data_2W2Q
# 
_entry.id   2W2Q 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2W2Q         
PDBE  EBI-37854    
WWPDB D_1290037854 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1F5Y unspecified 'NMR STRUCTURE OF A CONCATEMER OF THE FIRST AND SECOND LIGAND-BINDING MODULES OF THE HUMAN LDL RECEPTOR' 
PDB 1N7D unspecified 'EXTRACELLULAR DOMAIN OF THE LDL RECEPTOR' 
PDB 1I0U unspecified 
'SOLUTION STRUCTURE AND BACKBONE DYNAMICS OF A CONCATEMER OFEGF-HOMOLOGY MODULES OF THE HUMAN LOW DENSITY LIPOPROTEINRECEPTOR'    
PDB 1D2J unspecified 'LDL RECEPTOR LIGAND-BINDING MODULE 6' 
PDB 1HZ8 unspecified 
'SOLUTION STRUCTURE AND BACKBONE DYNAMICS OF A CONCATEMER OFEGF-HOMOLOGY MODULES OF THE HUMAN LOW DENSITY LIPOPROTEINRECEPTOR'    
PDB 1F8Z unspecified 'NMR STRUCTURE OF THE SIXTH LIGAND-BINDING MODULE OF THE LDLRECEPTOR' 
PDB 1AJJ unspecified 'LDL RECEPTOR LIGAND-BINDING MODULE 5, CALCIUM-COORDINATING' 
PDB 1LDL unspecified . 
PDB 1LDR unspecified 'SECOND REPEAT OF THE LDL RECEPTOR LIGAND- BINDING DOMAIN' 
PDB 1IJQ unspecified 'CRYSTAL STRUCTURE OF THE LDL RECEPTOR YWTD- EGF DOMAIN PAIR' 
PDB 1HJ7 unspecified 'NMR STUDY OF A PAIR OF LDL RECEPTOR CA ==2+== BINDING EPIDERMAL GROWTH FACTOR-LIKE DOMAINS, 20 STRUCTURES' 
PDB 2W2M unspecified 'WT PCSK9-DELTAC BOUND TO WT EGF-A OF LDLR' 
PDB 2W2O unspecified 'PCSK9-DELTAC D374Y MUTANT BOUND TO WT EGF -A OF LDLR' 
PDB 2FCW unspecified 
'STRUCTURE OF A COMPLEX BETWEEN THE PAIR OF THE LDL RECEPTORLIGAND-BINDING MODULES 3-4 AND THE RECEPTOR ASSOCIATEDPROTEIN (RAP).' 
PDB 1LRX unspecified 'THEORETIC MODEL OF THE HUMAN LOW-DENSITY LIPOPROTEINRECEPTOR YWTD BETA-PROPELLER DOMAIN' 
PDB 2W2N unspecified 'WT PCSK9-DELTAC BOUND TO EGF-A H306Y MUTANT OF LDLR' 
PDB 2W2P unspecified 'PCSK9-DELTAC D374A MUTANT BOUND TO WT EGF -A OF LDLR' 
PDB 1XFE unspecified 'SOLUTION STRUCTURE OF THE LA7-EGFA PAIR FROM THE LDLRECEPTOR' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2W2Q 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2008-11-03 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bottomley, M.J.'  1  
'Cirillo, A.'      2  
'Orsatti, L.'      3  
'Ruggeri, L.'      4  
'Fisher, T.S.'     5  
'Santoro, J.C.'    6  
'Cummings, R.T.'   7  
'Cubbon, R.M.'     8  
'Lo Surdo, P.'     9  
'Calzetta, A.'     10 
'Noto, A.'         11 
'Baysarowich, J.'  12 
'Mattu, M.'        13 
'Talamo, F.'       14 
'De Francesco, R.' 15 
'Sparrow, C.P.'    16 
'Sitlani, A.'      17 
'Carfi, A.'        18 
# 
_citation.id                        primary 
_citation.title                     
'Structural and Biochemical Characterization of the Wild Type Pcsk9/Egf-Ab Complex and Natural Fh Mutants.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            284 
_citation.page_first                1313 
_citation.page_last                 ? 
_citation.year                      2009 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19001363 
_citation.pdbx_database_id_DOI      10.1074/JBC.M808363200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bottomley, M.J.'  1  
primary 'Cirillo, A.'      2  
primary 'Orsatti, L.'      3  
primary 'Ruggeri, L.'      4  
primary 'Fisher, T.S.'     5  
primary 'Santoro, J.C.'    6  
primary 'Cummings, R.T.'   7  
primary 'Cubbon, R.M.'     8  
primary 'Lo Surdo, P.'     9  
primary 'Calzetta, A.'     10 
primary 'Noto, A.'         11 
primary 'Baysarowich, J.'  12 
primary 'Mattu, M.'        13 
primary 'Talamo, F.'       14 
primary 'De Francesco, R.' 15 
primary 'Sparrow, C.P.'    16 
primary 'Sitlani, A.'      17 
primary 'Carfi, A.'        18 
# 
_cell.entry_id           2W2Q 
_cell.length_a           88.370 
_cell.length_b           88.370 
_cell.length_c           218.403 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2W2Q 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9' 33131.285 1   3.4.21.- YES 'CATALYTIC DOMAIN, RESIDUES 153-451' 
? 
2 polymer     man 'LOW-DENSITY LIPOPROTEIN RECEPTOR'              12095.453 1   ?        ?   'EGF-A DOMAIN, RESIDUES 314-393'     
? 
3 polymer     man 'PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9' 12679.604 1   ?        ?   'PROPEPTIDE, RESIDUES 53-152'        
? 
4 non-polymer syn 'CALCIUM ION'                                   40.078    2   ?        ?   ?                                    
? 
5 water       nat water                                           18.015    195 ?        ?   ?                                    
? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'PCSK9, PROPROTEIN CONVERTASE PC9, SUBTILISIN/KEXIN-LIKE PROTEASE PC9, NEURAL APOPTOSIS-REGULATED CONVERTASE 1, NARC-1' 
2 'LDL RECEPTOR'                                                                                                          
3 'PCSK9, PROPROTEIN CONVERTASE PC9, SUBTILISIN/KEXIN-LIKE PROTEASE PC9, NEURAL APOPTOSIS-REGULATED CONVERTASE 1, NARC-1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAG
VVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLV
TAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSHCSTCFVSQSGTSQAAAHV
AGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGAAGTAAASHHHHHH
;
;SIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAG
VVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLV
TAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSHCSTCFVSQSGTSQAAAHV
AGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGAAGTAAASHHHHHH
;
A ? 
2 'polypeptide(L)' no no 
;MKHHHHHHPMSDYDIPTTENLYFQGAMGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQ
LCVNLEGGYKCQCEEGFQLDPHTKACK
;
;MKHHHHHHPMSDYDIPTTENLYFQGAMGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQ
LCVNLEGGYKCQCEEGFQLDPHTKACK
;
E ? 
3 'polypeptide(L)' no no 
;MKGSKGSKGSKPMSAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGL
LPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
;
;MKGSKGSKGSKPMSAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGL
LPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
;
P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ILE n 
1 3   PRO n 
1 4   TRP n 
1 5   ASN n 
1 6   LEU n 
1 7   GLU n 
1 8   ARG n 
1 9   ILE n 
1 10  THR n 
1 11  PRO n 
1 12  PRO n 
1 13  ARG n 
1 14  TYR n 
1 15  ARG n 
1 16  ALA n 
1 17  ASP n 
1 18  GLU n 
1 19  TYR n 
1 20  GLN n 
1 21  PRO n 
1 22  PRO n 
1 23  ASP n 
1 24  GLY n 
1 25  GLY n 
1 26  SER n 
1 27  LEU n 
1 28  VAL n 
1 29  GLU n 
1 30  VAL n 
1 31  TYR n 
1 32  LEU n 
1 33  LEU n 
1 34  ASP n 
1 35  THR n 
1 36  SER n 
1 37  ILE n 
1 38  GLN n 
1 39  SER n 
1 40  ASP n 
1 41  HIS n 
1 42  ARG n 
1 43  GLU n 
1 44  ILE n 
1 45  GLU n 
1 46  GLY n 
1 47  ARG n 
1 48  VAL n 
1 49  MET n 
1 50  VAL n 
1 51  THR n 
1 52  ASP n 
1 53  PHE n 
1 54  GLU n 
1 55  ASN n 
1 56  VAL n 
1 57  PRO n 
1 58  GLU n 
1 59  GLU n 
1 60  ASP n 
1 61  GLY n 
1 62  THR n 
1 63  ARG n 
1 64  PHE n 
1 65  HIS n 
1 66  ARG n 
1 67  GLN n 
1 68  ALA n 
1 69  SER n 
1 70  LYS n 
1 71  CYS n 
1 72  ASP n 
1 73  SER n 
1 74  HIS n 
1 75  GLY n 
1 76  THR n 
1 77  HIS n 
1 78  LEU n 
1 79  ALA n 
1 80  GLY n 
1 81  VAL n 
1 82  VAL n 
1 83  SER n 
1 84  GLY n 
1 85  ARG n 
1 86  ASP n 
1 87  ALA n 
1 88  GLY n 
1 89  VAL n 
1 90  ALA n 
1 91  LYS n 
1 92  GLY n 
1 93  ALA n 
1 94  SER n 
1 95  MET n 
1 96  ARG n 
1 97  SER n 
1 98  LEU n 
1 99  ARG n 
1 100 VAL n 
1 101 LEU n 
1 102 ASN n 
1 103 CYS n 
1 104 GLN n 
1 105 GLY n 
1 106 LYS n 
1 107 GLY n 
1 108 THR n 
1 109 VAL n 
1 110 SER n 
1 111 GLY n 
1 112 THR n 
1 113 LEU n 
1 114 ILE n 
1 115 GLY n 
1 116 LEU n 
1 117 GLU n 
1 118 PHE n 
1 119 ILE n 
1 120 ARG n 
1 121 LYS n 
1 122 SER n 
1 123 GLN n 
1 124 LEU n 
1 125 VAL n 
1 126 GLN n 
1 127 PRO n 
1 128 VAL n 
1 129 GLY n 
1 130 PRO n 
1 131 LEU n 
1 132 VAL n 
1 133 VAL n 
1 134 LEU n 
1 135 LEU n 
1 136 PRO n 
1 137 LEU n 
1 138 ALA n 
1 139 GLY n 
1 140 GLY n 
1 141 TYR n 
1 142 SER n 
1 143 ARG n 
1 144 VAL n 
1 145 LEU n 
1 146 ASN n 
1 147 ALA n 
1 148 ALA n 
1 149 CYS n 
1 150 GLN n 
1 151 ARG n 
1 152 LEU n 
1 153 ALA n 
1 154 ARG n 
1 155 ALA n 
1 156 GLY n 
1 157 VAL n 
1 158 VAL n 
1 159 LEU n 
1 160 VAL n 
1 161 THR n 
1 162 ALA n 
1 163 ALA n 
1 164 GLY n 
1 165 ASN n 
1 166 PHE n 
1 167 ARG n 
1 168 ASP n 
1 169 ASP n 
1 170 ALA n 
1 171 CYS n 
1 172 LEU n 
1 173 TYR n 
1 174 SER n 
1 175 PRO n 
1 176 ALA n 
1 177 SER n 
1 178 ALA n 
1 179 PRO n 
1 180 GLU n 
1 181 VAL n 
1 182 ILE n 
1 183 THR n 
1 184 VAL n 
1 185 GLY n 
1 186 ALA n 
1 187 THR n 
1 188 ASN n 
1 189 ALA n 
1 190 GLN n 
1 191 ASP n 
1 192 GLN n 
1 193 PRO n 
1 194 VAL n 
1 195 THR n 
1 196 LEU n 
1 197 GLY n 
1 198 THR n 
1 199 LEU n 
1 200 GLY n 
1 201 THR n 
1 202 ASN n 
1 203 PHE n 
1 204 GLY n 
1 205 ARG n 
1 206 CYS n 
1 207 VAL n 
1 208 ASP n 
1 209 LEU n 
1 210 PHE n 
1 211 ALA n 
1 212 PRO n 
1 213 GLY n 
1 214 GLU n 
1 215 ASP n 
1 216 ILE n 
1 217 ILE n 
1 218 GLY n 
1 219 ALA n 
1 220 SER n 
1 221 SER n 
1 222 HIS n 
1 223 CYS n 
1 224 SER n 
1 225 THR n 
1 226 CYS n 
1 227 PHE n 
1 228 VAL n 
1 229 SER n 
1 230 GLN n 
1 231 SER n 
1 232 GLY n 
1 233 THR n 
1 234 SER n 
1 235 GLN n 
1 236 ALA n 
1 237 ALA n 
1 238 ALA n 
1 239 HIS n 
1 240 VAL n 
1 241 ALA n 
1 242 GLY n 
1 243 ILE n 
1 244 ALA n 
1 245 ALA n 
1 246 MET n 
1 247 MET n 
1 248 LEU n 
1 249 SER n 
1 250 ALA n 
1 251 GLU n 
1 252 PRO n 
1 253 GLU n 
1 254 LEU n 
1 255 THR n 
1 256 LEU n 
1 257 ALA n 
1 258 GLU n 
1 259 LEU n 
1 260 ARG n 
1 261 GLN n 
1 262 ARG n 
1 263 LEU n 
1 264 ILE n 
1 265 HIS n 
1 266 PHE n 
1 267 SER n 
1 268 ALA n 
1 269 LYS n 
1 270 ASP n 
1 271 VAL n 
1 272 ILE n 
1 273 ASN n 
1 274 GLU n 
1 275 ALA n 
1 276 TRP n 
1 277 PHE n 
1 278 PRO n 
1 279 GLU n 
1 280 ASP n 
1 281 GLN n 
1 282 ARG n 
1 283 VAL n 
1 284 LEU n 
1 285 THR n 
1 286 PRO n 
1 287 ASN n 
1 288 LEU n 
1 289 VAL n 
1 290 ALA n 
1 291 ALA n 
1 292 LEU n 
1 293 PRO n 
1 294 PRO n 
1 295 SER n 
1 296 THR n 
1 297 HIS n 
1 298 GLY n 
1 299 ALA n 
1 300 ALA n 
1 301 GLY n 
1 302 THR n 
1 303 ALA n 
1 304 ALA n 
1 305 ALA n 
1 306 SER n 
1 307 HIS n 
1 308 HIS n 
1 309 HIS n 
1 310 HIS n 
1 311 HIS n 
1 312 HIS n 
2 1   MET n 
2 2   LYS n 
2 3   HIS n 
2 4   HIS n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   HIS n 
2 9   PRO n 
2 10  MET n 
2 11  SER n 
2 12  ASP n 
2 13  TYR n 
2 14  ASP n 
2 15  ILE n 
2 16  PRO n 
2 17  THR n 
2 18  THR n 
2 19  GLU n 
2 20  ASN n 
2 21  LEU n 
2 22  TYR n 
2 23  PHE n 
2 24  GLN n 
2 25  GLY n 
2 26  ALA n 
2 27  MET n 
2 28  GLY n 
2 29  THR n 
2 30  ASN n 
2 31  GLU n 
2 32  CYS n 
2 33  LEU n 
2 34  ASP n 
2 35  ASN n 
2 36  ASN n 
2 37  GLY n 
2 38  GLY n 
2 39  CYS n 
2 40  SER n 
2 41  HIS n 
2 42  VAL n 
2 43  CYS n 
2 44  ASN n 
2 45  ASP n 
2 46  LEU n 
2 47  LYS n 
2 48  ILE n 
2 49  GLY n 
2 50  TYR n 
2 51  GLU n 
2 52  CYS n 
2 53  LEU n 
2 54  CYS n 
2 55  PRO n 
2 56  ASP n 
2 57  GLY n 
2 58  PHE n 
2 59  GLN n 
2 60  LEU n 
2 61  VAL n 
2 62  ALA n 
2 63  GLN n 
2 64  ARG n 
2 65  ARG n 
2 66  CYS n 
2 67  GLU n 
2 68  ASP n 
2 69  ILE n 
2 70  ASP n 
2 71  GLU n 
2 72  CYS n 
2 73  GLN n 
2 74  ASP n 
2 75  PRO n 
2 76  ASP n 
2 77  THR n 
2 78  CYS n 
2 79  SER n 
2 80  GLN n 
2 81  LEU n 
2 82  CYS n 
2 83  VAL n 
2 84  ASN n 
2 85  LEU n 
2 86  GLU n 
2 87  GLY n 
2 88  GLY n 
2 89  TYR n 
2 90  LYS n 
2 91  CYS n 
2 92  GLN n 
2 93  CYS n 
2 94  GLU n 
2 95  GLU n 
2 96  GLY n 
2 97  PHE n 
2 98  GLN n 
2 99  LEU n 
2 100 ASP n 
2 101 PRO n 
2 102 HIS n 
2 103 THR n 
2 104 LYS n 
2 105 ALA n 
2 106 CYS n 
2 107 LYS n 
3 1   MET n 
3 2   LYS n 
3 3   GLY n 
3 4   SER n 
3 5   LYS n 
3 6   GLY n 
3 7   SER n 
3 8   LYS n 
3 9   GLY n 
3 10  SER n 
3 11  LYS n 
3 12  PRO n 
3 13  MET n 
3 14  SER n 
3 15  ALA n 
3 16  GLU n 
3 17  ALA n 
3 18  PRO n 
3 19  GLU n 
3 20  HIS n 
3 21  GLY n 
3 22  THR n 
3 23  THR n 
3 24  ALA n 
3 25  THR n 
3 26  PHE n 
3 27  HIS n 
3 28  ARG n 
3 29  CYS n 
3 30  ALA n 
3 31  LYS n 
3 32  ASP n 
3 33  PRO n 
3 34  TRP n 
3 35  ARG n 
3 36  LEU n 
3 37  PRO n 
3 38  GLY n 
3 39  THR n 
3 40  TYR n 
3 41  VAL n 
3 42  VAL n 
3 43  VAL n 
3 44  LEU n 
3 45  LYS n 
3 46  GLU n 
3 47  GLU n 
3 48  THR n 
3 49  HIS n 
3 50  LEU n 
3 51  SER n 
3 52  GLN n 
3 53  SER n 
3 54  GLU n 
3 55  ARG n 
3 56  THR n 
3 57  ALA n 
3 58  ARG n 
3 59  ARG n 
3 60  LEU n 
3 61  GLN n 
3 62  ALA n 
3 63  GLN n 
3 64  ALA n 
3 65  ALA n 
3 66  ARG n 
3 67  ARG n 
3 68  GLY n 
3 69  TYR n 
3 70  LEU n 
3 71  THR n 
3 72  LYS n 
3 73  ILE n 
3 74  LEU n 
3 75  HIS n 
3 76  VAL n 
3 77  PHE n 
3 78  HIS n 
3 79  GLY n 
3 80  LEU n 
3 81  LEU n 
3 82  PRO n 
3 83  GLY n 
3 84  PHE n 
3 85  LEU n 
3 86  VAL n 
3 87  LYS n 
3 88  MET n 
3 89  SER n 
3 90  GLY n 
3 91  ASP n 
3 92  LEU n 
3 93  LEU n 
3 94  GLU n 
3 95  LEU n 
3 96  ALA n 
3 97  LEU n 
3 98  LYS n 
3 99  LEU n 
3 100 PRO n 
3 101 HIS n 
3 102 VAL n 
3 103 ASP n 
3 104 TYR n 
3 105 ILE n 
3 106 GLU n 
3 107 GLU n 
3 108 ASP n 
3 109 SER n 
3 110 SER n 
3 111 VAL n 
3 112 PHE n 
3 113 ALA n 
3 114 GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? 
? ? ? ? ? ? ? ? PETM-10 ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? 
? ? ? ? ? ? ? ? PETM-11 ? ? 
3 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? 
? ? ? ? ? ? ? ? PETM-10 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2W2Q        3 ? ? 2W2Q   ? 
2 UNP PCSK9_HUMAN 3 ? ? Q8NBP7 ? 
3 UNP PCSK9_HUMAN 1 ? ? Q8NBP7 ? 
4 PDB 2W2Q        1 ? ? 2W2Q   ? 
5 PDB 2W2Q        2 ? ? 2W2Q   ? 
6 UNP LDLR_HUMAN  2 ? ? P01130 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2W2Q P 1   ? 14  ? 2W2Q   39  ? 52  ? 39  52  
2 2 2W2Q P 15  ? 114 ? Q8NBP7 53  ? 152 ? 53  152 
3 3 2W2Q A 1   ? 299 ? Q8NBP7 153 ? 451 ? 153 451 
4 4 2W2Q A 300 ? 312 ? 2W2Q   452 ? 464 ? 452 464 
5 5 2W2Q E 1   ? 27  ? 2W2Q   266 ? 292 ? 266 292 
6 6 2W2Q E 28  ? 107 ? P01130 314 ? 393 ? 293 372 
# 
_struct_ref_seq_dif.align_id                     3 
_struct_ref_seq_dif.pdbx_pdb_id_code             2W2Q 
_struct_ref_seq_dif.mon_id                       HIS 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      222 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q8NBP7 
_struct_ref_seq_dif.db_mon_id                    ASP 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          374 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            374 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2W2Q 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.02 
_exptl_crystal.density_percent_sol   70 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1M HEPES PH 7.5, 10% (W/V) PEG 8000 AND 8% (V/V) ETHYLENE GLYCOL' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2008-07-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.980 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_wavelength             0.980 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2W2Q 
_reflns.observed_criterion_sigma_I   3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.00 
_reflns.d_resolution_high            2.33 
_reflns.number_obs                   37593 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            0.10 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.10 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.2 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.33 
_reflns_shell.d_res_low              2.46 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.60 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.30 
_reflns_shell.pdbx_redundancy        4.3 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2W2Q 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     35652 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.00 
_refine.ls_d_res_high                            2.33 
_refine.ls_percent_reflns_obs                    98.99 
_refine.ls_R_factor_obs                          0.22095 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.21932 
_refine.ls_R_factor_R_free                       0.25279 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1872 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.936 
_refine.correlation_coeff_Fo_to_Fc_free          0.920 
_refine.B_iso_mean                               37.689 
_refine.aniso_B[1][1]                            1.79 
_refine.aniso_B[2][2]                            1.79 
_refine.aniso_B[3][3]                            -3.59 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2QTW' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.203 
_refine.pdbx_overall_ESU_R_Free                  0.185 
_refine.overall_SU_ML                            0.143 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             11.491 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3129 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             195 
_refine_hist.number_atoms_total               3326 
_refine_hist.d_res_high                       2.33 
_refine_hist.d_res_low                        40.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.008  0.022  ? 3243 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.162  1.967  ? 4415 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.147  5.000  ? 423  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.005 23.786 ? 140  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       17.258 15.000 ? 530  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       14.314 15.000 ? 25   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.076  0.200  ? 511  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.020  ? 2457 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.185  0.200  ? 1438 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.295  0.200  ? 2168 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.115  0.200  ? 212  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.194  0.200  ? 24   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.160  0.200  ? 15   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.475  1.500  ? 2127 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.871  2.000  ? 3345 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.994  3.000  ? 1225 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.707  4.500  ? 1064 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.330 
_refine_ls_shell.d_res_low                        2.390 
_refine_ls_shell.number_reflns_R_work             2599 
_refine_ls_shell.R_factor_R_work                  0.302 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.388 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             128 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2W2Q 
_struct.title                     'PCSK9-deltaC D374H mutant bound to WT EGF-A of LDLR' 
_struct.pdbx_descriptor           'PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9 (E.C.3.4.21.-), LOW-DENSITY LIPOPROTEIN RECEPTOR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2W2Q 
_struct_keywords.pdbx_keywords   HYDROLASE/RECEPTOR 
_struct_keywords.text            
;HYDROLASE-RECEPTOR COMPLEX, PCSK9, LDLR, PROPROTEIN CONVERTASE, LOW-DENSITY LIPOPROTEIN RECEPTOR, EGF, CARDIOVASCULAR DISEASE, FAMILIAL HYPERCHOLESTEROLEMIA, LIPID METABOLISM, SERINE PROTEASE, HYDROLASE, LIPID TRANSPORT, STEROID METABOLISM, RECEPTOR
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 3   ? THR A 10  ? PRO A 155 THR A 162 1 ? 8  
HELX_P HELX_P2  2  ASP A 72  ? GLY A 84  ? ASP A 224 GLY A 236 1 ? 13 
HELX_P HELX_P3  3  VAL A 109 ? GLN A 126 ? VAL A 261 GLN A 278 1 ? 18 
HELX_P HELX_P4  4  SER A 142 ? ALA A 155 ? SER A 294 ALA A 307 1 ? 14 
HELX_P HELX_P5  5  GLY A 232 ? GLU A 251 ? GLY A 384 GLU A 403 1 ? 20 
HELX_P HELX_P6  6  THR A 255 ? SER A 267 ? THR A 407 SER A 419 1 ? 13 
HELX_P HELX_P7  7  ASN A 273 ? PHE A 277 ? ASN A 425 PHE A 429 5 ? 5  
HELX_P HELX_P8  8  PRO A 278 ? ARG A 282 ? PRO A 430 ARG A 434 5 ? 5  
HELX_P HELX_P9  9  ASN B 30  ? ASP B 34  ? ASN E 295 ASP E 299 5 ? 5  
HELX_P HELX_P10 10 ASP B 34  ? CYS B 39  ? ASP E 299 CYS E 304 5 ? 6  
HELX_P HELX_P11 11 LYS C 31  ? PRO C 33  ? LYS P 69  PRO P 71  5 ? 3  
HELX_P HELX_P12 12 HIS C 49  ? ARG C 67  ? HIS P 87  ARG P 105 1 ? 19 
HELX_P HELX_P13 13 SER C 89  ? ASP C 91  ? SER P 127 ASP P 129 5 ? 3  
HELX_P HELX_P14 14 LEU C 92  ? LYS C 98  ? LEU P 130 LYS P 136 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 71  SG ? ? ? 1_555 A CYS 103 SG  ? ? A CYS 223  A CYS 255  1_555 ? ? ? ? ? ? ? 2.063 ? 
disulf2  disulf ? ? A CYS 171 SG ? ? ? 1_555 A CYS 206 SG  ? ? A CYS 323  A CYS 358  1_555 ? ? ? ? ? ? ? 2.050 ? 
disulf3  disulf ? ? A CYS 223 SG ? ? ? 1_555 A CYS 226 SG  ? ? A CYS 375  A CYS 378  1_555 ? ? ? ? ? ? ? 2.053 ? 
disulf4  disulf ? ? B CYS 32  SG ? ? ? 1_555 B CYS 43  SG  ? ? E CYS 297  E CYS 308  1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf5  disulf ? ? B CYS 39  SG ? ? ? 1_555 B CYS 52  SG  ? ? E CYS 304  E CYS 317  1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf6  disulf ? ? B CYS 54  SG ? ? ? 1_555 B CYS 66  SG  ? ? E CYS 319  E CYS 331  1_555 ? ? ? ? ? ? ? 2.056 ? 
metalc1  metalc ? ? D CA  .   CA ? ? ? 1_555 A ALA 178 O   ? ? A CA  1448 A ALA 330  1_555 ? ? ? ? ? ? ? 2.626 ? 
metalc2  metalc ? ? D CA  .   CA ? ? ? 1_555 A THR 183 OG1 ? ? A CA  1448 A THR 335  1_555 ? ? ? ? ? ? ? 2.835 ? 
metalc3  metalc ? ? D CA  .   CA ? ? ? 1_555 A ASP 208 OD2 ? ? A CA  1448 A ASP 360  1_555 ? ? ? ? ? ? ? 2.984 ? 
metalc4  metalc ? ? D CA  .   CA ? ? ? 1_555 A VAL 181 O   ? ? A CA  1448 A VAL 333  1_555 ? ? ? ? ? ? ? 2.695 ? 
metalc5  metalc ? ? E CA  .   CA ? ? ? 1_555 B LEU 46  O   ? ? E CA  1333 E LEU 311  1_555 ? ? ? ? ? ? ? 2.739 ? 
metalc6  metalc ? ? E CA  .   CA ? ? ? 1_555 B GLU 31  OE1 ? ? E CA  1333 E GLU 296  1_555 ? ? ? ? ? ? ? 2.594 ? 
metalc7  metalc ? ? E CA  .   CA ? ? ? 1_555 B GLY 49  O   ? ? E CA  1333 E GLY 314  1_555 ? ? ? ? ? ? ? 2.484 ? 
metalc8  metalc ? ? E CA  .   CA ? ? ? 1_555 B THR 29  O   ? ? E CA  1333 E THR 294  1_555 ? ? ? ? ? ? ? 2.724 ? 
metalc9  metalc ? ? E CA  .   CA ? ? ? 1_555 G HOH .   O   ? ? E CA  1333 E HOH 2010 1_555 ? ? ? ? ? ? ? 2.751 ? 
metalc10 metalc ? ? E CA  .   CA ? ? ? 1_555 G HOH .   O   ? ? E CA  1333 E HOH 2007 1_555 ? ? ? ? ? ? ? 2.305 ? 
metalc11 metalc ? ? E CA  .   CA ? ? ? 1_555 B ASP 45  OD2 ? ? E CA  1333 E ASP 310  1_555 ? ? ? ? ? ? ? 2.475 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 127 A . ? PRO 279 A VAL 128 A ? VAL 280 A 1 -4.75 
2 SER 174 A . ? SER 326 A PRO 175 A ? PRO 327 A 1 -1.95 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 7 ? 
AB ? 4 ? 
AC ? 3 ? 
AD ? 4 ? 
AE ? 2 ? 
