? 6.517  -8.538  -13.736 0.45 32.91 ? 266  LYS B CG  1 
ATOM   296  C CG  B LYS B 2 25  ? 6.021  -7.354  -12.718 0.23 33.30 ? 266  LYS B CG  1 
ATOM   297  C CG  C LYS B 2 25  ? 6.472  -7.934  -13.966 0.32 33.54 ? 266  LYS B CG  1 
ATOM   298  C CD  A LYS B 2 25  ? 5.740  -7.674  -14.717 0.45 32.12 ? 266  LYS B CD  1 
ATOM   299  C CD  B LYS B 2 25  ? 5.621  -6.320  -13.768 0.23 33.12 ? 266  LYS B CD  1 
ATOM   300  C CD  C LYS B 2 25  ? 6.545  -7.701  -15.472 0.32 33.50 ? 266  LYS B CD  1 
ATOM   301  C CE  A LYS B 2 25  ? 4.397  -8.307  -15.062 0.45 31.87 ? 266  LYS B CE  1 
ATOM   302  C CE  B LYS B 2 25  ? 5.922  -4.899  -13.304 0.23 32.97 ? 266  LYS B CE  1 
ATOM   303  C CE  C LYS B 2 25  ? 5.170  -7.471  -16.087 0.32 33.84 ? 266  LYS B CE  1 
ATOM   304  N NZ  A LYS B 2 25  ? 3.540  -8.506  -13.859 0.45 30.75 ? 266  LYS B NZ  1 
ATOM   305  N NZ  B LYS B 2 25  ? 5.719  -3.903  -14.390 0.23 32.76 ? 266  LYS B NZ  1 
ATOM   306  N NZ  C LYS B 2 25  ? 4.662  -6.087  -15.843 0.32 33.83 ? 266  LYS B NZ  1 
ATOM   307  N N   . THR B 2 26  ? 9.150  -10.249 -12.109 1.00 33.04 ? 267  THR B N   1 
ATOM   308  C CA  . THR B 2 26  ? 9.368  -11.707 -12.216 1.00 32.58 ? 267  THR B CA  1 
ATOM   309  C C   . THR B 2 26  ? 9.435  -12.396 -10.848 1.00 32.09 ? 267  THR B C   1 
ATOM   310  O O   . THR B 2 26  ? 8.871  -13.474 -10.666 1.00 32.17 ? 267  THR B O   1 
ATOM   311  C CB  . THR B 2 26  ? 10.664 -12.020 -13.003 1.00 32.69 ? 267  THR B CB  1 
ATOM   312  O OG1 . THR B 2 26  ? 10.661 -11.306 -14.244 1.00 32.10 ? 267  THR B OG1 1 
ATOM   313  C CG2 . THR B 2 26  ? 10.800 -13.510 -13.272 1.00 33.00 ? 267  THR B CG2 1 
ATOM   314  N N   A LEU B 2 27  ? 10.123 -11.768 -9.902  0.62 31.72 ? 268  LEU B N   1 
ATOM   315  N N   B LEU B 2 27  ? 10.137 -11.769 -9.906  0.38 31.92 ? 268  LEU B N   1 
ATOM   316  C CA  A LEU B 2 27  ? 10.189 -12.282 -8.533  0.62 31.52 ? 268  LEU B CA  1 
ATOM   317  C CA  B LEU B 2 27  ? 10.196 -12.244 -8.520  0.38 31.81 ? 268  LEU B CA  1 
ATOM   318  C C   A LEU B 2 27  ? 8.858  -12.156 -7.788  0.62 31.52 ? 268  LEU B C   1 
ATOM   319  C C   B LEU B 2 27  ? 8.835  -12.184 -7.832  0.38 31.70 ? 268  LEU B C   1 
ATOM   320  O O   A LEU B 2 27  ? 8.548  -12.994 -6.947  0.62 31.67 ? 268  LEU B O   1 
ATOM   321  O O   B LEU B 2 27  ? 8.485  -13.086 -7.072  0.38 31.75 ? 268  LEU B O   1 
ATOM   322  C CB  A LEU B 2 27  ? 11.341 -11.637 -7.755  0.62 31.25 ? 268  LEU B CB  1 
ATOM   323  C CB  B LEU B 2 27  ? 11.238 -11.455 -7.717  0.38 31.72 ? 268  LEU B CB  1 
ATOM   324  C CG  A LEU B 2 27  ? 12.746 -12.007 -8.265  0.62 30.68 ? 268  LEU B CG  1 
ATOM   325  C CG  B LEU B 2 27  ? 12.631 -12.057 -7.467  0.38 31.85 ? 268  LEU B CG  1 
ATOM   326  C CD1 A LEU B 2 27  ? 13.804 -11.062 -7.721  0.62 30.30 ? 268  LEU B CD1 1 
ATOM   327  C CD1 B LEU B 2 27  ? 13.146 -12.922 -8.612  0.38 31.08 ? 268  LEU B CD1 1 
ATOM   328  C CD2 A LEU B 2 27  ? 13.090 -13.452 -7.931  0.62 28.71 ? 268  LEU B CD2 1 
ATOM   329  C CD2 B LEU B 2 27  ? 13.637 -10.958 -7.137  0.38 31.87 ? 268  LEU B CD2 1 
ATOM   330  N N   . ILE B 2 28  ? 8.074  -11.126 -8.113  1.00 31.50 ? 269  ILE B N   1 
ATOM   331  C CA  . ILE B 2 28  ? 6.728  -10.942 -7.538  1.00 31.65 ? 269  ILE B CA  1 
ATOM   332  C C   . ILE B 2 28  ? 5.764  -12.049 -7.994  1.00 31.11 ? 269  ILE B C   1 
ATOM   333  O O   . ILE B 2 28  ? 5.113  -12.684 -7.172  1.00 31.17 ? 269  ILE B O   1 
ATOM   334  C CB  . ILE B 2 28  ? 6.155  -9.506  -7.818  1.00 31.86 ? 269  ILE B CB  1 
ATOM   335  C CG1 . ILE B 2 28  ? 6.522  -8.546  -6.684  1.00 32.62 ? 269  ILE B CG1 1 
ATOM   336  C CG2 . ILE B 2 28  ? 4.630  -9.518  -7.969  1.00 32.55 ? 269  ILE B CG2 1 
ATOM   337  C CD1 . ILE B 2 28  ? 6.603  -7.055  -7.098  1.00 32.32 ? 269  ILE B CD1 1 
ATOM   338  N N   . THR B 2 29  ? 5.696  -12.290 -9.301  1.00 30.45 ? 270  THR B N   1 
ATOM   339  C CA  . THR B 2 29  ? 4.946  -13.421 -9.849  1.00 29.54 ? 270  THR B CA  1 
ATOM   340  C C   . THR B 2 29  ? 5.320  -14.739 -9.163  1.00 29.60 ? 270  THR B C   1 
ATOM   341  O O   . THR B 2 29  ? 4.439  -15.527 -8.788  1.00 29.49 ? 270  THR B O   1 
ATOM   342  C CB  . THR B 2 29  ? 5.175  -13.542 -11.376 1.00 29.37 ? 270  THR B CB  1 
ATOM   343  O OG1 . THR B 2 29  ? 4.751  -12.331 -12.005 1.00 28.73 ? 270  THR B OG1 1 
ATOM   344  C CG2 . THR B 2 29  ? 4.403  -14.708 -11.961 1.00 28.42 ? 270  THR B CG2 1 
ATOM   345  N N   . PHE B 2 30  ? 6.623  -14.965 -9.007  1.00 29.16 ? 271  PHE B N   1 
ATOM   346  C CA  . PHE B 2 30  ? 7.150  -16.181 -8.394  1.00 29.39 ? 271  PHE B CA  1 
ATOM   347  C C   . PHE B 2 30  ? 6.688  -16.351 -6.946  1.00 29.22 ? 271  PHE B C   1 
ATOM   348  O O   . PHE B 2 30  ? 6.140  -17.397 -6.594  1.00 29.36 ? 271  PHE B O   1 
ATOM   349  C CB  . PHE B 2 30  ? 8.698  -16.244 -8.506  1.00 29.47 ? 271  PHE B CB  1 
ATOM   350  C CG  . PHE B 2 30  ? 9.355  -17.188 -7.512  1.00 29.74 ? 271  PHE B CG  1 
ATOM   351  C CD1 . PHE B 2 30  ? 9.260  -18.565 -7.666  1.00 29.88 ? 271  PHE B CD1 1 
ATOM   352  C CD2 . PHE B 2 30  ? 10.066 -16.692 -6.424  1.00 30.33 ? 271  PHE B CD2 1 
ATOM   353  C CE1 . PHE B 2 30  ? 9.845  -19.434 -6.751  1.00 29.42 ? 271  PHE B CE1 1 
ATOM   354  C CE2 . PHE B 2 30  ? 10.662 -17.557 -5.502  1.00 30.85 ? 271  PHE B CE2 1 
ATOM   355  C CZ  . PHE B 2 30  ? 10.550 -18.928 -5.668  1.00 30.52 ? 271  PHE B CZ  1 
ATOM   356  N N   . VAL B 2 31  ? 6.919  -15.336 -6.112  1.00 29.04 ? 272  VAL B N   1 
ATOM   357  C CA  . VAL B 2 31  ? 6.549  -15.413 -4.694  1.00 28.71 ? 272  VAL B CA  1 
ATOM   358  C C   . VAL B 2 31  ? 5.043  -15.548 -4.508  1.00 28.17 ? 272  VAL B C   1 
ATOM   359  O O   . VAL B 2 31  ? 4.591  -16.266 -3.615  1.00 28.23 ? 272  VAL B O   1 
ATOM   360  C CB  . VAL B 2 31  ? 7.109  -14.224 -3.826  1.00 28.66 ? 272  VAL B CB  1 
ATOM   361  C CG1 . VAL B 2 31  ? 8.641  -14.184 -3.865  1.00 28.26 ? 272  VAL B CG1 1 
ATOM   362  C CG2 . VAL B 2 31  ? 6.502  -12.883 -4.235  1.00 29.36 ? 272  VAL B CG2 1 
ATOM   363  N N   . ASN B 2 32  ? 4.280  -14.866 -5.358  1.00 27.50 ? 273  ASN B N   1 
ATOM   364  C CA  . ASN B 2 32  ? 2.819  -14.903 -5.299  1.00 27.52 ? 273  ASN B CA  1 
ATOM   365  C C   . ASN B 2 32  ? 2.219  -16.217 -5.746  1.00 27.83 ? 273  ASN B C   1 
ATOM   366  O O   . ASN B 2 32  ? 1.161  -16.607 -5.259  1.00 27.99 ? 273  ASN B O   1 
ATOM   367  C CB  . ASN B 2 32  ? 2.199  -13.738 -6.068  1.00 26.94 ? 273  ASN B CB  1 
ATOM   368  C CG  . ASN B 2 32  ? 2.267  -12.434 -5.288  1.00 26.94 ? 273  ASN B CG  1 
ATOM   369  O OD1 . ASN B 2 32  ? 2.522  -12.439 -4.084  1.00 27.11 ? 273  ASN B OD1 1 
ATOM   370  N ND2 . ASN B 2 32  ? 2.043  -11.318 -5.966  1.00 25.69 ? 273  ASN B ND2 1 
ATOM   371  N N   . LYS B 2 33  ? 2.905  -16.896 -6.667  1.00 28.00 ? 274  LYS B N   1 
ATOM   372  C CA  . LYS B 2 33  ? 2.497  -18.214 -7.138  1.00 28.18 ? 274  LYS B CA  1 
ATOM   373  C C   . LYS B 2 33  ? 2.372  -19.145 -5.946  1.00 27.63 ? 274  LYS B C   1 
ATOM   374  O O   . LYS B 2 33  ? 1.486  -19.989 -5.895  1.00 27.80 ? 274  LYS B O   1 
ATOM   375  C CB  . LYS B 2 33  ? 3.543  -18.764 -8.109  1.00 28.42 ? 274  LYS B CB  1 
ATOM   376  C CG  . LYS B 2 33  ? 3.236  -20.139 -8.661  1.00 30.27 ? 274  LYS B CG  1 
ATOM   377  C CD  . LYS B 2 33  ? 4.439  -20.697 -9.419  1.00 32.65 ? 274  LYS B CD  1 
ATOM   378  C CE  . LYS B 2 33  ? 4.161  -22.101 -9.927  1.00 35.30 ? 274  LYS B CE  1 
ATOM   379  N NZ  . LYS B 2 33  ? 5.402  -22.786 -10.420 1.00 37.13 ? 274  LYS B NZ  1 
ATOM   380  N N   . HIS B 2 34  ? 3.277  -18.975 -4.989  1.00 27.10 ? 275  HIS B N   1 
ATOM   381  C CA  . HIS B 2 34  ? 3.303  -19.810 -3.807  1.00 26.55 ? 275  HIS B CA  1 
ATOM   382  C C   . HIS B 2 34  ? 2.525  -19.201 -2.659  1.00 26.22 ? 275  HIS B C   1 
ATOM   383  O O   . HIS B 2 34  ? 1.709  -19.884 -2.053  1.00 26.32 ? 275  HIS B O   1 
ATOM   384  C CB  . HIS B 2 34  ? 4.748  -20.108 -3.425  1.00 26.57 ? 275  HIS B CB  1 
ATOM   385  C CG  . HIS B 2 34  ? 5.523  -20.729 -4.539  1.00 26.54 ? 275  HIS B CG  1 
ATOM   386  N ND1 . HIS B 2 34  ? 5.254  -21.999 -5.004  1.00 26.43 ? 275  HIS B ND1 1 
ATOM   387  C CD2 . HIS B 2 34  ? 6.515  -20.239 -5.321  1.00 25.30 ? 275  HIS B CD2 1 
ATOM   388  C CE1 . HIS B 2 34  ? 6.066  -22.277 -6.009  1.00 24.81 ? 275  HIS B CE1 1 
ATOM   389  N NE2 . HIS B 2 34  ? 6.841  -21.226 -6.220  1.00 25.68 ? 275  HIS B NE2 1 
ATOM   390  N N   . LEU B 2 35  ? 2.745  -17.911 -2.387  1.00 25.81 ? 276  LEU B N   1 
ATOM   391  C CA  . LEU B 2 35  ? 2.073  -17.239 -1.264  1.00 25.54 ? 276  LEU B CA  1 
ATOM   392  C C   . LEU B 2 35  ? 0.550  -17.194 -1.408  1.00 25.80 ? 276  LEU B C   1 
ATOM   393  O O   . LEU B 2 35  ? -0.162 -17.231 -0.396  1.00 25.42 ? 276  LEU B O   1 
ATOM   394  C CB  . LEU B 2 35  ? 2.658  -15.848 -1.005  1.00 25.04 ? 276  LEU B CB  1 
ATOM   395  C CG  . LEU B 2 35  ? 4.070  -15.832 -0.406  1.00 24.54 ? 276  LEU B CG  1 
ATOM   396  C CD1 . LEU B 2 35  ? 4.711  -14.473 -0.587  1.00 23.31 ? 276  LEU B CD1 1 
ATOM   397  C CD2 . LEU B 2 35  ? 4.109  -16.264 1.082   1.00 23.50 ? 276  LEU B CD2 1 
ATOM   398  N N   . ASN B 2 36  ? 0.059  -17.159 -2.655  1.00 25.79 ? 277  ASN B N   1 
ATOM   399  C CA  . ASN B 2 36  ? -1.382 -17.161 -2.926  1.00 26.62 ? 277  ASN B CA  1 
ATOM   400  C C   . ASN B 2 36  ? -2.088 -18.430 -2.435  1.00 26.68 ? 277  ASN B C   1 
ATOM   401  O O   . ASN B 2 36  ? -3.291 -18.418 -2.224  1.00 26.89 ? 277  ASN B O   1 
ATOM   402  C CB  . ASN B 2 36  ? -1.693 -16.912 -4.426  1.00 26.73 ? 277  ASN B CB  1 
ATOM   403  C CG  . ASN B 2 36  ? -1.452 -15.443 -4.864  1.00 27.62 ? 277  ASN B CG  1 
ATOM   404  O OD1 . ASN B 2 36  ? -1.066 -14.577 -4.058  1.00 27.87 ? 277  ASN B OD1 1 
ATOM   405  N ND2 . ASN B 2 36  ? -1.676 -15.172 -6.149  1.00 24.29 ? 277  ASN B ND2 1 
ATOM   406  N N   . LYS B 2 37  ? -1.341 -19.513 -2.249  1.00 27.40 ? 278  LYS B N   1 
ATOM   407  C CA  . LYS B 2 37  ? -1.896 -20.754 -1.700  1.00 28.50 ? 278  LYS B CA  1 
ATOM   408  C C   . LYS B 2 37  ? -2.321 -20.614 -0.234  1.00 28.65 ? 278  LYS B C   1 
ATOM   409  O O   . LYS B 2 37  ? -3.155 -21.377 0.261   1.00 28.62 ? 278  LYS B O   1 
ATOM   410  C CB  . LYS B 2 37  ? -0.883 -21.890 -1.816  1.00 28.87 ? 278  LYS B CB  1 
ATOM   411  C CG  . LYS B 2 37  ? -0.718 -22.454 -3.214  1.00 30.56 ? 278  LYS B CG  1 
ATOM   412  C CD  . LYS B 2 37  ? 0.570  -23.244 -3.295  1.00 32.85 ? 278  LYS B CD  1 
ATOM   413  C CE  . LYS B 2 37  ? 0.866  -23.684 -4.718  1.00 33.94 ? 278  LYS B CE  1 
ATOM   414  N NZ  . LYS B 2 37  ? 2.087  -24.526 -4.718  1.00 33.99 ? 278  LYS B NZ  1 
ATOM   415  N N   A LEU B 2 38  ? -1.734 -19.648 0.462   0.90 28.88 ? 279  LEU B N   1 
ATOM   416  N N   B LEU B 2 38  ? -1.720 -19.642 0.446   0.10 28.73 ? 279  LEU B N   1 
ATOM   417  C CA  A LEU B 2 38  ? -2.049 -19.403 1.867   0.90 28.58 ? 279  LEU B CA  1 
ATOM   418  C CA  B LEU B 2 38  ? -1.990 -19.367 1.850   0.10 28.77 ? 279  LEU B CA  1 
ATOM   419  C C   A LEU B 2 38  ? -2.924 -18.160 2.024   0.90 28.72 ? 279  LEU B C   1 
ATOM   420  C C   B LEU B 2 38  ? -2.809 -18.081 2.001   0.10 28.83 ? 279  LEU B C   1 
ATOM   421  O O   A LEU B 2 38  ? -3.136 -17.688 3.140   0.90 28.91 ? 279  LEU B O   1 
ATOM   422  O O   B LEU B 2 38  ? -2.869 -17.503 3.089   0.10 28.85 ? 279  LEU B O   1 
ATOM   423  C CB  A LEU B 2 38  ? -0.758 -19.234 2.677   0.90 28.27 ? 279  LEU B CB  1 
ATOM   424  C CB  B LEU B 2 38  ? -0.671 -19.254 2.631   0.10 28.75 ? 279  LEU B CB  1 
ATOM   425  C CG  A LEU B 2 38  ? 0.359  -20.271 2.586   0.90 27.98 ? 279  LEU B CG  1 
ATOM   426  C CG  B LEU B 2 38  ? 0.193  -20.494 2.900   0.10 28.78 ? 279  LEU B CG  1 
ATOM   427  C CD1 A LEU B 2 38  ? 1.540  -19.820 3.431   0.90 27.01 ? 279  LEU B CD1 1 
ATOM   428  C CD1 B LEU B 2 38  ? 0.914  -20.992 1.651   0.10 28.79 ? 279  LEU B CD1 1 
ATOM   429  C CD2 A LEU B 2 38  ? -0.128 -21.647 3.020   0.90 27.05 ? 279  LEU B CD2 1 
ATOM   430  C CD2 B LEU B 2 38  ? 1.207  -20.189 3.990   0.10 28.78 ? 279  LEU B CD2 1 
ATOM   431  N N   . ASN B 2 39  ? -3.437 -17.650 0.902   1.00 28.87 ? 280  ASN B N   1 
ATOM   432  C CA  . ASN B 2 39  ? -4.230 -16.394 0.852   1.00 29.03 ? 280  ASN B CA  1 
ATOM   433  C C   . ASN B 2 39  ? -3.392 -15.146 1.144   1.00 29.41 ? 280  ASN B C   1 
ATOM   434  O O   . ASN B 2 39  ? -3.894 -14.145 1.661   1.00 29.76 ? 280  ASN B O   1 
ATOM   435  C CB  . ASN B 2 39  ? -5.461 -16.435 1.775   1.00 28.86 ? 280  ASN B CB  1 
ATOM   436  C CG  . ASN B 2 39  ? -6.404 -17.563 1.448   1.00 27.54 ? 280  ASN B CG  1 
ATOM   437  O OD1 . ASN B 2 39  ? -6.647 -17.863 0.288   1.00 27.57 ? 280  ASN B OD1 1 
ATOM   438  N ND2 . ASN B 2 39  ? -6.965 -18.179 2.478   1.00 25.87 ? 280  ASN B ND2 1 
ATOM   439  N N   . LEU B 2 40  ? -2.111 -15.219 0.808   1.00 30.00 ? 281  LEU B N   1 
ATOM   440  C CA  . LEU B 2 40  ? -1.181 -14.129 1.064   1.00 30.44 ? 281  LEU B CA  1 
ATOM   441  C C   . LEU B 2 40  ? -0.749 -13.508 -0.247  1.00 31.43 ? 281  LEU B C   1 
ATOM   442  O O   . LEU B 2 40  ? -0.688 -14.192 -1.277  1.00 31.35 ? 281  LEU B O   1 
ATOM   443  C CB  . LEU B 2 40  ? 0.033  -14.634 1.834   1.00 29.94 ? 281  LEU B CB  1 
ATOM   444  C CG  . LEU B 2 40  ? -0.237 -15.300 3.190   1.00 29.81 ? 281  LEU B CG  1 
ATOM   445  C CD1 . LEU B 2 40  ? 1.048  -15.916 3.721   1.00 29.69 ? 281  LEU B CD1 1 
ATOM   446  C CD2 . LEU B 2 40  ? -0.837 -14.330 4.196   1.00 28.07 ? 281  LEU B CD2 1 
ATOM   447  N N   . GLU B 2 41  ? -0.466 -12.209 -0.218  1.00 32.37 ? 282  GLU B N   1 
ATOM   448  C CA  . GLU B 2 41  ? -0.051 -11.520 -1.431  1.00 33.13 ? 282  GLU B CA  1 
ATOM   449  C C   . GLU B 2 41  ? 1.040  -10.476 -1.199  1.00 33.41 ? 282  GLU B C   1 
ATOM   450  O O   . GLU B 2 41  ? 1.094  -9.826  -0.152  1.00 33.62 ? 282  GLU B O   1 
