data_2W2N
# 
_entry.id   2W2N 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2W2N         
PDBE  EBI-37851    
WWPDB D_1290037851 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1F5Y unspecified 'NMR STRUCTURE OF A CONCATEMER OF THE FIRST AND SECOND LIGAND-BINDING MODULES OF THE HUMAN LDL RECEPTOR' 
PDB 1HJ7 unspecified 'NMR STUDY OF A PAIR OF LDL RECEPTOR CA ==2+== BINDING EPIDERMAL GROWTH FACTOR-LIKE DOMAINS, 20 STRUCTURES' 
PDB 1N7D unspecified 'EXTRACELLULAR DOMAIN OF THE LDL RECEPTOR' 
PDB 2FCW unspecified 
'STRUCTURE OF A COMPLEX BETWEEN THE PAIR OF THE LDL RECEPTORLIGAND-BINDING MODULES 3-4 AND THE RECEPTOR ASSOCIATEDPROTEIN (RAP).' 
PDB 1I0U unspecified 
'SOLUTION STRUCTURE AND BACKBONE DYNAMICS OF A CONCATEMER OFEGF-HOMOLOGY MODULES OF THE HUMAN LOW DENSITY LIPOPROTEINRECEPTOR'    
PDB 1D2J unspecified 'LDL RECEPTOR LIGAND-BINDING MODULE 6' 
PDB 1LRX unspecified 'THEORETIC MODEL OF THE HUMAN LOW-DENSITY LIPOPROTEINRECEPTOR YWTD BETA-PROPELLER DOMAIN' 
PDB 1HZ8 unspecified 
'SOLUTION STRUCTURE AND BACKBONE DYNAMICS OF A CONCATEMER OFEGF-HOMOLOGY MODULES OF THE HUMAN LOW DENSITY LIPOPROTEINRECEPTOR'    
PDB 1F8Z unspecified 'NMR STRUCTURE OF THE SIXTH LIGAND-BINDING MODULE OF THE LDLRECEPTOR' 
PDB 1XFE unspecified 'SOLUTION STRUCTURE OF THE LA7-EGFA PAIR FROM THE LDLRECEPTOR' 
PDB 1AJJ unspecified 'LDL RECEPTOR LIGAND-BINDING MODULE 5, CALCIUM-COORDINATING' 
PDB 1LDL unspecified . 
PDB 1LDR unspecified 'SECOND REPEAT OF THE LDL RECEPTOR LIGAND- BINDING DOMAIN' 
PDB 1IJQ unspecified 'CRYSTAL STRUCTURE OF THE LDL RECEPTOR YWTD- EGF DOMAIN PAIR' 
PDB 2W2O unspecified 'PCSK9-DELTAC D374Y MUTANT BOUND TO WT EGF -A OF LDLR' 
PDB 2W2M unspecified 'WT PCSK9-DELTAC BOUND TO WT EGF-A OF LDLR' 
PDB 2W2P unspecified 'PCSK9-DELTAC D374A MUTANT BOUND TO WT EGF -A OF LDLR' 
PDB 2W2Q unspecified 'PCSK9-DELTAC D374H MUTANT BOUND TO WT EGF -A OF LDLR' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2W2N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2008-11-03 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bottomley, M.J.'  1  
'Cirillo, A.'      2  
'Orsatti, L.'      3  
'Ruggeri, L.'      4  
'Fisher, T.S.'     5  
'Santoro, J.C.'    6  
'Cummings, R.T.'   7  
'Cubbon, R.M.'     8  
'Lo Surdo, P.'     9  
'Calzetta, A.'     10 
'Noto, A.'         11 
'Baysarowich, J.'  12 
'Mattu, M.'        13 
'Talamo, F.'       14 
'De Francesco, R.' 15 
'Sparrow, C.P.'    16 
'Sitlani, A.'      17 
'Carfi, A.'        18 
# 
_citation.id                        primary 
_citation.title                     
'Structural and Biochemical Characterization of the Wild Type Pcsk9/Egf-Ab Complex and Natural Fh Mutants.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            284 
_citation.page_first                1313 
_citation.page_last                 ? 
_citation.year                      2009 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19001363 
_citation.pdbx_database_id_DOI      10.1074/JBC.M808363200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bottomley, M.J.'  1  
primary 'Cirillo, A.'      2  
primary 'Orsatti, L.'      3  
primary 'Ruggeri, L.'      4  
primary 'Fisher, T.S.'     5  
primary 'Santoro, J.C.'    6  
primary 'Cummings, R.T.'   7  
primary 'Cubbon, R.M.'     8  
primary 'Lo Surdo, P.'     9  
primary 'Calzetta, A.'     10 
primary 'Noto, A.'         11 
primary 'Baysarowich, J.'  12 
primary 'Mattu, M.'        13 
primary 'Talamo, F.'       14 
primary 'De Francesco, R.' 15 
primary 'Sparrow, C.P.'    16 
primary 'Sitlani, A.'      17 
primary 'Carfi, A.'        18 
# 
_cell.entry_id           2W2N 
_cell.length_a           83.940 
_cell.length_b           83.940 
_cell.length_c           209.933 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2W2N 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9' 33108.227 1   3.4.21.- ?   'CATALYTIC DOMAIN, RESIDUES 153-451' 
? 
2 polymer     man 'LOW-DENSITY LIPOPROTEIN RECEPTOR'              12120.479 1   ?        YES 'EGF-A DOMAIN, RESIDUES 314-393'     
? 
3 polymer     man 'PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9' 12679.604 1   3.4.21.- ?   'PRODOMAIN, RESIDUES 53-152'         
? 
4 non-polymer syn 'CALCIUM ION'                                   40.078    3   ?        ?   ?                                    
? 
5 water       nat water                                           18.015    175 ?        ?   ?                                    
? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'PROPROTEIN CONVERTASE PC9, SUBTILISIN/KEXIN-LIKE PROTEASE PC9, NEURAL APOPTOSIS-REGULATED CONVERTASE 1, NARC-1, PCSK9' 
2 'LDL RECEPTOR'                                                                                                          
3 'PROPROTEIN CONVERTASE PC9, SUBTILISIN/KEXIN-LIKE PROTEASE PC9, NEURAL APOPTOSIS-REGULATED CONVERTASE 1, NARC-1, PCSK9' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAG
VVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLV
TAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHV
AGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGAAGTAAASHHHHHH
;
;SIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAG
VVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLV
TAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHV
AGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGAAGTAAASHHHHHH
;
A ? 
2 'polypeptide(L)' no no 
;MKHHHHHHPMSDYDIPTTENLYFQGAMGTNECLDNNGGCSYVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQ
LCVNLEGGYKCQCEEGFQLDPHTKACK
;
;MKHHHHHHPMSDYDIPTTENLYFQGAMGTNECLDNNGGCSYVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQ
LCVNLEGGYKCQCEEGFQLDPHTKACK
;
E ? 
3 'polypeptide(L)' no no 
;MKGSKGSKGSKPMSAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGL
LPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
;
;MKGSKGSKGSKPMSAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGL
LPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
;
P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ILE n 
1 3   PRO n 
1 4   TRP n 
1 5   ASN n 
1 6   LEU n 
1 7   GLU n 
1 8   ARG n 
1 9   ILE n 
1 10  THR n 
1 11  PRO n 
1 12  PRO n 
1 13  ARG n 
1 14  TYR n 
1 15  ARG n 
1 16  ALA n 
1 17  ASP n 
1 18  GLU n 
1 19  TYR n 
1 20  GLN n 
1 21  PRO n 
1 22  PRO n 
1 23  ASP n 
1 24  GLY n 
1 25  GLY n 
1 26  SER n 
1 27  LEU n 
1 28  VAL n 
1 29  GLU n 
1 30  VAL n 
1 31  TYR n 
1 32  LEU n 
1 33  LEU n 
1 34  ASP n 
1 35  THR n 
1 36  SER n 
1 37  ILE n 
1 38  GLN n 
1 39  SER n 
1 40  ASP n 
1 41  HIS n 
1 42  ARG n 
1 43  GLU n 
1 44  ILE n 
1 45  GLU n 
1 46  GLY n 
1 47  ARG n 
1 48  VAL n 
1 49  MET n 
1 50  VAL n 
1 51  THR n 
1 52  ASP n 
1 53  PHE n 
1 54  GLU n 
1 55  ASN n 
1 56  VAL n 
1 57  PRO n 
1 58  GLU n 
1 59  GLU n 
1 60  ASP n 
1 61  GLY n 
1 62  THR n 
1 63  ARG n 
1 64  PHE n 
1 65  HIS n 
1 66  ARG n 
1 67  GLN n 
1 68  ALA n 
1 69  SER n 
1 70  LYS n 
1 71  CYS n 
1 72  ASP n 
1 73  SER n 
1 74  HIS n 
1 75  GLY n 
1 76  THR n 
1 77  HIS n 
1 78  LEU n 
1 79  ALA n 
1 80  GLY n 
1 81  VAL n 
1 82  VAL n 
1 83  SER n 
1 84  GLY n 
1 85  ARG n 
1 86  ASP n 
1 87  ALA n 
1 88  GLY n 
1 89  VAL n 
1 90  ALA n 
1 91  LYS n 
1 92  GLY n 
1 93  ALA n 
1 94  SER n 
1 95  MET n 
1 96  ARG n 
1 97  SER n 
1 98  LEU n 
1 99  ARG n 
1 100 VAL n 
1 101 LEU n 
1 102 ASN n 
1 103 CYS n 
1 104 GLN n 
1 105 GLY n 
1 106 LYS n 
1 107 GLY n 
1 108 THR n 
1 109 VAL n 
1 110 SER n 
1 111 GLY n 
1 112 THR n 
1 113 LEU n 
1 114 ILE n 
1 115 GLY n 
1 116 LEU n 
1 117 GLU n 
1 118 PHE n 
1 119 ILE n 
1 120 ARG n 
1 121 LYS n 
1 122 SER n 
1 123 GLN n 
1 124 LEU n 
1 125 VAL n 
1 126 GLN n 
1 127 PRO n 
1 128 VAL n 
1 129 GLY n 
1 130 PRO n 
1 131 LEU n 
1 132 VAL n 
1 133 VAL n 
1 134 LEU n 
1 135 LEU n 
1 136 PRO n 
1 137 LEU n 
1 138 ALA n 
1 139 GLY n 
1 140 GLY n 
1 141 TYR n 
1 142 SER n 
1 143 ARG n 
1 144 VAL n 
1 145 LEU n 
1 146 ASN n 
1 147 ALA n 
1 148 ALA n 
1 149 CYS n 
1 150 GLN n 
1 151 ARG n 
1 152 LEU n 
1 153 ALA n 
1 154 ARG n 
1 155 ALA n 
1 156 GLY n 
1 157 VAL n 
1 158 VAL n 
1 159 LEU n 
1 160 VAL n 
1 161 THR n 
1 162 ALA n 
1 163 ALA n 
1 164 GLY n 
1 165 ASN n 
1 166 PHE n 
1 167 ARG n 
1 168 ASP n 
1 169 ASP n 
1 170 ALA n 
1 171 CYS n 
1 172 LEU n 
1 173 TYR n 
1 174 SER n 
1 175 PRO n 
1 176 ALA n 
1 177 SER n 
1 178 ALA n 
1 179 PRO n 
1 180 GLU n 
1 181 VAL n 
1 182 ILE n 
1 183 THR n 
1 184 VAL n 
1 185 GLY n 
1 186 ALA n 
1 187 THR n 
1 188 ASN n 
1 189 ALA n 
1 190 GLN n 
1 191 ASP n 
1 192 GLN n 
1 193 PRO n 
1 194 VAL n 
1 195 THR n 
1 196 LEU n 
1 197 GLY n 
1 198 THR n 
1 199 LEU n 
1 200 GLY n 
1 201 THR n 
1 202 ASN n 
1 203 PHE n 
1 204 GLY n 
1 205 ARG n 
1 206 CYS n 
1 207 VAL n 
1 208 ASP n 
1 209 LEU n 
1 210 PHE n 
1 211 ALA n 
1 212 PRO n 
1 213 GLY n 
1 214 GLU n 
1 215 ASP n 
1 216 ILE n 
1 217 ILE n 
1 218 GLY n 
1 219 ALA n 
1 220 SER n 
1 221 SER n 
1 222 ASP n 
1 223 CYS n 
1 224 SER n 
1 225 THR n 
1 226 CYS n 
1 227 PHE n 
1 228 VAL n 
1 229 SER n 
1 230 GLN n 
1 231 SER n 
1 232 GLY n 
1 233 THR n 
1 234 SER n 
1 235 GLN n 
1 236 ALA n 
1 237 ALA n 
1 238 ALA n 
1 239 HIS n 
1 240 VAL n 
1 241 ALA n 
1 242 GLY n 
1 243 ILE n 
1 244 ALA n 
1 245 ALA n 
1 246 MET n 
1 247 MET n 
1 248 LEU n 
1 249 SER n 
1 250 ALA n 
1 251 GLU n 
1 252 PRO n 
1 253 GLU n 
1 254 LEU n 
1 255 THR n 
1 256 LEU n 
1 257 ALA n 
1 258 GLU n 
1 259 LEU n 
1 260 ARG n 
1 261 GLN n 
1 262 ARG n 
1 263 LEU n 
1 264 ILE n 
1 265 HIS n 
1 266 PHE n 
1 267 SER n 
1 268 ALA n 
1 269 LYS n 
1 270 ASP n 
1 271 VAL n 
1 272 ILE n 
1 273 ASN n 
1 274 GLU n 
1 275 ALA n 
1 276 TRP n 
1 277 PHE n 
1 278 PRO n 
1 279 GLU n 
1 280 ASP n 
1 281 GLN n 
1 282 ARG n 
1 283 VAL n 
1 284 LEU n 
1 285 THR n 
1 286 PRO n 
1 287 ASN n 
1 288 LEU n 
1 289 VAL n 
1 290 ALA n 
1 291 ALA n 
1 292 LEU n 
1 293 PRO n 
1 294 PRO n 
1 295 SER n 
1 296 THR n 
1 297 HIS n 
1 298 GLY n 
1 299 ALA n 
1 300 ALA n 
1 301 GLY n 
1 302 THR n 
1 303 ALA n 
1 304 ALA n 
1 305 ALA n 
1 306 SER n 
1 307 HIS n 
1 308 HIS n 
1 309 HIS n 
1 310 HIS n 
1 311 HIS n 
1 312 HIS n 
2 1   MET n 
2 2   LYS n 
2 3   HIS n 
2 4   HIS n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   HIS n 
2 9   PRO n 
2 10  MET n 
2 11  SER n 
2 12  ASP n 
2 13  TYR n 
2 14  ASP n 
2 15  ILE n 
2 16  PRO n 
2 17  THR n 
2 18  THR n 
2 19  GLU n 
2 20  ASN n 
2 21  LEU n 
2 22  TYR n 
2 23  PHE n 
2 24  GLN n 
2 25  GLY n 
2 26  ALA n 
2 27  MET n 
2 28  GLY n 
2 29  THR n 
2 30  ASN n 
2 31  GLU n 
2 32  CYS n 
2 33  LEU n 
2 34  ASP n 
2 35  ASN n 
2 36  ASN n 
2 37  GLY n 
2 38  GLY n 
2 39  CYS n 
2 40  SER n 
2 41  TYR n 
2 42  VAL n 
2 43  CYS n 
2 44  ASN n 
2 45  ASP n 
2 46  LEU n 
2 47  LYS n 
2 48  ILE n 
2 49  GLY n 
2 50  TYR n 
2 51  GLU n 
2 52  CYS n 
2 53  LEU n 
2 54  CYS n 
2 55  PRO n 
2 56  ASP n 
2 57  GLY n 
2 58  PHE n 
2 59  GLN n 
2 60  LEU n 
2 61  VAL n 
2 62  ALA n 
2 63  GLN n 
2 64  ARG n 
2 65  ARG n 
2 66  CYS n 
2 67  GLU n 
2 68  ASP n 
2 69  ILE n 
2 70  ASP n 
2 71  GLU n 
2 72  CYS n 
2 73  GLN n 
2 74  ASP n 
2 75  PRO n 
2 76  ASP n 
2 77  THR n 
2 78  CYS n 
2 79  SER n 
2 80  GLN n 
2 81  LEU n 
2 82  CYS n 
2 83  VAL n 
2 84  ASN n 
2 85  LEU n 
2 86  GLU n 
2 87  GLY n 
2 88  GLY n 
2 89  TYR n 
2 90  LYS n 
2 91  CYS n 
2 92  GLN n 
2 93  CYS n 
2 94  GLU n 
2 95  GLU n 
2 96  GLY n 
2 97  PHE n 
2 98  GLN n 
2 99  LEU n 
2 100 ASP n 
2 101 PRO n 
2 102 HIS n 
2 103 THR n 
2 104 LYS n 
2 105 ALA n 
2 106 CYS n 
2 107 LYS n 
3 1   MET n 
3 2   LYS n 
3 3   GLY n 
3 4   SER n 
3 5   LYS n 
3 6   GLY n 
3 7   SER n 
3 8   LYS n 
3 9   GLY n 
3 10  SER n 
3 11  LYS n 
3 12  PRO n 
3 13  MET n 
3 14  SER n 
3 15  ALA n 
3 16  GLU n 
3 17  ALA n 
3 18  PRO n 
3 19  GLU n 
3 20  HIS n 
3 21  GLY n 
3 22  THR n 
3 23  THR n 
3 24  ALA n 
3 25  THR n 
3 26  PHE n 
3 27  HIS n 
3 28  ARG n 
3 29  CYS n 
3 30  ALA n 
3 31  LYS n 
3 32  ASP n 
3 33  PRO n 
3 34  TRP n 
3 35  ARG n 
3 36  LEU n 
3 37  PRO n 
3 38  GLY n 
3 39  THR n 
3 40  TYR n 
3 41  VAL n 
3 42  VAL n 
3 43  VAL n 
3 44  LEU n 
3 45  LYS n 
3 46  GLU n 
3 47  GLU n 
3 48  THR n 
3 49  HIS n 
3 50  LEU n 
3 51  SER n 
3 52  GLN n 
3 53  SER n 
3 54  GLU n 
3 55  ARG n 
3 56  THR n 
3 57  ALA n 
3 58  ARG n 
3 59  ARG n 
3 60  LEU n 
3 61  GLN n 
3 62  ALA n 
3 63  GLN n 
3 64  ALA n 
3 65  ALA n 
3 66  ARG n 
3 67  ARG n 
3 68  GLY n 
3 69  TYR n 
3 70  LEU n 
3 71  THR n 
3 72  LYS n 
3 73  ILE n 
3 74  LEU n 
3 75  HIS n 
3 76  VAL n 
3 77  PHE n 
3 78  HIS n 
3 79  GLY n 
3 80  LEU n 
3 81  LEU n 
3 82  PRO n 
3 83  GLY n 
3 84  PHE n 
3 85  LEU n 
3 86  VAL n 
3 87  LYS n 
3 88  MET n 
3 89  SER n 
3 90  GLY n 
3 91  ASP n 
3 92  LEU n 
3 93  LEU n 
3 94  GLU n 
3 95  LEU n 
3 96  ALA n 
3 97  LEU n 
3 98  LYS n 
3 99  LEU n 
3 100 PRO n 
3 101 HIS n 
3 102 VAL n 
3 103 ASP n 
3 104 TYR n 
3 105 ILE n 
3 106 GLU n 
3 107 GLU n 
3 108 ASP n 
3 109 SER n 
3 110 SER n 
3 111 VAL n 
3 112 PHE n 
3 113 ALA n 
3 114 GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? 
? ? ? ? ? ? ? ? PETM-10 ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? 
? ? ? ? ? ? ? ? PETM-11 ? ? 
3 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? 
? ? ? ? ? ? ? ? PETM-10 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2W2N        3 ? ? 2W2N   ? 
2 UNP PCSK9_HUMAN 3 ? ? Q8NBP7 ? 
3 UNP PCSK9_HUMAN 1 ? ? Q8NBP7 ? 
4 PDB 2W2N        1 ? ? 2W2N   ? 
5 PDB 2W2N        2 ? ? 2W2N   ? 
6 UNP LDLR_HUMAN  2 ? ? P01130 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2W2N P 1   ? 14  ? 2W2N   39  ? 52  ? 39  52  
2 2 2W2N P 15  ? 114 ? Q8NBP7 53  ? 152 ? 53  152 
3 3 2W2N A 1   ? 299 ? Q8NBP7 153 ? 451 ? 153 451 
4 4 2W2N A 300 ? 312 ? 2W2N   452 ? 464 ? 452 464 
5 5 2W2N E 1   ? 27  ? 2W2N   266 ? 292 ? 266 292 
6 6 2W2N E 28  ? 107 ? P01130 314 ? 393 ? 293 372 
# 
_struct_ref_seq_dif.align_id                     5 
_struct_ref_seq_dif.pdbx_pdb_id_code             2W2N 
_struct_ref_seq_dif.mon_id                       TYR 
_struct_ref_seq_dif.pdbx_pdb_strand_id           E 
_struct_ref_seq_dif.seq_num                      41 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P01130 
_struct_ref_seq_dif.db_mon_id                    HIS 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          327 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            306 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2W2N 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.02 
_exptl_crystal.density_percent_sol   69 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1M HEPES PH 7.5, 10% (W/V) PEG 8000, 8% (V/V) ETHYLENE GLYCOL.' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2008-05-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.033 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_wavelength             1.033 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2W2N 
_reflns.observed_criterion_sigma_I   3.5 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             45.00 
_reflns.d_resolution_high            2.30 
_reflns.number_obs                   33566 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.1 
_reflns.pdbx_Rmerge_I_obs            0.15 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.70 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.0 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.42 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           0.64 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.90 
_reflns_shell.pdbx_redundancy        7.0 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2W2N 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     31695 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.00 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    97.41 
_refine.ls_R_factor_obs                          0.21531 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.21332 
_refine.ls_R_factor_R_free                       0.25393 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1691 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.933 
_refine.correlation_coeff_Fo_to_Fc_free          0.915 
_refine.B_iso_mean                               22.177 
_refine.aniso_B[1][1]                            1.49 
_refine.aniso_B[2][2]                            1.49 
_refine.aniso_B[3][3]                            -2.98 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2QTW' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.216 
_refine.pdbx_overall_ESU_R_Free                  0.195 
_refine.overall_SU_ML                            0.142 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             11.342 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3132 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             175 
_refine_hist.number_atoms_total               3310 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        40.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.008  0.022  ? 3259 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 2188 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.188  1.967  ? 4444 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.028  3.004  ? 5335 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       7.002  5.000  ? 430  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       32.844 23.958 ? 144  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.347 15.000 ? 531  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       14.361 15.000 ? 25   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.099  0.200  ? 512  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.020  ? 3684 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 642  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.186  0.200  ? 620  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.183  0.200  ? 2299 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.164  0.200  ? 1571 'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.084  0.200  ? 1772 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.134  0.200  ? 128  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.238  0.200  ? 5    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.248  0.200  ? 39   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.286  0.200  ? 6    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.437  1.500  ? 2159 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.759  2.000  ? 3358 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.002  3.000  ? 1239 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.561  4.500  ? 1076 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.300 
_refine_ls_shell.d_res_low                        2.360 
_refine_ls_shell.number_reflns_R_work             2248 
_refine_ls_shell.R_factor_R_work                  0.268 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.323 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             128 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2W2N 
_struct.title                     'WT PCSK9-deltaC bound to EGF-A H306Y mutant of LDLR' 
_struct.pdbx_descriptor           'PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9 (E.C.3.4.21.-), LOW-DENSITY LIPOPROTEIN RECEPTOR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2W2N 
_struct_keywords.pdbx_keywords   HYDROLASE/RECEPTOR 
_struct_keywords.text            
;HYDROLASE-RECEPTOR COMPLEX, PCSK9, LDLR, PROPROTEIN CONVERTASE, LOW-DENSITY LIPOPROTEIN RECEPTOR, EGF, CARDIOVASCULAR DISEASE, FAMILIAL HYPERCHOLESTEROLEMIA, LIPID METABOLISM, SERINE PROTEASE, HYDROLASE, LIPID TRANSPORT, STEROID METABOLISM, RECEPTOR
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 3   ? THR A 10  ? PRO A 155 THR A 162 1 ? 8  
HELX_P HELX_P2  2  ASP A 72  ? GLY A 84  ? ASP A 224 GLY A 236 1 ? 13 
HELX_P HELX_P3  3  VAL A 109 ? GLN A 126 ? VAL A 261 GLN A 278 1 ? 18 
HELX_P HELX_P4  4  SER A 142 ? ALA A 155 ? SER A 294 ALA A 307 1 ? 14 
HELX_P HELX_P5  5  GLY A 232 ? GLU A 251 ? GLY A 384 GLU A 403 1 ? 20 
HELX_P HELX_P6  6  THR A 255 ? PHE A 266 ? THR A 407 PHE A 418 1 ? 12 
HELX_P HELX_P7  7  ASN A 273 ? PHE A 277 ? ASN A 425 PHE A 429 5 ? 5  
HELX_P HELX_P8  8  PRO A 278 ? ARG A 282 ? PRO A 430 ARG A 434 5 ? 5  
HELX_P HELX_P9  9  ASN B 30  ? ASP B 34  ? ASN E 295 ASP E 299 5 ? 5  
HELX_P HELX_P10 10 ASP B 34  ? CYS B 39  ? ASP E 299 CYS E 304 5 ? 6  
HELX_P HELX_P11 11 LYS C 31  ? PRO C 33  ? LYS P 69  PRO P 71  5 ? 3  
HELX_P HELX_P12 12 HIS C 49  ? ARG C 67  ? HIS P 87  ARG P 105 1 ? 19 
HELX_P HELX_P13 13 SER C 89  ? ASP C 91  ? SER P 127 ASP P 129 5 ? 3  
HELX_P HELX_P14 14 LEU C 92  ? LYS C 98  ? LEU P 130 LYS P 136 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 71  SG ? ? ? 1_555 A CYS 103 SG  ? ? A CYS 223  A CYS 255  1_555 ? ? ? ? ? ? ? 2.056 ? 
disulf2  disulf ? ? A CYS 171 SG ? ? ? 1_555 A CYS 206 SG  ? ? A CYS 323  A CYS 358  1_555 ? ? ? ? ? ? ? 2.059 ? 
disulf3  disulf ? ? A CYS 223 SG ? ? ? 1_555 A CYS 226 SG  ? ? A CYS 375  A CYS 378  1_555 ? ? ? ? ? ? ? 2.063 ? 
disulf4  disulf ? ? B CYS 32  SG ? ? ? 1_555 B CYS 43  SG  ? ? E CYS 297  E CYS 308  1_555 ? ? ? ? ? ? ? 2.048 ? 
disulf5  disulf ? ? B CYS 39  SG ? ? ? 1_555 B CYS 52  SG  ? ? E CYS 304  E CYS 317  1_555 ? ? ? ? ? ? ? 2.019 ? 
disulf6  disulf ? ? B CYS 54  SG ? ? ? 1_555 B CYS 66  SG  ? ? E CYS 319  E CYS 331  1_555 ? ? ? ? ? ? ? 2.065 ? 
metalc1  metalc ? ? D CA  .   CA ? ? ? 1_555 A VAL 181 O   ? ? A CA  1447 A VAL 333  1_555 ? ? ? ? ? ? ? 2.729 ? 
metalc2  metalc ? ? D CA  .   CA ? ? ? 1_555 A ALA 178 O   ? ? A CA  1447 A ALA 330  1_555 ? ? ? ? ? ? ? 2.793 ? 
metalc3  metalc ? ? D CA  .   CA ? ? ? 1_555 A THR 183 OG1 ? ? A CA  1447 A THR 335  1_555 ? ? ? ? ? ? ? 2.702 ? 
metalc4  metalc ? ? D CA  .   CA ? ? ? 1_555 A CYS 206 O   ? ? A CA  1447 A CYS 358  1_555 ? ? ? ? ? ? ? 3.137 ? 
metalc5  metalc ? ? D CA  .   CA ? ? ? 1_555 G HOH .   O   ? ? A CA  1447 A HOH 2054 1_555 ? ? ? ? ? ? ? 3.082 ? 
metalc6  metalc ? ? E CA  .   CA ? ? ? 1_555 B GLU 31  OE1 ? ? E CA  1334 E GLU 296  1_555 ? ? ? ? ? ? ? 2.668 ? 
metalc7  metalc ? ? E CA  .   CA ? ? ? 1_555 H HOH .   O   ? ? E CA  1334 E HOH 2006 1_555 ? ? ? ? ? ? ? 2.391 ? 
metalc8  metalc ? ? E CA  .   CA ? ? ? 1_555 B THR 29  O   ? ? E CA  1334 E THR 294  1_555 ? ? ? ? ? ? ? 2.374 ? 
metalc9  metalc ? ? E CA  .   CA ? ? ? 1_555 B GLY 49  O   ? ? E CA  1334 E GLY 314  1_555 ? ? ? ? ? ? ? 2.397 ? 
metalc10 metalc ? ? E CA  .   CA ? ? ? 1_555 B ASP 45  OD2 ? ? E CA  1334 E ASP 310  1_555 ? ? ? ? ? ? ? 2.310 ? 
metalc11 metalc ? ? E CA  .   CA ? ? ? 1_555 B LEU 46  O   ? ? E CA  1334 E LEU 311  1_555 ? ? ? ? ? ? ? 2.356 ? 
metalc12 metalc ? ? F CA  .   CA ? ? ? 1_555 B ASP 68  O   ? ? E CA  1335 E ASP 333  1_555 ? ? ? ? ? ? ? 2.823 ? 
metalc13 metalc ? ? F CA  .   CA ? ? ? 1_555 B ASP 68  OD1 ? ? E CA  1335 E ASP 333  1_555 ? ? ? ? ? ? ? 3.137 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 174 A . ? SER 326 A PRO 175 A ? PRO 327 A 1 -0.90 
2 ASN 20  B . ? ASN 285 E LEU 21  B ? LEU 286 E 1 8.62  
3 THR 22  C . ? THR 60  P THR 23  C ? THR 61  P 1 -3.18 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 7 ? 
AB ? 4 ? 
AC ? 3 ? 
AD ? 4 ? 
AE ? 2 ? 
EA ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? parallel      
AA 5 6 ? parallel      
AA 6 7 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? parallel      
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? anti-parallel 
EA 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 48  ? GLU A 54  ? VAL A 200 GLU A 206 
AA 2 SER A 94  ? ARG A 99  ? SER A 246 ARG A 251 
AA 3 GLU A 29  ? ASP A 34  ? GLU A 181 ASP A 186 
AA 4 LEU A 131 ? LEU A 135 ? LEU A 283 LEU A 287 
AA 5 VAL A 158 ? ALA A 162 ? VAL A 310 ALA A 314 
AA 6 ILE A 182 ? THR A 187 ? ILE A 334 THR A 339 
AA 7 LEU A 209 ? PRO A 212 ? LEU A 361 PRO A 364 
AB 1 LYS A 106 ? THR A 108 ? LYS A 258 THR A 260 
AB 2 VAL C 102 ? ALA C 113 ? VAL P 140 ALA P 151 
AB 3 LEU A 137 ? GLY A 140 ? LEU A 289 GLY A 292 
AB 4 TYR A 173 ? SER A 174 ? TYR A 325 SER A 326 
AC 1 LYS A 106 ? THR A 108 ? LYS A 258 THR A 260 
AC 2 VAL C 102 ? ALA C 113 ? VAL P 140 ALA P 151 
AC 3 THR C 25  ? HIS C 27  ? THR P 63  HIS P 65  
AD 1 ILE A 216 ? ALA A 219 ? ILE A 368 ALA A 371 
AD 2 CYS A 226 ? GLN A 230 ? CYS A 378 GLN A 382 
AD 3 VAL B 42  ? ASN B 44  ? VAL E 307 ASN E 309 
AD 4 GLU B 51  ? LEU B 53  ? GLU E 316 LEU E 318 
AE 1 ALA A 268 ? LYS A 269 ? ALA A 420 LYS A 421 
AE 2 LEU A 288 ? VAL A 289 ? LEU A 440 VAL A 441 
EA 1 GLN B 59  ? VAL B 61  ? GLN E 324 VAL E 326 
EA 2 ARG B 65  ? GLU B 67  ? ARG E 330 GLU E 332 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N MET A 49  ? N MET A 201 O MET A 95  ? O MET A 247 
AA 2 3 N ARG A 96  ? N ARG A 248 O VAL A 30  ? O VAL A 182 
AA 3 4 N TYR A 31  ? N TYR A 183 O VAL A 132 ? O VAL A 284 
AA 4 5 N VAL A 133 ? N VAL A 285 O VAL A 158 ? O VAL A 310 
AA 5 6 N THR A 161 ? N THR A 313 O ILE A 182 ? O ILE A 334 
AA 6 7 N GLY A 185 ? N GLY A 337 O LEU A 209 ? O LEU A 361 
AB 1 2 N GLY A 107 ? N GLY A 259 O VAL C 111 ? O VAL P 149 
AB 2 3 N PHE C 112 ? N PHE P 150 O ALA A 138 ? O ALA A 290 
AB 3 4 N GLY A 139 ? N GLY A 291 O SER A 174 ? O SER A 326 
AC 1 2 N GLY A 107 ? N GLY A 259 O VAL C 111 ? O VAL P 149 
AC 2 3 N ILE C 105 ? N ILE P 143 O THR C 25  ? O THR P 63  
AD 1 2 N GLY A 218 ? N GLY A 370 O VAL A 228 ? O VAL A 380 
AD 2 3 N PHE A 227 ? N PHE A 379 O CYS B 43  ? O CYS E 308 
AD 3 4 N ASN B 44  ? N ASN E 309 O GLU B 51  ? O GLU E 316 
AE 1 2 N ALA A 268 ? N ALA A 420 O VAL A 289 ? O VAL A 441 
EA 1 2 N VAL B 61  ? N VAL E 326 O ARG B 65  ? O ARG E 330 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA E1334' 
AC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CA E1335' 
AC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CA A1447' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 THR B 29  ? THR E 294  . ? 1_555 ? 
2  AC1 6 GLU B 31  ? GLU E 296  . ? 1_555 ? 
3  AC1 6 ASP B 45  ? ASP E 310  . ? 1_555 ? 
4  AC1 6 LEU B 46  ? LEU E 311  . ? 1_555 ? 
5  AC1 6 GLY B 49  ? GLY E 314  . ? 1_555 ? 
6  AC1 6 HOH H .   ? HOH E 2006 . ? 1_555 ? 
7  AC2 1 ASP B 68  ? ASP E 333  . ? 1_555 ? 
8  AC3 7 ALA A 176 ? ALA A 328  . ? 1_555 ? 
9  AC3 7 ALA A 178 ? ALA A 330  . ? 1_555 ? 
10 AC3 7 VAL A 181 ? VAL A 333  . ? 1_555 ? 
11 AC3 7 THR A 183 ? THR A 335  . ? 1_555 ? 
12 AC3 7 CYS A 206 ? CYS A 358  . ? 1_555 ? 
13 AC3 7 ASP A 208 ? ASP A 360  . ? 1_555 ? 
14 AC3 7 HOH G .   ? HOH A 2054 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2W2N 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2W2N 
_atom_sites.fract_transf_matrix[1][1]   0.011913 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011913 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004763 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 1   ? -0.297  -1.393  8.755  1.00 33.02 ? 153  SER A N   1 
ATOM   2    C  CA  . SER A 1 1   ? 0.570   -2.098  9.744  1.00 33.11 ? 153  SER A CA  1 
ATOM   3    C  C   . SER A 1 1   ? 0.491   -1.424  11.121 1.00 32.56 ? 153  SER A C   1 
ATOM   4    O  O   . SER A 1 1   ? -0.216  -0.421  11.293 1.00 33.10 ? 153  SER A O   1 
ATOM   5    C  CB  . SER A 1 1   ? 2.021   -2.160  9.232  1.00 33.29 ? 153  SER A CB  1 
ATOM   6    O  OG  . SER A 1 1   ? 2.415   -0.934  8.629  1.00 34.24 ? 153  SER A OG  1 
ATOM   7    N  N   . ILE A 1 2   ? 1.183   -2.007  12.100 1.00 31.60 ? 154  ILE A N   1 
ATOM   8    C  CA  . ILE A 1 2   ? 1.294   -1.436  13.443 1.00 30.55 ? 154  ILE A CA  1 
ATOM   9    C  C   . ILE A 1 2   ? 2.733   -0.966  13.631 1.00 29.49 ? 154  ILE A C   1 
ATOM   10   O  O   . ILE A 1 2   ? 3.591   -1.320  12.828 1.00 29.38 ? 154  ILE A O   1 
ATOM   11   C  CB  . ILE A 1 2   ? 0.878   -2.457  14.533 1.00 30.75 ? 154  ILE A CB  1 
ATOM   12   C  CG1 . ILE A 1 2   ? 1.912   -3.585  14.681 1.00 30.07 ? 154  ILE A CG1 1 
ATOM   13   C  CG2 . ILE A 1 2   ? -0.513  -3.021  14.208 1.00 30.71 ? 154  ILE A CG2 1 
ATOM   14   C  CD1 . ILE A 1 2   ? 2.003   -4.135  16.092 1.00 28.57 ? 154  ILE A CD1 1 
ATOM   15   N  N   . PRO A 1 3   ? 3.006   -0.154  14.672 1.00 28.33 ? 155  PRO A N   1 
ATOM   16   C  CA  . PRO A 1 3   ? 4.368   0.359   14.846 1.00 27.43 ? 155  PRO A CA  1 
ATOM   17   C  C   . PRO A 1 3   ? 5.426   -0.743  14.765 1.00 26.48 ? 155  PRO A C   1 
ATOM   18   O  O   . PRO A 1 3   ? 5.277   -1.791  15.387 1.00 26.56 ? 155  PRO A O   1 
ATOM   19   C  CB  . PRO A 1 3   ? 4.322   0.992   16.237 1.00 27.51 ? 155  PRO A CB  1 
ATOM   20   C  CG  . PRO A 1 3   ? 2.920   1.417   16.394 1.00 27.77 ? 155  PRO A CG  1 
ATOM   21   C  CD  . PRO A 1 3   ? 2.107   0.349   15.725 1.00 28.28 ? 155  PRO A CD  1 
ATOM   22   N  N   . TRP A 1 4   ? 6.473   -0.508  13.982 1.00 25.61 ? 156  TRP A N   1 
ATOM   23   C  CA  . TRP A 1 4   ? 7.493   -1.535  13.704 1.00 25.00 ? 156  TRP A CA  1 
ATOM   24   C  C   . TRP A 1 4   ? 8.055   -2.113  14.994 1.00 25.09 ? 156  TRP A C   1 
ATOM   25   O  O   . TRP A 1 4   ? 8.344   -3.310  15.077 1.00 25.50 ? 156  TRP A O   1 
ATOM   26   C  CB  . TRP A 1 4   ? 8.636   -0.960  12.844 1.00 24.09 ? 156  TRP A CB  1 
ATOM   27   C  CG  . TRP A 1 4   ? 9.623   -0.105  13.615 1.00 23.89 ? 156  TRP A CG  1 
ATOM   28   C  CD1 . TRP A 1 4   ? 9.600   1.256   13.756 1.00 22.59 ? 156  TRP A CD1 1 
ATOM   29   C  CD2 . TRP A 1 4   ? 10.771  -0.565  14.356 1.00 23.14 ? 156  TRP A CD2 1 
ATOM   30   N  NE1 . TRP A 1 4   ? 10.656  1.667   14.534 1.00 22.61 ? 156  TRP A NE1 1 
ATOM   31   C  CE2 . TRP A 1 4   ? 11.386  0.574   14.921 1.00 22.11 ? 156  TRP A CE2 1 
ATOM   32   C  CE3 . TRP A 1 4   ? 11.322  -1.829  14.609 1.00 23.09 ? 156  TRP A CE3 1 
ATOM   33   C  CZ2 . TRP A 1 4   ? 12.536  0.491   15.712 1.00 22.34 ? 156  TRP A CZ2 1 
ATOM   34   C  CZ3 . TRP A 1 4   ? 12.471  -1.911  15.394 1.00 23.13 ? 156  TRP A CZ3 1 
ATOM   35   C  CH2 . TRP A 1 4   ? 13.065  -0.754  15.933 1.00 23.01 ? 156  TRP A CH2 1 
ATOM   36   N  N   . ASN A 1 5   ? 8.210   -1.237  15.986 1.00 25.13 ? 157  ASN A N   1 
ATOM   37   C  CA  . ASN A 1 5   ? 8.790   -1.570  17.279 1.00 25.13 ? 157  ASN A CA  1 
ATOM   38   C  C   . ASN A 1 5   ? 7.943   -2.539  18.098 1.00 25.67 ? 157  ASN A C   1 
ATOM   39   O  O   . ASN A 1 5   ? 8.491   -3.412  18.774 1.00 25.95 ? 157  ASN A O   1 
ATOM   40   C  CB  . ASN A 1 5   ? 9.065   -0.290  18.079 1.00 24.87 ? 157  ASN A CB  1 
ATOM   41   C  CG  . ASN A 1 5   ? 7.861   0.623   18.161 1.00 24.47 ? 157  ASN A CG  1 
ATOM   42   O  OD1 . ASN A 1 5   ? 7.399   1.149   17.141 1.00 23.86 ? 157  ASN A OD1 1 
ATOM   43   N  ND2 . ASN A 1 5   ? 7.344   0.825   19.373 1.00 23.31 ? 157  ASN A ND2 1 
ATOM   44   N  N   . LEU A 1 6   ? 6.619   -2.391  18.025 1.00 26.06 ? 158  LEU A N   1 
ATOM   45   C  CA  . LEU A 1 6   ? 5.694   -3.279  18.724 1.00 26.33 ? 158  LEU A CA  1 
ATOM   46   C  C   . LEU A 1 6   ? 5.672   -4.664  18.089 1.00 27.30 ? 158  LEU A C   1 
ATOM   47   O  O   . LEU A 1 6   ? 5.593   -5.686  18.787 1.00 27.44 ? 158  LEU A O   1 
ATOM   48   C  CB  . LEU A 1 6   ? 4.284   -2.682  18.737 1.00 26.03 ? 158  LEU A CB  1 
ATOM   49   C  CG  . LEU A 1 6   ? 4.131   -1.381  19.530 1.00 25.13 ? 158  LEU A CG  1 
ATOM   50   C  CD1 . LEU A 1 6   ? 2.672   -0.975  19.569 1.00 24.10 ? 158  LEU A CD1 1 
ATOM   51   C  CD2 . LEU A 1 6   ? 4.697   -1.512  20.942 1.00 23.33 ? 158  LEU A CD2 1 
ATOM   52   N  N   . GLU A 1 7   ? 5.739   -4.687  16.762 1.00 27.93 ? 159  GLU A N   1 
ATOM   53   C  CA  A GLU A 1 7   ? 5.803   -5.956  16.053 0.50 28.33 ? 159  GLU A CA  1 
ATOM   54   C  CA  B GLU A 1 7   ? 5.845   -5.908  15.973 0.50 28.38 ? 159  GLU A CA  1 
ATOM   55   C  C   . GLU A 1 7   ? 7.158   -6.632  16.290 1.00 28.50 ? 159  GLU A C   1 
ATOM   56   O  O   . GLU A 1 7   ? 7.220   -7.854  16.352 1.00 28.69 ? 159  GLU A O   1 
ATOM   57   C  CB  A GLU A 1 7   ? 5.514   -5.786  14.557 0.50 28.42 ? 159  GLU A CB  1 
ATOM   58   C  CB  B GLU A 1 7   ? 5.794   -5.526  14.485 0.50 28.35 ? 159  GLU A CB  1 
ATOM   59   C  CG  A GLU A 1 7   ? 5.150   -7.095  13.831 0.50 29.07 ? 159  GLU A CG  1 
ATOM   60   C  CG  B GLU A 1 7   ? 5.397   -6.630  13.522 0.50 28.86 ? 159  GLU A CG  1 
ATOM   61   C  CD  A GLU A 1 7   ? 3.700   -7.546  14.050 0.50 29.90 ? 159  GLU A CD  1 
ATOM   62   C  CD  B GLU A 1 7   ? 5.148   -6.108  12.104 0.50 28.97 ? 159  GLU A CD  1 
ATOM   63   O  OE1 A GLU A 1 7   ? 2.954   -7.647  13.050 0.50 30.17 ? 159  GLU A OE1 1 
ATOM   64   O  OE1 B GLU A 1 7   ? 5.513   -6.814  11.140 0.50 29.30 ? 159  GLU A OE1 1 
ATOM   65   O  OE2 A GLU A 1 7   ? 3.305   -7.810  15.210 0.50 30.12 ? 159  GLU A OE2 1 
ATOM   66   O  OE2 B GLU A 1 7   ? 4.589   -4.994  11.953 0.50 29.46 ? 159  GLU A OE2 1 
ATOM   67   N  N   . ARG A 1 8   ? 8.222   -5.848  16.477 1.00 28.78 ? 160  ARG A N   1 
ATOM   68   C  CA  . ARG A 1 8   ? 9.566   -6.383  16.714 1.00 28.82 ? 160  ARG A CA  1 
ATOM   69   C  C   . ARG A 1 8   ? 9.748   -7.071  18.072 1.00 29.71 ? 160  ARG A C   1 
ATOM   70   O  O   . ARG A 1 8   ? 10.567  -7.985  18.193 1.00 29.97 ? 160  ARG A O   1 
ATOM   71   C  CB  . ARG A 1 8   ? 10.608  -5.264  16.571 1.00 28.51 ? 160  ARG A CB  1 
ATOM   72   C  CG  . ARG A 1 8   ? 12.056  -5.731  16.468 1.00 27.27 ? 160  ARG A CG  1 
ATOM   73   C  CD  . ARG A 1 8   ? 12.305  -6.572  15.229 1.00 26.15 ? 160  ARG A CD  1 
ATOM   74   N  NE  . ARG A 1 8   ? 11.875  -5.875  14.018 1.00 25.76 ? 160  ARG A NE  1 
ATOM   75   C  CZ  . ARG A 1 8   ? 12.683  -5.261  13.155 1.00 25.88 ? 160  ARG A CZ  1 
ATOM   76   N  NH1 . ARG A 1 8   ? 13.996  -5.291  13.310 1.00 27.19 ? 160  ARG A NH1 1 
ATOM   77   N  NH2 . ARG A 1 8   ? 12.170  -4.642  12.102 1.00 26.07 ? 160  ARG A NH2 1 
ATOM   78   N  N   . ILE A 1 9   ? 9.020   -6.622  19.093 1.00 30.44 ? 161  ILE A N   1 
ATOM   79   C  CA  . ILE A 1 9   ? 9.107   -7.235  20.424 1.00 30.99 ? 161  ILE A CA  1 
ATOM   80   C  C   . ILE A 1 9   ? 8.073   -8.345  20.617 1.00 32.26 ? 161  ILE A C   1 
ATOM   81   O  O   . ILE A 1 9   ? 8.130   -9.084  21.597 1.00 32.33 ? 161  ILE A O   1 
ATOM   82   C  CB  . ILE A 1 9   ? 8.981   -6.189  21.570 1.00 30.94 ? 161  ILE A CB  1 
ATOM   83   C  CG1 . ILE A 1 9   ? 7.576   -5.566  21.623 1.00 30.57 ? 161  ILE A CG1 1 
ATOM   84   C  CG2 . ILE A 1 9   ? 10.052  -5.099  21.430 1.00 30.08 ? 161  ILE A CG2 1 
ATOM   85   C  CD1 . ILE A 1 9   ? 7.288   -4.837  22.931 1.00 30.53 ? 161  ILE A CD1 1 
ATOM   86   N  N   . THR A 1 10  ? 7.131   -8.452  19.683 1.00 33.76 ? 162  THR A N   1 
ATOM   87   C  CA  . THR A 1 10  ? 6.105   -9.485  19.716 1.00 35.10 ? 162  THR A CA  1 
ATOM   88   C  C   . THR A 1 10  ? 6.571   -10.721 18.959 1.00 36.26 ? 162  THR A C   1 
ATOM   89   O  O   . THR A 1 10  ? 6.791   -10.655 17.751 1.00 36.53 ? 162  THR A O   1 
ATOM   90   C  CB  . THR A 1 10  ? 4.803   -8.992  19.065 1.00 35.16 ? 162  THR A CB  1 
ATOM   91   O  OG1 . THR A 1 10  ? 4.248   -7.933  19.855 1.00 35.57 ? 162  THR A OG1 1 
ATOM   92   C  CG2 . THR A 1 10  ? 3.794   -10.122 18.948 1.00 35.04 ? 162  THR A CG2 1 
ATOM   93   N  N   . PRO A 1 11  ? 6.702   -11.863 19.655 1.00 37.75 ? 163  PRO A N   1 
ATOM   94   C  CA  . PRO A 1 11  ? 7.129   -13.069 18.954 1.00 38.65 ? 163  PRO A CA  1 
ATOM   95   C  C   . PRO A 1 11  ? 5.970   -13.682 18.168 1.00 39.42 ? 163  PRO A C   1 
ATOM   96   O  O   . PRO A 1 11  ? 4.812   -13.391 18.472 1.00 39.53 ? 163  PRO A O   1 
ATOM   97   C  CB  . PRO A 1 11  ? 7.560   -13.994 20.092 1.00 38.58 ? 163  PRO A CB  1 
ATOM   98   C  CG  . PRO A 1 11  ? 6.688   -13.608 21.216 1.00 38.28 ? 163  PRO A CG  1 
ATOM   99   C  CD  . PRO A 1 11  ? 6.447   -12.127 21.083 1.00 37.75 ? 163  PRO A CD  1 
ATOM   100  N  N   . PRO A 1 12  ? 6.272   -14.494 17.139 1.00 40.50 ? 164  PRO A N   1 
ATOM   101  C  CA  . PRO A 1 12  ? 5.217   -15.261 16.457 1.00 41.00 ? 164  PRO A CA  1 
ATOM   102  C  C   . PRO A 1 12  ? 4.590   -16.381 17.311 1.00 41.49 ? 164  PRO A C   1 
ATOM   103  O  O   . PRO A 1 12  ? 3.435   -16.758 17.072 1.00 41.69 ? 164  PRO A O   1 
ATOM   104  C  CB  . PRO A 1 12  ? 5.942   -15.859 15.236 1.00 41.06 ? 164  PRO A CB  1 
ATOM   105  C  CG  . PRO A 1 12  ? 7.231   -15.090 15.113 1.00 41.03 ? 164  PRO A CG  1 
ATOM   106  C  CD  . PRO A 1 12  ? 7.591   -14.706 16.513 1.00 40.60 ? 164  PRO A CD  1 
ATOM   107  N  N   . ARG A 1 13  ? 5.346   -16.901 18.283 1.00 41.85 ? 165  ARG A N   1 
ATOM   108  C  CA  . ARG A 1 13  ? 4.904   -18.013 19.136 1.00 41.98 ? 165  ARG A CA  1 
ATOM   109  C  C   . ARG A 1 13  ? 4.857   -19.326 18.351 1.00 42.16 ? 165  ARG A C   1 
ATOM   110  O  O   . ARG A 1 13  ? 4.221   -20.299 18.765 1.00 42.33 ? 165  ARG A O   1 
ATOM   111  C  CB  . ARG A 1 13  ? 3.541   -17.707 19.772 1.00 42.00 ? 165  ARG A CB  1 
ATOM   112  N  N   . LEU A 1 27  ? -1.602  -5.990  39.085 1.00 32.89 ? 179  LEU A N   1 
ATOM   113  C  CA  . LEU A 1 27  ? -1.310  -5.119  40.224 1.00 32.88 ? 179  LEU A CA  1 
ATOM   114  C  C   . LEU A 1 27  ? 0.102   -4.513  40.171 1.00 32.75 ? 179  LEU A C   1 
ATOM   115  O  O   . LEU A 1 27  ? 0.618   -4.052  41.192 1.00 32.71 ? 179  LEU A O   1 
ATOM   116  C  CB  . LEU A 1 27  ? -1.512  -5.880  41.540 1.00 32.98 ? 179  LEU A CB  1 
ATOM   117  N  N   . VAL A 1 28  ? 0.719   -4.510  38.991 1.00 32.48 ? 180  VAL A N   1 
ATOM   118  C  CA  . VAL A 1 28  ? 2.022   -3.877  38.814 1.00 32.46 ? 180  VAL A CA  1 
ATOM   119  C  C   . VAL A 1 28  ? 1.842   -2.362  38.713 1.00 32.37 ? 180  VAL A C   1 
ATOM   120  O  O   . VAL A 1 28  ? 0.884   -1.880  38.116 1.00 32.57 ? 180  VAL A O   1 
ATOM   121  C  CB  . VAL A 1 28  ? 2.754   -4.382  37.548 1.00 32.31 ? 180  VAL A CB  1 
ATOM   122  C  CG1 . VAL A 1 28  ? 4.101   -3.681  37.389 1.00 32.21 ? 180  VAL A CG1 1 
ATOM   123  C  CG2 . VAL A 1 28  ? 2.955   -5.876  37.608 1.00 32.39 ? 180  VAL A CG2 1 
ATOM   124  N  N   . GLU A 1 29  ? 2.763   -1.624  39.318 1.00 32.24 ? 181  GLU A N   1 
ATOM   125  C  CA  . GLU A 1 29  ? 2.795   -0.173  39.225 1.00 32.18 ? 181  GLU A CA  1 
ATOM   126  C  C   . GLU A 1 29  ? 4.112   0.226   38.561 1.00 31.51 ? 181  GLU A C   1 
ATOM   127  O  O   . GLU A 1 29  ? 5.175   -0.257  38.962 1.00 31.23 ? 181  GLU A O   1 
ATOM   128  C  CB  . GLU A 1 29  ? 2.698   0.432   40.629 1.00 32.58 ? 181  GLU A CB  1 
ATOM   129  C  CG  . GLU A 1 29  ? 2.282   1.895   40.654 1.00 34.42 ? 181  GLU A CG  1 
ATOM   130  C  CD  . GLU A 1 29  ? 0.817   2.088   40.318 1.00 36.20 ? 181  GLU A CD  1 
ATOM   131  O  OE1 . GLU A 1 29  ? -0.045  1.819   41.186 1.00 37.13 ? 181  GLU A OE1 1 
ATOM   132  O  OE2 . GLU A 1 29  ? 0.534   2.514   39.181 1.00 38.50 ? 181  GLU A OE2 1 
ATOM   133  N  N   . VAL A 1 30  ? 4.035   1.082   37.542 1.00 30.78 ? 182  VAL A N   1 
ATOM   134  C  CA  . VAL A 1 30  ? 5.224   1.608   36.885 1.00 30.49 ? 182  VAL A CA  1 
ATOM   135  C  C   . VAL A 1 30  ? 5.426   3.086   37.229 1.00 30.17 ? 182  VAL A C   1 
ATOM   136  O  O   . VAL A 1 30  ? 4.597   3.926   36.899 1.00 30.24 ? 182  VAL A O   1 
ATOM   137  C  CB  . VAL A 1 30  ? 5.170   1.436   35.347 1.00 30.49 ? 182  VAL A CB  1 
ATOM   138  C  CG1 . VAL A 1 30  ? 6.492   1.880   34.702 1.00 29.69 ? 182  VAL A CG1 1 
ATOM   139  C  CG2 . VAL A 1 30  ? 4.857   -0.009  34.982 1.00 30.72 ? 182  VAL A CG2 1 
ATOM   140  N  N   . TYR A 1 31  ? 6.536   3.387   37.899 1.00 29.74 ? 183  TYR A N   1 
ATOM   141  C  CA  . TYR A 1 31  ? 6.929   4.769   38.193 1.00 29.33 ? 183  TYR A CA  1 
ATOM   142  C  C   . TYR A 1 31  ? 7.788   5.340   37.082 1.00 28.76 ? 183  TYR A C   1 
ATOM   143  O  O   . TYR A 1 31  ? 8.679   4.672   36.572 1.00 28.39 ? 183  TYR A O   1 
ATOM   144  C  CB  . TYR A 1 31  ? 7.702   4.842   39.501 1.00 29.39 ? 183  TYR A CB  1 
ATOM   145  C  CG  . TYR A 1 31  ? 6.820   4.775   40.717 1.00 29.55 ? 183  TYR A CG  1 
ATOM   146  C  CD1 . TYR A 1 31  ? 6.353   5.939   41.318 1.00 29.60 ? 183  TYR A CD1 1 
ATOM   147  C  CD2 . TYR A 1 31  ? 6.460   3.556   41.272 1.00 29.40 ? 183  TYR A CD2 1 
ATOM   148  C  CE1 . TYR A 1 31  ? 5.543   5.894   42.437 1.00 29.51 ? 183  TYR A CE1 1 
ATOM   149  C  CE2 . TYR A 1 31  ? 5.653   3.497   42.397 1.00 30.07 ? 183  TYR A CE2 1 
ATOM   150  C  CZ  . TYR A 1 31  ? 5.198   4.673   42.975 1.00 29.56 ? 183  TYR A CZ  1 
ATOM   151  O  OH  . TYR A 1 31  ? 4.398   4.630   44.088 1.00 29.76 ? 183  TYR A OH  1 
ATOM   152  N  N   . LEU A 1 32  ? 7.506   6.581   36.708 1.00 28.36 ? 184  LEU A N   1 
ATOM   153  C  CA  . LEU A 1 32  ? 8.271   7.266   35.685 1.00 28.19 ? 184  LEU A CA  1 
ATOM   154  C  C   . LEU A 1 32  ? 8.868   8.512   36.320 1.00 27.81 ? 184  LEU A C   1 
ATOM   155  O  O   . LEU A 1 32  ? 8.141   9.349   36.835 1.00 27.60 ? 184  LEU A O   1 
ATOM   156  C  CB  . LEU A 1 32  ? 7.373   7.623   34.491 1.00 28.12 ? 184  LEU A CB  1 
ATOM   157  C  CG  . LEU A 1 32  ? 8.009   8.367   33.309 1.00 28.32 ? 184  LEU A CG  1 
ATOM   158  C  CD1 . LEU A 1 32  ? 9.197   7.592   32.726 1.00 27.64 ? 184  LEU A CD1 1 
ATOM   159  C  CD2 . LEU A 1 32  ? 6.970   8.635   32.235 1.00 28.32 ? 184  LEU A CD2 1 
ATOM   160  N  N   . LEU A 1 33  ? 10.197  8.594   36.327 1.00 27.72 ? 185  LEU A N   1 
ATOM   161  C  CA  . LEU A 1 33  ? 10.919  9.804   36.757 1.00 27.60 ? 185  LEU A CA  1 
ATOM   162  C  C   . LEU A 1 33  ? 11.392  10.533  35.518 1.00 27.40 ? 185  LEU A C   1 
ATOM   163  O  O   . LEU A 1 33  ? 12.387  10.132  34.909 1.00 27.48 ? 185  LEU A O   1 
ATOM   164  C  CB  . LEU A 1 33  ? 12.133  9.458   37.623 1.00 27.42 ? 185  LEU A CB  1 
ATOM   165  C  CG  . LEU A 1 33  ? 11.871  8.985   39.056 1.00 27.76 ? 185  LEU A CG  1 
ATOM   166  C  CD1 . LEU A 1 33  ? 11.770  7.471   39.106 1.00 28.24 ? 185  LEU A CD1 1 
ATOM   167  C  CD2 . LEU A 1 33  ? 12.976  9.481   39.992 1.00 27.05 ? 185  LEU A CD2 1 
ATOM   168  N  N   . ASP A 1 34  ? 10.688  11.594  35.140 1.00 27.31 ? 186  ASP A N   1 
ATOM   169  C  CA  . ASP A 1 34  ? 10.974  12.278  33.890 1.00 27.55 ? 186  ASP A CA  1 
ATOM   170  C  C   . ASP A 1 34  ? 10.521  13.742  33.920 1.00 27.03 ? 186  ASP A C   1 
ATOM   171  O  O   . ASP A 1 34  ? 10.500  14.370  34.977 1.00 26.45 ? 186  ASP A O   1 
ATOM   172  C  CB  . ASP A 1 34  ? 10.320  11.513  32.733 1.00 28.11 ? 186  ASP A CB  1 
ATOM   173  C  CG  . ASP A 1 34  ? 10.985  11.801  31.378 1.00 30.74 ? 186  ASP A CG  1 
ATOM   174  O  OD1 . ASP A 1 34  ? 10.336  12.406  30.503 1.00 35.03 ? 186  ASP A OD1 1 
ATOM   175  O  OD2 . ASP A 1 34  ? 12.168  11.463  31.185 1.00 35.36 ? 186  ASP A OD2 1 
ATOM   176  N  N   . THR A 1 35  ? 10.206  14.290  32.748 1.00 26.78 ? 187  THR A N   1 
ATOM   177  C  CA  . THR A 1 35  ? 9.620   15.609  32.633 1.00 26.53 ? 187  THR A CA  1 
ATOM   178  C  C   . THR A 1 35  ? 8.201   15.516  33.143 1.00 26.47 ? 187  THR A C   1 
ATOM   179  O  O   . THR A 1 35  ? 7.776   14.462  33.617 1.00 26.56 ? 187  THR A O   1 
ATOM   180  C  CB  . THR A 1 35  ? 9.606   16.100  31.165 1.00 26.38 ? 187  THR A CB  1 
ATOM   181  O  OG1 . THR A 1 35  ? 8.861   15.183  30.358 1.00 26.24 ? 187  THR A OG1 1 
ATOM   182  C  CG2 . THR A 1 35  ? 11.028  16.223  30.615 1.00 26.03 ? 187  THR A CG2 1 
ATOM   183  N  N   . SER A 1 36  ? 7.477   16.624  33.071 1.00 26.45 ? 188  SER A N   1 
ATOM   184  C  CA  . SER A 1 36  ? 6.048   16.606  33.287 1.00 26.62 ? 188  SER A CA  1 
ATOM   185  C  C   . SER A 1 36  ? 5.376   15.848  32.141 1.00 26.67 ? 188  SER A C   1 
ATOM   186  O  O   . SER A 1 36  ? 5.946   15.722  31.057 1.00 26.46 ? 188  SER A O   1 
ATOM   187  C  CB  . SER A 1 36  ? 5.518   18.037  33.380 1.00 26.81 ? 188  SER A CB  1 
ATOM   188  O  OG  . SER A 1 36  ? 6.107   18.847  32.383 1.00 27.05 ? 188  SER A OG  1 
ATOM   189  N  N   . ILE A 1 37  ? 4.182   15.320  32.394 1.00 26.91 ? 189  ILE A N   1 
ATOM   190  C  CA  . ILE A 1 37  ? 3.423   14.594  31.381 1.00 27.36 ? 189  ILE A CA  1 
ATOM   191  C  C   . ILE A 1 37  ? 2.078   15.279  31.118 1.00 27.08 ? 189  ILE A C   1 
ATOM   192  O  O   . ILE A 1 37  ? 1.563   15.993  31.979 1.00 26.89 ? 189  ILE A O   1 
ATOM   193  C  CB  . ILE A 1 37  ? 3.205   13.094  31.779 1.00 27.61 ? 189  ILE A CB  1 
ATOM   194  C  CG1 . ILE A 1 37  ? 2.224   12.947  32.945 1.00 28.30 ? 189  ILE A CG1 1 
ATOM   195  C  CG2 . ILE A 1 37  ? 4.533   12.436  32.162 1.00 28.13 ? 189  ILE A CG2 1 
ATOM   196  C  CD1 . ILE A 1 37  ? 1.534   11.595  32.972 1.00 28.27 ? 189  ILE A CD1 1 
ATOM   197  N  N   . GLN A 1 38  ? 1.540   15.082  29.912 1.00 26.87 ? 190  GLN A N   1 
ATOM   198  C  CA  . GLN A 1 38  ? 0.162   15.443  29.600 1.00 26.68 ? 190  GLN A CA  1 
ATOM   199  C  C   . GLN A 1 38  ? -0.706  14.236  29.962 1.00 26.00 ? 190  GLN A C   1 
ATOM   200  O  O   . GLN A 1 38  ? -0.880  13.307  29.166 1.00 25.37 ? 190  GLN A O   1 
ATOM   201  C  CB  . GLN A 1 38  ? -0.010  15.822  28.122 1.00 26.97 ? 190  GLN A CB  1 
ATOM   202  C  CG  . GLN A 1 38  ? -1.408  16.410  27.811 1.00 28.41 ? 190  GLN A CG  1 
ATOM   203  C  CD  . GLN A 1 38  ? -1.948  16.027  26.429 1.00 30.36 ? 190  GLN A CD  1 
ATOM   204  O  OE1 . GLN A 1 38  ? -1.236  15.454  25.605 1.00 32.49 ? 190  GLN A OE1 1 
ATOM   205  N  NE2 . GLN A 1 38  ? -3.215  16.346  26.176 1.00 31.59 ? 190  GLN A NE2 1 
ATOM   206  N  N   . SER A 1 39  ? -1.235  14.261  31.181 1.00 25.47 ? 191  SER A N   1 
ATOM   207  C  CA  . SER A 1 39  ? -1.912  13.107  31.762 1.00 25.21 ? 191  SER A CA  1 
ATOM   208  C  C   . SER A 1 39  ? -3.277  12.815  31.132 1.00 24.85 ? 191  SER A C   1 
ATOM   209  O  O   . SER A 1 39  ? -3.809  11.726  31.309 1.00 24.82 ? 191  SER A O   1 
ATOM   210  C  CB  . SER A 1 39  ? -2.051  13.285  33.283 1.00 25.22 ? 191  SER A CB  1 
ATOM   211  O  OG  . SER A 1 39  ? -2.712  14.501  33.600 1.00 25.65 ? 191  SER A OG  1 
ATOM   212  N  N   . ASP A 1 40  ? -3.837  13.774  30.399 1.00 24.64 ? 192  ASP A N   1 