EA ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? parallel      
AA 5 6 ? parallel      
AA 6 7 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? parallel      
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? anti-parallel 
EA 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 48  ? GLU A 54  ? VAL A 200 GLU A 206 
AA 2 MET A 95  ? ARG A 99  ? MET A 247 ARG A 251 
AA 3 GLU A 29  ? ASP A 34  ? GLU A 181 ASP A 186 
AA 4 LEU A 131 ? LEU A 135 ? LEU A 283 LEU A 287 
AA 5 VAL A 158 ? ALA A 162 ? VAL A 310 ALA A 314 
AA 6 ILE A 182 ? THR A 187 ? ILE A 334 THR A 339 
AA 7 LEU A 209 ? PRO A 212 ? LEU A 361 PRO A 364 
AB 1 LYS A 106 ? THR A 108 ? LYS A 258 THR A 260 
AB 2 VAL C 102 ? ALA C 113 ? VAL P 140 ALA P 151 
AB 3 LEU A 137 ? GLY A 140 ? LEU A 289 GLY A 292 
AB 4 TYR A 173 ? SER A 174 ? TYR A 325 SER A 326 
AC 1 LYS A 106 ? THR A 108 ? LYS A 258 THR A 260 
AC 2 VAL C 102 ? ALA C 113 ? VAL P 140 ALA P 151 
AC 3 THR C 25  ? HIS C 27  ? THR P 63  HIS P 65  
AD 1 ILE A 216 ? ALA A 219 ? ILE A 368 ALA A 371 
AD 2 CYS A 226 ? GLN A 230 ? CYS A 378 GLN A 382 
AD 3 VAL B 42  ? ASP B 45  ? VAL E 307 ASP E 310 
AD 4 TYR B 50  ? LEU B 53  ? TYR E 315 LEU E 318 
AE 1 ALA A 268 ? LYS A 269 ? ALA A 420 LYS A 421 
AE 2 LEU A 288 ? VAL A 289 ? LEU A 440 VAL A 441 
EA 1 GLN B 59  ? VAL B 61  ? GLN E 324 VAL E 326 
EA 2 ARG B 65  ? GLU B 67  ? ARG E 330 GLU E 332 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N MET A 49  ? N MET A 201 O MET A 95  ? O MET A 247 
AA 2 3 N ARG A 96  ? N ARG A 248 O VAL A 30  ? O VAL A 182 
AA 3 4 N TYR A 31  ? N TYR A 183 O VAL A 132 ? O VAL A 284 
AA 4 5 N VAL A 133 ? N VAL A 285 O VAL A 158 ? O VAL A 310 
AA 5 6 N THR A 161 ? N THR A 313 O ILE A 182 ? O ILE A 334 
AA 6 7 N GLY A 185 ? N GLY A 337 O LEU A 209 ? O LEU A 361 
AB 1 2 N GLY A 107 ? N GLY A 259 O VAL C 111 ? O VAL P 149 
AB 2 3 N PHE C 112 ? N PHE P 150 O ALA A 138 ? O ALA A 290 
AB 3 4 N GLY A 139 ? N GLY A 291 O SER A 174 ? O SER A 326 
AC 1 2 N GLY A 107 ? N GLY A 259 O VAL C 111 ? O VAL P 149 
AC 2 3 N ILE C 105 ? N ILE P 143 O THR C 25  ? O THR P 63  
AD 1 2 N GLY A 218 ? N GLY A 370 O VAL A 228 ? O VAL A 380 
AD 2 3 N PHE A 227 ? N PHE A 379 O CYS B 43  ? O CYS E 308 
AD 3 4 N ASN B 44  ? N ASN E 309 O GLU B 51  ? O GLU E 316 
AE 1 2 N ALA A 268 ? N ALA A 420 O VAL A 289 ? O VAL A 441 
EA 1 2 N VAL B 61  ? N VAL E 326 O ARG B 65  ? O ARG E 330 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CA E1333' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A1448' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 THR B 29  ? THR E 294  . ? 1_555 ? 
2  AC1 7 GLU B 31  ? GLU E 296  . ? 1_555 ? 
3  AC1 7 ASP B 45  ? ASP E 310  . ? 1_555 ? 
4  AC1 7 LEU B 46  ? LEU E 311  . ? 1_555 ? 
5  AC1 7 GLY B 49  ? GLY E 314  . ? 1_555 ? 
6  AC1 7 HOH G .   ? HOH E 2007 . ? 1_555 ? 
7  AC1 7 HOH G .   ? HOH E 2010 . ? 1_555 ? 
8  AC2 6 ALA A 176 ? ALA A 328  . ? 1_555 ? 
9  AC2 6 ALA A 178 ? ALA A 330  . ? 1_555 ? 
10 AC2 6 VAL A 181 ? VAL A 333  . ? 1_555 ? 
11 AC2 6 THR A 183 ? THR A 335  . ? 1_555 ? 
12 AC2 6 CYS A 206 ? CYS A 358  . ? 1_555 ? 
13 AC2 6 ASP A 208 ? ASP A 360  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2W2Q 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2W2Q 
_atom_sites.fract_transf_matrix[1][1]   0.011316 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011316 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004579 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 1   ? -2.192  -4.611  9.680  1.00 43.02 ? 153  SER A N   1 
ATOM   2    C  CA  . SER A 1 1   ? -3.245  -3.584  9.934  1.00 42.78 ? 153  SER A CA  1 
ATOM   3    C  C   . SER A 1 1   ? -3.471  -3.392  11.435 1.00 42.05 ? 153  SER A C   1 
ATOM   4    O  O   . SER A 1 1   ? -2.639  -3.795  12.263 1.00 41.98 ? 153  SER A O   1 
ATOM   5    C  CB  . SER A 1 1   ? -4.559  -3.980  9.243  1.00 43.14 ? 153  SER A CB  1 
ATOM   6    O  OG  . SER A 1 1   ? -5.353  -2.843  8.916  1.00 44.37 ? 153  SER A OG  1 
ATOM   7    N  N   . ILE A 1 2   ? -4.585  -2.747  11.777 1.00 40.74 ? 154  ILE A N   1 
ATOM   8    C  CA  . ILE A 1 2   ? -5.011  -2.641  13.166 1.00 39.43 ? 154  ILE A CA  1 
ATOM   9    C  C   . ILE A 1 2   ? -6.509  -2.974  13.216 1.00 38.05 ? 154  ILE A C   1 
ATOM   10   O  O   . ILE A 1 2   ? -7.254  -2.569  12.326 1.00 38.13 ? 154  ILE A O   1 
ATOM   11   C  CB  . ILE A 1 2   ? -4.635  -1.251  13.819 1.00 39.74 ? 154  ILE A CB  1 
ATOM   12   C  CG1 . ILE A 1 2   ? -5.823  -0.295  13.913 1.00 39.90 ? 154  ILE A CG1 1 
ATOM   13   C  CG2 . ILE A 1 2   ? -3.438  -0.589  13.123 1.00 40.11 ? 154  ILE A CG2 1 
ATOM   14   C  CD1 . ILE A 1 2   ? -6.284  -0.088  15.331 1.00 40.31 ? 154  ILE A CD1 1 
ATOM   15   N  N   . PRO A 1 3   ? -6.942  -3.758  14.224 1.00 36.69 ? 155  PRO A N   1 
ATOM   16   C  CA  . PRO A 1 3   ? -8.349  -4.161  14.336 1.00 35.54 ? 155  PRO A CA  1 
ATOM   17   C  C   . PRO A 1 3   ? -9.349  -3.007  14.164 1.00 34.57 ? 155  PRO A C   1 
ATOM   18   O  O   . PRO A 1 3   ? -9.158  -1.921  14.735 1.00 34.47 ? 155  PRO A O   1 
ATOM   19   C  CB  . PRO A 1 3   ? -8.422  -4.759  15.742 1.00 35.31 ? 155  PRO A CB  1 
ATOM   20   C  CG  . PRO A 1 3   ? -7.073  -5.304  15.969 1.00 35.90 ? 155  PRO A CG  1 
ATOM   21   C  CD  . PRO A 1 3   ? -6.128  -4.336  15.311 1.00 36.30 ? 155  PRO A CD  1 
ATOM   22   N  N   . TRP A 1 4   ? -10.404 -3.251  13.383 1.00 33.30 ? 156  TRP A N   1 
ATOM   23   C  CA  . TRP A 1 4   ? -11.401 -2.223  13.061 1.00 32.37 ? 156  TRP A CA  1 
ATOM   24   C  C   . TRP A 1 4   ? -11.933 -1.516  14.305 1.00 32.14 ? 156  TRP A C   1 
ATOM   25   O  O   . TRP A 1 4   ? -12.226 -0.326  14.271 1.00 31.93 ? 156  TRP A O   1 
ATOM   26   C  CB  . TRP A 1 4   ? -12.561 -2.806  12.232 1.00 31.69 ? 156  TRP A CB  1 
ATOM   27   C  CG  . TRP A 1 4   ? -13.614 -3.536  13.051 1.00 31.42 ? 156  TRP A CG  1 
ATOM   28   C  CD1 . TRP A 1 4   ? -13.691 -4.881  13.278 1.00 30.38 ? 156  TRP A CD1 1 
ATOM   29   C  CD2 . TRP A 1 4   ? -14.724 -2.948  13.748 1.00 30.46 ? 156  TRP A CD2 1 
ATOM   30   N  NE1 . TRP A 1 4   ? -14.772 -5.165  14.071 1.00 30.11 ? 156  TRP A NE1 1 
ATOM   31   C  CE2 . TRP A 1 4   ? -15.424 -4.000  14.377 1.00 30.28 ? 156  TRP A CE2 1 
ATOM   32   C  CE3 . TRP A 1 4   ? -15.189 -1.631  13.909 1.00 29.48 ? 156  TRP A CE3 1 
ATOM   33   C  CZ2 . TRP A 1 4   ? -16.576 -3.782  15.150 1.00 30.47 ? 156  TRP A CZ2 1 
ATOM   34   C  CZ3 . TRP A 1 4   ? -16.322 -1.414  14.679 1.00 30.39 ? 156  TRP A CZ3 1 
ATOM   35   C  CH2 . TRP A 1 4   ? -17.004 -2.486  15.291 1.00 30.72 ? 156  TRP A CH2 1 
ATOM   36   N  N   . ASN A 1 5   ? -12.038 -2.269  15.395 1.00 32.28 ? 157  ASN A N   1 
ATOM   37   C  CA  . ASN A 1 5   ? -12.675 -1.823  16.624 1.00 32.40 ? 157  ASN A CA  1 
ATOM   38   C  C   . ASN A 1 5   ? -11.840 -0.850  17.447 1.00 32.92 ? 157  ASN A C   1 
ATOM   39   O  O   . ASN A 1 5   ? -12.388 0.032   18.111 1.00 32.79 ? 157  ASN A O   1 
ATOM   40   C  CB  . ASN A 1 5   ? -13.071 -3.038  17.475 1.00 32.35 ? 157  ASN A CB  1 
ATOM   41   C  CG  . ASN A 1 5   ? -11.929 -4.020  17.673 1.00 31.80 ? 157  ASN A CG  1 
ATOM   42   O  OD1 . ASN A 1 5   ? -11.455 -4.645  16.723 1.00 30.03 ? 157  ASN A OD1 1 
ATOM   43   N  ND2 . ASN A 1 5   ? -11.490 -4.169  18.917 1.00 31.32 ? 157  ASN A ND2 1 
ATOM   44   N  N   . LEU A 1 6   ? -10.518 -1.019  17.401 1.00 33.70 ? 158  LEU A N   1 
ATOM   45   C  CA  . LEU A 1 6   ? -9.590  -0.140  18.108 1.00 34.60 ? 158  LEU A CA  1 
ATOM   46   C  C   . LEU A 1 6   ? -9.472  1.174   17.353 1.00 35.67 ? 158  LEU A C   1 
ATOM   47   O  O   . LEU A 1 6   ? -9.358  2.252   17.948 1.00 35.58 ? 158  LEU A O   1 
ATOM   48   C  CB  . LEU A 1 6   ? -8.215  -0.805  18.261 1.00 34.13 ? 158  LEU A CB  1 
ATOM   49   C  CG  . LEU A 1 6   ? -8.163  -2.144  19.010 1.00 33.63 ? 158  LEU A CG  1 
ATOM   50   C  CD1 . LEU A 1 6   ? -6.756  -2.722  19.027 1.00 32.51 ? 158  LEU A CD1 1 
ATOM   51   C  CD2 . LEU A 1 6   ? -8.707  -2.011  20.427 1.00 32.66 ? 158  LEU A CD2 1 
ATOM   52   N  N   . GLU A 1 7   ? -9.506  1.054   16.030 1.00 37.04 ? 159  GLU A N   1 
ATOM   53   C  CA  . GLU A 1 7   ? -9.563  2.182   15.125 1.00 38.49 ? 159  GLU A CA  1 
ATOM   54   C  C   . GLU A 1 7   ? -10.820 3.016   15.396 1.00 38.68 ? 159  GLU A C   1 
ATOM   55   O  O   . GLU A 1 7   ? -10.742 4.239   15.516 1.00 38.90 ? 159  GLU A O   1 
ATOM   56   C  CB  . GLU A 1 7   ? -9.553  1.654   13.689 1.00 38.93 ? 159  GLU A CB  1 
ATOM   57   C  CG  . GLU A 1 7   ? -8.913  2.564   12.673 1.00 42.08 ? 159  GLU A CG  1 
ATOM   58   C  CD  . GLU A 1 7   ? -8.114  1.786   11.635 1.00 46.44 ? 159  GLU A CD  1 
ATOM   59   O  OE1 . GLU A 1 7   ? -8.673  0.840   11.021 1.00 47.11 ? 159  GLU A OE1 1 
ATOM   60   O  OE2 . GLU A 1 7   ? -6.916  2.120   11.440 1.00 47.89 ? 159  GLU A OE2 1 
ATOM   61   N  N   . ARG A 1 8   ? -11.963 2.342   15.524 1.00 39.05 ? 160  ARG A N   1 
ATOM   62   C  CA  . ARG A 1 8   ? -13.264 2.994   15.698 1.00 39.68 ? 160  ARG A CA  1 
ATOM   63   C  C   . ARG A 1 8   ? -13.403 3.831   16.981 1.00 40.63 ? 160  ARG A C   1 
ATOM   64   O  O   . ARG A 1 8   ? -14.101 4.850   16.991 1.00 40.63 ? 160  ARG A O   1 
ATOM   65   C  CB  . ARG A 1 8   ? -14.383 1.948   15.621 1.00 39.21 ? 160  ARG A CB  1 
ATOM   66   C  CG  . ARG A 1 8   ? -15.790 2.506   15.474 1.00 38.32 ? 160  ARG A CG  1 
ATOM   67   C  CD  . ARG A 1 8   ? -15.971 3.290   14.172 1.00 36.76 ? 160  ARG A CD  1 
ATOM   68   N  NE  . ARG A 1 8   ? -15.524 2.531   13.005 1.00 36.14 ? 160  ARG A NE  1 
ATOM   69   C  CZ  . ARG A 1 8   ? -16.320 1.837   12.198 1.00 34.77 ? 160  ARG A CZ  1 
ATOM   70   N  NH1 . ARG A 1 8   ? -17.633 1.800   12.404 1.00 34.13 ? 160  ARG A NH1 1 
ATOM   71   N  NH2 . ARG A 1 8   ? -15.794 1.182   11.175 1.00 33.96 ? 160  ARG A NH2 1 
ATOM   72   N  N   . ILE A 1 9   ? -12.749 3.399   18.055 1.00 42.01 ? 161  ILE A N   1 
ATOM   73   C  CA  . ILE A 1 9   ? -12.824 4.099   19.345 1.00 43.36 ? 161  ILE A CA  1 
ATOM   74   C  C   . ILE A 1 9   ? -11.759 5.189   19.489 1.00 44.75 ? 161  ILE A C   1 
ATOM   75   O  O   . ILE A 1 9   ? -11.794 5.988   20.428 1.00 44.89 ? 161  ILE A O   1 
ATOM   76   C  CB  . ILE A 1 9   ? -12.739 3.122   20.549 1.00 43.10 ? 161  ILE A CB  1 
ATOM   77   C  CG1 . ILE A 1 9   ? -11.401 2.373   20.546 1.00 42.63 ? 161  ILE A CG1 1 
ATOM   78   C  CG2 . ILE A 1 9   ? -13.940 2.170   20.554 1.00 42.63 ? 161  ILE A CG2 1 
ATOM   79   C  CD1 . ILE A 1 9   ? -11.012 1.789   21.883 1.00 42.50 ? 161  ILE A CD1 1 
ATOM   80   N  N   . THR A 1 10  ? -10.813 5.203   18.555 1.00 46.61 ? 162  THR A N   1 
ATOM   81   C  CA  . THR A 1 10  ? -9.727  6.181   18.530 1.00 48.38 ? 162  THR A CA  1 
ATOM   82   C  C   . THR A 1 10  ? -10.124 7.345   17.624 1.00 49.51 ? 162  THR A C   1 
ATOM   83   O  O   . THR A 1 10  ? -10.220 7.171   16.405 1.00 49.80 ? 162  THR A O   1 
ATOM   84   C  CB  . THR A 1 10  ? -8.407  5.537   18.032 1.00 48.27 ? 162  THR A CB  1 
ATOM   85   O  OG1 . THR A 1 10  ? -8.033  4.476   18.918 1.00 48.90 ? 162  THR A OG1 1 
ATOM   86   C  CG2 . THR A 1 10  ? -7.276  6.553   17.984 1.00 49.09 ? 162  THR A CG2 1 
ATOM   87   N  N   . PRO A 1 11  ? -10.351 8.536   18.218 1.00 50.78 ? 163  PRO A N   1 
ATOM   88   C  CA  . PRO A 1 11  ? -10.781 9.728   17.476 1.00 51.67 ? 163  PRO A CA  1 
ATOM   89   C  C   . PRO A 1 11  ? -9.671  10.277  16.574 1.00 52.71 ? 163  PRO A C   1 
ATOM   90   O  O   . PRO A 1 11  ? -8.494  10.173  16.933 1.00 52.78 ? 163  PRO A O   1 
ATOM   91   C  CB  . PRO A 1 11  ? -11.102 10.731  18.589 1.00 51.66 ? 163  PRO A CB  1 
ATOM   92   C  CG  . PRO A 1 11  ? -10.230 10.318  19.724 1.00 51.25 ? 163  PRO A CG  1 
ATOM   93   C  CD  . PRO A 1 11  ? -10.191 8.819   19.660 1.00 50.83 ? 163  PRO A CD  1 
ATOM   94   N  N   . PRO A 1 12  ? -10.042 10.847  15.405 1.00 53.64 ? 164  PRO A N   1 
ATOM   95   C  CA  . PRO A 1 12  ? -9.077  11.449  14.471 1.00 54.33 ? 164  PRO A CA  1 
ATOM   96   C  C   . PRO A 1 12  ? -8.061  12.389  15.139 1.00 54.90 ? 164  PRO A C   1 
ATOM   97   O  O   . PRO A 1 12  ? -6.855  12.263  14.892 1.00 55.02 ? 164  PRO A O   1 
ATOM   98   C  CB  . PRO A 1 12  ? -9.972  12.219  13.492 1.00 54.35 ? 164  PRO A CB  1 
ATOM   99   C  CG  . PRO A 1 12  ? -11.245 11.438  13.475 1.00 54.03 ? 164  PRO A CG  1 
ATOM   100  C  CD  . PRO A 1 12  ? -11.424 10.927  14.886 1.00 53.73 ? 164  PRO A CD  1 
ATOM   101  N  N   . ARG A 1 13  ? -8.543  13.304  15.982 1.00 55.42 ? 165  ARG A N   1 
ATOM   102  C  CA  . ARG A 1 13  ? -7.667  14.251  16.680 1.00 55.80 ? 165  ARG A CA  1 
ATOM   103  C  C   . ARG A 1 13  ? -7.083  13.641  17.955 1.00 55.96 ? 165  ARG A C   1 
ATOM   104  O  O   . ARG A 1 13  ? -6.198  12.783  17.895 1.00 56.09 ? 165  ARG A O   1 
ATOM   105  C  CB  . ARG A 1 13  ? -8.410  15.557  16.989 1.00 55.87 ? 165  ARG A CB  1 
ATOM   106  N  N   . SER A 1 26  ? -1.690  3.809   35.772 1.00 52.69 ? 178  SER A N   1 
ATOM   107  C  CA  . SER A 1 26  ? -0.762  3.293   36.778 1.00 52.78 ? 178  SER A CA  1 
ATOM   108  C  C   . SER A 1 26  ? -1.498  2.735   37.997 1.00 52.39 ? 178  SER A C   1 
ATOM   109  O  O   . SER A 1 26  ? -1.323  1.569   38.360 1.00 52.57 ? 178  SER A O   1 
ATOM   110  C  CB  . SER A 1 26  ? 0.225   4.384   37.224 1.00 52.88 ? 178  SER A CB  1 
ATOM   111  O  OG  . SER A 1 26  ? 0.921   4.944   36.119 1.00 53.99 ? 178  SER A OG  1 
ATOM   112  N  N   . LEU A 1 27  ? -2.321  3.577   38.619 1.00 51.83 ? 179  LEU A N   1 
ATOM   113  C  CA  . LEU A 1 27  ? -3.011  3.223   39.858 1.00 51.24 ? 179  LEU A CA  1 
ATOM   114  C  C   . LEU A 1 27  ? -4.322  2.457   39.634 1.00 50.59 ? 179  LEU A C   1 
ATOM   115  O  O   . LEU A 1 27  ? -4.902  1.921   40.584 1.00 50.65 ? 179  LEU A O   1 
ATOM   116  C  CB  . LEU A 1 27  ? -3.264  4.482   40.699 1.00 51.40 ? 179  LEU A CB  1 
ATOM   117  C  CG  . LEU A 1 27  ? -2.047  5.186   41.310 1.00 51.79 ? 179  LEU A CG  1 
ATOM   118  C  CD1 . LEU A 1 27  ? -2.403  6.594   41.788 1.00 51.88 ? 179  LEU A CD1 1 
ATOM   119  C  CD2 . LEU A 1 27  ? -1.450  4.361   42.448 1.00 52.37 ? 179  LEU A CD2 1 
ATOM   120  N  N   . VAL A 1 28  ? -4.776  2.399   38.382 1.00 49.54 ? 180  VAL A N   1 
ATOM   121  C  CA  . VAL A 1 28  ? -6.040  1.744   38.041 1.00 48.52 ? 180  VAL A CA  1 
ATOM   122  C  C   . VAL A 1 28  ? -5.949  0.222   38.150 1.00 47.71 ? 180  VAL A C   1 
ATOM   123  O  O   . VAL A 1 28  ? -4.988  -0.392  37.680 1.00 47.68 ? 180  VAL A O   1 
ATOM   124  C  CB  . VAL A 1 28  ? -6.522  2.116   36.610 1.00 48.52 ? 180  VAL A CB  1 
ATOM   125  C  CG1 . VAL A 1 28  ? -7.967  1.675   36.396 1.00 48.47 ? 180  VAL A CG1 1 
ATOM   126  C  CG2 . VAL A 1 28  ? -6.398  3.603   36.373 1.00 48.68 ? 180  VAL A CG2 1 
ATOM   127  N  N   . GLU A 1 29  ? -6.956  -0.376  38.776 1.00 46.62 ? 181  GLU A N   1 
ATOM   128  C  CA  . GLU A 1 29  ? -7.103  -1.822  38.771 1.00 45.67 ? 181  GLU A CA  1 
ATOM   129  C  C   . GLU A 1 29  ? -8.406  -2.191  38.068 1.00 44.54 ? 181  GLU A C   1 
ATOM   130  O  O   . GLU A 1 29  ? -9.443  -1.569  38.304 1.00 44.49 ? 181  GLU A O   1 
ATOM   131  C  CB  . GLU A 1 29  ? -7.065  -2.383  40.196 1.00 46.07 ? 181  GLU A CB  1 
ATOM   132  C  CG  . GLU A 1 29  ? -6.681  -3.866  40.280 1.00 47.18 ? 181  GLU A CG  1 
ATOM   133  C  CD  . GLU A 1 29  ? -5.273  -4.143  39.766 1.00 48.69 ? 181  GLU A CD  1 
ATOM   134  O  OE1 . GLU A 1 29  ? -4.295  -3.886  40.506 1.00 48.69 ? 181  GLU A OE1 1 
ATOM   135  O  OE2 . GLU A 1 29  ? -5.153  -4.622  38.617 1.00 48.98 ? 181  GLU A OE2 1 
ATOM   136  N  N   . VAL A 1 30  ? -8.335  -3.182  37.183 1.00 43.13 ? 182  VAL A N   1 
ATOM   137  C  CA  . VAL A 1 30  ? -9.510  -3.675  36.473 1.00 41.64 ? 182  VAL A CA  1 
ATOM   138  C  C   . VAL A 1 30  ? -9.797  -5.105  36.904 1.00 40.78 ? 182  VAL A C   1 
ATOM   139  O  O   . VAL A 1 30  ? -8.972  -5.995  36.711 1.00 40.53 ? 182  VAL A O   1 
ATOM   140  C  CB  . VAL A 1 30  ? -9.336  -3.619  34.932 1.00 41.71 ? 182  VAL A CB  1 
ATOM   141  C  CG1 . VAL A 1 30  ? -10.607 -4.096  34.225 1.00 41.37 ? 182  VAL A CG1 1 
ATOM   142  C  CG2 . VAL A 1 30  ? -8.967  -2.212  34.475 1.00 41.25 ? 182  VAL A CG2 1 
ATOM   143  N  N   . TYR A 1 31  ? -10.970 -5.311  37.497 1.00 39.80 ? 183  TYR A N   1 
ATOM   144  C  CA  . TYR A 1 31  ? -11.416 -6.639  37.889 1.00 38.92 ? 183  TYR A CA  1 
ATOM   145  C  C   . TYR A 1 31  ? -12.318 -7.247  36.825 1.00 38.28 ? 183  TYR A C   1 
ATOM   146  O  O   . TYR A 1 31  ? -13.210 -6.587  36.291 1.00 37.99 ? 183  TYR A O   1 
ATOM   147  C  CB  . TYR A 1 31  ? -12.148 -6.600  39.234 1.00 39.26 ? 183  TYR A CB  1 
ATOM   148  C  CG  . TYR A 1 31  ? -11.255 -6.325  40.425 1.00 39.47 ? 183  TYR A CG  1 
ATOM   149  C  CD1 . TYR A 1 31  ? -10.743 -7.372  41.196 1.00 39.48 ? 183  TYR A CD1 1 
ATOM   150  C  CD2 . TYR A 1 31  ? -10.927 -5.018  40.789 1.00 39.51 ? 183  TYR A CD2 1 
ATOM   151  C  CE1 . TYR A 1 31  ? -9.931  -7.126  42.297 1.00 39.61 ? 183  TYR A CE1 1 
ATOM   152  C  CE2 . TYR A 1 31  ? -10.110 -4.761  41.887 1.00 39.80 ? 183  TYR A CE2 1 
ATOM   153  C  CZ  . TYR A 1 31  ? -9.616  -5.814  42.635 1.00 39.95 ? 183  TYR A CZ  1 
ATOM   154  O  OH  . TYR A 1 31  ? -8.800  -5.554  43.717 1.00 40.43 ? 183  TYR A OH  1 
ATOM   155  N  N   . LEU A 1 32  ? -12.068 -8.516  36.526 1.00 37.55 ? 184  LEU A N   1 
ATOM   156  C  CA  . LEU A 1 32  ? -12.893 -9.276  35.608 1.00 36.79 ? 184  LEU A CA  1 
ATOM   157  C  C   . LEU A 1 32  ? -13.507 -10.466 36.331 1.00 36.28 ? 184  LEU A C   1 
ATOM   158  O  O   . LEU A 1 32  ? -12.788 -11.326 36.844 1.00 36.11 ? 184  LEU A O   1 
ATOM   159  C  CB  . LEU A 1 32  ? -12.068 -9.735  34.398 1.00 36.82 ? 184  LEU A CB  1 
ATOM   160  C  CG  . LEU A 1 32  ? -12.708 -10.635 33.330 1.00 36.84 ? 184  LEU A CG  1 
ATOM   161  C  CD1 . LEU A 1 32  ? -13.877 -9.953  32.621 1.00 35.83 ? 184  LEU A CD1 1 
ATOM   162  C  CD2 . LEU A 1 32  ? -11.668 -11.101 32.321 1.00 36.72 ? 184  LEU A CD2 1 
ATOM   163  N  N   . LEU A 1 33  ? -14.839 -10.493 36.379 1.00 35.91 ? 185  LEU A N   1 
ATOM   164  C  CA  . LEU A 1 33  ? -15.579 -11.672 36.836 1.00 35.46 ? 185  LEU A CA  1 
ATOM   165  C  C   . LEU A 1 33  ? -16.098 -12.397 35.612 1.00 34.90 ? 185  LEU A C   1 