ATOM   451  C CB  . GLU B 2 41  ? -1.256 -10.892 -2.119  1.00 33.25 ? 282  GLU B CB  1 
ATOM   452  C CG  . GLU B 2 41  ? -1.040 -10.681 -3.594  1.00 34.22 ? 282  GLU B CG  1 
ATOM   453  C CD  . GLU B 2 41  ? -1.984 -9.671  -4.179  0.50 33.96 ? 282  GLU B CD  1 
ATOM   454  O OE1 . GLU B 2 41  ? -2.908 -9.236  -3.460  0.50 33.82 ? 282  GLU B OE1 1 
ATOM   455  O OE2 . GLU B 2 41  ? -1.792 -9.317  -5.362  0.50 34.02 ? 282  GLU B OE2 1 
ATOM   456  N N   . VAL B 2 42  ? 1.905  -10.332 -2.195  1.00 33.84 ? 283  VAL B N   1 
ATOM   457  C CA  . VAL B 2 42  ? 2.967  -9.335  -2.187  1.00 34.13 ? 283  VAL B CA  1 
ATOM   458  C C   . VAL B 2 42  ? 2.759  -8.375  -3.370  1.00 34.48 ? 283  VAL B C   1 
ATOM   459  O O   . VAL B 2 42  ? 2.616  -8.802  -4.518  1.00 34.08 ? 283  VAL B O   1 
ATOM   460  C CB  . VAL B 2 42  ? 4.361  -10.021 -2.216  1.00 33.82 ? 283  VAL B CB  1 
ATOM   461  C CG1 . VAL B 2 42  ? 5.482  -9.023  -2.499  1.00 34.14 ? 283  VAL B CG1 1 
ATOM   462  C CG2 . VAL B 2 42  ? 4.620  -10.731 -0.902  1.00 34.77 ? 283  VAL B CG2 1 
ATOM   463  N N   . THR B 2 43  ? 2.708  -7.078  -3.081  1.00 35.08 ? 284  THR B N   1 
ATOM   464  C CA  . THR B 2 43  ? 2.635  -6.076  -4.147  1.00 35.85 ? 284  THR B CA  1 
ATOM   465  C C   . THR B 2 43  ? 3.919  -5.258  -4.239  1.00 36.26 ? 284  THR B C   1 
ATOM   466  O O   . THR B 2 43  ? 4.115  -4.502  -5.191  1.00 36.79 ? 284  THR B O   1 
ATOM   467  C CB  . THR B 2 43  ? 1.416  -5.145  -3.986  1.00 35.85 ? 284  THR B CB  1 
ATOM   468  O OG1 . THR B 2 43  ? 1.434  -4.547  -2.683  1.00 36.10 ? 284  THR B OG1 1 
ATOM   469  C CG2 . THR B 2 43  ? 0.113  -5.930  -4.180  1.00 35.08 ? 284  THR B CG2 1 
ATOM   470  N N   . GLU B 2 44  ? 4.803  -5.448  -3.262  1.00 36.48 ? 285  GLU B N   1 
ATOM   471  C CA  . GLU B 2 44  ? 5.941  -4.567  -3.045  1.00 36.39 ? 285  GLU B CA  1 
ATOM   472  C C   . GLU B 2 44  ? 7.067  -5.323  -2.343  1.00 35.97 ? 285  GLU B C   1 
ATOM   473  O O   . GLU B 2 44  ? 6.977  -5.602  -1.149  1.00 35.36 ? 285  GLU B O   1 
ATOM   474  C CB  . GLU B 2 44  ? 5.483  -3.433  -2.146  1.00 36.73 ? 285  GLU B CB  1 
ATOM   475  C CG  . GLU B 2 44  ? 5.985  -2.066  -2.491  1.00 37.88 ? 285  GLU B CG  1 
ATOM   476  C CD  . GLU B 2 44  ? 5.265  -1.017  -1.682  1.00 39.59 ? 285  GLU B CD  1 
ATOM   477  O OE1 . GLU B 2 44  ? 4.919  -1.310  -0.516  1.00 41.37 ? 285  GLU B OE1 1 
ATOM   478  O OE2 . GLU B 2 44  ? 5.036  0.092   -2.205  1.00 41.31 ? 285  GLU B OE2 1 
ATOM   479  N N   . LEU B 2 45  ? 8.127  -5.637  -3.088  1.00 35.63 ? 286  LEU B N   1 
ATOM   480  C CA  . LEU B 2 45  ? 9.277  -6.373  -2.556  1.00 35.11 ? 286  LEU B CA  1 
ATOM   481  C C   . LEU B 2 45  ? 10.121 -5.523  -1.630  1.00 34.81 ? 286  LEU B C   1 
ATOM   482  O O   . LEU B 2 45  ? 10.896 -6.055  -0.834  1.00 34.45 ? 286  LEU B O   1 
ATOM   483  C CB  . LEU B 2 45  ? 10.176 -6.897  -3.692  1.00 35.28 ? 286  LEU B CB  1 
ATOM   484  C CG  . LEU B 2 45  ? 9.642  -7.818  -4.787  1.00 35.03 ? 286  LEU B CG  1 
ATOM   485  C CD1 . LEU B 2 45  ? 10.722 -8.034  -5.823  1.00 34.71 ? 286  LEU B CD1 1 
ATOM   486  C CD2 . LEU B 2 45  ? 9.188  -9.150  -4.216  1.00 34.90 ? 286  LEU B CD2 1 
ATOM   487  N N   . GLU B 2 46  ? 9.981  -4.206  -1.755  1.00 34.83 ? 287  GLU B N   1 
ATOM   488  C CA  . GLU B 2 46  ? 10.793 -3.256  -1.004  1.00 34.91 ? 287  GLU B CA  1 
ATOM   489  C C   . GLU B 2 46  ? 10.537 -3.287  0.503   1.00 34.67 ? 287  GLU B C   1 
ATOM   490  O O   . GLU B 2 46  ? 11.461 -3.066  1.294   1.00 34.41 ? 287  GLU B O   1 
ATOM   491  C CB  . GLU B 2 46  ? 10.597 -1.838  -1.533  1.00 35.28 ? 287  GLU B CB  1 
ATOM   492  C CG  . GLU B 2 46  ? 11.185 -1.607  -2.936  1.00 36.78 ? 287  GLU B CG  1 
ATOM   493  C CD  . GLU B 2 46  ? 10.187 -1.845  -4.061  1.00 38.90 ? 287  GLU B CD  1 
ATOM   494  O OE1 . GLU B 2 46  ? 9.150  -2.503  -3.838  1.00 40.06 ? 287  GLU B OE1 1 
ATOM   495  O OE2 . GLU B 2 46  ? 10.431 -1.354  -5.183  1.00 41.52 ? 287  GLU B OE2 1 
ATOM   496  N N   . THR B 2 47  ? 9.289  -3.563  0.888   1.00 34.18 ? 288  THR B N   1 
ATOM   497  C CA  . THR B 2 47  ? 8.888  -3.484  2.285   1.00 33.58 ? 288  THR B CA  1 
ATOM   498  C C   . THR B 2 47  ? 8.355  -4.795  2.836   1.00 33.21 ? 288  THR B C   1 
ATOM   499  O O   . THR B 2 47  ? 8.558  -5.090  4.016   1.00 32.74 ? 288  THR B O   1 
ATOM   500  C CB  . THR B 2 47  ? 7.835  -2.359  2.541   1.00 33.85 ? 288  THR B CB  1 
ATOM   501  O OG1 . THR B 2 47  ? 6.710  -2.528  1.669   1.00 33.85 ? 288  THR B OG1 1 
ATOM   502  C CG2 . THR B 2 47  ? 8.433  -0.987  2.318   1.00 33.40 ? 288  THR B CG2 1 
ATOM   503  N N   . GLN B 2 48  ? 7.700  -5.591  1.986   1.00 32.54 ? 289  GLN B N   1 
ATOM   504  C CA  . GLN B 2 48  ? 6.843  -6.674  2.475   1.00 32.08 ? 289  GLN B CA  1 
ATOM   505  C C   . GLN B 2 48  ? 7.542  -7.968  2.891   1.00 31.76 ? 289  GLN B C   1 
ATOM   506  O O   . GLN B 2 48  ? 6.876  -8.914  3.305   1.00 32.18 ? 289  GLN B O   1 
ATOM   507  C CB  . GLN B 2 48  ? 5.682  -6.940  1.513   1.00 32.25 ? 289  GLN B CB  1 
ATOM   508  C CG  . GLN B 2 48  ? 4.605  -5.857  1.542   1.00 31.51 ? 289  GLN B CG  1 
ATOM   509  C CD  . GLN B 2 48  ? 3.538  -6.073  0.482   1.00 33.25 ? 289  GLN B CD  1 
ATOM   510  O OE1 . GLN B 2 48  ? 3.836  -6.410  -0.662  1.00 34.26 ? 289  GLN B OE1 1 
ATOM   511  N NE2 . GLN B 2 48  ? 2.283  -5.876  0.859   1.00 36.14 ? 289  GLN B NE2 1 
ATOM   512  N N   . PHE B 2 49  ? 8.871  -8.000  2.800   1.00 30.74 ? 290  PHE B N   1 
ATOM   513  C CA  . PHE B 2 49  ? 9.648  -9.135  3.281   1.00 30.43 ? 290  PHE B CA  1 
ATOM   514  C C   . PHE B 2 49  ? 10.492 -8.790  4.528   1.00 29.92 ? 290  PHE B C   1 
ATOM   515  O O   . PHE B 2 49  ? 11.108 -9.664  5.114   1.00 29.51 ? 290  PHE B O   1 
ATOM   516  C CB  . PHE B 2 49  ? 10.527 -9.733  2.160   1.00 30.53 ? 290  PHE B CB  1 
ATOM   517  C CG  . PHE B 2 49  ? 9.750  -10.545 1.136   1.00 30.89 ? 290  PHE B CG  1 
ATOM   518  C CD1 . PHE B 2 49  ? 9.320  -11.835 1.435   1.00 30.05 ? 290  PHE B CD1 1 
ATOM   519  C CD2 . PHE B 2 49  ? 9.436  -10.010 -0.110  1.00 31.02 ? 290  PHE B CD2 1 
ATOM   520  C CE1 . PHE B 2 49  ? 8.594  -12.581 0.524   1.00 30.26 ? 290  PHE B CE1 1 
ATOM   521  C CE2 . PHE B 2 49  ? 8.712  -10.758 -1.043  1.00 31.14 ? 290  PHE B CE2 1 
ATOM   522  C CZ  . PHE B 2 49  ? 8.292  -12.046 -0.725  1.00 31.04 ? 290  PHE B CZ  1 
ATOM   523  N N   . ALA B 2 50  ? 10.496 -7.516  4.916   1.00 29.44 ? 291  ALA B N   1 
ATOM   524  C CA  . ALA B 2 50  ? 11.347 -7.023  5.999   1.00 30.00 ? 291  ALA B CA  1 
ATOM   525  C C   . ALA B 2 50  ? 11.070 -7.632  7.383   1.00 30.15 ? 291  ALA B C   1 
ATOM   526  O O   . ALA B 2 50  ? 11.996 -7.788  8.170   1.00 30.14 ? 291  ALA B O   1 
ATOM   527  C CB  . ALA B 2 50  ? 11.306 -5.498  6.074   1.00 29.42 ? 291  ALA B CB  1 
ATOM   528  N N   . ASP B 2 51  ? 9.813  -7.978  7.672   1.00 30.24 ? 292  ASP B N   1 
ATOM   529  C CA  . ASP B 2 51  ? 9.466  -8.541  8.988   1.00 30.17 ? 292  ASP B CA  1 
ATOM   530  C C   . ASP B 2 51  ? 9.720  -10.058 9.106   1.00 29.95 ? 292  ASP B C   1 
ATOM   531  O O   . ASP B 2 51  ? 9.507  -10.652 10.163  1.00 30.41 ? 292  ASP B O   1 
ATOM   532  C CB  . ASP B 2 51  ? 8.041  -8.111  9.437   1.00 29.96 ? 292  ASP B CB  1 
ATOM   533  C CG  . ASP B 2 51  ? 6.903  -8.816  8.665   1.00 30.48 ? 292  ASP B CG  1 
ATOM   534  O OD1 . ASP B 2 51  ? 7.147  -9.751  7.864   1.00 28.47 ? 292  ASP B OD1 1 
ATOM   535  O OD2 . ASP B 2 51  ? 5.733  -8.425  8.886   1.00 30.79 ? 292  ASP B OD2 1 
ATOM   536  N N   . GLY B 2 52  ? 10.185 -10.674 8.021   1.00 29.47 ? 293  GLY B N   1 
ATOM   537  C CA  . GLY B 2 52  ? 10.540 -12.089 8.006   1.00 28.93 ? 293  GLY B CA  1 
ATOM   538  C C   . GLY B 2 52  ? 9.403  -13.093 7.918   1.00 28.92 ? 293  GLY B C   1 
ATOM   539  O O   . GLY B 2 52  ? 9.647  -14.260 7.672   1.00 29.05 ? 293  GLY B O   1 
ATOM   540  N N   . VAL B 2 53  ? 8.163  -12.652 8.113   1.00 29.20 ? 294  VAL B N   1 
ATOM   541  C CA  . VAL B 2 53  ? 7.003  -13.558 8.102   1.00 29.07 ? 294  VAL B CA  1 
ATOM   542  C C   . VAL B 2 53  ? 6.843  -14.266 6.747   1.00 29.22 ? 294  VAL B C   1 
ATOM   543  O O   . VAL B 2 53  ? 6.851  -15.481 6.702   1.00 29.06 ? 294  VAL B O   1 
ATOM   544  C CB  . VAL B 2 53  ? 5.682  -12.858 8.575   1.00 29.35 ? 294  VAL B CB  1 
ATOM   545  C CG1 . VAL B 2 53  ? 4.472  -13.798 8.468   1.00 28.85 ? 294  VAL B CG1 1 
ATOM   546  C CG2 . VAL B 2 53  ? 5.813  -12.335 10.028  1.00 27.86 ? 294  VAL B CG2 1 
ATOM   547  N N   . TYR B 2 54  ? 6.750  -13.515 5.646   1.00 29.81 ? 295  TYR B N   1 
ATOM   548  C CA  . TYR B 2 54  ? 6.529  -14.139 4.333   1.00 29.94 ? 295  TYR B CA  1 
ATOM   549  C C   . TYR B 2 54  ? 7.677  -15.037 3.876   1.00 30.25 ? 295  TYR B C   1 
ATOM   550  O O   . TYR B 2 54  ? 7.448  -16.027 3.182   1.00 30.27 ? 295  TYR B O   1 
ATOM   551  C CB  . TYR B 2 54  ? 6.172  -13.112 3.248   1.00 30.02 ? 295  TYR B CB  1 
ATOM   552  C CG  . TYR B 2 54  ? 4.791  -12.503 3.393   1.00 30.85 ? 295  TYR B CG  1 
ATOM   553  C CD1 . TYR B 2 54  ? 3.835  -13.048 4.258   1.00 31.15 ? 295  TYR B CD1 1 
ATOM   554  C CD2 . TYR B 2 54  ? 4.432  -11.390 2.647   1.00 32.52 ? 295  TYR B CD2 1 
ATOM   555  C CE1 . TYR B 2 54  ? 2.566  -12.465 4.389   1.00 32.46 ? 295  TYR B CE1 1 
ATOM   556  C CE2 . TYR B 2 54  ? 3.167  -10.812 2.756   1.00 30.86 ? 295  TYR B CE2 1 
ATOM   557  C CZ  . TYR B 2 54  ? 2.248  -11.343 3.627   1.00 31.26 ? 295  TYR B CZ  1 
ATOM   558  O OH  . TYR B 2 54  ? 1.006  -10.750 3.717   1.00 31.39 ? 295  TYR B OH  1 
ATOM   559  N N   A LEU B 2 55  ? 8.893  -14.688 4.292   0.51 30.24 ? 296  LEU B N   1 
ATOM   560  N N   B LEU B 2 55  ? 8.907  -14.671 4.238   0.49 30.04 ? 296  LEU B N   1 
ATOM   561  C CA  A LEU B 2 55  ? 10.100 -15.432 3.945   0.51 30.17 ? 296  LEU B CA  1 
ATOM   562  C CA  B LEU B 2 55  ? 10.071 -15.490 3.904   0.49 29.76 ? 296  LEU B CA  1 
ATOM   563  C C   A LEU B 2 55  ? 10.118 -16.803 4.624   0.51 29.92 ? 296  LEU B C   1 
ATOM   564  C C   B LEU B 2 55  ? 9.952  -16.851 4.576   0.49 29.68 ? 296  LEU B C   1 
ATOM   565  O O   A LEU B 2 55  ? 10.521 -17.793 4.015   0.51 30.32 ? 296  LEU B O   1 
ATOM   566  O O   B LEU B 2 55  ? 10.079 -17.884 3.913   0.49 29.96 ? 296  LEU B O   1 
ATOM   567  C CB  A LEU B 2 55  ? 11.341 -14.606 4.314   0.51 29.96 ? 296  LEU B CB  1 
ATOM   568  C CB  B LEU B 2 55  ? 11.387 -14.792 4.283   0.49 29.45 ? 296  LEU B CB  1 
ATOM   569  C CG  A LEU B 2 55  ? 12.559 -14.564 3.386   0.51 30.48 ? 296  LEU B CG  1 
ATOM   570  C CG  B LEU B 2 55  ? 11.860 -13.605 3.435   0.49 29.16 ? 296  LEU B CG  1 
ATOM   571  C CD1 A LEU B 2 55  ? 12.166 -14.365 1.919   0.51 29.97 ? 296  LEU B CD1 1 
ATOM   572  C CD1 B LEU B 2 55  ? 13.053 -12.894 4.090   0.49 28.73 ? 296  LEU B CD1 1 
ATOM   573  C CD2 A LEU B 2 55  ? 13.525 -13.458 3.834   0.51 30.34 ? 296  LEU B CD2 1 
ATOM   574  C CD2 B LEU B 2 55  ? 12.220 -14.035 2.012   0.49 28.81 ? 296  LEU B CD2 1 
ATOM   575  N N   . VAL B 2 56  ? 9.672  -16.851 5.879   1.00 29.62 ? 297  VAL B N   1 
ATOM   576  C CA  . VAL B 2 56  ? 9.484  -18.104 6.620   1.00 29.16 ? 297  VAL B CA  1 
ATOM   577  C C   . VAL B 2 56  ? 8.400  -19.001 6.002   1.00 29.07 ? 297  VAL B C   1 
ATOM   578  O O   . VAL B 2 56  ? 8.617  -20.195 5.785   1.00 29.23 ? 297  VAL B O   1 
ATOM   579  C CB  . VAL B 2 56  ? 9.163  -17.864 8.121   1.00 29.00 ? 297  VAL B CB  1 
ATOM   580  C CG1 . VAL B 2 56  ? 8.857  -19.179 8.801   1.00 29.22 ? 297  VAL B CG1 1 
ATOM   581  C CG2 . VAL B 2 56  ? 10.322 -17.161 8.831   1.00 29.09 ? 297  VAL B CG2 1 
ATOM   582  N N   . LEU B 2 57  ? 7.240  -18.422 5.720   1.00 29.16 ? 298  LEU B N   1 
ATOM   583  C CA  . LEU B 2 57  ? 6.123  -19.171 5.148   1.00 29.29 ? 298  LEU B CA  1 
ATOM   584  C C   . LEU B 2 57  ? 6.433  -19.709 3.754   1.00 29.65 ? 298  LEU B C   1 
ATOM   585  O O   . LEU B 2 57  ? 6.016  -20.811 3.403   1.00 29.40 ? 298  LEU B O   1 
ATOM   586  C CB  . LEU B 2 57  ? 4.858  -18.302 5.123   1.00 29.07 ? 298  LEU B CB  1 
ATOM   587  C CG  . LEU B 2 57  ? 4.362  -17.795 6.490   1.00 28.73 ? 298  LEU B CG  1 
ATOM   588  C CD1 . LEU B 2 57  ? 3.257  -16.737 6.315   1.00 27.44 ? 298  LEU B CD1 1 
ATOM   589  C CD2 . LEU B 2 57  ? 3.898  -18.964 7.360   1.00 26.04 ? 298  LEU B CD2 1 
ATOM   590  N N   . LEU B 2 58  ? 7.176  -18.926 2.982   1.00 30.10 ? 299  LEU B N   1 
ATOM   591  C CA  . LEU B 2 58  ? 7.590  -19.297 1.628   1.00 31.32 ? 299  LEU B CA  1 
ATOM   592  C C   . LEU B 2 58  ? 8.500  -20.517 1.634   1.00 31.40 ? 299  LEU B C   1 
ATOM   593  O O   . LEU B 2 58  ? 8.425  -21.358 0.740   1.00 32.04 ? 299  LEU B O   1 
ATOM   594  C CB  . LEU B 2 58  ? 8.288  -18.109 0.946   1.00 30.92 ? 299  LEU B CB  1 
ATOM   595  C CG  . LEU B 2 58  ? 8.618  -18.111 -0.547  1.00 32.26 ? 299  LEU B CG  1 
ATOM   596  C CD1 . LEU B 2 58  ? 7.384  -18.390 -1.431  1.00 31.94 ? 299  LEU B CD1 1 
ATOM   597  C CD2 . LEU B 2 58  ? 9.244  -16.756 -0.887  1.00 31.76 ? 299  LEU B CD2 1 
ATOM   598  N N   . MET B 2 59  ? 9.358  -20.618 2.644   1.00 31.85 ? 300  MET B N   1 
ATOM   599  C CA  . MET B 2 59  ? 10.223 -21.787 2.778   1.00 31.78 ? 300  MET B CA  1 
ATOM   600  C C   . MET B 2 59  ? 9.406  -23.060 3.047   1.00 31.43 ? 300  MET B C   1 
ATOM   601  O O   . MET B 2 59  ? 9.700  -24.120 2.483   1.00 30.81 ? 300  MET B O   1 
ATOM   602  C CB  . MET B 2 59  ? 11.286 -21.572 3.855   1.00 31.69 ? 300  MET B CB  1 
ATOM   603  C CG  . MET B 2 59  ? 12.355 -20.556 3.483   1.00 32.71 ? 300  MET B CG  1 
ATOM   604  S SD  . MET B 2 59  ? 13.032 -20.821 1.830   1.00 35.63 ? 300  MET B SD  1 
ATOM   605  C CE  . MET B 2 59  ? 13.641 -22.488 1.940   1.00 30.72 ? 300  MET B CE  1 
