data_2W2P
# 
_entry.id   2W2P 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2W2P         
PDBE  EBI-37853    
WWPDB D_1290037853 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1F5Y unspecified 'NMR STRUCTURE OF A CONCATEMER OF THE FIRST AND SECOND LIGAND-BINDING MODULES OF THE HUMAN LDL RECEPTOR' 
PDB 1HJ7 unspecified 'NMR STUDY OF A PAIR OF LDL RECEPTOR CA ==2+== BINDING EPIDERMAL GROWTH FACTOR-LIKE DOMAINS, 20 STRUCTURES' 
PDB 1N7D unspecified 'EXTRACELLULAR DOMAIN OF THE LDL RECEPTOR' 
PDB 2FCW unspecified 
'STRUCTURE OF A COMPLEX BETWEEN THE PAIR OF THE LDL RECEPTORLIGAND-BINDING MODULES 3-4 AND THE RECEPTOR ASSOCIATEDPROTEIN (RAP).' 
PDB 1I0U unspecified 
'SOLUTION STRUCTURE AND BACKBONE DYNAMICS OF A CONCATEMER OFEGF-HOMOLOGY MODULES OF THE HUMAN LOW DENSITY LIPOPROTEINRECEPTOR'    
PDB 1D2J unspecified 'LDL RECEPTOR LIGAND-BINDING MODULE 6' 
PDB 1LRX unspecified 'THEORETIC MODEL OF THE HUMAN LOW-DENSITY LIPOPROTEINRECEPTOR YWTD BETA-PROPELLER DOMAIN' 
PDB 1HZ8 unspecified 
'SOLUTION STRUCTURE AND BACKBONE DYNAMICS OF A CONCATEMER OFEGF-HOMOLOGY MODULES OF THE HUMAN LOW DENSITY LIPOPROTEINRECEPTOR'    
PDB 1F8Z unspecified 'NMR STRUCTURE OF THE SIXTH LIGAND-BINDING MODULE OF THE LDLRECEPTOR' 
PDB 1XFE unspecified 'SOLUTION STRUCTURE OF THE LA7-EGFA PAIR FROM THE LDLRECEPTOR' 
PDB 1AJJ unspecified 'LDL RECEPTOR LIGAND-BINDING MODULE 5, CALCIUM-COORDINATING' 
PDB 1LDL unspecified . 
PDB 1LDR unspecified 'SECOND REPEAT OF THE LDL RECEPTOR LIGAND- BINDING DOMAIN' 
PDB 1IJQ unspecified 'CRYSTAL STRUCTURE OF THE LDL RECEPTOR YWTD- EGF DOMAIN PAIR' 
PDB 2W2O unspecified 'PCSK9-DELTAC D374Y MUTANT BOUND TO WT EGF -A OF LDLR' 
PDB 2W2M unspecified 'WT PCSK9-DELTAC BOUND TO WT EGF-A OF LDLR' 
PDB 2W2Q unspecified 'PCSK9-DELTAC D374H MUTANT BOUND TO WT EGF -A OF LDLR' 
PDB 2W2N unspecified 'WT PCSK9-DELTAC BOUND TO EGF-A H306Y MUTANT OF LDLR' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2W2P 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2008-11-03 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bottomley, M.J.'  1  
'Cirillo, A.'      2  
'Orsatti, L.'      3  
'Ruggeri, L.'      4  
'Fisher, T.S.'     5  
'Santoro, J.C.'    6  
'Cummings, R.T.'   7  
'Cubbon, R.M.'     8  
'Lo Surdo, P.'     9  
'Calzetta, A.'     10 
'Noto, A.'         11 
'Baysarowich, J.'  12 
'Mattu, M.'        13 
'Talamo, F.'       14 
'De Francesco, R.' 15 
'Sparrow, C.P.'    16 
'Sitlani, A.'      17 
'Carfi, A.'        18 
# 
_citation.id                        primary 
_citation.title                     
'Structural and Biochemical Characterization of the Wild Type Pcsk9/Egf-Ab Complex and Natural Fh Mutants.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            284 
_citation.page_first                1313 
_citation.page_last                 ? 
_citation.year                      2009 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19001363 
_citation.pdbx_database_id_DOI      10.1074/JBC.M808363200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bottomley, M.J.'  1  
primary 'Cirillo, A.'      2  
primary 'Orsatti, L.'      3  
primary 'Ruggeri, L.'      4  
primary 'Fisher, T.S.'     5  
primary 'Santoro, J.C.'    6  
primary 'Cummings, R.T.'   7  
primary 'Cubbon, R.M.'     8  
primary 'Lo Surdo, P.'     9  
primary 'Calzetta, A.'     10 
primary 'Noto, A.'         11 
primary 'Baysarowich, J.'  12 
primary 'Mattu, M.'        13 
primary 'Talamo, F.'       14 
primary 'De Francesco, R.' 15 
primary 'Sparrow, C.P.'    16 
primary 'Sitlani, A.'      17 
primary 'Carfi, A.'        18 
# 
_cell.entry_id           2W2P 
_cell.length_a           84.106 
_cell.length_b           84.106 
_cell.length_c           209.745 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2W2P 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9' 33064.219 1  3.4.21.- YES 'CATALYTIC DOMAIN, RESIDUES 153-451' ? 
2 polymer     man 'LOW-DENSITY LIPOPROTEIN RECEPTOR'              12095.453 1  ?        ?   'EGF-A DOMAIN, RESIDUES 314-393'     ? 
3 polymer     man 'PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9' 12679.604 1  3.4.21.- ?   'PRODOMAIN, RESIDUES 53-152'         ? 
4 non-polymer syn 'CALCIUM ION'                                   40.078    1  ?        ?   ?                                    ? 
5 water       nat water                                           18.015    31 ?        ?   ?                                    ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'PROPROTEIN CONVERTASE PC9, SUBTILISIN/KEXIN-LIKE PROTEASE PC9, NEURAL APOPTOSIS-REGULATED CONVERTASE 1, NARC-1, PCSK9' 
2 'LDL RECEPTOR'                                                                                                          
3 'PROPROTEIN CONVERTASE PC9, SUBTILISIN/KEXIN-LIKE PROTEASE PC9, NEURAL APOPTOSIS-REGULATED CONVERTASE 1, NARC-1, PCSK9' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAG
VVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLV
TAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSACSTCFVSQSGTSQAAAHV
AGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGAAGTAAASHHHHHH
;
;SIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAG
VVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLV
TAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSACSTCFVSQSGTSQAAAHV
AGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGAAGTAAASHHHHHH
;
A ? 
2 'polypeptide(L)' no no 
;MKHHHHHHPMSDYDIPTTENLYFQGAMGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQ
LCVNLEGGYKCQCEEGFQLDPHTKACK
;
;MKHHHHHHPMSDYDIPTTENLYFQGAMGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQ
LCVNLEGGYKCQCEEGFQLDPHTKACK
;
E ? 
3 'polypeptide(L)' no no 
;MKGSKGSKGSKPMSAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGL
LPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
;
;MKGSKGSKGSKPMSAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGL
LPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
;
P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ILE n 
1 3   PRO n 
1 4   TRP n 
1 5   ASN n 
1 6   LEU n 
1 7   GLU n 
1 8   ARG n 
1 9   ILE n 
1 10  THR n 
1 11  PRO n 
1 12  PRO n 
1 13  ARG n 
1 14  TYR n 
1 15  ARG n 
1 16  ALA n 
1 17  ASP n 
1 18  GLU n 
1 19  TYR n 
1 20  GLN n 
1 21  PRO n 
1 22  PRO n 
1 23  ASP n 
1 24  GLY n 
1 25  GLY n 
1 26  SER n 
1 27  LEU n 
1 28  VAL n 
1 29  GLU n 
1 30  VAL n 
1 31  TYR n 
1 32  LEU n 
1 33  LEU n 
1 34  ASP n 
1 35  THR n 
1 36  SER n 
1 37  ILE n 
1 38  GLN n 
1 39  SER n 
1 40  ASP n 
1 41  HIS n 
1 42  ARG n 
1 43  GLU n 
1 44  ILE n 
1 45  GLU n 
1 46  GLY n 
1 47  ARG n 
1 48  VAL n 
1 49  MET n 
1 50  VAL n 
1 51  THR n 
1 52  ASP n 
1 53  PHE n 
1 54  GLU n 
1 55  ASN n 
1 56  VAL n 
1 57  PRO n 
1 58  GLU n 
1 59  GLU n 
1 60  ASP n 
1 61  GLY n 
1 62  THR n 
1 63  ARG n 
1 64  PHE n 
1 65  HIS n 
1 66  ARG n 
1 67  GLN n 
1 68  ALA n 
1 69  SER n 
1 70  LYS n 
1 71  CYS n 
1 72  ASP n 
1 73  SER n 
1 74  HIS n 
1 75  GLY n 
1 76  THR n 
1 77  HIS n 
1 78  LEU n 
1 79  ALA n 
1 80  GLY n 
1 81  VAL n 
1 82  VAL n 
1 83  SER n 
1 84  GLY n 
1 85  ARG n 
1 86  ASP n 
1 87  ALA n 
1 88  GLY n 
1 89  VAL n 
1 90  ALA n 
1 91  LYS n 
1 92  GLY n 
1 93  ALA n 
1 94  SER n 
1 95  MET n 
1 96  ARG n 
1 97  SER n 
1 98  LEU n 
1 99  ARG n 
1 100 VAL n 
1 101 LEU n 
1 102 ASN n 
1 103 CYS n 
1 104 GLN n 
1 105 GLY n 
1 106 LYS n 
1 107 GLY n 
1 108 THR n 
1 109 VAL n 
1 110 SER n 
1 111 GLY n 
1 112 THR n 
1 113 LEU n 
1 114 ILE n 
1 115 GLY n 
1 116 LEU n 
1 117 GLU n 
1 118 PHE n 
1 119 ILE n 
1 120 ARG n 
1 121 LYS n 
1 122 SER n 
1 123 GLN n 
1 124 LEU n 
1 125 VAL n 
1 126 GLN n 
1 127 PRO n 
1 128 VAL n 
1 129 GLY n 
1 130 PRO n 
1 131 LEU n 
1 132 VAL n 
1 133 VAL n 
1 134 LEU n 
1 135 LEU n 
1 136 PRO n 
1 137 LEU n 
1 138 ALA n 
1 139 GLY n 
1 140 GLY n 
1 141 TYR n 
1 142 SER n 
1 143 ARG n 
1 144 VAL n 
1 145 LEU n 
1 146 ASN n 
1 147 ALA n 
1 148 ALA n 
1 149 CYS n 
1 150 GLN n 
1 151 ARG n 
1 152 LEU n 
1 153 ALA n 
1 154 ARG n 
1 155 ALA n 
1 156 GLY n 
1 157 VAL n 
1 158 VAL n 
1 159 LEU n 
1 160 VAL n 
1 161 THR n 
1 162 ALA n 
1 163 ALA n 
1 164 GLY n 
1 165 ASN n 
1 166 PHE n 
1 167 ARG n 
1 168 ASP n 
1 169 ASP n 
1 170 ALA n 
1 171 CYS n 
1 172 LEU n 
1 173 TYR n 
1 174 SER n 
1 175 PRO n 
1 176 ALA n 
1 177 SER n 
1 178 ALA n 
1 179 PRO n 
1 180 GLU n 
1 181 VAL n 
1 182 ILE n 
1 183 THR n 
1 184 VAL n 
1 185 GLY n 
1 186 ALA n 
1 187 THR n 
1 188 ASN n 
1 189 ALA n 
1 190 GLN n 
1 191 ASP n 
1 192 GLN n 
1 193 PRO n 
1 194 VAL n 
1 195 THR n 
1 196 LEU n 
1 197 GLY n 
1 198 THR n 
1 199 LEU n 
1 200 GLY n 
1 201 THR n 
1 202 ASN n 
1 203 PHE n 
1 204 GLY n 
1 205 ARG n 
1 206 CYS n 
1 207 VAL n 
1 208 ASP n 
1 209 LEU n 
1 210 PHE n 
1 211 ALA n 
1 212 PRO n 
1 213 GLY n 
1 214 GLU n 
1 215 ASP n 
1 216 ILE n 
1 217 ILE n 
1 218 GLY n 
1 219 ALA n 
1 220 SER n 
1 221 SER n 
1 222 ALA n 
1 223 CYS n 
1 224 SER n 
1 225 THR n 
1 226 CYS n 
1 227 PHE n 
1 228 VAL n 
1 229 SER n 
1 230 GLN n 
1 231 SER n 
1 232 GLY n 
1 233 THR n 
1 234 SER n 
1 235 GLN n 
1 236 ALA n 
1 237 ALA n 
1 238 ALA n 
1 239 HIS n 
1 240 VAL n 
1 241 ALA n 
1 242 GLY n 
1 243 ILE n 
1 244 ALA n 
1 245 ALA n 
1 246 MET n 
1 247 MET n 
1 248 LEU n 
1 249 SER n 
1 250 ALA n 
1 251 GLU n 
1 252 PRO n 
1 253 GLU n 
1 254 LEU n 
1 255 THR n 
1 256 LEU n 
1 257 ALA n 
1 258 GLU n 
1 259 LEU n 
1 260 ARG n 
1 261 GLN n 
1 262 ARG n 
1 263 LEU n 
1 264 ILE n 
1 265 HIS n 
1 266 PHE n 
1 267 SER n 
1 268 ALA n 
1 269 LYS n 
1 270 ASP n 
1 271 VAL n 
1 272 ILE n 
1 273 ASN n 
1 274 GLU n 
1 275 ALA n 
1 276 TRP n 
1 277 PHE n 
1 278 PRO n 
1 279 GLU n 
1 280 ASP n 
1 281 GLN n 
1 282 ARG n 
1 283 VAL n 
1 284 LEU n 
1 285 THR n 
1 286 PRO n 
1 287 ASN n 
1 288 LEU n 
1 289 VAL n 
1 290 ALA n 
1 291 ALA n 
1 292 LEU n 
1 293 PRO n 
1 294 PRO n 
1 295 SER n 
1 296 THR n 
1 297 HIS n 
1 298 GLY n 
1 299 ALA n 
1 300 ALA n 
1 301 GLY n 
1 302 THR n 
1 303 ALA n 
1 304 ALA n 
1 305 ALA n 
1 306 SER n 
1 307 HIS n 
1 308 HIS n 
1 309 HIS n 
1 310 HIS n 
1 311 HIS n 
1 312 HIS n 
2 1   MET n 
2 2   LYS n 
2 3   HIS n 
2 4   HIS n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   HIS n 
2 9   PRO n 
2 10  MET n 
2 11  SER n 
2 12  ASP n 
2 13  TYR n 
2 14  ASP n 
2 15  ILE n 
2 16  PRO n 
2 17  THR n 
2 18  THR n 
2 19  GLU n 
2 20  ASN n 
2 21  LEU n 
2 22  TYR n 
2 23  PHE n 
2 24  GLN n 
2 25  GLY n 
2 26  ALA n 
2 27  MET n 
2 28  GLY n 
2 29  THR n 
2 30  ASN n 
2 31  GLU n 
2 32  CYS n 
2 33  LEU n 
2 34  ASP n 
2 35  ASN n 
2 36  ASN n 
2 37  GLY n 
2 38  GLY n 
2 39  CYS n 
2 40  SER n 
2 41  HIS n 
2 42  VAL n 
2 43  CYS n 
2 44  ASN n 
2 45  ASP n 
2 46  LEU n 
2 47  LYS n 
2 48  ILE n 
2 49  GLY n 
2 50  TYR n 
2 51  GLU n 
2 52  CYS n 
2 53  LEU n 
2 54  CYS n 
2 55  PRO n 
2 56  ASP n 
2 57  GLY n 
2 58  PHE n 
2 59  GLN n 
2 60  LEU n 
2 61  VAL n 
2 62  ALA n 
2 63  GLN n 
2 64  ARG n 
2 65  ARG n 
2 66  CYS n 
2 67  GLU n 
2 68  ASP n 
2 69  ILE n 
2 70  ASP n 
2 71  GLU n 
2 72  CYS n 
2 73  GLN n 
2 74  ASP n 
2 75  PRO n 
2 76  ASP n 
2 77  THR n 
2 78  CYS n 
2 79  SER n 
2 80  GLN n 
2 81  LEU n 
2 82  CYS n 
2 83  VAL n 
2 84  ASN n 
2 85  LEU n 
2 86  GLU n 
2 87  GLY n 
2 88  GLY n 
2 89  TYR n 
2 90  LYS n 
2 91  CYS n 
2 92  GLN n 
2 93  CYS n 
2 94  GLU n 
2 95  GLU n 
2 96  GLY n 
2 97  PHE n 
2 98  GLN n 
2 99  LEU n 
2 100 ASP n 
2 101 PRO n 
2 102 HIS n 
2 103 THR n 
2 104 LYS n 
2 105 ALA n 
2 106 CYS n 
2 107 LYS n 
3 1   MET n 
3 2   LYS n 
3 3   GLY n 
3 4   SER n 
3 5   LYS n 
3 6   GLY n 
3 7   SER n 
3 8   LYS n 
3 9   GLY n 
3 10  SER n 
3 11  LYS n 
3 12  PRO n 
3 13  MET n 
3 14  SER n 
3 15  ALA n 
3 16  GLU n 
3 17  ALA n 
3 18  PRO n 
3 19  GLU n 
3 20  HIS n 
3 21  GLY n 
3 22  THR n 
3 23  THR n 
3 24  ALA n 
3 25  THR n 
3 26  PHE n 
3 27  HIS n 
3 28  ARG n 
3 29  CYS n 
3 30  ALA n 
3 31  LYS n 
3 32  ASP n 
3 33  PRO n 
3 34  TRP n 
3 35  ARG n 
3 36  LEU n 
3 37  PRO n 
3 38  GLY n 
3 39  THR n 
3 40  TYR n 
3 41  VAL n 
3 42  VAL n 
3 43  VAL n 
3 44  LEU n 
3 45  LYS n 
3 46  GLU n 
3 47  GLU n 
3 48  THR n 
3 49  HIS n 
3 50  LEU n 
3 51  SER n 
3 52  GLN n 
3 53  SER n 
3 54  GLU n 
3 55  ARG n 
3 56  THR n 
3 57  ALA n 
3 58  ARG n 
3 59  ARG n 
3 60  LEU n 
3 61  GLN n 
3 62  ALA n 
3 63  GLN n 
3 64  ALA n 
3 65  ALA n 
3 66  ARG n 
3 67  ARG n 
3 68  GLY n 
3 69  TYR n 
3 70  LEU n 
3 71  THR n 
3 72  LYS n 
3 73  ILE n 
3 74  LEU n 
3 75  HIS n 
3 76  VAL n 
3 77  PHE n 
3 78  HIS n 
3 79  GLY n 
3 80  LEU n 
3 81  LEU n 
3 82  PRO n 
3 83  GLY n 
3 84  PHE n 
3 85  LEU n 
3 86  VAL n 
3 87  LYS n 
3 88  MET n 
3 89  SER n 
3 90  GLY n 
3 91  ASP n 
3 92  LEU n 
3 93  LEU n 
3 94  GLU n 
3 95  LEU n 
3 96  ALA n 
3 97  LEU n 
3 98  LYS n 
3 99  LEU n 
3 100 PRO n 
3 101 HIS n 
3 102 VAL n 
3 103 ASP n 
3 104 TYR n 
3 105 ILE n 
3 106 GLU n 
3 107 GLU n 
3 108 ASP n 
3 109 SER n 
3 110 SER n 
3 111 VAL n 
3 112 PHE n 
3 113 ALA n 
3 114 GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? 
? ? ? ? ? ? ? ? PETM-10 ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? 
? ? ? ? ? ? ? ? PETM-11 ? ? 
3 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? 
? ? ? ? ? ? ? ? PETM-10 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2W2P        3 ? ? 2W2P   ? 
2 UNP PCSK9_HUMAN 3 ? ? Q8NBP7 ? 
3 UNP PCSK9_HUMAN 1 ? ? Q8NBP7 ? 
4 PDB 2W2P        1 ? ? 2W2P   ? 
5 PDB 2W2P        2 ? ? 2W2P   ? 
6 UNP LDLR_HUMAN  2 ? ? P01130 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2W2P P 1   ? 14  ? 2W2P   39  ? 52  ? 39  52  
2 2 2W2P P 15  ? 114 ? Q8NBP7 53  ? 152 ? 53  152 
3 3 2W2P A 1   ? 299 ? Q8NBP7 153 ? 451 ? 153 451 
4 4 2W2P A 300 ? 312 ? 2W2P   452 ? 464 ? 452 464 
5 5 2W2P E 1   ? 27  ? 2W2P   266 ? 292 ? 266 292 
6 6 2W2P E 28  ? 107 ? P01130 314 ? 393 ? 293 372 
# 
_struct_ref_seq_dif.align_id                     3 
_struct_ref_seq_dif.pdbx_pdb_id_code             2W2P 
_struct_ref_seq_dif.mon_id                       ALA 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      222 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q8NBP7 
_struct_ref_seq_dif.db_mon_id                    ASP 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          374 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            374 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2W2P 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.1 
_exptl_crystal.density_percent_sol   70 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1M HEPES PH 7.5, 10% (W/V) PEG 8000 AND 8% (V/V) ETHYLENE GLYCOL' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2008-06-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             0.933 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2W2P 
_reflns.observed_criterion_sigma_I   3.5 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.00 
_reflns.d_resolution_high            2.62 
_reflns.number_obs                   23184 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.9 
_reflns.pdbx_Rmerge_I_obs            0.10 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.40 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.9 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.62 
_reflns_shell.d_res_low              2.76 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           0.67 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    10.40 
_reflns_shell.pdbx_redundancy        4.6 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2W2P 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     21932 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.00 
_refine.ls_d_res_high                            2.62 
_refine.ls_percent_reflns_obs                    98.45 
_refine.ls_R_factor_obs                          0.22803 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.22589 
_refine.ls_R_factor_R_free                       0.27020 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1185 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.927 
_refine.correlation_coeff_Fo_to_Fc_free          0.906 
_refine.B_iso_mean                               28.958 
_refine.aniso_B[1][1]                            1.88 
_refine.aniso_B[2][2]                            1.88 
_refine.aniso_B[3][3]                            -3.75 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2W2N' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.358 
_refine.pdbx_overall_ESU_R_Free                  0.276 
_refine.overall_SU_ML                            0.207 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             21.454 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3127 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             31 
_refine_hist.number_atoms_total               3159 
_refine_hist.d_res_high                       2.62 
_refine_hist.d_res_low                        40.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.007  0.022  ? 3233 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.148  1.965  ? 4402 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.268  5.000  ? 422  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.933 23.669 ? 139  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       17.182 15.000 ? 525  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.120 15.000 ? 25   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.072  0.200  ? 509  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.020  ? 2451 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.193  0.200  ? 1397 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.298  0.200  ? 2169 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.123  0.200  ? 107  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.223  0.200  ? 23   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.105  0.200  ? 4    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.355  1.500  ? 2120 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.658  2.000  ? 3335 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.817  3.000  ? 1220 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.439  4.500  ? 1061 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.620 
_refine_ls_shell.d_res_low                        2.688 
_refine_ls_shell.number_reflns_R_work             1599 
_refine_ls_shell.R_factor_R_work                  0.329 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.369 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             87 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2W2P 
_struct.title                     'PCSK9-deltaC D374A mutant bound to WT EGF-A of LDLR' 
_struct.pdbx_descriptor           'PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9 (E.C.3.4.21.-), LOW-DENSITY LIPOPROTEIN RECEPTOR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2W2P 
_struct_keywords.pdbx_keywords   HYDROLASE/RECEPTOR 
_struct_keywords.text            
;HYDROLASE-RECEPTOR COMPLEX, PCSK9, LDLR, PROPROTEIN CONVERTASE, LOW-DENSITY LIPOPROTEIN RECEPTOR, EGF, CARDIOVASCULAR DISEASE, FAMILIAL HYPERCHOLESTEROLEMIA, LIPID METABOLISM, SERINE PROTEASE, HYDROLASE, LIPID TRANSPORT, STEROID METABOLISM, RECEPTOR
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 3   ? ILE A 9   ? PRO A 155 ILE A 161 1 ? 7  
HELX_P HELX_P2  2  ASP A 72  ? GLY A 84  ? ASP A 224 GLY A 236 1 ? 13 
HELX_P HELX_P3  3  VAL A 109 ? GLN A 126 ? VAL A 261 GLN A 278 1 ? 18 
HELX_P HELX_P4  4  SER A 142 ? ALA A 155 ? SER A 294 ALA A 307 1 ? 14 
HELX_P HELX_P5  5  GLY A 232 ? GLU A 251 ? GLY A 384 GLU A 403 1 ? 20 
HELX_P HELX_P6  6  THR A 255 ? SER A 267 ? THR A 407 SER A 419 1 ? 13 
HELX_P HELX_P7  7  ASN A 273 ? PHE A 277 ? ASN A 425 PHE A 429 5 ? 5  
HELX_P HELX_P8  8  PRO A 278 ? ARG A 282 ? PRO A 430 ARG A 434 5 ? 5  
HELX_P HELX_P9  9  ASN B 30  ? ASP B 34  ? ASN E 295 ASP E 299 5 ? 5  
HELX_P HELX_P10 10 ASP B 34  ? CYS B 39  ? ASP E 299 CYS E 304 5 ? 6  
HELX_P HELX_P11 11 ALA B 62  ? ARG B 64  ? ALA E 327 ARG E 329 5 ? 3  
HELX_P HELX_P12 12 LYS C 31  ? PRO C 33  ? LYS P 69  PRO P 71  5 ? 3  
HELX_P HELX_P13 13 HIS C 49  ? ARG C 67  ? HIS P 87  ARG P 105 1 ? 19 
HELX_P HELX_P14 14 SER C 89  ? ASP C 91  ? SER P 127 ASP P 129 5 ? 3  
HELX_P HELX_P15 15 LEU C 92  ? LYS C 98  ? LEU P 130 LYS P 136 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 71  SG ? ? ? 1_555 A CYS 103 SG  ? ? A CYS 223  A CYS 255 1_555 ? ? ? ? ? ? ? 2.049 ? 
disulf2 disulf ? ? A CYS 171 SG ? ? ? 1_555 A CYS 206 SG  ? ? A CYS 323  A CYS 358 1_555 ? ? ? ? ? ? ? 2.055 ? 
disulf3 disulf ? ? A CYS 223 SG ? ? ? 1_555 A CYS 226 SG  ? ? A CYS 375  A CYS 378 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf4 disulf ? ? B CYS 32  SG ? ? ? 1_555 B CYS 43  SG  ? ? E CYS 297  E CYS 308 1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf5 disulf ? ? B CYS 39  SG ? ? ? 1_555 B CYS 52  SG  ? ? E CYS 304  E CYS 317 1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf6 disulf ? ? B CYS 54  SG ? ? ? 1_555 B CYS 66  SG  ? ? E CYS 319  E CYS 331 1_555 ? ? ? ? ? ? ? 2.046 ? 
metalc1 metalc ? ? D CA  .   CA ? ? ? 1_555 B THR 29  O   ? ? E CA  1333 E THR 294 1_555 ? ? ? ? ? ? ? 2.459 ? 
metalc2 metalc ? ? D CA  .   CA ? ? ? 1_555 B GLU 31  OE1 ? ? E CA  1333 E GLU 296 1_555 ? ? ? ? ? ? ? 2.535 ? 
metalc3 metalc ? ? D CA  .   CA ? ? ? 1_555 B ASP 45  OD2 ? ? E CA  1333 E ASP 310 1_555 ? ? ? ? ? ? ? 2.374 ? 
metalc4 metalc ? ? D CA  .   CA ? ? ? 1_555 B GLY 49  O   ? ? E CA  1333 E GLY 314 1_555 ? ? ? ? ? ? ? 2.426 ? 
metalc5 metalc ? ? D CA  .   CA ? ? ? 1_555 B LEU 46  O   ? ? E CA  1333 E LEU 311 1_555 ? ? ? ? ? ? ? 2.464 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 174 A . ? SER 326 A PRO 175 A ? PRO 327 A 1 -1.76 
2 ASN 20  B . ? ASN 285 E LEU 21  B ? LEU 286 E 1 2.30  
3 THR 22  C . ? THR 60  P THR 23  C ? THR 61  P 1 0.01  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 7 ? 
AB ? 4 ? 
AC ? 3 ? 
AD ? 4 ? 
AE ? 2 ? 
EA ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? parallel      
AA 5 6 ? parallel      
AA 6 7 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? parallel      
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? anti-parallel 
EA 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 48  ? GLU A 54  ? VAL A 200 GLU A 206 
AA 2 SER A 94  ? ARG A 99  ? SER A 246 ARG A 251 
AA 3 GLU A 29  ? ASP A 34  ? GLU A 181 ASP A 186 
AA 4 LEU A 131 ? LEU A 135 ? LEU A 283 LEU A 287 
AA 5 VAL A 158 ? ALA A 162 ? VAL A 310 ALA A 314 
AA 6 ILE A 182 ? THR A 187 ? ILE A 334 THR A 339 
AA 7 LEU A 209 ? PRO A 212 ? LEU A 361 PRO A 364 
AB 1 LYS A 106 ? THR A 108 ? LYS A 258 THR A 260 
AB 2 VAL C 102 ? ALA C 113 ? VAL P 140 ALA P 151 
AB 3 LEU A 137 ? GLY A 140 ? LEU A 289 GLY A 292 
AB 4 TYR A 173 ? SER A 174 ? TYR A 325 SER A 326 
AC 1 LYS A 106 ? THR A 108 ? LYS A 258 THR A 260 
AC 2 VAL C 102 ? ALA C 113 ? VAL P 140 ALA P 151 
AC 3 THR C 25  ? HIS C 27  ? THR P 63  HIS P 65  
AD 1 ILE A 216 ? SER A 220 ? ILE A 368 SER A 372 
AD 2 CYS A 226 ? GLN A 230 ? CYS A 378 GLN A 382 
AD 3 VAL B 42  ? ASP B 45  ? VAL E 307 ASP E 310 
AD 4 TYR B 50  ? LEU B 53  ? TYR E 315 LEU E 318 
AE 1 ALA A 268 ? LYS A 269 ? ALA A 420 LYS A 421 
AE 2 LEU A 288 ? VAL A 289 ? LEU A 440 VAL A 441 
EA 1 LEU B 60  ? VAL B 61  ? LEU E 325 VAL E 326 
EA 2 ARG B 65  ? CYS B 66  ? ARG E 330 CYS E 331 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N MET A 49  ? N MET A 201 O MET A 95  ? O MET A 247 
AA 2 3 N ARG A 96  ? N ARG A 248 O VAL A 30  ? O VAL A 182 
AA 3 4 N TYR A 31  ? N TYR A 183 O VAL A 132 ? O VAL A 284 
AA 4 5 N VAL A 133 ? N VAL A 285 O VAL A 158 ? O VAL A 310 
AA 5 6 N THR A 161 ? N THR A 313 O ILE A 182 ? O ILE A 334 
AA 6 7 N GLY A 185 ? N GLY A 337 O LEU A 209 ? O LEU A 361 
AB 1 2 N GLY A 107 ? N GLY A 259 O VAL C 111 ? O VAL P 149 
AB 2 3 N PHE C 112 ? N PHE P 150 O ALA A 138 ? O ALA A 290 
AB 3 4 N GLY A 139 ? N GLY A 291 O SER A 174 ? O SER A 326 
AC 1 2 N GLY A 107 ? N GLY A 259 O VAL C 111 ? O VAL P 149 
AC 2 3 N ILE C 105 ? N ILE P 143 O THR C 25  ? O THR P 63  
AD 1 2 N SER A 220 ? N SER A 372 O CYS A 226 ? O CYS A 378 
AD 2 3 N PHE A 227 ? N PHE A 379 O CYS B 43  ? O CYS E 308 
AD 3 4 N ASN B 44  ? N ASN E 309 O GLU B 51  ? O GLU E 316 
AE 1 2 N ALA A 268 ? N ALA A 420 O VAL A 289 ? O VAL A 441 
EA 1 2 N VAL B 61  ? N VAL E 326 O ARG B 65  ? O ARG E 330 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    5 
_struct_site.details              'BINDING SITE FOR RESIDUE CA E1333' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 5 THR B 29 ? THR E 294 . ? 1_555 ? 
2 AC1 5 GLU B 31 ? GLU E 296 . ? 1_555 ? 
3 AC1 5 ASP B 45 ? ASP E 310 . ? 1_555 ? 
4 AC1 5 LEU B 46 ? LEU E 311 . ? 1_555 ? 
5 AC1 5 GLY B 49 ? GLY E 314 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2W2P 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2W2P 
_atom_sites.fract_transf_matrix[1][1]   0.011890 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011890 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004768 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 1   ? -1.528  0.259   -43.687 1.00 33.23 ? 153  SER A N   1 
ATOM   2    C  CA  . SER A 1 1   ? -1.803  -0.820  -42.691 1.00 33.31 ? 153  SER A CA  1 
ATOM   3    C  C   . SER A 1 1   ? -1.396  -0.453  -41.264 1.00 33.12 ? 153  SER A C   1 
ATOM   4    O  O   . SER A 1 1   ? -0.675  0.530   -41.028 1.00 33.20 ? 153  SER A O   1 
ATOM   5    C  CB  . SER A 1 1   ? -1.096  -2.125  -43.086 1.00 33.30 ? 153  SER A CB  1 
ATOM   6    O  OG  . SER A 1 1   ? -1.808  -2.814  -44.094 1.00 33.69 ? 153  SER A OG  1 
ATOM   7    N  N   . ILE A 1 2   ? -1.910  -1.245  -40.325 1.00 32.52 ? 154  ILE A N   1 
ATOM   8    C  CA  . ILE A 1 2   ? -1.389  -1.330  -38.970 1.00 31.88 ? 154  ILE A CA  1 
ATOM   9    C  C   . ILE A 1 2   ? -0.948  -2.788  -38.811 1.00 31.41 ? 154  ILE A C   1 
ATOM   10   O  O   . ILE A 1 2   ? -1.384  -3.638  -39.590 1.00 31.49 ? 154  ILE A O   1 
ATOM   11   C  CB  . ILE A 1 2   ? -2.442  -0.925  -37.900 1.00 32.02 ? 154  ILE A CB  1 
ATOM   12   C  CG1 . ILE A 1 2   ? -3.692  -1.814  -37.978 1.00 31.55 ? 154  ILE A CG1 1 
ATOM   13   C  CG2 . ILE A 1 2   ? -2.779  0.569   -38.016 1.00 31.82 ? 154  ILE A CG2 1 
ATOM   14   C  CD1 . ILE A 1 2   ? -4.243  -2.210  -36.619 1.00 30.35 ? 154  ILE A CD1 1 
ATOM   15   N  N   . PRO A 1 3   ? -0.073  -3.089  -37.828 1.00 30.87 ? 155  PRO A N   1 
ATOM   16   C  CA  . PRO A 1 3   ? 0.452   -4.458  -37.701 1.00 30.38 ? 155  PRO A CA  1 
ATOM   17   C  C   . PRO A 1 3   ? -0.635  -5.535  -37.811 1.00 29.93 ? 155  PRO A C   1 
ATOM   18   O  O   . PRO A 1 3   ? -1.710  -5.386  -37.227 1.00 29.95 ? 155  PRO A O   1 
ATOM   19   C  CB  . PRO A 1 3   ? 1.060   -4.461  -36.300 1.00 30.35 ? 155  PRO A CB  1 
ATOM   20   C  CG  . PRO A 1 3   ? 1.467   -3.058  -36.072 1.00 30.42 ? 155  PRO A CG  1 
ATOM   21   C  CD  . PRO A 1 3   ? 0.473   -2.195  -36.790 1.00 30.76 ? 155  PRO A CD  1 
ATOM   22   N  N   . TRP A 1 4   ? -0.354  -6.608  -38.551 1.00 29.44 ? 156  TRP A N   1 
ATOM   23   C  CA  . TRP A 1 4   ? -1.338  -7.669  -38.781 1.00 29.00 ? 156  TRP A CA  1 
ATOM   24   C  C   . TRP A 1 4   ? -1.900  -8.225  -37.479 1.00 29.18 ? 156  TRP A C   1 
ATOM   25   O  O   . TRP A 1 4   ? -3.084  -8.552  -37.408 1.00 29.44 ? 156  TRP A O   1 
ATOM   26   C  CB  . TRP A 1 4   ? -0.758  -8.803  -39.639 1.00 28.65 ? 156  TRP A CB  1 
ATOM   27   C  CG  . TRP A 1 4   ? 0.097   -9.789  -38.875 1.00 28.27 ? 156  TRP A CG  1 
ATOM   28   C  CD1 . TRP A 1 4   ? 1.455   -9.777  -38.764 1.00 27.64 ? 156  TRP A CD1 1 
ATOM   29   C  CD2 . TRP A 1 4   ? -0.357  -10.921 -38.117 1.00 27.58 ? 156  TRP A CD2 1 
ATOM   30   N  NE1 . TRP A 1 4   ? 1.876   -10.825 -37.986 1.00 27.62 ? 156  TRP A NE1 1 
ATOM   31   C  CE2 . TRP A 1 4   ? 0.784   -11.542 -37.574 1.00 27.50 ? 156  TRP A CE2 1 
ATOM   32   C  CE3 . TRP A 1 4   ? -1.621  -11.463 -37.837 1.00 28.06 ? 156  TRP A CE3 1 
ATOM   33   C  CZ2 . TRP A 1 4   ? 0.705   -12.680 -36.765 1.00 27.29 ? 156  TRP A CZ2 1 
ATOM   34   C  CZ3 . TRP A 1 4   ? -1.699  -12.595 -37.038 1.00 27.80 ? 156  TRP A CZ3 1 
ATOM   35   C  CH2 . TRP A 1 4   ? -0.539  -13.188 -36.509 1.00 27.82 ? 156  TRP A CH2 1 
ATOM   36   N  N   . ASN A 1 5   ? -1.046  -8.341  -36.463 1.00 29.12 ? 157  ASN A N   1 
ATOM   37   C  CA  . ASN A 1 5   ? -1.436  -8.900  -35.169 1.00 29.24 ? 157  ASN A CA  1 
ATOM   38   C  C   . ASN A 1 5   ? -2.449  -8.031  -34.432 1.00 29.40 ? 157  ASN A C   1 
ATOM   39   O  O   . ASN A 1 5   ? -3.384  -8.551  -33.823 1.00 29.39 ? 157  ASN A O   1 
ATOM   40   C  CB  . ASN A 1 5   ? -0.207  -9.153  -34.287 1.00 29.10 ? 157  ASN A CB  1 
ATOM   41   C  CG  . ASN A 1 5   ? 0.744   -7.971  -34.254 1.00 29.29 ? 157  ASN A CG  1 
ATOM   42   O  OD1 . ASN A 1 5   ? 1.245   -7.532  -35.295 1.00 29.94 ? 157  ASN A OD1 1 
ATOM   43   N  ND2 . ASN A 1 5   ? 0.997   -7.448  -33.061 1.00 28.08 ? 157  ASN A ND2 1 
ATOM   44   N  N   . LEU A 1 6   ? -2.263  -6.713  -34.501 1.00 29.63 ? 158  LEU A N   1 
ATOM   45   C  CA  . LEU A 1 6   ? -3.153  -5.763  -33.836 1.00 29.96 ? 158  LEU A CA  1 
ATOM   46   C  C   . LEU A 1 6   ? -4.511  -5.716  -34.523 1.00 30.69 ? 158  LEU A C   1 
ATOM   47   O  O   . LEU A 1 6   ? -5.550  -5.595  -33.865 1.00 30.94 ? 158  LEU A O   1 
ATOM   48   C  CB  . LEU A 1 6   ? -2.521  -4.373  -33.775 1.00 29.46 ? 158  LEU A CB  1 
ATOM   49   C  CG  . LEU A 1 6   ? -1.287  -4.240  -32.884 1.00 28.89 ? 158  LEU A CG  1 
ATOM   50   C  CD1 . LEU A 1 6   ? -0.748  -2.829  -32.932 1.00 28.23 ? 158  LEU A CD1 1 
ATOM   51   C  CD2 . LEU A 1 6   ? -1.594  -4.648  -31.446 1.00 28.85 ? 158  LEU A CD2 1 
ATOM   52   N  N   . GLU A 1 7   ? -4.481  -5.820  -35.851 1.00 31.48 ? 159  GLU A N   1 
ATOM   53   C  CA  . GLU A 1 7   ? -5.667  -6.014  -36.676 1.00 32.15 ? 159  GLU A CA  1 
ATOM   54   C  C   . GLU A 1 7   ? -6.429  -7.278  -36.259 1.00 32.17 ? 159  GLU A C   1 
ATOM   55   O  O   . GLU A 1 7   ? -7.642  -7.244  -36.064 1.00 32.26 ? 159  GLU A O   1 
ATOM   56   C  CB  . GLU A 1 7   ? -5.231  -6.151  -38.133 1.00 32.56 ? 159  GLU A CB  1 
ATOM   57   C  CG  . GLU A 1 7   ? -6.360  -6.205  -39.153 1.00 34.46 ? 159  GLU A CG  1 
ATOM   58   C  CD  . GLU A 1 7   ? -6.573  -4.873  -39.837 1.00 36.91 ? 159  GLU A CD  1 
ATOM   59   O  OE1 . GLU A 1 7   ? -6.601  -4.854  -41.087 1.00 38.01 ? 159  GLU A OE1 1 
ATOM   60   O  OE2 . GLU A 1 7   ? -6.695  -3.845  -39.127 1.00 38.00 ? 159  GLU A OE2 1 
ATOM   61   N  N   . ARG A 1 8   ? -5.693  -8.381  -36.115 1.00 32.33 ? 160  ARG A N   1 
ATOM   62   C  CA  . ARG A 1 8   ? -6.261  -9.708  -35.871 1.00 32.38 ? 160  ARG A CA  1 
ATOM   63   C  C   . ARG A 1 8   ? -7.041  -9.805  -34.569 1.00 32.92 ? 160  ARG A C   1 
ATOM   64   O  O   . ARG A 1 8   ? -8.037  -10.516 -34.501 1.00 32.87 ? 160  ARG A O   1 
ATOM   65   C  CB  . ARG A 1 8   ? -5.153  -10.770 -35.897 1.00 32.03 ? 160  ARG A CB  1 
ATOM   66   C  CG  . ARG A 1 8   ? -5.635  -12.209 -36.060 1.00 30.83 ? 160  ARG A CG  1 
ATOM   67   C  CD  . ARG A 1 8   ? -6.428  -12.415 -37.347 1.00 30.10 ? 160  ARG A CD  1 
ATOM   68   N  NE  . ARG A 1 8   ? -5.705  -11.946 -38.530 1.00 29.96 ? 160  ARG A NE  1 
ATOM   69   C  CZ  . ARG A 1 8   ? -5.023  -12.729 -39.361 1.00 29.24 ? 160  ARG A CZ  1 
ATOM   70   N  NH1 . ARG A 1 8   ? -4.970  -14.040 -39.163 1.00 28.99 ? 160  ARG A NH1 1 
ATOM   71   N  NH2 . ARG A 1 8   ? -4.395  -12.200 -40.399 1.00 28.34 ? 160  ARG A NH2 1 
ATOM   72   N  N   . ILE A 1 9   ? -6.585  -9.089  -33.543 1.00 33.76 ? 161  ILE A N   1 
ATOM   73   C  CA  . ILE A 1 9   ? -7.209  -9.156  -32.218 1.00 34.44 ? 161  ILE A CA  1 
ATOM   74   C  C   . ILE A 1 9   ? -8.307  -8.109  -32.019 1.00 35.26 ? 161  ILE A C   1 
ATOM   75   O  O   . ILE A 1 9   ? -8.978  -8.098  -30.984 1.00 35.29 ? 161  ILE A O   1 
ATOM   76   C  CB  . ILE A 1 9   ? -6.168  -9.084  -31.064 1.00 34.31 ? 161  ILE A CB  1 
ATOM   77   C  CG1 . ILE A 1 9   ? -5.419  -7.747  -31.087 1.00 34.10 ? 161  ILE A CG1 1 
ATOM   78   C  CG2 . ILE A 1 9   ? -5.214  -10.284 -31.123 1.00 33.51 ? 161  ILE A CG2 1 
ATOM   79   C  CD1 . ILE A 1 9   ? -4.749  -7.402  -29.782 1.00 33.65 ? 161  ILE A CD1 1 
ATOM   80   N  N   . THR A 1 10  ? -8.491  -7.241  -33.012 1.00 36.23 ? 162  THR A N   1 
ATOM   81   C  CA  . THR A 1 10  ? -9.541  -6.232  -32.959 1.00 37.37 ? 162  THR A CA  1 
ATOM   82   C  C   . THR A 1 10  ? -10.795 -6.725  -33.678 1.00 38.26 ? 162  THR A C   1 
ATOM   83   O  O   . THR A 1 10  ? -10.733 -7.108  -34.847 1.00 38.48 ? 162  THR A O   1 
ATOM   84   C  CB  . THR A 1 10  ? -9.073  -4.895  -33.564 1.00 37.33 ? 162  THR A CB  1 
ATOM   85   O  OG1 . THR A 1 10  ? -7.875  -4.473  -32.902 1.00 37.80 ? 162  THR A OG1 1 
ATOM   86   C  CG2 . THR A 1 10  ? -10.143 -3.817  -33.408 1.00 37.13 ? 162  THR A CG2 1 
ATOM   87   N  N   . PRO A 1 11  ? -11.939 -6.731  -32.974 1.00 39.14 ? 163  PRO A N   1 
ATOM   88   C  CA  . PRO A 1 11  ? -13.198 -7.088  -33.620 1.00 39.87 ? 163  PRO A CA  1 
ATOM   89   C  C   . PRO A 1 11  ? -13.724 -5.923  -34.462 1.00 40.57 ? 163  PRO A C   1 
ATOM   90   O  O   . PRO A 1 11  ? -13.313 -4.780  -34.244 1.00 40.53 ? 163  PRO A O   1 
ATOM   91   C  CB  . PRO A 1 11  ? -14.125 -7.384  -32.438 1.00 39.87 ? 163  PRO A CB  1 
ATOM   92   C  CG  . PRO A 1 11  ? -13.598 -6.568  -31.327 1.00 39.71 ? 163  PRO A CG  1 
ATOM   93   C  CD  . PRO A 1 11  ? -12.117 -6.412  -31.546 1.00 39.24 ? 163  PRO A CD  1 
ATOM   94   N  N   . PRO A 1 12  ? -14.609 -6.210  -35.436 1.00 41.39 ? 164  PRO A N   1 
ATOM   95   C  CA  . PRO A 1 12  ? -15.154 -5.174  -36.337 1.00 41.93 ? 164  PRO A CA  1 
ATOM   96   C  C   . PRO A 1 12  ? -15.893 -4.022  -35.630 1.00 42.40 ? 164  PRO A C   1 
ATOM   97   O  O   . PRO A 1 12  ? -15.783 -2.866  -36.060 1.00 42.49 ? 164  PRO A O   1 
ATOM   98   C  CB  . PRO A 1 12  ? -16.116 -5.962  -37.239 1.00 41.97 ? 164  PRO A CB  1 
ATOM   99   C  CG  . PRO A 1 12  ? -15.627 -7.380  -37.170 1.00 41.92 ? 164  PRO A CG  1 
ATOM   100  C  CD  . PRO A 1 12  ? -15.129 -7.552  -35.766 1.00 41.45 ? 164  PRO A CD  1 
ATOM   101  N  N   . ARG A 1 13  ? -16.631 -4.338  -34.565 1.00 42.80 ? 165  ARG A N   1 
ATOM   102  C  CA  . ARG A 1 13  ? -17.364 -3.330  -33.793 1.00 43.03 ? 165  ARG A CA  1 
ATOM   103  C  C   . ARG A 1 13  ? -16.872 -3.276  -32.348 1.00 43.11 ? 165  ARG A C   1 
ATOM   104  O  O   . ARG A 1 13  ? -15.941 -2.535  -32.027 1.00 43.25 ? 165  ARG A O   1 
ATOM   105  C  CB  . ARG A 1 13  ? -18.875 -3.598  -33.842 1.00 43.01 ? 165  ARG A CB  1 
ATOM   106  N  N   . LEU A 1 27  ? -4.810  2.475   -13.122 1.00 33.01 ? 179  LEU A N   1 
ATOM   107  C  CA  . LEU A 1 27  ? -5.615  1.296   -12.821 1.00 33.00 ? 179  LEU A CA  1 
ATOM   108  C  C   . LEU A 1 27  ? -4.766  0.016   -12.669 1.00 32.87 ? 179  LEU A C   1 
ATOM   109  O  O   . LEU A 1 27  ? -4.494  -0.428  -11.552 1.00 32.90 ? 179  LEU A O   1 
ATOM   110  C  CB  . LEU A 1 27  ? -6.716  1.115   -13.885 1.00 32.92 ? 179  LEU A CB  1 
ATOM   111  N  N   . VAL A 1 28  ? -4.332  -0.545  -13.794 1.00 32.60 ? 180  VAL A N   1 
ATOM   112  C  CA  . VAL A 1 28  ? -3.718  -1.871  -13.847 1.00 32.46 ? 180  VAL A CA  1 
ATOM   113  C  C   . VAL A 1 28  ? -2.198  -1.792  -13.985 1.00 32.28 ? 180  VAL A C   1 
ATOM   114  O  O   . VAL A 1 28  ? -1.679  -0.929  -14.685 1.00 32.48 ? 180  VAL A O   1 
ATOM   115  C  CB  . VAL A 1 28  ? -4.273  -2.682  -15.059 1.00 32.43 ? 180  VAL A CB  1 
ATOM   116  C  CG1 . VAL A 1 28  ? -3.714  -4.100  -15.084 1.00 32.41 ? 180  VAL A CG1 1 
ATOM   117  C  CG2 . VAL A 1 28  ? -5.787  -2.722  -15.037 1.00 32.51 ? 180  VAL A CG2 1 
ATOM   118  N  N   . GLU A 1 29  ? -1.486  -2.702  -13.331 1.00 31.95 ? 181  GLU A N   1 
ATOM   119  C  CA  . GLU A 1 29  ? -0.056  -2.838  -13.579 1.00 31.76 ? 181  GLU A CA  1 
ATOM   120  C  C   . GLU A 1 29  ? 0.323   -4.200  -14.124 1.00 31.25 ? 181  GLU A C   1 
ATOM   121  O  O   . GLU A 1 29  ? -0.227  -5.225  -13.718 1.00 31.36 ? 181  GLU A O   1 
ATOM   122  C  CB  . GLU A 1 29  ? 0.776   -2.502  -12.346 1.00 32.03 ? 181  GLU A CB  1 
ATOM   123  C  CG  . GLU A 1 29  ? 1.563   -1.216  -12.510 1.00 32.98 ? 181  GLU A CG  1 
ATOM   124  C  CD  . GLU A 1 29  ? 2.025   -0.654  -11.193 1.00 35.02 ? 181  GLU A CD  1 
ATOM   125  O  OE1 . GLU A 1 29  ? 2.249   -1.455  -10.260 1.00 36.71 ? 181  GLU A OE1 1 
ATOM   126  O  OE2 . GLU A 1 29  ? 2.170   0.584   -11.083 1.00 35.67 ? 181  GLU A OE2 1 
ATOM   127  N  N   . VAL A 1 30  ? 1.263   -4.188  -15.061 1.00 30.57 ? 182  VAL A N   1 
ATOM   128  C  CA  . VAL A 1 30  ? 1.734   -5.394  -15.698 1.00 30.03 ? 182  VAL A CA  1 
ATOM   129  C  C   . VAL A 1 30  ? 3.186   -5.594  -15.304 1.00 29.69 ? 182  VAL A C   1 
ATOM   130  O  O   . VAL A 1 30  ? 4.034   -4.739  -15.577 1.00 29.50 ? 182  VAL A O   1 
ATOM   131  C  CB  . VAL A 1 30  ? 1.596   -5.315  -17.236 1.00 30.19 ? 182  VAL A CB  1 
ATOM   132  C  CG1 . VAL A 1 30  ? 2.037   -6.626  -17.889 1.00 29.78 ? 182  VAL A CG1 1 
ATOM   133  C  CG2 . VAL A 1 30  ? 0.159   -4.976  -17.634 1.00 30.23 ? 182  VAL A CG2 1 
ATOM   134  N  N   . TYR A 1 31  ? 3.455   -6.712  -14.631 1.00 29.31 ? 183  TYR A N   1 
ATOM   135  C  CA  . TYR A 1 31  ? 4.819   -7.106  -14.275 1.00 28.90 ? 183  TYR A CA  1 
ATOM   136  C  C   . TYR A 1 31  ? 5.440   -7.982  -15.353 1.00 28.43 ? 183  TYR A C   1 
ATOM   137  O  O   . TYR A 1 31  ? 4.826   -8.941  -15.825 1.00 28.14 ? 183  TYR A O   1 
ATOM   138  C  CB  . TYR A 1 31  ? 4.852   -7.830  -12.932 1.00 29.16 ? 183  TYR A CB  1 
ATOM   139  C  CG  . TYR A 1 31  ? 4.704   -6.906  -11.754 1.00 29.57 ? 183  TYR A CG  1 
ATOM   140  C  CD1 . TYR A 1 31  ? 5.823   -6.343  -11.146 1.00 29.78 ? 183  TYR A CD1 1 
ATOM   141  C  CD2 . TYR A 1 31  ? 3.447   -6.590  -11.245 1.00 29.92 ? 183  TYR A CD2 1 
ATOM   142  C  CE1 . TYR A 1 31  ? 5.698   -5.490  -10.063 1.00 30.04 ? 183  TYR A CE1 1 
ATOM   143  C  CE2 . TYR A 1 31  ? 3.311   -5.729  -10.162 1.00 30.26 ? 183  TYR A CE2 1 
ATOM   144  C  CZ  . TYR A 1 31  ? 4.441   -5.186  -9.578  1.00 30.08 ? 183  TYR A CZ  1 
ATOM   145  O  OH  . TYR A 1 31  ? 4.313   -4.338  -8.505  1.00 30.53 ? 183  TYR A OH  1 
ATOM   146  N  N   . LEU A 1 32  ? 6.664   -7.635  -15.730 1.00 27.91 ? 184  LEU A N   1 
ATOM   147  C  CA  . LEU A 1 32  ? 7.397   -8.350  -16.747 1.00 27.43 ? 184  LEU A CA  1 
ATOM   148  C  C   . LEU A 1 32  ? 8.667   -8.934  -16.145 1.00 27.48 ? 184  LEU A C   1 
ATOM   149  O  O   . LEU A 1 32  ? 9.536   -8.196  -15.682 1.00 27.32 ? 184  LEU A O   1 
ATOM   150  C  CB  . LEU A 1 32  ? 7.736   -7.399  -17.895 1.00 27.25 ? 184  LEU A CB  1 
ATOM   151  C  CG  . LEU A 1 32  ? 8.541   -7.960  -19.070 1.00 27.49 ? 184  LEU A CG  1 
ATOM   152  C  CD1 . LEU A 1 32  ? 7.694   -8.914  -19.906 1.00 26.32 ? 184  LEU A CD1 1 
ATOM   153  C  CD2 . LEU A 1 32  ? 9.122   -6.829  -19.925 1.00 27.24 ? 184  LEU A CD2 1 
ATOM   154  N  N   . LEU A 1 33  ? 8.760   -10.263 -16.138 1.00 27.63 ? 185  LEU A N   1 
ATOM   155  C  CA  . LEU A 1 33  ? 9.980   -10.962 -15.718 1.00 27.39 ? 185  LEU A CA  1 
ATOM   156  C  C   . LEU A 1 33  ? 10.688  -11.443 -16.966 1.00 27.50 ? 185  LEU A C   1 
ATOM   157  O  O   . LEU A 1 33  ? 10.367  -12.500 -17.507 1.00 27.74 ? 185  LEU A O   1 
ATOM   158  C  CB  . LEU A 1 33  ? 9.664   -12.154 -14.814 1.00 27.21 ? 185  LEU A CB  1 
ATOM   159  C  CG  . LEU A 1 33  ? 9.094   -11.899 -13.423 1.00 27.31 ? 185  LEU A CG  1 
ATOM   160  C  CD1 . LEU A 1 33  ? 7.598   -11.773 -13.505 1.00 27.71 ? 185  LEU A CD1 1 
ATOM   161  C  CD2 . LEU A 1 33  ? 9.461   -13.033 -12.490 1.00 26.93 ? 185  LEU A CD2 1 
ATOM   162  N  N   . ASP A 1 34  ? 11.642  -10.657 -17.441 1.00 27.63 ? 186  ASP A N   1 
ATOM   163  C  CA  . ASP A 1 34  ? 12.315  -10.984 -18.684 1.00 27.74 ? 186  ASP A CA  1 
ATOM   164  C  C   . ASP A 1 34  ? 13.775  -10.560 -18.624 1.00 27.21 ? 186  ASP A C   1 
ATOM   165  O  O   . ASP A 1 34  ? 14.376  -10.552 -17.549 1.00 27.14 ? 186  ASP A O   1 
ATOM   166  C  CB  . ASP A 1 34  ? 11.590  -10.334 -19.864 1.00 28.16 ? 186  ASP A CB  1 
ATOM   167  C  CG  . ASP A 1 34  ? 11.855  -11.053 -21.169 1.00 30.32 ? 186  ASP A CG  1 
ATOM   168  O  OD1 . ASP A 1 34  ? 12.746  -10.612 -21.924 1.00 33.68 ? 186  ASP A OD1 1 
ATOM   169  O  OD2 . ASP A 1 34  ? 11.200  -12.079 -21.435 1.00 32.35 ? 186  ASP A OD2 1 
ATOM   170  N  N   . THR A 1 35  ? 14.345  -10.227 -19.778 1.00 26.65 ? 187  THR A N   1 
ATOM   171  C  CA  . THR A 1 35  ? 15.692  -9.688  -19.849 1.00 26.38 ? 187  THR A CA  1 
ATOM   172  C  C   . THR A 1 35  ? 15.676  -8.267  -19.315 1.00 26.10 ? 187  THR A C   1 
ATOM   173  O  O   . THR A 1 35  ? 14.622  -7.759  -18.937 1.00 25.98 ? 187  THR A O   1 
ATOM   174  C  CB  . THR A 1 35  ? 16.200  -9.670  -21.292 1.00 26.48 ? 187  THR A CB  1 
ATOM   175  O  OG1 . THR A 1 35  ? 15.270  -8.958  -22.118 1.00 26.41 ? 187  THR A OG1 1 
ATOM   176  C  CG2 . THR A 1 35  ? 16.347  -11.079 -21.816 1.00 26.72 ? 187  THR A CG2 1 
ATOM   177  N  N   . SER A 1 36  ? 16.839  -7.624  -19.266 1.00 26.01 ? 188  SER A N   1 
ATOM   178  C  CA  . SER A 1 36  ? 16.883  -6.197  -18.984 1.00 25.98 ? 188  SER A CA  1 
ATOM   179  C  C   . SER A 1 36  ? 16.155  -5.519  -20.138 1.00 26.01 ? 188  SER A C   1 
ATOM   180  O  O   . SER A 1 36  ? 15.946  -6.142  -21.178 1.00 26.33 ? 188  SER A O   1 
ATOM   181  C  CB  . SER A 1 36  ? 18.321  -5.713  -18.886 1.00 25.91 ? 188  SER A CB  1 
ATOM   182  O  OG  . SER A 1 36  ? 19.023  -6.026  -20.071 1.00 26.27 ? 188  SER A OG  1 
ATOM   183  N  N   . ILE A 1 37  ? 15.723  -4.278  -19.961 1.00 25.91 ? 189  ILE A N   1 
ATOM   184  C  CA  . ILE A 1 37  ? 14.994  -3.600  -21.031 1.00 25.88 ? 189  ILE A CA  1 
ATOM   185  C  C   . ILE A 1 37  ? 15.542  -2.205  -21.310 1.00 25.86 ? 189  ILE A C   1 
ATOM   186  O  O   . ILE A 1 37  ? 16.238  -1.629  -20.478 1.00 25.87 ? 189  ILE A O   1 
ATOM   187  C  CB  . ILE A 1 37  ? 13.462  -3.567  -20.784 1.00 25.96 ? 189  ILE A CB  1 
ATOM   188  C  CG1 . ILE A 1 37  ? 13.105  -2.572  -19.684 1.00 25.94 ? 189  ILE A CG1 1 
ATOM   189  C  CG2 . ILE A 1 37  ? 12.911  -4.977  -20.470 1.00 25.48 ? 189  ILE A CG2 1 
ATOM   190  C  CD1 . ILE A 1 37  ? 11.759  -1.946  -19.895 1.00 26.70 ? 189  ILE A CD1 1 
ATOM   191  N  N   . GLN A 1 38  ? 15.265  -1.690  -22.505 1.00 25.88 ? 190  GLN A N   1 
ATOM   192  C  CA  . GLN A 1 38  ? 15.583  -0.310  -22.820 1.00 25.90 ? 190  GLN A CA  1 
ATOM   193  C  C   . GLN A 1 38  ? 14.350  0.504   -22.476 1.00 25.54 ? 190  GLN A C   1 
ATOM   194  O  O   . GLN A 1 38  ? 13.431  0.654   -23.284 1.00 25.41 ? 190  GLN A O   1 
ATOM   195  C  CB  . GLN A 1 38  ? 15.989  -0.127  -24.284 1.00 26.03 ? 190  GLN A CB  1 
ATOM   196  C  CG  . GLN A 1 38  ? 16.852  1.109   -24.511 1.00 27.55 ? 190  GLN A CG  1 
ATOM   197  C  CD  . GLN A 1 38  ? 16.724  1.673   -25.918 1.00 30.70 ? 190  GLN A CD  1 
ATOM   198  O  OE1 . GLN A 1 38  ? 16.956  0.972   -26.907 1.00 31.87 ? 190  GLN A OE1 1 
ATOM   199  N  NE2 . GLN A 1 38  ? 16.358  2.954   -26.016 1.00 31.36 ? 190  GLN A NE2 1 
ATOM   200  N  N   . SER A 1 39  ? 14.348  1.007   -21.247 1.00 25.31 ? 191  SER A N   1 