ATOM   166  O  O   . LEU A 1 33  ? -17.006 -11.918 34.940 1.00 35.01 ? 185  LEU A O   1 
ATOM   167  C  CB  . LEU A 1 33  ? -16.740 -11.300 37.767 1.00 35.45 ? 185  LEU A CB  1 
ATOM   168  C  CG  . LEU A 1 33  ? -16.419 -10.582 39.079 1.00 36.37 ? 185  LEU A CG  1 
ATOM   169  C  CD1 . LEU A 1 33  ? -16.537 -9.085  38.862 1.00 38.19 ? 185  LEU A CD1 1 
ATOM   170  C  CD2 . LEU A 1 33  ? -17.340 -11.027 40.211 1.00 36.61 ? 185  LEU A CD2 1 
ATOM   171  N  N   . ASP A 1 34  ? -15.510 -13.549 35.319 1.00 34.25 ? 186  ASP A N   1 
ATOM   172  C  CA  . ASP A 1 34  ? -15.802 -14.258 34.090 1.00 33.88 ? 186  ASP A CA  1 
ATOM   173  C  C   . ASP A 1 34  ? -15.408 -15.717 34.261 1.00 33.20 ? 186  ASP A C   1 
ATOM   174  O  O   . ASP A 1 34  ? -15.396 -16.229 35.374 1.00 33.25 ? 186  ASP A O   1 
ATOM   175  C  CB  . ASP A 1 34  ? -15.038 -13.614 32.922 1.00 34.05 ? 186  ASP A CB  1 
ATOM   176  C  CG  . ASP A 1 34  ? -15.698 -13.861 31.584 1.00 35.69 ? 186  ASP A CG  1 
ATOM   177  O  OD1 . ASP A 1 34  ? -15.284 -14.795 30.878 1.00 37.88 ? 186  ASP A OD1 1 
ATOM   178  O  OD2 . ASP A 1 34  ? -16.654 -13.142 31.236 1.00 38.64 ? 186  ASP A OD2 1 
ATOM   179  N  N   . THR A 1 35  ? -15.100 -16.380 33.153 1.00 32.65 ? 187  THR A N   1 
ATOM   180  C  CA  . THR A 1 35  ? -14.590 -17.742 33.152 1.00 32.48 ? 187  THR A CA  1 
ATOM   181  C  C   . THR A 1 35  ? -13.157 -17.762 33.687 1.00 32.76 ? 187  THR A C   1 
ATOM   182  O  O   . THR A 1 35  ? -12.607 -16.723 34.078 1.00 32.70 ? 187  THR A O   1 
ATOM   183  C  CB  . THR A 1 35  ? -14.588 -18.326 31.719 1.00 32.37 ? 187  THR A CB  1 
ATOM   184  O  OG1 . THR A 1 35  ? -13.758 -17.523 30.873 1.00 31.32 ? 187  THR A OG1 1 
ATOM   185  C  CG2 . THR A 1 35  ? -16.006 -18.379 31.133 1.00 32.02 ? 187  THR A CG2 1 
ATOM   186  N  N   . SER A 1 36  ? -12.548 -18.942 33.712 1.00 32.91 ? 188  SER A N   1 
ATOM   187  C  CA  . SER A 1 36  ? -11.109 -19.017 33.900 1.00 32.76 ? 188  SER A CA  1 
ATOM   188  C  C   . SER A 1 36  ? -10.424 -18.359 32.705 1.00 33.00 ? 188  SER A C   1 
ATOM   189  O  O   . SER A 1 36  ? -11.041 -18.140 31.657 1.00 33.10 ? 188  SER A O   1 
ATOM   190  C  CB  . SER A 1 36  ? -10.640 -20.461 34.104 1.00 32.86 ? 188  SER A CB  1 
ATOM   191  O  OG  . SER A 1 36  ? -11.153 -21.330 33.116 1.00 33.12 ? 188  SER A OG  1 
ATOM   192  N  N   . ILE A 1 37  ? -9.159  -18.004 32.882 1.00 33.34 ? 189  ILE A N   1 
ATOM   193  C  CA  . ILE A 1 37  ? -8.400  -17.307 31.857 1.00 33.49 ? 189  ILE A CA  1 
ATOM   194  C  C   . ILE A 1 37  ? -7.048  -17.987 31.684 1.00 33.40 ? 189  ILE A C   1 
ATOM   195  O  O   . ILE A 1 37  ? -6.532  -18.573 32.621 1.00 33.24 ? 189  ILE A O   1 
ATOM   196  C  CB  . ILE A 1 37  ? -8.199  -15.802 32.214 1.00 33.79 ? 189  ILE A CB  1 
ATOM   197  C  CG1 . ILE A 1 37  ? -7.358  -15.653 33.483 1.00 33.88 ? 189  ILE A CG1 1 
ATOM   198  C  CG2 . ILE A 1 37  ? -9.550  -15.093 32.380 1.00 32.76 ? 189  ILE A CG2 1 
ATOM   199  C  CD1 . ILE A 1 37  ? -6.585  -14.360 33.548 1.00 34.92 ? 189  ILE A CD1 1 
ATOM   200  N  N   . GLN A 1 38  ? -6.495  -17.930 30.477 1.00 33.49 ? 190  GLN A N   1 
ATOM   201  C  CA  . GLN A 1 38  ? -5.132  -18.390 30.241 1.00 33.35 ? 190  GLN A CA  1 
ATOM   202  C  C   . GLN A 1 38  ? -4.229  -17.197 30.519 1.00 32.99 ? 190  GLN A C   1 
ATOM   203  O  O   . GLN A 1 38  ? -3.938  -16.400 29.624 1.00 32.62 ? 190  GLN A O   1 
ATOM   204  C  CB  . GLN A 1 38  ? -4.960  -18.890 28.800 1.00 33.47 ? 190  GLN A CB  1 
ATOM   205  C  CG  . GLN A 1 38  ? -3.781  -19.828 28.601 1.00 35.02 ? 190  GLN A CG  1 
ATOM   206  C  CD  . GLN A 1 38  ? -3.203  -19.784 27.185 1.00 36.43 ? 190  GLN A CD  1 
ATOM   207  O  OE1 . GLN A 1 38  ? -3.829  -20.232 26.226 1.00 37.05 ? 190  GLN A OE1 1 
ATOM   208  N  NE2 . GLN A 1 38  ? -1.988  -19.266 27.062 1.00 37.26 ? 190  GLN A NE2 1 
ATOM   209  N  N   . SER A 1 39  ? -3.797  -17.083 31.774 1.00 32.94 ? 191  SER A N   1 
ATOM   210  C  CA  . SER A 1 39  ? -3.086  -15.899 32.263 1.00 32.80 ? 191  SER A CA  1 
ATOM   211  C  C   . SER A 1 39  ? -1.700  -15.715 31.652 1.00 32.81 ? 191  SER A C   1 
ATOM   212  O  O   . SER A 1 39  ? -1.166  -14.606 31.636 1.00 32.60 ? 191  SER A O   1 
ATOM   213  C  CB  . SER A 1 39  ? -2.978  -15.932 33.789 1.00 32.93 ? 191  SER A CB  1 
ATOM   214  O  OG  . SER A 1 39  ? -2.270  -17.074 34.232 1.00 32.89 ? 191  SER A OG  1 
ATOM   215  N  N   . ASP A 1 40  ? -1.122  -16.797 31.146 1.00 32.69 ? 192  ASP A N   1 
ATOM   216  C  CA  . ASP A 1 40  ? 0.191   -16.720 30.535 1.00 32.92 ? 192  ASP A CA  1 
ATOM   217  C  C   . ASP A 1 40  ? 0.155   -16.505 29.018 1.00 32.46 ? 192  ASP A C   1 
ATOM   218  O  O   . ASP A 1 40  ? 1.192   -16.608 28.356 1.00 32.85 ? 192  ASP A O   1 
ATOM   219  C  CB  . ASP A 1 40  ? 1.017   -17.957 30.889 1.00 33.58 ? 192  ASP A CB  1 
ATOM   220  C  CG  . ASP A 1 40  ? 0.488   -19.217 30.240 1.00 35.75 ? 192  ASP A CG  1 
ATOM   221  O  OD1 . ASP A 1 40  ? -0.756  -19.352 30.077 1.00 38.06 ? 192  ASP A OD1 1 
ATOM   222  O  OD2 . ASP A 1 40  ? 1.328   -20.081 29.901 1.00 38.30 ? 192  ASP A OD2 1 
ATOM   223  N  N   . HIS A 1 41  ? -1.024  -16.208 28.467 1.00 31.64 ? 193  HIS A N   1 
ATOM   224  C  CA  . HIS A 1 41  ? -1.134  -15.847 27.053 1.00 30.77 ? 193  HIS A CA  1 
ATOM   225  C  C   . HIS A 1 41  ? -0.259  -14.620 26.798 1.00 30.64 ? 193  HIS A C   1 
ATOM   226  O  O   . HIS A 1 41  ? -0.212  -13.712 27.629 1.00 30.53 ? 193  HIS A O   1 
ATOM   227  C  CB  . HIS A 1 41  ? -2.593  -15.557 26.649 1.00 30.54 ? 193  HIS A CB  1 
ATOM   228  C  CG  . HIS A 1 41  ? -2.782  -15.377 25.172 1.00 28.96 ? 193  HIS A CG  1 
ATOM   229  N  ND1 . HIS A 1 41  ? -3.232  -16.386 24.348 1.00 27.50 ? 193  HIS A ND1 1 
ATOM   230  C  CD2 . HIS A 1 41  ? -2.541  -14.317 24.365 1.00 27.63 ? 193  HIS A CD2 1 
ATOM   231  C  CE1 . HIS A 1 41  ? -3.268  -15.954 23.102 1.00 26.35 ? 193  HIS A CE1 1 
ATOM   232  N  NE2 . HIS A 1 41  ? -2.854  -14.701 23.084 1.00 26.96 ? 193  HIS A NE2 1 
ATOM   233  N  N   . ARG A 1 42  ? 0.424   -14.597 25.654 1.00 30.44 ? 194  ARG A N   1 
ATOM   234  C  CA  . ARG A 1 42  ? 1.363   -13.516 25.321 1.00 30.48 ? 194  ARG A CA  1 
ATOM   235  C  C   . ARG A 1 42  ? 0.759   -12.116 25.478 1.00 30.78 ? 194  ARG A C   1 
ATOM   236  O  O   . ARG A 1 42  ? 1.462   -11.175 25.858 1.00 30.72 ? 194  ARG A O   1 
ATOM   237  C  CB  . ARG A 1 42  ? 1.928   -13.703 23.906 1.00 30.50 ? 194  ARG A CB  1 
ATOM   238  C  CG  . ARG A 1 42  ? 3.171   -12.877 23.582 1.00 29.65 ? 194  ARG A CG  1 
ATOM   239  C  CD  . ARG A 1 42  ? 3.546   -13.026 22.115 1.00 30.06 ? 194  ARG A CD  1 
ATOM   240  N  NE  . ARG A 1 42  ? 2.614   -12.314 21.237 1.00 30.23 ? 194  ARG A NE  1 
ATOM   241  C  CZ  . ARG A 1 42  ? 2.524   -12.478 19.916 1.00 30.05 ? 194  ARG A CZ  1 
ATOM   242  N  NH1 . ARG A 1 42  ? 3.297   -13.351 19.284 1.00 29.57 ? 194  ARG A NH1 1 
ATOM   243  N  NH2 . ARG A 1 42  ? 1.647   -11.765 19.219 1.00 29.23 ? 194  ARG A NH2 1 
ATOM   244  N  N   . GLU A 1 43  ? -0.540  -11.996 25.195 1.00 31.23 ? 195  GLU A N   1 
ATOM   245  C  CA  . GLU A 1 43  ? -1.266  -10.720 25.259 1.00 31.65 ? 195  GLU A CA  1 
ATOM   246  C  C   . GLU A 1 43  ? -1.346  -10.132 26.660 1.00 32.09 ? 195  GLU A C   1 
ATOM   247  O  O   . GLU A 1 43  ? -1.343  -8.911  26.823 1.00 31.92 ? 195  GLU A O   1 
ATOM   248  C  CB  . GLU A 1 43  ? -2.694  -10.880 24.714 1.00 31.58 ? 195  GLU A CB  1 
ATOM   249  C  CG  . GLU A 1 43  ? -2.806  -10.827 23.196 1.00 31.60 ? 195  GLU A CG  1 
ATOM   250  C  CD  . GLU A 1 43  ? -2.613  -9.427  22.626 1.00 30.63 ? 195  GLU A CD  1 
ATOM   251  O  OE1 . GLU A 1 43  ? -1.460  -9.084  22.296 1.00 29.49 ? 195  GLU A OE1 1 
ATOM   252  O  OE2 . GLU A 1 43  ? -3.605  -8.674  22.512 1.00 29.50 ? 195  GLU A OE2 1 
ATOM   253  N  N   . ILE A 1 44  ? -1.426  -11.006 27.661 1.00 32.84 ? 196  ILE A N   1 
ATOM   254  C  CA  . ILE A 1 44  ? -1.748  -10.598 29.032 1.00 33.71 ? 196  ILE A CA  1 
ATOM   255  C  C   . ILE A 1 44  ? -0.768  -11.114 30.092 1.00 34.52 ? 196  ILE A C   1 
ATOM   256  O  O   . ILE A 1 44  ? -0.856  -10.732 31.259 1.00 34.41 ? 196  ILE A O   1 
ATOM   257  C  CB  . ILE A 1 44  ? -3.194  -11.020 29.433 1.00 33.52 ? 196  ILE A CB  1 
ATOM   258  C  CG1 . ILE A 1 44  ? -3.386  -12.538 29.263 1.00 33.24 ? 196  ILE A CG1 1 
ATOM   259  C  CG2 . ILE A 1 44  ? -4.231  -10.186 28.663 1.00 33.44 ? 196  ILE A CG2 1 
ATOM   260  C  CD1 . ILE A 1 44  ? -4.716  -13.093 29.779 1.00 33.24 ? 196  ILE A CD1 1 
ATOM   261  N  N   . GLU A 1 45  ? 0.146   -11.988 29.681 1.00 35.76 ? 197  GLU A N   1 
ATOM   262  C  CA  . GLU A 1 45  ? 1.115   -12.594 30.591 1.00 37.33 ? 197  GLU A CA  1 
ATOM   263  C  C   . GLU A 1 45  ? 1.809   -11.550 31.465 1.00 37.64 ? 197  GLU A C   1 
ATOM   264  O  O   . GLU A 1 45  ? 2.272   -10.521 30.970 1.00 37.40 ? 197  GLU A O   1 
ATOM   265  C  CB  . GLU A 1 45  ? 2.141   -13.409 29.807 1.00 37.18 ? 197  GLU A CB  1 
ATOM   266  C  CG  . GLU A 1 45  ? 2.934   -14.397 30.656 1.00 38.73 ? 197  GLU A CG  1 
ATOM   267  C  CD  . GLU A 1 45  ? 4.013   -15.134 29.865 1.00 38.98 ? 197  GLU A CD  1 
ATOM   268  O  OE1 . GLU A 1 45  ? 4.084   -14.963 28.618 1.00 41.19 ? 197  GLU A OE1 1 
ATOM   269  O  OE2 . GLU A 1 45  ? 4.786   -15.889 30.501 1.00 40.62 ? 197  GLU A OE2 1 
ATOM   270  N  N   . GLY A 1 46  ? 1.841   -11.818 32.768 1.00 38.43 ? 198  GLY A N   1 
ATOM   271  C  CA  . GLY A 1 46  ? 2.447   -10.914 33.745 1.00 39.49 ? 198  GLY A CA  1 
ATOM   272  C  C   . GLY A 1 46  ? 1.657   -9.655  34.057 1.00 40.31 ? 198  GLY A C   1 
ATOM   273  O  O   . GLY A 1 46  ? 2.104   -8.818  34.832 1.00 40.55 ? 198  GLY A O   1 
ATOM   274  N  N   . ARG A 1 47  ? 0.474   -9.519  33.472 1.00 41.24 ? 199  ARG A N   1 
ATOM   275  C  CA  . ARG A 1 47  ? -0.303  -8.290  33.607 1.00 42.15 ? 199  ARG A CA  1 
ATOM   276  C  C   . ARG A 1 47  ? -1.667  -8.536  34.252 1.00 42.32 ? 199  ARG A C   1 
ATOM   277  O  O   . ARG A 1 47  ? -2.236  -7.645  34.886 1.00 41.94 ? 199  ARG A O   1 
ATOM   278  C  CB  . ARG A 1 47  ? -0.456  -7.621  32.238 1.00 42.42 ? 199  ARG A CB  1 
ATOM   279  C  CG  . ARG A 1 47  ? -0.291  -6.118  32.259 1.00 43.76 ? 199  ARG A CG  1 
ATOM   280  C  CD  . ARG A 1 47  ? 1.119   -5.682  32.655 1.00 45.65 ? 199  ARG A CD  1 
ATOM   281  N  NE  . ARG A 1 47  ? 1.086   -4.361  33.284 1.00 47.66 ? 199  ARG A NE  1 
ATOM   282  C  CZ  . ARG A 1 47  ? 0.880   -4.143  34.584 1.00 48.78 ? 199  ARG A CZ  1 
ATOM   283  N  NH1 . ARG A 1 47  ? 0.698   -5.158  35.425 1.00 49.91 ? 199  ARG A NH1 1 
ATOM   284  N  NH2 . ARG A 1 47  ? 0.856   -2.901  35.049 1.00 49.11 ? 199  ARG A NH2 1 
ATOM   285  N  N   . VAL A 1 48  ? -2.182  -9.748  34.078 1.00 42.95 ? 200  VAL A N   1 
ATOM   286  C  CA  . VAL A 1 48  ? -3.412  -10.166 34.726 1.00 43.53 ? 200  VAL A CA  1 
ATOM   287  C  C   . VAL A 1 48  ? -3.092  -11.156 35.843 1.00 44.10 ? 200  VAL A C   1 
ATOM   288  O  O   . VAL A 1 48  ? -2.545  -12.230 35.590 1.00 44.45 ? 200  VAL A O   1 
ATOM   289  C  CB  . VAL A 1 48  ? -4.414  -10.795 33.735 1.00 43.53 ? 200  VAL A CB  1 
ATOM   290  C  CG1 . VAL A 1 48  ? -5.743  -11.059 34.429 1.00 43.51 ? 200  VAL A CG1 1 
ATOM   291  C  CG2 . VAL A 1 48  ? -4.637  -9.878  32.537 1.00 43.84 ? 200  VAL A CG2 1 
ATOM   292  N  N   . MET A 1 49  ? -3.421  -10.769 37.076 1.00 44.38 ? 201  MET A N   1 
ATOM   293  C  CA  . MET A 1 49  ? -3.305  -11.639 38.248 1.00 44.94 ? 201  MET A CA  1 
ATOM   294  C  C   . MET A 1 49  ? -4.576  -12.495 38.411 1.00 44.11 ? 201  MET A C   1 
ATOM   295  O  O   . MET A 1 49  ? -5.692  -11.971 38.442 1.00 44.02 ? 201  MET A O   1 
ATOM   296  C  CB  . MET A 1 49  ? -3.065  -10.798 39.512 1.00 44.89 ? 201  MET A CB  1 
ATOM   297  C  CG  . MET A 1 49  ? -2.966  -11.605 40.809 1.00 45.95 ? 201  MET A CG  1 
ATOM   298  S  SD  . MET A 1 49  ? -4.084  -11.011 42.110 1.00 47.46 ? 201  MET A SD  1 
ATOM   299  C  CE  . MET A 1 49  ? -3.773  -12.198 43.424 1.00 46.49 ? 201  MET A CE  1 
ATOM   300  N  N   . VAL A 1 50  ? -4.394  -13.809 38.495 1.00 43.46 ? 202  VAL A N   1 
ATOM   301  C  CA  . VAL A 1 50  ? -5.481  -14.735 38.790 1.00 42.68 ? 202  VAL A CA  1 
ATOM   302  C  C   . VAL A 1 50  ? -5.635  -14.826 40.306 1.00 42.59 ? 202  VAL A C   1 
ATOM   303  O  O   . VAL A 1 50  ? -4.760  -15.360 40.998 1.00 42.40 ? 202  VAL A O   1 
ATOM   304  C  CB  . VAL A 1 50  ? -5.215  -16.145 38.196 1.00 42.59 ? 202  VAL A CB  1 
ATOM   305  C  CG1 . VAL A 1 50  ? -6.285  -17.140 38.630 1.00 41.59 ? 202  VAL A CG1 1 
ATOM   306  C  CG2 . VAL A 1 50  ? -5.139  -16.083 36.679 1.00 42.47 ? 202  VAL A CG2 1 
ATOM   307  N  N   . THR A 1 51  ? -6.740  -14.285 40.815 1.00 42.31 ? 203  THR A N   1 
ATOM   308  C  CA  . THR A 1 51  ? -7.062  -14.372 42.234 1.00 42.03 ? 203  THR A CA  1 
ATOM   309  C  C   . THR A 1 51  ? -7.478  -15.801 42.570 1.00 42.18 ? 203  THR A C   1 
ATOM   310  O  O   . THR A 1 51  ? -7.738  -16.609 41.672 1.00 42.10 ? 203  THR A O   1 
ATOM   311  C  CB  . THR A 1 51  ? -8.203  -13.400 42.645 1.00 42.09 ? 203  THR A CB  1 
ATOM   312  O  OG1 . THR A 1 51  ? -9.467  -13.907 42.190 1.00 41.81 ? 203  THR A OG1 1 
ATOM   313  C  CG2 . THR A 1 51  ? -7.967  -11.992 42.088 1.00 41.48 ? 203  THR A CG2 1 
ATOM   314  N  N   . ASP A 1 52  ? -7.545  -16.107 43.863 1.00 42.20 ? 204  ASP A N   1 
ATOM   315  C  CA  . ASP A 1 52  ? -7.981  -17.429 44.317 1.00 42.43 ? 204  ASP A CA  1 
ATOM   316  C  C   . ASP A 1 52  ? -9.504  -17.607 44.297 1.00 41.78 ? 204  ASP A C   1 
ATOM   317  O  O   . ASP A 1 52  ? -10.008 -18.699 44.575 1.00 41.83 ? 204  ASP A O   1 
ATOM   318  C  CB  . ASP A 1 52  ? -7.408  -17.762 45.710 1.00 42.97 ? 204  ASP A CB  1 
ATOM   319  C  CG  . ASP A 1 52  ? -7.563  -16.614 46.715 1.00 45.02 ? 204  ASP A CG  1 
ATOM   320  O  OD1 . ASP A 1 52  ? -7.661  -16.898 47.931 1.00 46.87 ? 204  ASP A OD1 1 
ATOM   321  O  OD2 . ASP A 1 52  ? -7.565  -15.429 46.300 1.00 47.73 ? 204  ASP A OD2 1 
ATOM   322  N  N   . PHE A 1 53  ? -10.238 -16.550 43.957 1.00 41.02 ? 205  PHE A N   1 
ATOM   323  C  CA  . PHE A 1 53  ? -11.693 -16.644 43.954 1.00 40.30 ? 205  PHE A CA  1 
ATOM   324  C  C   . PHE A 1 53  ? -12.269 -17.537 42.854 1.00 40.24 ? 205  PHE A C   1 
ATOM   325  O  O   . PHE A 1 53  ? -12.016 -17.335 41.661 1.00 39.99 ? 205  PHE A O   1 
ATOM   326  C  CB  . PHE A 1 53  ? -12.389 -15.282 43.927 1.00 39.87 ? 205  PHE A CB  1 
ATOM   327  C  CG  . PHE A 1 53  ? -13.863 -15.383 44.186 1.00 39.28 ? 205  PHE A CG  1 
ATOM   328  C  CD1 . PHE A 1 53  ? -14.364 -15.230 45.475 1.00 38.58 ? 205  PHE A CD1 1 
ATOM   329  C  CD2 . PHE A 1 53  ? -14.747 -15.708 43.154 1.00 38.21 ? 205  PHE A CD2 1 
ATOM   330  C  CE1 . PHE A 1 53  ? -15.723 -15.363 45.723 1.00 37.75 ? 205  PHE A CE1 1 
ATOM   331  C  CE2 . PHE A 1 53  ? -16.106 -15.846 43.398 1.00 36.76 ? 205  PHE A CE2 1 
ATOM   332  C  CZ  . PHE A 1 53  ? -16.591 -15.673 44.680 1.00 37.74 ? 205  PHE A CZ  1 
ATOM   333  N  N   . GLU A 1 54  ? -13.055 -18.517 43.294 1.00 40.01 ? 206  GLU A N   1 
ATOM   334  C  CA  . GLU A 1 54  ? -13.812 -19.379 42.410 1.00 40.06 ? 206  GLU A CA  1 
ATOM   335  C  C   . GLU A 1 54  ? -15.151 -19.755 43.047 1.00 39.97 ? 206  GLU A C   1 
ATOM   336  O  O   . GLU A 1 54  ? -15.201 -20.367 44.120 1.00 39.98 ? 206  GLU A O   1 
ATOM   337  C  CB  . GLU A 1 54  ? -13.013 -20.632 42.066 1.00 40.06 ? 206  GLU A CB  1 
ATOM   338  C  CG  . GLU A 1 54  ? -13.675 -21.525 41.034 1.00 41.21 ? 206  GLU A CG  1 
ATOM   339  C  CD  . GLU A 1 54  ? -12.884 -22.789 40.771 1.00 43.14 ? 206  GLU A CD  1 
ATOM   340  O  OE1 . GLU A 1 54  ? -12.445 -22.986 39.620 1.00 43.36 ? 206  GLU A OE1 1 
ATOM   341  O  OE2 . GLU A 1 54  ? -12.691 -23.585 41.718 1.00 44.83 ? 206  GLU A OE2 1 
ATOM   342  N  N   . ASN A 1 55  ? -16.233 -19.351 42.388 1.00 39.85 ? 207  ASN A N   1 
ATOM   343  C  CA  . ASN A 1 55  ? -17.567 -19.836 42.723 1.00 39.69 ? 207  ASN A CA  1 
ATOM   344  C  C   . ASN A 1 55  ? -18.351 -20.083 41.440 1.00 39.67 ? 207  ASN A C   1 
ATOM   345  O  O   . ASN A 1 55  ? -18.886 -19.152 40.839 1.00 39.41 ? 207  ASN A O   1 
ATOM   346  C  CB  . ASN A 1 55  ? -18.301 -18.865 43.652 1.00 39.43 ? 207  ASN A CB  1 
ATOM   347  C  CG  . ASN A 1 55  ? -19.466 -19.521 44.378 1.00 39.20 ? 207  ASN A CG  1 
ATOM   348  O  OD1 . ASN A 1 55  ? -20.394 -20.032 43.752 1.00 38.42 ? 207  ASN A OD1 1 
ATOM   349  N  ND2 . ASN A 1 55  ? -19.422 -19.504 45.711 1.00 38.59 ? 207  ASN A ND2 1 
ATOM   350  N  N   . VAL A 1 56  ? -18.376 -21.343 41.011 1.00 39.88 ? 208  VAL A N   1 
ATOM   351  C  CA  . VAL A 1 56  ? -19.054 -21.733 39.774 1.00 40.32 ? 208  VAL A CA  1 
ATOM   352  C  C   . VAL A 1 56  ? -19.969 -22.946 39.986 1.00 40.78 ? 208  VAL A C   1 
ATOM   353  O  O   . VAL A 1 56  ? -19.681 -23.797 40.829 1.00 40.50 ? 208  VAL A O   1 
ATOM   354  C  CB  . VAL A 1 56  ? -18.050 -22.006 38.594 1.00 40.13 ? 208  VAL A CB  1 
ATOM   355  C  CG1 . VAL A 1 56  ? -17.173 -20.790 38.330 1.00 39.74 ? 208  VAL A CG1 1 
ATOM   356  C  CG2 . VAL A 1 56  ? -17.200 -23.256 38.847 1.00 39.69 ? 208  VAL A CG2 1 
ATOM   357  N  N   . PRO A 1 57  ? -21.084 -23.019 39.235 1.00 41.54 ? 209  PRO A N   1 
ATOM   358  C  CA  . PRO A 1 57  ? -21.911 -24.226 39.249 1.00 42.39 ? 209  PRO A CA  1 
ATOM   359  C  C   . PRO A 1 57  ? -21.280 -25.406 38.494 1.00 43.39 ? 209  PRO A C   1 
ATOM   360  O  O   . PRO A 1 57  ? -20.384 -25.213 37.679 1.00 43.13 ? 209  PRO A O   1 
ATOM   361  C  CB  . PRO A 1 57  ? -23.204 -23.775 38.555 1.00 42.14 ? 209  PRO A CB  1 
ATOM   362  C  CG  . PRO A 1 57  ? -22.802 -22.654 37.687 1.00 41.53 ? 209  PRO A CG  1 
ATOM   363  C  CD  . PRO A 1 57  ? -21.654 -21.970 38.368 1.00 41.48 ? 209  PRO A CD  1 
ATOM   364  N  N   . GLU A 1 58  ? -21.768 -26.611 38.782 1.00 45.11 ? 210  GLU A N   1 
ATOM   365  C  CA  . GLU A 1 58  ? -21.379 -27.838 38.083 1.00 47.09 ? 210  GLU A CA  1 
ATOM   366  C  C   . GLU A 1 58  ? -21.749 -27.776 36.601 1.00 47.45 ? 210  GLU A C   1 
ATOM   367  O  O   . GLU A 1 58  ? -22.858 -27.370 36.253 1.00 47.63 ? 210  GLU A O   1 
ATOM   368  C  CB  . GLU A 1 58  ? -22.046 -29.065 38.739 1.00 47.03 ? 210  GLU A CB  1 