ATOM   606  N N   . GLY B 2 60  ? 8.391  -22.943 3.907   1.00 31.26 ? 301  GLY B N   1 
ATOM   607  C CA  . GLY B 2 60  ? 7.432  -24.033 4.126   1.00 31.55 ? 301  GLY B CA  1 
ATOM   608  C C   . GLY B 2 60  ? 6.754  -24.449 2.829   1.00 31.86 ? 301  GLY B C   1 
ATOM   609  O O   . GLY B 2 60  ? 6.596  -25.640 2.548   1.00 31.97 ? 301  GLY B O   1 
ATOM   610  N N   A LEU B 2 61  ? 6.370  -23.452 2.036   0.50 31.88 ? 302  LEU B N   1 
ATOM   611  N N   B LEU B 2 61  ? 6.366  -23.451 2.041   0.50 31.98 ? 302  LEU B N   1 
ATOM   612  C CA  A LEU B 2 61  ? 5.721  -23.655 0.745   0.50 32.02 ? 302  LEU B CA  1 
ATOM   613  C CA  B LEU B 2 61  ? 5.735  -23.647 0.741   0.50 32.22 ? 302  LEU B CA  1 
ATOM   614  C C   A LEU B 2 61  ? 6.625  -24.305 -0.318  0.50 32.29 ? 302  LEU B C   1 
ATOM   615  C C   B LEU B 2 61  ? 6.637  -24.331 -0.294  0.50 32.41 ? 302  LEU B C   1 
ATOM   616  O O   A LEU B 2 61  ? 6.164  -25.119 -1.110  0.50 32.35 ? 302  LEU B O   1 
ATOM   617  O O   B LEU B 2 61  ? 6.187  -25.195 -1.039  0.50 32.47 ? 302  LEU B O   1 
ATOM   618  C CB  A LEU B 2 61  ? 5.175  -22.321 0.217   0.50 31.79 ? 302  LEU B CB  1 
ATOM   619  C CB  B LEU B 2 61  ? 5.254  -22.297 0.196   0.50 32.10 ? 302  LEU B CB  1 
ATOM   620  C CG  A LEU B 2 61  ? 3.873  -21.761 0.793   0.50 30.52 ? 302  LEU B CG  1 
ATOM   621  C CG  B LEU B 2 61  ? 3.783  -21.893 0.332   0.50 31.36 ? 302  LEU B CG  1 
ATOM   622  C CD1 A LEU B 2 61  ? 3.842  -20.252 0.625   0.50 29.89 ? 302  LEU B CD1 1 
ATOM   623  C CD1 B LEU B 2 61  ? 3.061  -22.678 1.413   0.50 31.61 ? 302  LEU B CD1 1 
ATOM   624  C CD2 A LEU B 2 61  ? 2.648  -22.401 0.144   0.50 29.88 ? 302  LEU B CD2 1 
ATOM   625  C CD2 B LEU B 2 61  ? 3.683  -20.397 0.572   0.50 30.83 ? 302  LEU B CD2 1 
ATOM   626  N N   . LEU B 2 62  ? 7.901  -23.923 -0.335  1.00 32.80 ? 303  LEU B N   1 
ATOM   627  C CA  . LEU B 2 62  ? 8.848  -24.382 -1.347  1.00 32.71 ? 303  LEU B CA  1 
ATOM   628  C C   . LEU B 2 62  ? 9.456  -25.754 -1.037  1.00 33.07 ? 303  LEU B C   1 
ATOM   629  O O   . LEU B 2 62  ? 9.624  -26.593 -1.933  1.00 32.68 ? 303  LEU B O   1 
ATOM   630  C CB  . LEU B 2 62  ? 9.938  -23.324 -1.547  1.00 32.82 ? 303  LEU B CB  1 
ATOM   631  C CG  . LEU B 2 62  ? 9.497  -21.963 -2.118  1.00 32.32 ? 303  LEU B CG  1 
ATOM   632  C CD1 . LEU B 2 62  ? 10.657 -20.955 -2.145  1.00 30.19 ? 303  LEU B CD1 1 
ATOM   633  C CD2 . LEU B 2 62  ? 8.856  -22.096 -3.499  1.00 30.09 ? 303  LEU B CD2 1 
ATOM   634  N N   . GLU B 2 63  ? 9.772  -25.982 0.233   1.00 33.51 ? 304  GLU B N   1 
ATOM   635  C CA  . GLU B 2 63  ? 10.280 -27.281 0.677   1.00 33.83 ? 304  GLU B CA  1 
ATOM   636  C C   . GLU B 2 63  ? 9.158  -28.260 1.022   1.00 34.01 ? 304  GLU B C   1 
ATOM   637  O O   . GLU B 2 63  ? 9.409  -29.453 1.206   1.00 34.24 ? 304  GLU B O   1 
ATOM   638  C CB  . GLU B 2 63  ? 11.235 -27.116 1.862   1.00 33.56 ? 304  GLU B CB  1 
ATOM   639  C CG  . GLU B 2 63  ? 12.646 -26.719 1.492   1.00 34.16 ? 304  GLU B CG  1 
ATOM   640  C CD  . GLU B 2 63  ? 13.443 -27.838 0.819   1.00 36.61 ? 304  GLU B CD  1 
ATOM   641  O OE1 . GLU B 2 63  ? 13.396 -29.002 1.290   1.00 37.84 ? 304  GLU B OE1 1 
ATOM   642  O OE2 . GLU B 2 63  ? 14.134 -27.549 -0.187  1.00 37.67 ? 304  GLU B OE2 1 
ATOM   643  N N   . GLY B 2 64  ? 7.927  -27.758 1.114   1.00 34.29 ? 305  GLY B N   1 
ATOM   644  C CA  . GLY B 2 64  ? 6.757  -28.608 1.343   1.00 34.99 ? 305  GLY B CA  1 
ATOM   645  C C   . GLY B 2 64  ? 6.581  -29.125 2.761   1.00 35.47 ? 305  GLY B C   1 
ATOM   646  O O   . GLY B 2 64  ? 6.440  -30.319 2.969   1.00 35.66 ? 305  GLY B O   1 
ATOM   647  N N   . TYR B 2 65  ? 6.603  -28.222 3.738   1.00 36.18 ? 306  TYR B N   1 
ATOM   648  C CA  . TYR B 2 65  ? 6.269  -28.554 5.131   1.00 36.39 ? 306  TYR B CA  1 
ATOM   649  C C   . TYR B 2 65  ? 5.495  -27.416 5.792   1.00 36.44 ? 306  TYR B C   1 
ATOM   650  O O   . TYR B 2 65  ? 5.609  -26.254 5.389   1.00 35.91 ? 306  TYR B O   1 
ATOM   651  C CB  . TYR B 2 65  ? 7.522  -28.909 5.959   1.00 36.55 ? 306  TYR B CB  1 
ATOM   652  C CG  . TYR B 2 65  ? 8.681  -27.932 5.839   1.00 36.60 ? 306  TYR B CG  1 
ATOM   653  C CD1 . TYR B 2 65  ? 9.818  -28.266 5.101   1.00 36.68 ? 306  TYR B CD1 1 
ATOM   654  C CD2 . TYR B 2 65  ? 8.650  -26.689 6.472   1.00 36.92 ? 306  TYR B CD2 1 
ATOM   655  C CE1 . TYR B 2 65  ? 10.893 -27.389 4.983   1.00 37.09 ? 306  TYR B CE1 1 
ATOM   656  C CE2 . TYR B 2 65  ? 9.731  -25.787 6.355   1.00 38.19 ? 306  TYR B CE2 1 
ATOM   657  C CZ  . TYR B 2 65  ? 10.846 -26.148 5.601   1.00 37.36 ? 306  TYR B CZ  1 
ATOM   658  O OH  . TYR B 2 65  ? 11.915 -25.285 5.468   1.00 37.18 ? 306  TYR B OH  1 
ATOM   659  N N   . PHE B 2 66  ? 4.699  -27.758 6.801   1.00 36.72 ? 307  PHE B N   1 
ATOM   660  C CA  . PHE B 2 66  ? 3.993  -26.752 7.596   1.00 36.92 ? 307  PHE B CA  1 
ATOM   661  C C   . PHE B 2 66  ? 4.936  -26.224 8.670   1.00 36.39 ? 307  PHE B C   1 
ATOM   662  O O   . PHE B 2 66  ? 5.462  -26.999 9.466   1.00 36.47 ? 307  PHE B O   1 
ATOM   663  C CB  . PHE B 2 66  ? 2.730  -27.348 8.238   1.00 37.60 ? 307  PHE B CB  1 
ATOM   664  C CG  . PHE B 2 66  ? 1.814  -28.052 7.259   1.00 39.05 ? 307  PHE B CG  1 
ATOM   665  C CD1 . PHE B 2 66  ? 0.913  -27.325 6.474   1.00 40.31 ? 307  PHE B CD1 1 
ATOM   666  C CD2 . PHE B 2 66  ? 1.846  -29.443 7.128   1.00 39.90 ? 307  PHE B CD2 1 
ATOM   667  C CE1 . PHE B 2 66  ? 0.064  -27.974 5.574   1.00 40.41 ? 307  PHE B CE1 1 
ATOM   668  C CE2 . PHE B 2 66  ? 1.008  -30.096 6.233   1.00 40.58 ? 307  PHE B CE2 1 
ATOM   669  C CZ  . PHE B 2 66  ? 0.112  -29.360 5.456   1.00 40.47 ? 307  PHE B CZ  1 
ATOM   670  N N   . VAL B 2 67  ? 5.167  -24.912 8.685   1.00 35.90 ? 308  VAL B N   1 
ATOM   671  C CA  . VAL B 2 67  ? 6.023  -24.302 9.711   1.00 35.30 ? 308  VAL B CA  1 
ATOM   672  C C   . VAL B 2 67  ? 5.200  -24.029 10.980  1.00 34.91 ? 308  VAL B C   1 
ATOM   673  O O   . VAL B 2 67  ? 4.249  -23.230 10.953  1.00 35.02 ? 308  VAL B O   1 
ATOM   674  C CB  . VAL B 2 67  ? 6.741  -22.998 9.222   1.00 35.12 ? 308  VAL B CB  1 
ATOM   675  C CG1 . VAL B 2 67  ? 7.832  -22.582 10.203  1.00 35.25 ? 308  VAL B CG1 1 
ATOM   676  C CG2 . VAL B 2 67  ? 7.354  -23.196 7.856   1.00 34.93 ? 308  VAL B CG2 1 
ATOM   677  N N   . PRO B 2 68  ? 5.559  -24.691 12.098  1.00 34.30 ? 309  PRO B N   1 
ATOM   678  C CA  . PRO B 2 68  ? 4.832  -24.441 13.339  1.00 33.73 ? 309  PRO B CA  1 
ATOM   679  C C   . PRO B 2 68  ? 4.991  -22.989 13.783  1.00 32.91 ? 309  PRO B C   1 
ATOM   680  O O   . PRO B 2 68  ? 6.070  -22.411 13.660  1.00 32.80 ? 309  PRO B O   1 
ATOM   681  C CB  . PRO B 2 68  ? 5.478  -25.406 14.337  1.00 33.86 ? 309  PRO B CB  1 
ATOM   682  C CG  . PRO B 2 68  ? 6.791  -25.753 13.768  1.00 34.34 ? 309  PRO B CG  1 
ATOM   683  C CD  . PRO B 2 68  ? 6.642  -25.673 12.279  1.00 34.57 ? 309  PRO B CD  1 
ATOM   684  N N   . LEU B 2 69  ? 3.910  -22.399 14.277  1.00 32.22 ? 310  LEU B N   1 
ATOM   685  C CA  . LEU B 2 69  ? 3.919  -20.982 14.597  1.00 31.42 ? 310  LEU B CA  1 
ATOM   686  C C   . LEU B 2 69  ? 4.772  -20.631 15.813  1.00 31.16 ? 310  LEU B C   1 
ATOM   687  O O   . LEU B 2 69  ? 5.255  -19.498 15.921  1.00 30.84 ? 310  LEU B O   1 
ATOM   688  C CB  . LEU B 2 69  ? 2.496  -20.437 14.734  1.00 31.45 ? 310  LEU B CB  1 
ATOM   689  C CG  . LEU B 2 69  ? 1.660  -20.333 13.454  1.00 31.01 ? 310  LEU B CG  1 
ATOM   690  C CD1 . LEU B 2 69  ? 0.371  -19.588 13.740  1.00 30.38 ? 310  LEU B CD1 1 
ATOM   691  C CD2 . LEU B 2 69  ? 2.422  -19.661 12.327  1.00 29.83 ? 310  LEU B CD2 1 
ATOM   692  N N   A HIS B 2 70  ? 4.960  -21.595 16.713  0.56 31.01 ? 311  HIS B N   1 
ATOM   693  N N   B HIS B 2 70  ? 4.956  -21.605 16.706  0.44 30.90 ? 311  HIS B N   1 
ATOM   694  C CA  A HIS B 2 70  ? 5.807  -21.408 17.892  0.56 30.91 ? 311  HIS B CA  1 
ATOM   695  C CA  B HIS B 2 70  ? 5.770  -21.438 17.910  0.44 30.70 ? 311  HIS B CA  1 
ATOM   696  C C   A HIS B 2 70  ? 7.290  -21.274 17.532  0.56 30.74 ? 311  HIS B C   1 
ATOM   697  C C   B HIS B 2 70  ? 7.259  -21.323 17.588  0.44 30.61 ? 311  HIS B C   1 
ATOM   698  O O   A HIS B 2 70  ? 8.090  -20.801 18.341  0.56 30.76 ? 311  HIS B O   1 
ATOM   699  O O   B HIS B 2 70  ? 8.064  -20.967 18.447  0.44 30.61 ? 311  HIS B O   1 
ATOM   700  C CB  A HIS B 2 70  ? 5.600  -22.549 18.896  0.56 30.90 ? 311  HIS B CB  1 
ATOM   701  C CB  B HIS B 2 70  ? 5.518  -22.580 18.910  0.44 30.59 ? 311  HIS B CB  1 
ATOM   702  C CG  A HIS B 2 70  ? 6.353  -22.371 20.180  0.56 30.88 ? 311  HIS B CG  1 
ATOM   703  C CG  B HIS B 2 70  ? 5.965  -23.929 18.432  0.44 30.14 ? 311  HIS B CG  1 
ATOM   704  N ND1 A HIS B 2 70  ? 6.082  -21.352 21.068  0.56 30.63 ? 311  HIS B ND1 1 
ATOM   705  N ND1 B HIS B 2 70  ? 5.082  -24.904 18.021  0.44 29.93 ? 311  HIS B ND1 1 
ATOM   706  C CD2 A HIS B 2 70  ? 7.370  -23.082 20.723  0.56 31.14 ? 311  HIS B CD2 1 
ATOM   707  C CD2 B HIS B 2 70  ? 7.200  -24.470 18.314  0.44 29.45 ? 311  HIS B CD2 1 
ATOM   708  C CE1 A HIS B 2 70  ? 6.898  -21.443 22.103  0.56 31.07 ? 311  HIS B CE1 1 
ATOM   709  C CE1 B HIS B 2 70  ? 5.754  -25.984 17.665  0.44 29.78 ? 311  HIS B CE1 1 
ATOM   710  N NE2 A HIS B 2 70  ? 7.689  -22.485 21.919  0.56 31.11 ? 311  HIS B NE2 1 
ATOM   711  N NE2 B HIS B 2 70  ? 7.042  -25.743 17.826  0.44 29.53 ? 311  HIS B NE2 1 
ATOM   712  N N   A SER B 2 71  ? 7.641  -21.675 16.313  0.56 30.84 ? 312  SER B N   1 
ATOM   713  N N   B SER B 2 71  ? 7.615  -21.620 16.343  0.44 30.73 ? 312  SER B N   1 
ATOM   714  C CA  A SER B 2 71  ? 9.020  -21.610 15.826  0.56 30.77 ? 312  SER B CA  1 
ATOM   715  C CA  B SER B 2 71  ? 9.009  -21.587 15.912  0.44 30.74 ? 312  SER B CA  1 
ATOM   716  C C   A SER B 2 71  ? 9.425  -20.231 15.295  0.56 30.72 ? 312  SER B C   1 
ATOM   717  C C   B SER B 2 71  ? 9.428  -20.225 15.347  0.44 30.70 ? 312  SER B C   1 
ATOM   718  O O   A SER B 2 71  ? 10.586 -20.022 14.929  0.56 30.77 ? 312  SER B O   1 
ATOM   719  O O   B SER B 2 71  ? 10.598 -20.023 15.008  0.44 30.76 ? 312  SER B O   1 
ATOM   720  C CB  A SER B 2 71  ? 9.256  -22.678 14.753  0.56 30.74 ? 312  SER B CB  1 
ATOM   721  C CB  B SER B 2 71  ? 9.272  -22.698 14.889  0.44 30.73 ? 312  SER B CB  1 
ATOM   722  O OG  A SER B 2 71  ? 9.220  -23.978 15.312  0.56 30.86 ? 312  SER B OG  1 
ATOM   723  O OG  B SER B 2 71  ? 10.662 -22.918 14.722  0.44 31.01 ? 312  SER B OG  1 
ATOM   724  N N   . PHE B 2 72  ? 8.473  -19.300 15.243  1.00 30.67 ? 313  PHE B N   1 
ATOM   725  C CA  . PHE B 2 72  ? 8.752  -17.922 14.776  1.00 30.56 ? 313  PHE B CA  1 
ATOM   726  C C   . PHE B 2 72  ? 7.734  -16.892 15.286  1.00 30.35 ? 313  PHE B C   1 
ATOM   727  O O   . PHE B 2 72  ? 6.870  -17.219 16.103  1.00 29.94 ? 313  PHE B O   1 
ATOM   728  C CB  . PHE B 2 72  ? 8.969  -17.843 13.240  1.00 30.47 ? 313  PHE B CB  1 
ATOM   729  C CG  . PHE B 2 72  ? 7.721  -18.026 12.415  1.00 30.64 ? 313  PHE B CG  1 
ATOM   730  C CD1 . PHE B 2 72  ? 7.130  -16.931 11.781  1.00 30.47 ? 313  PHE B CD1 1 
ATOM   731  C CD2 . PHE B 2 72  ? 7.152  -19.288 12.245  1.00 30.49 ? 313  PHE B CD2 1 
ATOM   732  C CE1 . PHE B 2 72  ? 5.977  -17.086 11.012  1.00 30.19 ? 313  PHE B CE1 1 
ATOM   733  C CE2 . PHE B 2 72  ? 5.994  -19.460 11.475  1.00 29.92 ? 313  PHE B CE2 1 
ATOM   734  C CZ  . PHE B 2 72  ? 5.412  -18.360 10.855  1.00 30.49 ? 313  PHE B CZ  1 
ATOM   735  N N   . PHE B 2 73  ? 7.869  -15.652 14.823  1.00 30.24 ? 314  PHE B N   1 
ATOM   736  C CA  . PHE B 2 73  ? 6.998  -14.556 15.244  1.00 30.70 ? 314  PHE B CA  1 
ATOM   737  C C   . PHE B 2 73  ? 6.085  -14.122 14.110  1.00 31.26 ? 314  PHE B C   1 
ATOM   738  O O   . PHE B 2 73  ? 6.500  -13.411 13.189  1.00 31.06 ? 314  PHE B O   1 
ATOM   739  C CB  . PHE B 2 73  ? 7.819  -13.377 15.790  1.00 30.41 ? 314  PHE B CB  1 
ATOM   740  C CG  . PHE B 2 73  ? 8.656  -13.733 16.992  1.00 30.16 ? 314  PHE B CG  1 
ATOM   741  C CD1 . PHE B 2 73  ? 8.093  -13.758 18.267  1.00 30.63 ? 314  PHE B CD1 1 
ATOM   742  C CD2 . PHE B 2 73  ? 10.007 -14.055 16.851  1.00 30.54 ? 314  PHE B CD2 1 
ATOM   743  C CE1 . PHE B 2 73  ? 8.865  -14.099 19.401  1.00 30.40 ? 314  PHE B CE1 1 
ATOM   744  C CE2 . PHE B 2 73  ? 10.792 -14.396 17.975  1.00 30.15 ? 314  PHE B CE2 1 
ATOM   745  C CZ  . PHE B 2 73  ? 10.213 -14.416 19.250  1.00 29.70 ? 314  PHE B CZ  1 
ATOM   746  N N   . LEU B 2 74  ? 4.844  -14.591 14.173  1.00 31.78 ? 315  LEU B N   1 
ATOM   747  C CA  . LEU B 2 74  ? 3.836  -14.265 13.170  1.00 32.75 ? 315  LEU B CA  1 
ATOM   748  C C   . LEU B 2 74  ? 3.458  -12.774 13.198  1.00 32.64 ? 315  LEU B C   1 
ATOM   749  O O   . LEU B 2 74  ? 3.164  -12.189 12.168  1.00 32.71 ? 315  LEU B O   1 
ATOM   750  C CB  . LEU B 2 74  ? 2.592  -15.137 13.364  1.00 32.89 ? 315  LEU B CB  1 
ATOM   751  C CG  . LEU B 2 74  ? 1.552  -15.180 12.247  1.00 34.29 ? 315  LEU B CG  1 
ATOM   752  C CD1 . LEU B 2 74  ? 1.970  -16.179 11.173  1.00 36.39 ? 315  LEU B CD1 1 
ATOM   753  C CD2 . LEU B 2 74  ? 0.182  -15.538 12.809  1.00 33.98 ? 315  LEU B CD2 1 
ATOM   754  N N   A THR B 2 75  ? 3.454  -12.187 14.392  0.13 32.65 ? 316  THR B N   1 
ATOM   755  N N   B THR B 2 75  ? 3.482  -12.169 14.379  0.87 32.84 ? 316  THR B N   1 
ATOM   756  C CA  A THR B 2 75  ? 3.192  -10.760 14.554  0.13 32.59 ? 316  THR B CA  1 
ATOM   757  C CA  B THR B 2 75  ? 3.194  -10.748 14.510  0.87 32.95 ? 316  THR B CA  1 
ATOM   758  C C   A THR B 2 75  ? 4.372  -10.123 15.296  0.13 32.62 ? 316  THR B C   1 
ATOM   759  C C   B THR B 2 75  ? 4.341  -10.066 15.260  0.87 32.81 ? 316  THR B C   1 
ATOM   760  O O   A THR B 2 75  ? 4.282  -9.857  16.501  0.13 32.74 ? 316  THR B O   1 
ATOM   761  O O   B THR B 2 75  ? 4.192  -9.692  16.432  0.87 33.53 ? 316  THR B O   1 