ATOM   213  C  CA  . ASP A 1 40  ? -5.114  13.560  29.712 1.00 24.65 ? 192  ASP A CA  1 
ATOM   214  C  C   . ASP A 1 40  ? -4.978  13.260  28.207 1.00 24.08 ? 192  ASP A C   1 
ATOM   215  O  O   . ASP A 1 40  ? -5.941  13.404  27.456 1.00 24.06 ? 192  ASP A O   1 
ATOM   216  C  CB  . ASP A 1 40  ? -6.084  14.727  29.970 1.00 25.16 ? 192  ASP A CB  1 
ATOM   217  C  CG  . ASP A 1 40  ? -5.529  16.082  29.543 1.00 26.63 ? 192  ASP A CG  1 
ATOM   218  O  OD1 . ASP A 1 40  ? -4.400  16.139  28.998 1.00 27.67 ? 192  ASP A OD1 1 
ATOM   219  O  OD2 . ASP A 1 40  ? -6.236  17.096  29.776 1.00 28.24 ? 192  ASP A OD2 1 
ATOM   220  N  N   . HIS A 1 41  ? -3.795  12.825  27.772 1.00 23.38 ? 193  HIS A N   1 
ATOM   221  C  CA  . HIS A 1 41  ? -3.636  12.314  26.414 1.00 22.85 ? 193  HIS A CA  1 
ATOM   222  C  C   . HIS A 1 41  ? -4.421  11.009  26.309 1.00 22.62 ? 193  HIS A C   1 
ATOM   223  O  O   . HIS A 1 41  ? -4.385  10.197  27.228 1.00 22.43 ? 193  HIS A O   1 
ATOM   224  C  CB  . HIS A 1 41  ? -2.163  12.074  26.063 1.00 22.56 ? 193  HIS A CB  1 
ATOM   225  C  CG  . HIS A 1 41  ? -1.923  11.863  24.597 1.00 22.24 ? 193  HIS A CG  1 
ATOM   226  N  ND1 . HIS A 1 41  ? -1.586  12.890  23.743 1.00 22.06 ? 193  HIS A ND1 1 
ATOM   227  C  CD2 . HIS A 1 41  ? -1.986  10.749  23.832 1.00 21.24 ? 193  HIS A CD2 1 
ATOM   228  C  CE1 . HIS A 1 41  ? -1.453  12.417  22.518 1.00 21.61 ? 193  HIS A CE1 1 
ATOM   229  N  NE2 . HIS A 1 41  ? -1.686  11.118  22.544 1.00 21.08 ? 193  HIS A NE2 1 
ATOM   230  N  N   . ARG A 1 42  ? -5.127  10.823  25.194 1.00 22.50 ? 194  ARG A N   1 
ATOM   231  C  CA  . ARG A 1 42  ? -5.996  9.652   24.981 1.00 22.38 ? 194  ARG A CA  1 
ATOM   232  C  C   . ARG A 1 42  ? -5.270  8.303   25.172 1.00 22.59 ? 194  ARG A C   1 
ATOM   233  O  O   . ARG A 1 42  ? -5.876  7.319   25.575 1.00 22.38 ? 194  ARG A O   1 
ATOM   234  C  CB  . ARG A 1 42  ? -6.633  9.726   23.585 1.00 22.33 ? 194  ARG A CB  1 
ATOM   235  C  CG  . ARG A 1 42  ? -7.840  8.807   23.363 1.00 21.94 ? 194  ARG A CG  1 
ATOM   236  C  CD  . ARG A 1 42  ? -8.265  8.786   21.895 1.00 21.87 ? 194  ARG A CD  1 
ATOM   237  N  NE  . ARG A 1 42  ? -7.229  8.189   21.048 1.00 21.87 ? 194  ARG A NE  1 
ATOM   238  C  CZ  . ARG A 1 42  ? -7.193  8.233   19.715 1.00 20.93 ? 194  ARG A CZ  1 
ATOM   239  N  NH1 . ARG A 1 42  ? -8.136  8.861   19.021 1.00 19.80 ? 194  ARG A NH1 1 
ATOM   240  N  NH2 . ARG A 1 42  ? -6.183  7.652   19.075 1.00 21.56 ? 194  ARG A NH2 1 
ATOM   241  N  N   . GLU A 1 43  ? -3.977  8.264   24.881 1.00 23.05 ? 195  GLU A N   1 
ATOM   242  C  CA  . GLU A 1 43  ? -3.157  7.068   25.118 1.00 23.64 ? 195  GLU A CA  1 
ATOM   243  C  C   . GLU A 1 43  ? -3.093  6.658   26.588 1.00 24.22 ? 195  GLU A C   1 
ATOM   244  O  O   . GLU A 1 43  ? -3.144  5.471   26.894 1.00 24.39 ? 195  GLU A O   1 
ATOM   245  C  CB  . GLU A 1 43  ? -1.720  7.262   24.599 1.00 23.47 ? 195  GLU A CB  1 
ATOM   246  C  CG  . GLU A 1 43  ? -1.571  7.128   23.086 1.00 23.33 ? 195  GLU A CG  1 
ATOM   247  C  CD  . GLU A 1 43  ? -1.698  5.681   22.609 1.00 22.89 ? 195  GLU A CD  1 
ATOM   248  O  OE1 . GLU A 1 43  ? -2.835  5.218   22.406 1.00 20.98 ? 195  GLU A OE1 1 
ATOM   249  O  OE2 . GLU A 1 43  ? -0.659  5.006   22.432 1.00 23.04 ? 195  GLU A OE2 1 
ATOM   250  N  N   . ILE A 1 44  ? -2.985  7.639   27.485 1.00 24.93 ? 196  ILE A N   1 
ATOM   251  C  CA  . ILE A 1 44  ? -2.689  7.378   28.901 1.00 25.43 ? 196  ILE A CA  1 
ATOM   252  C  C   . ILE A 1 44  ? -3.746  7.895   29.889 1.00 26.17 ? 196  ILE A C   1 
ATOM   253  O  O   . ILE A 1 44  ? -3.587  7.725   31.098 1.00 25.78 ? 196  ILE A O   1 
ATOM   254  C  CB  . ILE A 1 44  ? -1.283  7.948   29.286 1.00 25.57 ? 196  ILE A CB  1 
ATOM   255  C  CG1 . ILE A 1 44  ? -1.228  9.478   29.106 1.00 25.63 ? 196  ILE A CG1 1 
ATOM   256  C  CG2 . ILE A 1 44  ? -0.194  7.259   28.459 1.00 24.89 ? 196  ILE A CG2 1 
ATOM   257  C  CD1 . ILE A 1 44  ? 0.144   10.096  29.359 1.00 25.38 ? 196  ILE A CD1 1 
ATOM   258  N  N   . GLU A 1 45  ? -4.825  8.487   29.369 1.00 27.19 ? 197  GLU A N   1 
ATOM   259  C  CA  . GLU A 1 45  ? -5.850  9.156   30.176 1.00 28.16 ? 197  GLU A CA  1 
ATOM   260  C  C   . GLU A 1 45  ? -6.471  8.214   31.207 1.00 28.53 ? 197  GLU A C   1 
ATOM   261  O  O   . GLU A 1 45  ? -6.877  7.103   30.879 1.00 28.39 ? 197  GLU A O   1 
ATOM   262  C  CB  . GLU A 1 45  ? -6.943  9.725   29.263 1.00 28.19 ? 197  GLU A CB  1 
ATOM   263  C  CG  . GLU A 1 45  ? -7.884  10.729  29.923 1.00 29.15 ? 197  GLU A CG  1 
ATOM   264  C  CD  . GLU A 1 45  ? -8.795  11.453  28.914 1.00 29.82 ? 197  GLU A CD  1 
ATOM   265  O  OE1 . GLU A 1 45  ? -8.818  11.062  27.711 1.00 31.53 ? 197  GLU A OE1 1 
ATOM   266  O  OE2 . GLU A 1 45  ? -9.491  12.415  29.332 1.00 31.26 ? 197  GLU A OE2 1 
ATOM   267  N  N   . GLY A 1 46  ? -6.518  8.663   32.459 1.00 29.44 ? 198  GLY A N   1 
ATOM   268  C  CA  . GLY A 1 46  ? -7.089  7.879   33.559 1.00 30.17 ? 198  GLY A CA  1 
ATOM   269  C  C   . GLY A 1 46  ? -6.254  6.681   33.985 1.00 30.80 ? 198  GLY A C   1 
ATOM   270  O  O   . GLY A 1 46  ? -6.663  5.898   34.842 1.00 31.03 ? 198  GLY A O   1 
ATOM   271  N  N   . ARG A 1 47  ? -5.082  6.539   33.384 1.00 31.61 ? 199  ARG A N   1 
ATOM   272  C  CA  . ARG A 1 47  ? -4.214  5.398   33.618 1.00 32.30 ? 199  ARG A CA  1 
ATOM   273  C  C   . ARG A 1 47  ? -2.887  5.818   34.248 1.00 32.35 ? 199  ARG A C   1 
ATOM   274  O  O   . ARG A 1 47  ? -2.220  5.007   34.887 1.00 32.15 ? 199  ARG A O   1 
ATOM   275  C  CB  . ARG A 1 47  ? -3.966  4.687   32.289 1.00 32.70 ? 199  ARG A CB  1 
ATOM   276  C  CG  . ARG A 1 47  ? -4.073  3.182   32.358 1.00 34.34 ? 199  ARG A CG  1 
ATOM   277  C  CD  . ARG A 1 47  ? -5.505  2.727   32.633 1.00 36.40 ? 199  ARG A CD  1 
ATOM   278  N  NE  . ARG A 1 47  ? -5.520  1.405   33.255 1.00 37.91 ? 199  ARG A NE  1 
ATOM   279  C  CZ  . ARG A 1 47  ? -5.159  1.145   34.515 1.00 38.92 ? 199  ARG A CZ  1 
ATOM   280  N  NH1 . ARG A 1 47  ? -4.739  2.113   35.325 1.00 39.84 ? 199  ARG A NH1 1 
ATOM   281  N  NH2 . ARG A 1 47  ? -5.209  -0.103  34.970 1.00 39.44 ? 199  ARG A NH2 1 
ATOM   282  N  N   . VAL A 1 48  ? -2.510  7.079   34.051 1.00 32.64 ? 200  VAL A N   1 
ATOM   283  C  CA  . VAL A 1 48  ? -1.309  7.643   34.638 1.00 33.01 ? 200  VAL A CA  1 
ATOM   284  C  C   . VAL A 1 48  ? -1.713  8.614   35.743 1.00 33.21 ? 200  VAL A C   1 
ATOM   285  O  O   . VAL A 1 48  ? -2.561  9.485   35.537 1.00 33.52 ? 200  VAL A O   1 
ATOM   286  C  CB  . VAL A 1 48  ? -0.459  8.369   33.575 1.00 33.10 ? 200  VAL A CB  1 
ATOM   287  C  CG1 . VAL A 1 48  ? -1.114  9.683   33.163 1.00 33.35 ? 200  VAL A CG1 1 
ATOM   288  C  CG2 . VAL A 1 48  ? 0.954   8.603   34.091 1.00 33.53 ? 200  VAL A CG2 1 
ATOM   289  N  N   . MET A 1 49  ? -1.137  8.442   36.925 1.00 33.19 ? 201  MET A N   1 
ATOM   290  C  CA  . MET A 1 49  ? -1.373  9.368   38.017 1.00 33.57 ? 201  MET A CA  1 
ATOM   291  C  C   . MET A 1 49  ? -0.171  10.298  38.158 1.00 32.46 ? 201  MET A C   1 
ATOM   292  O  O   . MET A 1 49  ? 0.962   9.845   38.299 1.00 32.23 ? 201  MET A O   1 
ATOM   293  C  CB  . MET A 1 49  ? -1.606  8.615   39.323 1.00 33.56 ? 201  MET A CB  1 
ATOM   294  C  CG  . MET A 1 49  ? -2.338  9.449   40.370 1.00 34.88 ? 201  MET A CG  1 
ATOM   295  S  SD  . MET A 1 49  ? -1.674  9.262   42.039 1.00 36.75 ? 201  MET A SD  1 
ATOM   296  C  CE  . MET A 1 49  ? -0.015  9.888   41.815 1.00 35.66 ? 201  MET A CE  1 
ATOM   297  N  N   . VAL A 1 50  ? -0.421  11.600  38.098 1.00 31.58 ? 202  VAL A N   1 
ATOM   298  C  CA  . VAL A 1 50  ? 0.618   12.579  38.361 1.00 31.01 ? 202  VAL A CA  1 
ATOM   299  C  C   . VAL A 1 50  ? 0.702   12.755  39.868 1.00 30.45 ? 202  VAL A C   1 
ATOM   300  O  O   . VAL A 1 50  ? -0.253  13.210  40.497 1.00 30.50 ? 202  VAL A O   1 
ATOM   301  C  CB  . VAL A 1 50  ? 0.314   13.928  37.696 1.00 30.94 ? 202  VAL A CB  1 
ATOM   302  C  CG1 . VAL A 1 50  ? 1.402   14.939  38.013 1.00 30.48 ? 202  VAL A CG1 1 
ATOM   303  C  CG2 . VAL A 1 50  ? 0.177   13.744  36.196 1.00 31.16 ? 202  VAL A CG2 1 
ATOM   304  N  N   . THR A 1 51  ? 1.833   12.364  40.446 1.00 29.74 ? 203  THR A N   1 
ATOM   305  C  CA  . THR A 1 51  ? 2.075   12.572  41.867 1.00 29.21 ? 203  THR A CA  1 
ATOM   306  C  C   . THR A 1 51  ? 2.401   14.045  42.102 1.00 29.38 ? 203  THR A C   1 
ATOM   307  O  O   . THR A 1 51  ? 2.653   14.797  41.156 1.00 29.33 ? 203  THR A O   1 
ATOM   308  C  CB  . THR A 1 51  ? 3.246   11.717  42.402 1.00 29.04 ? 203  THR A CB  1 
ATOM   309  O  OG1 . THR A 1 51  ? 4.487   12.271  41.954 1.00 27.74 ? 203  THR A OG1 1 
ATOM   310  C  CG2 . THR A 1 51  ? 3.134   10.263  41.951 1.00 28.49 ? 203  THR A CG2 1 
ATOM   311  N  N   . ASP A 1 52  ? 2.417   14.443  43.370 1.00 29.37 ? 204  ASP A N   1 
ATOM   312  C  CA  . ASP A 1 52  ? 2.742   15.823  43.733 1.00 29.58 ? 204  ASP A CA  1 
ATOM   313  C  C   . ASP A 1 52  ? 4.261   16.082  43.817 1.00 29.36 ? 204  ASP A C   1 
ATOM   314  O  O   . ASP A 1 52  ? 4.683   17.167  44.235 1.00 29.44 ? 204  ASP A O   1 
ATOM   315  C  CB  . ASP A 1 52  ? 2.032   16.225  45.047 1.00 29.71 ? 204  ASP A CB  1 
ATOM   316  C  CG  . ASP A 1 52  ? 2.474   15.390  46.261 1.00 30.76 ? 204  ASP A CG  1 
ATOM   317  O  OD1 . ASP A 1 52  ? 2.167   15.793  47.408 1.00 31.29 ? 204  ASP A OD1 1 
ATOM   318  O  OD2 . ASP A 1 52  ? 3.117   14.333  46.078 1.00 33.30 ? 204  ASP A OD2 1 
ATOM   319  N  N   . PHE A 1 53  ? 5.079   15.107  43.418 1.00 28.98 ? 205  PHE A N   1 
ATOM   320  C  CA  . PHE A 1 53  ? 6.531   15.275  43.472 1.00 28.69 ? 205  PHE A CA  1 
ATOM   321  C  C   . PHE A 1 53  ? 7.071   16.092  42.297 1.00 28.69 ? 205  PHE A C   1 
ATOM   322  O  O   . PHE A 1 53  ? 6.803   15.785  41.139 1.00 28.32 ? 205  PHE A O   1 
ATOM   323  C  CB  . PHE A 1 53  ? 7.275   13.937  43.535 1.00 28.41 ? 205  PHE A CB  1 
ATOM   324  C  CG  . PHE A 1 53  ? 8.751   14.102  43.789 1.00 28.26 ? 205  PHE A CG  1 
ATOM   325  C  CD1 . PHE A 1 53  ? 9.237   14.189  45.089 1.00 28.08 ? 205  PHE A CD1 1 
ATOM   326  C  CD2 . PHE A 1 53  ? 9.644   14.240  42.732 1.00 28.14 ? 205  PHE A CD2 1 
ATOM   327  C  CE1 . PHE A 1 53  ? 10.597  14.383  45.333 1.00 28.33 ? 205  PHE A CE1 1 
ATOM   328  C  CE2 . PHE A 1 53  ? 11.012  14.433  42.968 1.00 28.21 ? 205  PHE A CE2 1 
ATOM   329  C  CZ  . PHE A 1 53  ? 11.486  14.504  44.266 1.00 28.00 ? 205  PHE A CZ  1 
ATOM   330  N  N   . GLU A 1 54  ? 7.845   17.123  42.623 1.00 28.87 ? 206  GLU A N   1 
ATOM   331  C  CA  . GLU A 1 54  ? 8.587   17.903  41.640 1.00 29.29 ? 206  GLU A CA  1 
ATOM   332  C  C   . GLU A 1 54  ? 9.895   18.398  42.258 1.00 28.71 ? 206  GLU A C   1 
ATOM   333  O  O   . GLU A 1 54  ? 9.891   19.005  43.326 1.00 28.71 ? 206  GLU A O   1 
ATOM   334  C  CB  . GLU A 1 54  ? 7.760   19.089  41.146 1.00 29.45 ? 206  GLU A CB  1 
ATOM   335  C  CG  . GLU A 1 54  ? 8.573   20.125  40.356 1.00 30.51 ? 206  GLU A CG  1 
ATOM   336  C  CD  . GLU A 1 54  ? 7.719   21.253  39.810 1.00 30.84 ? 206  GLU A CD  1 
ATOM   337  O  OE1 . GLU A 1 54  ? 6.849   20.978  38.954 1.00 33.17 ? 206  GLU A OE1 1 
ATOM   338  O  OE2 . GLU A 1 54  ? 7.928   22.415  40.234 1.00 33.22 ? 206  GLU A OE2 1 
ATOM   339  N  N   . ASN A 1 55  ? 11.009  18.114  41.590 1.00 28.44 ? 207  ASN A N   1 
ATOM   340  C  CA  . ASN A 1 55  ? 12.320  18.636  41.985 1.00 27.93 ? 207  ASN A CA  1 
ATOM   341  C  C   . ASN A 1 55  ? 13.164  18.827  40.727 1.00 27.83 ? 207  ASN A C   1 
ATOM   342  O  O   . ASN A 1 55  ? 13.746  17.871  40.203 1.00 27.56 ? 207  ASN A O   1 
ATOM   343  C  CB  . ASN A 1 55  ? 13.015  17.710  42.999 1.00 27.68 ? 207  ASN A CB  1 
ATOM   344  C  CG  . ASN A 1 55  ? 14.169  18.399  43.733 1.00 27.46 ? 207  ASN A CG  1 
ATOM   345  O  OD1 . ASN A 1 55  ? 15.079  18.940  43.113 1.00 26.87 ? 207  ASN A OD1 1 
ATOM   346  N  ND2 . ASN A 1 55  ? 14.132  18.373  45.060 1.00 27.34 ? 207  ASN A ND2 1 
ATOM   347  N  N   . VAL A 1 56  ? 13.207  20.067  40.240 1.00 27.59 ? 208  VAL A N   1 
ATOM   348  C  CA  . VAL A 1 56  ? 13.835  20.378  38.963 1.00 27.52 ? 208  VAL A CA  1 
ATOM   349  C  C   . VAL A 1 56  ? 14.684  21.640  39.070 1.00 27.92 ? 208  VAL A C   1 
ATOM   350  O  O   . VAL A 1 56  ? 14.317  22.569  39.791 1.00 27.86 ? 208  VAL A O   1 
ATOM   351  C  CB  . VAL A 1 56  ? 12.765  20.564  37.845 1.00 27.44 ? 208  VAL A CB  1 
ATOM   352  C  CG1 . VAL A 1 56  ? 11.909  19.312  37.718 1.00 26.94 ? 208  VAL A CG1 1 
ATOM   353  C  CG2 . VAL A 1 56  ? 11.882  21.800  38.112 1.00 26.14 ? 208  VAL A CG2 1 
ATOM   354  N  N   . PRO A 1 57  ? 15.827  21.679  38.356 1.00 28.59 ? 209  PRO A N   1 
ATOM   355  C  CA  . PRO A 1 57  ? 16.625  22.910  38.322 1.00 29.22 ? 209  PRO A CA  1 
ATOM   356  C  C   . PRO A 1 57  ? 15.960  23.981  37.459 1.00 30.31 ? 209  PRO A C   1 
ATOM   357  O  O   . PRO A 1 57  ? 15.132  23.653  36.602 1.00 30.06 ? 209  PRO A O   1 
ATOM   358  C  CB  . PRO A 1 57  ? 17.948  22.451  37.705 1.00 28.86 ? 209  PRO A CB  1 
ATOM   359  C  CG  . PRO A 1 57  ? 17.592  21.277  36.879 1.00 28.40 ? 209  PRO A CG  1 
ATOM   360  C  CD  . PRO A 1 57  ? 16.447  20.600  37.565 1.00 28.18 ? 209  PRO A CD  1 
ATOM   361  N  N   . GLU A 1 58  ? 16.311  25.246  37.689 1.00 31.87 ? 210  GLU A N   1 
ATOM   362  C  CA  . GLU A 1 58  ? 15.763  26.344  36.894 1.00 33.40 ? 210  GLU A CA  1 
ATOM   363  C  C   . GLU A 1 58  ? 16.306  26.259  35.468 1.00 34.23 ? 210  GLU A C   1 
ATOM   364  O  O   . GLU A 1 58  ? 17.410  25.751  35.250 1.00 34.40 ? 210  GLU A O   1 
ATOM   365  C  CB  . GLU A 1 58  ? 16.048  27.713  37.542 1.00 33.52 ? 210  GLU A CB  1 
ATOM   366  C  CG  . GLU A 1 58  ? 17.497  28.242  37.449 1.00 34.44 ? 210  GLU A CG  1 
ATOM   367  C  CD  . GLU A 1 58  ? 17.665  29.664  38.040 1.00 34.83 ? 210  GLU A CD  1 
ATOM   368  O  OE1 . GLU A 1 58  ? 16.764  30.517  37.856 1.00 36.17 ? 210  GLU A OE1 1 
ATOM   369  O  OE2 . GLU A 1 58  ? 18.709  29.935  38.683 1.00 37.16 ? 210  GLU A OE2 1 
ATOM   370  N  N   . GLU A 1 59  ? 15.516  26.725  34.502 1.00 35.32 ? 211  GLU A N   1 
ATOM   371  C  CA  . GLU A 1 59  ? 15.917  26.673  33.093 1.00 36.38 ? 211  GLU A CA  1 
ATOM   372  C  C   . GLU A 1 59  ? 17.094  27.606  32.787 1.00 37.03 ? 211  GLU A C   1 
ATOM   373  O  O   . GLU A 1 59  ? 17.287  28.626  33.454 1.00 37.10 ? 211  GLU A O   1 
ATOM   374  C  CB  . GLU A 1 59  ? 14.738  26.984  32.158 1.00 36.55 ? 211  GLU A CB  1 
ATOM   375  C  CG  . GLU A 1 59  ? 13.797  25.792  31.896 1.00 37.58 ? 211  GLU A CG  1 
ATOM   376  C  CD  . GLU A 1 59  ? 12.517  25.827  32.725 1.00 39.11 ? 211  GLU A CD  1 
ATOM   377  O  OE1 . GLU A 1 59  ? 12.046  24.744  33.156 1.00 39.86 ? 211  GLU A OE1 1 
ATOM   378  O  OE2 . GLU A 1 59  ? 11.975  26.936  32.934 1.00 39.40 ? 211  GLU A OE2 1 
ATOM   379  N  N   . ASP A 1 60  ? 17.880  27.234  31.776 1.00 37.91 ? 212  ASP A N   1 
ATOM   380  C  CA  . ASP A 1 60  ? 19.076  27.983  31.389 1.00 38.52 ? 212  ASP A CA  1 
ATOM   381  C  C   . ASP A 1 60  ? 19.534  27.611  29.979 1.00 38.65 ? 212  ASP A C   1 
ATOM   382  O  O   . ASP A 1 60  ? 18.722  27.474  29.066 1.00 38.82 ? 212  ASP A O   1 
ATOM   383  C  CB  . ASP A 1 60  ? 20.215  27.738  32.391 1.00 38.91 ? 212  ASP A CB  1 
ATOM   384  C  CG  . ASP A 1 60  ? 20.867  26.356  32.234 1.00 40.04 ? 212  ASP A CG  1 
ATOM   385  O  OD1 . ASP A 1 60  ? 20.136  25.343  32.094 1.00 40.69 ? 212  ASP A OD1 1 
ATOM   386  O  OD2 . ASP A 1 60  ? 22.121  26.294  32.267 1.00 41.46 ? 212  ASP A OD2 1 
ATOM   387  N  N   . SER A 1 69  ? 3.173   22.498  26.171 1.00 37.03 ? 221  SER A N   1 
ATOM   388  C  CA  . SER A 1 69  ? 3.172   21.799  24.877 1.00 37.00 ? 221  SER A CA  1 
ATOM   389  C  C   . SER A 1 69  ? 4.505   21.108  24.567 1.00 36.35 ? 221  SER A C   1 
ATOM   390  O  O   . SER A 1 69  ? 4.505   20.047  23.954 1.00 37.17 ? 221  SER A O   1 
ATOM   391  C  CB  . SER A 1 69  ? 2.829   22.767  23.740 1.00 37.17 ? 221  SER A CB  1 
ATOM   392  O  OG  . SER A 1 69  ? 3.093   22.182  22.472 1.00 38.02 ? 221  SER A OG  1 
ATOM   393  N  N   . LYS A 1 70  ? 5.616   21.728  24.978 1.00 35.57 ? 222  LYS A N   1 
ATOM   394  C  CA  A LYS A 1 70  ? 6.969   21.210  24.737 0.70 35.02 ? 222  LYS A CA  1 
ATOM   395  C  CA  B LYS A 1 70  ? 6.957   21.199  24.732 0.30 34.98 ? 222  LYS A CA  1 
ATOM   396  C  C   . LYS A 1 70  ? 7.609   20.721  26.033 1.00 34.58 ? 222  LYS A C   1 
ATOM   397  O  O   . LYS A 1 70  ? 8.362   19.745  26.027 1.00 34.47 ? 222  LYS A O   1 
ATOM   398  C  CB  A LYS A 1 70  ? 7.847   22.302  24.110 0.70 35.08 ? 222  LYS A CB  1 
ATOM   399  C  CB  B LYS A 1 70  ? 7.820   22.268  24.045 0.30 34.96 ? 222  LYS A CB  1 
ATOM   400  C  CG  A LYS A 1 70  ? 9.315   21.926  23.875 0.70 35.16 ? 222  LYS A CG  1 
ATOM   401  C  CG  B LYS A 1 70  ? 8.995   21.722  23.226 0.30 34.78 ? 222  LYS A CG  1 
ATOM   402  C  CD  A LYS A 1 70  ? 9.453   20.761  22.889 0.70 35.61 ? 222  LYS A CD  1 
ATOM   403  C  CD  B LYS A 1 70  ? 9.042   22.311  21.808 0.30 34.34 ? 222  LYS A CD  1 
ATOM   404  C  CE  A LYS A 1 70  ? 10.893  20.508  22.494 0.70 35.26 ? 222  LYS A CE  1 
ATOM   405  C  CE  B LYS A 1 70  ? 9.498   23.765  21.778 0.30 33.99 ? 222  LYS A CE  1 
ATOM   406  N  NZ  A LYS A 1 70  ? 11.440  21.667  21.733 0.70 35.68 ? 222  LYS A NZ  1 
ATOM   407  N  NZ  B LYS A 1 70  ? 10.981  23.883  21.742 0.30 33.54 ? 222  LYS A NZ  1 
ATOM   408  N  N   . CYS A 1 71  ? 7.318   21.403  27.146 1.00 33.75 ? 223  CYS A N   1 
ATOM   409  C  CA  . CYS A 1 71  ? 7.845   21.010  28.461 1.00 33.13 ? 223  CYS A CA  1 
ATOM   410  C  C   . CYS A 1 71  ? 7.594   19.542  28.765 1.00 32.23 ? 223  CYS A C   1 
ATOM   411  O  O   . CYS A 1 71  ? 8.423   18.880  29.398 1.00 31.90 ? 223  CYS A O   1 
ATOM   412  C  CB  . CYS A 1 71  ? 7.226   21.845  29.592 1.00 33.08 ? 223  CYS A CB  1 
ATOM   413  S  SG  . CYS A 1 71  ? 7.802   23.566  29.660 1.00 34.67 ? 223  CYS A SG  1 
ATOM   414  N  N   . ASP A 1 72  ? 6.446   19.046  28.313 1.00 31.23 ? 224  ASP A N   1 
ATOM   415  C  CA  . ASP A 1 72  ? 6.003   17.693  28.637 1.00 30.69 ? 224  ASP A CA  1 
ATOM   416  C  C   . ASP A 1 72  ? 6.180   16.653  27.517 1.00 29.69 ? 224  ASP A C   1 
ATOM   417  O  O   . ASP A 1 72  ? 5.712   15.526  27.669 1.00 29.57 ? 224  ASP A O   1 
ATOM   418  C  CB  . ASP A 1 72  ? 4.542   17.717  29.141 1.00 30.77 ? 224  ASP A CB  1 
ATOM   419  C  CG  . ASP A 1 72  ? 3.587   18.482  28.215 1.00 31.77 ? 224  ASP A CG  1 
ATOM   420  O  OD1 . ASP A 1 72  ? 4.039   19.056  27.198 1.00 33.65 ? 224  ASP A OD1 1 
ATOM   421  O  OD2 . ASP A 1 72  ? 2.369   18.516  28.515 1.00 32.20 ? 224  ASP A OD2 1 
ATOM   422  N  N   . SER A 1 73  ? 6.884   16.993  26.432 1.00 28.71 ? 225  SER A N   1 
ATOM   423  C  CA  . SER A 1 73  ? 6.937   16.093  25.263 1.00 28.31 ? 225  SER A CA  1 
ATOM   424  C  C   . SER A 1 73  ? 7.629   14.760  25.543 1.00 27.62 ? 225  SER A C   1 
ATOM   425  O  O   . SER A 1 73  ? 7.089   13.707  25.202 1.00 27.35 ? 225  SER A O   1 
ATOM   426  C  CB  . SER A 1 73  ? 7.537   16.763  24.013 1.00 28.32 ? 225  SER A CB  1 
ATOM   427  O  OG  . SER A 1 73  ? 8.652   17.567  24.308 1.00 28.59 ? 225  SER A OG  1 
ATOM   428  N  N   . HIS A 1 74  ? 8.797   14.811  26.180 1.00 27.07 ? 226  HIS A N   1 
ATOM   429  C  CA  . HIS A 1 74  ? 9.577   13.613  26.498 1.00 26.67 ? 226  HIS A CA  1 
ATOM   430  C  C   . HIS A 1 74  ? 8.771   12.610  27.329 1.00 26.32 ? 226  HIS A C   1 
ATOM   431  O  O   . HIS A 1 74  ? 8.613   11.452  26.930 1.00 26.34 ? 226  HIS A O   1 
ATOM   432  C  CB  . HIS A 1 74  ? 10.862  14.015  27.237 1.00 26.90 ? 226  HIS A CB  1 
ATOM   433  C  CG  . HIS A 1 74  ? 11.875  12.919  27.342 1.00 27.54 ? 226  HIS A CG  1 
ATOM   434  N  ND1 . HIS A 1 74  ? 12.170  12.286  28.533 1.00 28.29 ? 226  HIS A ND1 1 
ATOM   435  C  CD2 . HIS A 1 74  ? 12.673  12.351  26.404 1.00 28.02 ? 226  HIS A CD2 1 
ATOM   436  C  CE1 . HIS A 1 74  ? 13.101  11.370  28.322 1.00 29.23 ? 226  HIS A CE1 1 
ATOM   437  N  NE2 . HIS A 1 74  ? 13.423  11.389  27.038 1.00 28.99 ? 226  HIS A NE2 1 
ATOM   438  N  N   . GLY A 1 75  ? 8.236   13.068  28.463 1.00 25.55 ? 227  GLY A N   1 
ATOM   439  C  CA  . GLY A 1 75  ? 7.542   12.195  29.409 1.00 24.89 ? 227  GLY A CA  1 
ATOM   440  C  C   . GLY A 1 75  ? 6.217   11.646  28.918 1.00 24.51 ? 227  GLY A C   1 
ATOM   441  O  O   . GLY A 1 75  ? 5.881   10.488  29.189 1.00 24.44 ? 227  GLY A O   1 
ATOM   442  N  N   . THR A 1 76  ? 5.458   12.474  28.202 1.00 23.76 ? 228  THR A N   1 
ATOM   443  C  CA  . THR A 1 76  ? 4.209   12.034  27.583 1.00 23.04 ? 228  THR A CA  1 
ATOM   444  C  C   . THR A 1 76  ? 4.455   10.896  26.585 1.00 22.85 ? 228  THR A C   1 
ATOM   445  O  O   . THR A 1 76  ? 3.702   9.918   26.547 1.00 22.94 ? 228  THR A O   1 
ATOM   446  C  CB  . THR A 1 76  ? 3.485   13.218  26.883 1.00 23.23 ? 228  THR A CB  1 
ATOM   447  O  OG1 . THR A 1 76  ? 3.349   14.317  27.802 1.00 22.08 ? 228  THR A OG1 1 
ATOM   448  C  CG2 . THR A 1 76  ? 2.102   12.797  26.374 1.00 22.68 ? 228  THR A CG2 1 
ATOM   449  N  N   . HIS A 1 77  ? 5.519   11.017  25.793 1.00 22.58 ? 229  HIS A N   1 
ATOM   450  C  CA  . HIS A 1 77  ? 5.857   10.014  24.792 1.00 22.24 ? 229  HIS A CA  1 
ATOM   451  C  C   . HIS A 1 77  ? 6.226   8.686   25.448 1.00 22.17 ? 229  HIS A C   1 
ATOM   452  O  O   . HIS A 1 77  ? 5.762   7.631   25.025 1.00 21.93 ? 229  HIS A O   1 
ATOM   453  C  CB  . HIS A 1 77  ? 6.999   10.507  23.889 1.00 22.33 ? 229  HIS A CB  1 
ATOM   454  C  CG  . HIS A 1 77  ? 7.217   9.658   22.670 1.00 22.27 ? 229  HIS A CG  1 
ATOM   455  N  ND1 . HIS A 1 77  ? 8.091   8.592   22.652 1.00 21.90 ? 229  HIS A ND1 1 
ATOM   456  C  CD2 . HIS A 1 77  ? 6.659   9.708   21.438 1.00 21.82 ? 229  HIS A CD2 1 
ATOM   457  C  CE1 . HIS A 1 77  ? 8.058   8.019   21.463 1.00 21.66 ? 229  HIS A CE1 1 
ATOM   458  N  NE2 . HIS A 1 77  ? 7.203   8.681   20.705 1.00 21.65 ? 229  HIS A NE2 1 
ATOM   459  N  N   . LEU A 1 78  ? 7.047   8.751   26.493 1.00 22.62 ? 230  LEU A N   1 
ATOM   460  C  CA  . LEU A 1 78  ? 7.518   7.557   27.195 1.00 22.68 ? 230  LEU A CA  1 
ATOM   461  C  C   . LEU A 1 78  ? 6.414   6.847   27.958 1.00 22.61 ? 230  LEU A C   1 
ATOM   462  O  O   . LEU A 1 78  ? 6.414   5.621   28.036 1.00 22.99 ? 230  LEU A O   1 
ATOM   463  C  CB  . LEU A 1 78  ? 8.668   7.904   28.144 1.00 22.95 ? 230  LEU A CB  1 
ATOM   464  C  CG  . LEU A 1 78  ? 9.981   8.329   27.473 1.00 23.59 ? 230  LEU A CG  1 
ATOM   465  C  CD1 . LEU A 1 78  ? 11.016  8.597   28.533 1.00 23.96 ? 230  LEU A CD1 1 
ATOM   466  C  CD2 . LEU A 1 78  ? 10.498  7.283   26.486 1.00 23.23 ? 230  LEU A CD2 1 
ATOM   467  N  N   . ALA A 1 79  ? 5.487   7.611   28.533 1.00 22.71 ? 231  ALA A N   1 
ATOM   468  C  CA  . ALA A 1 79  ? 4.297   7.038   29.172 1.00 22.56 ? 231  ALA A CA  1 
ATOM   469  C  C   . ALA A 1 79  ? 3.442   6.317   28.125 1.00 22.56 ? 231  ALA A C   1 
ATOM   470  O  O   . ALA A 1 79  ? 2.934   5.220   28.366 1.00 22.86 ? 231  ALA A O   1 
ATOM   471  C  CB  . ALA A 1 79  ? 3.487   8.128   29.891 1.00 22.50 ? 231  ALA A CB  1 
ATOM   472  N  N   . GLY A 1 80  ? 3.300   6.939   26.958 1.00 22.50 ? 232  GLY A N   1 
ATOM   473  C  CA  . GLY A 1 80  ? 2.691   6.294   25.804 1.00 22.31 ? 232  GLY A CA  1 
ATOM   474  C  C   . GLY A 1 80  ? 3.370   4.991   25.409 1.00 22.22 ? 232  GLY A C   1 
ATOM   475  O  O   . GLY A 1 80  ? 2.701   3.991   25.179 1.00 21.93 ? 232  GLY A O   1 
ATOM   476  N  N   . VAL A 1 81  ? 4.699   4.994   25.342 1.00 22.30 ? 233  VAL A N   1 
ATOM   477  C  CA  . VAL A 1 81  ? 5.452   3.796   24.943 1.00 22.26 ? 233  VAL A CA  1 
ATOM   478  C  C   . VAL A 1 81  ? 5.257   2.657   25.941 1.00 22.63 ? 233  VAL A C   1 
ATOM   479  O  O   . VAL A 1 81  ? 5.068   1.507   25.544 1.00 23.08 ? 233  VAL A O   1 
ATOM   480  C  CB  . VAL A 1 81  ? 6.975   4.081   24.755 1.00 22.45 ? 233  VAL A CB  1 
ATOM   481  C  CG1 . VAL A 1 81  ? 7.732   2.787   24.426 1.00 21.76 ? 233  VAL A CG1 1 
ATOM   482  C  CG2 . VAL A 1 81  ? 7.203   5.125   23.665 1.00 20.89 ? 233  VAL A CG2 1 
ATOM   483  N  N   . VAL A 1 82  ? 5.283   2.977   27.232 1.00 22.84 ? 234  VAL A N   1 
ATOM   484  C  CA  . VAL A 1 82  ? 5.117   1.967   28.270 1.00 22.87 ? 234  VAL A CA  1 
ATOM   485  C  C   . VAL A 1 82  ? 3.691   1.397   28.260 1.00 23.31 ? 234  VAL A C   1 
ATOM   486  O  O   . VAL A 1 82  ? 3.506   0.176   28.246 1.00 23.55 ? 234  VAL A O   1 
ATOM   487  C  CB  . VAL A 1 82  ? 5.480   2.528   29.686 1.00 22.74 ? 234  VAL A CB  1 
ATOM   488  C  CG1 . VAL A 1 82  ? 5.105   1.543   30.774 1.00 22.24 ? 234  VAL A CG1 1 
ATOM   489  C  CG2 . VAL A 1 82  ? 6.963   2.851   29.776 1.00 22.34 ? 234  VAL A CG2 1 
ATOM   490  N  N   . SER A 1 83  ? 2.699   2.284   28.228 1.00 23.67 ? 235  SER A N   1 
ATOM   491  C  CA  . SER A 1 83  ? 1.325   1.920   28.575 1.00 24.36 ? 235  SER A CA  1 
ATOM   492  C  C   . SER A 1 83  ? 0.230   2.404   27.631 1.00 24.53 ? 235  SER A C   1 
ATOM   493  O  O   . SER A 1 83  ? -0.943  2.167   27.907 1.00 24.70 ? 235  SER A O   1 
ATOM   494  C  CB  . SER A 1 83  ? 1.006   2.457   29.979 1.00 24.61 ? 235  SER A CB  1 
ATOM   495  O  OG  . SER A 1 83  ? 1.115   3.876   30.020 1.00 25.28 ? 235  SER A OG  1 
ATOM   496  N  N   . GLY A 1 84  ? 0.593   3.068   26.535 1.00 24.89 ? 236  GLY A N   1 
ATOM   497  C  CA  . GLY A 1 84  ? -0.392  3.664   25.627 1.00 25.26 ? 236  GLY A CA  1 
ATOM   498  C  C   . GLY A 1 84  ? -1.387  2.647   25.108 1.00 25.45 ? 236  GLY A C   1 
ATOM   499  O  O   . GLY A 1 84  ? -1.020  1.522   24.795 1.00 25.19 ? 236  GLY A O   1 
ATOM   500  N  N   . ARG A 1 85  ? -2.651  3.040   25.019 1.00 26.21 ? 237  ARG A N   1 
ATOM   501  C  CA  . ARG A 1 85  ? -3.709  2.093   24.660 1.00 27.11 ? 237  ARG A CA  1 
ATOM   502  C  C   . ARG A 1 85  ? -3.647  1.578   23.217 1.00 26.41 ? 237  ARG A C   1 
ATOM   503  O  O   . ARG A 1 85  ? -4.010  0.437   22.972 1.00 26.39 ? 237  ARG A O   1 
ATOM   504  C  CB  . ARG A 1 85  ? -5.103  2.647   24.984 1.00 27.33 ? 237  ARG A CB  1 
ATOM   505  C  CG  . ARG A 1 85  ? -5.412  4.021   24.429 1.00 28.87 ? 237  ARG A CG  1 
ATOM   506  C  CD  . ARG A 1 85  ? -6.908  4.291   24.512 1.00 29.74 ? 237  ARG A CD  1 
ATOM   507  N  NE  . ARG A 1 85  ? -7.631  3.556   23.478 1.00 32.56 ? 237  ARG A NE  1 
ATOM   508  C  CZ  . ARG A 1 85  ? -8.044  4.055   22.308 1.00 34.46 ? 237  ARG A CZ  1 
ATOM   509  N  NH1 . ARG A 1 85  ? -7.830  5.327   21.981 1.00 35.98 ? 237  ARG A NH1 1 
ATOM   510  N  NH2 . ARG A 1 85  ? -8.691  3.265   21.449 1.00 34.33 ? 237  ARG A NH2 1 
ATOM   511  N  N   . ASP A 1 86  ? -3.181  2.404   22.281 1.00 26.21 ? 238  ASP A N   1 
ATOM   512  C  CA  . ASP A 1 86  ? -2.997  1.991   20.880 1.00 26.10 ? 238  ASP A CA  1 
ATOM   513  C  C   . ASP A 1 86  ? -1.557  1.605   20.544 1.00 25.95 ? 238  ASP A C   1 
ATOM   514  O  O   . ASP A 1 86  ? -1.328  0.631   19.821 1.00 26.02 ? 238  ASP A O   1 
ATOM   515  C  CB  . ASP A 1 86  ? -3.416  3.112   19.926 1.00 26.24 ? 238  ASP A CB  1 
ATOM   516  C  CG  . ASP A 1 86  ? -4.904  3.411   19.977 1.00 26.48 ? 238  ASP A CG  1 
ATOM   517  O  OD1 . ASP A 1 86  ? -5.694  2.525   20.371 1.00 26.55 ? 238  ASP A OD1 1 
ATOM   518  O  OD2 . ASP A 1 86  ? -5.283  4.543   19.609 1.00 26.88 ? 238  ASP A OD2 1 
ATOM   519  N  N   . ALA A 1 87  ? -0.599  2.378   21.058 1.00 25.66 ? 239  ALA A N   1 
ATOM   520  C  CA  . ALA A 1 87  ? 0.807   2.273   20.661 1.00 25.49 ? 239  ALA A CA  1 
ATOM   521  C  C   . ALA A 1 87  ? 1.759   1.856   21.794 1.00 25.35 ? 239  ALA A C   1 
ATOM   522  O  O   . ALA A 1 87  ? 2.977   1.890   21.621 1.00 25.33 ? 239  ALA A O   1 
ATOM   523  C  CB  . ALA A 1 87  ? 1.268   3.610   20.069 1.00 25.42 ? 239  ALA A CB  1 
ATOM   524  N  N   . GLY A 1 88  ? 1.219   1.454   22.938 1.00 25.13 ? 240  GLY A N   1 
ATOM   525  C  CA  . GLY A 1 88  ? 2.044   1.065   24.071 1.00 25.12 ? 240  GLY A CA  1 
ATOM   526  C  C   . GLY A 1 88  ? 2.403   -0.406  24.078 1.00 25.23 ? 240  GLY A C   1 
ATOM   527  O  O   . GLY A 1 88  ? 1.770   -1.222  23.408 1.00 25.39 ? 240  GLY A O   1 
ATOM   528  N  N   . VAL A 1 89  ? 3.428   -0.734  24.854 1.00 25.39 ? 241  VAL A N   1 
ATOM   529  C  CA  . VAL A 1 89  ? 3.892   -2.105  25.010 1.00 25.39 ? 241  VAL A CA  1 
ATOM   530  C  C   . VAL A 1 89  ? 2.966   -2.863  25.944 1.00 25.73 ? 241  VAL A C   1 
ATOM   531  O  O   . VAL A 1 89  ? 2.483   -3.937  25.603 1.00 25.54 ? 241  VAL A O   1 
ATOM   532  C  CB  . VAL A 1 89  ? 5.327   -2.145  25.582 1.00 25.30 ? 241  VAL A CB  1 
ATOM   533  C  CG1 . VAL A 1 89  ? 5.724   -3.576  25.954 1.00 25.18 ? 241  VAL A CG1 1 
ATOM   534  C  CG2 . VAL A 1 89  ? 6.310   -1.530  24.587 1.00 24.34 ? 241  VAL A CG2 1 
ATOM   535  N  N   . ALA A 1 90  ? 2.736   -2.291  27.126 1.00 26.39 ? 242  ALA A N   1 
ATOM   536  C  CA  . ALA A 1 90  ? 1.843   -2.863  28.135 1.00 26.74 ? 242  ALA A CA  1 
ATOM   537  C  C   . ALA A 1 90  ? 0.570   -2.016  28.193 1.00 27.26 ? 242  ALA A C   1 
ATOM   538  O  O   . ALA A 1 90  ? 0.429   -1.142  29.039 1.00 27.52 ? 242  ALA A O   1 
ATOM   539  C  CB  . ALA A 1 90  ? 2.541   -2.901  29.497 1.00 26.49 ? 242  ALA A CB  1 
ATOM   540  N  N   . LYS A 1 91  ? -0.356  -2.293  27.284 1.00 28.09 ? 243  LYS A N   1 
ATOM   541  C  CA  . LYS A 1 91  ? -1.506  -1.417  27.043 1.00 28.66 ? 243  LYS A CA  1 
ATOM   542  C  C   . LYS A 1 91  ? -2.423  -1.341  28.259 1.00 29.13 ? 243  LYS A C   1 
ATOM   543  O  O   . LYS A 1 91  ? -2.908  -2.364  28.747 1.00 29.50 ? 243  LYS A O   1 
ATOM   544  C  CB  . LYS A 1 91  ? -2.289  -1.887  25.811 1.00 28.51 ? 243  LYS A CB  1 
ATOM   545  C  CG  . LYS A 1 91  ? -1.485  -1.823  24.515 1.00 28.74 ? 243  LYS A CG  1 
ATOM   546  C  CD  . LYS A 1 91  ? -2.217  -2.461  23.356 1.00 28.97 ? 243  LYS A CD  1 
ATOM   547  C  CE  . LYS A 1 91  ? -1.466  -2.276  22.045 1.00 29.41 ? 243  LYS A CE  1 
ATOM   548  N  NZ  . LYS A 1 91  ? -0.052  -2.746  22.120 1.00 30.63 ? 243  LYS A NZ  1 
ATOM   549  N  N   . GLY A 1 92  ? -2.640  -0.122  28.747 1.00 29.47 ? 244  GLY A N   1 
ATOM   550  C  CA  . GLY A 1 92  ? -3.465  0.112   29.927 1.00 29.80 ? 244  GLY A CA  1 
ATOM   551  C  C   . GLY A 1 92  ? -2.755  0.003   31.272 1.00 29.90 ? 244  GLY A C   1 
ATOM   552  O  O   . GLY A 1 92  ? -3.398  0.098   32.312 1.00 30.12 ? 244  GLY A O   1 
ATOM   553  N  N   . ALA A 1 93  ? -1.438  -0.183  31.269 1.00 30.10 ? 245  ALA A N   1 
ATOM   554  C  CA  . ALA A 1 93  ? -0.680  -0.330  32.517 1.00 29.91 ? 245  ALA A CA  1 
ATOM   555  C  C   . ALA A 1 93  ? -0.823  0.915   33.383 1.00 29.78 ? 245  ALA A C   1 
ATOM   556  O  O   . ALA A 1 93  ? -0.941  2.023   32.863 1.00 29.91 ? 245  ALA A O   1 
ATOM   557  C  CB  . ALA A 1 93  ? 0.788   -0.596  32.219 1.00 29.94 ? 245  ALA A CB  1 
ATOM   558  N  N   . SER A 1 94  ? -0.822  0.727   34.700 1.00 29.62 ? 246  SER A N   1 
ATOM   559  C  CA  . SER A 1 94  ? -0.908  1.840   35.633 1.00 29.73 ? 246  SER A CA  1 
ATOM   560  C  C   . SER A 1 94  ? 0.452   2.492   35.744 1.00 29.36 ? 246  SER A C   1 
ATOM   561  O  O   . SER A 1 94  ? 1.466   1.801   35.812 1.00 29.48 ? 246  SER A O   1 
ATOM   562  C  CB  . SER A 1 94  ? -1.340  1.366   37.019 1.00 29.72 ? 246  SER A CB  1 
ATOM   563  O  OG  . SER A 1 94  ? -2.459  0.521   36.927 1.00 31.43 ? 246  SER A OG  1 
ATOM   564  N  N   . MET A 1 95  ? 0.475   3.819   35.762 1.00 29.07 ? 247  MET A N   1 
ATOM   565  C  CA  . MET A 1 95  ? 1.717   4.550   35.948 1.00 28.86 ? 247  MET A CA  1 
ATOM   566  C  C   . MET A 1 95  ? 1.552   5.702   36.924 1.00 28.45 ? 247  MET A C   1 
ATOM   567  O  O   . MET A 1 95  ? 0.452   6.205   37.128 1.00 28.30 ? 247  MET A O   1 
ATOM   568  C  CB  . MET A 1 95  ? 2.230   5.077   34.611 1.00 28.92 ? 247  MET A CB  1 
ATOM   569  C  CG  . MET A 1 95  ? 2.486   3.993   33.571 1.00 28.83 ? 247  MET A CG  1 
ATOM   570  S  SD  . MET A 1 95  ? 3.310   4.627   32.103 1.00 29.39 ? 247  MET A SD  1 
ATOM   571  C  CE  . MET A 1 95  ? 4.930   5.075   32.744 1.00 28.54 ? 247  MET A CE  1 
ATOM   572  N  N   . ARG A 1 96  ? 2.666   6.097   37.530 1.00 28.19 ? 248  ARG A N   1 
ATOM   573  C  CA  . ARG A 1 96  ? 2.731   7.270   38.398 1.00 27.92 ? 248  ARG A CA  1 
ATOM   574  C  C   . ARG A 1 96  ? 3.958   8.076   38.008 1.00 26.85 ? 248  ARG A C   1 
ATOM   575  O  O   . ARG A 1 96  ? 5.046   7.526   37.950 1.00 26.25 ? 248  ARG A O   1 
ATOM   576  C  CB  . ARG A 1 96  ? 2.872   6.857   39.859 1.00 28.21 ? 248  ARG A CB  1 
ATOM   577  C  CG  . ARG A 1 96  ? 1.743   6.030   40.391 1.00 30.15 ? 248  ARG A CG  1 
ATOM   578  C  CD  . ARG A 1 96  ? 2.113   5.479   41.744 1.00 33.12 ? 248  ARG A CD  1 
ATOM   579  N  NE  . ARG A 1 96  ? 0.978   4.806   42.354 1.00 34.87 ? 248  ARG A NE  1 
ATOM   580  C  CZ  . ARG A 1 96  ? 0.087   5.381   43.158 1.00 36.17 ? 248  ARG A CZ  1 
ATOM   581  N  NH1 . ARG A 1 96  ? -0.911  4.643   43.630 1.00 36.41 ? 248  ARG A NH1 1 
ATOM   582  N  NH2 . ARG A 1 96  ? 0.185   6.665   43.508 1.00 36.81 ? 248  ARG A NH2 1 
ATOM   583  N  N   . SER A 1 97  ? 3.784   9.366   37.742 1.00 26.05 ? 249  SER A N   1 
ATOM   584  C  CA  . SER A 1 97  ? 4.899   10.193  37.313 1.00 25.70 ? 249  SER A CA  1 
ATOM   585  C  C   . SER A 1 97  ? 5.404   11.093  38.432 1.00 25.06 ? 249  SER A C   1 
ATOM   586  O  O   . SER A 1 97  ? 4.629   11.698  39.177 1.00 24.59 ? 249  SER A O   1 
ATOM   587  C  CB  . SER A 1 97  ? 4.544   11.021  36.077 1.00 25.69 ? 249  SER A CB  1 
ATOM   588  O  OG  . SER A 1 97  ? 3.505   11.928  36.351 1.00 26.91 ? 249  SER A OG  1 
ATOM   589  N  N   . LEU A 1 98  ? 6.729   11.135  38.539 1.00 24.74 ? 250  LEU A N   1 
ATOM   590  C  CA  . LEU A 1 98  ? 7.453   12.069  39.388 1.00 24.20 ? 250  LEU A CA  1 
ATOM   591  C  C   . LEU A 1 98  ? 8.196   12.986  38.435 1.00 23.80 ? 250  LEU A C   1 
ATOM   592  O  O   . LEU A 1 98  ? 8.725   12.519  37.433 1.00 23.85 ? 250  LEU A O   1 
ATOM   593  C  CB  . LEU A 1 98  ? 8.458   11.328  40.270 1.00 24.03 ? 250  LEU A CB  1 
ATOM   594  C  CG  . LEU A 1 98  ? 7.914   10.507  41.441 1.00 24.38 ? 250  LEU A CG  1 
ATOM   595  C  CD1 . LEU A 1 98  ? 7.063   9.327   40.972 1.00 23.54 ? 250  LEU A CD1 1 
ATOM   596  C  CD2 . LEU A 1 98  ? 9.072   10.024  42.302 1.00 24.33 ? 250  LEU A CD2 1 
ATOM   597  N  N   . ARG A 1 99  ? 8.228   14.280  38.738 1.00 23.61 ? 251  ARG A N   1 
ATOM   598  C  CA  . ARG A 1 99  ? 8.897   15.251  37.883 1.00 23.37 ? 251  ARG A CA  1 
ATOM   599  C  C   . ARG A 1 99  ? 10.293  15.605  38.418 1.00 22.95 ? 251  ARG A C   1 
ATOM   600  O  O   . ARG A 1 99  ? 10.431  16.356  39.385 1.00 22.80 ? 251  ARG A O   1 
ATOM   601  C  CB  . ARG A 1 99  ? 8.048   16.516  37.711 1.00 23.42 ? 251  ARG A CB  1 
ATOM   602  C  CG  . ARG A 1 99  ? 8.473   17.315  36.498 1.00 23.88 ? 251  ARG A CG  1 
ATOM   603  C  CD  . ARG A 1 99  ? 8.040   18.754  36.543 1.00 24.58 ? 251  ARG A CD  1 
ATOM   604  N  NE  . ARG A 1 99  ? 8.706   19.513  35.486 1.00 25.33 ? 251  ARG A NE  1 
ATOM   605  C  CZ  . ARG A 1 99  ? 8.609   20.831  35.320 1.00 25.85 ? 251  ARG A CZ  1 
ATOM   606  N  NH1 . ARG A 1 99  ? 9.261   21.418  34.324 1.00 25.96 ? 251  ARG A NH1 1 
ATOM   607  N  NH2 . ARG A 1 99  ? 7.862   21.564  36.133 1.00 25.48 ? 251  ARG A NH2 1 
ATOM   608  N  N   . VAL A 1 100 ? 11.316  15.036  37.781 1.00 22.59 ? 252  VAL A N   1 
ATOM   609  C  CA  . VAL A 1 100 ? 12.710  15.323  38.111 1.00 22.17 ? 252  VAL A CA  1 
ATOM   610  C  C   . VAL A 1 100 ? 13.498  15.997  36.967 1.00 22.01 ? 252  VAL A C   1 
ATOM   611  O  O   . VAL A 1 100 ? 14.675  16.309  37.134 1.00 22.36 ? 252  VAL A O   1 
ATOM   612  C  CB  . VAL A 1 100 ? 13.439  14.031  38.571 1.00 22.50 ? 252  VAL A CB  1 
ATOM   613  C  CG1 . VAL A 1 100 ? 12.757  13.455  39.814 1.00 22.33 ? 252  VAL A CG1 1 
ATOM   614  C  CG2 . VAL A 1 100 ? 13.511  12.992  37.449 1.00 20.75 ? 252  VAL A CG2 1 
ATOM   615  N  N   . LEU A 1 101 ? 12.859  16.215  35.818 1.00 21.80 ? 253  LEU A N   1 
ATOM   616  C  CA  . LEU A 1 101 ? 13.484  16.896  34.675 1.00 21.71 ? 253  LEU A CA  1 
ATOM   617  C  C   . LEU A 1 101 ? 12.714  18.173  34.334 1.00 21.63 ? 253  LEU A C   1 
ATOM   618  O  O   . LEU A 1 101 ? 11.491  18.163  34.276 1.00 21.53 ? 253  LEU A O   1 
ATOM   619  C  CB  . LEU A 1 101 ? 13.516  15.974  33.449 1.00 21.62 ? 253  LEU A CB  1 
ATOM   620  C  CG  . LEU A 1 101 ? 14.259  14.636  33.570 1.00 21.77 ? 253  LEU A CG  1 
ATOM   621  C  CD1 . LEU A 1 101 ? 13.980  13.753  32.354 1.00 21.26 ? 253  LEU A CD1 1 
ATOM   622  C  CD2 . LEU A 1 101 ? 15.758  14.850  33.737 1.00 22.35 ? 253  LEU A CD2 1 
ATOM   623  N  N   . ASN A 1 102 ? 13.431  19.269  34.101 1.00 21.82 ? 254  ASN A N   1 
ATOM   624  C  CA  . ASN A 1 102 ? 12.796  20.551  33.775 1.00 21.86 ? 254  ASN A CA  1 
ATOM   625  C  C   . ASN A 1 102 ? 12.301  20.604  32.322 1.00 22.47 ? 254  ASN A C   1 
ATOM   626  O  O   . ASN A 1 102 ? 12.312  19.591  31.621 1.00 22.40 ? 254  ASN A O   1 
ATOM   627  C  CB  . ASN A 1 102 ? 13.724  21.735  34.132 1.00 21.65 ? 254  ASN A CB  1 
ATOM   628  C  CG  . ASN A 1 102 ? 14.914  21.880  33.198 1.00 20.19 ? 254  ASN A CG  1 
ATOM   629  O  OD1 . ASN A 1 102 ? 15.010  21.221  32.172 1.00 18.37 ? 254  ASN A OD1 1 
ATOM   630  N  ND2 . ASN A 1 102 ? 15.819  22.776  33.549 1.00 18.66 ? 254  ASN A ND2 1 
ATOM   631  N  N   . CYS A 1 103 ? 11.851  21.774  31.880 1.00 23.46 ? 255  CYS A N   1 
ATOM   632  C  CA  . CYS A 1 103 ? 11.282  21.927  30.534 1.00 24.68 ? 255  CYS A CA  1 
ATOM   633  C  C   . CYS A 1 103 ? 12.250  21.586  29.406 1.00 24.45 ? 255  CYS A C   1 
ATOM   634  O  O   . CYS A 1 103 ? 11.812  21.223  28.323 1.00 24.54 ? 255  CYS A O   1 
ATOM   635  C  CB  . CYS A 1 103 ? 10.753  23.347  30.329 1.00 25.33 ? 255  CYS A CB  1 
ATOM   636  S  SG  . CYS A 1 103 ? 9.193   23.620  31.173 1.00 29.32 ? 255  CYS A SG  1 
ATOM   637  N  N   . GLN A 1 104 ? 13.552  21.713  29.672 1.00 24.33 ? 256  GLN A N   1 
ATOM   638  C  CA  . GLN A 1 104 ? 14.600  21.422  28.703 1.00 24.43 ? 256  GLN A CA  1 
ATOM   639  C  C   . GLN A 1 104 ? 15.168  20.013  28.867 1.00 23.50 ? 256  GLN A C   1 
ATOM   640  O  O   . GLN A 1 104 ? 16.153  19.674  28.228 1.00 23.14 ? 256  GLN A O   1 
ATOM   641  C  CB  . GLN A 1 104 ? 15.736  22.431  28.856 1.00 24.52 ? 256  GLN A CB  1 
ATOM   642  C  CG  . GLN A 1 104 ? 15.290  23.884  28.784 1.00 25.63 ? 256  GLN A CG  1 
ATOM   643  C  CD  . GLN A 1 104 ? 16.347  24.834  29.305 1.00 26.64 ? 256  GLN A CD  1 
ATOM   644  O  OE1 . GLN A 1 104 ? 16.959  24.596  30.363 1.00 29.82 ? 256  GLN A OE1 1 
ATOM   645  N  NE2 . GLN A 1 104 ? 16.570  25.926  28.572 1.00 29.16 ? 256  GLN A NE2 1 
ATOM   646  N  N   . GLY A 1 105 ? 14.549  19.201  29.722 1.00 22.91 ? 257  GLY A N   1 
ATOM   647  C  CA  . GLY A 1 105 ? 14.973  17.811  29.928 1.00 22.19 ? 257  GLY A CA  1 
ATOM   648  C  C   . GLY A 1 105 ? 16.127  17.647  30.898 1.00 21.46 ? 257  GLY A C   1 
ATOM   649  O  O   . GLY A 1 105 ? 16.738  16.589  30.950 1.00 21.04 ? 257  GLY A O   1 
ATOM   650  N  N   . LYS A 1 106 ? 16.407  18.685  31.683 1.00 21.10 ? 258  LYS A N   1 
ATOM   651  C  CA  . LYS A 1 106 ? 17.563  18.695  32.577 1.00 21.09 ? 258  LYS A CA  1 
ATOM   652  C  C   . LYS A 1 106 ? 17.136  18.547  34.036 1.00 20.56 ? 258  LYS A C   1 
ATOM   653  O  O   . LYS A 1 106 ? 16.169  19.156  34.476 1.00 20.19 ? 258  LYS A O   1 
ATOM   654  C  CB  . LYS A 1 106 ? 18.371  19.981  32.392 1.00 20.87 ? 258  LYS A CB  1 
ATOM   655  C  CG  . LYS A 1 106 ? 19.684  19.985  33.156 1.00 21.70 ? 258  LYS A CG  1 
ATOM   656  C  CD  . LYS A 1 106 ? 20.603  21.145  32.762 1.00 21.97 ? 258  LYS A CD  1 
ATOM   657  C  CE  . LYS A 1 106 ? 20.274  22.423  33.524 1.00 24.26 ? 258  LYS A CE  1 
ATOM   658  N  NZ  . LYS A 1 106 ? 21.397  23.425  33.442 1.00 25.88 ? 258  LYS A NZ  1 
ATOM   659  N  N   . GLY A 1 107 ? 17.878  17.724  34.768 1.00 20.43 ? 259  GLY A N   1 
ATOM   660  C  CA  . GLY A 1 107 ? 17.655  17.511  36.189 1.00 20.19 ? 259  GLY A CA  1 
ATOM   661  C  C   . GLY A 1 107 ? 18.955  17.532  36.963 1.00 19.99 ? 259  GLY A C   1 
ATOM   662  O  O   . GLY A 1 107 ? 19.995  17.914  36.432 1.00 19.40 ? 259  GLY A O   1 
ATOM   663  N  N   . THR A 1 108 ? 18.880  17.140  38.234 1.00 20.11 ? 260  THR A N   1 
ATOM   664  C  CA  . THR A 1 108 ? 20.056  17.018  39.098 1.00 19.73 ? 260  THR A CA  1 
ATOM   665  C  C   . THR A 1 108 ? 20.078  15.625  39.705 1.00 19.89 ? 260  THR A C   1 
ATOM   666  O  O   . THR A 1 108 ? 19.036  14.976  39.823 1.00 19.86 ? 260  THR A O   1 
ATOM   667  C  CB  . THR A 1 108 ? 20.046  18.066  40.241 1.00 19.81 ? 260  THR A CB  1 
ATOM   668  O  OG1 . THR A 1 108 ? 18.825  17.963  40.992 1.00 19.02 ? 260  THR A OG1 1 
ATOM   669  C  CG2 . THR A 1 108 ? 20.185  19.486  39.685 1.00 19.10 ? 260  THR A CG2 1 
ATOM   670  N  N   . VAL A 1 109 ? 21.267  15.163  40.082 1.00 20.02 ? 261  VAL A N   1 
ATOM   671  C  CA  . VAL A 1 109 ? 21.408  13.909  40.823 1.00 20.01 ? 261  VAL A CA  1 
ATOM   672  C  C   . VAL A 1 109 ? 20.690  14.004  42.172 1.00 20.14 ? 261  VAL A C   1 
ATOM   673  O  O   . VAL A 1 109 ? 19.973  13.090  42.564 1.00 20.43 ? 261  VAL A O   1 
ATOM   674  C  CB  . VAL A 1 109 ? 22.891  13.549  41.045 1.00 20.06 ? 261  VAL A CB  1 
ATOM   675  C  CG1 . VAL A 1 109 ? 23.045  12.488  42.134 1.00 19.35 ? 261  VAL A CG1 1 
ATOM   676  C  CG2 . VAL A 1 109 ? 23.516  13.087  39.729 1.00 19.89 ? 261  VAL A CG2 1 
ATOM   677  N  N   . SER A 1 110 ? 20.870  15.121  42.865 1.00 20.16 ? 262  SER A N   1 
ATOM   678  C  CA  . SER A 1 110 ? 20.223  15.325  44.151 1.00 20.27 ? 262  SER A CA  1 
ATOM   679  C  C   . SER A 1 110 ? 18.695  15.250  44.049 1.00 20.48 ? 262  SER A C   1 
ATOM   680  O  O   . SER A 1 110 ? 18.038  14.716  44.941 1.00 20.47 ? 262  SER A O   1 
ATOM   681  C  CB  . SER A 1 110 ? 20.652  16.658  44.759 1.00 20.13 ? 262  SER A CB  1 
ATOM   682  O  OG  . SER A 1 110 ? 20.101  17.757  44.057 1.00 20.32 ? 262  SER A OG  1 
ATOM   683  N  N   . GLY A 1 111 ? 18.144  15.780  42.958 1.00 20.71 ? 263  GLY A N   1 
ATOM   684  C  CA  . GLY A 1 111 ? 16.705  15.769  42.717 1.00 20.75 ? 263  GLY A CA  1 
ATOM   685  C  C   . GLY A 1 111 ? 16.179  14.391  42.387 1.00 21.07 ? 263  GLY A C   1 
ATOM   686  O  O   . GLY A 1 111 ? 15.106  14.014  42.843 1.00 21.48 ? 263  GLY A O   1 
ATOM   687  N  N   . THR A 1 112 ? 16.929  13.640  41.586 1.00 21.53 ? 264  THR A N   1 
ATOM   688  C  CA  . THR A 1 112 ? 16.610  12.242  41.313 1.00 21.95 ? 264  THR A CA  1 
ATOM   689  C  C   . THR A 1 112 ? 16.667  11.383  42.586 1.00 21.99 ? 264  THR A C   1 
ATOM   690  O  O   . THR A 1 112 ? 15.847  10.498  42.765 1.00 22.50 ? 264  THR A O   1 
ATOM   691  C  CB  . THR A 1 112 ? 17.549  11.639  40.224 1.00 22.32 ? 264  THR A CB  1 
ATOM   692  O  OG1 . THR A 1 112 ? 17.704  12.572  39.147 1.00 22.45 ? 264  THR A OG1 1 
ATOM   693  C  CG2 . THR A 1 112 ? 16.992  10.322  39.674 1.00 20.95 ? 264  THR A CG2 1 
ATOM   694  N  N   . LEU A 1 113 ? 17.628  11.650  43.467 1.00 22.16 ? 265  LEU A N   1 
ATOM   695  C  CA  . LEU A 1 113 ? 17.742  10.917  44.743 1.00 21.95 ? 265  LEU A CA  1 
ATOM   696  C  C   . LEU A 1 113 ? 16.521  11.114  45.640 1.00 21.22 ? 265  LEU A C   1 
ATOM   697  O  O   . LEU A 1 113 ? 16.039  10.175  46.256 1.00 20.39 ? 265  LEU A O   1 
ATOM   698  C  CB  . LEU A 1 113 ? 18.979  11.364  45.528 1.00 21.95 ? 265  LEU A CB  1 
ATOM   699  C  CG  . LEU A 1 113 ? 20.350  10.858  45.095 1.00 23.21 ? 265  LEU A CG  1 
ATOM   700  C  CD1 . LEU A 1 113 ? 21.408  11.526  45.976 1.00 22.61 ? 265  LEU A CD1 1 
ATOM   701  C  CD2 . LEU A 1 113 ? 20.445  9.330   45.166 1.00 23.43 ? 265  LEU A CD2 1 
ATOM   702  N  N   . ILE A 1 114 ? 16.058  12.355  45.733 1.00 20.89 ? 266  ILE A N   1 
ATOM   703  C  CA  . ILE A 1 114 ? 14.888  12.676  46.531 1.00 20.64 ? 266  ILE A CA  1 
ATOM   704  C  C   . ILE A 1 114 ? 13.668  12.003  45.909 1.00 20.87 ? 266  ILE A C   1 
ATOM   705  O  O   . ILE A 1 114 ? 12.778  11.544  46.616 1.00 21.26 ? 266  ILE A O   1 
ATOM   706  C  CB  . ILE A 1 114 ? 14.695  14.210  46.668 1.00 20.64 ? 266  ILE A CB  1 
ATOM   707  C  CG1 . ILE A 1 114 ? 15.866  14.833  47.443 1.00 20.50 ? 266  ILE A CG1 1 
ATOM   708  C  CG2 . ILE A 1 114 ? 13.388  14.534  47.387 1.00 19.92 ? 266  ILE A CG2 1 
ATOM   709  C  CD1 . ILE A 1 114 ? 15.881  16.358  47.433 1.00 20.37 ? 266  ILE A CD1 1 
ATOM   710  N  N   . GLY A 1 115 ? 13.642  11.928  44.584 1.00 21.12 ? 267  GLY A N   1 
ATOM   711  C  CA  . GLY A 1 115 ? 12.581  11.226  43.876 1.00 21.36 ? 267  GLY A CA  1 
ATOM   712  C  C   . GLY A 1 115 ? 12.563  9.733   44.147 1.00 21.53 ? 267  GLY A C   1 
ATOM   713  O  O   . GLY A 1 115 ? 11.498  9.141   44.326 1.00 21.21 ? 267  GLY A O   1 
ATOM   714  N  N   . LEU A 1 116 ? 13.744  9.123   44.163 1.00 21.76 ? 268  LEU A N   1 
ATOM   715  C  CA  . LEU A 1 116 ? 13.881  7.697   44.461 1.00 22.00 ? 268  LEU A CA  1 
ATOM   716  C  C   . LEU A 1 116 ? 13.494  7.388   45.904 1.00 22.47 ? 268  LEU A C   1 
ATOM   717  O  O   . LEU A 1 116 ? 12.959  6.317   46.195 1.00 22.37 ? 268  LEU A O   1 
ATOM   718  C  CB  . LEU A 1 116 ? 15.313  7.231   44.182 1.00 21.72 ? 268  LEU A CB  1 
ATOM   719  C  CG  . LEU A 1 116 ? 15.700  7.154   42.703 1.00 21.63 ? 268  LEU A CG  1 
ATOM   720  C  CD1 . LEU A 1 116 ? 17.199  6.924   42.571 1.00 20.47 ? 268  LEU A CD1 1 
ATOM   721  C  CD2 . LEU A 1 116 ? 14.902  6.044   41.990 1.00 19.65 ? 268  LEU A CD2 1 
ATOM   722  N  N   . GLU A 1 117 ? 13.763  8.343   46.791 1.00 23.07 ? 269  GLU A N   1 
ATOM   723  C  CA  . GLU A 1 117 ? 13.412  8.250   48.203 1.00 23.83 ? 269  GLU A CA  1 