ATOM   201  C  CA  . SER A 1 39  ? 13.207  1.700   -20.660 1.00 25.04 ? 191  SER A CA  1 
ATOM   202  C  C   . SER A 1 39  ? 12.893  3.036   -21.317 1.00 24.77 ? 191  SER A C   1 
ATOM   203  O  O   . SER A 1 39  ? 11.773  3.528   -21.213 1.00 24.90 ? 191  SER A O   1 
ATOM   204  C  CB  . SER A 1 39  ? 13.453  1.920   -19.169 1.00 25.02 ? 191  SER A CB  1 
ATOM   205  O  OG  . SER A 1 39  ? 14.692  2.574   -18.967 1.00 24.78 ? 191  SER A OG  1 
ATOM   206  N  N   . ASP A 1 40  ? 13.877  3.622   -21.985 1.00 24.59 ? 192  ASP A N   1 
ATOM   207  C  CA  . ASP A 1 40  ? 13.706  4.948   -22.579 1.00 24.48 ? 192  ASP A CA  1 
ATOM   208  C  C   . ASP A 1 40  ? 13.341  4.891   -24.064 1.00 24.02 ? 192  ASP A C   1 
ATOM   209  O  O   . ASP A 1 40  ? 13.436  5.890   -24.766 1.00 24.10 ? 192  ASP A O   1 
ATOM   210  C  CB  . ASP A 1 40  ? 14.957  5.816   -22.338 1.00 24.69 ? 192  ASP A CB  1 
ATOM   211  C  CG  . ASP A 1 40  ? 16.195  5.295   -23.069 1.00 25.73 ? 192  ASP A CG  1 
ATOM   212  O  OD1 . ASP A 1 40  ? 16.297  4.064   -23.317 1.00 26.60 ? 192  ASP A OD1 1 
ATOM   213  O  OD2 . ASP A 1 40  ? 17.074  6.127   -23.387 1.00 26.25 ? 192  ASP A OD2 1 
ATOM   214  N  N   . HIS A 1 41  ? 12.922  3.720   -24.539 1.00 23.72 ? 193  HIS A N   1 
ATOM   215  C  CA  . HIS A 1 41  ? 12.448  3.583   -25.915 1.00 23.11 ? 193  HIS A CA  1 
ATOM   216  C  C   . HIS A 1 41  ? 11.140  4.343   -26.090 1.00 23.08 ? 193  HIS A C   1 
ATOM   217  O  O   . HIS A 1 41  ? 10.263  4.296   -25.223 1.00 22.81 ? 193  HIS A O   1 
ATOM   218  C  CB  . HIS A 1 41  ? 12.248  2.116   -26.298 1.00 22.86 ? 193  HIS A CB  1 
ATOM   219  C  CG  . HIS A 1 41  ? 11.974  1.912   -27.756 1.00 22.04 ? 193  HIS A CG  1 
ATOM   220  N  ND1 . HIS A 1 41  ? 12.931  1.460   -28.637 1.00 21.75 ? 193  HIS A ND1 1 
ATOM   221  C  CD2 . HIS A 1 41  ? 10.858  2.124   -28.491 1.00 20.96 ? 193  HIS A CD2 1 
ATOM   222  C  CE1 . HIS A 1 41  ? 12.413  1.392   -29.850 1.00 20.78 ? 193  HIS A CE1 1 
ATOM   223  N  NE2 . HIS A 1 41  ? 11.156  1.789   -29.788 1.00 20.36 ? 193  HIS A NE2 1 
ATOM   224  N  N   . ARG A 1 42  ? 11.012  5.028   -27.221 1.00 23.00 ? 194  ARG A N   1 
ATOM   225  C  CA  . ARG A 1 42  ? 9.840   5.848   -27.500 1.00 23.31 ? 194  ARG A CA  1 
ATOM   226  C  C   . ARG A 1 42  ? 8.507   5.096   -27.363 1.00 23.74 ? 194  ARG A C   1 
ATOM   227  O  O   . ARG A 1 42  ? 7.474   5.706   -27.085 1.00 24.14 ? 194  ARG A O   1 
ATOM   228  C  CB  . ARG A 1 42  ? 9.959   6.492   -28.882 1.00 23.14 ? 194  ARG A CB  1 
ATOM   229  C  CG  . ARG A 1 42  ? 8.962   7.608   -29.128 1.00 22.43 ? 194  ARG A CG  1 
ATOM   230  C  CD  . ARG A 1 42  ? 8.916   7.987   -30.584 1.00 21.72 ? 194  ARG A CD  1 
ATOM   231  N  NE  . ARG A 1 42  ? 8.366   6.917   -31.411 1.00 21.00 ? 194  ARG A NE  1 
ATOM   232  C  CZ  . ARG A 1 42  ? 8.189   7.005   -32.724 1.00 20.04 ? 194  ARG A CZ  1 
ATOM   233  N  NH1 . ARG A 1 42  ? 8.517   8.118   -33.367 1.00 19.33 ? 194  ARG A NH1 1 
ATOM   234  N  NH2 . ARG A 1 42  ? 7.681   5.981   -33.393 1.00 19.13 ? 194  ARG A NH2 1 
ATOM   235  N  N   . GLU A 1 43  ? 8.526   3.782   -27.553 1.00 24.10 ? 195  GLU A N   1 
ATOM   236  C  CA  . GLU A 1 43  ? 7.316   2.976   -27.397 1.00 24.74 ? 195  GLU A CA  1 
ATOM   237  C  C   . GLU A 1 43  ? 6.812   2.900   -25.956 1.00 25.28 ? 195  GLU A C   1 
ATOM   238  O  O   . GLU A 1 43  ? 5.608   2.836   -25.725 1.00 25.29 ? 195  GLU A O   1 
ATOM   239  C  CB  . GLU A 1 43  ? 7.520   1.562   -27.950 1.00 24.36 ? 195  GLU A CB  1 
ATOM   240  C  CG  . GLU A 1 43  ? 7.286   1.443   -29.449 1.00 24.49 ? 195  GLU A CG  1 
ATOM   241  C  CD  . GLU A 1 43  ? 5.830   1.671   -29.840 1.00 24.65 ? 195  GLU A CD  1 
ATOM   242  O  OE1 . GLU A 1 43  ? 5.419   2.843   -30.027 1.00 23.99 ? 195  GLU A OE1 1 
ATOM   243  O  OE2 . GLU A 1 43  ? 5.100   0.669   -29.968 1.00 25.10 ? 195  GLU A OE2 1 
ATOM   244  N  N   . ILE A 1 44  ? 7.737   2.929   -24.997 1.00 26.01 ? 196  ILE A N   1 
ATOM   245  C  CA  . ILE A 1 44  ? 7.429   2.608   -23.601 1.00 26.48 ? 196  ILE A CA  1 
ATOM   246  C  C   . ILE A 1 44  ? 7.926   3.625   -22.563 1.00 27.27 ? 196  ILE A C   1 
ATOM   247  O  O   . ILE A 1 44  ? 7.637   3.480   -21.374 1.00 27.27 ? 196  ILE A O   1 
ATOM   248  C  CB  . ILE A 1 44  ? 7.962   1.199   -23.229 1.00 26.47 ? 196  ILE A CB  1 
ATOM   249  C  CG1 . ILE A 1 44  ? 9.439   1.049   -23.634 1.00 26.23 ? 196  ILE A CG1 1 
ATOM   250  C  CG2 . ILE A 1 44  ? 7.073   0.112   -23.854 1.00 26.55 ? 196  ILE A CG2 1 
ATOM   251  C  CD1 . ILE A 1 44  ? 10.139  -0.171  -23.066 1.00 25.90 ? 196  ILE A CD1 1 
ATOM   252  N  N   . GLU A 1 45  ? 8.651   4.651   -23.016 1.00 28.12 ? 197  GLU A N   1 
ATOM   253  C  CA  . GLU A 1 45  ? 9.252   5.648   -22.125 1.00 28.99 ? 197  GLU A CA  1 
ATOM   254  C  C   . GLU A 1 45  ? 8.212   6.336   -21.254 1.00 29.41 ? 197  GLU A C   1 
ATOM   255  O  O   . GLU A 1 45  ? 7.171   6.772   -21.746 1.00 29.39 ? 197  GLU A O   1 
ATOM   256  C  CB  . GLU A 1 45  ? 10.035  6.693   -22.921 1.00 28.87 ? 197  GLU A CB  1 
ATOM   257  C  CG  . GLU A 1 45  ? 10.946  7.574   -22.064 1.00 29.54 ? 197  GLU A CG  1 
ATOM   258  C  CD  . GLU A 1 45  ? 11.393  8.851   -22.777 1.00 29.68 ? 197  GLU A CD  1 
ATOM   259  O  OE1 . GLU A 1 45  ? 11.027  9.052   -23.959 1.00 30.25 ? 197  GLU A OE1 1 
ATOM   260  O  OE2 . GLU A 1 45  ? 12.115  9.657   -22.149 1.00 30.50 ? 197  GLU A OE2 1 
ATOM   261  N  N   . GLY A 1 46  ? 8.510   6.420   -19.958 1.00 30.18 ? 198  GLY A N   1 
ATOM   262  C  CA  . GLY A 1 46  ? 7.608   7.025   -18.977 1.00 30.96 ? 198  GLY A CA  1 
ATOM   263  C  C   . GLY A 1 46  ? 6.516   6.093   -18.473 1.00 31.66 ? 198  GLY A C   1 
ATOM   264  O  O   . GLY A 1 46  ? 5.864   6.383   -17.468 1.00 31.62 ? 198  GLY A O   1 
ATOM   265  N  N   . ARG A 1 47  ? 6.318   4.975   -19.170 1.00 32.29 ? 199  ARG A N   1 
ATOM   266  C  CA  . ARG A 1 47  ? 5.255   4.030   -18.842 1.00 33.07 ? 199  ARG A CA  1 
ATOM   267  C  C   . ARG A 1 47  ? 5.788   2.742   -18.206 1.00 33.19 ? 199  ARG A C   1 
ATOM   268  O  O   . ARG A 1 47  ? 5.037   2.023   -17.547 1.00 33.23 ? 199  ARG A O   1 
ATOM   269  C  CB  . ARG A 1 47  ? 4.419   3.688   -20.088 1.00 33.45 ? 199  ARG A CB  1 
ATOM   270  C  CG  . ARG A 1 47  ? 3.804   4.878   -20.866 1.00 35.05 ? 199  ARG A CG  1 
ATOM   271  C  CD  . ARG A 1 47  ? 2.779   5.706   -20.070 1.00 37.66 ? 199  ARG A CD  1 
ATOM   272  N  NE  . ARG A 1 47  ? 1.963   4.901   -19.156 1.00 39.84 ? 199  ARG A NE  1 
ATOM   273  C  CZ  . ARG A 1 47  ? 1.115   5.399   -18.255 1.00 40.69 ? 199  ARG A CZ  1 
ATOM   274  N  NH1 . ARG A 1 47  ? 0.945   6.716   -18.142 1.00 40.72 ? 199  ARG A NH1 1 
ATOM   275  N  NH2 . ARG A 1 47  ? 0.432   4.576   -17.463 1.00 40.67 ? 199  ARG A NH2 1 
ATOM   276  N  N   . VAL A 1 48  ? 7.070   2.447   -18.414 1.00 33.44 ? 200  VAL A N   1 
ATOM   277  C  CA  . VAL A 1 48  ? 7.695   1.269   -17.812 1.00 33.80 ? 200  VAL A CA  1 
ATOM   278  C  C   . VAL A 1 48  ? 8.690   1.645   -16.716 1.00 34.05 ? 200  VAL A C   1 
ATOM   279  O  O   . VAL A 1 48  ? 9.684   2.325   -16.970 1.00 34.15 ? 200  VAL A O   1 
ATOM   280  C  CB  . VAL A 1 48  ? 8.406   0.378   -18.856 1.00 33.84 ? 200  VAL A CB  1 
ATOM   281  C  CG1 . VAL A 1 48  ? 8.980   -0.861  -18.188 1.00 34.01 ? 200  VAL A CG1 1 
ATOM   282  C  CG2 . VAL A 1 48  ? 7.445   -0.046  -19.951 1.00 34.32 ? 200  VAL A CG2 1 
ATOM   283  N  N   . MET A 1 49  ? 8.407   1.195   -15.499 1.00 34.34 ? 201  MET A N   1 
ATOM   284  C  CA  . MET A 1 49  ? 9.319   1.350   -14.374 1.00 34.89 ? 201  MET A CA  1 
ATOM   285  C  C   . MET A 1 49  ? 10.248  0.137   -14.289 1.00 34.27 ? 201  MET A C   1 
ATOM   286  O  O   . MET A 1 49  ? 9.789   -1.010  -14.231 1.00 34.37 ? 201  MET A O   1 
ATOM   287  C  CB  . MET A 1 49  ? 8.529   1.496   -13.071 1.00 34.75 ? 201  MET A CB  1 
ATOM   288  C  CG  . MET A 1 49  ? 9.395   1.717   -11.843 1.00 35.80 ? 201  MET A CG  1 
ATOM   289  S  SD  . MET A 1 49  ? 8.817   0.760   -10.422 1.00 37.22 ? 201  MET A SD  1 
ATOM   290  C  CE  . MET A 1 49  ? 10.229  0.851   -9.304  1.00 35.89 ? 201  MET A CE  1 
ATOM   291  N  N   . VAL A 1 50  ? 11.553  0.389   -14.299 1.00 33.73 ? 202  VAL A N   1 
ATOM   292  C  CA  . VAL A 1 50  ? 12.530  -0.672  -14.081 1.00 33.23 ? 202  VAL A CA  1 
ATOM   293  C  C   . VAL A 1 50  ? 12.665  -0.880  -12.572 1.00 33.17 ? 202  VAL A C   1 
ATOM   294  O  O   . VAL A 1 50  ? 13.092  0.028   -11.853 1.00 33.21 ? 202  VAL A O   1 
ATOM   295  C  CB  . VAL A 1 50  ? 13.899  -0.331  -14.726 1.00 33.04 ? 202  VAL A CB  1 
ATOM   296  C  CG1 . VAL A 1 50  ? 14.984  -1.300  -14.275 1.00 32.66 ? 202  VAL A CG1 1 
ATOM   297  C  CG2 . VAL A 1 50  ? 13.786  -0.348  -16.228 1.00 32.84 ? 202  VAL A CG2 1 
ATOM   298  N  N   . THR A 1 51  ? 12.270  -2.056  -12.088 1.00 32.91 ? 203  THR A N   1 
ATOM   299  C  CA  . THR A 1 51  ? 12.458  -2.384  -10.677 1.00 32.87 ? 203  THR A CA  1 
ATOM   300  C  C   . THR A 1 51  ? 13.946  -2.619  -10.440 1.00 32.91 ? 203  THR A C   1 
ATOM   301  O  O   . THR A 1 51  ? 14.716  -2.748  -11.387 1.00 32.94 ? 203  THR A O   1 
ATOM   302  C  CB  . THR A 1 51  ? 11.635  -3.621  -10.219 1.00 32.85 ? 203  THR A CB  1 
ATOM   303  O  OG1 . THR A 1 51  ? 12.082  -4.792  -10.909 1.00 32.58 ? 203  THR A OG1 1 
ATOM   304  C  CG2 . THR A 1 51  ? 10.148  -3.420  -10.474 1.00 32.80 ? 203  THR A CG2 1 
ATOM   305  N  N   . ASP A 1 52  ? 14.357  -2.656  -9.179  1.00 33.08 ? 204  ASP A N   1 
ATOM   306  C  CA  . ASP A 1 52  ? 15.761  -2.885  -8.860  1.00 33.18 ? 204  ASP A CA  1 
ATOM   307  C  C   . ASP A 1 52  ? 16.062  -4.379  -8.680  1.00 33.02 ? 204  ASP A C   1 
ATOM   308  O  O   . ASP A 1 52  ? 17.135  -4.748  -8.200  1.00 32.97 ? 204  ASP A O   1 
ATOM   309  C  CB  . ASP A 1 52  ? 16.197  -2.048  -7.641  1.00 33.35 ? 204  ASP A CB  1 
ATOM   310  C  CG  . ASP A 1 52  ? 15.385  -2.356  -6.374  1.00 34.09 ? 204  ASP A CG  1 
ATOM   311  O  OD1 . ASP A 1 52  ? 15.862  -2.013  -5.266  1.00 34.23 ? 204  ASP A OD1 1 
ATOM   312  O  OD2 . ASP A 1 52  ? 14.277  -2.931  -6.474  1.00 34.73 ? 204  ASP A OD2 1 
ATOM   313  N  N   . PHE A 1 53  ? 15.117  -5.232  -9.083  1.00 32.91 ? 205  PHE A N   1 
ATOM   314  C  CA  . PHE A 1 53  ? 15.307  -6.678  -8.994  1.00 32.75 ? 205  PHE A CA  1 
ATOM   315  C  C   . PHE A 1 53  ? 16.163  -7.234  -10.129 1.00 32.76 ? 205  PHE A C   1 
ATOM   316  O  O   . PHE A 1 53  ? 15.949  -6.909  -11.298 1.00 33.01 ? 205  PHE A O   1 
ATOM   317  C  CB  . PHE A 1 53  ? 13.976  -7.433  -8.939  1.00 32.45 ? 205  PHE A CB  1 
ATOM   318  C  CG  . PHE A 1 53  ? 14.146  -8.907  -8.682  1.00 32.75 ? 205  PHE A CG  1 
ATOM   319  C  CD1 . PHE A 1 53  ? 14.265  -9.390  -7.375  1.00 32.34 ? 205  PHE A CD1 1 
ATOM   320  C  CD2 . PHE A 1 53  ? 14.233  -9.814  -9.742  1.00 32.30 ? 205  PHE A CD2 1 
ATOM   321  C  CE1 . PHE A 1 53  ? 14.446  -10.755 -7.128  1.00 31.64 ? 205  PHE A CE1 1 
ATOM   322  C  CE2 . PHE A 1 53  ? 14.418  -11.180 -9.502  1.00 32.17 ? 205  PHE A CE2 1 
ATOM   323  C  CZ  . PHE A 1 53  ? 14.526  -11.649 -8.192  1.00 31.78 ? 205  PHE A CZ  1 
ATOM   324  N  N   . GLU A 1 54  ? 17.115  -8.092  -9.770  1.00 32.65 ? 206  GLU A N   1 
ATOM   325  C  CA  . GLU A 1 54  ? 17.991  -8.753  -10.732 1.00 32.56 ? 206  GLU A CA  1 
ATOM   326  C  C   . GLU A 1 54  ? 18.515  -10.069 -10.170 1.00 32.40 ? 206  GLU A C   1 
ATOM   327  O  O   . GLU A 1 54  ? 19.170  -10.095 -9.121  1.00 32.43 ? 206  GLU A O   1 
ATOM   328  C  CB  . GLU A 1 54  ? 19.158  -7.835  -11.116 1.00 32.59 ? 206  GLU A CB  1 
ATOM   329  C  CG  . GLU A 1 54  ? 20.207  -8.492  -12.002 1.00 32.96 ? 206  GLU A CG  1 
ATOM   330  C  CD  . GLU A 1 54  ? 21.154  -7.493  -12.640 1.00 32.84 ? 206  GLU A CD  1 
ATOM   331  O  OE1 . GLU A 1 54  ? 20.713  -6.702  -13.508 1.00 32.57 ? 206  GLU A OE1 1 
ATOM   332  O  OE2 . GLU A 1 54  ? 22.347  -7.514  -12.276 1.00 33.55 ? 206  GLU A OE2 1 
ATOM   333  N  N   . ASN A 1 55  ? 18.210  -11.157 -10.870 1.00 32.24 ? 207  ASN A N   1 
ATOM   334  C  CA  . ASN A 1 55  ? 18.705  -12.489 -10.519 1.00 32.05 ? 207  ASN A CA  1 
ATOM   335  C  C   . ASN A 1 55  ? 18.905  -13.332 -11.780 1.00 32.18 ? 207  ASN A C   1 
ATOM   336  O  O   . ASN A 1 55  ? 17.970  -13.965 -12.280 1.00 32.38 ? 207  ASN A O   1 
ATOM   337  C  CB  . ASN A 1 55  ? 17.759  -13.182 -9.531  1.00 31.80 ? 207  ASN A CB  1 
ATOM   338  C  CG  . ASN A 1 55  ? 18.413  -14.354 -8.814  1.00 31.24 ? 207  ASN A CG  1 
ATOM   339  O  OD1 . ASN A 1 55  ? 18.855  -15.313 -9.443  1.00 30.74 ? 207  ASN A OD1 1 
ATOM   340  N  ND2 . ASN A 1 55  ? 18.460  -14.287 -7.486  1.00 29.99 ? 207  ASN A ND2 1 
ATOM   341  N  N   . VAL A 1 56  ? 20.129  -13.318 -12.297 1.00 32.22 ? 208  VAL A N   1 
ATOM   342  C  CA  . VAL A 1 56  ? 20.437  -13.982 -13.558 1.00 32.28 ? 208  VAL A CA  1 
ATOM   343  C  C   . VAL A 1 56  ? 21.699  -14.839 -13.466 1.00 32.65 ? 208  VAL A C   1 
ATOM   344  O  O   . VAL A 1 56  ? 22.640  -14.475 -12.763 1.00 32.44 ? 208  VAL A O   1 
ATOM   345  C  CB  . VAL A 1 56  ? 20.558  -12.965 -14.723 1.00 32.28 ? 208  VAL A CB  1 
ATOM   346  C  CG1 . VAL A 1 56  ? 19.223  -12.270 -14.955 1.00 32.06 ? 208  VAL A CG1 1 
ATOM   347  C  CG2 . VAL A 1 56  ? 21.677  -11.943 -14.477 1.00 31.28 ? 208  VAL A CG2 1 
ATOM   348  N  N   . PRO A 1 57  ? 21.718  -15.989 -14.165 1.00 33.19 ? 209  PRO A N   1 
ATOM   349  C  CA  . PRO A 1 57  ? 22.928  -16.814 -14.212 1.00 33.75 ? 209  PRO A CA  1 
ATOM   350  C  C   . PRO A 1 57  ? 23.987  -16.191 -15.112 1.00 34.55 ? 209  PRO A C   1 
ATOM   351  O  O   . PRO A 1 57  ? 23.657  -15.386 -15.984 1.00 34.73 ? 209  PRO A O   1 
ATOM   352  C  CB  . PRO A 1 57  ? 22.428  -18.131 -14.805 1.00 33.56 ? 209  PRO A CB  1 
ATOM   353  C  CG  . PRO A 1 57  ? 21.256  -17.755 -15.621 1.00 33.11 ? 209  PRO A CG  1 
ATOM   354  C  CD  . PRO A 1 57  ? 20.612  -16.590 -14.934 1.00 33.05 ? 209  PRO A CD  1 
ATOM   355  N  N   . GLU A 1 58  ? 25.247  -16.554 -14.904 1.00 35.64 ? 210  GLU A N   1 
ATOM   356  C  CA  . GLU A 1 58  ? 26.340  -15.999 -15.702 1.00 36.84 ? 210  GLU A CA  1 
ATOM   357  C  C   . GLU A 1 58  ? 26.210  -16.391 -17.173 1.00 37.42 ? 210  GLU A C   1 
ATOM   358  O  O   . GLU A 1 58  ? 25.602  -17.417 -17.494 1.00 37.53 ? 210  GLU A O   1 
ATOM   359  C  CB  . GLU A 1 58  ? 27.694  -16.447 -15.146 1.00 36.86 ? 210  GLU A CB  1 
ATOM   360  C  CG  . GLU A 1 58  ? 28.024  -15.844 -13.790 1.00 38.09 ? 210  GLU A CG  1 
ATOM   361  C  CD  . GLU A 1 58  ? 29.497  -15.970 -13.426 1.00 39.69 ? 210  GLU A CD  1 
ATOM   362  O  OE1 . GLU A 1 58  ? 30.247  -14.999 -13.661 1.00 40.15 ? 210  GLU A OE1 1 
ATOM   363  O  OE2 . GLU A 1 58  ? 29.908  -17.035 -12.909 1.00 40.26 ? 210  GLU A OE2 1 
ATOM   364  N  N   . GLU A 1 59  ? 26.766  -15.565 -18.059 1.00 38.22 ? 211  GLU A N   1 
ATOM   365  C  CA  . GLU A 1 59  ? 26.828  -15.889 -19.491 1.00 39.03 ? 211  GLU A CA  1 
ATOM   366  C  C   . GLU A 1 59  ? 27.796  -17.034 -19.770 1.00 39.30 ? 211  GLU A C   1 
ATOM   367  O  O   . GLU A 1 59  ? 28.792  -17.206 -19.061 1.00 39.52 ? 211  GLU A O   1 
ATOM   368  C  CB  . GLU A 1 59  ? 27.210  -14.665 -20.331 1.00 39.15 ? 211  GLU A CB  1 
ATOM   369  C  CG  . GLU A 1 59  ? 26.019  -13.869 -20.857 1.00 40.23 ? 211  GLU A CG  1 
ATOM   370  C  CD  . GLU A 1 59  ? 25.576  -12.756 -19.914 1.00 41.68 ? 211  GLU A CD  1 
ATOM   371  O  OE1 . GLU A 1 59  ? 25.521  -12.969 -18.683 1.00 42.37 ? 211  GLU A OE1 1 
ATOM   372  O  OE2 . GLU A 1 59  ? 25.276  -11.655 -20.412 1.00 42.43 ? 211  GLU A OE2 1 
ATOM   373  N  N   . ASP A 1 60  ? 27.493  -17.813 -20.804 1.00 39.72 ? 212  ASP A N   1 
ATOM   374  C  CA  . ASP A 1 60  ? 28.311  -18.962 -21.176 1.00 40.10 ? 212  ASP A CA  1 
ATOM   375  C  C   . ASP A 1 60  ? 28.336  -19.149 -22.686 1.00 40.06 ? 212  ASP A C   1 
ATOM   376  O  O   . ASP A 1 60  ? 29.203  -18.596 -23.365 1.00 40.09 ? 212  ASP A O   1 
ATOM   377  C  CB  . ASP A 1 60  ? 27.829  -20.238 -20.471 1.00 40.31 ? 212  ASP A CB  1 
ATOM   378  C  CG  . ASP A 1 60  ? 26.325  -20.451 -20.595 1.00 41.25 ? 212  ASP A CG  1 
ATOM   379  O  OD1 . ASP A 1 60  ? 25.548  -19.652 -20.019 1.00 42.36 ? 212  ASP A OD1 1 
ATOM   380  O  OD2 . ASP A 1 60  ? 25.918  -21.430 -21.257 1.00 42.11 ? 212  ASP A OD2 1 
ATOM   381  N  N   . SER A 1 69  ? 22.873  -3.724  -25.580 1.00 36.57 ? 221  SER A N   1 
ATOM   382  C  CA  . SER A 1 69  ? 21.883  -3.522  -26.652 1.00 36.74 ? 221  SER A CA  1 
ATOM   383  C  C   . SER A 1 69  ? 21.358  -4.823  -27.284 1.00 36.75 ? 221  SER A C   1 
ATOM   384  O  O   . SER A 1 69  ? 20.280  -4.830  -27.885 1.00 36.69 ? 221  SER A O   1 
ATOM   385  C  CB  . SER A 1 69  ? 22.423  -2.598  -27.746 1.00 36.77 ? 221  SER A CB  1 
ATOM   386  O  OG  . SER A 1 69  ? 21.484  -2.489  -28.803 1.00 36.27 ? 221  SER A OG  1 
ATOM   387  N  N   . LYS A 1 70  ? 22.136  -5.902  -27.174 1.00 36.71 ? 222  LYS A N   1 
ATOM   388  C  CA  . LYS A 1 70  ? 21.652  -7.254  -27.476 1.00 36.32 ? 222  LYS A CA  1 
ATOM   389  C  C   . LYS A 1 70  ? 20.978  -7.845  -26.228 1.00 35.64 ? 222  LYS A C   1 
ATOM   390  O  O   . LYS A 1 70  ? 20.050  -8.653  -26.336 1.00 35.76 ? 222  LYS A O   1 
ATOM   391  C  CB  . LYS A 1 70  ? 22.800  -8.161  -27.954 1.00 36.50 ? 222  LYS A CB  1 
ATOM   392  C  CG  . LYS A 1 70  ? 22.345  -9.535  -28.468 1.00 37.82 ? 222  LYS A CG  1 
ATOM   393  C  CD  . LYS A 1 70  ? 21.738  -9.448  -29.884 1.00 40.07 ? 222  LYS A CD  1 
ATOM   394  C  CE  . LYS A 1 70  ? 20.310  -10.032 -29.952 1.00 40.54 ? 222  LYS A CE  1 
ATOM   395  N  NZ  . LYS A 1 70  ? 20.244  -11.512 -29.798 1.00 40.53 ? 222  LYS A NZ  1 
ATOM   396  N  N   . CYS A 1 71  ? 21.447  -7.417  -25.054 1.00 34.60 ? 223  CYS A N   1 
ATOM   397  C  CA  . CYS A 1 71  ? 20.930  -7.878  -23.766 1.00 33.73 ? 223  CYS A CA  1 
ATOM   398  C  C   . CYS A 1 71  ? 19.446  -7.638  -23.566 1.00 33.00 ? 223  CYS A C   1 
ATOM   399  O  O   . CYS A 1 71  ? 18.777  -8.426  -22.892 1.00 33.00 ? 223  CYS A O   1 
ATOM   400  C  CB  . CYS A 1 71  ? 21.670  -7.194  -22.621 1.00 33.56 ? 223  CYS A CB  1 
ATOM   401  S  SG  . CYS A 1 71  ? 23.380  -7.691  -22.491 1.00 34.54 ? 223  CYS A SG  1 
ATOM   402  N  N   . ASP A 1 72  ? 18.942  -6.539  -24.127 1.00 31.97 ? 224  ASP A N   1 
ATOM   403  C  CA  . ASP A 1 72  ? 17.580  -6.098  -23.832 1.00 30.99 ? 224  ASP A CA  1 
ATOM   404  C  C   . ASP A 1 72  ? 16.552  -6.269  -24.949 1.00 29.83 ? 224  ASP A C   1 
ATOM   405  O  O   . ASP A 1 72  ? 15.392  -5.881  -24.786 1.00 29.55 ? 224  ASP A O   1 
ATOM   406  C  CB  . ASP A 1 72  ? 17.530  -4.665  -23.236 1.00 31.40 ? 224  ASP A CB  1 
ATOM   407  C  CG  . ASP A 1 72  ? 18.740  -3.804  -23.587 1.00 32.64 ? 224  ASP A CG  1 
ATOM   408  O  OD1 . ASP A 1 72  ? 19.447  -4.091  -24.581 1.00 34.67 ? 224  ASP A OD1 1 
ATOM   409  O  OD2 . ASP A 1 72  ? 18.971  -2.811  -22.856 1.00 33.22 ? 224  ASP A OD2 1 
ATOM   410  N  N   . SER A 1 73  ? 16.953  -6.899  -26.049 1.00 28.48 ? 225  SER A N   1 
ATOM   411  C  CA  . SER A 1 73  ? 16.093  -6.954  -27.224 1.00 27.45 ? 225  SER A CA  1 
ATOM   412  C  C   . SER A 1 73  ? 14.807  -7.748  -26.972 1.00 26.43 ? 225  SER A C   1 
ATOM   413  O  O   . SER A 1 73  ? 13.722  -7.318  -27.381 1.00 26.84 ? 225  SER A O   1 
ATOM   414  C  CB  . SER A 1 73  ? 16.856  -7.471  -28.447 1.00 27.51 ? 225  SER A CB  1 
ATOM   415  O  OG  . SER A 1 73  ? 16.446  -8.776  -28.804 1.00 28.15 ? 225  SER A OG  1 
ATOM   416  N  N   . HIS A 1 74  ? 14.935  -8.882  -26.287 1.00 25.11 ? 226  HIS A N   1 
ATOM   417  C  CA  A HIS A 1 74  ? 13.774  -9.733  -26.009 0.50 24.12 ? 226  HIS A CA  1 
ATOM   418  C  CA  B HIS A 1 74  ? 13.819  -9.759  -25.966 0.50 24.75 ? 226  HIS A CA  1 
ATOM   419  C  C   . HIS A 1 74  ? 12.738  -9.009  -25.160 1.00 24.32 ? 226  HIS A C   1 
ATOM   420  O  O   . HIS A 1 74  ? 11.577  -8.898  -25.574 1.00 24.10 ? 226  HIS A O   1 
ATOM   421  C  CB  A HIS A 1 74  ? 14.169  -11.069 -25.363 0.50 23.63 ? 226  HIS A CB  1 
ATOM   422  C  CB  B HIS A 1 74  ? 14.343  -10.978 -25.182 0.50 24.76 ? 226  HIS A CB  1 
ATOM   423  C  CG  A HIS A 1 74  ? 13.040  -12.051 -25.256 0.50 21.23 ? 226  HIS A CG  1 
ATOM   424  C  CG  B HIS A 1 74  ? 15.802  -11.285 -25.411 0.50 25.07 ? 226  HIS A CG  1 
ATOM   425  N  ND1 A HIS A 1 74  ? 12.432  -12.361 -24.060 0.50 19.09 ? 226  HIS A ND1 1 
ATOM   426  N  ND1 B HIS A 1 74  ? 16.816  -10.413 -25.066 0.50 24.30 ? 226  HIS A ND1 1 
ATOM   427  C  CD2 A HIS A 1 74  ? 12.408  -12.790 -26.198 0.50 19.45 ? 226  HIS A CD2 1 
ATOM   428  C  CD2 B HIS A 1 74  ? 16.415  -12.384 -25.918 0.50 25.18 ? 226  HIS A CD2 1 
ATOM   429  C  CE1 A HIS A 1 74  ? 11.479  -13.252 -24.268 0.50 17.61 ? 226  HIS A CE1 1 
ATOM   430  C  CE1 B HIS A 1 74  ? 17.985  -10.952 -25.367 0.50 24.12 ? 226  HIS A CE1 1 
ATOM   431  N  NE2 A HIS A 1 74  ? 11.440  -13.524 -25.557 0.50 17.64 ? 226  HIS A NE2 1 
ATOM   432  N  NE2 B HIS A 1 74  ? 17.770  -12.148 -25.884 0.50 24.60 ? 226  HIS A NE2 1 
ATOM   433  N  N   . GLY A 1 75  ? 13.145  -8.489  -23.998 1.00 24.12 ? 227  GLY A N   1 
ATOM   434  C  CA  . GLY A 1 75  ? 12.236  -7.797  -23.078 1.00 23.52 ? 227  GLY A CA  1 
ATOM   435  C  C   . GLY A 1 75  ? 11.683  -6.476  -23.579 1.00 23.42 ? 227  GLY A C   1 
ATOM   436  O  O   . GLY A 1 75  ? 10.512  -6.155  -23.330 1.00 23.45 ? 227  GLY A O   1 
ATOM   437  N  N   . THR A 1 76  ? 12.523  -5.706  -24.272 1.00 22.99 ? 228  THR A N   1 
ATOM   438  C  CA  . THR A 1 76  ? 12.106  -4.433  -24.856 1.00 22.71 ? 228  THR A CA  1 
ATOM   439  C  C   . THR A 1 76  ? 10.981  -4.672  -25.849 1.00 22.71 ? 228  THR A C   1 
ATOM   440  O  O   . THR A 1 76  ? 9.964   -3.984  -25.813 1.00 22.89 ? 228  THR A O   1 
ATOM   441  C  CB  . THR A 1 76  ? 13.282  -3.699  -25.562 1.00 22.73 ? 228  THR A CB  1 
ATOM   442  O  OG1 . THR A 1 76  ? 14.371  -3.542  -24.644 1.00 22.62 ? 228  THR A OG1 1 
ATOM   443  C  CG2 . THR A 1 76  ? 12.851  -2.326  -26.066 1.00 21.93 ? 228  THR A CG2 1 
ATOM   444  N  N   . HIS A 1 77  ? 11.162  -5.662  -26.721 1.00 22.58 ? 229  HIS A N   1 
ATOM   445  C  CA  . HIS A 1 77  ? 10.144  -6.012  -27.703 1.00 22.41 ? 229  HIS A CA  1 
ATOM   446  C  C   . HIS A 1 77  ? 8.803   -6.289  -27.031 1.00 22.45 ? 229  HIS A C   1 
ATOM   447  O  O   . HIS A 1 77  ? 7.767   -5.744  -27.440 1.00 22.32 ? 229  HIS A O   1 
ATOM   448  C  CB  . HIS A 1 77  ? 10.576  -7.219  -28.532 1.00 22.20 ? 229  HIS A CB  1 
ATOM   449  C  CG  . HIS A 1 77  ? 9.751   -7.431  -29.762 1.00 22.29 ? 229  HIS A CG  1 
ATOM   450  N  ND1 . HIS A 1 77  ? 8.721   -8.345  -29.820 1.00 22.61 ? 229  HIS A ND1 1 
ATOM   451  C  CD2 . HIS A 1 77  ? 9.799   -6.842  -30.981 1.00 22.67 ? 229  HIS A CD2 1 
ATOM   452  C  CE1 . HIS A 1 77  ? 8.171   -8.312  -31.021 1.00 22.58 ? 229  HIS A CE1 1 
ATOM   453  N  NE2 . HIS A 1 77  ? 8.807   -7.409  -31.746 1.00 22.85 ? 229  HIS A NE2 1 
ATOM   454  N  N   . LEU A 1 78  ? 8.832   -7.118  -25.988 1.00 22.24 ? 230  LEU A N   1 
ATOM   455  C  CA  . LEU A 1 78  ? 7.605   -7.572  -25.345 1.00 21.95 ? 230  LEU A CA  1 
ATOM   456  C  C   . LEU A 1 78  ? 6.908   -6.455  -24.578 1.00 21.83 ? 230  LEU A C   1 
ATOM   457  O  O   . LEU A 1 78  ? 5.679   -6.344  -24.618 1.00 21.92 ? 230  LEU A O   1 
ATOM   458  C  CB  . LEU A 1 78  ? 7.879   -8.774  -24.454 1.00 21.94 ? 230  LEU A CB  1 
ATOM   459  C  CG  . LEU A 1 78  ? 8.434   -9.983  -25.211 1.00 22.41 ? 230  LEU A CG  1 
ATOM   460  C  CD1 . LEU A 1 78  ? 9.028   -10.976 -24.239 1.00 22.45 ? 230  LEU A CD1 1 
ATOM   461  C  CD2 . LEU A 1 78  ? 7.371   -10.644 -26.087 1.00 22.19 ? 230  LEU A CD2 1 
ATOM   462  N  N   . ALA A 1 79  ? 7.689   -5.620  -23.898 1.00 21.38 ? 231  ALA A N   1 
ATOM   463  C  CA  . ALA A 1 79  ? 7.149   -4.421  -23.269 1.00 21.03 ? 231  ALA A CA  1 
ATOM   464  C  C   . ALA A 1 79  ? 6.439   -3.599  -24.339 1.00 20.87 ? 231  ALA A C   1 
ATOM   465  O  O   . ALA A 1 79  ? 5.376   -3.010  -24.097 1.00 20.62 ? 231  ALA A O   1 
ATOM   466  C  CB  . ALA A 1 79  ? 8.260   -3.615  -22.626 1.00 20.82 ? 231  ALA A CB  1 
ATOM   467  N  N   . GLY A 1 80  ? 7.037   -3.581  -25.528 1.00 20.72 ? 232  GLY A N   1 
ATOM   468  C  CA  . GLY A 1 80  ? 6.456   -2.920  -26.685 1.00 20.68 ? 232  GLY A CA  1 
ATOM   469  C  C   . GLY A 1 80  ? 5.126   -3.531  -27.067 1.00 20.47 ? 232  GLY A C   1 
ATOM   470  O  O   . GLY A 1 80  ? 4.159   -2.810  -27.273 1.00 20.57 ? 232  GLY A O   1 
ATOM   471  N  N   . VAL A 1 81  ? 5.076   -4.861  -27.144 1.00 20.54 ? 233  VAL A N   1 
ATOM   472  C  CA  . VAL A 1 81  ? 3.851   -5.562  -27.535 1.00 20.46 ? 233  VAL A CA  1 
ATOM   473  C  C   . VAL A 1 81  ? 2.722   -5.277  -26.546 1.00 20.77 ? 233  VAL A C   1 
ATOM   474  O  O   . VAL A 1 81  ? 1.614   -4.918  -26.958 1.00 20.95 ? 233  VAL A O   1 
ATOM   475  C  CB  . VAL A 1 81  ? 4.058   -7.091  -27.706 1.00 20.32 ? 233  VAL A CB  1 
ATOM   476  C  CG1 . VAL A 1 81  ? 2.765   -7.756  -28.158 1.00 20.59 ? 233  VAL A CG1 1 
ATOM   477  C  CG2 . VAL A 1 81  ? 5.165   -7.392  -28.705 1.00 19.59 ? 233  VAL A CG2 1 
ATOM   478  N  N   . VAL A 1 82  ? 3.014   -5.411  -25.251 1.00 21.05 ? 234  VAL A N   1 
ATOM   479  C  CA  . VAL A 1 82  ? 2.026   -5.161  -24.197 1.00 21.36 ? 234  VAL A CA  1 
ATOM   480  C  C   . VAL A 1 82  ? 1.515   -3.721  -24.195 1.00 21.88 ? 234  VAL A C   1 
ATOM   481  O  O   . VAL A 1 82  ? 0.303   -3.491  -24.102 1.00 21.86 ? 234  VAL A O   1 
ATOM   482  C  CB  . VAL A 1 82  ? 2.568   -5.517  -22.781 1.00 21.20 ? 234  VAL A CB  1 
ATOM   483  C  CG1 . VAL A 1 82  ? 1.540   -5.193  -21.706 1.00 20.88 ? 234  VAL A CG1 1 
ATOM   484  C  CG2 . VAL A 1 82  ? 2.916   -6.974  -22.702 1.00 21.10 ? 234  VAL A CG2 1 
ATOM   485  N  N   . SER A 1 83  ? 2.434   -2.762  -24.320 1.00 22.45 ? 235  SER A N   1 
ATOM   486  C  CA  . SER A 1 83  ? 2.129   -1.371  -23.967 1.00 23.20 ? 235  SER A CA  1 
ATOM   487  C  C   . SER A 1 83  ? 2.563   -0.279  -24.938 1.00 23.27 ? 235  SER A C   1 
ATOM   488  O  O   . SER A 1 83  ? 2.213   0.875   -24.732 1.00 23.24 ? 235  SER A O   1 
ATOM   489  C  CB  . SER A 1 83  ? 2.695   -1.047  -22.577 1.00 23.40 ? 235  SER A CB  1 
ATOM   490  O  OG  . SER A 1 83  ? 4.115   -1.126  -22.564 1.00 24.70 ? 235  SER A OG  1 
ATOM   491  N  N   . GLY A 1 84  ? 3.314   -0.632  -25.982 1.00 23.60 ? 236  GLY A N   1 
ATOM   492  C  CA  . GLY A 1 84  ? 3.844   0.352   -26.937 1.00 23.85 ? 236  GLY A CA  1 
ATOM   493  C  C   . GLY A 1 84  ? 2.824   1.388   -27.375 1.00 24.15 ? 236  GLY A C   1 
ATOM   494  O  O   . GLY A 1 84  ? 1.663   1.060   -27.606 1.00 24.20 ? 236  GLY A O   1 
ATOM   495  N  N   . ARG A 1 85  ? 3.246   2.643   -27.483 1.00 24.53 ? 237  ARG A N   1 
ATOM   496  C  CA  . ARG A 1 85  ? 2.314   3.707   -27.851 1.00 25.21 ? 237  ARG A CA  1 
ATOM   497  C  C   . ARG A 1 85  ? 1.810   3.576   -29.295 1.00 25.07 ? 237  ARG A C   1 
ATOM   498  O  O   . ARG A 1 85  ? 0.677   3.944   -29.580 1.00 25.06 ? 237  ARG A O   1 
ATOM   499  C  CB  . ARG A 1 85  ? 2.875   5.113   -27.555 1.00 25.43 ? 237  ARG A CB  1 
ATOM   500  C  CG  . ARG A 1 85  ? 4.124   5.502   -28.341 1.00 27.15 ? 237  ARG A CG  1 
ATOM   501  C  CD  . ARG A 1 85  ? 4.221   7.013   -28.523 1.00 29.38 ? 237  ARG A CD  1 
ATOM   502  N  NE  . ARG A 1 85  ? 3.497   7.472   -29.712 1.00 31.15 ? 237  ARG A NE  1 
ATOM   503  C  CZ  . ARG A 1 85  ? 4.003   8.256   -30.667 1.00 31.93 ? 237  ARG A CZ  1 
ATOM   504  N  NH1 . ARG A 1 85  ? 5.253   8.705   -30.590 1.00 32.04 ? 237  ARG A NH1 1 
ATOM   505  N  NH2 . ARG A 1 85  ? 3.246   8.607   -31.704 1.00 32.19 ? 237  ARG A NH2 1 
ATOM   506  N  N   . ASP A 1 86  ? 2.636   3.032   -30.188 1.00 25.12 ? 238  ASP A N   1 
ATOM   507  C  CA  . ASP A 1 86  ? 2.225   2.829   -31.579 1.00 25.34 ? 238  ASP A CA  1 
ATOM   508  C  C   . ASP A 1 86  ? 1.828   1.387   -31.884 1.00 25.43 ? 238  ASP A C   1 
ATOM   509  O  O   . ASP A 1 86  ? 0.823   1.145   -32.552 1.00 25.47 ? 238  ASP A O   1 
ATOM   510  C  CB  . ASP A 1 86  ? 3.317   3.280   -32.553 1.00 25.32 ? 238  ASP A CB  1 
ATOM   511  C  CG  . ASP A 1 86  ? 3.577   4.776   -32.498 1.00 25.72 ? 238  ASP A CG  1 
ATOM   512  O  OD1 . ASP A 1 86  ? 2.610   5.557   -32.344 1.00 25.53 ? 238  ASP A OD1 1 
ATOM   513  O  OD2 . ASP A 1 86  ? 4.758   5.173   -32.617 1.00 26.37 ? 238  ASP A OD2 1 
ATOM   514  N  N   . ALA A 1 87  ? 2.617   0.435   -31.393 1.00 25.64 ? 239  ALA A N   1 
ATOM   515  C  CA  . ALA A 1 87  ? 2.457   -0.974  -31.759 1.00 25.82 ? 239  ALA A CA  1 
ATOM   516  C  C   . ALA A 1 87  ? 2.000   -1.873  -30.607 1.00 26.06 ? 239  ALA A C   1 
ATOM   517  O  O   . ALA A 1 87  ? 2.018   -3.099  -30.732 1.00 26.31 ? 239  ALA A O   1 
ATOM   518  C  CB  . ALA A 1 87  ? 3.753   -1.513  -32.390 1.00 25.47 ? 239  ALA A CB  1 
ATOM   519  N  N   . GLY A 1 88  ? 1.573   -1.271  -29.499 1.00 26.21 ? 240  GLY A N   1 
ATOM   520  C  CA  . GLY A 1 88  ? 1.113   -2.042  -28.344 1.00 26.63 ? 240  GLY A CA  1 
ATOM   521  C  C   . GLY A 1 88  ? -0.346  -2.478  -28.396 1.00 26.92 ? 240  GLY A C   1 
ATOM   522  O  O   . GLY A 1 88  ? -1.159  -1.884  -29.105 1.00 27.02 ? 240  GLY A O   1 
ATOM   523  N  N   . VAL A 1 89  ? -0.673  -3.521  -27.636 1.00 27.12 ? 241  VAL A N   1 
ATOM   524  C  CA  . VAL A 1 89  ? -2.050  -3.993  -27.499 1.00 27.29 ? 241  VAL A CA  1 
ATOM   525  C  C   . VAL A 1 89  ? -2.853  -3.071  -26.581 1.00 27.58 ? 241  VAL A C   1 
ATOM   526  O  O   . VAL A 1 89  ? -3.936  -2.609  -26.940 1.00 27.51 ? 241  VAL A O   1 
ATOM   527  C  CB  . VAL A 1 89  ? -2.092  -5.430  -26.947 1.00 27.20 ? 241  VAL A CB  1 
ATOM   528  C  CG1 . VAL A 1 89  ? -3.526  -5.850  -26.628 1.00 26.88 ? 241  VAL A CG1 1 
ATOM   529  C  CG2 . VAL A 1 89  ? -1.445  -6.394  -27.932 1.00 27.21 ? 241  VAL A CG2 1 
ATOM   530  N  N   . ALA A 1 90  ? -2.313  -2.833  -25.387 1.00 28.03 ? 242  ALA A N   1 
ATOM   531  C  CA  . ALA A 1 90  ? -2.894  -1.919  -24.415 1.00 28.31 ? 242  ALA A CA  1 
ATOM   532  C  C   . ALA A 1 90  ? -1.978  -0.707  -24.348 1.00 28.59 ? 242  ALA A C   1 
ATOM   533  O  O   . ALA A 1 90  ? -1.011  -0.689  -23.589 1.00 28.83 ? 242  ALA A O   1 
ATOM   534  C  CB  . ALA A 1 90  ? -3.000  -2.600  -23.052 1.00 28.16 ? 242  ALA A CB  1 
ATOM   535  N  N   . LYS A 1 91  ? -2.280  0.300   -25.154 1.00 28.93 ? 243  LYS A N   1 
ATOM   536  C  CA  . LYS A 1 91  ? -1.335  1.391   -25.404 1.00 29.33 ? 243  LYS A CA  1 
ATOM   537  C  C   . LYS A 1 91  ? -0.996  2.257   -24.188 1.00 29.69 ? 243  LYS A C   1 
ATOM   538  O  O   . LYS A 1 91  ? 0.144   2.706   -24.040 1.00 29.84 ? 243  LYS A O   1 
ATOM   539  C  CB  . LYS A 1 91  ? -1.799  2.234   -26.591 1.00 29.29 ? 243  LYS A CB  1 
ATOM   540  C  CG  . LYS A 1 91  ? -1.592  1.526   -27.916 1.00 29.22 ? 243  LYS A CG  1 
ATOM   541  C  CD  . LYS A 1 91  ? -2.675  1.863   -28.897 1.00 29.95 ? 243  LYS A CD  1 
ATOM   542  C  CE  . LYS A 1 91  ? -2.589  0.978   -30.116 1.00 30.13 ? 243  LYS A CE  1 
ATOM   543  N  NZ  . LYS A 1 91  ? -3.454  1.532   -31.178 1.00 31.39 ? 243  LYS A NZ  1 
ATOM   544  N  N   . GLY A 1 92  ? -1.969  2.483   -23.312 1.00 30.04 ? 244  GLY A N   1 
ATOM   545  C  CA  . GLY A 1 92  ? -1.707  3.239   -22.081 1.00 30.28 ? 244  GLY A CA  1 
ATOM   546  C  C   . GLY A 1 92  ? -0.884  2.465   -21.054 1.00 30.35 ? 244  GLY A C   1 
ATOM   547  O  O   . GLY A 1 92  ? -0.016  3.038   -20.380 1.00 30.44 ? 244  GLY A O   1 
ATOM   548  N  N   . ALA A 1 93  ? -1.150  1.158   -20.973 1.00 30.06 ? 245  ALA A N   1 
ATOM   549  C  CA  . ALA A 1 93  ? -0.719  0.277   -19.874 1.00 29.81 ? 245  ALA A CA  1 
ATOM   550  C  C   . ALA A 1 93  ? 0.594   0.617   -19.176 1.00 29.64 ? 245  ALA A C   1 
ATOM   551  O  O   . ALA A 1 93  ? 1.618   0.866   -19.819 1.00 29.77 ? 245  ALA A O   1 
ATOM   552  C  CB  . ALA A 1 93  ? -0.708  -1.179  -20.332 1.00 29.65 ? 245  ALA A CB  1 
ATOM   553  N  N   . SER A 1 94  ? 0.537   0.619   -17.849 1.00 29.33 ? 246  SER A N   1 
ATOM   554  C  CA  . SER A 1 94  ? 1.696   0.863   -17.001 1.00 29.04 ? 246  SER A CA  1 
ATOM   555  C  C   . SER A 1 94  ? 2.426   -0.452  -16.731 1.00 28.79 ? 246  SER A C   1 
ATOM   556  O  O   . SER A 1 94  ? 1.788   -1.477  -16.510 1.00 28.97 ? 246  SER A O   1 
ATOM   557  C  CB  . SER A 1 94  ? 1.240   1.509   -15.691 1.00 28.94 ? 246  SER A CB  1 
ATOM   558  O  OG  . SER A 1 94  ? 2.227   1.397   -14.688 1.00 29.23 ? 246  SER A OG  1 
ATOM   559  N  N   . MET A 1 95  ? 3.756   -0.425  -16.748 1.00 28.35 ? 247  MET A N   1 
ATOM   560  C  CA  . MET A 1 95  ? 4.534   -1.655  -16.602 1.00 28.08 ? 247  MET A CA  1 
ATOM   561  C  C   . MET A 1 95  ? 5.654   -1.573  -15.574 1.00 27.73 ? 247  MET A C   1 
ATOM   562  O  O   . MET A 1 95  ? 6.132   -0.491  -15.236 1.00 27.62 ? 247  MET A O   1 
ATOM   563  C  CB  . MET A 1 95  ? 5.103   -2.102  -17.948 1.00 27.96 ? 247  MET A CB  1 
ATOM   564  C  CG  . MET A 1 95  ? 4.050   -2.592  -18.936 1.00 28.24 ? 247  MET A CG  1 
ATOM   565  S  SD  . MET A 1 95  ? 4.746   -3.503  -20.328 1.00 28.92 ? 247  MET A SD  1 
ATOM   566  C  CE  . MET A 1 95  ? 5.148   -5.068  -19.550 1.00 27.78 ? 247  MET A CE  1 
ATOM   567  N  N   . ARG A 1 96  ? 6.058   -2.742  -15.086 1.00 27.28 ? 248  ARG A N   1 
ATOM   568  C  CA  . ARG A 1 96  ? 7.161   -2.875  -14.145 1.00 26.73 ? 248  ARG A CA  1 
ATOM   569  C  C   . ARG A 1 96  ? 7.977   -4.101  -14.527 1.00 26.12 ? 248  ARG A C   1 
ATOM   570  O  O   . ARG A 1 96  ? 7.433   -5.201  -14.623 1.00 25.81 ? 248  ARG A O   1 
ATOM   571  C  CB  . ARG A 1 96  ? 6.632   -3.035  -12.723 1.00 26.88 ? 248  ARG A CB  1 
ATOM   572  C  CG  . ARG A 1 96  ? 6.187   -1.754  -12.064 1.00 27.74 ? 248  ARG A CG  1 
ATOM   573  C  CD  . ARG A 1 96  ? 5.576   -2.050  -10.713 1.00 29.53 ? 248  ARG A CD  1 
ATOM   574  N  NE  . ARG A 1 96  ? 4.922   -0.878  -10.147 1.00 31.14 ? 248  ARG A NE  1 
ATOM   575  C  CZ  . ARG A 1 96  ? 5.263   -0.290  -9.006  1.00 32.21 ? 248  ARG A CZ  1 
ATOM   576  N  NH1 . ARG A 1 96  ? 4.591   0.779   -8.599  1.00 33.30 ? 248  ARG A NH1 1 
ATOM   577  N  NH2 . ARG A 1 96  ? 6.262   -0.763  -8.269  1.00 32.10 ? 248  ARG A NH2 1 
ATOM   578  N  N   . SER A 1 97  ? 9.276   -3.920  -14.745 1.00 25.54 ? 249  SER A N   1 
ATOM   579  C  CA  . SER A 1 97  ? 10.104  -5.038  -15.183 1.00 25.14 ? 249  SER A CA  1 
ATOM   580  C  C   . SER A 1 97  ? 11.085  -5.523  -14.124 1.00 24.70 ? 249  SER A C   1 
ATOM   581  O  O   . SER A 1 97  ? 11.743  -4.724  -13.452 1.00 24.61 ? 249  SER A O   1 
ATOM   582  C  CB  . SER A 1 97  ? 10.840  -4.711  -16.478 1.00 24.94 ? 249  SER A CB  1 
ATOM   583  O  OG  . SER A 1 97  ? 11.760  -3.662  -16.264 1.00 26.28 ? 249  SER A OG  1 
ATOM   584  N  N   . LEU A 1 98  ? 11.147  -6.847  -13.987 1.00 24.16 ? 250  LEU A N   1 
ATOM   585  C  CA  . LEU A 1 98  ? 12.118  -7.540  -13.158 1.00 23.53 ? 250  LEU A CA  1 
ATOM   586  C  C   . LEU A 1 98  ? 13.033  -8.300  -14.101 1.00 23.50 ? 250  LEU A C   1 
ATOM   587  O  O   . LEU A 1 98  ? 12.591  -8.787  -15.147 1.00 23.36 ? 250  LEU A O   1 
ATOM   588  C  CB  . LEU A 1 98  ? 11.418  -8.528  -12.224 1.00 23.43 ? 250  LEU A CB  1 
ATOM   589  C  CG  . LEU A 1 98  ? 10.614  -8.046  -11.012 1.00 23.42 ? 250  LEU A CG  1 
ATOM   590  C  CD1 . LEU A 1 98  ? 9.270   -7.461  -11.414 1.00 23.26 ? 250  LEU A CD1 1 
ATOM   591  C  CD2 . LEU A 1 98  ? 10.401  -9.196  -10.038 1.00 23.60 ? 250  LEU A CD2 1 
ATOM   592  N  N   . ARG A 1 99  ? 14.307  -8.411  -13.737 1.00 23.55 ? 251  ARG A N   1 
ATOM   593  C  CA  . ARG A 1 99  ? 15.274  -9.092  -14.596 1.00 23.56 ? 251  ARG A CA  1 
ATOM   594  C  C   . ARG A 1 99  ? 15.651  -10.481 -14.075 1.00 23.70 ? 251  ARG A C   1 
ATOM   595  O  O   . ARG A 1 99  ? 16.399  -10.612 -13.105 1.00 23.67 ? 251  ARG A O   1 
ATOM   596  C  CB  . ARG A 1 99  ? 16.520  -8.232  -14.804 1.00 23.56 ? 251  ARG A CB  1 
ATOM   597  C  CG  . ARG A 1 99  ? 17.330  -8.652  -16.008 1.00 23.14 ? 251  ARG A CG  1 
ATOM   598  C  CD  . ARG A 1 99  ? 18.780  -8.284  -15.849 1.00 22.25 ? 251  ARG A CD  1 
ATOM   599  N  NE  . ARG A 1 99  ? 19.557  -8.703  -17.010 1.00 21.96 ? 251  ARG A NE  1 
ATOM   600  C  CZ  . ARG A 1 99  ? 20.882  -8.802  -17.035 1.00 21.45 ? 251  ARG A CZ  1 
ATOM   601  N  NH1 . ARG A 1 99  ? 21.491  -9.188  -18.145 1.00 21.21 ? 251  ARG A NH1 1 
ATOM   602  N  NH2 . ARG A 1 99  ? 21.598  -8.521  -15.952 1.00 21.87 ? 251  ARG A NH2 1 
ATOM   603  N  N   . VAL A 1 100 ? 15.122  -11.509 -14.741 1.00 23.80 ? 252  VAL A N   1 
ATOM   604  C  CA  . VAL A 1 100 ? 15.387  -12.905 -14.397 1.00 23.76 ? 252  VAL A CA  1 
ATOM   605  C  C   . VAL A 1 100 ? 16.026  -13.687 -15.551 1.00 23.82 ? 252  VAL A C   1 
ATOM   606  O  O   . VAL A 1 100 ? 16.309  -14.877 -15.412 1.00 23.89 ? 252  VAL A O   1 
ATOM   607  C  CB  . VAL A 1 100 ? 14.106  -13.642 -13.901 1.00 23.90 ? 252  VAL A CB  1 
ATOM   608  C  CG1 . VAL A 1 100 ? 13.523  -12.951 -12.663 1.00 24.13 ? 252  VAL A CG1 1 
ATOM   609  C  CG2 . VAL A 1 100 ? 13.065  -13.756 -15.009 1.00 23.42 ? 252  VAL A CG2 1 
ATOM   610  N  N   . LEU A 1 101 ? 16.250  -13.014 -16.677 1.00 23.92 ? 253  LEU A N   1 
ATOM   611  C  CA  . LEU A 1 101 ? 16.934  -13.606 -17.828 1.00 24.09 ? 253  LEU A CA  1 
ATOM   612  C  C   . LEU A 1 101 ? 18.185  -12.806 -18.182 1.00 24.48 ? 253  LEU A C   1 
ATOM   613  O  O   . LEU A 1 101 ? 18.142  -11.578 -18.198 1.00 24.72 ? 253  LEU A O   1 
ATOM   614  C  CB  . LEU A 1 101 ? 15.998  -13.662 -19.037 1.00 23.89 ? 253  LEU A CB  1 
ATOM   615  C  CG  . LEU A 1 101 ? 14.639  -14.371 -18.936 1.00 23.05 ? 253  LEU A CG  1 
ATOM   616  C  CD1 . LEU A 1 101 ? 13.862  -14.195 -20.232 1.00 22.25 ? 253  LEU A CD1 1 
ATOM   617  C  CD2 . LEU A 1 101 ? 14.775  -15.848 -18.599 1.00 22.25 ? 253  LEU A CD2 1 
ATOM   618  N  N   . ASN A 1 102 ? 19.296  -13.496 -18.454 1.00 24.91 ? 254  ASN A N   1 
ATOM   619  C  CA  . ASN A 1 102 ? 20.555  -12.824 -18.827 1.00 25.40 ? 254  ASN A CA  1 
ATOM   620  C  C   . ASN A 1 102 ? 20.594  -12.424 -20.305 1.00 25.74 ? 254  ASN A C   1 
ATOM   621  O  O   . ASN A 1 102 ? 19.592  -12.550 -21.010 1.00 25.79 ? 254  ASN A O   1 
ATOM   622  C  CB  . ASN A 1 102 ? 21.800  -13.645 -18.413 1.00 25.30 ? 254  ASN A CB  1 
ATOM   623  C  CG  . ASN A 1 102 ? 21.955  -14.953 -19.192 1.00 25.17 ? 254  ASN A CG  1 
ATOM   624  O  OD1 . ASN A 1 102 ? 21.294  -15.185 -20.204 1.00 25.53 ? 254  ASN A OD1 1 
ATOM   625  N  ND2 . ASN A 1 102 ? 22.850  -15.808 -18.717 1.00 24.58 ? 254  ASN A ND2 1 
ATOM   626  N  N   . CYS A 1 103 ? 21.745  -11.960 -20.777 1.00 26.32 ? 255  CYS A N   1 
ATOM   627  C  CA  . CYS A 1 103 ? 21.853  -11.461 -22.153 1.00 27.15 ? 255  CYS A CA  1 
ATOM   628  C  C   . CYS A 1 103 ? 21.633  -12.513 -23.239 1.00 26.91 ? 255  CYS A C   1 
ATOM   629  O  O   . CYS A 1 103 ? 21.276  -12.169 -24.353 1.00 26.97 ? 255  CYS A O   1 
ATOM   630  C  CB  . CYS A 1 103 ? 23.173  -10.725 -22.364 1.00 27.54 ? 255  CYS A CB  1 
ATOM   631  S  SG  . CYS A 1 103 ? 23.354  -9.313  -21.240 1.00 30.25 ? 255  CYS A SG  1 
ATOM   632  N  N   . GLN A 1 104 ? 21.826  -13.789 -22.909 1.00 27.03 ? 256  GLN A N   1 
ATOM   633  C  CA  . GLN A 1 104 ? 21.526  -14.881 -23.840 1.00 26.92 ? 256  GLN A CA  1 
ATOM   634  C  C   . GLN A 1 104 ? 20.094  -15.405 -23.664 1.00 26.53 ? 256  GLN A C   1 
ATOM   635  O  O   . GLN A 1 104 ? 19.723  -16.441 -24.220 1.00 26.33 ? 256  GLN A O   1 
ATOM   636  C  CB  . GLN A 1 104 ? 22.527  -16.025 -23.677 1.00 27.19 ? 256  GLN A CB  1 
ATOM   637  C  CG  . GLN A 1 104 ? 24.001  -15.635 -23.771 1.00 28.53 ? 256  GLN A CG  1 
ATOM   638  C  CD  . GLN A 1 104 ? 24.884  -16.608 -23.003 1.00 31.18 ? 256  GLN A CD  1 
ATOM   639  O  OE1 . GLN A 1 104 ? 24.471  -17.168 -21.973 1.00 32.23 ? 256  GLN A OE1 1 
ATOM   640  N  NE2 . GLN A 1 104 ? 26.101  -16.821 -23.494 1.00 31.57 ? 256  GLN A NE2 1 
ATOM   641  N  N   . GLY A 1 105 ? 19.293  -14.683 -22.886 1.00 26.37 ? 257  GLY A N   1 
ATOM   642  C  CA  . GLY A 1 105 ? 17.896  -15.052 -22.642 1.00 26.07 ? 257  GLY A CA  1 
ATOM   643  C  C   . GLY A 1 105 ? 17.736  -16.234 -21.706 1.00 25.74 ? 257  GLY A C   1 
ATOM   644  O  O   . GLY A 1 105 ? 16.669  -16.840 -21.653 1.00 25.49 ? 257  GLY A O   1 
ATOM   645  N  N   . LYS A 1 106 ? 18.802  -16.550 -20.970 1.00 25.63 ? 258  LYS A N   1 
ATOM   646  C  CA  . LYS A 1 106 ? 18.834  -17.682 -20.048 1.00 25.62 ? 258  LYS A CA  1 
ATOM   647  C  C   . LYS A 1 106 ? 18.610  -17.241 -18.597 1.00 25.20 ? 258  LYS A C   1 
ATOM   648  O  O   . LYS A 1 106 ? 19.129  -16.210 -18.164 1.00 25.24 ? 258  LYS A O   1 
ATOM   649  C  CB  . LYS A 1 106 ? 20.167  -18.430 -20.174 1.00 25.42 ? 258  LYS A CB  1 
ATOM   650  C  CG  . LYS A 1 106 ? 20.095  -19.882 -19.711 1.00 26.38 ? 258  LYS A CG  1 
ATOM   651  C  CD  . LYS A 1 106 ? 21.324  -20.703 -20.094 1.00 26.44 ? 258  LYS A CD  1 
ATOM   652  C  CE  . LYS A 1 106 ? 22.322  -20.773 -18.945 1.00 28.74 ? 258  LYS A CE  1 
ATOM   653  N  NZ  . LYS A 1 106 ? 23.510  -21.601 -19.290 1.00 29.68 ? 258  LYS A NZ  1 
ATOM   654  N  N   . GLY A 1 107 ? 17.834  -18.030 -17.861 1.00 24.71 ? 259  GLY A N   1 
ATOM   655  C  CA  . GLY A 1 107 ? 17.566  -17.781 -16.449 1.00 24.02 ? 259  GLY A CA  1 
ATOM   656  C  C   . GLY A 1 107 ? 17.559  -19.067 -15.646 1.00 23.70 ? 259  GLY A C   1 
ATOM   657  O  O   . GLY A 1 107 ? 17.816  -20.146 -16.184 1.00 24.11 ? 259  GLY A O   1 
ATOM   658  N  N   . THR A 1 108 ? 17.278  -18.954 -14.351 1.00 23.15 ? 260  THR A N   1 
ATOM   659  C  CA  . THR A 1 108 ? 17.146  -20.123 -13.477 1.00 22.19 ? 260  THR A CA  1 
ATOM   660  C  C   . THR A 1 108 ? 15.739  -20.161 -12.881 1.00 22.09 ? 260  THR A C   1 
ATOM   661  O  O   . THR A 1 108 ? 15.070  -19.133 -12.797 1.00 21.75 ? 260  THR A O   1 
ATOM   662  C  CB  . THR A 1 108 ? 18.191  -20.111 -12.331 1.00 22.06 ? 260  THR A CB  1 
ATOM   663  O  OG1 . THR A 1 108 ? 17.969  -18.977 -11.489 1.00 21.05 ? 260  THR A OG1 1 
ATOM   664  C  CG2 . THR A 1 108 ? 19.609  -20.042 -12.874 1.00 21.55 ? 260  THR A CG2 1 
ATOM   665  N  N   . VAL A 1 109 ? 15.292  -21.347 -12.473 1.00 22.19 ? 261  VAL A N   1 
ATOM   666  C  CA  . VAL A 1 109 ? 14.000  -21.493 -11.789 1.00 22.11 ? 261  VAL A CA  1 
ATOM   667  C  C   . VAL A 1 109 ? 14.027  -20.775 -10.440 1.00 22.08 ? 261  VAL A C   1 
ATOM   668  O  O   . VAL A 1 109 ? 13.080  -20.068 -10.093 1.00 22.42 ? 261  VAL A O   1 
ATOM   669  C  CB  . VAL A 1 109 ? 13.594  -22.976 -11.620 1.00 22.14 ? 261  VAL A CB  1 
ATOM   670  C  CG1 . VAL A 1 109 ? 12.502  -23.139 -10.573 1.00 21.86 ? 261  VAL A CG1 1 
ATOM   671  C  CG2 . VAL A 1 109 ? 13.123  -23.544 -12.949 1.00 22.33 ? 261  VAL A CG2 1 
ATOM   672  N  N   . SER A 1 110 ? 15.122  -20.934 -9.702  1.00 21.81 ? 262  SER A N   1 
ATOM   673  C  CA  . SER A 1 110 ? 15.285  -20.271 -8.415  1.00 21.71 ? 262  SER A CA  1 
ATOM   674  C  C   . SER A 1 110 ? 15.164  -18.743 -8.517  1.00 22.01 ? 262  SER A C   1 
ATOM   675  O  O   . SER A 1 110 ? 14.482  -18.114 -7.687  1.00 21.90 ? 262  SER A O   1 
ATOM   676  C  CB  . SER A 1 110 ? 16.609  -20.672 -7.761  1.00 21.63 ? 262  SER A CB  1 
ATOM   677  O  OG  . SER A 1 110 ? 17.720  -20.300 -8.550  1.00 20.85 ? 262  SER A OG  1 