ATOM   762  C CB  A THR B 2 75  ? 1.855  -10.505 15.300  0.13 32.58 ? 316  THR B CB  1 
ATOM   763  C CB  B THR B 2 75  ? 1.825  -10.492 15.197  0.87 32.97 ? 316  THR B CB  1 
ATOM   764  O OG1 A THR B 2 75  ? 0.842  -11.385 14.795  0.13 32.35 ? 316  THR B OG1 1 
ATOM   765  O OG1 B THR B 2 75  ? 1.864  -10.983 16.538  0.87 34.85 ? 316  THR B OG1 1 
ATOM   766  C CG2 A THR B 2 75  ? 1.397  -9.060  15.124  0.13 32.61 ? 316  THR B CG2 1 
ATOM   767  C CG2 B THR B 2 75  ? 0.691  -11.194 14.446  0.87 32.38 ? 316  THR B CG2 1 
ATOM   768  N N   . PRO B 2 76  ? 5.497  -9.898  14.584  1.00 32.66 ? 317  PRO B N   1 
ATOM   769  C CA  . PRO B 2 76  ? 6.683  -9.335  15.246  1.00 32.62 ? 317  PRO B CA  1 
ATOM   770  C C   . PRO B 2 76  ? 6.475  -7.875  15.668  1.00 32.75 ? 317  PRO B C   1 
ATOM   771  O O   . PRO B 2 76  ? 5.944  -7.074  14.894  1.00 32.43 ? 317  PRO B O   1 
ATOM   772  C CB  . PRO B 2 76  ? 7.790  -9.476  14.198  1.00 32.19 ? 317  PRO B CB  1 
ATOM   773  C CG  . PRO B 2 76  ? 7.104  -9.645  12.901  1.00 32.68 ? 317  PRO B CG  1 
ATOM   774  C CD  . PRO B 2 76  ? 5.735  -10.165 13.147  1.00 32.49 ? 317  PRO B CD  1 
ATOM   775  N N   . ASP B 2 77  ? 6.867  -7.566  16.907  1.00 32.70 ? 318  ASP B N   1 
ATOM   776  C CA  . ASP B 2 77  ? 6.586  -6.274  17.525  1.00 32.74 ? 318  ASP B CA  1 
ATOM   777  C C   . ASP B 2 77  ? 7.864  -5.486  17.791  1.00 32.23 ? 318  ASP B C   1 
ATOM   778  O O   . ASP B 2 77  ? 7.816  -4.375  18.311  1.00 32.27 ? 318  ASP B O   1 
ATOM   779  C CB  . ASP B 2 77  ? 5.741  -6.438  18.808  1.00 32.87 ? 318  ASP B CB  1 
ATOM   780  C CG  . ASP B 2 77  ? 6.552  -6.945  20.024  1.00 34.70 ? 318  ASP B CG  1 
ATOM   781  O OD1 . ASP B 2 77  ? 7.805  -6.908  20.029  1.00 36.32 ? 318  ASP B OD1 1 
ATOM   782  O OD2 . ASP B 2 77  ? 5.915  -7.368  21.013  1.00 36.21 ? 318  ASP B OD2 1 
ATOM   783  N N   . SER B 2 78  ? 9.005  -6.076  17.440  1.00 31.43 ? 319  SER B N   1 
ATOM   784  C CA  . SER B 2 78  ? 10.285 -5.408  17.602  1.00 30.65 ? 319  SER B CA  1 
ATOM   785  C C   . SER B 2 78  ? 11.214 -5.750  16.453  1.00 29.93 ? 319  SER B C   1 
ATOM   786  O O   . SER B 2 78  ? 11.006 -6.719  15.747  1.00 29.98 ? 319  SER B O   1 
ATOM   787  C CB  . SER B 2 78  ? 10.936 -5.789  18.936  1.00 30.91 ? 319  SER B CB  1 
ATOM   788  O OG  . SER B 2 78  ? 11.514 -7.081  18.865  1.00 31.02 ? 319  SER B OG  1 
ATOM   789  N N   . PHE B 2 79  ? 12.237 -4.925  16.280  1.00 29.52 ? 320  PHE B N   1 
ATOM   790  C CA  . PHE B 2 79  ? 13.315 -5.177  15.339  1.00 28.94 ? 320  PHE B CA  1 
ATOM   791  C C   . PHE B 2 79  ? 13.940 -6.556  15.564  1.00 28.56 ? 320  PHE B C   1 
ATOM   792  O O   . PHE B 2 79  ? 14.220 -7.283  14.609  1.00 28.69 ? 320  PHE B O   1 
ATOM   793  C CB  . PHE B 2 79  ? 14.370 -4.082  15.507  1.00 28.97 ? 320  PHE B CB  1 
ATOM   794  C CG  . PHE B 2 79  ? 15.614 -4.295  14.693  1.00 29.38 ? 320  PHE B CG  1 
ATOM   795  C CD1 . PHE B 2 79  ? 15.643 -3.954  13.341  1.00 29.52 ? 320  PHE B CD1 1 
ATOM   796  C CD2 . PHE B 2 79  ? 16.766 -4.805  15.284  1.00 29.12 ? 320  PHE B CD2 1 
ATOM   797  C CE1 . PHE B 2 79  ? 16.795 -4.137  12.587  1.00 29.80 ? 320  PHE B CE1 1 
ATOM   798  C CE2 . PHE B 2 79  ? 17.922 -4.996  14.539  1.00 30.17 ? 320  PHE B CE2 1 
ATOM   799  C CZ  . PHE B 2 79  ? 17.935 -4.666  13.185  1.00 29.85 ? 320  PHE B CZ  1 
ATOM   800  N N   A GLU B 2 80  ? 14.166 -6.914  16.828  0.50 28.32 ? 321  GLU B N   1 
ATOM   801  N N   B GLU B 2 80  ? 14.132 -6.882  16.840  0.50 28.21 ? 321  GLU B N   1 
ATOM   802  C CA  A GLU B 2 80  ? 14.819 -8.181  17.154  0.50 27.83 ? 321  GLU B CA  1 
ATOM   803  C CA  B GLU B 2 80  ? 14.764 -8.115  17.293  0.50 27.62 ? 321  GLU B CA  1 
ATOM   804  C C   A GLU B 2 80  ? 13.973 -9.401  16.792  0.50 27.47 ? 321  GLU B C   1 
ATOM   805  C C   B GLU B 2 80  ? 13.984 -9.363  16.859  0.50 27.37 ? 321  GLU B C   1 
ATOM   806  O O   A GLU B 2 80  ? 14.507 -10.407 16.337  0.50 27.09 ? 321  GLU B O   1 
ATOM   807  O O   B GLU B 2 80  ? 14.573 -10.342 16.410  0.50 26.98 ? 321  GLU B O   1 
ATOM   808  C CB  A GLU B 2 80  ? 15.255 -8.224  18.625  0.50 28.02 ? 321  GLU B CB  1 
ATOM   809  C CB  B GLU B 2 80  ? 14.926 -8.072  18.822  0.50 27.69 ? 321  GLU B CB  1 
ATOM   810  C CG  A GLU B 2 80  ? 16.085 -9.455  19.017  0.50 27.82 ? 321  GLU B CG  1 
ATOM   811  C CG  B GLU B 2 80  ? 15.950 -7.037  19.355  0.50 26.97 ? 321  GLU B CG  1 
ATOM   812  C CD  A GLU B 2 80  ? 17.284 -9.712  18.108  0.50 28.44 ? 321  GLU B CD  1 
ATOM   813  C CD  B GLU B 2 80  ? 15.551 -5.564  19.144  0.50 26.14 ? 321  GLU B CD  1 
ATOM   814  O OE1 A GLU B 2 80  ? 17.837 -8.756  17.508  0.50 27.42 ? 321  GLU B OE1 1 
ATOM   815  O OE1 B GLU B 2 80  ? 14.347 -5.232  19.181  0.50 25.04 ? 321  GLU B OE1 1 
ATOM   816  O OE2 A GLU B 2 80  ? 17.680 -10.892 18.004  0.50 29.72 ? 321  GLU B OE2 1 
ATOM   817  O OE2 B GLU B 2 80  ? 16.462 -4.730  18.951  0.50 26.20 ? 321  GLU B OE2 1 
ATOM   818  N N   . GLN B 2 81  ? 12.661 -9.308  16.995  1.00 27.23 ? 322  GLN B N   1 
ATOM   819  C CA  . GLN B 2 81  ? 11.765 -10.389 16.599  1.00 27.33 ? 322  GLN B CA  1 
ATOM   820  C C   . GLN B 2 81  ? 11.737 -10.581 15.067  1.00 27.39 ? 322  GLN B C   1 
ATOM   821  O O   . GLN B 2 81  ? 11.633 -11.704 14.586  1.00 28.00 ? 322  GLN B O   1 
ATOM   822  C CB  . GLN B 2 81  ? 10.355 -10.151 17.133  1.00 27.10 ? 322  GLN B CB  1 
ATOM   823  C CG  . GLN B 2 81  ? 10.250 -10.259 18.644  1.00 27.88 ? 322  GLN B CG  1 
ATOM   824  C CD  . GLN B 2 81  ? 8.822  -10.277 19.124  1.00 28.64 ? 322  GLN B CD  1 
ATOM   825  O OE1 . GLN B 2 81  ? 7.887  -10.133 18.332  1.00 28.80 ? 322  GLN B OE1 1 
ATOM   826  N NE2 . GLN B 2 81  ? 8.639  -10.460 20.428  1.00 29.11 ? 322  GLN B NE2 1 
ATOM   827  N N   . LYS B 2 82  ? 11.845 -9.483  14.326  1.00 27.27 ? 323  LYS B N   1 
ATOM   828  C CA  . LYS B 2 82  ? 11.911 -9.517  12.862  1.00 27.22 ? 323  LYS B CA  1 
ATOM   829  C C   . LYS B 2 82  ? 13.227 -10.143 12.395  1.00 27.13 ? 323  LYS B C   1 
ATOM   830  O O   . LYS B 2 82  ? 13.230 -10.984 11.499  1.00 27.27 ? 323  LYS B O   1 
ATOM   831  C CB  . LYS B 2 82  ? 11.722 -8.117  12.284  1.00 27.00 ? 323  LYS B CB  1 
ATOM   832  C CG  . LYS B 2 82  ? 10.332 -7.560  12.520  1.00 27.14 ? 323  LYS B CG  1 
ATOM   833  C CD  . LYS B 2 82  ? 10.146 -6.158  11.961  1.00 27.00 ? 323  LYS B CD  1 
ATOM   834  C CE  . LYS B 2 82  ? 8.713  -5.706  12.219  1.00 28.36 ? 323  LYS B CE  1 
ATOM   835  N NZ  . LYS B 2 82  ? 8.443  -4.284  11.898  1.00 29.11 ? 323  LYS B NZ  1 
ATOM   836  N N   . VAL B 2 83  ? 14.326 -9.764  13.044  1.00 27.01 ? 324  VAL B N   1 
ATOM   837  C CA  . VAL B 2 83  ? 15.636 -10.367 12.790  1.00 26.94 ? 324  VAL B CA  1 
ATOM   838  C C   . VAL B 2 83  ? 15.589 -11.885 12.977  1.00 27.21 ? 324  VAL B C   1 
ATOM   839  O O   . VAL B 2 83  ? 16.074 -12.646 12.135  1.00 26.67 ? 324  VAL B O   1 
ATOM   840  C CB  . VAL B 2 83  ? 16.720 -9.737  13.689  1.00 27.09 ? 324  VAL B CB  1 
ATOM   841  C CG1 . VAL B 2 83  ? 18.018 -10.544 13.652  1.00 27.14 ? 324  VAL B CG1 1 
ATOM   842  C CG2 . VAL B 2 83  ? 16.980 -8.298  13.261  1.00 26.42 ? 324  VAL B CG2 1 
ATOM   843  N N   . LEU B 2 84  ? 14.983 -12.313 14.081  1.00 26.73 ? 325  LEU B N   1 
ATOM   844  C CA  . LEU B 2 84  ? 14.878 -13.725 14.408  1.00 26.62 ? 325  LEU B CA  1 
ATOM   845  C C   . LEU B 2 84  ? 14.071 -14.485 13.360  1.00 26.20 ? 325  LEU B C   1 
ATOM   846  O O   . LEU B 2 84  ? 14.399 -15.615 13.038  1.00 26.14 ? 325  LEU B O   1 
ATOM   847  C CB  . LEU B 2 84  ? 14.311 -13.919 15.823  1.00 26.09 ? 325  LEU B CB  1 
ATOM   848  C CG  . LEU B 2 84  ? 15.274 -13.527 16.970  1.00 26.99 ? 325  LEU B CG  1 
ATOM   849  C CD1 . LEU B 2 84  ? 14.539 -13.317 18.297  1.00 25.44 ? 325  LEU B CD1 1 
ATOM   850  C CD2 . LEU B 2 84  ? 16.449 -14.528 17.140  1.00 25.33 ? 325  LEU B CD2 1 
ATOM   851  N N   . ASN B 2 85  ? 13.019 -13.869 12.830  1.00 26.64 ? 326  ASN B N   1 
ATOM   852  C CA  . ASN B 2 85  ? 12.293 -14.465 11.703  1.00 26.99 ? 326  ASN B CA  1 
ATOM   853  C C   . ASN B 2 85  ? 13.167 -14.667 10.467  1.00 27.09 ? 326  ASN B C   1 
ATOM   854  O O   . ASN B 2 85  ? 13.154 -15.746 9.867   1.00 27.08 ? 326  ASN B O   1 
ATOM   855  C CB  . ASN B 2 85  ? 11.027 -13.672 11.348  1.00 26.41 ? 326  ASN B CB  1 
ATOM   856  C CG  . ASN B 2 85  ? 9.948  -13.803 12.402  1.00 26.40 ? 326  ASN B CG  1 
ATOM   857  O OD1 . ASN B 2 85  ? 10.007 -14.676 13.266  1.00 25.15 ? 326  ASN B OD1 1 
ATOM   858  N ND2 . ASN B 2 85  ? 8.965  -12.920 12.346  1.00 24.87 ? 326  ASN B ND2 1 
ATOM   859  N N   A VAL B 2 86  ? 13.934 -13.636 10.123  0.88 27.70 ? 327  VAL B N   1 
ATOM   860  N N   B VAL B 2 86  ? 13.916 -13.632 10.083  0.12 27.43 ? 327  VAL B N   1 
ATOM   861  C CA  A VAL B 2 86  ? 14.797 -13.668 8.940   0.88 28.20 ? 327  VAL B CA  1 
ATOM   862  C CA  B VAL B 2 86  ? 14.752 -13.695 8.876   0.12 27.73 ? 327  VAL B CA  1 
ATOM   863  C C   A VAL B 2 86  ? 15.908 -14.694 9.090   0.88 28.65 ? 327  VAL B C   1 
ATOM   864  C C   B VAL B 2 86  ? 15.937 -14.639 9.067   0.12 27.94 ? 327  VAL B C   1 
ATOM   865  O O   A VAL B 2 86  ? 16.150 -15.479 8.171   0.88 29.29 ? 327  VAL B O   1 
ATOM   866  O O   B VAL B 2 86  ? 16.388 -15.279 8.121   0.12 28.06 ? 327  VAL B O   1 
ATOM   867  C CB  A VAL B 2 86  ? 15.340 -12.265 8.559   0.88 28.16 ? 327  VAL B CB  1 
ATOM   868  C CB  B VAL B 2 86  ? 15.229 -12.294 8.375   0.12 27.73 ? 327  VAL B CB  1 
ATOM   869  C CG1 A VAL B 2 86  ? 16.156 -12.339 7.263   0.88 26.93 ? 327  VAL B CG1 1 
ATOM   870  C CG1 B VAL B 2 86  ? 14.050 -11.350 8.193   0.12 27.70 ? 327  VAL B CG1 1 
ATOM   871  C CG2 A VAL B 2 86  ? 14.185 -11.300 8.371   0.88 28.07 ? 327  VAL B CG2 1 
ATOM   872  C CG2 B VAL B 2 86  ? 16.270 -11.685 9.304   0.12 27.65 ? 327  VAL B CG2 1 
ATOM   873  N N   A SER B 2 87  ? 16.554 -14.700 10.256  0.88 29.10 ? 328  SER B N   1 
ATOM   874  N N   B SER B 2 87  ? 16.427 -14.724 10.299  0.12 28.20 ? 328  SER B N   1 
ATOM   875  C CA  A SER B 2 87  ? 17.527 -15.727 10.637  0.88 29.23 ? 328  SER B CA  1 
ATOM   876  C CA  B SER B 2 87  ? 17.485 -15.668 10.641  0.12 28.41 ? 328  SER B CA  1 
ATOM   877  C C   A SER B 2 87  ? 16.959 -17.136 10.546  0.88 29.23 ? 328  SER B C   1 
ATOM   878  C C   B SER B 2 87  ? 16.963 -17.101 10.560  0.12 28.59 ? 328  SER B C   1 
ATOM   879  O O   A SER B 2 87  ? 17.629 -18.061 10.081  0.88 29.38 ? 328  SER B O   1 
ATOM   880  O O   B SER B 2 87  ? 17.671 -18.004 10.109  0.12 28.66 ? 328  SER B O   1 
ATOM   881  C CB  A SER B 2 87  ? 18.012 -15.494 12.067  0.88 29.33 ? 328  SER B CB  1 
ATOM   882  C CB  B SER B 2 87  ? 18.028 -15.382 12.042  0.12 28.39 ? 328  SER B CB  1 
ATOM   883  O OG  A SER B 2 87  ? 19.089 -14.593 12.086  0.88 30.64 ? 328  SER B OG  1 
ATOM   884  O OG  B SER B 2 87  ? 18.367 -14.014 12.185  0.12 28.37 ? 328  SER B OG  1 
ATOM   885  N N   . PHE B 2 88  ? 15.723 -17.296 11.005  1.00 28.88 ? 329  PHE B N   1 
ATOM   886  C CA  . PHE B 2 88  ? 15.040 -18.574 10.894  1.00 28.73 ? 329  PHE B CA  1 
ATOM   887  C C   . PHE B 2 88  ? 14.743 -18.990 9.433   1.00 28.73 ? 329  PHE B C   1 
ATOM   888  O O   . PHE B 2 88  ? 14.910 -20.156 9.083   1.00 29.08 ? 329  PHE B O   1 
ATOM   889  C CB  . PHE B 2 88  ? 13.762 -18.590 11.741  1.00 28.38 ? 329  PHE B CB  1 
ATOM   890  C CG  . PHE B 2 88  ? 13.093 -19.928 11.774  1.00 28.39 ? 329  PHE B CG  1 
ATOM   891  C CD1 . PHE B 2 88  ? 13.830 -21.074 12.062  1.00 27.66 ? 329  PHE B CD1 1 
ATOM   892  C CD2 . PHE B 2 88  ? 11.737 -20.052 11.502  1.00 28.76 ? 329  PHE B CD2 1 
ATOM   893  C CE1 . PHE B 2 88  ? 13.220 -22.324 12.080  1.00 29.47 ? 329  PHE B CE1 1 
ATOM   894  C CE2 . PHE B 2 88  ? 11.118 -21.298 11.516  1.00 27.67 ? 329  PHE B CE2 1 
ATOM   895  C CZ  . PHE B 2 88  ? 11.863 -22.435 11.800  1.00 28.89 ? 329  PHE B CZ  1 
ATOM   896  N N   . ALA B 2 89  ? 14.314 -18.052 8.588   1.00 28.45 ? 330  ALA B N   1 
ATOM   897  C CA  . ALA B 2 89  ? 14.136 -18.354 7.150   1.00 28.09 ? 330  ALA B CA  1 
ATOM   898  C C   . ALA B 2 89  ? 15.459 -18.719 6.466   1.00 27.96 ? 330  ALA B C   1 
ATOM   899  O O   . ALA B 2 89  ? 15.498 -19.585 5.608   1.00 28.56 ? 330  ALA B O   1 
ATOM   900  C CB  . ALA B 2 89  ? 13.452 -17.194 6.426   1.00 27.35 ? 330  ALA B CB  1 
ATOM   901  N N   . PHE B 2 90  ? 16.542 -18.056 6.868   1.00 28.20 ? 331  PHE B N   1 
ATOM   902  C CA  . PHE B 2 90  ? 17.891 -18.307 6.338   1.00 27.78 ? 331  PHE B CA  1 
ATOM   903  C C   . PHE B 2 90  ? 18.365 -19.699 6.719   1.00 27.93 ? 331  PHE B C   1 
ATOM   904  O O   . PHE B 2 90  ? 18.976 -20.407 5.915   1.00 28.23 ? 331  PHE B O   1 
ATOM   905  C CB  . PHE B 2 90  ? 18.865 -17.265 6.884   1.00 27.13 ? 331  PHE B CB  1 
ATOM   906  C CG  . PHE B 2 90  ? 18.800 -15.922 6.186   1.00 26.11 ? 331  PHE B CG  1 
ATOM   907  C CD1 . PHE B 2 90  ? 17.793 -15.627 5.267   1.00 24.19 ? 331  PHE B CD1 1 
ATOM   908  C CD2 . PHE B 2 90  ? 19.743 -14.944 6.472   1.00 24.35 ? 331  PHE B CD2 1 
ATOM   909  C CE1 . PHE B 2 90  ? 17.745 -14.402 4.634   1.00 21.45 ? 331  PHE B CE1 1 
ATOM   910  C CE2 . PHE B 2 90  ? 19.690 -13.708 5.848   1.00 23.24 ? 331  PHE B CE2 1 
ATOM   911  C CZ  . PHE B 2 90  ? 18.685 -13.438 4.934   1.00 23.40 ? 331  PHE B CZ  1 
ATOM   912  N N   . GLU B 2 91  ? 18.067 -20.077 7.960   1.00 27.92 ? 332  GLU B N   1 
ATOM   913  C CA  . GLU B 2 91  ? 18.322 -21.409 8.479   1.00 27.52 ? 332  GLU B CA  1 
ATOM   914  C C   . GLU B 2 91  ? 17.566 -22.476 7.677   1.00 27.33 ? 332  GLU B C   1 
ATOM   915  O O   . GLU B 2 91  ? 18.136 -23.514 7.346   1.00 27.72 ? 332  GLU B O   1 
ATOM   916  C CB  . GLU B 2 91  ? 17.922 -21.463 9.950   1.00 27.84 ? 332  GLU B CB  1 