ATOM   369  C  CG  . GLU A 1 58  ? -23.556 -28.878 39.078 1.00 48.93 ? 210  GLU A CG  1 
ATOM   370  C  CD  . GLU A 1 58  ? -24.365 -30.193 39.134 1.00 48.96 ? 210  GLU A CD  1 
ATOM   371  O  OE1 . GLU A 1 58  ? -24.214 -31.047 38.223 1.00 51.22 ? 210  GLU A OE1 1 
ATOM   372  O  OE2 . GLU A 1 58  ? -25.176 -30.359 40.080 1.00 50.55 ? 210  GLU A OE2 1 
ATOM   373  N  N   . GLU A 1 59  ? -20.814 -28.166 35.735 1.00 48.37 ? 211  GLU A N   1 
ATOM   374  C  CA  . GLU A 1 59  ? -21.082 -28.278 34.303 1.00 49.45 ? 211  GLU A CA  1 
ATOM   375  C  C   . GLU A 1 59  ? -22.185 -29.307 34.070 1.00 50.16 ? 211  GLU A C   1 
ATOM   376  O  O   . GLU A 1 59  ? -22.161 -30.381 34.675 1.00 50.42 ? 211  GLU A O   1 
ATOM   377  C  CB  . GLU A 1 59  ? -19.814 -28.690 33.542 1.00 49.51 ? 211  GLU A CB  1 
ATOM   378  C  CG  . GLU A 1 59  ? -18.843 -27.541 33.227 1.00 50.10 ? 211  GLU A CG  1 
ATOM   379  C  CD  . GLU A 1 59  ? -17.913 -27.179 34.383 1.00 51.31 ? 211  GLU A CD  1 
ATOM   380  O  OE1 . GLU A 1 59  ? -17.878 -27.905 35.402 1.00 53.13 ? 211  GLU A OE1 1 
ATOM   381  O  OE2 . GLU A 1 59  ? -17.196 -26.163 34.272 1.00 51.43 ? 211  GLU A OE2 1 
ATOM   382  N  N   . ASP A 1 60  ? -23.160 -28.973 33.223 1.00 50.95 ? 212  ASP A N   1 
ATOM   383  C  CA  . ASP A 1 60  ? -24.247 -29.908 32.904 1.00 51.57 ? 212  ASP A CA  1 
ATOM   384  C  C   . ASP A 1 60  ? -24.215 -30.380 31.451 1.00 51.72 ? 212  ASP A C   1 
ATOM   385  O  O   . ASP A 1 60  ? -23.747 -31.485 31.163 1.00 51.92 ? 212  ASP A O   1 
ATOM   386  C  CB  . ASP A 1 60  ? -25.634 -29.347 33.288 1.00 51.90 ? 212  ASP A CB  1 
ATOM   387  C  CG  . ASP A 1 60  ? -25.911 -27.956 32.707 1.00 52.99 ? 212  ASP A CG  1 
ATOM   388  O  OD1 . ASP A 1 60  ? -25.742 -27.749 31.483 1.00 53.46 ? 212  ASP A OD1 1 
ATOM   389  O  OD2 . ASP A 1 60  ? -26.329 -27.070 33.487 1.00 53.72 ? 212  ASP A OD2 1 
ATOM   390  N  N   . SER A 1 69  ? -8.724  -24.957 27.944 1.00 42.83 ? 221  SER A N   1 
ATOM   391  C  CA  . SER A 1 69  ? -8.580  -24.437 26.582 1.00 42.95 ? 221  SER A CA  1 
ATOM   392  C  C   . SER A 1 69  ? -9.894  -23.845 26.076 1.00 42.89 ? 221  SER A C   1 
ATOM   393  O  O   . SER A 1 69  ? -9.923  -22.732 25.547 1.00 42.94 ? 221  SER A O   1 
ATOM   394  C  CB  . SER A 1 69  ? -8.081  -25.523 25.623 1.00 43.08 ? 221  SER A CB  1 
ATOM   395  O  OG  . SER A 1 69  ? -8.192  -25.104 24.271 1.00 43.12 ? 221  SER A OG  1 
ATOM   396  N  N   . LYS A 1 70  ? -10.972 -24.606 26.231 1.00 42.68 ? 222  LYS A N   1 
ATOM   397  C  CA  . LYS A 1 70  ? -12.306 -24.114 25.948 1.00 42.22 ? 222  LYS A CA  1 
ATOM   398  C  C   . LYS A 1 70  ? -12.941 -23.434 27.172 1.00 41.43 ? 222  LYS A C   1 
ATOM   399  O  O   . LYS A 1 70  ? -13.725 -22.495 27.011 1.00 41.58 ? 222  LYS A O   1 
ATOM   400  C  CB  . LYS A 1 70  ? -13.190 -25.242 25.405 1.00 42.67 ? 222  LYS A CB  1 
ATOM   401  C  CG  . LYS A 1 70  ? -14.553 -24.774 24.871 1.00 44.74 ? 222  LYS A CG  1 
ATOM   402  C  CD  . LYS A 1 70  ? -14.413 -23.609 23.868 1.00 46.90 ? 222  LYS A CD  1 
ATOM   403  C  CE  . LYS A 1 70  ? -15.744 -22.904 23.649 1.00 48.01 ? 222  LYS A CE  1 
ATOM   404  N  NZ  . LYS A 1 70  ? -16.708 -23.774 22.911 1.00 49.26 ? 222  LYS A NZ  1 
ATOM   405  N  N   . CYS A 1 71  ? -12.595 -23.888 28.384 1.00 40.37 ? 223  CYS A N   1 
ATOM   406  C  CA  . CYS A 1 71  ? -13.068 -23.247 29.628 1.00 39.36 ? 223  CYS A CA  1 
ATOM   407  C  C   . CYS A 1 71  ? -12.668 -21.785 29.715 1.00 38.55 ? 223  CYS A C   1 
ATOM   408  O  O   . CYS A 1 71  ? -13.418 -20.963 30.240 1.00 38.20 ? 223  CYS A O   1 
ATOM   409  C  CB  . CYS A 1 71  ? -12.550 -23.958 30.884 1.00 39.36 ? 223  CYS A CB  1 
ATOM   410  S  SG  . CYS A 1 71  ? -12.930 -25.707 30.980 1.00 40.53 ? 223  CYS A SG  1 
ATOM   411  N  N   . ASP A 1 72  ? -11.487 -21.464 29.197 1.00 37.57 ? 224  ASP A N   1 
ATOM   412  C  CA  . ASP A 1 72  ? -10.958 -20.113 29.313 1.00 37.05 ? 224  ASP A CA  1 
ATOM   413  C  C   . ASP A 1 72  ? -11.120 -19.207 28.104 1.00 36.02 ? 224  ASP A C   1 
ATOM   414  O  O   . ASP A 1 72  ? -10.673 -18.064 28.159 1.00 35.58 ? 224  ASP A O   1 
ATOM   415  C  CB  . ASP A 1 72  ? -9.489  -20.119 29.754 1.00 37.99 ? 224  ASP A CB  1 
ATOM   416  C  CG  . ASP A 1 72  ? -8.920  -21.503 29.888 1.00 40.06 ? 224  ASP A CG  1 
ATOM   417  O  OD1 . ASP A 1 72  ? -9.045  -22.298 28.926 1.00 43.75 ? 224  ASP A OD1 1 
ATOM   418  O  OD2 . ASP A 1 72  ? -8.348  -21.786 30.960 1.00 41.62 ? 224  ASP A OD2 1 
ATOM   419  N  N   . SER A 1 73  ? -11.767 -19.686 27.037 1.00 34.82 ? 225  SER A N   1 
ATOM   420  C  CA  . SER A 1 73  ? -11.890 -18.878 25.817 1.00 34.12 ? 225  SER A CA  1 
ATOM   421  C  C   . SER A 1 73  ? -12.543 -17.522 26.053 1.00 33.23 ? 225  SER A C   1 
ATOM   422  O  O   . SER A 1 73  ? -11.991 -16.499 25.661 1.00 32.89 ? 225  SER A O   1 
ATOM   423  C  CB  . SER A 1 73  ? -12.564 -19.633 24.658 1.00 33.90 ? 225  SER A CB  1 
ATOM   424  O  OG  . SER A 1 73  ? -13.730 -20.300 25.073 1.00 35.15 ? 225  SER A OG  1 
ATOM   425  N  N   . HIS A 1 74  ? -13.690 -17.519 26.726 1.00 32.74 ? 226  HIS A N   1 
ATOM   426  C  CA  . HIS A 1 74  ? -14.446 -16.292 26.955 1.00 31.99 ? 226  HIS A CA  1 
ATOM   427  C  C   . HIS A 1 74  ? -13.639 -15.249 27.747 1.00 31.59 ? 226  HIS A C   1 
ATOM   428  O  O   . HIS A 1 74  ? -13.456 -14.118 27.291 1.00 31.49 ? 226  HIS A O   1 
ATOM   429  C  CB  . HIS A 1 74  ? -15.774 -16.612 27.644 1.00 31.97 ? 226  HIS A CB  1 
ATOM   430  C  CG  . HIS A 1 74  ? -16.737 -15.469 27.652 1.00 32.55 ? 226  HIS A CG  1 
ATOM   431  N  ND1 . HIS A 1 74  ? -16.913 -14.651 28.748 1.00 32.21 ? 226  HIS A ND1 1 
ATOM   432  C  CD2 . HIS A 1 74  ? -17.563 -14.994 26.688 1.00 32.64 ? 226  HIS A CD2 1 
ATOM   433  C  CE1 . HIS A 1 74  ? -17.812 -13.725 28.460 1.00 33.42 ? 226  HIS A CE1 1 
ATOM   434  N  NE2 . HIS A 1 74  ? -18.221 -13.911 27.218 1.00 33.41 ? 226  HIS A NE2 1 
ATOM   435  N  N   . GLY A 1 75  ? -13.143 -15.643 28.916 1.00 31.09 ? 227  GLY A N   1 
ATOM   436  C  CA  . GLY A 1 75  ? -12.386 -14.749 29.787 1.00 30.47 ? 227  GLY A CA  1 
ATOM   437  C  C   . GLY A 1 75  ? -11.037 -14.320 29.248 1.00 30.17 ? 227  GLY A C   1 
ATOM   438  O  O   . GLY A 1 75  ? -10.637 -13.175 29.444 1.00 30.10 ? 227  GLY A O   1 
ATOM   439  N  N   . THR A 1 76  ? -10.331 -15.233 28.582 1.00 30.06 ? 228  THR A N   1 
ATOM   440  C  CA  . THR A 1 76  ? -9.027  -14.921 27.972 1.00 30.03 ? 228  THR A CA  1 
ATOM   441  C  C   . THR A 1 76  ? -9.154  -13.843 26.881 1.00 29.75 ? 228  THR A C   1 
ATOM   442  O  O   . THR A 1 76  ? -8.319  -12.928 26.800 1.00 29.57 ? 228  THR A O   1 
ATOM   443  C  CB  . THR A 1 76  ? -8.315  -16.195 27.419 1.00 30.18 ? 228  THR A CB  1 
ATOM   444  O  OG1 . THR A 1 76  ? -8.103  -17.131 28.487 1.00 31.12 ? 228  THR A OG1 1 
ATOM   445  C  CG2 . THR A 1 76  ? -6.959  -15.862 26.782 1.00 29.31 ? 228  THR A CG2 1 
ATOM   446  N  N   . HIS A 1 77  ? -10.202 -13.953 26.062 1.00 29.23 ? 229  HIS A N   1 
ATOM   447  C  CA  . HIS A 1 77  ? -10.455 -13.002 24.974 1.00 28.67 ? 229  HIS A CA  1 
ATOM   448  C  C   . HIS A 1 77  ? -10.763 -11.607 25.513 1.00 28.74 ? 229  HIS A C   1 
ATOM   449  O  O   . HIS A 1 77  ? -10.244 -10.605 25.010 1.00 28.79 ? 229  HIS A O   1 
ATOM   450  C  CB  . HIS A 1 77  ? -11.591 -13.491 24.068 1.00 28.33 ? 229  HIS A CB  1 
ATOM   451  C  CG  . HIS A 1 77  ? -11.750 -12.686 22.814 1.00 27.27 ? 229  HIS A CG  1 
ATOM   452  N  ND1 . HIS A 1 77  ? -12.598 -11.602 22.727 1.00 26.96 ? 229  HIS A ND1 1 
ATOM   453  C  CD2 . HIS A 1 77  ? -11.164 -12.802 21.600 1.00 25.16 ? 229  HIS A CD2 1 
ATOM   454  C  CE1 . HIS A 1 77  ? -12.524 -11.086 21.512 1.00 25.94 ? 229  HIS A CE1 1 
ATOM   455  N  NE2 . HIS A 1 77  ? -11.663 -11.796 20.809 1.00 24.40 ? 229  HIS A NE2 1 
ATOM   456  N  N   . LEU A 1 78  ? -11.599 -11.558 26.545 1.00 28.77 ? 230  LEU A N   1 
ATOM   457  C  CA  . LEU A 1 78  ? -12.006 -10.307 27.174 1.00 28.86 ? 230  LEU A CA  1 
ATOM   458  C  C   . LEU A 1 78  ? -10.868 -9.619  27.912 1.00 28.90 ? 230  LEU A C   1 
ATOM   459  O  O   . LEU A 1 78  ? -10.759 -8.393  27.868 1.00 29.38 ? 230  LEU A O   1 
ATOM   460  C  CB  . LEU A 1 78  ? -13.193 -10.540 28.108 1.00 28.77 ? 230  LEU A CB  1 
ATOM   461  C  CG  . LEU A 1 78  ? -14.487 -10.976 27.403 1.00 28.70 ? 230  LEU A CG  1 
ATOM   462  C  CD1 . LEU A 1 78  ? -15.561 -11.197 28.415 1.00 26.55 ? 230  LEU A CD1 1 
ATOM   463  C  CD2 . LEU A 1 78  ? -14.945 -9.964  26.359 1.00 27.00 ? 230  LEU A CD2 1 
ATOM   464  N  N   . ALA A 1 79  ? -10.024 -10.404 28.583 1.00 28.90 ? 231  ALA A N   1 
ATOM   465  C  CA  . ALA A 1 79  ? -8.805  -9.876  29.198 1.00 29.06 ? 231  ALA A CA  1 
ATOM   466  C  C   . ALA A 1 79  ? -7.946  -9.205  28.127 1.00 29.09 ? 231  ALA A C   1 
ATOM   467  O  O   . ALA A 1 79  ? -7.399  -8.118  28.346 1.00 29.32 ? 231  ALA A O   1 
ATOM   468  C  CB  . ALA A 1 79  ? -8.026  -10.980 29.914 1.00 28.81 ? 231  ALA A CB  1 
ATOM   469  N  N   . GLY A 1 80  ? -7.861  -9.855  26.966 1.00 28.99 ? 232  GLY A N   1 
ATOM   470  C  CA  . GLY A 1 80  ? -7.142  -9.337  25.814 1.00 29.16 ? 232  GLY A CA  1 
ATOM   471  C  C   . GLY A 1 80  ? -7.718  -8.045  25.273 1.00 29.60 ? 232  GLY A C   1 
ATOM   472  O  O   . GLY A 1 80  ? -6.971  -7.114  24.973 1.00 29.96 ? 232  GLY A O   1 
ATOM   473  N  N   . VAL A 1 81  ? -9.046  -7.987  25.141 1.00 29.71 ? 233  VAL A N   1 
ATOM   474  C  CA  . VAL A 1 81  ? -9.727  -6.790  24.644 1.00 29.47 ? 233  VAL A CA  1 
ATOM   475  C  C   . VAL A 1 81  ? -9.421  -5.584  25.527 1.00 29.71 ? 233  VAL A C   1 
ATOM   476  O  O   . VAL A 1 81  ? -9.162  -4.487  25.025 1.00 29.82 ? 233  VAL A O   1 
ATOM   477  C  CB  . VAL A 1 81  ? -11.274 -6.983  24.517 1.00 29.59 ? 233  VAL A CB  1 
ATOM   478  C  CG1 . VAL A 1 81  ? -11.956 -5.671  24.110 1.00 28.93 ? 233  VAL A CG1 1 
ATOM   479  C  CG2 . VAL A 1 81  ? -11.622 -8.092  23.516 1.00 28.49 ? 233  VAL A CG2 1 
ATOM   480  N  N   . VAL A 1 82  ? -9.460  -5.792  26.840 1.00 29.99 ? 234  VAL A N   1 
ATOM   481  C  CA  . VAL A 1 82  ? -9.181  -4.722  27.794 1.00 30.08 ? 234  VAL A CA  1 
ATOM   482  C  C   . VAL A 1 82  ? -7.704  -4.299  27.770 1.00 30.19 ? 234  VAL A C   1 
ATOM   483  O  O   . VAL A 1 82  ? -7.402  -3.113  27.650 1.00 30.03 ? 234  VAL A O   1 
ATOM   484  C  CB  . VAL A 1 82  ? -9.609  -5.111  29.240 1.00 29.99 ? 234  VAL A CB  1 
ATOM   485  C  CG1 . VAL A 1 82  ? -9.184  -4.034  30.253 1.00 30.52 ? 234  VAL A CG1 1 
ATOM   486  C  CG2 . VAL A 1 82  ? -11.101 -5.347  29.312 1.00 29.13 ? 234  VAL A CG2 1 
ATOM   487  N  N   . SER A 1 83  ? -6.793  -5.265  27.863 1.00 30.55 ? 235  SER A N   1 
ATOM   488  C  CA  . SER A 1 83  ? -5.391  -4.953  28.170 1.00 31.20 ? 235  SER A CA  1 
ATOM   489  C  C   . SER A 1 83  ? -4.320  -5.631  27.312 1.00 31.20 ? 235  SER A C   1 
ATOM   490  O  O   . SER A 1 83  ? -3.135  -5.458  27.579 1.00 31.61 ? 235  SER A O   1 
ATOM   491  C  CB  . SER A 1 83  ? -5.118  -5.277  29.636 1.00 31.40 ? 235  SER A CB  1 
ATOM   492  O  OG  . SER A 1 83  ? -5.419  -6.641  29.892 1.00 32.67 ? 235  SER A OG  1 
ATOM   493  N  N   . GLY A 1 84  ? -4.726  -6.401  26.304 1.00 31.35 ? 236  GLY A N   1 
ATOM   494  C  CA  . GLY A 1 84  ? -3.790  -7.100  25.425 1.00 31.77 ? 236  GLY A CA  1 
ATOM   495  C  C   . GLY A 1 84  ? -2.763  -6.169  24.799 1.00 32.17 ? 236  GLY A C   1 
ATOM   496  O  O   . GLY A 1 84  ? -3.103  -5.072  24.339 1.00 32.20 ? 236  GLY A O   1 
ATOM   497  N  N   . ARG A 1 85  ? -1.506  -6.597  24.779 1.00 32.28 ? 237  ARG A N   1 
ATOM   498  C  CA  . ARG A 1 85  ? -0.441  -5.733  24.287 1.00 32.88 ? 237  ARG A CA  1 
ATOM   499  C  C   . ARG A 1 85  ? -0.549  -5.376  22.804 1.00 32.74 ? 237  ARG A C   1 
ATOM   500  O  O   . ARG A 1 85  ? -0.242  -4.251  22.414 1.00 32.87 ? 237  ARG A O   1 
ATOM   501  C  CB  . ARG A 1 85  ? 0.949   -6.276  24.641 1.00 33.34 ? 237  ARG A CB  1 
ATOM   502  C  CG  . ARG A 1 85  ? 1.161   -7.756  24.410 1.00 35.17 ? 237  ARG A CG  1 
ATOM   503  C  CD  . ARG A 1 85  ? 2.649   -8.078  24.460 1.00 39.33 ? 237  ARG A CD  1 
ATOM   504  N  NE  . ARG A 1 85  ? 3.355   -7.441  23.345 1.00 42.14 ? 237  ARG A NE  1 
ATOM   505  C  CZ  . ARG A 1 85  ? 3.745   -8.061  22.232 1.00 43.61 ? 237  ARG A CZ  1 
ATOM   506  N  NH1 . ARG A 1 85  ? 3.533   -9.361  22.064 1.00 44.37 ? 237  ARG A NH1 1 
ATOM   507  N  NH2 . ARG A 1 85  ? 4.370   -7.375  21.285 1.00 45.05 ? 237  ARG A NH2 1 
ATOM   508  N  N   . ASP A 1 86  ? -0.991  -6.321  21.981 1.00 32.70 ? 238  ASP A N   1 
ATOM   509  C  CA  . ASP A 1 86  ? -1.176  -6.048  20.552 1.00 32.60 ? 238  ASP A CA  1 
ATOM   510  C  C   . ASP A 1 86  ? -2.582  -5.561  20.201 1.00 32.36 ? 238  ASP A C   1 
ATOM   511  O  O   . ASP A 1 86  ? -2.730  -4.662  19.384 1.00 32.29 ? 238  ASP A O   1 
ATOM   512  C  CB  . ASP A 1 86  ? -0.812  -7.265  19.692 1.00 32.59 ? 238  ASP A CB  1 
ATOM   513  C  CG  . ASP A 1 86  ? 0.657   -7.638  19.789 1.00 32.96 ? 238  ASP A CG  1 
ATOM   514  O  OD1 . ASP A 1 86  ? 1.457   -6.869  20.369 1.00 32.70 ? 238  ASP A OD1 1 
ATOM   515  O  OD2 . ASP A 1 86  ? 1.012   -8.717  19.276 1.00 34.32 ? 238  ASP A OD2 1 
ATOM   516  N  N   . ALA A 1 87  ? -3.598  -6.145  20.833 1.00 32.38 ? 239  ALA A N   1 
ATOM   517  C  CA  . ALA A 1 87  ? -4.990  -5.964  20.415 1.00 32.29 ? 239  ALA A CA  1 
ATOM   518  C  C   . ALA A 1 87  ? -5.899  -5.347  21.472 1.00 32.42 ? 239  ALA A C   1 
ATOM   519  O  O   . ALA A 1 87  ? -7.123  -5.297  21.287 1.00 32.52 ? 239  ALA A O   1 
ATOM   520  C  CB  . ALA A 1 87  ? -5.566  -7.304  19.954 1.00 32.26 ? 239  ALA A CB  1 
ATOM   521  N  N   . GLY A 1 88  ? -5.315  -4.886  22.575 1.00 32.52 ? 240  GLY A N   1 
ATOM   522  C  CA  . GLY A 1 88  ? -6.099  -4.347  23.689 1.00 32.72 ? 240  GLY A CA  1 
ATOM   523  C  C   . GLY A 1 88  ? -6.418  -2.871  23.559 1.00 33.01 ? 240  GLY A C   1 
ATOM   524  O  O   . GLY A 1 88  ? -5.762  -2.145  22.811 1.00 32.89 ? 240  GLY A O   1 
ATOM   525  N  N   . VAL A 1 89  ? -7.435  -2.430  24.291 1.00 33.39 ? 241  VAL A N   1 
ATOM   526  C  CA  . VAL A 1 89  ? -7.812  -1.020  24.335 1.00 33.71 ? 241  VAL A CA  1 
ATOM   527  C  C   . VAL A 1 89  ? -6.849  -0.270  25.256 1.00 34.37 ? 241  VAL A C   1 
ATOM   528  O  O   . VAL A 1 89  ? -6.305  0.764   24.871 1.00 34.43 ? 241  VAL A O   1 
ATOM   529  C  CB  . VAL A 1 89  ? -9.289  -0.825  24.795 1.00 33.77 ? 241  VAL A CB  1 
ATOM   530  C  CG1 . VAL A 1 89  ? -9.609  0.653   25.023 1.00 33.07 ? 241  VAL A CG1 1 
ATOM   531  C  CG2 . VAL A 1 89  ? -10.267 -1.442  23.783 1.00 32.90 ? 241  VAL A CG2 1 
ATOM   532  N  N   . ALA A 1 90  ? -6.643  -0.809  26.459 1.00 35.00 ? 242  ALA A N   1 
ATOM   533  C  CA  . ALA A 1 90  ? -5.711  -0.251  27.441 1.00 36.05 ? 242  ALA A CA  1 
ATOM   534  C  C   . ALA A 1 90  ? -4.493  -1.169  27.609 1.00 36.61 ? 242  ALA A C   1 
ATOM   535  O  O   . ALA A 1 90  ? -4.336  -1.835  28.633 1.00 36.71 ? 242  ALA A O   1 
ATOM   536  C  CB  . ALA A 1 90  ? -6.423  -0.028  28.779 1.00 35.92 ? 242  ALA A CB  1 
ATOM   537  N  N   . LYS A 1 91  ? -3.636  -1.179  26.589 1.00 37.44 ? 243  LYS A N   1 
ATOM   538  C  CA  . LYS A 1 91  ? -2.494  -2.100  26.476 1.00 38.29 ? 243  LYS A CA  1 
ATOM   539  C  C   . LYS A 1 91  ? -1.657  -2.289  27.757 1.00 38.94 ? 243  LYS A C   1 
ATOM   540  O  O   . LYS A 1 91  ? -1.249  -3.412  28.088 1.00 39.26 ? 243  LYS A O   1 
ATOM   541  C  CB  . LYS A 1 91  ? -1.613  -1.692  25.294 1.00 38.31 ? 243  LYS A CB  1 
ATOM   542  C  CG  . LYS A 1 91  ? -2.314  -1.841  23.950 1.00 38.54 ? 243  LYS A CG  1 
ATOM   543  C  CD  . LYS A 1 91  ? -1.518  -1.224  22.813 1.00 39.00 ? 243  LYS A CD  1 
ATOM   544  C  CE  . LYS A 1 91  ? -2.019  -1.703  21.445 1.00 40.12 ? 243  LYS A CE  1 
ATOM   545  N  NZ  . LYS A 1 91  ? -3.503  -1.571  21.267 1.00 39.27 ? 243  LYS A NZ  1 
ATOM   546  N  N   . GLY A 1 92  ? -1.414  -1.205  28.484 1.00 39.10 ? 244  GLY A N   1 
ATOM   547  C  CA  . GLY A 1 92  ? -0.842  -1.327  29.821 1.00 39.60 ? 244  GLY A CA  1 
ATOM   548  C  C   . GLY A 1 92  ? -1.661  -2.181  30.791 1.00 39.59 ? 244  GLY A C   1 
ATOM   549  O  O   . GLY A 1 92  ? -1.184  -3.209  31.277 1.00 39.48 ? 244  GLY A O   1 
ATOM   550  N  N   . ALA A 1 93  ? -2.911  -1.764  31.007 1.00 39.61 ? 245  ALA A N   1 
ATOM   551  C  CA  . ALA A 1 93  ? -3.750  -2.114  32.173 1.00 39.22 ? 245  ALA A CA  1 
ATOM   552  C  C   . ALA A 1 93  ? -3.429  -3.362  32.990 1.00 39.18 ? 245  ALA A C   1 
ATOM   553  O  O   . ALA A 1 93  ? -3.327  -4.470  32.457 1.00 39.45 ? 245  ALA A O   1 
ATOM   554  C  CB  . ALA A 1 93  ? -5.231  -2.098  31.792 1.00 39.07 ? 245  ALA A CB  1 
ATOM   555  N  N   . SER A 1 94  ? -3.299  -3.166  34.299 1.00 38.90 ? 246  SER A N   1 
ATOM   556  C  CA  . SER A 1 94  ? -3.230  -4.273  35.247 1.00 38.67 ? 246  SER A CA  1 
ATOM   557  C  C   . SER A 1 94  ? -4.640  -4.811  35.493 1.00 38.30 ? 246  SER A C   1 
ATOM   558  O  O   . SER A 1 94  ? -5.591  -4.039  35.641 1.00 38.47 ? 246  SER A O   1 
ATOM   559  C  CB  . SER A 1 94  ? -2.596  -3.809  36.559 1.00 38.66 ? 246  SER A CB  1 
ATOM   560  O  OG  . SER A 1 94  ? -2.661  -4.818  37.555 1.00 39.61 ? 246  SER A OG  1 
ATOM   561  N  N   . MET A 1 95  ? -4.771  -6.133  35.530 1.00 37.70 ? 247  MET A N   1 
ATOM   562  C  CA  . MET A 1 95  ? -6.065  -6.776  35.739 1.00 37.42 ? 247  MET A CA  1 
ATOM   563  C  C   . MET A 1 95  ? -6.030  -7.852  36.822 1.00 36.71 ? 247  MET A C   1 
ATOM   564  O  O   . MET A 1 95  ? -5.008  -8.504  37.035 1.00 36.33 ? 247  MET A O   1 
ATOM   565  C  CB  . MET A 1 95  ? -6.584  -7.394  34.434 1.00 37.19 ? 247  MET A CB  1 
ATOM   566  C  CG  . MET A 1 95  ? -6.936  -6.406  33.332 1.00 37.36 ? 247  MET A CG  1 
ATOM   567  S  SD  . MET A 1 95  ? -7.650  -7.241  31.889 1.00 38.90 ? 247  MET A SD  1 
ATOM   568  C  CE  . MET A 1 95  ? -9.332  -7.545  32.459 1.00 37.77 ? 247  MET A CE  1 
ATOM   569  N  N   . ARG A 1 96  ? -7.162  -8.029  37.498 1.00 36.42 ? 248  ARG A N   1 
ATOM   570  C  CA  . ARG A 1 96  ? -7.355  -9.133  38.436 1.00 36.23 ? 248  ARG A CA  1 
ATOM   571  C  C   . ARG A 1 96  ? -8.596  -9.913  38.036 1.00 35.64 ? 248  ARG A C   1 
ATOM   572  O  O   . ARG A 1 96  ? -9.658  -9.325  37.844 1.00 35.62 ? 248  ARG A O   1 