ATOM   724  C  C   . GLU A 1 117 ? 11.890  8.308   48.399 1.00 24.09 ? 269  GLU A C   1 
ATOM   725  O  O   . GLU A 1 117 ? 11.335  7.606   49.240 1.00 23.93 ? 269  GLU A O   1 
ATOM   726  C  CB  . GLU A 1 117 ? 14.083  9.395   48.966 1.00 23.74 ? 269  GLU A CB  1 
ATOM   727  C  CG  . GLU A 1 117 ? 14.139  9.203   50.475 1.00 24.45 ? 269  GLU A CG  1 
ATOM   728  C  CD  . GLU A 1 117 ? 14.270  10.505  51.257 1.00 25.14 ? 269  GLU A CD  1 
ATOM   729  O  OE1 . GLU A 1 117 ? 13.857  11.575  50.768 1.00 27.02 ? 269  GLU A OE1 1 
ATOM   730  O  OE2 . GLU A 1 117 ? 14.759  10.450  52.397 1.00 29.38 ? 269  GLU A OE2 1 
ATOM   731  N  N   . PHE A 1 118 ? 11.235  9.164   47.619 1.00 24.66 ? 270  PHE A N   1 
ATOM   732  C  CA  . PHE A 1 118 ? 9.779   9.282   47.603 1.00 25.19 ? 270  PHE A CA  1 
ATOM   733  C  C   . PHE A 1 118 ? 9.126   7.964   47.151 1.00 25.64 ? 270  PHE A C   1 
ATOM   734  O  O   . PHE A 1 118 ? 8.091   7.572   47.676 1.00 25.45 ? 270  PHE A O   1 
ATOM   735  C  CB  . PHE A 1 118 ? 9.383   10.450  46.690 1.00 25.35 ? 270  PHE A CB  1 
ATOM   736  C  CG  . PHE A 1 118 ? 7.908   10.578  46.441 1.00 25.86 ? 270  PHE A CG  1 
ATOM   737  C  CD1 . PHE A 1 118 ? 7.149   11.503  47.136 1.00 26.62 ? 270  PHE A CD1 1 
ATOM   738  C  CD2 . PHE A 1 118 ? 7.281   9.798   45.483 1.00 25.93 ? 270  PHE A CD2 1 
ATOM   739  C  CE1 . PHE A 1 118 ? 5.786   11.622  46.894 1.00 26.16 ? 270  PHE A CE1 1 
ATOM   740  C  CE2 . PHE A 1 118 ? 5.925   9.919   45.246 1.00 25.79 ? 270  PHE A CE2 1 
ATOM   741  C  CZ  . PHE A 1 118 ? 5.184   10.834  45.947 1.00 25.85 ? 270  PHE A CZ  1 
ATOM   742  N  N   . ILE A 1 119 ? 9.733   7.285   46.183 1.00 26.19 ? 271  ILE A N   1 
ATOM   743  C  CA  . ILE A 1 119 ? 9.228   5.991   45.733 1.00 26.85 ? 271  ILE A CA  1 
ATOM   744  C  C   . ILE A 1 119 ? 9.387   4.941   46.841 1.00 27.36 ? 271  ILE A C   1 
ATOM   745  O  O   . ILE A 1 119 ? 8.479   4.147   47.082 1.00 27.66 ? 271  ILE A O   1 
ATOM   746  C  CB  . ILE A 1 119 ? 9.921   5.524   44.435 1.00 26.85 ? 271  ILE A CB  1 
ATOM   747  C  CG1 . ILE A 1 119 ? 9.545   6.454   43.273 1.00 26.60 ? 271  ILE A CG1 1 
ATOM   748  C  CG2 . ILE A 1 119 ? 9.536   4.080   44.102 1.00 26.96 ? 271  ILE A CG2 1 
ATOM   749  C  CD1 . ILE A 1 119 ? 10.281  6.161   42.003 1.00 26.16 ? 271  ILE A CD1 1 
ATOM   750  N  N   . ARG A 1 120 ? 10.528  4.958   47.520 1.00 27.92 ? 272  ARG A N   1 
ATOM   751  C  CA  . ARG A 1 120 ? 10.781  4.050   48.631 1.00 28.47 ? 272  ARG A CA  1 
ATOM   752  C  C   . ARG A 1 120 ? 9.757   4.223   49.756 1.00 29.16 ? 272  ARG A C   1 
ATOM   753  O  O   . ARG A 1 120 ? 9.291   3.242   50.323 1.00 28.75 ? 272  ARG A O   1 
ATOM   754  C  CB  . ARG A 1 120 ? 12.202  4.256   49.171 1.00 28.46 ? 272  ARG A CB  1 
ATOM   755  C  CG  . ARG A 1 120 ? 12.572  3.385   50.364 1.00 28.22 ? 272  ARG A CG  1 
ATOM   756  C  CD  . ARG A 1 120 ? 12.651  1.914   49.997 1.00 29.05 ? 272  ARG A CD  1 
ATOM   757  N  NE  . ARG A 1 120 ? 13.048  1.107   51.151 1.00 29.55 ? 272  ARG A NE  1 
ATOM   758  C  CZ  . ARG A 1 120 ? 12.436  0.007   51.589 1.00 29.91 ? 272  ARG A CZ  1 
ATOM   759  N  NH1 . ARG A 1 120 ? 11.376  -0.498  50.972 1.00 30.26 ? 272  ARG A NH1 1 
ATOM   760  N  NH2 . ARG A 1 120 ? 12.910  -0.613  52.661 1.00 30.48 ? 272  ARG A NH2 1 
ATOM   761  N  N   . LYS A 1 121 ? 9.415   5.468   50.071 1.00 30.28 ? 273  LYS A N   1 
ATOM   762  C  CA  . LYS A 1 121 ? 8.395   5.761   51.083 1.00 31.51 ? 273  LYS A CA  1 
ATOM   763  C  C   . LYS A 1 121 ? 6.996   5.313   50.652 1.00 31.90 ? 273  LYS A C   1 
ATOM   764  O  O   . LYS A 1 121 ? 6.243   4.770   51.459 1.00 32.05 ? 273  LYS A O   1 
ATOM   765  C  CB  . LYS A 1 121 ? 8.385   7.255   51.422 1.00 31.48 ? 273  LYS A CB  1 
ATOM   766  C  CG  . LYS A 1 121 ? 9.648   7.712   52.137 1.00 32.82 ? 273  LYS A CG  1 
ATOM   767  C  CD  . LYS A 1 121 ? 9.764   9.231   52.221 1.00 32.98 ? 273  LYS A CD  1 
ATOM   768  C  CE  . LYS A 1 121 ? 10.995  9.631   53.029 1.00 34.27 ? 273  LYS A CE  1 
ATOM   769  N  NZ  . LYS A 1 121 ? 11.070  11.104  53.267 1.00 35.63 ? 273  LYS A NZ  1 
ATOM   770  N  N   . SER A 1 122 ? 6.654   5.553   49.388 1.00 32.64 ? 274  SER A N   1 
ATOM   771  C  CA  . SER A 1 122 ? 5.386   5.093   48.816 1.00 33.28 ? 274  SER A CA  1 
ATOM   772  C  C   . SER A 1 122 ? 5.268   3.574   48.917 1.00 33.88 ? 274  SER A C   1 
ATOM   773  O  O   . SER A 1 122 ? 4.224   3.049   49.297 1.00 33.70 ? 274  SER A O   1 
ATOM   774  C  CB  . SER A 1 122 ? 5.285   5.503   47.347 1.00 33.30 ? 274  SER A CB  1 
ATOM   775  O  OG  . SER A 1 122 ? 5.490   6.893   47.187 1.00 33.23 ? 274  SER A OG  1 
ATOM   776  N  N   . GLN A 1 123 ? 6.355   2.886   48.568 1.00 34.68 ? 275  GLN A N   1 
ATOM   777  C  CA  . GLN A 1 123 ? 6.440   1.432   48.670 1.00 35.33 ? 275  GLN A CA  1 
ATOM   778  C  C   . GLN A 1 123 ? 6.164   0.921   50.085 1.00 35.89 ? 275  GLN A C   1 
ATOM   779  O  O   . GLN A 1 123 ? 5.652   -0.175  50.248 1.00 36.17 ? 275  GLN A O   1 
ATOM   780  C  CB  . GLN A 1 123 ? 7.823   0.950   48.212 1.00 35.26 ? 275  GLN A CB  1 
ATOM   781  C  CG  . GLN A 1 123 ? 7.946   -0.569  48.067 1.00 35.58 ? 275  GLN A CG  1 
ATOM   782  C  CD  . GLN A 1 123 ? 9.372   -1.036  47.847 1.00 35.46 ? 275  GLN A CD  1 
ATOM   783  O  OE1 . GLN A 1 123 ? 10.322  -0.278  48.036 1.00 35.86 ? 275  GLN A OE1 1 
ATOM   784  N  NE2 . GLN A 1 123 ? 9.528   -2.296  47.450 1.00 34.93 ? 275  GLN A NE2 1 
ATOM   785  N  N   . LEU A 1 124 ? 6.507   1.708   51.100 1.00 36.70 ? 276  LEU A N   1 
ATOM   786  C  CA  . LEU A 1 124 ? 6.307   1.315   52.497 1.00 37.25 ? 276  LEU A CA  1 
ATOM   787  C  C   . LEU A 1 124 ? 4.947   1.732   53.062 1.00 38.01 ? 276  LEU A C   1 
ATOM   788  O  O   . LEU A 1 124 ? 4.312   0.958   53.788 1.00 38.26 ? 276  LEU A O   1 
ATOM   789  C  CB  . LEU A 1 124 ? 7.410   1.916   53.379 1.00 37.20 ? 276  LEU A CB  1 
ATOM   790  C  CG  . LEU A 1 124 ? 8.843   1.455   53.111 1.00 37.08 ? 276  LEU A CG  1 
ATOM   791  C  CD1 . LEU A 1 124 ? 9.831   2.355   53.837 1.00 37.03 ? 276  LEU A CD1 1 
ATOM   792  C  CD2 . LEU A 1 124 ? 9.041   0.004   53.513 1.00 36.80 ? 276  LEU A CD2 1 
ATOM   793  N  N   . VAL A 1 125 ? 4.515   2.955   52.751 1.00 38.74 ? 277  VAL A N   1 
ATOM   794  C  CA  . VAL A 1 125 ? 3.346   3.554   53.411 1.00 39.34 ? 277  VAL A CA  1 
ATOM   795  C  C   . VAL A 1 125 ? 2.024   2.991   52.894 1.00 39.74 ? 277  VAL A C   1 
ATOM   796  O  O   . VAL A 1 125 ? 1.134   2.667   53.692 1.00 39.97 ? 277  VAL A O   1 
ATOM   797  C  CB  . VAL A 1 125 ? 3.350   5.111   53.320 1.00 39.37 ? 277  VAL A CB  1 
ATOM   798  C  CG1 . VAL A 1 125 ? 1.936   5.661   53.178 1.00 39.65 ? 277  VAL A CG1 1 
ATOM   799  C  CG2 . VAL A 1 125 ? 4.028   5.710   54.548 1.00 39.36 ? 277  VAL A CG2 1 
ATOM   800  N  N   . GLN A 1 126 ? 1.895   2.874   51.575 1.00 40.05 ? 278  GLN A N   1 
ATOM   801  C  CA  . GLN A 1 126 ? 0.697   2.282   50.974 1.00 40.40 ? 278  GLN A CA  1 
ATOM   802  C  C   . GLN A 1 126 ? 1.061   1.409   49.757 1.00 40.17 ? 278  GLN A C   1 
ATOM   803  O  O   . GLN A 1 126 ? 0.878   1.805   48.606 1.00 40.36 ? 278  GLN A O   1 
ATOM   804  C  CB  . GLN A 1 126 ? -0.372  3.361   50.678 1.00 40.76 ? 278  GLN A CB  1 
ATOM   805  C  CG  . GLN A 1 126 ? -0.224  4.210   49.399 1.00 41.87 ? 278  GLN A CG  1 
ATOM   806  C  CD  . GLN A 1 126 ? 1.177   4.767   49.171 1.00 43.56 ? 278  GLN A CD  1 
ATOM   807  O  OE1 . GLN A 1 126 ? 1.821   5.272   50.099 1.00 44.74 ? 278  GLN A OE1 1 
ATOM   808  N  NE2 . GLN A 1 126 ? 1.652   4.684   47.922 1.00 43.73 ? 278  GLN A NE2 1 
ATOM   809  N  N   . PRO A 1 127 ? 1.635   0.222   50.021 1.00 39.87 ? 279  PRO A N   1 
ATOM   810  C  CA  . PRO A 1 127 ? 1.978   -0.776  49.012 1.00 39.55 ? 279  PRO A CA  1 
ATOM   811  C  C   . PRO A 1 127 ? 0.902   -1.784  48.617 1.00 38.84 ? 279  PRO A C   1 
ATOM   812  O  O   . PRO A 1 127 ? -0.242  -1.725  49.078 1.00 38.69 ? 279  PRO A O   1 
ATOM   813  C  CB  . PRO A 1 127 ? 3.102   -1.553  49.695 1.00 39.70 ? 279  PRO A CB  1 
ATOM   814  C  CG  . PRO A 1 127 ? 2.701   -1.563  51.100 1.00 39.90 ? 279  PRO A CG  1 
ATOM   815  C  CD  . PRO A 1 127 ? 2.113   -0.193  51.351 1.00 40.09 ? 279  PRO A CD  1 
ATOM   816  N  N   . VAL A 1 128 ? 1.327   -2.677  47.722 1.00 38.05 ? 280  VAL A N   1 
ATOM   817  C  CA  . VAL A 1 128 ? 0.703   -3.981  47.456 1.00 37.35 ? 280  VAL A CA  1 
ATOM   818  C  C   . VAL A 1 128 ? 1.049   -4.939  46.294 1.00 36.64 ? 280  VAL A C   1 
ATOM   819  O  O   . VAL A 1 128 ? 0.417   -5.980  46.123 1.00 36.55 ? 280  VAL A O   1 
ATOM   820  C  CB  . VAL A 1 128 ? -0.641  -4.262  48.185 1.00 37.53 ? 280  VAL A CB  1 
ATOM   821  N  N   . GLY A 1 129 ? 2.057   -4.568  45.504 1.00 35.73 ? 281  GLY A N   1 
ATOM   822  C  CA  . GLY A 1 129 ? 2.455   -5.353  44.335 1.00 34.92 ? 281  GLY A CA  1 
ATOM   823  C  C   . GLY A 1 129 ? 3.815   -4.976  43.776 1.00 34.08 ? 281  GLY A C   1 
ATOM   824  O  O   . GLY A 1 129 ? 4.493   -4.098  44.320 1.00 33.95 ? 281  GLY A O   1 
ATOM   825  N  N   . PRO A 1 130 ? 4.228   -5.643  42.684 1.00 33.02 ? 282  PRO A N   1 
ATOM   826  C  CA  . PRO A 1 130 ? 5.511   -5.354  42.041 1.00 32.26 ? 282  PRO A CA  1 
ATOM   827  C  C   . PRO A 1 130 ? 5.635   -3.889  41.622 1.00 31.45 ? 282  PRO A C   1 
ATOM   828  O  O   . PRO A 1 130 ? 4.656   -3.287  41.179 1.00 31.18 ? 282  PRO A O   1 
ATOM   829  C  CB  . PRO A 1 130 ? 5.505   -6.259  40.805 1.00 32.23 ? 282  PRO A CB  1 
ATOM   830  C  CG  . PRO A 1 130 ? 4.544   -7.324  41.110 1.00 32.72 ? 282  PRO A CG  1 
ATOM   831  C  CD  . PRO A 1 130 ? 3.501   -6.721  41.993 1.00 32.94 ? 282  PRO A CD  1 
ATOM   832  N  N   . LEU A 1 131 ? 6.832   -3.336  41.787 1.00 30.58 ? 283  LEU A N   1 
ATOM   833  C  CA  . LEU A 1 131 ? 7.134   -1.963  41.397 1.00 30.06 ? 283  LEU A CA  1 
ATOM   834  C  C   . LEU A 1 131 ? 8.153   -1.972  40.276 1.00 28.97 ? 283  LEU A C   1 
ATOM   835  O  O   . LEU A 1 131 ? 9.207   -2.594  40.406 1.00 28.54 ? 283  LEU A O   1 
ATOM   836  C  CB  . LEU A 1 131 ? 7.707   -1.174  42.578 1.00 30.18 ? 283  LEU A CB  1 
ATOM   837  C  CG  . LEU A 1 131 ? 6.784   -0.168  43.262 1.00 30.75 ? 283  LEU A CG  1 
ATOM   838  C  CD1 . LEU A 1 131 ? 5.611   -0.861  43.916 1.00 31.00 ? 283  LEU A CD1 1 
ATOM   839  C  CD2 . LEU A 1 131 ? 7.571   0.637   44.289 1.00 30.64 ? 283  LEU A CD2 1 
ATOM   840  N  N   . VAL A 1 132 ? 7.828   -1.290  39.180 1.00 28.03 ? 284  VAL A N   1 
ATOM   841  C  CA  . VAL A 1 132 ? 8.790   -1.022  38.115 1.00 27.30 ? 284  VAL A CA  1 
ATOM   842  C  C   . VAL A 1 132 ? 9.072   0.475   38.120 1.00 26.84 ? 284  VAL A C   1 
ATOM   843  O  O   . VAL A 1 132 ? 8.141   1.274   38.153 1.00 26.79 ? 284  VAL A O   1 
ATOM   844  C  CB  . VAL A 1 132 ? 8.256   -1.455  36.728 1.00 27.21 ? 284  VAL A CB  1 
ATOM   845  C  CG1 . VAL A 1 132 ? 9.301   -1.219  35.660 1.00 26.59 ? 284  VAL A CG1 1 
ATOM   846  C  CG2 . VAL A 1 132 ? 7.843   -2.919  36.747 1.00 26.66 ? 284  VAL A CG2 1 
ATOM   847  N  N   . VAL A 1 133 ? 10.349  0.853   38.103 1.00 26.18 ? 285  VAL A N   1 
ATOM   848  C  CA  . VAL A 1 133 ? 10.732  2.265   38.045 1.00 25.74 ? 285  VAL A CA  1 
ATOM   849  C  C   . VAL A 1 133 ? 11.490  2.532   36.745 1.00 25.37 ? 285  VAL A C   1 
ATOM   850  O  O   . VAL A 1 133 ? 12.509  1.910   36.482 1.00 25.40 ? 285  VAL A O   1 
ATOM   851  C  CB  . VAL A 1 133 ? 11.590  2.677   39.278 1.00 25.85 ? 285  VAL A CB  1 
ATOM   852  C  CG1 . VAL A 1 133 ? 11.912  4.186   39.250 1.00 26.23 ? 285  VAL A CG1 1 
ATOM   853  C  CG2 . VAL A 1 133 ? 10.881  2.309   40.573 1.00 24.39 ? 285  VAL A CG2 1 
ATOM   854  N  N   . LEU A 1 134 ? 10.976  3.442   35.925 1.00 24.87 ? 286  LEU A N   1 
ATOM   855  C  CA  . LEU A 1 134 ? 11.633  3.805   34.681 1.00 24.52 ? 286  LEU A CA  1 
ATOM   856  C  C   . LEU A 1 134 ? 12.394  5.100   34.880 1.00 24.43 ? 286  LEU A C   1 
ATOM   857  O  O   . LEU A 1 134 ? 11.824  6.105   35.316 1.00 23.96 ? 286  LEU A O   1 
ATOM   858  C  CB  . LEU A 1 134 ? 10.618  3.938   33.542 1.00 24.45 ? 286  LEU A CB  1 
ATOM   859  C  CG  . LEU A 1 134 ? 11.149  4.324   32.157 1.00 24.50 ? 286  LEU A CG  1 
ATOM   860  C  CD1 . LEU A 1 134 ? 12.269  3.381   31.672 1.00 24.62 ? 286  LEU A CD1 1 
ATOM   861  C  CD2 . LEU A 1 134 ? 10.009  4.363   31.157 1.00 24.41 ? 286  LEU A CD2 1 
ATOM   862  N  N   . LEU A 1 135 ? 13.687  5.049   34.550 1.00 24.79 ? 287  LEU A N   1 
ATOM   863  C  CA  . LEU A 1 135 ? 14.628  6.159   34.702 1.00 24.76 ? 287  LEU A CA  1 
ATOM   864  C  C   . LEU A 1 135 ? 15.244  6.485   33.342 1.00 24.77 ? 287  LEU A C   1 
ATOM   865  O  O   . LEU A 1 135 ? 16.370  6.069   33.044 1.00 25.00 ? 287  LEU A O   1 
ATOM   866  C  CB  . LEU A 1 135 ? 15.734  5.761   35.672 1.00 24.90 ? 287  LEU A CB  1 
ATOM   867  C  CG  . LEU A 1 135 ? 15.317  5.697   37.140 1.00 25.81 ? 287  LEU A CG  1 
ATOM   868  C  CD1 . LEU A 1 135 ? 16.146  4.688   37.907 1.00 26.02 ? 287  LEU A CD1 1 
ATOM   869  C  CD2 . LEU A 1 135 ? 15.435  7.093   37.754 1.00 27.18 ? 287  LEU A CD2 1 
ATOM   870  N  N   . PRO A 1 136 ? 14.515  7.236   32.505 1.00 24.54 ? 288  PRO A N   1 
ATOM   871  C  CA  . PRO A 1 136 ? 14.945  7.524   31.147 1.00 24.52 ? 288  PRO A CA  1 
ATOM   872  C  C   . PRO A 1 136 ? 15.883  8.731   31.106 1.00 24.30 ? 288  PRO A C   1 
ATOM   873  O  O   . PRO A 1 136 ? 15.670  9.673   30.342 1.00 24.69 ? 288  PRO A O   1 
ATOM   874  C  CB  . PRO A 1 136 ? 13.623  7.832   30.448 1.00 24.83 ? 288  PRO A CB  1 
ATOM   875  C  CG  . PRO A 1 136 ? 12.859  8.554   31.514 1.00 24.75 ? 288  PRO A CG  1 
ATOM   876  C  CD  . PRO A 1 136 ? 13.228  7.883   32.809 1.00 24.51 ? 288  PRO A CD  1 
ATOM   877  N  N   . LEU A 1 137 ? 16.926  8.686   31.923 1.00 23.89 ? 289  LEU A N   1 
ATOM   878  C  CA  . LEU A 1 137 ? 17.833  9.804   32.065 1.00 23.51 ? 289  LEU A CA  1 
ATOM   879  C  C   . LEU A 1 137 ? 19.231  9.267   32.297 1.00 22.68 ? 289  LEU A C   1 
ATOM   880  O  O   . LEU A 1 137 ? 19.393  8.094   32.607 1.00 22.26 ? 289  LEU A O   1 
ATOM   881  C  CB  . LEU A 1 137 ? 17.388  10.713  33.214 1.00 23.65 ? 289  LEU A CB  1 
ATOM   882  C  CG  . LEU A 1 137 ? 16.898  10.057  34.517 1.00 24.46 ? 289  LEU A CG  1 
ATOM   883  C  CD1 . LEU A 1 137 ? 18.062  9.589   35.392 1.00 24.91 ? 289  LEU A CD1 1 
ATOM   884  C  CD2 . LEU A 1 137 ? 16.014  11.039  35.290 1.00 23.85 ? 289  LEU A CD2 1 
ATOM   885  N  N   . ALA A 1 138 ? 20.225  10.130  32.109 1.00 21.74 ? 290  ALA A N   1 
ATOM   886  C  CA  . ALA A 1 138 ? 21.624  9.772   32.317 1.00 21.46 ? 290  ALA A CA  1 
ATOM   887  C  C   . ALA A 1 138 ? 22.413  11.003  32.700 1.00 21.00 ? 290  ALA A C   1 
ATOM   888  O  O   . ALA A 1 138 ? 22.149  12.104  32.209 1.00 21.04 ? 290  ALA A O   1 
ATOM   889  C  CB  . ALA A 1 138 ? 22.237  9.133   31.051 1.00 21.05 ? 290  ALA A CB  1 
ATOM   890  N  N   . GLY A 1 139 ? 23.362  10.808  33.607 1.00 20.56 ? 291  GLY A N   1 
ATOM   891  C  CA  . GLY A 1 139 ? 24.397  11.794  33.878 1.00 20.12 ? 291  GLY A CA  1 
ATOM   892  C  C   . GLY A 1 139 ? 25.699  11.037  33.939 1.00 19.80 ? 291  GLY A C   1 
ATOM   893  O  O   . GLY A 1 139 ? 25.738  9.865   33.593 1.00 19.32 ? 291  GLY A O   1 
ATOM   894  N  N   . GLY A 1 140 ? 26.755  11.698  34.401 1.00 19.98 ? 292  GLY A N   1 
ATOM   895  C  CA  . GLY A 1 140 ? 28.046  11.054  34.590 1.00 20.07 ? 292  GLY A CA  1 
ATOM   896  C  C   . GLY A 1 140 ? 27.975  10.037  35.707 1.00 20.31 ? 292  GLY A C   1 
ATOM   897  O  O   . GLY A 1 140 ? 27.013  10.020  36.477 1.00 20.20 ? 292  GLY A O   1 
ATOM   898  N  N   . TYR A 1 141 ? 28.984  9.174   35.785 1.00 20.59 ? 293  TYR A N   1 
ATOM   899  C  CA  . TYR A 1 141 ? 29.044  8.175   36.839 1.00 20.88 ? 293  TYR A CA  1 
ATOM   900  C  C   . TYR A 1 141 ? 28.867  8.860   38.197 1.00 20.76 ? 293  TYR A C   1 
ATOM   901  O  O   . TYR A 1 141 ? 29.581  9.799   38.514 1.00 20.41 ? 293  TYR A O   1 
ATOM   902  C  CB  . TYR A 1 141 ? 30.367  7.396   36.812 1.00 21.32 ? 293  TYR A CB  1 
ATOM   903  C  CG  . TYR A 1 141 ? 30.543  6.572   38.064 1.00 21.71 ? 293  TYR A CG  1 
ATOM   904  C  CD1 . TYR A 1 141 ? 29.875  5.364   38.212 1.00 22.64 ? 293  TYR A CD1 1 
ATOM   905  C  CD2 . TYR A 1 141 ? 31.315  7.029   39.125 1.00 21.91 ? 293  TYR A CD2 1 
ATOM   906  C  CE1 . TYR A 1 141 ? 29.995  4.614   39.366 1.00 22.28 ? 293  TYR A CE1 1 
ATOM   907  C  CE2 . TYR A 1 141 ? 31.437  6.285   40.291 1.00 22.16 ? 293  TYR A CE2 1 
ATOM   908  C  CZ  . TYR A 1 141 ? 30.772  5.072   40.398 1.00 22.16 ? 293  TYR A CZ  1 
ATOM   909  O  OH  . TYR A 1 141 ? 30.879  4.310   41.537 1.00 22.51 ? 293  TYR A OH  1 
ATOM   910  N  N   . SER A 1 142 ? 27.905  8.377   38.979 1.00 20.90 ? 294  SER A N   1 
ATOM   911  C  CA  . SER A 1 142 ? 27.620  8.912   40.302 1.00 20.68 ? 294  SER A CA  1 
ATOM   912  C  C   . SER A 1 142 ? 27.562  7.781   41.320 1.00 20.44 ? 294  SER A C   1 
ATOM   913  O  O   . SER A 1 142 ? 26.724  6.891   41.228 1.00 20.37 ? 294  SER A O   1 
ATOM   914  C  CB  . SER A 1 142 ? 26.296  9.666   40.293 1.00 20.63 ? 294  SER A CB  1 
ATOM   915  O  OG  . SER A 1 142 ? 25.820  9.857   41.616 1.00 21.92 ? 294  SER A OG  1 
ATOM   916  N  N   . ARG A 1 143 ? 28.451  7.826   42.302 1.00 20.70 ? 295  ARG A N   1 
ATOM   917  C  CA  . ARG A 1 143 ? 28.495  6.794   43.327 1.00 20.84 ? 295  ARG A CA  1 
ATOM   918  C  C   . ARG A 1 143 ? 27.196  6.704   44.128 1.00 21.15 ? 295  ARG A C   1 
ATOM   919  O  O   . ARG A 1 143 ? 26.729  5.607   44.417 1.00 21.27 ? 295  ARG A O   1 
ATOM   920  C  CB  . ARG A 1 143 ? 29.660  7.030   44.274 1.00 20.75 ? 295  ARG A CB  1 
ATOM   921  C  CG  . ARG A 1 143 ? 29.896  5.865   45.194 1.00 20.51 ? 295  ARG A CG  1 
ATOM   922  C  CD  . ARG A 1 143 ? 31.072  6.102   46.064 1.00 20.51 ? 295  ARG A CD  1 
ATOM   923  N  NE  . ARG A 1 143 ? 31.161  5.070   47.083 1.00 20.40 ? 295  ARG A NE  1 
ATOM   924  C  CZ  . ARG A 1 143 ? 31.986  5.113   48.118 1.00 19.93 ? 295  ARG A CZ  1 
ATOM   925  N  NH1 . ARG A 1 143 ? 32.829  6.128   48.271 1.00 20.20 ? 295  ARG A NH1 1 
ATOM   926  N  NH2 . ARG A 1 143 ? 31.966  4.123   48.997 1.00 20.50 ? 295  ARG A NH2 1 
ATOM   927  N  N   . VAL A 1 144 ? 26.629  7.860   44.475 1.00 21.42 ? 296  VAL A N   1 
ATOM   928  C  CA  . VAL A 1 144 ? 25.438  7.936   45.319 1.00 21.63 ? 296  VAL A CA  1 
ATOM   929  C  C   . VAL A 1 144 ? 24.168  7.539   44.575 1.00 21.99 ? 296  VAL A C   1 
ATOM   930  O  O   . VAL A 1 144 ? 23.275  6.919   45.148 1.00 22.01 ? 296  VAL A O   1 
ATOM   931  C  CB  . VAL A 1 144 ? 25.274  9.356   45.940 1.00 21.75 ? 296  VAL A CB  1 
ATOM   932  C  CG1 . VAL A 1 144 ? 24.879  10.377  44.885 1.00 21.47 ? 296  VAL A CG1 1 
ATOM   933  C  CG2 . VAL A 1 144 ? 24.257  9.334   47.085 1.00 21.52 ? 296  VAL A CG2 1 
ATOM   934  N  N   . LEU A 1 145 ? 24.086  7.896   43.298 1.00 22.47 ? 297  LEU A N   1 
ATOM   935  C  CA  . LEU A 1 145 ? 22.947  7.516   42.485 1.00 22.66 ? 297  LEU A CA  1 
ATOM   936  C  C   . LEU A 1 145 ? 22.922  6.012   42.281 1.00 22.82 ? 297  LEU A C   1 
ATOM   937  O  O   . LEU A 1 145 ? 21.861  5.392   42.342 1.00 22.67 ? 297  LEU A O   1 
ATOM   938  C  CB  . LEU A 1 145 ? 22.981  8.228   41.136 1.00 22.94 ? 297  LEU A CB  1 
ATOM   939  C  CG  . LEU A 1 145 ? 21.665  8.190   40.360 1.00 23.10 ? 297  LEU A CG  1 
ATOM   940  C  CD1 . LEU A 1 145 ? 20.530  8.656   41.258 1.00 23.42 ? 297  LEU A CD1 1 
ATOM   941  C  CD2 . LEU A 1 145 ? 21.751  9.036   39.087 1.00 22.52 ? 297  LEU A CD2 1 
ATOM   942  N  N   . ASN A 1 146 ? 24.097  5.434   42.041 1.00 23.09 ? 298  ASN A N   1 
ATOM   943  C  CA  . ASN A 1 146 ? 24.228  3.985   41.920 1.00 23.30 ? 298  ASN A CA  1 
ATOM   944  C  C   . ASN A 1 146 ? 23.909  3.270   43.234 1.00 23.56 ? 298  ASN A C   1 
ATOM   945  O  O   . ASN A 1 146 ? 23.359  2.167   43.221 1.00 23.68 ? 298  ASN A O   1 
ATOM   946  C  CB  . ASN A 1 146 ? 25.632  3.598   41.423 1.00 23.22 ? 298  ASN A CB  1 
ATOM   947  C  CG  . ASN A 1 146 ? 25.840  3.890   39.935 1.00 23.05 ? 298  ASN A CG  1 
ATOM   948  O  OD1 . ASN A 1 146 ? 25.120  4.693   39.332 1.00 22.70 ? 298  ASN A OD1 1 
ATOM   949  N  ND2 . ASN A 1 146 ? 26.835  3.235   39.341 1.00 21.71 ? 298  ASN A ND2 1 
ATOM   950  N  N   . ALA A 1 147 ? 24.252  3.900   44.358 1.00 23.83 ? 299  ALA A N   1 
ATOM   951  C  CA  . ALA A 1 147 ? 23.955  3.352   45.687 1.00 24.04 ? 299  ALA A CA  1 
ATOM   952  C  C   . ALA A 1 147 ? 22.457  3.353   45.973 1.00 24.38 ? 299  ALA A C   1 
ATOM   953  O  O   . ALA A 1 147 ? 21.918  2.374   46.488 1.00 24.34 ? 299  ALA A O   1 
ATOM   954  C  CB  . ALA A 1 147 ? 24.693  4.133   46.765 1.00 23.84 ? 299  ALA A CB  1 
ATOM   955  N  N   . ALA A 1 148 ? 21.787  4.455   45.642 1.00 24.89 ? 300  ALA A N   1 
ATOM   956  C  CA  . ALA A 1 148 ? 20.344  4.566   45.851 1.00 25.36 ? 300  ALA A CA  1 
ATOM   957  C  C   . ALA A 1 148 ? 19.583  3.508   45.047 1.00 25.77 ? 300  ALA A C   1 
ATOM   958  O  O   . ALA A 1 148 ? 18.622  2.926   45.541 1.00 25.83 ? 300  ALA A O   1 
ATOM   959  C  CB  . ALA A 1 148 ? 19.853  5.972   45.495 1.00 25.20 ? 300  ALA A CB  1 
ATOM   960  N  N   . CYS A 1 149 ? 20.025  3.260   43.816 1.00 26.33 ? 301  CYS A N   1 
ATOM   961  C  CA  . CYS A 1 149 ? 19.385  2.268   42.949 1.00 26.65 ? 301  CYS A CA  1 
ATOM   962  C  C   . CYS A 1 149 ? 19.574  0.858   43.472 1.00 27.28 ? 301  CYS A C   1 
ATOM   963  O  O   . CYS A 1 149 ? 18.643  0.053   43.461 1.00 27.01 ? 301  CYS A O   1 
ATOM   964  C  CB  . CYS A 1 149 ? 19.946  2.354   41.535 1.00 26.59 ? 301  CYS A CB  1 
ATOM   965  S  SG  . CYS A 1 149 ? 19.466  3.834   40.654 1.00 26.30 ? 301  CYS A SG  1 
ATOM   966  N  N   . GLN A 1 150 ? 20.793  0.570   43.920 1.00 28.16 ? 302  GLN A N   1 
ATOM   967  C  CA  . GLN A 1 150 ? 21.133  -0.715  44.520 1.00 28.91 ? 302  GLN A CA  1 
ATOM   968  C  C   . GLN A 1 150 ? 20.266  -1.024  45.739 1.00 29.06 ? 302  GLN A C   1 
ATOM   969  O  O   . GLN A 1 150 ? 19.741  -2.126  45.872 1.00 28.92 ? 302  GLN A O   1 
ATOM   970  C  CB  . GLN A 1 150 ? 22.604  -0.707  44.920 1.00 29.14 ? 302  GLN A CB  1 
ATOM   971  C  CG  . GLN A 1 150 ? 23.070  -1.939  45.640 1.00 30.45 ? 302  GLN A CG  1 
ATOM   972  C  CD  . GLN A 1 150 ? 24.542  -1.862  45.961 1.00 33.14 ? 302  GLN A CD  1 
ATOM   973  O  OE1 . GLN A 1 150 ? 24.985  -0.967  46.696 1.00 34.86 ? 302  GLN A OE1 1 
ATOM   974  N  NE2 . GLN A 1 150 ? 25.320  -2.795  45.407 1.00 33.91 ? 302  GLN A NE2 1 
ATOM   975  N  N   . ARG A 1 151 ? 20.139  -0.040  46.622 1.00 29.57 ? 303  ARG A N   1 
ATOM   976  C  CA  . ARG A 1 151 ? 19.283  -0.128  47.813 1.00 30.17 ? 303  ARG A CA  1 
ATOM   977  C  C   . ARG A 1 151 ? 17.834  -0.416  47.441 1.00 29.87 ? 303  ARG A C   1 
ATOM   978  O  O   . ARG A 1 151 ? 17.154  -1.201  48.088 1.00 29.74 ? 303  ARG A O   1 
ATOM   979  C  CB  . ARG A 1 151 ? 19.349  1.195   48.584 1.00 30.58 ? 303  ARG A CB  1 
ATOM   980  C  CG  . ARG A 1 151 ? 18.434  1.307   49.796 1.00 32.33 ? 303  ARG A CG  1 
ATOM   981  C  CD  . ARG A 1 151 ? 19.040  0.635   51.006 1.00 34.84 ? 303  ARG A CD  1 
ATOM   982  N  NE  . ARG A 1 151 ? 18.142  0.661   52.162 1.00 36.42 ? 303  ARG A NE  1 
ATOM   983  C  CZ  . ARG A 1 151 ? 17.089  -0.140  52.331 1.00 37.21 ? 303  ARG A CZ  1 
ATOM   984  N  NH1 . ARG A 1 151 ? 16.761  -1.050  51.414 1.00 37.81 ? 303  ARG A NH1 1 
ATOM   985  N  NH2 . ARG A 1 151 ? 16.353  -0.028  53.433 1.00 37.41 ? 303  ARG A NH2 1 
ATOM   986  N  N   . LEU A 1 152 ? 17.378  0.246   46.390 1.00 29.96 ? 304  LEU A N   1 
ATOM   987  C  CA  . LEU A 1 152 ? 15.996  0.169   45.959 1.00 29.98 ? 304  LEU A CA  1 
ATOM   988  C  C   . LEU A 1 152 ? 15.744  -1.170  45.259 1.00 30.09 ? 304  LEU A C   1 
ATOM   989  O  O   . LEU A 1 152 ? 14.667  -1.743  45.385 1.00 30.14 ? 304  LEU A O   1 
ATOM   990  C  CB  . LEU A 1 152 ? 15.702  1.366   45.059 1.00 30.04 ? 304  LEU A CB  1 
ATOM   991  C  CG  . LEU A 1 152 ? 14.291  1.916   44.893 1.00 30.18 ? 304  LEU A CG  1 
ATOM   992  C  CD1 . LEU A 1 152 ? 13.498  1.909   46.179 1.00 29.54 ? 304  LEU A CD1 1 
ATOM   993  C  CD2 . LEU A 1 152 ? 14.415  3.334   44.327 1.00 29.86 ? 304  LEU A CD2 1 
ATOM   994  N  N   . ALA A 1 153 ? 16.759  -1.689  44.570 1.00 30.33 ? 305  ALA A N   1 
ATOM   995  C  CA  . ALA A 1 153 ? 16.695  -3.018  43.958 1.00 30.55 ? 305  ALA A CA  1 
ATOM   996  C  C   . ALA A 1 153 ? 16.736  -4.152  44.988 1.00 30.97 ? 305  ALA A C   1 
ATOM   997  O  O   . ALA A 1 153 ? 16.083  -5.182  44.805 1.00 31.03 ? 305  ALA A O   1 
ATOM   998  C  CB  . ALA A 1 153 ? 17.818  -3.187  42.948 1.00 30.43 ? 305  ALA A CB  1 
ATOM   999  N  N   . ARG A 1 154 ? 17.505  -3.970  46.063 1.00 31.48 ? 306  ARG A N   1 
ATOM   1000 C  CA  . ARG A 1 154 ? 17.555  -4.955  47.151 1.00 31.88 ? 306  ARG A CA  1 
ATOM   1001 C  C   . ARG A 1 154 ? 16.246  -5.036  47.932 1.00 31.29 ? 306  ARG A C   1 
ATOM   1002 O  O   . ARG A 1 154 ? 16.020  -6.001  48.660 1.00 31.54 ? 306  ARG A O   1 
ATOM   1003 C  CB  . ARG A 1 154 ? 18.698  -4.655  48.125 1.00 32.57 ? 306  ARG A CB  1 
ATOM   1004 C  CG  . ARG A 1 154 ? 20.095  -4.953  47.573 1.00 35.09 ? 306  ARG A CG  1 
ATOM   1005 C  CD  . ARG A 1 154 ? 21.055  -5.373  48.691 1.00 38.90 ? 306  ARG A CD  1 
ATOM   1006 N  NE  . ARG A 1 154 ? 22.447  -5.020  48.399 1.00 40.84 ? 306  ARG A NE  1 
ATOM   1007 C  CZ  . ARG A 1 154 ? 23.224  -5.630  47.501 1.00 42.16 ? 306  ARG A CZ  1 
ATOM   1008 N  NH1 . ARG A 1 154 ? 22.765  -6.645  46.765 1.00 43.04 ? 306  ARG A NH1 1 
ATOM   1009 N  NH2 . ARG A 1 154 ? 24.479  -5.218  47.336 1.00 42.08 ? 306  ARG A NH2 1 
ATOM   1010 N  N   . ALA A 1 155 ? 15.402  -4.017  47.799 1.00 30.46 ? 307  ALA A N   1 
ATOM   1011 C  CA  . ALA A 1 155 ? 14.047  -4.057  48.334 1.00 29.78 ? 307  ALA A CA  1 
ATOM   1012 C  C   . ALA A 1 155 ? 13.054  -4.642  47.319 1.00 29.26 ? 307  ALA A C   1 
ATOM   1013 O  O   . ALA A 1 155 ? 11.845  -4.562  47.517 1.00 29.36 ? 307  ALA A O   1 
ATOM   1014 C  CB  . ALA A 1 155 ? 13.617  -2.662  48.753 1.00 29.77 ? 307  ALA A CB  1 
ATOM   1015 N  N   . GLY A 1 156 ? 13.559  -5.218  46.230 1.00 28.68 ? 308  GLY A N   1 
ATOM   1016 C  CA  . GLY A 1 156 ? 12.719  -5.891  45.240 1.00 28.13 ? 308  GLY A CA  1 
ATOM   1017 C  C   . GLY A 1 156 ? 12.207  -5.045  44.087 1.00 27.67 ? 308  GLY A C   1 
ATOM   1018 O  O   . GLY A 1 156 ? 11.488  -5.553  43.222 1.00 27.91 ? 308  GLY A O   1 
ATOM   1019 N  N   . VAL A 1 157 ? 12.573  -3.766  44.047 1.00 26.95 ? 309  VAL A N   1 
ATOM   1020 C  CA  . VAL A 1 157 ? 12.110  -2.884  42.975 1.00 26.33 ? 309  VAL A CA  1 
ATOM   1021 C  C   . VAL A 1 157 ? 12.877  -3.176  41.680 1.00 25.95 ? 309  VAL A C   1 
ATOM   1022 O  O   . VAL A 1 157 ? 14.092  -3.362  41.690 1.00 25.79 ? 309  VAL A O   1 
ATOM   1023 C  CB  . VAL A 1 157 ? 12.246  -1.383  43.354 1.00 26.17 ? 309  VAL A CB  1 
ATOM   1024 C  CG1 . VAL A 1 157 ? 11.733  -0.489  42.243 1.00 25.30 ? 309  VAL A CG1 1 
ATOM   1025 C  CG2 . VAL A 1 157 ? 11.492  -1.093  44.638 1.00 25.85 ? 309  VAL A CG2 1 
ATOM   1026 N  N   . VAL A 1 158 ? 12.142  -3.227  40.573 1.00 25.51 ? 310  VAL A N   1 
ATOM   1027 C  CA  . VAL A 1 158 ? 12.716  -3.444  39.252 1.00 25.00 ? 310  VAL A CA  1 
ATOM   1028 C  C   . VAL A 1 158 ? 12.996  -2.085  38.626 1.00 24.35 ? 310  VAL A C   1 
ATOM   1029 O  O   . VAL A 1 158 ? 12.080  -1.369  38.253 1.00 24.59 ? 310  VAL A O   1 
ATOM   1030 C  CB  . VAL A 1 158 ? 11.760  -4.265  38.354 1.00 24.92 ? 310  VAL A CB  1 
ATOM   1031 C  CG1 . VAL A 1 158 ? 12.362  -4.482  36.971 1.00 24.54 ? 310  VAL A CG1 1 
ATOM   1032 C  CG2 . VAL A 1 158 ? 11.442  -5.597  39.011 1.00 25.16 ? 310  VAL A CG2 1 
ATOM   1033 N  N   . LEU A 1 159 ? 14.273  -1.731  38.528 1.00 23.92 ? 311  LEU A N   1 
ATOM   1034 C  CA  . LEU A 1 159 ? 14.683  -0.450  37.980 1.00 23.21 ? 311  LEU A CA  1 
ATOM   1035 C  C   . LEU A 1 159 ? 15.195  -0.632  36.548 1.00 22.81 ? 311  LEU A C   1 
ATOM   1036 O  O   . LEU A 1 159 ? 16.066  -1.464  36.295 1.00 21.87 ? 311  LEU A O   1 
ATOM   1037 C  CB  . LEU A 1 159 ? 15.762  0.180   38.859 1.00 23.58 ? 311  LEU A CB  1 
ATOM   1038 C  CG  . LEU A 1 159 ? 15.340  0.737   40.225 1.00 24.35 ? 311  LEU A CG  1 
ATOM   1039 C  CD1 . LEU A 1 159 ? 15.324  -0.327  41.292 1.00 24.91 ? 311  LEU A CD1 1 
ATOM   1040 C  CD2 . LEU A 1 159 ? 16.289  1.857   40.636 1.00 25.89 ? 311  LEU A CD2 1 
ATOM   1041 N  N   . VAL A 1 160 ? 14.626  0.141   35.624 1.00 22.35 ? 312  VAL A N   1 
ATOM   1042 C  CA  . VAL A 1 160 ? 14.992  0.100   34.213 1.00 22.51 ? 312  VAL A CA  1 
ATOM   1043 C  C   . VAL A 1 160 ? 15.478  1.481   33.762 1.00 22.69 ? 312  VAL A C   1 
ATOM   1044 O  O   . VAL A 1 160 ? 14.784  2.483   33.941 1.00 22.32 ? 312  VAL A O   1 
ATOM   1045 C  CB  . VAL A 1 160 ? 13.808  -0.337  33.324 1.00 22.46 ? 312  VAL A CB  1 
ATOM   1046 C  CG1 . VAL A 1 160 ? 14.212  -0.328  31.856 1.00 21.57 ? 312  VAL A CG1 1 
ATOM   1047 C  CG2 . VAL A 1 160 ? 13.327  -1.719  33.735 1.00 22.37 ? 312  VAL A CG2 1 
ATOM   1048 N  N   . THR A 1 161 ? 16.680  1.532   33.187 1.00 22.68 ? 313  THR A N   1 
ATOM   1049 C  CA  . THR A 1 161 ? 17.264  2.811   32.819 1.00 22.63 ? 313  THR A CA  1 
ATOM   1050 C  C   . THR A 1 161 ? 17.786  2.850   31.387 1.00 22.38 ? 313  THR A C   1 
ATOM   1051 O  O   . THR A 1 161 ? 18.004  1.819   30.750 1.00 22.30 ? 313  THR A O   1 
ATOM   1052 C  CB  . THR A 1 161 ? 18.392  3.217   33.803 1.00 22.84 ? 313  THR A CB  1 
ATOM   1053 O  OG1 . THR A 1 161 ? 18.738  4.599   33.591 1.00 23.84 ? 313  THR A OG1 1 
ATOM   1054 C  CG2 . THR A 1 161 ? 19.628  2.322   33.628 1.00 22.25 ? 313  THR A CG2 1 
ATOM   1055 N  N   . ALA A 1 162 ? 17.954  4.074   30.894 1.00 22.32 ? 314  ALA A N   1 
ATOM   1056 C  CA  . ALA A 1 162 ? 18.569  4.339   29.604 1.00 21.86 ? 314  ALA A CA  1 
ATOM   1057 C  C   . ALA A 1 162 ? 20.073  4.100   29.686 1.00 21.72 ? 314  ALA A C   1 
ATOM   1058 O  O   . ALA A 1 162 ? 20.716  4.472   30.669 1.00 21.97 ? 314  ALA A O   1 
ATOM   1059 C  CB  . ALA A 1 162 ? 18.296  5.765   29.198 1.00 21.66 ? 314  ALA A CB  1 
ATOM   1060 N  N   . ALA A 1 163 ? 20.632  3.470   28.656 1.00 21.38 ? 315  ALA A N   1 
ATOM   1061 C  CA  . ALA A 1 163 ? 22.076  3.275   28.557 1.00 21.03 ? 315  ALA A CA  1 
ATOM   1062 C  C   . ALA A 1 163 ? 22.841  4.598   28.343 1.00 21.02 ? 315  ALA A C   1 
ATOM   1063 O  O   . ALA A 1 163 ? 23.978  4.743   28.795 1.00 20.88 ? 315  ALA A O   1 
ATOM   1064 C  CB  . ALA A 1 163 ? 22.378  2.300   27.440 1.00 20.89 ? 315  ALA A CB  1 
ATOM   1065 N  N   . GLY A 1 164 ? 22.200  5.553   27.664 1.00 21.28 ? 316  GLY A N   1 
ATOM   1066 C  CA  . GLY A 1 164 ? 22.806  6.831   27.291 1.00 21.40 ? 316  GLY A CA  1 
ATOM   1067 C  C   . GLY A 1 164 ? 22.976  6.954   25.785 1.00 21.71 ? 316  GLY A C   1 
ATOM   1068 O  O   . GLY A 1 164 ? 23.166  5.951   25.096 1.00 21.52 ? 316  GLY A O   1 
ATOM   1069 N  N   . ASN A 1 165 ? 22.915  8.190   25.278 1.00 22.18 ? 317  ASN A N   1 
ATOM   1070 C  CA  . ASN A 1 165 ? 22.974  8.470   23.833 1.00 22.42 ? 317  ASN A CA  1 
ATOM   1071 C  C   . ASN A 1 165 ? 24.293  9.147   23.406 1.00 22.75 ? 317  ASN A C   1 
ATOM   1072 O  O   . ASN A 1 165 ? 24.286  10.069  22.592 1.00 23.00 ? 317  ASN A O   1 
ATOM   1073 C  CB  . ASN A 1 165 ? 21.803  9.374   23.415 1.00 22.40 ? 317  ASN A CB  1 
ATOM   1074 C  CG  . ASN A 1 165 ? 20.449  8.798   23.761 1.00 23.00 ? 317  ASN A CG  1 
ATOM   1075 O  OD1 . ASN A 1 165 ? 20.286  7.581   23.892 1.00 23.07 ? 317  ASN A OD1 1 
ATOM   1076 N  ND2 . ASN A 1 165 ? 19.455  9.676   23.900 1.00 21.20 ? 317  ASN A ND2 1 
ATOM   1077 N  N   . PHE A 1 166 ? 25.422  8.660   23.920 1.00 23.04 ? 318  PHE A N   1 
ATOM   1078 C  CA  . PHE A 1 166 ? 26.719  9.306   23.716 1.00 22.90 ? 318  PHE A CA  1 
ATOM   1079 C  C   . PHE A 1 166 ? 27.715  8.455   22.923 1.00 22.93 ? 318  PHE A C   1 
ATOM   1080 O  O   . PHE A 1 166 ? 28.887  8.825   22.804 1.00 22.81 ? 318  PHE A O   1 
ATOM   1081 C  CB  . PHE A 1 166 ? 27.312  9.675   25.083 1.00 23.21 ? 318  PHE A CB  1 
ATOM   1082 C  CG  . PHE A 1 166 ? 26.406  10.531  25.912 1.00 23.01 ? 318  PHE A CG  1 
ATOM   1083 C  CD1 . PHE A 1 166 ? 26.328  11.895  25.684 1.00 23.12 ? 318  PHE A CD1 1 
ATOM   1084 C  CD2 . PHE A 1 166 ? 25.606  9.970   26.895 1.00 24.01 ? 318  PHE A CD2 1 
ATOM   1085 C  CE1 . PHE A 1 166 ? 25.476  12.696  26.433 1.00 23.23 ? 318  PHE A CE1 1 
ATOM   1086 C  CE2 . PHE A 1 166 ? 24.748  10.764  27.658 1.00 24.43 ? 318  PHE A CE2 1 
ATOM   1087 C  CZ  . PHE A 1 166 ? 24.686  12.132  27.422 1.00 23.96 ? 318  PHE A CZ  1 
ATOM   1088 N  N   . ARG A 1 167 ? 27.240  7.340   22.365 1.00 23.06 ? 319  ARG A N   1 
ATOM   1089 C  CA  . ARG A 1 167 ? 28.086  6.342   21.687 1.00 23.26 ? 319  ARG A CA  1 
ATOM   1090 C  C   . ARG A 1 167 ? 29.361  6.084   22.483 1.00 23.15 ? 319  ARG A C   1 
ATOM   1091 O  O   . ARG A 1 167 ? 30.480  6.227   21.989 1.00 23.37 ? 319  ARG A O   1 
ATOM   1092 C  CB  . ARG A 1 167 ? 28.386  6.753   20.239 1.00 23.18 ? 319  ARG A CB  1 
ATOM   1093 C  CG  . ARG A 1 167 ? 28.988  5.629   19.421 1.00 23.58 ? 319  ARG A CG  1 
ATOM   1094 C  CD  . ARG A 1 167 ? 28.890  5.845   17.914 1.00 24.16 ? 319  ARG A CD  1 
ATOM   1095 N  NE  . ARG A 1 167 ? 29.325  4.644   17.206 1.00 24.77 ? 319  ARG A NE  1 
ATOM   1096 C  CZ  . ARG A 1 167 ? 29.368  4.513   15.882 1.00 26.29 ? 319  ARG A CZ  1 
ATOM   1097 N  NH1 . ARG A 1 167 ? 28.980  5.509   15.089 1.00 26.34 ? 319  ARG A NH1 1 
ATOM   1098 N  NH2 . ARG A 1 167 ? 29.792  3.366   15.347 1.00 25.21 ? 319  ARG A NH2 1 
ATOM   1099 N  N   . ASP A 1 168 ? 29.171  5.702   23.736 1.00 23.20 ? 320  ASP A N   1 
ATOM   1100 C  CA  . ASP A 1 168 ? 30.255  5.665   24.700 1.00 23.43 ? 320  ASP A CA  1 
ATOM   1101 C  C   . ASP A 1 168 ? 30.023  4.473   25.614 1.00 23.34 ? 320  ASP A C   1 
ATOM   1102 O  O   . ASP A 1 168 ? 28.981  3.825   25.534 1.00 22.89 ? 320  ASP A O   1 
ATOM   1103 C  CB  . ASP A 1 168 ? 30.258  6.981   25.486 1.00 23.63 ? 320  ASP A CB  1 
ATOM   1104 C  CG  . ASP A 1 168 ? 31.568  7.255   26.207 1.00 24.32 ? 320  ASP A CG  1 
ATOM   1105 O  OD1 . ASP A 1 168 ? 32.547  6.488   26.069 1.00 24.14 ? 320  ASP A OD1 1 
ATOM   1106 O  OD2 . ASP A 1 168 ? 31.607  8.272   26.927 1.00 26.57 ? 320  ASP A OD2 1 
ATOM   1107 N  N   . ASP A 1 169 ? 31.013  4.167   26.445 1.00 23.30 ? 321  ASP A N   1 
ATOM   1108 C  CA  . ASP A 1 169 ? 30.889  3.114   27.445 1.00 23.47 ? 321  ASP A CA  1 
ATOM   1109 C  C   . ASP A 1 169 ? 29.862  3.512   28.515 1.00 23.30 ? 321  ASP A C   1 
ATOM   1110 O  O   . ASP A 1 169 ? 30.050  4.499   29.223 1.00 22.76 ? 321  ASP A O   1 
ATOM   1111 C  CB  . ASP A 1 169 ? 32.253  2.852   28.095 1.00 23.54 ? 321  ASP A CB  1 
ATOM   1112 C  CG  . ASP A 1 169 ? 32.270  1.602   28.961 1.00 24.73 ? 321  ASP A CG  1 
ATOM   1113 O  OD1 . ASP A 1 169 ? 31.196  1.029   29.240 1.00 25.86 ? 321  ASP A OD1 1 
ATOM   1114 O  OD2 . ASP A 1 169 ? 33.378  1.183   29.370 1.00 27.55 ? 321  ASP A OD2 1 
ATOM   1115 N  N   . ALA A 1 170 ? 28.799  2.711   28.631 1.00 23.29 ? 322  ALA A N   1 
ATOM   1116 C  CA  . ALA A 1 170 ? 27.720  2.932   29.598 1.00 23.46 ? 322  ALA A CA  1 
ATOM   1117 C  C   . ALA A 1 170 ? 28.177  2.952   31.057 1.00 23.56 ? 322  ALA A C   1 
ATOM   1118 O  O   . ALA A 1 170 ? 27.482  3.492   31.913 1.00 23.37 ? 322  ALA A O   1 
ATOM   1119 C  CB  . ALA A 1 170 ? 26.637  1.875   29.423 1.00 23.37 ? 322  ALA A CB  1 
ATOM   1120 N  N   . CYS A 1 171 ? 29.332  2.362   31.343 1.00 23.59 ? 323  CYS A N   1 
ATOM   1121 C  CA  . CYS A 1 171 ? 29.865  2.353   32.699 1.00 24.27 ? 323  CYS A CA  1 
ATOM   1122 C  C   . CYS A 1 171 ? 30.358  3.721   33.171 1.00 23.12 ? 323  CYS A C   1 
ATOM   1123 O  O   . CYS A 1 171 ? 30.562  3.922   34.363 1.00 23.02 ? 323  CYS A O   1 
ATOM   1124 C  CB  . CYS A 1 171 ? 30.982  1.318   32.816 1.00 24.68 ? 323  CYS A CB  1 
ATOM   1125 S  SG  . CYS A 1 171 ? 30.436  -0.355  32.315 1.00 30.34 ? 323  CYS A SG  1 
ATOM   1126 N  N   . LEU A 1 172 ? 30.531  4.657   32.238 1.00 22.28 ? 324  LEU A N   1 
ATOM   1127 C  CA  . LEU A 1 172 ? 30.932  6.029   32.563 1.00 21.61 ? 324  LEU A CA  1 
ATOM   1128 C  C   . LEU A 1 172 ? 29.741  6.943   32.859 1.00 20.95 ? 324  LEU A C   1 
ATOM   1129 O  O   . LEU A 1 172 ? 29.934  8.138   33.044 1.00 21.00 ? 324  LEU A O   1 
ATOM   1130 C  CB  . LEU A 1 172 ? 31.765  6.626   31.417 1.00 21.34 ? 324  LEU A CB  1 
ATOM   1131 C  CG  . LEU A 1 172 ? 32.968  5.800   30.953 1.00 21.51 ? 324  LEU A CG  1 
ATOM   1132 C  CD1 . LEU A 1 172 ? 33.625  6.431   29.736 1.00 20.63 ? 324  LEU A CD1 1 
ATOM   1133 C  CD2 . LEU A 1 172 ? 33.968  5.635   32.085 1.00 20.04 ? 324  LEU A CD2 1 
ATOM   1134 N  N   . TYR A 1 173 ? 28.530  6.381   32.918 1.00 20.56 ? 325  TYR A N   1 
ATOM   1135 C  CA  . TYR A 1 173 ? 27.279  7.146   33.105 1.00 20.34 ? 325  TYR A CA  1 
ATOM   1136 C  C   . TYR A 1 173 ? 26.405  6.524   34.207 1.00 20.25 ? 325  TYR A C   1 
ATOM   1137 O  O   . TYR A 1 173 ? 26.540  5.344   34.519 1.00 20.30 ? 325  TYR A O   1 
ATOM   1138 C  CB  . TYR A 1 173 ? 26.504  7.220   31.767 1.00 20.32 ? 325  TYR A CB  1 
ATOM   1139 C  CG  . TYR A 1 173 ? 27.314  7.893   30.672 1.00 20.27 ? 325  TYR A CG  1 
ATOM   1140 C  CD1 . TYR A 1 173 ? 27.267  9.276   30.494 1.00 20.79 ? 325  TYR A CD1 1 
ATOM   1141 C  CD2 . TYR A 1 173 ? 28.172  7.159   29.858 1.00 20.13 ? 325  TYR A CD2 1 
ATOM   1142 C  CE1 . TYR A 1 173 ? 28.034  9.907   29.518 1.00 20.82 ? 325  TYR A CE1 1 
ATOM   1143 C  CE2 . TYR A 1 173 ? 28.951  7.781   28.881 1.00 21.00 ? 325  TYR A CE2 1 
ATOM   1144 C  CZ  . TYR A 1 173 ? 28.876  9.160   28.708 1.00 20.88 ? 325  TYR A CZ  1 
ATOM   1145 O  OH  . TYR A 1 173 ? 29.644  9.795   27.746 1.00 19.88 ? 325  TYR A OH  1 
ATOM   1146 N  N   . SER A 1 174 ? 25.526  7.325   34.810 1.00 20.14 ? 326  SER A N   1 
ATOM   1147 C  CA  . SER A 1 174 ? 24.595  6.832   35.831 1.00 19.90 ? 326  SER A CA  1 
ATOM   1148 C  C   . SER A 1 174 ? 23.193  7.352   35.564 1.00 20.07 ? 326  SER A C   1 
ATOM   1149 O  O   . SER A 1 174 ? 23.032  8.449   35.047 1.00 20.19 ? 326  SER A O   1 
ATOM   1150 C  CB  . SER A 1 174 ? 25.020  7.239   37.249 1.00 20.01 ? 326  SER A CB  1 
ATOM   1151 O  OG  . SER A 1 174 ? 26.056  6.408   37.742 1.00 19.70 ? 326  SER A OG  1 
ATOM   1152 N  N   . PRO A 1 175 ? 22.167  6.572   35.943 1.00 20.27 ? 327  PRO A N   1 
ATOM   1153 C  CA  . PRO A 1 175 ? 22.257  5.240   36.582 1.00 20.55 ? 327  PRO A CA  1 
ATOM   1154 C  C   . PRO A 1 175 ? 22.685  4.031   35.709 1.00 20.72 ? 327  PRO A C   1 
ATOM   1155 O  O   . PRO A 1 175 ? 22.677  2.914   36.202 1.00 20.77 ? 327  PRO A O   1 
ATOM   1156 C  CB  . PRO A 1 175 ? 20.846  5.024   37.150 1.00 20.37 ? 327  PRO A CB  1 
ATOM   1157 C  CG  . PRO A 1 175 ? 19.966  5.991   36.475 1.00 20.36 ? 327  PRO A CG  1 
ATOM   1158 C  CD  . PRO A 1 175 ? 20.780  7.048   35.811 1.00 20.42 ? 327  PRO A CD  1 
ATOM   1159 N  N   . ALA A 1 176 ? 23.063  4.247   34.448 1.00 21.17 ? 328  ALA A N   1 
ATOM   1160 C  CA  . ALA A 1 176 ? 23.425  3.151   33.530 1.00 21.40 ? 328  ALA A CA  1 
ATOM   1161 C  C   . ALA A 1 176 ? 24.428  2.141   34.117 1.00 21.79 ? 328  ALA A C   1 
ATOM   1162 O  O   . ALA A 1 176 ? 24.282  0.936   33.926 1.00 21.79 ? 328  ALA A O   1 
ATOM   1163 C  CB  . ALA A 1 176 ? 23.970  3.724   32.214 1.00 21.16 ? 328  ALA A CB  1 
ATOM   1164 N  N   . SER A 1 177 ? 25.433  2.638   34.833 1.00 22.13 ? 329  SER A N   1 
ATOM   1165 C  CA  . SER A 1 177 ? 26.495  1.792   35.377 1.00 22.58 ? 329  SER A CA  1 
ATOM   1166 C  C   . SER A 1 177 ? 26.113  0.998   36.640 1.00 23.07 ? 329  SER A C   1 
ATOM   1167 O  O   . SER A 1 177 ? 26.899  0.167   37.094 1.00 22.83 ? 329  SER A O   1 
ATOM   1168 C  CB  . SER A 1 177 ? 27.732  2.645   35.662 1.00 22.51 ? 329  SER A CB  1 
ATOM   1169 O  OG  . SER A 1 177 ? 27.410  3.730   36.510 1.00 23.10 ? 329  SER A OG  1 
ATOM   1170 N  N   . ALA A 1 178 ? 24.926  1.244   37.206 1.00 23.81 ? 330  ALA A N   1 
ATOM   1171 C  CA  . ALA A 1 178 ? 24.461  0.491   38.382 1.00 24.39 ? 330  ALA A CA  1 
ATOM   1172 C  C   . ALA A 1 178 ? 24.175  -0.959  37.985 1.00 25.06 ? 330  ALA A C   1 
ATOM   1173 O  O   . ALA A 1 178 ? 23.311  -1.205  37.156 1.00 25.41 ? 330  ALA A O   1 
ATOM   1174 C  CB  . ALA A 1 178 ? 23.219  1.133   38.971 1.00 24.21 ? 330  ALA A CB  1 
ATOM   1175 N  N   . PRO A 1 179 ? 24.918  -1.927  38.547 1.00 26.04 ? 331  PRO A N   1 
ATOM   1176 C  CA  . PRO A 1 179 ? 24.686  -3.317  38.107 1.00 26.52 ? 331  PRO A CA  1 
ATOM   1177 C  C   . PRO A 1 179 ? 23.320  -3.916  38.509 1.00 26.98 ? 331  PRO A C   1 
ATOM   1178 O  O   . PRO A 1 179 ? 22.865  -4.881  37.877 1.00 27.22 ? 331  PRO A O   1 
ATOM   1179 C  CB  . PRO A 1 179 ? 25.848  -4.098  38.739 1.00 26.60 ? 331  PRO A CB  1 
ATOM   1180 C  CG  . PRO A 1 179 ? 26.398  -3.230  39.811 1.00 26.35 ? 331  PRO A CG  1 
ATOM   1181 C  CD  . PRO A 1 179 ? 25.993  -1.818  39.552 1.00 26.13 ? 331  PRO A CD  1 
ATOM   1182 N  N   . GLU A 1 180 ? 22.668  -3.321  39.511 1.00 27.09 ? 332  GLU A N   1 
ATOM   1183 C  CA  A GLU A 1 180 ? 21.375  -3.816  39.992 0.50 27.15 ? 332  GLU A CA  1 
ATOM   1184 C  CA  B GLU A 1 180 ? 21.378  -3.792  40.008 0.50 26.99 ? 332  GLU A CA  1 
ATOM   1185 C  C   . GLU A 1 180 ? 20.223  -3.214  39.185 1.00 27.01 ? 332  GLU A C   1 
ATOM   1186 O  O   . GLU A 1 180 ? 19.054  -3.486  39.462 1.00 27.39 ? 332  GLU A O   1 
ATOM   1187 C  CB  A GLU A 1 180 ? 21.197  -3.524  41.490 0.50 27.19 ? 332  GLU A CB  1 
ATOM   1188 C  CB  B GLU A 1 180 ? 21.208  -3.413  41.483 0.50 26.91 ? 332  GLU A CB  1 
ATOM   1189 C  CG  A GLU A 1 180 ? 21.964  -4.472  42.423 0.50 27.49 ? 332  GLU A CG  1 
ATOM   1190 C  CG  B GLU A 1 180 ? 22.361  -3.869  42.396 0.50 26.56 ? 332  GLU A CG  1 
ATOM   1191 C  CD  A GLU A 1 180 ? 21.210  -5.766  42.724 0.50 27.89 ? 332  GLU A CD  1 
ATOM   1192 C  CD  B GLU A 1 180 ? 23.613  -2.999  42.290 0.50 25.97 ? 332  GLU A CD  1 
ATOM   1193 O  OE1 A GLU A 1 180 ? 20.872  -6.500  41.770 0.50 28.08 ? 332  GLU A OE1 1 
ATOM   1194 O  OE1 B GLU A 1 180 ? 23.537  -1.890  41.715 0.50 24.73 ? 332  GLU A OE1 1 
ATOM   1195 O  OE2 A GLU A 1 180 ? 20.964  -6.051  43.919 0.50 27.45 ? 332  GLU A OE2 1 
ATOM   1196 O  OE2 B GLU A 1 180 ? 24.677  -3.432  42.781 0.50 25.54 ? 332  GLU A OE2 1 
ATOM   1197 N  N   . VAL A 1 181 ? 20.557  -2.414  38.176 1.00 26.81 ? 333  VAL A N   1 
ATOM   1198 C  CA  . VAL A 1 181 ? 19.574  -1.776  37.298 1.00 26.68 ? 333  VAL A CA  1 
ATOM   1199 C  C   . VAL A 1 181 ? 19.607  -2.430  35.915 1.00 26.26 ? 333  VAL A C   1 
ATOM   1200 O  O   . VAL A 1 181 ? 20.668  -2.831  35.436 1.00 26.54 ? 333  VAL A O   1 
ATOM   1201 C  CB  . VAL A 1 181 ? 19.892  -0.271  37.164 1.00 26.65 ? 333  VAL A CB  1 
ATOM   1202 C  CG1 . VAL A 1 181 ? 18.887  0.439   36.277 1.00 26.81 ? 333  VAL A CG1 1 
ATOM   1203 C  CG2 . VAL A 1 181 ? 19.929  0.375   38.539 1.00 27.00 ? 333  VAL A CG2 1 
ATOM   1204 N  N   . ILE A 1 182 ? 18.444  -2.547  35.280 1.00 25.73 ? 334  ILE A N   1 
ATOM   1205 C  CA  . ILE A 1 182 ? 18.360  -3.054  33.913 1.00 24.84 ? 334  ILE A CA  1 
ATOM   1206 C  C   . ILE A 1 182 ? 18.678  -1.885  32.979 1.00 24.23 ? 334  ILE A C   1 
ATOM   1207 O  O   . ILE A 1 182 ? 17.879  -0.959  32.850 1.00 24.50 ? 334  ILE A O   1 
ATOM   1208 C  CB  . ILE A 1 182 ? 16.964  -3.652  33.597 1.00 24.94 ? 334  ILE A CB  1 
ATOM   1209 C  CG1 . ILE A 1 182 ? 16.614  -4.769  34.589 1.00 24.56 ? 334  ILE A CG1 1 
ATOM   1210 C  CG2 . ILE A 1 182 ? 16.918  -4.194  32.161 1.00 24.56 ? 334  ILE A CG2 1 
ATOM   1211 C  CD1 . ILE A 1 182 ? 15.143  -5.111  34.612 1.00 24.61 ? 334  ILE A CD1 1 
ATOM   1212 N  N   . THR A 1 183 ? 19.858  -1.933  32.362 1.00 23.35 ? 335  THR A N   1 
ATOM   1213 C  CA  . THR A 1 183 ? 20.360  -0.877  31.484 1.00 22.90 ? 335  THR A CA  1 
ATOM   1214 C  C   . THR A 1 183 ? 20.155  -1.255  30.018 1.00 22.51 ? 335  THR A C   1 
ATOM   1215 O  O   . THR A 1 183 ? 20.663  -2.287  29.560 1.00 22.23 ? 335  THR A O   1 
ATOM   1216 C  CB  . THR A 1 183 ? 21.866  -0.621  31.730 1.00 22.86 ? 335  THR A CB  1 
ATOM   1217 O  OG1 . THR A 1 183 ? 22.065  -0.189  33.084 1.00 22.56 ? 335  THR A OG1 1 
ATOM   1218 C  CG2 . THR A 1 183 ? 22.404  0.442   30.784 1.00 22.53 ? 335  THR A CG2 1 
ATOM   1219 N  N   . VAL A 1 184 ? 19.442  -0.389  29.293 1.00 21.92 ? 336  VAL A N   1 
ATOM   1220 C  CA  . VAL A 1 184 ? 18.907  -0.699  27.967 1.00 21.22 ? 336  VAL A CA  1 
ATOM   1221 C  C   . VAL A 1 184 ? 19.483  0.227   26.876 1.00 21.27 ? 336  VAL A C   1 
ATOM   1222 O  O   . VAL A 1 184 ? 19.341  1.458   26.924 1.00 20.69 ? 336  VAL A O   1 
ATOM   1223 C  CB  . VAL A 1 184 ? 17.350  -0.618  27.961 1.00 21.54 ? 336  VAL A CB  1 
ATOM   1224 C  CG1 . VAL A 1 184 ? 16.772  -1.259  26.694 1.00 21.03 ? 336  VAL A CG1 1 
ATOM   1225 C  CG2 . VAL A 1 184 ? 16.758  -1.287  29.216 1.00 19.46 ? 336  VAL A CG2 1 
ATOM   1226 N  N   . GLY A 1 185 ? 20.161  -0.388  25.909 1.00 21.03 ? 337  GLY A N   1 
ATOM   1227 C  CA  . GLY A 1 185 ? 20.618  0.296   24.716 1.00 20.92 ? 337  GLY A CA  1 
ATOM   1228 C  C   . GLY A 1 185 ? 19.534  0.305   23.660 1.00 20.79 ? 337  GLY A C   1 
ATOM   1229 O  O   . GLY A 1 185 ? 18.525  -0.403  23.787 1.00 20.82 ? 337  GLY A O   1 
ATOM   1230 N  N   . ALA A 1 186 ? 19.750  1.101   22.615 1.00 20.49 ? 338  ALA A N   1 
ATOM   1231 C  CA  . ALA A 1 186 ? 18.751  1.309   21.570 1.00 20.44 ? 338  ALA A CA  1 
ATOM   1232 C  C   . ALA A 1 186 ? 19.182  0.670   20.254 1.00 20.54 ? 338  ALA A C   1 
ATOM   1233 O  O   . ALA A 1 186 ? 20.336  0.807   19.832 1.00 20.33 ? 338  ALA A O   1 
ATOM   1234 C  CB  . ALA A 1 186 ? 18.493  2.809   21.372 1.00 19.86 ? 338  ALA A CB  1 