ATOM   917  C CG  . GLU B 2 91  ? 18.397 -22.683 10.693  1.00 29.02 ? 332  GLU B CG  1 
ATOM   918  C CD  . GLU B 2 91  ? 17.807 -22.771 12.091  1.00 31.50 ? 332  GLU B CD  1 
ATOM   919  O OE1 . GLU B 2 91  ? 17.835 -21.759 12.824  1.00 32.72 ? 332  GLU B OE1 1 
ATOM   920  O OE2 . GLU B 2 91  ? 17.320 -23.857 12.457  1.00 33.43 ? 332  GLU B OE2 1 
ATOM   921  N N   . LEU B 2 92  ? 16.301 -22.214 7.358   1.00 26.44 ? 333  LEU B N   1 
ATOM   922  C CA  . LEU B 2 92  ? 15.501 -23.137 6.570   1.00 26.40 ? 333  LEU B CA  1 
ATOM   923  C C   . LEU B 2 92  ? 15.984 -23.218 5.113   1.00 26.70 ? 333  LEU B C   1 
ATOM   924  O O   . LEU B 2 92  ? 15.897 -24.270 4.495   1.00 26.17 ? 333  LEU B O   1 
ATOM   925  C CB  . LEU B 2 92  ? 14.007 -22.773 6.632   1.00 26.15 ? 333  LEU B CB  1 
ATOM   926  C CG  . LEU B 2 92  ? 13.239 -22.834 7.962   1.00 25.53 ? 333  LEU B CG  1 
ATOM   927  C CD1 . LEU B 2 92  ? 11.861 -22.233 7.796   1.00 24.98 ? 333  LEU B CD1 1 
ATOM   928  C CD2 . LEU B 2 92  ? 13.119 -24.263 8.531   1.00 23.61 ? 333  LEU B CD2 1 
ATOM   929  N N   . MET B 2 93  ? 16.484 -22.103 4.581   1.00 27.40 ? 334  MET B N   1 
ATOM   930  C CA  . MET B 2 93  ? 17.135 -22.085 3.263   1.00 28.31 ? 334  MET B CA  1 
ATOM   931  C C   . MET B 2 93  ? 18.342 -23.004 3.251   1.00 28.15 ? 334  MET B C   1 
ATOM   932  O O   . MET B 2 93  ? 18.480 -23.832 2.352   1.00 28.22 ? 334  MET B O   1 
ATOM   933  C CB  . MET B 2 93  ? 17.540 -20.670 2.845   1.00 27.61 ? 334  MET B CB  1 
ATOM   934  C CG  . MET B 2 93  ? 16.350 -19.785 2.518   1.00 28.49 ? 334  MET B CG  1 
ATOM   935  S SD  . MET B 2 93  ? 16.779 -18.048 2.414   1.00 30.21 ? 334  MET B SD  1 
ATOM   936  C CE  . MET B 2 93  ? 15.200 -17.311 2.827   1.00 27.02 ? 334  MET B CE  1 
ATOM   937  N N   . GLN B 2 94  ? 19.209 -22.870 4.253   1.00 28.71 ? 335  GLN B N   1 
ATOM   938  C CA  . GLN B 2 94  ? 20.381 -23.756 4.364   1.00 28.48 ? 335  GLN B CA  1 
ATOM   939  C C   . GLN B 2 94  ? 20.012 -25.221 4.603   1.00 28.40 ? 335  GLN B C   1 
ATOM   940  O O   . GLN B 2 94  ? 20.700 -26.122 4.112   1.00 28.49 ? 335  GLN B O   1 
ATOM   941  C CB  . GLN B 2 94  ? 21.371 -23.240 5.402   1.00 28.63 ? 335  GLN B CB  1 
ATOM   942  C CG  . GLN B 2 94  ? 21.941 -21.870 5.033   1.00 29.07 ? 335  GLN B CG  1 
ATOM   943  C CD  . GLN B 2 94  ? 23.084 -21.436 5.926   1.00 28.32 ? 335  GLN B CD  1 
ATOM   944  O OE1 . GLN B 2 94  ? 24.196 -21.961 5.842   1.00 29.16 ? 335  GLN B OE1 1 
ATOM   945  N NE2 . GLN B 2 94  ? 22.824 -20.447 6.766   1.00 29.20 ? 335  GLN B NE2 1 
ATOM   946  N N   . ASP B 2 95  ? 18.917 -25.450 5.330   1.00 28.39 ? 336  ASP B N   1 
ATOM   947  C CA  . ASP B 2 95  ? 18.370 -26.800 5.543   1.00 28.72 ? 336  ASP B CA  1 
ATOM   948  C C   . ASP B 2 95  ? 17.933 -27.443 4.220   1.00 29.03 ? 336  ASP B C   1 
ATOM   949  O O   . ASP B 2 95  ? 17.960 -28.664 4.086   1.00 29.50 ? 336  ASP B O   1 
ATOM   950  C CB  . ASP B 2 95  ? 17.170 -26.771 6.508   1.00 28.37 ? 336  ASP B CB  1 
ATOM   951  C CG  . ASP B 2 95  ? 17.560 -26.475 7.966   0.96 28.51 ? 336  ASP B CG  1 
ATOM   952  O OD1 . ASP B 2 95  ? 18.766 -26.434 8.321   0.96 29.02 ? 336  ASP B OD1 1 
ATOM   953  O OD2 . ASP B 2 95  ? 16.631 -26.296 8.776   0.96 27.44 ? 336  ASP B OD2 1 
ATOM   954  N N   . GLY B 2 96  ? 17.523 -26.610 3.263   1.00 29.17 ? 337  GLY B N   1 
ATOM   955  C CA  . GLY B 2 96  ? 17.128 -27.053 1.926   1.00 29.62 ? 337  GLY B CA  1 
ATOM   956  C C   . GLY B 2 96  ? 18.270 -27.221 0.938   1.00 29.97 ? 337  GLY B C   1 
ATOM   957  O O   . GLY B 2 96  ? 18.065 -27.666 -0.193  1.00 30.27 ? 337  GLY B O   1 
ATOM   958  N N   . GLY B 2 97  ? 19.477 -26.869 1.360   1.00 30.13 ? 338  GLY B N   1 
ATOM   959  C CA  . GLY B 2 97  ? 20.666 -27.093 0.552   1.00 30.43 ? 338  GLY B CA  1 
ATOM   960  C C   . GLY B 2 97  ? 21.299 -25.834 0.002   1.00 30.86 ? 338  GLY B C   1 
ATOM   961  O O   . GLY B 2 97  ? 22.344 -25.897 -0.653  1.00 31.32 ? 338  GLY B O   1 
ATOM   962  N N   A LEU B 2 98  ? 20.622 -24.710 0.213   0.72 30.91 ? 339  LEU B N   1 
ATOM   963  N N   B LEU B 2 98  ? 20.715 -24.675 0.301   0.28 30.92 ? 339  LEU B N   1 
ATOM   964  C CA  A LEU B 2 98  ? 21.146 -23.418 -0.176  0.72 31.36 ? 339  LEU B CA  1 
ATOM   965  C CA  B LEU B 2 98  ? 21.271 -23.396 -0.155  0.28 31.14 ? 339  LEU B CA  1 
ATOM   966  C C   A LEU B 2 98  ? 22.353 -23.087 0.689   0.72 31.60 ? 339  LEU B C   1 
ATOM   967  C C   B LEU B 2 98  ? 22.487 -22.922 0.653   0.28 31.25 ? 339  LEU B C   1 
ATOM   968  O O   A LEU B 2 98  ? 22.459 -23.530 1.834   0.72 31.60 ? 339  LEU B O   1 
ATOM   969  O O   B LEU B 2 98  ? 22.584 -23.167 1.854   0.28 31.27 ? 339  LEU B O   1 
ATOM   970  C CB  A LEU B 2 98  ? 20.075 -22.326 -0.067  0.72 31.15 ? 339  LEU B CB  1 
ATOM   971  C CB  B LEU B 2 98  ? 20.192 -22.305 -0.168  0.28 31.04 ? 339  LEU B CB  1 
ATOM   972  C CG  A LEU B 2 98  ? 19.182 -22.081 -1.290  0.72 31.83 ? 339  LEU B CG  1 
ATOM   973  C CG  B LEU B 2 98  ? 19.173 -22.317 -1.313  0.28 31.32 ? 339  LEU B CG  1 
ATOM   974  C CD1 A LEU B 2 98  ? 17.864 -21.454 -0.883  0.72 32.33 ? 339  LEU B CD1 1 
ATOM   975  C CD1 B LEU B 2 98  ? 18.010 -21.385 -1.012  0.28 30.73 ? 339  LEU B CD1 1 
ATOM   976  C CD2 A LEU B 2 98  ? 19.889 -21.191 -2.294  0.72 30.28 ? 339  LEU B CD2 1 
ATOM   977  C CD2 B LEU B 2 98  ? 19.824 -21.952 -2.643  0.28 31.49 ? 339  LEU B CD2 1 
ATOM   978  N N   A GLU B 2 99  ? 23.279 -22.334 0.118   0.72 31.64 ? 340  GLU B N   1 
ATOM   979  N N   B GLU B 2 99  ? 23.413 -22.250 -0.028  0.28 31.30 ? 340  GLU B N   1 
ATOM   980  C CA  A GLU B 2 99  ? 24.422 -21.872 0.866   0.72 31.94 ? 340  GLU B CA  1 
ATOM   981  C CA  B GLU B 2 99  ? 24.536 -21.585 0.627   0.28 31.50 ? 340  GLU B CA  1 
ATOM   982  C C   A GLU B 2 99  ? 24.010 -20.650 1.699   0.72 32.03 ? 340  GLU B C   1 
ATOM   983  C C   B GLU B 2 99  ? 23.991 -20.645 1.708   0.28 31.58 ? 340  GLU B C   1 
ATOM   984  O O   A GLU B 2 99  ? 22.949 -20.052 1.463   0.72 31.94 ? 340  GLU B O   1 
ATOM   985  O O   B GLU B 2 99  ? 22.822 -20.246 1.653   0.28 31.52 ? 340  GLU B O   1 
ATOM   986  C CB  A GLU B 2 99  ? 25.590 -21.610 -0.084  0.72 32.24 ? 340  GLU B CB  1 
ATOM   987  C CB  B GLU B 2 99  ? 25.349 -20.792 -0.417  0.28 31.45 ? 340  GLU B CB  1 
ATOM   988  C CG  A GLU B 2 99  ? 26.315 -22.913 -0.484  0.72 33.52 ? 340  GLU B CG  1 
ATOM   989  C CG  B GLU B 2 99  ? 26.725 -20.279 0.051   0.28 31.70 ? 340  GLU B CG  1 
ATOM   990  C CD  A GLU B 2 99  ? 27.068 -22.841 -1.804  0.62 35.28 ? 340  GLU B CD  1 
ATOM   991  C CD  B GLU B 2 99  ? 27.459 -19.421 -0.987  0.38 31.88 ? 340  GLU B CD  1 
ATOM   992  O OE1 A GLU B 2 99  ? 26.866 -21.883 -2.581  0.62 37.06 ? 340  GLU B OE1 1 
ATOM   993  O OE1 B GLU B 2 99  ? 26.967 -19.284 -2.131  0.38 32.46 ? 340  GLU B OE1 1 
ATOM   994  O OE2 A GLU B 2 99  ? 27.857 -23.770 -2.074  0.62 35.16 ? 340  GLU B OE2 1 
ATOM   995  O OE2 B GLU B 2 99  ? 28.540 -18.891 -0.652  0.38 32.40 ? 340  GLU B OE2 1 
ATOM   996  N N   . LYS B 2 100 ? 24.823 -20.318 2.699   1.00 31.56 ? 341  LYS B N   1 
ATOM   997  C CA  . LYS B 2 100 ? 24.526 -19.224 3.627   1.00 31.50 ? 341  LYS B CA  1 
ATOM   998  C C   . LYS B 2 100 ? 24.213 -17.953 2.825   1.00 30.87 ? 341  LYS B C   1 
ATOM   999  O O   . LYS B 2 100 ? 25.038 -17.521 2.024   1.00 31.23 ? 341  LYS B O   1 
ATOM   1000 C CB  . LYS B 2 100 ? 25.722 -18.989 4.576   1.00 31.07 ? 341  LYS B CB  1 
ATOM   1001 C CG  . LYS B 2 100 ? 25.566 -17.795 5.518   1.00 31.20 ? 341  LYS B CG  1 
ATOM   1002 C CD  . LYS B 2 100 ? 26.811 -17.600 6.377   1.00 32.27 ? 341  LYS B CD  1 
ATOM   1003 C CE  . LYS B 2 100 ? 26.681 -16.375 7.261   1.00 33.66 ? 341  LYS B CE  1 
ATOM   1004 N NZ  . LYS B 2 100 ? 27.901 -16.163 8.097   1.00 35.28 ? 341  LYS B NZ  1 
ATOM   1005 N N   . PRO B 2 101 ? 23.013 -17.368 3.012   1.00 30.78 ? 342  PRO B N   1 
ATOM   1006 C CA  . PRO B 2 101 ? 22.724 -16.110 2.306   1.00 30.60 ? 342  PRO B CA  1 
ATOM   1007 C C   . PRO B 2 101 ? 23.806 -15.048 2.511   1.00 30.92 ? 342  PRO B C   1 
ATOM   1008 O O   . PRO B 2 101 ? 24.446 -15.002 3.572   1.00 30.94 ? 342  PRO B O   1 
ATOM   1009 C CB  . PRO B 2 101 ? 21.390 -15.679 2.906   1.00 30.21 ? 342  PRO B CB  1 
ATOM   1010 C CG  . PRO B 2 101 ? 20.744 -16.972 3.290   1.00 29.76 ? 342  PRO B CG  1 
ATOM   1011 C CD  . PRO B 2 101 ? 21.860 -17.810 3.821   1.00 30.15 ? 342  PRO B CD  1 
ATOM   1012 N N   A LYS B 2 102 ? 24.010 -14.216 1.490   0.43 31.10 ? 343  LYS B N   1 
ATOM   1013 N N   B LYS B 2 102 ? 24.007 -14.216 1.490   0.30 31.03 ? 343  LYS B N   1 
ATOM   1014 N N   C LYS B 2 102 ? 24.011 -14.199 1.511   0.27 30.94 ? 343  LYS B N   1 
ATOM   1015 C CA  A LYS B 2 102 ? 25.023 -13.157 1.528   0.43 31.22 ? 343  LYS B CA  1 
ATOM   1016 C CA  B LYS B 2 102 ? 25.023 -13.158 1.510   0.30 31.12 ? 343  LYS B CA  1 
ATOM   1017 C CA  C LYS B 2 102 ? 25.060 -13.183 1.597   0.27 30.93 ? 343  LYS B CA  1 
ATOM   1018 C C   A LYS B 2 102 ? 24.693 -12.062 2.545   0.43 31.39 ? 343  LYS B C   1 
ATOM   1019 C C   B LYS B 2 102 ? 24.699 -12.050 2.524   0.30 31.30 ? 343  LYS B C   1 
ATOM   1020 C C   C LYS B 2 102 ? 24.718 -12.002 2.524   0.27 31.19 ? 343  LYS B C   1 
ATOM   1021 O O   A LYS B 2 102 ? 25.552 -11.709 3.361   0.43 31.43 ? 343  LYS B O   1 
ATOM   1022 O O   B LYS B 2 102 ? 25.569 -11.679 3.317   0.30 31.32 ? 343  LYS B O   1 
ATOM   1023 O O   C LYS B 2 102 ? 25.598 -11.529 3.251   0.27 31.20 ? 343  LYS B O   1 
ATOM   1024 C CB  A LYS B 2 102 ? 25.226 -12.533 0.143   0.43 31.26 ? 343  LYS B CB  1 
ATOM   1025 C CB  B LYS B 2 102 ? 25.229 -12.578 0.099   0.30 31.13 ? 343  LYS B CB  1 
ATOM   1026 C CB  C LYS B 2 102 ? 25.498 -12.710 0.203   0.27 30.86 ? 343  LYS B CB  1 
ATOM   1027 C CG  A LYS B 2 102 ? 26.058 -13.351 -0.825  0.43 31.39 ? 343  LYS B CG  1 
ATOM   1028 C CG  B LYS B 2 102 ? 26.281 -11.469 -0.014  0.30 31.13 ? 343  LYS B CG  1 
ATOM   1029 C CG  C LYS B 2 102 ? 26.277 -13.761 -0.600  0.27 30.22 ? 343  LYS B CG  1 
ATOM   1030 C CD  A LYS B 2 102 ? 26.352 -12.534 -2.073  0.43 31.76 ? 343  LYS B CD  1 
ATOM   1031 C CD  B LYS B 2 102 ? 26.137 -10.723 -1.339  0.30 31.03 ? 343  LYS B CD  1 
ATOM   1032 C CD  C LYS B 2 102 ? 27.652 -14.042 0.006   0.27 29.30 ? 343  LYS B CD  1 
ATOM   1033 C CE  A LYS B 2 102 ? 26.883 -13.408 -3.193  0.43 31.93 ? 343  LYS B CE  1 
ATOM   1034 C CE  B LYS B 2 102 ? 26.968 -9.442  -1.379  0.30 30.85 ? 343  LYS B CE  1 
ATOM   1035 C CE  C LYS B 2 102 ? 28.346 -15.207 -0.681  0.27 28.62 ? 343  LYS B CE  1 
ATOM   1036 N NZ  A LYS B 2 102 ? 26.761 -12.724 -4.505  0.43 32.25 ? 343  LYS B NZ  1 
ATOM   1037 N NZ  B LYS B 2 102 ? 28.352 -9.663  -1.889  0.30 30.40 ? 343  LYS B NZ  1 
ATOM   1038 N NZ  C LYS B 2 102 ? 29.746 -15.385 -0.200  0.27 27.82 ? 343  LYS B NZ  1 
ATOM   1039 N N   . PRO B 2 103 ? 23.455 -11.516 2.505   1.00 31.23 ? 344  PRO B N   1 
ATOM   1040 C CA  . PRO B 2 103 ? 23.118 -10.443 3.458   1.00 31.24 ? 344  PRO B CA  1 
ATOM   1041 C C   . PRO B 2 103 ? 22.985 -10.908 4.899   1.00 31.14 ? 344  PRO B C   1 
ATOM   1042 O O   . PRO B 2 103 ? 22.741 -12.096 5.155   1.00 30.83 ? 344  PRO B O   1 
ATOM   1043 C CB  . PRO B 2 103 ? 21.753 -9.953  2.971   1.00 31.29 ? 344  PRO B CB  1 
ATOM   1044 C CG  . PRO B 2 103 ? 21.152 -11.119 2.305   1.00 31.65 ? 344  PRO B CG  1 
ATOM   1045 C CD  . PRO B 2 103 ? 22.292 -11.817 1.637   1.00 31.49 ? 344  PRO B CD  1 
ATOM   1046 N N   A ARG B 2 104 ? 23.146 -9.965  5.827   0.52 30.90 ? 345  ARG B N   1 
ATOM   1047 N N   B ARG B 2 104 ? 23.177 -9.974  5.828   0.48 30.99 ? 345  ARG B N   1 
ATOM   1048 C CA  A ARG B 2 104 ? 22.789 -10.178 7.219   0.52 30.80 ? 345  ARG B CA  1 
ATOM   1049 C CA  B ARG B 2 104 ? 22.854 -10.199 7.224   0.48 31.00 ? 345  ARG B CA  1 
ATOM   1050 C C   A ARG B 2 104 ? 21.266 -10.246 7.285   0.52 30.59 ? 345  ARG B C   1 
ATOM   1051 C C   B ARG B 2 104 ? 21.341 -10.111 7.322   0.48 30.77 ? 345  ARG B C   1 
ATOM   1052 O O   A ARG B 2 104 ? 20.595 -9.729  6.387   0.52 30.32 ? 345  ARG B O   1 
ATOM   1053 O O   B ARG B 2 104 ? 20.716 -9.374  6.565   0.48 30.69 ? 345  ARG B O   1 
ATOM   1054 C CB  A ARG B 2 104 ? 23.297 -9.027  8.095   0.52 31.00 ? 345  ARG B CB  1 
ATOM   1055 C CB  B ARG B 2 104 ? 23.501 -9.135  8.115   0.48 31.08 ? 345  ARG B CB  1 
ATOM   1056 C CG  A ARG B 2 104 ? 24.801 -8.758  8.019   0.52 31.66 ? 345  ARG B CG  1 
ATOM   1057 C CG  B ARG B 2 104 ? 25.010 -8.953  7.912   0.48 31.37 ? 345  ARG B CG  1 
ATOM   1058 C CD  A ARG B 2 104 ? 25.301 -8.056  9.277   0.52 32.73 ? 345  ARG B CD  1 
ATOM   1059 C CD  B ARG B 2 104 ? 25.559 -7.739  8.665   0.48 31.50 ? 345  ARG B CD  1 
ATOM   1060 N NE  A ARG B 2 104 ? 25.493 -9.009  10.371  0.52 33.95 ? 345  ARG B NE  1 
ATOM   1061 N NE  B ARG B 2 104 ? 24.807 -6.513  8.387   0.48 33.22 ? 345  ARG B NE  1 
ATOM   1062 C CZ  A ARG B 2 104 ? 25.860 -8.693  11.611  0.52 34.19 ? 345  ARG B CZ  1 
ATOM   1063 C CZ  B ARG B 2 104 ? 24.141 -5.808  9.301   0.48 33.59 ? 345  ARG B CZ  1 
ATOM   1064 N NH1 A ARG B 2 104 ? 26.078 -7.427  11.961  0.52 33.77 ? 345  ARG B NH1 1 
ATOM   1065 N NH1 B ARG B 2 104 ? 24.139 -6.185  10.575  0.48 33.69 ? 345  ARG B NH1 1 
ATOM   1066 N NH2 A ARG B 2 104 ? 26.002 -9.659  12.510  0.52 34.19 ? 345  ARG B NH2 1 
ATOM   1067 N NH2 B ARG B 2 104 ? 23.486 -4.710  8.941   0.48 33.44 ? 345  ARG B NH2 1 
ATOM   1068 N N   A PRO B 2 105 ? 20.708 -10.906 8.324   0.52 30.41 ? 346  PRO B N   1 
ATOM   1069 N N   B PRO B 2 105 ? 20.738 -10.885 8.234   0.48 30.60 ? 346  PRO B N   1 
ATOM   1070 C CA  A PRO B 2 105 ? 19.254 -10.823 8.531   0.52 30.27 ? 346  PRO B CA  1 
ATOM   1071 C CA  B PRO B 2 105 ? 19.288 -10.800 8.427   0.48 30.41 ? 346  PRO B CA  1 
ATOM   1072 C C   A PRO B 2 105 ? 18.775 -9.384  8.745   0.52 30.14 ? 346  PRO B C   1 