ATOM   573  C  CB  . ARG A 1 96  ? -7.522  -8.618  39.866 1.00 36.54 ? 248  ARG A CB  1 
ATOM   574  C  CG  . ARG A 1 96  ? -6.307  -7.920  40.461 1.00 37.95 ? 248  ARG A CG  1 
ATOM   575  C  CD  . ARG A 1 96  ? -6.349  -8.068  41.972 1.00 41.29 ? 248  ARG A CD  1 
ATOM   576  N  NE  . ARG A 1 96  ? -5.709  -6.960  42.668 1.00 44.77 ? 248  ARG A NE  1 
ATOM   577  C  CZ  . ARG A 1 96  ? -4.416  -6.906  42.981 1.00 47.04 ? 248  ARG A CZ  1 
ATOM   578  N  NH1 . ARG A 1 96  ? -3.937  -5.842  43.619 1.00 47.46 ? 248  ARG A NH1 1 
ATOM   579  N  NH2 . ARG A 1 96  ? -3.596  -7.903  42.652 1.00 47.63 ? 248  ARG A NH2 1 
ATOM   580  N  N   . SER A 1 97  ? -8.473  -11.233 37.912 1.00 34.94 ? 249  SER A N   1 
ATOM   581  C  CA  . SER A 1 97  ? -9.598  -12.051 37.464 1.00 34.26 ? 249  SER A CA  1 
ATOM   582  C  C   . SER A 1 97  ? -10.179 -12.950 38.554 1.00 33.92 ? 249  SER A C   1 
ATOM   583  O  O   . SER A 1 97  ? -9.443  -13.570 39.326 1.00 33.56 ? 249  SER A O   1 
ATOM   584  C  CB  . SER A 1 97  ? -9.209  -12.891 36.248 1.00 34.26 ? 249  SER A CB  1 
ATOM   585  O  OG  . SER A 1 97  ? -8.501  -14.045 36.648 1.00 34.56 ? 249  SER A OG  1 
ATOM   586  N  N   . LEU A 1 98  ? -11.512 -13.001 38.593 1.00 33.59 ? 250  LEU A N   1 
ATOM   587  C  CA  . LEU A 1 98  ? -12.265 -13.886 39.481 1.00 33.00 ? 250  LEU A CA  1 
ATOM   588  C  C   . LEU A 1 98  ? -13.043 -14.855 38.616 1.00 32.52 ? 250  LEU A C   1 
ATOM   589  O  O   . LEU A 1 98  ? -13.532 -14.470 37.559 1.00 32.89 ? 250  LEU A O   1 
ATOM   590  C  CB  . LEU A 1 98  ? -13.253 -13.092 40.336 1.00 32.95 ? 250  LEU A CB  1 
ATOM   591  C  CG  . LEU A 1 98  ? -12.732 -12.214 41.471 1.00 33.18 ? 250  LEU A CG  1 
ATOM   592  C  CD1 . LEU A 1 98  ? -12.051 -10.942 40.951 1.00 32.71 ? 250  LEU A CD1 1 
ATOM   593  C  CD2 . LEU A 1 98  ? -13.890 -11.872 42.395 1.00 33.10 ? 250  LEU A CD2 1 
ATOM   594  N  N   . ARG A 1 99  ? -13.165 -16.103 39.052 1.00 31.74 ? 251  ARG A N   1 
ATOM   595  C  CA  . ARG A 1 99  ? -13.940 -17.065 38.287 1.00 31.02 ? 251  ARG A CA  1 
ATOM   596  C  C   . ARG A 1 99  ? -15.357 -17.211 38.839 1.00 30.84 ? 251  ARG A C   1 
ATOM   597  O  O   . ARG A 1 99  ? -15.549 -17.674 39.968 1.00 30.92 ? 251  ARG A O   1 
ATOM   598  C  CB  . ARG A 1 99  ? -13.237 -18.415 38.216 1.00 30.91 ? 251  ARG A CB  1 
ATOM   599  C  CG  . ARG A 1 99  ? -13.751 -19.266 37.085 1.00 30.19 ? 251  ARG A CG  1 
ATOM   600  C  CD  . ARG A 1 99  ? -13.455 -20.718 37.293 1.00 28.94 ? 251  ARG A CD  1 
ATOM   601  N  NE  . ARG A 1 99  ? -13.821 -21.490 36.114 1.00 29.18 ? 251  ARG A NE  1 
ATOM   602  C  CZ  . ARG A 1 99  ? -13.949 -22.814 36.095 1.00 29.48 ? 251  ARG A CZ  1 
ATOM   603  N  NH1 . ARG A 1 99  ? -14.290 -23.429 34.967 1.00 27.56 ? 251  ARG A NH1 1 
ATOM   604  N  NH2 . ARG A 1 99  ? -13.747 -23.522 37.205 1.00 29.41 ? 251  ARG A NH2 1 
ATOM   605  N  N   . VAL A 1 100 ? -16.340 -16.802 38.038 1.00 30.33 ? 252  VAL A N   1 
ATOM   606  C  CA  . VAL A 1 100 ? -17.757 -16.946 38.396 1.00 30.04 ? 252  VAL A CA  1 
ATOM   607  C  C   . VAL A 1 100 ? -18.550 -17.707 37.325 1.00 29.90 ? 252  VAL A C   1 
ATOM   608  O  O   . VAL A 1 100 ? -19.739 -17.988 37.509 1.00 30.29 ? 252  VAL A O   1 
ATOM   609  C  CB  . VAL A 1 100 ? -18.446 -15.572 38.686 1.00 30.01 ? 252  VAL A CB  1 
ATOM   610  C  CG1 . VAL A 1 100 ? -17.800 -14.870 39.888 1.00 29.79 ? 252  VAL A CG1 1 
ATOM   611  C  CG2 . VAL A 1 100 ? -18.432 -14.677 37.457 1.00 29.60 ? 252  VAL A CG2 1 
ATOM   612  N  N   . LEU A 1 101 ? -17.889 -18.039 36.216 1.00 29.44 ? 253  LEU A N   1 
ATOM   613  C  CA  . LEU A 1 101 ? -18.513 -18.771 35.113 1.00 29.16 ? 253  LEU A CA  1 
ATOM   614  C  C   . LEU A 1 101 ? -17.779 -20.080 34.856 1.00 29.49 ? 253  LEU A C   1 
ATOM   615  O  O   . LEU A 1 101 ? -16.549 -20.097 34.770 1.00 29.49 ? 253  LEU A O   1 
ATOM   616  C  CB  . LEU A 1 101 ? -18.525 -17.920 33.834 1.00 28.87 ? 253  LEU A CB  1 
ATOM   617  C  CG  . LEU A 1 101 ? -19.163 -16.527 33.836 1.00 28.16 ? 253  LEU A CG  1 
ATOM   618  C  CD1 . LEU A 1 101 ? -18.953 -15.830 32.479 1.00 26.33 ? 253  LEU A CD1 1 
ATOM   619  C  CD2 . LEU A 1 101 ? -20.656 -16.594 34.200 1.00 27.47 ? 253  LEU A CD2 1 
ATOM   620  N  N   . ASN A 1 102 ? -18.531 -21.174 34.734 1.00 29.86 ? 254  ASN A N   1 
ATOM   621  C  CA  . ASN A 1 102 ? -17.941 -22.497 34.505 1.00 30.31 ? 254  ASN A CA  1 
ATOM   622  C  C   . ASN A 1 102 ? -17.453 -22.696 33.057 1.00 31.07 ? 254  ASN A C   1 
ATOM   623  O  O   . ASN A 1 102 ? -17.375 -21.732 32.294 1.00 31.28 ? 254  ASN A O   1 
ATOM   624  C  CB  . ASN A 1 102 ? -18.891 -23.617 34.974 1.00 30.22 ? 254  ASN A CB  1 
ATOM   625  C  CG  . ASN A 1 102 ? -20.168 -23.735 34.131 1.00 29.58 ? 254  ASN A CG  1 
ATOM   626  O  OD1 . ASN A 1 102 ? -20.278 -23.188 33.031 1.00 28.75 ? 254  ASN A OD1 1 
ATOM   627  N  ND2 . ASN A 1 102 ? -21.137 -24.478 34.654 1.00 28.88 ? 254  ASN A ND2 1 
ATOM   628  N  N   . CYS A 1 103 ? -17.118 -23.932 32.684 1.00 31.79 ? 255  CYS A N   1 
ATOM   629  C  CA  . CYS A 1 103 ? -16.546 -24.207 31.365 1.00 32.84 ? 255  CYS A CA  1 
ATOM   630  C  C   . CYS A 1 103 ? -17.524 -23.948 30.215 1.00 32.72 ? 255  CYS A C   1 
ATOM   631  O  O   . CYS A 1 103 ? -17.102 -23.688 29.086 1.00 32.62 ? 255  CYS A O   1 
ATOM   632  C  CB  . CYS A 1 103 ? -15.986 -25.627 31.299 1.00 33.31 ? 255  CYS A CB  1 
ATOM   633  S  SG  . CYS A 1 103 ? -14.499 -25.870 32.309 1.00 36.39 ? 255  CYS A SG  1 
ATOM   634  N  N   . GLN A 1 104 ? -18.822 -24.015 30.519 1.00 32.67 ? 256  GLN A N   1 
ATOM   635  C  CA  . GLN A 1 104 ? -19.886 -23.738 29.549 1.00 32.64 ? 256  GLN A CA  1 
ATOM   636  C  C   . GLN A 1 104 ? -20.319 -22.261 29.575 1.00 31.91 ? 256  GLN A C   1 
ATOM   637  O  O   . GLN A 1 104 ? -21.266 -21.872 28.895 1.00 31.71 ? 256  GLN A O   1 
ATOM   638  C  CB  . GLN A 1 104 ? -21.092 -24.652 29.799 1.00 32.64 ? 256  GLN A CB  1 
ATOM   639  C  CG  . GLN A 1 104 ? -20.761 -26.152 29.949 1.00 33.53 ? 256  GLN A CG  1 
ATOM   640  C  CD  . GLN A 1 104 ? -21.907 -26.948 30.590 1.00 34.34 ? 256  GLN A CD  1 
ATOM   641  O  OE1 . GLN A 1 104 ? -22.576 -26.477 31.531 1.00 36.07 ? 256  GLN A OE1 1 
ATOM   642  N  NE2 . GLN A 1 104 ? -22.135 -28.164 30.087 1.00 35.76 ? 256  GLN A NE2 1 
ATOM   643  N  N   . GLY A 1 105 ? -19.606 -21.443 30.345 1.00 31.21 ? 257  GLY A N   1 
ATOM   644  C  CA  . GLY A 1 105 ? -19.899 -20.018 30.448 1.00 30.48 ? 257  GLY A CA  1 
ATOM   645  C  C   . GLY A 1 105 ? -21.094 -19.707 31.335 1.00 30.06 ? 257  GLY A C   1 
ATOM   646  O  O   . GLY A 1 105 ? -21.739 -18.676 31.170 1.00 29.65 ? 257  GLY A O   1 
ATOM   647  N  N   . LYS A 1 106 ? -21.373 -20.595 32.287 1.00 29.83 ? 258  LYS A N   1 
ATOM   648  C  CA  . LYS A 1 106 ? -22.543 -20.463 33.151 1.00 29.70 ? 258  LYS A CA  1 
ATOM   649  C  C   . LYS A 1 106 ? -22.178 -20.181 34.617 1.00 29.07 ? 258  LYS A C   1 
ATOM   650  O  O   . LYS A 1 106 ? -21.313 -20.825 35.188 1.00 28.99 ? 258  LYS A O   1 
ATOM   651  C  CB  . LYS A 1 106 ? -23.435 -21.704 33.027 1.00 29.66 ? 258  LYS A CB  1 
ATOM   652  C  CG  . LYS A 1 106 ? -24.827 -21.513 33.600 1.00 31.48 ? 258  LYS A CG  1 
ATOM   653  C  CD  . LYS A 1 106 ? -25.838 -22.473 32.984 1.00 33.99 ? 258  LYS A CD  1 
ATOM   654  C  CE  . LYS A 1 106 ? -26.131 -23.650 33.888 1.00 36.00 ? 258  LYS A CE  1 
ATOM   655  N  NZ  . LYS A 1 106 ? -27.436 -24.271 33.519 1.00 37.95 ? 258  LYS A NZ  1 
ATOM   656  N  N   . GLY A 1 107 ? -22.852 -19.203 35.209 1.00 28.86 ? 259  GLY A N   1 
ATOM   657  C  CA  . GLY A 1 107 ? -22.672 -18.870 36.615 1.00 28.40 ? 259  GLY A CA  1 
ATOM   658  C  C   . GLY A 1 107 ? -23.987 -18.760 37.366 1.00 28.24 ? 259  GLY A C   1 
ATOM   659  O  O   . GLY A 1 107 ? -25.054 -19.066 36.831 1.00 28.15 ? 259  GLY A O   1 
ATOM   660  N  N   . THR A 1 108 ? -23.904 -18.335 38.622 1.00 28.28 ? 260  THR A N   1 
ATOM   661  C  CA  . THR A 1 108 ? -25.089 -18.103 39.444 1.00 28.25 ? 260  THR A CA  1 
ATOM   662  C  C   . THR A 1 108 ? -25.097 -16.653 39.931 1.00 28.16 ? 260  THR A C   1 
ATOM   663  O  O   . THR A 1 108 ? -24.064 -15.991 39.941 1.00 28.17 ? 260  THR A O   1 
ATOM   664  C  CB  . THR A 1 108 ? -25.163 -19.079 40.655 1.00 28.40 ? 260  THR A CB  1 
ATOM   665  O  OG1 . THR A 1 108 ? -24.054 -18.851 41.536 1.00 28.50 ? 260  THR A OG1 1 
ATOM   666  C  CG2 . THR A 1 108 ? -25.154 -20.540 40.197 1.00 27.74 ? 260  THR A CG2 1 
ATOM   667  N  N   . VAL A 1 109 ? -26.269 -16.156 40.306 1.00 28.30 ? 261  VAL A N   1 
ATOM   668  C  CA  . VAL A 1 109 ? -26.379 -14.844 40.943 1.00 28.54 ? 261  VAL A CA  1 
ATOM   669  C  C   . VAL A 1 109 ? -25.608 -14.837 42.277 1.00 29.05 ? 261  VAL A C   1 
ATOM   670  O  O   . VAL A 1 109 ? -24.853 -13.906 42.554 1.00 29.25 ? 261  VAL A O   1 
ATOM   671  C  CB  . VAL A 1 109 ? -27.876 -14.425 41.123 1.00 28.71 ? 261  VAL A CB  1 
ATOM   672  C  CG1 . VAL A 1 109 ? -28.032 -13.269 42.116 1.00 27.97 ? 261  VAL A CG1 1 
ATOM   673  C  CG2 . VAL A 1 109 ? -28.496 -14.065 39.765 1.00 27.13 ? 261  VAL A CG2 1 
ATOM   674  N  N   . SER A 1 110 ? -25.773 -15.895 43.070 1.00 29.36 ? 262  SER A N   1 
ATOM   675  C  CA  . SER A 1 110 ? -25.149 -15.986 44.388 1.00 29.63 ? 262  SER A CA  1 
ATOM   676  C  C   . SER A 1 110 ? -23.618 -16.010 44.320 1.00 30.11 ? 262  SER A C   1 
ATOM   677  O  O   . SER A 1 110 ? -22.954 -15.297 45.073 1.00 30.20 ? 262  SER A O   1 
ATOM   678  C  CB  . SER A 1 110 ? -25.692 -17.185 45.177 1.00 29.40 ? 262  SER A CB  1 
ATOM   679  O  OG  . SER A 1 110 ? -25.373 -18.419 44.565 1.00 28.59 ? 262  SER A OG  1 
ATOM   680  N  N   . GLY A 1 111 ? -23.073 -16.816 43.409 1.00 30.38 ? 263  GLY A N   1 
ATOM   681  C  CA  . GLY A 1 111 ? -21.632 -16.843 43.143 1.00 30.26 ? 263  GLY A CA  1 
ATOM   682  C  C   . GLY A 1 111 ? -21.093 -15.493 42.706 1.00 30.45 ? 263  GLY A C   1 
ATOM   683  O  O   . GLY A 1 111 ? -20.000 -15.084 43.125 1.00 30.63 ? 263  GLY A O   1 
ATOM   684  N  N   . THR A 1 112 ? -21.858 -14.802 41.858 1.00 30.46 ? 264  THR A N   1 
ATOM   685  C  CA  . THR A 1 112 ? -21.530 -13.437 41.437 1.00 30.56 ? 264  THR A CA  1 
ATOM   686  C  C   . THR A 1 112 ? -21.585 -12.438 42.609 1.00 30.82 ? 264  THR A C   1 
ATOM   687  O  O   . THR A 1 112 ? -20.727 -11.564 42.707 1.00 31.07 ? 264  THR A O   1 
ATOM   688  C  CB  . THR A 1 112 ? -22.403 -12.981 40.235 1.00 30.71 ? 264  THR A CB  1 
ATOM   689  O  OG1 . THR A 1 112 ? -22.343 -13.974 39.203 1.00 30.70 ? 264  THR A OG1 1 
ATOM   690  C  CG2 . THR A 1 112 ? -21.924 -11.651 39.662 1.00 29.65 ? 264  THR A CG2 1 
ATOM   691  N  N   . LEU A 1 113 ? -22.568 -12.586 43.497 1.00 31.05 ? 265  LEU A N   1 
ATOM   692  C  CA  . LEU A 1 113 ? -22.654 -11.773 44.721 1.00 31.34 ? 265  LEU A CA  1 
ATOM   693  C  C   . LEU A 1 113 ? -21.437 -11.940 45.634 1.00 31.47 ? 265  LEU A C   1 
ATOM   694  O  O   . LEU A 1 113 ? -20.907 -10.959 46.155 1.00 31.49 ? 265  LEU A O   1 
ATOM   695  C  CB  . LEU A 1 113 ? -23.915 -12.109 45.524 1.00 31.52 ? 265  LEU A CB  1 
ATOM   696  C  CG  . LEU A 1 113 ? -25.306 -11.733 45.007 1.00 31.92 ? 265  LEU A CG  1 
ATOM   697  C  CD1 . LEU A 1 113 ? -26.348 -12.250 45.978 1.00 31.49 ? 265  LEU A CD1 1 
ATOM   698  C  CD2 . LEU A 1 113 ? -25.444 -10.233 44.818 1.00 32.58 ? 265  LEU A CD2 1 
ATOM   699  N  N   . ILE A 1 114 ? -21.021 -13.189 45.828 1.00 31.63 ? 266  ILE A N   1 
ATOM   700  C  CA  . ILE A 1 114 ? -19.862 -13.527 46.651 1.00 31.86 ? 266  ILE A CA  1 
ATOM   701  C  C   . ILE A 1 114 ? -18.566 -13.002 46.010 1.00 32.19 ? 266  ILE A C   1 
ATOM   702  O  O   . ILE A 1 114 ? -17.646 -12.579 46.712 1.00 32.34 ? 266  ILE A O   1 
ATOM   703  C  CB  . ILE A 1 114 ? -19.787 -15.064 46.922 1.00 31.92 ? 266  ILE A CB  1 
ATOM   704  C  CG1 . ILE A 1 114 ? -21.048 -15.536 47.661 1.00 31.56 ? 266  ILE A CG1 1 
ATOM   705  C  CG2 . ILE A 1 114 ? -18.538 -15.418 47.730 1.00 31.40 ? 266  ILE A CG2 1 
ATOM   706  C  CD1 . ILE A 1 114 ? -21.202 -17.055 47.788 1.00 31.53 ? 266  ILE A CD1 1 
ATOM   707  N  N   . GLY A 1 115 ? -18.513 -13.026 44.680 1.00 32.47 ? 267  GLY A N   1 
ATOM   708  C  CA  . GLY A 1 115 ? -17.401 -12.449 43.928 1.00 32.86 ? 267  GLY A CA  1 
ATOM   709  C  C   . GLY A 1 115 ? -17.277 -10.953 44.130 1.00 33.29 ? 267  GLY A C   1 
ATOM   710  O  O   . GLY A 1 115 ? -16.188 -10.447 44.402 1.00 33.18 ? 267  GLY A O   1 
ATOM   711  N  N   . LEU A 1 116 ? -18.402 -10.251 44.003 1.00 33.88 ? 268  LEU A N   1 
ATOM   712  C  CA  . LEU A 1 116 ? -18.467 -8.810  44.226 1.00 34.58 ? 268  LEU A CA  1 
ATOM   713  C  C   . LEU A 1 116 ? -18.117 -8.456  45.674 1.00 35.38 ? 268  LEU A C   1 
ATOM   714  O  O   . LEU A 1 116 ? -17.488 -7.425  45.937 1.00 35.03 ? 268  LEU A O   1 
ATOM   715  C  CB  . LEU A 1 116 ? -19.858 -8.272  43.863 1.00 34.28 ? 268  LEU A CB  1 
ATOM   716  C  CG  . LEU A 1 116 ? -20.320 -8.249  42.398 1.00 34.53 ? 268  LEU A CG  1 
ATOM   717  C  CD1 . LEU A 1 116 ? -21.776 -7.780  42.301 1.00 33.11 ? 268  LEU A CD1 1 
ATOM   718  C  CD2 . LEU A 1 116 ? -19.412 -7.384  41.510 1.00 33.29 ? 268  LEU A CD2 1 
ATOM   719  N  N   . GLU A 1 117 ? -18.525 -9.322  46.602 1.00 36.42 ? 269  GLU A N   1 
ATOM   720  C  CA  . GLU A 1 117 ? -18.168 -9.177  48.006 1.00 37.85 ? 269  GLU A CA  1 
ATOM   721  C  C   . GLU A 1 117 ? -16.656 -9.319  48.213 1.00 38.11 ? 269  GLU A C   1 
ATOM   722  O  O   . GLU A 1 117 ? -16.068 -8.592  49.010 1.00 38.08 ? 269  GLU A O   1 
ATOM   723  C  CB  . GLU A 1 117 ? -18.925 -10.185 48.875 1.00 38.01 ? 269  GLU A CB  1 
ATOM   724  C  CG  . GLU A 1 117 ? -18.920 -9.807  50.351 1.00 40.31 ? 269  GLU A CG  1 
ATOM   725  C  CD  . GLU A 1 117 ? -19.236 -10.963 51.278 1.00 43.21 ? 269  GLU A CD  1 
ATOM   726  O  OE1 . GLU A 1 117 ? -18.809 -12.105 50.999 1.00 44.80 ? 269  GLU A OE1 1 
ATOM   727  O  OE2 . GLU A 1 117 ? -19.894 -10.719 52.308 1.00 44.31 ? 269  GLU A OE2 1 
ATOM   728  N  N   . PHE A 1 118 ? -16.046 -10.255 47.489 1.00 39.05 ? 270  PHE A N   1 
ATOM   729  C  CA  . PHE A 1 118 ? -14.590 -10.457 47.493 1.00 40.18 ? 270  PHE A CA  1 
ATOM   730  C  C   . PHE A 1 118 ? -13.850 -9.210  47.006 1.00 40.97 ? 270  PHE A C   1 
ATOM   731  O  O   . PHE A 1 118 ? -12.780 -8.882  47.517 1.00 41.16 ? 270  PHE A O   1 
ATOM   732  C  CB  . PHE A 1 118 ? -14.224 -11.683 46.635 1.00 40.12 ? 270  PHE A CB  1 
ATOM   733  C  CG  . PHE A 1 118 ? -12.743 -11.959 46.536 1.00 40.30 ? 270  PHE A CG  1 
ATOM   734  C  CD1 . PHE A 1 118 ? -12.117 -12.809 47.447 1.00 40.96 ? 270  PHE A CD1 1 
ATOM   735  C  CD2 . PHE A 1 118 ? -11.977 -11.391 45.514 1.00 40.37 ? 270  PHE A CD2 1 
ATOM   736  C  CE1 . PHE A 1 118 ? -10.746 -13.078 47.355 1.00 40.91 ? 270  PHE A CE1 1 
ATOM   737  C  CE2 . PHE A 1 118 ? -10.608 -11.651 45.413 1.00 40.31 ? 270  PHE A CE2 1 
ATOM   738  C  CZ  . PHE A 1 118 ? -9.992  -12.497 46.334 1.00 40.55 ? 270  PHE A CZ  1 
ATOM   739  N  N   . ILE A 1 119 ? -14.426 -8.522  46.020 1.00 42.14 ? 271  ILE A N   1 
ATOM   740  C  CA  . ILE A 1 119 ? -13.844 -7.296  45.473 1.00 43.23 ? 271  ILE A CA  1 
ATOM   741  C  C   . ILE A 1 119 ? -13.928 -6.144  46.476 1.00 44.26 ? 271  ILE A C   1 
ATOM   742  O  O   . ILE A 1 119 ? -12.955 -5.408  46.663 1.00 44.45 ? 271  ILE A O   1 
ATOM   743  C  CB  . ILE A 1 119 ? -14.499 -6.900  44.122 1.00 43.04 ? 271  ILE A CB  1 
ATOM   744  C  CG1 . ILE A 1 119 ? -14.059 -7.866  43.020 1.00 42.64 ? 271  ILE A CG1 1 
ATOM   745  C  CG2 . ILE A 1 119 ? -14.153 -5.462  43.741 1.00 42.68 ? 271  ILE A CG2 1 
ATOM   746  C  CD1 . ILE A 1 119 ? -14.784 -7.676  41.717 1.00 42.48 ? 271  ILE A CD1 1 
ATOM   747  N  N   . ARG A 1 120 ? -15.089 -5.995  47.112 1.00 45.52 ? 272  ARG A N   1 
ATOM   748  C  CA  . ARG A 1 120 ? -15.296 -4.976  48.141 1.00 46.88 ? 272  ARG A CA  1 
ATOM   749  C  C   . ARG A 1 120 ? -14.206 -5.037  49.218 1.00 47.69 ? 272  ARG A C   1 
ATOM   750  O  O   . ARG A 1 120 ? -13.643 -4.010  49.588 1.00 47.59 ? 272  ARG A O   1 
ATOM   751  C  CB  . ARG A 1 120 ? -16.690 -5.115  48.761 1.00 46.85 ? 272  ARG A CB  1 
ATOM   752  C  CG  . ARG A 1 120 ? -17.024 -4.072  49.819 1.00 47.74 ? 272  ARG A CG  1 
ATOM   753  C  CD  . ARG A 1 120 ? -17.278 -2.699  49.210 1.00 49.31 ? 272  ARG A CD  1 
ATOM   754  N  NE  . ARG A 1 120 ? -17.479 -1.687  50.245 1.00 50.57 ? 272  ARG A NE  1 
ATOM   755  C  CZ  . ARG A 1 120 ? -16.614 -0.719  50.541 1.00 51.08 ? 272  ARG A CZ  1 
ATOM   756  N  NH1 . ARG A 1 120 ? -15.474 -0.604  49.869 1.00 51.20 ? 272  ARG A NH1 1 
ATOM   757  N  NH2 . ARG A 1 120 ? -16.897 0.146   51.508 1.00 50.95 ? 272  ARG A NH2 1 
ATOM   758  N  N   . LYS A 1 121 ? -13.910 -6.247  49.694 1.00 48.96 ? 273  LYS A N   1 
ATOM   759  C  CA  . LYS A 1 121 ? -12.816 -6.488  50.636 1.00 50.34 ? 273  LYS A CA  1 
ATOM   760  C  C   . LYS A 1 121 ? -11.443 -6.085  50.082 1.00 51.07 ? 273  LYS A C   1 
ATOM   761  O  O   . LYS A 1 121 ? -10.643 -5.484  50.799 1.00 51.17 ? 273  LYS A O   1 
ATOM   762  C  CB  . LYS A 1 121 ? -12.810 -7.954  51.083 1.00 50.43 ? 273  LYS A CB  1 
ATOM   763  C  CG  . LYS A 1 121 ? -13.757 -8.232  52.241 1.00 51.94 ? 273  LYS A CG  1 
ATOM   764  C  CD  . LYS A 1 121 ? -14.504 -9.555  52.091 1.00 53.64 ? 273  LYS A CD  1 
ATOM   765  C  CE  . LYS A 1 121 ? -15.625 -9.656  53.125 1.00 54.39 ? 273  LYS A CE  1 
ATOM   766  N  NZ  . LYS A 1 121 ? -16.420 -10.913 53.015 1.00 55.23 ? 273  LYS A NZ  1 
ATOM   767  N  N   . SER A 1 122 ? -11.183 -6.411  48.814 1.00 52.04 ? 274  SER A N   1 
ATOM   768  C  CA  . SER A 1 122 ? -9.928  -6.047  48.148 1.00 53.10 ? 274  SER A CA  1 
ATOM   769  C  C   . SER A 1 122 ? -9.754  -4.532  48.076 1.00 53.61 ? 274  SER A C   1 
ATOM   770  O  O   . SER A 1 122 ? -8.662  -4.013  48.339 1.00 53.77 ? 274  SER A O   1 
ATOM   771  C  CB  . SER A 1 122 ? -9.864  -6.639  46.736 1.00 53.21 ? 274  SER A CB  1 
ATOM   772  O  OG  . SER A 1 122 ? -9.933  -8.053  46.765 1.00 54.05 ? 274  SER A OG  1 
ATOM   773  N  N   . GLN A 1 123 ? -10.838 -3.837  47.721 1.00 54.11 ? 275  GLN A N   1 
ATOM   774  C  CA  . GLN A 1 123 ? -10.885 -2.371  47.693 1.00 54.45 ? 275  GLN A CA  1 
ATOM   775  C  C   . GLN A 1 123 ? -10.429 -1.769  49.031 1.00 55.04 ? 275  GLN A C   1 