ATOM   678  N  N   . GLY A 1 111 ? 15.808  -18.164 -9.537  1.00 21.81 ? 263  GLY A N   1 
ATOM   679  C  CA  . GLY A 1 111 ? 15.788  -16.723 -9.771  1.00 21.65 ? 263  GLY A CA  1 
ATOM   680  C  C   . GLY A 1 111 ? 14.384  -16.256 -10.084 1.00 22.07 ? 263  GLY A C   1 
ATOM   681  O  O   . GLY A 1 111 ? 13.967  -15.176 -9.662  1.00 22.59 ? 263  GLY A O   1 
ATOM   682  N  N   . THR A 1 112 ? 13.643  -17.085 -10.813 1.00 22.09 ? 264  THR A N   1 
ATOM   683  C  CA  . THR A 1 112 ? 12.259  -16.787 -11.142 1.00 21.87 ? 264  THR A CA  1 
ATOM   684  C  C   . THR A 1 112 ? 11.393  -16.794 -9.879  1.00 21.95 ? 264  THR A C   1 
ATOM   685  O  O   . THR A 1 112 ? 10.597  -15.872 -9.684  1.00 22.16 ? 264  THR A O   1 
ATOM   686  C  CB  . THR A 1 112 ? 11.705  -17.768 -12.204 1.00 22.07 ? 264  THR A CB  1 
ATOM   687  O  OG1 . THR A 1 112 ? 12.642  -17.876 -13.283 1.00 21.24 ? 264  THR A OG1 1 
ATOM   688  C  CG2 . THR A 1 112 ? 10.359  -17.293 -12.745 1.00 21.20 ? 264  THR A CG2 1 
ATOM   689  N  N   . LEU A 1 113 ? 11.553  -17.817 -9.031  1.00 21.65 ? 265  LEU A N   1 
ATOM   690  C  CA  . LEU A 1 113 ? 10.856  -17.868 -7.736  1.00 21.54 ? 265  LEU A CA  1 
ATOM   691  C  C   . LEU A 1 113 ? 11.131  -16.616 -6.915  1.00 21.40 ? 265  LEU A C   1 
ATOM   692  O  O   . LEU A 1 113 ? 10.211  -16.013 -6.369  1.00 21.30 ? 265  LEU A O   1 
ATOM   693  C  CB  . LEU A 1 113 ? 11.284  -19.074 -6.901  1.00 21.35 ? 265  LEU A CB  1 
ATOM   694  C  CG  . LEU A 1 113 ? 10.936  -20.495 -7.318  1.00 21.95 ? 265  LEU A CG  1 
ATOM   695  C  CD1 . LEU A 1 113 ? 11.566  -21.462 -6.323  1.00 21.30 ? 265  LEU A CD1 1 
ATOM   696  C  CD2 . LEU A 1 113 ? 9.431   -20.703 -7.405  1.00 22.43 ? 265  LEU A CD2 1 
ATOM   697  N  N   . ILE A 1 114 ? 12.403  -16.235 -6.828  1.00 21.29 ? 266  ILE A N   1 
ATOM   698  C  CA  . ILE A 1 114 ? 12.778  -15.089 -6.028  1.00 21.26 ? 266  ILE A CA  1 
ATOM   699  C  C   . ILE A 1 114 ? 12.140  -13.846 -6.627  1.00 21.38 ? 266  ILE A C   1 
ATOM   700  O  O   . ILE A 1 114 ? 11.722  -12.953 -5.897  1.00 21.57 ? 266  ILE A O   1 
ATOM   701  C  CB  . ILE A 1 114 ? 14.305  -14.974 -5.843  1.00 21.29 ? 266  ILE A CB  1 
ATOM   702  C  CG1 . ILE A 1 114 ? 14.819  -16.197 -5.077  1.00 21.44 ? 266  ILE A CG1 1 
ATOM   703  C  CG2 . ILE A 1 114 ? 14.667  -13.712 -5.055  1.00 21.02 ? 266  ILE A CG2 1 
ATOM   704  C  CD1 . ILE A 1 114 ? 16.333  -16.304 -4.980  1.00 22.34 ? 266  ILE A CD1 1 
ATOM   705  N  N   . GLY A 1 115 ? 12.024  -13.820 -7.951  1.00 21.48 ? 267  GLY A N   1 
ATOM   706  C  CA  . GLY A 1 115 ? 11.307  -12.755 -8.641  1.00 21.56 ? 267  GLY A CA  1 
ATOM   707  C  C   . GLY A 1 115 ? 9.817   -12.753 -8.356  1.00 21.81 ? 267  GLY A C   1 
ATOM   708  O  O   . GLY A 1 115 ? 9.220   -11.695 -8.136  1.00 21.86 ? 267  GLY A O   1 
ATOM   709  N  N   . LEU A 1 116 ? 9.211   -13.938 -8.361  1.00 21.91 ? 268  LEU A N   1 
ATOM   710  C  CA  . LEU A 1 116 ? 7.787   -14.065 -8.075  1.00 22.17 ? 268  LEU A CA  1 
ATOM   711  C  C   . LEU A 1 116 ? 7.474   -13.717 -6.621  1.00 22.60 ? 268  LEU A C   1 
ATOM   712  O  O   . LEU A 1 116 ? 6.381   -13.234 -6.319  1.00 22.76 ? 268  LEU A O   1 
ATOM   713  C  CB  . LEU A 1 116 ? 7.280   -15.466 -8.417  1.00 21.96 ? 268  LEU A CB  1 
ATOM   714  C  CG  . LEU A 1 116 ? 7.220   -15.874 -9.891  1.00 21.51 ? 268  LEU A CG  1 
ATOM   715  C  CD1 . LEU A 1 116 ? 7.046   -17.375 -9.991  1.00 21.48 ? 268  LEU A CD1 1 
ATOM   716  C  CD2 . LEU A 1 116 ? 6.103   -15.163 -10.634 1.00 20.86 ? 268  LEU A CD2 1 
ATOM   717  N  N   . GLU A 1 117 ? 8.437   -13.960 -5.732  1.00 22.90 ? 269  GLU A N   1 
ATOM   718  C  CA  . GLU A 1 117 ? 8.325   -13.570 -4.328  1.00 23.50 ? 269  GLU A CA  1 
ATOM   719  C  C   . GLU A 1 117 ? 8.344   -12.045 -4.196  1.00 23.81 ? 269  GLU A C   1 
ATOM   720  O  O   . GLU A 1 117 ? 7.572   -11.470 -3.415  1.00 23.80 ? 269  GLU A O   1 
ATOM   721  C  CB  . GLU A 1 117 ? 9.459   -14.182 -3.510  1.00 23.15 ? 269  GLU A CB  1 
ATOM   722  C  CG  . GLU A 1 117 ? 9.276   -14.072 -2.009  1.00 23.67 ? 269  GLU A CG  1 
ATOM   723  C  CD  . GLU A 1 117 ? 10.522  -14.463 -1.215  1.00 24.00 ? 269  GLU A CD  1 
ATOM   724  O  OE1 . GLU A 1 117 ? 11.651  -14.219 -1.683  1.00 24.48 ? 269  GLU A OE1 1 
ATOM   725  O  OE2 . GLU A 1 117 ? 10.373  -15.006 -0.106  1.00 24.94 ? 269  GLU A OE2 1 
ATOM   726  N  N   . PHE A 1 118 ? 9.226   -11.409 -4.972  1.00 24.22 ? 270  PHE A N   1 
ATOM   727  C  CA  . PHE A 1 118 ? 9.364   -9.950  -5.011  1.00 24.64 ? 270  PHE A CA  1 
ATOM   728  C  C   . PHE A 1 118 ? 8.041   -9.269  -5.369  1.00 24.95 ? 270  PHE A C   1 
ATOM   729  O  O   . PHE A 1 118 ? 7.660   -8.285  -4.741  1.00 25.07 ? 270  PHE A O   1 
ATOM   730  C  CB  . PHE A 1 118 ? 10.465  -9.552  -5.997  1.00 24.59 ? 270  PHE A CB  1 
ATOM   731  C  CG  . PHE A 1 118 ? 10.714  -8.067  -6.086  1.00 24.66 ? 270  PHE A CG  1 
ATOM   732  C  CD1 . PHE A 1 118 ? 11.672  -7.462  -5.280  1.00 24.56 ? 270  PHE A CD1 1 
ATOM   733  C  CD2 . PHE A 1 118 ? 10.011  -7.280  -6.998  1.00 24.45 ? 270  PHE A CD2 1 
ATOM   734  C  CE1 . PHE A 1 118 ? 11.913  -6.097  -5.365  1.00 24.48 ? 270  PHE A CE1 1 
ATOM   735  C  CE2 . PHE A 1 118 ? 10.244  -5.915  -7.091  1.00 23.97 ? 270  PHE A CE2 1 
ATOM   736  C  CZ  . PHE A 1 118 ? 11.197  -5.323  -6.276  1.00 24.33 ? 270  PHE A CZ  1 
ATOM   737  N  N   . ILE A 1 119 ? 7.347   -9.806  -6.370  1.00 25.29 ? 271  ILE A N   1 
ATOM   738  C  CA  . ILE A 1 119 ? 6.033   -9.317  -6.755  1.00 25.74 ? 271  ILE A CA  1 
ATOM   739  C  C   . ILE A 1 119 ? 5.008   -9.447  -5.616  1.00 26.26 ? 271  ILE A C   1 
ATOM   740  O  O   . ILE A 1 119 ? 4.294   -8.488  -5.316  1.00 26.44 ? 271  ILE A O   1 
ATOM   741  C  CB  . ILE A 1 119 ? 5.544   -10.006 -8.039  1.00 25.74 ? 271  ILE A CB  1 
ATOM   742  C  CG1 . ILE A 1 119 ? 6.358   -9.500  -9.232  1.00 25.78 ? 271  ILE A CG1 1 
ATOM   743  C  CG2 . ILE A 1 119 ? 4.045   -9.764  -8.266  1.00 25.99 ? 271  ILE A CG2 1 
ATOM   744  C  CD1 . ILE A 1 119 ? 6.234   -10.355 -10.476 1.00 25.96 ? 271  ILE A CD1 1 
ATOM   745  N  N   . ARG A 1 120 ? 4.955   -10.613 -4.972  1.00 26.85 ? 272  ARG A N   1 
ATOM   746  C  CA  . ARG A 1 120 ? 4.023   -10.837 -3.861  1.00 27.44 ? 272  ARG A CA  1 
ATOM   747  C  C   . ARG A 1 120 ? 4.233   -9.860  -2.708  1.00 28.00 ? 272  ARG A C   1 
ATOM   748  O  O   . ARG A 1 120 ? 3.267   -9.442  -2.078  1.00 27.74 ? 272  ARG A O   1 
ATOM   749  C  CB  . ARG A 1 120 ? 4.082   -12.287 -3.365  1.00 27.26 ? 272  ARG A CB  1 
ATOM   750  C  CG  . ARG A 1 120 ? 3.208   -12.592 -2.141  1.00 26.85 ? 272  ARG A CG  1 
ATOM   751  C  CD  . ARG A 1 120 ? 1.745   -12.835 -2.493  1.00 26.43 ? 272  ARG A CD  1 
ATOM   752  N  NE  . ARG A 1 120 ? 0.942   -13.081 -1.293  1.00 26.47 ? 272  ARG A NE  1 
ATOM   753  C  CZ  . ARG A 1 120 ? -0.120  -12.367 -0.923  1.00 25.84 ? 272  ARG A CZ  1 
ATOM   754  N  NH1 . ARG A 1 120 ? -0.549  -11.358 -1.664  1.00 25.48 ? 272  ARG A NH1 1 
ATOM   755  N  NH2 . ARG A 1 120 ? -0.769  -12.673 0.190   1.00 25.71 ? 272  ARG A NH2 1 
ATOM   756  N  N   . LYS A 1 121 ? 5.485   -9.493  -2.443  1.00 29.22 ? 273  LYS A N   1 
ATOM   757  C  CA  . LYS A 1 121 ? 5.792   -8.477  -1.426  1.00 30.64 ? 273  LYS A CA  1 
ATOM   758  C  C   . LYS A 1 121 ? 5.339   -7.095  -1.873  1.00 31.29 ? 273  LYS A C   1 
ATOM   759  O  O   . LYS A 1 121 ? 4.862   -6.308  -1.057  1.00 31.64 ? 273  LYS A O   1 
ATOM   760  C  CB  . LYS A 1 121 ? 7.283   -8.429  -1.092  1.00 30.71 ? 273  LYS A CB  1 
ATOM   761  C  CG  . LYS A 1 121 ? 7.833   -9.699  -0.485  1.00 32.44 ? 273  LYS A CG  1 
ATOM   762  C  CD  . LYS A 1 121 ? 9.314   -9.559  -0.174  1.00 34.81 ? 273  LYS A CD  1 
ATOM   763  C  CE  . LYS A 1 121 ? 9.884   -10.865 0.364   1.00 35.96 ? 273  LYS A CE  1 
ATOM   764  N  NZ  . LYS A 1 121 ? 11.076  -10.614 1.229   1.00 37.12 ? 273  LYS A NZ  1 
ATOM   765  N  N   . SER A 1 122 ? 5.501   -6.805  -3.164  1.00 32.09 ? 274  SER A N   1 
ATOM   766  C  CA  . SER A 1 122 ? 5.037   -5.548  -3.748  1.00 32.77 ? 274  SER A CA  1 
ATOM   767  C  C   . SER A 1 122 ? 3.515   -5.450  -3.674  1.00 33.23 ? 274  SER A C   1 
ATOM   768  O  O   . SER A 1 122 ? 2.971   -4.376  -3.406  1.00 33.31 ? 274  SER A O   1 
ATOM   769  C  CB  . SER A 1 122 ? 5.504   -5.419  -5.198  1.00 32.79 ? 274  SER A CB  1 
ATOM   770  O  OG  . SER A 1 122 ? 6.916   -5.369  -5.274  1.00 33.01 ? 274  SER A OG  1 
ATOM   771  N  N   . GLN A 1 123 ? 2.842   -6.580  -3.902  1.00 33.66 ? 275  GLN A N   1 
ATOM   772  C  CA  . GLN A 1 123 ? 1.385   -6.670  -3.800  1.00 34.13 ? 275  GLN A CA  1 
ATOM   773  C  C   . GLN A 1 123 ? 0.884   -6.347  -2.388  1.00 34.87 ? 275  GLN A C   1 
ATOM   774  O  O   . GLN A 1 123 ? -0.221  -5.834  -2.223  1.00 35.05 ? 275  GLN A O   1 
ATOM   775  C  CB  . GLN A 1 123 ? 0.911   -8.066  -4.217  1.00 34.06 ? 275  GLN A CB  1 
ATOM   776  C  CG  . GLN A 1 123 ? -0.588  -8.174  -4.501  1.00 33.77 ? 275  GLN A CG  1 
ATOM   777  C  CD  . GLN A 1 123 ? -1.090  -9.609  -4.559  1.00 33.48 ? 275  GLN A CD  1 
ATOM   778  O  OE1 . GLN A 1 123 ? -0.396  -10.537 -4.161  1.00 33.53 ? 275  GLN A OE1 1 
ATOM   779  N  NE2 . GLN A 1 123 ? -2.307  -9.791  -5.051  1.00 32.33 ? 275  GLN A NE2 1 
ATOM   780  N  N   . LEU A 1 124 ? 1.703   -6.644  -1.382  1.00 35.59 ? 276  LEU A N   1 
ATOM   781  C  CA  . LEU A 1 124 ? 1.330   -6.448  0.016   1.00 36.39 ? 276  LEU A CA  1 
ATOM   782  C  C   . LEU A 1 124 ? 1.776   -5.099  0.585   1.00 37.15 ? 276  LEU A C   1 
ATOM   783  O  O   . LEU A 1 124 ? 1.069   -4.505  1.403   1.00 37.18 ? 276  LEU A O   1 
ATOM   784  C  CB  . LEU A 1 124 ? 1.890   -7.586  0.878   1.00 36.21 ? 276  LEU A CB  1 
ATOM   785  C  CG  . LEU A 1 124 ? 1.359   -9.005  0.637   1.00 36.24 ? 276  LEU A CG  1 
ATOM   786  C  CD1 . LEU A 1 124 ? 2.269   -10.052 1.278   1.00 35.40 ? 276  LEU A CD1 1 
ATOM   787  C  CD2 . LEU A 1 124 ? -0.089  -9.169  1.110   1.00 35.97 ? 276  LEU A CD2 1 
ATOM   788  N  N   . VAL A 1 125 ? 2.947   -4.626  0.159   1.00 38.13 ? 277  VAL A N   1 
ATOM   789  C  CA  . VAL A 1 125 ? 3.552   -3.408  0.718   1.00 39.04 ? 277  VAL A CA  1 
ATOM   790  C  C   . VAL A 1 125 ? 3.060   -2.138  0.021   1.00 39.44 ? 277  VAL A C   1 
ATOM   791  O  O   . VAL A 1 125 ? 2.626   -1.195  0.687   1.00 39.79 ? 277  VAL A O   1 
ATOM   792  C  CB  . VAL A 1 125 ? 5.113   -3.488  0.753   1.00 39.16 ? 277  VAL A CB  1 
ATOM   793  C  CG1 . VAL A 1 125 ? 5.745   -2.110  0.973   1.00 39.50 ? 277  VAL A CG1 1 
ATOM   794  C  CG2 . VAL A 1 125 ? 5.575   -4.466  1.838   1.00 39.16 ? 277  VAL A CG2 1 
ATOM   795  N  N   . GLN A 1 126 ? 3.126   -2.115  -1.307  1.00 39.98 ? 278  GLN A N   1 
ATOM   796  C  CA  . GLN A 1 126 ? 2.540   -1.024  -2.097  1.00 40.32 ? 278  GLN A CA  1 
ATOM   797  C  C   . GLN A 1 126 ? 1.461   -1.596  -3.042  1.00 40.48 ? 278  GLN A C   1 
ATOM   798  O  O   . GLN A 1 126 ? 1.731   -1.898  -4.215  1.00 40.46 ? 278  GLN A O   1 
ATOM   799  C  CB  . GLN A 1 126 ? 3.638   -0.213  -2.824  1.00 40.56 ? 278  GLN A CB  1 
ATOM   800  C  CG  . GLN A 1 126 ? 3.170   0.824   -3.880  1.00 40.40 ? 278  GLN A CG  1 
ATOM   801  C  CD  . GLN A 1 126 ? 3.230   0.287   -5.324  1.00 40.64 ? 278  GLN A CD  1 
ATOM   802  O  OE1 . GLN A 1 126 ? 3.872   -0.733  -5.601  1.00 39.95 ? 278  GLN A OE1 1 
ATOM   803  N  NE2 . GLN A 1 126 ? 2.555   0.978   -6.241  1.00 40.33 ? 278  GLN A NE2 1 
ATOM   804  N  N   . PRO A 1 127 ? 0.249   -1.826  -2.496  1.00 40.51 ? 279  PRO A N   1 
ATOM   805  C  CA  . PRO A 1 127 ? -0.939  -2.261  -3.226  1.00 40.36 ? 279  PRO A CA  1 
ATOM   806  C  C   . PRO A 1 127 ? -1.710  -1.139  -3.911  1.00 40.05 ? 279  PRO A C   1 
ATOM   807  O  O   . PRO A 1 127 ? -1.835  -0.030  -3.387  1.00 39.88 ? 279  PRO A O   1 
ATOM   808  C  CB  . PRO A 1 127 ? -1.811  -2.904  -2.131  1.00 40.47 ? 279  PRO A CB  1 
ATOM   809  C  CG  . PRO A 1 127 ? -0.920  -2.970  -0.897  1.00 40.75 ? 279  PRO A CG  1 
ATOM   810  C  CD  . PRO A 1 127 ? -0.024  -1.791  -1.056  1.00 40.55 ? 279  PRO A CD  1 
ATOM   811  N  N   . VAL A 1 128 ? -2.211  -1.470  -5.094  1.00 39.83 ? 280  VAL A N   1 
ATOM   812  C  CA  . VAL A 1 128 ? -3.046  -0.602  -5.901  1.00 39.53 ? 280  VAL A CA  1 
ATOM   813  C  C   . VAL A 1 128 ? -4.343  -1.389  -6.136  1.00 38.97 ? 280  VAL A C   1 
ATOM   814  O  O   . VAL A 1 128 ? -5.189  -1.485  -5.239  1.00 38.87 ? 280  VAL A O   1 
ATOM   815  C  CB  . VAL A 1 128 ? -2.362  -0.254  -7.273  1.00 39.81 ? 280  VAL A CB  1 
ATOM   816  C  CG1 . VAL A 1 128 ? -2.960  1.032   -7.877  1.00 39.98 ? 280  VAL A CG1 1 
ATOM   817  C  CG2 . VAL A 1 128 ? -0.831  -0.133  -7.136  1.00 39.56 ? 280  VAL A CG2 1 
ATOM   818  N  N   . GLY A 1 129 ? -4.465  -1.972  -7.331  1.00 38.18 ? 281  GLY A N   1 
ATOM   819  C  CA  . GLY A 1 129 ? -5.579  -2.840  -7.698  1.00 37.16 ? 281  GLY A CA  1 
ATOM   820  C  C   . GLY A 1 129 ? -5.090  -4.080  -8.437  1.00 36.42 ? 281  GLY A C   1 
ATOM   821  O  O   . GLY A 1 129 ? -4.148  -4.735  -7.983  1.00 36.45 ? 281  GLY A O   1 
ATOM   822  N  N   . PRO A 1 130 ? -5.711  -4.398  -9.593  1.00 35.64 ? 282  PRO A N   1 
ATOM   823  C  CA  . PRO A 1 130 ? -5.453  -5.656  -10.302 1.00 34.91 ? 282  PRO A CA  1 
ATOM   824  C  C   . PRO A 1 130 ? -4.037  -5.767  -10.876 1.00 34.18 ? 282  PRO A C   1 
ATOM   825  O  O   . PRO A 1 130 ? -3.505  -4.802  -11.430 1.00 34.06 ? 282  PRO A O   1 
ATOM   826  C  CB  . PRO A 1 130 ? -6.501  -5.647  -11.423 1.00 34.92 ? 282  PRO A CB  1 
ATOM   827  C  CG  . PRO A 1 130 ? -6.783  -4.209  -11.657 1.00 35.08 ? 282  PRO A CG  1 
ATOM   828  C  CD  . PRO A 1 130 ? -6.696  -3.563  -10.305 1.00 35.48 ? 282  PRO A CD  1 
ATOM   829  N  N   . LEU A 1 131 ? -3.446  -6.949  -10.732 1.00 33.28 ? 283  LEU A N   1 
ATOM   830  C  CA  . LEU A 1 131 ? -2.085  -7.209  -11.180 1.00 32.48 ? 283  LEU A CA  1 
ATOM   831  C  C   . LEU A 1 131 ? -2.039  -8.262  -12.273 1.00 31.53 ? 283  LEU A C   1 
ATOM   832  O  O   . LEU A 1 131 ? -2.633  -9.332  -12.139 1.00 31.60 ? 283  LEU A O   1 
ATOM   833  C  CB  . LEU A 1 131 ? -1.234  -7.703  -10.015 1.00 32.76 ? 283  LEU A CB  1 
ATOM   834  C  CG  . LEU A 1 131 ? -0.184  -6.807  -9.370  1.00 33.79 ? 283  LEU A CG  1 
ATOM   835  C  CD1 . LEU A 1 131 ? -0.794  -5.786  -8.405  1.00 34.59 ? 283  LEU A CD1 1 
ATOM   836  C  CD2 . LEU A 1 131 ? 0.790   -7.713  -8.635  1.00 34.95 ? 283  LEU A CD2 1 
ATOM   837  N  N   . VAL A 1 132 ? -1.319  -7.958  -13.346 1.00 30.23 ? 284  VAL A N   1 
ATOM   838  C  CA  . VAL A 1 132 ? -1.027  -8.934  -14.388 1.00 28.87 ? 284  VAL A CA  1 
ATOM   839  C  C   . VAL A 1 132 ? 0.476   -9.180  -14.372 1.00 28.10 ? 284  VAL A C   1 
ATOM   840  O  O   . VAL A 1 132 ? 1.267   -8.236  -14.335 1.00 28.15 ? 284  VAL A O   1 
ATOM   841  C  CB  . VAL A 1 132 ? -1.469  -8.442  -15.789 1.00 28.86 ? 284  VAL A CB  1 
ATOM   842  C  CG1 . VAL A 1 132 ? -1.123  -9.469  -16.847 1.00 28.59 ? 284  VAL A CG1 1 
ATOM   843  C  CG2 . VAL A 1 132 ? -2.965  -8.138  -15.812 1.00 28.39 ? 284  VAL A CG2 1 
ATOM   844  N  N   . VAL A 1 133 ? 0.866   -10.446 -14.375 1.00 26.92 ? 285  VAL A N   1 
ATOM   845  C  CA  . VAL A 1 133 ? 2.273   -10.808 -14.412 1.00 25.84 ? 285  VAL A CA  1 
ATOM   846  C  C   . VAL A 1 133 ? 2.534   -11.616 -15.675 1.00 25.21 ? 285  VAL A C   1 
ATOM   847  O  O   . VAL A 1 133 ? 1.962   -12.689 -15.855 1.00 25.32 ? 285  VAL A O   1 
ATOM   848  C  CB  . VAL A 1 133 ? 2.698   -11.590 -13.134 1.00 25.96 ? 285  VAL A CB  1 
ATOM   849  C  CG1 . VAL A 1 133 ? 4.125   -12.106 -13.254 1.00 25.35 ? 285  VAL A CG1 1 
ATOM   850  C  CG2 . VAL A 1 133 ? 2.561   -10.706 -11.899 1.00 25.48 ? 285  VAL A CG2 1 
ATOM   851  N  N   . LEU A 1 134 ? 3.384   -11.083 -16.549 1.00 24.34 ? 286  LEU A N   1 
ATOM   852  C  CA  . LEU A 1 134 ? 3.732   -11.732 -17.805 1.00 23.39 ? 286  LEU A CA  1 
ATOM   853  C  C   . LEU A 1 134 ? 5.029   -12.509 -17.665 1.00 23.10 ? 286  LEU A C   1 
ATOM   854  O  O   . LEU A 1 134 ? 6.040   -11.955 -17.243 1.00 23.21 ? 286  LEU A O   1 
ATOM   855  C  CB  . LEU A 1 134 ? 3.865   -10.689 -18.916 1.00 23.51 ? 286  LEU A CB  1 
ATOM   856  C  CG  . LEU A 1 134 ? 4.271   -11.177 -20.312 1.00 23.47 ? 286  LEU A CG  1 
ATOM   857  C  CD1 . LEU A 1 134 ? 3.232   -12.134 -20.880 1.00 23.00 ? 286  LEU A CD1 1 
ATOM   858  C  CD2 . LEU A 1 134 ? 4.484   -10.007 -21.249 1.00 23.15 ? 286  LEU A CD2 1 
ATOM   859  N  N   . LEU A 1 135 ? 4.988   -13.790 -18.020 1.00 22.74 ? 287  LEU A N   1 
ATOM   860  C  CA  . LEU A 1 135 ? 6.139   -14.693 -17.889 1.00 22.61 ? 287  LEU A CA  1 
ATOM   861  C  C   . LEU A 1 135 ? 6.498   -15.312 -19.245 1.00 22.35 ? 287  LEU A C   1 
ATOM   862  O  O   . LEU A 1 135 ? 6.030   -16.402 -19.591 1.00 22.54 ? 287  LEU A O   1 
ATOM   863  C  CB  . LEU A 1 135 ? 5.851   -15.787 -16.860 1.00 22.47 ? 287  LEU A CB  1 
ATOM   864  C  CG  . LEU A 1 135 ? 5.957   -15.363 -15.395 1.00 23.27 ? 287  LEU A CG  1 
ATOM   865  C  CD1 . LEU A 1 135 ? 4.862   -16.009 -14.581 1.00 23.83 ? 287  LEU A CD1 1 
ATOM   866  C  CD2 . LEU A 1 135 ? 7.342   -15.688 -14.809 1.00 23.91 ? 287  LEU A CD2 1 
ATOM   867  N  N   . PRO A 1 136 ? 7.335   -14.617 -20.023 1.00 21.82 ? 288  PRO A N   1 
ATOM   868  C  CA  . PRO A 1 136 ? 7.520   -15.037 -21.395 1.00 21.42 ? 288  PRO A CA  1 
ATOM   869  C  C   . PRO A 1 136 ? 8.724   -15.953 -21.489 1.00 21.02 ? 288  PRO A C   1 
ATOM   870  O  O   . PRO A 1 136 ? 9.648   -15.687 -22.262 1.00 21.13 ? 288  PRO A O   1 
ATOM   871  C  CB  . PRO A 1 136 ? 7.767   -13.710 -22.129 1.00 21.31 ? 288  PRO A CB  1 
ATOM   872  C  CG  . PRO A 1 136 ? 8.228   -12.723 -21.036 1.00 21.61 ? 288  PRO A CG  1 
ATOM   873  C  CD  . PRO A 1 136 ? 8.155   -13.434 -19.706 1.00 21.77 ? 288  PRO A CD  1 
ATOM   874  N  N   . LEU A 1 137 ? 8.697   -17.024 -20.694 1.00 20.30 ? 289  LEU A N   1 
ATOM   875  C  CA  . LEU A 1 137 ? 9.822   -17.940 -20.555 1.00 19.36 ? 289  LEU A CA  1 
ATOM   876  C  C   . LEU A 1 137 ? 9.359   -19.371 -20.298 1.00 19.80 ? 289  LEU A C   1 
ATOM   877  O  O   . LEU A 1 137 ? 8.193   -19.604 -19.942 1.00 19.73 ? 289  LEU A O   1 
ATOM   878  C  CB  . LEU A 1 137 ? 10.734  -17.472 -19.418 1.00 19.04 ? 289  LEU A CB  1 
ATOM   879  C  CG  . LEU A 1 137 ? 10.146  -17.169 -18.034 1.00 17.33 ? 289  LEU A CG  1 
ATOM   880  C  CD1 . LEU A 1 137 ? 9.908   -18.424 -17.216 1.00 14.63 ? 289  LEU A CD1 1 
ATOM   881  C  CD2 . LEU A 1 137 ? 11.076  -16.238 -17.287 1.00 16.09 ? 289  LEU A CD2 1 
ATOM   882  N  N   . ALA A 1 138 ? 10.274  -20.329 -20.453 1.00 19.84 ? 290  ALA A N   1 
ATOM   883  C  CA  . ALA A 1 138 ? 9.940   -21.731 -20.231 1.00 20.04 ? 290  ALA A CA  1 
ATOM   884  C  C   . ALA A 1 138 ? 11.138  -22.583 -19.825 1.00 20.31 ? 290  ALA A C   1 
ATOM   885  O  O   . ALA A 1 138 ? 12.256  -22.392 -20.327 1.00 20.54 ? 290  ALA A O   1 
ATOM   886  C  CB  . ALA A 1 138 ? 9.276   -22.321 -21.465 1.00 20.07 ? 290  ALA A CB  1 
ATOM   887  N  N   . GLY A 1 139 ? 10.889  -23.519 -18.910 1.00 19.94 ? 291  GLY A N   1 
ATOM   888  C  CA  . GLY A 1 139 ? 11.857  -24.552 -18.566 1.00 20.00 ? 291  GLY A CA  1 
ATOM   889  C  C   . GLY A 1 139 ? 11.120  -25.875 -18.588 1.00 20.03 ? 291  GLY A C   1 
ATOM   890  O  O   . GLY A 1 139 ? 9.952   -25.919 -18.978 1.00 20.17 ? 291  GLY A O   1 
ATOM   891  N  N   . GLY A 1 140 ? 11.786  -26.950 -18.173 1.00 19.94 ? 292  GLY A N   1 
ATOM   892  C  CA  . GLY A 1 140 ? 11.113  -28.232 -17.949 1.00 19.89 ? 292  GLY A CA  1 
ATOM   893  C  C   . GLY A 1 140 ? 10.068  -28.117 -16.850 1.00 19.99 ? 292  GLY A C   1 
ATOM   894  O  O   . GLY A 1 140 ? 10.094  -27.168 -16.068 1.00 19.73 ? 292  GLY A O   1 
ATOM   895  N  N   . TYR A 1 141 ? 9.135   -29.069 -16.797 1.00 20.30 ? 293  TYR A N   1 
ATOM   896  C  CA  . TYR A 1 141 ? 8.126   -29.093 -15.736 1.00 20.34 ? 293  TYR A CA  1 
ATOM   897  C  C   . TYR A 1 141 ? 8.807   -28.917 -14.384 1.00 20.28 ? 293  TYR A C   1 
ATOM   898  O  O   . TYR A 1 141 ? 9.739   -29.648 -14.046 1.00 20.00 ? 293  TYR A O   1 
ATOM   899  C  CB  . TYR A 1 141 ? 7.309   -30.401 -15.740 1.00 20.54 ? 293  TYR A CB  1 
ATOM   900  C  CG  . TYR A 1 141 ? 6.552   -30.633 -14.436 1.00 20.66 ? 293  TYR A CG  1 
ATOM   901  C  CD1 . TYR A 1 141 ? 5.261   -30.127 -14.253 1.00 20.85 ? 293  TYR A CD1 1 
ATOM   902  C  CD2 . TYR A 1 141 ? 7.141   -31.327 -13.376 1.00 19.99 ? 293  TYR A CD2 1 
ATOM   903  C  CE1 . TYR A 1 141 ? 4.569   -30.320 -13.054 1.00 20.39 ? 293  TYR A CE1 1 
ATOM   904  C  CE2 . TYR A 1 141 ? 6.463   -31.515 -12.177 1.00 20.23 ? 293  TYR A CE2 1 
ATOM   905  C  CZ  . TYR A 1 141 ? 5.177   -31.014 -12.024 1.00 20.69 ? 293  TYR A CZ  1 
ATOM   906  O  OH  . TYR A 1 141 ? 4.504   -31.211 -10.837 1.00 20.64 ? 293  TYR A OH  1 
ATOM   907  N  N   . SER A 1 142 ? 8.330   -27.941 -13.624 1.00 20.35 ? 294  SER A N   1 
ATOM   908  C  CA  . SER A 1 142 ? 8.867   -27.649 -12.312 1.00 20.31 ? 294  SER A CA  1 
ATOM   909  C  C   . SER A 1 142 ? 7.742   -27.612 -11.284 1.00 20.57 ? 294  SER A C   1 
ATOM   910  O  O   . SER A 1 142 ? 6.822   -26.800 -11.384 1.00 20.59 ? 294  SER A O   1 
ATOM   911  C  CB  . SER A 1 142 ? 9.605   -26.323 -12.343 1.00 19.92 ? 294  SER A CB  1 
ATOM   912  O  OG  . SER A 1 142 ? 9.982   -25.945 -11.037 1.00 20.57 ? 294  SER A OG  1 
ATOM   913  N  N   . ARG A 1 143 ? 7.810   -28.501 -10.299 1.00 20.96 ? 295  ARG A N   1 
ATOM   914  C  CA  . ARG A 1 143 ? 6.777   -28.565 -9.272  1.00 21.28 ? 295  ARG A CA  1 
ATOM   915  C  C   . ARG A 1 143 ? 6.693   -27.264 -8.485  1.00 21.65 ? 295  ARG A C   1 
ATOM   916  O  O   . ARG A 1 143 ? 5.594   -26.754 -8.255  1.00 21.89 ? 295  ARG A O   1 
ATOM   917  C  CB  . ARG A 1 143 ? 7.017   -29.731 -8.325  1.00 21.09 ? 295  ARG A CB  1 
ATOM   918  C  CG  . ARG A 1 143 ? 5.889   -29.943 -7.348  1.00 20.98 ? 295  ARG A CG  1 
ATOM   919  C  CD  . ARG A 1 143 ? 6.184   -31.107 -6.435  1.00 20.58 ? 295  ARG A CD  1 
ATOM   920  N  NE  . ARG A 1 143 ? 5.179   -31.207 -5.388  1.00 20.01 ? 295  ARG A NE  1 
ATOM   921  C  CZ  . ARG A 1 143 ? 5.113   -32.188 -4.496  1.00 19.86 ? 295  ARG A CZ  1 
ATOM   922  N  NH1 . ARG A 1 143 ? 5.999   -33.176 -4.505  1.00 19.75 ? 295  ARG A NH1 1 
ATOM   923  N  NH2 . ARG A 1 143 ? 4.151   -32.178 -3.588  1.00 20.21 ? 295  ARG A NH2 1 
ATOM   924  N  N   . VAL A 1 144 ? 7.857   -26.735 -8.094  1.00 21.83 ? 296  VAL A N   1 
ATOM   925  C  CA  . VAL A 1 144 ? 7.952   -25.521 -7.279  1.00 21.91 ? 296  VAL A CA  1 
ATOM   926  C  C   . VAL A 1 144 ? 7.489   -24.278 -8.032  1.00 21.84 ? 296  VAL A C   1 
ATOM   927  O  O   . VAL A 1 144 ? 6.802   -23.430 -7.469  1.00 21.70 ? 296  VAL A O   1 
ATOM   928  C  CB  . VAL A 1 144 ? 9.386   -25.314 -6.696  1.00 22.04 ? 296  VAL A CB  1 
ATOM   929  C  CG1 . VAL A 1 144 ? 10.402  -24.950 -7.783  1.00 22.11 ? 296  VAL A CG1 1 
ATOM   930  C  CG2 . VAL A 1 144 ? 9.376   -24.253 -5.608  1.00 22.41 ? 296  VAL A CG2 1 
ATOM   931  N  N   . LEU A 1 145 ? 7.862   -24.179 -9.304  1.00 22.07 ? 297  LEU A N   1 
ATOM   932  C  CA  . LEU A 1 145 ? 7.508   -23.016 -10.102 1.00 22.19 ? 297  LEU A CA  1 
ATOM   933  C  C   . LEU A 1 145 ? 6.004   -23.011 -10.299 1.00 22.47 ? 297  LEU A C   1 
ATOM   934  O  O   . LEU A 1 145 ? 5.353   -21.973 -10.135 1.00 22.67 ? 297  LEU A O   1 
ATOM   935  C  CB  . LEU A 1 145 ? 8.258   -23.012 -11.430 1.00 22.10 ? 297  LEU A CB  1 
ATOM   936  C  CG  . LEU A 1 145 ? 8.130   -21.790 -12.349 1.00 22.65 ? 297  LEU A CG  1 
ATOM   937  C  CD1 . LEU A 1 145 ? 8.370   -20.494 -11.591 1.00 22.81 ? 297  LEU A CD1 1 
ATOM   938  C  CD2 . LEU A 1 145 ? 9.085   -21.908 -13.540 1.00 21.90 ? 297  LEU A CD2 1 
ATOM   939  N  N   . ASN A 1 146 ? 5.452   -24.183 -10.609 1.00 22.64 ? 298  ASN A N   1 
ATOM   940  C  CA  . ASN A 1 146 ? 4.005   -24.348 -10.683 1.00 22.76 ? 298  ASN A CA  1 
ATOM   941  C  C   . ASN A 1 146 ? 3.319   -23.984 -9.366  1.00 23.25 ? 298  ASN A C   1 
ATOM   942  O  O   . ASN A 1 146 ? 2.319   -23.262 -9.366  1.00 23.31 ? 298  ASN A O   1 
ATOM   943  C  CB  . ASN A 1 146 ? 3.634   -25.755 -11.166 1.00 22.44 ? 298  ASN A CB  1 
ATOM   944  C  CG  . ASN A 1 146 ? 3.911   -25.953 -12.657 1.00 21.68 ? 298  ASN A CG  1 
ATOM   945  O  OD1 . ASN A 1 146 ? 4.693   -25.213 -13.254 1.00 20.05 ? 298  ASN A OD1 1 
ATOM   946  N  ND2 . ASN A 1 146 ? 3.263   -26.948 -13.262 1.00 20.45 ? 298  ASN A ND2 1 
ATOM   947  N  N   . ALA A 1 147 ? 3.886   -24.451 -8.253  1.00 23.79 ? 299  ALA A N   1 
ATOM   948  C  CA  . ALA A 1 147 ? 3.403   -24.109 -6.910  1.00 24.26 ? 299  ALA A CA  1 
ATOM   949  C  C   . ALA A 1 147 ? 3.393   -22.600 -6.681  1.00 24.78 ? 299  ALA A C   1 
ATOM   950  O  O   . ALA A 1 147 ? 2.392   -22.035 -6.232  1.00 24.74 ? 299  ALA A O   1 
ATOM   951  C  CB  . ALA A 1 147 ? 4.249   -24.799 -5.848  1.00 24.01 ? 299  ALA A CB  1 
ATOM   952  N  N   . ALA A 1 148 ? 4.508   -21.953 -7.011  1.00 25.54 ? 300  ALA A N   1 
ATOM   953  C  CA  . ALA A 1 148 ? 4.655   -20.516 -6.812  1.00 26.27 ? 300  ALA A CA  1 
ATOM   954  C  C   . ALA A 1 148 ? 3.620   -19.726 -7.605  1.00 26.83 ? 300  ALA A C   1 
ATOM   955  O  O   . ALA A 1 148 ? 3.031   -18.780 -7.086  1.00 27.12 ? 300  ALA A O   1 
ATOM   956  C  CB  . ALA A 1 148 ? 6.054   -20.071 -7.172  1.00 26.17 ? 300  ALA A CB  1 
ATOM   957  N  N   . CYS A 1 149 ? 3.404   -20.118 -8.858  1.00 27.36 ? 301  CYS A N   1 
ATOM   958  C  CA  . CYS A 1 149 ? 2.396   -19.487 -9.697  1.00 27.90 ? 301  CYS A CA  1 
ATOM   959  C  C   . CYS A 1 149 ? 1.000   -19.722 -9.129  1.00 28.36 ? 301  CYS A C   1 
ATOM   960  O  O   . CYS A 1 149 ? 0.176   -18.810 -9.098  1.00 28.31 ? 301  CYS A O   1 
ATOM   961  C  CB  . CYS A 1 149 ? 2.474   -20.029 -11.121 1.00 27.89 ? 301  CYS A CB  1 
ATOM   962  S  SG  . CYS A 1 149 ? 3.960   -19.553 -12.019 1.00 27.94 ? 301  CYS A SG  1 
ATOM   963  N  N   . GLN A 1 150 ? 0.749   -20.946 -8.673  1.00 29.05 ? 302  GLN A N   1 
ATOM   964  C  CA  . GLN A 1 150 ? -0.550  -21.319 -8.124  1.00 29.88 ? 302  GLN A CA  1 
ATOM   965  C  C   . GLN A 1 150 ? -0.916  -20.473 -6.912  1.00 30.20 ? 302  GLN A C   1 
ATOM   966  O  O   . GLN A 1 150 ? -2.020  -19.928 -6.839  1.00 30.23 ? 302  GLN A O   1 
ATOM   967  C  CB  . GLN A 1 150 ? -0.570  -22.801 -7.759  1.00 29.95 ? 302  GLN A CB  1 
ATOM   968  C  CG  . GLN A 1 150 ? -1.846  -23.260 -7.096  1.00 30.96 ? 302  GLN A CG  1 
ATOM   969  C  CD  . GLN A 1 150 ? -1.761  -24.690 -6.626  1.00 32.83 ? 302  GLN A CD  1 
ATOM   970  O  OE1 . GLN A 1 150 ? -0.950  -25.024 -5.756  1.00 34.22 ? 302  GLN A OE1 1 
ATOM   971  N  NE2 . GLN A 1 150 ? -2.600  -25.552 -7.195  1.00 32.65 ? 302  GLN A NE2 1 
ATOM   972  N  N   . ARG A 1 151 ? 0.015   -20.366 -5.968  1.00 30.80 ? 303  ARG A N   1 
ATOM   973  C  CA  . ARG A 1 151 ? -0.196  -19.570 -4.760  1.00 31.55 ? 303  ARG A CA  1 
ATOM   974  C  C   . ARG A 1 151 ? -0.394  -18.094 -5.115  1.00 31.36 ? 303  ARG A C   1 
ATOM   975  O  O   . ARG A 1 151 ? -1.192  -17.401 -4.492  1.00 31.45 ? 303  ARG A O   1 
ATOM   976  C  CB  . ARG A 1 151 ? 0.957   -19.780 -3.756  1.00 31.80 ? 303  ARG A CB  1 
ATOM   977  C  CG  . ARG A 1 151 ? 0.922   -18.894 -2.501  1.00 33.68 ? 303  ARG A CG  1 
ATOM   978  C  CD  . ARG A 1 151 ? -0.173  -19.282 -1.490  1.00 36.72 ? 303  ARG A CD  1 
ATOM   979  N  NE  . ARG A 1 151 ? -0.695  -18.108 -0.770  1.00 38.53 ? 303  ARG A NE  1 
ATOM   980  C  CZ  . ARG A 1 151 ? -1.799  -17.435 -1.112  1.00 39.08 ? 303  ARG A CZ  1 
ATOM   981  N  NH1 . ARG A 1 151 ? -2.525  -17.810 -2.161  1.00 39.34 ? 303  ARG A NH1 1 
ATOM   982  N  NH2 . ARG A 1 151 ? -2.189  -16.384 -0.400  1.00 39.12 ? 303  ARG A NH2 1 
ATOM   983  N  N   . LEU A 1 152 ? 0.311   -17.635 -6.142  1.00 31.38 ? 304  LEU A N   1 
ATOM   984  C  CA  . LEU A 1 152 ? 0.205   -16.255 -6.585  1.00 31.57 ? 304  LEU A CA  1 
ATOM   985  C  C   . LEU A 1 152 ? -1.129  -15.971 -7.287  1.00 31.89 ? 304  LEU A C   1 
ATOM   986  O  O   . LEU A 1 152 ? -1.648  -14.861 -7.209  1.00 32.18 ? 304  LEU A O   1 
ATOM   987  C  CB  . LEU A 1 152 ? 1.395   -15.899 -7.473  1.00 31.40 ? 304  LEU A CB  1 
ATOM   988  C  CG  . LEU A 1 152 ? 1.804   -14.434 -7.623  1.00 31.15 ? 304  LEU A CG  1 
ATOM   989  C  CD1 . LEU A 1 152 ? 1.827   -13.705 -6.304  1.00 30.86 ? 304  LEU A CD1 1 
ATOM   990  C  CD2 . LEU A 1 152 ? 3.167   -14.371 -8.276  1.00 31.42 ? 304  LEU A CD2 1 
ATOM   991  N  N   . ALA A 1 153 ? -1.691  -16.981 -7.947  1.00 32.14 ? 305  ALA A N   1 
ATOM   992  C  CA  . ALA A 1 153 ? -3.003  -16.863 -8.587  1.00 32.23 ? 305  ALA A CA  1 
ATOM   993  C  C   . ALA A 1 153 ? -4.151  -16.786 -7.576  1.00 32.50 ? 305  ALA A C   1 
ATOM   994  O  O   . ALA A 1 153 ? -5.082  -15.997 -7.753  1.00 32.68 ? 305  ALA A O   1 
ATOM   995  C  CB  . ALA A 1 153 ? -3.225  -18.011 -9.553  1.00 32.34 ? 305  ALA A CB  1 
ATOM   996  N  N   . ARG A 1 154 ? -4.085  -17.602 -6.524  1.00 32.69 ? 306  ARG A N   1 
ATOM   997  C  CA  . ARG A 1 154 ? -5.107  -17.594 -5.471  1.00 32.97 ? 306  ARG A CA  1 
ATOM   998  C  C   . ARG A 1 154 ? -5.149  -16.257 -4.747  1.00 32.47 ? 306  ARG A C   1 
ATOM   999  O  O   . ARG A 1 154 ? -6.164  -15.897 -4.159  1.00 32.52 ? 306  ARG A O   1 
ATOM   1000 C  CB  . ARG A 1 154 ? -4.879  -18.712 -4.448  1.00 33.42 ? 306  ARG A CB  1 
ATOM   1001 C  CG  . ARG A 1 154 ? -5.125  -20.122 -4.975  1.00 35.52 ? 306  ARG A CG  1 
ATOM   1002 C  CD  . ARG A 1 154 ? -5.421  -21.104 -3.829  1.00 38.93 ? 306  ARG A CD  1 
ATOM   1003 N  NE  . ARG A 1 154 ? -4.943  -22.462 -4.115  1.00 41.17 ? 306  ARG A NE  1 
ATOM   1004 C  CZ  . ARG A 1 154 ? -5.510  -23.315 -4.971  1.00 42.19 ? 306  ARG A CZ  1 
ATOM   1005 N  NH1 . ARG A 1 154 ? -6.597  -22.977 -5.662  1.00 42.58 ? 306  ARG A NH1 1 
ATOM   1006 N  NH2 . ARG A 1 154 ? -4.980  -24.517 -5.140  1.00 42.69 ? 306  ARG A NH2 1 
ATOM   1007 N  N   . ALA A 1 155 ? -4.038  -15.531 -4.793  1.00 32.00 ? 307  ALA A N   1 
ATOM   1008 C  CA  . ALA A 1 155 ? -3.964  -14.197 -4.220  1.00 31.48 ? 307  ALA A CA  1 
ATOM   1009 C  C   . ALA A 1 155 ? -4.592  -13.163 -5.152  1.00 31.16 ? 307  ALA A C   1 
ATOM   1010 O  O   . ALA A 1 155 ? -4.632  -11.980 -4.824  1.00 31.46 ? 307  ALA A O   1 
ATOM   1011 C  CB  . ALA A 1 155 ? -2.516  -13.836 -3.903  1.00 31.51 ? 307  ALA A CB  1 
ATOM   1012 N  N   . GLY A 1 156 ? -5.075  -13.610 -6.310  1.00 30.62 ? 308  GLY A N   1 
ATOM   1013 C  CA  . GLY A 1 156 ? -5.786  -12.745 -7.251  1.00 29.89 ? 308  GLY A CA  1 
ATOM   1014 C  C   . GLY A 1 156 ? -4.982  -12.297 -8.457  1.00 29.44 ? 308  GLY A C   1 
ATOM   1015 O  O   . GLY A 1 156 ? -5.521  -11.685 -9.377  1.00 29.57 ? 308  GLY A O   1 
ATOM   1016 N  N   . VAL A 1 157 ? -3.690  -12.601 -8.454  1.00 29.07 ? 309  VAL A N   1 
ATOM   1017 C  CA  . VAL A 1 157 ? -2.787  -12.201 -9.531  1.00 28.41 ? 309  VAL A CA  1 
ATOM   1018 C  C   . VAL A 1 157 ? -3.086  -12.964 -10.823 1.00 28.06 ? 309  VAL A C   1 
ATOM   1019 O  O   . VAL A 1 157 ? -3.239  -14.184 -10.816 1.00 28.07 ? 309  VAL A O   1 
ATOM   1020 C  CB  . VAL A 1 157 ? -1.312  -12.408 -9.124  1.00 28.25 ? 309  VAL A CB  1 
ATOM   1021 C  CG1 . VAL A 1 157 ? -0.376  -12.045 -10.262 1.00 28.29 ? 309  VAL A CG1 1 
ATOM   1022 C  CG2 . VAL A 1 157 ? -0.984  -11.594 -7.885  1.00 28.03 ? 309  VAL A CG2 1 
ATOM   1023 N  N   . VAL A 1 158 ? -3.177  -12.228 -11.924 1.00 27.57 ? 310  VAL A N   1 
ATOM   1024 C  CA  . VAL A 1 158 ? -3.372  -12.824 -13.238 1.00 27.30 ? 310  VAL A CA  1 
ATOM   1025 C  C   . VAL A 1 158 ? -2.013  -13.109 -13.874 1.00 27.26 ? 310  VAL A C   1 
ATOM   1026 O  O   . VAL A 1 158 ? -1.255  -12.187 -14.183 1.00 27.19 ? 310  VAL A O   1 
ATOM   1027 C  CB  . VAL A 1 158 ? -4.196  -11.906 -14.165 1.00 27.19 ? 310  VAL A CB  1 
ATOM   1028 C  CG1 . VAL A 1 158 ? -4.309  -12.515 -15.545 1.00 26.91 ? 310  VAL A CG1 1 
ATOM   1029 C  CG2 . VAL A 1 158 ? -5.569  -11.652 -13.578 1.00 26.92 ? 310  VAL A CG2 1 
ATOM   1030 N  N   . LEU A 1 159 ? -1.715  -14.389 -14.068 1.00 27.12 ? 311  LEU A N   1 
ATOM   1031 C  CA  . LEU A 1 159 ? -0.447  -14.798 -14.661 1.00 26.93 ? 311  LEU A CA  1 
ATOM   1032 C  C   . LEU A 1 159 ? -0.600  -15.260 -16.112 1.00 26.90 ? 311  LEU A C   1 
ATOM   1033 O  O   . LEU A 1 159 ? -1.388  -16.159 -16.416 1.00 26.90 ? 311  LEU A O   1 
ATOM   1034 C  CB  . LEU A 1 159 ? 0.218   -15.889 -13.823 1.00 26.98 ? 311  LEU A CB  1 
ATOM   1035 C  CG  . LEU A 1 159 ? 0.857   -15.452 -12.507 1.00 26.88 ? 311  LEU A CG  1 
ATOM   1036 C  CD1 . LEU A 1 159 ? -0.116  -15.610 -11.365 1.00 27.38 ? 311  LEU A CD1 1 
ATOM   1037 C  CD2 . LEU A 1 159 ? 2.095   -16.278 -12.242 1.00 27.08 ? 311  LEU A CD2 1 
ATOM   1038 N  N   . VAL A 1 160 ? 0.164   -14.635 -17.001 1.00 26.59 ? 312  VAL A N   1 
ATOM   1039 C  CA  . VAL A 1 160 ? 0.140   -14.971 -18.414 1.00 26.31 ? 312  VAL A CA  1 
ATOM   1040 C  C   . VAL A 1 160 ? 1.523   -15.497 -18.808 1.00 26.24 ? 312  VAL A C   1 
ATOM   1041 O  O   . VAL A 1 160 ? 2.537   -14.820 -18.583 1.00 26.24 ? 312  VAL A O   1 
ATOM   1042 C  CB  . VAL A 1 160 ? -0.262  -13.749 -19.280 1.00 26.11 ? 312  VAL A CB  1 
ATOM   1043 C  CG1 . VAL A 1 160 ? -0.253  -14.109 -20.750 1.00 26.79 ? 312  VAL A CG1 1 
ATOM   1044 C  CG2 . VAL A 1 160 ? -1.638  -13.245 -18.895 1.00 25.95 ? 312  VAL A CG2 1 
ATOM   1045 N  N   . THR A 1 161 ? 1.562   -16.702 -19.383 1.00 25.77 ? 313  THR A N   1 
ATOM   1046 C  CA  . THR A 1 161 ? 2.836   -17.332 -19.741 1.00 25.34 ? 313  THR A CA  1 
ATOM   1047 C  C   . THR A 1 161 ? 2.906   -17.803 -21.189 1.00 24.75 ? 313  THR A C   1 
ATOM   1048 O  O   . THR A 1 161 ? 1.886   -17.924 -21.870 1.00 24.70 ? 313  THR A O   1 
ATOM   1049 C  CB  . THR A 1 161 ? 3.184   -18.518 -18.795 1.00 25.63 ? 313  THR A CB  1 
ATOM   1050 O  OG1 . THR A 1 161 ? 4.546   -18.913 -19.003 1.00 26.14 ? 313  THR A OG1 1 
ATOM   1051 C  CG2 . THR A 1 161 ? 2.286   -19.730 -19.061 1.00 25.88 ? 313  THR A CG2 1 
ATOM   1052 N  N   . ALA A 1 162 ? 4.129   -18.064 -21.645 1.00 24.12 ? 314  ALA A N   1 
ATOM   1053 C  CA  . ALA A 1 162 ? 4.374   -18.647 -22.956 1.00 23.44 ? 314  ALA A CA  1 
ATOM   1054 C  C   . ALA A 1 162 ? 4.239   -20.166 -22.890 1.00 23.11 ? 314  ALA A C   1 
ATOM   1055 O  O   . ALA A 1 162 ? 4.653   -20.784 -21.909 1.00 23.22 ? 314  ALA A O   1 
ATOM   1056 C  CB  . ALA A 1 162 ? 5.744   -18.262 -23.443 1.00 23.39 ? 314  ALA A CB  1 
ATOM   1057 N  N   . ALA A 1 163 ? 3.650   -20.762 -23.928 1.00 22.65 ? 315  ALA A N   1 
ATOM   1058 C  CA  . ALA A 1 163 ? 3.474   -22.214 -24.001 1.00 22.17 ? 315  ALA A CA  1 
ATOM   1059 C  C   . ALA A 1 163 ? 4.796   -22.946 -24.269 1.00 22.30 ? 315  ALA A C   1 
ATOM   1060 O  O   . ALA A 1 163 ? 4.970   -24.113 -23.885 1.00 22.32 ? 315  ALA A O   1 
ATOM   1061 C  CB  . ALA A 1 163 ? 2.451   -22.567 -25.056 1.00 21.86 ? 315  ALA A CB  1 
ATOM   1062 N  N   . GLY A 1 164 ? 5.723   -22.249 -24.921 1.00 22.22 ? 316  GLY A N   1 
ATOM   1063 C  CA  . GLY A 1 164 ? 7.013   -22.810 -25.277 1.00 22.28 ? 316  GLY A CA  1 
ATOM   1064 C  C   . GLY A 1 164 ? 7.111   -23.048 -26.772 1.00 22.40 ? 316  GLY A C   1 
ATOM   1065 O  O   . GLY A 1 164 ? 6.106   -23.348 -27.430 1.00 22.38 ? 316  GLY A O   1 
ATOM   1066 N  N   . ASN A 1 165 ? 8.328   -22.930 -27.300 1.00 22.14 ? 317  ASN A N   1 
ATOM   1067 C  CA  . ASN A 1 165 ? 8.577   -23.041 -28.734 1.00 21.95 ? 317  ASN A CA  1 
ATOM   1068 C  C   . ASN A 1 165 ? 9.171   -24.385 -29.180 1.00 22.31 ? 317  ASN A C   1 
ATOM   1069 O  O   . ASN A 1 165 ? 10.056  -24.419 -30.042 1.00 22.39 ? 317  ASN A O   1 
ATOM   1070 C  CB  . ASN A 1 165 ? 9.490   -21.898 -29.161 1.00 21.83 ? 317  ASN A CB  1 
ATOM   1071 C  CG  . ASN A 1 165 ? 8.918   -20.544 -28.827 1.00 21.42 ? 317  ASN A CG  1 
ATOM   1072 O  OD1 . ASN A 1 165 ? 7.705   -20.360 -28.801 1.00 21.78 ? 317  ASN A OD1 1 
ATOM   1073 N  ND2 . ASN A 1 165 ? 9.789   -19.584 -28.572 1.00 21.57 ? 317  ASN A ND2 1 
ATOM   1074 N  N   . PHE A 1 166 ? 8.660   -25.487 -28.623 1.00 22.34 ? 318  PHE A N   1 
ATOM   1075 C  CA  . PHE A 1 166 ? 9.270   -26.803 -28.815 1.00 22.35 ? 318  PHE A CA  1 
ATOM   1076 C  C   . PHE A 1 166 ? 8.400   -27.804 -29.589 1.00 22.70 ? 318  PHE A C   1 
ATOM   1077 O  O   . PHE A 1 166 ? 8.717   -29.005 -29.644 1.00 22.80 ? 318  PHE A O   1 
ATOM   1078 C  CB  . PHE A 1 166 ? 9.667   -27.388 -27.453 1.00 22.13 ? 318  PHE A CB  1 
ATOM   1079 C  CG  . PHE A 1 166 ? 10.587  -26.504 -26.662 1.00 22.22 ? 318  PHE A CG  1 
ATOM   1080 C  CD1 . PHE A 1 166 ? 11.957  -26.493 -26.919 1.00 21.74 ? 318  PHE A CD1 1 
ATOM   1081 C  CD2 . PHE A 1 166 ? 10.085  -25.669 -25.666 1.00 22.13 ? 318  PHE A CD2 1 
ATOM   1082 C  CE1 . PHE A 1 166 ? 12.810  -25.667 -26.192 1.00 21.91 ? 318  PHE A CE1 1 
ATOM   1083 C  CE2 . PHE A 1 166 ? 10.938  -24.840 -24.927 1.00 21.78 ? 318  PHE A CE2 1 
ATOM   1084 C  CZ  . PHE A 1 166 ? 12.297  -24.837 -25.193 1.00 21.70 ? 318  PHE A CZ  1 
ATOM   1085 N  N   . ARG A 1 167 ? 7.318   -27.313 -30.193 1.00 22.75 ? 319  ARG A N   1 
ATOM   1086 C  CA  . ARG A 1 167 ? 6.310   -28.169 -30.845 1.00 22.85 ? 319  ARG A CA  1 
ATOM   1087 C  C   . ARG A 1 167 ? 6.081   -29.441 -30.035 1.00 22.64 ? 319  ARG A C   1 
ATOM   1088 O  O   . ARG A 1 167 ? 6.074   -30.554 -30.568 1.00 22.93 ? 319  ARG A O   1 
ATOM   1089 C  CB  . ARG A 1 167 ? 6.684   -28.483 -32.299 1.00 22.64 ? 319  ARG A CB  1 
ATOM   1090 C  CG  . ARG A 1 167 ? 5.513   -28.988 -33.129 1.00 23.09 ? 319  ARG A CG  1 
ATOM   1091 C  CD  . ARG A 1 167 ? 5.860   -29.141 -34.597 1.00 23.45 ? 319  ARG A CD  1 
ATOM   1092 N  NE  . ARG A 1 167 ? 4.691   -29.554 -35.379 1.00 25.48 ? 319  ARG A NE  1 
ATOM   1093 C  CZ  . ARG A 1 167 ? 4.506   -29.279 -36.673 1.00 26.89 ? 319  ARG A CZ  1 
ATOM   1094 N  NH1 . ARG A 1 167 ? 5.403   -28.558 -37.344 1.00 27.57 ? 319  ARG A NH1 1 
ATOM   1095 N  NH2 . ARG A 1 167 ? 3.407   -29.697 -37.295 1.00 26.92 ? 319  ARG A NH2 1 
ATOM   1096 N  N   . ASP A 1 168 ? 5.892   -29.253 -28.735 1.00 22.43 ? 320  ASP A N   1 
ATOM   1097 C  CA  . ASP A 1 168 ? 5.773   -30.352 -27.799 1.00 22.50 ? 320  ASP A CA  1 
ATOM   1098 C  C   . ASP A 1 168 ? 4.523   -30.137 -26.950 1.00 22.37 ? 320  ASP A C   1 
ATOM   1099 O  O   . ASP A 1 168 ? 3.798   -29.149 -27.133 1.00 22.33 ? 320  ASP A O   1 
ATOM   1100 C  CB  . ASP A 1 168 ? 7.030   -30.406 -26.923 1.00 22.80 ? 320  ASP A CB  1 
ATOM   1101 C  CG  . ASP A 1 168 ? 7.260   -31.767 -26.292 1.00 22.94 ? 320  ASP A CG  1 
ATOM   1102 O  OD1 . ASP A 1 168 ? 6.449   -32.687 -26.519 1.00 23.46 ? 320  ASP A OD1 1 
ATOM   1103 O  OD2 . ASP A 1 168 ? 8.261   -31.913 -25.560 1.00 23.61 ? 320  ASP A OD2 1 
ATOM   1104 N  N   . ASP A 1 169 ? 4.262   -31.074 -26.044 1.00 21.96 ? 321  ASP A N   1 
ATOM   1105 C  CA  . ASP A 1 169 ? 3.162   -30.955 -25.109 1.00 21.95 ? 321  ASP A CA  1 
ATOM   1106 C  C   . ASP A 1 169 ? 3.512   -29.910 -24.053 1.00 21.97 ? 321  ASP A C   1 
ATOM   1107 O  O   . ASP A 1 169 ? 4.513   -30.048 -23.350 1.00 22.03 ? 321  ASP A O   1 
ATOM   1108 C  CB  . ASP A 1 169 ? 2.886   -32.308 -24.456 1.00 21.90 ? 321  ASP A CB  1 
ATOM   1109 C  CG  . ASP A 1 169 ? 1.693   -32.281 -23.516 1.00 22.36 ? 321  ASP A CG  1 
ATOM   1110 O  OD1 . ASP A 1 169 ? 1.179   -31.181 -23.193 1.00 22.96 ? 321  ASP A OD1 1 
ATOM   1111 O  OD2 . ASP A 1 169 ? 1.266   -33.378 -23.095 1.00 22.83 ? 321  ASP A OD2 1 
ATOM   1112 N  N   . ALA A 1 170 ? 2.683   -28.873 -23.935 1.00 21.94 ? 322  ALA A N   1 
ATOM   1113 C  CA  . ALA A 1 170 ? 2.947   -27.799 -22.978 1.00 22.19 ? 322  ALA A CA  1 
ATOM   1114 C  C   . ALA A 1 170 ? 3.020   -28.285 -21.529 1.00 22.21 ? 322  ALA A C   1 
ATOM   1115 O  O   . ALA A 1 170 ? 3.633   -27.636 -20.683 1.00 22.18 ? 322  ALA A O   1 
ATOM   1116 C  CB  . ALA A 1 170 ? 1.921   -26.678 -23.118 1.00 22.30 ? 322  ALA A CB  1 
ATOM   1117 N  N   . CYS A 1 171 ? 2.411   -29.434 -21.258 1.00 22.26 ? 323  CYS A N   1 
ATOM   1118 C  CA  . CYS A 1 171 ? 2.381   -29.997 -19.916 1.00 22.58 ? 323  CYS A CA  1 
ATOM   1119 C  C   . CYS A 1 171 ? 3.744   -30.470 -19.420 1.00 22.05 ? 323  CYS A C   1 
ATOM   1120 O  O   . CYS A 1 171 ? 3.912   -30.722 -18.226 1.00 22.13 ? 323  CYS A O   1 
ATOM   1121 C  CB  . CYS A 1 171 ? 1.364   -31.139 -19.837 1.00 22.81 ? 323  CYS A CB  1 
ATOM   1122 S  SG  . CYS A 1 171 ? -0.323  -30.602 -20.182 1.00 25.82 ? 323  CYS A SG  1 
ATOM   1123 N  N   . LEU A 1 172 ? 4.709   -30.585 -20.327 1.00 21.45 ? 324  LEU A N   1 
ATOM   1124 C  CA  . LEU A 1 172 ? 6.061   -30.988 -19.955 1.00 21.14 ? 324  LEU A CA  1 
ATOM   1125 C  C   . LEU A 1 172 ? 6.965   -29.791 -19.652 1.00 20.93 ? 324  LEU A C   1 
ATOM   1126 O  O   . LEU A 1 172 ? 8.167   -29.961 -19.465 1.00 21.27 ? 324  LEU A O   1 
ATOM   1127 C  CB  . LEU A 1 172 ? 6.689   -31.870 -21.043 1.00 21.19 ? 324  LEU A CB  1 
ATOM   1128 C  CG  . LEU A 1 172 ? 5.941   -33.135 -21.501 1.00 20.97 ? 324  LEU A CG  1 
ATOM   1129 C  CD1 . LEU A 1 172 ? 6.566   -33.702 -22.769 1.00 20.50 ? 324  LEU A CD1 1 
ATOM   1130 C  CD2 . LEU A 1 172 ? 5.888   -34.188 -20.407 1.00 20.30 ? 324  LEU A CD2 1 
ATOM   1131 N  N   . TYR A 1 173 ? 6.383   -28.591 -19.598 1.00 20.37 ? 325  TYR A N   1 
ATOM   1132 C  CA  . TYR A 1 173 ? 7.141   -27.350 -19.397 1.00 19.95 ? 325  TYR A CA  1 
ATOM   1133 C  C   . TYR A 1 173 ? 6.513   -26.476 -18.307 1.00 19.93 ? 325  TYR A C   1 
ATOM   1134 O  O   . TYR A 1 173 ? 5.325   -26.588 -18.015 1.00 19.87 ? 325  TYR A O   1 
ATOM   1135 C  CB  . TYR A 1 173 ? 7.256   -26.567 -20.718 1.00 19.75 ? 325  TYR A CB  1 
ATOM   1136 C  CG  . TYR A 1 173 ? 7.881   -27.377 -21.831 1.00 19.74 ? 325  TYR A CG  1 
ATOM   1137 C  CD1 . TYR A 1 173 ? 9.245   -27.281 -22.111 1.00 19.76 ? 325  TYR A CD1 1 
ATOM   1138 C  CD2 . TYR A 1 173 ? 7.114   -28.261 -22.593 1.00 18.90 ? 325  TYR A CD2 1 
ATOM   1139 C  CE1 . TYR A 1 173 ? 9.831   -28.049 -23.121 1.00 19.20 ? 325  TYR A CE1 1 
ATOM   1140 C  CE2 . TYR A 1 173 ? 7.693   -29.031 -23.601 1.00 19.50 ? 325  TYR A CE2 1 
ATOM   1141 C  CZ  . TYR A 1 173 ? 9.049   -28.918 -23.863 1.00 19.13 ? 325  TYR A CZ  1 
ATOM   1142 O  OH  . TYR A 1 173 ? 9.617   -29.679 -24.863 1.00 19.33 ? 325  TYR A OH  1 
ATOM   1143 N  N   . SER A 1 174 ? 7.318   -25.614 -17.697 1.00 19.92 ? 326  SER A N   1 
ATOM   1144 C  CA  . SER A 1 174 ? 6.823   -24.694 -16.676 1.00 20.12 ? 326  SER A CA  1 
ATOM   1145 C  C   . SER A 1 174 ? 7.352   -23.303 -16.972 1.00 20.36 ? 326  SER A C   1 
ATOM   1146 O  O   . SER A 1 174 ? 8.445   -23.173 -17.533 1.00 20.69 ? 326  SER A O   1 
ATOM   1147 C  CB  . SER A 1 174 ? 7.235   -25.134 -15.266 1.00 20.09 ? 326  SER A CB  1 
ATOM   1148 O  OG  . SER A 1 174 ? 6.462   -26.237 -14.820 1.00 19.97 ? 326  SER A OG  1 
ATOM   1149 N  N   . PRO A 1 175 ? 6.582   -22.257 -16.606 1.00 20.57 ? 327  PRO A N   1 
ATOM   1150 C  CA  . PRO A 1 175 ? 5.252   -22.336 -15.975 1.00 20.85 ? 327  PRO A CA  1 
ATOM   1151 C  C   . PRO A 1 175 ? 4.061   -22.762 -16.861 1.00 21.23 ? 327  PRO A C   1 
ATOM   1152 O  O   . PRO A 1 175 ? 2.942   -22.841 -16.362 1.00 21.29 ? 327  PRO A O   1 
ATOM   1153 C  CB  . PRO A 1 175 ? 5.043   -20.924 -15.415 1.00 20.51 ? 327  PRO A CB  1 
ATOM   1154 C  CG  . PRO A 1 175 ? 5.928   -20.060 -16.193 1.00 20.08 ? 327  PRO A CG  1 