ATOM   1073 C C   B PRO B 2 105 ? 18.800 -9.370  8.686   0.48 30.23 ? 346  PRO B C   1 
ATOM   1074 O O   A PRO B 2 105 ? 17.638 -9.049  8.400   0.52 30.02 ? 346  PRO B O   1 
ATOM   1075 O O   B PRO B 2 105 ? 17.668 -9.030  8.327   0.48 30.09 ? 346  PRO B O   1 
ATOM   1076 C CB  A PRO B 2 105 ? 19.016 -11.672 9.792   0.52 30.37 ? 346  PRO B CB  1 
ATOM   1077 C CB  B PRO B 2 105 ? 19.047 -11.701 9.644   0.48 30.53 ? 346  PRO B CB  1 
ATOM   1078 C CG  A PRO B 2 105 ? 20.363 -11.809 10.444  0.52 30.17 ? 346  PRO B CG  1 
ATOM   1079 C CG  B PRO B 2 105 ? 20.174 -12.693 9.587   0.48 30.38 ? 346  PRO B CG  1 
ATOM   1080 C CD  A PRO B 2 105 ? 21.359 -11.776 9.323   0.52 30.33 ? 346  PRO B CD  1 
ATOM   1081 C CD  B PRO B 2 105 ? 21.358 -11.899 9.105   0.48 30.50 ? 346  PRO B CD  1 
ATOM   1082 N N   . GLU B 2 106 ? 19.653 -8.547  9.294   1.00 30.23 ? 347  GLU B N   1 
ATOM   1083 C CA  . GLU B 2 106 ? 19.350 -7.142  9.575   1.00 30.15 ? 347  GLU B CA  1 
ATOM   1084 C C   . GLU B 2 106 ? 19.167 -6.306  8.307   1.00 29.88 ? 347  GLU B C   1 
ATOM   1085 O O   . GLU B 2 106 ? 18.389 -5.351  8.295   1.00 29.68 ? 347  GLU B O   1 
ATOM   1086 C CB  . GLU B 2 106 ? 20.455 -6.526  10.431  1.00 30.47 ? 347  GLU B CB  1 
ATOM   1087 C CG  . GLU B 2 106 ? 20.480 -7.010  11.901  1.00 31.02 ? 347  GLU B CG  1 
ATOM   1088 C CD  . GLU B 2 106 ? 21.324 -8.252  12.120  1.00 31.13 ? 347  GLU B CD  1 
ATOM   1089 O OE1 . GLU B 2 106 ? 21.716 -8.926  11.138  1.00 29.39 ? 347  GLU B OE1 1 
ATOM   1090 O OE2 . GLU B 2 106 ? 21.602 -8.544  13.294  1.00 31.72 ? 347  GLU B OE2 1 
ATOM   1091 N N   . ASP B 2 107 ? 19.903 -6.659  7.257   1.00 29.70 ? 348  ASP B N   1 
ATOM   1092 C CA  . ASP B 2 107 ? 19.784 -6.007  5.948   1.00 29.57 ? 348  ASP B CA  1 
ATOM   1093 C C   . ASP B 2 107 ? 18.399 -6.179  5.358   1.00 29.04 ? 348  ASP B C   1 
ATOM   1094 O O   . ASP B 2 107 ? 17.885 -5.271  4.726   1.00 29.16 ? 348  ASP B O   1 
ATOM   1095 C CB  . ASP B 2 107 ? 20.823 -6.561  4.975   1.00 29.83 ? 348  ASP B CB  1 
ATOM   1096 C CG  . ASP B 2 107 ? 22.236 -6.269  5.411   1.00 30.57 ? 348  ASP B CG  1 
ATOM   1097 O OD1 . ASP B 2 107 ? 22.458 -5.203  6.018   1.00 32.97 ? 348  ASP B OD1 1 
ATOM   1098 O OD2 . ASP B 2 107 ? 23.124 -7.103  5.151   1.00 31.49 ? 348  ASP B OD2 1 
ATOM   1099 N N   A ILE B 2 108 ? 17.810 -7.349  5.566   0.89 28.97 ? 349  ILE B N   1 
ATOM   1100 N N   B ILE B 2 108 ? 17.808 -7.353  5.577   0.11 29.08 ? 349  ILE B N   1 
ATOM   1101 C CA  A ILE B 2 108 ? 16.433 -7.634  5.137   0.89 28.82 ? 349  ILE B CA  1 
ATOM   1102 C CA  B ILE B 2 108 ? 16.448 -7.656  5.128   0.11 28.97 ? 349  ILE B CA  1 
ATOM   1103 C C   A ILE B 2 108 ? 15.423 -6.829  5.960   0.89 28.59 ? 349  ILE B C   1 
ATOM   1104 C C   B ILE B 2 108 ? 15.434 -6.810  5.895   0.11 28.87 ? 349  ILE B C   1 
ATOM   1105 O O   A ILE B 2 108 ? 14.505 -6.203  5.401   0.89 28.20 ? 349  ILE B O   1 
ATOM   1106 O O   B ILE B 2 108 ? 14.593 -6.139  5.296   0.11 28.83 ? 349  ILE B O   1 
ATOM   1107 C CB  A ILE B 2 108 ? 16.123 -9.168  5.203   0.89 28.47 ? 349  ILE B CB  1 
ATOM   1108 C CB  B ILE B 2 108 ? 16.115 -9.171  5.285   0.11 28.95 ? 349  ILE B CB  1 
ATOM   1109 C CG1 A ILE B 2 108 ? 17.015 -9.942  4.213   0.89 29.10 ? 349  ILE B CG1 1 
ATOM   1110 C CG1 B ILE B 2 108 ? 17.117 -10.046 4.508   0.11 29.07 ? 349  ILE B CG1 1 
ATOM   1111 C CG2 A ILE B 2 108 ? 14.638 -9.457  4.975   0.89 27.91 ? 349  ILE B CG2 1 
ATOM   1112 C CG2 B ILE B 2 108 ? 14.666 -9.471  4.878   0.11 28.87 ? 349  ILE B CG2 1 
ATOM   1113 C CD1 A ILE B 2 108 ? 16.733 -9.686  2.711   0.89 26.61 ? 349  ILE B CD1 1 
ATOM   1114 C CD1 B ILE B 2 108 ? 17.157 -9.816  2.989   0.11 29.03 ? 349  ILE B CD1 1 
ATOM   1115 N N   A VAL B 2 109 ? 15.605 -6.845  7.285   0.89 28.44 ? 350  VAL B N   1 
ATOM   1116 N N   B VAL B 2 109 ? 15.523 -6.834  7.221   0.11 28.77 ? 350  VAL B N   1 
ATOM   1117 C CA  A VAL B 2 109 ? 14.767 -6.057  8.195   0.89 28.08 ? 350  VAL B CA  1 
ATOM   1118 C CA  B VAL B 2 109 ? 14.625 -6.025  8.046   0.11 28.63 ? 350  VAL B CA  1 
ATOM   1119 C C   A VAL B 2 109 ? 14.896 -4.558  7.901   0.89 27.82 ? 350  VAL B C   1 
ATOM   1120 C C   B VAL B 2 109 ? 14.863 -4.520  7.849   0.11 28.48 ? 350  VAL B C   1 
ATOM   1121 O O   A VAL B 2 109 ? 13.941 -3.809  8.048   0.89 27.65 ? 350  VAL B O   1 
ATOM   1122 O O   B VAL B 2 109 ? 13.945 -3.718  8.028   0.11 28.43 ? 350  VAL B O   1 
ATOM   1123 C CB  A VAL B 2 109 ? 15.057 -6.374  9.705   0.89 28.15 ? 350  VAL B CB  1 
ATOM   1124 C CB  B VAL B 2 109 ? 14.640 -6.454  9.555   0.11 28.68 ? 350  VAL B CB  1 
ATOM   1125 C CG1 A VAL B 2 109 ? 14.210 -5.488  10.616  0.89 27.52 ? 350  VAL B CG1 1 
ATOM   1126 C CG1 B VAL B 2 109 ? 16.015 -6.306  10.166  0.11 28.61 ? 350  VAL B CG1 1 
ATOM   1127 C CG2 A VAL B 2 109 ? 14.781 -7.839  10.005  0.89 26.18 ? 350  VAL B CG2 1 
ATOM   1128 C CG2 B VAL B 2 109 ? 13.599 -5.682  10.365  0.11 28.63 ? 350  VAL B CG2 1 
ATOM   1129 N N   . ASN B 2 110 ? 16.080 -4.143  7.459   1.00 28.29 ? 351  ASN B N   1 
ATOM   1130 C CA  . ASN B 2 110 ? 16.364 -2.740  7.123   1.00 28.48 ? 351  ASN B CA  1 
ATOM   1131 C C   . ASN B 2 110 ? 15.876 -2.331  5.719   1.00 28.81 ? 351  ASN B C   1 
ATOM   1132 O O   . ASN B 2 110 ? 16.120 -1.205  5.278   1.00 28.66 ? 351  ASN B O   1 
ATOM   1133 C CB  . ASN B 2 110 ? 17.851 -2.414  7.302   1.00 28.55 ? 351  ASN B CB  1 
ATOM   1134 C CG  . ASN B 2 110 ? 18.232 -2.150  8.758   1.00 29.44 ? 351  ASN B CG  1 
ATOM   1135 O OD1 . ASN B 2 110 ? 17.406 -1.715  9.567   1.00 30.86 ? 351  ASN B OD1 1 
ATOM   1136 N ND2 . ASN B 2 110 ? 19.498 -2.393  9.090   1.00 28.90 ? 351  ASN B ND2 1 
ATOM   1137 N N   . CYS B 2 111 ? 15.180 -3.245  5.041   1.00 28.85 ? 352  CYS B N   1 
ATOM   1138 C CA  . CYS B 2 111 ? 14.612 -3.016  3.715   1.00 30.01 ? 352  CYS B CA  1 
ATOM   1139 C C   . CYS B 2 111 ? 15.670 -2.722  2.660   1.00 29.72 ? 352  CYS B C   1 
ATOM   1140 O O   . CYS B 2 111 ? 15.418 -1.915  1.760   1.00 29.86 ? 352  CYS B O   1 
ATOM   1141 C CB  . CYS B 2 111 ? 13.572 -1.874  3.713   1.00 30.15 ? 352  CYS B CB  1 
ATOM   1142 S SG  . CYS B 2 111 ? 12.072 -2.143  4.695   1.00 33.75 ? 352  CYS B SG  1 
ATOM   1143 N N   . ASP B 2 112 ? 16.846 -3.342  2.770   1.00 29.38 ? 353  ASP B N   1 
ATOM   1144 C CA  . ASP B 2 112 ? 17.860 -3.182  1.730   1.00 29.58 ? 353  ASP B CA  1 
ATOM   1145 C C   . ASP B 2 112 ? 17.379 -3.979  0.516   1.00 29.06 ? 353  ASP B C   1 
ATOM   1146 O O   . ASP B 2 112 ? 17.218 -5.199  0.596   1.00 29.14 ? 353  ASP B O   1 
ATOM   1147 C CB  . ASP B 2 112 ? 19.239 -3.660  2.205   1.00 29.88 ? 353  ASP B CB  1 
ATOM   1148 C CG  . ASP B 2 112 ? 20.333 -3.438  1.159   0.98 30.86 ? 353  ASP B CG  1 
ATOM   1149 O OD1 . ASP B 2 112 ? 20.655 -2.274  0.850   0.98 34.76 ? 353  ASP B OD1 1 
ATOM   1150 O OD2 . ASP B 2 112 ? 20.890 -4.425  0.648   0.98 32.27 ? 353  ASP B OD2 1 
ATOM   1151 N N   . LEU B 2 113 ? 17.118 -3.279  -0.585  1.00 28.56 ? 354  LEU B N   1 
ATOM   1152 C CA  . LEU B 2 113 ? 16.483 -3.903  -1.753  1.00 28.17 ? 354  LEU B CA  1 
ATOM   1153 C C   . LEU B 2 113 ? 17.370 -4.938  -2.483  1.00 27.85 ? 354  LEU B C   1 
ATOM   1154 O O   . LEU B 2 113 ? 16.877 -5.979  -2.931  1.00 27.70 ? 354  LEU B O   1 
ATOM   1155 C CB  . LEU B 2 113 ? 15.964 -2.842  -2.728  1.00 28.06 ? 354  LEU B CB  1 
ATOM   1156 C CG  . LEU B 2 113 ? 15.218 -3.340  -3.978  1.00 27.97 ? 354  LEU B CG  1 
ATOM   1157 C CD1 . LEU B 2 113 ? 13.964 -4.130  -3.600  1.00 28.23 ? 354  LEU B CD1 1 
ATOM   1158 C CD2 . LEU B 2 113 ? 14.871 -2.184  -4.912  1.00 27.93 ? 354  LEU B CD2 1 
ATOM   1159 N N   A LYS B 2 114 ? 18.659 -4.619  -2.620  0.44 27.38 ? 355  LYS B N   1 
ATOM   1160 N N   B LYS B 2 114 ? 18.658 -4.632  -2.596  0.56 27.41 ? 355  LYS B N   1 
ATOM   1161 C CA  A LYS B 2 114 ? 19.648 -5.533  -3.189  0.44 27.20 ? 355  LYS B CA  1 
ATOM   1162 C CA  B LYS B 2 114 ? 19.619 -5.530  -3.207  0.56 27.35 ? 355  LYS B CA  1 
ATOM   1163 C C   A LYS B 2 114 ? 19.631 -6.852  -2.435  0.44 27.09 ? 355  LYS B C   1 
ATOM   1164 C C   B LYS B 2 114 ? 19.657 -6.849  -2.439  0.56 27.13 ? 355  LYS B C   1 
ATOM   1165 O O   A LYS B 2 114 ? 19.549 -7.918  -3.041  0.44 26.78 ? 355  LYS B O   1 
ATOM   1166 O O   B LYS B 2 114 ? 19.625 -7.919  -3.043  0.56 26.73 ? 355  LYS B O   1 
ATOM   1167 C CB  A LYS B 2 114 ? 21.054 -4.927  -3.114  0.44 27.14 ? 355  LYS B CB  1 
ATOM   1168 C CB  B LYS B 2 114 ? 20.998 -4.869  -3.225  0.56 27.37 ? 355  LYS B CB  1 
ATOM   1169 C CG  A LYS B 2 114 ? 21.471 -4.117  -4.320  0.44 26.90 ? 355  LYS B CG  1 
ATOM   1170 C CG  B LYS B 2 114 ? 21.917 -5.357  -4.316  0.56 27.62 ? 355  LYS B CG  1 
ATOM   1171 C CD  A LYS B 2 114 ? 22.735 -3.305  -4.037  0.44 27.10 ? 355  LYS B CD  1 
ATOM   1172 C CD  B LYS B 2 114 ? 23.208 -4.551  -4.359  0.56 29.35 ? 355  LYS B CD  1 
ATOM   1173 C CE  A LYS B 2 114 ? 23.439 -2.932  -5.331  0.44 27.63 ? 355  LYS B CE  1 
ATOM   1174 C CE  B LYS B 2 114 ? 23.026 -3.195  -5.021  0.56 29.64 ? 355  LYS B CE  1 
ATOM   1175 N NZ  A LYS B 2 114 ? 24.448 -1.838  -5.171  0.44 27.52 ? 355  LYS B NZ  1 
ATOM   1176 N NZ  B LYS B 2 114 ? 24.330 -2.493  -5.207  0.56 30.74 ? 355  LYS B NZ  1 
ATOM   1177 N N   . SER B 2 115 ? 19.704 -6.755  -1.104  1.00 27.26 ? 356  SER B N   1 
ATOM   1178 C CA  . SER B 2 115 ? 19.663 -7.922  -0.210  1.00 26.87 ? 356  SER B CA  1 
ATOM   1179 C C   . SER B 2 115 ? 18.374 -8.705  -0.374  1.00 26.69 ? 356  SER B C   1 
ATOM   1180 O O   . SER B 2 115 ? 18.383 -9.919  -0.401  1.00 26.39 ? 356  SER B O   1 
ATOM   1181 C CB  . SER B 2 115 ? 19.807 -7.497  1.256   1.00 26.60 ? 356  SER B CB  1 
ATOM   1182 O OG  . SER B 2 115 ? 21.025 -6.816  1.472   1.00 27.79 ? 356  SER B OG  1 
ATOM   1183 N N   . THR B 2 116 ? 17.263 -7.996  -0.489  1.00 27.30 ? 357  THR B N   1 
ATOM   1184 C CA  . THR B 2 116 ? 15.971 -8.642  -0.663  1.00 27.86 ? 357  THR B CA  1 
ATOM   1185 C C   . THR B 2 116 ? 15.931 -9.335  -2.027  1.00 27.86 ? 357  THR B C   1 
ATOM   1186 O O   . THR B 2 116 ? 15.470 -10.473 -2.123  1.00 28.20 ? 357  THR B O   1 
ATOM   1187 C CB  . THR B 2 116 ? 14.822 -7.631  -0.433  1.00 28.03 ? 357  THR B CB  1 
ATOM   1188 O OG1 . THR B 2 116 ? 14.993 -7.038  0.861   1.00 29.74 ? 357  THR B OG1 1 
ATOM   1189 C CG2 . THR B 2 116 ? 13.441 -8.297  -0.489  1.00 28.43 ? 357  THR B CG2 1 
ATOM   1190 N N   . LEU B 2 117 ? 16.468 -8.677  -3.060  1.00 27.32 ? 358  LEU B N   1 
ATOM   1191 C CA  . LEU B 2 117 ? 16.504 -9.271  -4.409  1.00 27.37 ? 358  LEU B CA  1 
ATOM   1192 C C   . LEU B 2 117 ? 17.369 -10.525 -4.506  1.00 27.04 ? 358  LEU B C   1 
ATOM   1193 O O   . LEU B 2 117 ? 16.995 -11.465 -5.184  1.00 27.10 ? 358  LEU B O   1 
ATOM   1194 C CB  . LEU B 2 117 ? 16.920 -8.252  -5.481  1.00 26.70 ? 358  LEU B CB  1 
ATOM   1195 C CG  . LEU B 2 117 ? 15.971 -7.072  -5.677  1.00 26.98 ? 358  LEU B CG  1 
ATOM   1196 C CD1 . LEU B 2 117 ? 16.461 -6.123  -6.771  1.00 26.30 ? 358  LEU B CD1 1 
ATOM   1197 C CD2 . LEU B 2 117 ? 14.559 -7.546  -5.969  1.00 27.16 ? 358  LEU B CD2 1 
ATOM   1198 N N   . ARG B 2 118 ? 18.513 -10.522 -3.823  1.00 26.93 ? 359  ARG B N   1 
ATOM   1199 C CA  . ARG B 2 118 ? 19.437 -11.655 -3.809  1.00 26.90 ? 359  ARG B CA  1 
ATOM   1200 C C   . ARG B 2 118 ? 18.807 -12.888 -3.177  1.00 27.20 ? 359  ARG B C   1 
ATOM   1201 O O   . ARG B 2 118 ? 18.872 -13.994 -3.733  1.00 27.13 ? 359  ARG B O   1 
ATOM   1202 C CB  . ARG B 2 118 ? 20.697 -11.297 -3.021  1.00 27.36 ? 359  ARG B CB  1 
ATOM   1203 C CG  . ARG B 2 118 ? 21.628 -10.339 -3.716  1.00 27.29 ? 359  ARG B CG  1 
ATOM   1204 C CD  . ARG B 2 118 ? 22.785 -9.947  -2.811  1.00 28.77 ? 359  ARG B CD  1 
ATOM   1205 N NE  . ARG B 2 118 ? 23.793 -9.200  -3.563  1.00 30.35 ? 359  ARG B NE  1 
ATOM   1206 C CZ  . ARG B 2 118 ? 24.232 -7.985  -3.247  1.00 31.37 ? 359  ARG B CZ  1 
ATOM   1207 N NH1 . ARG B 2 118 ? 23.792 -7.370  -2.154  1.00 32.71 ? 359  ARG B NH1 1 
ATOM   1208 N NH2 . ARG B 2 118 ? 25.138 -7.394  -4.012  1.00 32.73 ? 359  ARG B NH2 1 
ATOM   1209 N N   . VAL B 2 119 ? 18.218 -12.695 -1.997  1.00 27.05 ? 360  VAL B N   1 
ATOM   1210 C CA  . VAL B 2 119 ? 17.552 -13.781 -1.297  1.00 26.41 ? 360  VAL B CA  1 
ATOM   1211 C C   . VAL B 2 119 ? 16.454 -14.359 -2.195  1.00 26.72 ? 360  VAL B C   1 
ATOM   1212 O O   . VAL B 2 119 ? 16.434 -15.548 -2.446  1.00 26.52 ? 360  VAL B O   1 
ATOM   1213 C CB  . VAL B 2 119 ? 17.032 -13.339 0.121   1.00 26.19 ? 360  VAL B CB  1 
ATOM   1214 C CG1 . VAL B 2 119 ? 15.998 -14.321 0.691   1.00 24.11 ? 360  VAL B CG1 1 
ATOM   1215 C CG2 . VAL B 2 119 ? 18.193 -13.170 1.071   1.00 24.50 ? 360  VAL B CG2 1 
ATOM   1216 N N   . LEU B 2 120 ? 15.567 -13.507 -2.702  1.00 27.22 ? 361  LEU B N   1 
ATOM   1217 C CA  . LEU B 2 120 ? 14.443 -13.965 -3.520  1.00 27.49 ? 361  LEU B CA  1 
ATOM   1218 C C   . LEU B 2 120 ? 14.869 -14.633 -4.839  1.00 28.19 ? 361  LEU B C   1 
ATOM   1219 O O   . LEU B 2 120 ? 14.280 -15.624 -5.255  1.00 28.11 ? 361  LEU B O   1 
ATOM   1220 C CB  . LEU B 2 120 ? 13.452 -12.818 -3.760  1.00 27.18 ? 361  LEU B CB  1 
ATOM   1221 C CG  . LEU B 2 120 ? 12.716 -12.322 -2.508  1.00 26.64 ? 361  LEU B CG  1 
ATOM   1222 C CD1 . LEU B 2 120 ? 11.751 -11.218 -2.861  1.00 24.98 ? 361  LEU B CD1 1 
ATOM   1223 C CD2 . LEU B 2 120 ? 11.991 -13.437 -1.764  1.00 24.83 ? 361  LEU B CD2 1 
ATOM   1224 N N   . TYR B 2 121 ? 15.916 -14.110 -5.469  1.00 29.46 ? 362  TYR B N   1 
ATOM   1225 C CA  . TYR B 2 121 ? 16.428 -14.677 -6.709  1.00 29.92 ? 362  TYR B CA  1 
ATOM   1226 C C   . TYR B 2 121 ? 17.006 -16.081 -6.524  1.00 30.42 ? 362  TYR B C   1 
ATOM   1227 O O   . TYR B 2 121 ? 16.810 -16.954 -7.381  1.00 30.74 ? 362  TYR B O   1 