ATOM   1235 N  N   . THR A 1 187 ? 18.245  -0.035  19.615 1.00 20.72 ? 339  THR A N   1 
ATOM   1236 C  CA  . THR A 1 187 ? 18.426  -0.524  18.251 1.00 20.57 ? 339  THR A CA  1 
ATOM   1237 C  C   . THR A 1 187 ? 17.337  0.027   17.340 1.00 20.74 ? 339  THR A C   1 
ATOM   1238 O  O   . THR A 1 187 ? 16.259  0.403   17.797 1.00 20.60 ? 339  THR A O   1 
ATOM   1239 C  CB  . THR A 1 187 ? 18.416  -2.063  18.171 1.00 20.75 ? 339  THR A CB  1 
ATOM   1240 O  OG1 . THR A 1 187 ? 17.290  -2.582  18.890 1.00 20.37 ? 339  THR A OG1 1 
ATOM   1241 C  CG2 . THR A 1 187 ? 19.728  -2.653  18.729 1.00 20.29 ? 339  THR A CG2 1 
ATOM   1242 N  N   . ASN A 1 188 ? 17.642  0.062   16.045 1.00 20.92 ? 340  ASN A N   1 
ATOM   1243 C  CA  . ASN A 1 188 ? 16.726  0.551   15.015 1.00 20.66 ? 340  ASN A CA  1 
ATOM   1244 C  C   . ASN A 1 188 ? 16.004  -0.598  14.305 1.00 20.78 ? 340  ASN A C   1 
ATOM   1245 O  O   . ASN A 1 188 ? 16.095  -1.754  14.734 1.00 20.69 ? 340  ASN A O   1 
ATOM   1246 C  CB  . ASN A 1 188 ? 17.475  1.462   14.020 1.00 20.77 ? 340  ASN A CB  1 
ATOM   1247 C  CG  . ASN A 1 188 ? 18.626  0.757   13.308 1.00 20.04 ? 340  ASN A CG  1 
ATOM   1248 O  OD1 . ASN A 1 188 ? 18.592  -0.444  13.086 1.00 18.68 ? 340  ASN A OD1 1 
ATOM   1249 N  ND2 . ASN A 1 188 ? 19.651  1.520   12.949 1.00 19.63 ? 340  ASN A ND2 1 
ATOM   1250 N  N   . ALA A 1 189 ? 15.283  -0.273  13.229 1.00 21.00 ? 341  ALA A N   1 
ATOM   1251 C  CA  . ALA A 1 189 ? 14.439  -1.237  12.507 1.00 21.25 ? 341  ALA A CA  1 
ATOM   1252 C  C   . ALA A 1 189 ? 15.250  -2.283  11.750 1.00 21.58 ? 341  ALA A C   1 
ATOM   1253 O  O   . ALA A 1 189 ? 14.689  -3.243  11.241 1.00 21.18 ? 341  ALA A O   1 
ATOM   1254 C  CB  . ALA A 1 189 ? 13.481  -0.511  11.548 1.00 20.81 ? 341  ALA A CB  1 
ATOM   1255 N  N   . GLN A 1 190 ? 16.564  -2.084  11.676 1.00 22.22 ? 342  GLN A N   1 
ATOM   1256 C  CA  . GLN A 1 190 ? 17.476  -3.068  11.104 1.00 22.69 ? 342  GLN A CA  1 
ATOM   1257 C  C   . GLN A 1 190 ? 18.177  -3.904  12.196 1.00 22.49 ? 342  GLN A C   1 
ATOM   1258 O  O   . GLN A 1 190 ? 19.053  -4.702  11.889 1.00 22.19 ? 342  GLN A O   1 
ATOM   1259 C  CB  . GLN A 1 190 ? 18.507  -2.360  10.221 1.00 23.09 ? 342  GLN A CB  1 
ATOM   1260 C  CG  . GLN A 1 190 ? 17.908  -1.667  8.980  1.00 25.40 ? 342  GLN A CG  1 
ATOM   1261 C  CD  . GLN A 1 190 ? 17.278  -0.310  9.291  1.00 28.44 ? 342  GLN A CD  1 
ATOM   1262 O  OE1 . GLN A 1 190 ? 17.917  0.557   9.895  1.00 30.67 ? 342  GLN A OE1 1 
ATOM   1263 N  NE2 . GLN A 1 190 ? 16.023  -0.115  8.864  1.00 29.41 ? 342  GLN A NE2 1 
ATOM   1264 N  N   . ASP A 1 191 ? 17.765  -3.714  13.455 1.00 22.50 ? 343  ASP A N   1 
ATOM   1265 C  CA  . ASP A 1 191 ? 18.362  -4.346  14.652 1.00 22.42 ? 343  ASP A CA  1 
ATOM   1266 C  C   . ASP A 1 191 ? 19.810  -3.945  14.909 1.00 22.23 ? 343  ASP A C   1 
ATOM   1267 O  O   . ASP A 1 191 ? 20.551  -4.660  15.584 1.00 21.95 ? 343  ASP A O   1 
ATOM   1268 C  CB  . ASP A 1 191 ? 18.235  -5.874  14.618 1.00 22.82 ? 343  ASP A CB  1 
ATOM   1269 C  CG  . ASP A 1 191 ? 16.800  -6.345  14.756 1.00 23.57 ? 343  ASP A CG  1 
ATOM   1270 O  OD1 . ASP A 1 191 ? 16.066  -5.783  15.608 1.00 24.56 ? 343  ASP A OD1 1 
ATOM   1271 O  OD2 . ASP A 1 191 ? 16.414  -7.278  14.012 1.00 23.44 ? 343  ASP A OD2 1 
ATOM   1272 N  N   . GLN A 1 192 ? 20.197  -2.780  14.407 1.00 22.05 ? 344  GLN A N   1 
ATOM   1273 C  CA  . GLN A 1 192 ? 21.547  -2.298  14.589 1.00 22.28 ? 344  GLN A CA  1 
ATOM   1274 C  C   . GLN A 1 192 ? 21.533  -1.168  15.595 1.00 22.83 ? 344  GLN A C   1 
ATOM   1275 O  O   . GLN A 1 192 ? 20.498  -0.510  15.779 1.00 22.88 ? 344  GLN A O   1 
ATOM   1276 C  CB  . GLN A 1 192 ? 22.147  -1.862  13.244 1.00 22.30 ? 344  GLN A CB  1 
ATOM   1277 C  CG  . GLN A 1 192 ? 22.201  -2.997  12.211 1.00 20.81 ? 344  GLN A CG  1 
ATOM   1278 C  CD  . GLN A 1 192 ? 22.687  -4.308  12.829 1.00 20.08 ? 344  GLN A CD  1 
ATOM   1279 O  OE1 . GLN A 1 192 ? 23.775  -4.360  13.401 1.00 18.97 ? 344  GLN A OE1 1 
ATOM   1280 N  NE2 . GLN A 1 192 ? 21.871  -5.360  12.740 1.00 17.79 ? 344  GLN A NE2 1 
ATOM   1281 N  N   . PRO A 1 193 ? 22.676  -0.937  16.263 1.00 23.28 ? 345  PRO A N   1 
ATOM   1282 C  CA  . PRO A 1 193 ? 22.720  0.106   17.280 1.00 23.71 ? 345  PRO A CA  1 
ATOM   1283 C  C   . PRO A 1 193 ? 22.329  1.451   16.681 1.00 24.37 ? 345  PRO A C   1 
ATOM   1284 O  O   . PRO A 1 193 ? 22.774  1.773   15.594 1.00 24.48 ? 345  PRO A O   1 
ATOM   1285 C  CB  . PRO A 1 193 ? 24.184  0.113   17.716 1.00 23.37 ? 345  PRO A CB  1 
ATOM   1286 C  CG  . PRO A 1 193 ? 24.726  -1.195  17.302 1.00 23.32 ? 345  PRO A CG  1 
ATOM   1287 C  CD  . PRO A 1 193 ? 23.984  -1.593  16.087 1.00 23.32 ? 345  PRO A CD  1 
ATOM   1288 N  N   . VAL A 1 194 ? 21.492  2.213   17.379 1.00 25.48 ? 346  VAL A N   1 
ATOM   1289 C  CA  . VAL A 1 194 ? 21.029  3.510   16.879 1.00 26.30 ? 346  VAL A CA  1 
ATOM   1290 C  C   . VAL A 1 194 ? 22.179  4.516   16.740 1.00 27.50 ? 346  VAL A C   1 
ATOM   1291 O  O   . VAL A 1 194 ? 22.966  4.695   17.666 1.00 27.15 ? 346  VAL A O   1 
ATOM   1292 C  CB  . VAL A 1 194 ? 19.909  4.097   17.775 1.00 26.02 ? 346  VAL A CB  1 
ATOM   1293 C  CG1 . VAL A 1 194 ? 19.618  5.544   17.404 1.00 25.88 ? 346  VAL A CG1 1 
ATOM   1294 C  CG2 . VAL A 1 194 ? 18.658  3.262   17.647 1.00 25.18 ? 346  VAL A CG2 1 
ATOM   1295 N  N   . THR A 1 195 ? 22.261  5.144   15.563 1.00 29.22 ? 347  THR A N   1 
ATOM   1296 C  CA  . THR A 1 195 ? 23.256  6.166   15.252 1.00 30.75 ? 347  THR A CA  1 
ATOM   1297 C  C   . THR A 1 195 ? 22.528  7.505   15.096 1.00 32.22 ? 347  THR A C   1 
ATOM   1298 O  O   . THR A 1 195 ? 21.857  7.745   14.092 1.00 32.78 ? 347  THR A O   1 
ATOM   1299 C  CB  . THR A 1 195 ? 24.015  5.807   13.950 1.00 30.93 ? 347  THR A CB  1 
ATOM   1300 O  OG1 . THR A 1 195 ? 24.601  4.504   14.077 1.00 31.44 ? 347  THR A OG1 1 
ATOM   1301 C  CG2 . THR A 1 195 ? 25.112  6.802   13.653 1.00 30.93 ? 347  THR A CG2 1 
ATOM   1302 N  N   . LEU A 1 196 ? 22.643  8.369   16.102 1.00 33.65 ? 348  LEU A N   1 
ATOM   1303 C  CA  . LEU A 1 196 ? 21.856  9.607   16.155 1.00 34.39 ? 348  LEU A CA  1 
ATOM   1304 C  C   . LEU A 1 196 ? 22.604  10.801  15.550 1.00 34.62 ? 348  LEU A C   1 
ATOM   1305 O  O   . LEU A 1 196 ? 22.025  11.891  15.472 1.00 35.37 ? 348  LEU A O   1 
ATOM   1306 C  CB  . LEU A 1 196 ? 21.431  9.939   17.606 1.00 34.88 ? 348  LEU A CB  1 
ATOM   1307 C  CG  . LEU A 1 196 ? 20.878  8.849   18.563 1.00 35.75 ? 348  LEU A CG  1 
ATOM   1308 C  CD1 . LEU A 1 196 ? 21.344  9.122   19.976 1.00 35.52 ? 348  LEU A CD1 1 
ATOM   1309 C  CD2 . LEU A 1 196 ? 19.339  8.695   18.544 1.00 35.66 ? 348  LEU A CD2 1 
ATOM   1310 N  N   . GLY A 1 197 ? 23.869  10.600  15.146 1.00 34.10 ? 349  GLY A N   1 
ATOM   1311 C  CA  . GLY A 1 197 ? 24.676  11.626  14.447 1.00 33.42 ? 349  GLY A CA  1 
ATOM   1312 C  C   . GLY A 1 197 ? 26.154  11.228  14.374 1.00 32.94 ? 349  GLY A C   1 
ATOM   1313 O  O   . GLY A 1 197 ? 26.517  10.293  13.648 1.00 32.82 ? 349  GLY A O   1 
ATOM   1314 N  N   . THR A 1 198 ? 27.008  11.945  15.115 1.00 31.88 ? 350  THR A N   1 
ATOM   1315 C  CA  . THR A 1 198 ? 28.319  11.420  15.529 1.00 31.12 ? 350  THR A CA  1 
ATOM   1316 C  C   . THR A 1 198 ? 28.194  10.638  16.845 1.00 30.06 ? 350  THR A C   1 
ATOM   1317 O  O   . THR A 1 198 ? 29.160  10.030  17.309 1.00 29.99 ? 350  THR A O   1 
ATOM   1318 C  CB  . THR A 1 198 ? 29.363  12.537  15.750 1.00 31.23 ? 350  THR A CB  1 
ATOM   1319 O  OG1 . THR A 1 198 ? 28.795  13.561  16.573 1.00 32.24 ? 350  THR A OG1 1 
ATOM   1320 C  CG2 . THR A 1 198 ? 29.820  13.133  14.420 1.00 31.42 ? 350  THR A CG2 1 
ATOM   1321 N  N   . LEU A 1 199 ? 27.006  10.673  17.449 1.00 28.66 ? 351  LEU A N   1 
ATOM   1322 C  CA  . LEU A 1 199 ? 26.729  9.940   18.674 1.00 27.54 ? 351  LEU A CA  1 
ATOM   1323 C  C   . LEU A 1 199 ? 25.715  8.818   18.377 1.00 26.51 ? 351  LEU A C   1 
ATOM   1324 O  O   . LEU A 1 199 ? 25.525  8.444   17.217 1.00 26.38 ? 351  LEU A O   1 
ATOM   1325 C  CB  . LEU A 1 199 ? 26.239  10.904  19.757 1.00 27.56 ? 351  LEU A CB  1 
ATOM   1326 C  CG  . LEU A 1 199 ? 27.165  12.082  20.095 1.00 27.73 ? 351  LEU A CG  1 
ATOM   1327 C  CD1 . LEU A 1 199 ? 26.471  13.068  21.035 1.00 26.74 ? 351  LEU A CD1 1 
ATOM   1328 C  CD2 . LEU A 1 199 ? 28.480  11.598  20.695 1.00 27.14 ? 351  LEU A CD2 1 
ATOM   1329 N  N   . GLY A 1 200 ? 25.086  8.270   19.412 1.00 25.19 ? 352  GLY A N   1 
ATOM   1330 C  CA  . GLY A 1 200 ? 24.219  7.108   19.255 1.00 24.52 ? 352  GLY A CA  1 
ATOM   1331 C  C   . GLY A 1 200 ? 24.113  6.337   20.552 1.00 23.67 ? 352  GLY A C   1 
ATOM   1332 O  O   . GLY A 1 200 ? 24.456  6.860   21.599 1.00 23.51 ? 352  GLY A O   1 
ATOM   1333 N  N   . THR A 1 201 ? 23.661  5.086   20.492 1.00 22.84 ? 353  THR A N   1 
ATOM   1334 C  CA  . THR A 1 201 ? 23.490  4.302   21.714 1.00 22.34 ? 353  THR A CA  1 
ATOM   1335 C  C   . THR A 1 201 ? 24.822  3.995   22.414 1.00 22.18 ? 353  THR A C   1 
ATOM   1336 O  O   . THR A 1 201 ? 25.848  3.752   21.771 1.00 21.71 ? 353  THR A O   1 
ATOM   1337 C  CB  . THR A 1 201 ? 22.717  2.967   21.482 1.00 22.25 ? 353  THR A CB  1 
ATOM   1338 O  OG1 . THR A 1 201 ? 22.419  2.365   22.754 1.00 21.22 ? 353  THR A OG1 1 
ATOM   1339 C  CG2 . THR A 1 201 ? 23.523  1.986   20.622 1.00 21.24 ? 353  THR A CG2 1 
ATOM   1340 N  N   . ASN A 1 202 ? 24.793  4.021   23.744 1.00 22.01 ? 354  ASN A N   1 
ATOM   1341 C  CA  . ASN A 1 202 ? 25.907  3.532   24.527 1.00 21.79 ? 354  ASN A CA  1 
ATOM   1342 C  C   . ASN A 1 202 ? 25.942  2.008   24.463 1.00 22.18 ? 354  ASN A C   1 
ATOM   1343 O  O   . ASN A 1 202 ? 24.975  1.352   24.061 1.00 21.35 ? 354  ASN A O   1 
ATOM   1344 C  CB  . ASN A 1 202 ? 25.821  3.999   25.982 1.00 21.59 ? 354  ASN A CB  1 
ATOM   1345 C  CG  . ASN A 1 202 ? 26.270  5.434   26.167 1.00 21.28 ? 354  ASN A CG  1 
ATOM   1346 O  OD1 . ASN A 1 202 ? 26.710  6.093   25.219 1.00 21.13 ? 354  ASN A OD1 1 
ATOM   1347 N  ND2 . ASN A 1 202 ? 26.162  5.929   27.398 1.00 18.41 ? 354  ASN A ND2 1 
ATOM   1348 N  N   . PHE A 1 203 ? 27.078  1.468   24.884 1.00 22.89 ? 355  PHE A N   1 
ATOM   1349 C  CA  . PHE A 1 203 ? 27.394  0.060   24.739 1.00 23.23 ? 355  PHE A CA  1 
ATOM   1350 C  C   . PHE A 1 203 ? 28.246  -0.358  25.926 1.00 23.53 ? 355  PHE A C   1 
ATOM   1351 O  O   . PHE A 1 203 ? 28.515  0.447   26.812 1.00 23.63 ? 355  PHE A O   1 
ATOM   1352 C  CB  . PHE A 1 203 ? 28.160  -0.159  23.424 1.00 23.15 ? 355  PHE A CB  1 
ATOM   1353 C  CG  . PHE A 1 203 ? 29.227  0.875   23.161 1.00 22.98 ? 355  PHE A CG  1 
ATOM   1354 C  CD1 . PHE A 1 203 ? 29.032  1.863   22.210 1.00 22.56 ? 355  PHE A CD1 1 
ATOM   1355 C  CD2 . PHE A 1 203 ? 30.417  0.874   23.882 1.00 22.73 ? 355  PHE A CD2 1 
ATOM   1356 C  CE1 . PHE A 1 203 ? 30.008  2.818   21.970 1.00 22.93 ? 355  PHE A CE1 1 
ATOM   1357 C  CE2 . PHE A 1 203 ? 31.393  1.828   23.650 1.00 22.52 ? 355  PHE A CE2 1 
ATOM   1358 C  CZ  . PHE A 1 203 ? 31.191  2.800   22.691 1.00 22.94 ? 355  PHE A CZ  1 
ATOM   1359 N  N   . GLY A 1 204 ? 28.651  -1.621  25.940 1.00 23.87 ? 356  GLY A N   1 
ATOM   1360 C  CA  . GLY A 1 204 ? 29.602  -2.122  26.918 1.00 24.35 ? 356  GLY A CA  1 
ATOM   1361 C  C   . GLY A 1 204 ? 28.982  -3.069  27.919 1.00 24.82 ? 356  GLY A C   1 
ATOM   1362 O  O   . GLY A 1 204 ? 27.790  -3.377  27.849 1.00 24.63 ? 356  GLY A O   1 
ATOM   1363 N  N   . ARG A 1 205 ? 29.813  -3.509  28.860 1.00 25.43 ? 357  ARG A N   1 
ATOM   1364 C  CA  . ARG A 1 205 ? 29.442  -4.510  29.867 1.00 26.24 ? 357  ARG A CA  1 
ATOM   1365 C  C   . ARG A 1 205 ? 28.366  -4.065  30.854 1.00 26.14 ? 357  ARG A C   1 
ATOM   1366 O  O   . ARG A 1 205 ? 27.777  -4.902  31.528 1.00 26.38 ? 357  ARG A O   1 
ATOM   1367 C  CB  . ARG A 1 205 ? 30.685  -4.945  30.656 1.00 26.31 ? 357  ARG A CB  1 
ATOM   1368 C  CG  . ARG A 1 205 ? 31.279  -3.859  31.533 1.00 27.23 ? 357  ARG A CG  1 
ATOM   1369 C  CD  . ARG A 1 205 ? 32.570  -4.302  32.177 1.00 27.50 ? 357  ARG A CD  1 
ATOM   1370 N  NE  . ARG A 1 205 ? 33.192  -3.208  32.920 1.00 29.10 ? 357  ARG A NE  1 
ATOM   1371 C  CZ  . ARG A 1 205 ? 32.800  -2.769  34.121 1.00 30.59 ? 357  ARG A CZ  1 
ATOM   1372 N  NH1 . ARG A 1 205 ? 31.757  -3.313  34.755 1.00 30.92 ? 357  ARG A NH1 1 
ATOM   1373 N  NH2 . ARG A 1 205 ? 33.453  -1.759  34.693 1.00 30.57 ? 357  ARG A NH2 1 
ATOM   1374 N  N   . CYS A 1 206 ? 28.130  -2.760  30.960 1.00 26.29 ? 358  CYS A N   1 
ATOM   1375 C  CA  . CYS A 1 206 ? 27.060  -2.235  31.816 1.00 26.39 ? 358  CYS A CA  1 
ATOM   1376 C  C   . CYS A 1 206 ? 25.689  -2.258  31.135 1.00 25.82 ? 358  CYS A C   1 
ATOM   1377 O  O   . CYS A 1 206 ? 24.677  -2.085  31.797 1.00 26.16 ? 358  CYS A O   1 
ATOM   1378 C  CB  . CYS A 1 206 ? 27.392  -0.817  32.298 1.00 26.50 ? 358  CYS A CB  1 
ATOM   1379 S  SG  . CYS A 1 206 ? 28.782  -0.770  33.469 1.00 27.65 ? 358  CYS A SG  1 
ATOM   1380 N  N   . VAL A 1 207 ? 25.652  -2.473  29.825 1.00 25.15 ? 359  VAL A N   1 
ATOM   1381 C  CA  . VAL A 1 207 ? 24.386  -2.642  29.122 1.00 24.57 ? 359  VAL A CA  1 
ATOM   1382 C  C   . VAL A 1 207 ? 23.909  -4.095  29.246 1.00 24.44 ? 359  VAL A C   1 
ATOM   1383 O  O   . VAL A 1 207 ? 24.689  -5.033  29.063 1.00 24.64 ? 359  VAL A O   1 
ATOM   1384 C  CB  . VAL A 1 207 ? 24.508  -2.214  27.643 1.00 24.69 ? 359  VAL A CB  1 
ATOM   1385 C  CG1 . VAL A 1 207 ? 23.223  -2.518  26.866 1.00 24.30 ? 359  VAL A CG1 1 
ATOM   1386 C  CG2 . VAL A 1 207 ? 24.848  -0.736  27.562 1.00 23.89 ? 359  VAL A CG2 1 
ATOM   1387 N  N   . ASP A 1 208 ? 22.629  -4.266  29.566 1.00 23.93 ? 360  ASP A N   1 
ATOM   1388 C  CA  . ASP A 1 208 ? 22.030  -5.586  29.788 1.00 23.63 ? 360  ASP A CA  1 
ATOM   1389 C  C   . ASP A 1 208 ? 21.355  -6.139  28.537 1.00 22.71 ? 360  ASP A C   1 
ATOM   1390 O  O   . ASP A 1 208 ? 21.454  -7.325  28.244 1.00 22.70 ? 360  ASP A O   1 
ATOM   1391 C  CB  . ASP A 1 208 ? 21.032  -5.505  30.947 1.00 23.94 ? 360  ASP A CB  1 
ATOM   1392 C  CG  . ASP A 1 208 ? 21.701  -5.095  32.250 1.00 25.22 ? 360  ASP A CG  1 
ATOM   1393 O  OD1 . ASP A 1 208 ? 22.706  -5.736  32.630 1.00 29.01 ? 360  ASP A OD1 1 
ATOM   1394 O  OD2 . ASP A 1 208 ? 21.259  -4.118  32.879 1.00 26.05 ? 360  ASP A OD2 1 
ATOM   1395 N  N   . LEU A 1 209 ? 20.652  -5.283  27.809 1.00 21.93 ? 361  LEU A N   1 
ATOM   1396 C  CA  . LEU A 1 209 ? 20.099  -5.669  26.518 1.00 21.17 ? 361  LEU A CA  1 
ATOM   1397 C  C   . LEU A 1 209 ? 19.753  -4.430  25.716 1.00 20.26 ? 361  LEU A C   1 
ATOM   1398 O  O   . LEU A 1 209 ? 19.864  -3.312  26.213 1.00 19.38 ? 361  LEU A O   1 
ATOM   1399 C  CB  . LEU A 1 209 ? 18.880  -6.606  26.667 1.00 21.20 ? 361  LEU A CB  1 
ATOM   1400 C  CG  . LEU A 1 209 ? 17.526  -6.111  27.188 1.00 21.90 ? 361  LEU A CG  1 
ATOM   1401 C  CD1 . LEU A 1 209 ? 16.550  -7.271  27.178 1.00 22.00 ? 361  LEU A CD1 1 
ATOM   1402 C  CD2 . LEU A 1 209 ? 17.609  -5.516  28.581 1.00 22.35 ? 361  LEU A CD2 1 
ATOM   1403 N  N   . PHE A 1 210 ? 19.384  -4.647  24.457 1.00 19.41 ? 362  PHE A N   1 
ATOM   1404 C  CA  . PHE A 1 210 ? 18.947  -3.579  23.581 1.00 19.03 ? 362  PHE A CA  1 
ATOM   1405 C  C   . PHE A 1 210 ? 17.446  -3.709  23.334 1.00 19.14 ? 362  PHE A C   1 
ATOM   1406 O  O   . PHE A 1 210 ? 16.862  -4.767  23.522 1.00 18.87 ? 362  PHE A O   1 
ATOM   1407 C  CB  . PHE A 1 210 ? 19.736  -3.600  22.264 1.00 18.27 ? 362  PHE A CB  1 
ATOM   1408 C  CG  . PHE A 1 210 ? 21.178  -3.208  22.426 1.00 17.83 ? 362  PHE A CG  1 
ATOM   1409 C  CD1 . PHE A 1 210 ? 21.595  -1.915  22.148 1.00 16.90 ? 362  PHE A CD1 1 
ATOM   1410 C  CD2 . PHE A 1 210 ? 22.124  -4.132  22.888 1.00 17.72 ? 362  PHE A CD2 1 
ATOM   1411 C  CE1 . PHE A 1 210 ? 22.923  -1.544  22.321 1.00 17.34 ? 362  PHE A CE1 1 
ATOM   1412 C  CE2 . PHE A 1 210 ? 23.458  -3.764  23.063 1.00 17.07 ? 362  PHE A CE2 1 
ATOM   1413 C  CZ  . PHE A 1 210 ? 23.858  -2.479  22.777 1.00 17.00 ? 362  PHE A CZ  1 
ATOM   1414 N  N   . ALA A 1 211 ? 16.826  -2.618  22.927 1.00 19.64 ? 363  ALA A N   1 
ATOM   1415 C  CA  . ALA A 1 211 ? 15.416  -2.643  22.580 1.00 20.07 ? 363  ALA A CA  1 
ATOM   1416 C  C   . ALA A 1 211 ? 15.156  -1.556  21.558 1.00 20.08 ? 363  ALA A C   1 
ATOM   1417 O  O   . ALA A 1 211 ? 15.992  -0.667  21.387 1.00 19.60 ? 363  ALA A O   1 
ATOM   1418 C  CB  . ALA A 1 211 ? 14.546  -2.453  23.833 1.00 20.10 ? 363  ALA A CB  1 
ATOM   1419 N  N   . PRO A 1 212 ? 14.017  -1.641  20.844 1.00 20.50 ? 364  PRO A N   1 
ATOM   1420 C  CA  . PRO A 1 212 ? 13.688  -0.613  19.859 1.00 20.88 ? 364  PRO A CA  1 
ATOM   1421 C  C   . PRO A 1 212 ? 13.748  0.799   20.426 1.00 21.18 ? 364  PRO A C   1 
ATOM   1422 O  O   . PRO A 1 212 ? 13.130  1.074   21.443 1.00 21.29 ? 364  PRO A O   1 
ATOM   1423 C  CB  . PRO A 1 212 ? 12.265  -0.978  19.437 1.00 20.75 ? 364  PRO A CB  1 
ATOM   1424 C  CG  . PRO A 1 212 ? 12.220  -2.450  19.602 1.00 20.56 ? 364  PRO A CG  1 
ATOM   1425 C  CD  . PRO A 1 212 ? 13.002  -2.707  20.862 1.00 20.46 ? 364  PRO A CD  1 
ATOM   1426 N  N   . GLY A 1 213 ? 14.508  1.672   19.769 1.00 21.76 ? 365  GLY A N   1 
ATOM   1427 C  CA  . GLY A 1 213 ? 14.598  3.072   20.172 1.00 22.30 ? 365  GLY A CA  1 
ATOM   1428 C  C   . GLY A 1 213 ? 14.924  4.051   19.060 1.00 22.58 ? 365  GLY A C   1 
ATOM   1429 O  O   . GLY A 1 213 ? 15.581  5.054   19.299 1.00 23.08 ? 365  GLY A O   1 
ATOM   1430 N  N   . GLU A 1 214 ? 14.482  3.757   17.843 1.00 22.81 ? 366  GLU A N   1 
ATOM   1431 C  CA  . GLU A 1 214 ? 14.537  4.713   16.753 1.00 23.33 ? 366  GLU A CA  1 
ATOM   1432 C  C   . GLU A 1 214 ? 13.172  4.746   16.105 1.00 22.71 ? 366  GLU A C   1 
ATOM   1433 O  O   . GLU A 1 214 ? 12.559  3.699   15.920 1.00 22.98 ? 366  GLU A O   1 
ATOM   1434 C  CB  . GLU A 1 214 ? 15.591  4.334   15.707 1.00 23.34 ? 366  GLU A CB  1 
ATOM   1435 C  CG  . GLU A 1 214 ? 15.895  5.482   14.740 1.00 24.52 ? 366  GLU A CG  1 
ATOM   1436 C  CD  . GLU A 1 214 ? 16.894  5.129   13.649 1.00 26.06 ? 366  GLU A CD  1 
ATOM   1437 O  OE1 . GLU A 1 214 ? 18.022  5.673   13.675 1.00 30.17 ? 366  GLU A OE1 1 
ATOM   1438 O  OE2 . GLU A 1 214 ? 16.554  4.331   12.742 1.00 31.05 ? 366  GLU A OE2 1 
ATOM   1439 N  N   . ASP A 1 215 ? 12.707  5.950   15.767 1.00 22.30 ? 367  ASP A N   1 
ATOM   1440 C  CA  A ASP A 1 215 ? 11.434  6.133   15.074 0.50 22.13 ? 367  ASP A CA  1 
ATOM   1441 C  CA  B ASP A 1 215 ? 11.448  6.123   15.067 0.50 21.99 ? 367  ASP A CA  1 
ATOM   1442 C  C   . ASP A 1 215 ? 10.323  5.391   15.812 1.00 21.90 ? 367  ASP A C   1 
ATOM   1443 O  O   . ASP A 1 215 ? 9.649   4.531   15.256 1.00 21.71 ? 367  ASP A O   1 
ATOM   1444 C  CB  A ASP A 1 215 ? 11.521  5.658   13.613 0.50 22.23 ? 367  ASP A CB  1 
ATOM   1445 C  CB  B ASP A 1 215 ? 11.608  5.623   13.622 0.50 21.97 ? 367  ASP A CB  1 
ATOM   1446 C  CG  A ASP A 1 215 ? 12.584  6.391   12.805 0.50 22.16 ? 367  ASP A CG  1 
ATOM   1447 C  CG  B ASP A 1 215 ? 10.424  5.956   12.742 0.50 21.33 ? 367  ASP A CG  1 
ATOM   1448 O  OD1 A ASP A 1 215 ? 13.064  7.457   13.244 0.50 23.48 ? 367  ASP A OD1 1 
ATOM   1449 O  OD1 B ASP A 1 215 ? 9.791   7.010   12.957 0.50 21.10 ? 367  ASP A OD1 1 
ATOM   1450 O  OD2 A ASP A 1 215 ? 12.935  5.897   11.712 0.50 22.18 ? 367  ASP A OD2 1 
ATOM   1451 O  OD2 B ASP A 1 215 ? 10.135  5.157   11.826 0.50 20.81 ? 367  ASP A OD2 1 
ATOM   1452 N  N   . ILE A 1 216 ? 10.134  5.733   17.083 1.00 21.89 ? 368  ILE A N   1 
ATOM   1453 C  CA  . ILE A 1 216 ? 9.099   5.100   17.897 1.00 21.59 ? 368  ILE A CA  1 
ATOM   1454 C  C   . ILE A 1 216 ? 7.855   5.976   17.961 1.00 21.64 ? 368  ILE A C   1 
ATOM   1455 O  O   . ILE A 1 216 ? 7.897   7.069   18.505 1.00 21.77 ? 368  ILE A O   1 
ATOM   1456 C  CB  . ILE A 1 216 ? 9.596   4.819   19.326 1.00 21.59 ? 368  ILE A CB  1 
ATOM   1457 C  CG1 . ILE A 1 216 ? 10.869  3.951   19.288 1.00 20.55 ? 368  ILE A CG1 1 
ATOM   1458 C  CG2 . ILE A 1 216 ? 8.476   4.177   20.171 1.00 20.23 ? 368  ILE A CG2 1 
ATOM   1459 C  CD1 . ILE A 1 216 ? 10.725  2.628   18.560 1.00 18.58 ? 368  ILE A CD1 1 
ATOM   1460 N  N   . ILE A 1 217 ? 6.755   5.483   17.402 1.00 21.79 ? 369  ILE A N   1 
ATOM   1461 C  CA  . ILE A 1 217 ? 5.482   6.212   17.415 1.00 22.02 ? 369  ILE A CA  1 
ATOM   1462 C  C   . ILE A 1 217 ? 4.933   6.182   18.838 1.00 21.97 ? 369  ILE A C   1 
ATOM   1463 O  O   . ILE A 1 217 ? 4.907   5.125   19.482 1.00 22.41 ? 369  ILE A O   1 
ATOM   1464 C  CB  . ILE A 1 217 ? 4.443   5.613   16.420 1.00 21.84 ? 369  ILE A CB  1 
ATOM   1465 C  CG1 . ILE A 1 217 ? 4.980   5.663   14.977 1.00 22.59 ? 369  ILE A CG1 1 
ATOM   1466 C  CG2 . ILE A 1 217 ? 3.124   6.370   16.506 1.00 22.03 ? 369  ILE A CG2 1 
ATOM   1467 C  CD1 . ILE A 1 217 ? 4.322   4.661   14.002 1.00 22.11 ? 369  ILE A CD1 1 
ATOM   1468 N  N   . GLY A 1 218 ? 4.547   7.353   19.337 1.00 21.47 ? 370  GLY A N   1 
ATOM   1469 C  CA  . GLY A 1 218 ? 3.975   7.474   20.669 1.00 21.42 ? 370  GLY A CA  1 
ATOM   1470 C  C   . GLY A 1 218 ? 3.229   8.784   20.858 1.00 21.04 ? 370  GLY A C   1 
ATOM   1471 O  O   . GLY A 1 218 ? 3.259   9.648   19.988 1.00 20.91 ? 370  GLY A O   1 
ATOM   1472 N  N   . ALA A 1 219 ? 2.567   8.923   22.004 1.00 20.85 ? 371  ALA A N   1 
ATOM   1473 C  CA  . ALA A 1 219 ? 1.785   10.123  22.332 1.00 20.91 ? 371  ALA A CA  1 
ATOM   1474 C  C   . ALA A 1 219 ? 2.581   11.428  22.191 1.00 20.86 ? 371  ALA A C   1 
ATOM   1475 O  O   . ALA A 1 219 ? 3.707   11.521  22.654 1.00 21.04 ? 371  ALA A O   1 
ATOM   1476 C  CB  . ALA A 1 219 ? 1.237   10.010  23.746 1.00 20.65 ? 371  ALA A CB  1 
ATOM   1477 N  N   . SER A 1 220 ? 1.976   12.427  21.548 1.00 21.05 ? 372  SER A N   1 
ATOM   1478 C  CA  . SER A 1 220 ? 2.527   13.781  21.469 1.00 20.91 ? 372  SER A CA  1 
ATOM   1479 C  C   . SER A 1 220 ? 1.728   14.719  22.365 1.00 21.27 ? 372  SER A C   1 
ATOM   1480 O  O   . SER A 1 220 ? 0.495   14.762  22.292 1.00 21.47 ? 372  SER A O   1 
ATOM   1481 C  CB  . SER A 1 220 ? 2.485   14.300  20.030 1.00 20.96 ? 372  SER A CB  1 
ATOM   1482 O  OG  . SER A 1 220 ? 2.647   15.707  19.974 1.00 19.71 ? 372  SER A OG  1 
ATOM   1483 N  N   . SER A 1 221 ? 2.432   15.498  23.181 1.00 21.63 ? 373  SER A N   1 
ATOM   1484 C  CA  . SER A 1 221 ? 1.792   16.442  24.105 1.00 22.09 ? 373  SER A CA  1 
ATOM   1485 C  C   . SER A 1 221 ? 1.197   17.672  23.412 1.00 22.28 ? 373  SER A C   1 
ATOM   1486 O  O   . SER A 1 221 ? 0.618   18.521  24.074 1.00 22.52 ? 373  SER A O   1 
ATOM   1487 C  CB  . SER A 1 221 ? 2.782   16.886  25.184 1.00 22.13 ? 373  SER A CB  1 
ATOM   1488 O  OG  . SER A 1 221 ? 3.940   17.468  24.610 1.00 23.04 ? 373  SER A OG  1 
ATOM   1489 N  N   . ASP A 1 222 ? 1.322   17.758  22.087 1.00 22.67 ? 374  ASP A N   1 
ATOM   1490 C  CA  . ASP A 1 222 ? 0.739   18.856  21.316 1.00 22.85 ? 374  ASP A CA  1 
ATOM   1491 C  C   . ASP A 1 222 ? -0.787  18.849  21.336 1.00 22.85 ? 374  ASP A C   1 
ATOM   1492 O  O   . ASP A 1 222 ? -1.405  19.905  21.243 1.00 22.85 ? 374  ASP A O   1 
ATOM   1493 C  CB  . ASP A 1 222 ? 1.227   18.816  19.860 1.00 23.00 ? 374  ASP A CB  1 
ATOM   1494 C  CG  . ASP A 1 222 ? 2.693   19.213  19.709 1.00 23.23 ? 374  ASP A CG  1 
ATOM   1495 O  OD1 . ASP A 1 222 ? 3.388   19.418  20.729 1.00 24.11 ? 374  ASP A OD1 1 
ATOM   1496 O  OD2 . ASP A 1 222 ? 3.153   19.322  18.550 1.00 23.63 ? 374  ASP A OD2 1 
ATOM   1497 N  N   . CYS A 1 223 ? -1.391  17.665  21.427 1.00 23.07 ? 375  CYS A N   1 
ATOM   1498 C  CA  . CYS A 1 223 ? -2.853  17.541  21.492 1.00 23.29 ? 375  CYS A CA  1 
ATOM   1499 C  C   . CYS A 1 223 ? -3.258  16.132  21.964 1.00 22.77 ? 375  CYS A C   1 
ATOM   1500 O  O   . CYS A 1 223 ? -2.459  15.203  21.904 1.00 22.45 ? 375  CYS A O   1 
ATOM   1501 C  CB  . CYS A 1 223 ? -3.476  17.894  20.129 1.00 23.47 ? 375  CYS A CB  1 
ATOM   1502 S  SG  . CYS A 1 223 ? -3.788  16.496  19.006 1.00 26.37 ? 375  CYS A SG  1 
ATOM   1503 N  N   . SER A 1 224 ? -4.497  15.977  22.427 1.00 22.50 ? 376  SER A N   1 
ATOM   1504 C  CA  . SER A 1 224 ? -4.922  14.733  23.094 1.00 22.40 ? 376  SER A CA  1 
ATOM   1505 C  C   . SER A 1 224 ? -4.945  13.484  22.197 1.00 21.82 ? 376  SER A C   1 
ATOM   1506 O  O   . SER A 1 224 ? -4.802  12.365  22.695 1.00 21.93 ? 376  SER A O   1 
ATOM   1507 C  CB  . SER A 1 224 ? -6.280  14.925  23.797 1.00 22.63 ? 376  SER A CB  1 
ATOM   1508 O  OG  . SER A 1 224 ? -7.345  15.186  22.881 1.00 23.92 ? 376  SER A OG  1 
ATOM   1509 N  N   . THR A 1 225 ? -5.094  13.674  20.886 1.00 21.10 ? 377  THR A N   1 
ATOM   1510 C  CA  . THR A 1 225 ? -5.150  12.564  19.923 1.00 20.52 ? 377  THR A CA  1 
ATOM   1511 C  C   . THR A 1 225 ? -3.950  12.572  18.951 1.00 20.49 ? 377  THR A C   1 
ATOM   1512 O  O   . THR A 1 225 ? -3.986  11.952  17.878 1.00 20.12 ? 377  THR A O   1 
ATOM   1513 C  CB  . THR A 1 225 ? -6.484  12.591  19.158 1.00 20.41 ? 377  THR A CB  1 
ATOM   1514 O  OG1 . THR A 1 225 ? -6.737  13.918  18.677 1.00 20.05 ? 377  THR A OG1 1 
ATOM   1515 C  CG2 . THR A 1 225 ? -7.632  12.178  20.082 1.00 19.99 ? 377  THR A CG2 1 
ATOM   1516 N  N   . CYS A 1 226 ? -2.873  13.235  19.375 1.00 20.24 ? 378  CYS A N   1 
ATOM   1517 C  CA  . CYS A 1 226 ? -1.703  13.472  18.539 1.00 20.27 ? 378  CYS A CA  1 
ATOM   1518 C  C   . CYS A 1 226 ? -0.593  12.455  18.792 1.00 19.92 ? 378  CYS A C   1 
ATOM   1519 O  O   . CYS A 1 226 ? -0.400  11.987  19.914 1.00 19.82 ? 378  CYS A O   1 
ATOM   1520 C  CB  . CYS A 1 226 ? -1.157  14.883  18.774 1.00 20.34 ? 378  CYS A CB  1 
ATOM   1521 S  SG  . CYS A 1 226 ? -2.055  16.190  17.929 1.00 21.67 ? 378  CYS A SG  1 
ATOM   1522 N  N   . PHE A 1 227 ? 0.148   12.141  17.734 1.00 19.40 ? 379  PHE A N   1 
ATOM   1523 C  CA  . PHE A 1 227 ? 1.231   11.173  17.790 1.00 19.01 ? 379  PHE A CA  1 
ATOM   1524 C  C   . PHE A 1 227 ? 2.477   11.721  17.095 1.00 18.99 ? 379  PHE A C   1 
ATOM   1525 O  O   . PHE A 1 227 ? 2.377   12.493  16.145 1.00 18.83 ? 379  PHE A O   1 
ATOM   1526 C  CB  . PHE A 1 227 ? 0.779   9.869   17.142 1.00 18.94 ? 379  PHE A CB  1 
ATOM   1527 C  CG  . PHE A 1 227 ? -0.287  9.162   17.912 1.00 18.80 ? 379  PHE A CG  1 
ATOM   1528 C  CD1 . PHE A 1 227 ? 0.035   8.133   18.782 1.00 19.06 ? 379  PHE A CD1 1 
ATOM   1529 C  CD2 . PHE A 1 227 ? -1.616  9.543   17.791 1.00 19.28 ? 379  PHE A CD2 1 
ATOM   1530 C  CE1 . PHE A 1 227 ? -0.948  7.487   19.502 1.00 19.16 ? 379  PHE A CE1 1 
ATOM   1531 C  CE2 . PHE A 1 227 ? -2.601  8.907   18.508 1.00 18.95 ? 379  PHE A CE2 1 
ATOM   1532 C  CZ  . PHE A 1 227 ? -2.270  7.874   19.366 1.00 19.20 ? 379  PHE A CZ  1 
ATOM   1533 N  N   . VAL A 1 228 ? 3.643   11.335  17.600 1.00 19.11 ? 380  VAL A N   1 
ATOM   1534 C  CA  . VAL A 1 228 ? 4.932   11.750  17.048 1.00 19.17 ? 380  VAL A CA  1 
ATOM   1535 C  C   . VAL A 1 228 ? 5.948   10.613  17.193 1.00 19.66 ? 380  VAL A C   1 
ATOM   1536 O  O   . VAL A 1 228 ? 5.812   9.775   18.080 1.00 19.38 ? 380  VAL A O   1 
ATOM   1537 C  CB  . VAL A 1 228 ? 5.483   13.023  17.768 1.00 19.15 ? 380  VAL A CB  1 
ATOM   1538 C  CG1 . VAL A 1 228 ? 5.831   12.725  19.226 1.00 18.61 ? 380  VAL A CG1 1 
ATOM   1539 C  CG2 . VAL A 1 228 ? 6.702   13.573  17.041 1.00 17.87 ? 380  VAL A CG2 1 
ATOM   1540 N  N   . SER A 1 229 ? 6.952   10.597  16.314 1.00 20.61 ? 381  SER A N   1 
ATOM   1541 C  CA  A SER A 1 229 ? 8.062   9.641   16.416 0.50 20.95 ? 381  SER A CA  1 
ATOM   1542 C  CA  B SER A 1 229 ? 8.070   9.648   16.386 0.50 20.96 ? 381  SER A CA  1 
ATOM   1543 C  C   . SER A 1 229 ? 9.258   10.262  17.135 1.00 21.35 ? 381  SER A C   1 
ATOM   1544 O  O   . SER A 1 229 ? 9.700   11.362  16.801 1.00 21.51 ? 381  SER A O   1 
ATOM   1545 C  CB  A SER A 1 229 ? 8.481   9.130   15.037 0.50 20.95 ? 381  SER A CB  1 
ATOM   1546 C  CB  B SER A 1 229 ? 8.506   9.251   14.974 0.50 20.97 ? 381  SER A CB  1 
ATOM   1547 O  OG  A SER A 1 229 ? 7.628   8.079   14.619 0.50 21.03 ? 381  SER A OG  1 
ATOM   1548 O  OG  B SER A 1 229 ? 9.620   8.379   15.000 0.50 21.13 ? 381  SER A OG  1 
ATOM   1549 N  N   . GLN A 1 230 ? 9.774   9.553   18.138 1.00 21.93 ? 382  GLN A N   1 
ATOM   1550 C  CA  . GLN A 1 230 ? 10.955  9.998   18.874 1.00 22.66 ? 382  GLN A CA  1 
ATOM   1551 C  C   . GLN A 1 230 ? 11.975  8.863   18.967 1.00 22.59 ? 382  GLN A C   1 
ATOM   1552 O  O   . GLN A 1 230 ? 11.625  7.685   18.863 1.00 22.39 ? 382  GLN A O   1 
ATOM   1553 C  CB  . GLN A 1 230 ? 10.573  10.523  20.266 1.00 22.74 ? 382  GLN A CB  1 
ATOM   1554 C  CG  . GLN A 1 230 ? 9.841   11.888  20.253 1.00 23.39 ? 382  GLN A CG  1 
ATOM   1555 C  CD  . GLN A 1 230 ? 9.549   12.419  21.656 1.00 24.32 ? 382  GLN A CD  1 
ATOM   1556 O  OE1 . GLN A 1 230 ? 10.210  12.042  22.631 1.00 28.53 ? 382  GLN A OE1 1 
ATOM   1557 N  NE2 . GLN A 1 230 ? 8.560   13.300  21.764 1.00 26.31 ? 382  GLN A NE2 1 
ATOM   1558 N  N   . SER A 1 231 ? 13.242  9.233   19.133 1.00 22.89 ? 383  SER A N   1 
ATOM   1559 C  CA  . SER A 1 231 ? 14.345  8.266   19.198 1.00 23.09 ? 383  SER A CA  1 
ATOM   1560 C  C   . SER A 1 231 ? 15.184  8.465   20.465 1.00 22.96 ? 383  SER A C   1 
ATOM   1561 O  O   . SER A 1 231 ? 15.336  9.587   20.949 1.00 22.67 ? 383  SER A O   1 
ATOM   1562 C  CB  . SER A 1 231 ? 15.236  8.406   17.961 1.00 23.13 ? 383  SER A CB  1 
ATOM   1563 O  OG  . SER A 1 231 ? 14.472  8.371   16.763 1.00 23.88 ? 383  SER A OG  1 
ATOM   1564 N  N   . GLY A 1 232 ? 15.716  7.366   20.992 1.00 22.97 ? 384  GLY A N   1 
ATOM   1565 C  CA  . GLY A 1 232 ? 16.690  7.399   22.091 1.00 22.55 ? 384  GLY A CA  1 
ATOM   1566 C  C   . GLY A 1 232 ? 16.660  6.158   22.962 1.00 22.38 ? 384  GLY A C   1 
ATOM   1567 O  O   . GLY A 1 232 ? 15.768  5.311   22.833 1.00 22.24 ? 384  GLY A O   1 
ATOM   1568 N  N   . THR A 1 233 ? 17.643  6.044   23.852 1.00 22.41 ? 385  THR A N   1 
ATOM   1569 C  CA  . THR A 1 233 ? 17.678  4.947   24.828 1.00 22.55 ? 385  THR A CA  1 
ATOM   1570 C  C   . THR A 1 233 ? 16.575  5.063   25.894 1.00 22.85 ? 385  THR A C   1 
ATOM   1571 O  O   . THR A 1 233 ? 16.263  4.080   26.573 1.00 23.08 ? 385  THR A O   1 
ATOM   1572 C  CB  . THR A 1 233 ? 19.043  4.837   25.527 1.00 22.40 ? 385  THR A CB  1 
ATOM   1573 O  OG1 . THR A 1 233 ? 19.430  6.119   26.043 1.00 21.51 ? 385  THR A OG1 1 
ATOM   1574 C  CG2 . THR A 1 233 ? 20.091  4.322   24.560 1.00 21.65 ? 385  THR A CG2 1 
ATOM   1575 N  N   . SER A 1 234 ? 16.004  6.258   26.036 1.00 23.04 ? 386  SER A N   1 
ATOM   1576 C  CA  . SER A 1 234 ? 14.794  6.468   26.833 1.00 23.54 ? 386  SER A CA  1 
ATOM   1577 C  C   . SER A 1 234 ? 13.641  5.624   26.312 1.00 23.31 ? 386  SER A C   1 
ATOM   1578 O  O   . SER A 1 234 ? 12.977  4.925   27.080 1.00 23.00 ? 386  SER A O   1 
ATOM   1579 C  CB  . SER A 1 234 ? 14.371  7.940   26.795 1.00 23.78 ? 386  SER A CB  1 
ATOM   1580 O  OG  . SER A 1 234 ? 15.189  8.712   27.650 1.00 25.84 ? 386  SER A OG  1 
ATOM   1581 N  N   . GLN A 1 235 ? 13.411  5.720   25.002 1.00 23.14 ? 387  GLN A N   1 
ATOM   1582 C  CA  . GLN A 1 235 ? 12.373  4.947   24.325 1.00 22.85 ? 387  GLN A CA  1 
ATOM   1583 C  C   . GLN A 1 235 ? 12.661  3.448   24.420 1.00 22.63 ? 387  GLN A C   1 
ATOM   1584 O  O   . GLN A 1 235 ? 11.745  2.661   24.638 1.00 22.32 ? 387  GLN A O   1 
ATOM   1585 C  CB  . GLN A 1 235 ? 12.239  5.370   22.854 1.00 22.82 ? 387  GLN A CB  1 
ATOM   1586 C  CG  . GLN A 1 235 ? 11.366  6.595   22.621 1.00 23.32 ? 387  GLN A CG  1 
ATOM   1587 C  CD  . GLN A 1 235 ? 12.000  7.896   23.080 1.00 23.82 ? 387  GLN A CD  1 
ATOM   1588 O  OE1 . GLN A 1 235 ? 13.220  8.019   23.143 1.00 25.85 ? 387  GLN A OE1 1 
ATOM   1589 N  NE2 . GLN A 1 235 ? 11.166  8.882   23.395 1.00 24.67 ? 387  GLN A NE2 1 
ATOM   1590 N  N   . ALA A 1 236 ? 13.929  3.067   24.245 1.00 22.38 ? 388  ALA A N   1 
ATOM   1591 C  CA  . ALA A 1 236 ? 14.370  1.667   24.420 1.00 22.07 ? 388  ALA A CA  1 
ATOM   1592 C  C   . ALA A 1 236 ? 14.025  1.159   25.820 1.00 21.95 ? 388  ALA A C   1 
ATOM   1593 O  O   . ALA A 1 236 ? 13.322  0.160   25.977 1.00 21.94 ? 388  ALA A O   1 
ATOM   1594 C  CB  . ALA A 1 236 ? 15.882  1.541   24.156 1.00 21.71 ? 388  ALA A CB  1 
ATOM   1595 N  N   . ALA A 1 237 ? 14.509  1.872   26.834 1.00 22.09 ? 389  ALA A N   1 
ATOM   1596 C  CA  . ALA A 1 237 ? 14.205  1.554   28.231 1.00 21.89 ? 389  ALA A CA  1 
ATOM   1597 C  C   . ALA A 1 237 ? 12.702  1.455   28.486 1.00 21.85 ? 389  ALA A C   1 
ATOM   1598 O  O   . ALA A 1 237 ? 12.271  0.562   29.210 1.00 22.36 ? 389  ALA A O   1 
ATOM   1599 C  CB  . ALA A 1 237 ? 14.847  2.576   29.170 1.00 21.62 ? 389  ALA A CB  1 
ATOM   1600 N  N   . ALA A 1 238 ? 11.908  2.348   27.891 1.00 21.67 ? 390  ALA A N   1 
ATOM   1601 C  CA  . ALA A 1 238 ? 10.435  2.292   28.038 1.00 21.69 ? 390  ALA A CA  1 
ATOM   1602 C  C   . ALA A 1 238 ? 9.789   0.980   27.515 1.00 21.88 ? 390  ALA A C   1 
ATOM   1603 O  O   . ALA A 1 238 ? 8.740   0.564   28.018 1.00 21.60 ? 390  ALA A O   1 
ATOM   1604 C  CB  . ALA A 1 238 ? 9.794   3.492   27.379 1.00 21.42 ? 390  ALA A CB  1 
ATOM   1605 N  N   . HIS A 1 239 ? 10.413  0.351   26.513 1.00 22.15 ? 391  HIS A N   1 
ATOM   1606 C  CA  . HIS A 1 239 ? 9.953   -0.935  25.970 1.00 22.30 ? 391  HIS A CA  1 
ATOM   1607 C  C   . HIS A 1 239 ? 10.198  -2.048  26.982 1.00 22.30 ? 391  HIS A C   1 
ATOM   1608 O  O   . HIS A 1 239 ? 9.312   -2.846  27.254 1.00 23.31 ? 391  HIS A O   1 
ATOM   1609 C  CB  . HIS A 1 239 ? 10.670  -1.286  24.650 1.00 22.45 ? 391  HIS A CB  1 
ATOM   1610 C  CG  . HIS A 1 239 ? 10.119  -0.592  23.441 1.00 22.01 ? 391  HIS A CG  1 
ATOM   1611 N  ND1 . HIS A 1 239 ? 10.405  0.721   23.137 1.00 22.72 ? 391  HIS A ND1 1 
ATOM   1612 C  CD2 . HIS A 1 239 ? 9.315   -1.039  22.448 1.00 22.22 ? 391  HIS A CD2 1 
ATOM   1613 C  CE1 . HIS A 1 239 ? 9.786   1.060   22.021 1.00 21.95 ? 391  HIS A CE1 1 
ATOM   1614 N  NE2 . HIS A 1 239 ? 9.116   0.010   21.582 1.00 22.43 ? 391  HIS A NE2 1 
ATOM   1615 N  N   . VAL A 1 240 ? 11.405  -2.090  27.533 1.00 22.33 ? 392  VAL A N   1 
ATOM   1616 C  CA  . VAL A 1 240 ? 11.783  -3.082  28.539 1.00 22.01 ? 392  VAL A CA  1 
ATOM   1617 C  C   . VAL A 1 240 ? 10.983  -2.910  29.833 1.00 22.36 ? 392  VAL A C   1 
ATOM   1618 O  O   . VAL A 1 240 ? 10.608  -3.891  30.461 1.00 22.72 ? 392  VAL A O   1 
ATOM   1619 C  CB  . VAL A 1 240 ? 13.312  -3.033  28.824 1.00 22.04 ? 392  VAL A CB  1 
ATOM   1620 C  CG1 . VAL A 1 240 ? 13.703  -3.957  30.011 1.00 21.13 ? 392  VAL A CG1 1 
ATOM   1621 C  CG2 . VAL A 1 240 ? 14.084  -3.413  27.566 1.00 20.63 ? 392  VAL A CG2 1 
ATOM   1622 N  N   . ALA A 1 241 ? 10.719  -1.670  30.231 1.00 22.59 ? 393  ALA A N   1 
ATOM   1623 C  CA  . ALA A 1 241 ? 9.834   -1.412  31.369 1.00 22.89 ? 393  ALA A CA  1 
ATOM   1624 C  C   . ALA A 1 241 ? 8.423   -1.982  31.132 1.00 23.05 ? 393  ALA A C   1 
ATOM   1625 O  O   . ALA A 1 241 ? 7.768   -2.451  32.067 1.00 23.07 ? 393  ALA A O   1 
ATOM   1626 C  CB  . ALA A 1 241 ? 9.767   0.083   31.662 1.00 22.81 ? 393  ALA A CB  1 
ATOM   1627 N  N   . GLY A 1 242 ? 7.969   -1.936  29.878 1.00 23.26 ? 394  GLY A N   1 
ATOM   1628 C  CA  . GLY A 1 242 ? 6.675   -2.485  29.487 1.00 23.38 ? 394  GLY A CA  1 
ATOM   1629 C  C   . GLY A 1 242 ? 6.664   -3.998  29.465 1.00 23.47 ? 394  GLY A C   1 
ATOM   1630 O  O   . GLY A 1 242 ? 5.708   -4.614  29.904 1.00 23.44 ? 394  GLY A O   1 
ATOM   1631 N  N   . ILE A 1 243 ? 7.734   -4.593  28.949 1.00 23.92 ? 395  ILE A N   1 
ATOM   1632 C  CA  . ILE A 1 243 ? 7.896   -6.048  28.953 1.00 24.21 ? 395  ILE A CA  1 
ATOM   1633 C  C   . ILE A 1 243 ? 7.948   -6.554  30.396 1.00 24.41 ? 395  ILE A C   1 
ATOM   1634 O  O   . ILE A 1 243 ? 7.251   -7.514  30.745 1.00 23.95 ? 395  ILE A O   1 
ATOM   1635 C  CB  . ILE A 1 243 ? 9.167   -6.490  28.156 1.00 24.33 ? 395  ILE A CB  1 
ATOM   1636 C  CG1 . ILE A 1 243 ? 9.011   -6.147  26.670 1.00 24.26 ? 395  ILE A CG1 1 
ATOM   1637 C  CG2 . ILE A 1 243 ? 9.409   -7.987  28.305 1.00 24.27 ? 395  ILE A CG2 1 
ATOM   1638 C  CD1 . ILE A 1 243 ? 10.262  -6.355  25.852 1.00 24.26 ? 395  ILE A CD1 1 
ATOM   1639 N  N   . ALA A 1 244 ? 8.752   -5.890  31.229 1.00 24.80 ? 396  ALA A N   1 
ATOM   1640 C  CA  . ALA A 1 244 ? 8.795   -6.165  32.674 1.00 25.36 ? 396  ALA A CA  1 
ATOM   1641 C  C   . ALA A 1 244 ? 7.409   -6.154  33.324 1.00 25.91 ? 396  ALA A C   1 
ATOM   1642 O  O   . ALA A 1 244 ? 7.069   -7.063  34.072 1.00 26.06 ? 396  ALA A O   1 
ATOM   1643 C  CB  . ALA A 1 244 ? 9.701   -5.158  33.385 1.00 25.26 ? 396  ALA A CB  1 
ATOM   1644 N  N   . ALA A 1 245 ? 6.622   -5.116  33.051 1.00 26.74 ? 397  ALA A N   1 
ATOM   1645 C  CA  . ALA A 1 245 ? 5.272   -4.997  33.612 1.00 27.35 ? 397  ALA A CA  1 
ATOM   1646 C  C   . ALA A 1 245 ? 4.367   -6.138  33.167 1.00 28.19 ? 397  ALA A C   1 
ATOM   1647 O  O   . ALA A 1 245 ? 3.593   -6.667  33.965 1.00 28.58 ? 397  ALA A O   1 
ATOM   1648 C  CB  . ALA A 1 245 ? 4.651   -3.672  33.224 1.00 27.28 ? 397  ALA A CB  1 
ATOM   1649 N  N   . MET A 1 246 ? 4.458   -6.506  31.893 1.00 29.20 ? 398  MET A N   1 
ATOM   1650 C  CA  . MET A 1 246 ? 3.663   -7.604  31.338 1.00 29.99 ? 398  MET A CA  1 
ATOM   1651 C  C   . MET A 1 246 ? 4.008   -8.907  32.028 1.00 29.91 ? 398  MET A C   1 
ATOM   1652 O  O   . MET A 1 246 ? 3.121   -9.671  32.410 1.00 29.96 ? 398  MET A O   1 
ATOM   1653 C  CB  . MET A 1 246 ? 3.931   -7.760  29.839 1.00 30.60 ? 398  MET A CB  1 
ATOM   1654 C  CG  . MET A 1 246 ? 3.471   -6.584  29.004 1.00 32.68 ? 398  MET A CG  1 
ATOM   1655 S  SD  . MET A 1 246 ? 1.684   -6.563  28.897 1.00 37.64 ? 398  MET A SD  1 
ATOM   1656 C  CE  . MET A 1 246 ? 1.473   -7.321  27.277 1.00 37.28 ? 398  MET A CE  1 
ATOM   1657 N  N   . MET A 1 247 ? 5.309   -9.151  32.168 1.00 30.11 ? 399  MET A N   1 
ATOM   1658 C  CA  . MET A 1 247 ? 5.827   -10.351 32.820 1.00 30.39 ? 399  MET A CA  1 
ATOM   1659 C  C   . MET A 1 247 ? 5.386   -10.436 34.277 1.00 30.47 ? 399  MET A C   1 
ATOM   1660 O  O   . MET A 1 247 ? 5.048   -11.516 34.766 1.00 30.23 ? 399  MET A O   1 
ATOM   1661 C  CB  . MET A 1 247 ? 7.357   -10.371 32.753 1.00 30.34 ? 399  MET A CB  1 
ATOM   1662 C  CG  . MET A 1 247 ? 7.917   -10.666 31.371 1.00 30.43 ? 399  MET A CG  1 
ATOM   1663 S  SD  . MET A 1 247 ? 9.720   -10.723 31.391 1.00 30.87 ? 399  MET A SD  1 
ATOM   1664 C  CE  . MET A 1 247 ? 10.052  -11.370 29.746 1.00 30.97 ? 399  MET A CE  1 
ATOM   1665 N  N   . LEU A 1 248 ? 5.389   -9.291  34.955 1.00 30.74 ? 400  LEU A N   1 
ATOM   1666 C  CA  . LEU A 1 248 ? 5.021   -9.219  36.366 1.00 30.94 ? 400  LEU A CA  1 
ATOM   1667 C  C   . LEU A 1 248 ? 3.505   -9.248  36.615 1.00 31.38 ? 400  LEU A C   1 
ATOM   1668 O  O   . LEU A 1 248 ? 3.073   -9.577  37.719 1.00 31.56 ? 400  LEU A O   1 
ATOM   1669 C  CB  . LEU A 1 248 ? 5.663   -7.987  37.021 1.00 30.76 ? 400  LEU A CB  1 
ATOM   1670 C  CG  . LEU A 1 248 ? 7.178   -8.097  37.221 1.00 30.07 ? 400  LEU A CG  1 
ATOM   1671 C  CD1 . LEU A 1 248 ? 7.813   -6.733  37.485 1.00 28.90 ? 400  LEU A CD1 1 
ATOM   1672 C  CD2 . LEU A 1 248 ? 7.498   -9.076  38.341 1.00 29.24 ? 400  LEU A CD2 1 
ATOM   1673 N  N   . SER A 1 249 ? 2.701   -8.916  35.607 1.00 31.85 ? 401  SER A N   1 
ATOM   1674 C  CA  . SER A 1 249 ? 1.246   -9.072  35.713 1.00 32.48 ? 401  SER A CA  1 
ATOM   1675 C  C   . SER A 1 249 ? 0.859   -10.545 35.713 1.00 32.73 ? 401  SER A C   1 
ATOM   1676 O  O   . SER A 1 249 ? 0.075   -10.995 36.553 1.00 32.78 ? 401  SER A O   1 
ATOM   1677 C  CB  . SER A 1 249 ? 0.535   -8.369  34.564 1.00 32.46 ? 401  SER A CB  1 
ATOM   1678 O  OG  . SER A 1 249 ? 0.880   -6.998  34.542 1.00 33.97 ? 401  SER A OG  1 
ATOM   1679 N  N   . ALA A 1 250 ? 1.414   -11.287 34.761 1.00 33.15 ? 402  ALA A N   1 
ATOM   1680 C  CA  . ALA A 1 250 ? 1.186   -12.721 34.661 1.00 33.42 ? 402  ALA A CA  1 
ATOM   1681 C  C   . ALA A 1 250 ? 1.772   -13.466 35.865 1.00 33.78 ? 402  ALA A C   1 
ATOM   1682 O  O   . ALA A 1 250 ? 1.163   -14.410 36.358 1.00 34.16 ? 402  ALA A O   1 
ATOM   1683 C  CB  . ALA A 1 250 ? 1.777   -13.258 33.361 1.00 33.22 ? 402  ALA A CB  1 
ATOM   1684 N  N   . GLU A 1 251 ? 2.943   -13.035 36.332 1.00 34.20 ? 403  GLU A N   1 
ATOM   1685 C  CA  . GLU A 1 251 ? 3.633   -13.679 37.457 1.00 34.61 ? 403  GLU A CA  1 
ATOM   1686 C  C   . GLU A 1 251 ? 4.129   -12.636 38.464 1.00 34.63 ? 403  GLU A C   1 
ATOM   1687 O  O   . GLU A 1 251 ? 5.275   -12.194 38.381 1.00 34.42 ? 403  GLU A O   1 
ATOM   1688 C  CB  . GLU A 1 251 ? 4.812   -14.516 36.951 1.00 34.57 ? 403  GLU A CB  1 
ATOM   1689 C  CG  . GLU A 1 251 ? 4.401   -15.680 36.063 1.00 35.24 ? 403  GLU A CG  1 
ATOM   1690 C  CD  . GLU A 1 251 ? 5.576   -16.542 35.629 1.00 35.51 ? 403  GLU A CD  1 
ATOM   1691 O  OE1 . GLU A 1 251 ? 6.493   -16.017 34.951 1.00 36.75 ? 403  GLU A OE1 1 
ATOM   1692 O  OE2 . GLU A 1 251 ? 5.574   -17.752 35.956 1.00 36.95 ? 403  GLU A OE2 1 
ATOM   1693 N  N   . PRO A 1 252 ? 3.267   -12.250 39.428 1.00 34.88 ? 404  PRO A N   1 
ATOM   1694 C  CA  . PRO A 1 252 ? 3.636   -11.227 40.419 1.00 34.96 ? 404  PRO A CA  1 
ATOM   1695 C  C   . PRO A 1 252 ? 4.708   -11.679 41.420 1.00 35.07 ? 404  PRO A C   1 
ATOM   1696 O  O   . PRO A 1 252 ? 5.412   -10.841 41.984 1.00 34.79 ? 404  PRO A O   1 
ATOM   1697 C  CB  . PRO A 1 252 ? 2.312   -10.934 41.146 1.00 35.02 ? 404  PRO A CB  1 
ATOM   1698 C  CG  . PRO A 1 252 ? 1.236   -11.649 40.374 1.00 34.99 ? 404  PRO A CG  1 
ATOM   1699 C  CD  . PRO A 1 252 ? 1.901   -12.759 39.646 1.00 34.87 ? 404  PRO A CD  1 
ATOM   1700 N  N   . GLU A 1 253 ? 4.828   -12.990 41.628 1.00 35.25 ? 405  GLU A N   1 
ATOM   1701 C  CA  . GLU A 1 253 ? 5.820   -13.545 42.553 1.00 35.48 ? 405  GLU A CA  1 
ATOM   1702 C  C   . GLU A 1 253 ? 7.221   -13.685 41.934 1.00 35.11 ? 405  GLU A C   1 
ATOM   1703 O  O   . GLU A 1 253 ? 8.128   -14.221 42.572 1.00 35.28 ? 405  GLU A O   1 
ATOM   1704 C  CB  . GLU A 1 253 ? 5.339   -14.899 43.103 1.00 35.52 ? 405  GLU A CB  1 
ATOM   1705 C  CG  . GLU A 1 253 ? 4.221   -14.785 44.145 1.00 36.14 ? 405  GLU A CG  1 
ATOM   1706 C  CD  . GLU A 1 253 ? 3.860   -16.123 44.779 1.00 36.43 ? 405  GLU A CD  1 
ATOM   1707 O  OE1 . GLU A 1 253 ? 3.757   -17.127 44.040 1.00 38.23 ? 405  GLU A OE1 1 
ATOM   1708 O  OE2 . GLU A 1 253 ? 3.670   -16.172 46.017 1.00 37.31 ? 405  GLU A OE2 1 
ATOM   1709 N  N   . LEU A 1 254 ? 7.402   -13.212 40.701 1.00 34.74 ? 406  LEU A N   1 
ATOM   1710 C  CA  . LEU A 1 254 ? 8.725   -13.201 40.074 1.00 34.38 ? 406  LEU A CA  1 
ATOM   1711 C  C   . LEU A 1 254 ? 9.684   -12.309 40.854 1.00 34.19 ? 406  LEU A C   1 
ATOM   1712 O  O   . LEU A 1 254 ? 9.369   -11.155 41.155 1.00 33.95 ? 406  LEU A O   1 
ATOM   1713 C  CB  . LEU A 1 254 ? 8.659   -12.693 38.625 1.00 34.42 ? 406  LEU A CB  1 
ATOM   1714 C  CG  . LEU A 1 254 ? 8.466   -13.691 37.487 1.00 33.95 ? 406  LEU A CG  1 
ATOM   1715 C  CD1 . LEU A 1 254 ? 8.464   -12.937 36.163 1.00 33.62 ? 406  LEU A CD1 1 
ATOM   1716 C  CD2 . LEU A 1 254 ? 9.554   -14.743 37.499 1.00 33.50 ? 406  LEU A CD2 1 
ATOM   1717 N  N   . THR A 1 255 ? 10.859  -12.848 41.168 1.00 33.99 ? 407  THR A N   1 
ATOM   1718 C  CA  . THR A 1 255 ? 11.910  -12.068 41.802 1.00 33.74 ? 407  THR A CA  1 
ATOM   1719 C  C   . THR A 1 255 ? 12.605  -11.210 40.746 1.00 33.69 ? 407  THR A C   1 
ATOM   1720 O  O   . THR A 1 255 ? 12.294  -11.287 39.554 1.00 33.63 ? 407  THR A O   1 
ATOM   1721 C  CB  . THR A 1 255 ? 12.945  -12.969 42.520 1.00 33.81 ? 407  THR A CB  1 
ATOM   1722 O  OG1 . THR A 1 255 ? 13.641  -13.772 41.561 1.00 33.73 ? 407  THR A OG1 1 
ATOM   1723 C  CG2 . THR A 1 255 ? 12.263  -13.879 43.545 1.00 33.50 ? 407  THR A CG2 1 
ATOM   1724 N  N   . LEU A 1 256 ? 13.539  -10.384 41.199 1.00 33.56 ? 408  LEU A N   1 
ATOM   1725 C  CA  . LEU A 1 256 ? 14.311  -9.523  40.318 1.00 33.53 ? 408  LEU A CA  1 
ATOM   1726 C  C   . LEU A 1 256 ? 15.284  -10.342 39.473 1.00 33.43 ? 408  LEU A C   1 
ATOM   1727 O  O   . LEU A 1 256 ? 15.465  -10.062 38.285 1.00 33.27 ? 408  LEU A O   1 
ATOM   1728 C  CB  . LEU A 1 256 ? 15.063  -8.484  41.149 1.00 33.54 ? 408  LEU A CB  1 
ATOM   1729 C  CG  . LEU A 1 256 ? 15.885  -7.407  40.438 1.00 33.66 ? 408  LEU A CG  1 
ATOM   1730 C  CD1 . LEU A 1 256 ? 15.112  -6.720  39.321 1.00 33.11 ? 408  LEU A CD1 1 
ATOM   1731 C  CD2 . LEU A 1 256 ? 16.353  -6.394  41.486 1.00 33.74 ? 408  LEU A CD2 1 
ATOM   1732 N  N   . ALA A 1 257 ? 15.898  -11.354 40.089 1.00 33.22 ? 409  ALA A N   1 
ATOM   1733 C  CA  . ALA A 1 257 ? 16.829  -12.243 39.392 1.00 33.13 ? 409  ALA A CA  1 
ATOM   1734 C  C   . ALA A 1 257 ? 16.118  -13.101 38.347 1.00 33.07 ? 409  ALA A C   1 
ATOM   1735 O  O   . ALA A 1 257 ? 16.663  -13.341 37.267 1.00 33.06 ? 409  ALA A O   1 
ATOM   1736 C  CB  . ALA A 1 257 ? 17.568  -13.128 40.387 1.00 33.00 ? 409  ALA A CB  1 
ATOM   1737 N  N   . GLU A 1 258 ? 14.907  -13.555 38.673 1.00 33.04 ? 410  GLU A N   1 
ATOM   1738 C  CA  . GLU A 1 258 ? 14.097  -14.376 37.762 1.00 33.11 ? 410  GLU A CA  1 
ATOM   1739 C  C   . GLU A 1 258 ? 13.588  -13.578 36.555 1.00 32.86 ? 410  GLU A C   1 
ATOM   1740 O  O   . GLU A 1 258 ? 13.565  -14.094 35.439 1.00 32.54 ? 410  GLU A O   1 
ATOM   1741 C  CB  . GLU A 1 258 ? 12.913  -15.010 38.505 1.00 33.07 ? 410  GLU A CB  1 
ATOM   1742 C  CG  . GLU A 1 258 ? 13.310  -16.134 39.469 1.00 33.67 ? 410  GLU A CG  1 
ATOM   1743 C  CD  . GLU A 1 258 ? 12.151  -16.644 40.336 1.00 33.89 ? 410  GLU A CD  1 
ATOM   1744 O  OE1 . GLU A 1 258 ? 11.016  -16.133 40.201 1.00 35.37 ? 410  GLU A OE1 1 
ATOM   1745 O  OE2 . GLU A 1 258 ? 12.381  -17.563 41.156 1.00 33.69 ? 410  GLU A OE2 1 