ATOM   1155 C  CD  . PRO A 1 175 ? 7.042   -20.866 -16.754 1.00 20.21 ? 327  PRO A CD  1 
ATOM   1156 N  N   . ALA A 1 176 ? 4.294   -23.073 -18.134 1.00 22.00 ? 328  ALA A N   1 
ATOM   1157 C  CA  . ALA A 1 176 ? 3.204   -23.471 -19.045 1.00 22.77 ? 328  ALA A CA  1 
ATOM   1158 C  C   . ALA A 1 176 ? 2.204   -24.457 -18.424 1.00 23.45 ? 328  ALA A C   1 
ATOM   1159 O  O   . ALA A 1 176 ? 0.987   -24.224 -18.470 1.00 23.54 ? 328  ALA A O   1 
ATOM   1160 C  CB  . ALA A 1 176 ? 3.761   -24.021 -20.350 1.00 22.62 ? 328  ALA A CB  1 
ATOM   1161 N  N   . SER A 1 177 ? 2.721   -25.523 -17.808 1.00 24.00 ? 329  SER A N   1 
ATOM   1162 C  CA  . SER A 1 177 ? 1.885   -26.610 -17.283 1.00 24.69 ? 329  SER A CA  1 
ATOM   1163 C  C   . SER A 1 177 ? 1.101   -26.285 -16.006 1.00 25.30 ? 329  SER A C   1 
ATOM   1164 O  O   . SER A 1 177 ? 0.242   -27.072 -15.597 1.00 25.33 ? 329  SER A O   1 
ATOM   1165 C  CB  . SER A 1 177 ? 2.724   -27.866 -17.051 1.00 24.66 ? 329  SER A CB  1 
ATOM   1166 O  OG  . SER A 1 177 ? 3.725   -27.636 -16.069 1.00 25.13 ? 329  SER A OG  1 
ATOM   1167 N  N   . ALA A 1 178 ? 1.404   -25.150 -15.370 1.00 26.07 ? 330  ALA A N   1 
ATOM   1168 C  CA  . ALA A 1 178 ? 0.648   -24.702 -14.193 1.00 26.75 ? 330  ALA A CA  1 
ATOM   1169 C  C   . ALA A 1 178 ? -0.788  -24.381 -14.614 1.00 27.42 ? 330  ALA A C   1 
ATOM   1170 O  O   . ALA A 1 178 ? -0.996  -23.588 -15.541 1.00 27.71 ? 330  ALA A O   1 
ATOM   1171 C  CB  . ALA A 1 178 ? 1.308   -23.494 -13.540 1.00 26.29 ? 330  ALA A CB  1 
ATOM   1172 N  N   . PRO A 1 179 ? -1.781  -25.012 -13.956 1.00 28.05 ? 331  PRO A N   1 
ATOM   1173 C  CA  . PRO A 1 179 ? -3.164  -24.871 -14.425 1.00 28.45 ? 331  PRO A CA  1 
ATOM   1174 C  C   . PRO A 1 179 ? -3.784  -23.512 -14.090 1.00 28.80 ? 331  PRO A C   1 
ATOM   1175 O  O   . PRO A 1 179 ? -4.697  -23.073 -14.792 1.00 29.04 ? 331  PRO A O   1 
ATOM   1176 C  CB  . PRO A 1 179 ? -3.919  -26.001 -13.696 1.00 28.41 ? 331  PRO A CB  1 
ATOM   1177 C  CG  . PRO A 1 179 ? -2.885  -26.770 -12.913 1.00 28.26 ? 331  PRO A CG  1 
ATOM   1178 C  CD  . PRO A 1 179 ? -1.695  -25.870 -12.760 1.00 28.17 ? 331  PRO A CD  1 
ATOM   1179 N  N   . GLU A 1 180 ? -3.290  -22.852 -13.041 1.00 28.89 ? 332  GLU A N   1 
ATOM   1180 C  CA  . GLU A 1 180 ? -3.855  -21.573 -12.609 1.00 29.28 ? 332  GLU A CA  1 
ATOM   1181 C  C   . GLU A 1 180 ? -3.236  -20.406 -13.365 1.00 29.18 ? 332  GLU A C   1 
ATOM   1182 O  O   . GLU A 1 180 ? -3.478  -19.240 -13.040 1.00 29.66 ? 332  GLU A O   1 
ATOM   1183 C  CB  . GLU A 1 180 ? -3.690  -21.375 -11.101 1.00 29.44 ? 332  GLU A CB  1 
ATOM   1184 C  CG  . GLU A 1 180 ? -4.262  -22.505 -10.249 1.00 31.04 ? 332  GLU A CG  1 
ATOM   1185 C  CD  . GLU A 1 180 ? -3.349  -23.731 -10.191 1.00 33.26 ? 332  GLU A CD  1 
ATOM   1186 O  OE1 . GLU A 1 180 ? -2.251  -23.716 -10.807 1.00 33.67 ? 332  GLU A OE1 1 
ATOM   1187 O  OE2 . GLU A 1 180 ? -3.735  -24.711 -9.516  1.00 34.28 ? 332  GLU A OE2 1 
ATOM   1188 N  N   . VAL A 1 181 ? -2.437  -20.735 -14.373 1.00 28.76 ? 333  VAL A N   1 
ATOM   1189 C  CA  . VAL A 1 181 ? -1.777  -19.751 -15.220 1.00 28.21 ? 333  VAL A CA  1 
ATOM   1190 C  C   . VAL A 1 181 ? -2.378  -19.799 -16.624 1.00 27.71 ? 333  VAL A C   1 
ATOM   1191 O  O   . VAL A 1 181 ? -2.588  -20.884 -17.183 1.00 27.77 ? 333  VAL A O   1 
ATOM   1192 C  CB  . VAL A 1 181 ? -0.267  -20.035 -15.289 1.00 28.07 ? 333  VAL A CB  1 
ATOM   1193 C  CG1 . VAL A 1 181 ? 0.417   -19.097 -16.250 1.00 28.13 ? 333  VAL A CG1 1 
ATOM   1194 C  CG2 . VAL A 1 181 ? 0.341   -19.902 -13.916 1.00 28.56 ? 333  VAL A CG2 1 
ATOM   1195 N  N   . ILE A 1 182 ? -2.662  -18.619 -17.175 1.00 26.93 ? 334  ILE A N   1 
ATOM   1196 C  CA  . ILE A 1 182 ? -3.109  -18.486 -18.558 1.00 26.37 ? 334  ILE A CA  1 
ATOM   1197 C  C   . ILE A 1 182 ? -1.928  -18.754 -19.481 1.00 26.12 ? 334  ILE A C   1 
ATOM   1198 O  O   . ILE A 1 182 ? -0.996  -17.952 -19.571 1.00 26.08 ? 334  ILE A O   1 
ATOM   1199 C  CB  . ILE A 1 182 ? -3.722  -17.094 -18.833 1.00 26.40 ? 334  ILE A CB  1 
ATOM   1200 C  CG1 . ILE A 1 182 ? -4.926  -16.862 -17.914 1.00 26.38 ? 334  ILE A CG1 1 
ATOM   1201 C  CG2 . ILE A 1 182 ? -4.119  -16.950 -20.307 1.00 25.92 ? 334  ILE A CG2 1 
ATOM   1202 C  CD1 . ILE A 1 182 ? -5.297  -15.408 -17.737 1.00 27.45 ? 334  ILE A CD1 1 
ATOM   1203 N  N   . THR A 1 183 ? -1.981  -19.905 -20.144 1.00 25.81 ? 335  THR A N   1 
ATOM   1204 C  CA  . THR A 1 183 ? -0.900  -20.401 -20.984 1.00 25.46 ? 335  THR A CA  1 
ATOM   1205 C  C   . THR A 1 183 ? -1.244  -20.181 -22.453 1.00 25.36 ? 335  THR A C   1 
ATOM   1206 O  O   . THR A 1 183 ? -2.235  -20.724 -22.958 1.00 25.48 ? 335  THR A O   1 
ATOM   1207 C  CB  . THR A 1 183 ? -0.656  -21.894 -20.699 1.00 25.42 ? 335  THR A CB  1 
ATOM   1208 O  OG1 . THR A 1 183 ? -0.285  -22.050 -19.324 1.00 25.70 ? 335  THR A OG1 1 
ATOM   1209 C  CG2 . THR A 1 183 ? 0.439   -22.460 -21.588 1.00 25.21 ? 335  THR A CG2 1 
ATOM   1210 N  N   . VAL A 1 184 ? -0.414  -19.392 -23.132 1.00 25.04 ? 336  VAL A N   1 
ATOM   1211 C  CA  . VAL A 1 184 ? -0.714  -18.912 -24.484 1.00 24.84 ? 336  VAL A CA  1 
ATOM   1212 C  C   . VAL A 1 184 ? 0.211   -19.512 -25.545 1.00 24.67 ? 336  VAL A C   1 
ATOM   1213 O  O   . VAL A 1 184 ? 1.435   -19.463 -25.414 1.00 24.67 ? 336  VAL A O   1 
ATOM   1214 C  CB  . VAL A 1 184 ? -0.640  -17.359 -24.541 1.00 25.06 ? 336  VAL A CB  1 
ATOM   1215 C  CG1 . VAL A 1 184 ? -1.129  -16.830 -25.889 1.00 24.77 ? 336  VAL A CG1 1 
ATOM   1216 C  CG2 . VAL A 1 184 ? -1.441  -16.749 -23.395 1.00 24.78 ? 336  VAL A CG2 1 
ATOM   1217 N  N   . GLY A 1 185 ? -0.386  -20.081 -26.589 1.00 24.59 ? 337  GLY A N   1 
ATOM   1218 C  CA  . GLY A 1 185 ? 0.354   -20.607 -27.742 1.00 24.17 ? 337  GLY A CA  1 
ATOM   1219 C  C   . GLY A 1 185 ? 0.326   -19.585 -28.863 1.00 23.98 ? 337  GLY A C   1 
ATOM   1220 O  O   . GLY A 1 185 ? -0.409  -18.599 -28.781 1.00 24.07 ? 337  GLY A O   1 
ATOM   1221 N  N   . ALA A 1 186 ? 1.108   -19.809 -29.917 1.00 23.67 ? 338  ALA A N   1 
ATOM   1222 C  CA  . ALA A 1 186 ? 1.260   -18.790 -30.954 1.00 23.34 ? 338  ALA A CA  1 
ATOM   1223 C  C   . ALA A 1 186 ? 0.761   -19.207 -32.328 1.00 23.38 ? 338  ALA A C   1 
ATOM   1224 O  O   . ALA A 1 186 ? 1.055   -20.303 -32.809 1.00 23.70 ? 338  ALA A O   1 
ATOM   1225 C  CB  . ALA A 1 186 ? 2.699   -18.327 -31.037 1.00 23.29 ? 338  ALA A CB  1 
ATOM   1226 N  N   . THR A 1 187 ? 0.007   -18.312 -32.956 1.00 23.28 ? 339  THR A N   1 
ATOM   1227 C  CA  . THR A 1 187 ? -0.454  -18.493 -34.327 1.00 22.95 ? 339  THR A CA  1 
ATOM   1228 C  C   . THR A 1 187 ? 0.150   -17.435 -35.250 1.00 23.04 ? 339  THR A C   1 
ATOM   1229 O  O   . THR A 1 187 ? 0.682   -16.416 -34.783 1.00 22.95 ? 339  THR A O   1 
ATOM   1230 C  CB  . THR A 1 187 ? -1.978  -18.437 -34.413 1.00 22.83 ? 339  THR A CB  1 
ATOM   1231 O  OG1 . THR A 1 187 ? -2.452  -17.266 -33.733 1.00 23.34 ? 339  THR A OG1 1 
ATOM   1232 C  CG2 . THR A 1 187 ? -2.580  -19.665 -33.776 1.00 22.61 ? 339  THR A CG2 1 
ATOM   1233 N  N   . ASN A 1 188 ? 0.078   -17.686 -36.556 1.00 22.94 ? 340  ASN A N   1 
ATOM   1234 C  CA  . ASN A 1 188 ? 0.606   -16.763 -37.558 1.00 23.00 ? 340  ASN A CA  1 
ATOM   1235 C  C   . ASN A 1 188 ? -0.494  -15.946 -38.231 1.00 23.00 ? 340  ASN A C   1 
ATOM   1236 O  O   . ASN A 1 188 ? -1.642  -15.963 -37.788 1.00 23.20 ? 340  ASN A O   1 
ATOM   1237 C  CB  . ASN A 1 188 ? 1.426   -17.527 -38.605 1.00 23.09 ? 340  ASN A CB  1 
ATOM   1238 C  CG  . ASN A 1 188 ? 0.650   -18.672 -39.230 1.00 22.91 ? 340  ASN A CG  1 
ATOM   1239 O  OD1 . ASN A 1 188 ? -0.543  -18.549 -39.496 1.00 23.44 ? 340  ASN A OD1 1 
ATOM   1240 N  ND2 . ASN A 1 188 ? 1.327   -19.793 -39.469 1.00 21.44 ? 340  ASN A ND2 1 
ATOM   1241 N  N   . ALA A 1 189 ? -0.137  -15.239 -39.302 1.00 22.96 ? 341  ALA A N   1 
ATOM   1242 C  CA  . ALA A 1 189 ? -1.098  -14.437 -40.070 1.00 22.90 ? 341  ALA A CA  1 
ATOM   1243 C  C   . ALA A 1 189 ? -2.191  -15.262 -40.773 1.00 22.84 ? 341  ALA A C   1 
ATOM   1244 O  O   . ALA A 1 189 ? -3.188  -14.710 -41.241 1.00 22.64 ? 341  ALA A O   1 
ATOM   1245 C  CB  . ALA A 1 189 ? -0.363  -13.540 -41.069 1.00 22.72 ? 341  ALA A CB  1 
ATOM   1246 N  N   . GLN A 1 190 ? -2.002  -16.576 -40.841 1.00 23.03 ? 342  GLN A N   1 
ATOM   1247 C  CA  . GLN A 1 190 ? -2.994  -17.471 -41.442 1.00 23.57 ? 342  GLN A CA  1 
ATOM   1248 C  C   . GLN A 1 190 ? -3.852  -18.128 -40.354 1.00 23.32 ? 342  GLN A C   1 
ATOM   1249 O  O   . GLN A 1 190 ? -4.692  -18.976 -40.654 1.00 23.28 ? 342  GLN A O   1 
ATOM   1250 C  CB  . GLN A 1 190 ? -2.317  -18.545 -42.322 1.00 23.88 ? 342  GLN A CB  1 
ATOM   1251 C  CG  . GLN A 1 190 ? -1.554  -18.024 -43.562 1.00 25.98 ? 342  GLN A CG  1 
ATOM   1252 C  CD  . GLN A 1 190 ? -0.217  -17.347 -43.203 1.00 29.59 ? 342  GLN A CD  1 
ATOM   1253 O  OE1 . GLN A 1 190 ? 0.657   -17.960 -42.581 1.00 30.95 ? 342  GLN A OE1 1 
ATOM   1254 N  NE2 . GLN A 1 190 ? -0.063  -16.075 -43.588 1.00 30.42 ? 342  GLN A NE2 1 
ATOM   1255 N  N   . ASP A 1 191 ? -3.638  -17.719 -39.099 1.00 23.23 ? 343  ASP A N   1 
ATOM   1256 C  CA  . ASP A 1 191 ? -4.292  -18.313 -37.915 1.00 23.26 ? 343  ASP A CA  1 
ATOM   1257 C  C   . ASP A 1 191 ? -3.860  -19.758 -37.653 1.00 23.59 ? 343  ASP A C   1 
ATOM   1258 O  O   . ASP A 1 191 ? -4.576  -20.526 -37.004 1.00 23.72 ? 343  ASP A O   1 
ATOM   1259 C  CB  . ASP A 1 191 ? -5.824  -18.224 -38.002 1.00 22.95 ? 343  ASP A CB  1 
ATOM   1260 C  CG  . ASP A 1 191 ? -6.346  -16.814 -37.805 1.00 22.19 ? 343  ASP A CG  1 
ATOM   1261 O  OD1 . ASP A 1 191 ? -5.868  -16.113 -36.892 1.00 21.78 ? 343  ASP A OD1 1 
ATOM   1262 O  OD2 . ASP A 1 191 ? -7.251  -16.413 -38.561 1.00 20.95 ? 343  ASP A OD2 1 
ATOM   1263 N  N   . GLN A 1 192 ? -2.688  -20.123 -38.157 1.00 23.85 ? 344  GLN A N   1 
ATOM   1264 C  CA  . GLN A 1 192 ? -2.165  -21.468 -37.981 1.00 24.21 ? 344  GLN A CA  1 
ATOM   1265 C  C   . GLN A 1 192 ? -1.048  -21.466 -36.935 1.00 24.76 ? 344  GLN A C   1 
ATOM   1266 O  O   . GLN A 1 192 ? -0.447  -20.417 -36.676 1.00 24.77 ? 344  GLN A O   1 
ATOM   1267 C  CB  . GLN A 1 192 ? -1.689  -22.040 -39.325 1.00 24.12 ? 344  GLN A CB  1 
ATOM   1268 C  CG  . GLN A 1 192 ? -2.797  -22.158 -40.379 1.00 23.76 ? 344  GLN A CG  1 
ATOM   1269 C  CD  . GLN A 1 192 ? -4.117  -22.684 -39.809 1.00 24.47 ? 344  GLN A CD  1 
ATOM   1270 O  OE1 . GLN A 1 192 ? -4.205  -23.829 -39.354 1.00 24.15 ? 344  GLN A OE1 1 
ATOM   1271 N  NE2 . GLN A 1 192 ? -5.148  -21.840 -39.828 1.00 24.44 ? 344  GLN A NE2 1 
ATOM   1272 N  N   . PRO A 1 193 ? -0.781  -22.631 -36.308 1.00 25.17 ? 345  PRO A N   1 
ATOM   1273 C  CA  . PRO A 1 193 ? 0.274   -22.689 -35.298 1.00 25.50 ? 345  PRO A CA  1 
ATOM   1274 C  C   . PRO A 1 193 ? 1.626   -22.321 -35.903 1.00 26.05 ? 345  PRO A C   1 
ATOM   1275 O  O   . PRO A 1 193 ? 1.942   -22.761 -37.013 1.00 26.38 ? 345  PRO A O   1 
ATOM   1276 C  CB  . PRO A 1 193 ? 0.259   -24.159 -34.875 1.00 25.29 ? 345  PRO A CB  1 
ATOM   1277 C  CG  . PRO A 1 193 ? -1.109  -24.641 -35.223 1.00 24.88 ? 345  PRO A CG  1 
ATOM   1278 C  CD  . PRO A 1 193 ? -1.435  -23.942 -36.485 1.00 24.93 ? 345  PRO A CD  1 
ATOM   1279 N  N   . VAL A 1 194 ? 2.408   -21.517 -35.189 1.00 26.62 ? 346  VAL A N   1 
ATOM   1280 C  CA  . VAL A 1 194 ? 3.691   -21.052 -35.707 1.00 27.43 ? 346  VAL A CA  1 
ATOM   1281 C  C   . VAL A 1 194 ? 4.690   -22.194 -35.858 1.00 28.16 ? 346  VAL A C   1 
ATOM   1282 O  O   . VAL A 1 194 ? 4.891   -22.963 -34.927 1.00 28.40 ? 346  VAL A O   1 
ATOM   1283 C  CB  . VAL A 1 194 ? 4.292   -19.928 -34.833 1.00 27.37 ? 346  VAL A CB  1 
ATOM   1284 C  CG1 . VAL A 1 194 ? 5.685   -19.546 -35.322 1.00 27.11 ? 346  VAL A CG1 1 
ATOM   1285 C  CG2 . VAL A 1 194 ? 3.386   -18.703 -34.850 1.00 27.08 ? 346  VAL A CG2 1 
ATOM   1286 N  N   . THR A 1 195 ? 5.287   -22.302 -37.043 1.00 29.09 ? 347  THR A N   1 
ATOM   1287 C  CA  . THR A 1 195 ? 6.362   -23.260 -37.311 1.00 30.21 ? 347  THR A CA  1 
ATOM   1288 C  C   . THR A 1 195 ? 7.719   -22.534 -37.319 1.00 31.12 ? 347  THR A C   1 
ATOM   1289 O  O   . THR A 1 195 ? 8.053   -21.837 -38.281 1.00 31.50 ? 347  THR A O   1 
ATOM   1290 C  CB  . THR A 1 195 ? 6.122   -23.993 -38.653 1.00 30.08 ? 347  THR A CB  1 
ATOM   1291 O  OG1 . THR A 1 195 ? 4.877   -24.692 -38.593 1.00 29.74 ? 347  THR A OG1 1 
ATOM   1292 C  CG2 . THR A 1 195 ? 7.226   -24.994 -38.946 1.00 30.58 ? 347  THR A CG2 1 
ATOM   1293 N  N   . LEU A 1 196 ? 8.493   -22.697 -36.246 1.00 32.03 ? 348  LEU A N   1 
ATOM   1294 C  CA  . LEU A 1 196 ? 9.725   -21.906 -36.044 1.00 32.89 ? 348  LEU A CA  1 
ATOM   1295 C  C   . LEU A 1 196 ? 10.982  -22.525 -36.673 1.00 33.35 ? 348  LEU A C   1 
ATOM   1296 O  O   . LEU A 1 196 ? 12.023  -21.861 -36.771 1.00 33.67 ? 348  LEU A O   1 
ATOM   1297 C  CB  . LEU A 1 196 ? 9.947   -21.579 -34.550 1.00 32.92 ? 348  LEU A CB  1 
ATOM   1298 C  CG  . LEU A 1 196 ? 8.922   -20.623 -33.910 1.00 33.02 ? 348  LEU A CG  1 
ATOM   1299 C  CD1 . LEU A 1 196 ? 8.734   -20.886 -32.423 1.00 32.14 ? 348  LEU A CD1 1 
ATOM   1300 C  CD2 . LEU A 1 196 ? 9.253   -19.146 -34.179 1.00 32.58 ? 348  LEU A CD2 1 
ATOM   1301 N  N   . GLY A 1 197 ? 10.863  -23.782 -37.106 1.00 33.39 ? 349  GLY A N   1 
ATOM   1302 C  CA  . GLY A 1 197 ? 11.917  -24.484 -37.836 1.00 33.31 ? 349  GLY A CA  1 
ATOM   1303 C  C   . GLY A 1 197 ? 11.520  -25.942 -37.953 1.00 33.36 ? 349  GLY A C   1 
ATOM   1304 O  O   . GLY A 1 197 ? 10.669  -26.308 -38.771 1.00 33.32 ? 349  GLY A O   1 
ATOM   1305 N  N   . THR A 1 198 ? 12.142  -26.776 -37.126 1.00 33.28 ? 350  THR A N   1 
ATOM   1306 C  CA  . THR A 1 198 ? 11.661  -28.133 -36.880 1.00 33.13 ? 350  THR A CA  1 
ATOM   1307 C  C   . THR A 1 198 ? 10.779  -28.106 -35.632 1.00 32.75 ? 350  THR A C   1 
ATOM   1308 O  O   . THR A 1 198 ? 10.191  -29.121 -35.239 1.00 33.04 ? 350  THR A O   1 
ATOM   1309 C  CB  . THR A 1 198 ? 12.820  -29.124 -36.676 1.00 33.29 ? 350  THR A CB  1 
ATOM   1310 O  OG1 . THR A 1 198 ? 13.916  -28.453 -36.034 1.00 33.73 ? 350  THR A OG1 1 
ATOM   1311 C  CG2 . THR A 1 198 ? 13.283  -29.689 -38.019 1.00 33.72 ? 350  THR A CG2 1 
ATOM   1312 N  N   . LEU A 1 199 ? 10.692  -26.925 -35.023 1.00 31.73 ? 351  LEU A N   1 
ATOM   1313 C  CA  . LEU A 1 199 ? 9.911   -26.715 -33.821 1.00 30.92 ? 351  LEU A CA  1 
ATOM   1314 C  C   . LEU A 1 199 ? 8.804   -25.677 -34.090 1.00 30.55 ? 351  LEU A C   1 
ATOM   1315 O  O   . LEU A 1 199 ? 8.430   -25.443 -35.243 1.00 30.79 ? 351  LEU A O   1 
ATOM   1316 C  CB  . LEU A 1 199 ? 10.837  -26.273 -32.682 1.00 30.85 ? 351  LEU A CB  1 
ATOM   1317 C  CG  . LEU A 1 199 ? 12.160  -27.036 -32.495 1.00 30.97 ? 351  LEU A CG  1 
ATOM   1318 C  CD1 . LEU A 1 199 ? 13.160  -26.203 -31.688 1.00 30.94 ? 351  LEU A CD1 1 
ATOM   1319 C  CD2 . LEU A 1 199 ? 11.971  -28.433 -31.873 1.00 30.17 ? 351  LEU A CD2 1 
ATOM   1320 N  N   . GLY A 1 200 ? 8.286   -25.052 -33.038 1.00 29.57 ? 352  GLY A N   1 
ATOM   1321 C  CA  . GLY A 1 200 ? 7.167   -24.138 -33.173 1.00 28.38 ? 352  GLY A CA  1 
ATOM   1322 C  C   . GLY A 1 200 ? 6.323   -24.208 -31.925 1.00 27.74 ? 352  GLY A C   1 
ATOM   1323 O  O   . GLY A 1 200 ? 6.751   -24.793 -30.936 1.00 27.72 ? 352  GLY A O   1 
ATOM   1324 N  N   . THR A 1 201 ? 5.123   -23.630 -31.965 1.00 26.94 ? 353  THR A N   1 
ATOM   1325 C  CA  . THR A 1 201 ? 4.297   -23.532 -30.763 1.00 26.22 ? 353  THR A CA  1 
ATOM   1326 C  C   . THR A 1 201 ? 3.988   -24.874 -30.107 1.00 26.08 ? 353  THR A C   1 
ATOM   1327 O  O   . THR A 1 201 ? 3.803   -25.890 -30.787 1.00 25.82 ? 353  THR A O   1 
ATOM   1328 C  CB  . THR A 1 201 ? 2.983   -22.756 -31.002 1.00 26.26 ? 353  THR A CB  1 
ATOM   1329 O  OG1 . THR A 1 201 ? 2.362   -22.476 -29.739 1.00 26.79 ? 353  THR A OG1 1 
ATOM   1330 C  CG2 . THR A 1 201 ? 2.022   -23.539 -31.873 1.00 25.16 ? 353  THR A CG2 1 
ATOM   1331 N  N   . ASN A 1 202 ? 3.963   -24.868 -28.777 1.00 25.66 ? 354  ASN A N   1 
ATOM   1332 C  CA  . ASN A 1 202 ? 3.519   -26.013 -28.017 1.00 25.35 ? 354  ASN A CA  1 
ATOM   1333 C  C   . ASN A 1 202 ? 2.004   -26.124 -28.087 1.00 25.31 ? 354  ASN A C   1 
ATOM   1334 O  O   . ASN A 1 202 ? 1.319   -25.188 -28.520 1.00 25.32 ? 354  ASN A O   1 
ATOM   1335 C  CB  . ASN A 1 202 ? 3.985   -25.905 -26.572 1.00 25.58 ? 354  ASN A CB  1 
ATOM   1336 C  CG  . ASN A 1 202 ? 5.428   -26.342 -26.386 1.00 26.14 ? 354  ASN A CG  1 
ATOM   1337 O  OD1 . ASN A 1 202 ? 6.094   -26.761 -27.334 1.00 27.39 ? 354  ASN A OD1 1 
ATOM   1338 N  ND2 . ASN A 1 202 ? 5.917   -26.246 -25.156 1.00 25.57 ? 354  ASN A ND2 1 
ATOM   1339 N  N   . PHE A 1 203 ? 1.489   -27.274 -27.661 1.00 25.02 ? 355  PHE A N   1 
ATOM   1340 C  CA  . PHE A 1 203 ? 0.068   -27.586 -27.755 1.00 24.84 ? 355  PHE A CA  1 
ATOM   1341 C  C   . PHE A 1 203 ? -0.357  -28.363 -26.516 1.00 25.13 ? 355  PHE A C   1 
ATOM   1342 O  O   . PHE A 1 203 ? 0.430   -28.513 -25.575 1.00 25.49 ? 355  PHE A O   1 
ATOM   1343 C  CB  . PHE A 1 203 ? -0.196  -28.412 -29.019 1.00 24.33 ? 355  PHE A CB  1 
ATOM   1344 C  CG  . PHE A 1 203 ? 0.881   -29.422 -29.313 1.00 23.30 ? 355  PHE A CG  1 
ATOM   1345 C  CD1 . PHE A 1 203 ? 1.845   -29.162 -30.278 1.00 22.37 ? 355  PHE A CD1 1 
ATOM   1346 C  CD2 . PHE A 1 203 ? 0.952   -30.616 -28.602 1.00 22.04 ? 355  PHE A CD2 1 
ATOM   1347 C  CE1 . PHE A 1 203 ? 2.853   -30.078 -30.539 1.00 21.68 ? 355  PHE A CE1 1 
ATOM   1348 C  CE2 . PHE A 1 203 ? 1.956   -31.536 -28.856 1.00 21.30 ? 355  PHE A CE2 1 
ATOM   1349 C  CZ  . PHE A 1 203 ? 2.907   -31.267 -29.825 1.00 22.22 ? 355  PHE A CZ  1 
ATOM   1350 N  N   . GLY A 1 204 ? -1.596  -28.849 -26.513 1.00 25.37 ? 356  GLY A N   1 
ATOM   1351 C  CA  . GLY A 1 204 ? -2.061  -29.767 -25.476 1.00 25.80 ? 356  GLY A CA  1 
ATOM   1352 C  C   . GLY A 1 204 ? -3.040  -29.162 -24.495 1.00 26.26 ? 356  GLY A C   1 
ATOM   1353 O  O   . GLY A 1 204 ? -3.357  -27.971 -24.569 1.00 26.43 ? 356  GLY A O   1 
ATOM   1354 N  N   . ARG A 1 205 ? -3.504  -29.991 -23.561 1.00 26.51 ? 357  ARG A N   1 
ATOM   1355 C  CA  . ARG A 1 205 ? -4.506  -29.597 -22.562 1.00 26.64 ? 357  ARG A CA  1 
ATOM   1356 C  C   . ARG A 1 205 ? -4.041  -28.468 -21.645 1.00 26.31 ? 357  ARG A C   1 
ATOM   1357 O  O   . ARG A 1 205 ? -4.864  -27.773 -21.052 1.00 26.39 ? 357  ARG A O   1 
ATOM   1358 C  CB  . ARG A 1 205 ? -4.940  -30.807 -21.729 1.00 26.76 ? 357  ARG A CB  1 
ATOM   1359 C  CG  . ARG A 1 205 ? -3.793  -31.593 -21.100 1.00 27.27 ? 357  ARG A CG  1 
ATOM   1360 C  CD  . ARG A 1 205 ? -4.306  -32.717 -20.216 1.00 27.62 ? 357  ARG A CD  1 
ATOM   1361 N  NE  . ARG A 1 205 ? -3.224  -33.333 -19.448 1.00 30.98 ? 357  ARG A NE  1 
ATOM   1362 C  CZ  . ARG A 1 205 ? -2.820  -32.936 -18.236 1.00 32.50 ? 357  ARG A CZ  1 
ATOM   1363 N  NH1 . ARG A 1 205 ? -3.398  -31.903 -17.620 1.00 32.47 ? 357  ARG A NH1 1 
ATOM   1364 N  NH2 . ARG A 1 205 ? -1.823  -33.574 -17.632 1.00 32.73 ? 357  ARG A NH2 1 
ATOM   1365 N  N   . CYS A 1 206 ? -2.725  -28.290 -21.537 1.00 26.01 ? 358  CYS A N   1 
ATOM   1366 C  CA  . CYS A 1 206 ? -2.147  -27.227 -20.712 1.00 25.45 ? 358  CYS A CA  1 
ATOM   1367 C  C   . CYS A 1 206 ? -2.215  -25.855 -21.378 1.00 25.16 ? 358  CYS A C   1 
ATOM   1368 O  O   . CYS A 1 206 ? -2.033  -24.833 -20.720 1.00 25.15 ? 358  CYS A O   1 
ATOM   1369 C  CB  . CYS A 1 206 ? -0.702  -27.563 -20.334 1.00 25.54 ? 358  CYS A CB  1 
ATOM   1370 S  SG  . CYS A 1 206 ? -0.559  -28.879 -19.087 1.00 24.70 ? 358  CYS A SG  1 
ATOM   1371 N  N   . VAL A 1 207 ? -2.469  -25.830 -22.681 1.00 24.78 ? 359  VAL A N   1 
ATOM   1372 C  CA  . VAL A 1 207 ? -2.628  -24.567 -23.392 1.00 24.65 ? 359  VAL A CA  1 
ATOM   1373 C  C   . VAL A 1 207 ? -4.064  -24.064 -23.214 1.00 24.66 ? 359  VAL A C   1 
ATOM   1374 O  O   . VAL A 1 207 ? -5.013  -24.836 -23.326 1.00 24.88 ? 359  VAL A O   1 
ATOM   1375 C  CB  . VAL A 1 207 ? -2.254  -24.697 -24.891 1.00 24.57 ? 359  VAL A CB  1 
ATOM   1376 C  CG1 . VAL A 1 207 ? -2.591  -23.409 -25.665 1.00 24.69 ? 359  VAL A CG1 1 
ATOM   1377 C  CG2 . VAL A 1 207 ? -0.781  -25.034 -25.041 1.00 23.67 ? 359  VAL A CG2 1 
ATOM   1378 N  N   . ASP A 1 208 ? -4.210  -22.777 -22.914 1.00 24.55 ? 360  ASP A N   1 
ATOM   1379 C  CA  . ASP A 1 208 ? -5.526  -22.175 -22.678 1.00 24.48 ? 360  ASP A CA  1 
ATOM   1380 C  C   . ASP A 1 208 ? -6.102  -21.529 -23.938 1.00 24.07 ? 360  ASP A C   1 
ATOM   1381 O  O   . ASP A 1 208 ? -7.273  -21.720 -24.256 1.00 23.90 ? 360  ASP A O   1 
ATOM   1382 C  CB  . ASP A 1 208 ? -5.451  -21.163 -21.530 1.00 24.66 ? 360  ASP A CB  1 
ATOM   1383 C  CG  . ASP A 1 208 ? -5.248  -21.832 -20.180 1.00 25.54 ? 360  ASP A CG  1 
ATOM   1384 O  OD1 . ASP A 1 208 ? -6.252  -22.330 -19.620 1.00 26.53 ? 360  ASP A OD1 1 
ATOM   1385 O  OD2 . ASP A 1 208 ? -4.094  -21.860 -19.681 1.00 25.37 ? 360  ASP A OD2 1 
ATOM   1386 N  N   . LEU A 1 209 ? -5.272  -20.768 -24.645 1.00 23.72 ? 361  LEU A N   1 
ATOM   1387 C  CA  . LEU A 1 209 ? -5.655  -20.168 -25.918 1.00 23.52 ? 361  LEU A CA  1 
ATOM   1388 C  C   . LEU A 1 209 ? -4.417  -19.851 -26.744 1.00 23.10 ? 361  LEU A C   1 
ATOM   1389 O  O   . LEU A 1 209 ? -3.296  -19.965 -26.254 1.00 23.22 ? 361  LEU A O   1 
ATOM   1390 C  CB  . LEU A 1 209 ? -6.511  -18.906 -25.702 1.00 23.74 ? 361  LEU A CB  1 
ATOM   1391 C  CG  . LEU A 1 209 ? -5.876  -17.580 -25.275 1.00 24.04 ? 361  LEU A CG  1 
ATOM   1392 C  CD1 . LEU A 1 209 ? -6.913  -16.488 -25.340 1.00 24.53 ? 361  LEU A CD1 1 
ATOM   1393 C  CD2 . LEU A 1 209 ? -5.282  -17.655 -23.876 1.00 25.19 ? 361  LEU A CD2 1 
ATOM   1394 N  N   . PHE A 1 210 ? -4.623  -19.465 -27.999 1.00 22.57 ? 362  PHE A N   1 
ATOM   1395 C  CA  . PHE A 1 210 ? -3.526  -19.047 -28.868 1.00 22.12 ? 362  PHE A CA  1 
ATOM   1396 C  C   . PHE A 1 210 ? -3.634  -17.557 -29.151 1.00 22.22 ? 362  PHE A C   1 
ATOM   1397 O  O   . PHE A 1 210 ? -4.693  -16.962 -28.959 1.00 22.40 ? 362  PHE A O   1 
ATOM   1398 C  CB  . PHE A 1 210 ? -3.552  -19.826 -30.185 1.00 21.51 ? 362  PHE A CB  1 
ATOM   1399 C  CG  . PHE A 1 210 ? -3.199  -21.278 -30.044 1.00 20.67 ? 362  PHE A CG  1 
ATOM   1400 C  CD1 . PHE A 1 210 ? -1.927  -21.730 -30.383 1.00 19.26 ? 362  PHE A CD1 1 
ATOM   1401 C  CD2 . PHE A 1 210 ? -4.142  -22.202 -29.580 1.00 19.08 ? 362  PHE A CD2 1 
ATOM   1402 C  CE1 . PHE A 1 210 ? -1.600  -23.075 -30.256 1.00 19.29 ? 362  PHE A CE1 1 
ATOM   1403 C  CE2 . PHE A 1 210 ? -3.824  -23.542 -29.458 1.00 18.07 ? 362  PHE A CE2 1 
ATOM   1404 C  CZ  . PHE A 1 210 ? -2.553  -23.984 -29.793 1.00 18.81 ? 362  PHE A CZ  1 
ATOM   1405 N  N   . ALA A 1 211 ? -2.543  -16.954 -29.609 1.00 22.23 ? 363  ALA A N   1 
ATOM   1406 C  CA  . ALA A 1 211 ? -2.556  -15.541 -29.979 1.00 22.52 ? 363  ALA A CA  1 
ATOM   1407 C  C   . ALA A 1 211 ? -1.427  -15.232 -30.957 1.00 22.65 ? 363  ALA A C   1 
ATOM   1408 O  O   . ALA A 1 211 ? -0.456  -15.980 -31.019 1.00 22.55 ? 363  ALA A O   1 
ATOM   1409 C  CB  . ALA A 1 211 ? -2.455  -14.667 -28.739 1.00 22.64 ? 363  ALA A CB  1 
ATOM   1410 N  N   . PRO A 1 212 ? -1.555  -14.135 -31.737 1.00 22.96 ? 364  PRO A N   1 
ATOM   1411 C  CA  . PRO A 1 212 ? -0.523  -13.777 -32.714 1.00 23.03 ? 364  PRO A CA  1 
ATOM   1412 C  C   . PRO A 1 212 ? 0.893   -13.828 -32.141 1.00 23.16 ? 364  PRO A C   1 
ATOM   1413 O  O   . PRO A 1 212 ? 1.162   -13.230 -31.101 1.00 23.01 ? 364  PRO A O   1 
ATOM   1414 C  CB  . PRO A 1 212 ? -0.912  -12.357 -33.109 1.00 22.81 ? 364  PRO A CB  1 
ATOM   1415 C  CG  . PRO A 1 212 ? -2.388  -12.359 -33.008 1.00 22.62 ? 364  PRO A CG  1 
ATOM   1416 C  CD  . PRO A 1 212 ? -2.680  -13.178 -31.779 1.00 22.90 ? 364  PRO A CD  1 
ATOM   1417 N  N   . GLY A 1 213 ? 1.774   -14.557 -32.823 1.00 23.43 ? 365  GLY A N   1 
ATOM   1418 C  CA  . GLY A 1 213 ? 3.140   -14.761 -32.365 1.00 23.84 ? 365  GLY A CA  1 
ATOM   1419 C  C   . GLY A 1 213 ? 4.143   -15.090 -33.457 1.00 24.41 ? 365  GLY A C   1 
ATOM   1420 O  O   . GLY A 1 213 ? 5.099   -15.828 -33.214 1.00 24.35 ? 365  GLY A O   1 
ATOM   1421 N  N   . GLU A 1 214 ? 3.917   -14.551 -34.658 1.00 25.03 ? 366  GLU A N   1 
ATOM   1422 C  CA  . GLU A 1 214 ? 4.904   -14.570 -35.743 1.00 25.40 ? 366  GLU A CA  1 
ATOM   1423 C  C   . GLU A 1 214 ? 4.887   -13.233 -36.471 1.00 25.61 ? 366  GLU A C   1 
ATOM   1424 O  O   . GLU A 1 214 ? 3.814   -12.679 -36.711 1.00 25.51 ? 366  GLU A O   1 
ATOM   1425 C  CB  . GLU A 1 214 ? 4.608   -15.692 -36.730 1.00 25.60 ? 366  GLU A CB  1 
ATOM   1426 C  CG  . GLU A 1 214 ? 5.795   -16.091 -37.601 1.00 26.17 ? 366  GLU A CG  1 
ATOM   1427 C  CD  . GLU A 1 214 ? 5.382   -16.963 -38.770 1.00 27.44 ? 366  GLU A CD  1 
ATOM   1428 O  OE1 . GLU A 1 214 ? 5.684   -18.178 -38.758 1.00 28.18 ? 366  GLU A OE1 1 
ATOM   1429 O  OE2 . GLU A 1 214 ? 4.736   -16.435 -39.698 1.00 28.33 ? 366  GLU A OE2 1 
ATOM   1430 N  N   . ASP A 1 215 ? 6.071   -12.729 -36.826 1.00 25.85 ? 367  ASP A N   1 
ATOM   1431 C  CA  . ASP A 1 215 ? 6.233   -11.408 -37.471 1.00 26.36 ? 367  ASP A CA  1 
ATOM   1432 C  C   . ASP A 1 215 ? 5.526   -10.292 -36.701 1.00 25.90 ? 367  ASP A C   1 
ATOM   1433 O  O   . ASP A 1 215 ? 4.739   -9.525  -37.267 1.00 25.92 ? 367  ASP A O   1 
ATOM   1434 C  CB  . ASP A 1 215 ? 5.784   -11.419 -38.951 1.00 26.78 ? 367  ASP A CB  1 
ATOM   1435 C  CG  . ASP A 1 215 ? 6.426   -12.548 -39.760 1.00 29.33 ? 367  ASP A CG  1 
ATOM   1436 O  OD1 . ASP A 1 215 ? 7.458   -13.114 -39.319 1.00 31.92 ? 367  ASP A OD1 1 
ATOM   1437 O  OD2 . ASP A 1 215 ? 5.896   -12.884 -40.845 1.00 32.57 ? 367  ASP A OD2 1 
ATOM   1438 N  N   . ILE A 1 216 ? 5.813   -10.211 -35.405 1.00 25.50 ? 368  ILE A N   1 
ATOM   1439 C  CA  . ILE A 1 216 ? 5.212   -9.196  -34.548 1.00 25.12 ? 368  ILE A CA  1 
ATOM   1440 C  C   . ILE A 1 216 ? 6.113   -7.961  -34.491 1.00 25.11 ? 368  ILE A C   1 
ATOM   1441 O  O   . ILE A 1 216 ? 7.243   -8.028  -33.999 1.00 25.32 ? 368  ILE A O   1 
ATOM   1442 C  CB  . ILE A 1 216 ? 4.919   -9.745  -33.129 1.00 24.88 ? 368  ILE A CB  1 
ATOM   1443 C  CG1 . ILE A 1 216 ? 4.113   -11.054 -33.199 1.00 24.71 ? 368  ILE A CG1 1 
ATOM   1444 C  CG2 . ILE A 1 216 ? 4.211   -8.699  -32.270 1.00 24.93 ? 368  ILE A CG2 1 
ATOM   1445 C  CD1 . ILE A 1 216 ? 2.803   -10.991 -33.990 1.00 23.80 ? 368  ILE A CD1 1 
ATOM   1446 N  N   . ILE A 1 217 ? 5.619   -6.846  -35.027 1.00 24.89 ? 369  ILE A N   1 
ATOM   1447 C  CA  . ILE A 1 217 ? 6.368   -5.591  -35.010 1.00 24.58 ? 369  ILE A CA  1 
ATOM   1448 C  C   . ILE A 1 217 ? 6.275   -4.993  -33.615 1.00 24.66 ? 369  ILE A C   1 
ATOM   1449 O  O   . ILE A 1 217 ? 5.178   -4.797  -33.092 1.00 24.85 ? 369  ILE A O   1 
ATOM   1450 C  CB  . ILE A 1 217 ? 5.857   -4.577  -36.063 1.00 24.41 ? 369  ILE A CB  1 
ATOM   1451 C  CG1 . ILE A 1 217 ? 5.878   -5.194  -37.469 1.00 24.55 ? 369  ILE A CG1 1 
ATOM   1452 C  CG2 . ILE A 1 217 ? 6.709   -3.307  -36.035 1.00 24.34 ? 369  ILE A CG2 1 
ATOM   1453 C  CD1 . ILE A 1 217 ? 4.981   -4.484  -38.490 1.00 24.24 ? 369  ILE A CD1 1 
ATOM   1454 N  N   . GLY A 1 218 ? 7.435   -4.736  -33.017 1.00 24.48 ? 370  GLY A N   1 
ATOM   1455 C  CA  . GLY A 1 218 ? 7.530   -4.162  -31.683 1.00 24.47 ? 370  GLY A CA  1 
ATOM   1456 C  C   . GLY A 1 218 ? 8.840   -3.410  -31.516 1.00 24.51 ? 370  GLY A C   1 
ATOM   1457 O  O   . GLY A 1 218 ? 9.744   -3.531  -32.349 1.00 24.72 ? 370  GLY A O   1 
ATOM   1458 N  N   . ALA A 1 219 ? 8.943   -2.631  -30.442 1.00 24.24 ? 371  ALA A N   1 
ATOM   1459 C  CA  . ALA A 1 219 ? 10.135  -1.828  -30.169 1.00 24.07 ? 371  ALA A CA  1 
ATOM   1460 C  C   . ALA A 1 219 ? 11.438  -2.637  -30.248 1.00 24.01 ? 371  ALA A C   1 
ATOM   1461 O  O   . ALA A 1 219 ? 11.540  -3.733  -29.692 1.00 24.09 ? 371  ALA A O   1 
ATOM   1462 C  CB  . ALA A 1 219 ? 10.010  -1.159  -28.809 1.00 23.93 ? 371  ALA A CB  1 
ATOM   1463 N  N   . SER A 1 220 ? 12.422  -2.088  -30.951 1.00 23.97 ? 372  SER A N   1 
ATOM   1464 C  CA  . SER A 1 220 ? 13.754  -2.679  -31.027 1.00 23.93 ? 372  SER A CA  1 
ATOM   1465 C  C   . SER A 1 220 ? 14.711  -1.908  -30.133 1.00 23.94 ? 372  SER A C   1 
ATOM   1466 O  O   . SER A 1 220 ? 14.679  -0.675  -30.089 1.00 24.05 ? 372  SER A O   1 
ATOM   1467 C  CB  . SER A 1 220 ? 14.270  -2.665  -32.466 1.00 23.90 ? 372  SER A CB  1 
ATOM   1468 O  OG  . SER A 1 220 ? 15.583  -3.197  -32.547 1.00 24.06 ? 372  SER A OG  1 
ATOM   1469 N  N   . SER A 1 221 ? 15.575  -2.636  -29.433 1.00 23.84 ? 373  SER A N   1 
ATOM   1470 C  CA  . SER A 1 221 ? 16.547  -2.018  -28.535 1.00 23.71 ? 373  SER A CA  1 
ATOM   1471 C  C   . SER A 1 221 ? 17.788  -1.486  -29.284 1.00 23.64 ? 373  SER A C   1 
ATOM   1472 O  O   . SER A 1 221 ? 18.788  -1.100  -28.665 1.00 23.54 ? 373  SER A O   1 
ATOM   1473 C  CB  . SER A 1 221 ? 16.939  -3.002  -27.428 1.00 23.63 ? 373  SER A CB  1 
ATOM   1474 O  OG  . SER A 1 221 ? 17.566  -4.147  -27.976 1.00 23.75 ? 373  SER A OG  1 
ATOM   1475 N  N   . ALA A 1 222 ? 17.706  -1.457  -30.615 1.00 23.48 ? 374  ALA A N   1 
ATOM   1476 C  CA  . ALA A 1 222 ? 18.793  -0.953  -31.462 1.00 23.24 ? 374  ALA A CA  1 
ATOM   1477 C  C   . ALA A 1 222 ? 18.924  0.573   -31.396 1.00 23.06 ? 374  ALA A C   1 
ATOM   1478 O  O   . ALA A 1 222 ? 20.029  1.102   -31.304 1.00 23.13 ? 374  ALA A O   1 
ATOM   1479 C  CB  . ALA A 1 222 ? 18.606  -1.422  -32.897 1.00 23.10 ? 374  ALA A CB  1 
ATOM   1480 N  N   . CYS A 1 223 ? 17.792  1.268   -31.466 1.00 22.93 ? 375  CYS A N   1 
ATOM   1481 C  CA  . CYS A 1 223 ? 17.733  2.711   -31.240 1.00 22.95 ? 375  CYS A CA  1 
ATOM   1482 C  C   . CYS A 1 223 ? 16.401  3.064   -30.577 1.00 22.79 ? 375  CYS A C   1 
ATOM   1483 O  O   . CYS A 1 223 ? 15.477  2.248   -30.544 1.00 22.64 ? 375  CYS A O   1 
ATOM   1484 C  CB  . CYS A 1 223 ? 17.936  3.494   -32.546 1.00 23.04 ? 375  CYS A CB  1 
ATOM   1485 S  SG  . CYS A 1 223 ? 16.491  3.591   -33.643 1.00 23.68 ? 375  CYS A SG  1 
ATOM   1486 N  N   . SER A 1 224 ? 16.300  4.276   -30.047 1.00 22.74 ? 376  SER A N   1 
ATOM   1487 C  CA  . SER A 1 224 ? 15.122  4.660   -29.272 1.00 22.77 ? 376  SER A CA  1 
ATOM   1488 C  C   . SER A 1 224 ? 13.830  4.669   -30.102 1.00 22.44 ? 376  SER A C   1 
ATOM   1489 O  O   . SER A 1 224 ? 12.741  4.485   -29.557 1.00 22.47 ? 376  SER A O   1 
ATOM   1490 C  CB  . SER A 1 224 ? 15.343  6.008   -28.579 1.00 22.60 ? 376  SER A CB  1 
ATOM   1491 O  OG  . SER A 1 224 ? 15.210  7.076   -29.499 1.00 23.83 ? 376  SER A OG  1 
ATOM   1492 N  N   . THR A 1 225 ? 13.962  4.878   -31.411 1.00 22.20 ? 377  THR A N   1 
ATOM   1493 C  CA  . THR A 1 225 ? 12.814  4.866   -32.331 1.00 21.86 ? 377  THR A CA  1 
ATOM   1494 C  C   . THR A 1 225 ? 12.900  3.721   -33.355 1.00 22.04 ? 377  THR A C   1 
ATOM   1495 O  O   . THR A 1 225 ? 12.407  3.844   -34.487 1.00 22.04 ? 377  THR A O   1 
ATOM   1496 C  CB  . THR A 1 225 ? 12.664  6.210   -33.078 1.00 21.60 ? 377  THR A CB  1 
ATOM   1497 O  OG1 . THR A 1 225 ? 13.898  6.527   -33.725 1.00 20.75 ? 377  THR A OG1 1 
ATOM   1498 C  CG2 . THR A 1 225 ? 12.298  7.324   -32.116 1.00 21.13 ? 377  THR A CG2 1 
ATOM   1499 N  N   . CYS A 1 226 ? 13.519  2.614   -32.944 1.00 21.97 ? 378  CYS A N   1 
ATOM   1500 C  CA  . CYS A 1 226 ? 13.742  1.469   -33.821 1.00 22.04 ? 378  CYS A CA  1 
ATOM   1501 C  C   . CYS A 1 226 ? 12.726  0.374   -33.592 1.00 22.13 ? 378  CYS A C   1 
ATOM   1502 O  O   . CYS A 1 226 ? 12.295  0.126   -32.464 1.00 22.11 ? 378  CYS A O   1 
ATOM   1503 C  CB  . CYS A 1 226 ? 15.136  0.895   -33.615 1.00 22.02 ? 378  CYS A CB  1 
ATOM   1504 S  SG  . CYS A 1 226 ? 16.405  1.751   -34.516 1.00 22.68 ? 378  CYS A SG  1 
ATOM   1505 N  N   . PHE A 1 227 ? 12.363  -0.292  -34.679 1.00 22.05 ? 379  PHE A N   1 
ATOM   1506 C  CA  . PHE A 1 227 ? 11.397  -1.365  -34.639 1.00 21.97 ? 379  PHE A CA  1 
ATOM   1507 C  C   . PHE A 1 227 ? 11.984  -2.605  -35.285 1.00 22.21 ? 379  PHE A C   1 
ATOM   1508 O  O   . PHE A 1 227 ? 12.850  -2.511  -36.155 1.00 22.21 ? 379  PHE A O   1 
ATOM   1509 C  CB  . PHE A 1 227 ? 10.111  -0.928  -35.335 1.00 21.82 ? 379  PHE A CB  1 
ATOM   1510 C  CG  . PHE A 1 227 ? 9.331   0.087   -34.557 1.00 21.83 ? 379  PHE A CG  1 
ATOM   1511 C  CD1 . PHE A 1 227 ? 8.249   -0.304  -33.774 1.00 21.30 ? 379  PHE A CD1 1 
ATOM   1512 C  CD2 . PHE A 1 227 ? 9.695   1.435   -34.577 1.00 21.63 ? 379  PHE A CD2 1 
ATOM   1513 C  CE1 . PHE A 1 227 ? 7.530   0.635   -33.034 1.00 21.17 ? 379  PHE A CE1 1 
ATOM   1514 C  CE2 . PHE A 1 227 ? 8.987   2.378   -33.839 1.00 21.18 ? 379  PHE A CE2 1 
ATOM   1515 C  CZ  . PHE A 1 227 ? 7.901   1.978   -33.069 1.00 21.40 ? 379  PHE A CZ  1 
ATOM   1516 N  N   . VAL A 1 228 ? 11.520  -3.764  -34.833 1.00 22.54 ? 380  VAL A N   1 
ATOM   1517 C  CA  . VAL A 1 228 ? 11.974  -5.048  -35.350 1.00 22.94 ? 380  VAL A CA  1 
ATOM   1518 C  C   . VAL A 1 228 ? 10.808  -6.040  -35.332 1.00 23.30 ? 380  VAL A C   1 
ATOM   1519 O  O   . VAL A 1 228 ? 9.802   -5.828  -34.645 1.00 23.32 ? 380  VAL A O   1 
ATOM   1520 C  CB  . VAL A 1 228 ? 13.175  -5.589  -34.527 1.00 22.94 ? 380  VAL A CB  1 
ATOM   1521 C  CG1 . VAL A 1 228 ? 12.703  -6.190  -33.203 1.00 22.83 ? 380  VAL A CG1 1 
ATOM   1522 C  CG2 . VAL A 1 228 ? 13.976  -6.601  -35.326 1.00 23.12 ? 380  VAL A CG2 1 
ATOM   1523 N  N   . SER A 1 229 ? 10.947  -7.113  -36.103 1.00 23.94 ? 381  SER A N   1 
ATOM   1524 C  CA  . SER A 1 229 ? 9.947   -8.176  -36.148 1.00 24.21 ? 381  SER A CA  1 
ATOM   1525 C  C   . SER A 1 229 ? 10.467  -9.432  -35.457 1.00 24.27 ? 381  SER A C   1 
ATOM   1526 O  O   . SER A 1 229 ? 11.559  -9.919  -35.767 1.00 24.30 ? 381  SER A O   1 
ATOM   1527 C  CB  . SER A 1 229 ? 9.579   -8.487  -37.589 1.00 24.17 ? 381  SER A CB  1 
ATOM   1528 O  OG  . SER A 1 229 ? 8.288   -9.051  -37.639 1.00 25.29 ? 381  SER A OG  1 
ATOM   1529 N  N   . GLN A 1 230 ? 9.689   -9.938  -34.508 1.00 24.37 ? 382  GLN A N   1 
ATOM   1530 C  CA  . GLN A 1 230 ? 10.079  -11.110 -33.742 1.00 24.76 ? 382  GLN A CA  1 
ATOM   1531 C  C   . GLN A 1 230 ? 8.917   -12.080 -33.662 1.00 24.55 ? 382  GLN A C   1 
ATOM   1532 O  O   . GLN A 1 230 ? 7.759   -11.673 -33.752 1.00 24.79 ? 382  GLN A O   1 
ATOM   1533 C  CB  . GLN A 1 230 ? 10.529  -10.707 -32.338 1.00 24.66 ? 382  GLN A CB  1 
ATOM   1534 C  CG  . GLN A 1 230 ? 11.966  -10.207 -32.263 1.00 24.95 ? 382  GLN A CG  1 
ATOM   1535 C  CD  . GLN A 1 230 ? 12.368  -9.806  -30.852 1.00 25.87 ? 382  GLN A CD  1 
ATOM   1536 O  OE1 . GLN A 1 230 ? 12.214  -10.579 -29.890 1.00 27.26 ? 382  GLN A OE1 1 
ATOM   1537 N  NE2 . GLN A 1 230 ? 12.900  -8.593  -30.718 1.00 27.06 ? 382  GLN A NE2 1 
ATOM   1538 N  N   . SER A 1 231 ? 9.235   -13.360 -33.499 1.00 24.31 ? 383  SER A N   1 
ATOM   1539 C  CA  . SER A 1 231 ? 8.222   -14.412 -33.396 1.00 24.03 ? 383  SER A CA  1 
ATOM   1540 C  C   . SER A 1 231 ? 8.456   -15.258 -32.144 1.00 23.78 ? 383  SER A C   1 
ATOM   1541 O  O   . SER A 1 231 ? 9.590   -15.391 -31.690 1.00 23.58 ? 383  SER A O   1 
ATOM   1542 C  CB  . SER A 1 231 ? 8.255   -15.309 -34.638 1.00 23.85 ? 383  SER A CB  1 
ATOM   1543 O  OG  . SER A 1 231 ? 8.483   -14.559 -35.821 1.00 23.89 ? 383  SER A OG  1 
ATOM   1544 N  N   . GLY A 1 232 ? 7.384   -15.830 -31.598 1.00 23.65 ? 384  GLY A N   1 
ATOM   1545 C  CA  . GLY A 1 232 ? 7.501   -16.769 -30.483 1.00 23.75 ? 384  GLY A CA  1 
ATOM   1546 C  C   . GLY A 1 232 ? 6.295   -16.765 -29.570 1.00 24.08 ? 384  GLY A C   1 
ATOM   1547 O  O   . GLY A 1 232 ? 5.457   -15.854 -29.640 1.00 24.02 ? 384  GLY A O   1 
ATOM   1548 N  N   . THR A 1 233 ? 6.205   -17.774 -28.703 1.00 24.20 ? 385  THR A N   1 
ATOM   1549 C  CA  . THR A 1 233 ? 5.113   -17.833 -27.729 1.00 24.74 ? 385  THR A CA  1 
ATOM   1550 C  C   . THR A 1 233 ? 5.183   -16.708 -26.694 1.00 24.79 ? 385  THR A C   1 
ATOM   1551 O  O   . THR A 1 233 ? 4.160   -16.349 -26.109 1.00 24.73 ? 385  THR A O   1 
ATOM   1552 C  CB  . THR A 1 233 ? 4.972   -19.211 -27.033 1.00 24.95 ? 385  THR A CB  1 
ATOM   1553 O  OG1 . THR A 1 233 ? 6.234   -19.629 -26.491 1.00 25.08 ? 385  THR A OG1 1 
ATOM   1554 C  CG2 . THR A 1 233 ? 4.445   -20.253 -28.016 1.00 24.87 ? 385  THR A CG2 1 
ATOM   1555 N  N   . SER A 1 234 ? 6.381   -16.153 -26.486 1.00 24.96 ? 386  SER A N   1 
ATOM   1556 C  CA  . SER A 1 234 ? 6.553   -14.906 -25.727 1.00 25.07 ? 386  SER A CA  1 
ATOM   1557 C  C   . SER A 1 234 ? 5.636   -13.820 -26.279 1.00 25.01 ? 386  SER A C   1 
ATOM   1558 O  O   . SER A 1 234 ? 4.793   -13.277 -25.557 1.00 24.89 ? 386  SER A O   1 
ATOM   1559 C  CB  . SER A 1 234 ? 8.001   -14.406 -25.806 1.00 25.24 ? 386  SER A CB  1 
ATOM   1560 O  OG  . SER A 1 234 ? 8.831   -15.029 -24.845 1.00 26.13 ? 386  SER A OG  1 
ATOM   1561 N  N   . GLN A 1 235 ? 5.808   -13.514 -27.565 1.00 24.95 ? 387  GLN A N   1 
ATOM   1562 C  CA  . GLN A 1 235 ? 4.995   -12.500 -28.240 1.00 24.83 ? 387  GLN A CA  1 
ATOM   1563 C  C   . GLN A 1 235 ? 3.514   -12.811 -28.118 1.00 24.79 ? 387  GLN A C   1 
ATOM   1564 O  O   . GLN A 1 235 ? 2.711   -11.907 -27.899 1.00 24.97 ? 387  GLN A O   1 
ATOM   1565 C  CB  . GLN A 1 235 ? 5.401   -12.344 -29.707 1.00 24.57 ? 387  GLN A CB  1 
ATOM   1566 C  CG  . GLN A 1 235 ? 6.638   -11.475 -29.920 1.00 24.54 ? 387  GLN A CG  1 
ATOM   1567 C  CD  . GLN A 1 235 ? 7.944   -12.152 -29.523 1.00 25.20 ? 387  GLN A CD  1 
ATOM   1568 O  OE1 . GLN A 1 235 ? 8.023   -13.378 -29.414 1.00 25.50 ? 387  GLN A OE1 1 
ATOM   1569 N  NE2 . GLN A 1 235 ? 8.982   -11.346 -29.316 1.00 25.49 ? 387  GLN A NE2 1 
ATOM   1570 N  N   . ALA A 1 236 ? 3.164   -14.094 -28.234 1.00 24.86 ? 388  ALA A N   1 
ATOM   1571 C  CA  . ALA A 1 236 ? 1.778   -14.524 -28.076 1.00 24.69 ? 388  ALA A CA  1 
ATOM   1572 C  C   . ALA A 1 236 ? 1.244   -14.175 -26.682 1.00 24.65 ? 388  ALA A C   1 
ATOM   1573 O  O   . ALA A 1 236 ? 0.161   -13.586 -26.554 1.00 24.57 ? 388  ALA A O   1 
ATOM   1574 C  CB  . ALA A 1 236 ? 1.643   -16.000 -28.354 1.00 24.51 ? 388  ALA A CB  1 
ATOM   1575 N  N   . ALA A 1 237 ? 2.018   -14.525 -25.652 1.00 24.34 ? 389  ALA A N   1 
ATOM   1576 C  CA  . ALA A 1 237 ? 1.644   -14.261 -24.262 1.00 24.09 ? 389  ALA A CA  1 
ATOM   1577 C  C   . ALA A 1 237 ? 1.438   -12.765 -24.022 1.00 23.94 ? 389  ALA A C   1 
ATOM   1578 O  O   . ALA A 1 237 ? 0.425   -12.353 -23.434 1.00 23.88 ? 389  ALA A O   1 
ATOM   1579 C  CB  . ALA A 1 237 ? 2.691   -14.823 -23.309 1.00 23.89 ? 389  ALA A CB  1 
ATOM   1580 N  N   . ALA A 1 238 ? 2.395   -11.965 -24.500 1.00 23.39 ? 390  ALA A N   1 
ATOM   1581 C  CA  . ALA A 1 238 ? 2.339   -10.515 -24.394 1.00 23.07 ? 390  ALA A CA  1 
ATOM   1582 C  C   . ALA A 1 238 ? 1.035   -9.940  -24.953 1.00 23.03 ? 390  ALA A C   1 
ATOM   1583 O  O   . ALA A 1 238 ? 0.564   -8.890  -24.489 1.00 23.09 ? 390  ALA A O   1 
ATOM   1584 C  CB  . ALA A 1 238 ? 3.532   -9.888  -25.085 1.00 23.01 ? 390  ALA A CB  1 
ATOM   1585 N  N   . HIS A 1 239 ? 0.457   -10.628 -25.938 1.00 22.53 ? 391  HIS A N   1 
ATOM   1586 C  CA  . HIS A 1 239 ? -0.816  -10.209 -26.523 1.00 22.45 ? 391  HIS A CA  1 
ATOM   1587 C  C   . HIS A 1 239 ? -1.958  -10.387 -25.532 1.00 22.60 ? 391  HIS A C   1 
ATOM   1588 O  O   . HIS A 1 239 ? -2.796  -9.499  -25.364 1.00 22.78 ? 391  HIS A O   1 
ATOM   1589 C  CB  . HIS A 1 239 ? -1.108  -10.970 -27.820 1.00 22.21 ? 391  HIS A CB  1 
ATOM   1590 C  CG  . HIS A 1 239 ? -0.499  -10.347 -29.038 1.00 21.31 ? 391  HIS A CG  1 
ATOM   1591 N  ND1 . HIS A 1 239 ? 0.800   -10.594 -29.431 1.00 19.66 ? 391  HIS A ND1 1 
ATOM   1592 C  CD2 . HIS A 1 239 ? -1.012  -9.487  -29.950 1.00 19.66 ? 391  HIS A CD2 1 
ATOM   1593 C  CE1 . HIS A 1 239 ? 1.061   -9.909  -30.530 1.00 18.99 ? 391  HIS A CE1 1 
ATOM   1594 N  NE2 . HIS A 1 239 ? -0.023  -9.233  -30.869 1.00 18.90 ? 391  HIS A NE2 1 
ATOM   1595 N  N   . VAL A 1 240 ? -1.975  -11.537 -24.872 1.00 22.61 ? 392  VAL A N   1 
ATOM   1596 C  CA  . VAL A 1 240 ? -2.997  -11.846 -23.882 1.00 22.66 ? 392  VAL A CA  1 
ATOM   1597 C  C   . VAL A 1 240 ? -2.825  -11.008 -22.603 1.00 22.93 ? 392  VAL A C   1 
ATOM   1598 O  O   . VAL A 1 240 ? -3.814  -10.628 -21.972 1.00 23.08 ? 392  VAL A O   1 
ATOM   1599 C  CB  . VAL A 1 240 ? -3.034  -13.365 -23.592 1.00 22.44 ? 392  VAL A CB  1 
ATOM   1600 C  CG1 . VAL A 1 240 ? -4.007  -13.704 -22.473 1.00 22.23 ? 392  VAL A CG1 1 
ATOM   1601 C  CG2 . VAL A 1 240 ? -3.414  -14.112 -24.856 1.00 22.32 ? 392  VAL A CG2 1 
ATOM   1602 N  N   . ALA A 1 241 ? -1.584  -10.699 -22.231 1.00 23.18 ? 393  ALA A N   1 
ATOM   1603 C  CA  . ALA A 1 241 ? -1.346  -9.812  -21.090 1.00 23.48 ? 393  ALA A CA  1 
ATOM   1604 C  C   . ALA A 1 241 ? -1.901  -8.418  -21.391 1.00 23.74 ? 393  ALA A C   1 
ATOM   1605 O  O   . ALA A 1 241 ? -2.440  -7.753  -20.505 1.00 23.97 ? 393  ALA A O   1 
ATOM   1606 C  CB  . ALA A 1 241 ? 0.131   -9.745  -20.751 1.00 23.54 ? 393  ALA A CB  1 
ATOM   1607 N  N   . GLY A 1 242 ? -1.787  -7.999  -22.650 1.00 23.76 ? 394  GLY A N   1 
ATOM   1608 C  CA  . GLY A 1 242 ? -2.370  -6.750  -23.109 1.00 23.85 ? 394  GLY A CA  1 
ATOM   1609 C  C   . GLY A 1 242 ? -3.882  -6.775  -23.067 1.00 24.15 ? 394  GLY A C   1 
ATOM   1610 O  O   . GLY A 1 242 ? -4.512  -5.828  -22.594 1.00 24.30 ? 394  GLY A O   1 
ATOM   1611 N  N   . ILE A 1 243 ? -4.464  -7.864  -23.563 1.00 24.44 ? 395  ILE A N   1 
ATOM   1612 C  CA  . ILE A 1 243 ? -5.918  -8.024  -23.600 1.00 24.50 ? 395  ILE A CA  1 
ATOM   1613 C  C   . ILE A 1 243 ? -6.491  -8.090  -22.179 1.00 24.84 ? 395  ILE A C   1 
ATOM   1614 O  O   . ILE A 1 243 ? -7.484  -7.421  -21.871 1.00 24.80 ? 395  ILE A O   1 
ATOM   1615 C  CB  . ILE A 1 243 ? -6.329  -9.252  -24.448 1.00 24.49 ? 395  ILE A CB  1 
ATOM   1616 C  CG1 . ILE A 1 243 ? -5.880  -9.053  -25.899 1.00 24.32 ? 395  ILE A CG1 1 
ATOM   1617 C  CG2 . ILE A 1 243 ? -7.842  -9.492  -24.373 1.00 24.25 ? 395  ILE A CG2 1 
ATOM   1618 C  CD1 . ILE A 1 243 ? -5.997  -10.282 -26.773 1.00 23.93 ? 395  ILE A CD1 1 
ATOM   1619 N  N   . ALA A 1 244 ? -5.844  -8.873  -21.316 1.00 24.99 ? 396  ALA A N   1 
ATOM   1620 C  CA  . ALA A 1 244 ? -6.194  -8.918  -19.897 1.00 25.33 ? 396  ALA A CA  1 
ATOM   1621 C  C   . ALA A 1 244 ? -6.132  -7.537  -19.239 1.00 25.53 ? 396  ALA A C   1 
ATOM   1622 O  O   . ALA A 1 244 ? -7.031  -7.168  -18.491 1.00 25.61 ? 396  ALA A O   1 
ATOM   1623 C  CB  . ALA A 1 244 ? -5.299  -9.911  -19.151 1.00 25.30 ? 396  ALA A CB  1 
ATOM   1624 N  N   . ALA A 1 245 ? -5.080  -6.775  -19.529 1.00 26.06 ? 397  ALA A N   1 
ATOM   1625 C  CA  . ALA A 1 245 ? -4.926  -5.425  -18.976 1.00 26.71 ? 397  ALA A CA  1 
ATOM   1626 C  C   . ALA A 1 245 ? -6.024  -4.463  -19.442 1.00 27.26 ? 397  ALA A C   1 
ATOM   1627 O  O   . ALA A 1 245 ? -6.566  -3.702  -18.631 1.00 27.33 ? 397  ALA A O   1 
ATOM   1628 C  CB  . ALA A 1 245 ? -3.547  -4.870  -19.291 1.00 26.59 ? 397  ALA A CB  1 
ATOM   1629 N  N   . MET A 1 246 ? -6.344  -4.503  -20.739 1.00 28.01 ? 398  MET A N   1 
ATOM   1630 C  CA  . MET A 1 246 ? -7.450  -3.717  -21.313 1.00 28.88 ? 398  MET A CA  1 