ATOM   1228 C CB  . TYR B 2 121 ? 17.450 -13.747 -7.367  1.00 30.35 ? 362  TYR B CB  1 
ATOM   1229 C CG  . TYR B 2 121 ? 18.040 -14.310 -8.652  1.00 31.27 ? 362  TYR B CG  1 
ATOM   1230 C CD1 . TYR B 2 121 ? 17.241 -14.536 -9.778  1.00 31.64 ? 362  TYR B CD1 1 
ATOM   1231 C CD2 . TYR B 2 121 ? 19.387 -14.639 -8.730  1.00 31.97 ? 362  TYR B CD2 1 
ATOM   1232 C CE1 . TYR B 2 121 ? 17.783 -15.060 -10.950 1.00 31.07 ? 362  TYR B CE1 1 
ATOM   1233 C CE2 . TYR B 2 121 ? 19.933 -15.165 -9.896  1.00 31.44 ? 362  TYR B CE2 1 
ATOM   1234 C CZ  . TYR B 2 121 ? 19.126 -15.373 -11.000 1.00 31.50 ? 362  TYR B CZ  1 
ATOM   1235 O OH  . TYR B 2 121 ? 19.678 -15.905 -12.160 1.00 33.87 ? 362  TYR B OH  1 
ATOM   1236 N N   . ASN B 2 122 ? 17.715 -16.293 -5.416  1.00 30.42 ? 363  ASN B N   1 
ATOM   1237 C CA  . ASN B 2 122 ? 18.294 -17.597 -5.115  1.00 30.82 ? 363  ASN B CA  1 
ATOM   1238 C C   . ASN B 2 122 ? 17.227 -18.652 -4.814  1.00 30.72 ? 363  ASN B C   1 
ATOM   1239 O O   . ASN B 2 122 ? 17.431 -19.831 -5.078  1.00 30.91 ? 363  ASN B O   1 
ATOM   1240 C CB  . ASN B 2 122 ? 19.319 -17.504 -3.972  1.00 31.03 ? 363  ASN B CB  1 
ATOM   1241 C CG  . ASN B 2 122 ? 20.604 -16.772 -4.375  1.00 31.58 ? 363  ASN B CG  1 
ATOM   1242 O OD1 . ASN B 2 122 ? 20.883 -16.585 -5.550  1.00 32.64 ? 363  ASN B OD1 1 
ATOM   1243 N ND2 . ASN B 2 122 ? 21.392 -16.368 -3.387  1.00 31.10 ? 363  ASN B ND2 1 
ATOM   1244 N N   . LEU B 2 123 ? 16.095 -18.220 -4.264  1.00 30.58 ? 364  LEU B N   1 
ATOM   1245 C CA  . LEU B 2 123 ? 14.925 -19.089 -4.104  1.00 30.83 ? 364  LEU B CA  1 
ATOM   1246 C C   . LEU B 2 123 ? 14.309 -19.369 -5.468  1.00 30.68 ? 364  LEU B C   1 
ATOM   1247 O O   . LEU B 2 123 ? 13.955 -20.500 -5.780  1.00 30.75 ? 364  LEU B O   1 
ATOM   1248 C CB  . LEU B 2 123 ? 13.879 -18.441 -3.200  1.00 30.15 ? 364  LEU B CB  1 
ATOM   1249 C CG  . LEU B 2 123 ? 14.239 -18.224 -1.732  1.00 30.91 ? 364  LEU B CG  1 
ATOM   1250 C CD1 . LEU B 2 123 ? 13.067 -17.606 -0.988  1.00 27.88 ? 364  LEU B CD1 1 
ATOM   1251 C CD2 . LEU B 2 123 ? 14.678 -19.549 -1.095  1.00 31.09 ? 364  LEU B CD2 1 
ATOM   1252 N N   . PHE B 2 124 ? 14.199 -18.320 -6.270  1.00 30.87 ? 365  PHE B N   1 
ATOM   1253 C CA  . PHE B 2 124 ? 13.693 -18.411 -7.636  1.00 31.46 ? 365  PHE B CA  1 
ATOM   1254 C C   . PHE B 2 124 ? 14.452 -19.454 -8.469  1.00 31.40 ? 365  PHE B C   1 
ATOM   1255 O O   . PHE B 2 124 ? 13.837 -20.274 -9.144  1.00 31.44 ? 365  PHE B O   1 
ATOM   1256 C CB  . PHE B 2 124 ? 13.749 -17.034 -8.302  1.00 31.43 ? 365  PHE B CB  1 
ATOM   1257 C CG  . PHE B 2 124 ? 13.432 -17.050 -9.769  1.00 32.70 ? 365  PHE B CG  1 
ATOM   1258 C CD1 . PHE B 2 124 ? 12.132 -16.815 -10.212 1.00 34.21 ? 365  PHE B CD1 1 
ATOM   1259 C CD2 . PHE B 2 124 ? 14.430 -17.286 -10.711 1.00 32.30 ? 365  PHE B CD2 1 
ATOM   1260 C CE1 . PHE B 2 124 ? 11.828 -16.822 -11.579 1.00 35.68 ? 365  PHE B CE1 1 
ATOM   1261 C CE2 . PHE B 2 124 ? 14.139 -17.299 -12.070 1.00 34.21 ? 365  PHE B CE2 1 
ATOM   1262 C CZ  . PHE B 2 124 ? 12.837 -17.069 -12.508 1.00 34.42 ? 365  PHE B CZ  1 
ATOM   1263 N N   A THR B 2 125 ? 15.783 -19.428 -8.417  0.47 31.25 ? 366  THR B N   1 
ATOM   1264 N N   B THR B 2 125 ? 15.778 -19.406 -8.392  0.53 31.44 ? 366  THR B N   1 
ATOM   1265 C CA  A THR B 2 125 ? 16.587 -20.364 -9.213  0.47 31.07 ? 366  THR B CA  1 
ATOM   1266 C CA  B THR B 2 125 ? 16.654 -20.292 -9.150  0.53 31.51 ? 366  THR B CA  1 
ATOM   1267 C C   A THR B 2 125 ? 16.591 -21.777 -8.643  0.47 31.28 ? 366  THR B C   1 
ATOM   1268 C C   B THR B 2 125 ? 16.598 -21.735 -8.637  0.53 31.50 ? 366  THR B C   1 
ATOM   1269 O O   A THR B 2 125 ? 16.597 -22.757 -9.399  0.47 31.06 ? 366  THR B O   1 
ATOM   1270 O O   B THR B 2 125 ? 16.548 -22.690 -9.426  0.53 31.32 ? 366  THR B O   1 
ATOM   1271 C CB  A THR B 2 125 ? 18.047 -19.893 -9.408  0.47 31.06 ? 366  THR B CB  1 
ATOM   1272 C CB  B THR B 2 125 ? 18.103 -19.732 -9.153  0.53 31.52 ? 366  THR B CB  1 
ATOM   1273 O OG1 A THR B 2 125 ? 18.670 -19.689 -8.135  0.47 30.20 ? 366  THR B OG1 1 
ATOM   1274 O OG1 B THR B 2 125 ? 18.201 -18.693 -10.137 0.53 31.92 ? 366  THR B OG1 1 
ATOM   1275 C CG2 A THR B 2 125 ? 18.093 -18.609 -10.224 0.47 31.09 ? 366  THR B CG2 1 
ATOM   1276 C CG2 B THR B 2 125 ? 19.121 -20.803 -9.473  0.53 31.99 ? 366  THR B CG2 1 
ATOM   1277 N N   . LYS B 2 126 ? 16.599 -21.889 -7.317  1.00 31.40 ? 367  LYS B N   1 
ATOM   1278 C CA  . LYS B 2 126 ? 16.516 -23.206 -6.696  1.00 31.67 ? 367  LYS B CA  1 
ATOM   1279 C C   . LYS B 2 126 ? 15.145 -23.858 -6.896  1.00 31.07 ? 367  LYS B C   1 
ATOM   1280 O O   . LYS B 2 126 ? 15.072 -25.042 -7.208  1.00 31.64 ? 367  LYS B O   1 
ATOM   1281 C CB  . LYS B 2 126 ? 16.900 -23.179 -5.210  1.00 32.14 ? 367  LYS B CB  1 
ATOM   1282 C CG  . LYS B 2 126 ? 16.707 -24.552 -4.555  1.00 34.57 ? 367  LYS B CG  1 
ATOM   1283 C CD  . LYS B 2 126 ? 17.764 -24.902 -3.536  1.00 37.23 ? 367  LYS B CD  1 
ATOM   1284 C CE  . LYS B 2 126 ? 17.644 -26.366 -3.160  1.00 38.60 ? 367  LYS B CE  1 
ATOM   1285 N NZ  . LYS B 2 126 ? 18.960 -26.902 -2.738  1.00 41.41 ? 367  LYS B NZ  1 
ATOM   1286 N N   . TYR B 2 127 ? 14.072 -23.086 -6.743  1.00 30.59 ? 368  TYR B N   1 
ATOM   1287 C CA  . TYR B 2 127 ? 12.724 -23.650 -6.682  1.00 29.78 ? 368  TYR B CA  1 
ATOM   1288 C C   . TYR B 2 127 ? 11.851 -23.292 -7.875  1.00 29.60 ? 368  TYR B C   1 
ATOM   1289 O O   . TYR B 2 127 ? 10.630 -23.286 -7.774  1.00 29.59 ? 368  TYR B O   1 
ATOM   1290 C CB  . TYR B 2 127 ? 12.027 -23.242 -5.379  1.00 30.08 ? 368  TYR B CB  1 
ATOM   1291 C CG  . TYR B 2 127 ? 12.711 -23.721 -4.117  1.00 30.09 ? 368  TYR B CG  1 
ATOM   1292 C CD1 . TYR B 2 127 ? 12.625 -25.056 -3.715  1.00 30.45 ? 368  TYR B CD1 1 
ATOM   1293 C CD2 . TYR B 2 127 ? 13.441 -22.840 -3.321  1.00 29.69 ? 368  TYR B CD2 1 
ATOM   1294 C CE1 . TYR B 2 127 ? 13.260 -25.503 -2.559  1.00 29.79 ? 368  TYR B CE1 1 
ATOM   1295 C CE2 . TYR B 2 127 ? 14.074 -23.278 -2.161  1.00 29.43 ? 368  TYR B CE2 1 
ATOM   1296 C CZ  . TYR B 2 127 ? 13.978 -24.606 -1.787  1.00 30.50 ? 368  TYR B CZ  1 
ATOM   1297 O OH  . TYR B 2 127 ? 14.600 -25.039 -0.635  1.00 31.20 ? 368  TYR B OH  1 
ATOM   1298 N N   . ARG B 2 128 ? 12.498 -23.035 -9.008  1.00 29.45 ? 369  ARG B N   1 
ATOM   1299 C CA  . ARG B 2 128 ? 11.860 -22.704 -10.280 1.00 29.36 ? 369  ARG B CA  1 
ATOM   1300 C C   . ARG B 2 128 ? 10.758 -23.687 -10.696 1.00 29.26 ? 369  ARG B C   1 
ATOM   1301 O O   . ARG B 2 128 ? 9.764  -23.285 -11.286 1.00 29.46 ? 369  ARG B O   1 
ATOM   1302 C CB  . ARG B 2 128 ? 12.945 -22.637 -11.364 1.00 29.31 ? 369  ARG B CB  1 
ATOM   1303 C CG  . ARG B 2 128 ? 12.484 -22.131 -12.715 1.00 30.34 ? 369  ARG B CG  1 
ATOM   1304 C CD  . ARG B 2 128 ? 13.528 -22.382 -13.790 1.00 29.76 ? 369  ARG B CD  1 
ATOM   1305 N NE  . ARG B 2 128 ? 14.814 -21.775 -13.449 1.00 29.32 ? 369  ARG B NE  1 
ATOM   1306 C CZ  . ARG B 2 128 ? 15.151 -20.524 -13.740 1.00 29.13 ? 369  ARG B CZ  1 
ATOM   1307 N NH1 . ARG B 2 128 ? 14.293 -19.736 -14.381 1.00 28.85 ? 369  ARG B NH1 1 
ATOM   1308 N NH2 . ARG B 2 128 ? 16.343 -20.063 -13.387 1.00 27.87 ? 369  ARG B NH2 1 
ATOM   1309 N N   . ASN B 2 129 ? 10.943 -24.969 -10.387 1.00 29.40 ? 370  ASN B N   1 
ATOM   1310 C CA  . ASN B 2 129 ? 10.022 -26.029 -10.822 1.00 29.42 ? 370  ASN B CA  1 
ATOM   1311 C C   . ASN B 2 129 ? 8.900  -26.408 -9.849  1.00 29.82 ? 370  ASN B C   1 
ATOM   1312 O O   . ASN B 2 129 ? 8.023  -27.196 -10.203 1.00 29.68 ? 370  ASN B O   1 
ATOM   1313 C CB  . ASN B 2 129 ? 10.808 -27.283 -11.211 1.00 29.14 ? 370  ASN B CB  1 
ATOM   1314 C CG  . ASN B 2 129 ? 11.850 -27.012 -12.276 1.00 28.28 ? 370  ASN B CG  1 
ATOM   1315 O OD1 . ASN B 2 129 ? 12.957 -27.544 -12.212 1.00 27.48 ? 370  ASN B OD1 1 
ATOM   1316 N ND2 . ASN B 2 129 ? 11.508 -26.173 -13.252 1.00 25.26 ? 370  ASN B ND2 1 
ATOM   1317 N N   . VAL B 2 130 ? 8.913  -25.851 -8.638  1.00 30.66 ? 371  VAL B N   1 
ATOM   1318 C CA  . VAL B 2 130 ? 7.843  -26.130 -7.674  1.00 31.40 ? 371  VAL B CA  1 
ATOM   1319 C C   . VAL B 2 130 ? 6.501  -25.595 -8.196  1.00 32.41 ? 371  VAL B C   1 
ATOM   1320 O O   . VAL B 2 130 ? 6.378  -24.419 -8.535  1.00 32.50 ? 371  VAL B O   1 
ATOM   1321 C CB  . VAL B 2 130 ? 8.158  -25.590 -6.255  1.00 31.15 ? 371  VAL B CB  1 
ATOM   1322 C CG1 . VAL B 2 130 ? 6.980  -25.841 -5.297  1.00 30.61 ? 371  VAL B CG1 1 
ATOM   1323 C CG2 . VAL B 2 130 ? 9.434  -26.230 -5.703  1.00 31.04 ? 371  VAL B CG2 1 
ATOM   1324 N N   . GLU B 2 131 ? 5.516  -26.482 -8.282  1.00 33.96 ? 372  GLU B N   1 
ATOM   1325 C CA  . GLU B 2 131 ? 4.196  -26.144 -8.812  1.00 35.64 ? 372  GLU B CA  1 
ATOM   1326 C C   . GLU B 2 131 ? 3.360  -25.401 -7.774  1.00 36.34 ? 372  GLU B C   1 
ATOM   1327 O O   . GLU B 2 131 ? 3.480  -25.671 -6.573  1.00 36.73 ? 372  GLU B O   1 
ATOM   1328 C CB  . GLU B 2 131 ? 3.467  -27.410 -9.261  1.00 35.96 ? 372  GLU B CB  1 
ATOM   1329 C CG  . GLU B 2 131 ? 4.032  -28.040 -10.533 1.00 38.03 ? 372  GLU B CG  1 
ATOM   1330 C CD  . GLU B 2 131 ? 3.834  -29.554 -10.594 1.00 40.53 ? 372  GLU B CD  1 
ATOM   1331 O OE1 . GLU B 2 131 ? 4.235  -30.259 -9.636  1.00 42.29 ? 372  GLU B OE1 1 
ATOM   1332 O OE2 . GLU B 2 131 ? 3.296  -30.045 -11.609 1.00 40.45 ? 372  GLU B OE2 1 
ATOM   1333 O OXT . GLU B 2 131 ? 2.555  -24.520 -8.110  1.00 36.84 ? 372  GLU B OXT 1 
HETATM 1334 O O1  . PG4 C 3 .   ? 6.742  -3.294  14.199  1.00 41.11 ? 1373 PG4 B O1  1 
HETATM 1335 C C1  . PG4 C 3 .   ? 7.806  -3.610  15.107  1.00 41.60 ? 1373 PG4 B C1  1 
HETATM 1336 C C2  . PG4 C 3 .   ? 8.831  -2.484  15.215  1.00 41.26 ? 1373 PG4 B C2  1 
HETATM 1337 O O2  . PG4 C 3 .   ? 9.597  -2.379  14.017  1.00 42.50 ? 1373 PG4 B O2  1 
HETATM 1338 C C3  . PG4 C 3 .   ? 11.002 -2.456  14.274  1.00 43.25 ? 1373 PG4 B C3  1 
HETATM 1339 C C4  . PG4 C 3 .   ? 11.837 -2.111  13.038  1.00 44.31 ? 1373 PG4 B C4  1 
HETATM 1340 O O3  . PG4 C 3 .   ? 11.529 -2.958  11.928  1.00 44.99 ? 1373 PG4 B O3  1 
HETATM 1341 C C5  . PG4 C 3 .   ? 10.827 -2.246  10.905  1.00 45.70 ? 1373 PG4 B C5  1 
HETATM 1342 C C6  . PG4 C 3 .   ? 11.152 -2.785  9.515   1.00 45.79 ? 1373 PG4 B C6  1 
HETATM 1343 O O4  . PG4 C 3 .   ? 10.241 -3.818  9.139   1.00 46.12 ? 1373 PG4 B O4  1 
HETATM 1344 C C7  . PG4 C 3 .   ? 9.026  -3.316  8.589   1.00 45.86 ? 1373 PG4 B C7  1 
HETATM 1345 C C8  . PG4 C 3 .   ? 8.055  -4.477  8.450   1.00 45.86 ? 1373 PG4 B C8  1 
HETATM 1346 O O5  . PG4 C 3 .   ? 6.985  -4.327  9.386   1.00 46.27 ? 1373 PG4 B O5  1 
HETATM 1347 C C1  . EDO D 4 .   ? 8.883  -20.556 -9.999  1.00 44.50 ? 1374 EDO B C1  1 
HETATM 1348 O O1  . EDO D 4 .   ? 8.499  -20.010 -11.265 1.00 44.55 ? 1374 EDO B O1  1 
HETATM 1349 C C2  . EDO D 4 .   ? 7.865  -21.600 -9.550  1.00 43.69 ? 1374 EDO B C2  1 
HETATM 1350 O O2  . EDO D 4 .   ? 8.238  -22.198 -8.306  1.00 41.01 ? 1374 EDO B O2  1 
HETATM 1351 C C1  . PGE E 5 .   ? 1.676  -10.308 9.738   1.00 61.45 ? 1375 PGE B C1  1 
HETATM 1352 O O1  . PGE E 5 .   ? 2.520  -9.480  10.548  1.00 61.34 ? 1375 PGE B O1  1 
HETATM 1353 C C2  . PGE E 5 .   ? 2.409  -10.755 8.474   1.00 61.89 ? 1375 PGE B C2  1 
HETATM 1354 O O2  . PGE E 5 .   ? 3.229  -9.715  7.937   1.00 61.72 ? 1375 PGE B O2  1 
HETATM 1355 C C3  . PGE E 5 .   ? 2.861  -9.429  6.591   1.00 62.70 ? 1375 PGE B C3  1 
HETATM 1356 C C4  . PGE E 5 .   ? 4.042  -8.862  5.808   1.00 63.22 ? 1375 PGE B C4  1 
HETATM 1357 O O4  . PGE E 5 .   ? 1.016  -6.306  5.301   1.00 66.64 ? 1375 PGE B O4  1 
HETATM 1358 C C6  . PGE E 5 .   ? 2.009  -6.237  4.269   1.00 65.61 ? 1375 PGE B C6  1 
HETATM 1359 C C5  . PGE E 5 .   ? 2.819  -7.531  4.235   1.00 65.04 ? 1375 PGE B C5  1 
HETATM 1360 O O3  . PGE E 5 .   ? 3.747  -7.549  5.325   1.00 64.38 ? 1375 PGE B O3  1 
HETATM 1361 C C1  . EDO F 4 .   ? 19.645 -16.537 -0.015  1.00 25.75 ? 1376 EDO B C1  1 
HETATM 1362 O O1  . EDO F 4 .   ? 20.774 -16.470 -0.867  1.00 25.58 ? 1376 EDO B O1  1 
HETATM 1363 C C2  . EDO F 4 .   ? 18.793 -17.697 -0.479  1.00 25.87 ? 1376 EDO B C2  1 
HETATM 1364 O O2  . EDO F 4 .   ? 17.622 -17.162 -1.082  1.00 23.23 ? 1376 EDO B O2  1 
HETATM 1365 C C1  . PGE G 5 .   ? 15.588 -28.691 12.257  1.00 65.53 ? 1377 PGE B C1  1 
HETATM 1366 O O1  . PGE G 5 .   ? 16.753 -28.931 13.059  1.00 63.93 ? 1377 PGE B O1  1 
HETATM 1367 C C2  . PGE G 5 .   ? 15.828 -29.154 10.823  1.00 65.50 ? 1377 PGE B C2  1 
HETATM 1368 O O2  . PGE G 5 .   ? 14.713 -29.923 10.362  1.00 66.32 ? 1377 PGE B O2  1 
HETATM 1369 C C3  . PGE G 5 .   ? 14.710 -30.102 8.940   1.00 65.98 ? 1377 PGE B C3  1 
HETATM 1370 C C4  . PGE G 5 .   ? 13.467 -29.480 8.299   1.00 65.10 ? 1377 PGE B C4  1 
HETATM 1371 O O4  . PGE G 5 .   ? 9.890  -27.180 10.384  1.00 61.32 ? 1377 PGE B O4  1 
HETATM 1372 C C6  . PGE G 5 .   ? 11.307 -27.368 10.338  1.00 62.39 ? 1377 PGE B C6  1 
HETATM 1373 C C5  . PGE G 5 .   ? 11.679 -28.134 9.072   1.00 63.37 ? 1377 PGE B C5  1 
HETATM 1374 O O3  . PGE G 5 .   ? 13.100 -28.266 8.962   1.00 64.17 ? 1377 PGE B O3  1 
HETATM 1375 O O   . HOH H 6 .   ? 8.015  -15.923 -12.114 1.00 23.00 ? 2001 HOH B O   1 
HETATM 1376 O O   . HOH H 6 .   ? 1.949  -15.684 -9.701  1.00 29.12 ? 2002 HOH B O   1 
HETATM 1377 O O   . HOH H 6 .   ? 2.001  -11.515 -8.984  1.00 25.35 ? 2003 HOH B O   1 
HETATM 1378 O O   . HOH H 6 .   ? 3.961  -23.778 -3.385  1.00 30.75 ? 2004 HOH B O   1 
HETATM 1379 O O   . HOH H 6 .   ? -3.976 -17.007 5.451   1.00 15.11 ? 2005 HOH B O   1 
HETATM 1380 O O   . HOH H 6 .   ? -4.474 -12.713 4.052   1.00 16.42 ? 2006 HOH B O   1 
HETATM 1381 O O   . HOH H 6 .   ? 8.572  -4.318  -5.736  1.00 27.23 ? 2007 HOH B O   1 
HETATM 1382 O O   . HOH H 6 .   ? 9.484  -11.797 5.036   1.00 16.15 ? 2008 HOH B O   1 
HETATM 1383 O O   . HOH H 6 .   ? 11.021 -6.278  2.072   1.00 17.69 ? 2009 HOH B O   1 