ATOM   1746 N  N   . LEU A 1 259 ? 13.174  -12.330 36.792 1.00 32.79 ? 411  LEU A N   1 
ATOM   1747 C  CA  . LEU A 1 259 ? 12.732  -11.425 35.726 1.00 32.71 ? 411  LEU A CA  1 
ATOM   1748 C  C   . LEU A 1 259 ? 13.864  -11.159 34.738 1.00 32.78 ? 411  LEU A C   1 
ATOM   1749 O  O   . LEU A 1 259 ? 13.661  -11.174 33.523 1.00 32.49 ? 411  LEU A O   1 
ATOM   1750 C  CB  . LEU A 1 259 ? 12.253  -10.091 36.312 1.00 32.62 ? 411  LEU A CB  1 
ATOM   1751 C  CG  . LEU A 1 259 ? 11.807  -9.028  35.298 1.00 32.87 ? 411  LEU A CG  1 
ATOM   1752 C  CD1 . LEU A 1 259 ? 10.475  -9.427  34.683 1.00 32.99 ? 411  LEU A CD1 1 
ATOM   1753 C  CD2 . LEU A 1 259 ? 11.713  -7.643  35.927 1.00 32.71 ? 411  LEU A CD2 1 
ATOM   1754 N  N   . ARG A 1 260 ? 15.055  -10.931 35.283 1.00 32.84 ? 412  ARG A N   1 
ATOM   1755 C  CA  . ARG A 1 260 ? 16.241  -10.607 34.499 1.00 33.08 ? 412  ARG A CA  1 
ATOM   1756 C  C   . ARG A 1 260 ? 16.628  -11.705 33.507 1.00 32.64 ? 412  ARG A C   1 
ATOM   1757 O  O   . ARG A 1 260 ? 16.835  -11.424 32.327 1.00 32.44 ? 412  ARG A O   1 
ATOM   1758 C  CB  . ARG A 1 260 ? 17.408  -10.325 35.444 1.00 33.57 ? 412  ARG A CB  1 
ATOM   1759 C  CG  . ARG A 1 260 ? 18.504  -9.457  34.867 1.00 35.19 ? 412  ARG A CG  1 
ATOM   1760 C  CD  . ARG A 1 260 ? 18.861  -8.382  35.873 1.00 37.80 ? 412  ARG A CD  1 
ATOM   1761 N  NE  . ARG A 1 260 ? 20.000  -7.581  35.445 1.00 38.97 ? 412  ARG A NE  1 
ATOM   1762 C  CZ  . ARG A 1 260 ? 20.338  -6.410  35.975 1.00 39.74 ? 412  ARG A CZ  1 
ATOM   1763 N  NH1 . ARG A 1 260 ? 19.623  -5.876  36.956 1.00 40.78 ? 412  ARG A NH1 1 
ATOM   1764 N  NH2 . ARG A 1 260 ? 21.401  -5.768  35.515 1.00 40.23 ? 412  ARG A NH2 1 
ATOM   1765 N  N   . GLN A 1 261 ? 16.730  -12.947 33.980 1.00 32.38 ? 413  GLN A N   1 
ATOM   1766 C  CA  A GLN A 1 261 ? 17.083  -14.053 33.091 0.50 32.34 ? 413  GLN A CA  1 
ATOM   1767 C  CA  B GLN A 1 261 ? 17.064  -14.087 33.114 0.50 32.30 ? 413  GLN A CA  1 
ATOM   1768 C  C   . GLN A 1 261 ? 15.938  -14.396 32.133 1.00 32.28 ? 413  GLN A C   1 
ATOM   1769 O  O   . GLN A 1 261 ? 16.170  -14.996 31.088 1.00 32.30 ? 413  GLN A O   1 
ATOM   1770 C  CB  A GLN A 1 261 ? 17.539  -15.277 33.889 0.50 32.32 ? 413  GLN A CB  1 
ATOM   1771 C  CB  B GLN A 1 261 ? 17.414  -15.339 33.936 0.50 32.25 ? 413  GLN A CB  1 
ATOM   1772 C  CG  A GLN A 1 261 ? 18.795  -15.025 34.738 0.50 32.33 ? 413  GLN A CG  1 
ATOM   1773 C  CG  B GLN A 1 261 ? 16.285  -15.908 34.812 0.50 32.09 ? 413  GLN A CG  1 
ATOM   1774 C  CD  A GLN A 1 261 ? 19.934  -14.384 33.950 0.50 32.05 ? 413  GLN A CD  1 
ATOM   1775 C  CD  B GLN A 1 261 ? 15.442  -16.994 34.143 0.50 31.71 ? 413  GLN A CD  1 
ATOM   1776 O  OE1 A GLN A 1 261 ? 20.483  -13.355 34.353 0.50 31.35 ? 413  GLN A OE1 1 
ATOM   1777 O  OE1 B GLN A 1 261 ? 15.771  -17.496 33.065 0.50 31.19 ? 413  GLN A OE1 1 
ATOM   1778 N  NE2 A GLN A 1 261 ? 20.281  -14.984 32.813 0.50 31.72 ? 413  GLN A NE2 1 
ATOM   1779 N  NE2 B GLN A 1 261 ? 14.347  -17.366 34.799 0.50 31.21 ? 413  GLN A NE2 1 
ATOM   1780 N  N   . ARG A 1 262 ? 14.716  -13.993 32.486 1.00 32.27 ? 414  ARG A N   1 
ATOM   1781 C  CA  . ARG A 1 262 ? 13.554  -14.131 31.604 1.00 32.10 ? 414  ARG A CA  1 
ATOM   1782 C  C   . ARG A 1 262 ? 13.698  -13.171 30.431 1.00 31.70 ? 414  ARG A C   1 
ATOM   1783 O  O   . ARG A 1 262 ? 13.458  -13.544 29.285 1.00 31.50 ? 414  ARG A O   1 
ATOM   1784 C  CB  . ARG A 1 262 ? 12.253  -13.782 32.337 1.00 32.34 ? 414  ARG A CB  1 
ATOM   1785 C  CG  . ARG A 1 262 ? 11.141  -14.813 32.216 1.00 32.87 ? 414  ARG A CG  1 
ATOM   1786 C  CD  . ARG A 1 262 ? 11.114  -15.691 33.446 1.00 33.70 ? 414  ARG A CD  1 
ATOM   1787 N  NE  . ARG A 1 262 ? 9.917   -16.521 33.523 1.00 33.74 ? 414  ARG A NE  1 
ATOM   1788 C  CZ  . ARG A 1 262 ? 9.587   -17.262 34.579 1.00 34.07 ? 414  ARG A CZ  1 
ATOM   1789 N  NH1 . ARG A 1 262 ? 8.477   -17.987 34.556 1.00 34.35 ? 414  ARG A NH1 1 
ATOM   1790 N  NH2 . ARG A 1 262 ? 10.362  -17.283 35.661 1.00 34.51 ? 414  ARG A NH2 1 
ATOM   1791 N  N   . LEU A 1 263 ? 14.070  -11.927 30.738 1.00 31.37 ? 415  LEU A N   1 
ATOM   1792 C  CA  . LEU A 1 263 ? 14.285  -10.901 29.711 1.00 31.10 ? 415  LEU A CA  1 
ATOM   1793 C  C   . LEU A 1 263 ? 15.353  -11.348 28.717 1.00 30.64 ? 415  LEU A C   1 
ATOM   1794 O  O   . LEU A 1 263 ? 15.182  -11.185 27.508 1.00 30.55 ? 415  LEU A O   1 
ATOM   1795 C  CB  . LEU A 1 263 ? 14.677  -9.552  30.338 1.00 31.06 ? 415  LEU A CB  1 
ATOM   1796 C  CG  . LEU A 1 263 ? 13.542  -8.701  30.917 1.00 31.20 ? 415  LEU A CG  1 
ATOM   1797 C  CD1 . LEU A 1 263 ? 14.096  -7.591  31.793 1.00 30.99 ? 415  LEU A CD1 1 
ATOM   1798 C  CD2 . LEU A 1 263 ? 12.668  -8.118  29.817 1.00 31.39 ? 415  LEU A CD2 1 
ATOM   1799 N  N   . ILE A 1 264 ? 16.443  -11.912 29.241 1.00 30.21 ? 416  ILE A N   1 
ATOM   1800 C  CA  . ILE A 1 264 ? 17.537  -12.442 28.425 1.00 29.75 ? 416  ILE A CA  1 
ATOM   1801 C  C   . ILE A 1 264 ? 17.104  -13.686 27.643 1.00 29.32 ? 416  ILE A C   1 
ATOM   1802 O  O   . ILE A 1 264 ? 17.411  -13.818 26.458 1.00 29.48 ? 416  ILE A O   1 
ATOM   1803 C  CB  . ILE A 1 264 ? 18.773  -12.778 29.301 1.00 29.93 ? 416  ILE A CB  1 
ATOM   1804 C  CG1 . ILE A 1 264 ? 19.379  -11.492 29.875 1.00 30.09 ? 416  ILE A CG1 1 
ATOM   1805 C  CG2 . ILE A 1 264 ? 19.832  -13.548 28.504 1.00 29.40 ? 416  ILE A CG2 1 
ATOM   1806 C  CD1 . ILE A 1 264 ? 20.539  -11.745 30.830 1.00 29.92 ? 416  ILE A CD1 1 
ATOM   1807 N  N   . HIS A 1 265 ? 16.391  -14.591 28.307 1.00 28.62 ? 417  HIS A N   1 
ATOM   1808 C  CA  . HIS A 1 265 ? 15.928  -15.829 27.676 1.00 27.98 ? 417  HIS A CA  1 
ATOM   1809 C  C   . HIS A 1 265 ? 15.057  -15.588 26.439 1.00 27.40 ? 417  HIS A C   1 
ATOM   1810 O  O   . HIS A 1 265 ? 15.263  -16.211 25.397 1.00 27.36 ? 417  HIS A O   1 
ATOM   1811 C  CB  . HIS A 1 265 ? 15.148  -16.675 28.686 1.00 28.00 ? 417  HIS A CB  1 
ATOM   1812 C  CG  . HIS A 1 265 ? 14.644  -17.966 28.123 1.00 27.96 ? 417  HIS A CG  1 
ATOM   1813 N  ND1 . HIS A 1 265 ? 15.425  -19.099 28.049 1.00 27.74 ? 417  HIS A ND1 1 
ATOM   1814 C  CD2 . HIS A 1 265 ? 13.442  -18.301 27.597 1.00 27.75 ? 417  HIS A CD2 1 
ATOM   1815 C  CE1 . HIS A 1 265 ? 14.725  -20.077 27.502 1.00 27.93 ? 417  HIS A CE1 1 
ATOM   1816 N  NE2 . HIS A 1 265 ? 13.519  -19.618 27.218 1.00 27.82 ? 417  HIS A NE2 1 
ATOM   1817 N  N   . PHE A 1 266 ? 14.086  -14.690 26.562 1.00 26.84 ? 418  PHE A N   1 
ATOM   1818 C  CA  . PHE A 1 266 ? 13.140  -14.415 25.477 1.00 26.43 ? 418  PHE A CA  1 
ATOM   1819 C  C   . PHE A 1 266 ? 13.612  -13.347 24.470 1.00 25.81 ? 418  PHE A C   1 
ATOM   1820 O  O   . PHE A 1 266 ? 12.900  -13.049 23.519 1.00 25.61 ? 418  PHE A O   1 
ATOM   1821 C  CB  . PHE A 1 266 ? 11.762  -14.051 26.058 1.00 26.62 ? 418  PHE A CB  1 
ATOM   1822 C  CG  . PHE A 1 266 ? 11.041  -15.224 26.680 1.00 26.59 ? 418  PHE A CG  1 
ATOM   1823 C  CD1 . PHE A 1 266 ? 10.554  -16.252 25.886 1.00 26.77 ? 418  PHE A CD1 1 
ATOM   1824 C  CD2 . PHE A 1 266 ? 10.857  -15.304 28.056 1.00 27.19 ? 418  PHE A CD2 1 
ATOM   1825 C  CE1 . PHE A 1 266 ? 9.898   -17.345 26.448 1.00 26.97 ? 418  PHE A CE1 1 
ATOM   1826 C  CE2 . PHE A 1 266 ? 10.198  -16.398 28.629 1.00 27.48 ? 418  PHE A CE2 1 
ATOM   1827 C  CZ  . PHE A 1 266 ? 9.717   -17.414 27.822 1.00 26.97 ? 418  PHE A CZ  1 
ATOM   1828 N  N   . SER A 1 267 ? 14.803  -12.786 24.674 1.00 25.25 ? 419  SER A N   1 
ATOM   1829 C  CA  . SER A 1 267 ? 15.394  -11.838 23.717 1.00 24.86 ? 419  SER A CA  1 
ATOM   1830 C  C   . SER A 1 267 ? 15.828  -12.508 22.418 1.00 24.35 ? 419  SER A C   1 
ATOM   1831 O  O   . SER A 1 267 ? 16.131  -13.704 22.399 1.00 24.49 ? 419  SER A O   1 
ATOM   1832 C  CB  . SER A 1 267 ? 16.617  -11.141 24.322 1.00 24.84 ? 419  SER A CB  1 
ATOM   1833 O  OG  . SER A 1 267 ? 16.227  -10.104 25.196 1.00 25.12 ? 419  SER A OG  1 
ATOM   1834 N  N   . ALA A 1 268 ? 15.872  -11.725 21.341 1.00 23.63 ? 420  ALA A N   1 
ATOM   1835 C  CA  . ALA A 1 268 ? 16.464  -12.170 20.081 1.00 23.09 ? 420  ALA A CA  1 
ATOM   1836 C  C   . ALA A 1 268 ? 17.978  -12.043 20.182 1.00 22.89 ? 420  ALA A C   1 
ATOM   1837 O  O   . ALA A 1 268 ? 18.502  -10.997 20.560 1.00 22.71 ? 420  ALA A O   1 
ATOM   1838 C  CB  . ALA A 1 268 ? 15.944  -11.358 18.918 1.00 22.63 ? 420  ALA A CB  1 
ATOM   1839 N  N   . LYS A 1 269 ? 18.666  -13.118 19.818 1.00 22.88 ? 421  LYS A N   1 
ATOM   1840 C  CA  . LYS A 1 269 ? 20.101  -13.259 20.012 1.00 22.88 ? 421  LYS A CA  1 
ATOM   1841 C  C   . LYS A 1 269 ? 20.885  -13.175 18.711 1.00 22.46 ? 421  LYS A C   1 
ATOM   1842 O  O   . LYS A 1 269 ? 20.426  -13.640 17.669 1.00 22.72 ? 421  LYS A O   1 
ATOM   1843 C  CB  . LYS A 1 269 ? 20.379  -14.610 20.689 1.00 22.98 ? 421  LYS A CB  1 
ATOM   1844 C  CG  . LYS A 1 269 ? 20.078  -14.571 22.188 1.00 24.38 ? 421  LYS A CG  1 
ATOM   1845 C  CD  . LYS A 1 269 ? 19.469  -15.853 22.711 1.00 26.27 ? 421  LYS A CD  1 
ATOM   1846 C  CE  . LYS A 1 269 ? 18.893  -15.643 24.115 1.00 26.97 ? 421  LYS A CE  1 
ATOM   1847 N  NZ  . LYS A 1 269 ? 17.550  -15.001 24.049 1.00 27.12 ? 421  LYS A NZ  1 
ATOM   1848 N  N   . ASP A 1 270 ? 22.072  -12.575 18.795 1.00 22.07 ? 422  ASP A N   1 
ATOM   1849 C  CA  A ASP A 1 270 ? 23.037  -12.577 17.690 0.50 21.86 ? 422  ASP A CA  1 
ATOM   1850 C  CA  B ASP A 1 270 ? 23.035  -12.562 17.694 0.50 21.81 ? 422  ASP A CA  1 
ATOM   1851 C  C   . ASP A 1 270 ? 22.436  -11.988 16.410 1.00 21.66 ? 422  ASP A C   1 
ATOM   1852 O  O   . ASP A 1 270 ? 22.575  -12.549 15.332 1.00 21.40 ? 422  ASP A O   1 
ATOM   1853 C  CB  A ASP A 1 270 ? 23.567  -14.005 17.450 0.50 21.71 ? 422  ASP A CB  1 
ATOM   1854 C  CB  B ASP A 1 270 ? 23.610  -13.969 17.482 0.50 21.62 ? 422  ASP A CB  1 
ATOM   1855 C  CG  A ASP A 1 270 ? 25.001  -14.027 16.911 0.50 21.87 ? 422  ASP A CG  1 
ATOM   1856 C  CG  B ASP A 1 270 ? 24.342  -14.494 18.716 0.50 21.56 ? 422  ASP A CG  1 
ATOM   1857 O  OD1 A ASP A 1 270 ? 25.884  -13.388 17.528 0.50 22.00 ? 422  ASP A OD1 1 
ATOM   1858 O  OD1 B ASP A 1 270 ? 24.860  -13.671 19.505 0.50 20.68 ? 422  ASP A OD1 1 
ATOM   1859 O  OD2 A ASP A 1 270 ? 25.255  -14.698 15.883 0.50 21.61 ? 422  ASP A OD2 1 
ATOM   1860 O  OD2 B ASP A 1 270 ? 24.407  -15.732 18.896 0.50 21.69 ? 422  ASP A OD2 1 
ATOM   1861 N  N   . VAL A 1 271 ? 21.772  -10.848 16.548 1.00 21.52 ? 423  VAL A N   1 
ATOM   1862 C  CA  . VAL A 1 271 ? 21.147  -10.169 15.419 1.00 21.52 ? 423  VAL A CA  1 
ATOM   1863 C  C   . VAL A 1 271 ? 21.712  -8.741  15.233 1.00 21.35 ? 423  VAL A C   1 
ATOM   1864 O  O   . VAL A 1 271 ? 21.529  -8.127  14.189 1.00 21.28 ? 423  VAL A O   1 
ATOM   1865 C  CB  . VAL A 1 271 ? 19.595  -10.200 15.583 1.00 21.55 ? 423  VAL A CB  1 
ATOM   1866 C  CG1 . VAL A 1 271 ? 19.082  -8.978  16.337 1.00 21.24 ? 423  VAL A CG1 1 
ATOM   1867 C  CG2 . VAL A 1 271 ? 18.929  -10.337 14.252 1.00 21.73 ? 423  VAL A CG2 1 
ATOM   1868 N  N   . ILE A 1 272 ? 22.424  -8.241  16.239 1.00 21.44 ? 424  ILE A N   1 
ATOM   1869 C  CA  . ILE A 1 272 ? 23.166  -6.985  16.155 1.00 21.32 ? 424  ILE A CA  1 
ATOM   1870 C  C   . ILE A 1 272 ? 24.522  -7.283  15.542 1.00 21.65 ? 424  ILE A C   1 
ATOM   1871 O  O   . ILE A 1 272 ? 25.167  -8.261  15.926 1.00 21.72 ? 424  ILE A O   1 
ATOM   1872 C  CB  . ILE A 1 272 ? 23.393  -6.367  17.563 1.00 21.27 ? 424  ILE A CB  1 
ATOM   1873 C  CG1 . ILE A 1 272 ? 22.052  -6.123  18.270 1.00 21.50 ? 424  ILE A CG1 1 
ATOM   1874 C  CG2 . ILE A 1 272 ? 24.199  -5.063  17.474 1.00 20.40 ? 424  ILE A CG2 1 
ATOM   1875 C  CD1 . ILE A 1 272 ? 22.170  -5.883  19.772 1.00 21.05 ? 424  ILE A CD1 1 
ATOM   1876 N  N   . ASN A 1 273 ? 24.949  -6.460  14.585 1.00 22.03 ? 425  ASN A N   1 
ATOM   1877 C  CA  . ASN A 1 273 ? 26.304  -6.543  14.051 1.00 22.55 ? 425  ASN A CA  1 
ATOM   1878 C  C   . ASN A 1 273 ? 27.230  -5.771  14.994 1.00 23.29 ? 425  ASN A C   1 
ATOM   1879 O  O   . ASN A 1 273 ? 27.182  -4.535  15.082 1.00 23.17 ? 425  ASN A O   1 
ATOM   1880 C  CB  . ASN A 1 273 ? 26.399  -6.009  12.612 1.00 22.44 ? 425  ASN A CB  1 
ATOM   1881 C  CG  . ASN A 1 273 ? 25.611  -6.855  11.602 1.00 22.00 ? 425  ASN A CG  1 
ATOM   1882 O  OD1 . ASN A 1 273 ? 25.481  -8.068  11.749 1.00 21.23 ? 425  ASN A OD1 1 
ATOM   1883 N  ND2 . ASN A 1 273 ? 25.097  -6.204  10.563 1.00 20.13 ? 425  ASN A ND2 1 
ATOM   1884 N  N   . GLU A 1 274 ? 28.061  -6.524  15.710 1.00 24.12 ? 426  GLU A N   1 
ATOM   1885 C  CA  . GLU A 1 274 ? 28.877  -5.982  16.792 1.00 24.68 ? 426  GLU A CA  1 
ATOM   1886 C  C   . GLU A 1 274 ? 30.111  -5.204  16.298 1.00 24.75 ? 426  GLU A C   1 
ATOM   1887 O  O   . GLU A 1 274 ? 30.754  -4.512  17.088 1.00 24.93 ? 426  GLU A O   1 
ATOM   1888 C  CB  . GLU A 1 274 ? 29.277  -7.092  17.781 1.00 24.91 ? 426  GLU A CB  1 
ATOM   1889 C  CG  . GLU A 1 274 ? 30.089  -8.248  17.196 1.00 26.09 ? 426  GLU A CG  1 
ATOM   1890 C  CD  . GLU A 1 274 ? 29.232  -9.402  16.672 1.00 28.11 ? 426  GLU A CD  1 
ATOM   1891 O  OE1 . GLU A 1 274 ? 28.000  -9.241  16.535 1.00 29.28 ? 426  GLU A OE1 1 
ATOM   1892 O  OE2 . GLU A 1 274 ? 29.801  -10.478 16.385 1.00 30.21 ? 426  GLU A OE2 1 
ATOM   1893 N  N   . ALA A 1 275 ? 30.420  -5.296  15.003 1.00 24.53 ? 427  ALA A N   1 
ATOM   1894 C  CA  . ALA A 1 275 ? 31.457  -4.457  14.373 1.00 24.52 ? 427  ALA A CA  1 
ATOM   1895 C  C   . ALA A 1 275 ? 31.250  -2.945  14.620 1.00 24.65 ? 427  ALA A C   1 
ATOM   1896 O  O   . ALA A 1 275 ? 32.213  -2.167  14.617 1.00 24.72 ? 427  ALA A O   1 
ATOM   1897 C  CB  . ALA A 1 275 ? 31.515  -4.736  12.871 1.00 24.08 ? 427  ALA A CB  1 
ATOM   1898 N  N   . TRP A 1 276 ? 29.993  -2.549  14.814 1.00 24.48 ? 428  TRP A N   1 
ATOM   1899 C  CA  . TRP A 1 276 ? 29.618  -1.174  15.159 1.00 24.76 ? 428  TRP A CA  1 
ATOM   1900 C  C   . TRP A 1 276 ? 30.257  -0.689  16.461 1.00 24.79 ? 428  TRP A C   1 
ATOM   1901 O  O   . TRP A 1 276 ? 30.631  0.478   16.571 1.00 24.88 ? 428  TRP A O   1 
ATOM   1902 C  CB  . TRP A 1 276 ? 28.095  -1.089  15.286 1.00 24.87 ? 428  TRP A CB  1 
ATOM   1903 C  CG  . TRP A 1 276 ? 27.530  0.294   15.315 1.00 25.19 ? 428  TRP A CG  1 
ATOM   1904 C  CD1 . TRP A 1 276 ? 27.157  1.046   14.240 1.00 25.15 ? 428  TRP A CD1 1 
ATOM   1905 C  CD2 . TRP A 1 276 ? 27.227  1.077   16.477 1.00 24.94 ? 428  TRP A CD2 1 
ATOM   1906 N  NE1 . TRP A 1 276 ? 26.659  2.253   14.659 1.00 24.80 ? 428  TRP A NE1 1 
ATOM   1907 C  CE2 . TRP A 1 276 ? 26.691  2.300   16.027 1.00 24.76 ? 428  TRP A CE2 1 
ATOM   1908 C  CE3 . TRP A 1 276 ? 27.367  0.865   17.856 1.00 25.45 ? 428  TRP A CE3 1 
ATOM   1909 C  CZ2 . TRP A 1 276 ? 26.290  3.317   16.910 1.00 25.76 ? 428  TRP A CZ2 1 
ATOM   1910 C  CZ3 . TRP A 1 276 ? 26.970  1.875   18.737 1.00 25.36 ? 428  TRP A CZ3 1 
ATOM   1911 C  CH2 . TRP A 1 276 ? 26.437  3.087   18.257 1.00 25.16 ? 428  TRP A CH2 1 
ATOM   1912 N  N   . PHE A 1 277 ? 30.376  -1.584  17.440 1.00 24.73 ? 429  PHE A N   1 
ATOM   1913 C  CA  . PHE A 1 277 ? 31.004  -1.256  18.716 1.00 24.88 ? 429  PHE A CA  1 
ATOM   1914 C  C   . PHE A 1 277 ? 32.524  -1.211  18.545 1.00 25.39 ? 429  PHE A C   1 
ATOM   1915 O  O   . PHE A 1 277 ? 33.047  -1.766  17.579 1.00 25.60 ? 429  PHE A O   1 
ATOM   1916 C  CB  . PHE A 1 277 ? 30.625  -2.289  19.778 1.00 24.63 ? 429  PHE A CB  1 
ATOM   1917 C  CG  . PHE A 1 277 ? 29.138  -2.507  19.909 1.00 24.09 ? 429  PHE A CG  1 
ATOM   1918 C  CD1 . PHE A 1 277 ? 28.296  -1.452  20.222 1.00 23.82 ? 429  PHE A CD1 1 
ATOM   1919 C  CD2 . PHE A 1 277 ? 28.584  -3.770  19.723 1.00 23.52 ? 429  PHE A CD2 1 
ATOM   1920 C  CE1 . PHE A 1 277 ? 26.917  -1.643  20.336 1.00 23.84 ? 429  PHE A CE1 1 
ATOM   1921 C  CE2 . PHE A 1 277 ? 27.213  -3.975  19.840 1.00 23.76 ? 429  PHE A CE2 1 
ATOM   1922 C  CZ  . PHE A 1 277 ? 26.376  -2.907  20.144 1.00 23.91 ? 429  PHE A CZ  1 
ATOM   1923 N  N   . PRO A 1 278 ? 33.245  -0.522  19.452 1.00 26.01 ? 430  PRO A N   1 
ATOM   1924 C  CA  . PRO A 1 278 ? 34.714  -0.651  19.439 1.00 26.61 ? 430  PRO A CA  1 
ATOM   1925 C  C   . PRO A 1 278 ? 35.165  -2.092  19.720 1.00 27.27 ? 430  PRO A C   1 
ATOM   1926 O  O   . PRO A 1 278 ? 34.441  -2.842  20.386 1.00 27.12 ? 430  PRO A O   1 
ATOM   1927 C  CB  . PRO A 1 278 ? 35.166  0.303   20.557 1.00 26.40 ? 430  PRO A CB  1 
ATOM   1928 C  CG  . PRO A 1 278 ? 34.023  1.240   20.748 1.00 26.37 ? 430  PRO A CG  1 
ATOM   1929 C  CD  . PRO A 1 278 ? 32.794  0.424   20.485 1.00 26.01 ? 430  PRO A CD  1 
ATOM   1930 N  N   . GLU A 1 279 ? 36.343  -2.472  19.219 1.00 28.00 ? 431  GLU A N   1 
ATOM   1931 C  CA  . GLU A 1 279 ? 36.807  -3.860  19.319 1.00 28.70 ? 431  GLU A CA  1 
ATOM   1932 C  C   . GLU A 1 279 ? 36.810  -4.365  20.761 1.00 29.23 ? 431  GLU A C   1 
ATOM   1933 O  O   . GLU A 1 279 ? 36.328  -5.466  21.044 1.00 29.57 ? 431  GLU A O   1 
ATOM   1934 C  CB  . GLU A 1 279 ? 38.199  -4.031  18.699 1.00 28.70 ? 431  GLU A CB  1 
ATOM   1935 C  CG  . GLU A 1 279 ? 38.687  -5.482  18.688 1.00 29.09 ? 431  GLU A CG  1 
ATOM   1936 C  CD  . GLU A 1 279 ? 40.086  -5.656  18.095 1.00 29.26 ? 431  GLU A CD  1 
ATOM   1937 O  OE1 . GLU A 1 279 ? 40.234  -5.565  16.857 1.00 30.26 ? 431  GLU A OE1 1 
ATOM   1938 O  OE2 . GLU A 1 279 ? 41.034  -5.911  18.869 1.00 29.68 ? 431  GLU A OE2 1 
ATOM   1939 N  N   . ASP A 1 280 ? 37.343  -3.552  21.668 1.00 29.72 ? 432  ASP A N   1 
ATOM   1940 C  CA  . ASP A 1 280 ? 37.455  -3.926  23.086 1.00 30.20 ? 432  ASP A CA  1 
ATOM   1941 C  C   . ASP A 1 280 ? 36.115  -4.021  23.815 1.00 30.01 ? 432  ASP A C   1 
ATOM   1942 O  O   . ASP A 1 280 ? 36.065  -4.503  24.945 1.00 29.98 ? 432  ASP A O   1 
ATOM   1943 C  CB  . ASP A 1 280 ? 38.376  -2.947  23.834 1.00 30.60 ? 432  ASP A CB  1 
ATOM   1944 C  CG  . ASP A 1 280 ? 38.079  -1.492  23.499 1.00 32.20 ? 432  ASP A CG  1 
ATOM   1945 O  OD1 . ASP A 1 280 ? 38.361  -1.087  22.341 1.00 35.59 ? 432  ASP A OD1 1 
ATOM   1946 O  OD2 . ASP A 1 280 ? 37.566  -0.764  24.374 1.00 33.25 ? 432  ASP A OD2 1 
ATOM   1947 N  N   . GLN A 1 281 ? 35.038  -3.556  23.183 1.00 29.88 ? 433  GLN A N   1 
ATOM   1948 C  CA  . GLN A 1 281 ? 33.694  -3.632  23.769 1.00 29.71 ? 433  GLN A CA  1 
ATOM   1949 C  C   . GLN A 1 281 ? 32.840  -4.781  23.217 1.00 29.44 ? 433  GLN A C   1 
ATOM   1950 O  O   . GLN A 1 281 ? 31.784  -5.075  23.771 1.00 29.55 ? 433  GLN A O   1 
ATOM   1951 C  CB  . GLN A 1 281 ? 32.952  -2.314  23.537 1.00 29.81 ? 433  GLN A CB  1 
ATOM   1952 C  CG  . GLN A 1 281 ? 33.644  -1.098  24.118 1.00 30.20 ? 433  GLN A CG  1 
ATOM   1953 C  CD  . GLN A 1 281 ? 33.592  -1.060  25.631 1.00 31.15 ? 433  GLN A CD  1 
ATOM   1954 O  OE1 . GLN A 1 281 ? 32.657  -1.567  26.248 1.00 31.64 ? 433  GLN A OE1 1 
ATOM   1955 N  NE2 . GLN A 1 281 ? 34.597  -0.446  26.238 1.00 31.91 ? 433  GLN A NE2 1 
ATOM   1956 N  N   . ARG A 1 282 ? 33.292  -5.426  22.140 1.00 29.00 ? 434  ARG A N   1 
ATOM   1957 C  CA  . ARG A 1 282 ? 32.468  -6.407  21.415 1.00 28.54 ? 434  ARG A CA  1 
ATOM   1958 C  C   . ARG A 1 282 ? 32.092  -7.648  22.217 1.00 28.61 ? 434  ARG A C   1 
ATOM   1959 O  O   . ARG A 1 282 ? 30.943  -8.089  22.185 1.00 28.75 ? 434  ARG A O   1 
ATOM   1960 C  CB  . ARG A 1 282 ? 33.155  -6.822  20.115 1.00 28.21 ? 434  ARG A CB  1 
ATOM   1961 C  CG  . ARG A 1 282 ? 32.997  -5.791  19.026 1.00 27.15 ? 434  ARG A CG  1 
ATOM   1962 C  CD  . ARG A 1 282 ? 33.979  -5.973  17.908 1.00 26.02 ? 434  ARG A CD  1 
ATOM   1963 N  NE  . ARG A 1 282 ? 34.101  -4.743  17.133 1.00 25.71 ? 434  ARG A NE  1 
ATOM   1964 C  CZ  . ARG A 1 282 ? 35.017  -4.520  16.197 1.00 24.89 ? 434  ARG A CZ  1 
ATOM   1965 N  NH1 . ARG A 1 282 ? 35.926  -5.442  15.893 1.00 25.88 ? 434  ARG A NH1 1 
ATOM   1966 N  NH2 . ARG A 1 282 ? 35.028  -3.356  15.564 1.00 24.75 ? 434  ARG A NH2 1 
ATOM   1967 N  N   . VAL A 1 283 ? 33.061  -8.210  22.924 1.00 28.78 ? 435  VAL A N   1 
ATOM   1968 C  CA  . VAL A 1 283 ? 32.831  -9.391  23.753 1.00 28.74 ? 435  VAL A CA  1 
ATOM   1969 C  C   . VAL A 1 283 ? 31.848  -9.075  24.885 1.00 28.66 ? 435  VAL A C   1 
ATOM   1970 O  O   . VAL A 1 283 ? 30.899  -9.823  25.132 1.00 28.52 ? 435  VAL A O   1 
ATOM   1971 C  CB  . VAL A 1 283 ? 34.166  -9.911  24.326 1.00 28.85 ? 435  VAL A CB  1 
ATOM   1972 C  CG1 . VAL A 1 283 ? 33.937  -10.985 25.385 1.00 29.31 ? 435  VAL A CG1 1 
ATOM   1973 C  CG2 . VAL A 1 283 ? 35.042  -10.436 23.196 1.00 28.82 ? 435  VAL A CG2 1 
ATOM   1974 N  N   . LEU A 1 284 ? 32.060  -7.937  25.536 1.00 28.59 ? 436  LEU A N   1 
ATOM   1975 C  CA  . LEU A 1 284 ? 31.317  -7.577  26.745 1.00 28.52 ? 436  LEU A CA  1 
ATOM   1976 C  C   . LEU A 1 284 ? 29.909  -7.016  26.502 1.00 27.78 ? 436  LEU A C   1 
ATOM   1977 O  O   . LEU A 1 284 ? 29.054  -7.125  27.375 1.00 27.42 ? 436  LEU A O   1 
ATOM   1978 C  CB  . LEU A 1 284 ? 32.133  -6.576  27.571 1.00 28.83 ? 436  LEU A CB  1 
ATOM   1979 C  CG  . LEU A 1 284 ? 33.529  -7.039  28.013 1.00 29.56 ? 436  LEU A CG  1 
ATOM   1980 C  CD1 . LEU A 1 284 ? 34.361  -5.834  28.475 1.00 30.50 ? 436  LEU A CD1 1 
ATOM   1981 C  CD2 . LEU A 1 284 ? 33.435  -8.105  29.116 1.00 29.46 ? 436  LEU A CD2 1 
ATOM   1982 N  N   . THR A 1 285 ? 29.672  -6.414  25.335 1.00 27.25 ? 437  THR A N   1 
ATOM   1983 C  CA  . THR A 1 285 ? 28.348  -5.875  25.000 1.00 26.63 ? 437  THR A CA  1 
ATOM   1984 C  C   . THR A 1 285 ? 27.413  -7.013  24.591 1.00 26.40 ? 437  THR A C   1 
ATOM   1985 O  O   . THR A 1 285 ? 27.723  -7.769  23.674 1.00 26.78 ? 437  THR A O   1 
ATOM   1986 C  CB  . THR A 1 285 ? 28.402  -4.842  23.847 1.00 26.52 ? 437  THR A CB  1 
ATOM   1987 O  OG1 . THR A 1 285 ? 29.427  -3.878  24.103 1.00 25.32 ? 437  THR A OG1 1 
ATOM   1988 C  CG2 . THR A 1 285 ? 27.059  -4.125  23.704 1.00 25.97 ? 437  THR A CG2 1 
ATOM   1989 N  N   . PRO A 1 286 ? 26.259  -7.139  25.266 1.00 25.98 ? 438  PRO A N   1 
ATOM   1990 C  CA  . PRO A 1 286 ? 25.368  -8.262  24.977 1.00 25.43 ? 438  PRO A CA  1 
ATOM   1991 C  C   . PRO A 1 286 ? 24.639  -8.124  23.643 1.00 24.78 ? 438  PRO A C   1 
ATOM   1992 O  O   . PRO A 1 286 ? 24.011  -7.095  23.376 1.00 24.65 ? 438  PRO A O   1 
ATOM   1993 C  CB  . PRO A 1 286 ? 24.365  -8.207  26.132 1.00 25.56 ? 438  PRO A CB  1 
ATOM   1994 C  CG  . PRO A 1 286 ? 24.293  -6.779  26.476 1.00 25.87 ? 438  PRO A CG  1 
ATOM   1995 C  CD  . PRO A 1 286 ? 25.707  -6.269  26.322 1.00 26.05 ? 438  PRO A CD  1 
ATOM   1996 N  N   . ASN A 1 287 ? 24.715  -9.167  22.825 1.00 23.91 ? 439  ASN A N   1 
ATOM   1997 C  CA  . ASN A 1 287 ? 24.005  -9.193  21.560 1.00 23.20 ? 439  ASN A CA  1 
ATOM   1998 C  C   . ASN A 1 287 ? 22.585  -9.724  21.758 1.00 22.81 ? 439  ASN A C   1 
ATOM   1999 O  O   . ASN A 1 287 ? 22.271  -10.855 21.403 1.00 22.53 ? 439  ASN A O   1 
ATOM   2000 C  CB  . ASN A 1 287 ? 24.788  -10.003 20.519 1.00 22.89 ? 439  ASN A CB  1 
ATOM   2001 C  CG  . ASN A 1 287 ? 24.403  -9.641  19.095 1.00 22.09 ? 439  ASN A CG  1 
ATOM   2002 O  OD1 . ASN A 1 287 ? 23.228  -9.417  18.798 1.00 20.97 ? 439  ASN A OD1 1 
ATOM   2003 N  ND2 . ASN A 1 287 ? 25.386  -9.584  18.209 1.00 20.46 ? 439  ASN A ND2 1 
ATOM   2004 N  N   . LEU A 1 288 ? 21.738  -8.872  22.332 1.00 22.92 ? 440  LEU A N   1 
ATOM   2005 C  CA  . LEU A 1 288 ? 20.358  -9.218  22.700 1.00 22.78 ? 440  LEU A CA  1 
ATOM   2006 C  C   . LEU A 1 288 ? 19.420  -8.064  22.393 1.00 22.58 ? 440  LEU A C   1 
ATOM   2007 O  O   . LEU A 1 288 ? 19.706  -6.927  22.753 1.00 22.62 ? 440  LEU A O   1 
ATOM   2008 C  CB  . LEU A 1 288 ? 20.255  -9.505  24.202 1.00 22.73 ? 440  LEU A CB  1 
ATOM   2009 C  CG  . LEU A 1 288 ? 21.089  -10.639 24.789 1.00 22.30 ? 440  LEU A CG  1 
ATOM   2010 C  CD1 . LEU A 1 288 ? 21.012  -10.593 26.314 1.00 21.14 ? 440  LEU A CD1 1 
ATOM   2011 C  CD2 . LEU A 1 288 ? 20.629  -11.985 24.246 1.00 21.09 ? 440  LEU A CD2 1 
ATOM   2012 N  N   . VAL A 1 289 ? 18.303  -8.359  21.736 1.00 22.61 ? 441  VAL A N   1 
ATOM   2013 C  CA  . VAL A 1 289 ? 17.248  -7.378  21.514 1.00 22.62 ? 441  VAL A CA  1 
ATOM   2014 C  C   . VAL A 1 289 ? 15.979  -7.888  22.190 1.00 23.02 ? 441  VAL A C   1 
ATOM   2015 O  O   . VAL A 1 289 ? 15.539  -8.999  21.919 1.00 22.60 ? 441  VAL A O   1 
ATOM   2016 C  CB  . VAL A 1 289 ? 16.989  -7.118  20.009 1.00 22.74 ? 441  VAL A CB  1 
ATOM   2017 C  CG1 . VAL A 1 289 ? 15.875  -6.090  19.831 1.00 22.09 ? 441  VAL A CG1 1 
ATOM   2018 C  CG2 . VAL A 1 289 ? 18.263  -6.647  19.311 1.00 22.02 ? 441  VAL A CG2 1 
ATOM   2019 N  N   . ALA A 1 290 ? 15.403  -7.058  23.061 1.00 23.70 ? 442  ALA A N   1 
ATOM   2020 C  CA  . ALA A 1 290 ? 14.282  -7.442  23.921 1.00 24.21 ? 442  ALA A CA  1 
ATOM   2021 C  C   . ALA A 1 290 ? 13.083  -7.972  23.143 1.00 24.77 ? 442  ALA A C   1 
ATOM   2022 O  O   . ALA A 1 290 ? 12.838  -7.573  22.004 1.00 24.61 ? 442  ALA A O   1 
ATOM   2023 C  CB  . ALA A 1 290 ? 13.849  -6.258  24.795 1.00 24.12 ? 442  ALA A CB  1 
ATOM   2024 N  N   . ALA A 1 291 ? 12.344  -8.877  23.778 1.00 25.53 ? 443  ALA A N   1 
ATOM   2025 C  CA  . ALA A 1 291 ? 11.101  -9.385  23.227 1.00 26.29 ? 443  ALA A CA  1 
ATOM   2026 C  C   . ALA A 1 291 ? 10.195  -9.876  24.349 1.00 27.28 ? 443  ALA A C   1 
ATOM   2027 O  O   . ALA A 1 291 ? 10.675  -10.342 25.384 1.00 27.18 ? 443  ALA A O   1 
ATOM   2028 C  CB  . ALA A 1 291 ? 11.380  -10.506 22.238 1.00 26.12 ? 443  ALA A CB  1 
ATOM   2029 N  N   . LEU A 1 292 ? 8.885   -9.751  24.134 1.00 28.55 ? 444  LEU A N   1 
ATOM   2030 C  CA  . LEU A 1 292 ? 7.883   -10.342 25.009 1.00 29.31 ? 444  LEU A CA  1 
ATOM   2031 C  C   . LEU A 1 292 ? 7.940   -11.868 24.883 1.00 30.22 ? 444  LEU A C   1 
ATOM   2032 O  O   . LEU A 1 292 ? 8.333   -12.393 23.835 1.00 30.23 ? 444  LEU A O   1 
ATOM   2033 C  CB  . LEU A 1 292 ? 6.473   -9.870  24.619 1.00 29.37 ? 444  LEU A CB  1 
ATOM   2034 C  CG  . LEU A 1 292 ? 6.109   -8.391  24.769 1.00 29.56 ? 444  LEU A CG  1 
ATOM   2035 C  CD1 . LEU A 1 292 ? 4.959   -8.022  23.830 1.00 29.87 ? 444  LEU A CD1 1 
ATOM   2036 C  CD2 . LEU A 1 292 ? 5.754   -8.062  26.219 1.00 29.61 ? 444  LEU A CD2 1 
ATOM   2037 N  N   . PRO A 1 293 ? 7.558   -12.585 25.951 1.00 31.19 ? 445  PRO A N   1 
ATOM   2038 C  CA  . PRO A 1 293 ? 7.382   -14.037 25.850 1.00 31.98 ? 445  PRO A CA  1 
ATOM   2039 C  C   . PRO A 1 293 ? 6.151   -14.435 25.015 1.00 32.80 ? 445  PRO A C   1 
ATOM   2040 O  O   . PRO A 1 293 ? 5.213   -13.639 24.896 1.00 33.19 ? 445  PRO A O   1 
ATOM   2041 C  CB  . PRO A 1 293 ? 7.208   -14.477 27.307 1.00 31.94 ? 445  PRO A CB  1 
ATOM   2042 C  CG  . PRO A 1 293 ? 6.772   -13.261 28.043 1.00 31.68 ? 445  PRO A CG  1 
ATOM   2043 C  CD  . PRO A 1 293 ? 7.315   -12.077 27.313 1.00 31.24 ? 445  PRO A CD  1 
ATOM   2044 N  N   . PRO A 1 294 ? 6.161   -15.647 24.420 1.00 33.34 ? 446  PRO A N   1 
ATOM   2045 C  CA  . PRO A 1 294 ? 4.961   -16.174 23.753 1.00 33.83 ? 446  PRO A CA  1 
ATOM   2046 C  C   . PRO A 1 294 ? 3.748   -16.317 24.688 1.00 34.07 ? 446  PRO A C   1 
ATOM   2047 O  O   . PRO A 1 294 ? 3.904   -16.349 25.915 1.00 34.41 ? 446  PRO A O   1 
ATOM   2048 C  CB  . PRO A 1 294 ? 5.406   -17.561 23.248 1.00 33.78 ? 446  PRO A CB  1 
ATOM   2049 C  CG  . PRO A 1 294 ? 6.890   -17.506 23.199 1.00 33.69 ? 446  PRO A CG  1 
ATOM   2050 C  CD  . PRO A 1 294 ? 7.301   -16.575 24.307 1.00 33.50 ? 446  PRO A CD  1 
ATOM   2051 N  N   . ASN B 2 20  ? -10.952 5.281   -4.935 1.00 30.92 ? 285  ASN E N   1 
ATOM   2052 C  CA  . ASN B 2 20  ? -11.836 4.150   -4.520 1.00 30.50 ? 285  ASN E CA  1 
ATOM   2053 C  C   . ASN B 2 20  ? -13.285 4.286   -5.014 1.00 30.18 ? 285  ASN E C   1 
ATOM   2054 O  O   . ASN B 2 20  ? -13.836 3.302   -5.533 1.00 30.46 ? 285  ASN E O   1 
ATOM   2055 C  CB  . ASN B 2 20  ? -11.795 3.973   -2.999 1.00 30.76 ? 285  ASN E CB  1 
ATOM   2056 N  N   . LEU B 2 21  ? -13.905 5.472   -4.910 1.00 29.33 ? 286  LEU E N   1 
ATOM   2057 C  CA  . LEU B 2 21  ? -13.255 6.737   -4.517 1.00 28.52 ? 286  LEU E CA  1 
ATOM   2058 C  C   . LEU B 2 21  ? -13.027 6.873   -3.007 1.00 27.86 ? 286  LEU E C   1 
ATOM   2059 O  O   . LEU B 2 21  ? -13.800 6.368   -2.195 1.00 28.08 ? 286  LEU E O   1 
ATOM   2060 C  CB  . LEU B 2 21  ? -14.068 7.943   -5.012 1.00 28.26 ? 286  LEU E CB  1 
ATOM   2061 C  CG  . LEU B 2 21  ? -14.306 8.096   -6.518 1.00 28.29 ? 286  LEU E CG  1 
ATOM   2062 C  CD1 . LEU B 2 21  ? -15.230 9.281   -6.803 1.00 28.25 ? 286  LEU E CD1 1 
ATOM   2063 C  CD2 . LEU B 2 21  ? -13.004 8.248   -7.282 1.00 28.25 ? 286  LEU E CD2 1 
ATOM   2064 N  N   . TYR B 2 22  ? -11.947 7.560   -2.652 1.00 26.87 ? 287  TYR E N   1 
ATOM   2065 C  CA  . TYR B 2 22  ? -11.656 7.918   -1.272 1.00 26.34 ? 287  TYR E CA  1 
ATOM   2066 C  C   . TYR B 2 22  ? -12.402 9.211   -0.894 1.00 25.87 ? 287  TYR E C   1 
ATOM   2067 O  O   . TYR B 2 22  ? -12.399 10.167  -1.654 1.00 25.78 ? 287  TYR E O   1 
ATOM   2068 C  CB  . TYR B 2 22  ? -10.148 8.111   -1.105 1.00 25.94 ? 287  TYR E CB  1 
ATOM   2069 C  CG  . TYR B 2 22  ? -9.732  8.482   0.290  1.00 25.42 ? 287  TYR E CG  1 
ATOM   2070 C  CD1 . TYR B 2 22  ? -9.746  9.808   0.710  1.00 25.21 ? 287  TYR E CD1 1 
ATOM   2071 C  CD2 . TYR B 2 22  ? -9.328  7.511   1.195  1.00 24.97 ? 287  TYR E CD2 1 
ATOM   2072 C  CE1 . TYR B 2 22  ? -9.370  10.156  1.997  1.00 25.01 ? 287  TYR E CE1 1 
ATOM   2073 C  CE2 . TYR B 2 22  ? -8.946  7.848   2.481  1.00 24.89 ? 287  TYR E CE2 1 
ATOM   2074 C  CZ  . TYR B 2 22  ? -8.963  9.170   2.875  1.00 25.19 ? 287  TYR E CZ  1 
ATOM   2075 O  OH  . TYR B 2 22  ? -8.575  9.508   4.150  1.00 25.71 ? 287  TYR E OH  1 
ATOM   2076 N  N   . PHE B 2 23  ? -13.033 9.236   0.277  1.00 25.56 ? 288  PHE E N   1 
ATOM   2077 C  CA  . PHE B 2 23  ? -13.833 10.389  0.692  1.00 25.45 ? 288  PHE E CA  1 
ATOM   2078 C  C   . PHE B 2 23  ? -13.151 11.122  1.847  1.00 25.48 ? 288  PHE E C   1 
ATOM   2079 O  O   . PHE B 2 23  ? -12.446 12.103  1.614  1.00 25.34 ? 288  PHE E O   1 
ATOM   2080 C  CB  . PHE B 2 23  ? -15.263 9.952   1.027  1.00 25.15 ? 288  PHE E CB  1 
ATOM   2081 C  CG  . PHE B 2 23  ? -16.175 11.073  1.473  1.00 25.26 ? 288  PHE E CG  1 
ATOM   2082 C  CD1 . PHE B 2 23  ? -16.104 12.342  0.900  1.00 24.52 ? 288  PHE E CD1 1 
ATOM   2083 C  CD2 . PHE B 2 23  ? -17.150 10.835  2.442  1.00 25.02 ? 288  PHE E CD2 1 
ATOM   2084 C  CE1 . PHE B 2 23  ? -16.956 13.353  1.311  1.00 24.73 ? 288  PHE E CE1 1 
ATOM   2085 C  CE2 . PHE B 2 23  ? -18.013 11.842  2.854  1.00 24.74 ? 288  PHE E CE2 1 
ATOM   2086 C  CZ  . PHE B 2 23  ? -17.918 13.102  2.291  1.00 25.19 ? 288  PHE E CZ  1 
ATOM   2087 N  N   . GLN B 2 24  ? -13.348 10.645  3.075  1.00 25.79 ? 289  GLN E N   1 
ATOM   2088 C  CA  . GLN B 2 24  ? -12.677 11.207  4.249  1.00 26.03 ? 289  GLN E CA  1 
ATOM   2089 C  C   . GLN B 2 24  ? -11.932 10.160  5.090  1.00 26.37 ? 289  GLN E C   1 
ATOM   2090 O  O   . GLN B 2 24  ? -11.356 10.497  6.123  1.00 26.69 ? 289  GLN E O   1 
ATOM   2091 C  CB  . GLN B 2 24  ? -13.689 11.949  5.119  1.00 25.93 ? 289  GLN E CB  1 
ATOM   2092 C  CG  . GLN B 2 24  ? -14.156 13.255  4.519  1.00 25.89 ? 289  GLN E CG  1 
ATOM   2093 C  CD  . GLN B 2 24  ? -15.228 13.922  5.342  1.00 26.12 ? 289  GLN E CD  1 
ATOM   2094 O  OE1 . GLN B 2 24  ? -16.043 13.254  5.984  1.00 27.45 ? 289  GLN E OE1 1 
ATOM   2095 N  NE2 . GLN B 2 24  ? -15.248 15.250  5.320  1.00 25.52 ? 289  GLN E NE2 1 
ATOM   2096 N  N   . GLY B 2 25  ? -11.929 8.903   4.652  1.00 26.78 ? 290  GLY E N   1 
ATOM   2097 C  CA  . GLY B 2 25  ? -11.303 7.825   5.422  1.00 27.12 ? 290  GLY E CA  1 
ATOM   2098 C  C   . GLY B 2 25  ? -12.289 7.103   6.324  1.00 27.40 ? 290  GLY E C   1 
ATOM   2099 O  O   . GLY B 2 25  ? -13.482 7.414   6.332  1.00 27.23 ? 290  GLY E O   1 
ATOM   2100 N  N   . ALA B 2 26  ? -11.783 6.136   7.085  1.00 27.69 ? 291  ALA E N   1 
ATOM   2101 C  CA  . ALA B 2 26  ? -12.622 5.303   7.939  1.00 28.01 ? 291  ALA E CA  1 
ATOM   2102 C  C   . ALA B 2 26  ? -12.888 5.979   9.274  1.00 28.31 ? 291  ALA E C   1 
ATOM   2103 O  O   . ALA B 2 26  ? -12.180 6.897   9.669  1.00 28.27 ? 291  ALA E O   1 
ATOM   2104 C  CB  . ALA B 2 26  ? -11.967 3.939   8.161  1.00 27.86 ? 291  ALA E CB  1 
ATOM   2105 N  N   . MET B 2 27  ? -13.922 5.506   9.959  1.00 28.95 ? 292  MET E N   1 
ATOM   2106 C  CA  . MET B 2 27  ? -14.225 5.921   11.323 1.00 29.55 ? 292  MET E CA  1 
ATOM   2107 C  C   . MET B 2 27  ? -13.636 4.878   12.276 1.00 28.88 ? 292  MET E C   1 
ATOM   2108 O  O   . MET B 2 27  ? -13.640 3.692   11.973 1.00 28.76 ? 292  MET E O   1 
ATOM   2109 C  CB  . MET B 2 27  ? -15.740 6.039   11.508 1.00 29.56 ? 292  MET E CB  1 
ATOM   2110 C  CG  . MET B 2 27  ? -16.156 6.807   12.749 1.00 30.43 ? 292  MET E CG  1 
ATOM   2111 S  SD  . MET B 2 27  ? -17.946 7.109   12.840 1.00 32.38 ? 292  MET E SD  1 
ATOM   2112 C  CE  . MET B 2 27  ? -18.166 7.144   14.625 1.00 31.63 ? 292  MET E CE  1 
ATOM   2113 N  N   . GLY B 2 28  ? -13.089 5.333   13.399 1.00 28.72 ? 293  GLY E N   1 
ATOM   2114 C  CA  . GLY B 2 28  ? -12.612 4.436   14.460 1.00 28.38 ? 293  GLY E CA  1 
ATOM   2115 C  C   . GLY B 2 28  ? -11.238 3.808   14.269 1.00 28.16 ? 293  GLY E C   1 
ATOM   2116 O  O   . GLY B 2 28  ? -10.837 2.948   15.057 1.00 28.12 ? 293  GLY E O   1 
ATOM   2117 N  N   . THR B 2 29  ? -10.511 4.226   13.235 1.00 27.67 ? 294  THR E N   1 
ATOM   2118 C  CA  . THR B 2 29  ? -9.180  3.686   12.956 1.00 27.41 ? 294  THR E CA  1 
ATOM   2119 C  C   . THR B 2 29  ? -8.125  4.686   13.386 1.00 26.88 ? 294  THR E C   1 
ATOM   2120 O  O   . THR B 2 29  ? -8.253  5.874   13.099 1.00 27.07 ? 294  THR E O   1 
ATOM   2121 C  CB  . THR B 2 29  ? -8.978  3.397   11.449 1.00 27.37 ? 294  THR E CB  1 
ATOM   2122 O  OG1 . THR B 2 29  ? -10.024 2.548   10.972 1.00 28.41 ? 294  THR E OG1 1 
ATOM   2123 C  CG2 . THR B 2 29  ? -7.635  2.719   11.202 1.00 27.24 ? 294  THR E CG2 1 
ATOM   2124 N  N   . ASN B 2 30  ? -7.091  4.207   14.075 1.00 26.31 ? 295  ASN E N   1 
ATOM   2125 C  CA  . ASN B 2 30  ? -5.924  5.026   14.371 1.00 25.97 ? 295  ASN E CA  1 
ATOM   2126 C  C   . ASN B 2 30  ? -4.910  4.841   13.246 1.00 25.88 ? 295  ASN E C   1 
ATOM   2127 O  O   . ASN B 2 30  ? -4.156  3.864   13.230 1.00 25.44 ? 295  ASN E O   1 
ATOM   2128 C  CB  . ASN B 2 30  ? -5.320  4.664   15.735 1.00 25.78 ? 295  ASN E CB  1 
ATOM   2129 C  CG  . ASN B 2 30  ? -4.324  5.706   16.236 1.00 25.32 ? 295  ASN E CG  1 
ATOM   2130 O  OD1 . ASN B 2 30  ? -3.859  6.562   15.484 1.00 24.50 ? 295  ASN E OD1 1 
ATOM   2131 N  ND2 . ASN B 2 30  ? -3.998  5.636   17.519 1.00 25.41 ? 295  ASN E ND2 1 
ATOM   2132 N  N   . GLU B 2 31  ? -4.916  5.778   12.299 1.00 25.94 ? 296  GLU E N   1 
ATOM   2133 C  CA  . GLU B 2 31  ? -4.053  5.694   11.114 1.00 26.21 ? 296  GLU E CA  1 
ATOM   2134 C  C   . GLU B 2 31  ? -2.594  6.002   11.444 1.00 26.09 ? 296  GLU E C   1 
ATOM   2135 O  O   . GLU B 2 31  ? -1.695  5.636   10.687 1.00 25.90 ? 296  GLU E O   1 
ATOM   2136 C  CB  . GLU B 2 31  ? -4.523  6.639   10.002 1.00 26.28 ? 296  GLU E CB  1 
ATOM   2137 C  CG  . GLU B 2 31  ? -5.846  6.252   9.343  1.00 26.75 ? 296  GLU E CG  1 
ATOM   2138 C  CD  . GLU B 2 31  ? -7.063  6.702   10.125 1.00 27.43 ? 296  GLU E CD  1 
ATOM   2139 O  OE1 . GLU B 2 31  ? -6.907  7.464   11.107 1.00 27.25 ? 296  GLU E OE1 1 
ATOM   2140 O  OE2 . GLU B 2 31  ? -8.186  6.292   9.755  1.00 28.14 ? 296  GLU E OE2 1 
ATOM   2141 N  N   . CYS B 2 32  ? -2.372  6.675   12.571 1.00 26.01 ? 297  CYS E N   1 
ATOM   2142 C  CA  . CYS B 2 32  ? -1.022  6.983   13.046 1.00 26.00 ? 297  CYS E CA  1 
ATOM   2143 C  C   . CYS B 2 32  ? -0.217  5.728   13.409 1.00 25.70 ? 297  CYS E C   1 
ATOM   2144 O  O   . CYS B 2 32  ? 1.000   5.782   13.472 1.00 25.87 ? 297  CYS E O   1 
ATOM   2145 C  CB  . CYS B 2 32  ? -1.097  7.933   14.243 1.00 26.02 ? 297  CYS E CB  1 
ATOM   2146 S  SG  . CYS B 2 32  ? -2.110  9.449   13.956 1.00 26.56 ? 297  CYS E SG  1 
ATOM   2147 N  N   . LEU B 2 33  ? -0.888  4.603   13.646 1.00 25.57 ? 298  LEU E N   1 
ATOM   2148 C  CA  . LEU B 2 33  ? -0.197  3.340   13.944 1.00 25.52 ? 298  LEU E CA  1 
ATOM   2149 C  C   . LEU B 2 33  ? 0.629   2.799   12.756 1.00 25.56 ? 298  LEU E C   1 
ATOM   2150 O  O   . LEU B 2 33  ? 1.538   1.986   12.947 1.00 25.21 ? 298  LEU E O   1 
ATOM   2151 C  CB  . LEU B 2 33  ? -1.201  2.281   14.423 1.00 25.46 ? 298  LEU E CB  1 
ATOM   2152 C  CG  . LEU B 2 33  ? -1.977  2.603   15.708 1.00 25.31 ? 298  LEU E CG  1 
ATOM   2153 C  CD1 . LEU B 2 33  ? -2.960  1.480   16.056 1.00 23.69 ? 298  LEU E CD1 1 
ATOM   2154 C  CD2 . LEU B 2 33  ? -1.024  2.872   16.873 1.00 25.21 ? 298  LEU E CD2 1 
ATOM   2155 N  N   . ASP B 2 34  ? 0.298   3.248   11.544 1.00 25.71 ? 299  ASP E N   1 
ATOM   2156 C  CA  . ASP B 2 34  ? 1.056   2.923   10.336 1.00 25.86 ? 299  ASP E CA  1 
ATOM   2157 C  C   . ASP B 2 34  ? 1.971   4.091   9.965  1.00 25.78 ? 299  ASP E C   1 
ATOM   2158 O  O   . ASP B 2 34  ? 1.581   4.950   9.172  1.00 24.90 ? 299  ASP E O   1 
ATOM   2159 C  CB  . ASP B 2 34  ? 0.099   2.596   9.179  1.00 26.16 ? 299  ASP E CB  1 
ATOM   2160 C  CG  . ASP B 2 34  ? 0.811   1.990   7.955  1.00 26.70 ? 299  ASP E CG  1 
ATOM   2161 O  OD1 . ASP B 2 34  ? 2.033   2.169   7.782  1.00 28.57 ? 299  ASP E OD1 1 
ATOM   2162 O  OD2 . ASP B 2 34  ? 0.135   1.323   7.154  1.00 27.90 ? 299  ASP E OD2 1 
ATOM   2163 N  N   . ASN B 2 35  ? 3.179   4.062   10.484 1.00 25.94 ? 300  ASN E N   1 
ATOM   2164 C  CA  . ASN B 2 35  ? 4.213   4.960   10.077 1.00 26.21 ? 300  ASN E CA  1 
ATOM   2165 C  C   . ASN B 2 35  ? 3.804   6.399   10.244 1.00 26.33 ? 300  ASN E C   1 
ATOM   2166 O  O   . ASN B 2 35  ? 4.194   7.242   9.502  1.00 26.63 ? 300  ASN E O   1 
ATOM   2167 C  CB  . ASN B 2 35  ? 4.681   4.652   8.668  1.00 26.13 ? 300  ASN E CB  1 
ATOM   2168 C  CG  . ASN B 2 35  ? 5.948   5.341   8.335  1.00 26.02 ? 300  ASN E CG  1 
ATOM   2169 O  OD1 . ASN B 2 35  ? 6.099   5.899   7.281  1.00 26.73 ? 300  ASN E OD1 1 
ATOM   2170 N  ND2 . ASN B 2 35  ? 6.863   5.333   9.252  1.00 25.30 ? 300  ASN E ND2 1 
ATOM   2171 N  N   . ASN B 2 36  ? 3.005   6.622   11.266 1.00 26.67 ? 301  ASN E N   1 
ATOM   2172 C  CA  . ASN B 2 36  ? 2.631   7.907   11.739 1.00 26.47 ? 301  ASN E CA  1 
ATOM   2173 C  C   . ASN B 2 36  ? 1.847   8.682   10.725 1.00 26.30 ? 301  ASN E C   1 
ATOM   2174 O  O   . ASN B 2 36  ? 2.081   9.817   10.526 1.00 26.18 ? 301  ASN E O   1 
ATOM   2175 C  CB  . ASN B 2 36  ? 3.830   8.675   12.251 1.00 26.65 ? 301  ASN E CB  1 
ATOM   2176 C  CG  . ASN B 2 36  ? 3.466   9.683   13.270 1.00 26.96 ? 301  ASN E CG  1 
ATOM   2177 O  OD1 . ASN B 2 36  ? 3.972   10.758  13.284 1.00 28.26 ? 301  ASN E OD1 1 
ATOM   2178 N  ND2 . ASN B 2 36  ? 2.555   9.343   14.104 1.00 27.22 ? 301  ASN E ND2 1 
ATOM   2179 N  N   . GLY B 2 37  ? 0.924   8.011   10.073 1.00 26.16 ? 302  GLY E N   1 
ATOM   2180 C  CA  . GLY B 2 37  ? 0.213   8.510   8.919  1.00 26.27 ? 302  GLY E CA  1 
ATOM   2181 C  C   . GLY B 2 37  ? 0.983   8.917   7.688  1.00 26.20 ? 302  GLY E C   1 
ATOM   2182 O  O   . GLY B 2 37  ? 0.469   9.434   6.764  1.00 26.40 ? 302  GLY E O   1 
ATOM   2183 N  N   . GLY B 2 38  ? 2.260   8.686   7.714  1.00 26.42 ? 303  GLY E N   1 
ATOM   2184 C  CA  . GLY B 2 38  ? 3.200   9.220   6.736  1.00 26.25 ? 303  GLY E CA  1 
ATOM   2185 C  C   . GLY B 2 38  ? 3.619   10.649  7.054  1.00 26.40 ? 303  GLY E C   1 
ATOM   2186 O  O   . GLY B 2 38  ? 4.294   11.296  6.251  1.00 26.50 ? 303  GLY E O   1 
ATOM   2187 N  N   . CYS B 2 39  ? 3.224   11.147  8.224  1.00 26.51 ? 304  CYS E N   1 
ATOM   2188 C  CA  . CYS B 2 39  ? 3.542   12.512  8.634  1.00 26.69 ? 304  CYS E CA  1 
ATOM   2189 C  C   . CYS B 2 39  ? 5.000   12.601  9.083  1.00 26.78 ? 304  CYS E C   1 
ATOM   2190 O  O   . CYS B 2 39  ? 5.501   11.706  9.775  1.00 27.15 ? 304  CYS E O   1 
ATOM   2191 C  CB  . CYS B 2 39  ? 2.629   12.941  9.783  1.00 26.75 ? 304  CYS E CB  1 
ATOM   2192 S  SG  . CYS B 2 39  ? 0.855   12.682  9.492  1.00 27.16 ? 304  CYS E SG  1 
ATOM   2193 N  N   . SER B 2 40  ? 5.678   13.677  8.700  1.00 26.38 ? 305  SER E N   1 
ATOM   2194 C  CA  . SER B 2 40  ? 7.076   13.852  9.054  1.00 26.22 ? 305  SER E CA  1 
ATOM   2195 C  C   . SER B 2 40  ? 7.222   14.323  10.498 1.00 26.26 ? 305  SER E C   1 
ATOM   2196 O  O   . SER B 2 40  ? 8.265   14.106  11.125 1.00 26.15 ? 305  SER E O   1 
ATOM   2197 C  CB  . SER B 2 40  ? 7.753   14.835  8.100  1.00 26.22 ? 305  SER E CB  1 
ATOM   2198 O  OG  . SER B 2 40  ? 7.244   16.140  8.276  1.00 26.12 ? 305  SER E OG  1 
ATOM   2199 N  N   . TYR B 2 41  ? 6.177   14.958  11.026 1.00 26.30 ? 306  TYR E N   1 
ATOM   2200 C  CA  . TYR B 2 41  ? 6.187   15.439  12.405 1.00 26.44 ? 306  TYR E CA  1 
ATOM   2201 C  C   . TYR B 2 41  ? 5.075   14.781  13.245 1.00 26.21 ? 306  TYR E C   1 
ATOM   2202 O  O   . TYR B 2 41  ? 5.290   13.697  13.791 1.00 26.32 ? 306  TYR E O   1 
ATOM   2203 C  CB  . TYR B 2 41  ? 6.127   16.976  12.440 1.00 26.56 ? 306  TYR E CB  1 
ATOM   2204 C  CG  . TYR B 2 41  ? 6.021   17.531  13.838 1.00 26.90 ? 306  TYR E CG  1 
ATOM   2205 C  CD1 . TYR B 2 41  ? 6.984   17.224  14.797 1.00 26.88 ? 306  TYR E CD1 1 
ATOM   2206 C  CD2 . TYR B 2 41  ? 4.951   18.344  14.213 1.00 26.89 ? 306  TYR E CD2 1 
ATOM   2207 C  CE1 . TYR B 2 41  ? 6.895   17.712  16.089 1.00 27.00 ? 306  TYR E CE1 1 
ATOM   2208 C  CE2 . TYR B 2 41  ? 4.857   18.850  15.511 1.00 27.28 ? 306  TYR E CE2 1 
ATOM   2209 C  CZ  . TYR B 2 41  ? 5.833   18.526  16.442 1.00 27.08 ? 306  TYR E CZ  1 
ATOM   2210 O  OH  . TYR B 2 41  ? 5.755   19.004  17.728 1.00 27.21 ? 306  TYR E OH  1 
ATOM   2211 N  N   . VAL B 2 42  ? 3.904   15.410  13.338 1.00 26.05 ? 307  VAL E N   1 
ATOM   2212 C  CA  . VAL B 2 42  ? 2.828   14.930  14.207 1.00 25.93 ? 307  VAL E CA  1 
ATOM   2213 C  C   . VAL B 2 42  ? 1.655   14.401  13.387 1.00 25.94 ? 307  VAL E C   1 
ATOM   2214 O  O   . VAL B 2 42  ? 1.294   14.967  12.360 1.00 25.90 ? 307  VAL E O   1 
ATOM   2215 C  CB  . VAL B 2 42  ? 2.332   16.034  15.205 1.00 25.96 ? 307  VAL E CB  1 
ATOM   2216 C  CG1 . VAL B 2 42  ? 0.928   15.735  15.726 1.00 25.94 ? 307  VAL E CG1 1 
ATOM   2217 C  CG2 . VAL B 2 42  ? 3.280   16.166  16.374 1.00 25.52 ? 307  VAL E CG2 1 
ATOM   2218 N  N   . CYS B 2 43  ? 1.077   13.301  13.859 1.00 26.02 ? 308  CYS E N   1 
ATOM   2219 C  CA  . CYS B 2 43  ? -0.112  12.712  13.269 1.00 25.90 ? 308  CYS E CA  1 
ATOM   2220 C  C   . CYS B 2 43  ? -1.251  12.897  14.260 1.00 25.97 ? 308  CYS E C   1 
ATOM   2221 O  O   . CYS B 2 43  ? -1.139  12.531  15.433 1.00 26.03 ? 308  CYS E O   1 
ATOM   2222 C  CB  . CYS B 2 43  ? 0.129   11.230  13.000 1.00 26.01 ? 308  CYS E CB  1 
ATOM   2223 S  SG  . CYS B 2 43  ? -1.253  10.298  12.301 1.00 26.42 ? 308  CYS E SG  1 
ATOM   2224 N  N   . ASN B 2 44  ? -2.340  13.493  13.792 1.00 26.05 ? 309  ASN E N   1 
ATOM   2225 C  CA  . ASN B 2 44  ? -3.512  13.702  14.619 1.00 25.96 ? 309  ASN E CA  1 
ATOM   2226 C  C   . ASN B 2 44  ? -4.609  12.731  14.220 1.00 26.13 ? 309  ASN E C   1 
ATOM   2227 O  O   . ASN B 2 44  ? -5.201  12.860  13.139 1.00 26.13 ? 309  ASN E O   1 
ATOM   2228 C  CB  . ASN B 2 44  ? -3.992  15.141  14.481 1.00 25.76 ? 309  ASN E CB  1 
ATOM   2229 C  CG  . ASN B 2 44  ? -5.124  15.483  15.441 1.00 26.24 ? 309  ASN E CG  1 
ATOM   2230 O  OD1 . ASN B 2 44  ? -5.818  16.475  15.244 1.00 26.13 ? 309  ASN E OD1 1 
ATOM   2231 N  ND2 . ASN B 2 44  ? -5.312  14.671  16.481 1.00 26.23 ? 309  ASN E ND2 1 
ATOM   2232 N  N   . ASP B 2 45  ? -4.869  11.756  15.092 1.00 26.24 ? 310  ASP E N   1 
ATOM   2233 C  CA  . ASP B 2 45  ? -5.919  10.771  14.854 1.00 26.25 ? 310  ASP E CA  1 
ATOM   2234 C  C   . ASP B 2 45  ? -7.315  11.383  15.017 1.00 26.21 ? 310  ASP E C   1 
ATOM   2235 O  O   . ASP B 2 45  ? -7.858  11.458  16.122 1.00 26.44 ? 310  ASP E O   1 
ATOM   2236 C  CB  . ASP B 2 45  ? -5.765  9.565   15.789 1.00 26.30 ? 310  ASP E CB  1 
ATOM   2237 C  CG  . ASP B 2 45  ? -6.734  8.448   15.452 1.00 26.28 ? 310  ASP E CG  1 
ATOM   2238 O  OD1 . ASP B 2 45  ? -7.069  7.633   16.322 1.00 27.42 ? 310  ASP E OD1 1 
ATOM   2239 O  OD2 . ASP B 2 45  ? -7.170  8.376   14.295 1.00 28.22 ? 310  ASP E OD2 1 
ATOM   2240 N  N   . LEU B 2 46  ? -7.893  11.806  13.900 1.00 26.36 ? 311  LEU E N   1 
ATOM   2241 C  CA  . LEU B 2 46  ? -9.250  12.330  13.877 1.00 26.19 ? 311  LEU E CA  1 
ATOM   2242 C  C   . LEU B 2 46  ? -10.274 11.198  13.948 1.00 26.62 ? 311  LEU E C   1 
ATOM   2243 O  O   . LEU B 2 46  ? -9.966  10.040  13.641 1.00 26.56 ? 311  LEU E O   1 
ATOM   2244 C  CB  . LEU B 2 46  ? -9.469  13.155  12.612 1.00 26.27 ? 311  LEU E CB  1 
ATOM   2245 C  CG  . LEU B 2 46  ? -8.523  14.342  12.408 1.00 25.73 ? 311  LEU E CG  1 
ATOM   2246 C  CD1 . LEU B 2 46  ? -8.789  14.999  11.059 1.00 24.47 ? 311  LEU E CD1 1 
ATOM   2247 C  CD2 . LEU B 2 46  ? -8.657  15.337  13.549 1.00 25.50 ? 311  LEU E CD2 1 
ATOM   2248 N  N   . LYS B 2 47  ? -11.493 11.543  14.356 1.00 27.08 ? 312  LYS E N   1 
ATOM   2249 C  CA  . LYS B 2 47  ? -12.597 10.579  14.441 1.00 27.45 ? 312  LYS E CA  1 
ATOM   2250 C  C   . LYS B 2 47  ? -12.802 9.902   13.079 1.00 27.22 ? 312  LYS E C   1 
ATOM   2251 O  O   . LYS B 2 47  ? -12.884 8.673   12.985 1.00 27.04 ? 312  LYS E O   1 
ATOM   2252 C  CB  . LYS B 2 47  ? -13.881 11.280  14.905 1.00 27.71 ? 312  LYS E CB  1 
ATOM   2253 C  CG  . LYS B 2 47  ? -14.807 10.424  15.757 1.00 29.27 ? 312  LYS E CG  1 
ATOM   2254 C  CD  . LYS B 2 47  ? -15.854 9.686   14.939 1.00 30.66 ? 312  LYS E CD  1 
ATOM   2255 C  CE  . LYS B 2 47  ? -17.211 10.372  15.008 1.00 31.37 ? 312  LYS E CE  1 
ATOM   2256 N  NZ  . LYS B 2 47  ? -17.859 10.173  16.330 1.00 31.91 ? 312  LYS E NZ  1 
ATOM   2257 N  N   . ILE B 2 48  ? -12.866 10.718  12.031 1.00 27.02 ? 313  ILE E N   1 