ATOM   1631 C  C   . MET A 1 246 ? -8.761  -4.057  -20.612 1.00 28.91 ? 398  MET A C   1 
ATOM   1632 O  O   . MET A 1 246 ? -9.516  -3.169  -20.211 1.00 28.74 ? 398  MET A O   1 
ATOM   1633 C  CB  . MET A 1 246 ? -7.618  -4.003  -22.813 1.00 29.23 ? 398  MET A CB  1 
ATOM   1634 C  CG  . MET A 1 246 ? -6.475  -3.552  -23.704 1.00 31.01 ? 398  MET A CG  1 
ATOM   1635 S  SD  . MET A 1 246 ? -6.535  -1.796  -24.094 1.00 35.92 ? 398  MET A SD  1 
ATOM   1636 C  CE  . MET A 1 246 ? -7.722  -1.755  -25.449 1.00 33.98 ? 398  MET A CE  1 
ATOM   1637 N  N   . MET A 1 247 ? -9.019  -5.358  -20.479 1.00 29.16 ? 399  MET A N   1 
ATOM   1638 C  CA  . MET A 1 247 ? -10.222 -5.857  -19.828 1.00 29.38 ? 399  MET A CA  1 
ATOM   1639 C  C   . MET A 1 247 ? -10.285 -5.408  -18.377 1.00 29.74 ? 399  MET A C   1 
ATOM   1640 O  O   . MET A 1 247 ? -11.329 -4.938  -17.907 1.00 29.76 ? 399  MET A O   1 
ATOM   1641 C  CB  . MET A 1 247 ? -10.270 -7.380  -19.896 1.00 29.35 ? 399  MET A CB  1 
ATOM   1642 C  CG  . MET A 1 247 ? -10.639 -7.931  -21.252 1.00 28.93 ? 399  MET A CG  1 
ATOM   1643 S  SD  . MET A 1 247 ? -10.536 -9.718  -21.210 1.00 29.21 ? 399  MET A SD  1 
ATOM   1644 C  CE  . MET A 1 247 ? -11.259 -10.152 -22.795 1.00 29.76 ? 399  MET A CE  1 
ATOM   1645 N  N   . LEU A 1 248 ? -9.156  -5.532  -17.683 1.00 29.92 ? 400  LEU A N   1 
ATOM   1646 C  CA  . LEU A 1 248 ? -9.083  -5.170  -16.275 1.00 30.24 ? 400  LEU A CA  1 
ATOM   1647 C  C   . LEU A 1 248 ? -9.187  -3.675  -15.986 1.00 30.59 ? 400  LEU A C   1 
ATOM   1648 O  O   . LEU A 1 248 ? -9.545  -3.294  -14.873 1.00 30.75 ? 400  LEU A O   1 
ATOM   1649 C  CB  . LEU A 1 248 ? -7.852  -5.794  -15.606 1.00 30.14 ? 400  LEU A CB  1 
ATOM   1650 C  CG  . LEU A 1 248 ? -7.967  -7.301  -15.348 1.00 29.62 ? 400  LEU A CG  1 
ATOM   1651 C  CD1 . LEU A 1 248 ? -6.645  -7.873  -14.900 1.00 28.63 ? 400  LEU A CD1 1 
ATOM   1652 C  CD2 . LEU A 1 248 ? -9.067  -7.619  -14.336 1.00 29.64 ? 400  LEU A CD2 1 
ATOM   1653 N  N   . SER A 1 249 ? -8.891  -2.826  -16.969 1.00 31.02 ? 401  SER A N   1 
ATOM   1654 C  CA  . SER A 1 249 ? -9.135  -1.387  -16.804 1.00 31.63 ? 401  SER A CA  1 
ATOM   1655 C  C   . SER A 1 249 ? -10.623 -1.083  -16.810 1.00 31.76 ? 401  SER A C   1 
ATOM   1656 O  O   . SER A 1 249 ? -11.115 -0.367  -15.940 1.00 31.83 ? 401  SER A O   1 
ATOM   1657 C  CB  . SER A 1 249 ? -8.426  -0.557  -17.870 1.00 31.65 ? 401  SER A CB  1 
ATOM   1658 O  OG  . SER A 1 249 ? -7.063  -0.395  -17.529 1.00 32.86 ? 401  SER A OG  1 
ATOM   1659 N  N   . ALA A 1 250 ? -11.331 -1.644  -17.787 1.00 32.09 ? 402  ALA A N   1 
ATOM   1660 C  CA  . ALA A 1 250 ? -12.775 -1.474  -17.909 1.00 32.37 ? 402  ALA A CA  1 
ATOM   1661 C  C   . ALA A 1 250 ? -13.526 -2.006  -16.687 1.00 32.70 ? 402  ALA A C   1 
ATOM   1662 O  O   . ALA A 1 250 ? -14.506 -1.397  -16.249 1.00 32.83 ? 402  ALA A O   1 
ATOM   1663 C  CB  . ALA A 1 250 ? -13.282 -2.138  -19.183 1.00 32.21 ? 402  ALA A CB  1 
ATOM   1664 N  N   . GLU A 1 251 ? -13.063 -3.129  -16.138 1.00 33.02 ? 403  GLU A N   1 
ATOM   1665 C  CA  . GLU A 1 251 ? -13.718 -3.762  -14.990 1.00 33.53 ? 403  GLU A CA  1 
ATOM   1666 C  C   . GLU A 1 251 ? -12.695 -4.267  -13.978 1.00 33.76 ? 403  GLU A C   1 
ATOM   1667 O  O   . GLU A 1 251 ? -12.248 -5.412  -14.073 1.00 33.84 ? 403  GLU A O   1 
ATOM   1668 C  CB  . GLU A 1 251 ? -14.605 -4.926  -15.440 1.00 33.58 ? 403  GLU A CB  1 
ATOM   1669 C  CG  . GLU A 1 251 ? -15.805 -4.532  -16.281 1.00 34.23 ? 403  GLU A CG  1 
ATOM   1670 C  CD  . GLU A 1 251 ? -16.380 -5.700  -17.061 1.00 35.34 ? 403  GLU A CD  1 
ATOM   1671 O  OE1 . GLU A 1 251 ? -15.638 -6.330  -17.854 1.00 35.44 ? 403  GLU A OE1 1 
ATOM   1672 O  OE2 . GLU A 1 251 ? -17.586 -5.981  -16.887 1.00 36.15 ? 403  GLU A OE2 1 
ATOM   1673 N  N   . PRO A 1 252 ? -12.327 -3.421  -12.998 1.00 33.99 ? 404  PRO A N   1 
ATOM   1674 C  CA  . PRO A 1 252 ? -11.308 -3.790  -12.005 1.00 34.22 ? 404  PRO A CA  1 
ATOM   1675 C  C   . PRO A 1 252 ? -11.755 -4.910  -11.056 1.00 34.54 ? 404  PRO A C   1 
ATOM   1676 O  O   . PRO A 1 252 ? -10.915 -5.572  -10.440 1.00 34.41 ? 404  PRO A O   1 
ATOM   1677 C  CB  . PRO A 1 252 ? -11.085 -2.484  -11.224 1.00 34.25 ? 404  PRO A CB  1 
ATOM   1678 C  CG  . PRO A 1 252 ? -11.715 -1.397  -12.063 1.00 34.03 ? 404  PRO A CG  1 
ATOM   1679 C  CD  . PRO A 1 252 ? -12.844 -2.060  -12.768 1.00 33.90 ? 404  PRO A CD  1 
ATOM   1680 N  N   . GLU A 1 253 ? -13.068 -5.117  -10.958 1.00 35.02 ? 405  GLU A N   1 
ATOM   1681 C  CA  . GLU A 1 253 ? -13.655 -6.065  -10.008 1.00 35.42 ? 405  GLU A CA  1 
ATOM   1682 C  C   . GLU A 1 253 ? -13.717 -7.506  -10.514 1.00 35.42 ? 405  GLU A C   1 
ATOM   1683 O  O   . GLU A 1 253 ? -14.227 -8.384  -9.817  1.00 35.45 ? 405  GLU A O   1 
ATOM   1684 C  CB  . GLU A 1 253 ? -15.058 -5.603  -9.599  1.00 35.46 ? 405  GLU A CB  1 
ATOM   1685 C  CG  . GLU A 1 253 ? -15.120 -4.779  -8.311  1.00 35.69 ? 405  GLU A CG  1 
ATOM   1686 C  CD  . GLU A 1 253 ? -16.525 -4.742  -7.710  1.00 35.97 ? 405  GLU A CD  1 
ATOM   1687 O  OE1 . GLU A 1 253 ? -17.439 -5.388  -8.274  1.00 36.43 ? 405  GLU A OE1 1 
ATOM   1688 O  OE2 . GLU A 1 253 ? -16.723 -4.070  -6.670  1.00 36.76 ? 405  GLU A OE2 1 
ATOM   1689 N  N   . LEU A 1 254 ? -13.201 -7.748  -11.718 1.00 35.56 ? 406  LEU A N   1 
ATOM   1690 C  CA  . LEU A 1 254 ? -13.217 -9.084  -12.319 1.00 35.56 ? 406  LEU A CA  1 
ATOM   1691 C  C   . LEU A 1 254 ? -12.389 -10.081 -11.522 1.00 35.79 ? 406  LEU A C   1 
ATOM   1692 O  O   . LEU A 1 254 ? -11.250 -9.792  -11.144 1.00 36.03 ? 406  LEU A O   1 
ATOM   1693 C  CB  . LEU A 1 254 ? -12.704 -9.041  -13.762 1.00 35.51 ? 406  LEU A CB  1 
ATOM   1694 C  CG  . LEU A 1 254 ? -13.654 -8.600  -14.878 1.00 34.99 ? 406  LEU A CG  1 
ATOM   1695 C  CD1 . LEU A 1 254 ? -12.878 -8.353  -16.160 1.00 34.29 ? 406  LEU A CD1 1 
ATOM   1696 C  CD2 . LEU A 1 254 ? -14.742 -9.634  -15.106 1.00 34.52 ? 406  LEU A CD2 1 
ATOM   1697 N  N   . THR A 1 255 ? -12.964 -11.252 -11.263 1.00 35.89 ? 407  THR A N   1 
ATOM   1698 C  CA  . THR A 1 255 ? -12.211 -12.340 -10.644 1.00 36.02 ? 407  THR A CA  1 
ATOM   1699 C  C   . THR A 1 255 ? -11.340 -12.996 -11.710 1.00 36.01 ? 407  THR A C   1 
ATOM   1700 O  O   . THR A 1 255 ? -11.547 -12.783 -12.906 1.00 35.94 ? 407  THR A O   1 
ATOM   1701 C  CB  . THR A 1 255 ? -13.128 -13.403 -9.976  1.00 36.00 ? 407  THR A CB  1 
ATOM   1702 O  OG1 . THR A 1 255 ? -13.780 -14.190 -10.979 1.00 36.16 ? 407  THR A OG1 1 
ATOM   1703 C  CG2 . THR A 1 255 ? -14.175 -12.747 -9.080  1.00 36.09 ? 407  THR A CG2 1 
ATOM   1704 N  N   . LEU A 1 256 ? -10.365 -13.787 -11.278 1.00 36.10 ? 408  LEU A N   1 
ATOM   1705 C  CA  . LEU A 1 256 ? -9.535  -14.532 -12.212 1.00 36.16 ? 408  LEU A CA  1 
ATOM   1706 C  C   . LEU A 1 256 ? -10.392 -15.444 -13.091 1.00 36.19 ? 408  LEU A C   1 
ATOM   1707 O  O   . LEU A 1 256 ? -10.218 -15.471 -14.311 1.00 36.29 ? 408  LEU A O   1 
ATOM   1708 C  CB  . LEU A 1 256 ? -8.466  -15.336 -11.473 1.00 35.95 ? 408  LEU A CB  1 
ATOM   1709 C  CG  . LEU A 1 256 ? -7.492  -16.119 -12.355 1.00 36.30 ? 408  LEU A CG  1 
ATOM   1710 C  CD1 . LEU A 1 256 ? -6.666  -15.184 -13.250 1.00 35.86 ? 408  LEU A CD1 1 
ATOM   1711 C  CD2 . LEU A 1 256 ? -6.594  -17.003 -11.497 1.00 36.45 ? 408  LEU A CD2 1 
ATOM   1712 N  N   . ALA A 1 257 ? -11.324 -16.164 -12.464 1.00 36.19 ? 409  ALA A N   1 
ATOM   1713 C  CA  . ALA A 1 257 ? -12.230 -17.080 -13.163 1.00 36.17 ? 409  ALA A CA  1 
ATOM   1714 C  C   . ALA A 1 257 ? -13.057 -16.379 -14.242 1.00 36.21 ? 409  ALA A C   1 
ATOM   1715 O  O   . ALA A 1 257 ? -13.185 -16.894 -15.355 1.00 36.18 ? 409  ALA A O   1 
ATOM   1716 C  CB  . ALA A 1 257 ? -13.144 -17.791 -12.168 1.00 36.04 ? 409  ALA A CB  1 
ATOM   1717 N  N   . GLU A 1 258 ? -13.601 -15.208 -13.902 1.00 36.31 ? 410  GLU A N   1 
ATOM   1718 C  CA  . GLU A 1 258 ? -14.428 -14.406 -14.816 1.00 36.41 ? 410  GLU A CA  1 
ATOM   1719 C  C   . GLU A 1 258 ? -13.632 -13.859 -16.010 1.00 36.47 ? 410  GLU A C   1 
ATOM   1720 O  O   . GLU A 1 258 ? -14.100 -13.927 -17.149 1.00 36.32 ? 410  GLU A O   1 
ATOM   1721 C  CB  . GLU A 1 258 ? -15.121 -13.260 -14.066 1.00 36.37 ? 410  GLU A CB  1 
ATOM   1722 C  CG  . GLU A 1 258 ? -16.267 -13.691 -13.142 1.00 36.54 ? 410  GLU A CG  1 
ATOM   1723 C  CD  . GLU A 1 258 ? -16.742 -12.582 -12.198 1.00 36.55 ? 410  GLU A CD  1 
ATOM   1724 O  OE1 . GLU A 1 258 ? -15.942 -11.690 -11.839 1.00 36.69 ? 410  GLU A OE1 1 
ATOM   1725 O  OE2 . GLU A 1 258 ? -17.925 -12.608 -11.799 1.00 36.86 ? 410  GLU A OE2 1 
ATOM   1726 N  N   . LEU A 1 259 ? -12.439 -13.318 -15.741 1.00 36.60 ? 411  LEU A N   1 
ATOM   1727 C  CA  . LEU A 1 259 ? -11.528 -12.839 -16.788 1.00 36.59 ? 411  LEU A CA  1 
ATOM   1728 C  C   . LEU A 1 259 ? -11.154 -13.971 -17.738 1.00 36.75 ? 411  LEU A C   1 
ATOM   1729 O  O   . LEU A 1 259 ? -11.117 -13.783 -18.954 1.00 36.89 ? 411  LEU A O   1 
ATOM   1730 C  CB  . LEU A 1 259 ? -10.249 -12.241 -16.185 1.00 36.48 ? 411  LEU A CB  1 
ATOM   1731 C  CG  . LEU A 1 259 ? -9.177  -11.803 -17.196 1.00 36.23 ? 411  LEU A CG  1 
ATOM   1732 C  CD1 . LEU A 1 259 ? -9.160  -10.295 -17.353 1.00 35.81 ? 411  LEU A CD1 1 
ATOM   1733 C  CD2 . LEU A 1 259 ? -7.800  -12.304 -16.806 1.00 35.68 ? 411  LEU A CD2 1 
ATOM   1734 N  N   . ARG A 1 260 ? -10.876 -15.143 -17.177 1.00 36.85 ? 412  ARG A N   1 
ATOM   1735 C  CA  . ARG A 1 260 ? -10.479 -16.291 -17.977 1.00 37.11 ? 412  ARG A CA  1 
ATOM   1736 C  C   . ARG A 1 260 ? -11.566 -16.700 -18.975 1.00 36.74 ? 412  ARG A C   1 
ATOM   1737 O  O   . ARG A 1 260 ? -11.286 -16.833 -20.168 1.00 36.93 ? 412  ARG A O   1 
ATOM   1738 C  CB  . ARG A 1 260 ? -10.077 -17.469 -17.089 1.00 37.45 ? 412  ARG A CB  1 
ATOM   1739 C  CG  . ARG A 1 260 ? -9.221  -18.489 -17.813 1.00 38.79 ? 412  ARG A CG  1 
ATOM   1740 C  CD  . ARG A 1 260 ? -9.154  -19.791 -17.060 1.00 40.71 ? 412  ARG A CD  1 
ATOM   1741 N  NE  . ARG A 1 260 ? -7.850  -20.418 -17.239 1.00 42.17 ? 412  ARG A NE  1 
ATOM   1742 C  CZ  . ARG A 1 260 ? -6.794  -20.174 -16.470 1.00 42.36 ? 412  ARG A CZ  1 
ATOM   1743 N  NH1 . ARG A 1 260 ? -6.886  -19.314 -15.461 1.00 42.52 ? 412  ARG A NH1 1 
ATOM   1744 N  NH2 . ARG A 1 260 ? -5.646  -20.795 -16.708 1.00 42.30 ? 412  ARG A NH2 1 
ATOM   1745 N  N   . GLN A 1 261 ? -12.798 -16.882 -18.497 1.00 36.45 ? 413  GLN A N   1 
ATOM   1746 C  CA  A GLN A 1 261 ? -13.882 -17.284 -19.388 0.50 36.29 ? 413  GLN A CA  1 
ATOM   1747 C  CA  B GLN A 1 261 ? -13.921 -17.268 -19.359 0.50 36.28 ? 413  GLN A CA  1 
ATOM   1748 C  C   . GLN A 1 261 ? -14.299 -16.148 -20.321 1.00 36.17 ? 413  GLN A C   1 
ATOM   1749 O  O   . GLN A 1 261 ? -14.946 -16.387 -21.342 1.00 36.33 ? 413  GLN A O   1 
ATOM   1750 C  CB  A GLN A 1 261 ? -15.072 -17.854 -18.607 0.50 36.28 ? 413  GLN A CB  1 
ATOM   1751 C  CB  B GLN A 1 261 ? -15.140 -17.730 -18.538 0.50 36.25 ? 413  GLN A CB  1 
ATOM   1752 C  CG  A GLN A 1 261 ? -14.754 -19.141 -17.826 0.50 36.26 ? 413  GLN A CG  1 
ATOM   1753 C  CG  B GLN A 1 261 ? -15.800 -16.668 -17.644 0.50 36.13 ? 413  GLN A CG  1 
ATOM   1754 C  CD  A GLN A 1 261 ? -13.996 -20.184 -18.648 0.50 35.90 ? 413  GLN A CD  1 
ATOM   1755 C  CD  B GLN A 1 261 ? -16.961 -15.924 -18.310 0.50 35.91 ? 413  GLN A CD  1 
ATOM   1756 O  OE1 A GLN A 1 261 ? -12.859 -20.537 -18.324 0.50 35.38 ? 413  GLN A OE1 1 
ATOM   1757 O  OE1 B GLN A 1 261 ? -17.379 -16.248 -19.424 0.50 35.55 ? 413  GLN A OE1 1 
ATOM   1758 N  NE2 A GLN A 1 261 ? -14.623 -20.675 -19.715 0.50 35.50 ? 413  GLN A NE2 1 
ATOM   1759 N  NE2 B GLN A 1 261 ? -17.489 -14.921 -17.614 0.50 35.58 ? 413  GLN A NE2 1 
ATOM   1760 N  N   . ARG A 1 262 ? -13.897 -14.924 -19.977 1.00 35.80 ? 414  ARG A N   1 
ATOM   1761 C  CA  . ARG A 1 262 ? -14.122 -13.755 -20.827 1.00 35.23 ? 414  ARG A CA  1 
ATOM   1762 C  C   . ARG A 1 262 ? -13.181 -13.827 -22.025 1.00 34.70 ? 414  ARG A C   1 
ATOM   1763 O  O   . ARG A 1 262 ? -13.573 -13.509 -23.155 1.00 34.58 ? 414  ARG A O   1 
ATOM   1764 C  CB  . ARG A 1 262 ? -13.854 -12.460 -20.056 1.00 35.42 ? 414  ARG A CB  1 
ATOM   1765 C  CG  . ARG A 1 262 ? -14.867 -11.348 -20.276 1.00 35.62 ? 414  ARG A CG  1 
ATOM   1766 C  CD  . ARG A 1 262 ? -15.844 -11.302 -19.118 1.00 36.63 ? 414  ARG A CD  1 
ATOM   1767 N  NE  . ARG A 1 262 ? -16.471 -9.991  -18.969 1.00 37.43 ? 414  ARG A NE  1 
ATOM   1768 C  CZ  . ARG A 1 262 ? -17.277 -9.653  -17.965 1.00 38.00 ? 414  ARG A CZ  1 
ATOM   1769 N  NH1 . ARG A 1 262 ? -17.801 -8.439  -17.921 1.00 38.46 ? 414  ARG A NH1 1 
ATOM   1770 N  NH2 . ARG A 1 262 ? -17.566 -10.523 -17.004 1.00 38.15 ? 414  ARG A NH2 1 
ATOM   1771 N  N   . LEU A 1 263 ? -11.941 -14.246 -21.763 1.00 33.85 ? 415  LEU A N   1 
ATOM   1772 C  CA  . LEU A 1 263 ? -10.936 -14.431 -22.808 1.00 33.11 ? 415  LEU A CA  1 
ATOM   1773 C  C   . LEU A 1 263 ? -11.374 -15.506 -23.794 1.00 32.76 ? 415  LEU A C   1 
ATOM   1774 O  O   . LEU A 1 263 ? -11.289 -15.312 -25.009 1.00 32.73 ? 415  LEU A O   1 
ATOM   1775 C  CB  . LEU A 1 263 ? -9.582  -14.810 -22.204 1.00 32.93 ? 415  LEU A CB  1 
ATOM   1776 C  CG  . LEU A 1 263 ? -8.730  -13.731 -21.544 1.00 32.55 ? 415  LEU A CG  1 
ATOM   1777 C  CD1 . LEU A 1 263 ? -7.561  -14.379 -20.830 1.00 32.73 ? 415  LEU A CD1 1 
ATOM   1778 C  CD2 . LEU A 1 263 ? -8.239  -12.716 -22.557 1.00 32.22 ? 415  LEU A CD2 1 
ATOM   1779 N  N   . ILE A 1 264 ? -11.843 -16.632 -23.258 1.00 32.22 ? 416  ILE A N   1 
ATOM   1780 C  CA  . ILE A 1 264 ? -12.340 -17.739 -24.069 1.00 31.81 ? 416  ILE A CA  1 
ATOM   1781 C  C   . ILE A 1 264 ? -13.558 -17.313 -24.895 1.00 31.64 ? 416  ILE A C   1 
ATOM   1782 O  O   . ILE A 1 264 ? -13.646 -17.629 -26.081 1.00 31.76 ? 416  ILE A O   1 
ATOM   1783 C  CB  . ILE A 1 264 ? -12.665 -18.982 -23.196 1.00 31.73 ? 416  ILE A CB  1 
ATOM   1784 C  CG1 . ILE A 1 264 ? -11.395 -19.466 -22.493 1.00 31.49 ? 416  ILE A CG1 1 
ATOM   1785 C  CG2 . ILE A 1 264 ? -13.293 -20.106 -24.036 1.00 31.19 ? 416  ILE A CG2 1 
ATOM   1786 C  CD1 . ILE A 1 264 ? -11.602 -20.623 -21.539 1.00 31.93 ? 416  ILE A CD1 1 
ATOM   1787 N  N   . HIS A 1 265 ? -14.472 -16.574 -24.269 1.00 31.38 ? 417  HIS A N   1 
ATOM   1788 C  CA  . HIS A 1 265 ? -15.713 -16.142 -24.917 1.00 31.11 ? 417  HIS A CA  1 
ATOM   1789 C  C   . HIS A 1 265 ? -15.512 -15.206 -26.113 1.00 30.74 ? 417  HIS A C   1 
ATOM   1790 O  O   . HIS A 1 265 ? -16.247 -15.297 -27.098 1.00 30.65 ? 417  HIS A O   1 
ATOM   1791 C  CB  . HIS A 1 265 ? -16.654 -15.496 -23.898 1.00 31.17 ? 417  HIS A CB  1 
ATOM   1792 C  CG  . HIS A 1 265 ? -17.992 -15.139 -24.462 1.00 31.54 ? 417  HIS A CG  1 
ATOM   1793 N  ND1 . HIS A 1 265 ? -18.943 -16.087 -24.774 1.00 31.95 ? 417  HIS A ND1 1 
ATOM   1794 C  CD2 . HIS A 1 265 ? -18.532 -13.940 -24.786 1.00 31.62 ? 417  HIS A CD2 1 
ATOM   1795 C  CE1 . HIS A 1 265 ? -20.014 -15.486 -25.261 1.00 32.16 ? 417  HIS A CE1 1 
ATOM   1796 N  NE2 . HIS A 1 265 ? -19.790 -14.184 -25.279 1.00 32.10 ? 417  HIS A NE2 1 
ATOM   1797 N  N   . PHE A 1 266 ? -14.526 -14.315 -26.019 1.00 30.39 ? 418  PHE A N   1 
ATOM   1798 C  CA  . PHE A 1 266 ? -14.263 -13.321 -27.070 1.00 30.01 ? 418  PHE A CA  1 
ATOM   1799 C  C   . PHE A 1 266 ? -13.229 -13.764 -28.113 1.00 29.58 ? 418  PHE A C   1 
ATOM   1800 O  O   . PHE A 1 266 ? -12.981 -13.044 -29.081 1.00 29.45 ? 418  PHE A O   1 
ATOM   1801 C  CB  . PHE A 1 266 ? -13.846 -11.978 -26.458 1.00 30.24 ? 418  PHE A CB  1 
ATOM   1802 C  CG  . PHE A 1 266 ? -14.977 -11.215 -25.823 1.00 30.47 ? 418  PHE A CG  1 
ATOM   1803 C  CD1 . PHE A 1 266 ? -16.030 -10.729 -26.594 1.00 30.62 ? 418  PHE A CD1 1 
ATOM   1804 C  CD2 . PHE A 1 266 ? -14.973 -10.958 -24.455 1.00 31.23 ? 418  PHE A CD2 1 
ATOM   1805 C  CE1 . PHE A 1 266 ? -17.075 -10.013 -26.009 1.00 31.22 ? 418  PHE A CE1 1 
ATOM   1806 C  CE2 . PHE A 1 266 ? -16.015 -10.245 -23.854 1.00 31.53 ? 418  PHE A CE2 1 
ATOM   1807 C  CZ  . PHE A 1 266 ? -17.069 -9.769  -24.635 1.00 31.20 ? 418  PHE A CZ  1 
ATOM   1808 N  N   . SER A 1 267 ? -12.627 -14.935 -27.903 1.00 29.09 ? 419  SER A N   1 
ATOM   1809 C  CA  . SER A 1 267 ? -11.713 -15.547 -28.874 1.00 28.64 ? 419  SER A CA  1 
ATOM   1810 C  C   . SER A 1 267 ? -12.426 -15.990 -30.143 1.00 28.17 ? 419  SER A C   1 
ATOM   1811 O  O   . SER A 1 267 ? -13.594 -16.396 -30.102 1.00 28.04 ? 419  SER A O   1 
ATOM   1812 C  CB  . SER A 1 267 ? -11.041 -16.784 -28.273 1.00 28.61 ? 419  SER A CB  1 
ATOM   1813 O  OG  . SER A 1 267 ? -10.145 -16.436 -27.240 1.00 29.62 ? 419  SER A OG  1 
ATOM   1814 N  N   . ALA A 1 268 ? -11.708 -15.929 -31.262 1.00 27.67 ? 420  ALA A N   1 
ATOM   1815 C  CA  . ALA A 1 268 ? -12.168 -16.527 -32.511 1.00 27.06 ? 420  ALA A CA  1 
ATOM   1816 C  C   . ALA A 1 268 ? -12.043 -18.039 -32.394 1.00 26.75 ? 420  ALA A C   1 
ATOM   1817 O  O   . ALA A 1 268 ? -10.994 -18.559 -32.008 1.00 26.77 ? 420  ALA A O   1 
ATOM   1818 C  CB  . ALA A 1 268 ? -11.363 -16.019 -33.672 1.00 26.83 ? 420  ALA A CB  1 
ATOM   1819 N  N   . LYS A 1 269 ? -13.123 -18.739 -32.722 1.00 26.44 ? 421  LYS A N   1 
ATOM   1820 C  CA  . LYS A 1 269 ? -13.196 -20.176 -32.509 1.00 26.03 ? 421  LYS A CA  1 
ATOM   1821 C  C   . LYS A 1 269 ? -13.086 -20.954 -33.806 1.00 25.72 ? 421  LYS A C   1 
ATOM   1822 O  O   . LYS A 1 269 ? -13.502 -20.479 -34.860 1.00 25.48 ? 421  LYS A O   1 
ATOM   1823 C  CB  . LYS A 1 269 ? -14.489 -20.531 -31.769 1.00 26.15 ? 421  LYS A CB  1 
ATOM   1824 C  CG  . LYS A 1 269 ? -14.645 -19.731 -30.490 1.00 26.83 ? 421  LYS A CG  1 
ATOM   1825 C  CD  . LYS A 1 269 ? -15.672 -20.290 -29.539 1.00 28.10 ? 421  LYS A CD  1 
ATOM   1826 C  CE  . LYS A 1 269 ? -15.578 -19.569 -28.187 1.00 28.97 ? 421  LYS A CE  1 
ATOM   1827 N  NZ  . LYS A 1 269 ? -15.471 -18.070 -28.305 1.00 28.51 ? 421  LYS A NZ  1 
ATOM   1828 N  N   . ASP A 1 270 ? -12.493 -22.142 -33.707 1.00 25.55 ? 422  ASP A N   1 
ATOM   1829 C  CA  . ASP A 1 270 ? -12.470 -23.142 -34.787 1.00 25.18 ? 422  ASP A CA  1 
ATOM   1830 C  C   . ASP A 1 270 ? -11.964 -22.574 -36.119 1.00 24.72 ? 422  ASP A C   1 
ATOM   1831 O  O   . ASP A 1 270 ? -12.625 -22.642 -37.154 1.00 24.55 ? 422  ASP A O   1 
ATOM   1832 C  CB  . ASP A 1 270 ? -13.825 -23.865 -34.891 1.00 25.20 ? 422  ASP A CB  1 
ATOM   1833 C  CG  . ASP A 1 270 ? -14.267 -24.480 -33.551 1.00 26.01 ? 422  ASP A CG  1 
ATOM   1834 O  OD1 . ASP A 1 270 ? -13.401 -24.916 -32.756 1.00 26.14 ? 422  ASP A OD1 1 
ATOM   1835 O  OD2 . ASP A 1 270 ? -15.485 -24.529 -33.283 1.00 27.79 ? 422  ASP A OD2 1 
ATOM   1836 N  N   . VAL A 1 271 ? -10.756 -22.025 -36.054 1.00 24.27 ? 423  VAL A N   1 
ATOM   1837 C  CA  . VAL A 1 271 ? -10.164 -21.281 -37.146 1.00 23.73 ? 423  VAL A CA  1 
ATOM   1838 C  C   . VAL A 1 271 ? -8.696  -21.729 -37.339 1.00 23.72 ? 423  VAL A C   1 
ATOM   1839 O  O   . VAL A 1 271 ? -8.061  -21.404 -38.344 1.00 23.74 ? 423  VAL A O   1 
ATOM   1840 C  CB  . VAL A 1 271 ? -10.346 -19.753 -36.886 1.00 23.66 ? 423  VAL A CB  1 
ATOM   1841 C  CG1 . VAL A 1 271 ? -9.076  -19.105 -36.355 1.00 23.33 ? 423  VAL A CG1 1 
ATOM   1842 C  CG2 . VAL A 1 271 ? -10.842 -19.049 -38.120 1.00 23.27 ? 423  VAL A CG2 1 
ATOM   1843 N  N   . ILE A 1 272 ? -8.185  -22.489 -36.366 1.00 23.81 ? 424  ILE A N   1 
ATOM   1844 C  CA  . ILE A 1 272 ? -6.898  -23.192 -36.446 1.00 23.72 ? 424  ILE A CA  1 
ATOM   1845 C  C   . ILE A 1 272 ? -7.136  -24.585 -37.013 1.00 24.10 ? 424  ILE A C   1 
ATOM   1846 O  O   . ILE A 1 272 ? -8.056  -25.277 -36.581 1.00 24.09 ? 424  ILE A O   1 
ATOM   1847 C  CB  . ILE A 1 272 ? -6.271  -23.398 -35.039 1.00 23.63 ? 424  ILE A CB  1 
ATOM   1848 C  CG1 . ILE A 1 272 ? -6.105  -22.073 -34.297 1.00 23.55 ? 424  ILE A CG1 1 
ATOM   1849 C  CG2 . ILE A 1 272 ? -4.930  -24.130 -35.129 1.00 23.19 ? 424  ILE A CG2 1 
ATOM   1850 C  CD1 . ILE A 1 272 ? -5.745  -22.227 -32.830 1.00 23.36 ? 424  ILE A CD1 1 
ATOM   1851 N  N   . ASN A 1 273 ? -6.315  -25.007 -37.969 1.00 24.64 ? 425  ASN A N   1 
ATOM   1852 C  CA  . ASN A 1 273 ? -6.410  -26.376 -38.471 1.00 25.15 ? 425  ASN A CA  1 
ATOM   1853 C  C   . ASN A 1 273 ? -5.690  -27.328 -37.521 1.00 25.86 ? 425  ASN A C   1 
ATOM   1854 O  O   . ASN A 1 273 ? -4.452  -27.373 -37.476 1.00 25.85 ? 425  ASN A O   1 
ATOM   1855 C  CB  . ASN A 1 273 ? -5.874  -26.503 -39.901 1.00 25.05 ? 425  ASN A CB  1 
ATOM   1856 C  CG  . ASN A 1 273 ? -6.668  -25.677 -40.906 1.00 24.90 ? 425  ASN A CG  1 
ATOM   1857 O  OD1 . ASN A 1 273 ? -7.897  -25.658 -40.885 1.00 25.12 ? 425  ASN A OD1 1 
ATOM   1858 N  ND2 . ASN A 1 273 ? -5.962  -24.994 -41.795 1.00 24.27 ? 425  ASN A ND2 1 
ATOM   1859 N  N   . GLU A 1 274 ? -6.483  -28.084 -36.760 1.00 26.47 ? 426  GLU A N   1 
ATOM   1860 C  CA  . GLU A 1 274 ? -5.960  -28.976 -35.728 1.00 26.89 ? 426  GLU A CA  1 
ATOM   1861 C  C   . GLU A 1 274 ? -5.185  -30.179 -36.283 1.00 26.91 ? 426  GLU A C   1 
ATOM   1862 O  O   . GLU A 1 274 ? -4.571  -30.925 -35.518 1.00 27.15 ? 426  GLU A O   1 
ATOM   1863 C  CB  . GLU A 1 274 ? -7.063  -29.407 -34.739 1.00 27.09 ? 426  GLU A CB  1 
ATOM   1864 C  CG  . GLU A 1 274 ? -8.199  -30.255 -35.315 1.00 27.78 ? 426  GLU A CG  1 
ATOM   1865 C  CD  . GLU A 1 274 ? -9.281  -29.432 -36.008 1.00 29.32 ? 426  GLU A CD  1 
ATOM   1866 O  OE1 . GLU A 1 274 ? -10.123 -30.035 -36.709 1.00 30.43 ? 426  GLU A OE1 1 
ATOM   1867 O  OE2 . GLU A 1 274 ? -9.294  -28.190 -35.859 1.00 29.61 ? 426  GLU A OE2 1 
ATOM   1868 N  N   . ALA A 1 275 ? -5.192  -30.347 -37.605 1.00 26.79 ? 427  ALA A N   1 
ATOM   1869 C  CA  . ALA A 1 275 ? -4.392  -31.388 -38.268 1.00 26.76 ? 427  ALA A CA  1 
ATOM   1870 C  C   . ALA A 1 275 ? -2.889  -31.204 -38.019 1.00 26.70 ? 427  ALA A C   1 
ATOM   1871 O  O   . ALA A 1 275 ? -2.118  -32.162 -38.051 1.00 26.49 ? 427  ALA A O   1 
ATOM   1872 C  CB  . ALA A 1 275 ? -4.688  -31.410 -39.764 1.00 26.56 ? 427  ALA A CB  1 
ATOM   1873 N  N   . TRP A 1 276 ? -2.496  -29.959 -37.763 1.00 26.86 ? 428  TRP A N   1 
ATOM   1874 C  CA  . TRP A 1 276 ? -1.112  -29.583 -37.498 1.00 27.03 ? 428  TRP A CA  1 
ATOM   1875 C  C   . TRP A 1 276 ? -0.581  -30.179 -36.197 1.00 27.17 ? 428  TRP A C   1 
ATOM   1876 O  O   . TRP A 1 276 ? 0.618   -30.456 -36.087 1.00 27.24 ? 428  TRP A O   1 
ATOM   1877 C  CB  . TRP A 1 276 ? -1.016  -28.061 -37.446 1.00 27.08 ? 428  TRP A CB  1 
ATOM   1878 C  CG  . TRP A 1 276 ? 0.371   -27.505 -37.369 1.00 27.18 ? 428  TRP A CG  1 
ATOM   1879 C  CD1 . TRP A 1 276 ? 1.131   -27.062 -38.413 1.00 26.94 ? 428  TRP A CD1 1 
ATOM   1880 C  CD2 . TRP A 1 276 ? 1.153   -27.294 -36.184 1.00 27.00 ? 428  TRP A CD2 1 
ATOM   1881 N  NE1 . TRP A 1 276 ? 2.339   -26.600 -37.957 1.00 27.00 ? 428  TRP A NE1 1 
ATOM   1882 C  CE2 . TRP A 1 276 ? 2.381   -26.725 -36.593 1.00 27.24 ? 428  TRP A CE2 1 
ATOM   1883 C  CE3 . TRP A 1 276 ? 0.938   -27.532 -34.818 1.00 27.01 ? 428  TRP A CE3 1 
ATOM   1884 C  CZ2 . TRP A 1 276 ? 3.398   -26.390 -35.682 1.00 27.33 ? 428  TRP A CZ2 1 
ATOM   1885 C  CZ3 . TRP A 1 276 ? 1.951   -27.199 -33.910 1.00 27.08 ? 428  TRP A CZ3 1 
ATOM   1886 C  CH2 . TRP A 1 276 ? 3.164   -26.634 -34.350 1.00 27.18 ? 428  TRP A CH2 1 
ATOM   1887 N  N   . PHE A 1 277 ? -1.470  -30.348 -35.215 1.00 27.13 ? 429  PHE A N   1 
ATOM   1888 C  CA  . PHE A 1 277 ? -1.121  -30.960 -33.930 1.00 27.14 ? 429  PHE A CA  1 
ATOM   1889 C  C   . PHE A 1 277 ? -1.023  -32.480 -34.081 1.00 27.36 ? 429  PHE A C   1 
ATOM   1890 O  O   . PHE A 1 277 ? -1.590  -33.037 -35.021 1.00 27.37 ? 429  PHE A O   1 
ATOM   1891 C  CB  . PHE A 1 277 ? -2.179  -30.634 -32.867 1.00 26.85 ? 429  PHE A CB  1 
ATOM   1892 C  CG  . PHE A 1 277 ? -2.473  -29.168 -32.717 1.00 26.48 ? 429  PHE A CG  1 
ATOM   1893 C  CD1 . PHE A 1 277 ? -1.471  -28.270 -32.371 1.00 25.64 ? 429  PHE A CD1 1 
ATOM   1894 C  CD2 . PHE A 1 277 ? -3.766  -28.687 -32.898 1.00 26.55 ? 429  PHE A CD2 1 
ATOM   1895 C  CE1 . PHE A 1 277 ? -1.750  -26.911 -32.223 1.00 25.64 ? 429  PHE A CE1 1 
ATOM   1896 C  CE2 . PHE A 1 277 ? -4.055  -27.324 -32.749 1.00 25.96 ? 429  PHE A CE2 1 
ATOM   1897 C  CZ  . PHE A 1 277 ? -3.047  -26.438 -32.413 1.00 25.47 ? 429  PHE A CZ  1 
ATOM   1898 N  N   . PRO A 1 278 ? -0.294  -33.158 -33.167 1.00 27.67 ? 430  PRO A N   1 
ATOM   1899 C  CA  . PRO A 1 278 ? -0.334  -34.627 -33.151 1.00 27.89 ? 430  PRO A CA  1 
ATOM   1900 C  C   . PRO A 1 278 ? -1.752  -35.144 -32.887 1.00 28.18 ? 430  PRO A C   1 
ATOM   1901 O  O   . PRO A 1 278 ? -2.525  -34.498 -32.173 1.00 28.16 ? 430  PRO A O   1 
ATOM   1902 C  CB  . PRO A 1 278 ? 0.598   -34.991 -31.990 1.00 27.78 ? 430  PRO A CB  1 
ATOM   1903 C  CG  . PRO A 1 278 ? 1.490   -33.808 -31.834 1.00 27.52 ? 430  PRO A CG  1 
ATOM   1904 C  CD  . PRO A 1 278 ? 0.615   -32.635 -32.132 1.00 27.50 ? 430  PRO A CD  1 
ATOM   1905 N  N   . GLU A 1 279 ? -2.087  -36.290 -33.468 1.00 28.54 ? 431  GLU A N   1 
ATOM   1906 C  CA  . GLU A 1 279 ? -3.438  -36.837 -33.364 1.00 29.17 ? 431  GLU A CA  1 
ATOM   1907 C  C   . GLU A 1 279 ? -3.981  -36.776 -31.928 1.00 29.13 ? 431  GLU A C   1 
ATOM   1908 O  O   . GLU A 1 279 ? -5.003  -36.138 -31.672 1.00 29.30 ? 431  GLU A O   1 
ATOM   1909 C  CB  . GLU A 1 279 ? -3.480  -38.268 -33.911 1.00 29.00 ? 431  GLU A CB  1 
ATOM   1910 C  CG  . GLU A 1 279 ? -4.873  -38.770 -34.273 1.00 29.53 ? 431  GLU A CG  1 
ATOM   1911 C  CD  . GLU A 1 279 ? -4.884  -40.233 -34.720 1.00 30.12 ? 431  GLU A CD  1 
ATOM   1912 O  OE1 . GLU A 1 279 ? -3.888  -40.954 -34.476 1.00 31.61 ? 431  GLU A OE1 1 
ATOM   1913 O  OE2 . GLU A 1 279 ? -5.898  -40.671 -35.310 1.00 31.09 ? 431  GLU A OE2 1 
ATOM   1914 N  N   . ASP A 1 280 ? -3.271  -37.408 -30.995 1.00 29.19 ? 432  ASP A N   1 
ATOM   1915 C  CA  . ASP A 1 280 ? -3.714  -37.512 -29.600 1.00 29.26 ? 432  ASP A CA  1 
ATOM   1916 C  C   . ASP A 1 280 ? -3.738  -36.186 -28.837 1.00 29.27 ? 432  ASP A C   1 
ATOM   1917 O  O   . ASP A 1 280 ? -4.130  -36.147 -27.673 1.00 29.43 ? 432  ASP A O   1 
ATOM   1918 C  CB  . ASP A 1 280 ? -2.879  -38.555 -28.837 1.00 29.28 ? 432  ASP A CB  1 
ATOM   1919 C  CG  . ASP A 1 280 ? -1.378  -38.346 -28.998 1.00 29.87 ? 432  ASP A CG  1 
ATOM   1920 O  OD1 . ASP A 1 280 ? -0.893  -38.333 -30.152 1.00 31.36 ? 432  ASP A OD1 1 
ATOM   1921 O  OD2 . ASP A 1 280 ? -0.678  -38.210 -27.973 1.00 29.34 ? 432  ASP A OD2 1 
ATOM   1922 N  N   . GLN A 1 281 ? -3.331  -35.100 -29.485 1.00 29.23 ? 433  GLN A N   1 
ATOM   1923 C  CA  . GLN A 1 281 ? -3.364  -33.782 -28.845 1.00 29.13 ? 433  GLN A CA  1 
ATOM   1924 C  C   . GLN A 1 281 ? -4.466  -32.878 -29.402 1.00 28.87 ? 433  GLN A C   1 
ATOM   1925 O  O   . GLN A 1 281 ? -4.705  -31.785 -28.876 1.00 28.95 ? 433  GLN A O   1 
ATOM   1926 C  CB  . GLN A 1 281 ? -1.998  -33.089 -28.942 1.00 29.15 ? 433  GLN A CB  1 
ATOM   1927 C  CG  . GLN A 1 281 ? -0.885  -33.772 -28.147 1.00 29.66 ? 433  GLN A CG  1 
ATOM   1928 C  CD  . GLN A 1 281 ? -0.901  -33.435 -26.660 1.00 30.23 ? 433  GLN A CD  1 
ATOM   1929 O  OE1 . GLN A 1 281 ? -1.837  -32.824 -26.149 1.00 30.59 ? 433  GLN A OE1 1 
ATOM   1930 N  NE2 . GLN A 1 281 ? 0.147   -33.841 -25.960 1.00 30.90 ? 433  GLN A NE2 1 
ATOM   1931 N  N   . ARG A 1 282 ? -5.145  -33.350 -30.447 1.00 28.41 ? 434  ARG A N   1 
ATOM   1932 C  CA  . ARG A 1 282 ? -6.127  -32.541 -31.175 1.00 27.83 ? 434  ARG A CA  1 
ATOM   1933 C  C   . ARG A 1 282 ? -7.371  -32.196 -30.376 1.00 27.82 ? 434  ARG A C   1 
ATOM   1934 O  O   . ARG A 1 282 ? -7.717  -31.020 -30.246 1.00 27.96 ? 434  ARG A O   1 
ATOM   1935 C  CB  . ARG A 1 282 ? -6.523  -33.225 -32.479 1.00 27.69 ? 434  ARG A CB  1 
ATOM   1936 C  CG  . ARG A 1 282 ? -5.486  -33.070 -33.545 1.00 26.37 ? 434  ARG A CG  1 
ATOM   1937 C  CD  . ARG A 1 282 ? -5.770  -33.933 -34.727 1.00 23.89 ? 434  ARG A CD  1 
ATOM   1938 N  NE  . ARG A 1 282 ? -4.538  -34.150 -35.465 1.00 22.27 ? 434  ARG A NE  1 
ATOM   1939 C  CZ  . ARG A 1 282 ? -4.378  -35.060 -36.413 1.00 21.73 ? 434  ARG A CZ  1 
ATOM   1940 N  NH1 . ARG A 1 282 ? -5.380  -35.858 -36.761 1.00 21.40 ? 434  ARG A NH1 1 
ATOM   1941 N  NH2 . ARG A 1 282 ? -3.204  -35.170 -37.012 1.00 21.90 ? 434  ARG A NH2 1 
ATOM   1942 N  N   . VAL A 1 283 ? -8.032  -33.224 -29.853 1.00 27.63 ? 435  VAL A N   1 
ATOM   1943 C  CA  . VAL A 1 283 ? -9.241  -33.069 -29.044 1.00 27.55 ? 435  VAL A CA  1 
ATOM   1944 C  C   . VAL A 1 283 ? -9.051  -32.099 -27.873 1.00 27.51 ? 435  VAL A C   1 
ATOM   1945 O  O   . VAL A 1 283 ? -9.940  -31.302 -27.570 1.00 27.63 ? 435  VAL A O   1 
ATOM   1946 C  CB  . VAL A 1 283 ? -9.728  -34.441 -28.520 1.00 27.59 ? 435  VAL A CB  1 
ATOM   1947 C  CG1 . VAL A 1 283 ? -10.859 -34.278 -27.510 1.00 27.68 ? 435  VAL A CG1 1 
ATOM   1948 C  CG2 . VAL A 1 283 ? -10.166 -35.325 -29.682 1.00 27.40 ? 435  VAL A CG2 1 
ATOM   1949 N  N   . LEU A 1 284 ? -7.884  -32.151 -27.238 1.00 27.30 ? 436  LEU A N   1 
ATOM   1950 C  CA  . LEU A 1 284 ? -7.649  -31.394 -26.010 1.00 27.15 ? 436  LEU A CA  1 
ATOM   1951 C  C   . LEU A 1 284 ? -7.057  -29.996 -26.198 1.00 26.85 ? 436  LEU A C   1 
ATOM   1952 O  O   . LEU A 1 284 ? -7.156  -29.164 -25.293 1.00 26.67 ? 436  LEU A O   1 
ATOM   1953 C  CB  . LEU A 1 284 ? -6.779  -32.206 -25.047 1.00 27.44 ? 436  LEU A CB  1 
ATOM   1954 C  CG  . LEU A 1 284 ? -7.367  -33.505 -24.494 1.00 27.43 ? 436  LEU A CG  1 
ATOM   1955 C  CD1 . LEU A 1 284 ? -6.233  -34.458 -24.135 1.00 27.91 ? 436  LEU A CD1 1 
ATOM   1956 C  CD2 . LEU A 1 284 ? -8.291  -33.245 -23.298 1.00 26.96 ? 436  LEU A CD2 1 
ATOM   1957 N  N   . THR A 1 285 ? -6.439  -29.740 -27.353 1.00 26.47 ? 437  THR A N   1 
ATOM   1958 C  CA  . THR A 1 285 ? -5.898  -28.413 -27.654 1.00 25.96 ? 437  THR A CA  1 
ATOM   1959 C  C   . THR A 1 285 ? -7.030  -27.474 -28.054 1.00 25.75 ? 437  THR A C   1 
ATOM   1960 O  O   . THR A 1 285 ? -7.682  -27.696 -29.071 1.00 25.69 ? 437  THR A O   1 
ATOM   1961 C  CB  . THR A 1 285 ? -4.834  -28.438 -28.778 1.00 25.91 ? 437  THR A CB  1 
ATOM   1962 O  OG1 . THR A 1 285 ? -3.760  -29.308 -28.414 1.00 25.79 ? 437  THR A OG1 1 
ATOM   1963 C  CG2 . THR A 1 285 ? -4.270  -27.050 -29.006 1.00 25.77 ? 437  THR A CG2 1 
ATOM   1964 N  N   . PRO A 1 286 ? -7.261  -26.416 -27.254 1.00 25.72 ? 438  PRO A N   1 
ATOM   1965 C  CA  . PRO A 1 286 ? -8.339  -25.470 -27.532 1.00 25.64 ? 438  PRO A CA  1 
ATOM   1966 C  C   . PRO A 1 286 ? -8.151  -24.797 -28.885 1.00 25.53 ? 438  PRO A C   1 
ATOM   1967 O  O   . PRO A 1 286 ? -7.043  -24.371 -29.210 1.00 25.73 ? 438  PRO A O   1 
ATOM   1968 C  CB  . PRO A 1 286 ? -8.201  -24.440 -26.401 1.00 25.47 ? 438  PRO A CB  1 
ATOM   1969 C  CG  . PRO A 1 286 ? -6.806  -24.582 -25.929 1.00 25.54 ? 438  PRO A CG  1 
ATOM   1970 C  CD  . PRO A 1 286 ? -6.510  -26.033 -26.046 1.00 25.64 ? 438  PRO A CD  1 
ATOM   1971 N  N   . ASN A 1 287 ? -9.219  -24.730 -29.673 1.00 25.33 ? 439  ASN A N   1 
ATOM   1972 C  CA  . ASN A 1 287 ? -9.172  -24.035 -30.944 1.00 25.18 ? 439  ASN A CA  1 
ATOM   1973 C  C   . ASN A 1 287 ? -9.606  -22.579 -30.779 1.00 25.10 ? 439  ASN A C   1 
ATOM   1974 O  O   . ASN A 1 287 ? -10.706 -22.198 -31.187 1.00 25.12 ? 439  ASN A O   1 
ATOM   1975 C  CB  . ASN A 1 287 ? -10.020 -24.757 -31.987 1.00 25.20 ? 439  ASN A CB  1 
ATOM   1976 C  CG  . ASN A 1 287 ? -9.644  -24.379 -33.411 1.00 25.83 ? 439  ASN A CG  1 
ATOM   1977 O  OD1 . ASN A 1 287 ? -9.478  -23.201 -33.742 1.00 26.51 ? 439  ASN A OD1 1 
ATOM   1978 N  ND2 . ASN A 1 287 ? -9.517  -25.382 -34.266 1.00 26.41 ? 439  ASN A ND2 1 
ATOM   1979 N  N   . LEU A 1 288 ? -8.723  -21.776 -30.185 1.00 25.02 ? 440  LEU A N   1 
ATOM   1980 C  CA  . LEU A 1 288 ? -9.031  -20.392 -29.816 1.00 25.01 ? 440  LEU A CA  1 
ATOM   1981 C  C   . LEU A 1 288 ? -7.893  -19.434 -30.145 1.00 25.19 ? 440  LEU A C   1 
ATOM   1982 O  O   . LEU A 1 288 ? -6.733  -19.691 -29.812 1.00 25.07 ? 440  LEU A O   1 
ATOM   1983 C  CB  . LEU A 1 288 ? -9.348  -20.296 -28.316 1.00 24.80 ? 440  LEU A CB  1 
ATOM   1984 C  CG  . LEU A 1 288 ? -10.462 -21.175 -27.736 1.00 24.36 ? 440  LEU A CG  1 
ATOM   1985 C  CD1 . LEU A 1 288 ? -10.339 -21.276 -26.231 1.00 23.74 ? 440  LEU A CD1 1 
ATOM   1986 C  CD2 . LEU A 1 288 ? -11.833 -20.664 -28.125 1.00 24.54 ? 440  LEU A CD2 1 
ATOM   1987 N  N   . VAL A 1 289 ? -8.230  -18.327 -30.797 1.00 25.41 ? 441  VAL A N   1 
ATOM   1988 C  CA  . VAL A 1 289 ? -7.265  -17.260 -31.044 1.00 25.84 ? 441  VAL A CA  1 
ATOM   1989 C  C   . VAL A 1 289 ? -7.775  -15.987 -30.371 1.00 26.38 ? 441  VAL A C   1 
ATOM   1990 O  O   . VAL A 1 289 ? -8.895  -15.545 -30.640 1.00 26.45 ? 441  VAL A O   1 
ATOM   1991 C  CB  . VAL A 1 289 ? -7.013  -17.025 -32.558 1.00 25.76 ? 441  VAL A CB  1 
ATOM   1992 C  CG1 . VAL A 1 289 ? -5.903  -15.999 -32.764 1.00 25.54 ? 441  VAL A CG1 1 
ATOM   1993 C  CG2 . VAL A 1 289 ? -6.653  -18.328 -33.260 1.00 25.31 ? 441  VAL A CG2 1 
ATOM   1994 N  N   . ALA A 1 290 ? -6.947  -15.410 -29.502 1.00 26.89 ? 442  ALA A N   1 
ATOM   1995 C  CA  . ALA A 1 290 ? -7.351  -14.303 -28.626 1.00 27.54 ? 442  ALA A CA  1 
ATOM   1996 C  C   . ALA A 1 290 ? -7.860  -13.092 -29.390 1.00 28.04 ? 442  ALA A C   1 
ATOM   1997 O  O   . ALA A 1 290 ? -7.458  -12.856 -30.528 1.00 28.11 ? 442  ALA A O   1 
ATOM   1998 C  CB  . ALA A 1 290 ? -6.193  -13.895 -27.715 1.00 27.40 ? 442  ALA A CB  1 
ATOM   1999 N  N   . ALA A 1 291 ? -8.749  -12.334 -28.750 1.00 28.86 ? 443  ALA A N   1 
ATOM   2000 C  CA  . ALA A 1 291 ? -9.280  -11.088 -29.307 1.00 29.44 ? 443  ALA A CA  1 
ATOM   2001 C  C   . ALA A 1 291 ? -9.872  -10.200 -28.214 1.00 30.04 ? 443  ALA A C   1 
ATOM   2002 O  O   . ALA A 1 291 ? -10.463 -10.692 -27.256 1.00 30.03 ? 443  ALA A O   1 
ATOM   2003 C  CB  . ALA A 1 291 ? -10.325 -11.383 -30.376 1.00 29.16 ? 443  ALA A CB  1 
ATOM   2004 N  N   . LEU A 1 292 ? -9.709  -8.890  -28.374 1.00 31.00 ? 444  LEU A N   1 
ATOM   2005 C  CA  . LEU A 1 292 ? -10.323 -7.898  -27.493 1.00 31.98 ? 444  LEU A CA  1 
ATOM   2006 C  C   . LEU A 1 292 ? -11.849 -7.922  -27.586 1.00 32.84 ? 444  LEU A C   1 
ATOM   2007 O  O   . LEU A 1 292 ? -12.401 -8.311  -28.619 1.00 32.90 ? 444  LEU A O   1 
ATOM   2008 C  CB  . LEU A 1 292 ? -9.833  -6.499  -27.868 1.00 31.87 ? 444  LEU A CB  1 
ATOM   2009 C  CG  . LEU A 1 292 ? -8.376  -6.147  -27.590 1.00 31.71 ? 444  LEU A CG  1 
ATOM   2010 C  CD1 . LEU A 1 292 ? -7.943  -4.979  -28.471 1.00 31.41 ? 444  LEU A CD1 1 
ATOM   2011 C  CD2 . LEU A 1 292 ? -8.184  -5.834  -26.113 1.00 31.33 ? 444  LEU A CD2 1 
ATOM   2012 N  N   . PRO A 1 293 ? -12.538 -7.509  -26.505 1.00 33.80 ? 445  PRO A N   1 
ATOM   2013 C  CA  . PRO A 1 293 ? -13.991 -7.286  -26.584 1.00 34.60 ? 445  PRO A CA  1 
ATOM   2014 C  C   . PRO A 1 293 ? -14.332 -6.052  -27.437 1.00 35.32 ? 445  PRO A C   1 
ATOM   2015 O  O   . PRO A 1 293 ? -13.502 -5.139  -27.544 1.00 35.60 ? 445  PRO A O   1 
ATOM   2016 C  CB  . PRO A 1 293 ? -14.392 -7.051  -25.122 1.00 34.44 ? 445  PRO A CB  1 
ATOM   2017 C  CG  . PRO A 1 293 ? -13.153 -6.542  -24.466 1.00 34.36 ? 445  PRO A CG  1 
ATOM   2018 C  CD  . PRO A 1 293 ? -12.013 -7.251  -25.150 1.00 33.96 ? 445  PRO A CD  1 
ATOM   2019 N  N   . PRO A 1 294 ? -15.531 -6.028  -28.058 1.00 35.82 ? 446  PRO A N   1 
ATOM   2020 C  CA  . PRO A 1 294 ? -16.017 -4.865  -28.819 1.00 36.20 ? 446  PRO A CA  1 
ATOM   2021 C  C   . PRO A 1 294 ? -15.982 -3.528  -28.051 1.00 36.61 ? 446  PRO A C   1 
ATOM   2022 O  O   . PRO A 1 294 ? -15.926 -3.521  -26.817 1.00 36.61 ? 446  PRO A O   1 
ATOM   2023 C  CB  . PRO A 1 294 ? -17.465 -5.249  -29.144 1.00 36.15 ? 446  PRO A CB  1 
ATOM   2024 C  CG  . PRO A 1 294 ? -17.448 -6.730  -29.200 1.00 35.98 ? 446  PRO A CG  1 
ATOM   2025 C  CD  . PRO A 1 294 ? -16.496 -7.143  -28.106 1.00 35.91 ? 446  PRO A CD  1 
ATOM   2026 N  N   . SER A 1 295 ? -16.007 -2.415  -28.793 1.00 37.15 ? 447  SER A N   1 
ATOM   2027 C  CA  . SER A 1 295 ? -16.065 -1.060  -28.215 1.00 37.43 ? 447  SER A CA  1 
ATOM   2028 C  C   . SER A 1 295 ? -17.503 -0.613  -27.943 1.00 37.44 ? 447  SER A C   1 
ATOM   2029 O  O   . SER A 1 295 ? -17.808 -0.098  -26.866 1.00 37.40 ? 447  SER A O   1 
ATOM   2030 C  CB  . SER A 1 295 ? -15.364 -0.038  -29.123 1.00 37.50 ? 447  SER A CB  1 
ATOM   2031 O  OG  . SER A 1 295 ? -14.038 0.218   -28.686 1.00 37.36 ? 447  SER A OG  1 
ATOM   2032 N  N   . ASN B 2 20  ? 4.074   12.253  -58.501 1.00 32.39 ? 285  ASN E N   1 
ATOM   2033 C  CA  . ASN B 2 20  ? 3.581   13.171  -57.439 1.00 32.23 ? 285  ASN E CA  1 
ATOM   2034 C  C   . ASN B 2 20  ? 4.396   14.480  -57.322 1.00 32.03 ? 285  ASN E C   1 
ATOM   2035 O  O   . ASN B 2 20  ? 3.814   15.557  -57.507 1.00 32.12 ? 285  ASN E O   1 
ATOM   2036 C  CB  . ASN B 2 20  ? 3.455   12.438  -56.082 1.00 32.33 ? 285  ASN E CB  1 
ATOM   2037 N  N   . LEU B 2 21  ? 5.713   14.437  -57.053 1.00 31.44 ? 286  LEU E N   1 
ATOM   2038 C  CA  . LEU B 2 21  ? 6.553   13.235  -56.886 1.00 30.66 ? 286  LEU E CA  1 
ATOM   2039 C  C   . LEU B 2 21  ? 6.798   12.968  -55.400 1.00 30.20 ? 286  LEU E C   1 
ATOM   2040 O  O   . LEU B 2 21  ? 6.328   13.721  -54.551 1.00 30.31 ? 286  LEU E O   1 
ATOM   2041 C  CB  . LEU B 2 21  ? 7.913   13.450  -57.561 1.00 30.63 ? 286  LEU E CB  1 
ATOM   2042 C  CG  . LEU B 2 21  ? 8.009   14.200  -58.891 1.00 30.45 ? 286  LEU E CG  1 
ATOM   2043 C  CD1 . LEU B 2 21  ? 8.909   15.418  -58.758 1.00 30.33 ? 286  LEU E CD1 1 
ATOM   2044 C  CD2 . LEU B 2 21  ? 8.490   13.287  -60.003 1.00 30.07 ? 286  LEU E CD2 1 
ATOM   2045 N  N   . TYR B 2 22  ? 7.538   11.904  -55.091 1.00 29.57 ? 287  TYR E N   1 
ATOM   2046 C  CA  . TYR B 2 22  ? 7.953   11.605  -53.715 1.00 28.88 ? 287  TYR E CA  1 
ATOM   2047 C  C   . TYR B 2 22  ? 9.182   12.433  -53.343 1.00 28.83 ? 287  TYR E C   1 
ATOM   2048 O  O   . TYR B 2 22  ? 10.091  12.608  -54.155 1.00 28.97 ? 287  TYR E O   1 
ATOM   2049 C  CB  . TYR B 2 22  ? 8.261   10.115  -53.558 1.00 28.47 ? 287  TYR E CB  1 
ATOM   2050 C  CG  . TYR B 2 22  ? 8.568   9.673   -52.145 1.00 27.77 ? 287  TYR E CG  1 
ATOM   2051 C  CD1 . TYR B 2 22  ? 9.844   9.829   -51.608 1.00 27.61 ? 287  TYR E CD1 1 
ATOM   2052 C  CD2 . TYR B 2 22  ? 7.592   9.076   -51.353 1.00 27.23 ? 287  TYR E CD2 1 
ATOM   2053 C  CE1 . TYR B 2 22  ? 10.142  9.419   -50.309 1.00 26.81 ? 287  TYR E CE1 1 
ATOM   2054 C  CE2 . TYR B 2 22  ? 7.883   8.655   -50.051 1.00 27.35 ? 287  TYR E CE2 1 
ATOM   2055 C  CZ  . TYR B 2 22  ? 9.161   8.835   -49.539 1.00 27.42 ? 287  TYR E CZ  1 
ATOM   2056 O  OH  . TYR B 2 22  ? 9.467   8.430   -48.257 1.00 27.95 ? 287  TYR E OH  1 
ATOM   2057 N  N   . PHE B 2 23  ? 9.200   12.948  -52.118 1.00 28.57 ? 288  PHE E N   1 
ATOM   2058 C  CA  . PHE B 2 23  ? 10.336  13.708  -51.632 1.00 28.32 ? 288  PHE E CA  1 
ATOM   2059 C  C   . PHE B 2 23  ? 11.014  12.965  -50.486 1.00 28.42 ? 288  PHE E C   1 
ATOM   2060 O  O   . PHE B 2 23  ? 11.923  12.167  -50.724 1.00 28.16 ? 288  PHE E O   1 
ATOM   2061 C  CB  . PHE B 2 23  ? 9.907   15.112  -51.225 1.00 28.10 ? 288  PHE E CB  1 
ATOM   2062 C  CG  . PHE B 2 23  ? 11.044  16.012  -50.845 1.00 28.25 ? 288  PHE E CG  1 
ATOM   2063 C  CD1 . PHE B 2 23  ? 12.277  15.920  -51.484 1.00 28.19 ? 288  PHE E CD1 1 
ATOM   2064 C  CD2 . PHE B 2 23  ? 10.871  16.991  -49.870 1.00 28.64 ? 288  PHE E CD2 1 
ATOM   2065 C  CE1 . PHE B 2 23  ? 13.326  16.776  -51.133 1.00 28.37 ? 288  PHE E CE1 1 
ATOM   2066 C  CE2 . PHE B 2 23  ? 11.914  17.850  -49.514 1.00 27.74 ? 288  PHE E CE2 1 
ATOM   2067 C  CZ  . PHE B 2 23  ? 13.140  17.741  -50.144 1.00 27.71 ? 288  PHE E CZ  1 
ATOM   2068 N  N   . GLN B 2 24  ? 10.574  13.217  -49.253 1.00 28.67 ? 289  GLN E N   1 
ATOM   2069 C  CA  . GLN B 2 24  ? 11.138  12.531  -48.091 1.00 28.90 ? 289  GLN E CA  1 
ATOM   2070 C  C   . GLN B 2 24  ? 10.086  11.767  -47.286 1.00 29.32 ? 289  GLN E C   1 
ATOM   2071 O  O   . GLN B 2 24  ? 10.386  11.180  -46.240 1.00 29.38 ? 289  GLN E O   1 
ATOM   2072 C  CB  . GLN B 2 24  ? 11.917  13.506  -47.213 1.00 28.63 ? 289  GLN E CB  1 
ATOM   2073 C  CG  . GLN B 2 24  ? 13.155  14.068  -47.894 1.00 28.65 ? 289  GLN E CG  1 
ATOM   2074 C  CD  . GLN B 2 24  ? 13.892  15.083  -47.045 1.00 28.90 ? 289  GLN E CD  1 
ATOM   2075 O  OE1 . GLN B 2 24  ? 13.284  15.898  -46.353 1.00 29.20 ? 289  GLN E OE1 1 
ATOM   2076 N  NE2 . GLN B 2 24  ? 15.212  15.044  -47.104 1.00 29.14 ? 289  GLN E NE2 1 
ATOM   2077 N  N   . GLY B 2 25  ? 8.861   11.749  -47.802 1.00 29.86 ? 290  GLY E N   1 
ATOM   2078 C  CA  . GLY B 2 25  ? 7.743   11.097  -47.125 1.00 30.30 ? 290  GLY E CA  1 
ATOM   2079 C  C   . GLY B 2 25  ? 7.119   12.020  -46.099 1.00 30.65 ? 290  GLY E C   1 
ATOM   2080 O  O   . GLY B 2 25  ? 7.530   13.179  -45.963 1.00 30.69 ? 290  GLY E O   1 
ATOM   2081 N  N   . ALA B 2 26  ? 6.132   11.501  -45.372 1.00 30.85 ? 291  ALA E N   1 
ATOM   2082 C  CA  . ALA B 2 26  ? 5.341   12.302  -44.441 1.00 31.13 ? 291  ALA E CA  1 
ATOM   2083 C  C   . ALA B 2 26  ? 6.101   12.643  -43.160 1.00 31.41 ? 291  ALA E C   1 
ATOM   2084 O  O   . ALA B 2 26  ? 7.124   12.029  -42.851 1.00 31.43 ? 291  ALA E O   1 
ATOM   2085 C  CB  . ALA B 2 26  ? 4.028   11.588  -44.119 1.00 30.98 ? 291  ALA E CB  1 
ATOM   2086 N  N   . MET B 2 27  ? 5.606   13.641  -42.433 1.00 31.83 ? 292  MET E N   1 
ATOM   2087 C  CA  . MET B 2 27  ? 6.112   13.945  -41.101 1.00 32.46 ? 292  MET E CA  1 
ATOM   2088 C  C   . MET B 2 27  ? 5.151   13.381  -40.065 1.00 32.29 ? 292  MET E C   1 
ATOM   2089 O  O   . MET B 2 27  ? 3.940   13.522  -40.205 1.00 32.34 ? 292  MET E O   1 
ATOM   2090 C  CB  . MET B 2 27  ? 6.277   15.451  -40.911 1.00 32.37 ? 292  MET E CB  1 
ATOM   2091 C  CG  . MET B 2 27  ? 6.807   15.838  -39.544 1.00 32.91 ? 292  MET E CG  1 
ATOM   2092 S  SD  . MET B 2 27  ? 6.946   17.624  -39.332 1.00 33.87 ? 292  MET E SD  1 
ATOM   2093 C  CE  . MET B 2 27  ? 6.940   17.752  -37.536 1.00 33.22 ? 292  MET E CE  1 
ATOM   2094 N  N   . GLY B 2 28  ? 5.696   12.725  -39.043 1.00 32.33 ? 293  GLY E N   1 
ATOM   2095 C  CA  . GLY B 2 28  ? 4.902   12.224  -37.927 1.00 32.29 ? 293  GLY E CA  1 
ATOM   2096 C  C   . GLY B 2 28  ? 4.086   10.976  -38.208 1.00 32.53 ? 293  GLY E C   1 
ATOM   2097 O  O   . GLY B 2 28  ? 3.132   10.682  -37.488 1.00 32.66 ? 293  GLY E O   1 
ATOM   2098 N  N   . THR B 2 29  ? 4.450   10.241  -39.254 1.00 32.59 ? 294  THR E N   1 
ATOM   2099 C  CA  . THR B 2 29  ? 3.826   8.951   -39.534 1.00 32.67 ? 294  THR E CA  1 
ATOM   2100 C  C   . THR B 2 29  ? 4.838   7.861   -39.214 1.00 32.58 ? 294  THR E C   1 
ATOM   2101 O  O   . THR B 2 29  ? 6.014   7.979   -39.571 1.00 32.63 ? 294  THR E O   1 
ATOM   2102 C  CB  . THR B 2 29  ? 3.369   8.822   -41.012 1.00 32.79 ? 294  THR E CB  1 
ATOM   2103 O  OG1 . THR B 2 29  ? 2.767   10.046  -41.445 1.00 33.16 ? 294  THR E OG1 1 
ATOM   2104 C  CG2 . THR B 2 29  ? 2.363   7.683   -41.180 1.00 32.60 ? 294  THR E CG2 1 
ATOM   2105 N  N   . ASN B 2 30  ? 4.383   6.817   -38.528 1.00 32.39 ? 295  ASN E N   1 
ATOM   2106 C  CA  . ASN B 2 30  ? 5.242   5.688   -38.201 1.00 32.44 ? 295  ASN E CA  1 
ATOM   2107 C  C   . ASN B 2 30  ? 5.112   4.606   -39.265 1.00 32.63 ? 295  ASN E C   1 