ATOM   776  O  O   . GLN A 1 123 ? -10.038 -0.600  49.095 1.00 55.12 ? 275  GLN A O   1 
ATOM   777  C  CB  . GLN A 1 123 ? -12.304 -1.900  47.350 1.00 54.32 ? 275  GLN A CB  1 
ATOM   778  C  CG  . GLN A 1 123 ? -12.422 -0.430  46.955 1.00 54.03 ? 275  GLN A CG  1 
ATOM   779  C  CD  . GLN A 1 123 ? -13.860 0.082   46.941 1.00 53.98 ? 275  GLN A CD  1 
ATOM   780  O  OE1 . GLN A 1 123 ? -14.800 -0.638  47.285 1.00 52.79 ? 275  GLN A OE1 1 
ATOM   781  N  NE2 . GLN A 1 123 ? -14.032 1.337   46.538 1.00 53.42 ? 275  GLN A NE2 1 
ATOM   782  N  N   . LEU A 1 124 ? -10.469 -2.580  50.086 1.00 55.67 ? 276  LEU A N   1 
ATOM   783  C  CA  . LEU A 1 124 ? -10.047 -2.145  51.418 1.00 56.44 ? 276  LEU A CA  1 
ATOM   784  C  C   . LEU A 1 124 ? -8.711  -2.759  51.876 1.00 57.00 ? 276  LEU A C   1 
ATOM   785  O  O   . LEU A 1 124 ? -8.021  -2.180  52.719 1.00 57.07 ? 276  LEU A O   1 
ATOM   786  C  CB  . LEU A 1 124 ? -11.155 -2.411  52.451 1.00 56.32 ? 276  LEU A CB  1 
ATOM   787  C  CG  . LEU A 1 124 ? -12.555 -1.834  52.186 1.00 56.30 ? 276  LEU A CG  1 
ATOM   788  C  CD1 . LEU A 1 124 ? -13.556 -2.345  53.213 1.00 55.89 ? 276  LEU A CD1 1 
ATOM   789  C  CD2 . LEU A 1 124 ? -12.560 -0.302  52.143 1.00 56.12 ? 276  LEU A CD2 1 
ATOM   790  N  N   . VAL A 1 125 ? -8.354  -3.921  51.319 1.00 57.67 ? 277  VAL A N   1 
ATOM   791  C  CA  . VAL A 1 125 ? -7.118  -4.631  51.697 1.00 58.26 ? 277  VAL A CA  1 
ATOM   792  C  C   . VAL A 1 125 ? -5.873  -4.011  51.045 1.00 58.52 ? 277  VAL A C   1 
ATOM   793  O  O   . VAL A 1 125 ? -4.913  -3.668  51.744 1.00 58.63 ? 277  VAL A O   1 
ATOM   794  C  CB  . VAL A 1 125 ? -7.202  -6.174  51.428 1.00 58.30 ? 277  VAL A CB  1 
ATOM   795  C  CG1 . VAL A 1 125 ? -5.820  -6.837  51.502 1.00 58.31 ? 277  VAL A CG1 1 
ATOM   796  C  CG2 . VAL A 1 125 ? -8.153  -6.842  52.419 1.00 58.49 ? 277  VAL A CG2 1 
ATOM   797  N  N   . GLN A 1 126 ? -5.891  -3.870  49.718 1.00 58.79 ? 278  GLN A N   1 
ATOM   798  C  CA  . GLN A 1 126 ? -4.817  -3.164  49.004 1.00 58.96 ? 278  GLN A CA  1 
ATOM   799  C  C   . GLN A 1 126 ? -5.322  -1.869  48.333 1.00 58.69 ? 278  GLN A C   1 
ATOM   800  O  O   . GLN A 1 126 ? -5.534  -1.836  47.114 1.00 58.87 ? 278  GLN A O   1 
ATOM   801  C  CB  . GLN A 1 126 ? -4.071  -4.083  48.009 1.00 59.16 ? 278  GLN A CB  1 
ATOM   802  C  CG  . GLN A 1 126 ? -4.935  -4.816  46.965 1.00 60.08 ? 278  GLN A CG  1 
ATOM   803  C  CD  . GLN A 1 126 ? -5.047  -6.311  47.229 1.00 61.19 ? 278  GLN A CD  1 
ATOM   804  O  OE1 . GLN A 1 126 ? -5.796  -6.752  48.106 1.00 61.57 ? 278  GLN A OE1 1 
ATOM   805  N  NE2 . GLN A 1 126 ? -4.306  -7.100  46.457 1.00 61.48 ? 278  GLN A NE2 1 
ATOM   806  N  N   . PRO A 1 127 ? -5.522  -0.799  49.137 1.00 58.31 ? 279  PRO A N   1 
ATOM   807  C  CA  . PRO A 1 127 ? -6.021  0.482   48.638 1.00 57.84 ? 279  PRO A CA  1 
ATOM   808  C  C   . PRO A 1 127 ? -4.882  1.485   48.337 1.00 57.15 ? 279  PRO A C   1 
ATOM   809  O  O   . PRO A 1 127 ? -3.732  1.231   48.708 1.00 57.15 ? 279  PRO A O   1 
ATOM   810  C  CB  . PRO A 1 127 ? -6.891  0.974   49.807 1.00 57.91 ? 279  PRO A CB  1 
ATOM   811  C  CG  . PRO A 1 127 ? -6.327  0.276   51.052 1.00 58.29 ? 279  PRO A CG  1 
ATOM   812  C  CD  . PRO A 1 127 ? -5.299  -0.735  50.594 1.00 58.39 ? 279  PRO A CD  1 
ATOM   813  N  N   . VAL A 1 128 ? -5.170  2.599   47.660 1.00 56.21 ? 280  VAL A N   1 
ATOM   814  C  CA  . VAL A 1 128 ? -6.481  2.909   47.084 1.00 55.19 ? 280  VAL A CA  1 
ATOM   815  C  C   . VAL A 1 128 ? -6.471  2.662   45.569 1.00 54.28 ? 280  VAL A C   1 
ATOM   816  O  O   . VAL A 1 128 ? -6.368  1.511   45.129 1.00 54.53 ? 280  VAL A O   1 
ATOM   817  C  CB  . VAL A 1 128 ? -6.957  4.359   47.428 1.00 55.30 ? 280  VAL A CB  1 
ATOM   818  C  CG1 . VAL A 1 128 ? -7.597  4.402   48.807 1.00 55.51 ? 280  VAL A CG1 1 
ATOM   819  C  CG2 . VAL A 1 128 ? -5.803  5.368   47.340 1.00 55.41 ? 280  VAL A CG2 1 
ATOM   820  N  N   . GLY A 1 129 ? -6.575  3.734   44.783 1.00 52.88 ? 281  GLY A N   1 
ATOM   821  C  CA  . GLY A 1 129 ? -6.581  3.640   43.324 1.00 50.80 ? 281  GLY A CA  1 
ATOM   822  C  C   . GLY A 1 129 ? -7.974  3.483   42.739 1.00 49.30 ? 281  GLY A C   1 
ATOM   823  O  O   . GLY A 1 129 ? -8.882  2.989   43.418 1.00 49.07 ? 281  GLY A O   1 
ATOM   824  N  N   . PRO A 1 130 ? -8.154  3.913   41.473 1.00 47.96 ? 282  PRO A N   1 
ATOM   825  C  CA  . PRO A 1 130 ? -9.419  3.731   40.764 1.00 46.75 ? 282  PRO A CA  1 
ATOM   826  C  C   . PRO A 1 130 ? -9.732  2.250   40.556 1.00 45.48 ? 282  PRO A C   1 
ATOM   827  O  O   . PRO A 1 130 ? -8.828  1.453   40.286 1.00 45.35 ? 282  PRO A O   1 
ATOM   828  C  CB  . PRO A 1 130 ? -9.174  4.419   39.414 1.00 46.80 ? 282  PRO A CB  1 
ATOM   829  C  CG  . PRO A 1 130 ? -8.005  5.313   39.634 1.00 47.36 ? 282  PRO A CG  1 
ATOM   830  C  CD  . PRO A 1 130 ? -7.160  4.616   40.643 1.00 47.84 ? 282  PRO A CD  1 
ATOM   831  N  N   . LEU A 1 131 ? -11.005 1.895   40.692 1.00 43.93 ? 283  LEU A N   1 
ATOM   832  C  CA  . LEU A 1 131 ? -11.439 0.513   40.545 1.00 42.58 ? 283  LEU A CA  1 
ATOM   833  C  C   . LEU A 1 131 ? -12.486 0.380   39.445 1.00 41.20 ? 283  LEU A C   1 
ATOM   834  O  O   . LEU A 1 131 ? -13.541 1.011   39.511 1.00 41.04 ? 283  LEU A O   1 
ATOM   835  C  CB  . LEU A 1 131 ? -12.014 0.004   41.862 1.00 42.89 ? 283  LEU A CB  1 
ATOM   836  C  CG  . LEU A 1 131 ? -11.599 -1.402  42.273 1.00 43.50 ? 283  LEU A CG  1 
ATOM   837  C  CD1 . LEU A 1 131 ? -10.346 -1.320  43.147 1.00 44.66 ? 283  LEU A CD1 1 
ATOM   838  C  CD2 . LEU A 1 131 ? -12.734 -2.074  43.025 1.00 44.36 ? 283  LEU A CD2 1 
ATOM   839  N  N   . VAL A 1 132 ? -12.172 -0.427  38.433 1.00 39.54 ? 284  VAL A N   1 
ATOM   840  C  CA  . VAL A 1 132 ? -13.115 -0.766  37.370 1.00 38.02 ? 284  VAL A CA  1 
ATOM   841  C  C   . VAL A 1 132 ? -13.459 -2.251  37.479 1.00 37.15 ? 284  VAL A C   1 
ATOM   842  O  O   . VAL A 1 132 ? -12.573 -3.094  37.623 1.00 36.82 ? 284  VAL A O   1 
ATOM   843  C  CB  . VAL A 1 132 ? -12.565 -0.431  35.944 1.00 38.01 ? 284  VAL A CB  1 
ATOM   844  C  CG1 . VAL A 1 132 ? -13.552 -0.862  34.854 1.00 37.54 ? 284  VAL A CG1 1 
ATOM   845  C  CG2 . VAL A 1 132 ? -12.263 1.055   35.810 1.00 37.54 ? 284  VAL A CG2 1 
ATOM   846  N  N   . VAL A 1 133 ? -14.753 -2.555  37.430 1.00 36.01 ? 285  VAL A N   1 
ATOM   847  C  CA  . VAL A 1 133 ? -15.239 -3.929  37.495 1.00 35.11 ? 285  VAL A CA  1 
ATOM   848  C  C   . VAL A 1 133 ? -15.981 -4.271  36.204 1.00 34.47 ? 285  VAL A C   1 
ATOM   849  O  O   . VAL A 1 133 ? -17.004 -3.667  35.883 1.00 34.22 ? 285  VAL A O   1 
ATOM   850  C  CB  . VAL A 1 133 ? -16.158 -4.169  38.730 1.00 35.04 ? 285  VAL A CB  1 
ATOM   851  C  CG1 . VAL A 1 133 ? -16.856 -5.523  38.633 1.00 34.99 ? 285  VAL A CG1 1 
ATOM   852  C  CG2 . VAL A 1 133 ? -15.368 -4.072  40.027 1.00 34.55 ? 285  VAL A CG2 1 
ATOM   853  N  N   . LEU A 1 134 ? -15.438 -5.226  35.458 1.00 33.84 ? 286  LEU A N   1 
ATOM   854  C  CA  . LEU A 1 134 ? -16.067 -5.697  34.235 1.00 33.30 ? 286  LEU A CA  1 
ATOM   855  C  C   . LEU A 1 134 ? -16.888 -6.947  34.530 1.00 33.03 ? 286  LEU A C   1 
ATOM   856  O  O   . LEU A 1 134 ? -16.363 -7.954  35.010 1.00 32.59 ? 286  LEU A O   1 
ATOM   857  C  CB  . LEU A 1 134 ? -15.020 -5.955  33.138 1.00 32.97 ? 286  LEU A CB  1 
ATOM   858  C  CG  . LEU A 1 134 ? -15.471 -6.579  31.810 1.00 32.98 ? 286  LEU A CG  1 
ATOM   859  C  CD1 . LEU A 1 134 ? -16.505 -5.726  31.092 1.00 31.88 ? 286  LEU A CD1 1 
ATOM   860  C  CD2 . LEU A 1 134 ? -14.269 -6.827  30.911 1.00 33.27 ? 286  LEU A CD2 1 
ATOM   861  N  N   . LEU A 1 135 ? -18.182 -6.858  34.235 1.00 33.20 ? 287  LEU A N   1 
ATOM   862  C  CA  . LEU A 1 135 ? -19.140 -7.944  34.457 1.00 33.18 ? 287  LEU A CA  1 
ATOM   863  C  C   . LEU A 1 135 ? -19.770 -8.352  33.139 1.00 32.77 ? 287  LEU A C   1 
ATOM   864  O  O   . LEU A 1 135 ? -20.886 -7.947  32.851 1.00 33.52 ? 287  LEU A O   1 
ATOM   865  C  CB  . LEU A 1 135 ? -20.251 -7.466  35.382 1.00 33.28 ? 287  LEU A CB  1 
ATOM   866  C  CG  . LEU A 1 135 ? -19.941 -7.268  36.855 1.00 33.97 ? 287  LEU A CG  1 
ATOM   867  C  CD1 . LEU A 1 135 ? -20.705 -6.058  37.373 1.00 34.48 ? 287  LEU A CD1 1 
ATOM   868  C  CD2 . LEU A 1 135 ? -20.309 -8.539  37.614 1.00 35.31 ? 287  LEU A CD2 1 
ATOM   869  N  N   . PRO A 1 136 ? -19.060 -9.149  32.327 1.00 32.51 ? 288  PRO A N   1 
ATOM   870  C  CA  . PRO A 1 136 ? -19.513 -9.459  30.963 1.00 31.78 ? 288  PRO A CA  1 
ATOM   871  C  C   . PRO A 1 136 ? -20.481 -10.644 30.902 1.00 31.23 ? 288  PRO A C   1 
ATOM   872  O  O   . PRO A 1 136 ? -20.290 -11.594 30.135 1.00 31.11 ? 288  PRO A O   1 
ATOM   873  C  CB  . PRO A 1 136 ? -18.204 -9.763  30.237 1.00 31.85 ? 288  PRO A CB  1 
ATOM   874  C  CG  . PRO A 1 136 ? -17.289 -10.296 31.316 1.00 32.17 ? 288  PRO A CG  1 
ATOM   875  C  CD  . PRO A 1 136 ? -17.770 -9.797  32.646 1.00 32.39 ? 288  PRO A CD  1 
ATOM   876  N  N   . LEU A 1 137 ? -21.530 -10.560 31.706 1.00 30.73 ? 289  LEU A N   1 
ATOM   877  C  CA  . LEU A 1 137 ? -22.484 -11.647 31.871 1.00 30.02 ? 289  LEU A CA  1 
ATOM   878  C  C   . LEU A 1 137 ? -23.863 -11.046 32.041 1.00 29.42 ? 289  LEU A C   1 
ATOM   879  O  O   . LEU A 1 137 ? -23.993 -9.834  32.250 1.00 29.25 ? 289  LEU A O   1 
ATOM   880  C  CB  . LEU A 1 137 ? -22.114 -12.525 33.086 1.00 29.78 ? 289  LEU A CB  1 
ATOM   881  C  CG  . LEU A 1 137 ? -21.782 -11.841 34.424 1.00 30.19 ? 289  LEU A CG  1 
ATOM   882  C  CD1 . LEU A 1 137 ? -23.035 -11.445 35.218 1.00 29.55 ? 289  LEU A CD1 1 
ATOM   883  C  CD2 . LEU A 1 137 ? -20.856 -12.715 35.281 1.00 30.03 ? 289  LEU A CD2 1 
ATOM   884  N  N   . ALA A 1 138 ? -24.883 -11.896 31.950 1.00 28.88 ? 290  ALA A N   1 
ATOM   885  C  CA  . ALA A 1 138 ? -26.254 -11.489 32.207 1.00 28.63 ? 290  ALA A CA  1 
ATOM   886  C  C   . ALA A 1 138 ? -27.082 -12.671 32.653 1.00 28.64 ? 290  ALA A C   1 
ATOM   887  O  O   . ALA A 1 138 ? -26.893 -13.790 32.171 1.00 28.41 ? 290  ALA A O   1 
ATOM   888  C  CB  . ALA A 1 138 ? -26.877 -10.851 30.967 1.00 28.42 ? 290  ALA A CB  1 
ATOM   889  N  N   . GLY A 1 139 ? -27.992 -12.410 33.590 1.00 28.68 ? 291  GLY A N   1 
ATOM   890  C  CA  . GLY A 1 139 ? -29.100 -13.314 33.887 1.00 28.81 ? 291  GLY A CA  1 
ATOM   891  C  C   . GLY A 1 139 ? -30.357 -12.477 33.790 1.00 29.16 ? 291  GLY A C   1 
ATOM   892  O  O   . GLY A 1 139 ? -30.294 -11.327 33.350 1.00 29.30 ? 291  GLY A O   1 
ATOM   893  N  N   . GLY A 1 140 ? -31.497 -13.031 34.195 1.00 29.17 ? 292  GLY A N   1 
ATOM   894  C  CA  . GLY A 1 140 ? -32.743 -12.257 34.239 1.00 29.86 ? 292  GLY A CA  1 
ATOM   895  C  C   . GLY A 1 140 ? -32.682 -11.194 35.324 1.00 30.31 ? 292  GLY A C   1 
ATOM   896  O  O   . GLY A 1 140 ? -31.815 -11.252 36.192 1.00 30.40 ? 292  GLY A O   1 
ATOM   897  N  N   . TYR A 1 141 ? -33.586 -10.217 35.278 1.00 30.66 ? 293  TYR A N   1 
ATOM   898  C  CA  . TYR A 1 141 ? -33.612 -9.161  36.291 1.00 31.24 ? 293  TYR A CA  1 
ATOM   899  C  C   . TYR A 1 141 ? -33.444 -9.753  37.697 1.00 31.55 ? 293  TYR A C   1 
ATOM   900  O  O   . TYR A 1 141 ? -34.134 -10.703 38.073 1.00 31.77 ? 293  TYR A O   1 
ATOM   901  C  CB  . TYR A 1 141 ? -34.906 -8.326  36.210 1.00 31.42 ? 293  TYR A CB  1 
ATOM   902  C  CG  . TYR A 1 141 ? -35.115 -7.464  37.437 1.00 31.64 ? 293  TYR A CG  1 
ATOM   903  C  CD1 . TYR A 1 141 ? -34.512 -6.211  37.543 1.00 31.54 ? 293  TYR A CD1 1 
ATOM   904  C  CD2 . TYR A 1 141 ? -35.878 -7.920  38.510 1.00 31.61 ? 293  TYR A CD2 1 
ATOM   905  C  CE1 . TYR A 1 141 ? -34.678 -5.430  38.673 1.00 31.25 ? 293  TYR A CE1 1 
ATOM   906  C  CE2 . TYR A 1 141 ? -36.047 -7.148  39.649 1.00 31.57 ? 293  TYR A CE2 1 
ATOM   907  C  CZ  . TYR A 1 141 ? -35.445 -5.902  39.722 1.00 31.80 ? 293  TYR A CZ  1 
ATOM   908  O  OH  . TYR A 1 141 ? -35.612 -5.128  40.848 1.00 32.09 ? 293  TYR A OH  1 
ATOM   909  N  N   . SER A 1 142 ? -32.514 -9.193  38.461 1.00 31.90 ? 294  SER A N   1 
ATOM   910  C  CA  . SER A 1 142 ? -32.264 -9.648  39.822 1.00 32.21 ? 294  SER A CA  1 
ATOM   911  C  C   . SER A 1 142 ? -32.211 -8.462  40.777 1.00 32.38 ? 294  SER A C   1 
ATOM   912  O  O   . SER A 1 142 ? -31.324 -7.611  40.675 1.00 32.66 ? 294  SER A O   1 
ATOM   913  C  CB  . SER A 1 142 ? -30.957 -10.444 39.889 1.00 32.45 ? 294  SER A CB  1 
ATOM   914  O  OG  . SER A 1 142 ? -30.664 -10.836 41.221 1.00 32.20 ? 294  SER A OG  1 
ATOM   915  N  N   . ARG A 1 143 ? -33.164 -8.412  41.702 1.00 32.61 ? 295  ARG A N   1 
ATOM   916  C  CA  . ARG A 1 143 ? -33.223 -7.331  42.683 1.00 32.62 ? 295  ARG A CA  1 
ATOM   917  C  C   . ARG A 1 143 ? -31.948 -7.257  43.531 1.00 32.65 ? 295  ARG A C   1 
ATOM   918  O  O   . ARG A 1 143 ? -31.413 -6.168  43.749 1.00 32.82 ? 295  ARG A O   1 
ATOM   919  C  CB  . ARG A 1 143 ? -34.465 -7.448  43.569 1.00 32.32 ? 295  ARG A CB  1 
ATOM   920  C  CG  . ARG A 1 143 ? -34.617 -6.274  44.523 1.00 31.83 ? 295  ARG A CG  1 
ATOM   921  C  CD  . ARG A 1 143 ? -35.771 -6.441  45.486 1.00 30.25 ? 295  ARG A CD  1 
ATOM   922  N  NE  . ARG A 1 143 ? -35.758 -5.379  46.488 1.00 29.56 ? 295  ARG A NE  1 
ATOM   923  C  CZ  . ARG A 1 143 ? -36.675 -5.210  47.438 1.00 29.62 ? 295  ARG A CZ  1 
ATOM   924  N  NH1 . ARG A 1 143 ? -37.719 -6.027  47.536 1.00 29.12 ? 295  ARG A NH1 1 
ATOM   925  N  NH2 . ARG A 1 143 ? -36.549 -4.210  48.297 1.00 29.38 ? 295  ARG A NH2 1 
ATOM   926  N  N   . VAL A 1 144 ? -31.456 -8.409  43.979 1.00 32.71 ? 296  VAL A N   1 
ATOM   927  C  CA  . VAL A 1 144 ? -30.262 -8.458  44.836 1.00 32.89 ? 296  VAL A CA  1 
ATOM   928  C  C   . VAL A 1 144 ? -28.951 -8.144  44.103 1.00 33.18 ? 296  VAL A C   1 
ATOM   929  O  O   . VAL A 1 144 ? -28.088 -7.443  44.648 1.00 33.39 ? 296  VAL A O   1 
ATOM   930  C  CB  . VAL A 1 144 ? -30.157 -9.798  45.633 1.00 32.82 ? 296  VAL A CB  1 
ATOM   931  C  CG1 . VAL A 1 144 ? -29.837 -10.970 44.715 1.00 33.04 ? 296  VAL A CG1 1 
ATOM   932  C  CG2 . VAL A 1 144 ? -29.122 -9.687  46.758 1.00 32.65 ? 296  VAL A CG2 1 
ATOM   933  N  N   . LEU A 1 145 ? -28.799 -8.653  42.878 1.00 33.38 ? 297  LEU A N   1 
ATOM   934  C  CA  . LEU A 1 145 ? -27.603 -8.365  42.085 1.00 33.50 ? 297  LEU A CA  1 
ATOM   935  C  C   . LEU A 1 145 ? -27.524 -6.874  41.761 1.00 33.69 ? 297  LEU A C   1 
ATOM   936  O  O   . LEU A 1 145 ? -26.462 -6.269  41.883 1.00 33.74 ? 297  LEU A O   1 
ATOM   937  C  CB  . LEU A 1 145 ? -27.548 -9.219  40.811 1.00 33.46 ? 297  LEU A CB  1 
ATOM   938  C  CG  . LEU A 1 145 ? -26.268 -9.218  39.965 1.00 33.42 ? 297  LEU A CG  1 
ATOM   939  C  CD1 . LEU A 1 145 ? -25.020 -9.557  40.795 1.00 32.90 ? 297  LEU A CD1 1 
ATOM   940  C  CD2 . LEU A 1 145 ? -26.407 -10.193 38.799 1.00 33.27 ? 297  LEU A CD2 1 
ATOM   941  N  N   . ASN A 1 146 ? -28.654 -6.291  41.370 1.00 34.04 ? 298  ASN A N   1 
ATOM   942  C  CA  . ASN A 1 146 ? -28.747 -4.855  41.152 1.00 34.60 ? 298  ASN A CA  1 
ATOM   943  C  C   . ASN A 1 146 ? -28.395 -4.049  42.401 1.00 34.97 ? 298  ASN A C   1 
ATOM   944  O  O   . ASN A 1 146 ? -27.689 -3.044  42.308 1.00 35.39 ? 298  ASN A O   1 
ATOM   945  C  CB  . ASN A 1 146 ? -30.141 -4.476  40.641 1.00 34.68 ? 298  ASN A CB  1 
ATOM   946  C  CG  . ASN A 1 146 ? -30.351 -4.838  39.168 1.00 35.24 ? 298  ASN A CG  1 
ATOM   947  O  OD1 . ASN A 1 146 ? -29.632 -5.670  38.607 1.00 35.92 ? 298  ASN A OD1 1 
ATOM   948  N  ND2 . ASN A 1 146 ? -31.338 -4.207  38.540 1.00 35.14 ? 298  ASN A ND2 1 
ATOM   949  N  N   . ALA A 1 147 ? -28.876 -4.500  43.561 1.00 35.19 ? 299  ALA A N   1 
ATOM   950  C  CA  . ALA A 1 147 ? -28.612 -3.824  44.831 1.00 35.35 ? 299  ALA A CA  1 
ATOM   951  C  C   . ALA A 1 147 ? -27.141 -3.916  45.247 1.00 35.54 ? 299  ALA A C   1 
ATOM   952  O  O   . ALA A 1 147 ? -26.574 -2.948  45.764 1.00 35.39 ? 299  ALA A O   1 
ATOM   953  C  CB  . ALA A 1 147 ? -29.517 -4.367  45.924 1.00 35.33 ? 299  ALA A CB  1 
ATOM   954  N  N   . ALA A 1 148 ? -26.536 -5.080  45.015 1.00 35.75 ? 300  ALA A N   1 
ATOM   955  C  CA  . ALA A 1 148 ? -25.110 -5.282  45.254 1.00 36.07 ? 300  ALA A CA  1 
ATOM   956  C  C   . ALA A 1 148 ? -24.265 -4.386  44.355 1.00 36.66 ? 300  ALA A C   1 
ATOM   957  O  O   . ALA A 1 148 ? -23.242 -3.857  44.782 1.00 36.67 ? 300  ALA A O   1 
ATOM   958  C  CB  . ALA A 1 148 ? -24.745 -6.734  45.041 1.00 35.91 ? 300  ALA A CB  1 
ATOM   959  N  N   . CYS A 1 149 ? -24.696 -4.228  43.105 1.00 37.47 ? 301  CYS A N   1 
ATOM   960  C  CA  . CYS A 1 149 ? -24.020 -3.346  42.156 1.00 38.19 ? 301  CYS A CA  1 
ATOM   961  C  C   . CYS A 1 149 ? -24.163 -1.882  42.545 1.00 38.80 ? 301  CYS A C   1 
ATOM   962  O  O   . CYS A 1 149 ? -23.191 -1.130  42.500 1.00 38.74 ? 301  CYS A O   1 
ATOM   963  C  CB  . CYS A 1 149 ? -24.560 -3.567  40.746 1.00 37.91 ? 301  CYS A CB  1 
ATOM   964  S  SG  . CYS A 1 149 ? -23.945 -5.060  39.988 1.00 37.71 ? 301  CYS A SG  1 
ATOM   965  N  N   . GLN A 1 150 ? -25.381 -1.494  42.921 1.00 39.84 ? 302  GLN A N   1 
ATOM   966  C  CA  . GLN A 1 150 ? -25.680 -0.135  43.383 1.00 40.94 ? 302  GLN A CA  1 
ATOM   967  C  C   . GLN A 1 150 ? -24.835 0.271   44.592 1.00 41.37 ? 302  GLN A C   1 
ATOM   968  O  O   . GLN A 1 150 ? -24.317 1.387   44.641 1.00 41.66 ? 302  GLN A O   1 
ATOM   969  C  CB  . GLN A 1 150 ? -27.169 0.003   43.706 1.00 40.95 ? 302  GLN A CB  1 
ATOM   970  C  CG  . GLN A 1 150 ? -27.474 0.979   44.839 1.00 42.48 ? 302  GLN A CG  1 
ATOM   971  C  CD  . GLN A 1 150 ? -28.913 1.429   44.857 1.00 43.86 ? 302  GLN A CD  1 
ATOM   972  O  OE1 . GLN A 1 150 ? -29.676 1.061   45.750 1.00 45.75 ? 302  GLN A OE1 1 
ATOM   973  N  NE2 . GLN A 1 150 ? -29.295 2.228   43.871 1.00 43.81 ? 302  GLN A NE2 1 
ATOM   974  N  N   . ARG A 1 151 ? -24.708 -0.639  45.554 1.00 41.74 ? 303  ARG A N   1 
ATOM   975  C  CA  . ARG A 1 151 ? -23.906 -0.416  46.753 1.00 42.52 ? 303  ARG A CA  1 
ATOM   976  C  C   . ARG A 1 151 ? -22.418 -0.210  46.418 1.00 42.34 ? 303  ARG A C   1 
ATOM   977  O  O   . ARG A 1 151 ? -21.772 0.716   46.922 1.00 42.47 ? 303  ARG A O   1 
ATOM   978  C  CB  . ARG A 1 151 ? -24.115 -1.579  47.733 1.00 42.73 ? 303  ARG A CB  1 