ATOM   2258 C  CA  . ILE B 2 48  ? -12.897 10.228  10.655 1.00 27.05 ? 313  ILE E CA  1 
ATOM   2259 C  C   . ILE B 2 48  ? -11.537 10.537  10.026 1.00 27.00 ? 313  ILE E C   1 
ATOM   2260 O  O   . ILE B 2 48  ? -11.119 11.692  9.943  1.00 26.89 ? 313  ILE E O   1 
ATOM   2261 C  CB  . ILE B 2 48  ? -14.050 10.875  9.834  1.00 27.21 ? 313  ILE E CB  1 
ATOM   2262 C  CG1 . ILE B 2 48  ? -15.399 10.620  10.524 1.00 26.85 ? 313  ILE E CG1 1 
ATOM   2263 C  CG2 . ILE B 2 48  ? -14.069 10.338  8.404  1.00 26.69 ? 313  ILE E CG2 1 
ATOM   2264 C  CD1 . ILE B 2 48  ? -16.587 10.942  9.665  1.00 27.38 ? 313  ILE E CD1 1 
ATOM   2265 N  N   . GLY B 2 49  ? -10.833 9.492   9.616  1.00 27.01 ? 314  GLY E N   1 
ATOM   2266 C  CA  . GLY B 2 49  ? -9.496  9.650   9.064  1.00 27.13 ? 314  GLY E CA  1 
ATOM   2267 C  C   . GLY B 2 49  ? -8.508  10.265  10.042 1.00 27.05 ? 314  GLY E C   1 
ATOM   2268 O  O   . GLY B 2 49  ? -8.525  9.962   11.253 1.00 26.84 ? 314  GLY E O   1 
ATOM   2269 N  N   . TYR B 2 50  ? -7.647  11.129  9.509  1.00 26.90 ? 315  TYR E N   1 
ATOM   2270 C  CA  . TYR B 2 50  ? -6.577  11.758  10.277 1.00 26.87 ? 315  TYR E CA  1 
ATOM   2271 C  C   . TYR B 2 50  ? -5.988  12.951  9.517  1.00 27.06 ? 315  TYR E C   1 
ATOM   2272 O  O   . TYR B 2 50  ? -6.381  13.217  8.382  1.00 27.19 ? 315  TYR E O   1 
ATOM   2273 C  CB  . TYR B 2 50  ? -5.475  10.735  10.588 1.00 26.39 ? 315  TYR E CB  1 
ATOM   2274 C  CG  . TYR B 2 50  ? -4.587  10.379  9.409  1.00 26.00 ? 315  TYR E CG  1 
ATOM   2275 C  CD1 . TYR B 2 50  ? -5.007  9.473   8.444  1.00 25.80 ? 315  TYR E CD1 1 
ATOM   2276 C  CD2 . TYR B 2 50  ? -3.318  10.949  9.265  1.00 25.96 ? 315  TYR E CD2 1 
ATOM   2277 C  CE1 . TYR B 2 50  ? -4.191  9.132   7.364  1.00 25.43 ? 315  TYR E CE1 1 
ATOM   2278 C  CE2 . TYR B 2 50  ? -2.495  10.621  8.182  1.00 25.88 ? 315  TYR E CE2 1 
ATOM   2279 C  CZ  . TYR B 2 50  ? -2.938  9.706   7.242  1.00 25.95 ? 315  TYR E CZ  1 
ATOM   2280 O  OH  . TYR B 2 50  ? -2.141  9.368   6.177  1.00 25.63 ? 315  TYR E OH  1 
ATOM   2281 N  N   . GLU B 2 51  ? -5.044  13.652  10.143 1.00 27.39 ? 316  GLU E N   1 
ATOM   2282 C  CA  . GLU B 2 51  ? -4.307  14.747  9.489  1.00 27.89 ? 316  GLU E CA  1 
ATOM   2283 C  C   . GLU B 2 51  ? -2.865  14.838  9.980  1.00 27.95 ? 316  GLU E C   1 
ATOM   2284 O  O   . GLU B 2 51  ? -2.555  14.440  11.104 1.00 27.51 ? 316  GLU E O   1 
ATOM   2285 C  CB  . GLU B 2 51  ? -4.995  16.088  9.747  1.00 27.76 ? 316  GLU E CB  1 
ATOM   2286 C  CG  . GLU B 2 51  ? -5.157  16.412  11.236 1.00 28.56 ? 316  GLU E CG  1 
ATOM   2287 C  CD  . GLU B 2 51  ? -5.602  17.830  11.518 1.00 28.88 ? 316  GLU E CD  1 
ATOM   2288 O  OE1 . GLU B 2 51  ? -5.923  18.125  12.695 1.00 29.49 ? 316  GLU E OE1 1 
ATOM   2289 O  OE2 . GLU B 2 51  ? -5.616  18.652  10.577 1.00 31.28 ? 316  GLU E OE2 1 
ATOM   2290 N  N   . CYS B 2 52  ? -1.997  15.380  9.128  1.00 28.69 ? 317  CYS E N   1 
ATOM   2291 C  CA  . CYS B 2 52  ? -0.623  15.698  9.500  1.00 29.28 ? 317  CYS E CA  1 
ATOM   2292 C  C   . CYS B 2 52  ? -0.521  17.148  9.925  1.00 29.78 ? 317  CYS E C   1 
ATOM   2293 O  O   . CYS B 2 52  ? -1.081  18.031  9.289  1.00 29.57 ? 317  CYS E O   1 
ATOM   2294 C  CB  . CYS B 2 52  ? 0.341   15.447  8.340  1.00 29.23 ? 317  CYS E CB  1 
ATOM   2295 S  SG  . CYS B 2 52  ? 0.440   13.716  7.808  1.00 30.14 ? 317  CYS E SG  1 
ATOM   2296 N  N   . LEU B 2 53  ? 0.211   17.375  11.008 1.00 30.71 ? 318  LEU E N   1 
ATOM   2297 C  CA  . LEU B 2 53  ? 0.437   18.705  11.551 1.00 31.48 ? 318  LEU E CA  1 
ATOM   2298 C  C   . LEU B 2 53  ? 1.928   19.028  11.497 1.00 32.32 ? 318  LEU E C   1 
ATOM   2299 O  O   . LEU B 2 53  ? 2.769   18.127  11.443 1.00 32.33 ? 318  LEU E O   1 
ATOM   2300 C  CB  . LEU B 2 53  ? -0.080  18.772  12.995 1.00 31.23 ? 318  LEU E CB  1 
ATOM   2301 C  CG  . LEU B 2 53  ? -1.554  19.146  13.226 1.00 31.34 ? 318  LEU E CG  1 
ATOM   2302 C  CD1 . LEU B 2 53  ? -2.437  18.951  11.992 1.00 30.46 ? 318  LEU E CD1 1 
ATOM   2303 C  CD2 . LEU B 2 53  ? -2.118  18.357  14.402 1.00 30.55 ? 318  LEU E CD2 1 
ATOM   2304 N  N   . CYS B 2 54  ? 2.239   20.319  11.512 1.00 33.33 ? 319  CYS E N   1 
ATOM   2305 C  CA  . CYS B 2 54  ? 3.614   20.791  11.478 1.00 34.39 ? 319  CYS E CA  1 
ATOM   2306 C  C   . CYS B 2 54  ? 3.849   21.740  12.640 1.00 34.48 ? 319  CYS E C   1 
ATOM   2307 O  O   . CYS B 2 54  ? 2.905   22.363  13.128 1.00 34.41 ? 319  CYS E O   1 
ATOM   2308 C  CB  . CYS B 2 54  ? 3.903   21.486  10.140 1.00 34.69 ? 319  CYS E CB  1 
ATOM   2309 S  SG  . CYS B 2 54  ? 4.043   20.331  8.729  1.00 37.08 ? 319  CYS E SG  1 
ATOM   2310 N  N   . PRO B 2 55  ? 5.110   21.853  13.095 1.00 34.91 ? 320  PRO E N   1 
ATOM   2311 C  CA  . PRO B 2 55  ? 5.403   22.787  14.173 1.00 35.31 ? 320  PRO E CA  1 
ATOM   2312 C  C   . PRO B 2 55  ? 5.343   24.221  13.665 1.00 35.59 ? 320  PRO E C   1 
ATOM   2313 O  O   . PRO B 2 55  ? 5.350   24.441  12.451 1.00 35.66 ? 320  PRO E O   1 
ATOM   2314 C  CB  . PRO B 2 55  ? 6.821   22.406  14.609 1.00 35.28 ? 320  PRO E CB  1 
ATOM   2315 C  CG  . PRO B 2 55  ? 7.418   21.713  13.461 1.00 35.09 ? 320  PRO E CG  1 
ATOM   2316 C  CD  . PRO B 2 55  ? 6.315   21.149  12.623 1.00 35.00 ? 320  PRO E CD  1 
ATOM   2317 N  N   . ASP B 2 56  ? 5.252   25.179  14.583 1.00 35.98 ? 321  ASP E N   1 
ATOM   2318 C  CA  . ASP B 2 56  ? 5.196   26.597  14.215 1.00 36.30 ? 321  ASP E CA  1 
ATOM   2319 C  C   . ASP B 2 56  ? 6.398   27.001  13.365 1.00 36.19 ? 321  ASP E C   1 
ATOM   2320 O  O   . ASP B 2 56  ? 7.537   26.630  13.664 1.00 35.92 ? 321  ASP E O   1 
ATOM   2321 C  CB  . ASP B 2 56  ? 5.121   27.484  15.466 1.00 36.55 ? 321  ASP E CB  1 
ATOM   2322 C  CG  . ASP B 2 56  ? 3.730   27.503  16.096 1.00 37.44 ? 321  ASP E CG  1 
ATOM   2323 O  OD1 . ASP B 2 56  ? 3.579   28.148  17.159 1.00 38.17 ? 321  ASP E OD1 1 
ATOM   2324 O  OD2 . ASP B 2 56  ? 2.794   26.882  15.534 1.00 37.98 ? 321  ASP E OD2 1 
ATOM   2325 N  N   . GLY B 2 57  ? 6.124   27.751  12.300 1.00 36.18 ? 322  GLY E N   1 
ATOM   2326 C  CA  . GLY B 2 57  ? 7.157   28.207  11.373 1.00 36.27 ? 322  GLY E CA  1 
ATOM   2327 C  C   . GLY B 2 57  ? 7.403   27.239  10.231 1.00 36.26 ? 322  GLY E C   1 
ATOM   2328 O  O   . GLY B 2 57  ? 8.397   27.366  9.514  1.00 36.36 ? 322  GLY E O   1 
ATOM   2329 N  N   . PHE B 2 58  ? 6.502   26.272  10.069 1.00 36.21 ? 323  PHE E N   1 
ATOM   2330 C  CA  . PHE B 2 58  ? 6.592   25.280  9.001  1.00 36.13 ? 323  PHE E CA  1 
ATOM   2331 C  C   . PHE B 2 58  ? 5.242   25.131  8.320  1.00 36.11 ? 323  PHE E C   1 
ATOM   2332 O  O   . PHE B 2 58  ? 4.200   25.305  8.955  1.00 36.24 ? 323  PHE E O   1 
ATOM   2333 C  CB  . PHE B 2 58  ? 7.022   23.917  9.558  1.00 36.09 ? 323  PHE E CB  1 
ATOM   2334 C  CG  . PHE B 2 58  ? 8.431   23.886  10.080 1.00 35.80 ? 323  PHE E CG  1 
ATOM   2335 C  CD1 . PHE B 2 58  ? 8.717   24.306  11.371 1.00 35.73 ? 323  PHE E CD1 1 
ATOM   2336 C  CD2 . PHE B 2 58  ? 9.469   23.421  9.284  1.00 35.74 ? 323  PHE E CD2 1 
ATOM   2337 C  CE1 . PHE B 2 58  ? 10.020  24.271  11.861 1.00 35.92 ? 323  PHE E CE1 1 
ATOM   2338 C  CE2 . PHE B 2 58  ? 10.772  23.386  9.760  1.00 35.84 ? 323  PHE E CE2 1 
ATOM   2339 C  CZ  . PHE B 2 58  ? 11.049  23.813  11.052 1.00 35.96 ? 323  PHE E CZ  1 
ATOM   2340 N  N   . GLN B 2 59  ? 5.271   24.805  7.029  1.00 36.10 ? 324  GLN E N   1 
ATOM   2341 C  CA  . GLN B 2 59  ? 4.061   24.546  6.253  0.50 35.99 ? 324  GLN E CA  1 
ATOM   2342 C  C   . GLN B 2 59  ? 4.077   23.107  5.751  1.00 36.10 ? 324  GLN E C   1 
ATOM   2343 O  O   . GLN B 2 59  ? 5.146   22.534  5.526  1.00 35.93 ? 324  GLN E O   1 
ATOM   2344 C  CB  . GLN B 2 59  ? 3.952   25.521  5.074  0.50 35.93 ? 324  GLN E CB  1 
ATOM   2345 C  CG  . GLN B 2 59  ? 5.020   25.343  3.996  0.50 35.81 ? 324  GLN E CG  1 
ATOM   2346 C  CD  . GLN B 2 59  ? 4.916   26.365  2.878  0.50 35.77 ? 324  GLN E CD  1 
ATOM   2347 O  OE1 . GLN B 2 59  ? 4.970   26.014  1.701  0.50 35.31 ? 324  GLN E OE1 1 
ATOM   2348 N  NE2 . GLN B 2 59  ? 4.768   27.635  3.240  0.50 35.30 ? 324  GLN E NE2 1 
ATOM   2349 N  N   . LEU B 2 60  ? 2.889   22.535  5.564  1.00 36.18 ? 325  LEU E N   1 
ATOM   2350 C  CA  . LEU B 2 60  ? 2.755   21.153  5.121  1.00 36.33 ? 325  LEU E CA  1 
ATOM   2351 C  C   . LEU B 2 60  ? 2.871   21.043  3.596  1.00 36.73 ? 325  LEU E C   1 
ATOM   2352 O  O   . LEU B 2 60  ? 2.143   21.715  2.855  1.00 36.88 ? 325  LEU E O   1 
ATOM   2353 C  CB  . LEU B 2 60  ? 1.416   20.570  5.601  1.00 36.36 ? 325  LEU E CB  1 
ATOM   2354 C  CG  . LEU B 2 60  ? 1.246   19.051  5.501  1.00 36.13 ? 325  LEU E CG  1 
ATOM   2355 C  CD1 . LEU B 2 60  ? 2.266   18.330  6.378  1.00 35.95 ? 325  LEU E CD1 1 
ATOM   2356 C  CD2 . LEU B 2 60  ? -0.177  18.636  5.868  1.00 36.07 ? 325  LEU E CD2 1 
ATOM   2357 N  N   . VAL B 2 61  ? 3.783   20.182  3.142  1.00 37.06 ? 326  VAL E N   1 
ATOM   2358 C  CA  . VAL B 2 61  ? 4.025   19.937  1.719  1.00 37.31 ? 326  VAL E CA  1 
ATOM   2359 C  C   . VAL B 2 61  ? 3.564   18.528  1.344  1.00 37.64 ? 326  VAL E C   1 
ATOM   2360 O  O   . VAL B 2 61  ? 3.930   17.559  2.006  1.00 37.62 ? 326  VAL E O   1 
ATOM   2361 C  CB  . VAL B 2 61  ? 5.524   20.056  1.383  1.00 37.32 ? 326  VAL E CB  1 
ATOM   2362 C  CG1 . VAL B 2 61  ? 5.770   19.767  -0.093 1.00 37.15 ? 326  VAL E CG1 1 
ATOM   2363 C  CG2 . VAL B 2 61  ? 6.049   21.434  1.763  1.00 37.46 ? 326  VAL E CG2 1 
ATOM   2364 N  N   . ALA B 2 62  ? 2.767   18.423  0.281  1.00 38.01 ? 327  ALA E N   1 
ATOM   2365 C  CA  . ALA B 2 62  ? 2.280   17.129  -0.216 1.00 38.28 ? 327  ALA E CA  1 
ATOM   2366 C  C   . ALA B 2 62  ? 1.470   16.354  0.835  1.00 38.57 ? 327  ALA E C   1 
ATOM   2367 O  O   . ALA B 2 62  ? 1.456   15.119  0.827  1.00 38.54 ? 327  ALA E O   1 
ATOM   2368 C  CB  . ALA B 2 62  ? 3.454   16.278  -0.732 1.00 38.20 ? 327  ALA E CB  1 
ATOM   2369 N  N   . GLN B 2 63  ? 0.798   17.095  1.723  1.00 38.90 ? 328  GLN E N   1 
ATOM   2370 C  CA  . GLN B 2 63  ? -0.049  16.542  2.799  1.00 39.18 ? 328  GLN E CA  1 
ATOM   2371 C  C   . GLN B 2 63  ? 0.705   15.771  3.896  1.00 39.29 ? 328  GLN E C   1 
ATOM   2372 O  O   . GLN B 2 63  ? 0.086   15.312  4.860  1.00 39.07 ? 328  GLN E O   1 
ATOM   2373 C  CB  . GLN B 2 63  ? -1.178  15.659  2.229  1.00 39.18 ? 328  GLN E CB  1 
ATOM   2374 C  CG  . GLN B 2 63  ? -2.132  16.385  1.287  1.00 39.62 ? 328  GLN E CG  1 
ATOM   2375 C  CD  . GLN B 2 63  ? -1.649  16.396  -0.152 1.00 40.18 ? 328  GLN E CD  1 
ATOM   2376 O  OE1 . GLN B 2 63  ? -1.590  15.351  -0.801 1.00 40.01 ? 328  GLN E OE1 1 
ATOM   2377 N  NE2 . GLN B 2 63  ? -1.294  17.581  -0.657 1.00 39.69 ? 328  GLN E NE2 1 
ATOM   2378 N  N   . ARG B 2 64  ? 2.029   15.661  3.769  1.00 39.53 ? 329  ARG E N   1 
ATOM   2379 C  CA  . ARG B 2 64  ? 2.821   14.753  4.603  1.00 39.62 ? 329  ARG E CA  1 
ATOM   2380 C  C   . ARG B 2 64  ? 4.060   15.397  5.243  1.00 39.64 ? 329  ARG E C   1 
ATOM   2381 O  O   . ARG B 2 64  ? 4.305   15.208  6.436  1.00 39.28 ? 329  ARG E O   1 
ATOM   2382 C  CB  . ARG B 2 64  ? 3.241   13.534  3.775  1.00 39.66 ? 329  ARG E CB  1 
ATOM   2383 C  CG  . ARG B 2 64  ? 2.078   12.700  3.221  1.00 39.91 ? 329  ARG E CG  1 
ATOM   2384 C  CD  . ARG B 2 64  ? 1.462   11.791  4.275  1.00 40.70 ? 329  ARG E CD  1 
ATOM   2385 N  NE  . ARG B 2 64  ? 0.453   10.899  3.701  1.00 41.34 ? 329  ARG E NE  1 
ATOM   2386 C  CZ  . ARG B 2 64  ? -0.847  11.187  3.572  1.00 42.35 ? 329  ARG E CZ  1 
ATOM   2387 N  NH1 . ARG B 2 64  ? -1.342  12.358  3.979  1.00 41.65 ? 329  ARG E NH1 1 
ATOM   2388 N  NH2 . ARG B 2 64  ? -1.667  10.291  3.027  1.00 42.01 ? 329  ARG E NH2 1 
ATOM   2389 N  N   . ARG B 2 65  ? 4.833   16.144  4.453  1.00 39.89 ? 330  ARG E N   1 
ATOM   2390 C  CA  . ARG B 2 65  ? 6.136   16.673  4.891  1.00 40.17 ? 330  ARG E CA  1 
ATOM   2391 C  C   . ARG B 2 65  ? 6.056   18.106  5.394  1.00 40.00 ? 330  ARG E C   1 
ATOM   2392 O  O   . ARG B 2 65  ? 5.257   18.891  4.902  1.00 40.17 ? 330  ARG E O   1 
ATOM   2393 C  CB  . ARG B 2 65  ? 7.150   16.603  3.747  1.00 40.12 ? 330  ARG E CB  1 
ATOM   2394 C  CG  . ARG B 2 65  ? 7.740   15.218  3.527  1.00 40.71 ? 330  ARG E CG  1 
ATOM   2395 C  CD  . ARG B 2 65  ? 8.779   15.209  2.398  1.00 41.04 ? 330  ARG E CD  1 
ATOM   2396 N  NE  . ARG B 2 65  ? 8.159   15.478  1.098  1.00 42.02 ? 330  ARG E NE  1 
ATOM   2397 C  CZ  . ARG B 2 65  ? 8.165   16.649  0.460  1.00 42.53 ? 330  ARG E CZ  1 
ATOM   2398 N  NH1 . ARG B 2 65  ? 7.546   16.757  -0.712 1.00 42.18 ? 330  ARG E NH1 1 
ATOM   2399 N  NH2 . ARG B 2 65  ? 8.783   17.712  0.970  1.00 43.10 ? 330  ARG E NH2 1 
ATOM   2400 N  N   . CYS B 2 66  ? 6.895   18.434  6.375  1.00 40.13 ? 331  CYS E N   1 
ATOM   2401 C  CA  . CYS B 2 66  ? 7.027   19.803  6.885  1.00 40.21 ? 331  CYS E CA  1 
ATOM   2402 C  C   . CYS B 2 66  ? 8.303   20.450  6.347  1.00 40.51 ? 331  CYS E C   1 
ATOM   2403 O  O   . CYS B 2 66  ? 9.347   19.802  6.248  1.00 40.23 ? 331  CYS E O   1 
ATOM   2404 C  CB  . CYS B 2 66  ? 7.069   19.820  8.418  1.00 40.06 ? 331  CYS E CB  1 
ATOM   2405 S  SG  . CYS B 2 66  ? 5.632   19.117  9.246  1.00 39.80 ? 331  CYS E SG  1 
ATOM   2406 N  N   . GLU B 2 67  ? 8.208   21.733  6.008  1.00 40.94 ? 332  GLU E N   1 
ATOM   2407 C  CA  . GLU B 2 67  ? 9.333   22.488  5.459  1.00 41.34 ? 332  GLU E CA  1 
ATOM   2408 C  C   . GLU B 2 67  ? 9.217   23.962  5.849  1.00 41.31 ? 332  GLU E C   1 
ATOM   2409 O  O   . GLU B 2 67  ? 8.150   24.406  6.271  1.00 41.37 ? 332  GLU E O   1 
ATOM   2410 C  CB  . GLU B 2 67  ? 9.366   22.353  3.930  1.00 41.44 ? 332  GLU E CB  1 
ATOM   2411 C  CG  . GLU B 2 67  ? 9.599   20.928  3.424  1.00 41.76 ? 332  GLU E CG  1 
ATOM   2412 C  CD  . GLU B 2 67  ? 9.863   20.855  1.925  1.00 41.94 ? 332  GLU E CD  1 
ATOM   2413 O  OE1 . GLU B 2 67  ? 9.300   21.677  1.164  1.00 42.35 ? 332  GLU E OE1 1 
ATOM   2414 O  OE2 . GLU B 2 67  ? 10.634  19.961  1.510  1.00 42.50 ? 332  GLU E OE2 1 
ATOM   2415 N  N   . ASP B 2 68  ? 10.316  24.703  5.704  1.00 41.36 ? 333  ASP E N   1 
ATOM   2416 C  CA  . ASP B 2 68  ? 10.362  26.151  5.970  1.00 41.46 ? 333  ASP E CA  1 
ATOM   2417 C  C   . ASP B 2 68  ? 10.551  26.429  7.462  1.00 41.52 ? 333  ASP E C   1 
ATOM   2418 O  O   . ASP B 2 68  ? 11.392  27.244  7.852  1.00 41.38 ? 333  ASP E O   1 
ATOM   2419 C  CB  . ASP B 2 68  ? 9.105   26.865  5.431  1.00 41.42 ? 333  ASP E CB  1 
ATOM   2420 C  CG  . ASP B 2 68  ? 9.156   28.373  5.600  1.00 41.73 ? 333  ASP E CG  1 
ATOM   2421 O  OD1 . ASP B 2 68  ? 10.257  28.971  5.518  1.00 42.05 ? 333  ASP E OD1 1 
ATOM   2422 O  OD2 . ASP B 2 68  ? 8.073   28.962  5.807  1.00 41.79 ? 333  ASP E OD2 1 
ATOM   2423 N  N   . THR C 3 22  ? 37.202  6.809   57.712 1.00 36.43 ? 60   THR P N   1 
ATOM   2424 C  CA  . THR C 3 22  ? 37.924  5.502   57.717 1.00 36.40 ? 60   THR P CA  1 
ATOM   2425 C  C   . THR C 3 22  ? 38.323  4.954   56.320 1.00 36.05 ? 60   THR P C   1 
ATOM   2426 O  O   . THR C 3 22  ? 38.373  3.733   56.145 1.00 36.37 ? 60   THR P O   1 
ATOM   2427 C  CB  . THR C 3 22  ? 37.061  4.430   58.440 1.00 36.58 ? 60   THR P CB  1 
ATOM   2428 O  OG1 . THR C 3 22  ? 35.900  4.128   57.650 1.00 36.73 ? 60   THR P OG1 1 
ATOM   2429 C  CG2 . THR C 3 22  ? 36.628  4.931   59.825 1.00 36.67 ? 60   THR P CG2 1 
ATOM   2430 N  N   . THR C 3 23  ? 38.612  5.802   55.324 1.00 35.37 ? 61   THR P N   1 
ATOM   2431 C  CA  . THR C 3 23  ? 38.528  7.267   55.395 1.00 34.69 ? 61   THR P CA  1 
ATOM   2432 C  C   . THR C 3 23  ? 37.507  7.745   54.360 1.00 33.64 ? 61   THR P C   1 
ATOM   2433 O  O   . THR C 3 23  ? 37.371  7.142   53.290 1.00 33.47 ? 61   THR P O   1 
ATOM   2434 C  CB  . THR C 3 23  ? 39.902  7.935   55.128 1.00 34.72 ? 61   THR P CB  1 
ATOM   2435 O  OG1 . THR C 3 23  ? 40.951  7.088   55.609 1.00 35.27 ? 61   THR P OG1 1 
ATOM   2436 C  CG2 . THR C 3 23  ? 39.994  9.287   55.824 1.00 34.95 ? 61   THR P CG2 1 
ATOM   2437 N  N   . ALA C 3 24  ? 36.792  8.821   54.685 1.00 32.47 ? 62   ALA P N   1 
ATOM   2438 C  CA  . ALA C 3 24  ? 35.767  9.367   53.801 1.00 31.52 ? 62   ALA P CA  1 
ATOM   2439 C  C   . ALA C 3 24  ? 36.406  9.983   52.558 1.00 30.83 ? 62   ALA P C   1 
ATOM   2440 O  O   . ALA C 3 24  ? 37.451  10.627  52.652 1.00 30.57 ? 62   ALA P O   1 
ATOM   2441 C  CB  . ALA C 3 24  ? 34.928  10.407  54.536 1.00 31.32 ? 62   ALA P CB  1 
ATOM   2442 N  N   . THR C 3 25  ? 35.774  9.779   51.403 1.00 29.93 ? 63   THR P N   1 
ATOM   2443 C  CA  . THR C 3 25  ? 36.284  10.293  50.131 1.00 29.28 ? 63   THR P CA  1 
ATOM   2444 C  C   . THR C 3 25  ? 35.310  11.283  49.484 1.00 28.90 ? 63   THR P C   1 
ATOM   2445 O  O   . THR C 3 25  ? 34.107  11.242  49.740 1.00 28.66 ? 63   THR P O   1 
ATOM   2446 C  CB  . THR C 3 25  ? 36.576  9.143   49.147 1.00 29.23 ? 63   THR P CB  1 
ATOM   2447 O  OG1 . THR C 3 25  ? 35.414  8.320   49.015 1.00 28.98 ? 63   THR P OG1 1 
ATOM   2448 C  CG2 . THR C 3 25  ? 37.747  8.294   49.639 1.00 28.56 ? 63   THR P CG2 1 
ATOM   2449 N  N   . PHE C 3 26  ? 35.851  12.178  48.657 1.00 28.42 ? 64   PHE P N   1 
ATOM   2450 C  CA  . PHE C 3 26  ? 35.057  13.160  47.920 1.00 27.97 ? 64   PHE P CA  1 
ATOM   2451 C  C   . PHE C 3 26  ? 34.966  12.761  46.446 1.00 27.72 ? 64   PHE P C   1 
ATOM   2452 O  O   . PHE C 3 26  ? 35.946  12.330  45.853 1.00 27.58 ? 64   PHE P O   1 
ATOM   2453 C  CB  . PHE C 3 26  ? 35.656  14.563  48.052 1.00 27.97 ? 64   PHE P CB  1 
ATOM   2454 C  CG  . PHE C 3 26  ? 35.008  15.582  47.158 1.00 27.91 ? 64   PHE P CG  1 
ATOM   2455 C  CD1 . PHE C 3 26  ? 33.761  16.101  47.464 1.00 28.29 ? 64   PHE P CD1 1 
ATOM   2456 C  CD2 . PHE C 3 26  ? 35.629  16.001  45.997 1.00 28.08 ? 64   PHE P CD2 1 
ATOM   2457 C  CE1 . PHE C 3 26  ? 33.153  17.028  46.634 1.00 27.44 ? 64   PHE P CE1 1 
ATOM   2458 C  CE2 . PHE C 3 26  ? 35.018  16.932  45.164 1.00 28.24 ? 64   PHE P CE2 1 
ATOM   2459 C  CZ  . PHE C 3 26  ? 33.780  17.438  45.487 1.00 27.50 ? 64   PHE P CZ  1 
ATOM   2460 N  N   . HIS C 3 27  ? 33.775  12.918  45.871 1.00 27.43 ? 65   HIS P N   1 
ATOM   2461 C  CA  . HIS C 3 27  ? 33.499  12.521  44.492 1.00 27.12 ? 65   HIS P CA  1 
ATOM   2462 C  C   . HIS C 3 27  ? 32.806  13.644  43.732 1.00 26.90 ? 65   HIS P C   1 
ATOM   2463 O  O   . HIS C 3 27  ? 31.996  14.387  44.284 1.00 26.36 ? 65   HIS P O   1 
ATOM   2464 C  CB  . HIS C 3 27  ? 32.615  11.267  44.475 1.00 27.04 ? 65   HIS P CB  1 
ATOM   2465 C  CG  . HIS C 3 27  ? 33.194  10.121  45.244 1.00 26.84 ? 65   HIS P CG  1 
ATOM   2466 N  ND1 . HIS C 3 27  ? 33.900  9.102   44.642 1.00 26.64 ? 65   HIS P ND1 1 
ATOM   2467 C  CD2 . HIS C 3 27  ? 33.199  9.849   46.570 1.00 26.87 ? 65   HIS P CD2 1 
ATOM   2468 C  CE1 . HIS C 3 27  ? 34.311  8.248   45.563 1.00 26.66 ? 65   HIS P CE1 1 
ATOM   2469 N  NE2 . HIS C 3 27  ? 33.902  8.681   46.742 1.00 26.59 ? 65   HIS P NE2 1 
ATOM   2470 N  N   . ARG C 3 28  ? 33.128  13.760  42.453 1.00 26.93 ? 66   ARG P N   1 
ATOM   2471 C  CA  . ARG C 3 28  ? 32.496  14.753  41.603 1.00 26.93 ? 66   ARG P CA  1 
ATOM   2472 C  C   . ARG C 3 28  ? 32.383  14.212  40.191 1.00 26.48 ? 66   ARG P C   1 
ATOM   2473 O  O   . ARG C 3 28  ? 33.042  13.242  39.837 1.00 25.71 ? 66   ARG P O   1 
ATOM   2474 C  CB  . ARG C 3 28  ? 33.286  16.063  41.633 1.00 27.22 ? 66   ARG P CB  1 
ATOM   2475 C  CG  . ARG C 3 28  ? 34.647  15.986  40.993 1.00 28.29 ? 66   ARG P CG  1 
ATOM   2476 C  CD  . ARG C 3 28  ? 35.378  17.303  41.116 1.00 30.76 ? 66   ARG P CD  1 
ATOM   2477 N  NE  . ARG C 3 28  ? 36.137  17.592  39.903 1.00 32.38 ? 66   ARG P NE  1 
ATOM   2478 C  CZ  . ARG C 3 28  ? 37.215  18.379  39.845 1.00 33.18 ? 66   ARG P CZ  1 
ATOM   2479 N  NH1 . ARG C 3 28  ? 37.685  18.990  40.935 1.00 33.24 ? 66   ARG P NH1 1 
ATOM   2480 N  NH2 . ARG C 3 28  ? 37.823  18.563  38.674 1.00 32.00 ? 66   ARG P NH2 1 
ATOM   2481 N  N   . CYS C 3 29  ? 31.523  14.838  39.398 1.00 26.56 ? 67   CYS P N   1 
ATOM   2482 C  CA  . CYS C 3 29  ? 31.305  14.408  38.021 1.00 26.59 ? 67   CYS P CA  1 
ATOM   2483 C  C   . CYS C 3 29  ? 32.591  14.569  37.210 1.00 26.49 ? 67   CYS P C   1 
ATOM   2484 O  O   . CYS C 3 29  ? 33.264  15.590  37.312 1.00 26.44 ? 67   CYS P O   1 
ATOM   2485 C  CB  . CYS C 3 29  ? 30.178  15.220  37.388 1.00 26.48 ? 67   CYS P CB  1 
ATOM   2486 S  SG  . CYS C 3 29  ? 29.702  14.630  35.756 1.00 27.06 ? 67   CYS P SG  1 
ATOM   2487 N  N   . ALA C 3 30  ? 32.935  13.556  36.419 1.00 26.61 ? 68   ALA P N   1 
ATOM   2488 C  CA  . ALA C 3 30  ? 34.155  13.599  35.607 1.00 26.71 ? 68   ALA P CA  1 
ATOM   2489 C  C   . ALA C 3 30  ? 34.005  14.540  34.418 1.00 26.82 ? 68   ALA P C   1 
ATOM   2490 O  O   . ALA C 3 30  ? 34.997  14.950  33.835 1.00 27.00 ? 68   ALA P O   1 
ATOM   2491 C  CB  . ALA C 3 30  ? 34.525  12.212  35.128 1.00 26.64 ? 68   ALA P CB  1 
ATOM   2492 N  N   . LYS C 3 31  ? 32.763  14.873  34.069 1.00 27.02 ? 69   LYS P N   1 
ATOM   2493 C  CA  . LYS C 3 31  ? 32.452  15.759  32.948 1.00 27.27 ? 69   LYS P CA  1 
ATOM   2494 C  C   . LYS C 3 31  ? 32.193  17.172  33.489 1.00 27.06 ? 69   LYS P C   1 
ATOM   2495 O  O   . LYS C 3 31  ? 31.126  17.464  34.040 1.00 27.24 ? 69   LYS P O   1 
ATOM   2496 C  CB  . LYS C 3 31  ? 31.249  15.191  32.174 1.00 27.40 ? 69   LYS P CB  1 
ATOM   2497 C  CG  . LYS C 3 31  ? 30.622  16.075  31.094 1.00 28.67 ? 69   LYS P CG  1 
ATOM   2498 C  CD  . LYS C 3 31  ? 31.395  16.106  29.777 1.00 30.16 ? 69   LYS P CD  1 
ATOM   2499 C  CE  . LYS C 3 31  ? 30.465  16.494  28.621 1.00 30.71 ? 69   LYS P CE  1 
ATOM   2500 N  NZ  . LYS C 3 31  ? 31.201  16.755  27.355 1.00 31.41 ? 69   LYS P NZ  1 
ATOM   2501 N  N   . ASP C 3 32  ? 33.194  18.032  33.320 1.00 26.77 ? 70   ASP P N   1 
ATOM   2502 C  CA  . ASP C 3 32  ? 33.219  19.402  33.863 1.00 26.58 ? 70   ASP P CA  1 
ATOM   2503 C  C   . ASP C 3 32  ? 31.938  20.225  33.632 1.00 25.72 ? 70   ASP P C   1 
ATOM   2504 O  O   . ASP C 3 32  ? 31.444  20.851  34.564 1.00 25.77 ? 70   ASP P O   1 
ATOM   2505 C  CB  . ASP C 3 32  ? 34.464  20.141  33.321 1.00 27.00 ? 70   ASP P CB  1 
ATOM   2506 C  CG  . ASP C 3 32  ? 34.365  21.668  33.441 1.00 28.70 ? 70   ASP P CG  1 
ATOM   2507 O  OD1 . ASP C 3 32  ? 34.446  22.189  34.579 1.00 30.63 ? 70   ASP P OD1 1 
ATOM   2508 O  OD2 . ASP C 3 32  ? 34.237  22.344  32.388 1.00 31.01 ? 70   ASP P OD2 1 
ATOM   2509 N  N   . PRO C 3 33  ? 31.405  20.243  32.395 1.00 24.81 ? 71   PRO P N   1 
ATOM   2510 C  CA  . PRO C 3 33  ? 30.126  20.924  32.141 1.00 24.37 ? 71   PRO P CA  1 
ATOM   2511 C  C   . PRO C 3 33  ? 28.928  20.462  32.993 1.00 23.77 ? 71   PRO P C   1 
ATOM   2512 O  O   . PRO C 3 33  ? 28.000  21.244  33.190 1.00 23.61 ? 71   PRO P O   1 
ATOM   2513 C  CB  . PRO C 3 33  ? 29.851  20.613  30.666 1.00 24.32 ? 71   PRO P CB  1 
ATOM   2514 C  CG  . PRO C 3 33  ? 31.158  20.334  30.089 1.00 24.61 ? 71   PRO P CG  1 
ATOM   2515 C  CD  . PRO C 3 33  ? 31.967  19.683  31.157 1.00 24.75 ? 71   PRO P CD  1 
ATOM   2516 N  N   . TRP C 3 34  ? 28.939  19.216  33.474 1.00 23.09 ? 72   TRP P N   1 
ATOM   2517 C  CA  . TRP C 3 34  ? 27.789  18.658  34.203 1.00 22.75 ? 72   TRP P CA  1 
ATOM   2518 C  C   . TRP C 3 34  ? 27.906  18.769  35.723 1.00 22.53 ? 72   TRP P C   1 
ATOM   2519 O  O   . TRP C 3 34  ? 27.025  18.323  36.445 1.00 22.27 ? 72   TRP P O   1 
ATOM   2520 C  CB  . TRP C 3 34  ? 27.567  17.192  33.829 1.00 22.59 ? 72   TRP P CB  1 
ATOM   2521 C  CG  . TRP C 3 34  ? 27.303  16.946  32.389 1.00 22.37 ? 72   TRP P CG  1 
ATOM   2522 C  CD1 . TRP C 3 34  ? 27.089  17.877  31.413 1.00 22.39 ? 72   TRP P CD1 1 
ATOM   2523 C  CD2 . TRP C 3 34  ? 27.167  15.669  31.761 1.00 23.31 ? 72   TRP P CD2 1 
ATOM   2524 N  NE1 . TRP C 3 34  ? 26.857  17.257  30.211 1.00 22.57 ? 72   TRP P NE1 1 
ATOM   2525 C  CE2 . TRP C 3 34  ? 26.891  15.901  30.396 1.00 22.73 ? 72   TRP P CE2 1 
ATOM   2526 C  CE3 . TRP C 3 34  ? 27.254  14.345  32.220 1.00 22.87 ? 72   TRP P CE3 1 
ATOM   2527 C  CZ2 . TRP C 3 34  ? 26.708  14.861  29.484 1.00 22.84 ? 72   TRP P CZ2 1 
ATOM   2528 C  CZ3 . TRP C 3 34  ? 27.067  13.313  31.309 1.00 22.44 ? 72   TRP P CZ3 1 
ATOM   2529 C  CH2 . TRP C 3 34  ? 26.798  13.577  29.962 1.00 22.73 ? 72   TRP P CH2 1 
ATOM   2530 N  N   . ARG C 3 35  ? 28.989  19.366  36.202 1.00 22.60 ? 73   ARG P N   1 
ATOM   2531 C  CA  . ARG C 3 35  ? 29.176  19.588  37.632 1.00 22.36 ? 73   ARG P CA  1 
ATOM   2532 C  C   . ARG C 3 35  ? 28.250  20.691  38.122 1.00 22.43 ? 73   ARG P C   1 
ATOM   2533 O  O   . ARG C 3 35  ? 27.985  21.644  37.400 1.00 22.64 ? 73   ARG P O   1 
ATOM   2534 C  CB  . ARG C 3 35  ? 30.619  19.982  37.934 1.00 21.88 ? 73   ARG P CB  1 
ATOM   2535 C  CG  . ARG C 3 35  ? 31.649  18.906  37.623 1.00 21.83 ? 73   ARG P CG  1 
ATOM   2536 C  CD  . ARG C 3 35  ? 33.065  19.435  37.851 1.00 21.81 ? 73   ARG P CD  1 
ATOM   2537 N  NE  . ARG C 3 35  ? 33.165  20.027  39.182 1.00 21.50 ? 73   ARG P NE  1 
ATOM   2538 C  CZ  . ARG C 3 35  ? 34.128  20.839  39.604 1.00 21.57 ? 73   ARG P CZ  1 
ATOM   2539 N  NH1 . ARG C 3 35  ? 34.074  21.313  40.843 1.00 22.10 ? 73   ARG P NH1 1 
ATOM   2540 N  NH2 . ARG C 3 35  ? 35.140  21.174  38.818 1.00 21.31 ? 73   ARG P NH2 1 
ATOM   2541 N  N   . LEU C 3 36  ? 27.765  20.552  39.351 1.00 22.60 ? 74   LEU P N   1 
ATOM   2542 C  CA  . LEU C 3 36  ? 26.994  21.604  40.006 1.00 22.68 ? 74   LEU P CA  1 
ATOM   2543 C  C   . LEU C 3 36  ? 27.635  21.966  41.350 1.00 22.99 ? 74   LEU P C   1 
ATOM   2544 O  O   . LEU C 3 36  ? 27.099  21.596  42.402 1.00 22.73 ? 74   LEU P O   1 
ATOM   2545 C  CB  . LEU C 3 36  ? 25.560  21.129  40.220 1.00 22.72 ? 74   LEU P CB  1 
ATOM   2546 C  CG  . LEU C 3 36  ? 24.759  20.787  38.967 1.00 22.24 ? 74   LEU P CG  1 
ATOM   2547 C  CD1 . LEU C 3 36  ? 23.410  20.194  39.351 1.00 21.27 ? 74   LEU P CD1 1 
ATOM   2548 C  CD2 . LEU C 3 36  ? 24.589  22.025  38.107 1.00 21.79 ? 74   LEU P CD2 1 
ATOM   2549 N  N   . PRO C 3 37  ? 28.781  22.696  41.322 1.00 23.16 ? 75   PRO P N   1 
ATOM   2550 C  CA  . PRO C 3 37  ? 29.528  23.045  42.543 1.00 23.48 ? 75   PRO P CA  1 
ATOM   2551 C  C   . PRO C 3 37  ? 28.708  23.792  43.600 1.00 23.68 ? 75   PRO P C   1 
ATOM   2552 O  O   . PRO C 3 37  ? 27.860  24.618  43.264 1.00 23.89 ? 75   PRO P O   1 
ATOM   2553 C  CB  . PRO C 3 37  ? 30.658  23.949  42.027 1.00 23.28 ? 75   PRO P CB  1 
ATOM   2554 C  CG  . PRO C 3 37  ? 30.816  23.596  40.609 1.00 23.12 ? 75   PRO P CG  1 
ATOM   2555 C  CD  . PRO C 3 37  ? 29.440  23.248  40.123 1.00 23.19 ? 75   PRO P CD  1 
ATOM   2556 N  N   . GLY C 3 38  ? 28.965  23.480  44.866 1.00 23.88 ? 76   GLY P N   1 
ATOM   2557 C  CA  . GLY C 3 38  ? 28.352  24.175  45.979 1.00 23.91 ? 76   GLY P CA  1 
ATOM   2558 C  C   . GLY C 3 38  ? 27.190  23.435  46.600 1.00 24.02 ? 76   GLY P C   1 
ATOM   2559 O  O   . GLY C 3 38  ? 26.683  23.848  47.637 1.00 24.17 ? 76   GLY P O   1 
ATOM   2560 N  N   . THR C 3 39  ? 26.755  22.354  45.968 1.00 24.05 ? 77   THR P N   1 
ATOM   2561 C  CA  . THR C 3 39  ? 25.734  21.506  46.546 1.00 24.24 ? 77   THR P CA  1 
ATOM   2562 C  C   . THR C 3 39  ? 26.297  20.101  46.628 1.00 24.10 ? 77   THR P C   1 
ATOM   2563 O  O   . THR C 3 39  ? 26.860  19.597  45.655 1.00 24.17 ? 77   THR P O   1 
ATOM   2564 C  CB  . THR C 3 39  ? 24.441  21.553  45.738 1.00 24.58 ? 77   THR P CB  1 
ATOM   2565 O  OG1 . THR C 3 39  ? 23.997  22.915  45.641 1.00 25.11 ? 77   THR P OG1 1 
ATOM   2566 C  CG2 . THR C 3 39  ? 23.355  20.711  46.414 1.00 24.32 ? 77   THR P CG2 1 
ATOM   2567 N  N   . TYR C 3 40  ? 26.187  19.495  47.810 1.00 23.77 ? 78   TYR P N   1 
ATOM   2568 C  CA  . TYR C 3 40  ? 26.839  18.222  48.088 1.00 23.74 ? 78   TYR P CA  1 
ATOM   2569 C  C   . TYR C 3 40  ? 25.894  17.281  48.801 1.00 23.82 ? 78   TYR P C   1 
ATOM   2570 O  O   . TYR C 3 40  ? 25.122  17.697  49.671 1.00 23.98 ? 78   TYR P O   1 
ATOM   2571 C  CB  . TYR C 3 40  ? 28.098  18.435  48.942 1.00 23.70 ? 78   TYR P CB  1 
ATOM   2572 C  CG  . TYR C 3 40  ? 29.021  19.468  48.359 1.00 23.18 ? 78   TYR P CG  1 
ATOM   2573 C  CD1 . TYR C 3 40  ? 29.977  19.117  47.420 1.00 22.78 ? 78   TYR P CD1 1 
ATOM   2574 C  CD2 . TYR C 3 40  ? 28.915  20.807  48.725 1.00 22.51 ? 78   TYR P CD2 1 
ATOM   2575 C  CE1 . TYR C 3 40  ? 30.807  20.074  46.862 1.00 22.62 ? 78   TYR P CE1 1 
ATOM   2576 C  CE2 . TYR C 3 40  ? 29.740  21.762  48.179 1.00 21.87 ? 78   TYR P CE2 1 
ATOM   2577 C  CZ  . TYR C 3 40  ? 30.680  21.392  47.247 1.00 22.04 ? 78   TYR P CZ  1 
ATOM   2578 O  OH  . TYR C 3 40  ? 31.498  22.346  46.694 1.00 23.66 ? 78   TYR P OH  1 
ATOM   2579 N  N   . VAL C 3 41  ? 25.946  16.013  48.407 1.00 23.89 ? 79   VAL P N   1 
ATOM   2580 C  CA  . VAL C 3 41  ? 25.279  14.947  49.141 1.00 23.75 ? 79   VAL P CA  1 
ATOM   2581 C  C   . VAL C 3 41  ? 26.299  14.337  50.088 1.00 23.42 ? 79   VAL P C   1 
ATOM   2582 O  O   . VAL C 3 41  ? 27.293  13.761  49.652 1.00 23.83 ? 79   VAL P O   1 
ATOM   2583 C  CB  . VAL C 3 41  ? 24.745  13.843  48.217 1.00 23.74 ? 79   VAL P CB  1 
ATOM   2584 C  CG1 . VAL C 3 41  ? 23.965  12.824  49.033 1.00 23.15 ? 79   VAL P CG1 1 
ATOM   2585 C  CG2 . VAL C 3 41  ? 23.875  14.437  47.134 1.00 24.84 ? 79   VAL P CG2 1 
ATOM   2586 N  N   . VAL C 3 42  ? 26.065  14.496  51.384 1.00 23.34 ? 80   VAL P N   1 
ATOM   2587 C  CA  . VAL C 3 42  ? 26.908  13.890  52.403 1.00 22.92 ? 80   VAL P CA  1 
ATOM   2588 C  C   . VAL C 3 42  ? 26.286  12.545  52.763 1.00 22.98 ? 80   VAL P C   1 
ATOM   2589 O  O   . VAL C 3 42  ? 25.228  12.501  53.371 1.00 23.17 ? 80   VAL P O   1 
ATOM   2590 C  CB  . VAL C 3 42  ? 27.003  14.785  53.633 1.00 22.76 ? 80   VAL P CB  1 
ATOM   2591 C  CG1 . VAL C 3 42  ? 27.863  14.123  54.705 1.00 22.09 ? 80   VAL P CG1 1 
ATOM   2592 C  CG2 . VAL C 3 42  ? 27.553  16.162  53.231 1.00 22.30 ? 80   VAL P CG2 1 
ATOM   2593 N  N   . VAL C 3 43  ? 26.936  11.460  52.354 1.00 23.01 ? 81   VAL P N   1 
ATOM   2594 C  CA  . VAL C 3 43  ? 26.409  10.111  52.542 1.00 23.14 ? 81   VAL P CA  1 
ATOM   2595 C  C   . VAL C 3 43  ? 27.044  9.468   53.770 1.00 23.45 ? 81   VAL P C   1 
ATOM   2596 O  O   . VAL C 3 43  ? 28.249  9.239   53.815 1.00 23.14 ? 81   VAL P O   1 
ATOM   2597 C  CB  . VAL C 3 43  ? 26.650  9.214   51.289 1.00 23.11 ? 81   VAL P CB  1 
ATOM   2598 C  CG1 . VAL C 3 43  ? 26.012  7.836   51.469 1.00 21.58 ? 81   VAL P CG1 1 
ATOM   2599 C  CG2 . VAL C 3 43  ? 26.116  9.897   50.040 1.00 22.55 ? 81   VAL P CG2 1 
ATOM   2600 N  N   . LEU C 3 44  ? 26.217  9.174   54.760 1.00 24.11 ? 82   LEU P N   1 
ATOM   2601 C  CA  . LEU C 3 44  ? 26.697  8.573   55.991 1.00 24.89 ? 82   LEU P CA  1 
ATOM   2602 C  C   . LEU C 3 44  ? 26.715  7.063   55.841 1.00 25.68 ? 82   LEU P C   1 
ATOM   2603 O  O   . LEU C 3 44  ? 26.161  6.523   54.890 1.00 26.22 ? 82   LEU P O   1 
ATOM   2604 C  CB  . LEU C 3 44  ? 25.833  9.015   57.174 1.00 24.51 ? 82   LEU P CB  1 
ATOM   2605 C  CG  . LEU C 3 44  ? 25.716  10.539  57.310 1.00 24.91 ? 82   LEU P CG  1 
ATOM   2606 C  CD1 . LEU C 3 44  ? 24.822  10.899  58.475 1.00 24.81 ? 82   LEU P CD1 1 
ATOM   2607 C  CD2 . LEU C 3 44  ? 27.076  11.206  57.462 1.00 24.11 ? 82   LEU P CD2 1 
ATOM   2608 N  N   . LYS C 3 45  ? 27.368  6.380   56.772 1.00 26.81 ? 83   LYS P N   1 
ATOM   2609 C  CA  . LYS C 3 45  ? 27.530  4.934   56.687 1.00 27.55 ? 83   LYS P CA  1 
ATOM   2610 C  C   . LYS C 3 45  ? 26.212  4.194   56.888 1.00 28.25 ? 83   LYS P C   1 
ATOM   2611 O  O   . LYS C 3 45  ? 25.260  4.730   57.456 1.00 28.72 ? 83   LYS P O   1 
ATOM   2612 C  CB  . LYS C 3 45  ? 28.593  4.455   57.678 1.00 27.74 ? 83   LYS P CB  1 
ATOM   2613 C  CG  . LYS C 3 45  ? 30.005  4.776   57.218 1.00 28.12 ? 83   LYS P CG  1 
ATOM   2614 C  CD  . LYS C 3 45  ? 31.004  4.681   58.345 1.00 29.28 ? 83   LYS P CD  1 
ATOM   2615 C  CE  . LYS C 3 45  ? 32.388  5.138   57.893 1.00 30.10 ? 83   LYS P CE  1 
ATOM   2616 N  NZ  . LYS C 3 45  ? 33.348  5.213   59.039 1.00 30.92 ? 83   LYS P NZ  1 
ATOM   2617 N  N   . GLU C 3 46  ? 26.197  2.947   56.428 1.00 28.92 ? 84   GLU P N   1 
ATOM   2618 C  CA  . GLU C 3 46  ? 24.976  2.168   56.184 1.00 29.47 ? 84   GLU P CA  1 
ATOM   2619 C  C   . GLU C 3 46  ? 23.924  2.193   57.299 1.00 29.41 ? 84   GLU P C   1 
ATOM   2620 O  O   . GLU C 3 46  ? 22.749  2.469   57.040 1.00 29.66 ? 84   GLU P O   1 
ATOM   2621 C  CB  . GLU C 3 46  ? 25.362  0.713   55.877 1.00 29.59 ? 84   GLU P CB  1 
ATOM   2622 C  CG  . GLU C 3 46  ? 24.239  -0.146  55.314 1.00 30.29 ? 84   GLU P CG  1 
ATOM   2623 C  CD  . GLU C 3 46  ? 24.747  -1.468  54.759 1.00 30.46 ? 84   GLU P CD  1 
ATOM   2624 O  OE1 . GLU C 3 46  ? 25.431  -2.204  55.504 1.00 31.60 ? 84   GLU P OE1 1 
ATOM   2625 O  OE2 . GLU C 3 46  ? 24.468  -1.767  53.575 1.00 31.83 ? 84   GLU P OE2 1 
ATOM   2626 N  N   . GLU C 3 47  ? 24.332  1.892   58.525 1.00 29.20 ? 85   GLU P N   1 
ATOM   2627 C  CA  . GLU C 3 47  ? 23.371  1.720   59.619 1.00 29.39 ? 85   GLU P CA  1 
ATOM   2628 C  C   . GLU C 3 47  ? 23.248  2.949   60.543 1.00 28.83 ? 85   GLU P C   1 
ATOM   2629 O  O   . GLU C 3 47  ? 22.876  2.823   61.706 1.00 28.85 ? 85   GLU P O   1 
ATOM   2630 C  CB  . GLU C 3 47  ? 23.710  0.443   60.404 1.00 29.40 ? 85   GLU P CB  1 
ATOM   2631 C  CG  . GLU C 3 47  ? 23.611  -0.818  59.535 1.00 30.03 ? 85   GLU P CG  1 
ATOM   2632 C  CD  . GLU C 3 47  ? 23.900  -2.113  60.280 1.00 30.60 ? 85   GLU P CD  1 
ATOM   2633 O  OE1 . GLU C 3 47  ? 23.824  -3.184  59.635 1.00 32.77 ? 85   GLU P OE1 1 
ATOM   2634 O  OE2 . GLU C 3 47  ? 24.195  -2.073  61.497 1.00 32.40 ? 85   GLU P OE2 1 
ATOM   2635 N  N   . THR C 3 48  ? 23.528  4.134   59.999 1.00 28.34 ? 86   THR P N   1 
ATOM   2636 C  CA  . THR C 3 48  ? 23.391  5.396   60.725 1.00 27.84 ? 86   THR P CA  1 
ATOM   2637 C  C   . THR C 3 48  ? 21.909  5.767   60.860 1.00 27.63 ? 86   THR P C   1 
ATOM   2638 O  O   . THR C 3 48  ? 21.201  5.864   59.855 1.00 27.55 ? 86   THR P O   1 
ATOM   2639 C  CB  . THR C 3 48  ? 24.141  6.545   59.981 1.00 27.80 ? 86   THR P CB  1 
ATOM   2640 O  OG1 . THR C 3 48  ? 25.514  6.181   59.776 1.00 27.09 ? 86   THR P OG1 1 
ATOM   2641 C  CG2 . THR C 3 48  ? 24.078  7.847   60.762 1.00 27.27 ? 86   THR P CG2 1 
ATOM   2642 N  N   . HIS C 3 49  ? 21.451  5.972   62.096 1.00 27.44 ? 87   HIS P N   1 
ATOM   2643 C  CA  A HIS C 3 49  ? 20.065  6.365   62.370 0.70 27.42 ? 87   HIS P CA  1 
ATOM   2644 C  CA  B HIS C 3 49  ? 20.062  6.355   62.354 0.30 27.31 ? 87   HIS P CA  1 
ATOM   2645 C  C   . HIS C 3 49  ? 19.835  7.828   61.997 1.00 27.24 ? 87   HIS P C   1 
ATOM   2646 O  O   . HIS C 3 49  ? 20.778  8.619   61.947 1.00 27.02 ? 87   HIS P O   1 
ATOM   2647 C  CB  A HIS C 3 49  ? 19.720  6.188   63.855 0.70 27.50 ? 87   HIS P CB  1 
ATOM   2648 C  CB  B HIS C 3 49  ? 19.703  6.089   63.824 0.30 27.30 ? 87   HIS P CB  1 
ATOM   2649 C  CG  A HIS C 3 49  ? 19.804  4.775   64.346 0.70 27.97 ? 87   HIS P CG  1 
ATOM   2650 C  CG  B HIS C 3 49  ? 18.229  6.044   64.096 0.30 27.33 ? 87   HIS P CG  1 
ATOM   2651 N  ND1 A HIS C 3 49  ? 20.645  4.393   65.371 0.70 28.41 ? 87   HIS P ND1 1 
ATOM   2652 N  ND1 B HIS C 3 49  ? 17.355  5.285   63.347 0.30 27.43 ? 87   HIS P ND1 1 
ATOM   2653 C  CD2 A HIS C 3 49  ? 19.139  3.657   63.970 0.70 28.34 ? 87   HIS P CD2 1 
ATOM   2654 C  CD2 B HIS C 3 49  ? 17.480  6.646   65.051 0.30 27.10 ? 87   HIS P CD2 1 
ATOM   2655 C  CE1 A HIS C 3 49  ? 20.501  3.100   65.598 0.70 28.38 ? 87   HIS P CE1 1 
ATOM   2656 C  CE1 B HIS C 3 49  ? 16.130  5.433   63.821 0.30 27.34 ? 87   HIS P CE1 1 
ATOM   2657 N  NE2 A HIS C 3 49  ? 19.592  2.630   64.763 0.70 28.62 ? 87   HIS P NE2 1 
ATOM   2658 N  NE2 B HIS C 3 49  ? 16.179  6.253   64.855 0.30 27.23 ? 87   HIS P NE2 1 
ATOM   2659 N  N   . LEU C 3 50  ? 18.575  8.178   61.749 1.00 27.03 ? 88   LEU P N   1 
ATOM   2660 C  CA  . LEU C 3 50  ? 18.155  9.545   61.415 1.00 26.91 ? 88   LEU P CA  1 
ATOM   2661 C  C   . LEU C 3 50  ? 18.636  10.591  62.431 1.00 26.96 ? 88   LEU P C   1 
ATOM   2662 O  O   . LEU C 3 50  ? 19.064  11.692  62.057 1.00 26.93 ? 88   LEU P O   1 
ATOM   2663 C  CB  . LEU C 3 50  ? 16.621  9.584   61.306 1.00 26.93 ? 88   LEU P CB  1 
ATOM   2664 C  CG  . LEU C 3 50  ? 15.902  10.915  61.088 1.00 26.97 ? 88   LEU P CG  1 
ATOM   2665 C  CD1 . LEU C 3 50  ? 16.343  11.553  59.782 1.00 26.55 ? 88   LEU P CD1 1 
ATOM   2666 C  CD2 . LEU C 3 50  ? 14.388  10.707  61.123 1.00 26.57 ? 88   LEU P CD2 1 
ATOM   2667 N  N   . SER C 3 51  ? 18.566  10.250  63.715 1.00 26.96 ? 89   SER P N   1 
ATOM   2668 C  CA  . SER C 3 51  ? 19.000  11.167  64.776 1.00 26.91 ? 89   SER P CA  1 
ATOM   2669 C  C   . SER C 3 51  ? 20.495  11.501  64.681 1.00 26.79 ? 89   SER P C   1 
ATOM   2670 O  O   . SER C 3 51  ? 20.904  12.625  64.983 1.00 26.76 ? 89   SER P O   1 
ATOM   2671 C  CB  . SER C 3 51  ? 18.674  10.578  66.147 1.00 26.84 ? 89   SER P CB  1 
ATOM   2672 O  OG  . SER C 3 51  ? 19.203  9.270   66.270 1.00 27.04 ? 89   SER P OG  1 
ATOM   2673 N  N   . GLN C 3 52  ? 21.295  10.517  64.265 1.00 26.79 ? 90   GLN P N   1 
ATOM   2674 C  CA  . GLN C 3 52  ? 22.738  10.689  64.081 1.00 26.84 ? 90   GLN P CA  1 
ATOM   2675 C  C   . GLN C 3 52  ? 23.009  11.541  62.853 1.00 26.54 ? 90   GLN P C   1 
ATOM   2676 O  O   . GLN C 3 52  ? 23.951  12.324  62.844 1.00 26.62 ? 90   GLN P O   1 
ATOM   2677 C  CB  . GLN C 3 52  ? 23.453  9.333   63.955 1.00 26.81 ? 90   GLN P CB  1 
ATOM   2678 C  CG  . GLN C 3 52  ? 23.379  8.476   65.220 1.00 27.30 ? 90   GLN P CG  1 
ATOM   2679 C  CD  . GLN C 3 52  ? 24.024  7.095   65.074 1.00 27.55 ? 90   GLN P CD  1 
ATOM   2680 O  OE1 . GLN C 3 52  ? 23.678  6.313   64.180 1.00 28.44 ? 90   GLN P OE1 1 
ATOM   2681 N  NE2 . GLN C 3 52  ? 24.949  6.782   65.979 1.00 27.37 ? 90   GLN P NE2 1 
ATOM   2682 N  N   . SER C 3 53  ? 22.178  11.385  61.823 1.00 26.48 ? 91   SER P N   1 
ATOM   2683 C  CA  A SER C 3 53  ? 22.301  12.186  60.606 0.50 26.47 ? 91   SER P CA  1 
ATOM   2684 C  CA  B SER C 3 53  ? 22.293  12.180  60.604 0.50 26.33 ? 91   SER P CA  1 
ATOM   2685 C  C   . SER C 3 53  ? 22.021  13.654  60.887 1.00 26.48 ? 91   SER P C   1 
ATOM   2686 O  O   . SER C 3 53  ? 22.746  14.536  60.412 1.00 26.56 ? 91   SER P O   1 
ATOM   2687 C  CB  A SER C 3 53  ? 21.352  11.681  59.515 0.50 26.32 ? 91   SER P CB  1 
ATOM   2688 C  CB  B SER C 3 53  ? 21.321  11.660  59.538 0.50 26.15 ? 91   SER P CB  1 
ATOM   2689 O  OG  A SER C 3 53  ? 21.748  10.404  59.058 0.50 26.30 ? 91   SER P OG  1 
ATOM   2690 O  OG  B SER C 3 53  ? 21.416  12.412  58.344 0.50 25.25 ? 91   SER P OG  1 
ATOM   2691 N  N   . GLU C 3 54  ? 20.970  13.912  61.656 1.00 26.85 ? 92   GLU P N   1 
ATOM   2692 C  CA  . GLU C 3 54  ? 20.594  15.275  62.024 1.00 27.23 ? 92   GLU P CA  1 
ATOM   2693 C  C   . GLU C 3 54  ? 21.645  15.925  62.924 1.00 27.17 ? 92   GLU P C   1 
ATOM   2694 O  O   . GLU C 3 54  ? 21.963  17.099  62.750 1.00 27.14 ? 92   GLU P O   1 
ATOM   2695 C  CB  . GLU C 3 54  ? 19.218  15.278  62.676 1.00 27.24 ? 92   GLU P CB  1 
ATOM   2696 C  CG  . GLU C 3 54  ? 18.118  14.942  61.679 1.00 28.30 ? 92   GLU P CG  1 
ATOM   2697 C  CD  . GLU C 3 54  ? 16.777  14.675  62.323 1.00 29.82 ? 92   GLU P CD  1 
ATOM   2698 O  OE1 . GLU C 3 54  ? 16.720  14.530  63.564 1.00 31.13 ? 92   GLU P OE1 1 
ATOM   2699 O  OE2 . GLU C 3 54  ? 15.773  14.606  61.580 1.00 31.33 ? 92   GLU P OE2 1 
ATOM   2700 N  N   . ARG C 3 55  ? 22.193  15.151  63.860 1.00 27.33 ? 93   ARG P N   1 
ATOM   2701 C  CA  A ARG C 3 55  ? 23.281  15.625  64.720 0.50 27.36 ? 93   ARG P CA  1 
ATOM   2702 C  CA  B ARG C 3 55  ? 23.280  15.617  64.724 0.50 27.44 ? 93   ARG P CA  1 
ATOM   2703 C  C   . ARG C 3 55  ? 24.523  15.968  63.903 1.00 27.35 ? 93   ARG P C   1 
ATOM   2704 O  O   . ARG C 3 55  ? 25.173  16.986  64.148 1.00 27.42 ? 93   ARG P O   1 
ATOM   2705 C  CB  A ARG C 3 55  ? 23.638  14.584  65.789 0.50 27.39 ? 93   ARG P CB  1 
ATOM   2706 C  CB  B ARG C 3 55  ? 23.628  14.550  65.771 0.50 27.47 ? 93   ARG P CB  1 
ATOM   2707 C  CG  A ARG C 3 55  ? 22.653  14.531  66.945 0.50 27.54 ? 93   ARG P CG  1 
ATOM   2708 C  CG  B ARG C 3 55  ? 24.526  15.037  66.909 0.50 27.71 ? 93   ARG P CG  1 
ATOM   2709 C  CD  A ARG C 3 55  ? 23.092  13.568  68.043 0.50 27.35 ? 93   ARG P CD  1 
ATOM   2710 C  CD  B ARG C 3 55  ? 24.894  13.897  67.852 0.50 27.75 ? 93   ARG P CD  1 
ATOM   2711 N  NE  A ARG C 3 55  ? 21.938  13.019  68.758 0.50 27.07 ? 93   ARG P NE  1 
ATOM   2712 N  NE  B ARG C 3 55  ? 25.894  14.298  68.842 0.50 28.49 ? 93   ARG P NE  1 
ATOM   2713 C  CZ  A ARG C 3 55  ? 21.401  11.816  68.551 0.50 27.07 ? 93   ARG P CZ  1 
ATOM   2714 C  CZ  B ARG C 3 55  ? 26.501  13.471  69.695 0.50 28.39 ? 93   ARG P CZ  1 
ATOM   2715 N  NH1 A ARG C 3 55  ? 21.906  10.978  67.648 0.50 27.02 ? 93   ARG P NH1 1 
ATOM   2716 N  NH1 B ARG C 3 55  ? 26.225  12.166  69.699 0.50 28.53 ? 93   ARG P NH1 1 
ATOM   2717 N  NH2 A ARG C 3 55  ? 20.346  11.438  69.266 0.50 27.29 ? 93   ARG P NH2 1 
ATOM   2718 N  NH2 B ARG C 3 55  ? 27.396  13.952  70.551 0.50 27.90 ? 93   ARG P NH2 1 
ATOM   2719 N  N   . THR C 3 56  ? 24.853  15.115  62.935 1.00 27.19 ? 94   THR P N   1 
ATOM   2720 C  CA  . THR C 3 56  ? 26.015  15.343  62.070 1.00 27.11 ? 94   THR P CA  1 
ATOM   2721 C  C   . THR C 3 56  ? 25.822  16.602  61.221 1.00 27.00 ? 94   THR P C   1 
ATOM   2722 O  O   . THR C 3 56  ? 26.764  17.366  61.025 1.00 26.99 ? 94   THR P O   1 
ATOM   2723 C  CB  . THR C 3 56  ? 26.303  14.115  61.170 1.00 27.08 ? 94   THR P CB  1 
ATOM   2724 O  OG1 . THR C 3 56  ? 26.722  13.016  61.984 1.00 27.18 ? 94   THR P OG1 1 
ATOM   2725 C  CG2 . THR C 3 56  ? 27.400  14.411  60.146 1.00 27.20 ? 94   THR P CG2 1 
ATOM   2726 N  N   . ALA C 3 57  ? 24.599  16.820  60.736 1.00 26.93 ? 95   ALA P N   1 
ATOM   2727 C  CA  . ALA C 3 57  ? 24.268  18.028  59.972 1.00 26.99 ? 95   ALA P CA  1 
ATOM   2728 C  C   . ALA C 3 57  ? 24.382  19.293  60.830 1.00 26.91 ? 95   ALA P C   1 
ATOM   2729 O  O   . ALA C 3 57  ? 24.941  20.291  60.392 1.00 26.84 ? 95   ALA P O   1 
ATOM   2730 C  CB  . ALA C 3 57  ? 22.864  17.915  59.373 1.00 27.15 ? 95   ALA P CB  1 
ATOM   2731 N  N   . ARG C 3 58  ? 23.850  19.239  62.048 1.00 27.01 ? 96   ARG P N   1 
ATOM   2732 C  CA  . ARG C 3 58  ? 23.959  20.350  63.000 1.00 27.33 ? 96   ARG P CA  1 
ATOM   2733 C  C   . ARG C 3 58  ? 25.405  20.701  63.358 1.00 26.83 ? 96   ARG P C   1 
ATOM   2734 O  O   . ARG C 3 58  ? 25.731  21.874  63.553 1.00 26.97 ? 96   ARG P O   1 
ATOM   2735 C  CB  . ARG C 3 58  ? 23.166  20.044  64.278 1.00 27.78 ? 96   ARG P CB  1 
ATOM   2736 C  CG  . ARG C 3 58  ? 21.733  20.562  64.242 1.00 29.74 ? 96   ARG P CG  1 
ATOM   2737 C  CD  . ARG C 3 58  ? 20.747  19.580  64.847 1.00 32.83 ? 96   ARG P CD  1 
ATOM   2738 N  NE  . ARG C 3 58  ? 21.198  19.044  66.132 1.00 33.71 ? 96   ARG P NE  1 
ATOM   2739 C  CZ  . ARG C 3 58  ? 20.730  17.925  66.687 1.00 34.41 ? 96   ARG P CZ  1 
ATOM   2740 N  NH1 . ARG C 3 58  ? 19.788  17.199  66.088 1.00 34.44 ? 96   ARG P NH1 1 
ATOM   2741 N  NH2 . ARG C 3 58  ? 21.212  17.524  67.855 1.00 35.16 ? 96   ARG P NH2 1 
ATOM   2742 N  N   . ARG C 3 59  ? 26.259  19.687  63.443 1.00 26.20 ? 97   ARG P N   1 
ATOM   2743 C  CA  . ARG C 3 59  ? 27.682  19.887  63.690 1.00 26.02 ? 97   ARG P CA  1 
ATOM   2744 C  C   . ARG C 3 59  ? 28.367  20.619  62.543 1.00 25.50 ? 97   ARG P C   1 
ATOM   2745 O  O   . ARG C 3 59  ? 29.171  21.519  62.767 1.00 25.78 ? 97   ARG P O   1 
ATOM   2746 C  CB  . ARG C 3 59  ? 28.371  18.540  63.912 1.00 26.25 ? 97   ARG P CB  1 
ATOM   2747 C  CG  . ARG C 3 59  ? 29.848  18.658  64.274 1.00 26.63 ? 97   ARG P CG  1 
ATOM   2748 C  CD  . ARG C 3 59  ? 30.135  17.947  65.572 1.00 28.55 ? 97   ARG P CD  1 
ATOM   2749 N  NE  . ARG C 3 59  ? 30.939  16.752  65.434 1.00 28.99 ? 97   ARG P NE  1 
ATOM   2750 C  CZ  . ARG C 3 59  ? 31.163  15.888  66.417 1.00 28.42 ? 97   ARG P CZ  1 
ATOM   2751 N  NH1 . ARG C 3 59  ? 30.609  16.061  67.611 1.00 27.27 ? 97   ARG P NH1 1 
ATOM   2752 N  NH2 . ARG C 3 59  ? 31.935  14.830  66.189 1.00 29.33 ? 97   ARG P NH2 1 
ATOM   2753 N  N   . LEU C 3 60  ? 28.065  20.206  61.320 1.00 25.17 ? 98   LEU P N   1 
ATOM   2754 C  CA  . LEU C 3 60  ? 28.550  20.883  60.125 1.00 24.83 ? 98   LEU P CA  1 
ATOM   2755 C  C   . LEU C 3 60  ? 28.205  22.366  60.163 1.00 24.90 ? 98   LEU P C   1 
ATOM   2756 O  O   . LEU C 3 60  ? 29.067  23.216  59.915 1.00 24.98 ? 98   LEU P O   1 
ATOM   2757 C  CB  . LEU C 3 60  ? 27.953  20.233  58.872 1.00 24.77 ? 98   LEU P CB  1 
ATOM   2758 C  CG  . LEU C 3 60  ? 28.167  20.924  57.526 1.00 24.86 ? 98   LEU P CG  1 
ATOM   2759 C  CD1 . LEU C 3 60  ? 29.590  21.433  57.385 1.00 26.67 ? 98   LEU P CD1 1 
ATOM   2760 C  CD2 . LEU C 3 60  ? 27.832  19.987  56.399 1.00 24.72 ? 98   LEU P CD2 1 
ATOM   2761 N  N   . GLN C 3 61  ? 26.947  22.665  60.477 1.00 24.75 ? 99   GLN P N   1 
ATOM   2762 C  CA  . GLN C 3 61  ? 26.468  24.043  60.552 1.00 25.21 ? 99   GLN P CA  1 
ATOM   2763 C  C   . GLN C 3 61  ? 27.167  24.830  61.649 1.00 24.75 ? 99   GLN P C   1 
ATOM   2764 O  O   . GLN C 3 61  ? 27.556  25.977  61.433 1.00 24.88 ? 99   GLN P O   1 
ATOM   2765 C  CB  . GLN C 3 61  ? 24.954  24.077  60.780 1.00 25.13 ? 99   GLN P CB  1 
ATOM   2766 C  CG  . GLN C 3 61  ? 24.161  23.582  59.588 1.00 26.27 ? 99   GLN P CG  1 
ATOM   2767 C  CD  . GLN C 3 61  ? 22.677  23.863  59.704 1.00 26.88 ? 99   GLN P CD  1 
ATOM   2768 O  OE1 . GLN C 3 61  ? 22.012  23.372  60.620 1.00 29.80 ? 99   GLN P OE1 1 