ATOM   2108 O  O   . ASN B 2 30  ? 4.187   3.792   -39.241 1.00 32.54 ? 295  ASN E O   1 
ATOM   2109 C  CB  . ASN B 2 30  ? 4.927   5.141   -36.802 1.00 32.28 ? 295  ASN E CB  1 
ATOM   2110 C  CG  . ASN B 2 30  ? 6.002   4.191   -36.279 1.00 31.90 ? 295  ASN E CG  1 
ATOM   2111 O  OD1 . ASN B 2 30  ? 6.863   3.717   -37.024 1.00 31.30 ? 295  ASN E OD1 1 
ATOM   2112 N  ND2 . ASN B 2 30  ? 5.948   3.908   -34.984 1.00 31.82 ? 295  ASN E ND2 1 
ATOM   2113 N  N   . GLU B 2 31  ? 6.056   4.608   -40.198 1.00 32.93 ? 296  GLU E N   1 
ATOM   2114 C  CA  . GLU B 2 31  ? 5.999   3.731   -41.361 1.00 33.26 ? 296  GLU E CA  1 
ATOM   2115 C  C   . GLU B 2 31  ? 6.283   2.267   -41.020 1.00 33.41 ? 296  GLU E C   1 
ATOM   2116 O  O   . GLU B 2 31  ? 5.849   1.357   -41.736 1.00 33.49 ? 296  GLU E O   1 
ATOM   2117 C  CB  . GLU B 2 31  ? 6.953   4.231   -42.447 1.00 33.34 ? 296  GLU E CB  1 
ATOM   2118 C  CG  . GLU B 2 31  ? 6.514   5.544   -43.128 1.00 34.08 ? 296  GLU E CG  1 
ATOM   2119 C  CD  . GLU B 2 31  ? 6.886   6.801   -42.342 1.00 34.95 ? 296  GLU E CD  1 
ATOM   2120 O  OE1 . GLU B 2 31  ? 7.669   6.703   -41.369 1.00 35.23 ? 296  GLU E OE1 1 
ATOM   2121 O  OE2 . GLU B 2 31  ? 6.391   7.896   -42.698 1.00 34.90 ? 296  GLU E OE2 1 
ATOM   2122 N  N   . CYS B 2 32  ? 6.996   2.047   -39.917 1.00 33.44 ? 297  CYS E N   1 
ATOM   2123 C  CA  . CYS B 2 32  ? 7.327   0.705   -39.456 1.00 33.37 ? 297  CYS E CA  1 
ATOM   2124 C  C   . CYS B 2 32  ? 6.071   -0.094  -39.114 1.00 33.37 ? 297  CYS E C   1 
ATOM   2125 O  O   . CYS B 2 32  ? 6.094   -1.325  -39.121 1.00 33.24 ? 297  CYS E O   1 
ATOM   2126 C  CB  . CYS B 2 32  ? 8.262   0.779   -38.250 1.00 33.30 ? 297  CYS E CB  1 
ATOM   2127 S  SG  . CYS B 2 32  ? 9.793   1.731   -38.524 1.00 34.05 ? 297  CYS E SG  1 
ATOM   2128 N  N   . LEU B 2 33  ? 4.979   0.615   -38.830 1.00 33.53 ? 298  LEU E N   1 
ATOM   2129 C  CA  . LEU B 2 33  ? 3.684   -0.009  -38.547 1.00 33.78 ? 298  LEU E CA  1 
ATOM   2130 C  C   . LEU B 2 33  ? 3.120   -0.741  -39.767 1.00 33.93 ? 298  LEU E C   1 
ATOM   2131 O  O   . LEU B 2 33  ? 2.172   -1.523  -39.647 1.00 33.82 ? 298  LEU E O   1 
ATOM   2132 C  CB  . LEU B 2 33  ? 2.674   1.027   -38.045 1.00 33.73 ? 298  LEU E CB  1 
ATOM   2133 C  CG  . LEU B 2 33  ? 2.944   1.777   -36.739 1.00 33.78 ? 298  LEU E CG  1 
ATOM   2134 C  CD1 . LEU B 2 33  ? 1.929   2.898   -36.570 1.00 33.91 ? 298  LEU E CD1 1 
ATOM   2135 C  CD2 . LEU B 2 33  ? 2.918   0.845   -35.529 1.00 33.72 ? 298  LEU E CD2 1 
ATOM   2136 N  N   . ASP B 2 34  ? 3.677   -0.487  -40.929 1.00 34.18 ? 299  ASP E N   1 
ATOM   2137 C  CA  . ASP B 2 34  ? 3.277   -1.184  -42.121 1.00 34.40 ? 299  ASP E CA  1 
ATOM   2138 C  C   . ASP B 2 34  ? 4.350   -2.126  -42.519 1.00 34.53 ? 299  ASP E C   1 
ATOM   2139 O  O   . ASP B 2 34  ? 5.215   -1.781  -43.259 1.00 34.46 ? 299  ASP E O   1 
ATOM   2140 C  CB  . ASP B 2 34  ? 3.034   -0.196  -43.238 1.00 34.40 ? 299  ASP E CB  1 
ATOM   2141 C  CG  . ASP B 2 34  ? 2.427   -0.817  -44.453 1.00 34.86 ? 299  ASP E CG  1 
ATOM   2142 O  OD1 . ASP B 2 34  ? 2.713   -1.958  -44.772 1.00 35.91 ? 299  ASP E OD1 1 
ATOM   2143 O  OD2 . ASP B 2 34  ? 1.651   -0.147  -45.122 1.00 35.24 ? 299  ASP E OD2 1 
ATOM   2144 N  N   . ASN B 2 35  ? 4.278   -3.338  -42.012 1.00 34.82 ? 300  ASN E N   1 
ATOM   2145 C  CA  . ASN B 2 35  ? 5.195   -4.390  -42.389 1.00 35.08 ? 300  ASN E CA  1 
ATOM   2146 C  C   . ASN B 2 35  ? 6.622   -4.042  -42.151 1.00 35.11 ? 300  ASN E C   1 
ATOM   2147 O  O   . ASN B 2 35  ? 7.465   -4.344  -42.928 1.00 35.53 ? 300  ASN E O   1 
ATOM   2148 C  CB  . ASN B 2 35  ? 4.966   -4.843  -43.812 1.00 35.24 ? 300  ASN E CB  1 
ATOM   2149 C  CG  . ASN B 2 35  ? 5.737   -6.068  -44.164 1.00 35.41 ? 300  ASN E CG  1 
ATOM   2150 O  OD1 . ASN B 2 35  ? 5.637   -7.088  -43.507 1.00 35.49 ? 300  ASN E OD1 1 
ATOM   2151 N  ND2 . ASN B 2 35  ? 6.513   -5.979  -45.214 1.00 34.23 ? 300  ASN E ND2 1 
ATOM   2152 N  N   . ASN B 2 36  ? 6.868   -3.415  -41.022 1.00 35.06 ? 301  ASN E N   1 
ATOM   2153 C  CA  . ASN B 2 36  ? 8.160   -2.941  -40.641 1.00 35.20 ? 301  ASN E CA  1 
ATOM   2154 C  C   . ASN B 2 36  ? 8.803   -2.132  -41.690 1.00 35.47 ? 301  ASN E C   1 
ATOM   2155 O  O   . ASN B 2 36  ? 9.981   -2.205  -41.854 1.00 35.37 ? 301  ASN E O   1 
ATOM   2156 C  CB  . ASN B 2 36  ? 9.056   -4.092  -40.299 1.00 35.30 ? 301  ASN E CB  1 
ATOM   2157 C  CG  . ASN B 2 36  ? 10.066  -3.745  -39.263 1.00 35.92 ? 301  ASN E CG  1 
ATOM   2158 O  OD1 . ASN B 2 36  ? 9.803   -2.975  -38.391 1.00 37.38 ? 301  ASN E OD1 1 
ATOM   2159 N  ND2 . ASN B 2 36  ? 11.226  -4.319  -39.362 1.00 35.02 ? 301  ASN E ND2 1 
ATOM   2160 N  N   . GLY B 2 37  ? 8.042   -1.347  -42.415 1.00 35.81 ? 302  GLY E N   1 
ATOM   2161 C  CA  . GLY B 2 37  ? 8.724   -0.423  -43.318 1.00 35.59 ? 302  GLY E CA  1 
ATOM   2162 C  C   . GLY B 2 37  ? 9.234   -1.126  -44.573 1.00 35.71 ? 302  GLY E C   1 
ATOM   2163 O  O   . GLY B 2 37  ? 9.805   -0.488  -45.465 1.00 35.74 ? 302  GLY E O   1 
ATOM   2164 N  N   . GLY B 2 38  ? 9.023   -2.440  -44.645 1.00 35.45 ? 303  GLY E N   1 
ATOM   2165 C  CA  . GLY B 2 38  ? 9.584   -3.268  -45.708 1.00 35.31 ? 303  GLY E CA  1 
ATOM   2166 C  C   . GLY B 2 38  ? 10.991  -3.753  -45.397 1.00 35.40 ? 303  GLY E C   1 
ATOM   2167 O  O   . GLY B 2 38  ? 11.599  -4.460  -46.200 1.00 35.20 ? 303  GLY E O   1 
ATOM   2168 N  N   . CYS B 2 39  ? 11.503  -3.378  -44.224 1.00 35.75 ? 304  CYS E N   1 
ATOM   2169 C  CA  . CYS B 2 39  ? 12.878  -3.702  -43.817 1.00 36.03 ? 304  CYS E CA  1 
ATOM   2170 C  C   . CYS B 2 39  ? 13.081  -5.162  -43.440 1.00 35.61 ? 304  CYS E C   1 
ATOM   2171 O  O   . CYS B 2 39  ? 12.243  -5.772  -42.781 1.00 35.54 ? 304  CYS E O   1 
ATOM   2172 C  CB  . CYS B 2 39  ? 13.308  -2.833  -42.641 1.00 36.24 ? 304  CYS E CB  1 
ATOM   2173 S  SG  . CYS B 2 39  ? 13.065  -1.084  -42.907 1.00 38.50 ? 304  CYS E SG  1 
ATOM   2174 N  N   . SER B 2 40  ? 14.216  -5.703  -43.856 1.00 35.26 ? 305  SER E N   1 
ATOM   2175 C  CA  . SER B 2 40  ? 14.612  -7.057  -43.520 1.00 34.83 ? 305  SER E CA  1 
ATOM   2176 C  C   . SER B 2 40  ? 14.882  -7.241  -42.025 1.00 34.60 ? 305  SER E C   1 
ATOM   2177 O  O   . SER B 2 40  ? 14.542  -8.270  -41.450 1.00 34.62 ? 305  SER E O   1 
ATOM   2178 C  CB  . SER B 2 40  ? 15.852  -7.420  -44.328 1.00 34.90 ? 305  SER E CB  1 
ATOM   2179 O  OG  . SER B 2 40  ? 16.788  -8.135  -43.550 1.00 35.26 ? 305  SER E OG  1 
ATOM   2180 N  N   . HIS B 2 41  ? 15.497  -6.243  -41.399 1.00 34.39 ? 306  HIS E N   1 
ATOM   2181 C  CA  . HIS B 2 41  ? 15.881  -6.361  -39.996 1.00 34.11 ? 306  HIS E CA  1 
ATOM   2182 C  C   . HIS B 2 41  ? 15.261  -5.288  -39.102 1.00 33.99 ? 306  HIS E C   1 
ATOM   2183 O  O   . HIS B 2 41  ? 14.190  -5.510  -38.531 1.00 34.14 ? 306  HIS E O   1 
ATOM   2184 C  CB  . HIS B 2 41  ? 17.406  -6.433  -39.864 1.00 33.99 ? 306  HIS E CB  1 
ATOM   2185 C  CG  . HIS B 2 41  ? 17.970  -7.767  -40.242 1.00 33.91 ? 306  HIS E CG  1 
ATOM   2186 N  ND1 . HIS B 2 41  ? 18.016  -8.215  -41.545 1.00 33.51 ? 306  HIS E ND1 1 
ATOM   2187 C  CD2 . HIS B 2 41  ? 18.491  -8.761  -39.485 1.00 33.67 ? 306  HIS E CD2 1 
ATOM   2188 C  CE1 . HIS B 2 41  ? 18.548  -9.424  -41.575 1.00 33.27 ? 306  HIS E CE1 1 
ATOM   2189 N  NE2 . HIS B 2 41  ? 18.846  -9.777  -40.339 1.00 33.81 ? 306  HIS E NE2 1 
ATOM   2190 N  N   . VAL B 2 42  ? 15.921  -4.133  -38.999 1.00 33.62 ? 307  VAL E N   1 
ATOM   2191 C  CA  . VAL B 2 42  ? 15.454  -3.034  -38.159 1.00 33.18 ? 307  VAL E CA  1 
ATOM   2192 C  C   . VAL B 2 42  ? 14.891  -1.899  -39.006 1.00 33.08 ? 307  VAL E C   1 
ATOM   2193 O  O   . VAL B 2 42  ? 15.494  -1.508  -40.002 1.00 33.02 ? 307  VAL E O   1 
ATOM   2194 C  CB  . VAL B 2 42  ? 16.586  -2.486  -37.258 1.00 33.16 ? 307  VAL E CB  1 
ATOM   2195 C  CG1 . VAL B 2 42  ? 16.087  -1.332  -36.404 1.00 33.08 ? 307  VAL E CG1 1 
ATOM   2196 C  CG2 . VAL B 2 42  ? 17.152  -3.578  -36.375 1.00 33.21 ? 307  VAL E CG2 1 
ATOM   2197 N  N   . CYS B 2 43  ? 13.733  -1.383  -38.597 1.00 33.05 ? 308  CYS E N   1 
ATOM   2198 C  CA  . CYS B 2 43  ? 13.102  -0.218  -39.219 1.00 32.99 ? 308  CYS E CA  1 
ATOM   2199 C  C   . CYS B 2 43  ? 13.189  0.951   -38.253 1.00 32.79 ? 308  CYS E C   1 
ATOM   2200 O  O   . CYS B 2 43  ? 12.802  0.820   -37.095 1.00 33.02 ? 308  CYS E O   1 
ATOM   2201 C  CB  . CYS B 2 43  ? 11.631  -0.514  -39.524 1.00 33.05 ? 308  CYS E CB  1 
ATOM   2202 S  SG  . CYS B 2 43  ? 10.639  0.875   -40.174 1.00 33.41 ? 308  CYS E SG  1 
ATOM   2203 N  N   . ASN B 2 44  ? 13.685  2.092   -38.726 1.00 32.64 ? 309  ASN E N   1 
ATOM   2204 C  CA  . ASN B 2 44  ? 13.892  3.256   -37.864 1.00 32.36 ? 309  ASN E CA  1 
ATOM   2205 C  C   . ASN B 2 44  ? 12.942  4.400   -38.214 1.00 32.40 ? 309  ASN E C   1 
ATOM   2206 O  O   . ASN B 2 44  ? 13.096  5.049   -39.249 1.00 32.46 ? 309  ASN E O   1 
ATOM   2207 C  CB  . ASN B 2 44  ? 15.356  3.708   -37.932 1.00 32.13 ? 309  ASN E CB  1 
ATOM   2208 C  CG  . ASN B 2 44  ? 15.703  4.778   -36.893 1.00 32.40 ? 309  ASN E CG  1 
ATOM   2209 O  OD1 . ASN B 2 44  ? 16.666  5.523   -37.071 1.00 32.11 ? 309  ASN E OD1 1 
ATOM   2210 N  ND2 . ASN B 2 44  ? 14.932  4.849   -35.807 1.00 31.84 ? 309  ASN E ND2 1 
ATOM   2211 N  N   . ASP B 2 45  ? 11.955  4.634   -37.352 1.00 32.40 ? 310  ASP E N   1 
ATOM   2212 C  CA  . ASP B 2 45  ? 10.960  5.683   -37.579 1.00 32.45 ? 310  ASP E CA  1 
ATOM   2213 C  C   . ASP B 2 45  ? 11.550  7.087   -37.399 1.00 32.84 ? 310  ASP E C   1 
ATOM   2214 O  O   . ASP B 2 45  ? 11.629  7.608   -36.283 1.00 32.88 ? 310  ASP E O   1 
ATOM   2215 C  CB  . ASP B 2 45  ? 9.753   5.490   -36.658 1.00 32.28 ? 310  ASP E CB  1 
ATOM   2216 C  CG  . ASP B 2 45  ? 8.645   6.489   -36.929 1.00 31.43 ? 310  ASP E CG  1 
ATOM   2217 O  OD1 . ASP B 2 45  ? 7.973   6.921   -35.977 1.00 31.09 ? 310  ASP E OD1 1 
ATOM   2218 O  OD2 . ASP B 2 45  ? 8.438   6.849   -38.099 1.00 31.86 ? 310  ASP E OD2 1 
ATOM   2219 N  N   . LEU B 2 46  ? 11.958  7.694   -38.507 1.00 33.21 ? 311  LEU E N   1 
ATOM   2220 C  CA  . LEU B 2 46  ? 12.509  9.042   -38.481 1.00 33.66 ? 311  LEU E CA  1 
ATOM   2221 C  C   . LEU B 2 46  ? 11.403  10.098  -38.421 1.00 33.98 ? 311  LEU E C   1 
ATOM   2222 O  O   . LEU B 2 46  ? 10.253  9.822   -38.784 1.00 33.97 ? 311  LEU E O   1 
ATOM   2223 C  CB  . LEU B 2 46  ? 13.397  9.275   -39.704 1.00 33.65 ? 311  LEU E CB  1 
ATOM   2224 C  CG  . LEU B 2 46  ? 14.614  8.368   -39.882 1.00 33.70 ? 311  LEU E CG  1 
ATOM   2225 C  CD1 . LEU B 2 46  ? 15.168  8.557   -41.282 1.00 33.67 ? 311  LEU E CD1 1 
ATOM   2226 C  CD2 . LEU B 2 46  ? 15.681  8.659   -38.832 1.00 34.08 ? 311  LEU E CD2 1 
ATOM   2227 N  N   . LYS B 2 47  ? 11.762  11.297  -37.957 1.00 34.39 ? 312  LYS E N   1 
ATOM   2228 C  CA  . LYS B 2 47  ? 10.847  12.441  -37.896 1.00 34.77 ? 312  LYS E CA  1 
ATOM   2229 C  C   . LYS B 2 47  ? 10.182  12.647  -39.258 1.00 34.94 ? 312  LYS E C   1 
ATOM   2230 O  O   . LYS B 2 47  ? 8.951   12.720  -39.348 1.00 34.96 ? 312  LYS E O   1 
ATOM   2231 C  CB  . LYS B 2 47  ? 11.598  13.698  -37.447 1.00 34.76 ? 312  LYS E CB  1 
ATOM   2232 C  CG  . LYS B 2 47  ? 10.748  14.708  -36.678 1.00 35.55 ? 312  LYS E CG  1 
ATOM   2233 C  CD  . LYS B 2 47  ? 10.278  15.873  -37.554 1.00 36.14 ? 312  LYS E CD  1 
ATOM   2234 C  CE  . LYS B 2 47  ? 11.322  16.990  -37.646 1.00 36.31 ? 312  LYS E CE  1 
ATOM   2235 N  NZ  . LYS B 2 47  ? 11.405  17.794  -36.391 1.00 36.37 ? 312  LYS E NZ  1 
ATOM   2236 N  N   . ILE B 2 48  ? 11.002  12.720  -40.310 1.00 35.11 ? 313  ILE E N   1 
ATOM   2237 C  CA  . ILE B 2 48  ? 10.509  12.652  -41.689 1.00 35.10 ? 313  ILE E CA  1 
ATOM   2238 C  C   . ILE B 2 48  ? 10.920  11.317  -42.334 1.00 35.36 ? 313  ILE E C   1 
ATOM   2239 O  O   . ILE B 2 48  ? 12.112  10.980  -42.405 1.00 35.17 ? 313  ILE E O   1 
ATOM   2240 C  CB  . ILE B 2 48  ? 10.968  13.857  -42.562 1.00 35.19 ? 313  ILE E CB  1 
ATOM   2241 C  CG1 . ILE B 2 48  ? 10.551  15.192  -41.923 1.00 35.03 ? 313  ILE E CG1 1 
ATOM   2242 C  CG2 . ILE B 2 48  ? 10.401  13.734  -43.984 1.00 34.68 ? 313  ILE E CG2 1 
ATOM   2243 C  CD1 . ILE B 2 48  ? 11.101  16.433  -42.624 1.00 34.84 ? 313  ILE E CD1 1 
ATOM   2244 N  N   . GLY B 2 49  ? 9.915   10.568  -42.787 1.00 35.57 ? 314  GLY E N   1 
ATOM   2245 C  CA  . GLY B 2 49  ? 10.113  9.255   -43.386 1.00 35.90 ? 314  GLY E CA  1 
ATOM   2246 C  C   . GLY B 2 49  ? 10.671  8.231   -42.415 1.00 36.29 ? 314  GLY E C   1 
ATOM   2247 O  O   . GLY B 2 49  ? 10.317  8.217   -41.227 1.00 35.86 ? 314  GLY E O   1 
ATOM   2248 N  N   . TYR B 2 50  ? 11.558  7.383   -42.936 1.00 36.73 ? 315  TYR E N   1 
ATOM   2249 C  CA  . TYR B 2 50  ? 12.188  6.309   -42.168 1.00 37.32 ? 315  TYR E CA  1 
ATOM   2250 C  C   . TYR B 2 50  ? 13.409  5.708   -42.901 1.00 37.72 ? 315  TYR E C   1 
ATOM   2251 O  O   . TYR B 2 50  ? 13.837  6.224   -43.932 1.00 37.89 ? 315  TYR E O   1 
ATOM   2252 C  CB  . TYR B 2 50  ? 11.152  5.227   -41.821 1.00 37.10 ? 315  TYR E CB  1 
ATOM   2253 C  CG  . TYR B 2 50  ? 10.732  4.374   -42.989 1.00 37.08 ? 315  TYR E CG  1 
ATOM   2254 C  CD1 . TYR B 2 50  ? 9.876   4.875   -43.973 1.00 36.76 ? 315  TYR E CD1 1 
ATOM   2255 C  CD2 . TYR B 2 50  ? 11.196  3.061   -43.116 1.00 36.92 ? 315  TYR E CD2 1 
ATOM   2256 C  CE1 . TYR B 2 50  ? 9.492   4.088   -45.055 1.00 37.01 ? 315  TYR E CE1 1 
ATOM   2257 C  CE2 . TYR B 2 50  ? 10.821  2.266   -44.193 1.00 37.05 ? 315  TYR E CE2 1 
ATOM   2258 C  CZ  . TYR B 2 50  ? 9.964   2.783   -45.156 1.00 36.88 ? 315  TYR E CZ  1 
ATOM   2259 O  OH  . TYR B 2 50  ? 9.585   2.002   -46.216 1.00 36.54 ? 315  TYR E OH  1 
ATOM   2260 N  N   . GLU B 2 51  ? 13.967  4.629   -42.355 1.00 38.22 ? 316  GLU E N   1 
ATOM   2261 C  CA  . GLU B 2 51  ? 15.143  3.974   -42.922 1.00 38.75 ? 316  GLU E CA  1 
ATOM   2262 C  C   . GLU B 2 51  ? 15.276  2.555   -42.374 1.00 39.45 ? 316  GLU E C   1 
ATOM   2263 O  O   . GLU B 2 51  ? 14.803  2.255   -41.269 1.00 39.51 ? 316  GLU E O   1 
ATOM   2264 C  CB  . GLU B 2 51  ? 16.412  4.768   -42.604 1.00 38.67 ? 316  GLU E CB  1 
ATOM   2265 C  CG  . GLU B 2 51  ? 16.644  4.999   -41.107 1.00 38.74 ? 316  GLU E CG  1 
ATOM   2266 C  CD  . GLU B 2 51  ? 17.993  5.626   -40.773 1.00 38.67 ? 316  GLU E CD  1 
ATOM   2267 O  OE1 . GLU B 2 51  ? 18.116  6.176   -39.660 1.00 37.83 ? 316  GLU E OE1 1 
ATOM   2268 O  OE2 . GLU B 2 51  ? 18.928  5.566   -41.601 1.00 39.07 ? 316  GLU E OE2 1 
ATOM   2269 N  N   . CYS B 2 52  ? 15.920  1.686   -43.148 1.00 40.06 ? 317  CYS E N   1 
ATOM   2270 C  CA  . CYS B 2 52  ? 16.192  0.332   -42.700 1.00 40.77 ? 317  CYS E CA  1 
ATOM   2271 C  C   . CYS B 2 52  ? 17.617  0.228   -42.215 1.00 41.65 ? 317  CYS E C   1 
ATOM   2272 O  O   . CYS B 2 52  ? 18.530  0.744   -42.848 1.00 41.77 ? 317  CYS E O   1 
ATOM   2273 C  CB  . CYS B 2 52  ? 15.949  -0.683  -43.811 1.00 40.43 ? 317  CYS E CB  1 
ATOM   2274 S  SG  . CYS B 2 52  ? 14.290  -0.651  -44.480 1.00 39.86 ? 317  CYS E SG  1 
ATOM   2275 N  N   . LEU B 2 53  ? 17.792  -0.445  -41.083 1.00 42.89 ? 318  LEU E N   1 
ATOM   2276 C  CA  . LEU B 2 53  ? 19.099  -0.629  -40.466 1.00 44.17 ? 318  LEU E CA  1 
ATOM   2277 C  C   . LEU B 2 53  ? 19.437  -2.109  -40.419 1.00 45.22 ? 318  LEU E C   1 
ATOM   2278 O  O   . LEU B 2 53  ? 18.541  -2.949  -40.340 1.00 45.42 ? 318  LEU E O   1 
ATOM   2279 C  CB  . LEU B 2 53  ? 19.101  -0.051  -39.044 1.00 44.00 ? 318  LEU E CB  1 
ATOM   2280 C  CG  . LEU B 2 53  ? 19.422  1.423   -38.762 1.00 43.54 ? 318  LEU E CG  1 
ATOM   2281 C  CD1 . LEU B 2 53  ? 18.744  2.385   -39.722 1.00 43.07 ? 318  LEU E CD1 1 
ATOM   2282 C  CD2 . LEU B 2 53  ? 19.037  1.763   -37.330 1.00 42.97 ? 318  LEU E CD2 1 
ATOM   2283 N  N   . CYS B 2 54  ? 20.729  -2.421  -40.458 1.00 46.67 ? 319  CYS E N   1 
ATOM   2284 C  CA  . CYS B 2 54  ? 21.192  -3.803  -40.415 1.00 48.27 ? 319  CYS E CA  1 
ATOM   2285 C  C   . CYS B 2 54  ? 22.015  -4.080  -39.153 1.00 48.95 ? 319  CYS E C   1 
ATOM   2286 O  O   . CYS B 2 54  ? 22.463  -3.141  -38.494 1.00 49.15 ? 319  CYS E O   1 
ATOM   2287 C  CB  . CYS B 2 54  ? 22.009  -4.120  -41.672 1.00 48.50 ? 319  CYS E CB  1 
ATOM   2288 S  SG  . CYS B 2 54  ? 21.071  -4.028  -43.231 1.00 50.59 ? 319  CYS E SG  1 
ATOM   2289 N  N   . PRO B 2 55  ? 22.195  -5.369  -38.794 1.00 49.70 ? 320  PRO E N   1 
ATOM   2290 C  CA  . PRO B 2 55  ? 23.188  -5.694  -37.765 1.00 50.31 ? 320  PRO E CA  1 
ATOM   2291 C  C   . PRO B 2 55  ? 24.610  -5.629  -38.337 1.00 50.96 ? 320  PRO E C   1 
ATOM   2292 O  O   . PRO B 2 55  ? 24.787  -5.244  -39.496 1.00 51.07 ? 320  PRO E O   1 
ATOM   2293 C  CB  . PRO B 2 55  ? 22.818  -7.125  -37.351 1.00 50.34 ? 320  PRO E CB  1 
ATOM   2294 C  CG  . PRO B 2 55  ? 22.126  -7.704  -38.530 1.00 50.03 ? 320  PRO E CG  1 
ATOM   2295 C  CD  . PRO B 2 55  ? 21.488  -6.569  -39.287 1.00 49.74 ? 320  PRO E CD  1 
ATOM   2296 N  N   . ASP B 2 56  ? 25.606  -6.006  -37.535 1.00 51.73 ? 321  ASP E N   1 
ATOM   2297 C  CA  . ASP B 2 56  ? 27.020  -5.884  -37.925 1.00 52.39 ? 321  ASP E CA  1 
ATOM   2298 C  C   . ASP B 2 56  ? 27.485  -6.936  -38.941 1.00 52.77 ? 321  ASP E C   1 
ATOM   2299 O  O   . ASP B 2 56  ? 27.259  -8.138  -38.756 1.00 52.79 ? 321  ASP E O   1 
ATOM   2300 C  CB  . ASP B 2 56  ? 27.927  -5.901  -36.683 1.00 52.47 ? 321  ASP E CB  1 
ATOM   2301 C  CG  . ASP B 2 56  ? 27.874  -4.596  -35.893 1.00 52.49 ? 321  ASP E CG  1 
ATOM   2302 O  OD1 . ASP B 2 56  ? 28.041  -4.649  -34.655 1.00 52.40 ? 321  ASP E OD1 1 
ATOM   2303 O  OD2 . ASP B 2 56  ? 27.670  -3.520  -36.503 1.00 52.01 ? 321  ASP E OD2 1 
ATOM   2304 N  N   . GLY B 2 57  ? 28.138  -6.467  -40.005 1.00 53.16 ? 322  GLY E N   1 
ATOM   2305 C  CA  . GLY B 2 57  ? 28.660  -7.337  -41.065 1.00 53.66 ? 322  GLY E CA  1 
ATOM   2306 C  C   . GLY B 2 57  ? 27.775  -7.431  -42.299 1.00 53.99 ? 322  GLY E C   1 
ATOM   2307 O  O   . GLY B 2 57  ? 28.182  -7.983  -43.324 1.00 54.03 ? 322  GLY E O   1 
ATOM   2308 N  N   . PHE B 2 58  ? 26.563  -6.889  -42.194 1.00 54.32 ? 323  PHE E N   1 
ATOM   2309 C  CA  . PHE B 2 58  ? 25.570  -6.930  -43.267 1.00 54.62 ? 323  PHE E CA  1 
ATOM   2310 C  C   . PHE B 2 58  ? 25.507  -5.585  -43.985 1.00 54.79 ? 323  PHE E C   1 
ATOM   2311 O  O   . PHE B 2 58  ? 25.673  -4.538  -43.359 1.00 54.85 ? 323  PHE E O   1 
ATOM   2312 C  CB  . PHE B 2 58  ? 24.183  -7.257  -42.696 1.00 54.61 ? 323  PHE E CB  1 
ATOM   2313 C  CG  . PHE B 2 58  ? 24.049  -8.661  -42.156 1.00 54.70 ? 323  PHE E CG  1 
ATOM   2314 C  CD1 . PHE B 2 58  ? 24.517  -8.985  -40.883 1.00 54.80 ? 323  PHE E CD1 1 
ATOM   2315 C  CD2 . PHE B 2 58  ? 23.428  -9.653  -42.911 1.00 54.74 ? 323  PHE E CD2 1 
ATOM   2316 C  CE1 . PHE B 2 58  ? 24.384  -10.282 -40.379 1.00 54.80 ? 323  PHE E CE1 1 
ATOM   2317 C  CE2 . PHE B 2 58  ? 23.291  -10.951 -42.418 1.00 54.76 ? 323  PHE E CE2 1 
ATOM   2318 C  CZ  . PHE B 2 58  ? 23.771  -11.266 -41.149 1.00 54.73 ? 323  PHE E CZ  1 
ATOM   2319 N  N   . GLN B 2 59  ? 25.264  -5.618  -45.295 1.00 55.02 ? 324  GLN E N   1 
ATOM   2320 C  CA  . GLN B 2 59  ? 25.033  -4.397  -46.072 1.00 55.30 ? 324  GLN E CA  1 
ATOM   2321 C  C   . GLN B 2 59  ? 23.603  -4.323  -46.606 1.00 55.42 ? 324  GLN E C   1 
ATOM   2322 O  O   . GLN B 2 59  ? 22.990  -5.353  -46.903 1.00 55.68 ? 324  GLN E O   1 
ATOM   2323 C  CB  . GLN B 2 59  ? 26.045  -4.262  -47.212 1.00 55.31 ? 324  GLN E CB  1 
ATOM   2324 C  CG  . GLN B 2 59  ? 27.275  -3.448  -46.837 1.00 55.66 ? 324  GLN E CG  1 
ATOM   2325 C  CD  . GLN B 2 59  ? 28.060  -2.965  -48.047 1.00 56.14 ? 324  GLN E CD  1 
ATOM   2326 O  OE1 . GLN B 2 59  ? 28.769  -3.788  -48.668 1.00 56.43 ? 324  GLN E OE1 1 
ATOM   2327 N  NE2 . GLN B 2 59  ? 27.980  -1.759  -48.369 1.00 55.74 ? 324  GLN E NE2 1 
ATOM   2328 N  N   . LEU B 2 60  ? 23.082  -3.104  -46.726 1.00 55.38 ? 325  LEU E N   1 
ATOM   2329 C  CA  . LEU B 2 60  ? 21.697  -2.879  -47.140 1.00 55.40 ? 325  LEU E CA  1 
ATOM   2330 C  C   . LEU B 2 60  ? 21.513  -2.896  -48.667 1.00 55.58 ? 325  LEU E C   1 
ATOM   2331 O  O   . LEU B 2 60  ? 21.679  -1.872  -49.346 1.00 55.53 ? 325  LEU E O   1 
ATOM   2332 C  CB  . LEU B 2 60  ? 21.165  -1.571  -46.535 1.00 55.42 ? 325  LEU E CB  1 
ATOM   2333 C  CG  . LEU B 2 60  ? 19.663  -1.265  -46.624 1.00 55.42 ? 325  LEU E CG  1 
ATOM   2334 C  CD1 . LEU B 2 60  ? 18.854  -2.126  -45.656 1.00 55.21 ? 325  LEU E CD1 1 
ATOM   2335 C  CD2 . LEU B 2 60  ? 19.400  0.217   -46.372 1.00 55.30 ? 325  LEU E CD2 1 
ATOM   2336 N  N   . VAL B 2 61  ? 21.164  -4.069  -49.195 1.00 55.69 ? 326  VAL E N   1 
ATOM   2337 C  CA  . VAL B 2 61  ? 20.871  -4.232  -50.620 1.00 55.81 ? 326  VAL E CA  1 
ATOM   2338 C  C   . VAL B 2 61  ? 19.465  -3.710  -50.937 1.00 55.90 ? 326  VAL E C   1 
ATOM   2339 O  O   . VAL B 2 61  ? 18.504  -4.017  -50.221 1.00 55.87 ? 326  VAL E O   1 
ATOM   2340 C  CB  . VAL B 2 61  ? 21.011  -5.713  -51.078 1.00 55.80 ? 326  VAL E CB  1 
ATOM   2341 C  CG1 . VAL B 2 61  ? 20.823  -5.842  -52.588 1.00 55.79 ? 326  VAL E CG1 1 
ATOM   2342 C  CG2 . VAL B 2 61  ? 22.365  -6.285  -50.668 1.00 55.84 ? 326  VAL E CG2 1 
ATOM   2343 N  N   . ALA B 2 62  ? 19.368  -2.910  -52.002 1.00 55.93 ? 327  ALA E N   1 
ATOM   2344 C  CA  . ALA B 2 62  ? 18.098  -2.366  -52.510 1.00 55.90 ? 327  ALA E CA  1 
ATOM   2345 C  C   . ALA B 2 62  ? 17.231  -1.686  -51.442 1.00 55.91 ? 327  ALA E C   1 
ATOM   2346 O  O   . ALA B 2 62  ? 15.998  -1.759  -51.489 1.00 55.91 ? 327  ALA E O   1 
ATOM   2347 C  CB  . ALA B 2 62  ? 17.303  -3.445  -53.273 1.00 55.87 ? 327  ALA E CB  1 
ATOM   2348 N  N   . GLN B 2 63  ? 17.898  -1.036  -50.485 1.00 55.91 ? 328  GLN E N   1 
ATOM   2349 C  CA  . GLN B 2 63  ? 17.264  -0.198  -49.446 1.00 55.91 ? 328  GLN E CA  1 
ATOM   2350 C  C   . GLN B 2 63  ? 16.320  -0.901  -48.460 1.00 55.83 ? 328  GLN E C   1 
ATOM   2351 O  O   . GLN B 2 63  ? 15.667  -0.234  -47.650 1.00 55.81 ? 328  GLN E O   1 
ATOM   2352 C  CB  . GLN B 2 63  ? 16.546  1.011   -50.067 1.00 55.93 ? 328  GLN E CB  1 
ATOM   2353 C  CG  . GLN B 2 63  ? 17.471  2.070   -50.647 1.00 56.30 ? 328  GLN E CG  1 
ATOM   2354 C  CD  . GLN B 2 63  ? 17.932  1.750   -52.060 1.00 56.42 ? 328  GLN E CD  1 
ATOM   2355 O  OE1 . GLN B 2 63  ? 17.182  1.186   -52.860 1.00 56.24 ? 328  GLN E OE1 1 
ATOM   2356 N  NE2 . GLN B 2 63  ? 19.171  2.119   -52.374 1.00 56.31 ? 328  GLN E NE2 1 
ATOM   2357 N  N   . ARG B 2 64  ? 16.252  -2.233  -48.518 1.00 55.71 ? 329  ARG E N   1 
ATOM   2358 C  CA  . ARG B 2 64  ? 15.311  -2.994  -47.685 1.00 55.51 ? 329  ARG E CA  1 
ATOM   2359 C  C   . ARG B 2 64  ? 15.907  -4.250  -47.034 1.00 55.39 ? 329  ARG E C   1 
ATOM   2360 O  O   . ARG B 2 64  ? 15.555  -4.573  -45.898 1.00 55.48 ? 329  ARG E O   1 
ATOM   2361 C  CB  . ARG B 2 64  ? 14.042  -3.365  -48.477 1.00 55.50 ? 329  ARG E CB  1 
ATOM   2362 C  CG  . ARG B 2 64  ? 13.257  -2.188  -49.088 1.00 55.61 ? 329  ARG E CG  1 
ATOM   2363 C  CD  . ARG B 2 64  ? 12.371  -1.457  -48.079 1.00 55.45 ? 329  ARG E CD  1 
ATOM   2364 N  NE  . ARG B 2 64  ? 11.694  -0.306  -48.681 1.00 55.76 ? 329  ARG E NE  1 
ATOM   2365 C  CZ  . ARG B 2 64  ? 12.155  0.947   -48.661 1.00 56.50 ? 329  ARG E CZ  1 
ATOM   2366 N  NH1 . ARG B 2 64  ? 13.306  1.243   -48.065 1.00 56.51 ? 329  ARG E NH1 1 
ATOM   2367 N  NH2 . ARG B 2 64  ? 11.460  1.918   -49.241 1.00 56.47 ? 329  ARG E NH2 1 
ATOM   2368 N  N   . ARG B 2 65  ? 16.794  -4.950  -47.746 1.00 55.15 ? 330  ARG E N   1 
ATOM   2369 C  CA  . ARG B 2 65  ? 17.334  -6.242  -47.283 1.00 54.91 ? 330  ARG E CA  1 
ATOM   2370 C  C   . ARG B 2 65  ? 18.805  -6.203  -46.863 1.00 54.73 ? 330  ARG E C   1 
ATOM   2371 O  O   . ARG B 2 65  ? 19.606  -5.490  -47.458 1.00 54.79 ? 330  ARG E O   1 
ATOM   2372 C  CB  . ARG B 2 65  ? 17.138  -7.327  -48.347 1.00 54.83 ? 330  ARG E CB  1 
ATOM   2373 C  CG  . ARG B 2 65  ? 15.700  -7.797  -48.518 1.00 54.80 ? 330  ARG E CG  1 
ATOM   2374 C  CD  . ARG B 2 65  ? 15.572  -8.831  -49.637 1.00 55.04 ? 330  ARG E CD  1 
ATOM   2375 N  NE  . ARG B 2 65  ? 15.993  -8.301  -50.937 1.00 55.22 ? 330  ARG E NE  1 
ATOM   2376 C  CZ  . ARG B 2 65  ? 17.064  -8.710  -51.616 1.00 54.92 ? 330  ARG E CZ  1 
ATOM   2377 N  NH1 . ARG B 2 65  ? 17.358  -8.154  -52.783 1.00 54.48 ? 330  ARG E NH1 1 
ATOM   2378 N  NH2 . ARG B 2 65  ? 17.838  -9.675  -51.136 1.00 54.84 ? 330  ARG E NH2 1 
ATOM   2379 N  N   . CYS B 2 66  ? 19.148  -6.997  -45.848 1.00 54.55 ? 331  CYS E N   1 
ATOM   2380 C  CA  . CYS B 2 66  ? 20.514  -7.068  -45.321 1.00 54.38 ? 331  CYS E CA  1 
ATOM   2381 C  C   . CYS B 2 66  ? 21.232  -8.351  -45.749 1.00 54.57 ? 331  CYS E C   1 
ATOM   2382 O  O   . CYS B 2 66  ? 20.643  -9.435  -45.732 1.00 54.58 ? 331  CYS E O   1 
ATOM   2383 C  CB  . CYS B 2 66  ? 20.507  -6.978  -43.790 1.00 54.17 ? 331  CYS E CB  1 
ATOM   2384 S  SG  . CYS B 2 66  ? 19.679  -5.521  -43.085 1.00 53.40 ? 331  CYS E SG  1 
ATOM   2385 N  N   . GLU B 2 67  ? 22.506  -8.219  -46.123 1.00 54.71 ? 332  GLU E N   1 
ATOM   2386 C  CA  . GLU B 2 67  ? 23.349  -9.360  -46.509 1.00 54.81 ? 332  GLU E CA  1 
ATOM   2387 C  C   . GLU B 2 67  ? 24.805  -9.138  -46.097 1.00 54.68 ? 332  GLU E C   1 
ATOM   2388 O  O   . GLU B 2 67  ? 25.643  -10.034 -46.210 1.00 54.55 ? 332  GLU E O   1 
ATOM   2389 C  CB  . GLU B 2 67  ? 23.256  -9.616  -48.017 1.00 54.94 ? 332  GLU E CB  1 
ATOM   2390 C  CG  . GLU B 2 67  ? 22.008  -10.380 -48.453 1.00 55.33 ? 332  GLU E CG  1 
ATOM   2391 C  CD  . GLU B 2 67  ? 21.367  -9.795  -49.701 1.00 56.01 ? 332  GLU E CD  1 
ATOM   2392 O  OE1 . GLU B 2 67  ? 22.063  -9.651  -50.732 1.00 56.07 ? 332  GLU E OE1 1 
ATOM   2393 O  OE2 . GLU B 2 67  ? 20.159  -9.479  -49.648 1.00 56.35 ? 332  GLU E OE2 1 
ATOM   2394 N  N   . THR C 3 22  ? 5.800   -38.138 4.745   1.00 39.00 ? 60   THR P N   1 
ATOM   2395 C  CA  . THR C 3 22  ? 4.753   -38.984 4.075   1.00 39.08 ? 60   THR P CA  1 
ATOM   2396 C  C   . THR C 3 22  ? 5.182   -39.791 2.811   1.00 38.79 ? 60   THR P C   1 
ATOM   2397 O  O   . THR C 3 22  ? 4.372   -40.569 2.291   1.00 38.99 ? 60   THR P O   1 
ATOM   2398 C  CB  . THR C 3 22  ? 3.449   -38.168 3.755   1.00 39.27 ? 60   THR P CB  1 
ATOM   2399 O  OG1 . THR C 3 22  ? 3.780   -36.957 3.061   1.00 39.01 ? 60   THR P OG1 1 
ATOM   2400 C  CG2 . THR C 3 22  ? 2.663   -37.848 5.039   1.00 39.37 ? 60   THR P CG2 1 
ATOM   2401 N  N   . THR C 3 23  ? 6.412   -39.637 2.306   1.00 38.03 ? 61   THR P N   1 
ATOM   2402 C  CA  . THR C 3 23  ? 7.438   -38.750 2.844   1.00 37.27 ? 61   THR P CA  1 
ATOM   2403 C  C   . THR C 3 23  ? 7.789   -37.674 1.810   1.00 36.44 ? 61   THR P C   1 
ATOM   2404 O  O   . THR C 3 23  ? 7.048   -37.465 0.841   1.00 36.22 ? 61   THR P O   1 
ATOM   2405 C  CB  . THR C 3 23  ? 8.711   -39.536 3.261   1.00 37.50 ? 61   THR P CB  1 
ATOM   2406 O  OG1 . THR C 3 23  ? 8.412   -40.935 3.349   1.00 37.61 ? 61   THR P OG1 1 
ATOM   2407 C  CG2 . THR C 3 23  ? 9.246   -39.039 4.619   1.00 37.68 ? 61   THR P CG2 1 
ATOM   2408 N  N   . ALA C 3 24  ? 8.911   -36.992 2.030   1.00 35.32 ? 62   ALA P N   1 
ATOM   2409 C  CA  . ALA C 3 24  ? 9.382   -35.957 1.123   1.00 34.25 ? 62   ALA P CA  1 
ATOM   2410 C  C   . ALA C 3 24  ? 10.080  -36.582 -0.081  1.00 33.50 ? 62   ALA P C   1 
ATOM   2411 O  O   . ALA C 3 24  ? 10.829  -37.549 0.060   1.00 33.35 ? 62   ALA P O   1 
ATOM   2412 C  CB  . ALA C 3 24  ? 10.310  -35.008 1.852   1.00 34.10 ? 62   ALA P CB  1 
ATOM   2413 N  N   . THR C 3 25  ? 9.825   -36.025 -1.262  1.00 32.65 ? 63   THR P N   1 
ATOM   2414 C  CA  . THR C 3 25  ? 10.387  -36.554 -2.502  1.00 31.87 ? 63   THR P CA  1 
ATOM   2415 C  C   . THR C 3 25  ? 11.343  -35.573 -3.166  1.00 31.34 ? 63   THR P C   1 
ATOM   2416 O  O   . THR C 3 25  ? 11.247  -34.361 -2.961  1.00 31.23 ? 63   THR P O   1 
ATOM   2417 C  CB  . THR C 3 25  ? 9.284   -36.940 -3.512  1.00 31.94 ? 63   THR P CB  1 
ATOM   2418 O  OG1 . THR C 3 25  ? 8.413   -35.824 -3.722  1.00 31.77 ? 63   THR P OG1 1 
ATOM   2419 C  CG2 . THR C 3 25  ? 8.470   -38.135 -3.009  1.00 31.96 ? 63   THR P CG2 1 
ATOM   2420 N  N   . PHE C 3 26  ? 12.263  -36.112 -3.964  1.00 30.66 ? 64   PHE P N   1 
ATOM   2421 C  CA  . PHE C 3 26  ? 13.207  -35.307 -4.733  1.00 30.01 ? 64   PHE P CA  1 
ATOM   2422 C  C   . PHE C 3 26  ? 12.736  -35.133 -6.179  1.00 29.84 ? 64   PHE P C   1 
ATOM   2423 O  O   . PHE C 3 26  ? 12.259  -36.080 -6.799  1.00 29.76 ? 64   PHE P O   1 
ATOM   2424 C  CB  . PHE C 3 26  ? 14.593  -35.948 -4.691  1.00 29.66 ? 64   PHE P CB  1 
ATOM   2425 C  CG  . PHE C 3 26  ? 15.633  -35.224 -5.499  1.00 29.11 ? 64   PHE P CG  1 
ATOM   2426 C  CD1 . PHE C 3 26  ? 16.158  -34.019 -5.065  1.00 29.09 ? 64   PHE P CD1 1 
ATOM   2427 C  CD2 . PHE C 3 26  ? 16.105  -35.764 -6.684  1.00 28.74 ? 64   PHE P CD2 1 
ATOM   2428 C  CE1 . PHE C 3 26  ? 17.125  -33.359 -5.813  1.00 29.32 ? 64   PHE P CE1 1 
ATOM   2429 C  CE2 . PHE C 3 26  ? 17.076  -35.117 -7.430  1.00 28.13 ? 64   PHE P CE2 1 
ATOM   2430 C  CZ  . PHE C 3 26  ? 17.587  -33.917 -6.994  1.00 28.89 ? 64   PHE P CZ  1 
ATOM   2431 N  N   . HIS C 3 27  ? 12.868  -33.914 -6.699  1.00 29.70 ? 65   HIS P N   1 
ATOM   2432 C  CA  . HIS C 3 27  ? 12.459  -33.587 -8.070  1.00 29.67 ? 65   HIS P CA  1 
ATOM   2433 C  C   . HIS C 3 27  ? 13.577  -32.877 -8.823  1.00 29.46 ? 65   HIS P C   1 
ATOM   2434 O  O   . HIS C 3 27  ? 14.236  -31.983 -8.288  1.00 29.42 ? 65   HIS P O   1 
ATOM   2435 C  CB  . HIS C 3 27  ? 11.190  -32.727 -8.073  1.00 29.60 ? 65   HIS P CB  1 
ATOM   2436 C  CG  . HIS C 3 27  ? 10.051  -33.344 -7.325  1.00 30.33 ? 65   HIS P CG  1 
ATOM   2437 N  ND1 . HIS C 3 27  ? 9.012   -33.995 -7.955  1.00 30.63 ? 65   HIS P ND1 1 
ATOM   2438 C  CD2 . HIS C 3 27  ? 9.802   -33.436 -5.996  1.00 30.59 ? 65   HIS P CD2 1 
ATOM   2439 C  CE1 . HIS C 3 27  ? 8.168   -34.454 -7.047  1.00 30.92 ? 65   HIS P CE1 1 
ATOM   2440 N  NE2 . HIS C 3 27  ? 8.626   -34.129 -5.851  1.00 31.26 ? 65   HIS P NE2 1 
ATOM   2441 N  N   . ARG C 3 28  ? 13.795  -33.289 -10.065 1.00 29.23 ? 66   ARG P N   1 
ATOM   2442 C  CA  . ARG C 3 28  ? 14.804  -32.659 -10.900 1.00 29.26 ? 66   ARG P CA  1 
ATOM   2443 C  C   . ARG C 3 28  ? 14.279  -32.510 -12.314 1.00 29.04 ? 66   ARG P C   1 
ATOM   2444 O  O   . ARG C 3 28  ? 13.354  -33.221 -12.717 1.00 28.83 ? 66   ARG P O   1 
ATOM   2445 C  CB  . ARG C 3 28  ? 16.103  -33.466 -10.883 1.00 29.27 ? 66   ARG P CB  1 
ATOM   2446 C  CG  . ARG C 3 28  ? 16.098  -34.678 -11.791 1.00 29.94 ? 66   ARG P CG  1 
ATOM   2447 C  CD  . ARG C 3 28  ? 17.260  -35.581 -11.485 1.00 31.56 ? 66   ARG P CD  1 
ATOM   2448 N  NE  . ARG C 3 28  ? 17.545  -36.469 -12.606 1.00 33.40 ? 66   ARG P NE  1 
ATOM   2449 C  CZ  . ARG C 3 28  ? 18.354  -37.520 -12.533 1.00 34.24 ? 66   ARG P CZ  1 
ATOM   2450 N  NH1 . ARG C 3 28  ? 18.956  -37.822 -11.382 1.00 34.20 ? 66   ARG P NH1 1 
ATOM   2451 N  NH2 . ARG C 3 28  ? 18.559  -38.268 -13.609 1.00 33.73 ? 66   ARG P NH2 1 
ATOM   2452 N  N   . CYS C 3 29  ? 14.875  -31.589 -13.064 1.00 28.95 ? 67   CYS P N   1 
ATOM   2453 C  CA  . CYS C 3 29  ? 14.461  -31.358 -14.444 1.00 28.78 ? 67   CYS P CA  1 
ATOM   2454 C  C   . CYS C 3 29  ? 14.576  -32.622 -15.298 1.00 28.60 ? 67   CYS P C   1 
ATOM   2455 O  O   . CYS C 3 29  ? 15.594  -33.320 -15.256 1.00 28.76 ? 67   CYS P O   1 
ATOM   2456 C  CB  . CYS C 3 29  ? 15.276  -30.237 -15.068 1.00 28.66 ? 67   CYS P CB  1 
ATOM   2457 S  SG  . CYS C 3 29  ? 14.772  -29.887 -16.745 1.00 29.45 ? 67   CYS P SG  1 
ATOM   2458 N  N   . ALA C 3 30  ? 13.528  -32.902 -16.072 1.00 28.20 ? 68   ALA P N   1 
ATOM   2459 C  CA  . ALA C 3 30  ? 13.479  -34.100 -16.909 1.00 27.73 ? 68   ALA P CA  1 
ATOM   2460 C  C   . ALA C 3 30  ? 14.423  -34.023 -18.107 1.00 27.66 ? 68   ALA P C   1 
ATOM   2461 O  O   . ALA C 3 30  ? 14.737  -35.047 -18.719 1.00 27.50 ? 68   ALA P O   1 
ATOM   2462 C  CB  . ALA C 3 30  ? 12.048  -34.376 -17.368 1.00 27.61 ? 68   ALA P CB  1 
ATOM   2463 N  N   . LYS C 3 31  ? 14.865  -32.809 -18.440 1.00 27.63 ? 69   LYS P N   1 
ATOM   2464 C  CA  A LYS C 3 31  ? 15.769  -32.599 -19.563 0.50 27.57 ? 69   LYS P CA  1 
ATOM   2465 C  CA  B LYS C 3 31  ? 15.771  -32.598 -19.570 0.50 27.57 ? 69   LYS P CA  1 
ATOM   2466 C  C   . LYS C 3 31  ? 17.193  -32.332 -19.081 1.00 27.52 ? 69   LYS P C   1 
ATOM   2467 O  O   . LYS C 3 31  ? 17.488  -31.269 -18.534 1.00 27.55 ? 69   LYS P O   1 
ATOM   2468 C  CB  A LYS C 3 31  ? 15.241  -31.490 -20.482 0.50 27.52 ? 69   LYS P CB  1 
ATOM   2469 C  CB  B LYS C 3 31  ? 15.255  -31.489 -20.507 0.50 27.53 ? 69   LYS P CB  1 
ATOM   2470 C  CG  A LYS C 3 31  ? 14.138  -31.980 -21.417 0.50 27.41 ? 69   LYS P CG  1 
ATOM   2471 C  CG  B LYS C 3 31  ? 16.242  -31.052 -21.598 0.50 27.38 ? 69   LYS P CG  1 
ATOM   2472 C  CD  A LYS C 3 31  ? 13.154  -30.888 -21.808 0.50 26.66 ? 69   LYS P CD  1 
ATOM   2473 C  CD  B LYS C 3 31  ? 15.611  -30.970 -22.989 0.50 27.01 ? 69   LYS P CD  1 
ATOM   2474 C  CE  A LYS C 3 31  ? 11.970  -31.471 -22.571 0.50 25.77 ? 69   LYS P CE  1 
ATOM   2475 C  CE  B LYS C 3 31  ? 15.828  -32.262 -23.772 0.50 26.61 ? 69   LYS P CE  1 
ATOM   2476 N  NZ  A LYS C 3 31  ? 11.180  -32.436 -21.756 0.50 24.92 ? 69   LYS P NZ  1 
ATOM   2477 N  NZ  B LYS C 3 31  ? 15.380  -32.153 -25.186 0.50 26.10 ? 69   LYS P NZ  1 
ATOM   2478 N  N   . ASP C 3 32  ? 18.058  -33.320 -19.291 1.00 27.56 ? 70   ASP P N   1 
ATOM   2479 C  CA  . ASP C 3 32  ? 19.443  -33.321 -18.816 1.00 27.57 ? 70   ASP P CA  1 
ATOM   2480 C  C   . ASP C 3 32  ? 20.227  -32.009 -18.995 1.00 27.01 ? 70   ASP P C   1 
ATOM   2481 O  O   . ASP C 3 32  ? 20.792  -31.512 -18.022 1.00 27.10 ? 70   ASP P O   1 
ATOM   2482 C  CB  . ASP C 3 32  ? 20.210  -34.514 -19.419 1.00 28.03 ? 70   ASP P CB  1 
ATOM   2483 C  CG  . ASP C 3 32  ? 21.463  -34.884 -18.618 1.00 29.29 ? 70   ASP P CG  1 
ATOM   2484 O  OD1 . ASP C 3 32  ? 21.389  -34.939 -17.361 1.00 29.82 ? 70   ASP P OD1 1 
ATOM   2485 O  OD2 . ASP C 3 32  ? 22.516  -35.147 -19.254 1.00 30.09 ? 70   ASP P OD2 1 
ATOM   2486 N  N   . PRO C 3 33  ? 20.272  -31.442 -20.224 1.00 26.50 ? 71   PRO P N   1 
ATOM   2487 C  CA  . PRO C 3 33  ? 21.035  -30.198 -20.389 1.00 26.01 ? 71   PRO P CA  1 
ATOM   2488 C  C   . PRO C 3 33  ? 20.507  -29.004 -19.582 1.00 25.70 ? 71   PRO P C   1 
ATOM   2489 O  O   . PRO C 3 33  ? 21.245  -28.033 -19.402 1.00 25.97 ? 71   PRO P O   1 
ATOM   2490 C  CB  . PRO C 3 33  ? 20.911  -29.896 -21.887 1.00 25.80 ? 71   PRO P CB  1 
ATOM   2491 C  CG  . PRO C 3 33  ? 20.499  -31.161 -22.511 1.00 26.11 ? 71   PRO P CG  1 
ATOM   2492 C  CD  . PRO C 3 33  ? 19.683  -31.883 -21.501 1.00 26.32 ? 71   PRO P CD  1 
ATOM   2493 N  N   . TRP C 3 34  ? 19.261  -29.060 -19.108 1.00 25.04 ? 72   TRP P N   1 
ATOM   2494 C  CA  . TRP C 3 34  ? 18.674  -27.919 -18.386 1.00 24.45 ? 72   TRP P CA  1 
ATOM   2495 C  C   . TRP C 3 34  ? 18.819  -27.992 -16.863 1.00 24.40 ? 72   TRP P C   1 
ATOM   2496 O  O   . TRP C 3 34  ? 18.487  -27.030 -16.163 1.00 24.21 ? 72   TRP P O   1 
ATOM   2497 C  CB  . TRP C 3 34  ? 17.209  -27.689 -18.769 1.00 24.04 ? 72   TRP P CB  1 
ATOM   2498 C  CG  . TRP C 3 34  ? 16.984  -27.371 -20.224 1.00 23.97 ? 72   TRP P CG  1 
ATOM   2499 C  CD1 . TRP C 3 34  ? 17.938  -27.119 -21.178 1.00 23.55 ? 72   TRP P CD1 1 
ATOM   2500 C  CD2 . TRP C 3 34  ? 15.718  -27.242 -20.884 1.00 23.72 ? 72   TRP P CD2 1 
ATOM   2501 N  NE1 . TRP C 3 34  ? 17.342  -26.866 -22.388 1.00 23.13 ? 72   TRP P NE1 1 
ATOM   2502 C  CE2 . TRP C 3 34  ? 15.982  -26.931 -22.238 1.00 23.37 ? 72   TRP P CE2 1 
ATOM   2503 C  CE3 . TRP C 3 34  ? 14.386  -27.367 -20.463 1.00 23.33 ? 72   TRP P CE3 1 
ATOM   2504 C  CZ2 . TRP C 3 34  ? 14.962  -26.743 -23.176 1.00 23.59 ? 72   TRP P CZ2 1 
ATOM   2505 C  CZ3 . TRP C 3 34  ? 13.374  -27.179 -21.393 1.00 23.53 ? 72   TRP P CZ3 1 
ATOM   2506 C  CH2 . TRP C 3 34  ? 13.668  -26.874 -22.738 1.00 23.64 ? 72   TRP P CH2 1 
ATOM   2507 N  N   . ARG C 3 35  ? 19.319  -29.126 -16.366 1.00 24.11 ? 73   ARG P N   1 
ATOM   2508 C  CA  . ARG C 3 35  ? 19.569  -29.326 -14.940 1.00 23.62 ? 73   ARG P CA  1 
ATOM   2509 C  C   . ARG C 3 35  ? 20.710  -28.439 -14.462 1.00 24.04 ? 73   ARG P C   1 
ATOM   2510 O  O   . ARG C 3 35  ? 21.684  -28.226 -15.188 1.00 24.05 ? 73   ARG P O   1 
ATOM   2511 C  CB  . ARG C 3 35  ? 19.932  -30.781 -14.657 1.00 23.33 ? 73   ARG P CB  1 
ATOM   2512 C  CG  . ARG C 3 35  ? 18.857  -31.804 -15.006 1.00 21.52 ? 73   ARG P CG  1 
ATOM   2513 C  CD  . ARG C 3 35  ? 19.333  -33.202 -14.681 1.00 18.41 ? 73   ARG P CD  1 
ATOM   2514 N  NE  . ARG C 3 35  ? 19.817  -33.309 -13.301 1.00 17.18 ? 73   ARG P NE  1 
ATOM   2515 C  CZ  . ARG C 3 35  ? 20.769  -34.151 -12.895 1.00 15.36 ? 73   ARG P CZ  1 
ATOM   2516 N  NH1 . ARG C 3 35  ? 21.148  -34.167 -11.626 1.00 13.73 ? 73   ARG P NH1 1 
ATOM   2517 N  NH2 . ARG C 3 35  ? 21.353  -34.966 -13.757 1.00 13.56 ? 73   ARG P NH2 1 
ATOM   2518 N  N   . LEU C 3 36  ? 20.579  -27.918 -13.244 1.00 24.37 ? 74   LEU P N   1 
ATOM   2519 C  CA  . LEU C 3 36  ? 21.668  -27.200 -12.591 1.00 24.76 ? 74   LEU P CA  1 
ATOM   2520 C  C   . LEU C 3 36  ? 21.974  -27.837 -11.226 1.00 25.03 ? 74   LEU P C   1 
ATOM   2521 O  O   . LEU C 3 36  ? 21.522  -27.337 -10.188 1.00 25.19 ? 74   LEU P O   1 
ATOM   2522 C  CB  . LEU C 3 36  ? 21.332  -25.716 -12.431 1.00 24.70 ? 74   LEU P CB  1 
ATOM   2523 C  CG  . LEU C 3 36  ? 20.871  -24.891 -13.635 1.00 25.09 ? 74   LEU P CG  1 
ATOM   2524 C  CD1 . LEU C 3 36  ? 20.522  -23.492 -13.177 1.00 24.61 ? 74   LEU P CD1 1 
ATOM   2525 C  CD2 . LEU C 3 36  ? 21.916  -24.847 -14.742 1.00 25.79 ? 74   LEU P CD2 1 
ATOM   2526 N  N   . PRO C 3 37  ? 22.754  -28.937 -11.220 1.00 25.05 ? 75   PRO P N   1 
ATOM   2527 C  CA  . PRO C 3 37  ? 22.997  -29.700 -9.997  1.00 25.11 ? 75   PRO P CA  1 
ATOM   2528 C  C   . PRO C 3 37  ? 23.756  -28.886 -8.961  1.00 25.42 ? 75   PRO P C   1 
ATOM   2529 O  O   . PRO C 3 37  ? 24.530  -28.000 -9.322  1.00 25.44 ? 75   PRO P O   1 
ATOM   2530 C  CB  . PRO C 3 37  ? 23.869  -30.865 -10.472 1.00 24.89 ? 75   PRO P CB  1 
ATOM   2531 C  CG  . PRO C 3 37  ? 23.695  -30.927 -11.935 1.00 25.06 ? 75   PRO P CG  1 
ATOM   2532 C  CD  . PRO C 3 37  ? 23.471  -29.515 -12.368 1.00 25.00 ? 75   PRO P CD  1 
ATOM   2533 N  N   . GLY C 3 38  ? 23.523  -29.181 -7.686  1.00 25.71 ? 76   GLY P N   1 
ATOM   2534 C  CA  . GLY C 3 38  ? 24.245  -28.524 -6.607  1.00 26.09 ? 76   GLY P CA  1 
ATOM   2535 C  C   . GLY C 3 38  ? 23.549  -27.303 -6.040  1.00 26.45 ? 76   GLY P C   1 
ATOM   2536 O  O   . GLY C 3 38  ? 24.017  -26.713 -5.064  1.00 26.80 ? 76   GLY P O   1 
ATOM   2537 N  N   . THR C 3 39  ? 22.439  -26.912 -6.651  1.00 26.45 ? 77   THR P N   1 
ATOM   2538 C  CA  . THR C 3 39  ? 21.584  -25.880 -6.085  1.00 26.69 ? 77   THR P CA  1 
ATOM   2539 C  C   . THR C 3 39  ? 20.174  -26.449 -5.941  1.00 26.74 ? 77   THR P C   1 
ATOM   2540 O  O   . THR C 3 39  ? 19.651  -27.053 -6.882  1.00 27.16 ? 77   THR P O   1 
ATOM   2541 C  CB  . THR C 3 39  ? 21.587  -24.605 -6.950  1.00 26.71 ? 77   THR P CB  1 
ATOM   2542 O  OG1 . THR C 3 39  ? 22.937  -24.157 -7.128  1.00 27.43 ? 77   THR P OG1 1 
ATOM   2543 C  CG2 . THR C 3 39  ? 20.784  -23.495 -6.280  1.00 26.68 ? 77   THR P CG2 1 
ATOM   2544 N  N   . TYR C 3 40  ? 19.567  -26.276 -4.766  1.00 26.44 ? 78   TYR P N   1 
ATOM   2545 C  CA  . TYR C 3 40  ? 18.270  -26.897 -4.485  1.00 26.27 ? 78   TYR P CA  1 
ATOM   2546 C  C   . TYR C 3 40  ? 17.266  -25.956 -3.828  1.00 26.23 ? 78   TYR P C   1 
ATOM   2547 O  O   . TYR C 3 40  ? 17.632  -25.106 -3.007  1.00 26.42 ? 78   TYR P O   1 
ATOM   2548 C  CB  . TYR C 3 40  ? 18.450  -28.156 -3.628  1.00 26.29 ? 78   TYR P CB  1 
ATOM   2549 C  CG  . TYR C 3 40  ? 19.452  -29.123 -4.207  1.00 26.21 ? 78   TYR P CG  1 
ATOM   2550 C  CD1 . TYR C 3 40  ? 19.055  -30.091 -5.117  1.00 26.31 ? 78   TYR P CD1 1 
ATOM   2551 C  CD2 . TYR C 3 40  ? 20.806  -29.046 -3.869  1.00 25.95 ? 78   TYR P CD2 1 
ATOM   2552 C  CE1 . TYR C 3 40  ? 19.976  -30.970 -5.670  1.00 27.31 ? 78   TYR P CE1 1 
ATOM   2553 C  CE2 . TYR C 3 40  ? 21.737  -29.917 -4.420  1.00 25.90 ? 78   TYR P CE2 1 
ATOM   2554 C  CZ  . TYR C 3 40  ? 21.314  -30.875 -5.316  1.00 26.44 ? 78   TYR P CZ  1 
ATOM   2555 O  OH  . TYR C 3 40  ? 22.210  -31.745 -5.871  1.00 26.96 ? 78   TYR P OH  1 
ATOM   2556 N  N   . VAL C 3 41  ? 16.001  -26.100 -4.212  1.00 25.87 ? 79   VAL P N   1 
ATOM   2557 C  CA  . VAL C 3 41  ? 14.918  -25.427 -3.511  1.00 25.63 ? 79   VAL P CA  1 
ATOM   2558 C  C   . VAL C 3 41  ? 14.328  -26.439 -2.541  1.00 25.66 ? 79   VAL P C   1 
ATOM   2559 O  O   . VAL C 3 41  ? 13.836  -27.495 -2.959  1.00 25.59 ? 79   VAL P O   1 
ATOM   2560 C  CB  . VAL C 3 41  ? 13.805  -24.903 -4.454  1.00 25.49 ? 79   VAL P CB  1 
ATOM   2561 C  CG1 . VAL C 3 41  ? 12.777  -24.105 -3.658  1.00 24.87 ? 79   VAL P CG1 1 
ATOM   2562 C  CG2 . VAL C 3 41  ? 14.389  -24.061 -5.579  1.00 25.18 ? 79   VAL P CG2 1 
ATOM   2563 N  N   . VAL C 3 42  ? 14.402  -26.119 -1.249  1.00 25.59 ? 80   VAL P N   1 
ATOM   2564 C  CA  . VAL C 3 42  ? 13.875  -26.989 -0.204  1.00 25.60 ? 80   VAL P CA  1 
ATOM   2565 C  C   . VAL C 3 42  ? 12.514  -26.439 0.191   1.00 25.70 ? 80   VAL P C   1 
ATOM   2566 O  O   . VAL C 3 42  ? 12.422  -25.388 0.809   1.00 25.91 ? 80   VAL P O   1 
ATOM   2567 C  CB  . VAL C 3 42  ? 14.838  -27.088 1.015   1.00 25.48 ? 80   VAL P CB  1 
ATOM   2568 C  CG1 . VAL C 3 42  ? 14.206  -27.884 2.151   1.00 24.75 ? 80   VAL P CG1 1 
ATOM   2569 C  CG2 . VAL C 3 42  ? 16.162  -27.715 0.598   1.00 25.23 ? 80   VAL P CG2 1 
ATOM   2570 N  N   . VAL C 3 43  ? 11.462  -27.150 -0.195  1.00 25.97 ? 81   VAL P N   1 
ATOM   2571 C  CA  . VAL C 3 43  ? 10.097  -26.661 -0.022  1.00 26.16 ? 81   VAL P CA  1 
ATOM   2572 C  C   . VAL C 3 43  ? 9.455   -27.280 1.214   1.00 26.19 ? 81   VAL P C   1 
ATOM   2573 O  O   . VAL C 3 43  ? 9.333   -28.505 1.333   1.00 26.00 ? 81   VAL P O   1 
ATOM   2574 C  CB  . VAL C 3 43  ? 9.223   -26.909 -1.291  1.00 26.23 ? 81   VAL P CB  1 
ATOM   2575 C  CG1 . VAL C 3 43  ? 7.864   -26.217 -1.160  1.00 25.96 ? 81   VAL P CG1 1 
ATOM   2576 C  CG2 . VAL C 3 43  ? 9.943   -26.409 -2.542  1.00 26.29 ? 81   VAL P CG2 1 
ATOM   2577 N  N   . LEU C 3 44  ? 9.051   -26.418 2.134   1.00 26.25 ? 82   LEU P N   1 
ATOM   2578 C  CA  . LEU C 3 44  ? 8.439   -26.871 3.367   1.00 26.70 ? 82   LEU P CA  1 
ATOM   2579 C  C   . LEU C 3 44  ? 6.927   -26.930 3.236   1.00 27.20 ? 82   LEU P C   1 
ATOM   2580 O  O   . LEU C 3 44  ? 6.344   -26.299 2.352   1.00 27.29 ? 82   LEU P O   1 
ATOM   2581 C  CB  . LEU C 3 44  ? 8.858   -25.980 4.534   1.00 26.44 ? 82   LEU P CB  1 
ATOM   2582 C  CG  . LEU C 3 44  ? 10.367  -25.797 4.716   1.00 26.44 ? 82   LEU P CG  1 
ATOM   2583 C  CD1 . LEU C 3 44  ? 10.620  -25.040 5.988   1.00 26.66 ? 82   LEU P CD1 1 
ATOM   2584 C  CD2 . LEU C 3 44  ? 11.141  -27.127 4.725   1.00 25.92 ? 82   LEU P CD2 1 