ATOM   979  C  CG  . ARG A 1 151 ? -22.938 -1.889  48.638 1.00 45.02 ? 303  ARG A CG  1 
ATOM   980  C  CD  . ARG A 1 151 ? -22.873 -0.985  49.861 1.00 49.01 ? 303  ARG A CD  1 
ATOM   981  N  NE  . ARG A 1 151 ? -21.514 -0.942  50.403 1.00 51.53 ? 303  ARG A NE  1 
ATOM   982  C  CZ  . ARG A 1 151 ? -21.210 -0.644  51.663 1.00 53.12 ? 303  ARG A CZ  1 
ATOM   983  N  NH1 . ARG A 1 151 ? -22.170 -0.365  52.540 1.00 53.83 ? 303  ARG A NH1 1 
ATOM   984  N  NH2 . ARG A 1 151 ? -19.939 -0.632  52.050 1.00 54.29 ? 303  ARG A NH2 1 
ATOM   985  N  N   . LEU A 1 152 ? -21.893 -1.073  45.557 1.00 42.15 ? 304  LEU A N   1 
ATOM   986  C  CA  . LEU A 1 152 ? -20.504 -1.012  45.124 1.00 41.98 ? 304  LEU A CA  1 
ATOM   987  C  C   . LEU A 1 152 ? -20.206 0.279   44.333 1.00 41.85 ? 304  LEU A C   1 
ATOM   988  O  O   . LEU A 1 152 ? -19.169 0.911   44.536 1.00 41.88 ? 304  LEU A O   1 
ATOM   989  C  CB  . LEU A 1 152 ? -20.179 -2.269  44.313 1.00 41.97 ? 304  LEU A CB  1 
ATOM   990  C  CG  . LEU A 1 152 ? -18.750 -2.788  44.169 1.00 42.25 ? 304  LEU A CG  1 
ATOM   991  C  CD1 . LEU A 1 152 ? -18.033 -2.922  45.513 1.00 42.09 ? 304  LEU A CD1 1 
ATOM   992  C  CD2 . LEU A 1 152 ? -18.779 -4.123  43.437 1.00 41.99 ? 304  LEU A CD2 1 
ATOM   993  N  N   . ALA A 1 153 ? -21.127 0.679   43.459 1.00 41.64 ? 305  ALA A N   1 
ATOM   994  C  CA  . ALA A 1 153 ? -21.009 1.945   42.730 1.00 41.53 ? 305  ALA A CA  1 
ATOM   995  C  C   . ALA A 1 153 ? -21.006 3.149   43.671 1.00 41.48 ? 305  ALA A C   1 
ATOM   996  O  O   . ALA A 1 153 ? -20.322 4.144   43.414 1.00 41.65 ? 305  ALA A O   1 
ATOM   997  C  CB  . ALA A 1 153 ? -22.126 2.081   41.706 1.00 41.48 ? 305  ALA A CB  1 
ATOM   998  N  N   . ARG A 1 154 ? -21.779 3.053   44.752 1.00 41.25 ? 306  ARG A N   1 
ATOM   999  C  CA  . ARG A 1 154 ? -21.853 4.109   45.757 1.00 40.99 ? 306  ARG A CA  1 
ATOM   1000 C  C   . ARG A 1 154 ? -20.558 4.229   46.566 1.00 40.56 ? 306  ARG A C   1 
ATOM   1001 O  O   . ARG A 1 154 ? -20.303 5.260   47.191 1.00 40.51 ? 306  ARG A O   1 
ATOM   1002 C  CB  . ARG A 1 154 ? -23.068 3.913   46.669 1.00 41.18 ? 306  ARG A CB  1 
ATOM   1003 C  CG  . ARG A 1 154 ? -24.379 4.368   46.032 1.00 42.60 ? 306  ARG A CG  1 
ATOM   1004 C  CD  . ARG A 1 154 ? -25.537 4.290   47.015 1.00 44.98 ? 306  ARG A CD  1 
ATOM   1005 N  NE  . ARG A 1 154 ? -26.829 4.579   46.388 1.00 46.44 ? 306  ARG A NE  1 
ATOM   1006 C  CZ  . ARG A 1 154 ? -27.994 4.599   47.039 1.00 47.51 ? 306  ARG A CZ  1 
ATOM   1007 N  NH1 . ARG A 1 154 ? -28.042 4.350   48.343 1.00 47.17 ? 306  ARG A NH1 1 
ATOM   1008 N  NH2 . ARG A 1 154 ? -29.118 4.871   46.385 1.00 47.74 ? 306  ARG A NH2 1 
ATOM   1009 N  N   . ALA A 1 155 ? -19.742 3.176   46.535 1.00 40.09 ? 307  ALA A N   1 
ATOM   1010 C  CA  . ALA A 1 155 ? -18.410 3.197   47.132 1.00 39.58 ? 307  ALA A CA  1 
ATOM   1011 C  C   . ALA A 1 155 ? -17.326 3.651   46.141 1.00 39.30 ? 307  ALA A C   1 
ATOM   1012 O  O   . ALA A 1 155 ? -16.128 3.513   46.417 1.00 39.51 ? 307  ALA A O   1 
ATOM   1013 C  CB  . ALA A 1 155 ? -18.070 1.830   47.720 1.00 39.59 ? 307  ALA A CB  1 
ATOM   1014 N  N   . GLY A 1 156 ? -17.748 4.186   44.995 1.00 38.67 ? 308  GLY A N   1 
ATOM   1015 C  CA  . GLY A 1 156 ? -16.834 4.805   44.033 1.00 38.00 ? 308  GLY A CA  1 
ATOM   1016 C  C   . GLY A 1 156 ? -16.378 3.922   42.882 1.00 37.64 ? 308  GLY A C   1 
ATOM   1017 O  O   . GLY A 1 156 ? -15.644 4.375   41.994 1.00 37.59 ? 308  GLY A O   1 
ATOM   1018 N  N   . VAL A 1 157 ? -16.818 2.665   42.892 1.00 37.00 ? 309  VAL A N   1 
ATOM   1019 C  CA  . VAL A 1 157 ? -16.405 1.685   41.892 1.00 36.38 ? 309  VAL A CA  1 
ATOM   1020 C  C   . VAL A 1 157 ? -17.092 1.934   40.544 1.00 36.18 ? 309  VAL A C   1 
ATOM   1021 O  O   . VAL A 1 157 ? -18.267 2.318   40.487 1.00 36.24 ? 309  VAL A O   1 
ATOM   1022 C  CB  . VAL A 1 157 ? -16.648 0.228   42.384 1.00 36.36 ? 309  VAL A CB  1 
ATOM   1023 C  CG1 . VAL A 1 157 ? -16.149 -0.791  41.365 1.00 36.11 ? 309  VAL A CG1 1 
ATOM   1024 C  CG2 . VAL A 1 157 ? -15.963 -0.004  43.718 1.00 35.59 ? 309  VAL A CG2 1 
ATOM   1025 N  N   . VAL A 1 158 ? -16.338 1.729   39.467 1.00 35.67 ? 310  VAL A N   1 
ATOM   1026 C  CA  . VAL A 1 158 ? -16.868 1.831   38.114 1.00 35.01 ? 310  VAL A CA  1 
ATOM   1027 C  C   . VAL A 1 158 ? -17.220 0.433   37.618 1.00 34.64 ? 310  VAL A C   1 
ATOM   1028 O  O   . VAL A 1 158 ? -16.335 -0.370  37.316 1.00 34.66 ? 310  VAL A O   1 
ATOM   1029 C  CB  . VAL A 1 158 ? -15.865 2.533   37.158 1.00 35.19 ? 310  VAL A CB  1 
ATOM   1030 C  CG1 . VAL A 1 158 ? -16.387 2.546   35.723 1.00 34.44 ? 310  VAL A CG1 1 
ATOM   1031 C  CG2 . VAL A 1 158 ? -15.585 3.954   37.637 1.00 35.21 ? 310  VAL A CG2 1 
ATOM   1032 N  N   . LEU A 1 159 ? -18.519 0.142   37.562 1.00 34.07 ? 311  LEU A N   1 
ATOM   1033 C  CA  . LEU A 1 159 ? -19.002 -1.154  37.085 1.00 33.62 ? 311  LEU A CA  1 
ATOM   1034 C  C   . LEU A 1 159 ? -19.471 -1.059  35.636 1.00 33.09 ? 311  LEU A C   1 
ATOM   1035 O  O   . LEU A 1 159 ? -20.324 -0.238  35.301 1.00 33.19 ? 311  LEU A O   1 
ATOM   1036 C  CB  . LEU A 1 159 ? -20.122 -1.708  37.984 1.00 33.50 ? 311  LEU A CB  1 
ATOM   1037 C  CG  . LEU A 1 159 ? -19.758 -2.040  39.437 1.00 33.78 ? 311  LEU A CG  1 
ATOM   1038 C  CD1 . LEU A 1 159 ? -20.239 -0.943  40.361 1.00 33.65 ? 311  LEU A CD1 1 
ATOM   1039 C  CD2 . LEU A 1 159 ? -20.343 -3.372  39.870 1.00 33.48 ? 311  LEU A CD2 1 
ATOM   1040 N  N   . VAL A 1 160 ? -18.893 -1.896  34.782 1.00 32.62 ? 312  VAL A N   1 
ATOM   1041 C  CA  . VAL A 1 160 ? -19.286 -1.976  33.375 1.00 32.10 ? 312  VAL A CA  1 
ATOM   1042 C  C   . VAL A 1 160 ? -19.857 -3.368  33.096 1.00 31.69 ? 312  VAL A C   1 
ATOM   1043 O  O   . VAL A 1 160 ? -19.248 -4.378  33.440 1.00 31.86 ? 312  VAL A O   1 
ATOM   1044 C  CB  . VAL A 1 160 ? -18.097 -1.685  32.407 1.00 32.38 ? 312  VAL A CB  1 
ATOM   1045 C  CG1 . VAL A 1 160 ? -18.586 -1.554  30.959 1.00 31.28 ? 312  VAL A CG1 1 
ATOM   1046 C  CG2 . VAL A 1 160 ? -17.327 -0.428  32.828 1.00 31.81 ? 312  VAL A CG2 1 
ATOM   1047 N  N   . THR A 1 161 ? -21.031 -3.415  32.480 1.00 31.12 ? 313  THR A N   1 
ATOM   1048 C  CA  . THR A 1 161 ? -21.662 -4.689  32.168 1.00 30.62 ? 313  THR A CA  1 
ATOM   1049 C  C   . THR A 1 161 ? -22.094 -4.799  30.699 1.00 30.13 ? 313  THR A C   1 
ATOM   1050 O  O   . THR A 1 161 ? -22.138 -3.807  29.967 1.00 29.84 ? 313  THR A O   1 
ATOM   1051 C  CB  . THR A 1 161 ? -22.856 -4.987  33.133 1.00 30.71 ? 313  THR A CB  1 
ATOM   1052 O  OG1 . THR A 1 161 ? -23.123 -6.398  33.151 1.00 31.57 ? 313  THR A OG1 1 
ATOM   1053 C  CG2 . THR A 1 161 ? -24.114 -4.226  32.719 1.00 30.11 ? 313  THR A CG2 1 
ATOM   1054 N  N   . ALA A 1 162 ? -22.384 -6.029  30.287 1.00 29.65 ? 314  ALA A N   1 
ATOM   1055 C  CA  . ALA A 1 162 ? -22.959 -6.333  28.989 1.00 29.03 ? 314  ALA A CA  1 
ATOM   1056 C  C   . ALA A 1 162 ? -24.463 -6.068  29.030 1.00 28.95 ? 314  ALA A C   1 
ATOM   1057 O  O   . ALA A 1 162 ? -25.118 -6.365  30.025 1.00 28.84 ? 314  ALA A O   1 
ATOM   1058 C  CB  . ALA A 1 162 ? -22.691 -7.798  28.642 1.00 28.68 ? 314  ALA A CB  1 
ATOM   1059 N  N   . ALA A 1 163 ? -25.008 -5.511  27.951 1.00 28.76 ? 315  ALA A N   1 
ATOM   1060 C  CA  . ALA A 1 163 ? -26.457 -5.284  27.846 1.00 28.28 ? 315  ALA A CA  1 
ATOM   1061 C  C   . ALA A 1 163 ? -27.230 -6.584  27.644 1.00 28.32 ? 315  ALA A C   1 
ATOM   1062 O  O   . ALA A 1 163 ? -28.392 -6.695  28.047 1.00 28.79 ? 315  ALA A O   1 
ATOM   1063 C  CB  . ALA A 1 163 ? -26.768 -4.315  26.726 1.00 28.16 ? 315  ALA A CB  1 
ATOM   1064 N  N   . GLY A 1 164 ? -26.584 -7.566  27.025 1.00 28.06 ? 316  GLY A N   1 
ATOM   1065 C  CA  . GLY A 1 164 ? -27.226 -8.841  26.730 1.00 27.60 ? 316  GLY A CA  1 
ATOM   1066 C  C   . GLY A 1 164 ? -27.381 -9.064  25.239 1.00 27.48 ? 316  GLY A C   1 
ATOM   1067 O  O   . GLY A 1 164 ? -27.524 -8.111  24.462 1.00 27.30 ? 316  GLY A O   1 
ATOM   1068 N  N   . ASN A 1 165 ? -27.357 -10.335 24.850 1.00 27.47 ? 317  ASN A N   1 
ATOM   1069 C  CA  . ASN A 1 165 ? -27.365 -10.736 23.449 1.00 27.48 ? 317  ASN A CA  1 
ATOM   1070 C  C   . ASN A 1 165 ? -28.694 -11.347 23.030 1.00 27.65 ? 317  ASN A C   1 
ATOM   1071 O  O   . ASN A 1 165 ? -28.721 -12.355 22.322 1.00 27.52 ? 317  ASN A O   1 
ATOM   1072 C  CB  . ASN A 1 165 ? -26.243 -11.758 23.189 1.00 27.51 ? 317  ASN A CB  1 
ATOM   1073 C  CG  . ASN A 1 165 ? -24.861 -11.230 23.523 1.00 26.83 ? 317  ASN A CG  1 
ATOM   1074 O  OD1 . ASN A 1 165 ? -24.623 -10.022 23.579 1.00 26.45 ? 317  ASN A OD1 1 
ATOM   1075 N  ND2 . ASN A 1 165 ? -23.937 -12.146 23.742 1.00 26.71 ? 317  ASN A ND2 1 
ATOM   1076 N  N   . PHE A 1 166 ? -29.795 -10.725 23.444 1.00 28.12 ? 318  PHE A N   1 
ATOM   1077 C  CA  . PHE A 1 166 ? -31.118 -11.342 23.300 1.00 28.37 ? 318  PHE A CA  1 
ATOM   1078 C  C   . PHE A 1 166 ? -32.084 -10.609 22.375 1.00 28.87 ? 318  PHE A C   1 
ATOM   1079 O  O   . PHE A 1 166 ? -33.240 -11.013 22.256 1.00 29.00 ? 318  PHE A O   1 
ATOM   1080 C  CB  . PHE A 1 166 ? -31.750 -11.545 24.681 1.00 27.96 ? 318  PHE A CB  1 
ATOM   1081 C  CG  . PHE A 1 166 ? -30.932 -12.423 25.587 1.00 28.07 ? 318  PHE A CG  1 
ATOM   1082 C  CD1 . PHE A 1 166 ? -31.014 -13.814 25.496 1.00 27.52 ? 318  PHE A CD1 1 
ATOM   1083 C  CD2 . PHE A 1 166 ? -30.067 -11.864 26.522 1.00 26.47 ? 318  PHE A CD2 1 
ATOM   1084 C  CE1 . PHE A 1 166 ? -30.241 -14.629 26.331 1.00 26.86 ? 318  PHE A CE1 1 
ATOM   1085 C  CE2 . PHE A 1 166 ? -29.312 -12.667 27.353 1.00 26.70 ? 318  PHE A CE2 1 
ATOM   1086 C  CZ  . PHE A 1 166 ? -29.398 -14.058 27.251 1.00 26.89 ? 318  PHE A CZ  1 
ATOM   1087 N  N   . ARG A 1 167 ? -31.593 -9.568  21.698 1.00 29.60 ? 319  ARG A N   1 
ATOM   1088 C  CA  . ARG A 1 167 ? -32.428 -8.601  20.958 1.00 30.10 ? 319  ARG A CA  1 
ATOM   1089 C  C   . ARG A 1 167 ? -33.698 -8.242  21.737 1.00 30.43 ? 319  ARG A C   1 
ATOM   1090 O  O   . ARG A 1 167 ? -34.826 -8.402  21.253 1.00 30.18 ? 319  ARG A O   1 
ATOM   1091 C  CB  . ARG A 1 167 ? -32.735 -9.067  19.524 1.00 30.04 ? 319  ARG A CB  1 
ATOM   1092 C  CG  . ARG A 1 167 ? -33.121 -7.910  18.620 1.00 30.19 ? 319  ARG A CG  1 
ATOM   1093 C  CD  . ARG A 1 167 ? -33.094 -8.242  17.144 1.00 31.36 ? 319  ARG A CD  1 
ATOM   1094 N  NE  . ARG A 1 167 ? -33.557 -7.100  16.352 1.00 31.62 ? 319  ARG A NE  1 
ATOM   1095 C  CZ  . ARG A 1 167 ? -33.403 -6.970  15.036 1.00 32.41 ? 319  ARG A CZ  1 
ATOM   1096 N  NH1 . ARG A 1 167 ? -32.777 -7.912  14.333 1.00 32.40 ? 319  ARG A NH1 1 
ATOM   1097 N  NH2 . ARG A 1 167 ? -33.866 -5.885  14.419 1.00 31.85 ? 319  ARG A NH2 1 
ATOM   1098 N  N   . ASP A 1 168 ? -33.484 -7.742  22.954 1.00 31.00 ? 320  ASP A N   1 
ATOM   1099 C  CA  . ASP A 1 168 ? -34.555 -7.560  23.926 1.00 31.43 ? 320  ASP A CA  1 
ATOM   1100 C  C   . ASP A 1 168 ? -34.326 -6.283  24.740 1.00 31.74 ? 320  ASP A C   1 
ATOM   1101 O  O   . ASP A 1 168 ? -33.283 -5.646  24.622 1.00 31.73 ? 320  ASP A O   1 
ATOM   1102 C  CB  . ASP A 1 168 ? -34.622 -8.791  24.841 1.00 31.37 ? 320  ASP A CB  1 
ATOM   1103 C  CG  . ASP A 1 168 ? -35.982 -8.984  25.478 1.00 32.17 ? 320  ASP A CG  1 
ATOM   1104 O  OD1 . ASP A 1 168 ? -36.881 -8.145  25.271 1.00 32.03 ? 320  ASP A OD1 1 
ATOM   1105 O  OD2 . ASP A 1 168 ? -36.154 -9.986  26.203 1.00 34.22 ? 320  ASP A OD2 1 
ATOM   1106 N  N   . ASP A 1 169 ? -35.321 -5.908  25.542 1.00 32.14 ? 321  ASP A N   1 
ATOM   1107 C  CA  . ASP A 1 169 ? -35.202 -4.807  26.493 1.00 32.59 ? 321  ASP A CA  1 
ATOM   1108 C  C   . ASP A 1 169 ? -34.197 -5.176  27.587 1.00 32.54 ? 321  ASP A C   1 
ATOM   1109 O  O   . ASP A 1 169 ? -34.367 -6.177  28.285 1.00 32.38 ? 321  ASP A O   1 
ATOM   1110 C  CB  . ASP A 1 169 ? -36.574 -4.505  27.109 1.00 32.81 ? 321  ASP A CB  1 
ATOM   1111 C  CG  . ASP A 1 169 ? -36.609 -3.182  27.872 1.00 33.94 ? 321  ASP A CG  1 
ATOM   1112 O  OD1 . ASP A 1 169 ? -35.537 -2.640  28.224 1.00 35.28 ? 321  ASP A OD1 1 
ATOM   1113 O  OD2 . ASP A 1 169 ? -37.727 -2.681  28.122 1.00 35.06 ? 321  ASP A OD2 1 
ATOM   1114 N  N   . ALA A 1 170 ? -33.152 -4.362  27.727 1.00 32.67 ? 322  ALA A N   1 
ATOM   1115 C  CA  . ALA A 1 170 ? -32.074 -4.627  28.687 1.00 32.43 ? 322  ALA A CA  1 
ATOM   1116 C  C   . ALA A 1 170 ? -32.528 -4.539  30.146 1.00 32.67 ? 322  ALA A C   1 
ATOM   1117 O  O   . ALA A 1 170 ? -31.841 -5.029  31.042 1.00 32.45 ? 322  ALA A O   1 
ATOM   1118 C  CB  . ALA A 1 170 ? -30.920 -3.696  28.443 1.00 32.52 ? 322  ALA A CB  1 
ATOM   1119 N  N   . CYS A 1 171 ? -33.694 -3.929  30.372 1.00 32.79 ? 323  CYS A N   1 
ATOM   1120 C  CA  . CYS A 1 171 ? -34.250 -3.774  31.716 1.00 32.76 ? 323  CYS A CA  1 
ATOM   1121 C  C   . CYS A 1 171 ? -34.770 -5.084  32.299 1.00 32.10 ? 323  CYS A C   1 
ATOM   1122 O  O   . CYS A 1 171 ? -35.090 -5.152  33.486 1.00 32.12 ? 323  CYS A O   1 
ATOM   1123 C  CB  . CYS A 1 171 ? -35.349 -2.707  31.735 1.00 32.88 ? 323  CYS A CB  1 
ATOM   1124 S  SG  . CYS A 1 171 ? -34.796 -1.038  31.240 1.00 36.04 ? 323  CYS A SG  1 
ATOM   1125 N  N   . LEU A 1 172 ? -34.832 -6.122  31.468 1.00 31.30 ? 324  LEU A N   1 
ATOM   1126 C  CA  . LEU A 1 172 ? -35.269 -7.448  31.907 1.00 30.46 ? 324  LEU A CA  1 
ATOM   1127 C  C   . LEU A 1 172 ? -34.107 -8.346  32.353 1.00 30.11 ? 324  LEU A C   1 
ATOM   1128 O  O   . LEU A 1 172 ? -34.314 -9.496  32.743 1.00 30.09 ? 324  LEU A O   1 
ATOM   1129 C  CB  . LEU A 1 172 ? -36.082 -8.124  30.792 1.00 30.43 ? 324  LEU A CB  1 
ATOM   1130 C  CG  . LEU A 1 172 ? -37.393 -7.459  30.341 1.00 30.08 ? 324  LEU A CG  1 
ATOM   1131 C  CD1 . LEU A 1 172 ? -37.896 -8.083  29.047 1.00 29.24 ? 324  LEU A CD1 1 
ATOM   1132 C  CD2 . LEU A 1 172 ? -38.467 -7.525  31.419 1.00 28.19 ? 324  LEU A CD2 1 
ATOM   1133 N  N   . TYR A 1 173 ? -32.890 -7.811  32.306 1.00 29.80 ? 325  TYR A N   1 
ATOM   1134 C  CA  . TYR A 1 173 ? -31.677 -8.577  32.587 1.00 29.33 ? 325  TYR A CA  1 
ATOM   1135 C  C   . TYR A 1 173 ? -30.843 -7.893  33.663 1.00 29.36 ? 325  TYR A C   1 
ATOM   1136 O  O   . TYR A 1 173 ? -30.904 -6.676  33.819 1.00 29.03 ? 325  TYR A O   1 
ATOM   1137 C  CB  . TYR A 1 173 ? -30.857 -8.785  31.294 1.00 29.47 ? 325  TYR A CB  1 
ATOM   1138 C  CG  . TYR A 1 173 ? -31.663 -9.466  30.201 1.00 29.37 ? 325  TYR A CG  1 
ATOM   1139 C  CD1 . TYR A 1 173 ? -31.649 -10.853 30.060 1.00 28.44 ? 325  TYR A CD1 1 
ATOM   1140 C  CD2 . TYR A 1 173 ? -32.474 -8.725  29.340 1.00 28.68 ? 325  TYR A CD2 1 
ATOM   1141 C  CE1 . TYR A 1 173 ? -32.407 -11.480 29.087 1.00 28.36 ? 325  TYR A CE1 1 
ATOM   1142 C  CE2 . TYR A 1 173 ? -33.238 -9.344  28.364 1.00 28.51 ? 325  TYR A CE2 1 
ATOM   1143 C  CZ  . TYR A 1 173 ? -33.199 -10.721 28.243 1.00 29.14 ? 325  TYR A CZ  1 
ATOM   1144 O  OH  . TYR A 1 173 ? -33.957 -11.342 27.273 1.00 30.31 ? 325  TYR A OH  1 
ATOM   1145 N  N   . SER A 1 174 ? -30.082 -8.689  34.413 1.00 29.40 ? 326  SER A N   1 
ATOM   1146 C  CA  . SER A 1 174 ? -29.125 -8.173  35.391 1.00 29.79 ? 326  SER A CA  1 
ATOM   1147 C  C   . SER A 1 174 ? -27.717 -8.718  35.134 1.00 29.85 ? 326  SER A C   1 
ATOM   1148 O  O   . SER A 1 174 ? -27.575 -9.846  34.661 1.00 30.07 ? 326  SER A O   1 
ATOM   1149 C  CB  . SER A 1 174 ? -29.563 -8.510  36.815 1.00 29.45 ? 326  SER A CB  1 
ATOM   1150 O  OG  . SER A 1 174 ? -30.608 -7.655  37.220 1.00 30.21 ? 326  SER A OG  1 
ATOM   1151 N  N   . PRO A 1 175 ? -26.672 -7.929  35.464 1.00 30.17 ? 327  PRO A N   1 
ATOM   1152 C  CA  . PRO A 1 175 ? -26.745 -6.563  36.017 1.00 30.31 ? 327  PRO A CA  1 
ATOM   1153 C  C   . PRO A 1 175 ? -27.049 -5.423  35.032 1.00 30.53 ? 327  PRO A C   1 
ATOM   1154 O  O   . PRO A 1 175 ? -26.957 -4.260  35.421 1.00 30.48 ? 327  PRO A O   1 
ATOM   1155 C  CB  . PRO A 1 175 ? -25.371 -6.373  36.678 1.00 30.41 ? 327  PRO A CB  1 
ATOM   1156 C  CG  . PRO A 1 175 ? -24.463 -7.318  36.000 1.00 29.91 ? 327  PRO A CG  1 
ATOM   1157 C  CD  . PRO A 1 175 ? -25.279 -8.413  35.364 1.00 30.17 ? 327  PRO A CD  1 
ATOM   1158 N  N   . ALA A 1 176 ? -27.442 -5.750  33.797 1.00 30.76 ? 328  ALA A N   1 
ATOM   1159 C  CA  . ALA A 1 176 ? -27.770 -4.743  32.774 1.00 30.92 ? 328  ALA A CA  1 
ATOM   1160 C  C   . ALA A 1 176 ? -28.740 -3.645  33.240 1.00 31.29 ? 328  ALA A C   1 
ATOM   1161 O  O   . ALA A 1 176 ? -28.528 -2.457  32.964 1.00 30.97 ? 328  ALA A O   1 
ATOM   1162 C  CB  . ALA A 1 176 ? -28.300 -5.422  31.505 1.00 30.60 ? 328  ALA A CB  1 
ATOM   1163 N  N   . SER A 1 177 ? -29.791 -4.054  33.951 1.00 31.84 ? 329  SER A N   1 
ATOM   1164 C  CA  . SER A 1 177 ? -30.873 -3.163  34.381 1.00 32.31 ? 329  SER A CA  1 
ATOM   1165 C  C   . SER A 1 177 ? -30.507 -2.219  35.537 1.00 32.98 ? 329  SER A C   1 
ATOM   1166 O  O   . SER A 1 177 ? -31.298 -1.340  35.889 1.00 33.16 ? 329  SER A O   1 
ATOM   1167 C  CB  . SER A 1 177 ? -32.102 -3.984  34.763 1.00 32.02 ? 329  SER A CB  1 
ATOM   1168 O  OG  . SER A 1 177 ? -31.780 -4.940  35.760 1.00 31.86 ? 329  SER A OG  1 
ATOM   1169 N  N   . ALA A 1 178 ? -29.322 -2.399  36.124 1.00 33.56 ? 330  ALA A N   1 
ATOM   1170 C  CA  . ALA A 1 178 ? -28.873 -1.546  37.234 1.00 34.03 ? 330  ALA A CA  1 
ATOM   1171 C  C   . ALA A 1 178 ? -28.469 -0.156  36.722 1.00 34.39 ? 330  ALA A C   1 
ATOM   1172 O  O   . ALA A 1 178 ? -27.531 -0.040  35.935 1.00 34.61 ? 330  ALA A O   1 
ATOM   1173 C  CB  . ALA A 1 178 ? -27.727 -2.206  37.984 1.00 33.63 ? 330  ALA A CB  1 
ATOM   1174 N  N   . PRO A 1 179 ? -29.189 0.902   37.150 1.00 34.84 ? 331  PRO A N   1 
ATOM   1175 C  CA  . PRO A 1 179 ? -28.878 2.262   36.672 1.00 34.86 ? 331  PRO A CA  1 
ATOM   1176 C  C   . PRO A 1 179 ? -27.526 2.829   37.142 1.00 34.76 ? 331  PRO A C   1 
ATOM   1177 O  O   . PRO A 1 179 ? -27.035 3.790   36.547 1.00 34.94 ? 331  PRO A O   1 
ATOM   1178 C  CB  . PRO A 1 179 ? -30.053 3.110   37.186 1.00 34.80 ? 331  PRO A CB  1 
ATOM   1179 C  CG  . PRO A 1 179 ? -30.641 2.338   38.311 1.00 35.19 ? 331  PRO A CG  1 
ATOM   1180 C  CD  . PRO A 1 179 ? -30.336 0.881   38.081 1.00 35.11 ? 331  PRO A CD  1 
ATOM   1181 N  N   . GLU A 1 180 ? -26.929 2.231   38.171 1.00 34.55 ? 332  GLU A N   1 
ATOM   1182 C  CA  A GLU A 1 180 ? -25.635 2.705   38.659 0.50 34.45 ? 332  GLU A CA  1 