ATOM   2769 N  NE2 . GLN C 3 61  ? 22.144  24.640  58.762 1.00 29.23 ? 99   GLN P NE2 1 
ATOM   2770 N  N   . ALA C 3 62  ? 27.326  24.206  62.818 1.00 24.46 ? 100  ALA P N   1 
ATOM   2771 C  CA  . ALA C 3 62  ? 27.971  24.845  63.969 1.00 24.08 ? 100  ALA P CA  1 
ATOM   2772 C  C   . ALA C 3 62  ? 29.451  25.091  63.730 1.00 23.74 ? 100  ALA P C   1 
ATOM   2773 O  O   . ALA C 3 62  ? 29.936  26.191  63.991 1.00 23.86 ? 100  ALA P O   1 
ATOM   2774 C  CB  . ALA C 3 62  ? 27.776  24.013  65.228 1.00 23.87 ? 100  ALA P CB  1 
ATOM   2775 N  N   . GLN C 3 63  ? 30.165  24.084  63.228 1.00 23.58 ? 101  GLN P N   1 
ATOM   2776 C  CA  . GLN C 3 63  ? 31.610  24.226  62.942 1.00 23.31 ? 101  GLN P CA  1 
ATOM   2777 C  C   . GLN C 3 63  ? 31.881  25.278  61.879 1.00 23.40 ? 101  GLN P C   1 
ATOM   2778 O  O   . GLN C 3 63  ? 32.806  26.092  62.021 1.00 23.76 ? 101  GLN P O   1 
ATOM   2779 C  CB  . GLN C 3 63  ? 32.237  22.893  62.505 1.00 23.27 ? 101  GLN P CB  1 
ATOM   2780 C  CG  . GLN C 3 63  ? 32.354  21.859  63.629 1.00 23.29 ? 101  GLN P CG  1 
ATOM   2781 C  CD  . GLN C 3 63  ? 32.955  20.524  63.182 1.00 23.04 ? 101  GLN P CD  1 
ATOM   2782 O  OE1 . GLN C 3 63  ? 32.960  20.188  61.998 1.00 23.72 ? 101  GLN P OE1 1 
ATOM   2783 N  NE2 . GLN C 3 63  ? 33.450  19.756  64.140 1.00 21.29 ? 101  GLN P NE2 1 
ATOM   2784 N  N   . ALA C 3 64  ? 31.077  25.256  60.818 1.00 23.56 ? 102  ALA P N   1 
ATOM   2785 C  CA  . ALA C 3 64  ? 31.210  26.197  59.706 1.00 23.59 ? 102  ALA P CA  1 
ATOM   2786 C  C   . ALA C 3 64  ? 30.945  27.622  60.155 1.00 23.76 ? 102  ALA P C   1 
ATOM   2787 O  O   . ALA C 3 64  ? 31.725  28.524  59.855 1.00 23.92 ? 102  ALA P O   1 
ATOM   2788 C  CB  . ALA C 3 64  ? 30.263  25.824  58.572 1.00 23.49 ? 102  ALA P CB  1 
ATOM   2789 N  N   . ALA C 3 65  ? 29.841  27.816  60.874 1.00 24.08 ? 103  ALA P N   1 
ATOM   2790 C  CA  . ALA C 3 65  ? 29.433  29.135  61.370 1.00 23.99 ? 103  ALA P CA  1 
ATOM   2791 C  C   . ALA C 3 65  ? 30.530  29.783  62.198 1.00 24.13 ? 103  ALA P C   1 
ATOM   2792 O  O   . ALA C 3 65  ? 30.785  30.969  62.065 1.00 24.66 ? 103  ALA P O   1 
ATOM   2793 C  CB  . ALA C 3 65  ? 28.169  29.012  62.199 1.00 24.06 ? 103  ALA P CB  1 
ATOM   2794 N  N   . ARG C 3 66  ? 31.182  28.994  63.048 1.00 24.19 ? 104  ARG P N   1 
ATOM   2795 C  CA  . ARG C 3 66  ? 32.247  29.493  63.909 1.00 23.75 ? 104  ARG P CA  1 
ATOM   2796 C  C   . ARG C 3 66  ? 33.512  29.847  63.132 1.00 23.85 ? 104  ARG P C   1 
ATOM   2797 O  O   . ARG C 3 66  ? 34.328  30.628  63.619 1.00 23.53 ? 104  ARG P O   1 
ATOM   2798 C  CB  . ARG C 3 66  ? 32.554  28.477  65.009 1.00 23.67 ? 104  ARG P CB  1 
ATOM   2799 C  CG  . ARG C 3 66  ? 31.506  28.472  66.099 1.00 22.89 ? 104  ARG P CG  1 
ATOM   2800 C  CD  . ARG C 3 66  ? 31.438  27.157  66.843 1.00 21.80 ? 104  ARG P CD  1 
ATOM   2801 N  NE  . ARG C 3 66  ? 32.588  26.925  67.712 1.00 21.66 ? 104  ARG P NE  1 
ATOM   2802 C  CZ  . ARG C 3 66  ? 32.749  27.463  68.918 1.00 20.40 ? 104  ARG P CZ  1 
ATOM   2803 N  NH1 . ARG C 3 66  ? 31.835  28.264  69.442 1.00 21.36 ? 104  ARG P NH1 1 
ATOM   2804 N  NH2 . ARG C 3 66  ? 33.828  27.176  69.616 1.00 20.34 ? 104  ARG P NH2 1 
ATOM   2805 N  N   . ARG C 3 67  ? 33.659  29.279  61.934 1.00 23.89 ? 105  ARG P N   1 
ATOM   2806 C  CA  . ARG C 3 67  ? 34.755  29.620  61.027 1.00 23.95 ? 105  ARG P CA  1 
ATOM   2807 C  C   . ARG C 3 67  ? 34.397  30.727  60.028 1.00 23.85 ? 105  ARG P C   1 
ATOM   2808 O  O   . ARG C 3 67  ? 35.248  31.139  59.227 1.00 24.04 ? 105  ARG P O   1 
ATOM   2809 C  CB  . ARG C 3 67  ? 35.212  28.380  60.267 1.00 24.11 ? 105  ARG P CB  1 
ATOM   2810 C  CG  . ARG C 3 67  ? 35.835  27.336  61.157 1.00 24.87 ? 105  ARG P CG  1 
ATOM   2811 C  CD  . ARG C 3 67  ? 36.302  26.132  60.357 1.00 25.91 ? 105  ARG P CD  1 
ATOM   2812 N  NE  . ARG C 3 67  ? 36.123  24.904  61.124 1.00 26.90 ? 105  ARG P NE  1 
ATOM   2813 C  CZ  . ARG C 3 67  ? 36.491  23.693  60.716 1.00 27.00 ? 105  ARG P CZ  1 
ATOM   2814 N  NH1 . ARG C 3 67  ? 37.098  23.527  59.547 1.00 27.23 ? 105  ARG P NH1 1 
ATOM   2815 N  NH2 . ARG C 3 67  ? 36.265  22.642  61.504 1.00 27.36 ? 105  ARG P NH2 1 
ATOM   2816 N  N   . GLY C 3 68  ? 33.149  31.196  60.074 1.00 23.53 ? 106  GLY P N   1 
ATOM   2817 C  CA  . GLY C 3 68  ? 32.693  32.324  59.263 1.00 23.20 ? 106  GLY P CA  1 
ATOM   2818 C  C   . GLY C 3 68  ? 31.907  31.961  58.012 1.00 23.10 ? 106  GLY P C   1 
ATOM   2819 O  O   . GLY C 3 68  ? 31.859  32.748  57.075 1.00 22.78 ? 106  GLY P O   1 
ATOM   2820 N  N   . TYR C 3 69  ? 31.269  30.789  58.006 1.00 23.15 ? 107  TYR P N   1 
ATOM   2821 C  CA  . TYR C 3 69  ? 30.571  30.285  56.824 1.00 23.25 ? 107  TYR P CA  1 
ATOM   2822 C  C   . TYR C 3 69  ? 29.085  29.976  57.072 1.00 23.60 ? 107  TYR P C   1 
ATOM   2823 O  O   . TYR C 3 69  ? 28.721  29.390  58.088 1.00 23.47 ? 107  TYR P O   1 
ATOM   2824 C  CB  . TYR C 3 69  ? 31.250  29.007  56.323 1.00 23.18 ? 107  TYR P CB  1 
ATOM   2825 C  CG  . TYR C 3 69  ? 32.615  29.192  55.688 1.00 22.97 ? 107  TYR P CG  1 
ATOM   2826 C  CD1 . TYR C 3 69  ? 32.769  29.168  54.304 1.00 23.15 ? 107  TYR P CD1 1 
ATOM   2827 C  CD2 . TYR C 3 69  ? 33.755  29.358  56.468 1.00 23.29 ? 107  TYR P CD2 1 
ATOM   2828 C  CE1 . TYR C 3 69  ? 34.023  29.323  53.714 1.00 23.78 ? 107  TYR P CE1 1 
ATOM   2829 C  CE2 . TYR C 3 69  ? 35.015  29.514  55.889 1.00 23.15 ? 107  TYR P CE2 1 
ATOM   2830 C  CZ  . TYR C 3 69  ? 35.142  29.494  54.516 1.00 23.23 ? 107  TYR P CZ  1 
ATOM   2831 O  OH  . TYR C 3 69  ? 36.380  29.643  53.940 1.00 22.98 ? 107  TYR P OH  1 
ATOM   2832 N  N   . LEU C 3 70  ? 28.239  30.350  56.112 1.00 23.97 ? 108  LEU P N   1 
ATOM   2833 C  CA  . LEU C 3 70  ? 26.840  29.912  56.078 1.00 24.23 ? 108  LEU P CA  1 
ATOM   2834 C  C   . LEU C 3 70  ? 26.762  28.549  55.387 1.00 24.42 ? 108  LEU P C   1 
ATOM   2835 O  O   . LEU C 3 70  ? 27.435  28.315  54.380 1.00 24.72 ? 108  LEU P O   1 
ATOM   2836 C  CB  . LEU C 3 70  ? 25.987  30.918  55.292 1.00 24.41 ? 108  LEU P CB  1 
ATOM   2837 C  CG  . LEU C 3 70  ? 24.545  31.244  55.707 1.00 24.81 ? 108  LEU P CG  1 
ATOM   2838 C  CD1 . LEU C 3 70  ? 23.675  31.390  54.462 1.00 24.09 ? 108  LEU P CD1 1 
ATOM   2839 C  CD2 . LEU C 3 70  ? 23.943  30.212  56.666 1.00 26.19 ? 108  LEU P CD2 1 
ATOM   2840 N  N   . THR C 3 71  ? 25.956  27.645  55.931 1.00 24.39 ? 109  THR P N   1 
ATOM   2841 C  CA  . THR C 3 71  ? 25.621  26.407  55.245 1.00 24.28 ? 109  THR P CA  1 
ATOM   2842 C  C   . THR C 3 71  ? 24.115  26.223  55.299 1.00 24.47 ? 109  THR P C   1 
ATOM   2843 O  O   . THR C 3 71  ? 23.475  26.635  56.264 1.00 24.81 ? 109  THR P O   1 
ATOM   2844 C  CB  . THR C 3 71  ? 26.326  25.177  55.863 1.00 24.33 ? 109  THR P CB  1 
ATOM   2845 O  OG1 . THR C 3 71  ? 25.841  24.948  57.186 1.00 24.05 ? 109  THR P OG1 1 
ATOM   2846 C  CG2 . THR C 3 71  ? 27.842  25.376  55.895 1.00 23.40 ? 109  THR P CG2 1 
ATOM   2847 N  N   . LYS C 3 72  ? 23.551  25.628  54.253 1.00 24.52 ? 110  LYS P N   1 
ATOM   2848 C  CA  . LYS C 3 72  ? 22.117  25.363  54.191 1.00 24.67 ? 110  LYS P CA  1 
ATOM   2849 C  C   . LYS C 3 72  ? 21.873  23.877  53.991 1.00 24.29 ? 110  LYS P C   1 
ATOM   2850 O  O   . LYS C 3 72  ? 22.220  23.332  52.961 1.00 24.22 ? 110  LYS P O   1 
ATOM   2851 C  CB  . LYS C 3 72  ? 21.472  26.171  53.058 1.00 24.86 ? 110  LYS P CB  1 
ATOM   2852 C  CG  . LYS C 3 72  ? 21.659  27.683  53.196 1.00 25.18 ? 110  LYS P CG  1 
ATOM   2853 C  CD  . LYS C 3 72  ? 20.974  28.458  52.084 1.00 25.20 ? 110  LYS P CD  1 
ATOM   2854 C  CE  . LYS C 3 72  ? 21.160  29.966  52.262 1.00 25.85 ? 110  LYS P CE  1 
ATOM   2855 N  NZ  . LYS C 3 72  ? 20.231  30.766  51.393 1.00 27.30 ? 110  LYS P NZ  1 
ATOM   2856 N  N   . ILE C 3 73  ? 21.291  23.223  54.993 1.00 24.55 ? 111  ILE P N   1 
ATOM   2857 C  CA  . ILE C 3 73  ? 20.846  21.835  54.856 1.00 24.41 ? 111  ILE P CA  1 
ATOM   2858 C  C   . ILE C 3 73  ? 19.529  21.894  54.099 1.00 24.53 ? 111  ILE P C   1 
ATOM   2859 O  O   . ILE C 3 73  ? 18.538  22.406  54.616 1.00 24.10 ? 111  ILE P O   1 
ATOM   2860 C  CB  . ILE C 3 73  ? 20.647  21.130  56.227 1.00 24.51 ? 111  ILE P CB  1 
ATOM   2861 C  CG1 . ILE C 3 73  ? 21.915  21.223  57.088 1.00 24.17 ? 111  ILE P CG1 1 
ATOM   2862 C  CG2 . ILE C 3 73  ? 20.254  19.669  56.033 1.00 24.18 ? 111  ILE P CG2 1 
ATOM   2863 C  CD1 . ILE C 3 73  ? 23.177  20.898  56.354 1.00 24.00 ? 111  ILE P CD1 1 
ATOM   2864 N  N   . LEU C 3 74  ? 19.543  21.409  52.859 1.00 24.68 ? 112  LEU P N   1 
ATOM   2865 C  CA  . LEU C 3 74  ? 18.386  21.494  51.972 1.00 24.73 ? 112  LEU P CA  1 
ATOM   2866 C  C   . LEU C 3 74  ? 17.415  20.338  52.176 1.00 24.82 ? 112  LEU P C   1 
ATOM   2867 O  O   . LEU C 3 74  ? 16.210  20.489  51.967 1.00 24.97 ? 112  LEU P O   1 
ATOM   2868 C  CB  . LEU C 3 74  ? 18.835  21.511  50.507 1.00 24.76 ? 112  LEU P CB  1 
ATOM   2869 C  CG  . LEU C 3 74  ? 19.700  22.677  50.044 1.00 24.27 ? 112  LEU P CG  1 
ATOM   2870 C  CD1 . LEU C 3 74  ? 19.962  22.581  48.545 1.00 23.30 ? 112  LEU P CD1 1 
ATOM   2871 C  CD2 . LEU C 3 74  ? 19.049  24.000  50.390 1.00 24.31 ? 112  LEU P CD2 1 
ATOM   2872 N  N   . HIS C 3 75  ? 17.947  19.193  52.586 1.00 24.81 ? 113  HIS P N   1 
ATOM   2873 C  CA  . HIS C 3 75  ? 17.167  17.982  52.723 1.00 24.72 ? 113  HIS P CA  1 
ATOM   2874 C  C   . HIS C 3 75  ? 17.941  16.959  53.548 1.00 24.99 ? 113  HIS P C   1 
ATOM   2875 O  O   . HIS C 3 75  ? 19.132  16.763  53.329 1.00 25.01 ? 113  HIS P O   1 
ATOM   2876 C  CB  . HIS C 3 75  ? 16.871  17.417  51.329 1.00 24.57 ? 113  HIS P CB  1 
ATOM   2877 C  CG  . HIS C 3 75  ? 15.972  16.224  51.342 1.00 24.12 ? 113  HIS P CG  1 
ATOM   2878 N  ND1 . HIS C 3 75  ? 16.443  14.940  51.177 1.00 23.60 ? 113  HIS P ND1 1 
ATOM   2879 C  CD2 . HIS C 3 75  ? 14.635  16.115  51.520 1.00 23.96 ? 113  HIS P CD2 1 
ATOM   2880 C  CE1 . HIS C 3 75  ? 15.434  14.093  51.244 1.00 23.59 ? 113  HIS P CE1 1 
ATOM   2881 N  NE2 . HIS C 3 75  ? 14.326  14.779  51.450 1.00 23.84 ? 113  HIS P NE2 1 
ATOM   2882 N  N   . VAL C 3 76  ? 17.269  16.321  54.503 1.00 25.73 ? 114  VAL P N   1 
ATOM   2883 C  CA  . VAL C 3 76  ? 17.845  15.185  55.237 1.00 26.35 ? 114  VAL P CA  1 
ATOM   2884 C  C   . VAL C 3 76  ? 17.175  13.916  54.730 1.00 27.25 ? 114  VAL P C   1 
ATOM   2885 O  O   . VAL C 3 76  ? 15.957  13.834  54.697 1.00 27.12 ? 114  VAL P O   1 
ATOM   2886 C  CB  . VAL C 3 76  ? 17.671  15.328  56.777 1.00 26.33 ? 114  VAL P CB  1 
ATOM   2887 C  CG1 . VAL C 3 76  ? 18.276  14.132  57.514 1.00 25.13 ? 114  VAL P CG1 1 
ATOM   2888 C  CG2 . VAL C 3 76  ? 18.309  16.634  57.264 1.00 25.51 ? 114  VAL P CG2 1 
ATOM   2889 N  N   . PHE C 3 77  ? 17.979  12.947  54.302 1.00 28.78 ? 115  PHE P N   1 
ATOM   2890 C  CA  . PHE C 3 77  ? 17.461  11.690  53.763 1.00 30.03 ? 115  PHE P CA  1 
ATOM   2891 C  C   . PHE C 3 77  ? 17.054  10.738  54.885 1.00 31.36 ? 115  PHE P C   1 
ATOM   2892 O  O   . PHE C 3 77  ? 17.795  10.557  55.854 1.00 31.74 ? 115  PHE P O   1 
ATOM   2893 C  CB  . PHE C 3 77  ? 18.506  10.991  52.876 1.00 30.10 ? 115  PHE P CB  1 
ATOM   2894 C  CG  . PHE C 3 77  ? 18.834  11.731  51.606 1.00 30.01 ? 115  PHE P CG  1 
ATOM   2895 C  CD1 . PHE C 3 77  ? 18.116  11.495  50.442 1.00 30.47 ? 115  PHE P CD1 1 
ATOM   2896 C  CD2 . PHE C 3 77  ? 19.872  12.647  51.568 1.00 30.48 ? 115  PHE P CD2 1 
ATOM   2897 C  CE1 . PHE C 3 77  ? 18.417  12.172  49.268 1.00 30.11 ? 115  PHE P CE1 1 
ATOM   2898 C  CE2 . PHE C 3 77  ? 20.180  13.328  50.398 1.00 30.51 ? 115  PHE P CE2 1 
ATOM   2899 C  CZ  . PHE C 3 77  ? 19.448  13.096  49.248 1.00 30.41 ? 115  PHE P CZ  1 
ATOM   2900 N  N   . HIS C 3 78  ? 15.869  10.149  54.764 1.00 32.77 ? 116  HIS P N   1 
ATOM   2901 C  CA  . HIS C 3 78  ? 15.535  8.971   55.553 1.00 34.02 ? 116  HIS P CA  1 
ATOM   2902 C  C   . HIS C 3 78  ? 14.663  8.009   54.772 1.00 34.31 ? 116  HIS P C   1 
ATOM   2903 O  O   . HIS C 3 78  ? 13.445  8.156   54.730 1.00 34.78 ? 116  HIS P O   1 
ATOM   2904 C  CB  . HIS C 3 78  ? 14.893  9.321   56.910 1.00 34.71 ? 116  HIS P CB  1 
ATOM   2905 C  CG  . HIS C 3 78  ? 13.955  10.493  56.886 1.00 35.94 ? 116  HIS P CG  1 
ATOM   2906 N  ND1 . HIS C 3 78  ? 14.372  11.786  57.139 1.00 36.94 ? 116  HIS P ND1 1 
ATOM   2907 C  CD2 . HIS C 3 78  ? 12.611  10.556  56.723 1.00 36.24 ? 116  HIS P CD2 1 
ATOM   2908 C  CE1 . HIS C 3 78  ? 13.330  12.598  57.099 1.00 37.12 ? 116  HIS P CE1 1 
ATOM   2909 N  NE2 . HIS C 3 78  ? 12.250  11.877  56.849 1.00 37.18 ? 116  HIS P NE2 1 
ATOM   2910 N  N   . GLY C 3 79  ? 15.299  7.023   54.146 1.00 34.56 ? 117  GLY P N   1 
ATOM   2911 C  CA  . GLY C 3 79  ? 14.568  5.992   53.418 1.00 34.58 ? 117  GLY P CA  1 
ATOM   2912 C  C   . GLY C 3 79  ? 15.468  5.084   52.607 1.00 34.44 ? 117  GLY P C   1 
ATOM   2913 O  O   . GLY C 3 79  ? 15.546  3.879   52.860 1.00 35.02 ? 117  GLY P O   1 
ATOM   2914 N  N   . LEU C 3 80  ? 16.133  5.659   51.615 1.00 34.13 ? 118  LEU P N   1 
ATOM   2915 C  CA  . LEU C 3 80  ? 17.050  4.892   50.787 1.00 33.85 ? 118  LEU P CA  1 
ATOM   2916 C  C   . LEU C 3 80  ? 18.410  4.854   51.458 1.00 33.44 ? 118  LEU P C   1 
ATOM   2917 O  O   . LEU C 3 80  ? 18.864  3.795   51.884 1.00 33.77 ? 118  LEU P O   1 
ATOM   2918 C  CB  . LEU C 3 80  ? 17.153  5.473   49.372 1.00 33.78 ? 118  LEU P CB  1 
ATOM   2919 C  CG  . LEU C 3 80  ? 16.037  5.064   48.416 1.00 33.80 ? 118  LEU P CG  1 
ATOM   2920 C  CD1 . LEU C 3 80  ? 16.406  5.500   47.020 1.00 33.82 ? 118  LEU P CD1 1 
ATOM   2921 C  CD2 . LEU C 3 80  ? 15.785  3.562   48.465 1.00 32.89 ? 118  LEU P CD2 1 
ATOM   2922 N  N   . LEU C 3 81  ? 19.045  6.011   51.577 1.00 32.77 ? 119  LEU P N   1 
ATOM   2923 C  CA  . LEU C 3 81  ? 20.342  6.085   52.224 1.00 32.41 ? 119  LEU P CA  1 
ATOM   2924 C  C   . LEU C 3 81  ? 20.353  7.112   53.353 1.00 31.48 ? 119  LEU P C   1 
ATOM   2925 O  O   . LEU C 3 81  ? 19.509  8.007   53.391 1.00 31.46 ? 119  LEU P O   1 
ATOM   2926 C  CB  . LEU C 3 81  ? 21.448  6.366   51.197 1.00 32.58 ? 119  LEU P CB  1 
ATOM   2927 C  CG  . LEU C 3 81  ? 21.140  7.213   49.963 1.00 33.28 ? 119  LEU P CG  1 
ATOM   2928 C  CD1 . LEU C 3 81  ? 20.721  8.627   50.352 1.00 33.25 ? 119  LEU P CD1 1 
ATOM   2929 C  CD2 . LEU C 3 81  ? 22.364  7.231   49.046 1.00 32.82 ? 119  LEU P CD2 1 
ATOM   2930 N  N   . PRO C 3 82  ? 21.306  6.972   54.289 1.00 30.33 ? 120  PRO P N   1 
ATOM   2931 C  CA  . PRO C 3 82  ? 21.428  7.941   55.360 1.00 29.64 ? 120  PRO P CA  1 
ATOM   2932 C  C   . PRO C 3 82  ? 22.343  9.069   54.931 1.00 28.71 ? 120  PRO P C   1 
ATOM   2933 O  O   . PRO C 3 82  ? 23.387  8.822   54.322 1.00 28.76 ? 120  PRO P O   1 
ATOM   2934 C  CB  . PRO C 3 82  ? 22.059  7.135   56.494 1.00 29.57 ? 120  PRO P CB  1 
ATOM   2935 C  CG  . PRO C 3 82  ? 22.831  6.050   55.815 1.00 30.16 ? 120  PRO P CG  1 
ATOM   2936 C  CD  . PRO C 3 82  ? 22.335  5.923   54.393 1.00 30.42 ? 120  PRO P CD  1 
ATOM   2937 N  N   . GLY C 3 83  ? 21.946  10.296  55.232 1.00 27.69 ? 121  GLY P N   1 
ATOM   2938 C  CA  . GLY C 3 83  ? 22.749  11.456  54.892 1.00 27.06 ? 121  GLY P CA  1 
ATOM   2939 C  C   . GLY C 3 83  ? 21.897  12.683  54.688 1.00 26.56 ? 121  GLY P C   1 
ATOM   2940 O  O   . GLY C 3 83  ? 20.743  12.737  55.118 1.00 26.23 ? 121  GLY P O   1 
ATOM   2941 N  N   . PHE C 3 84  ? 22.471  13.672  54.016 1.00 26.05 ? 122  PHE P N   1 
ATOM   2942 C  CA  . PHE C 3 84  ? 21.779  14.930  53.782 1.00 25.63 ? 122  PHE P CA  1 
ATOM   2943 C  C   . PHE C 3 84  ? 22.393  15.716  52.630 1.00 25.52 ? 122  PHE P C   1 
ATOM   2944 O  O   . PHE C 3 84  ? 23.526  15.467  52.218 1.00 24.84 ? 122  PHE P O   1 
ATOM   2945 C  CB  . PHE C 3 84  ? 21.756  15.777  55.060 1.00 25.47 ? 122  PHE P CB  1 
ATOM   2946 C  CG  . PHE C 3 84  ? 23.115  16.021  55.655 1.00 24.89 ? 122  PHE P CG  1 
ATOM   2947 C  CD1 . PHE C 3 84  ? 23.618  15.178  56.632 1.00 24.98 ? 122  PHE P CD1 1 
ATOM   2948 C  CD2 . PHE C 3 84  ? 23.883  17.094  55.242 1.00 24.45 ? 122  PHE P CD2 1 
ATOM   2949 C  CE1 . PHE C 3 84  ? 24.865  15.397  57.184 1.00 25.29 ? 122  PHE P CE1 1 
ATOM   2950 C  CE2 . PHE C 3 84  ? 25.128  17.320  55.785 1.00 25.17 ? 122  PHE P CE2 1 
ATOM   2951 C  CZ  . PHE C 3 84  ? 25.624  16.469  56.760 1.00 25.06 ? 122  PHE P CZ  1 
ATOM   2952 N  N   . LEU C 3 85  ? 21.605  16.660  52.132 1.00 25.64 ? 123  LEU P N   1 
ATOM   2953 C  CA  . LEU C 3 85  ? 21.973  17.536  51.043 1.00 25.94 ? 123  LEU P CA  1 
ATOM   2954 C  C   . LEU C 3 85  ? 22.294  18.906  51.637 1.00 26.21 ? 123  LEU P C   1 
ATOM   2955 O  O   . LEU C 3 85  ? 21.469  19.498  52.332 1.00 26.39 ? 123  LEU P O   1 
ATOM   2956 C  CB  . LEU C 3 85  ? 20.808  17.637  50.049 1.00 26.02 ? 123  LEU P CB  1 
ATOM   2957 C  CG  . LEU C 3 85  ? 21.025  18.447  48.769 1.00 26.64 ? 123  LEU P CG  1 
ATOM   2958 C  CD1 . LEU C 3 85  ? 22.057  17.756  47.857 1.00 26.80 ? 123  LEU P CD1 1 
ATOM   2959 C  CD2 . LEU C 3 85  ? 19.700  18.679  48.050 1.00 25.90 ? 123  LEU P CD2 1 
ATOM   2960 N  N   . VAL C 3 86  ? 23.501  19.397  51.370 1.00 26.48 ? 124  VAL P N   1 
ATOM   2961 C  CA  . VAL C 3 86  ? 23.968  20.666  51.917 1.00 26.35 ? 124  VAL P CA  1 
ATOM   2962 C  C   . VAL C 3 86  ? 24.412  21.588  50.781 1.00 26.52 ? 124  VAL P C   1 
ATOM   2963 O  O   . VAL C 3 86  ? 25.030  21.146  49.811 1.00 26.75 ? 124  VAL P O   1 
ATOM   2964 C  CB  . VAL C 3 86  ? 25.135  20.452  52.949 1.00 26.52 ? 124  VAL P CB  1 
ATOM   2965 C  CG1 . VAL C 3 86  ? 26.321  19.772  52.297 1.00 26.20 ? 124  VAL P CG1 1 
ATOM   2966 C  CG2 . VAL C 3 86  ? 25.559  21.770  53.608 1.00 25.65 ? 124  VAL P CG2 1 
ATOM   2967 N  N   . LYS C 3 87  ? 24.075  22.866  50.913 1.00 26.36 ? 125  LYS P N   1 
ATOM   2968 C  CA  . LYS C 3 87  ? 24.565  23.909  50.037 1.00 26.38 ? 125  LYS P CA  1 
ATOM   2969 C  C   . LYS C 3 87  ? 25.550  24.758  50.842 1.00 26.17 ? 125  LYS P C   1 
ATOM   2970 O  O   . LYS C 3 87  ? 25.197  25.290  51.899 1.00 25.79 ? 125  LYS P O   1 
ATOM   2971 C  CB  . LYS C 3 87  ? 23.396  24.754  49.548 1.00 26.39 ? 125  LYS P CB  1 
ATOM   2972 C  CG  . LYS C 3 87  ? 23.722  25.704  48.425 1.00 27.27 ? 125  LYS P CG  1 
ATOM   2973 C  CD  . LYS C 3 87  ? 22.441  26.162  47.686 1.00 27.75 ? 125  LYS P CD  1 
ATOM   2974 C  CE  . LYS C 3 87  ? 22.573  27.598  47.160 1.00 29.55 ? 125  LYS P CE  1 
ATOM   2975 N  NZ  . LYS C 3 87  ? 21.903  27.794  45.835 1.00 30.72 ? 125  LYS P NZ  1 
ATOM   2976 N  N   . MET C 3 88  ? 26.786  24.855  50.353 1.00 25.80 ? 126  MET P N   1 
ATOM   2977 C  CA  . MET C 3 88  ? 27.860  25.542  51.061 1.00 25.81 ? 126  MET P CA  1 
ATOM   2978 C  C   . MET C 3 88  ? 29.037  25.847  50.125 1.00 25.59 ? 126  MET P C   1 
ATOM   2979 O  O   . MET C 3 88  ? 29.011  25.521  48.940 1.00 25.75 ? 126  MET P O   1 
ATOM   2980 C  CB  . MET C 3 88  ? 28.339  24.687  52.235 1.00 25.64 ? 126  MET P CB  1 
ATOM   2981 C  CG  . MET C 3 88  ? 28.920  23.350  51.813 1.00 26.24 ? 126  MET P CG  1 
ATOM   2982 S  SD  . MET C 3 88  ? 29.437  22.297  53.174 1.00 26.45 ? 126  MET P SD  1 
ATOM   2983 C  CE  . MET C 3 88  ? 30.568  21.190  52.324 1.00 25.79 ? 126  MET P CE  1 
ATOM   2984 N  N   . SER C 3 89  ? 30.063  26.487  50.668 1.00 25.75 ? 127  SER P N   1 
ATOM   2985 C  CA  . SER C 3 89  ? 31.323  26.677  49.954 1.00 25.59 ? 127  SER P CA  1 
ATOM   2986 C  C   . SER C 3 89  ? 32.091  25.358  49.905 1.00 25.76 ? 127  SER P C   1 
ATOM   2987 O  O   . SER C 3 89  ? 32.072  24.587  50.859 1.00 26.01 ? 127  SER P O   1 
ATOM   2988 C  CB  . SER C 3 89  ? 32.176  27.733  50.648 1.00 25.38 ? 127  SER P CB  1 
ATOM   2989 O  OG  . SER C 3 89  ? 33.470  27.805  50.077 1.00 24.62 ? 127  SER P OG  1 
ATOM   2990 N  N   . GLY C 3 90  ? 32.773  25.112  48.793 1.00 25.95 ? 128  GLY P N   1 
ATOM   2991 C  CA  . GLY C 3 90  ? 33.643  23.952  48.663 1.00 26.04 ? 128  GLY P CA  1 
ATOM   2992 C  C   . GLY C 3 90  ? 34.871  24.014  49.562 1.00 25.84 ? 128  GLY P C   1 
ATOM   2993 O  O   . GLY C 3 90  ? 35.570  23.018  49.714 1.00 25.88 ? 128  GLY P O   1 
ATOM   2994 N  N   . ASP C 3 91  ? 35.145  25.188  50.130 1.00 25.85 ? 129  ASP P N   1 
ATOM   2995 C  CA  . ASP C 3 91  ? 36.116  25.349  51.219 1.00 25.66 ? 129  ASP P CA  1 
ATOM   2996 C  C   . ASP C 3 91  ? 35.864  24.438  52.423 1.00 25.54 ? 129  ASP P C   1 
ATOM   2997 O  O   . ASP C 3 91  ? 36.794  24.099  53.149 1.00 25.28 ? 129  ASP P O   1 
ATOM   2998 C  CB  . ASP C 3 91  ? 36.086  26.785  51.751 1.00 25.83 ? 129  ASP P CB  1 
ATOM   2999 C  CG  . ASP C 3 91  ? 36.719  27.780  50.810 1.00 25.95 ? 129  ASP P CG  1 
ATOM   3000 O  OD1 . ASP C 3 91  ? 37.186  27.378  49.725 1.00 27.72 ? 129  ASP P OD1 1 
ATOM   3001 O  OD2 . ASP C 3 91  ? 36.740  28.974  51.165 1.00 24.35 ? 129  ASP P OD2 1 
ATOM   3002 N  N   . LEU C 3 92  ? 34.603  24.082  52.652 1.00 25.50 ? 130  LEU P N   1 
ATOM   3003 C  CA  . LEU C 3 92  ? 34.221  23.318  53.835 1.00 25.38 ? 130  LEU P CA  1 
ATOM   3004 C  C   . LEU C 3 92  ? 34.248  21.805  53.626 1.00 25.59 ? 130  LEU P C   1 
ATOM   3005 O  O   . LEU C 3 92  ? 33.784  21.070  54.491 1.00 25.70 ? 130  LEU P O   1 
ATOM   3006 C  CB  . LEU C 3 92  ? 32.821  23.743  54.310 1.00 25.24 ? 130  LEU P CB  1 
ATOM   3007 C  CG  . LEU C 3 92  ? 32.628  25.218  54.673 1.00 24.02 ? 130  LEU P CG  1 
ATOM   3008 C  CD1 . LEU C 3 92  ? 31.155  25.485  54.995 1.00 22.77 ? 130  LEU P CD1 1 
ATOM   3009 C  CD2 . LEU C 3 92  ? 33.523  25.605  55.831 1.00 22.20 ? 130  LEU P CD2 1 
ATOM   3010 N  N   . LEU C 3 93  ? 34.792  21.329  52.509 1.00 25.95 ? 131  LEU P N   1 
ATOM   3011 C  CA  . LEU C 3 93  ? 34.796  19.889  52.242 1.00 26.52 ? 131  LEU P CA  1 
ATOM   3012 C  C   . LEU C 3 93  ? 35.707  19.118  53.193 1.00 26.78 ? 131  LEU P C   1 
ATOM   3013 O  O   . LEU C 3 93  ? 35.351  18.039  53.636 1.00 27.12 ? 131  LEU P O   1 
ATOM   3014 C  CB  . LEU C 3 93  ? 35.156  19.581  50.783 1.00 26.33 ? 131  LEU P CB  1 
ATOM   3015 C  CG  . LEU C 3 93  ? 34.013  19.807  49.797 1.00 26.39 ? 131  LEU P CG  1 
ATOM   3016 C  CD1 . LEU C 3 93  ? 34.528  19.835  48.345 1.00 26.00 ? 131  LEU P CD1 1 
ATOM   3017 C  CD2 . LEU C 3 93  ? 32.929  18.741  49.988 1.00 25.83 ? 131  LEU P CD2 1 
ATOM   3018 N  N   . GLU C 3 94  ? 36.875  19.658  53.510 1.00 27.66 ? 132  GLU P N   1 
ATOM   3019 C  CA  . GLU C 3 94  ? 37.747  19.009  54.494 1.00 28.14 ? 132  GLU P CA  1 
ATOM   3020 C  C   . GLU C 3 94  ? 37.045  18.845  55.841 1.00 27.77 ? 132  GLU P C   1 
ATOM   3021 O  O   . GLU C 3 94  ? 37.135  17.784  56.468 1.00 28.08 ? 132  GLU P O   1 
ATOM   3022 C  CB  . GLU C 3 94  ? 39.044  19.785  54.688 1.00 28.43 ? 132  GLU P CB  1 
ATOM   3023 C  CG  . GLU C 3 94  ? 40.116  19.449  53.664 1.00 30.50 ? 132  GLU P CG  1 
ATOM   3024 C  CD  . GLU C 3 94  ? 41.529  19.702  54.183 1.00 33.13 ? 132  GLU P CD  1 
ATOM   3025 O  OE1 . GLU C 3 94  ? 41.670  20.240  55.312 1.00 34.13 ? 132  GLU P OE1 1 
ATOM   3026 O  OE2 . GLU C 3 94  ? 42.497  19.345  53.463 1.00 34.79 ? 132  GLU P OE2 1 
ATOM   3027 N  N   . LEU C 3 95  ? 36.349  19.897  56.270 1.00 27.09 ? 133  LEU P N   1 
ATOM   3028 C  CA  . LEU C 3 95  ? 35.579  19.868  57.513 1.00 26.56 ? 133  LEU P CA  1 
ATOM   3029 C  C   . LEU C 3 95  ? 34.488  18.798  57.453 1.00 26.01 ? 133  LEU P C   1 
ATOM   3030 O  O   . LEU C 3 95  ? 34.366  17.982  58.366 1.00 25.87 ? 133  LEU P O   1 
ATOM   3031 C  CB  . LEU C 3 95  ? 35.026  21.274  57.845 1.00 26.53 ? 133  LEU P CB  1 
ATOM   3032 C  CG  . LEU C 3 95  ? 33.558  21.609  58.174 1.00 27.38 ? 133  LEU P CG  1 
ATOM   3033 C  CD1 . LEU C 3 95  ? 32.880  20.641  59.111 1.00 27.96 ? 133  LEU P CD1 1 
ATOM   3034 C  CD2 . LEU C 3 95  ? 33.478  23.030  58.747 1.00 26.65 ? 133  LEU P CD2 1 
ATOM   3035 N  N   . ALA C 3 96  ? 33.730  18.785  56.363 1.00 25.30 ? 134  ALA P N   1 
ATOM   3036 C  CA  . ALA C 3 96  ? 32.656  17.820  56.175 1.00 24.89 ? 134  ALA P CA  1 
ATOM   3037 C  C   . ALA C 3 96  ? 33.179  16.381  56.077 1.00 24.44 ? 134  ALA P C   1 
ATOM   3038 O  O   . ALA C 3 96  ? 32.566  15.473  56.614 1.00 24.28 ? 134  ALA P O   1 
ATOM   3039 C  CB  . ALA C 3 96  ? 31.827  18.186  54.942 1.00 24.61 ? 134  ALA P CB  1 
ATOM   3040 N  N   . LEU C 3 97  ? 34.309  16.173  55.407 1.00 24.24 ? 135  LEU P N   1 
ATOM   3041 C  CA  . LEU C 3 97  ? 34.895  14.829  55.304 1.00 24.38 ? 135  LEU P CA  1 
ATOM   3042 C  C   . LEU C 3 97  ? 35.289  14.230  56.664 1.00 24.74 ? 135  LEU P C   1 
ATOM   3043 O  O   . LEU C 3 97  ? 35.312  13.012  56.824 1.00 25.14 ? 135  LEU P O   1 
ATOM   3044 C  CB  . LEU C 3 97  ? 36.108  14.828  54.357 1.00 24.20 ? 135  LEU P CB  1 
ATOM   3045 C  CG  . LEU C 3 97  ? 35.820  14.914  52.849 1.00 23.71 ? 135  LEU P CG  1 
ATOM   3046 C  CD1 . LEU C 3 97  ? 37.102  15.170  52.059 1.00 21.97 ? 135  LEU P CD1 1 
ATOM   3047 C  CD2 . LEU C 3 97  ? 35.116  13.669  52.346 1.00 22.87 ? 135  LEU P CD2 1 
ATOM   3048 N  N   . LYS C 3 98  ? 35.591  15.087  57.636 1.00 25.10 ? 136  LYS P N   1 
ATOM   3049 C  CA  . LYS C 3 98  ? 36.027  14.647  58.964 1.00 25.50 ? 136  LYS P CA  1 
ATOM   3050 C  C   . LYS C 3 98  ? 34.895  14.541  59.989 1.00 25.27 ? 136  LYS P C   1 
ATOM   3051 O  O   . LYS C 3 98  ? 35.146  14.244  61.150 1.00 24.93 ? 136  LYS P O   1 
ATOM   3052 C  CB  . LYS C 3 98  ? 37.153  15.559  59.470 1.00 25.68 ? 136  LYS P CB  1 
ATOM   3053 C  CG  . LYS C 3 98  ? 38.515  15.137  58.917 1.00 26.91 ? 136  LYS P CG  1 
ATOM   3054 C  CD  . LYS C 3 98  ? 39.470  16.302  58.662 1.00 28.67 ? 136  LYS P CD  1 
ATOM   3055 C  CE  . LYS C 3 98  ? 40.688  15.825  57.848 1.00 29.39 ? 136  LYS P CE  1 
ATOM   3056 N  NZ  . LYS C 3 98  ? 41.661  16.915  57.512 1.00 30.19 ? 136  LYS P NZ  1 
ATOM   3057 N  N   . LEU C 3 99  ? 33.657  14.759  59.553 1.00 25.38 ? 137  LEU P N   1 
ATOM   3058 C  CA  . LEU C 3 99  ? 32.492  14.614  60.425 1.00 25.59 ? 137  LEU P CA  1 
ATOM   3059 C  C   . LEU C 3 99  ? 32.238  13.142  60.738 1.00 25.89 ? 137  LEU P C   1 
ATOM   3060 O  O   . LEU C 3 99  ? 32.618  12.269  59.958 1.00 25.94 ? 137  LEU P O   1 
ATOM   3061 C  CB  . LEU C 3 99  ? 31.249  15.233  59.777 1.00 25.53 ? 137  LEU P CB  1 
ATOM   3062 C  CG  . LEU C 3 99  ? 31.235  16.766  59.725 1.00 25.23 ? 137  LEU P CG  1 
ATOM   3063 C  CD1 . LEU C 3 99  ? 30.058  17.267  58.923 1.00 24.02 ? 137  LEU P CD1 1 
ATOM   3064 C  CD2 . LEU C 3 99  ? 31.202  17.344  61.138 1.00 24.15 ? 137  LEU P CD2 1 
ATOM   3065 N  N   . PRO C 3 100 ? 31.607  12.855  61.894 1.00 26.31 ? 138  PRO P N   1 
ATOM   3066 C  CA  . PRO C 3 100 ? 31.356  11.449  62.235 1.00 26.35 ? 138  PRO P CA  1 
ATOM   3067 C  C   . PRO C 3 100 ? 30.271  10.816  61.366 1.00 26.32 ? 138  PRO P C   1 
ATOM   3068 O  O   . PRO C 3 100 ? 29.369  11.507  60.901 1.00 26.33 ? 138  PRO P O   1 
ATOM   3069 C  CB  . PRO C 3 100 ? 30.933  11.500  63.710 1.00 26.48 ? 138  PRO P CB  1 
ATOM   3070 C  CG  . PRO C 3 100 ? 30.467  12.894  63.950 1.00 26.68 ? 138  PRO P CG  1 
ATOM   3071 C  CD  . PRO C 3 100 ? 31.120  13.787  62.930 1.00 26.49 ? 138  PRO P CD  1 
ATOM   3072 N  N   . HIS C 3 101 ? 30.396  9.510   61.148 1.00 26.32 ? 139  HIS P N   1 
ATOM   3073 C  CA  . HIS C 3 101 ? 29.459  8.706   60.349 1.00 26.31 ? 139  HIS P CA  1 
ATOM   3074 C  C   . HIS C 3 101 ? 29.564  8.907   58.834 1.00 26.08 ? 139  HIS P C   1 
ATOM   3075 O  O   . HIS C 3 101 ? 28.865  8.233   58.090 1.00 26.13 ? 139  HIS P O   1 
ATOM   3076 C  CB  . HIS C 3 101 ? 27.996  8.914   60.788 1.00 26.50 ? 139  HIS P CB  1 
ATOM   3077 C  CG  . HIS C 3 101 ? 27.787  8.840   62.267 1.00 26.34 ? 139  HIS P CG  1 
ATOM   3078 N  ND1 . HIS C 3 101 ? 28.187  7.761   63.022 1.00 26.71 ? 139  HIS P ND1 1 
ATOM   3079 C  CD2 . HIS C 3 101 ? 27.209  9.708   63.130 1.00 26.75 ? 139  HIS P CD2 1 
ATOM   3080 C  CE1 . HIS C 3 101 ? 27.876  7.972   64.288 1.00 26.83 ? 139  HIS P CE1 1 
ATOM   3081 N  NE2 . HIS C 3 101 ? 27.279  9.146   64.380 1.00 26.34 ? 139  HIS P NE2 1 
ATOM   3082 N  N   . VAL C 3 102 ? 30.436  9.802   58.373 1.00 25.80 ? 140  VAL P N   1 
ATOM   3083 C  CA  . VAL C 3 102 ? 30.538  10.099  56.944 1.00 25.36 ? 140  VAL P CA  1 
ATOM   3084 C  C   . VAL C 3 102 ? 31.233  8.957   56.197 1.00 25.10 ? 140  VAL P C   1 
ATOM   3085 O  O   . VAL C 3 102 ? 32.313  8.522   56.584 1.00 24.85 ? 140  VAL P O   1 
ATOM   3086 C  CB  . VAL C 3 102 ? 31.284  11.434  56.681 1.00 25.49 ? 140  VAL P CB  1 
ATOM   3087 C  CG1 . VAL C 3 102 ? 31.505  11.645  55.190 1.00 25.06 ? 140  VAL P CG1 1 
ATOM   3088 C  CG2 . VAL C 3 102 ? 30.496  12.614  57.267 1.00 25.59 ? 140  VAL P CG2 1 
ATOM   3089 N  N   . ASP C 3 103 ? 30.590  8.476   55.132 1.00 24.73 ? 141  ASP P N   1 
ATOM   3090 C  CA  . ASP C 3 103 ? 31.154  7.443   54.273 1.00 24.42 ? 141  ASP P CA  1 
ATOM   3091 C  C   . ASP C 3 103 ? 31.847  8.126   53.103 1.00 24.12 ? 141  ASP P C   1 
ATOM   3092 O  O   . ASP C 3 103 ? 33.003  7.848   52.806 1.00 23.76 ? 141  ASP P O   1 
ATOM   3093 C  CB  . ASP C 3 103 ? 30.048  6.507   53.770 1.00 24.46 ? 141  ASP P CB  1 
ATOM   3094 C  CG  . ASP C 3 103 ? 30.585  5.218   53.169 1.00 24.94 ? 141  ASP P CG  1 
ATOM   3095 O  OD1 . ASP C 3 103 ? 31.812  4.986   53.222 1.00 26.08 ? 141  ASP P OD1 1 
ATOM   3096 O  OD2 . ASP C 3 103 ? 29.771  4.427   52.639 1.00 25.37 ? 141  ASP P OD2 1 
ATOM   3097 N  N   . TYR C 3 104 ? 31.117  9.014   52.436 1.00 23.89 ? 142  TYR P N   1 
ATOM   3098 C  CA  . TYR C 3 104 ? 31.667  9.818   51.358 1.00 23.73 ? 142  TYR P CA  1 
ATOM   3099 C  C   . TYR C 3 104 ? 30.806  11.056  51.110 1.00 23.70 ? 142  TYR P C   1 
ATOM   3100 O  O   . TYR C 3 104 ? 29.673  11.152  51.587 1.00 23.22 ? 142  TYR P O   1 
ATOM   3101 C  CB  . TYR C 3 104 ? 31.826  8.991   50.070 1.00 23.70 ? 142  TYR P CB  1 
ATOM   3102 C  CG  . TYR C 3 104 ? 30.555  8.337   49.552 1.00 23.57 ? 142  TYR P CG  1 
ATOM   3103 C  CD1 . TYR C 3 104 ? 30.102  7.131   50.077 1.00 23.73 ? 142  TYR P CD1 1 
ATOM   3104 C  CD2 . TYR C 3 104 ? 29.825  8.914   48.515 1.00 23.84 ? 142  TYR P CD2 1 
ATOM   3105 C  CE1 . TYR C 3 104 ? 28.946  6.529   49.601 1.00 23.53 ? 142  TYR P CE1 1 
ATOM   3106 C  CE2 . TYR C 3 104 ? 28.665  8.330   48.039 1.00 23.33 ? 142  TYR P CE2 1 
ATOM   3107 C  CZ  . TYR C 3 104 ? 28.230  7.134   48.581 1.00 23.96 ? 142  TYR P CZ  1 
ATOM   3108 O  OH  . TYR C 3 104 ? 27.082  6.546   48.100 1.00 23.60 ? 142  TYR P OH  1 
ATOM   3109 N  N   . ILE C 3 105 ? 31.369  12.010  50.377 1.00 23.79 ? 143  ILE P N   1 
ATOM   3110 C  CA  . ILE C 3 105 ? 30.634  13.196  49.964 1.00 23.68 ? 143  ILE P CA  1 
ATOM   3111 C  C   . ILE C 3 105 ? 30.703  13.289  48.445 1.00 23.89 ? 143  ILE P C   1 
ATOM   3112 O  O   . ILE C 3 105 ? 31.765  13.113  47.863 1.00 23.08 ? 143  ILE P O   1 
ATOM   3113 C  CB  . ILE C 3 105 ? 31.198  14.476  50.611 1.00 23.45 ? 143  ILE P CB  1 
ATOM   3114 C  CG1 . ILE C 3 105 ? 31.086  14.390  52.138 1.00 23.37 ? 143  ILE P CG1 1 
ATOM   3115 C  CG2 . ILE C 3 105 ? 30.450  15.699  50.102 1.00 22.77 ? 143  ILE P CG2 1 
ATOM   3116 C  CD1 . ILE C 3 105 ? 31.801  15.527  52.877 1.00 23.09 ? 143  ILE P CD1 1 
ATOM   3117 N  N   . GLU C 3 106 ? 29.556  13.532  47.812 1.00 24.38 ? 144  GLU P N   1 
ATOM   3118 C  CA  . GLU C 3 106 ? 29.502  13.672  46.366 1.00 25.10 ? 144  GLU P CA  1 
ATOM   3119 C  C   . GLU C 3 106 ? 28.978  15.048  45.978 1.00 24.52 ? 144  GLU P C   1 
ATOM   3120 O  O   . GLU C 3 106 ? 27.970  15.503  46.494 1.00 24.40 ? 144  GLU P O   1 
ATOM   3121 C  CB  . GLU C 3 106 ? 28.639  12.577  45.738 1.00 25.17 ? 144  GLU P CB  1 
ATOM   3122 C  CG  . GLU C 3 106 ? 28.680  12.603  44.209 1.00 26.76 ? 144  GLU P CG  1 
ATOM   3123 C  CD  . GLU C 3 106 ? 28.072  11.380  43.566 1.00 28.00 ? 144  GLU P CD  1 
ATOM   3124 O  OE1 . GLU C 3 106 ? 28.330  10.254  44.063 1.00 32.95 ? 144  GLU P OE1 1 
ATOM   3125 O  OE2 . GLU C 3 106 ? 27.342  11.543  42.553 1.00 31.68 ? 144  GLU P OE2 1 
ATOM   3126 N  N   . GLU C 3 107 ? 29.690  15.710  45.074 1.00 24.37 ? 145  GLU P N   1 
ATOM   3127 C  CA  . GLU C 3 107 ? 29.250  16.979  44.525 1.00 24.30 ? 145  GLU P CA  1 
ATOM   3128 C  C   . GLU C 3 107 ? 28.115  16.717  43.546 1.00 24.23 ? 145  GLU P C   1 
ATOM   3129 O  O   . GLU C 3 107 ? 28.211  15.814  42.721 1.00 24.04 ? 145  GLU P O   1 
ATOM   3130 C  CB  . GLU C 3 107 ? 30.404  17.646  43.796 1.00 24.52 ? 145  GLU P CB  1 
ATOM   3131 C  CG  . GLU C 3 107 ? 30.116  19.050  43.302 1.00 25.03 ? 145  GLU P CG  1 
ATOM   3132 C  CD  . GLU C 3 107 ? 31.182  19.523  42.362 1.00 25.79 ? 145  GLU P CD  1 
ATOM   3133 O  OE1 . GLU C 3 107 ? 31.297  18.946  41.254 1.00 26.32 ? 145  GLU P OE1 1 
ATOM   3134 O  OE2 . GLU C 3 107 ? 31.912  20.462  42.734 1.00 27.77 ? 145  GLU P OE2 1 
ATOM   3135 N  N   . ASP C 3 108 ? 27.052  17.513  43.640 1.00 24.12 ? 146  ASP P N   1 
ATOM   3136 C  CA  . ASP C 3 108 ? 25.899  17.375  42.756 1.00 24.01 ? 146  ASP P CA  1 
ATOM   3137 C  C   . ASP C 3 108 ? 26.311  17.552  41.287 1.00 23.80 ? 146  ASP P C   1 
ATOM   3138 O  O   . ASP C 3 108 ? 27.384  18.088  40.982 1.00 24.18 ? 146  ASP P O   1 
ATOM   3139 C  CB  . ASP C 3 108 ? 24.803  18.387  43.136 1.00 24.06 ? 146  ASP P CB  1 
ATOM   3140 C  CG  . ASP C 3 108 ? 23.381  17.918  42.764 1.00 24.37 ? 146  ASP P CG  1 
ATOM   3141 O  OD1 . ASP C 3 108 ? 23.215  16.813  42.199 1.00 23.32 ? 146  ASP P OD1 1 
ATOM   3142 O  OD2 . ASP C 3 108 ? 22.418  18.674  43.047 1.00 24.69 ? 146  ASP P OD2 1 
ATOM   3143 N  N   . SER C 3 109 ? 25.466  17.060  40.389 1.00 23.48 ? 147  SER P N   1 
ATOM   3144 C  CA  . SER C 3 109 ? 25.743  17.084  38.968 1.00 23.36 ? 147  SER P CA  1 
ATOM   3145 C  C   . SER C 3 109 ? 24.450  16.933  38.186 1.00 22.58 ? 147  SER P C   1 
ATOM   3146 O  O   . SER C 3 109 ? 23.408  16.598  38.748 1.00 22.42 ? 147  SER P O   1 
ATOM   3147 C  CB  . SER C 3 109 ? 26.731  15.972  38.592 1.00 23.82 ? 147  SER P CB  1 
ATOM   3148 O  OG  . SER C 3 109 ? 26.140  14.684  38.726 1.00 26.11 ? 147  SER P OG  1 
ATOM   3149 N  N   . SER C 3 110 ? 24.531  17.182  36.883 1.00 21.88 ? 148  SER P N   1 
ATOM   3150 C  CA  . SER C 3 110 ? 23.359  17.222  36.025 1.00 21.05 ? 148  SER P CA  1 
ATOM   3151 C  C   . SER C 3 110 ? 23.026  15.858  35.442 1.00 20.41 ? 148  SER P C   1 
ATOM   3152 O  O   . SER C 3 110 ? 23.919  15.040  35.169 1.00 20.35 ? 148  SER P O   1 
ATOM   3153 C  CB  . SER C 3 110 ? 23.577  18.227  34.895 1.00 21.08 ? 148  SER P CB  1 
ATOM   3154 O  OG  . SER C 3 110 ? 23.782  19.527  35.418 1.00 21.37 ? 148  SER P OG  1 
ATOM   3155 N  N   . VAL C 3 111 ? 21.728  15.626  35.263 1.00 19.29 ? 149  VAL P N   1 
ATOM   3156 C  CA  . VAL C 3 111 ? 21.220  14.460  34.547 1.00 18.57 ? 149  VAL P CA  1 
ATOM   3157 C  C   . VAL C 3 111 ? 20.345  14.977  33.423 1.00 18.04 ? 149  VAL P C   1 
ATOM   3158 O  O   . VAL C 3 111 ? 19.790  16.069  33.514 1.00 17.69 ? 149  VAL P O   1 
ATOM   3159 C  CB  . VAL C 3 111 ? 20.427  13.476  35.463 1.00 18.16 ? 149  VAL P CB  1 
ATOM   3160 C  CG1 . VAL C 3 111 ? 21.296  13.018  36.624 1.00 17.37 ? 149  VAL P CG1 1 
ATOM   3161 C  CG2 . VAL C 3 111 ? 19.143  14.104  35.968 1.00 18.12 ? 149  VAL P CG2 1 
ATOM   3162 N  N   . PHE C 3 112 ? 20.235  14.189  32.360 1.00 17.91 ? 150  PHE P N   1 
ATOM   3163 C  CA  . PHE C 3 112 ? 19.565  14.627  31.144 1.00 17.75 ? 150  PHE P CA  1 
ATOM   3164 C  C   . PHE C 3 112 ? 18.634  13.560  30.611 1.00 17.75 ? 150  PHE P C   1 
ATOM   3165 O  O   . PHE C 3 112 ? 18.928  12.380  30.716 1.00 18.12 ? 150  PHE P O   1 
ATOM   3166 C  CB  . PHE C 3 112 ? 20.607  14.967  30.079 1.00 17.51 ? 150  PHE P CB  1 
ATOM   3167 C  CG  . PHE C 3 112 ? 21.561  16.033  30.502 1.00 17.16 ? 150  PHE P CG  1 
ATOM   3168 C  CD1 . PHE C 3 112 ? 21.258  17.368  30.298 1.00 17.48 ? 150  PHE P CD1 1 
ATOM   3169 C  CD2 . PHE C 3 112 ? 22.752  15.704  31.130 1.00 17.17 ? 150  PHE P CD2 1 
ATOM   3170 C  CE1 . PHE C 3 112 ? 22.131  18.360  30.702 1.00 17.81 ? 150  PHE P CE1 1 
ATOM   3171 C  CE2 . PHE C 3 112 ? 23.625  16.684  31.546 1.00 17.25 ? 150  PHE P CE2 1 
ATOM   3172 C  CZ  . PHE C 3 112 ? 23.319  18.019  31.326 1.00 17.96 ? 150  PHE P CZ  1 
ATOM   3173 N  N   . ALA C 3 113 ? 17.514  13.988  30.034 1.00 17.73 ? 151  ALA P N   1 
ATOM   3174 C  CA  . ALA C 3 113 ? 16.628  13.098  29.289 1.00 17.70 ? 151  ALA P CA  1 
ATOM   3175 C  C   . ALA C 3 113 ? 17.395  12.449  28.147 1.00 17.90 ? 151  ALA P C   1 
ATOM   3176 O  O   . ALA C 3 113 ? 18.161  13.116  27.456 1.00 17.87 ? 151  ALA P O   1 
ATOM   3177 C  CB  . ALA C 3 113 ? 15.433  13.886  28.719 1.00 17.57 ? 151  ALA P CB  1 
ATOM   3178 N  N   . GLN C 3 114 ? 17.169  11.152  27.940 1.00 18.32 ? 152  GLN P N   1 
ATOM   3179 C  CA  . GLN C 3 114 ? 17.806  10.415  26.854 1.00 18.23 ? 152  GLN P CA  1 
ATOM   3180 C  C   . GLN C 3 114 ? 16.777  10.009  25.787 1.00 18.91 ? 152  GLN P C   1 
ATOM   3181 O  O   . GLN C 3 114 ? 16.855  8.964   25.124 1.00 18.80 ? 152  GLN P O   1 
ATOM   3182 C  CB  . GLN C 3 114 ? 18.555  9.203   27.424 1.00 18.10 ? 152  GLN P CB  1 
ATOM   3183 C  CG  . GLN C 3 114 ? 19.670  9.567   28.416 1.00 16.39 ? 152  GLN P CG  1 
ATOM   3184 C  CD  . GLN C 3 114 ? 20.759  10.435  27.801 1.00 14.28 ? 152  GLN P CD  1 
ATOM   3185 O  OE1 . GLN C 3 114 ? 21.361  10.076  26.801 1.00 14.05 ? 152  GLN P OE1 1 
ATOM   3186 N  NE2 . GLN C 3 114 ? 21.025  11.572  28.413 1.00 14.05 ? 152  GLN P NE2 1 
ATOM   3187 O  OXT . GLN C 3 114 ? 15.811  10.751  25.549 1.00 19.64 ? 152  GLN P OXT 1 
HETATM 3188 CA CA  . CA  D 4 .   ? 23.163  -2.180  34.543 1.00 80.99 ? 1447 CA  A CA  1 
HETATM 3189 CA CA  . CA  E 4 .   ? -8.885  8.138   12.766 1.00 35.81 ? 1334 CA  E CA  1 
HETATM 3190 CA CA  . CA  F 4 .   ? 11.925  30.014  7.961  1.00 93.64 ? 1335 CA  E CA  1 
HETATM 3191 O  O   . HOH G 5 .   ? 9.180   -4.948  13.182 1.00 29.95 ? 2001 HOH A O   1 
HETATM 3192 O  O   . HOH G 5 .   ? 6.546   2.301   12.779 1.00 33.24 ? 2002 HOH A O   1 
HETATM 3193 O  O   . HOH G 5 .   ? 7.295   3.308   15.680 1.00 25.31 ? 2003 HOH A O   1 
HETATM 3194 O  O   . HOH G 5 .   ? 10.142  -2.991  9.740  1.00 35.56 ? 2004 HOH A O   1 
HETATM 3195 O  O   . HOH G 5 .   ? -1.606  -9.103  38.531 1.00 53.22 ? 2005 HOH A O   1 
HETATM 3196 O  O   . HOH G 5 .   ? 3.421   15.918  35.328 1.00 36.98 ? 2006 HOH A O   1 
HETATM 3197 O  O   . HOH G 5 .   ? -1.758  16.892  32.748 1.00 40.74 ? 2007 HOH A O   1 
HETATM 3198 O  O   . HOH G 5 .   ? -10.057 9.238   16.793 1.00 46.33 ? 2008 HOH A O   1 
HETATM 3199 O  O   . HOH G 5 .   ? -11.113 9.673   19.880 1.00 45.88 ? 2009 HOH A O   1 
HETATM 3200 O  O   . HOH G 5 .   ? -4.954  6.220   21.684 1.00 41.24 ? 2010 HOH A O   1 
HETATM 3201 O  O   . HOH G 5 .   ? 1.687   6.310   22.769 1.00 29.56 ? 2011 HOH A O   1 
HETATM 3202 O  O   . HOH G 5 .   ? -3.203  12.394  38.096 1.00 45.53 ? 2012 HOH A O   1 
HETATM 3203 O  O   . HOH G 5 .   ? 1.140   11.526  45.476 1.00 34.17 ? 2013 HOH A O   1 
HETATM 3204 O  O   . HOH G 5 .   ? 6.332   14.431  48.052 1.00 46.48 ? 2014 HOH A O   1 
HETATM 3205 O  O   . HOH G 5 .   ? 4.773   15.290  39.614 1.00 33.11 ? 2015 HOH A O   1 
HETATM 3206 O  O   . HOH G 5 .   ? 8.041   17.581  45.643 1.00 44.90 ? 2016 HOH A O   1 
HETATM 3207 O  O   . HOH G 5 .   ? 16.060  17.003  39.399 1.00 25.12 ? 2017 HOH A O   1 
HETATM 3208 O  O   . HOH G 5 .   ? 16.295  20.535  46.813 1.00 43.46 ? 2018 HOH A O   1 
HETATM 3209 O  O   . HOH G 5 .   ? 12.301  17.981  47.087 1.00 51.08 ? 2019 HOH A O   1 
HETATM 3210 O  O   . HOH G 5 .   ? 11.394  22.018  41.648 1.00 34.94 ? 2020 HOH A O   1 
HETATM 3211 O  O   . HOH G 5 .   ? 17.669  22.035  41.474 1.00 36.01 ? 2021 HOH A O   1 
HETATM 3212 O  O   . HOH G 5 .   ? 5.166   24.285  27.069 1.00 43.51 ? 2022 HOH A O   1 
HETATM 3213 O  O   . HOH G 5 .   ? 6.935   19.593  21.536 1.00 38.61 ? 2023 HOH A O   1 
HETATM 3214 O  O   . HOH G 5 .   ? 10.917  17.650  27.313 1.00 33.36 ? 2024 HOH A O   1 
HETATM 3215 O  O   . HOH G 5 .   ? 9.315   19.212  32.073 1.00 32.56 ? 2025 HOH A O   1 
HETATM 3216 O  O   . HOH G 5 .   ? 11.361  15.869  22.978 1.00 44.85 ? 2026 HOH A O   1 
HETATM 3217 O  O   . HOH G 5 .   ? 5.165   14.007  23.423 1.00 27.37 ? 2027 HOH A O   1 
HETATM 3218 O  O   . HOH G 5 .   ? -5.842  -1.082  24.590 1.00 41.74 ? 2028 HOH A O   1 
HETATM 3219 O  O   . HOH G 5 .   ? -3.474  -1.066  18.761 1.00 48.84 ? 2029 HOH A O   1 
HETATM 3220 O  O   . HOH G 5 .   ? -0.136  -1.403  18.020 1.00 40.37 ? 2030 HOH A O   1 
HETATM 3221 O  O   . HOH G 5 .   ? -11.660 7.187   20.970 1.00 50.70 ? 2031 HOH A O   1 
HETATM 3222 O  O   . HOH G 5 .   ? 2.228   -4.301  22.358 1.00 38.83 ? 2032 HOH A O   1 
HETATM 3223 O  O   . HOH G 5 .   ? 3.808   18.061  39.149 1.00 50.23 ? 2033 HOH A O   1 
HETATM 3224 O  O   . HOH G 5 .   ? -1.888  4.842   38.075 1.00 48.55 ? 2034 HOH A O   1 
HETATM 3225 O  O   . HOH G 5 .   ? 4.499   20.665  35.711 1.00 47.45 ? 2035 HOH A O   1 
HETATM 3226 O  O   . HOH G 5 .   ? -5.882  -0.886  27.054 1.00 40.57 ? 2036 HOH A O   1 
HETATM 3227 O  O   . HOH G 5 .   ? 19.427  22.373  29.637 1.00 41.08 ? 2037 HOH A O   1 
HETATM 3228 O  O   . HOH G 5 .   ? 18.774  20.038  28.473 1.00 53.74 ? 2038 HOH A O   1 
HETATM 3229 O  O   . HOH G 5 .   ? 23.599  23.447  34.849 1.00 42.33 ? 2039 HOH A O   1 
HETATM 3230 O  O   . HOH G 5 .   ? 23.845  21.765  30.324 1.00 47.77 ? 2040 HOH A O   1 
HETATM 3231 O  O   . HOH G 5 .   ? 21.232  20.195  36.234 1.00 33.51 ? 2041 HOH A O   1 
HETATM 3232 O  O   . HOH G 5 .   ? 16.747  19.495  40.921 1.00 37.56 ? 2042 HOH A O   1 
HETATM 3233 O  O   . HOH G 5 .   ? 17.949  19.438  44.725 1.00 38.47 ? 2043 HOH A O   1 
HETATM 3234 O  O   . HOH G 5 .   ? 10.803  15.358  50.469 1.00 44.30 ? 2044 HOH A O   1 
HETATM 3235 O  O   . HOH G 5 .   ? 11.365  12.562  49.433 1.00 42.93 ? 2045 HOH A O   1 
HETATM 3236 O  O   . HOH G 5 .   ? 10.799  -3.876  51.265 1.00 50.08 ? 2046 HOH A O   1 
HETATM 3237 O  O   . HOH G 5 .   ? 31.115  11.253  36.568 1.00 36.36 ? 2047 HOH A O   1 
HETATM 3238 O  O   . HOH G 5 .   ? 29.205  2.785   42.401 1.00 39.89 ? 2048 HOH A O   1 
HETATM 3239 O  O   . HOH G 5 .   ? 28.871  3.155   47.043 1.00 31.98 ? 2049 HOH A O   1 
HETATM 3240 O  O   . HOH G 5 .   ? 27.901  3.326   44.519 1.00 34.37 ? 2050 HOH A O   1 
HETATM 3241 O  O   . HOH G 5 .   ? 28.048  0.848   40.959 1.00 45.23 ? 2051 HOH A O   1 
HETATM 3242 O  O   . HOH G 5 .   ? 26.344  0.799   44.716 1.00 37.25 ? 2052 HOH A O   1 
HETATM 3243 O  O   . HOH G 5 .   ? 23.938  -11.605 28.692 1.00 47.28 ? 2053 HOH A O   1 
HETATM 3244 O  O   . HOH G 5 .   ? 26.052  -3.101  35.092 1.00 44.37 ? 2054 HOH A O   1 
HETATM 3245 O  O   . HOH G 5 .   ? 8.970   -4.918  42.985 1.00 44.00 ? 2055 HOH A O   1 
HETATM 3246 O  O   . HOH G 5 .   ? 8.814   -7.343  41.620 1.00 43.84 ? 2056 HOH A O   1 
HETATM 3247 O  O   . HOH G 5 .   ? 21.427  6.236   32.561 1.00 26.14 ? 2057 HOH A O   1 
HETATM 3248 O  O   . HOH G 5 .   ? 19.796  12.629  24.141 1.00 32.82 ? 2058 HOH A O   1 
HETATM 3249 O  O   . HOH G 5 .   ? 27.867  4.279   12.239 1.00 43.90 ? 2059 HOH A O   1 
HETATM 3250 O  O   . HOH G 5 .   ? 29.227  -0.397  29.551 1.00 30.38 ? 2060 HOH A O   1 
HETATM 3251 O  O   . HOH G 5 .   ? 29.649  12.483  27.150 1.00 36.19 ? 2061 HOH A O   1 
HETATM 3252 O  O   . HOH G 5 .   ? 31.723  11.600  30.399 1.00 49.06 ? 2062 HOH A O   1 
HETATM 3253 O  O   . HOH G 5 .   ? 23.503  -7.467  40.469 1.00 51.83 ? 2063 HOH A O   1 
HETATM 3254 O  O   . HOH G 5 .   ? 21.186  0.171   10.403 1.00 43.54 ? 2064 HOH A O   1 
HETATM 3255 O  O   . HOH G 5 .   ? 14.564  2.320   12.838 1.00 32.20 ? 2065 HOH A O   1 
HETATM 3256 O  O   . HOH G 5 .   ? 16.952  2.719   10.543 1.00 49.86 ? 2066 HOH A O   1 
HETATM 3257 O  O   . HOH G 5 .   ? 16.846  -7.279  11.448 1.00 24.62 ? 2067 HOH A O   1 
HETATM 3258 O  O   . HOH G 5 .   ? 15.455  -3.601  17.054 1.00 24.37 ? 2068 HOH A O   1 
HETATM 3259 O  O   . HOH G 5 .   ? 25.742  -2.803  13.374 1.00 36.55 ? 2069 HOH A O   1 
HETATM 3260 O  O   . HOH G 5 .   ? 23.735  1.451   13.202 1.00 35.45 ? 2070 HOH A O   1 
HETATM 3261 O  O   . HOH G 5 .   ? 27.456  7.902   15.478 1.00 41.09 ? 2071 HOH A O   1 
HETATM 3262 O  O   . HOH G 5 .   ? 24.452  -5.435  34.796 1.00 51.75 ? 2072 HOH A O   1 
HETATM 3263 O  O   . HOH G 5 .   ? 22.764  -9.224  29.610 1.00 34.24 ? 2073 HOH A O   1 
HETATM 3264 O  O   . HOH G 5 .   ? 20.099  4.290   13.534 1.00 13.55 ? 2074 HOH A O   1 
HETATM 3265 O  O   . HOH G 5 .   ? 10.036  6.557   9.145  1.00 51.50 ? 2075 HOH A O   1 
HETATM 3266 O  O   . HOH G 5 .   ? 12.152  3.225   11.355 1.00 34.31 ? 2076 HOH A O   1 
HETATM 3267 O  O   . HOH G 5 .   ? 4.990   2.500   19.479 1.00 28.83 ? 2077 HOH A O   1 
HETATM 3268 O  O   . HOH G 5 .   ? 3.989   4.517   22.112 1.00 32.76 ? 2078 HOH A O   1 
HETATM 3269 O  O   . HOH G 5 .   ? 5.205   16.396  19.390 1.00 33.40 ? 2079 HOH A O   1 
HETATM 3270 O  O   . HOH G 5 .   ? -4.113  21.638  20.326 1.00 48.09 ? 2080 HOH A O   1 
HETATM 3271 O  O   . HOH G 5 .   ? -8.318  16.438  25.797 1.00 51.26 ? 2081 HOH A O   1 
HETATM 3272 O  O   . HOH G 5 .   ? 12.544  10.020  15.123 1.00 59.31 ? 2082 HOH A O   1 
HETATM 3273 O  O   . HOH G 5 .   ? 13.749  11.996  19.201 1.00 31.24 ? 2083 HOH A O   1 
HETATM 3274 O  O   . HOH G 5 .   ? 23.045  -10.020 36.600 1.00 56.32 ? 2084 HOH A O   1 
HETATM 3275 O  O   . HOH G 5 .   ? 19.460  -15.781 15.752 1.00 38.00 ? 2085 HOH A O   1 
HETATM 3276 O  O   . HOH G 5 .   ? 21.547  -14.754 14.420 1.00 27.59 ? 2086 HOH A O   1 
HETATM 3277 O  O   . HOH G 5 .   ? 23.875  -16.092 14.243 1.00 36.23 ? 2087 HOH A O   1 
HETATM 3278 O  O   . HOH G 5 .   ? 29.383  -7.721  13.228 1.00 42.00 ? 2088 HOH A O   1 
HETATM 3279 O  O   . HOH G 5 .   ? 31.035  2.596   18.475 1.00 37.77 ? 2089 HOH A O   1 