ATOM   2585 N  N   . LYS C 3 45  ? 6.301   -27.707 4.112   1.00 27.84 ? 83   LYS P N   1 
ATOM   2586 C  CA  . LYS C 3 45  ? 4.860   -27.878 4.098   1.00 28.58 ? 83   LYS P CA  1 
ATOM   2587 C  C   . LYS C 3 45  ? 4.143   -26.539 4.273   1.00 28.99 ? 83   LYS P C   1 
ATOM   2588 O  O   . LYS C 3 45  ? 4.652   -25.628 4.929   1.00 29.13 ? 83   LYS P O   1 
ATOM   2589 C  CB  . LYS C 3 45  ? 4.439   -28.899 5.159   1.00 28.70 ? 83   LYS P CB  1 
ATOM   2590 C  CG  . LYS C 3 45  ? 4.736   -30.339 4.755   1.00 29.37 ? 83   LYS P CG  1 
ATOM   2591 C  CD  . LYS C 3 45  ? 4.674   -31.290 5.939   1.00 30.43 ? 83   LYS P CD  1 
ATOM   2592 C  CE  . LYS C 3 45  ? 5.014   -32.716 5.510   1.00 30.94 ? 83   LYS P CE  1 
ATOM   2593 N  NZ  . LYS C 3 45  ? 4.911   -33.690 6.642   1.00 31.01 ? 83   LYS P NZ  1 
ATOM   2594 N  N   . GLU C 3 46  ? 2.956   -26.448 3.678   1.00 29.52 ? 84   GLU P N   1 
ATOM   2595 C  CA  . GLU C 3 46  ? 2.195   -25.199 3.506   1.00 30.05 ? 84   GLU P CA  1 
ATOM   2596 C  C   . GLU C 3 46  ? 2.248   -24.159 4.644   1.00 30.00 ? 84   GLU P C   1 
ATOM   2597 O  O   . GLU C 3 46  ? 2.570   -22.995 4.406   1.00 30.09 ? 84   GLU P O   1 
ATOM   2598 C  CB  . GLU C 3 46  ? 0.737   -25.537 3.175   1.00 29.99 ? 84   GLU P CB  1 
ATOM   2599 C  CG  . GLU C 3 46  ? 0.042   -24.537 2.261   1.00 30.52 ? 84   GLU P CG  1 
ATOM   2600 C  CD  . GLU C 3 46  ? -1.453  -24.806 2.132   1.00 30.75 ? 84   GLU P CD  1 
ATOM   2601 O  OE1 . GLU C 3 46  ? -2.016  -25.517 2.997   1.00 31.64 ? 84   GLU P OE1 1 
ATOM   2602 O  OE2 . GLU C 3 46  ? -2.067  -24.302 1.166   1.00 31.60 ? 84   GLU P OE2 1 
ATOM   2603 N  N   . GLU C 3 47  ? 1.930   -24.572 5.866   1.00 29.98 ? 85   GLU P N   1 
ATOM   2604 C  CA  . GLU C 3 47  ? 1.737   -23.613 6.960   1.00 30.25 ? 85   GLU P CA  1 
ATOM   2605 C  C   . GLU C 3 47  ? 2.969   -23.384 7.849   1.00 29.98 ? 85   GLU P C   1 
ATOM   2606 O  O   . GLU C 3 47  ? 2.850   -22.930 8.993   1.00 30.14 ? 85   GLU P O   1 
ATOM   2607 C  CB  . GLU C 3 47  ? 0.504   -23.990 7.792   1.00 30.18 ? 85   GLU P CB  1 
ATOM   2608 C  CG  . GLU C 3 47  ? -0.814  -23.677 7.080   1.00 30.77 ? 85   GLU P CG  1 
ATOM   2609 C  CD  . GLU C 3 47  ? -2.023  -24.351 7.719   1.00 30.96 ? 85   GLU P CD  1 
ATOM   2610 O  OE1 . GLU C 3 47  ? -2.959  -24.710 6.968   1.00 31.98 ? 85   GLU P OE1 1 
ATOM   2611 O  OE2 . GLU C 3 47  ? -2.044  -24.521 8.960   1.00 31.39 ? 85   GLU P OE2 1 
ATOM   2612 N  N   . THR C 3 48  ? 4.144   -23.675 7.299   1.00 29.58 ? 86   THR P N   1 
ATOM   2613 C  CA  . THR C 3 48  ? 5.407   -23.535 8.009   1.00 29.15 ? 86   THR P CA  1 
ATOM   2614 C  C   . THR C 3 48  ? 5.819   -22.069 8.159   1.00 29.09 ? 86   THR P C   1 
ATOM   2615 O  O   . THR C 3 48  ? 6.058   -21.381 7.162   1.00 29.04 ? 86   THR P O   1 
ATOM   2616 C  CB  . THR C 3 48  ? 6.520   -24.320 7.285   1.00 29.03 ? 86   THR P CB  1 
ATOM   2617 O  OG1 . THR C 3 48  ? 6.096   -25.674 7.098   1.00 28.68 ? 86   THR P OG1 1 
ATOM   2618 C  CG2 . THR C 3 48  ? 7.803   -24.311 8.084   1.00 28.65 ? 86   THR P CG2 1 
ATOM   2619 N  N   . HIS C 3 49  ? 5.898   -21.614 9.411   1.00 29.04 ? 87   HIS P N   1 
ATOM   2620 C  CA  A HIS C 3 49  ? 6.320   -20.250 9.724   0.50 29.07 ? 87   HIS P CA  1 
ATOM   2621 C  CA  B HIS C 3 49  ? 6.326   -20.252 9.747   0.50 29.00 ? 87   HIS P CA  1 
ATOM   2622 C  C   . HIS C 3 49  ? 7.783   -20.033 9.332   1.00 29.04 ? 87   HIS P C   1 
ATOM   2623 O  O   . HIS C 3 49  ? 8.558   -20.989 9.225   1.00 29.11 ? 87   HIS P O   1 
ATOM   2624 C  CB  A HIS C 3 49  ? 6.125   -19.947 11.217  0.50 29.11 ? 87   HIS P CB  1 
ATOM   2625 C  CB  B HIS C 3 49  ? 6.156   -20.013 11.255  0.50 29.01 ? 87   HIS P CB  1 
ATOM   2626 C  CG  A HIS C 3 49  ? 4.750   -20.255 11.730  0.50 29.25 ? 87   HIS P CG  1 
ATOM   2627 C  CG  B HIS C 3 49  ? 6.268   -18.576 11.670  0.50 28.83 ? 87   HIS P CG  1 
ATOM   2628 N  ND1 A HIS C 3 49  ? 4.510   -21.231 12.674  0.50 29.20 ? 87   HIS P ND1 1 
ATOM   2629 N  ND1 B HIS C 3 49  ? 5.184   -17.726 11.711  0.50 28.83 ? 87   HIS P ND1 1 
ATOM   2630 C  CD2 A HIS C 3 49  ? 3.544   -19.713 11.434  0.50 29.12 ? 87   HIS P CD2 1 
ATOM   2631 C  CD2 B HIS C 3 49  ? 7.331   -17.847 12.085  0.50 28.62 ? 87   HIS P CD2 1 
ATOM   2632 C  CE1 A HIS C 3 49  ? 3.216   -21.278 12.937  0.50 29.18 ? 87   HIS P CE1 1 
ATOM   2633 C  CE1 B HIS C 3 49  ? 5.577   -16.532 12.120  0.50 28.65 ? 87   HIS P CE1 1 
ATOM   2634 N  NE2 A HIS C 3 49  ? 2.608   -20.368 12.197  0.50 29.10 ? 87   HIS P NE2 1 
ATOM   2635 N  NE2 B HIS C 3 49  ? 6.876   -16.580 12.354  0.50 28.30 ? 87   HIS P NE2 1 
ATOM   2636 N  N   . LEU C 3 50  ? 8.153   -18.775 9.101   1.00 28.95 ? 88   LEU P N   1 
ATOM   2637 C  CA  . LEU C 3 50  ? 9.533   -18.412 8.762   1.00 28.83 ? 88   LEU P CA  1 
ATOM   2638 C  C   . LEU C 3 50  ? 10.552  -18.912 9.802   1.00 28.82 ? 88   LEU P C   1 
ATOM   2639 O  O   . LEU C 3 50  ? 11.622  -19.403 9.443   1.00 28.75 ? 88   LEU P O   1 
ATOM   2640 C  CB  . LEU C 3 50  ? 9.650   -16.891 8.579   1.00 28.77 ? 88   LEU P CB  1 
ATOM   2641 C  CG  . LEU C 3 50  ? 11.026  -16.220 8.451   1.00 28.73 ? 88   LEU P CG  1 
ATOM   2642 C  CD1 . LEU C 3 50  ? 11.715  -16.594 7.149   1.00 28.05 ? 88   LEU P CD1 1 
ATOM   2643 C  CD2 . LEU C 3 50  ? 10.900  -14.703 8.576   1.00 28.75 ? 88   LEU P CD2 1 
ATOM   2644 N  N   . SER C 3 51  ? 10.214  -18.790 11.085  1.00 28.73 ? 89   SER P N   1 
ATOM   2645 C  CA  . SER C 3 51  ? 11.115  -19.218 12.161  1.00 28.75 ? 89   SER P CA  1 
ATOM   2646 C  C   . SER C 3 51  ? 11.408  -20.721 12.108  1.00 28.69 ? 89   SER P C   1 
ATOM   2647 O  O   . SER C 3 51  ? 12.499  -21.156 12.476  1.00 28.57 ? 89   SER P O   1 
ATOM   2648 C  CB  . SER C 3 51  ? 10.560  -18.821 13.530  1.00 28.63 ? 89   SER P CB  1 
ATOM   2649 O  OG  . SER C 3 51  ? 9.382   -19.545 13.834  1.00 28.64 ? 89   SER P OG  1 
ATOM   2650 N  N   . GLN C 3 52  ? 10.426  -21.496 11.648  1.00 28.78 ? 90   GLN P N   1 
ATOM   2651 C  CA  . GLN C 3 52  ? 10.593  -22.930 11.412  1.00 28.90 ? 90   GLN P CA  1 
ATOM   2652 C  C   . GLN C 3 52  ? 11.485  -23.190 10.197  1.00 28.78 ? 90   GLN P C   1 
ATOM   2653 O  O   . GLN C 3 52  ? 12.219  -24.186 10.169  1.00 28.74 ? 90   GLN P O   1 
ATOM   2654 C  CB  . GLN C 3 52  ? 9.237   -23.613 11.222  1.00 28.99 ? 90   GLN P CB  1 
ATOM   2655 C  CG  . GLN C 3 52  ? 8.497   -23.940 12.515  1.00 30.19 ? 90   GLN P CG  1 
ATOM   2656 C  CD  . GLN C 3 52  ? 6.975   -24.049 12.343  1.00 31.82 ? 90   GLN P CD  1 
ATOM   2657 O  OE1 . GLN C 3 52  ? 6.434   -23.922 11.235  1.00 31.97 ? 90   GLN P OE1 1 
ATOM   2658 N  NE2 . GLN C 3 52  ? 6.281   -24.283 13.452  1.00 31.97 ? 90   GLN P NE2 1 
ATOM   2659 N  N   . SER C 3 53  ? 11.416  -22.299 9.204   1.00 28.63 ? 91   SER P N   1 
ATOM   2660 C  CA  A SER C 3 53  ? 12.251  -22.402 8.007   0.50 28.63 ? 91   SER P CA  1 
ATOM   2661 C  CA  B SER C 3 53  ? 12.248  -22.416 8.013   0.50 28.59 ? 91   SER P CA  1 
ATOM   2662 C  C   . SER C 3 53  ? 13.719  -22.173 8.342   1.00 28.67 ? 91   SER P C   1 
ATOM   2663 O  O   . SER C 3 53  ? 14.594  -22.917 7.884   1.00 28.73 ? 91   SER P O   1 
ATOM   2664 C  CB  A SER C 3 53  ? 11.802  -21.412 6.929   0.50 28.61 ? 91   SER P CB  1 
ATOM   2665 C  CB  B SER C 3 53  ? 11.772  -21.462 6.917   0.50 28.56 ? 91   SER P CB  1 
ATOM   2666 O  OG  A SER C 3 53  ? 10.563  -21.790 6.359   0.50 28.68 ? 91   SER P OG  1 
ATOM   2667 O  OG  B SER C 3 53  ? 12.392  -21.763 5.681   0.50 28.40 ? 91   SER P OG  1 
ATOM   2668 N  N   . GLU C 3 54  ? 13.985  -21.145 9.145   1.00 28.72 ? 92   GLU P N   1 
ATOM   2669 C  CA  . GLU C 3 54  ? 15.353  -20.821 9.548   1.00 28.95 ? 92   GLU P CA  1 
ATOM   2670 C  C   . GLU C 3 54  ? 15.990  -21.902 10.424  1.00 28.66 ? 92   GLU P C   1 
ATOM   2671 O  O   . GLU C 3 54  ? 17.170  -22.208 10.256  1.00 28.81 ? 92   GLU P O   1 
ATOM   2672 C  CB  . GLU C 3 54  ? 15.409  -19.452 10.214  1.00 29.15 ? 92   GLU P CB  1 
ATOM   2673 C  CG  . GLU C 3 54  ? 15.356  -18.315 9.203   1.00 30.62 ? 92   GLU P CG  1 
ATOM   2674 C  CD  . GLU C 3 54  ? 14.701  -17.064 9.750   1.00 32.63 ? 92   GLU P CD  1 
ATOM   2675 O  OE1 . GLU C 3 54  ? 14.054  -17.142 10.819  1.00 33.75 ? 92   GLU P OE1 1 
ATOM   2676 O  OE2 . GLU C 3 54  ? 14.829  -16.001 9.104   1.00 33.28 ? 92   GLU P OE2 1 
ATOM   2677 N  N   . ARG C 3 55  ? 15.204  -22.482 11.334  1.00 28.39 ? 93   ARG P N   1 
ATOM   2678 C  CA  A ARG C 3 55  ? 15.668  -23.594 12.159  0.50 28.16 ? 93   ARG P CA  1 
ATOM   2679 C  CA  B ARG C 3 55  ? 15.671  -23.592 12.163  0.50 28.18 ? 93   ARG P CA  1 
ATOM   2680 C  C   . ARG C 3 55  ? 16.015  -24.808 11.304  1.00 27.98 ? 93   ARG P C   1 
ATOM   2681 O  O   . ARG C 3 55  ? 17.018  -25.479 11.545  1.00 28.22 ? 93   ARG P O   1 
ATOM   2682 C  CB  A ARG C 3 55  ? 14.619  -23.979 13.204  0.50 28.15 ? 93   ARG P CB  1 
ATOM   2683 C  CB  B ARG C 3 55  ? 14.628  -23.968 13.221  0.50 28.19 ? 93   ARG P CB  1 
ATOM   2684 C  CG  A ARG C 3 55  ? 14.598  -23.086 14.432  0.50 28.18 ? 93   ARG P CG  1 
ATOM   2685 C  CG  B ARG C 3 55  ? 15.111  -24.997 14.248  0.50 28.25 ? 93   ARG P CG  1 
ATOM   2686 C  CD  A ARG C 3 55  ? 13.883  -23.778 15.581  0.50 27.66 ? 93   ARG P CD  1 
ATOM   2687 C  CD  B ARG C 3 55  ? 14.017  -25.321 15.252  0.50 28.23 ? 93   ARG P CD  1 
ATOM   2688 N  NE  A ARG C 3 55  ? 13.478  -22.845 16.627  0.50 27.08 ? 93   ARG P NE  1 
ATOM   2689 N  NE  B ARG C 3 55  ? 14.380  -26.415 16.150  0.50 28.13 ? 93   ARG P NE  1 
ATOM   2690 C  CZ  A ARG C 3 55  ? 12.330  -22.174 16.635  0.50 26.89 ? 93   ARG P CZ  1 
ATOM   2691 C  CZ  B ARG C 3 55  ? 13.538  -26.997 17.004  0.50 28.15 ? 93   ARG P CZ  1 
ATOM   2692 N  NH1 A ARG C 3 55  ? 11.455  -22.317 15.646  0.50 26.45 ? 93   ARG P NH1 1 
ATOM   2693 N  NH1 B ARG C 3 55  ? 12.274  -26.596 17.080  0.50 27.99 ? 93   ARG P NH1 1 
ATOM   2694 N  NH2 A ARG C 3 55  ? 12.057  -21.352 17.639  0.50 26.93 ? 93   ARG P NH2 1 
ATOM   2695 N  NH2 B ARG C 3 55  ? 13.959  -27.984 17.784  0.50 27.51 ? 93   ARG P NH2 1 
ATOM   2696 N  N   . THR C 3 56  ? 15.183  -25.088 10.305  1.00 27.54 ? 94   THR P N   1 
ATOM   2697 C  CA  . THR C 3 56  ? 15.415  -26.225 9.421   1.00 26.93 ? 94   THR P CA  1 
ATOM   2698 C  C   . THR C 3 56  ? 16.699  -26.013 8.615   1.00 27.03 ? 94   THR P C   1 
ATOM   2699 O  O   . THR C 3 56  ? 17.509  -26.934 8.487   1.00 27.17 ? 94   THR P O   1 
ATOM   2700 C  CB  . THR C 3 56  ? 14.197  -26.491 8.510   1.00 26.81 ? 94   THR P CB  1 
ATOM   2701 O  OG1 . THR C 3 56  ? 13.075  -26.845 9.323   1.00 26.17 ? 94   THR P OG1 1 
ATOM   2702 C  CG2 . THR C 3 56  ? 14.470  -27.622 7.521   1.00 26.05 ? 94   THR P CG2 1 
ATOM   2703 N  N   . ALA C 3 57  ? 16.889  -24.796 8.101   1.00 26.88 ? 95   ALA P N   1 
ATOM   2704 C  CA  . ALA C 3 57  ? 18.103  -24.439 7.371   1.00 26.79 ? 95   ALA P CA  1 
ATOM   2705 C  C   . ALA C 3 57  ? 19.331  -24.485 8.281   1.00 26.74 ? 95   ALA P C   1 
ATOM   2706 O  O   . ALA C 3 57  ? 20.385  -24.972 7.878   1.00 26.74 ? 95   ALA P O   1 
ATOM   2707 C  CB  . ALA C 3 57  ? 17.964  -23.063 6.718   1.00 26.74 ? 95   ALA P CB  1 
ATOM   2708 N  N   . ARG C 3 58  ? 19.189  -23.993 9.508   1.00 26.59 ? 96   ARG P N   1 
ATOM   2709 C  CA  . ARG C 3 58  ? 20.282  -24.058 10.482  1.00 26.81 ? 96   ARG P CA  1 
ATOM   2710 C  C   . ARG C 3 58  ? 20.628  -25.487 10.903  1.00 26.42 ? 96   ARG P C   1 
ATOM   2711 O  O   . ARG C 3 58  ? 21.781  -25.770 11.234  1.00 26.48 ? 96   ARG P O   1 
ATOM   2712 C  CB  . ARG C 3 58  ? 19.993  -23.175 11.697  1.00 26.88 ? 96   ARG P CB  1 
ATOM   2713 C  CG  . ARG C 3 58  ? 20.580  -21.772 11.569  1.00 28.72 ? 96   ARG P CG  1 
ATOM   2714 C  CD  . ARG C 3 58  ? 19.704  -20.708 12.225  1.00 31.80 ? 96   ARG P CD  1 
ATOM   2715 N  NE  . ARG C 3 58  ? 19.238  -21.119 13.549  1.00 33.85 ? 96   ARG P NE  1 
ATOM   2716 C  CZ  . ARG C 3 58  ? 18.044  -20.819 14.053  1.00 35.11 ? 96   ARG P CZ  1 
ATOM   2717 N  NH1 . ARG C 3 58  ? 17.174  -20.100 13.351  1.00 35.19 ? 96   ARG P NH1 1 
ATOM   2718 N  NH2 . ARG C 3 58  ? 17.712  -21.251 15.265  1.00 36.49 ? 96   ARG P NH2 1 
ATOM   2719 N  N   . ARG C 3 59  ? 19.633  -26.374 10.870  1.00 26.05 ? 97   ARG P N   1 
ATOM   2720 C  CA  . ARG C 3 59  ? 19.817  -27.803 11.145  1.00 25.84 ? 97   ARG P CA  1 
ATOM   2721 C  C   . ARG C 3 59  ? 20.542  -28.494 9.998   1.00 25.83 ? 97   ARG P C   1 
ATOM   2722 O  O   . ARG C 3 59  ? 21.414  -29.337 10.221  1.00 25.71 ? 97   ARG P O   1 
ATOM   2723 C  CB  . ARG C 3 59  ? 18.459  -28.469 11.381  1.00 25.92 ? 97   ARG P CB  1 
ATOM   2724 C  CG  . ARG C 3 59  ? 18.485  -29.957 11.709  1.00 25.68 ? 97   ARG P CG  1 
ATOM   2725 C  CD  . ARG C 3 59  ? 17.786  -30.156 13.034  1.00 25.88 ? 97   ARG P CD  1 
ATOM   2726 N  NE  . ARG C 3 59  ? 16.726  -31.150 13.002  1.00 25.86 ? 97   ARG P NE  1 
ATOM   2727 C  CZ  . ARG C 3 59  ? 15.869  -31.346 14.001  1.00 26.55 ? 97   ARG P CZ  1 
ATOM   2728 N  NH1 . ARG C 3 59  ? 15.952  -30.615 15.109  1.00 25.60 ? 97   ARG P NH1 1 
ATOM   2729 N  NH2 . ARG C 3 59  ? 14.924  -32.275 13.892  1.00 27.14 ? 97   ARG P NH2 1 
ATOM   2730 N  N   . LEU C 3 60  ? 20.162  -28.139 8.772   1.00 25.70 ? 98   LEU P N   1 
ATOM   2731 C  CA  . LEU C 3 60  ? 20.816  -28.652 7.581   1.00 25.57 ? 98   LEU P CA  1 
ATOM   2732 C  C   . LEU C 3 60  ? 22.300  -28.306 7.615   1.00 25.50 ? 98   LEU P C   1 
ATOM   2733 O  O   . LEU C 3 60  ? 23.149  -29.184 7.435   1.00 25.56 ? 98   LEU P O   1 
ATOM   2734 C  CB  . LEU C 3 60  ? 20.140  -28.094 6.331   1.00 25.59 ? 98   LEU P CB  1 
ATOM   2735 C  CG  . LEU C 3 60  ? 20.747  -28.262 4.940   1.00 25.98 ? 98   LEU P CG  1 
ATOM   2736 C  CD1 . LEU C 3 60  ? 21.358  -29.627 4.730   1.00 27.29 ? 98   LEU P CD1 1 
ATOM   2737 C  CD2 . LEU C 3 60  ? 19.667  -28.016 3.911   1.00 26.27 ? 98   LEU P CD2 1 
ATOM   2738 N  N   . GLN C 3 61  ? 22.604  -27.037 7.879   1.00 25.27 ? 99   GLN P N   1 
ATOM   2739 C  CA  . GLN C 3 61  ? 23.983  -26.575 7.982   1.00 25.20 ? 99   GLN P CA  1 
ATOM   2740 C  C   . GLN C 3 61  ? 24.749  -27.284 9.088   1.00 25.14 ? 99   GLN P C   1 
ATOM   2741 O  O   . GLN C 3 61  ? 25.912  -27.633 8.901   1.00 25.19 ? 99   GLN P O   1 
ATOM   2742 C  CB  . GLN C 3 61  ? 24.031  -25.070 8.202   1.00 25.11 ? 99   GLN P CB  1 
ATOM   2743 C  CG  . GLN C 3 61  ? 23.567  -24.275 7.005   1.00 25.85 ? 99   GLN P CG  1 
ATOM   2744 C  CD  . GLN C 3 61  ? 23.945  -22.816 7.101   1.00 26.95 ? 99   GLN P CD  1 
ATOM   2745 O  OE1 . GLN C 3 61  ? 23.450  -22.087 7.964   1.00 27.84 ? 99   GLN P OE1 1 
ATOM   2746 N  NE2 . GLN C 3 61  ? 24.827  -22.377 6.211   1.00 26.72 ? 99   GLN P NE2 1 
ATOM   2747 N  N   . ALA C 3 62  ? 24.089  -27.502 10.228  1.00 25.03 ? 100  ALA P N   1 
ATOM   2748 C  CA  . ALA C 3 62  ? 24.711  -28.153 11.389  1.00 24.80 ? 100  ALA P CA  1 
ATOM   2749 C  C   . ALA C 3 62  ? 24.968  -29.636 11.163  1.00 24.61 ? 100  ALA P C   1 
ATOM   2750 O  O   . ALA C 3 62  ? 26.071  -30.117 11.424  1.00 24.90 ? 100  ALA P O   1 
ATOM   2751 C  CB  . ALA C 3 62  ? 23.875  -27.943 12.644  1.00 24.62 ? 100  ALA P CB  1 
ATOM   2752 N  N   . GLN C 3 63  ? 23.957  -30.357 10.684  1.00 24.24 ? 101  GLN P N   1 
ATOM   2753 C  CA  . GLN C 3 63  ? 24.098  -31.787 10.397  1.00 24.04 ? 101  GLN P CA  1 
ATOM   2754 C  C   . GLN C 3 63  ? 25.205  -32.039 9.380   1.00 23.74 ? 101  GLN P C   1 
ATOM   2755 O  O   . GLN C 3 63  ? 26.045  -32.913 9.585   1.00 23.95 ? 101  GLN P O   1 
ATOM   2756 C  CB  . GLN C 3 63  ? 22.772  -32.395 9.915   1.00 23.97 ? 101  GLN P CB  1 
ATOM   2757 C  CG  . GLN C 3 63  ? 21.751  -32.605 11.027  1.00 24.19 ? 101  GLN P CG  1 
ATOM   2758 C  CD  . GLN C 3 63  ? 20.450  -33.245 10.553  1.00 24.27 ? 101  GLN P CD  1 
ATOM   2759 O  OE1 . GLN C 3 63  ? 20.057  -33.112 9.397   1.00 23.95 ? 101  GLN P OE1 1 
ATOM   2760 N  NE2 . GLN C 3 63  ? 19.772  -33.937 11.463  1.00 24.91 ? 101  GLN P NE2 1 
ATOM   2761 N  N   . ALA C 3 64  ? 25.211  -31.254 8.303   1.00 23.53 ? 102  ALA P N   1 
ATOM   2762 C  CA  . ALA C 3 64  ? 26.204  -31.381 7.228   1.00 23.37 ? 102  ALA P CA  1 
ATOM   2763 C  C   . ALA C 3 64  ? 27.621  -31.031 7.665   1.00 23.27 ? 102  ALA P C   1 
ATOM   2764 O  O   . ALA C 3 64  ? 28.561  -31.770 7.357   1.00 23.44 ? 102  ALA P O   1 
ATOM   2765 C  CB  . ALA C 3 64  ? 25.808  -30.543 6.028   1.00 23.30 ? 102  ALA P CB  1 
ATOM   2766 N  N   . ALA C 3 65  ? 27.776  -29.908 8.371   1.00 22.99 ? 103  ALA P N   1 
ATOM   2767 C  CA  . ALA C 3 65  ? 29.098  -29.467 8.836   1.00 22.72 ? 103  ALA P CA  1 
ATOM   2768 C  C   . ALA C 3 65  ? 29.759  -30.548 9.684   1.00 22.53 ? 103  ALA P C   1 
ATOM   2769 O  O   . ALA C 3 65  ? 30.961  -30.781 9.582   1.00 22.59 ? 103  ALA P O   1 
ATOM   2770 C  CB  . ALA C 3 65  ? 28.997  -28.161 9.617   1.00 22.65 ? 103  ALA P CB  1 
ATOM   2771 N  N   . ARG C 3 66  ? 28.954  -31.215 10.507  1.00 22.14 ? 104  ARG P N   1 
ATOM   2772 C  CA  . ARG C 3 66  ? 29.443  -32.258 11.387  1.00 21.83 ? 104  ARG P CA  1 
ATOM   2773 C  C   . ARG C 3 66  ? 29.841  -33.514 10.609  1.00 21.78 ? 104  ARG P C   1 
ATOM   2774 O  O   . ARG C 3 66  ? 30.654  -34.313 11.086  1.00 21.81 ? 104  ARG P O   1 
ATOM   2775 C  CB  . ARG C 3 66  ? 28.412  -32.556 12.481  1.00 21.73 ? 104  ARG P CB  1 
ATOM   2776 C  CG  . ARG C 3 66  ? 28.391  -31.506 13.585  1.00 20.90 ? 104  ARG P CG  1 
ATOM   2777 C  CD  . ARG C 3 66  ? 27.091  -31.506 14.376  1.00 19.97 ? 104  ARG P CD  1 
ATOM   2778 N  NE  . ARG C 3 66  ? 26.883  -32.737 15.142  1.00 19.76 ? 104  ARG P NE  1 
ATOM   2779 C  CZ  . ARG C 3 66  ? 27.448  -33.007 16.317  1.00 18.80 ? 104  ARG P CZ  1 
ATOM   2780 N  NH1 . ARG C 3 66  ? 28.276  -32.142 16.886  1.00 18.42 ? 104  ARG P NH1 1 
ATOM   2781 N  NH2 . ARG C 3 66  ? 27.186  -34.151 16.924  1.00 18.66 ? 104  ARG P NH2 1 
ATOM   2782 N  N   . ARG C 3 67  ? 29.284  -33.669 9.409   1.00 21.40 ? 105  ARG P N   1 
ATOM   2783 C  CA  . ARG C 3 67  ? 29.657  -34.768 8.523   1.00 21.18 ? 105  ARG P CA  1 
ATOM   2784 C  C   . ARG C 3 67  ? 30.786  -34.392 7.562   1.00 21.07 ? 105  ARG P C   1 
ATOM   2785 O  O   . ARG C 3 67  ? 31.178  -35.198 6.723   1.00 21.13 ? 105  ARG P O   1 
ATOM   2786 C  CB  . ARG C 3 67  ? 28.442  -35.260 7.734   1.00 21.07 ? 105  ARG P CB  1 
ATOM   2787 C  CG  . ARG C 3 67  ? 27.446  -36.028 8.565   1.00 21.34 ? 105  ARG P CG  1 
ATOM   2788 C  CD  . ARG C 3 67  ? 26.268  -36.498 7.739   1.00 21.61 ? 105  ARG P CD  1 
ATOM   2789 N  NE  . ARG C 3 67  ? 25.043  -36.409 8.530   1.00 22.81 ? 105  ARG P NE  1 
ATOM   2790 C  CZ  . ARG C 3 67  ? 23.823  -36.750 8.113   1.00 23.36 ? 105  ARG P CZ  1 
ATOM   2791 N  NH1 . ARG C 3 67  ? 23.632  -37.224 6.882   1.00 22.87 ? 105  ARG P NH1 1 
ATOM   2792 N  NH2 . ARG C 3 67  ? 22.784  -36.608 8.939   1.00 22.60 ? 105  ARG P NH2 1 
ATOM   2793 N  N   . GLY C 3 68  ? 31.291  -33.167 7.674   1.00 21.07 ? 106  GLY P N   1 
ATOM   2794 C  CA  . GLY C 3 68  ? 32.404  -32.701 6.834   1.00 21.19 ? 106  GLY P CA  1 
ATOM   2795 C  C   . GLY C 3 68  ? 32.029  -31.910 5.585   1.00 21.37 ? 106  GLY P C   1 
ATOM   2796 O  O   . GLY C 3 68  ? 32.867  -31.711 4.706   1.00 21.44 ? 106  GLY P O   1 
ATOM   2797 N  N   . TYR C 3 69  ? 30.784  -31.436 5.515   1.00 21.21 ? 107  TYR P N   1 
ATOM   2798 C  CA  . TYR C 3 69  ? 30.273  -30.767 4.320   1.00 21.13 ? 107  TYR P CA  1 
ATOM   2799 C  C   . TYR C 3 69  ? 29.969  -29.289 4.541   1.00 21.32 ? 107  TYR P C   1 
ATOM   2800 O  O   . TYR C 3 69  ? 29.388  -28.916 5.560   1.00 21.69 ? 107  TYR P O   1 
ATOM   2801 C  CB  . TYR C 3 69  ? 28.999  -31.464 3.843   1.00 20.84 ? 107  TYR P CB  1 
ATOM   2802 C  CG  . TYR C 3 69  ? 29.213  -32.823 3.221   1.00 20.52 ? 107  TYR P CG  1 
ATOM   2803 C  CD1 . TYR C 3 69  ? 29.190  -32.982 1.837   1.00 19.77 ? 107  TYR P CD1 1 
ATOM   2804 C  CD2 . TYR C 3 69  ? 29.431  -33.958 4.015   1.00 19.96 ? 107  TYR P CD2 1 
ATOM   2805 C  CE1 . TYR C 3 69  ? 29.375  -34.229 1.255   1.00 19.72 ? 107  TYR P CE1 1 
ATOM   2806 C  CE2 . TYR C 3 69  ? 29.620  -35.211 3.441   1.00 19.45 ? 107  TYR P CE2 1 
ATOM   2807 C  CZ  . TYR C 3 69  ? 29.588  -35.336 2.060   1.00 19.88 ? 107  TYR P CZ  1 
ATOM   2808 O  OH  . TYR C 3 69  ? 29.773  -36.564 1.474   1.00 20.33 ? 107  TYR P OH  1 
ATOM   2809 N  N   . LEU C 3 70  ? 30.346  -28.453 3.578   1.00 21.33 ? 108  LEU P N   1 
ATOM   2810 C  CA  . LEU C 3 70  ? 29.980  -27.040 3.602   1.00 21.54 ? 108  LEU P CA  1 
ATOM   2811 C  C   . LEU C 3 70  ? 28.651  -26.913 2.898   1.00 21.63 ? 108  LEU P C   1 
ATOM   2812 O  O   . LEU C 3 70  ? 28.453  -27.519 1.850   1.00 22.37 ? 108  LEU P O   1 
ATOM   2813 C  CB  . LEU C 3 70  ? 31.010  -26.197 2.838   1.00 21.62 ? 108  LEU P CB  1 
ATOM   2814 C  CG  . LEU C 3 70  ? 31.441  -24.777 3.257   1.00 21.38 ? 108  LEU P CG  1 
ATOM   2815 C  CD1 . LEU C 3 70  ? 32.065  -24.062 2.056   1.00 20.48 ? 108  LEU P CD1 1 
ATOM   2816 C  CD2 . LEU C 3 70  ? 30.329  -23.918 3.871   1.00 21.21 ? 108  LEU P CD2 1 
ATOM   2817 N  N   . THR C 3 71  ? 27.731  -26.145 3.463   1.00 21.51 ? 109  THR P N   1 
ATOM   2818 C  CA  . THR C 3 71  ? 26.507  -25.808 2.749   1.00 21.56 ? 109  THR P CA  1 
ATOM   2819 C  C   . THR C 3 71  ? 26.308  -24.306 2.770   1.00 21.78 ? 109  THR P C   1 
ATOM   2820 O  O   . THR C 3 71  ? 26.718  -23.639 3.716   1.00 21.77 ? 109  THR P O   1 
ATOM   2821 C  CB  . THR C 3 71  ? 25.257  -26.470 3.344   1.00 21.55 ? 109  THR P CB  1 
ATOM   2822 O  OG1 . THR C 3 71  ? 25.069  -26.019 4.686   1.00 21.04 ? 109  THR P OG1 1 
ATOM   2823 C  CG2 . THR C 3 71  ? 25.372  -27.984 3.320   1.00 21.70 ? 109  THR P CG2 1 
ATOM   2824 N  N   . LYS C 3 72  ? 25.674  -23.784 1.725   1.00 21.80 ? 110  LYS P N   1 
ATOM   2825 C  CA  . LYS C 3 72  ? 25.445  -22.359 1.600   1.00 21.88 ? 110  LYS P CA  1 
ATOM   2826 C  C   . LYS C 3 72  ? 23.960  -22.073 1.397   1.00 22.03 ? 110  LYS P C   1 
ATOM   2827 O  O   . LYS C 3 72  ? 23.388  -22.419 0.361   1.00 22.35 ? 110  LYS P O   1 
ATOM   2828 C  CB  . LYS C 3 72  ? 26.259  -21.806 0.428   1.00 22.01 ? 110  LYS P CB  1 
ATOM   2829 C  CG  . LYS C 3 72  ? 27.752  -21.702 0.688   1.00 22.01 ? 110  LYS P CG  1 
ATOM   2830 C  CD  . LYS C 3 72  ? 28.490  -21.141 -0.523  1.00 21.79 ? 110  LYS P CD  1 
ATOM   2831 C  CE  . LYS C 3 72  ? 29.969  -20.954 -0.218  1.00 21.57 ? 110  LYS P CE  1 
ATOM   2832 N  NZ  . LYS C 3 72  ? 30.766  -20.672 -1.441  1.00 21.88 ? 110  LYS P NZ  1 
ATOM   2833 N  N   . ILE C 3 73  ? 23.336  -21.456 2.393   1.00 22.08 ? 111  ILE P N   1 
ATOM   2834 C  CA  . ILE C 3 73  ? 21.948  -21.022 2.279   1.00 22.14 ? 111  ILE P CA  1 
ATOM   2835 C  C   . ILE C 3 73  ? 21.928  -19.695 1.516   1.00 22.38 ? 111  ILE P C   1 
ATOM   2836 O  O   . ILE C 3 73  ? 22.301  -18.656 2.053   1.00 22.29 ? 111  ILE P O   1 
ATOM   2837 C  CB  . ILE C 3 73  ? 21.278  -20.853 3.676   1.00 22.12 ? 111  ILE P CB  1 
ATOM   2838 C  CG1 . ILE C 3 73  ? 21.475  -22.097 4.561   1.00 21.89 ? 111  ILE P CG1 1 
ATOM   2839 C  CG2 . ILE C 3 73  ? 19.800  -20.466 3.540   1.00 22.20 ? 111  ILE P CG2 1 
ATOM   2840 C  CD1 . ILE C 3 73  ? 20.851  -23.369 4.039   1.00 21.94 ? 111  ILE P CD1 1 
ATOM   2841 N  N   . LEU C 3 74  ? 21.509  -19.734 0.257   1.00 22.73 ? 112  LEU P N   1 
ATOM   2842 C  CA  . LEU C 3 74  ? 21.550  -18.541 -0.586  1.00 23.25 ? 112  LEU P CA  1 
ATOM   2843 C  C   . LEU C 3 74  ? 20.386  -17.580 -0.335  1.00 23.58 ? 112  LEU P C   1 
ATOM   2844 O  O   . LEU C 3 74  ? 20.553  -16.363 -0.390  1.00 23.52 ? 112  LEU P O   1 
ATOM   2845 C  CB  . LEU C 3 74  ? 21.604  -18.920 -2.065  1.00 23.06 ? 112  LEU P CB  1 
ATOM   2846 C  CG  . LEU C 3 74  ? 22.757  -19.786 -2.572  1.00 23.60 ? 112  LEU P CG  1 
ATOM   2847 C  CD1 . LEU C 3 74  ? 22.590  -20.002 -4.075  1.00 24.31 ? 112  LEU P CD1 1 
ATOM   2848 C  CD2 . LEU C 3 74  ? 24.114  -19.165 -2.266  1.00 23.37 ? 112  LEU P CD2 1 
ATOM   2849 N  N   . HIS C 3 75  ? 19.215  -18.138 -0.059  1.00 23.94 ? 113  HIS P N   1 
ATOM   2850 C  CA  . HIS C 3 75  ? 18.010  -17.352 0.094   1.00 24.28 ? 113  HIS P CA  1 
ATOM   2851 C  C   . HIS C 3 75  ? 17.024  -18.106 0.973   1.00 24.95 ? 113  HIS P C   1 
ATOM   2852 O  O   . HIS C 3 75  ? 16.913  -19.326 0.874   1.00 25.06 ? 113  HIS P O   1 
ATOM   2853 C  CB  . HIS C 3 75  ? 17.400  -17.093 -1.282  1.00 24.00 ? 113  HIS P CB  1 
ATOM   2854 C  CG  . HIS C 3 75  ? 16.224  -16.172 -1.256  1.00 23.59 ? 113  HIS P CG  1 
ATOM   2855 N  ND1 . HIS C 3 75  ? 14.934  -16.610 -1.461  1.00 22.87 ? 113  HIS P ND1 1 
ATOM   2856 C  CD2 . HIS C 3 75  ? 16.139  -14.839 -1.034  1.00 22.65 ? 113  HIS P CD2 1 
ATOM   2857 C  CE1 . HIS C 3 75  ? 14.106  -15.585 -1.372  1.00 22.00 ? 113  HIS P CE1 1 
ATOM   2858 N  NE2 . HIS C 3 75  ? 14.811  -14.500 -1.113  1.00 21.62 ? 113  HIS P NE2 1 
ATOM   2859 N  N   . VAL C 3 76  ? 16.323  -17.382 1.841   1.00 25.69 ? 114  VAL P N   1 
ATOM   2860 C  CA  . VAL C 3 76  ? 15.237  -17.963 2.624   1.00 26.43 ? 114  VAL P CA  1 
ATOM   2861 C  C   . VAL C 3 76  ? 13.938  -17.340 2.123   1.00 27.32 ? 114  VAL P C   1 
ATOM   2862 O  O   . VAL C 3 76  ? 13.797  -16.115 2.119   1.00 27.63 ? 114  VAL P O   1 
ATOM   2863 C  CB  . VAL C 3 76  ? 15.423  -17.736 4.159   1.00 26.40 ? 114  VAL P CB  1 
ATOM   2864 C  CG1 . VAL C 3 76  ? 14.263  -18.333 4.951   1.00 25.92 ? 114  VAL P CG1 1 
ATOM   2865 C  CG2 . VAL C 3 76  ? 16.738  -18.335 4.643   1.00 25.97 ? 114  VAL P CG2 1 
ATOM   2866 N  N   . PHE C 3 77  ? 13.008  -18.182 1.676   1.00 28.44 ? 115  PHE P N   1 
ATOM   2867 C  CA  . PHE C 3 77  ? 11.719  -17.718 1.157   1.00 29.62 ? 115  PHE P CA  1 
ATOM   2868 C  C   . PHE C 3 77  ? 10.737  -17.385 2.277   1.00 30.66 ? 115  PHE P C   1 
ATOM   2869 O  O   . PHE C 3 77  ? 10.431  -18.232 3.124   1.00 31.18 ? 115  PHE P O   1 
ATOM   2870 C  CB  . PHE C 3 77  ? 11.087  -18.759 0.225   1.00 29.36 ? 115  PHE P CB  1 
ATOM   2871 C  CG  . PHE C 3 77  ? 11.816  -18.942 -1.076  1.00 29.62 ? 115  PHE P CG  1 
ATOM   2872 C  CD1 . PHE C 3 77  ? 11.578  -18.089 -2.149  1.00 29.36 ? 115  PHE P CD1 1 
ATOM   2873 C  CD2 . PHE C 3 77  ? 12.733  -19.980 -1.235  1.00 29.28 ? 115  PHE P CD2 1 
ATOM   2874 C  CE1 . PHE C 3 77  ? 12.254  -18.260 -3.356  1.00 29.35 ? 115  PHE P CE1 1 
ATOM   2875 C  CE2 . PHE C 3 77  ? 13.413  -20.160 -2.440  1.00 28.67 ? 115  PHE P CE2 1 
ATOM   2876 C  CZ  . PHE C 3 77  ? 13.174  -19.301 -3.499  1.00 28.99 ? 115  PHE P CZ  1 
ATOM   2877 N  N   . HIS C 3 78  ? 10.267  -16.144 2.295   1.00 31.70 ? 116  HIS P N   1 
ATOM   2878 C  CA  . HIS C 3 78  ? 9.100   -15.789 3.087   1.00 32.85 ? 116  HIS P CA  1 
ATOM   2879 C  C   . HIS C 3 78  ? 8.186   -14.860 2.314   1.00 32.98 ? 116  HIS P C   1 
ATOM   2880 O  O   . HIS C 3 78  ? 8.495   -13.687 2.125   1.00 33.33 ? 116  HIS P O   1 
ATOM   2881 C  CB  . HIS C 3 78  ? 9.462   -15.210 4.467   1.00 33.54 ? 116  HIS P CB  1 
ATOM   2882 C  CG  . HIS C 3 78  ? 10.532  -14.155 4.453   1.00 35.31 ? 116  HIS P CG  1 
ATOM   2883 N  ND1 . HIS C 3 78  ? 11.881  -14.456 4.451   1.00 36.52 ? 116  HIS P ND1 1 
ATOM   2884 C  CD2 . HIS C 3 78  ? 10.451  -12.803 4.512   1.00 35.84 ? 116  HIS P CD2 1 
ATOM   2885 C  CE1 . HIS C 3 78  ? 12.582  -13.336 4.484   1.00 36.63 ? 116  HIS P CE1 1 
ATOM   2886 N  NE2 . HIS C 3 78  ? 11.738  -12.318 4.517   1.00 36.80 ? 116  HIS P NE2 1 
ATOM   2887 N  N   . GLY C 3 79  ? 7.067   -15.404 1.852   1.00 33.05 ? 117  GLY P N   1 
ATOM   2888 C  CA  . GLY C 3 79  ? 6.106   -14.625 1.095   1.00 33.25 ? 117  GLY P CA  1 
ATOM   2889 C  C   . GLY C 3 79  ? 5.224   -15.502 0.239   1.00 33.34 ? 117  GLY P C   1 
ATOM   2890 O  O   . GLY C 3 79  ? 4.012   -15.566 0.455   1.00 33.66 ? 117  GLY P O   1 
ATOM   2891 N  N   . LEU C 3 80  ? 5.826   -16.172 -0.738  1.00 33.05 ? 118  LEU P N   1 
ATOM   2892 C  CA  . LEU C 3 80  ? 5.073   -17.057 -1.613  1.00 32.95 ? 118  LEU P CA  1 
ATOM   2893 C  C   . LEU C 3 80  ? 4.932   -18.441 -1.010  1.00 32.83 ? 118  LEU P C   1 
ATOM   2894 O  O   . LEU C 3 80  ? 3.826   -18.895 -0.741  1.00 33.04 ? 118  LEU P O   1 
ATOM   2895 C  CB  . LEU C 3 80  ? 5.710   -17.149 -3.003  1.00 33.01 ? 118  LEU P CB  1 
ATOM   2896 C  CG  . LEU C 3 80  ? 5.068   -16.297 -4.096  1.00 33.00 ? 118  LEU P CG  1 
ATOM   2897 C  CD1 . LEU C 3 80  ? 5.735   -16.605 -5.405  1.00 33.17 ? 118  LEU P CD1 1 
ATOM   2898 C  CD2 . LEU C 3 80  ? 3.563   -16.550 -4.192  1.00 32.97 ? 118  LEU P CD2 1 
ATOM   2899 N  N   . LEU C 3 81  ? 6.059   -19.103 -0.801  1.00 32.59 ? 119  LEU P N   1 
ATOM   2900 C  CA  . LEU C 3 81  ? 6.067   -20.438 -0.239  1.00 32.39 ? 119  LEU P CA  1 
ATOM   2901 C  C   . LEU C 3 81  ? 7.119   -20.542 0.862   1.00 31.94 ? 119  LEU P C   1 
ATOM   2902 O  O   . LEU C 3 81  ? 8.078   -19.774 0.866   1.00 32.17 ? 119  LEU P O   1 
ATOM   2903 C  CB  . LEU C 3 81  ? 6.325   -21.469 -1.341  1.00 32.60 ? 119  LEU P CB  1 
ATOM   2904 C  CG  . LEU C 3 81  ? 7.157   -21.089 -2.569  1.00 32.81 ? 119  LEU P CG  1 
ATOM   2905 C  CD1 . LEU C 3 81  ? 8.643   -20.936 -2.254  1.00 33.28 ? 119  LEU P CD1 1 
ATOM   2906 C  CD2 . LEU C 3 81  ? 6.943   -22.139 -3.646  1.00 32.67 ? 119  LEU P CD2 1 
ATOM   2907 N  N   . PRO C 3 82  ? 6.942   -21.482 1.809   1.00 31.33 ? 120  PRO P N   1 
ATOM   2908 C  CA  . PRO C 3 82  ? 7.971   -21.637 2.829   1.00 30.62 ? 120  PRO P CA  1 
ATOM   2909 C  C   . PRO C 3 82  ? 9.097   -22.538 2.339   1.00 30.02 ? 120  PRO P C   1 
ATOM   2910 O  O   . PRO C 3 82  ? 8.857   -23.496 1.604   1.00 29.92 ? 120  PRO P O   1 
ATOM   2911 C  CB  . PRO C 3 82  ? 7.222   -22.287 3.988   1.00 30.61 ? 120  PRO P CB  1 
ATOM   2912 C  CG  . PRO C 3 82  ? 6.099   -23.035 3.352   1.00 31.16 ? 120  PRO P CG  1 
ATOM   2913 C  CD  . PRO C 3 82  ? 5.827   -22.430 1.995   1.00 31.29 ? 120  PRO P CD  1 
ATOM   2914 N  N   . GLY C 3 83  ? 10.318  -22.215 2.744   1.00 29.35 ? 121  GLY P N   1 
ATOM   2915 C  CA  . GLY C 3 83  ? 11.491  -22.973 2.341   1.00 28.31 ? 121  GLY P CA  1 
ATOM   2916 C  C   . GLY C 3 83  ? 12.674  -22.062 2.089   1.00 27.85 ? 121  GLY P C   1 
ATOM   2917 O  O   . GLY C 3 83  ? 12.620  -20.863 2.362   1.00 27.86 ? 121  GLY P O   1 
ATOM   2918 N  N   . PHE C 3 84  ? 13.745  -22.634 1.558   1.00 27.19 ? 122  PHE P N   1 
ATOM   2919 C  CA  . PHE C 3 84  ? 14.975  -21.890 1.333   1.00 26.70 ? 122  PHE P CA  1 
ATOM   2920 C  C   . PHE C 3 84  ? 15.747  -22.445 0.137   1.00 26.46 ? 122  PHE P C   1 
ATOM   2921 O  O   . PHE C 3 84  ? 15.420  -23.514 -0.385  1.00 26.41 ? 122  PHE P O   1 
ATOM   2922 C  CB  . PHE C 3 84  ? 15.845  -21.902 2.599   1.00 26.47 ? 122  PHE P CB  1 
ATOM   2923 C  CG  . PHE C 3 84  ? 16.123  -23.275 3.129   1.00 26.00 ? 122  PHE P CG  1 
ATOM   2924 C  CD1 . PHE C 3 84  ? 15.273  -23.859 4.062   1.00 25.40 ? 122  PHE P CD1 1 
ATOM   2925 C  CD2 . PHE C 3 84  ? 17.231  -23.992 2.690   1.00 26.01 ? 122  PHE P CD2 1 
ATOM   2926 C  CE1 . PHE C 3 84  ? 15.521  -25.133 4.549   1.00 24.84 ? 122  PHE P CE1 1 
ATOM   2927 C  CE2 . PHE C 3 84  ? 17.485  -25.268 3.170   1.00 25.50 ? 122  PHE P CE2 1 
ATOM   2928 C  CZ  . PHE C 3 84  ? 16.630  -25.838 4.107   1.00 25.49 ? 122  PHE P CZ  1 
ATOM   2929 N  N   . LEU C 3 85  ? 16.768  -21.704 -0.287  1.00 26.23 ? 123  LEU P N   1 
ATOM   2930 C  CA  . LEU C 3 85  ? 17.606  -22.075 -1.422  1.00 26.01 ? 123  LEU P CA  1 
ATOM   2931 C  C   . LEU C 3 85  ? 18.988  -22.475 -0.917  1.00 25.85 ? 123  LEU P C   1 
ATOM   2932 O  O   . LEU C 3 85  ? 19.695  -21.652 -0.326  1.00 25.81 ? 123  LEU P O   1 
ATOM   2933 C  CB  . LEU C 3 85  ? 17.716  -20.903 -2.406  1.00 25.85 ? 123  LEU P CB  1 
ATOM   2934 C  CG  . LEU C 3 85  ? 18.447  -21.122 -3.736  1.00 26.23 ? 123  LEU P CG  1 
ATOM   2935 C  CD1 . LEU C 3 85  ? 17.651  -22.063 -4.630  1.00 26.70 ? 123  LEU P CD1 1 
ATOM   2936 C  CD2 . LEU C 3 85  ? 18.733  -19.802 -4.466  1.00 25.74 ? 123  LEU P CD2 1 
ATOM   2937 N  N   . VAL C 3 86  ? 19.364  -23.733 -1.140  1.00 25.49 ? 124  VAL P N   1 
ATOM   2938 C  CA  . VAL C 3 86  ? 20.649  -24.238 -0.658  1.00 25.39 ? 124  VAL P CA  1 
ATOM   2939 C  C   . VAL C 3 86  ? 21.594  -24.646 -1.786  1.00 25.54 ? 124  VAL P C   1 
ATOM   2940 O  O   . VAL C 3 86  ? 21.179  -25.276 -2.764  1.00 25.87 ? 124  VAL P O   1 
ATOM   2941 C  CB  . VAL C 3 86  ? 20.469  -25.407 0.349   1.00 25.32 ? 124  VAL P CB  1 
ATOM   2942 C  CG1 . VAL C 3 86  ? 19.879  -26.634 -0.332  1.00 24.96 ? 124  VAL P CG1 1 
ATOM   2943 C  CG2 . VAL C 3 86  ? 21.790  -25.745 1.031   1.00 25.11 ? 124  VAL P CG2 1 
ATOM   2944 N  N   . LYS C 3 87  ? 22.859  -24.262 -1.646  1.00 25.46 ? 125  LYS P N   1 
ATOM   2945 C  CA  . LYS C 3 87  ? 23.913  -24.731 -2.529  1.00 25.58 ? 125  LYS P CA  1 
ATOM   2946 C  C   . LYS C 3 87  ? 24.771  -25.704 -1.743  1.00 25.48 ? 125  LYS P C   1 
ATOM   2947 O  O   . LYS C 3 87  ? 25.329  -25.337 -0.703  1.00 25.78 ? 125  LYS P O   1 
ATOM   2948 C  CB  . LYS C 3 87  ? 24.753  -23.560 -3.045  1.00 25.87 ? 125  LYS P CB  1 
ATOM   2949 C  CG  . LYS C 3 87  ? 25.738  -23.951 -4.130  1.00 26.76 ? 125  LYS P CG  1 
ATOM   2950 C  CD  . LYS C 3 87  ? 25.976  -22.836 -5.145  1.00 28.09 ? 125  LYS P CD  1 
ATOM   2951 C  CE  . LYS C 3 87  ? 26.847  -23.380 -6.282  1.00 29.66 ? 125  LYS P CE  1 
ATOM   2952 N  NZ  . LYS C 3 87  ? 27.115  -22.412 -7.375  1.00 30.48 ? 125  LYS P NZ  1 
ATOM   2953 N  N   . MET C 3 88  ? 24.858  -26.944 -2.226  1.00 25.09 ? 126  MET P N   1 
ATOM   2954 C  CA  . MET C 3 88  ? 25.572  -28.017 -1.526  1.00 24.65 ? 126  MET P CA  1 
ATOM   2955 C  C   . MET C 3 88  ? 25.859  -29.197 -2.444  1.00 24.40 ? 126  MET P C   1 
ATOM   2956 O  O   . MET C 3 88  ? 25.462  -29.203 -3.605  1.00 24.45 ? 126  MET P O   1 
ATOM   2957 C  CB  . MET C 3 88  ? 24.747  -28.513 -0.336  1.00 24.59 ? 126  MET P CB  1 
ATOM   2958 C  CG  . MET C 3 88  ? 23.523  -29.328 -0.745  1.00 24.94 ? 126  MET P CG  1 
ATOM   2959 S  SD  . MET C 3 88  ? 22.401  -29.716 0.605   1.00 25.07 ? 126  MET P SD  1 
ATOM   2960 C  CE  . MET C 3 88  ? 21.051  -30.479 -0.296  1.00 24.72 ? 126  MET P CE  1 
ATOM   2961 N  N   . SER C 3 89  ? 26.535  -30.204 -1.897  1.00 24.23 ? 127  SER P N   1 
ATOM   2962 C  CA  . SER C 3 89  ? 26.761  -31.465 -2.579  1.00 23.89 ? 127  SER P CA  1 
ATOM   2963 C  C   . SER C 3 89  ? 25.482  -32.301 -2.678  1.00 24.02 ? 127  SER P C   1 
ATOM   2964 O  O   . SER C 3 89  ? 24.666  -32.324 -1.751  1.00 24.06 ? 127  SER P O   1 
ATOM   2965 C  CB  . SER C 3 89  ? 27.826  -32.268 -1.838  1.00 23.85 ? 127  SER P CB  1 
ATOM   2966 O  OG  . SER C 3 89  ? 27.855  -33.608 -2.291  1.00 23.20 ? 127  SER P OG  1 
ATOM   2967 N  N   . GLY C 3 90  ? 25.323  -32.999 -3.800  1.00 23.88 ? 128  GLY P N   1 
ATOM   2968 C  CA  . GLY C 3 90  ? 24.242  -33.963 -3.964  1.00 23.71 ? 128  GLY P CA  1 
ATOM   2969 C  C   . GLY C 3 90  ? 24.249  -35.089 -2.934  1.00 23.73 ? 128  GLY P C   1 
ATOM   2970 O  O   . GLY C 3 90  ? 23.207  -35.700 -2.684  1.00 24.09 ? 128  GLY P O   1 
ATOM   2971 N  N   . ASP C 3 91  ? 25.404  -35.366 -2.326  1.00 23.27 ? 129  ASP P N   1 
ATOM   2972 C  CA  . ASP C 3 91  ? 25.494  -36.384 -1.266  1.00 23.25 ? 129  ASP P CA  1 
ATOM   2973 C  C   . ASP C 3 91  ? 24.567  -36.124 -0.075  1.00 23.43 ? 129  ASP P C   1 
ATOM   2974 O  O   . ASP C 3 91  ? 24.212  -37.051 0.656   1.00 23.48 ? 129  ASP P O   1 
ATOM   2975 C  CB  . ASP C 3 91  ? 26.925  -36.520 -0.742  1.00 22.92 ? 129  ASP P CB  1 
ATOM   2976 C  CG  . ASP C 3 91  ? 27.896  -36.983 -1.797  1.00 22.43 ? 129  ASP P CG  1 
ATOM   2977 O  OD1 . ASP C 3 91  ? 27.464  -37.371 -2.906  1.00 22.18 ? 129  ASP P OD1 1 
ATOM   2978 O  OD2 . ASP C 3 91  ? 29.109  -36.952 -1.508  1.00 21.78 ? 129  ASP P OD2 1 
ATOM   2979 N  N   . LEU C 3 92  ? 24.190  -34.863 0.117   1.00 23.63 ? 130  LEU P N   1 
ATOM   2980 C  CA  . LEU C 3 92  ? 23.415  -34.453 1.282   1.00 23.81 ? 130  LEU P CA  1 
ATOM   2981 C  C   . LEU C 3 92  ? 21.911  -34.443 1.041   1.00 24.08 ? 130  LEU P C   1 
ATOM   2982 O  O   . LEU C 3 92  ? 21.155  -33.911 1.858   1.00 24.21 ? 130  LEU P O   1 
ATOM   2983 C  CB  . LEU C 3 92  ? 23.866  -33.070 1.764   1.00 23.63 ? 130  LEU P CB  1 
ATOM   2984 C  CG  . LEU C 3 92  ? 25.299  -32.923 2.271   1.00 23.19 ? 130  LEU P CG  1 
ATOM   2985 C  CD1 . LEU C 3 92  ? 25.560  -31.474 2.584   1.00 22.02 ? 130  LEU P CD1 1 
ATOM   2986 C  CD2 . LEU C 3 92  ? 25.557  -33.796 3.491   1.00 23.35 ? 130  LEU P CD2 1 
ATOM   2987 N  N   . LEU C 3 93  ? 21.469  -35.025 -0.066  1.00 24.32 ? 131  LEU P N   1 
ATOM   2988 C  CA  . LEU C 3 93  ? 20.040  -35.036 -0.357  1.00 24.84 ? 131  LEU P CA  1 
ATOM   2989 C  C   . LEU C 3 93  ? 19.288  -35.947 0.618   1.00 25.27 ? 131  LEU P C   1 
ATOM   2990 O  O   . LEU C 3 93  ? 18.261  -35.548 1.160   1.00 25.35 ? 131  LEU P O   1 
ATOM   2991 C  CB  . LEU C 3 93  ? 19.762  -35.363 -1.829  1.00 24.61 ? 131  LEU P CB  1 
ATOM   2992 C  CG  . LEU C 3 93  ? 20.038  -34.192 -2.791  1.00 25.18 ? 131  LEU P CG  1 
ATOM   2993 C  CD1 . LEU C 3 93  ? 20.098  -34.631 -4.253  1.00 24.95 ? 131  LEU P CD1 1 
ATOM   2994 C  CD2 . LEU C 3 93  ? 19.033  -33.046 -2.622  1.00 24.09 ? 131  LEU P CD2 1 
ATOM   2995 N  N   . GLU C 3 94  ? 19.820  -37.145 0.868   1.00 25.75 ? 132  GLU P N   1 
ATOM   2996 C  CA  . GLU C 3 94  ? 19.261  -38.033 1.885   1.00 26.34 ? 132  GLU P CA  1 
ATOM   2997 C  C   . GLU C 3 94  ? 19.070  -37.316 3.218   1.00 26.12 ? 132  GLU P C   1 
ATOM   2998 O  O   . GLU C 3 94  ? 18.045  -37.479 3.877   1.00 25.97 ? 132  GLU P O   1 
ATOM   2999 C  CB  . GLU C 3 94  ? 20.150  -39.254 2.094   1.00 26.79 ? 132  GLU P CB  1 
ATOM   3000 C  CG  . GLU C 3 94  ? 19.635  -40.533 1.450   1.00 29.08 ? 132  GLU P CG  1 
ATOM   3001 C  CD  . GLU C 3 94  ? 20.099  -41.777 2.204   1.00 32.76 ? 132  GLU P CD  1 
ATOM   3002 O  OE1 . GLU C 3 94  ? 20.110  -41.746 3.463   1.00 33.69 ? 132  GLU P OE1 1 
ATOM   3003 O  OE2 . GLU C 3 94  ? 20.450  -42.787 1.543   1.00 33.93 ? 132  GLU P OE2 1 
ATOM   3004 N  N   . LEU C 3 95  ? 20.064  -36.525 3.610   1.00 25.98 ? 133  LEU P N   1 
ATOM   3005 C  CA  . LEU C 3 95  ? 19.974  -35.757 4.845   1.00 25.89 ? 133  LEU P CA  1 
ATOM   3006 C  C   . LEU C 3 95  ? 18.858  -34.699 4.800   1.00 25.74 ? 133  LEU P C   1 
ATOM   3007 O  O   . LEU C 3 95  ? 17.985  -34.682 5.671   1.00 26.03 ? 133  LEU P O   1 
ATOM   3008 C  CB  . LEU C 3 95  ? 21.356  -35.199 5.230   1.00 25.93 ? 133  LEU P CB  1 
ATOM   3009 C  CG  . LEU C 3 95  ? 21.763  -33.764 5.605   1.00 26.23 ? 133  LEU P CG  1 
ATOM   3010 C  CD1 . LEU C 3 95  ? 20.740  -32.965 6.388   1.00 25.55 ? 133  LEU P CD1 1 
ATOM   3011 C  CD2 . LEU C 3 95  ? 23.084  -33.823 6.366   1.00 25.88 ? 133  LEU P CD2 1 
ATOM   3012 N  N   . ALA C 3 96  ? 18.869  -33.852 3.775   1.00 25.41 ? 134  ALA P N   1 
ATOM   3013 C  CA  . ALA C 3 96  ? 17.884  -32.777 3.646   1.00 25.16 ? 134  ALA P CA  1 
ATOM   3014 C  C   . ALA C 3 96  ? 16.435  -33.286 3.561   1.00 25.09 ? 134  ALA P C   1 
ATOM   3015 O  O   . ALA C 3 96  ? 15.536  -32.700 4.151   1.00 24.99 ? 134  ALA P O   1 
ATOM   3016 C  CB  . ALA C 3 96  ? 18.230  -31.870 2.458   1.00 24.94 ? 134  ALA P CB  1 
ATOM   3017 N  N   . LEU C 3 97  ? 16.224  -34.389 2.848   1.00 25.27 ? 135  LEU P N   1 
ATOM   3018 C  CA  . LEU C 3 97  ? 14.895  -34.992 2.705   1.00 25.37 ? 135  LEU P CA  1 
ATOM   3019 C  C   . LEU C 3 97  ? 14.280  -35.412 4.039   1.00 25.69 ? 135  LEU P C   1 
ATOM   3020 O  O   . LEU C 3 97  ? 13.058  -35.474 4.171   1.00 25.76 ? 135  LEU P O   1 
ATOM   3021 C  CB  . LEU C 3 97  ? 14.950  -36.204 1.762   1.00 25.28 ? 135  LEU P CB  1 
ATOM   3022 C  CG  . LEU C 3 97  ? 15.104  -35.981 0.251   1.00 24.86 ? 135  LEU P CG  1 
ATOM   3023 C  CD1 . LEU C 3 97  ? 15.390  -37.295 -0.451  1.00 23.54 ? 135  LEU P CD1 1 
ATOM   3024 C  CD2 . LEU C 3 97  ? 13.866  -35.312 -0.338  1.00 24.63 ? 135  LEU P CD2 1 
ATOM   3025 N  N   . LYS C 3 98  ? 15.133  -35.699 5.020   1.00 25.97 ? 136  LYS P N   1 
ATOM   3026 C  CA  . LYS C 3 98  ? 14.690  -36.160 6.333   1.00 26.26 ? 136  LYS P CA  1 
ATOM   3027 C  C   . LYS C 3 98  ? 14.566  -35.055 7.386   1.00 26.14 ? 136  LYS P C   1 
ATOM   3028 O  O   . LYS C 3 98  ? 14.466  -35.343 8.577   1.00 26.21 ? 136  LYS P O   1 
ATOM   3029 C  CB  . LYS C 3 98  ? 15.610  -37.280 6.831   1.00 26.34 ? 136  LYS P CB  1 
ATOM   3030 C  CG  . LYS C 3 98  ? 15.251  -38.647 6.272   1.00 27.50 ? 136  LYS P CG  1 
ATOM   3031 C  CD  . LYS C 3 98  ? 16.479  -39.548 6.135   1.00 29.52 ? 136  LYS P CD  1 
ATOM   3032 C  CE  . LYS C 3 98  ? 16.074  -40.963 5.697   1.00 30.53 ? 136  LYS P CE  1 
ATOM   3033 N  NZ  . LYS C 3 98  ? 17.142  -41.683 4.935   1.00 30.72 ? 136  LYS P NZ  1 
ATOM   3034 N  N   . LEU C 3 99  ? 14.567  -33.799 6.943   1.00 26.09 ? 137  LEU P N   1 
ATOM   3035 C  CA  . LEU C 3 99  ? 14.464  -32.654 7.846   1.00 26.06 ? 137  LEU P CA  1 
ATOM   3036 C  C   . LEU C 3 99  ? 13.001  -32.330 8.141   1.00 26.25 ? 137  LEU P C   1 
ATOM   3037 O  O   . LEU C 3 99  ? 12.144  -32.509 7.270   1.00 26.17 ? 137  LEU P O   1 
ATOM   3038 C  CB  . LEU C 3 99  ? 15.157  -31.428 7.241   1.00 26.12 ? 137  LEU P CB  1 
ATOM   3039 C  CG  . LEU C 3 99  ? 16.682  -31.391 7.079   1.00 25.99 ? 137  LEU P CG  1 
ATOM   3040 C  CD1 . LEU C 3 99  ? 17.089  -30.259 6.156   1.00 25.79 ? 137  LEU P CD1 1 
ATOM   3041 C  CD2 . LEU C 3 99  ? 17.373  -31.235 8.417   1.00 26.52 ? 137  LEU P CD2 1 
ATOM   3042 N  N   . PRO C 3 100 ? 12.702  -31.855 9.372   1.00 26.38 ? 138  PRO P N   1 
ATOM   3043 C  CA  . PRO C 3 100 ? 11.313  -31.498 9.710   1.00 26.41 ? 138  PRO P CA  1 
ATOM   3044 C  C   . PRO C 3 100 ? 10.688  -30.468 8.760   1.00 26.23 ? 138  PRO P C   1 
ATOM   3045 O  O   . PRO C 3 100 ? 11.375  -29.569 8.270   1.00 25.89 ? 138  PRO P O   1 
ATOM   3046 C  CB  . PRO C 3 100 ? 11.416  -30.931 11.142  1.00 26.43 ? 138  PRO P CB  1 
ATOM   3047 C  CG  . PRO C 3 100 ? 12.866  -30.677 11.381  1.00 26.26 ? 138  PRO P CG  1 
ATOM   3048 C  CD  . PRO C 3 100 ? 13.611  -31.649 10.514  1.00 26.53 ? 138  PRO P CD  1 
ATOM   3049 N  N   . HIS C 3 101 ? 9.389   -30.632 8.509   1.00 26.19 ? 139  HIS P N   1 
ATOM   3050 C  CA  . HIS C 3 101 ? 8.585   -29.732 7.669   1.00 26.17 ? 139  HIS P CA  1 
ATOM   3051 C  C   . HIS C 3 101 ? 8.801   -29.889 6.160   1.00 26.12 ? 139  HIS P C   1 
ATOM   3052 O  O   . HIS C 3 101 ? 8.010   -29.362 5.374   1.00 26.41 ? 139  HIS P O   1 
ATOM   3053 C  CB  . HIS C 3 101 ? 8.748   -28.258 8.084   1.00 26.22 ? 139  HIS P CB  1 
ATOM   3054 C  CG  . HIS C 3 101 ? 8.684   -28.033 9.564   1.00 26.94 ? 139  HIS P CG  1 
ATOM   3055 N  ND1 . HIS C 3 101 ? 7.651   -28.502 10.347  1.00 27.44 ? 139  HIS P ND1 1 
ATOM   3056 C  CD2 . HIS C 3 101 ? 9.528   -27.385 10.403  1.00 27.17 ? 139  HIS P CD2 1 
ATOM   3057 C  CE1 . HIS C 3 101 ? 7.865   -28.159 11.605  1.00 27.67 ? 139  HIS P CE1 1 
ATOM   3058 N  NE2 . HIS C 3 101 ? 8.995   -27.478 11.665  1.00 27.62 ? 139  HIS P NE2 1 
ATOM   3059 N  N   . VAL C 3 102 ? 9.847   -30.607 5.752   1.00 25.76 ? 140  VAL P N   1 
ATOM   3060 C  CA  . VAL C 3 102 ? 10.146  -30.763 4.325   1.00 25.48 ? 140  VAL P CA  1 
ATOM   3061 C  C   . VAL C 3 102 ? 9.022   -31.481 3.582   1.00 25.32 ? 140  VAL P C   1 