HETATM 1384 O O   . HOH H 6 .   ? 7.095  -10.760 5.547   1.00 8.81  ? 2010 HOH B O   1 
HETATM 1385 O O   . HOH H 6 .   ? 7.451  -6.796  6.302   1.00 20.69 ? 2011 HOH B O   1 
HETATM 1386 O O   . HOH H 6 .   ? 5.090  -6.742  10.858  1.00 27.63 ? 2012 HOH B O   1 
HETATM 1387 O O   . HOH H 6 .   ? 4.388  -22.405 4.991   1.00 30.64 ? 2013 HOH B O   1 
HETATM 1388 O O   . HOH H 6 .   ? 15.920 -30.273 0.601   1.00 41.25 ? 2014 HOH B O   1 
HETATM 1389 O O   . HOH H 6 .   ? 3.410  -23.048 7.155   1.00 32.82 ? 2015 HOH B O   1 
HETATM 1390 O O   . HOH H 6 .   ? 1.454  -23.886 14.673  1.00 40.45 ? 2016 HOH B O   1 
HETATM 1391 O O   . HOH H 6 .   ? 2.872  -23.864 16.949  1.00 39.70 ? 2017 HOH B O   1 
HETATM 1392 O O   . HOH H 6 .   ? 1.142  -10.716 19.028  1.00 32.25 ? 2018 HOH B O   1 
HETATM 1393 O O   . HOH H 6 .   ? 9.486  -7.270  22.168  1.00 33.12 ? 2019 HOH B O   1 
HETATM 1394 O O   . HOH H 6 .   ? 12.356 -2.498  18.282  1.00 41.93 ? 2020 HOH B O   1 
HETATM 1395 O O   . HOH H 6 .   ? 5.486  -10.971 18.860  1.00 40.27 ? 2021 HOH B O   1 
HETATM 1396 O O   . HOH H 6 .   ? 20.308 -18.182 10.212  1.00 22.19 ? 2022 HOH B O   1 
HETATM 1397 O O   . HOH H 6 .   ? 10.453 -4.751  22.549  1.00 35.49 ? 2023 HOH B O   1 
HETATM 1398 O O   . HOH H 6 .   ? 23.262 -22.112 -2.816  1.00 28.54 ? 2024 HOH B O   1 
HETATM 1399 O O   . HOH H 6 .   ? 24.603 -17.115 -0.680  1.00 31.81 ? 2025 HOH B O   1 
HETATM 1400 O O   . HOH H 6 .   ? 27.437 -21.850 2.808   1.00 27.42 ? 2026 HOH B O   1 
HETATM 1401 O O   . HOH H 6 .   ? 23.576 -14.490 5.941   1.00 21.10 ? 2027 HOH B O   1 
HETATM 1402 O O   . HOH H 6 .   ? 20.471 -1.225  4.534   1.00 35.31 ? 2028 HOH B O   1 
HETATM 1403 O O   . HOH H 6 .   ? 23.570 -10.684 11.814  1.00 32.66 ? 2029 HOH B O   1 
HETATM 1404 O O   . HOH H 6 .   ? 21.308 -2.777  6.631   1.00 24.05 ? 2030 HOH B O   1 
HETATM 1405 O O   . HOH H 6 .   ? 13.547 -6.483  2.952   1.00 10.41 ? 2031 HOH B O   1 
HETATM 1406 O O   . HOH H 6 .   ? 18.113 -0.382  3.595   1.00 34.68 ? 2032 HOH B O   1 
HETATM 1407 O O   . HOH H 6 .   ? 23.579 -8.264  0.486   1.00 28.88 ? 2033 HOH B O   1 
HETATM 1408 O O   . HOH H 6 .   ? 23.551 -13.862 -3.261  1.00 24.28 ? 2034 HOH B O   1 
HETATM 1409 O O   . HOH H 6 .   ? 13.022 -26.369 -8.732  1.00 23.40 ? 2035 HOH B O   1 
HETATM 1410 O O   . HOH H 6 .   ? 16.999 -22.961 -12.273 1.00 25.94 ? 2036 HOH B O   1 
HETATM 1411 O O   . HOH H 6 .   ? 6.980  -17.881 -11.197 1.00 19.03 ? 2037 HOH B O   1 
HETATM 1412 O O   . HOH H 6 .   ? 22.116 -18.744 -0.793  1.00 23.42 ? 2038 HOH B O   1 
HETATM 1413 O O   . HOH H 6 .   ? 22.207 -14.229 -0.831  1.00 21.30 ? 2039 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   THR 2   2   2   THR THR A . n 
A 1 3   ARG 3   3   3   ARG ARG A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   LEU 5   5   5   LEU LEU A . n 
A 1 6   ASP 6   6   6   ASP ASP A . n 
A 1 7   GLU 7   7   7   GLU GLU A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   MET 9   9   9   MET MET A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  SER 13  13  13  SER SER A . n 
A 1 14  ASP 14  14  ?   ?   ?   A . n 
A 1 15  PHE 15  15  ?   ?   ?   A . n 
A 1 16  LYS 16  16  ?   ?   ?   A . n 
A 1 17  PHE 17  17  ?   ?   ?   A . n 
A 1 18  MET 18  18  ?   ?   ?   A . n 
A 1 19  ALA 19  19  ?   ?   ?   A . n 
A 1 20  GLN 20  20  ?   ?   ?   A . n 
B 2 1   SER 1   242 ?   ?   ?   B . n 
B 2 2   GLY 2   243 ?   ?   ?   B . n 
B 2 3   ARG 3   244 ?   ?   ?   B . n 
B 2 4   HIS 4   245 ?   ?   ?   B . n 
B 2 5   GLU 5   246 ?   ?   ?   B . n 
B 2 6   ARG 6   247 247 ARG ARG B . n 
B 2 7   ASP 7   248 248 ASP ASP B . n 
B 2 8   ALA 8   249 249 ALA ALA B . n 
B 2 9   PHE 9   250 250 PHE PHE B . n 
B 2 10  ASP 10  251 251 ASP ASP B . n 
B 2 11  THR 11  252 252 THR THR B . n 
B 2 12  LEU 12  253 253 LEU LEU B . n 
B 2 13  PHE 13  254 254 PHE PHE B . n 
B 2 14  ASP 14  255 255 ASP ASP B . n 
B 2 15  HIS 15  256 256 HIS HIS B . n 
B 2 16  ALA 16  257 257 ALA ALA B . n 
B 2 17  PRO 17  258 258 PRO PRO B . n 
B 2 18  ASP 18  259 259 ASP ASP B . n 
B 2 19  LYS 19  260 260 LYS LYS B . n 
B 2 20  LEU 20  261 261 LEU LEU B . n 
B 2 21  ASN 21  262 262 ASN ASN B . n 
B 2 22  VAL 22  263 263 VAL VAL B . n 
B 2 23  VAL 23  264 264 VAL VAL B . n 
B 2 24  LYS 24  265 265 LYS LYS B . n 
B 2 25  LYS 25  266 266 LYS LYS B . n 
B 2 26  THR 26  267 267 THR THR B . n 
B 2 27  LEU 27  268 268 LEU LEU B . n 
B 2 28  ILE 28  269 269 ILE ILE B . n 
B 2 29  THR 29  270 270 THR THR B . n 
B 2 30  PHE 30  271 271 PHE PHE B . n 
B 2 31  VAL 31  272 272 VAL VAL B . n 
B 2 32  ASN 32  273 273 ASN ASN B . n 
B 2 33  LYS 33  274 274 LYS LYS B . n 
B 2 34  HIS 34  275 275 HIS HIS B . n 
B 2 35  LEU 35  276 276 LEU LEU B . n 
B 2 36  ASN 36  277 277 ASN ASN B . n 
B 2 37  LYS 37  278 278 LYS LYS B . n 
B 2 38  LEU 38  279 279 LEU LEU B . n 
B 2 39  ASN 39  280 280 ASN ASN B . n 
B 2 40  LEU 40  281 281 LEU LEU B . n 
B 2 41  GLU 41  282 282 GLU GLU B . n 
B 2 42  VAL 42  283 283 VAL VAL B . n 
B 2 43  THR 43  284 284 THR THR B . n 
B 2 44  GLU 44  285 285 GLU GLU B . n 
B 2 45  LEU 45  286 286 LEU LEU B . n 
B 2 46  GLU 46  287 287 GLU GLU B . n 
B 2 47  THR 47  288 288 THR THR B . n 
B 2 48  GLN 48  289 289 GLN GLN B . n 
B 2 49  PHE 49  290 290 PHE PHE B . n 
B 2 50  ALA 50  291 291 ALA ALA B . n 
B 2 51  ASP 51  292 292 ASP ASP B . n 
B 2 52  GLY 52  293 293 GLY GLY B . n 
B 2 53  VAL 53  294 294 VAL VAL B . n 
B 2 54  TYR 54  295 295 TYR TYR B . n 
B 2 55  LEU 55  296 296 LEU LEU B . n 
B 2 56  VAL 56  297 297 VAL VAL B . n 
B 2 57  LEU 57  298 298 LEU LEU B . n 
B 2 58  LEU 58  299 299 LEU LEU B . n 
B 2 59  MET 59  300 300 MET MET B . n 
B 2 60  GLY 60  301 301 GLY GLY B . n 
B 2 61  LEU 61  302 302 LEU LEU B . n 
B 2 62  LEU 62  303 303 LEU LEU B . n 
B 2 63  GLU 63  304 304 GLU GLU B . n 
B 2 64  GLY 64  305 305 GLY GLY B . n 
B 2 65  TYR 65  306 306 TYR TYR B . n 
B 2 66  PHE 66  307 307 PHE PHE B . n 
B 2 67  VAL 67  308 308 VAL VAL B . n 
B 2 68  PRO 68  309 309 PRO PRO B . n 
B 2 69  LEU 69  310 310 LEU LEU B . n 
B 2 70  HIS 70  311 311 HIS HIS B . n 
B 2 71  SER 71  312 312 SER SER B . n 
B 2 72  PHE 72  313 313 PHE PHE B . n 
B 2 73  PHE 73  314 314 PHE PHE B . n 
B 2 74  LEU 74  315 315 LEU LEU B . n 
B 2 75  THR 75  316 316 THR THR B . n 
B 2 76  PRO 76  317 317 PRO PRO B . n 
B 2 77  ASP 77  318 318 ASP ASP B . n 
B 2 78  SER 78  319 319 SER SER B . n 
B 2 79  PHE 79  320 320 PHE PHE B . n 
B 2 80  GLU 80  321 321 GLU GLU B . n 
B 2 81  GLN 81  322 322 GLN GLN B . n 
B 2 82  LYS 82  323 323 LYS LYS B . n 
B 2 83  VAL 83  324 324 VAL VAL B . n 
B 2 84  LEU 84  325 325 LEU LEU B . n 
B 2 85  ASN 85  326 326 ASN ASN B . n 
B 2 86  VAL 86  327 327 VAL VAL B . n 
B 2 87  SER 87  328 328 SER SER B . n 
B 2 88  PHE 88  329 329 PHE PHE B . n 
B 2 89  ALA 89  330 330 ALA ALA B . n 
B 2 90  PHE 90  331 331 PHE PHE B . n 
B 2 91  GLU 91  332 332 GLU GLU B . n 
B 2 92  LEU 92  333 333 LEU LEU B . n 
B 2 93  MET 93  334 334 MET MET B . n 
B 2 94  GLN 94  335 335 GLN GLN B . n 
B 2 95  ASP 95  336 336 ASP ASP B . n 
B 2 96  GLY 96  337 337 GLY GLY B . n 
B 2 97  GLY 97  338 338 GLY GLY B . n 
B 2 98  LEU 98  339 339 LEU LEU B . n 
B 2 99  GLU 99  340 340 GLU GLU B . n 
B 2 100 LYS 100 341 341 LYS LYS B . n 
B 2 101 PRO 101 342 342 PRO PRO B . n 
B 2 102 LYS 102 343 343 LYS LYS B . n 
B 2 103 PRO 103 344 344 PRO PRO B . n 
B 2 104 ARG 104 345 345 ARG ARG B . n 
B 2 105 PRO 105 346 346 PRO PRO B . n 
B 2 106 GLU 106 347 347 GLU GLU B . n 
B 2 107 ASP 107 348 348 ASP ASP B . n 
B 2 108 ILE 108 349 349 ILE ILE B . n 
B 2 109 VAL 109 350 350 VAL VAL B . n 
B 2 110 ASN 110 351 351 ASN ASN B . n 
B 2 111 CYS 111 352 352 CYS CYS B . n 
B 2 112 ASP 112 353 353 ASP ASP B . n 
B 2 113 LEU 113 354 354 LEU LEU B . n 
B 2 114 LYS 114 355 355 LYS LYS B . n 
B 2 115 SER 115 356 356 SER SER B . n 
B 2 116 THR 116 357 357 THR THR B . n 
B 2 117 LEU 117 358 358 LEU LEU B . n 
B 2 118 ARG 118 359 359 ARG ARG B . n 
B 2 119 VAL 119 360 360 VAL VAL B . n 
B 2 120 LEU 120 361 361 LEU LEU B . n 
B 2 121 TYR 121 362 362 TYR TYR B . n 
B 2 122 ASN 122 363 363 ASN ASN B . n 
B 2 123 LEU 123 364 364 LEU LEU B . n 
B 2 124 PHE 124 365 365 PHE PHE B . n 
B 2 125 THR 125 366 366 THR THR B . n 
B 2 126 LYS 126 367 367 LYS LYS B . n 
B 2 127 TYR 127 368 368 TYR TYR B . n 
B 2 128 ARG 128 369 369 ARG ARG B . n 
B 2 129 ASN 129 370 370 ASN ASN B . n 
B 2 130 VAL 130 371 371 VAL VAL B . n 
B 2 131 GLU 131 372 372 GLU GLU B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 PG4 1  1373 1373 PG4 PG4 B . 
D 4 EDO 1  1374 1374 EDO EDO B . 
E 5 PGE 1  1375 1375 PGE PGE B . 
F 4 EDO 1  1376 1376 EDO EDO B . 
G 5 PGE 1  1377 1377 PGE PGE B . 
H 6 HOH 1  2001 2001 HOH HOH B . 
H 6 HOH 2  2002 2002 HOH HOH B . 
H 6 HOH 3  2003 2003 HOH HOH B . 
H 6 HOH 4  2004 2004 HOH HOH B . 
H 6 HOH 5  2005 2005 HOH HOH B . 
H 6 HOH 6  2006 2006 HOH HOH B . 
H 6 HOH 7  2007 2007 HOH HOH B . 
H 6 HOH 8  2008 2008 HOH HOH B . 
H 6 HOH 9  2009 2009 HOH HOH B . 
H 6 HOH 10 2010 2010 HOH HOH B . 
H 6 HOH 11 2011 2011 HOH HOH B . 
H 6 HOH 12 2012 2012 HOH HOH B . 
H 6 HOH 13 2013 2013 HOH HOH B . 
H 6 HOH 14 2014 2014 HOH HOH B . 
H 6 HOH 15 2015 2015 HOH HOH B . 
H 6 HOH 16 2016 2016 HOH HOH B . 
H 6 HOH 17 2017 2017 HOH HOH B . 
H 6 HOH 18 2018 2018 HOH HOH B . 
H 6 HOH 19 2019 2019 HOH HOH B . 
H 6 HOH 20 2020 2020 HOH HOH B . 
H 6 HOH 21 2021 2021 HOH HOH B . 
H 6 HOH 22 2022 2022 HOH HOH B . 
H 6 HOH 23 2023 2023 HOH HOH B . 
H 6 HOH 24 2024 2024 HOH HOH B . 
H 6 HOH 25 2025 2025 HOH HOH B . 
H 6 HOH 26 2026 2026 HOH HOH B . 
H 6 HOH 27 2027 2027 HOH HOH B . 
H 6 HOH 28 2028 2028 HOH HOH B . 
H 6 HOH 29 2029 2029 HOH HOH B . 
H 6 HOH 30 2030 2030 HOH HOH B . 
H 6 HOH 31 2031 2031 HOH HOH B . 
H 6 HOH 32 2032 2032 HOH HOH B . 
H 6 HOH 33 2033 2033 HOH HOH B . 
H 6 HOH 34 2034 2034 HOH HOH B . 
H 6 HOH 35 2035 2035 HOH HOH B . 
H 6 HOH 36 2036 2036 HOH HOH B . 
H 6 HOH 37 2037 2037 HOH HOH B . 
H 6 HOH 38 2038 2038 HOH HOH B . 
H 6 HOH 39 2039 2039 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1160  ? 
1 MORE         -12.9 ? 
1 'SSA (A^2)'  9550  ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-10-28 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2012-05-30 
4 'Structure model' 1 3 2019-04-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' Other                       
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Database references'       
6 4 'Structure model' 'Experimental preparation'  
7 4 'Structure model' Other                       
8 4 'Structure model' 'Source and taxonomy'       
9 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' citation             
2  4 'Structure model' citation_author      
3  4 'Structure model' entity               
4  4 'Structure model' entity_name_com      
5  4 'Structure model' entity_src_gen       
6  4 'Structure model' exptl_crystal_grow   
7  4 'Structure model' pdbx_database_proc   
8  4 'Structure model' pdbx_database_status 
9  4 'Structure model' pdbx_entity_src_syn  
10 4 'Structure model' struct_biol          
11 4 'Structure model' struct_ref           
12 4 'Structure model' struct_ref_seq       
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_citation.page_last'                         
2  4 'Structure model' '_citation.pdbx_database_id_DOI'              
3  4 'Structure model' '_citation.title'                             
4  4 'Structure model' '_citation_author.name'                       
5  4 'Structure model' '_entity.pdbx_description'                    
6  4 'Structure model' '_entity.pdbx_fragment'                       
7  4 'Structure model' '_entity.src_method'                          
8  4 'Structure model' '_entity_name_com.name'                       
9  4 'Structure model' '_exptl_crystal_grow.method'                  
10 4 'Structure model' '_exptl_crystal_grow.temp'                    
11 4 'Structure model' '_pdbx_database_status.recvd_author_approval' 
12 4 'Structure model' '_struct_ref_seq.ref_id'                      
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 12.7620 -13.5570 0.5910   -0.1856 -0.1830 -0.1916 0.0200 -0.0052 0.0055 2.8449  2.9152  4.0816 
-0.6744 -0.2849 0.3094 0.0378 0.2252  -0.0782 0.0540  -0.1091 -0.0250 -0.1666 -0.0229 0.0714 
'X-RAY DIFFRACTION' 2 ? refined 18.6920 -12.8100 -17.5570 0.1477  0.1657  -0.1252 0.2406 0.1033  0.0807 17.5981 24.6280 9.7863 
-6.1078 0.4524  0.5423 0.2045 -0.5549 -0.2725 -1.5900 -0.4823 -0.5034 -0.2463 0.3778  0.2777 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 B 247 ? ? B 372 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 7   ? ? A 13  ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
REFMAC refinement       5.2.0019 ? 1 ? ? ? ? 
MOSFLM 'data reduction' .        ? 2 ? ? ? ? 
SCALA  'data scaling'   .        ? 3 ? ? ? ? 
PHASER phasing          .        ? 4 ? ? ? ? 
# 
_pdbx_entry_details.entry_id             2VZI 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;LD4 MOTIF OF PAXILLIN ISOFORM BETA (EXCLUDING RESIDUES
278-311 OF UNIPROT ENTRY P49023 PROTEIN SEQUENCE)
;
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 14  ? A ASP 14 
2  1 Y 1 A PHE 15  ? A PHE 15 
3  1 Y 1 A LYS 16  ? A LYS 16 
4  1 Y 1 A PHE 17  ? A PHE 17 
5  1 Y 1 A MET 18  ? A MET 18 
6  1 Y 1 A ALA 19  ? A ALA 19 
7  1 Y 1 A GLN 20  ? A GLN 20 
8  1 Y 1 B SER 242 ? B SER 1  
9  1 Y 1 B GLY 243 ? B GLY 2  
10 1 Y 1 B ARG 244 ? B ARG 3  
11 1 Y 1 B HIS 245 ? B HIS 4  
12 1 Y 1 B GLU 246 ? B GLU 5  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'TETRAETHYLENE GLYCOL' PG4 
4 1,2-ETHANEDIOL         EDO 
5 'TRIETHYLENE GLYCOL'   PGE 
6 water                  HOH 
#