HETATM 3280 O  O   . HOH G 5 .   ? 34.029  0.135   15.467 1.00 44.12 ? 2090 HOH A O   1 
HETATM 3281 O  O   . HOH G 5 .   ? 37.551  0.156   17.455 1.00 43.29 ? 2091 HOH A O   1 
HETATM 3282 O  O   . HOH G 5 .   ? 34.662  2.497   24.900 1.00 50.23 ? 2092 HOH A O   1 
HETATM 3283 O  O   . HOH G 5 .   ? 32.432  -2.022  28.833 1.00 48.10 ? 2093 HOH A O   1 
HETATM 3284 O  O   . HOH G 5 .   ? 38.604  -4.647  14.142 1.00 57.55 ? 2094 HOH A O   1 
HETATM 3285 O  O   . HOH G 5 .   ? 28.264  -10.548 19.941 1.00 50.28 ? 2095 HOH A O   1 
HETATM 3286 O  O   . HOH G 5 .   ? 20.622  -9.751  19.190 1.00 36.68 ? 2096 HOH A O   1 
HETATM 3287 O  O   . HOH G 5 .   ? 25.544  -11.885 23.974 1.00 41.86 ? 2097 HOH A O   1 
HETATM 3288 O  O   . HOH G 5 .   ? 12.927  -8.177  19.534 1.00 30.85 ? 2098 HOH A O   1 
HETATM 3289 O  O   . HOH G 5 .   ? 12.931  -9.798  26.473 1.00 44.77 ? 2099 HOH A O   1 
HETATM 3290 O  O   . HOH H 5 .   ? -17.040 5.417   -4.731 1.00 47.02 ? 2001 HOH E O   1 
HETATM 3291 O  O   . HOH H 5 .   ? -7.467  8.008   6.012  1.00 27.82 ? 2002 HOH E O   1 
HETATM 3292 O  O   . HOH H 5 .   ? -12.716 7.217   2.352  1.00 29.20 ? 2003 HOH E O   1 
HETATM 3293 O  O   . HOH H 5 .   ? -16.879 10.615  6.032  1.00 43.62 ? 2004 HOH E O   1 
HETATM 3294 O  O   . HOH H 5 .   ? -15.213 8.943   4.559  1.00 30.12 ? 2005 HOH E O   1 
HETATM 3295 O  O   . HOH H 5 .   ? -9.786  7.313   14.821 1.00 33.97 ? 2006 HOH E O   1 
HETATM 3296 O  O   . HOH H 5 .   ? -3.548  1.600   11.554 1.00 45.41 ? 2007 HOH E O   1 
HETATM 3297 O  O   . HOH H 5 .   ? -8.758  6.012   7.346  1.00 31.92 ? 2008 HOH E O   1 
HETATM 3298 O  O   . HOH H 5 .   ? 3.959   1.688   11.475 1.00 33.81 ? 2009 HOH E O   1 
HETATM 3299 O  O   . HOH H 5 .   ? 9.055   3.916   6.669  1.00 54.97 ? 2010 HOH E O   1 
HETATM 3300 O  O   . HOH H 5 .   ? 3.982   5.879   5.255  1.00 42.34 ? 2011 HOH E O   1 
HETATM 3301 O  O   . HOH H 5 .   ? 6.020   9.241   9.053  1.00 25.67 ? 2012 HOH E O   1 
HETATM 3302 O  O   . HOH H 5 .   ? 7.249   10.691  11.615 1.00 41.47 ? 2013 HOH E O   1 
HETATM 3303 O  O   . HOH H 5 .   ? 7.399   12.289  13.830 1.00 32.24 ? 2014 HOH E O   1 
HETATM 3304 O  O   . HOH H 5 .   ? -8.741  5.712   16.626 1.00 38.03 ? 2015 HOH E O   1 
HETATM 3305 O  O   . HOH H 5 .   ? -12.081 14.025  9.724  1.00 44.18 ? 2016 HOH E O   1 
HETATM 3306 O  O   . HOH H 5 .   ? -13.068 13.799  12.041 1.00 26.88 ? 2017 HOH E O   1 
HETATM 3307 O  O   . HOH H 5 .   ? -11.393 14.219  7.338  1.00 50.19 ? 2018 HOH E O   1 
HETATM 3308 O  O   . HOH H 5 .   ? -1.602  21.084  8.644  1.00 45.69 ? 2019 HOH E O   1 
HETATM 3309 O  O   . HOH H 5 .   ? -3.022  15.992  6.136  1.00 40.85 ? 2020 HOH E O   1 
HETATM 3310 O  O   . HOH H 5 .   ? 3.764   16.101  9.709  1.00 30.24 ? 2021 HOH E O   1 
HETATM 3311 O  O   . HOH H 5 .   ? -0.243  22.133  10.753 1.00 48.36 ? 2022 HOH E O   1 
HETATM 3312 O  O   . HOH H 5 .   ? 5.624   23.935  17.149 1.00 50.77 ? 2023 HOH E O   1 
HETATM 3313 O  O   . HOH H 5 .   ? 0.611   23.606  6.618  1.00 61.99 ? 2024 HOH E O   1 
HETATM 3314 O  O   . HOH H 5 .   ? 0.378   19.934  1.673  1.00 31.34 ? 2025 HOH E O   1 
HETATM 3315 O  O   . HOH H 5 .   ? 2.514   12.850  -0.180 1.00 50.08 ? 2026 HOH E O   1 
HETATM 3316 O  O   . HOH H 5 .   ? -0.012  12.035  -0.224 1.00 58.40 ? 2027 HOH E O   1 
HETATM 3317 O  O   . HOH I 5 .   ? 39.101  12.720  55.125 1.00 47.16 ? 2001 HOH P O   1 
HETATM 3318 O  O   . HOH I 5 .   ? 38.564  12.459  48.618 1.00 39.14 ? 2002 HOH P O   1 
HETATM 3319 O  O   . HOH I 5 .   ? 38.182  16.880  43.086 1.00 51.28 ? 2003 HOH P O   1 
HETATM 3320 O  O   . HOH I 5 .   ? 35.772  16.437  37.185 1.00 43.72 ? 2004 HOH P O   1 
HETATM 3321 O  O   . HOH I 5 .   ? 37.558  14.470  34.599 1.00 55.58 ? 2005 HOH P O   1 
HETATM 3322 O  O   . HOH I 5 .   ? 34.764  13.259  30.593 1.00 50.12 ? 2006 HOH P O   1 
HETATM 3323 O  O   . HOH I 5 .   ? 32.959  14.572  26.631 1.00 61.38 ? 2007 HOH P O   1 
HETATM 3324 O  O   . HOH I 5 .   ? 35.662  23.201  29.630 1.00 41.27 ? 2008 HOH P O   1 
HETATM 3325 O  O   . HOH I 5 .   ? 31.749  23.777  36.649 1.00 42.00 ? 2009 HOH P O   1 
HETATM 3326 O  O   . HOH I 5 .   ? 25.874  24.760  41.153 1.00 42.65 ? 2010 HOH P O   1 
HETATM 3327 O  O   . HOH I 5 .   ? 24.901  25.565  44.972 1.00 43.52 ? 2011 HOH P O   1 
HETATM 3328 O  O   . HOH I 5 .   ? 23.938  23.394  42.660 1.00 47.44 ? 2012 HOH P O   1 
HETATM 3329 O  O   . HOH I 5 .   ? 26.754  4.608   52.818 1.00 38.38 ? 2013 HOH P O   1 
HETATM 3330 O  O   . HOH I 5 .   ? 27.354  -0.414  53.243 1.00 52.79 ? 2014 HOH P O   1 
HETATM 3331 O  O   . HOH I 5 .   ? 17.522  15.334  65.767 1.00 44.52 ? 2015 HOH P O   1 
HETATM 3332 O  O   . HOH I 5 .   ? 14.965  15.919  59.296 1.00 46.36 ? 2016 HOH P O   1 
HETATM 3333 O  O   . HOH I 5 .   ? 18.981  19.172  60.209 1.00 39.88 ? 2017 HOH P O   1 
HETATM 3334 O  O   . HOH I 5 .   ? 24.113  23.433  64.548 1.00 35.44 ? 2018 HOH P O   1 
HETATM 3335 O  O   . HOH I 5 .   ? 19.898  25.093  57.004 1.00 31.66 ? 2019 HOH P O   1 
HETATM 3336 O  O   . HOH I 5 .   ? 19.037  26.024  59.837 1.00 47.79 ? 2020 HOH P O   1 
HETATM 3337 O  O   . HOH I 5 .   ? 24.473  27.303  63.117 1.00 42.97 ? 2021 HOH P O   1 
HETATM 3338 O  O   . HOH I 5 .   ? 33.480  32.388  65.910 1.00 42.42 ? 2022 HOH P O   1 
HETATM 3339 O  O   . HOH I 5 .   ? 36.296  32.651  62.513 1.00 43.48 ? 2023 HOH P O   1 
HETATM 3340 O  O   . HOH I 5 .   ? 37.767  30.495  58.395 1.00 50.88 ? 2024 HOH P O   1 
HETATM 3341 O  O   . HOH I 5 .   ? 38.714  20.882  58.921 1.00 42.89 ? 2025 HOH P O   1 
HETATM 3342 O  O   . HOH I 5 .   ? 26.964  27.562  59.012 1.00 30.35 ? 2026 HOH P O   1 
HETATM 3343 O  O   . HOH I 5 .   ? 29.617  28.069  52.952 1.00 27.20 ? 2027 HOH P O   1 
HETATM 3344 O  O   . HOH I 5 .   ? 18.661  27.499  48.633 1.00 49.06 ? 2028 HOH P O   1 
HETATM 3345 O  O   . HOH I 5 .   ? 14.718  20.609  55.281 1.00 38.50 ? 2029 HOH P O   1 
HETATM 3346 O  O   . HOH I 5 .   ? 23.619  27.988  44.169 1.00 51.23 ? 2030 HOH P O   1 
HETATM 3347 O  O   . HOH I 5 .   ? 18.537  28.906  44.440 1.00 50.29 ? 2031 HOH P O   1 
HETATM 3348 O  O   . HOH I 5 .   ? 31.984  26.429  45.995 1.00 26.41 ? 2032 HOH P O   1 
HETATM 3349 O  O   . HOH I 5 .   ? 37.291  22.751  55.468 1.00 30.32 ? 2033 HOH P O   1 
HETATM 3350 O  O   . HOH I 5 .   ? 38.226  21.934  51.708 1.00 32.50 ? 2034 HOH P O   1 
HETATM 3351 O  O   . HOH I 5 .   ? 37.508  29.285  47.149 1.00 40.58 ? 2035 HOH P O   1 
HETATM 3352 O  O   . HOH I 5 .   ? 34.730  18.513  60.906 1.00 33.82 ? 2036 HOH P O   1 
HETATM 3353 O  O   . HOH I 5 .   ? 34.669  11.077  58.909 1.00 43.39 ? 2037 HOH P O   1 
HETATM 3354 O  O   . HOH I 5 .   ? 27.542  9.941   67.573 1.00 49.90 ? 2038 HOH P O   1 
HETATM 3355 O  O   . HOH I 5 .   ? 34.452  5.757   50.958 1.00 39.41 ? 2039 HOH P O   1 
HETATM 3356 O  O   . HOH I 5 .   ? 29.615  2.912   50.513 1.00 49.46 ? 2040 HOH P O   1 
HETATM 3357 O  O   . HOH I 5 .   ? 27.140  3.549   48.957 1.00 37.94 ? 2041 HOH P O   1 
HETATM 3358 O  O   . HOH I 5 .   ? 26.792  13.910  41.422 1.00 35.84 ? 2042 HOH P O   1 
HETATM 3359 O  O   . HOH I 5 .   ? 29.865  16.986  40.346 1.00 24.19 ? 2043 HOH P O   1 
HETATM 3360 O  O   . HOH I 5 .   ? 21.999  21.290  42.680 1.00 35.34 ? 2044 HOH P O   1 
HETATM 3361 O  O   . HOH I 5 .   ? 26.140  14.181  35.974 1.00 31.91 ? 2045 HOH P O   1 
HETATM 3362 O  O   . HOH I 5 .   ? 18.634  15.708  27.065 1.00 32.97 ? 2046 HOH P O   1 
HETATM 3363 O  O   . HOH I 5 .   ? 17.238  13.100  24.034 1.00 55.38 ? 2047 HOH P O   1 
HETATM 3364 O  O   . HOH I 5 .   ? 16.965  24.218  58.725 1.00 51.73 ? 2048 HOH P O   1 
HETATM 3365 O  O   . HOH I 5 .   ? 37.324  26.116  56.824 1.00 42.41 ? 2049 HOH P O   1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'VAL A  280  C-ALPHA IS PLANAR' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   153 153 SER SER A . n 
A 1 2   ILE 2   154 154 ILE ILE A . n 
A 1 3   PRO 3   155 155 PRO PRO A . n 
A 1 4   TRP 4   156 156 TRP TRP A . n 
A 1 5   ASN 5   157 157 ASN ASN A . n 
A 1 6   LEU 6   158 158 LEU LEU A . n 
A 1 7   GLU 7   159 159 GLU GLU A . n 
A 1 8   ARG 8   160 160 ARG ARG A . n 
A 1 9   ILE 9   161 161 ILE ILE A . n 
A 1 10  THR 10  162 162 THR THR A . n 
A 1 11  PRO 11  163 163 PRO PRO A . n 
A 1 12  PRO 12  164 164 PRO PRO A . n 
A 1 13  ARG 13  165 165 ARG ARG A . n 
A 1 14  TYR 14  166 ?   ?   ?   A . n 
A 1 15  ARG 15  167 ?   ?   ?   A . n 
A 1 16  ALA 16  168 ?   ?   ?   A . n 
A 1 17  ASP 17  169 ?   ?   ?   A . n 
A 1 18  GLU 18  170 ?   ?   ?   A . n 
A 1 19  TYR 19  171 ?   ?   ?   A . n 
A 1 20  GLN 20  172 ?   ?   ?   A . n 
A 1 21  PRO 21  173 ?   ?   ?   A . n 
A 1 22  PRO 22  174 ?   ?   ?   A . n 
A 1 23  ASP 23  175 ?   ?   ?   A . n 
A 1 24  GLY 24  176 ?   ?   ?   A . n 
A 1 25  GLY 25  177 ?   ?   ?   A . n 
A 1 26  SER 26  178 ?   ?   ?   A . n 
A 1 27  LEU 27  179 179 LEU LEU A . n 
A 1 28  VAL 28  180 180 VAL VAL A . n 
A 1 29  GLU 29  181 181 GLU GLU A . n 
A 1 30  VAL 30  182 182 VAL VAL A . n 
A 1 31  TYR 31  183 183 TYR TYR A . n 
A 1 32  LEU 32  184 184 LEU LEU A . n 
A 1 33  LEU 33  185 185 LEU LEU A . n 
A 1 34  ASP 34  186 186 ASP ASP A . n 
A 1 35  THR 35  187 187 THR THR A . n 
A 1 36  SER 36  188 188 SER SER A . n 
A 1 37  ILE 37  189 189 ILE ILE A . n 
A 1 38  GLN 38  190 190 GLN GLN A . n 
A 1 39  SER 39  191 191 SER SER A . n 
A 1 40  ASP 40  192 192 ASP ASP A . n 
A 1 41  HIS 41  193 193 HIS HIS A . n 
A 1 42  ARG 42  194 194 ARG ARG A . n 
A 1 43  GLU 43  195 195 GLU GLU A . n 
A 1 44  ILE 44  196 196 ILE ILE A . n 
A 1 45  GLU 45  197 197 GLU GLU A . n 
A 1 46  GLY 46  198 198 GLY GLY A . n 
A 1 47  ARG 47  199 199 ARG ARG A . n 
A 1 48  VAL 48  200 200 VAL VAL A . n 
A 1 49  MET 49  201 201 MET MET A . n 
A 1 50  VAL 50  202 202 VAL VAL A . n 
A 1 51  THR 51  203 203 THR THR A . n 
A 1 52  ASP 52  204 204 ASP ASP A . n 
A 1 53  PHE 53  205 205 PHE PHE A . n 
A 1 54  GLU 54  206 206 GLU GLU A . n 
A 1 55  ASN 55  207 207 ASN ASN A . n 
A 1 56  VAL 56  208 208 VAL VAL A . n 
A 1 57  PRO 57  209 209 PRO PRO A . n 
A 1 58  GLU 58  210 210 GLU GLU A . n 
A 1 59  GLU 59  211 211 GLU GLU A . n 
A 1 60  ASP 60  212 212 ASP ASP A . n 
A 1 61  GLY 61  213 ?   ?   ?   A . n 
A 1 62  THR 62  214 ?   ?   ?   A . n 
A 1 63  ARG 63  215 ?   ?   ?   A . n 
A 1 64  PHE 64  216 ?   ?   ?   A . n 
A 1 65  HIS 65  217 ?   ?   ?   A . n 
A 1 66  ARG 66  218 ?   ?   ?   A . n 
A 1 67  GLN 67  219 ?   ?   ?   A . n 
A 1 68  ALA 68  220 ?   ?   ?   A . n 
A 1 69  SER 69  221 221 SER SER A . n 
A 1 70  LYS 70  222 222 LYS LYS A . n 
A 1 71  CYS 71  223 223 CYS CYS A . n 
A 1 72  ASP 72  224 224 ASP ASP A . n 
A 1 73  SER 73  225 225 SER SER A . n 
A 1 74  HIS 74  226 226 HIS HIS A . n 
A 1 75  GLY 75  227 227 GLY GLY A . n 
A 1 76  THR 76  228 228 THR THR A . n 
A 1 77  HIS 77  229 229 HIS HIS A . n 
A 1 78  LEU 78  230 230 LEU LEU A . n 
A 1 79  ALA 79  231 231 ALA ALA A . n 
A 1 80  GLY 80  232 232 GLY GLY A . n 
A 1 81  VAL 81  233 233 VAL VAL A . n 
A 1 82  VAL 82  234 234 VAL VAL A . n 
A 1 83  SER 83  235 235 SER SER A . n 
A 1 84  GLY 84  236 236 GLY GLY A . n 
A 1 85  ARG 85  237 237 ARG ARG A . n 
A 1 86  ASP 86  238 238 ASP ASP A . n 
A 1 87  ALA 87  239 239 ALA ALA A . n 
A 1 88  GLY 88  240 240 GLY GLY A . n 
A 1 89  VAL 89  241 241 VAL VAL A . n 
A 1 90  ALA 90  242 242 ALA ALA A . n 
A 1 91  LYS 91  243 243 LYS LYS A . n 
A 1 92  GLY 92  244 244 GLY GLY A . n 
A 1 93  ALA 93  245 245 ALA ALA A . n 
A 1 94  SER 94  246 246 SER SER A . n 
A 1 95  MET 95  247 247 MET MET A . n 
A 1 96  ARG 96  248 248 ARG ARG A . n 
A 1 97  SER 97  249 249 SER SER A . n 
A 1 98  LEU 98  250 250 LEU LEU A . n 
A 1 99  ARG 99  251 251 ARG ARG A . n 
A 1 100 VAL 100 252 252 VAL VAL A . n 
A 1 101 LEU 101 253 253 LEU LEU A . n 
A 1 102 ASN 102 254 254 ASN ASN A . n 
A 1 103 CYS 103 255 255 CYS CYS A . n 
A 1 104 GLN 104 256 256 GLN GLN A . n 
A 1 105 GLY 105 257 257 GLY GLY A . n 
A 1 106 LYS 106 258 258 LYS LYS A . n 
A 1 107 GLY 107 259 259 GLY GLY A . n 
A 1 108 THR 108 260 260 THR THR A . n 
A 1 109 VAL 109 261 261 VAL VAL A . n 
A 1 110 SER 110 262 262 SER SER A . n 
A 1 111 GLY 111 263 263 GLY GLY A . n 
A 1 112 THR 112 264 264 THR THR A . n 
A 1 113 LEU 113 265 265 LEU LEU A . n 
A 1 114 ILE 114 266 266 ILE ILE A . n 
A 1 115 GLY 115 267 267 GLY GLY A . n 
A 1 116 LEU 116 268 268 LEU LEU A . n 
A 1 117 GLU 117 269 269 GLU GLU A . n 
A 1 118 PHE 118 270 270 PHE PHE A . n 
A 1 119 ILE 119 271 271 ILE ILE A . n 
A 1 120 ARG 120 272 272 ARG ARG A . n 
A 1 121 LYS 121 273 273 LYS LYS A . n 
A 1 122 SER 122 274 274 SER SER A . n 
A 1 123 GLN 123 275 275 GLN GLN A . n 
A 1 124 LEU 124 276 276 LEU LEU A . n 
A 1 125 VAL 125 277 277 VAL VAL A . n 
A 1 126 GLN 126 278 278 GLN GLN A . n 
A 1 127 PRO 127 279 279 PRO PRO A . n 
A 1 128 VAL 128 280 280 VAL VAL A . n 
A 1 129 GLY 129 281 281 GLY GLY A . n 
A 1 130 PRO 130 282 282 PRO PRO A . n 
A 1 131 LEU 131 283 283 LEU LEU A . n 
A 1 132 VAL 132 284 284 VAL VAL A . n 
A 1 133 VAL 133 285 285 VAL VAL A . n 
A 1 134 LEU 134 286 286 LEU LEU A . n 
A 1 135 LEU 135 287 287 LEU LEU A . n 
A 1 136 PRO 136 288 288 PRO PRO A . n 
A 1 137 LEU 137 289 289 LEU LEU A . n 
A 1 138 ALA 138 290 290 ALA ALA A . n 
A 1 139 GLY 139 291 291 GLY GLY A . n 
A 1 140 GLY 140 292 292 GLY GLY A . n 
A 1 141 TYR 141 293 293 TYR TYR A . n 
A 1 142 SER 142 294 294 SER SER A . n 
A 1 143 ARG 143 295 295 ARG ARG A . n 
A 1 144 VAL 144 296 296 VAL VAL A . n 
A 1 145 LEU 145 297 297 LEU LEU A . n 
A 1 146 ASN 146 298 298 ASN ASN A . n 
A 1 147 ALA 147 299 299 ALA ALA A . n 
A 1 148 ALA 148 300 300 ALA ALA A . n 
A 1 149 CYS 149 301 301 CYS CYS A . n 
A 1 150 GLN 150 302 302 GLN GLN A . n 
A 1 151 ARG 151 303 303 ARG ARG A . n 
A 1 152 LEU 152 304 304 LEU LEU A . n 
A 1 153 ALA 153 305 305 ALA ALA A . n 
A 1 154 ARG 154 306 306 ARG ARG A . n 
A 1 155 ALA 155 307 307 ALA ALA A . n 
A 1 156 GLY 156 308 308 GLY GLY A . n 
A 1 157 VAL 157 309 309 VAL VAL A . n 
A 1 158 VAL 158 310 310 VAL VAL A . n 
A 1 159 LEU 159 311 311 LEU LEU A . n 
A 1 160 VAL 160 312 312 VAL VAL A . n 
A 1 161 THR 161 313 313 THR THR A . n 
A 1 162 ALA 162 314 314 ALA ALA A . n 
A 1 163 ALA 163 315 315 ALA ALA A . n 
A 1 164 GLY 164 316 316 GLY GLY A . n 
A 1 165 ASN 165 317 317 ASN ASN A . n 
A 1 166 PHE 166 318 318 PHE PHE A . n 
A 1 167 ARG 167 319 319 ARG ARG A . n 
A 1 168 ASP 168 320 320 ASP ASP A . n 
A 1 169 ASP 169 321 321 ASP ASP A . n 
A 1 170 ALA 170 322 322 ALA ALA A . n 
A 1 171 CYS 171 323 323 CYS CYS A . n 
A 1 172 LEU 172 324 324 LEU LEU A . n 
A 1 173 TYR 173 325 325 TYR TYR A . n 
A 1 174 SER 174 326 326 SER SER A . n 
A 1 175 PRO 175 327 327 PRO PRO A . n 
A 1 176 ALA 176 328 328 ALA ALA A . n 
A 1 177 SER 177 329 329 SER SER A . n 
A 1 178 ALA 178 330 330 ALA ALA A . n 
A 1 179 PRO 179 331 331 PRO PRO A . n 
A 1 180 GLU 180 332 332 GLU GLU A . n 
A 1 181 VAL 181 333 333 VAL VAL A . n 
A 1 182 ILE 182 334 334 ILE ILE A . n 
A 1 183 THR 183 335 335 THR THR A . n 
A 1 184 VAL 184 336 336 VAL VAL A . n 
A 1 185 GLY 185 337 337 GLY GLY A . n 
A 1 186 ALA 186 338 338 ALA ALA A . n 
A 1 187 THR 187 339 339 THR THR A . n 
A 1 188 ASN 188 340 340 ASN ASN A . n 
A 1 189 ALA 189 341 341 ALA ALA A . n 
A 1 190 GLN 190 342 342 GLN GLN A . n 
A 1 191 ASP 191 343 343 ASP ASP A . n 
A 1 192 GLN 192 344 344 GLN GLN A . n 
A 1 193 PRO 193 345 345 PRO PRO A . n 
A 1 194 VAL 194 346 346 VAL VAL A . n 
A 1 195 THR 195 347 347 THR THR A . n 
A 1 196 LEU 196 348 348 LEU LEU A . n 
A 1 197 GLY 197 349 349 GLY GLY A . n 
A 1 198 THR 198 350 350 THR THR A . n 
A 1 199 LEU 199 351 351 LEU LEU A . n 
A 1 200 GLY 200 352 352 GLY GLY A . n 
A 1 201 THR 201 353 353 THR THR A . n 
A 1 202 ASN 202 354 354 ASN ASN A . n 
A 1 203 PHE 203 355 355 PHE PHE A . n 
A 1 204 GLY 204 356 356 GLY GLY A . n 
A 1 205 ARG 205 357 357 ARG ARG A . n 
A 1 206 CYS 206 358 358 CYS CYS A . n 
A 1 207 VAL 207 359 359 VAL VAL A . n 
A 1 208 ASP 208 360 360 ASP ASP A . n 
A 1 209 LEU 209 361 361 LEU LEU A . n 
A 1 210 PHE 210 362 362 PHE PHE A . n 
A 1 211 ALA 211 363 363 ALA ALA A . n 
A 1 212 PRO 212 364 364 PRO PRO A . n 
A 1 213 GLY 213 365 365 GLY GLY A . n 
A 1 214 GLU 214 366 366 GLU GLU A . n 
A 1 215 ASP 215 367 367 ASP ASP A . n 
A 1 216 ILE 216 368 368 ILE ILE A . n 
A 1 217 ILE 217 369 369 ILE ILE A . n 
A 1 218 GLY 218 370 370 GLY GLY A . n 
A 1 219 ALA 219 371 371 ALA ALA A . n 
A 1 220 SER 220 372 372 SER SER A . n 
A 1 221 SER 221 373 373 SER SER A . n 
A 1 222 ASP 222 374 374 ASP ASP A . n 
A 1 223 CYS 223 375 375 CYS CYS A . n 
A 1 224 SER 224 376 376 SER SER A . n 
A 1 225 THR 225 377 377 THR THR A . n 
A 1 226 CYS 226 378 378 CYS CYS A . n 
A 1 227 PHE 227 379 379 PHE PHE A . n 
A 1 228 VAL 228 380 380 VAL VAL A . n 
A 1 229 SER 229 381 381 SER SER A . n 
A 1 230 GLN 230 382 382 GLN GLN A . n 
A 1 231 SER 231 383 383 SER SER A . n 
A 1 232 GLY 232 384 384 GLY GLY A . n 
A 1 233 THR 233 385 385 THR THR A . n 
A 1 234 SER 234 386 386 SER SER A . n 
A 1 235 GLN 235 387 387 GLN GLN A . n 
A 1 236 ALA 236 388 388 ALA ALA A . n 
A 1 237 ALA 237 389 389 ALA ALA A . n 
A 1 238 ALA 238 390 390 ALA ALA A . n 
A 1 239 HIS 239 391 391 HIS HIS A . n 
A 1 240 VAL 240 392 392 VAL VAL A . n 
A 1 241 ALA 241 393 393 ALA ALA A . n 
A 1 242 GLY 242 394 394 GLY GLY A . n 
A 1 243 ILE 243 395 395 ILE ILE A . n 
A 1 244 ALA 244 396 396 ALA ALA A . n 
A 1 245 ALA 245 397 397 ALA ALA A . n 
A 1 246 MET 246 398 398 MET MET A . n 
A 1 247 MET 247 399 399 MET MET A . n 
A 1 248 LEU 248 400 400 LEU LEU A . n 
A 1 249 SER 249 401 401 SER SER A . n 
A 1 250 ALA 250 402 402 ALA ALA A . n 
A 1 251 GLU 251 403 403 GLU GLU A . n 
A 1 252 PRO 252 404 404 PRO PRO A . n 
A 1 253 GLU 253 405 405 GLU GLU A . n 
A 1 254 LEU 254 406 406 LEU LEU A . n 
A 1 255 THR 255 407 407 THR THR A . n 
A 1 256 LEU 256 408 408 LEU LEU A . n 
A 1 257 ALA 257 409 409 ALA ALA A . n 
A 1 258 GLU 258 410 410 GLU GLU A . n 
A 1 259 LEU 259 411 411 LEU LEU A . n 
A 1 260 ARG 260 412 412 ARG ARG A . n 
A 1 261 GLN 261 413 413 GLN GLN A . n 
A 1 262 ARG 262 414 414 ARG ARG A . n 
A 1 263 LEU 263 415 415 LEU LEU A . n 
A 1 264 ILE 264 416 416 ILE ILE A . n 
A 1 265 HIS 265 417 417 HIS HIS A . n 
A 1 266 PHE 266 418 418 PHE PHE A . n 
A 1 267 SER 267 419 419 SER SER A . n 
A 1 268 ALA 268 420 420 ALA ALA A . n 
A 1 269 LYS 269 421 421 LYS LYS A . n 
A 1 270 ASP 270 422 422 ASP ASP A . n 
A 1 271 VAL 271 423 423 VAL VAL A . n 
A 1 272 ILE 272 424 424 ILE ILE A . n 
A 1 273 ASN 273 425 425 ASN ASN A . n 
A 1 274 GLU 274 426 426 GLU GLU A . n 
A 1 275 ALA 275 427 427 ALA ALA A . n 
A 1 276 TRP 276 428 428 TRP TRP A . n 
A 1 277 PHE 277 429 429 PHE PHE A . n 
A 1 278 PRO 278 430 430 PRO PRO A . n 
A 1 279 GLU 279 431 431 GLU GLU A . n 
A 1 280 ASP 280 432 432 ASP ASP A . n 
A 1 281 GLN 281 433 433 GLN GLN A . n 
A 1 282 ARG 282 434 434 ARG ARG A . n 
A 1 283 VAL 283 435 435 VAL VAL A . n 
A 1 284 LEU 284 436 436 LEU LEU A . n 
A 1 285 THR 285 437 437 THR THR A . n 
A 1 286 PRO 286 438 438 PRO PRO A . n 
A 1 287 ASN 287 439 439 ASN ASN A . n 
A 1 288 LEU 288 440 440 LEU LEU A . n 
A 1 289 VAL 289 441 441 VAL VAL A . n 
A 1 290 ALA 290 442 442 ALA ALA A . n 
A 1 291 ALA 291 443 443 ALA ALA A . n 
A 1 292 LEU 292 444 444 LEU LEU A . n 
A 1 293 PRO 293 445 445 PRO PRO A . n 
A 1 294 PRO 294 446 446 PRO PRO A . n 
A 1 295 SER 295 447 ?   ?   ?   A . n 
A 1 296 THR 296 448 ?   ?   ?   A . n 
A 1 297 HIS 297 449 ?   ?   ?   A . n 
A 1 298 GLY 298 450 ?   ?   ?   A . n 
A 1 299 ALA 299 451 ?   ?   ?   A . n 
A 1 300 ALA 300 452 ?   ?   ?   A . n 
A 1 301 GLY 301 453 ?   ?   ?   A . n 
A 1 302 THR 302 454 ?   ?   ?   A . n 
A 1 303 ALA 303 455 ?   ?   ?   A . n 
A 1 304 ALA 304 456 ?   ?   ?   A . n 
A 1 305 ALA 305 457 ?   ?   ?   A . n 
A 1 306 SER 306 458 ?   ?   ?   A . n 
A 1 307 HIS 307 459 ?   ?   ?   A . n 
A 1 308 HIS 308 460 ?   ?   ?   A . n 
A 1 309 HIS 309 461 ?   ?   ?   A . n 
A 1 310 HIS 310 462 ?   ?   ?   A . n 
A 1 311 HIS 311 463 ?   ?   ?   A . n 
A 1 312 HIS 312 464 ?   ?   ?   A . n 
B 2 1   MET 1   266 ?   ?   ?   E . n 
B 2 2   LYS 2   267 ?   ?   ?   E . n 
B 2 3   HIS 3   268 ?   ?   ?   E . n 
B 2 4   HIS 4   269 ?   ?   ?   E . n 
B 2 5   HIS 5   270 ?   ?   ?   E . n 
B 2 6   HIS 6   271 ?   ?   ?   E . n 
B 2 7   HIS 7   272 ?   ?   ?   E . n 
B 2 8   HIS 8   273 ?   ?   ?   E . n 
B 2 9   PRO 9   274 ?   ?   ?   E . n 
B 2 10  MET 10  275 ?   ?   ?   E . n 
B 2 11  SER 11  276 ?   ?   ?   E . n 
B 2 12  ASP 12  277 ?   ?   ?   E . n 
B 2 13  TYR 13  278 ?   ?   ?   E . n 
B 2 14  ASP 14  279 ?   ?   ?   E . n 
B 2 15  ILE 15  280 ?   ?   ?   E . n 
B 2 16  PRO 16  281 ?   ?   ?   E . n 
B 2 17  THR 17  282 ?   ?   ?   E . n 
B 2 18  THR 18  283 ?   ?   ?   E . n 
B 2 19  GLU 19  284 ?   ?   ?   E . n 
B 2 20  ASN 20  285 285 ASN ASN E . n 
B 2 21  LEU 21  286 286 LEU LEU E . n 
B 2 22  TYR 22  287 287 TYR TYR E . n 
B 2 23  PHE 23  288 288 PHE PHE E . n 
B 2 24  GLN 24  289 289 GLN GLN E . n 
B 2 25  GLY 25  290 290 GLY GLY E . n 
B 2 26  ALA 26  291 291 ALA ALA E . n 
B 2 27  MET 27  292 292 MET MET E . n 
B 2 28  GLY 28  293 293 GLY GLY E . n 
B 2 29  THR 29  294 294 THR THR E . n 
B 2 30  ASN 30  295 295 ASN ASN E . n 
B 2 31  GLU 31  296 296 GLU GLU E . n 
B 2 32  CYS 32  297 297 CYS CYS E . n 
B 2 33  LEU 33  298 298 LEU LEU E . n 
B 2 34  ASP 34  299 299 ASP ASP E . n 
B 2 35  ASN 35  300 300 ASN ASN E . n 
B 2 36  ASN 36  301 301 ASN ASN E . n 
B 2 37  GLY 37  302 302 GLY GLY E . n 
B 2 38  GLY 38  303 303 GLY GLY E . n 
B 2 39  CYS 39  304 304 CYS CYS E . n 
B 2 40  SER 40  305 305 SER SER E . n 
B 2 41  TYR 41  306 306 TYR TYR E . n 
B 2 42  VAL 42  307 307 VAL VAL E . n 
B 2 43  CYS 43  308 308 CYS CYS E . n 
B 2 44  ASN 44  309 309 ASN ASN E . n 
B 2 45  ASP 45  310 310 ASP ASP E . n 
B 2 46  LEU 46  311 311 LEU LEU E . n 
B 2 47  LYS 47  312 312 LYS LYS E . n 
B 2 48  ILE 48  313 313 ILE ILE E . n 
B 2 49  GLY 49  314 314 GLY GLY E . n 
B 2 50  TYR 50  315 315 TYR TYR E . n 
B 2 51  GLU 51  316 316 GLU GLU E . n 
B 2 52  CYS 52  317 317 CYS CYS E . n 
B 2 53  LEU 53  318 318 LEU LEU E . n 
B 2 54  CYS 54  319 319 CYS CYS E . n 
B 2 55  PRO 55  320 320 PRO PRO E . n 
B 2 56  ASP 56  321 321 ASP ASP E . n 
B 2 57  GLY 57  322 322 GLY GLY E . n 
B 2 58  PHE 58  323 323 PHE PHE E . n 
B 2 59  GLN 59  324 324 GLN GLN E . n 
B 2 60  LEU 60  325 325 LEU LEU E . n 
B 2 61  VAL 61  326 326 VAL VAL E . n 
B 2 62  ALA 62  327 327 ALA ALA E . n 
B 2 63  GLN 63  328 328 GLN GLN E . n 
B 2 64  ARG 64  329 329 ARG ARG E . n 
B 2 65  ARG 65  330 330 ARG ARG E . n 
B 2 66  CYS 66  331 331 CYS CYS E . n 
B 2 67  GLU 67  332 332 GLU GLU E . n 
B 2 68  ASP 68  333 333 ASP ASP E . n 
B 2 69  ILE 69  334 ?   ?   ?   E . n 
B 2 70  ASP 70  335 ?   ?   ?   E . n 
B 2 71  GLU 71  336 ?   ?   ?   E . n 
B 2 72  CYS 72  337 ?   ?   ?   E . n 
B 2 73  GLN 73  338 ?   ?   ?   E . n 
B 2 74  ASP 74  339 ?   ?   ?   E . n 
B 2 75  PRO 75  340 ?   ?   ?   E . n 
B 2 76  ASP 76  341 ?   ?   ?   E . n 
B 2 77  THR 77  342 ?   ?   ?   E . n 
B 2 78  CYS 78  343 ?   ?   ?   E . n 
B 2 79  SER 79  344 ?   ?   ?   E . n 
B 2 80  GLN 80  345 ?   ?   ?   E . n 
B 2 81  LEU 81  346 ?   ?   ?   E . n 
B 2 82  CYS 82  347 ?   ?   ?   E . n 
B 2 83  VAL 83  348 ?   ?   ?   E . n 
B 2 84  ASN 84  349 ?   ?   ?   E . n 
B 2 85  LEU 85  350 ?   ?   ?   E . n 
B 2 86  GLU 86  351 ?   ?   ?   E . n 
B 2 87  GLY 87  352 ?   ?   ?   E . n 
B 2 88  GLY 88  353 ?   ?   ?   E . n 
B 2 89  TYR 89  354 ?   ?   ?   E . n 
B 2 90  LYS 90  355 ?   ?   ?   E . n 
B 2 91  CYS 91  356 ?   ?   ?   E . n 
B 2 92  GLN 92  357 ?   ?   ?   E . n 
B 2 93  CYS 93  358 ?   ?   ?   E . n 
B 2 94  GLU 94  359 ?   ?   ?   E . n 
B 2 95  GLU 95  360 ?   ?   ?   E . n 
B 2 96  GLY 96  361 ?   ?   ?   E . n 
B 2 97  PHE 97  362 ?   ?   ?   E . n 
B 2 98  GLN 98  363 ?   ?   ?   E . n 
B 2 99  LEU 99  364 ?   ?   ?   E . n 
B 2 100 ASP 100 365 ?   ?   ?   E . n 
B 2 101 PRO 101 366 ?   ?   ?   E . n 
B 2 102 HIS 102 367 ?   ?   ?   E . n 
B 2 103 THR 103 368 ?   ?   ?   E . n 
B 2 104 LYS 104 369 ?   ?   ?   E . n 
B 2 105 ALA 105 370 ?   ?   ?   E . n 
B 2 106 CYS 106 371 ?   ?   ?   E . n 
B 2 107 LYS 107 372 ?   ?   ?   E . n 
C 3 1   MET 1   39  ?   ?   ?   P . n 
C 3 2   LYS 2   40  ?   ?   ?   P . n 
C 3 3   GLY 3   41  ?   ?   ?   P . n 
C 3 4   SER 4   42  ?   ?   ?   P . n 
C 3 5   LYS 5   43  ?   ?   ?   P . n 
C 3 6   GLY 6   44  ?   ?   ?   P . n 
C 3 7   SER 7   45  ?   ?   ?   P . n 
C 3 8   LYS 8   46  ?   ?   ?   P . n 
C 3 9   GLY 9   47  ?   ?   ?   P . n 
C 3 10  SER 10  48  ?   ?   ?   P . n 
C 3 11  LYS 11  49  ?   ?   ?   P . n 
C 3 12  PRO 12  50  ?   ?   ?   P . n 
C 3 13  MET 13  51  ?   ?   ?   P . n 
C 3 14  SER 14  52  ?   ?   ?   P . n 
C 3 15  ALA 15  53  ?   ?   ?   P . n 
C 3 16  GLU 16  54  ?   ?   ?   P . n 
C 3 17  ALA 17  55  ?   ?   ?   P . n 
C 3 18  PRO 18  56  ?   ?   ?   P . n 
C 3 19  GLU 19  57  ?   ?   ?   P . n 
C 3 20  HIS 20  58  ?   ?   ?   P . n 
C 3 21  GLY 21  59  ?   ?   ?   P . n 
C 3 22  THR 22  60  60  THR THR P . n 
C 3 23  THR 23  61  61  THR THR P . n 
C 3 24  ALA 24  62  62  ALA ALA P . n 
C 3 25  THR 25  63  63  THR THR P . n 
C 3 26  PHE 26  64  64  PHE PHE P . n 
C 3 27  HIS 27  65  65  HIS HIS P . n 
C 3 28  ARG 28  66  66  ARG ARG P . n 
C 3 29  CYS 29  67  67  CYS CYS P . n 
C 3 30  ALA 30  68  68  ALA ALA P . n 
C 3 31  LYS 31  69  69  LYS LYS P . n 
C 3 32  ASP 32  70  70  ASP ASP P . n 
C 3 33  PRO 33  71  71  PRO PRO P . n 
C 3 34  TRP 34  72  72  TRP TRP P . n 
C 3 35  ARG 35  73  73  ARG ARG P . n 
C 3 36  LEU 36  74  74  LEU LEU P . n 
C 3 37  PRO 37  75  75  PRO PRO P . n 
C 3 38  GLY 38  76  76  GLY GLY P . n 
C 3 39  THR 39  77  77  THR THR P . n 
C 3 40  TYR 40  78  78  TYR TYR P . n 
C 3 41  VAL 41  79  79  VAL VAL P . n 
C 3 42  VAL 42  80  80  VAL VAL P . n 
C 3 43  VAL 43  81  81  VAL VAL P . n 
C 3 44  LEU 44  82  82  LEU LEU P . n 
C 3 45  LYS 45  83  83  LYS LYS P . n 
C 3 46  GLU 46  84  84  GLU GLU P . n 
C 3 47  GLU 47  85  85  GLU GLU P . n 
C 3 48  THR 48  86  86  THR THR P . n 
C 3 49  HIS 49  87  87  HIS HIS P . n 
C 3 50  LEU 50  88  88  LEU LEU P . n 
C 3 51  SER 51  89  89  SER SER P . n 
C 3 52  GLN 52  90  90  GLN GLN P . n 
C 3 53  SER 53  91  91  SER SER P . n 
C 3 54  GLU 54  92  92  GLU GLU P . n 
C 3 55  ARG 55  93  93  ARG ARG P . n 
C 3 56  THR 56  94  94  THR THR P . n 
C 3 57  ALA 57  95  95  ALA ALA P . n 
C 3 58  ARG 58  96  96  ARG ARG P . n 
C 3 59  ARG 59  97  97  ARG ARG P . n 
C 3 60  LEU 60  98  98  LEU LEU P . n 
C 3 61  GLN 61  99  99  GLN GLN P . n 
C 3 62  ALA 62  100 100 ALA ALA P . n 
C 3 63  GLN 63  101 101 GLN GLN P . n 
C 3 64  ALA 64  102 102 ALA ALA P . n 
C 3 65  ALA 65  103 103 ALA ALA P . n 
C 3 66  ARG 66  104 104 ARG ARG P . n 
C 3 67  ARG 67  105 105 ARG ARG P . n 
C 3 68  GLY 68  106 106 GLY GLY P . n 
C 3 69  TYR 69  107 107 TYR TYR P . n 
C 3 70  LEU 70  108 108 LEU LEU P . n 
C 3 71  THR 71  109 109 THR THR P . n 
C 3 72  LYS 72  110 110 LYS LYS P . n 
C 3 73  ILE 73  111 111 ILE ILE P . n 
C 3 74  LEU 74  112 112 LEU LEU P . n 
C 3 75  HIS 75  113 113 HIS HIS P . n 
C 3 76  VAL 76  114 114 VAL VAL P . n 
C 3 77  PHE 77  115 115 PHE PHE P . n 
C 3 78  HIS 78  116 116 HIS HIS P . n 
C 3 79  GLY 79  117 117 GLY GLY P . n 
C 3 80  LEU 80  118 118 LEU LEU P . n 
C 3 81  LEU 81  119 119 LEU LEU P . n 
C 3 82  PRO 82  120 120 PRO PRO P . n 
C 3 83  GLY 83  121 121 GLY GLY P . n 
C 3 84  PHE 84  122 122 PHE PHE P . n 
C 3 85  LEU 85  123 123 LEU LEU P . n 
C 3 86  VAL 86  124 124 VAL VAL P . n 
C 3 87  LYS 87  125 125 LYS LYS P . n 
C 3 88  MET 88  126 126 MET MET P . n 
C 3 89  SER 89  127 127 SER SER P . n 
C 3 90  GLY 90  128 128 GLY GLY P . n 
C 3 91  ASP 91  129 129 ASP ASP P . n 
C 3 92  LEU 92  130 130 LEU LEU P . n 
C 3 93  LEU 93  131 131 LEU LEU P . n 
C 3 94  GLU 94  132 132 GLU GLU P . n 
C 3 95  LEU 95  133 133 LEU LEU P . n 
C 3 96  ALA 96  134 134 ALA ALA P . n 
C 3 97  LEU 97  135 135 LEU LEU P . n 
C 3 98  LYS 98  136 136 LYS LYS P . n 
C 3 99  LEU 99  137 137 LEU LEU P . n 
C 3 100 PRO 100 138 138 PRO PRO P . n 
C 3 101 HIS 101 139 139 HIS HIS P . n 
C 3 102 VAL 102 140 140 VAL VAL P . n 
C 3 103 ASP 103 141 141 ASP ASP P . n 
C 3 104 TYR 104 142 142 TYR TYR P . n 
C 3 105 ILE 105 143 143 ILE ILE P . n 
C 3 106 GLU 106 144 144 GLU GLU P . n 
C 3 107 GLU 107 145 145 GLU GLU P . n 
C 3 108 ASP 108 146 146 ASP ASP P . n 
C 3 109 SER 109 147 147 SER SER P . n 
C 3 110 SER 110 148 148 SER SER P . n 
C 3 111 VAL 111 149 149 VAL VAL P . n 
C 3 112 PHE 112 150 150 PHE PHE P . n 
C 3 113 ALA 113 151 151 ALA ALA P . n 
C 3 114 GLN 114 152 152 GLN GLN P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 CA  1  1447 1447 CA  CA  A . 
E 4 CA  1  1334 1334 CA  CA  E . 
F 4 CA  1  1335 1335 CA  CA  E . 
G 5 HOH 1  2001 2001 HOH HOH A . 
G 5 HOH 2  2002 2002 HOH HOH A . 
G 5 HOH 3  2003 2003 HOH HOH A . 
G 5 HOH 4  2004 2004 HOH HOH A . 
G 5 HOH 5  2005 2005 HOH HOH A . 
G 5 HOH 6  2006 2006 HOH HOH A . 
G 5 HOH 7  2007 2007 HOH HOH A . 
G 5 HOH 8  2008 2008 HOH HOH A . 
G 5 HOH 9  2009 2009 HOH HOH A . 
G 5 HOH 10 2010 2010 HOH HOH A . 
G 5 HOH 11 2011 2011 HOH HOH A . 
G 5 HOH 12 2012 2012 HOH HOH A . 
G 5 HOH 13 2013 2013 HOH HOH A . 
G 5 HOH 14 2014 2014 HOH HOH A . 
G 5 HOH 15 2015 2015 HOH HOH A . 
G 5 HOH 16 2016 2016 HOH HOH A . 
G 5 HOH 17 2017 2017 HOH HOH A . 
G 5 HOH 18 2018 2018 HOH HOH A . 
G 5 HOH 19 2019 2019 HOH HOH A . 
G 5 HOH 20 2020 2020 HOH HOH A . 
G 5 HOH 21 2021 2021 HOH HOH A . 
G 5 HOH 22 2022 2022 HOH HOH A . 
G 5 HOH 23 2023 2023 HOH HOH A . 
G 5 HOH 24 2024 2024 HOH HOH A . 
G 5 HOH 25 2025 2025 HOH HOH A . 
G 5 HOH 26 2026 2026 HOH HOH A . 
G 5 HOH 27 2027 2027 HOH HOH A . 
G 5 HOH 28 2028 2028 HOH HOH A . 
G 5 HOH 29 2029 2029 HOH HOH A . 
G 5 HOH 30 2030 2030 HOH HOH A . 
G 5 HOH 31 2031 2031 HOH HOH A . 
G 5 HOH 32 2032 2032 HOH HOH A . 
G 5 HOH 33 2033 2033 HOH HOH A . 
G 5 HOH 34 2034 2034 HOH HOH A . 
G 5 HOH 35 2035 2035 HOH HOH A . 
G 5 HOH 36 2036 2036 HOH HOH A . 
G 5 HOH 37 2037 2037 HOH HOH A . 
G 5 HOH 38 2038 2038 HOH HOH A . 
G 5 HOH 39 2039 2039 HOH HOH A . 
G 5 HOH 40 2040 2040 HOH HOH A . 
G 5 HOH 41 2041 2041 HOH HOH A . 
G 5 HOH 42 2042 2042 HOH HOH A . 
G 5 HOH 43 2043 2043 HOH HOH A . 
G 5 HOH 44 2044 2044 HOH HOH A . 
G 5 HOH 45 2045 2045 HOH HOH A . 
G 5 HOH 46 2046 2046 HOH HOH A . 
G 5 HOH 47 2047 2047 HOH HOH A . 
G 5 HOH 48 2048 2048 HOH HOH A . 
G 5 HOH 49 2049 2049 HOH HOH A . 
G 5 HOH 50 2050 2050 HOH HOH A . 
G 5 HOH 51 2051 2051 HOH HOH A . 
G 5 HOH 52 2052 2052 HOH HOH A . 
G 5 HOH 53 2053 2053 HOH HOH A . 
G 5 HOH 54 2054 2054 HOH HOH A . 
G 5 HOH 55 2055 2055 HOH HOH A . 
G 5 HOH 56 2056 2056 HOH HOH A . 
G 5 HOH 57 2057 2057 HOH HOH A . 
G 5 HOH 58 2058 2058 HOH HOH A . 
G 5 HOH 59 2059 2059 HOH HOH A . 
G 5 HOH 60 2060 2060 HOH HOH A . 
G 5 HOH 61 2061 2061 HOH HOH A . 
G 5 HOH 62 2062 2062 HOH HOH A . 
G 5 HOH 63 2063 2063 HOH HOH A . 
G 5 HOH 64 2064 2064 HOH HOH A . 
G 5 HOH 65 2065 2065 HOH HOH A . 
G 5 HOH 66 2066 2066 HOH HOH A . 
G 5 HOH 67 2067 2067 HOH HOH A . 
G 5 HOH 68 2068 2068 HOH HOH A . 
G 5 HOH 69 2069 2069 HOH HOH A . 
G 5 HOH 70 2070 2070 HOH HOH A . 
G 5 HOH 71 2071 2071 HOH HOH A . 
G 5 HOH 72 2072 2072 HOH HOH A . 
G 5 HOH 73 2073 2073 HOH HOH A . 
G 5 HOH 74 2074 2074 HOH HOH A . 
G 5 HOH 75 2075 2075 HOH HOH A . 
G 5 HOH 76 2076 2076 HOH HOH A . 
G 5 HOH 77 2077 2077 HOH HOH A . 
G 5 HOH 78 2078 2078 HOH HOH A . 
G 5 HOH 79 2079 2079 HOH HOH A . 
G 5 HOH 80 2080 2080 HOH HOH A . 
G 5 HOH 81 2081 2081 HOH HOH A . 
G 5 HOH 82 2082 2082 HOH HOH A . 
G 5 HOH 83 2083 2083 HOH HOH A . 
G 5 HOH 84 2084 2084 HOH HOH A . 
G 5 HOH 85 2085 2085 HOH HOH A . 
G 5 HOH 86 2086 2086 HOH HOH A . 
G 5 HOH 87 2087 2087 HOH HOH A . 
G 5 HOH 88 2088 2088 HOH HOH A . 
G 5 HOH 89 2089 2089 HOH HOH A . 
G 5 HOH 90 2090 2090 HOH HOH A . 
G 5 HOH 91 2091 2091 HOH HOH A . 
G 5 HOH 92 2092 2092 HOH HOH A . 
G 5 HOH 93 2093 2093 HOH HOH A . 
G 5 HOH 94 2094 2094 HOH HOH A . 
G 5 HOH 95 2095 2095 HOH HOH A . 
G 5 HOH 96 2096 2096 HOH HOH A . 
G 5 HOH 97 2097 2097 HOH HOH A . 
G 5 HOH 98 2098 2098 HOH HOH A . 
G 5 HOH 99 2099 2099 HOH HOH A . 
H 5 HOH 1  2001 2001 HOH HOH E . 
H 5 HOH 2  2002 2002 HOH HOH E . 
H 5 HOH 3  2003 2003 HOH HOH E . 
H 5 HOH 4  2004 2004 HOH HOH E . 
H 5 HOH 5  2005 2005 HOH HOH E . 
H 5 HOH 6  2006 2006 HOH HOH E . 
H 5 HOH 7  2007 2007 HOH HOH E . 
H 5 HOH 8  2008 2008 HOH HOH E . 
H 5 HOH 9  2009 2009 HOH HOH E . 
H 5 HOH 10 2010 2010 HOH HOH E . 
H 5 HOH 11 2011 2011 HOH HOH E . 
H 5 HOH 12 2012 2012 HOH HOH E . 
H 5 HOH 13 2013 2013 HOH HOH E . 
H 5 HOH 14 2014 2014 HOH HOH E . 
H 5 HOH 15 2015 2015 HOH HOH E . 
H 5 HOH 16 2016 2016 HOH HOH E . 
H 5 HOH 17 2017 2017 HOH HOH E . 
H 5 HOH 18 2018 2018 HOH HOH E . 
H 5 HOH 19 2019 2019 HOH HOH E . 
H 5 HOH 20 2020 2020 HOH HOH E . 
H 5 HOH 21 2021 2021 HOH HOH E . 
H 5 HOH 22 2022 2022 HOH HOH E . 
H 5 HOH 23 2023 2023 HOH HOH E . 
H 5 HOH 24 2024 2024 HOH HOH E . 
H 5 HOH 25 2025 2025 HOH HOH E . 
H 5 HOH 26 2026 2026 HOH HOH E . 
H 5 HOH 27 2027 2027 HOH HOH E . 
I 5 HOH 1  2001 2001 HOH HOH P . 
I 5 HOH 2  2002 2002 HOH HOH P . 
I 5 HOH 3  2003 2003 HOH HOH P . 
I 5 HOH 4  2004 2004 HOH HOH P . 
I 5 HOH 5  2005 2005 HOH HOH P . 
I 5 HOH 6  2006 2006 HOH HOH P . 
I 5 HOH 7  2007 2007 HOH HOH P . 
I 5 HOH 8  2008 2008 HOH HOH P . 
I 5 HOH 9  2009 2009 HOH HOH P . 
I 5 HOH 10 2010 2010 HOH HOH P . 
I 5 HOH 11 2011 2011 HOH HOH P . 
I 5 HOH 12 2012 2012 HOH HOH P . 
I 5 HOH 13 2013 2013 HOH HOH P . 
I 5 HOH 14 2014 2014 HOH HOH P . 
I 5 HOH 15 2015 2015 HOH HOH P . 
I 5 HOH 16 2016 2016 HOH HOH P . 
I 5 HOH 17 2017 2017 HOH HOH P . 
I 5 HOH 18 2018 2018 HOH HOH P . 
I 5 HOH 19 2019 2019 HOH HOH P . 
I 5 HOH 20 2020 2020 HOH HOH P . 
I 5 HOH 21 2021 2021 HOH HOH P . 
I 5 HOH 22 2022 2022 HOH HOH P . 
I 5 HOH 23 2023 2023 HOH HOH P . 
I 5 HOH 24 2024 2024 HOH HOH P . 
I 5 HOH 25 2025 2025 HOH HOH P . 
I 5 HOH 26 2026 2026 HOH HOH P . 
I 5 HOH 27 2027 2027 HOH HOH P . 
I 5 HOH 28 2028 2028 HOH HOH P . 
I 5 HOH 29 2029 2029 HOH HOH P . 
I 5 HOH 30 2030 2030 HOH HOH P . 
I 5 HOH 31 2031 2031 HOH HOH P . 
I 5 HOH 32 2032 2032 HOH HOH P . 
I 5 HOH 33 2033 2033 HOH HOH P . 
I 5 HOH 34 2034 2034 HOH HOH P . 
I 5 HOH 35 2035 2035 HOH HOH P . 
I 5 HOH 36 2036 2036 HOH HOH P . 
I 5 HOH 37 2037 2037 HOH HOH P . 
I 5 HOH 38 2038 2038 HOH HOH P . 
I 5 HOH 39 2039 2039 HOH HOH P . 
I 5 HOH 40 2040 2040 HOH HOH P . 
I 5 HOH 41 2041 2041 HOH HOH P . 
I 5 HOH 42 2042 2042 HOH HOH P . 
I 5 HOH 43 2043 2043 HOH HOH P . 
I 5 HOH 44 2044 2044 HOH HOH P . 
I 5 HOH 45 2045 2045 HOH HOH P . 
I 5 HOH 46 2046 2046 HOH HOH P . 
I 5 HOH 47 2047 2047 HOH HOH P . 
I 5 HOH 48 2048 2048 HOH HOH P . 
I 5 HOH 49 2049 2049 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4070  ? 
1 MORE         -28.0 ? 
1 'SSA (A^2)'  22360 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A VAL 181 ? A VAL 333  ? 1_555 CA ? D CA . ? A CA 1447 ? 1_555 O   ? A ALA 178 ? A ALA 330  ? 1_555 80.0  ? 
2  O   ? A VAL 181 ? A VAL 333  ? 1_555 CA ? D CA . ? A CA 1447 ? 1_555 OG1 ? A THR 183 ? A THR 335  ? 1_555 88.9  ? 
3  O   ? A ALA 178 ? A ALA 330  ? 1_555 CA ? D CA . ? A CA 1447 ? 1_555 OG1 ? A THR 183 ? A THR 335  ? 1_555 105.6 ? 
4  O   ? A VAL 181 ? A VAL 333  ? 1_555 CA ? D CA . ? A CA 1447 ? 1_555 O   ? A CYS 206 ? A CYS 358  ? 1_555 137.3 ? 
5  O   ? A ALA 178 ? A ALA 330  ? 1_555 CA ? D CA . ? A CA 1447 ? 1_555 O   ? A CYS 206 ? A CYS 358  ? 1_555 141.5 ? 
6  OG1 ? A THR 183 ? A THR 335  ? 1_555 CA ? D CA . ? A CA 1447 ? 1_555 O   ? A CYS 206 ? A CYS 358  ? 1_555 72.6  ? 
7  O   ? A VAL 181 ? A VAL 333  ? 1_555 CA ? D CA . ? A CA 1447 ? 1_555 O   ? G HOH .   ? A HOH 2054 ? 1_555 136.7 ? 
8  O   ? A ALA 178 ? A ALA 330  ? 1_555 CA ? D CA . ? A CA 1447 ? 1_555 O   ? G HOH .   ? A HOH 2054 ? 1_555 83.6  ? 
9  OG1 ? A THR 183 ? A THR 335  ? 1_555 CA ? D CA . ? A CA 1447 ? 1_555 O   ? G HOH .   ? A HOH 2054 ? 1_555 134.2 ? 
10 O   ? A CYS 206 ? A CYS 358  ? 1_555 CA ? D CA . ? A CA 1447 ? 1_555 O   ? G HOH .   ? A HOH 2054 ? 1_555 73.3  ? 
11 OE1 ? B GLU 31  ? E GLU 296  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 O   ? H HOH .   ? E HOH 2006 ? 1_555 136.6 ? 
12 OE1 ? B GLU 31  ? E GLU 296  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 O   ? B THR 29  ? E THR 294  ? 1_555 69.4  ? 
13 O   ? H HOH .   ? E HOH 2006 ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 O   ? B THR 29  ? E THR 294  ? 1_555 69.6  ? 
14 OE1 ? B GLU 31  ? E GLU 296  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 O   ? B GLY 49  ? E GLY 314  ? 1_555 71.8  ? 
15 O   ? H HOH .   ? E HOH 2006 ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 O   ? B GLY 49  ? E GLY 314  ? 1_555 149.5 ? 
16 O   ? B THR 29  ? E THR 294  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 O   ? B GLY 49  ? E GLY 314  ? 1_555 140.7 ? 
17 OE1 ? B GLU 31  ? E GLU 296  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 OD2 ? B ASP 45  ? E ASP 310  ? 1_555 83.5  ? 
18 O   ? H HOH .   ? E HOH 2006 ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 OD2 ? B ASP 45  ? E ASP 310  ? 1_555 75.3  ? 
19 O   ? B THR 29  ? E THR 294  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 OD2 ? B ASP 45  ? E ASP 310  ? 1_555 78.9  ? 
20 O   ? B GLY 49  ? E GLY 314  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 OD2 ? B ASP 45  ? E ASP 310  ? 1_555 103.2 ? 
21 OE1 ? B GLU 31  ? E GLU 296  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 O   ? B LEU 46  ? E LEU 311  ? 1_555 140.8 ? 
22 O   ? H HOH .   ? E HOH 2006 ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 O   ? B LEU 46  ? E LEU 311  ? 1_555 77.7  ? 
23 O   ? B THR 29  ? E THR 294  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 O   ? B LEU 46  ? E LEU 311  ? 1_555 147.1 ? 
24 O   ? B GLY 49  ? E GLY 314  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 O   ? B LEU 46  ? E LEU 311  ? 1_555 71.9  ? 
25 OD2 ? B ASP 45  ? E ASP 310  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 O   ? B LEU 46  ? E LEU 311  ? 1_555 90.7  ? 
26 O   ? B ASP 68  ? E ASP 333  ? 1_555 CA ? F CA . ? E CA 1335 ? 1_555 OD1 ? B ASP 68  ? E ASP 333  ? 1_555 62.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-11-18 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 13.2472 2.6094  30.0536 -0.0047 0.0642 0.0293 -0.0343 0.0109  -0.0076 1.6880 1.6116 3.3218 0.0088  
0.4338 0.9167  0.1163 -0.1012 -0.0473 0.1510  -0.1305 0.0539  0.2949  -0.1695 0.0142  
'X-RAY DIFFRACTION' 2 ? refined -1.9239 13.4930 8.5815  -0.0102 0.1359 0.0727 0.0445  0.0357  -0.0331 5.6580 1.6082 5.9955 -0.5501 
3.6307 -0.9600 0.0065 0.1672  0.3176  -0.0218 -0.0880 -0.0869 -0.0205 0.2277  0.0816  
'X-RAY DIFFRACTION' 3 ? refined 27.1868 16.0989 52.1835 0.0094  0.1178 0.0365 -0.0785 -0.0088 -0.0042 1.2625 2.0329 5.4033 0.1088  
1.4069 2.1085  0.0773 0.0046  -0.0812 0.2086  0.0037  -0.1048 0.3697  -0.1071 -0.0810 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 153 ? ? A 446 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 E 285 ? ? E 333 ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 P 60  ? ? P 152 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0019 ? 1 
MOSFLM 'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
PHASER phasing          .        ? 4 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;
SHEET
THE SHEET STRUCTURE OF THIS MOLECULE IS BIFURCATED. IN
ORDER TO REPRESENT THIS FEATURE IN THE SHEET RECORDS BELOW,
TWO SHEETS ARE DEFINED.
;
# 
_pdbx_entry_details.entry_id             2W2N 
_pdbx_entry_details.compound_details     'ENGINEERED RESIDUE IN CHAIN E, HIS 327 TO TYR' 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;HUMAN PCSK9 CATALYTIC DOMAIN. THE LAST 13 RESIDUES IN THE
SEQUENCE ABOVE ARE A CLONING ARTEFACT, A LINKER AND A 6HIS
TAG.
HUMAN LDLR EGF-AB DOMAIN. THE FIRST 27 RESIDUES IN THE
SEQUENCE ABOVE ARE A CLONING ARTEFACT, A 6HIS TAG AND A
LINKER.
HUMAN PCSK9 PRODOMAIN. THE FIRST 14 RESIDUES IN THE
SEQUENCE ABOVE ARE A CLONING ARTEFACT.
;
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    E 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     2018 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    P 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     2032 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   6_455 
_pdbx_validate_symm_contact.dist              2.11 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 186 ? ? -155.17 -152.65 
2 1 VAL A 280 ? ? 170.56  3.63    
3 1 ASN A 317 ? ? -109.61 43.76   
4 1 LEU A 351 ? ? -112.33 -163.15 
5 1 PHE E 288 ? ? -110.53 -83.13  
6 1 TYR E 306 ? ? -119.11 -92.91  
7 1 GLN E 328 ? ? 67.07   -0.76   
8 1 ARG E 329 ? ? -131.02 -46.40  
9 1 HIS P 139 ? ? 74.55   -2.29   
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    CA 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    VAL 
_pdbx_validate_chiral.auth_seq_id     280 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 165 ? CG  ? A ARG 13  CG  
2  1 Y 1 A ARG 165 ? CD  ? A ARG 13  CD  
3  1 Y 1 A ARG 165 ? NE  ? A ARG 13  NE  
4  1 Y 1 A ARG 165 ? CZ  ? A ARG 13  CZ  
5  1 Y 1 A ARG 165 ? NH1 ? A ARG 13  NH1 
6  1 Y 1 A ARG 165 ? NH2 ? A ARG 13  NH2 
7  1 Y 1 A LEU 179 ? CG  ? A LEU 27  CG  
8  1 Y 1 A LEU 179 ? CD1 ? A LEU 27  CD1 
9  1 Y 1 A LEU 179 ? CD2 ? A LEU 27  CD2 
10 1 Y 1 A VAL 280 ? CG1 ? A VAL 128 CG1 
11 1 Y 1 A VAL 280 ? CG2 ? A VAL 128 CG2 
12 1 Y 1 E ASN 285 ? CG  ? B ASN 20  CG  
13 1 Y 1 E ASN 285 ? OD1 ? B ASN 20  OD1 
14 1 Y 1 E ASN 285 ? ND2 ? B ASN 20  ND2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A TYR 166 ? A TYR 14  
2   1 Y 1 A ARG 167 ? A ARG 15  
3   1 Y 1 A ALA 168 ? A ALA 16  
4   1 Y 1 A ASP 169 ? A ASP 17  
5   1 Y 1 A GLU 170 ? A GLU 18  
6   1 Y 1 A TYR 171 ? A TYR 19  
7   1 Y 1 A GLN 172 ? A GLN 20  
8   1 Y 1 A PRO 173 ? A PRO 21  
9   1 Y 1 A PRO 174 ? A PRO 22  
10  1 Y 1 A ASP 175 ? A ASP 23  
11  1 Y 1 A GLY 176 ? A GLY 24  
12  1 Y 1 A GLY 177 ? A GLY 25  
13  1 Y 1 A SER 178 ? A SER 26  
14  1 Y 1 A GLY 213 ? A GLY 61  
15  1 Y 1 A THR 214 ? A THR 62  
16  1 Y 1 A ARG 215 ? A ARG 63  
17  1 Y 1 A PHE 216 ? A PHE 64  
18  1 Y 1 A HIS 217 ? A HIS 65  
19  1 Y 1 A ARG 218 ? A ARG 66  
20  1 Y 1 A GLN 219 ? A GLN 67  
21  1 Y 1 A ALA 220 ? A ALA 68  
22  1 Y 1 A SER 447 ? A SER 295 
23  1 Y 1 A THR 448 ? A THR 296 
24  1 Y 1 A HIS 449 ? A HIS 297 
25  1 Y 1 A GLY 450 ? A GLY 298 
26  1 Y 1 A ALA 451 ? A ALA 299 
27  1 Y 1 A ALA 452 ? A ALA 300 
28  1 Y 1 A GLY 453 ? A GLY 301 
29  1 Y 1 A THR 454 ? A THR 302 
30  1 Y 1 A ALA 455 ? A ALA 303 
31  1 Y 1 A ALA 456 ? A ALA 304 
32  1 Y 1 A ALA 457 ? A ALA 305 
33  1 Y 1 A SER 458 ? A SER 306 
34  1 Y 1 A HIS 459 ? A HIS 307 
35  1 Y 1 A HIS 460 ? A HIS 308 
36  1 Y 1 A HIS 461 ? A HIS 309 
37  1 Y 1 A HIS 462 ? A HIS 310 
38  1 Y 1 A HIS 463 ? A HIS 311 
39  1 Y 1 A HIS 464 ? A HIS 312 
40  1 Y 1 E MET 266 ? B MET 1   
41  1 Y 1 E LYS 267 ? B LYS 2   
42  1 Y 1 E HIS 268 ? B HIS 3   
43  1 Y 1 E HIS 269 ? B HIS 4   
44  1 Y 1 E HIS 270 ? B HIS 5   
45  1 Y 1 E HIS 271 ? B HIS 6   
46  1 Y 1 E HIS 272 ? B HIS 7   
47  1 Y 1 E HIS 273 ? B HIS 8   
48  1 Y 1 E PRO 274 ? B PRO 9   
49  1 Y 1 E MET 275 ? B MET 10  
50  1 Y 1 E SER 276 ? B SER 11  
51  1 Y 1 E ASP 277 ? B ASP 12  
52  1 Y 1 E TYR 278 ? B TYR 13  
53  1 Y 1 E ASP 279 ? B ASP 14  
54  1 Y 1 E ILE 280 ? B ILE 15  
55  1 Y 1 E PRO 281 ? B PRO 16  
56  1 Y 1 E THR 282 ? B THR 17  
57  1 Y 1 E THR 283 ? B THR 18  
58  1 Y 1 E GLU 284 ? B GLU 19  
59  1 Y 1 E ILE 334 ? B ILE 69  
60  1 Y 1 E ASP 335 ? B ASP 70  
61  1 Y 1 E GLU 336 ? B GLU 71  
62  1 Y 1 E CYS 337 ? B CYS 72  
63  1 Y 1 E GLN 338 ? B GLN 73  
64  1 Y 1 E ASP 339 ? B ASP 74  
65  1 Y 1 E PRO 340 ? B PRO 75  
66  1 Y 1 E ASP 341 ? B ASP 76  
67  1 Y 1 E THR 342 ? B THR 77  
68  1 Y 1 E CYS 343 ? B CYS 78  
69  1 Y 1 E SER 344 ? B SER 79  
70  1 Y 1 E GLN 345 ? B GLN 80  
71  1 Y 1 E LEU 346 ? B LEU 81  
72  1 Y 1 E CYS 347 ? B CYS 82  
73  1 Y 1 E VAL 348 ? B VAL 83  
74  1 Y 1 E ASN 349 ? B ASN 84  
75  1 Y 1 E LEU 350 ? B LEU 85  
76  1 Y 1 E GLU 351 ? B GLU 86  
77  1 Y 1 E GLY 352 ? B GLY 87  
78  1 Y 1 E GLY 353 ? B GLY 88  
79  1 Y 1 E TYR 354 ? B TYR 89  
80  1 Y 1 E LYS 355 ? B LYS 90  
81  1 Y 1 E CYS 356 ? B CYS 91  
82  1 Y 1 E GLN 357 ? B GLN 92  
83  1 Y 1 E CYS 358 ? B CYS 93  
84  1 Y 1 E GLU 359 ? B GLU 94  
85  1 Y 1 E GLU 360 ? B GLU 95  
86  1 Y 1 E GLY 361 ? B GLY 96  
87  1 Y 1 E PHE 362 ? B PHE 97  
88  1 Y 1 E GLN 363 ? B GLN 98  
89  1 Y 1 E LEU 364 ? B LEU 99  
90  1 Y 1 E ASP 365 ? B ASP 100 
91  1 Y 1 E PRO 366 ? B PRO 101 
92  1 Y 1 E HIS 367 ? B HIS 102 
93  1 Y 1 E THR 368 ? B THR 103 
94  1 Y 1 E LYS 369 ? B LYS 104 
95  1 Y 1 E ALA 370 ? B ALA 105 
96  1 Y 1 E CYS 371 ? B CYS 106 
97  1 Y 1 E LYS 372 ? B LYS 107 
98  1 Y 1 P MET 39  ? C MET 1   
99  1 Y 1 P LYS 40  ? C LYS 2   
100 1 Y 1 P GLY 41  ? C GLY 3   
101 1 Y 1 P SER 42  ? C SER 4   
102 1 Y 1 P LYS 43  ? C LYS 5   
103 1 Y 1 P GLY 44  ? C GLY 6   
104 1 Y 1 P SER 45  ? C SER 7   
105 1 Y 1 P LYS 46  ? C LYS 8   
106 1 Y 1 P GLY 47  ? C GLY 9   
107 1 Y 1 P SER 48  ? C SER 10  
108 1 Y 1 P LYS 49  ? C LYS 11  
109 1 Y 1 P PRO 50  ? C PRO 12  
110 1 Y 1 P MET 51  ? C MET 13  
111 1 Y 1 P SER 52  ? C SER 14  
112 1 Y 1 P ALA 53  ? C ALA 15  
113 1 Y 1 P GLU 54  ? C GLU 16  
114 1 Y 1 P ALA 55  ? C ALA 17  
115 1 Y 1 P PRO 56  ? C PRO 18  
116 1 Y 1 P GLU 57  ? C GLU 19  
117 1 Y 1 P HIS 58  ? C HIS 20  
118 1 Y 1 P GLY 59  ? C GLY 21  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'CALCIUM ION' CA  
5 water         HOH 
#