ATOM   3062 O  O   . VAL C 3 102 ? 8.609   -32.574 3.967   1.00 25.12 ? 140  VAL P O   1 
ATOM   3063 C  CB  . VAL C 3 102 ? 11.499  -31.464 4.068   1.00 25.53 ? 140  VAL P CB  1 
ATOM   3064 C  CG1 . VAL C 3 102 ? 11.750  -31.612 2.574   1.00 25.18 ? 140  VAL P CG1 1 
ATOM   3065 C  CG2 . VAL C 3 102 ? 12.632  -30.668 4.692   1.00 25.85 ? 140  VAL P CG2 1 
ATOM   3066 N  N   . ASP C 3 103 ? 8.535   -30.834 2.523   1.00 25.19 ? 141  ASP P N   1 
ATOM   3067 C  CA  . ASP C 3 103 ? 7.471   -31.360 1.675   1.00 24.97 ? 141  ASP P CA  1 
ATOM   3068 C  C   . ASP C 3 103 ? 8.089   -32.059 0.471   1.00 24.85 ? 141  ASP P C   1 
ATOM   3069 O  O   . ASP C 3 103 ? 7.725   -33.191 0.148   1.00 24.99 ? 141  ASP P O   1 
ATOM   3070 C  CB  . ASP C 3 103 ? 6.561   -30.206 1.230   1.00 25.11 ? 141  ASP P CB  1 
ATOM   3071 C  CG  . ASP C 3 103 ? 5.311   -30.668 0.496   1.00 24.82 ? 141  ASP P CG  1 
ATOM   3072 O  OD1 . ASP C 3 103 ? 5.004   -31.877 0.492   1.00 25.59 ? 141  ASP P OD1 1 
ATOM   3073 O  OD2 . ASP C 3 103 ? 4.622   -29.799 -0.078  1.00 24.56 ? 141  ASP P OD2 1 
ATOM   3074 N  N   . TYR C 3 104 ? 9.026   -31.374 -0.179  1.00 24.65 ? 142  TYR P N   1 
ATOM   3075 C  CA  . TYR C 3 104 ? 9.785   -31.908 -1.307  1.00 24.38 ? 142  TYR P CA  1 
ATOM   3076 C  C   . TYR C 3 104 ? 11.015  -31.036 -1.564  1.00 24.40 ? 142  TYR P C   1 
ATOM   3077 O  O   . TYR C 3 104 ? 11.085  -29.889 -1.095  1.00 24.15 ? 142  TYR P O   1 
ATOM   3078 C  CB  . TYR C 3 104 ? 8.912   -32.025 -2.572  1.00 24.43 ? 142  TYR P CB  1 
ATOM   3079 C  CG  . TYR C 3 104 ? 8.313   -30.725 -3.067  1.00 24.32 ? 142  TYR P CG  1 
ATOM   3080 C  CD1 . TYR C 3 104 ? 7.140   -30.217 -2.511  1.00 24.37 ? 142  TYR P CD1 1 
ATOM   3081 C  CD2 . TYR C 3 104 ? 8.911   -30.010 -4.103  1.00 23.88 ? 142  TYR P CD2 1 
ATOM   3082 C  CE1 . TYR C 3 104 ? 6.587   -29.025 -2.964  1.00 24.63 ? 142  TYR P CE1 1 
ATOM   3083 C  CE2 . TYR C 3 104 ? 8.368   -28.818 -4.563  1.00 23.75 ? 142  TYR P CE2 1 
ATOM   3084 C  CZ  . TYR C 3 104 ? 7.208   -28.329 -3.990  1.00 24.51 ? 142  TYR P CZ  1 
ATOM   3085 O  OH  . TYR C 3 104 ? 6.664   -27.146 -4.439  1.00 24.62 ? 142  TYR P OH  1 
ATOM   3086 N  N   . ILE C 3 105 ? 11.991  -31.591 -2.287  1.00 24.32 ? 143  ILE P N   1 
ATOM   3087 C  CA  . ILE C 3 105 ? 13.177  -30.837 -2.704  1.00 24.13 ? 143  ILE P CA  1 
ATOM   3088 C  C   . ILE C 3 105 ? 13.351  -30.897 -4.223  1.00 24.12 ? 143  ILE P C   1 
ATOM   3089 O  O   . ILE C 3 105 ? 13.253  -31.970 -4.835  1.00 24.13 ? 143  ILE P O   1 
ATOM   3090 C  CB  . ILE C 3 105 ? 14.467  -31.328 -2.005  1.00 24.10 ? 143  ILE P CB  1 
ATOM   3091 C  CG1 . ILE C 3 105 ? 14.316  -31.263 -0.485  1.00 24.19 ? 143  ILE P CG1 1 
ATOM   3092 C  CG2 . ILE C 3 105 ? 15.666  -30.485 -2.444  1.00 23.71 ? 143  ILE P CG2 1 
ATOM   3093 C  CD1 . ILE C 3 105 ? 15.488  -31.851 0.268   1.00 24.32 ? 143  ILE P CD1 1 
ATOM   3094 N  N   . GLU C 3 106 ? 13.612  -29.743 -4.825  1.00 23.94 ? 144  GLU P N   1 
ATOM   3095 C  CA  . GLU C 3 106 ? 13.793  -29.667 -6.260  1.00 24.15 ? 144  GLU P CA  1 
ATOM   3096 C  C   . GLU C 3 106 ? 15.182  -29.160 -6.621  1.00 24.07 ? 144  GLU P C   1 
ATOM   3097 O  O   . GLU C 3 106 ? 15.686  -28.219 -6.009  1.00 24.26 ? 144  GLU P O   1 
ATOM   3098 C  CB  . GLU C 3 106 ? 12.719  -28.781 -6.894  1.00 24.13 ? 144  GLU P CB  1 
ATOM   3099 C  CG  . GLU C 3 106 ? 12.682  -28.841 -8.410  1.00 24.37 ? 144  GLU P CG  1 
ATOM   3100 C  CD  . GLU C 3 106 ? 11.445  -28.182 -9.005  1.00 24.80 ? 144  GLU P CD  1 
ATOM   3101 O  OE1 . GLU C 3 106 ? 10.362  -28.229 -8.367  1.00 25.16 ? 144  GLU P OE1 1 
ATOM   3102 O  OE2 . GLU C 3 106 ? 11.564  -27.630 -10.123 1.00 24.53 ? 144  GLU P OE2 1 
ATOM   3103 N  N   . GLU C 3 107 ? 15.788  -29.788 -7.623  1.00 23.90 ? 145  GLU P N   1 
ATOM   3104 C  CA  . GLU C 3 107 ? 17.063  -29.346 -8.149  1.00 23.84 ? 145  GLU P CA  1 
ATOM   3105 C  C   . GLU C 3 107 ? 16.790  -28.153 -9.045  1.00 23.83 ? 145  GLU P C   1 
ATOM   3106 O  O   . GLU C 3 107 ? 15.830  -28.166 -9.823  1.00 24.18 ? 145  GLU P O   1 
ATOM   3107 C  CB  . GLU C 3 107 ? 17.720  -30.481 -8.934  1.00 23.70 ? 145  GLU P CB  1 
ATOM   3108 C  CG  . GLU C 3 107 ? 19.131  -30.198 -9.427  1.00 23.88 ? 145  GLU P CG  1 
ATOM   3109 C  CD  . GLU C 3 107 ? 19.681  -31.342 -10.262 1.00 24.48 ? 145  GLU P CD  1 
ATOM   3110 O  OE1 . GLU C 3 107 ? 19.127  -31.614 -11.351 1.00 26.18 ? 145  GLU P OE1 1 
ATOM   3111 O  OE2 . GLU C 3 107 ? 20.669  -31.973 -9.830  1.00 24.81 ? 145  GLU P OE2 1 
ATOM   3112 N  N   . ASP C 3 108 ? 17.620  -27.117 -8.924  1.00 23.62 ? 146  ASP P N   1 
ATOM   3113 C  CA  . ASP C 3 108 ? 17.496  -25.923 -9.751  1.00 23.38 ? 146  ASP P CA  1 
ATOM   3114 C  C   . ASP C 3 108 ? 17.648  -26.321 -11.216 1.00 23.38 ? 146  ASP P C   1 
ATOM   3115 O  O   . ASP C 3 108 ? 18.256  -27.359 -11.524 1.00 23.60 ? 146  ASP P O   1 
ATOM   3116 C  CB  . ASP C 3 108 ? 18.558  -24.894 -9.351  1.00 23.55 ? 146  ASP P CB  1 
ATOM   3117 C  CG  . ASP C 3 108 ? 18.177  -23.454 -9.724  1.00 23.59 ? 146  ASP P CG  1 
ATOM   3118 O  OD1 . ASP C 3 108 ? 17.046  -23.216 -10.209 1.00 24.21 ? 146  ASP P OD1 1 
ATOM   3119 O  OD2 . ASP C 3 108 ? 19.024  -22.551 -9.520  1.00 22.97 ? 146  ASP P OD2 1 
ATOM   3120 N  N   . SER C 3 109 ? 17.075  -25.515 -12.112 1.00 23.04 ? 147  SER P N   1 
ATOM   3121 C  CA  . SER C 3 109 ? 17.125  -25.782 -13.556 1.00 22.65 ? 147  SER P CA  1 
ATOM   3122 C  C   . SER C 3 109 ? 16.919  -24.511 -14.384 1.00 22.22 ? 147  SER P C   1 
ATOM   3123 O  O   . SER C 3 109 ? 16.418  -23.514 -13.871 1.00 22.45 ? 147  SER P O   1 
ATOM   3124 C  CB  . SER C 3 109 ? 16.108  -26.866 -13.959 1.00 22.63 ? 147  SER P CB  1 
ATOM   3125 O  OG  . SER C 3 109 ? 14.788  -26.498 -13.604 1.00 22.93 ? 147  SER P OG  1 
ATOM   3126 N  N   . SER C 3 110 ? 17.296  -24.560 -15.664 1.00 21.53 ? 148  SER P N   1 
ATOM   3127 C  CA  . SER C 3 110 ? 17.281  -23.379 -16.521 1.00 20.70 ? 148  SER P CA  1 
ATOM   3128 C  C   . SER C 3 110 ? 15.905  -23.086 -17.106 1.00 20.21 ? 148  SER P C   1 
ATOM   3129 O  O   . SER C 3 110 ? 15.159  -24.010 -17.452 1.00 20.33 ? 148  SER P O   1 
ATOM   3130 C  CB  . SER C 3 110 ? 18.285  -23.530 -17.661 1.00 20.62 ? 148  SER P CB  1 
ATOM   3131 O  OG  . SER C 3 110 ? 19.538  -23.966 -17.187 1.00 21.04 ? 148  SER P OG  1 
ATOM   3132 N  N   . VAL C 3 111 ? 15.582  -21.797 -17.202 1.00 19.25 ? 149  VAL P N   1 
ATOM   3133 C  CA  . VAL C 3 111 ? 14.451  -21.323 -17.997 1.00 18.52 ? 149  VAL P CA  1 
ATOM   3134 C  C   . VAL C 3 111 ? 14.974  -20.443 -19.129 1.00 18.38 ? 149  VAL P C   1 
ATOM   3135 O  O   . VAL C 3 111 ? 16.027  -19.811 -19.002 1.00 18.46 ? 149  VAL P O   1 
ATOM   3136 C  CB  . VAL C 3 111 ? 13.404  -20.557 -17.159 1.00 18.28 ? 149  VAL P CB  1 
ATOM   3137 C  CG1 . VAL C 3 111 ? 12.761  -21.494 -16.158 1.00 18.35 ? 149  VAL P CG1 1 
ATOM   3138 C  CG2 . VAL C 3 111 ? 14.026  -19.359 -16.459 1.00 17.62 ? 149  VAL P CG2 1 
ATOM   3139 N  N   . PHE C 3 112 ? 14.238  -20.405 -20.233 1.00 18.04 ? 150  PHE P N   1 
ATOM   3140 C  CA  . PHE C 3 112 ? 14.700  -19.715 -21.435 1.00 17.65 ? 150  PHE P CA  1 
ATOM   3141 C  C   . PHE C 3 112 ? 13.668  -18.757 -21.984 1.00 17.29 ? 150  PHE P C   1 
ATOM   3142 O  O   . PHE C 3 112 ? 12.474  -19.010 -21.884 1.00 17.72 ? 150  PHE P O   1 
ATOM   3143 C  CB  . PHE C 3 112 ? 15.052  -20.740 -22.510 1.00 17.44 ? 150  PHE P CB  1 
ATOM   3144 C  CG  . PHE C 3 112 ? 16.128  -21.685 -22.099 1.00 17.08 ? 150  PHE P CG  1 
ATOM   3145 C  CD1 . PHE C 3 112 ? 17.463  -21.363 -22.303 1.00 16.97 ? 150  PHE P CD1 1 
ATOM   3146 C  CD2 . PHE C 3 112 ? 15.811  -22.892 -21.492 1.00 17.08 ? 150  PHE P CD2 1 
ATOM   3147 C  CE1 . PHE C 3 112 ? 18.467  -22.235 -21.919 1.00 17.08 ? 150  PHE P CE1 1 
ATOM   3148 C  CE2 . PHE C 3 112 ? 16.804  -23.768 -21.101 1.00 17.13 ? 150  PHE P CE2 1 
ATOM   3149 C  CZ  . PHE C 3 112 ? 18.139  -23.441 -21.315 1.00 17.10 ? 150  PHE P CZ  1 
ATOM   3150 N  N   . ALA C 3 113 ? 14.135  -17.662 -22.569 1.00 16.84 ? 151  ALA P N   1 
ATOM   3151 C  CA  . ALA C 3 113 ? 13.267  -16.747 -23.299 1.00 16.51 ? 151  ALA P CA  1 
ATOM   3152 C  C   . ALA C 3 113 ? 12.571  -17.495 -24.425 1.00 16.30 ? 151  ALA P C   1 
ATOM   3153 O  O   . ALA C 3 113 ? 13.212  -18.253 -25.147 1.00 16.30 ? 151  ALA P O   1 
ATOM   3154 C  CB  . ALA C 3 113 ? 14.080  -15.612 -23.869 1.00 16.48 ? 151  ALA P CB  1 
ATOM   3155 N  N   . GLN C 3 114 ? 11.267  -17.284 -24.572 1.00 16.11 ? 152  GLN P N   1 
ATOM   3156 C  CA  . GLN C 3 114 ? 10.504  -17.904 -25.661 1.00 16.02 ? 152  GLN P CA  1 
ATOM   3157 C  C   . GLN C 3 114 ? 10.098  -16.907 -26.750 1.00 16.37 ? 152  GLN P C   1 
ATOM   3158 O  O   . GLN C 3 114 ? 9.113   -17.105 -27.468 1.00 16.66 ? 152  GLN P O   1 
ATOM   3159 C  CB  . GLN C 3 114 ? 9.275   -18.640 -25.114 1.00 15.80 ? 152  GLN P CB  1 
ATOM   3160 C  CG  . GLN C 3 114 ? 9.603   -19.728 -24.096 1.00 14.28 ? 152  GLN P CG  1 
ATOM   3161 C  CD  . GLN C 3 114 ? 10.527  -20.797 -24.655 1.00 12.61 ? 152  GLN P CD  1 
ATOM   3162 O  OE1 . GLN C 3 114 ? 10.143  -21.581 -25.525 1.00 11.48 ? 152  GLN P OE1 1 
ATOM   3163 N  NE2 . GLN C 3 114 ? 11.750  -20.836 -24.149 1.00 12.18 ? 152  GLN P NE2 1 
ATOM   3164 O  OXT . GLN C 3 114 ? 10.740  -15.871 -26.950 1.00 16.67 ? 152  GLN P OXT 1 
HETATM 3165 CA CA  . CA  D 4 .   ? 8.401   8.532   -39.773 1.00 46.86 ? 1333 CA  E CA  1 
HETATM 3166 O  O   . HOH E 5 .   ? -4.974  -9.437  -39.234 1.00 37.65 ? 2001 HOH A O   1 
HETATM 3167 O  O   . HOH E 5 .   ? 15.098  -4.840  -12.874 1.00 27.85 ? 2002 HOH A O   1 
HETATM 3168 O  O   . HOH E 5 .   ? 11.589  -1.495  -7.013  1.00 44.36 ? 2003 HOH A O   1 
HETATM 3169 O  O   . HOH E 5 .   ? 17.869  -7.914  -7.074  1.00 37.37 ? 2004 HOH A O   1 
HETATM 3170 O  O   . HOH E 5 .   ? 17.942  -11.972 -5.299  1.00 40.87 ? 2005 HOH A O   1 
HETATM 3171 O  O   . HOH E 5 .   ? 31.302  -18.085 -21.833 1.00 51.55 ? 2006 HOH A O   1 
HETATM 3172 O  O   . HOH E 5 .   ? 29.306  -19.420 -26.333 1.00 47.41 ? 2007 HOH A O   1 
HETATM 3173 O  O   . HOH E 5 .   ? 2.442   7.743   -34.195 1.00 39.78 ? 2008 HOH A O   1 
HETATM 3174 O  O   . HOH E 5 .   ? 17.792  -4.089  -13.162 1.00 31.47 ? 2009 HOH A O   1 
HETATM 3175 O  O   . HOH E 5 .   ? 13.895  -5.146  -15.730 1.00 50.68 ? 2010 HOH A O   1 
HETATM 3176 O  O   . HOH E 5 .   ? 12.244  -11.531 -3.287  1.00 50.70 ? 2011 HOH A O   1 
HETATM 3177 O  O   . HOH E 5 .   ? -7.741  -9.876  -10.661 1.00 44.32 ? 2012 HOH A O   1 
HETATM 3178 O  O   . HOH E 5 .   ? 6.207   -21.861 -19.837 1.00 26.13 ? 2013 HOH A O   1 
HETATM 3179 O  O   . HOH E 5 .   ? 2.948   -31.367 -34.028 1.00 41.72 ? 2014 HOH A O   1 
HETATM 3180 O  O   . HOH E 5 .   ? -2.124  -23.580 -18.141 1.00 37.55 ? 2015 HOH A O   1 
HETATM 3181 O  O   . HOH E 5 .   ? 15.078  -11.829 -28.711 1.00 37.29 ? 2016 HOH A O   1 
HETATM 3182 O  O   . HOH E 5 .   ? 12.012  -13.778 -30.008 1.00 53.42 ? 2017 HOH A O   1 
HETATM 3183 O  O   . HOH E 5 .   ? 9.764   -12.422 -37.353 1.00 50.52 ? 2018 HOH A O   1 
HETATM 3184 O  O   . HOH E 5 .   ? -7.450  -29.456 -39.225 1.00 52.82 ? 2019 HOH A O   1 
HETATM 3185 O  O   . HOH F 5 .   ? 19.722  -12.962 -45.538 1.00 47.60 ? 2001 HOH E O   1 
HETATM 3186 O  O   . HOH G 5 .   ? 21.615  -37.693 -17.440 1.00 38.23 ? 2001 HOH P O   1 
HETATM 3187 O  O   . HOH G 5 .   ? 1.215   -27.041 6.084   1.00 47.91 ? 2002 HOH P O   1 
HETATM 3188 O  O   . HOH G 5 .   ? 10.694  -25.035 14.702  1.00 65.72 ? 2003 HOH P O   1 
HETATM 3189 O  O   . HOH G 5 .   ? 32.305  -33.571 13.386  1.00 41.01 ? 2004 HOH P O   1 
HETATM 3190 O  O   . HOH G 5 .   ? 33.267  -21.514 -1.441  1.00 46.54 ? 2005 HOH P O   1 
HETATM 3191 O  O   . HOH G 5 .   ? 26.830  -31.948 -6.973  1.00 24.37 ? 2006 HOH P O   1 
HETATM 3192 O  O   . HOH G 5 .   ? 29.535  -37.234 -4.765  1.00 42.53 ? 2007 HOH P O   1 
HETATM 3193 O  O   . HOH G 5 .   ? 11.135  -34.935 6.181   1.00 41.96 ? 2008 HOH P O   1 
HETATM 3194 O  O   . HOH G 5 .   ? 2.805   -29.888 -1.834  1.00 36.18 ? 2009 HOH P O   1 
HETATM 3195 O  O   . HOH G 5 .   ? 15.814  -18.928 -25.345 1.00 32.92 ? 2010 HOH P O   1 
HETATM 3196 O  O   . HOH G 5 .   ? 13.343  -16.735 -28.611 1.00 40.01 ? 2011 HOH P O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   153 153 SER SER A . n 
A 1 2   ILE 2   154 154 ILE ILE A . n 
A 1 3   PRO 3   155 155 PRO PRO A . n 
A 1 4   TRP 4   156 156 TRP TRP A . n 
A 1 5   ASN 5   157 157 ASN ASN A . n 
A 1 6   LEU 6   158 158 LEU LEU A . n 
A 1 7   GLU 7   159 159 GLU GLU A . n 
A 1 8   ARG 8   160 160 ARG ARG A . n 
A 1 9   ILE 9   161 161 ILE ILE A . n 
A 1 10  THR 10  162 162 THR THR A . n 
A 1 11  PRO 11  163 163 PRO PRO A . n 
A 1 12  PRO 12  164 164 PRO PRO A . n 
A 1 13  ARG 13  165 165 ARG ARG A . n 
A 1 14  TYR 14  166 ?   ?   ?   A . n 
A 1 15  ARG 15  167 ?   ?   ?   A . n 
A 1 16  ALA 16  168 ?   ?   ?   A . n 
A 1 17  ASP 17  169 ?   ?   ?   A . n 
A 1 18  GLU 18  170 ?   ?   ?   A . n 
A 1 19  TYR 19  171 ?   ?   ?   A . n 
A 1 20  GLN 20  172 ?   ?   ?   A . n 
A 1 21  PRO 21  173 ?   ?   ?   A . n 
A 1 22  PRO 22  174 ?   ?   ?   A . n 
A 1 23  ASP 23  175 ?   ?   ?   A . n 
A 1 24  GLY 24  176 ?   ?   ?   A . n 
A 1 25  GLY 25  177 ?   ?   ?   A . n 
A 1 26  SER 26  178 ?   ?   ?   A . n 
A 1 27  LEU 27  179 179 LEU LEU A . n 
A 1 28  VAL 28  180 180 VAL VAL A . n 
A 1 29  GLU 29  181 181 GLU GLU A . n 
A 1 30  VAL 30  182 182 VAL VAL A . n 
A 1 31  TYR 31  183 183 TYR TYR A . n 
A 1 32  LEU 32  184 184 LEU LEU A . n 
A 1 33  LEU 33  185 185 LEU LEU A . n 
A 1 34  ASP 34  186 186 ASP ASP A . n 
A 1 35  THR 35  187 187 THR THR A . n 
A 1 36  SER 36  188 188 SER SER A . n 
A 1 37  ILE 37  189 189 ILE ILE A . n 
A 1 38  GLN 38  190 190 GLN GLN A . n 
A 1 39  SER 39  191 191 SER SER A . n 
A 1 40  ASP 40  192 192 ASP ASP A . n 
A 1 41  HIS 41  193 193 HIS HIS A . n 
A 1 42  ARG 42  194 194 ARG ARG A . n 
A 1 43  GLU 43  195 195 GLU GLU A . n 
A 1 44  ILE 44  196 196 ILE ILE A . n 
A 1 45  GLU 45  197 197 GLU GLU A . n 
A 1 46  GLY 46  198 198 GLY GLY A . n 
A 1 47  ARG 47  199 199 ARG ARG A . n 
A 1 48  VAL 48  200 200 VAL VAL A . n 
A 1 49  MET 49  201 201 MET MET A . n 
A 1 50  VAL 50  202 202 VAL VAL A . n 
A 1 51  THR 51  203 203 THR THR A . n 
A 1 52  ASP 52  204 204 ASP ASP A . n 
A 1 53  PHE 53  205 205 PHE PHE A . n 
A 1 54  GLU 54  206 206 GLU GLU A . n 
A 1 55  ASN 55  207 207 ASN ASN A . n 
A 1 56  VAL 56  208 208 VAL VAL A . n 
A 1 57  PRO 57  209 209 PRO PRO A . n 
A 1 58  GLU 58  210 210 GLU GLU A . n 
A 1 59  GLU 59  211 211 GLU GLU A . n 
A 1 60  ASP 60  212 212 ASP ASP A . n 
A 1 61  GLY 61  213 ?   ?   ?   A . n 
A 1 62  THR 62  214 ?   ?   ?   A . n 
A 1 63  ARG 63  215 ?   ?   ?   A . n 
A 1 64  PHE 64  216 ?   ?   ?   A . n 
A 1 65  HIS 65  217 ?   ?   ?   A . n 
A 1 66  ARG 66  218 ?   ?   ?   A . n 
A 1 67  GLN 67  219 ?   ?   ?   A . n 
A 1 68  ALA 68  220 ?   ?   ?   A . n 
A 1 69  SER 69  221 221 SER SER A . n 
A 1 70  LYS 70  222 222 LYS LYS A . n 
A 1 71  CYS 71  223 223 CYS CYS A . n 
A 1 72  ASP 72  224 224 ASP ASP A . n 
A 1 73  SER 73  225 225 SER SER A . n 
A 1 74  HIS 74  226 226 HIS HIS A . n 
A 1 75  GLY 75  227 227 GLY GLY A . n 
A 1 76  THR 76  228 228 THR THR A . n 
A 1 77  HIS 77  229 229 HIS HIS A . n 
A 1 78  LEU 78  230 230 LEU LEU A . n 
A 1 79  ALA 79  231 231 ALA ALA A . n 
A 1 80  GLY 80  232 232 GLY GLY A . n 
A 1 81  VAL 81  233 233 VAL VAL A . n 
A 1 82  VAL 82  234 234 VAL VAL A . n 
A 1 83  SER 83  235 235 SER SER A . n 
A 1 84  GLY 84  236 236 GLY GLY A . n 
A 1 85  ARG 85  237 237 ARG ARG A . n 
A 1 86  ASP 86  238 238 ASP ASP A . n 
A 1 87  ALA 87  239 239 ALA ALA A . n 
A 1 88  GLY 88  240 240 GLY GLY A . n 
A 1 89  VAL 89  241 241 VAL VAL A . n 
A 1 90  ALA 90  242 242 ALA ALA A . n 
A 1 91  LYS 91  243 243 LYS LYS A . n 
A 1 92  GLY 92  244 244 GLY GLY A . n 
A 1 93  ALA 93  245 245 ALA ALA A . n 
A 1 94  SER 94  246 246 SER SER A . n 
A 1 95  MET 95  247 247 MET MET A . n 
A 1 96  ARG 96  248 248 ARG ARG A . n 
A 1 97  SER 97  249 249 SER SER A . n 
A 1 98  LEU 98  250 250 LEU LEU A . n 
A 1 99  ARG 99  251 251 ARG ARG A . n 
A 1 100 VAL 100 252 252 VAL VAL A . n 
A 1 101 LEU 101 253 253 LEU LEU A . n 
A 1 102 ASN 102 254 254 ASN ASN A . n 
A 1 103 CYS 103 255 255 CYS CYS A . n 
A 1 104 GLN 104 256 256 GLN GLN A . n 
A 1 105 GLY 105 257 257 GLY GLY A . n 
A 1 106 LYS 106 258 258 LYS LYS A . n 
A 1 107 GLY 107 259 259 GLY GLY A . n 
A 1 108 THR 108 260 260 THR THR A . n 
A 1 109 VAL 109 261 261 VAL VAL A . n 
A 1 110 SER 110 262 262 SER SER A . n 
A 1 111 GLY 111 263 263 GLY GLY A . n 
A 1 112 THR 112 264 264 THR THR A . n 
A 1 113 LEU 113 265 265 LEU LEU A . n 
A 1 114 ILE 114 266 266 ILE ILE A . n 
A 1 115 GLY 115 267 267 GLY GLY A . n 
A 1 116 LEU 116 268 268 LEU LEU A . n 
A 1 117 GLU 117 269 269 GLU GLU A . n 
A 1 118 PHE 118 270 270 PHE PHE A . n 
A 1 119 ILE 119 271 271 ILE ILE A . n 
A 1 120 ARG 120 272 272 ARG ARG A . n 
A 1 121 LYS 121 273 273 LYS LYS A . n 
A 1 122 SER 122 274 274 SER SER A . n 
A 1 123 GLN 123 275 275 GLN GLN A . n 
A 1 124 LEU 124 276 276 LEU LEU A . n 
A 1 125 VAL 125 277 277 VAL VAL A . n 
A 1 126 GLN 126 278 278 GLN GLN A . n 
A 1 127 PRO 127 279 279 PRO PRO A . n 
A 1 128 VAL 128 280 280 VAL VAL A . n 
A 1 129 GLY 129 281 281 GLY GLY A . n 
A 1 130 PRO 130 282 282 PRO PRO A . n 
A 1 131 LEU 131 283 283 LEU LEU A . n 
A 1 132 VAL 132 284 284 VAL VAL A . n 
A 1 133 VAL 133 285 285 VAL VAL A . n 
A 1 134 LEU 134 286 286 LEU LEU A . n 
A 1 135 LEU 135 287 287 LEU LEU A . n 
A 1 136 PRO 136 288 288 PRO PRO A . n 
A 1 137 LEU 137 289 289 LEU LEU A . n 
A 1 138 ALA 138 290 290 ALA ALA A . n 
A 1 139 GLY 139 291 291 GLY GLY A . n 
A 1 140 GLY 140 292 292 GLY GLY A . n 
A 1 141 TYR 141 293 293 TYR TYR A . n 
A 1 142 SER 142 294 294 SER SER A . n 
A 1 143 ARG 143 295 295 ARG ARG A . n 
A 1 144 VAL 144 296 296 VAL VAL A . n 
A 1 145 LEU 145 297 297 LEU LEU A . n 
A 1 146 ASN 146 298 298 ASN ASN A . n 
A 1 147 ALA 147 299 299 ALA ALA A . n 
A 1 148 ALA 148 300 300 ALA ALA A . n 
A 1 149 CYS 149 301 301 CYS CYS A . n 
A 1 150 GLN 150 302 302 GLN GLN A . n 
A 1 151 ARG 151 303 303 ARG ARG A . n 
A 1 152 LEU 152 304 304 LEU LEU A . n 
A 1 153 ALA 153 305 305 ALA ALA A . n 
A 1 154 ARG 154 306 306 ARG ARG A . n 
A 1 155 ALA 155 307 307 ALA ALA A . n 
A 1 156 GLY 156 308 308 GLY GLY A . n 
A 1 157 VAL 157 309 309 VAL VAL A . n 
A 1 158 VAL 158 310 310 VAL VAL A . n 
A 1 159 LEU 159 311 311 LEU LEU A . n 
A 1 160 VAL 160 312 312 VAL VAL A . n 
A 1 161 THR 161 313 313 THR THR A . n 
A 1 162 ALA 162 314 314 ALA ALA A . n 
A 1 163 ALA 163 315 315 ALA ALA A . n 
A 1 164 GLY 164 316 316 GLY GLY A . n 
A 1 165 ASN 165 317 317 ASN ASN A . n 
A 1 166 PHE 166 318 318 PHE PHE A . n 
A 1 167 ARG 167 319 319 ARG ARG A . n 
A 1 168 ASP 168 320 320 ASP ASP A . n 
A 1 169 ASP 169 321 321 ASP ASP A . n 
A 1 170 ALA 170 322 322 ALA ALA A . n 
A 1 171 CYS 171 323 323 CYS CYS A . n 
A 1 172 LEU 172 324 324 LEU LEU A . n 
A 1 173 TYR 173 325 325 TYR TYR A . n 
A 1 174 SER 174 326 326 SER SER A . n 
A 1 175 PRO 175 327 327 PRO PRO A . n 
A 1 176 ALA 176 328 328 ALA ALA A . n 
A 1 177 SER 177 329 329 SER SER A . n 
A 1 178 ALA 178 330 330 ALA ALA A . n 
A 1 179 PRO 179 331 331 PRO PRO A . n 
A 1 180 GLU 180 332 332 GLU GLU A . n 
A 1 181 VAL 181 333 333 VAL VAL A . n 
A 1 182 ILE 182 334 334 ILE ILE A . n 
A 1 183 THR 183 335 335 THR THR A . n 
A 1 184 VAL 184 336 336 VAL VAL A . n 
A 1 185 GLY 185 337 337 GLY GLY A . n 
A 1 186 ALA 186 338 338 ALA ALA A . n 
A 1 187 THR 187 339 339 THR THR A . n 
A 1 188 ASN 188 340 340 ASN ASN A . n 
A 1 189 ALA 189 341 341 ALA ALA A . n 
A 1 190 GLN 190 342 342 GLN GLN A . n 
A 1 191 ASP 191 343 343 ASP ASP A . n 
A 1 192 GLN 192 344 344 GLN GLN A . n 
A 1 193 PRO 193 345 345 PRO PRO A . n 
A 1 194 VAL 194 346 346 VAL VAL A . n 
A 1 195 THR 195 347 347 THR THR A . n 
A 1 196 LEU 196 348 348 LEU LEU A . n 
A 1 197 GLY 197 349 349 GLY GLY A . n 
A 1 198 THR 198 350 350 THR THR A . n 
A 1 199 LEU 199 351 351 LEU LEU A . n 
A 1 200 GLY 200 352 352 GLY GLY A . n 
A 1 201 THR 201 353 353 THR THR A . n 
A 1 202 ASN 202 354 354 ASN ASN A . n 
A 1 203 PHE 203 355 355 PHE PHE A . n 
A 1 204 GLY 204 356 356 GLY GLY A . n 
A 1 205 ARG 205 357 357 ARG ARG A . n 
A 1 206 CYS 206 358 358 CYS CYS A . n 
A 1 207 VAL 207 359 359 VAL VAL A . n 
A 1 208 ASP 208 360 360 ASP ASP A . n 
A 1 209 LEU 209 361 361 LEU LEU A . n 
A 1 210 PHE 210 362 362 PHE PHE A . n 
A 1 211 ALA 211 363 363 ALA ALA A . n 
A 1 212 PRO 212 364 364 PRO PRO A . n 
A 1 213 GLY 213 365 365 GLY GLY A . n 
A 1 214 GLU 214 366 366 GLU GLU A . n 
A 1 215 ASP 215 367 367 ASP ASP A . n 
A 1 216 ILE 216 368 368 ILE ILE A . n 
A 1 217 ILE 217 369 369 ILE ILE A . n 
A 1 218 GLY 218 370 370 GLY GLY A . n 
A 1 219 ALA 219 371 371 ALA ALA A . n 
A 1 220 SER 220 372 372 SER SER A . n 
A 1 221 SER 221 373 373 SER SER A . n 
A 1 222 ALA 222 374 374 ALA ALA A . n 
A 1 223 CYS 223 375 375 CYS CYS A . n 
A 1 224 SER 224 376 376 SER SER A . n 
A 1 225 THR 225 377 377 THR THR A . n 
A 1 226 CYS 226 378 378 CYS CYS A . n 
A 1 227 PHE 227 379 379 PHE PHE A . n 
A 1 228 VAL 228 380 380 VAL VAL A . n 
A 1 229 SER 229 381 381 SER SER A . n 
A 1 230 GLN 230 382 382 GLN GLN A . n 
A 1 231 SER 231 383 383 SER SER A . n 
A 1 232 GLY 232 384 384 GLY GLY A . n 
A 1 233 THR 233 385 385 THR THR A . n 
A 1 234 SER 234 386 386 SER SER A . n 
A 1 235 GLN 235 387 387 GLN GLN A . n 
A 1 236 ALA 236 388 388 ALA ALA A . n 
A 1 237 ALA 237 389 389 ALA ALA A . n 
A 1 238 ALA 238 390 390 ALA ALA A . n 
A 1 239 HIS 239 391 391 HIS HIS A . n 
A 1 240 VAL 240 392 392 VAL VAL A . n 
A 1 241 ALA 241 393 393 ALA ALA A . n 
A 1 242 GLY 242 394 394 GLY GLY A . n 
A 1 243 ILE 243 395 395 ILE ILE A . n 
A 1 244 ALA 244 396 396 ALA ALA A . n 
A 1 245 ALA 245 397 397 ALA ALA A . n 
A 1 246 MET 246 398 398 MET MET A . n 
A 1 247 MET 247 399 399 MET MET A . n 
A 1 248 LEU 248 400 400 LEU LEU A . n 
A 1 249 SER 249 401 401 SER SER A . n 
A 1 250 ALA 250 402 402 ALA ALA A . n 
A 1 251 GLU 251 403 403 GLU GLU A . n 
A 1 252 PRO 252 404 404 PRO PRO A . n 
A 1 253 GLU 253 405 405 GLU GLU A . n 
A 1 254 LEU 254 406 406 LEU LEU A . n 
A 1 255 THR 255 407 407 THR THR A . n 
A 1 256 LEU 256 408 408 LEU LEU A . n 
A 1 257 ALA 257 409 409 ALA ALA A . n 
A 1 258 GLU 258 410 410 GLU GLU A . n 
A 1 259 LEU 259 411 411 LEU LEU A . n 
A 1 260 ARG 260 412 412 ARG ARG A . n 
A 1 261 GLN 261 413 413 GLN GLN A . n 
A 1 262 ARG 262 414 414 ARG ARG A . n 
A 1 263 LEU 263 415 415 LEU LEU A . n 
A 1 264 ILE 264 416 416 ILE ILE A . n 
A 1 265 HIS 265 417 417 HIS HIS A . n 
A 1 266 PHE 266 418 418 PHE PHE A . n 
A 1 267 SER 267 419 419 SER SER A . n 
A 1 268 ALA 268 420 420 ALA ALA A . n 
A 1 269 LYS 269 421 421 LYS LYS A . n 
A 1 270 ASP 270 422 422 ASP ASP A . n 
A 1 271 VAL 271 423 423 VAL VAL A . n 
A 1 272 ILE 272 424 424 ILE ILE A . n 
A 1 273 ASN 273 425 425 ASN ASN A . n 
A 1 274 GLU 274 426 426 GLU GLU A . n 
A 1 275 ALA 275 427 427 ALA ALA A . n 
A 1 276 TRP 276 428 428 TRP TRP A . n 
A 1 277 PHE 277 429 429 PHE PHE A . n 
A 1 278 PRO 278 430 430 PRO PRO A . n 
A 1 279 GLU 279 431 431 GLU GLU A . n 
A 1 280 ASP 280 432 432 ASP ASP A . n 
A 1 281 GLN 281 433 433 GLN GLN A . n 
A 1 282 ARG 282 434 434 ARG ARG A . n 
A 1 283 VAL 283 435 435 VAL VAL A . n 
A 1 284 LEU 284 436 436 LEU LEU A . n 
A 1 285 THR 285 437 437 THR THR A . n 
A 1 286 PRO 286 438 438 PRO PRO A . n 
A 1 287 ASN 287 439 439 ASN ASN A . n 
A 1 288 LEU 288 440 440 LEU LEU A . n 
A 1 289 VAL 289 441 441 VAL VAL A . n 
A 1 290 ALA 290 442 442 ALA ALA A . n 
A 1 291 ALA 291 443 443 ALA ALA A . n 
A 1 292 LEU 292 444 444 LEU LEU A . n 
A 1 293 PRO 293 445 445 PRO PRO A . n 
A 1 294 PRO 294 446 446 PRO PRO A . n 
A 1 295 SER 295 447 447 SER SER A . n 
A 1 296 THR 296 448 ?   ?   ?   A . n 
A 1 297 HIS 297 449 ?   ?   ?   A . n 
A 1 298 GLY 298 450 ?   ?   ?   A . n 
A 1 299 ALA 299 451 ?   ?   ?   A . n 
A 1 300 ALA 300 452 ?   ?   ?   A . n 
A 1 301 GLY 301 453 ?   ?   ?   A . n 
A 1 302 THR 302 454 ?   ?   ?   A . n 
A 1 303 ALA 303 455 ?   ?   ?   A . n 
A 1 304 ALA 304 456 ?   ?   ?   A . n 
A 1 305 ALA 305 457 ?   ?   ?   A . n 
A 1 306 SER 306 458 ?   ?   ?   A . n 
A 1 307 HIS 307 459 ?   ?   ?   A . n 
A 1 308 HIS 308 460 ?   ?   ?   A . n 
A 1 309 HIS 309 461 ?   ?   ?   A . n 
A 1 310 HIS 310 462 ?   ?   ?   A . n 
A 1 311 HIS 311 463 ?   ?   ?   A . n 
A 1 312 HIS 312 464 ?   ?   ?   A . n 
B 2 1   MET 1   266 ?   ?   ?   E . n 
B 2 2   LYS 2   267 ?   ?   ?   E . n 
B 2 3   HIS 3   268 ?   ?   ?   E . n 
B 2 4   HIS 4   269 ?   ?   ?   E . n 
B 2 5   HIS 5   270 ?   ?   ?   E . n 
B 2 6   HIS 6   271 ?   ?   ?   E . n 
B 2 7   HIS 7   272 ?   ?   ?   E . n 
B 2 8   HIS 8   273 ?   ?   ?   E . n 
B 2 9   PRO 9   274 ?   ?   ?   E . n 
B 2 10  MET 10  275 ?   ?   ?   E . n 
B 2 11  SER 11  276 ?   ?   ?   E . n 
B 2 12  ASP 12  277 ?   ?   ?   E . n 
B 2 13  TYR 13  278 ?   ?   ?   E . n 
B 2 14  ASP 14  279 ?   ?   ?   E . n 
B 2 15  ILE 15  280 ?   ?   ?   E . n 
B 2 16  PRO 16  281 ?   ?   ?   E . n 
B 2 17  THR 17  282 ?   ?   ?   E . n 
B 2 18  THR 18  283 ?   ?   ?   E . n 
B 2 19  GLU 19  284 ?   ?   ?   E . n 
B 2 20  ASN 20  285 285 ASN ASN E . n 
B 2 21  LEU 21  286 286 LEU LEU E . n 
B 2 22  TYR 22  287 287 TYR TYR E . n 
B 2 23  PHE 23  288 288 PHE PHE E . n 
B 2 24  GLN 24  289 289 GLN GLN E . n 
B 2 25  GLY 25  290 290 GLY GLY E . n 
B 2 26  ALA 26  291 291 ALA ALA E . n 
B 2 27  MET 27  292 292 MET MET E . n 
B 2 28  GLY 28  293 293 GLY GLY E . n 
B 2 29  THR 29  294 294 THR THR E . n 
B 2 30  ASN 30  295 295 ASN ASN E . n 
B 2 31  GLU 31  296 296 GLU GLU E . n 
B 2 32  CYS 32  297 297 CYS CYS E . n 
B 2 33  LEU 33  298 298 LEU LEU E . n 
B 2 34  ASP 34  299 299 ASP ASP E . n 
B 2 35  ASN 35  300 300 ASN ASN E . n 
B 2 36  ASN 36  301 301 ASN ASN E . n 
B 2 37  GLY 37  302 302 GLY GLY E . n 
B 2 38  GLY 38  303 303 GLY GLY E . n 
B 2 39  CYS 39  304 304 CYS CYS E . n 
B 2 40  SER 40  305 305 SER SER E . n 
B 2 41  HIS 41  306 306 HIS HIS E . n 
B 2 42  VAL 42  307 307 VAL VAL E . n 
B 2 43  CYS 43  308 308 CYS CYS E . n 
B 2 44  ASN 44  309 309 ASN ASN E . n 
B 2 45  ASP 45  310 310 ASP ASP E . n 
B 2 46  LEU 46  311 311 LEU LEU E . n 
B 2 47  LYS 47  312 312 LYS LYS E . n 
B 2 48  ILE 48  313 313 ILE ILE E . n 
B 2 49  GLY 49  314 314 GLY GLY E . n 
B 2 50  TYR 50  315 315 TYR TYR E . n 
B 2 51  GLU 51  316 316 GLU GLU E . n 
B 2 52  CYS 52  317 317 CYS CYS E . n 
B 2 53  LEU 53  318 318 LEU LEU E . n 
B 2 54  CYS 54  319 319 CYS CYS E . n 
B 2 55  PRO 55  320 320 PRO PRO E . n 
B 2 56  ASP 56  321 321 ASP ASP E . n 
B 2 57  GLY 57  322 322 GLY GLY E . n 
B 2 58  PHE 58  323 323 PHE PHE E . n 
B 2 59  GLN 59  324 324 GLN GLN E . n 
B 2 60  LEU 60  325 325 LEU LEU E . n 
B 2 61  VAL 61  326 326 VAL VAL E . n 
B 2 62  ALA 62  327 327 ALA ALA E . n 
B 2 63  GLN 63  328 328 GLN GLN E . n 
B 2 64  ARG 64  329 329 ARG ARG E . n 
B 2 65  ARG 65  330 330 ARG ARG E . n 
B 2 66  CYS 66  331 331 CYS CYS E . n 
B 2 67  GLU 67  332 332 GLU GLU E . n 
B 2 68  ASP 68  333 ?   ?   ?   E . n 
B 2 69  ILE 69  334 ?   ?   ?   E . n 
B 2 70  ASP 70  335 ?   ?   ?   E . n 
B 2 71  GLU 71  336 ?   ?   ?   E . n 
B 2 72  CYS 72  337 ?   ?   ?   E . n 
B 2 73  GLN 73  338 ?   ?   ?   E . n 
B 2 74  ASP 74  339 ?   ?   ?   E . n 
B 2 75  PRO 75  340 ?   ?   ?   E . n 
B 2 76  ASP 76  341 ?   ?   ?   E . n 
B 2 77  THR 77  342 ?   ?   ?   E . n 
B 2 78  CYS 78  343 ?   ?   ?   E . n 
B 2 79  SER 79  344 ?   ?   ?   E . n 
B 2 80  GLN 80  345 ?   ?   ?   E . n 
B 2 81  LEU 81  346 ?   ?   ?   E . n 
B 2 82  CYS 82  347 ?   ?   ?   E . n 
B 2 83  VAL 83  348 ?   ?   ?   E . n 
B 2 84  ASN 84  349 ?   ?   ?   E . n 
B 2 85  LEU 85  350 ?   ?   ?   E . n 
B 2 86  GLU 86  351 ?   ?   ?   E . n 
B 2 87  GLY 87  352 ?   ?   ?   E . n 
B 2 88  GLY 88  353 ?   ?   ?   E . n 
B 2 89  TYR 89  354 ?   ?   ?   E . n 
B 2 90  LYS 90  355 ?   ?   ?   E . n 
B 2 91  CYS 91  356 ?   ?   ?   E . n 
B 2 92  GLN 92  357 ?   ?   ?   E . n 
B 2 93  CYS 93  358 ?   ?   ?   E . n 
B 2 94  GLU 94  359 ?   ?   ?   E . n 
B 2 95  GLU 95  360 ?   ?   ?   E . n 
B 2 96  GLY 96  361 ?   ?   ?   E . n 
B 2 97  PHE 97  362 ?   ?   ?   E . n 
B 2 98  GLN 98  363 ?   ?   ?   E . n 
B 2 99  LEU 99  364 ?   ?   ?   E . n 
B 2 100 ASP 100 365 ?   ?   ?   E . n 
B 2 101 PRO 101 366 ?   ?   ?   E . n 
B 2 102 HIS 102 367 ?   ?   ?   E . n 
B 2 103 THR 103 368 ?   ?   ?   E . n 
B 2 104 LYS 104 369 ?   ?   ?   E . n 
B 2 105 ALA 105 370 ?   ?   ?   E . n 
B 2 106 CYS 106 371 ?   ?   ?   E . n 
B 2 107 LYS 107 372 ?   ?   ?   E . n 
C 3 1   MET 1   39  ?   ?   ?   P . n 
C 3 2   LYS 2   40  ?   ?   ?   P . n 
C 3 3   GLY 3   41  ?   ?   ?   P . n 
C 3 4   SER 4   42  ?   ?   ?   P . n 
C 3 5   LYS 5   43  ?   ?   ?   P . n 
C 3 6   GLY 6   44  ?   ?   ?   P . n 
C 3 7   SER 7   45  ?   ?   ?   P . n 
C 3 8   LYS 8   46  ?   ?   ?   P . n 
C 3 9   GLY 9   47  ?   ?   ?   P . n 
C 3 10  SER 10  48  ?   ?   ?   P . n 
C 3 11  LYS 11  49  ?   ?   ?   P . n 
C 3 12  PRO 12  50  ?   ?   ?   P . n 
C 3 13  MET 13  51  ?   ?   ?   P . n 
C 3 14  SER 14  52  ?   ?   ?   P . n 
C 3 15  ALA 15  53  ?   ?   ?   P . n 
C 3 16  GLU 16  54  ?   ?   ?   P . n 
C 3 17  ALA 17  55  ?   ?   ?   P . n 
C 3 18  PRO 18  56  ?   ?   ?   P . n 
C 3 19  GLU 19  57  ?   ?   ?   P . n 
C 3 20  HIS 20  58  ?   ?   ?   P . n 
C 3 21  GLY 21  59  ?   ?   ?   P . n 
C 3 22  THR 22  60  60  THR THR P . n 
C 3 23  THR 23  61  61  THR THR P . n 
C 3 24  ALA 24  62  62  ALA ALA P . n 
C 3 25  THR 25  63  63  THR THR P . n 
C 3 26  PHE 26  64  64  PHE PHE P . n 
C 3 27  HIS 27  65  65  HIS HIS P . n 
C 3 28  ARG 28  66  66  ARG ARG P . n 
C 3 29  CYS 29  67  67  CYS CYS P . n 
C 3 30  ALA 30  68  68  ALA ALA P . n 
C 3 31  LYS 31  69  69  LYS LYS P . n 
C 3 32  ASP 32  70  70  ASP ASP P . n 
C 3 33  PRO 33  71  71  PRO PRO P . n 
C 3 34  TRP 34  72  72  TRP TRP P . n 
C 3 35  ARG 35  73  73  ARG ARG P . n 
C 3 36  LEU 36  74  74  LEU LEU P . n 
C 3 37  PRO 37  75  75  PRO PRO P . n 
C 3 38  GLY 38  76  76  GLY GLY P . n 
C 3 39  THR 39  77  77  THR THR P . n 
C 3 40  TYR 40  78  78  TYR TYR P . n 
C 3 41  VAL 41  79  79  VAL VAL P . n 
C 3 42  VAL 42  80  80  VAL VAL P . n 
C 3 43  VAL 43  81  81  VAL VAL P . n 
C 3 44  LEU 44  82  82  LEU LEU P . n 
C 3 45  LYS 45  83  83  LYS LYS P . n 
C 3 46  GLU 46  84  84  GLU GLU P . n 
C 3 47  GLU 47  85  85  GLU GLU P . n 
C 3 48  THR 48  86  86  THR THR P . n 
C 3 49  HIS 49  87  87  HIS HIS P . n 
C 3 50  LEU 50  88  88  LEU LEU P . n 
C 3 51  SER 51  89  89  SER SER P . n 
C 3 52  GLN 52  90  90  GLN GLN P . n 
C 3 53  SER 53  91  91  SER SER P . n 
C 3 54  GLU 54  92  92  GLU GLU P . n 
C 3 55  ARG 55  93  93  ARG ARG P . n 
C 3 56  THR 56  94  94  THR THR P . n 
C 3 57  ALA 57  95  95  ALA ALA P . n 
C 3 58  ARG 58  96  96  ARG ARG P . n 
C 3 59  ARG 59  97  97  ARG ARG P . n 
C 3 60  LEU 60  98  98  LEU LEU P . n 
C 3 61  GLN 61  99  99  GLN GLN P . n 
C 3 62  ALA 62  100 100 ALA ALA P . n 
C 3 63  GLN 63  101 101 GLN GLN P . n 
C 3 64  ALA 64  102 102 ALA ALA P . n 
C 3 65  ALA 65  103 103 ALA ALA P . n 
C 3 66  ARG 66  104 104 ARG ARG P . n 
C 3 67  ARG 67  105 105 ARG ARG P . n 
C 3 68  GLY 68  106 106 GLY GLY P . n 
C 3 69  TYR 69  107 107 TYR TYR P . n 
C 3 70  LEU 70  108 108 LEU LEU P . n 
C 3 71  THR 71  109 109 THR THR P . n 
C 3 72  LYS 72  110 110 LYS LYS P . n 
C 3 73  ILE 73  111 111 ILE ILE P . n 
C 3 74  LEU 74  112 112 LEU LEU P . n 
C 3 75  HIS 75  113 113 HIS HIS P . n 
C 3 76  VAL 76  114 114 VAL VAL P . n 
C 3 77  PHE 77  115 115 PHE PHE P . n 
C 3 78  HIS 78  116 116 HIS HIS P . n 
C 3 79  GLY 79  117 117 GLY GLY P . n 
C 3 80  LEU 80  118 118 LEU LEU P . n 
C 3 81  LEU 81  119 119 LEU LEU P . n 
C 3 82  PRO 82  120 120 PRO PRO P . n 
C 3 83  GLY 83  121 121 GLY GLY P . n 
C 3 84  PHE 84  122 122 PHE PHE P . n 
C 3 85  LEU 85  123 123 LEU LEU P . n 
C 3 86  VAL 86  124 124 VAL VAL P . n 
C 3 87  LYS 87  125 125 LYS LYS P . n 
C 3 88  MET 88  126 126 MET MET P . n 
C 3 89  SER 89  127 127 SER SER P . n 
C 3 90  GLY 90  128 128 GLY GLY P . n 
C 3 91  ASP 91  129 129 ASP ASP P . n 
C 3 92  LEU 92  130 130 LEU LEU P . n 
C 3 93  LEU 93  131 131 LEU LEU P . n 
C 3 94  GLU 94  132 132 GLU GLU P . n 
C 3 95  LEU 95  133 133 LEU LEU P . n 
C 3 96  ALA 96  134 134 ALA ALA P . n 
C 3 97  LEU 97  135 135 LEU LEU P . n 
C 3 98  LYS 98  136 136 LYS LYS P . n 
C 3 99  LEU 99  137 137 LEU LEU P . n 
C 3 100 PRO 100 138 138 PRO PRO P . n 
C 3 101 HIS 101 139 139 HIS HIS P . n 
C 3 102 VAL 102 140 140 VAL VAL P . n 
C 3 103 ASP 103 141 141 ASP ASP P . n 
C 3 104 TYR 104 142 142 TYR TYR P . n 
C 3 105 ILE 105 143 143 ILE ILE P . n 
C 3 106 GLU 106 144 144 GLU GLU P . n 
C 3 107 GLU 107 145 145 GLU GLU P . n 
C 3 108 ASP 108 146 146 ASP ASP P . n 
C 3 109 SER 109 147 147 SER SER P . n 
C 3 110 SER 110 148 148 SER SER P . n 
C 3 111 VAL 111 149 149 VAL VAL P . n 
C 3 112 PHE 112 150 150 PHE PHE P . n 
C 3 113 ALA 113 151 151 ALA ALA P . n 
C 3 114 GLN 114 152 152 GLN GLN P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 CA  1  1333 1333 CA  CA  E . 
E 5 HOH 1  2001 2001 HOH HOH A . 
E 5 HOH 2  2002 2002 HOH HOH A . 
E 5 HOH 3  2003 2003 HOH HOH A . 
E 5 HOH 4  2004 2004 HOH HOH A . 
E 5 HOH 5  2005 2005 HOH HOH A . 
E 5 HOH 6  2006 2006 HOH HOH A . 
E 5 HOH 7  2007 2007 HOH HOH A . 
E 5 HOH 8  2008 2008 HOH HOH A . 
E 5 HOH 9  2009 2009 HOH HOH A . 
E 5 HOH 10 2010 2010 HOH HOH A . 
E 5 HOH 11 2011 2011 HOH HOH A . 
E 5 HOH 12 2012 2012 HOH HOH A . 
E 5 HOH 13 2013 2013 HOH HOH A . 
E 5 HOH 14 2014 2014 HOH HOH A . 
E 5 HOH 15 2015 2015 HOH HOH A . 
E 5 HOH 16 2016 2016 HOH HOH A . 
E 5 HOH 17 2017 2017 HOH HOH A . 
E 5 HOH 18 2018 2018 HOH HOH A . 
E 5 HOH 19 2019 2019 HOH HOH A . 
F 5 HOH 1  2001 2001 HOH HOH E . 
G 5 HOH 1  2001 2001 HOH HOH P . 
G 5 HOH 2  2002 2002 HOH HOH P . 
G 5 HOH 3  2003 2003 HOH HOH P . 
G 5 HOH 4  2004 2004 HOH HOH P . 
G 5 HOH 5  2005 2005 HOH HOH P . 
G 5 HOH 6  2006 2006 HOH HOH P . 
G 5 HOH 7  2007 2007 HOH HOH P . 
G 5 HOH 8  2008 2008 HOH HOH P . 
G 5 HOH 9  2009 2009 HOH HOH P . 
G 5 HOH 10 2010 2010 HOH HOH P . 
G 5 HOH 11 2011 2011 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4030  ? 
1 MORE         -28.6 ? 
1 'SSA (A^2)'  22370 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? B THR 29 ? E THR 294 ? 1_555 CA ? D CA . ? E CA 1333 ? 1_555 OE1 ? B GLU 31 ? E GLU 296 ? 1_555 67.0  ? 
2  O   ? B THR 29 ? E THR 294 ? 1_555 CA ? D CA . ? E CA 1333 ? 1_555 OD2 ? B ASP 45 ? E ASP 310 ? 1_555 78.3  ? 
3  OE1 ? B GLU 31 ? E GLU 296 ? 1_555 CA ? D CA . ? E CA 1333 ? 1_555 OD2 ? B ASP 45 ? E ASP 310 ? 1_555 86.4  ? 
4  O   ? B THR 29 ? E THR 294 ? 1_555 CA ? D CA . ? E CA 1333 ? 1_555 O   ? B GLY 49 ? E GLY 314 ? 1_555 141.9 ? 
5  OE1 ? B GLU 31 ? E GLU 296 ? 1_555 CA ? D CA . ? E CA 1333 ? 1_555 O   ? B GLY 49 ? E GLY 314 ? 1_555 75.9  ? 
6  OD2 ? B ASP 45 ? E ASP 310 ? 1_555 CA ? D CA . ? E CA 1333 ? 1_555 O   ? B GLY 49 ? E GLY 314 ? 1_555 108.6 ? 
7  O   ? B THR 29 ? E THR 294 ? 1_555 CA ? D CA . ? E CA 1333 ? 1_555 O   ? B LEU 46 ? E LEU 311 ? 1_555 144.5 ? 
8  OE1 ? B GLU 31 ? E GLU 296 ? 1_555 CA ? D CA . ? E CA 1333 ? 1_555 O   ? B LEU 46 ? E LEU 311 ? 1_555 147.9 ? 
9  OD2 ? B ASP 45 ? E ASP 310 ? 1_555 CA ? D CA . ? E CA 1333 ? 1_555 O   ? B LEU 46 ? E LEU 311 ? 1_555 94.4  ? 
10 O   ? B GLY 49 ? E GLY 314 ? 1_555 CA ? D CA . ? E CA 1333 ? 1_555 O   ? B LEU 46 ? E LEU 311 ? 1_555 73.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-11-18 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 2.7275  -13.3795 -22.2383 0.1883 0.0510  0.1018 0.0477  -0.0368 -0.0043 1.9996 1.5746 3.8988 
0.2825  1.2023  -0.2393 -0.1764 -0.1619 0.0724  0.0674  0.1077  0.0639  -0.2857 -0.2833 0.0687  
'X-RAY DIFFRACTION' 2 ? refined 13.5104 2.0479   -43.7901 0.3640 -0.0114 0.0714 -0.1317 -0.0742 -0.0200 2.9499 8.9619 5.8660 
0.1122  -0.0524 -5.5374 0.0985  -0.1128 0.0307  -0.3207 -0.3149 -0.5148 0.1374  0.1929  0.2164  
'X-RAY DIFFRACTION' 3 ? refined 16.1185 -27.3791 -0.5443  0.2134 0.1033  0.1075 0.1072  -0.0083 0.0112  2.2097 2.0287 5.1326 
-0.1966 1.4005  -1.6564 -0.0152 -0.3068 -0.1463 0.0092  0.0446  0.1136  -0.2003 -0.3162 -0.0294 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 153 ? ? A 447 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 E 285 ? ? E 332 ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 P 60  ? ? P 152 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0019 ? 1 
MOSFLM 'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
PHASER phasing          .        ? 4 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;
SHEET
THE SHEET STRUCTURE OF THIS MOLECULE IS BIFURCATED. IN
ORDER TO REPRESENT THIS FEATURE IN THE SHEET RECORDS BELOW,
TWO SHEETS ARE DEFINED.
;
# 
_pdbx_entry_details.entry_id             2W2P 
_pdbx_entry_details.compound_details     'ENGINEERED RESIDUE IN CHAIN A, ASP 374 TO ALA' 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;HUMAN PCSK9 CATALYTIC DOMAIN. THE LAST 13 RESIDUES IN THE
SEQUENCE ABOVE ARE A CLONING ARTEFACT, A LINKER AND A 6HIS
TAG.
HUMAN LDLR EGF-AB DOMAIN. THE FIRST 27 RESIDUES IN THE
SEQUENCE ABOVE ARE A CLONING ARTEFACT, A 6HIS TAG AND A
LINKER.
HUMAN PCSK9 PRODOMAIN. THE FIRST 14 RESIDUES IN THE
SEQUENCE ABOVE ARE A CLONING ARTEFACT.
;
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             P 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              133 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             P 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              133 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             P 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              133 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                129.55 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            14.25 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 186 ? ? -145.52 -150.58 
2  1 ALA A 245 ? ? -30.94  131.95  
3  1 VAL A 280 ? ? -123.04 -101.54 
4  1 PRO A 288 ? ? -94.00  55.61   
5  1 ASN A 317 ? ? -102.52 42.08   
6  1 ARG A 319 ? ? 38.42   48.02   
7  1 ASN A 340 ? ? -102.37 -169.50 
8  1 LEU A 351 ? ? -118.75 -158.82 
9  1 PHE E 288 ? ? -114.34 -89.53  
10 1 HIS E 306 ? ? -121.43 -86.77  
11 1 ARG E 329 ? ? -136.33 -36.67  
12 1 THR P 61  ? ? -117.10 -164.97 
13 1 HIS P 139 ? ? 76.21   -12.71  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 165 ? CG  ? A ARG 13 CG  
2  1 Y 1 A ARG 165 ? CD  ? A ARG 13 CD  
3  1 Y 1 A ARG 165 ? NE  ? A ARG 13 NE  
4  1 Y 1 A ARG 165 ? CZ  ? A ARG 13 CZ  
5  1 Y 1 A ARG 165 ? NH1 ? A ARG 13 NH1 
6  1 Y 1 A ARG 165 ? NH2 ? A ARG 13 NH2 
7  1 Y 1 A LEU 179 ? CG  ? A LEU 27 CG  
8  1 Y 1 A LEU 179 ? CD1 ? A LEU 27 CD1 
9  1 Y 1 A LEU 179 ? CD2 ? A LEU 27 CD2 
10 1 Y 1 E ASN 285 ? CG  ? B ASN 20 CG  
11 1 Y 1 E ASN 285 ? OD1 ? B ASN 20 OD1 
12 1 Y 1 E ASN 285 ? ND2 ? B ASN 20 ND2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A TYR 166 ? A TYR 14  
2   1 Y 1 A ARG 167 ? A ARG 15  
3   1 Y 1 A ALA 168 ? A ALA 16  
4   1 Y 1 A ASP 169 ? A ASP 17  
5   1 Y 1 A GLU 170 ? A GLU 18  
6   1 Y 1 A TYR 171 ? A TYR 19  
7   1 Y 1 A GLN 172 ? A GLN 20  
8   1 Y 1 A PRO 173 ? A PRO 21  
9   1 Y 1 A PRO 174 ? A PRO 22  
10  1 Y 1 A ASP 175 ? A ASP 23  
11  1 Y 1 A GLY 176 ? A GLY 24  
12  1 Y 1 A GLY 177 ? A GLY 25  
13  1 Y 1 A SER 178 ? A SER 26  
14  1 Y 1 A GLY 213 ? A GLY 61  
15  1 Y 1 A THR 214 ? A THR 62  
16  1 Y 1 A ARG 215 ? A ARG 63  
17  1 Y 1 A PHE 216 ? A PHE 64  
18  1 Y 1 A HIS 217 ? A HIS 65  
19  1 Y 1 A ARG 218 ? A ARG 66  
20  1 Y 1 A GLN 219 ? A GLN 67  
21  1 Y 1 A ALA 220 ? A ALA 68  
22  1 Y 1 A THR 448 ? A THR 296 
23  1 Y 1 A HIS 449 ? A HIS 297 
24  1 Y 1 A GLY 450 ? A GLY 298 
25  1 Y 1 A ALA 451 ? A ALA 299 
26  1 Y 1 A ALA 452 ? A ALA 300 
27  1 Y 1 A GLY 453 ? A GLY 301 
28  1 Y 1 A THR 454 ? A THR 302 
29  1 Y 1 A ALA 455 ? A ALA 303 
30  1 Y 1 A ALA 456 ? A ALA 304 
31  1 Y 1 A ALA 457 ? A ALA 305 
32  1 Y 1 A SER 458 ? A SER 306 
33  1 Y 1 A HIS 459 ? A HIS 307 
34  1 Y 1 A HIS 460 ? A HIS 308 
35  1 Y 1 A HIS 461 ? A HIS 309 
36  1 Y 1 A HIS 462 ? A HIS 310 
37  1 Y 1 A HIS 463 ? A HIS 311 
38  1 Y 1 A HIS 464 ? A HIS 312 
39  1 Y 1 E MET 266 ? B MET 1   
40  1 Y 1 E LYS 267 ? B LYS 2   
41  1 Y 1 E HIS 268 ? B HIS 3   
42  1 Y 1 E HIS 269 ? B HIS 4   
43  1 Y 1 E HIS 270 ? B HIS 5   
44  1 Y 1 E HIS 271 ? B HIS 6   
45  1 Y 1 E HIS 272 ? B HIS 7   
46  1 Y 1 E HIS 273 ? B HIS 8   
47  1 Y 1 E PRO 274 ? B PRO 9   
48  1 Y 1 E MET 275 ? B MET 10  
49  1 Y 1 E SER 276 ? B SER 11  
50  1 Y 1 E ASP 277 ? B ASP 12  
51  1 Y 1 E TYR 278 ? B TYR 13  
52  1 Y 1 E ASP 279 ? B ASP 14  
53  1 Y 1 E ILE 280 ? B ILE 15  
54  1 Y 1 E PRO 281 ? B PRO 16  
55  1 Y 1 E THR 282 ? B THR 17  
56  1 Y 1 E THR 283 ? B THR 18  
57  1 Y 1 E GLU 284 ? B GLU 19  
58  1 Y 1 E ASP 333 ? B ASP 68  
59  1 Y 1 E ILE 334 ? B ILE 69  
60  1 Y 1 E ASP 335 ? B ASP 70  
61  1 Y 1 E GLU 336 ? B GLU 71  
62  1 Y 1 E CYS 337 ? B CYS 72  
63  1 Y 1 E GLN 338 ? B GLN 73  
64  1 Y 1 E ASP 339 ? B ASP 74  
65  1 Y 1 E PRO 340 ? B PRO 75  
66  1 Y 1 E ASP 341 ? B ASP 76  
67  1 Y 1 E THR 342 ? B THR 77  
68  1 Y 1 E CYS 343 ? B CYS 78  
69  1 Y 1 E SER 344 ? B SER 79  
70  1 Y 1 E GLN 345 ? B GLN 80  
71  1 Y 1 E LEU 346 ? B LEU 81  
72  1 Y 1 E CYS 347 ? B CYS 82  
73  1 Y 1 E VAL 348 ? B VAL 83  
74  1 Y 1 E ASN 349 ? B ASN 84  
75  1 Y 1 E LEU 350 ? B LEU 85  
76  1 Y 1 E GLU 351 ? B GLU 86  
77  1 Y 1 E GLY 352 ? B GLY 87  
78  1 Y 1 E GLY 353 ? B GLY 88  
79  1 Y 1 E TYR 354 ? B TYR 89  
80  1 Y 1 E LYS 355 ? B LYS 90  
81  1 Y 1 E CYS 356 ? B CYS 91  
82  1 Y 1 E GLN 357 ? B GLN 92  
83  1 Y 1 E CYS 358 ? B CYS 93  
84  1 Y 1 E GLU 359 ? B GLU 94  
85  1 Y 1 E GLU 360 ? B GLU 95  
86  1 Y 1 E GLY 361 ? B GLY 96  
87  1 Y 1 E PHE 362 ? B PHE 97  
88  1 Y 1 E GLN 363 ? B GLN 98  
89  1 Y 1 E LEU 364 ? B LEU 99  
90  1 Y 1 E ASP 365 ? B ASP 100 
91  1 Y 1 E PRO 366 ? B PRO 101 
92  1 Y 1 E HIS 367 ? B HIS 102 
93  1 Y 1 E THR 368 ? B THR 103 
94  1 Y 1 E LYS 369 ? B LYS 104 
95  1 Y 1 E ALA 370 ? B ALA 105 
96  1 Y 1 E CYS 371 ? B CYS 106 
97  1 Y 1 E LYS 372 ? B LYS 107 
98  1 Y 1 P MET 39  ? C MET 1   
99  1 Y 1 P LYS 40  ? C LYS 2   
100 1 Y 1 P GLY 41  ? C GLY 3   
101 1 Y 1 P SER 42  ? C SER 4   
102 1 Y 1 P LYS 43  ? C LYS 5   
103 1 Y 1 P GLY 44  ? C GLY 6   
104 1 Y 1 P SER 45  ? C SER 7   
105 1 Y 1 P LYS 46  ? C LYS 8   
106 1 Y 1 P GLY 47  ? C GLY 9   
107 1 Y 1 P SER 48  ? C SER 10  
108 1 Y 1 P LYS 49  ? C LYS 11  
109 1 Y 1 P PRO 50  ? C PRO 12  
110 1 Y 1 P MET 51  ? C MET 13  
111 1 Y 1 P SER 52  ? C SER 14  
112 1 Y 1 P ALA 53  ? C ALA 15  
113 1 Y 1 P GLU 54  ? C GLU 16  
114 1 Y 1 P ALA 55  ? C ALA 17  
115 1 Y 1 P PRO 56  ? C PRO 18  
116 1 Y 1 P GLU 57  ? C GLU 19  
117 1 Y 1 P HIS 58  ? C HIS 20  
118 1 Y 1 P GLY 59  ? C GLY 21  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'CALCIUM ION' CA  
5 water         HOH 
#