ATOM   1183 C  CA  B GLU A 1 180 ? -25.634 2.655   38.708 0.50 34.54 ? 332  GLU A CA  1 
ATOM   1184 C  C   . GLU A 1 180 ? -24.462 2.010   37.962 1.00 34.40 ? 332  GLU A C   1 
ATOM   1185 O  O   . GLU A 1 180 ? -23.293 2.366   38.174 1.00 34.60 ? 332  GLU A O   1 
ATOM   1186 C  CB  A GLU A 1 180 ? -25.538 2.586   40.186 0.50 34.49 ? 332  GLU A CB  1 
ATOM   1187 C  CB  B GLU A 1 180 ? -25.544 2.308   40.200 0.50 34.61 ? 332  GLU A CB  1 
ATOM   1188 C  CG  A GLU A 1 180 ? -26.276 3.693   40.963 0.50 34.41 ? 332  GLU A CG  1 
ATOM   1189 C  CG  B GLU A 1 180 ? -26.662 2.885   41.074 0.50 34.98 ? 332  GLU A CG  1 
ATOM   1190 C  CD  A GLU A 1 180 ? -25.554 5.043   40.956 0.50 34.08 ? 332  GLU A CD  1 
ATOM   1191 C  CD  B GLU A 1 180 ? -27.980 2.141   40.930 0.50 35.34 ? 332  GLU A CD  1 
ATOM   1192 O  OE1 A GLU A 1 180 ? -25.263 5.575   39.861 0.50 33.63 ? 332  GLU A OE1 1 
ATOM   1193 O  OE1 B GLU A 1 180 ? -27.964 0.976   40.477 0.50 35.23 ? 332  GLU A OE1 1 
ATOM   1194 O  OE2 A GLU A 1 180 ? -25.296 5.584   42.055 0.50 33.83 ? 332  GLU A OE2 1 
ATOM   1195 O  OE2 B GLU A 1 180 ? -29.033 2.725   41.272 0.50 35.56 ? 332  GLU A OE2 1 
ATOM   1196 N  N   . VAL A 1 181 ? -24.782 1.045   37.104 1.00 33.98 ? 333  VAL A N   1 
ATOM   1197 C  CA  . VAL A 1 181 ? -23.796 0.307   36.323 1.00 33.35 ? 333  VAL A CA  1 
ATOM   1198 C  C   . VAL A 1 181 ? -23.817 0.803   34.874 1.00 32.82 ? 333  VAL A C   1 
ATOM   1199 O  O   . VAL A 1 181 ? -24.890 1.101   34.332 1.00 33.00 ? 333  VAL A O   1 
ATOM   1200 C  CB  . VAL A 1 181 ? -24.101 -1.218  36.382 1.00 33.69 ? 333  VAL A CB  1 
ATOM   1201 C  CG1 . VAL A 1 181 ? -23.182 -2.019  35.455 1.00 33.94 ? 333  VAL A CG1 1 
ATOM   1202 C  CG2 . VAL A 1 181 ? -23.979 -1.725  37.815 1.00 33.39 ? 333  VAL A CG2 1 
ATOM   1203 N  N   . ILE A 1 182 ? -22.639 0.899   34.256 1.00 31.95 ? 334  ILE A N   1 
ATOM   1204 C  CA  . ILE A 1 182 ? -22.532 1.282   32.844 1.00 31.24 ? 334  ILE A CA  1 
ATOM   1205 C  C   . ILE A 1 182 ? -22.849 0.087   31.934 1.00 30.77 ? 334  ILE A C   1 
ATOM   1206 O  O   . ILE A 1 182 ? -22.065 -0.857  31.837 1.00 30.30 ? 334  ILE A O   1 
ATOM   1207 C  CB  . ILE A 1 182 ? -21.144 1.887   32.497 1.00 31.31 ? 334  ILE A CB  1 
ATOM   1208 C  CG1 . ILE A 1 182 ? -20.801 3.036   33.458 1.00 31.42 ? 334  ILE A CG1 1 
ATOM   1209 C  CG2 . ILE A 1 182 ? -21.108 2.360   31.036 1.00 30.83 ? 334  ILE A CG2 1 
ATOM   1210 C  CD1 . ILE A 1 182 ? -19.360 3.517   33.382 1.00 31.36 ? 334  ILE A CD1 1 
ATOM   1211 N  N   . THR A 1 183 ? -24.012 0.148   31.289 1.00 30.26 ? 335  THR A N   1 
ATOM   1212 C  CA  . THR A 1 183 ? -24.544 -0.937  30.468 1.00 30.20 ? 335  THR A CA  1 
ATOM   1213 C  C   . THR A 1 183 ? -24.264 -0.704  28.984 1.00 30.21 ? 335  THR A C   1 
ATOM   1214 O  O   . THR A 1 183 ? -24.665 0.312   28.411 1.00 30.13 ? 335  THR A O   1 
ATOM   1215 C  CB  . THR A 1 183 ? -26.054 -1.109  30.710 1.00 30.08 ? 335  THR A CB  1 
ATOM   1216 O  OG1 . THR A 1 183 ? -26.272 -1.299  32.109 1.00 30.66 ? 335  THR A OG1 1 
ATOM   1217 C  CG2 . THR A 1 183 ? -26.608 -2.314  29.965 1.00 29.61 ? 335  THR A CG2 1 
ATOM   1218 N  N   . VAL A 1 184 ? -23.576 -1.661  28.369 1.00 30.17 ? 336  VAL A N   1 
ATOM   1219 C  CA  . VAL A 1 184 ? -23.044 -1.484  27.017 1.00 29.82 ? 336  VAL A CA  1 
ATOM   1220 C  C   . VAL A 1 184 ? -23.674 -2.444  26.006 1.00 29.97 ? 336  VAL A C   1 
ATOM   1221 O  O   . VAL A 1 184 ? -23.578 -3.668  26.152 1.00 30.10 ? 336  VAL A O   1 
ATOM   1222 C  CB  . VAL A 1 184 ? -21.508 -1.649  26.997 1.00 29.51 ? 336  VAL A CB  1 
ATOM   1223 C  CG1 . VAL A 1 184 ? -20.932 -1.109  25.697 1.00 29.49 ? 336  VAL A CG1 1 
ATOM   1224 C  CG2 . VAL A 1 184 ? -20.881 -0.957  28.191 1.00 28.88 ? 336  VAL A CG2 1 
ATOM   1225 N  N   . GLY A 1 185 ? -24.321 -1.875  24.993 1.00 30.07 ? 337  GLY A N   1 
ATOM   1226 C  CA  . GLY A 1 185 ? -24.807 -2.633  23.838 1.00 30.27 ? 337  GLY A CA  1 
ATOM   1227 C  C   . GLY A 1 185 ? -23.729 -2.763  22.770 1.00 30.24 ? 337  GLY A C   1 
ATOM   1228 O  O   . GLY A 1 185 ? -22.727 -2.060  22.812 1.00 30.27 ? 337  GLY A O   1 
ATOM   1229 N  N   . ALA A 1 186 ? -23.940 -3.663  21.812 1.00 30.38 ? 338  ALA A N   1 
ATOM   1230 C  CA  . ALA A 1 186 ? -22.942 -3.959  20.783 1.00 30.19 ? 338  ALA A CA  1 
ATOM   1231 C  C   . ALA A 1 186 ? -23.288 -3.376  19.402 1.00 30.38 ? 338  ALA A C   1 
ATOM   1232 O  O   . ALA A 1 186 ? -24.400 -3.536  18.908 1.00 30.31 ? 338  ALA A O   1 
ATOM   1233 C  CB  . ALA A 1 186 ? -22.741 -5.455  20.683 1.00 29.64 ? 338  ALA A CB  1 
ATOM   1234 N  N   . THR A 1 187 ? -22.316 -2.712  18.783 1.00 30.95 ? 339  THR A N   1 
ATOM   1235 C  CA  . THR A 1 187 ? -22.434 -2.270  17.389 1.00 31.20 ? 339  THR A CA  1 
ATOM   1236 C  C   . THR A 1 187 ? -21.360 -2.926  16.521 1.00 31.36 ? 339  THR A C   1 
ATOM   1237 O  O   . THR A 1 187 ? -20.317 -3.352  17.029 1.00 31.31 ? 339  THR A O   1 
ATOM   1238 C  CB  . THR A 1 187 ? -22.338 -0.720  17.239 1.00 31.24 ? 339  THR A CB  1 
ATOM   1239 O  OG1 . THR A 1 187 ? -21.206 -0.228  17.967 1.00 31.60 ? 339  THR A OG1 1 
ATOM   1240 C  CG2 . THR A 1 187 ? -23.597 -0.038  17.733 1.00 30.98 ? 339  THR A CG2 1 
ATOM   1241 N  N   . ASN A 1 188 ? -21.624 -3.006  15.216 1.00 31.71 ? 340  ASN A N   1 
ATOM   1242 C  CA  . ASN A 1 188 ? -20.684 -3.597  14.255 1.00 31.62 ? 340  ASN A CA  1 
ATOM   1243 C  C   . ASN A 1 188 ? -19.833 -2.555  13.514 1.00 31.79 ? 340  ASN A C   1 
ATOM   1244 O  O   . ASN A 1 188 ? -19.836 -1.377  13.879 1.00 31.92 ? 340  ASN A O   1 
ATOM   1245 C  CB  . ASN A 1 188 ? -21.416 -4.536  13.282 1.00 31.82 ? 340  ASN A CB  1 
ATOM   1246 C  CG  . ASN A 1 188 ? -22.531 -3.846  12.494 1.00 31.36 ? 340  ASN A CG  1 
ATOM   1247 O  OD1 . ASN A 1 188 ? -22.417 -2.689  12.100 1.00 32.18 ? 340  ASN A OD1 1 
ATOM   1248 N  ND2 . ASN A 1 188 ? -23.610 -4.574  12.252 1.00 30.67 ? 340  ASN A ND2 1 
ATOM   1249 N  N   . ALA A 1 189 ? -19.092 -2.994  12.497 1.00 31.90 ? 341  ALA A N   1 
ATOM   1250 C  CA  . ALA A 1 189 ? -18.207 -2.112  11.722 1.00 32.23 ? 341  ALA A CA  1 
ATOM   1251 C  C   . ALA A 1 189 ? -18.946 -1.031  10.910 1.00 32.57 ? 341  ALA A C   1 
ATOM   1252 O  O   . ALA A 1 189 ? -18.339 -0.058  10.463 1.00 32.55 ? 341  ALA A O   1 
ATOM   1253 C  CB  . ALA A 1 189 ? -17.290 -2.931  10.821 1.00 32.13 ? 341  ALA A CB  1 
ATOM   1254 N  N   . GLN A 1 190 ? -20.254 -1.215  10.734 1.00 33.15 ? 342  GLN A N   1 
ATOM   1255 C  CA  . GLN A 1 190 ? -21.125 -0.237  10.080 1.00 33.28 ? 342  GLN A CA  1 
ATOM   1256 C  C   . GLN A 1 190 ? -21.787 0.694   11.110 1.00 33.11 ? 342  GLN A C   1 
ATOM   1257 O  O   . GLN A 1 190 ? -22.658 1.498   10.757 1.00 33.11 ? 342  GLN A O   1 
ATOM   1258 C  CB  . GLN A 1 190 ? -22.198 -0.953  9.243  1.00 33.53 ? 342  GLN A CB  1 
ATOM   1259 C  CG  . GLN A 1 190 ? -21.673 -1.818  8.074  1.00 35.24 ? 342  GLN A CG  1 
ATOM   1260 C  CD  . GLN A 1 190 ? -20.954 -3.090  8.532  1.00 38.19 ? 342  GLN A CD  1 
ATOM   1261 O  OE1 . GLN A 1 190 ? -21.482 -3.869  9.337  1.00 39.62 ? 342  GLN A OE1 1 
ATOM   1262 N  NE2 . GLN A 1 190 ? -19.739 -3.301  8.023  1.00 38.51 ? 342  GLN A NE2 1 
ATOM   1263 N  N   . ASP A 1 191 ? -21.362 0.577   12.373 1.00 32.95 ? 343  ASP A N   1 
ATOM   1264 C  CA  . ASP A 1 191 ? -21.935 1.307   13.528 1.00 32.90 ? 343  ASP A CA  1 
ATOM   1265 C  C   . ASP A 1 191 ? -23.399 0.965   13.794 1.00 32.64 ? 343  ASP A C   1 
ATOM   1266 O  O   . ASP A 1 191 ? -24.137 1.741   14.406 1.00 32.31 ? 343  ASP A O   1 
ATOM   1267 C  CB  . ASP A 1 191 ? -21.764 2.827   13.394 1.00 33.15 ? 343  ASP A CB  1 
ATOM   1268 C  CG  . ASP A 1 191 ? -20.340 3.281   13.633 1.00 33.86 ? 343  ASP A CG  1 
ATOM   1269 O  OD1 . ASP A 1 191 ? -19.734 2.884   14.655 1.00 34.32 ? 343  ASP A OD1 1 
ATOM   1270 O  OD2 . ASP A 1 191 ? -19.831 4.050   12.792 1.00 35.48 ? 343  ASP A OD2 1 
ATOM   1271 N  N   . GLN A 1 192 ? -23.807 -0.208  13.332 1.00 32.57 ? 344  GLN A N   1 
ATOM   1272 C  CA  . GLN A 1 192 ? -25.176 -0.642  13.480 1.00 32.66 ? 344  GLN A CA  1 
ATOM   1273 C  C   . GLN A 1 192 ? -25.271 -1.713  14.571 1.00 33.27 ? 344  GLN A C   1 
ATOM   1274 O  O   . GLN A 1 192 ? -24.281 -2.394  14.862 1.00 33.45 ? 344  GLN A O   1 
ATOM   1275 C  CB  . GLN A 1 192 ? -25.725 -1.123  12.134 1.00 32.48 ? 344  GLN A CB  1 
ATOM   1276 C  CG  . GLN A 1 192 ? -25.648 -0.063  11.021 1.00 31.27 ? 344  GLN A CG  1 
ATOM   1277 C  CD  . GLN A 1 192 ? -26.106 1.320   11.478 1.00 29.73 ? 344  GLN A CD  1 
ATOM   1278 O  OE1 . GLN A 1 192 ? -27.154 1.458   12.102 1.00 28.79 ? 344  GLN A OE1 1 
ATOM   1279 N  NE2 . GLN A 1 192 ? -25.317 2.345   11.164 1.00 27.99 ? 344  GLN A NE2 1 
ATOM   1280 N  N   . PRO A 1 193 ? -26.453 -1.851  15.194 1.00 33.58 ? 345  PRO A N   1 
ATOM   1281 C  CA  . PRO A 1 193 ? -26.566 -2.805  16.290 1.00 34.05 ? 345  PRO A CA  1 
ATOM   1282 C  C   . PRO A 1 193 ? -26.288 -4.232  15.816 1.00 34.67 ? 345  PRO A C   1 
ATOM   1283 O  O   . PRO A 1 193 ? -26.835 -4.662  14.800 1.00 34.85 ? 345  PRO A O   1 
ATOM   1284 C  CB  . PRO A 1 193 ? -28.025 -2.656  16.733 1.00 33.96 ? 345  PRO A CB  1 
ATOM   1285 C  CG  . PRO A 1 193 ? -28.468 -1.331  16.207 1.00 33.53 ? 345  PRO A CG  1 
ATOM   1286 C  CD  . PRO A 1 193 ? -27.733 -1.167  14.925 1.00 33.34 ? 345  PRO A CD  1 
ATOM   1287 N  N   . VAL A 1 194 ? -25.436 -4.951  16.544 1.00 35.20 ? 346  VAL A N   1 
ATOM   1288 C  CA  . VAL A 1 194 ? -25.055 -6.312  16.167 1.00 35.70 ? 346  VAL A CA  1 
ATOM   1289 C  C   . VAL A 1 194 ? -26.290 -7.213  16.057 1.00 36.67 ? 346  VAL A C   1 
ATOM   1290 O  O   . VAL A 1 194 ? -27.111 -7.271  16.974 1.00 36.82 ? 346  VAL A O   1 
ATOM   1291 C  CB  . VAL A 1 194 ? -23.984 -6.907  17.139 1.00 35.26 ? 346  VAL A CB  1 
ATOM   1292 C  CG1 . VAL A 1 194 ? -23.707 -8.357  16.830 1.00 34.37 ? 346  VAL A CG1 1 
ATOM   1293 C  CG2 . VAL A 1 194 ? -22.692 -6.127  17.038 1.00 34.58 ? 346  VAL A CG2 1 
ATOM   1294 N  N   . THR A 1 195 ? -26.416 -7.881  14.913 1.00 37.94 ? 347  THR A N   1 
ATOM   1295 C  CA  . THR A 1 195 ? -27.495 -8.836  14.655 1.00 39.34 ? 347  THR A CA  1 
ATOM   1296 C  C   . THR A 1 195 ? -26.884 -10.231 14.707 1.00 40.35 ? 347  THR A C   1 
ATOM   1297 O  O   . THR A 1 195 ? -26.409 -10.748 13.703 1.00 40.72 ? 347  THR A O   1 
ATOM   1298 C  CB  . THR A 1 195 ? -28.170 -8.559  13.291 1.00 39.24 ? 347  THR A CB  1 
ATOM   1299 O  OG1 . THR A 1 195 ? -28.626 -7.202  13.255 1.00 39.05 ? 347  THR A OG1 1 
ATOM   1300 C  CG2 . THR A 1 195 ? -29.356 -9.472  13.067 1.00 39.41 ? 347  THR A CG2 1 
ATOM   1301 N  N   . LEU A 1 196 ? -26.885 -10.819 15.902 1.00 41.85 ? 348  LEU A N   1 
ATOM   1302 C  CA  . LEU A 1 196 ? -26.107 -12.033 16.203 1.00 42.75 ? 348  LEU A CA  1 
ATOM   1303 C  C   . LEU A 1 196 ? -26.641 -13.281 15.495 1.00 43.16 ? 348  LEU A C   1 
ATOM   1304 O  O   . LEU A 1 196 ? -25.964 -14.325 15.480 1.00 43.57 ? 348  LEU A O   1 
ATOM   1305 C  CB  . LEU A 1 196 ? -25.960 -12.244 17.729 1.00 42.99 ? 348  LEU A CB  1 
ATOM   1306 C  CG  . LEU A 1 196 ? -25.079 -11.234 18.510 1.00 43.18 ? 348  LEU A CG  1 
ATOM   1307 C  CD1 . LEU A 1 196 ? -25.576 -11.026 19.914 1.00 43.06 ? 348  LEU A CD1 1 
ATOM   1308 C  CD2 . LEU A 1 196 ? -23.555 -11.565 18.524 1.00 42.27 ? 348  LEU A CD2 1 
ATOM   1309 N  N   . GLY A 1 197 ? -27.835 -13.145 14.901 1.00 43.19 ? 349  GLY A N   1 
ATOM   1310 C  CA  . GLY A 1 197 ? -28.393 -14.113 13.952 1.00 42.89 ? 349  GLY A CA  1 
ATOM   1311 C  C   . GLY A 1 197 ? -29.903 -14.154 14.031 1.00 43.12 ? 349  GLY A C   1 
ATOM   1312 O  O   . GLY A 1 197 ? -30.625 -13.367 13.393 1.00 42.94 ? 349  GLY A O   1 
ATOM   1313 N  N   . THR A 1 198 ? -30.378 -15.097 14.831 1.00 43.06 ? 350  THR A N   1 
ATOM   1314 C  CA  . THR A 1 198 ? -31.763 -15.132 15.273 1.00 42.30 ? 350  THR A CA  1 
ATOM   1315 C  C   . THR A 1 198 ? -32.031 -13.957 16.242 1.00 41.49 ? 350  THR A C   1 
ATOM   1316 O  O   . THR A 1 198 ? -33.148 -13.436 16.318 1.00 41.49 ? 350  THR A O   1 
ATOM   1317 C  CB  . THR A 1 198 ? -32.060 -16.492 15.966 1.00 42.77 ? 350  THR A CB  1 
ATOM   1318 O  OG1 . THR A 1 198 ? -31.004 -16.810 16.886 1.00 42.87 ? 350  THR A OG1 1 
ATOM   1319 C  CG2 . THR A 1 198 ? -32.166 -17.622 14.929 1.00 43.06 ? 350  THR A CG2 1 
ATOM   1320 N  N   . LEU A 1 199 ? -30.984 -13.543 16.963 1.00 40.09 ? 351  LEU A N   1 
ATOM   1321 C  CA  . LEU A 1 199 ? -31.076 -12.505 17.990 1.00 38.70 ? 351  LEU A CA  1 
ATOM   1322 C  C   . LEU A 1 199 ? -30.138 -11.313 17.719 1.00 37.64 ? 351  LEU A C   1 
ATOM   1323 O  O   . LEU A 1 199 ? -30.021 -10.859 16.582 1.00 37.54 ? 351  LEU A O   1 
ATOM   1324 C  CB  . LEU A 1 199 ? -30.791 -13.115 19.363 1.00 38.66 ? 351  LEU A CB  1 
ATOM   1325 C  CG  . LEU A 1 199 ? -31.648 -14.306 19.800 1.00 38.95 ? 351  LEU A CG  1 
ATOM   1326 C  CD1 . LEU A 1 199 ? -30.906 -15.155 20.834 1.00 39.01 ? 351  LEU A CD1 1 
ATOM   1327 C  CD2 . LEU A 1 199 ? -33.003 -13.849 20.328 1.00 38.83 ? 351  LEU A CD2 1 
ATOM   1328 N  N   . GLY A 1 200 ? -29.481 -10.805 18.762 1.00 36.39 ? 352  GLY A N   1 
ATOM   1329 C  CA  . GLY A 1 200 ? -28.616 -9.635  18.630 1.00 34.90 ? 352  GLY A CA  1 
ATOM   1330 C  C   . GLY A 1 200 ? -28.477 -8.843  19.911 1.00 34.11 ? 352  GLY A C   1 
ATOM   1331 O  O   . GLY A 1 200 ? -28.807 -9.336  20.985 1.00 34.13 ? 352  GLY A O   1 
ATOM   1332 N  N   . THR A 1 201 ? -27.992 -7.607  19.803 1.00 33.27 ? 353  THR A N   1 
ATOM   1333 C  CA  . THR A 1 201 ? -27.796 -6.765  20.982 1.00 32.49 ? 353  THR A CA  1 
ATOM   1334 C  C   . THR A 1 201 ? -29.110 -6.328  21.633 1.00 32.28 ? 353  THR A C   1 
ATOM   1335 O  O   . THR A 1 201 ? -30.089 -6.039  20.946 1.00 31.99 ? 353  THR A O   1 
ATOM   1336 C  CB  . THR A 1 201 ? -26.888 -5.523  20.688 1.00 32.52 ? 353  THR A CB  1 
ATOM   1337 O  OG1 . THR A 1 201 ? -26.741 -4.725  21.875 1.00 31.95 ? 353  THR A OG1 1 
ATOM   1338 C  CG2 . THR A 1 201 ? -27.449 -4.662  19.567 1.00 31.92 ? 353  THR A CG2 1 
ATOM   1339 N  N   . ASN A 1 202 ? -29.114 -6.296  22.965 1.00 32.11 ? 354  ASN A N   1 
ATOM   1340 C  CA  . ASN A 1 202 ? -30.197 -5.674  23.723 1.00 31.84 ? 354  ASN A CA  1 
ATOM   1341 C  C   . ASN A 1 202 ? -30.221 -4.154  23.531 1.00 32.07 ? 354  ASN A C   1 
ATOM   1342 O  O   . ASN A 1 202 ? -29.234 -3.544  23.099 1.00 31.70 ? 354  ASN A O   1 
ATOM   1343 C  CB  . ASN A 1 202 ? -30.108 -6.026  25.215 1.00 31.53 ? 354  ASN A CB  1 
ATOM   1344 C  CG  . ASN A 1 202 ? -30.593 -7.439  25.521 1.00 31.56 ? 354  ASN A CG  1 
ATOM   1345 O  OD1 . ASN A 1 202 ? -31.077 -8.157  24.638 1.00 31.71 ? 354  ASN A OD1 1 
ATOM   1346 N  ND2 . ASN A 1 202 ? -30.452 -7.848  26.779 1.00 30.14 ? 354  ASN A ND2 1 
ATOM   1347 N  N   . PHE A 1 203 ? -31.357 -3.552  23.864 1.00 32.34 ? 355  PHE A N   1 
ATOM   1348 C  CA  . PHE A 1 203 ? -31.596 -2.137  23.614 1.00 32.98 ? 355  PHE A CA  1 
ATOM   1349 C  C   . PHE A 1 203 ? -32.421 -1.546  24.761 1.00 33.36 ? 355  PHE A C   1 
ATOM   1350 O  O   . PHE A 1 203 ? -32.624 -2.203  25.788 1.00 33.45 ? 355  PHE A O   1 
ATOM   1351 C  CB  . PHE A 1 203 ? -32.327 -1.964  22.270 1.00 32.76 ? 355  PHE A CB  1 
ATOM   1352 C  CG  . PHE A 1 203 ? -33.392 -3.001  22.025 1.00 32.58 ? 355  PHE A CG  1 
ATOM   1353 C  CD1 . PHE A 1 203 ? -33.169 -4.046  21.137 1.00 32.76 ? 355  PHE A CD1 1 
ATOM   1354 C  CD2 . PHE A 1 203 ? -34.609 -2.949  22.705 1.00 32.41 ? 355  PHE A CD2 1 
ATOM   1355 C  CE1 . PHE A 1 203 ? -34.149 -5.020  20.910 1.00 32.73 ? 355  PHE A CE1 1 
ATOM   1356 C  CE2 . PHE A 1 203 ? -35.593 -3.920  22.495 1.00 32.65 ? 355  PHE A CE2 1 
ATOM   1357 C  CZ  . PHE A 1 203 ? -35.361 -4.959  21.591 1.00 32.71 ? 355  PHE A CZ  1 
ATOM   1358 N  N   . GLY A 1 204 ? -32.879 -0.307  24.585 1.00 33.94 ? 356  GLY A N   1 
ATOM   1359 C  CA  . GLY A 1 204 ? -33.803 0.319   25.529 1.00 34.46 ? 356  GLY A CA  1 
ATOM   1360 C  C   . GLY A 1 204 ? -33.151 1.295   26.485 1.00 34.84 ? 356  GLY A C   1 
ATOM   1361 O  O   . GLY A 1 204 ? -31.948 1.548   26.406 1.00 34.91 ? 356  GLY A O   1 
ATOM   1362 N  N   . ARG A 1 205 ? -33.956 1.828   27.400 1.00 35.26 ? 357  ARG A N   1 
ATOM   1363 C  CA  . ARG A 1 205 ? -33.529 2.871   28.340 1.00 35.82 ? 357  ARG A CA  1 
ATOM   1364 C  C   . ARG A 1 205 ? -32.433 2.443   29.323 1.00 35.73 ? 357  ARG A C   1 
ATOM   1365 O  O   . ARG A 1 205 ? -31.698 3.298   29.836 1.00 35.87 ? 357  ARG A O   1 
ATOM   1366 C  CB  . ARG A 1 205 ? -34.735 3.405   29.122 1.00 36.04 ? 357  ARG A CB  1 
ATOM   1367 C  CG  . ARG A 1 205 ? -35.324 2.404   30.100 1.00 37.15 ? 357  ARG A CG  1 
ATOM   1368 C  CD  . ARG A 1 205 ? -36.718 2.787   30.537 1.00 39.37 ? 357  ARG A CD  1 
ATOM   1369 N  NE  . ARG A 1 205 ? -37.389 1.648   31.157 1.00 41.98 ? 357  ARG A NE  1 
ATOM   1370 C  CZ  . ARG A 1 205 ? -37.303 1.330   32.449 1.00 43.44 ? 357  ARG A CZ  1 
ATOM   1371 N  NH1 . ARG A 1 205 ? -36.569 2.066   33.282 1.00 43.64 ? 357  ARG A NH1 1 
ATOM   1372 N  NH2 . ARG A 1 205 ? -37.952 0.266   32.911 1.00 43.64 ? 357  ARG A NH2 1 
ATOM   1373 N  N   . CYS A 1 206 ? -32.332 1.136   29.588 1.00 35.41 ? 358  CYS A N   1 
ATOM   1374 C  CA  . CYS A 1 206 ? -31.319 0.609   30.515 1.00 35.28 ? 358  CYS A CA  1 
ATOM   1375 C  C   . CYS A 1 206 ? -29.918 0.521   29.893 1.00 35.08 ? 358  CYS A C   1 
ATOM   1376 O  O   . CYS A 1 206 ? -28.932 0.359   30.606 1.00 35.21 ? 358  CYS A O   1 
ATOM   1377 C  CB  . CYS A 1 206 ? -31.738 -0.753  31.083 1.00 35.25 ? 358  CYS A CB  1 
ATOM   1378 S  SG  . CYS A 1 206 ? -33.080 -0.680  32.302 1.00 35.11 ? 358  CYS A SG  1 
ATOM   1379 N  N   . VAL A 1 207 ? -29.839 0.616   28.569 1.00 34.85 ? 359  VAL A N   1 
ATOM   1380 C  CA  . VAL A 1 207 ? -28.552 0.677   27.870 1.00 34.85 ? 359  VAL A CA  1 
ATOM   1381 C  C   . VAL A 1 207 ? -28.025 2.114   27.941 1.00 35.10 ? 359  VAL A C   1 
ATOM   1382 O  O   . VAL A 1 207 ? -28.767 3.068   27.709 1.00 35.09 ? 359  VAL A O   1 
ATOM   1383 C  CB  . VAL A 1 207 ? -28.665 0.174   26.403 1.00 34.59 ? 359  VAL A CB  1 
ATOM   1384 C  CG1 . VAL A 1 207 ? -27.356 0.358   25.647 1.00 34.23 ? 359  VAL A CG1 1 
ATOM   1385 C  CG2 . VAL A 1 207 ? -29.077 -1.295  26.378 1.00 34.38 ? 359  VAL A CG2 1 
ATOM   1386 N  N   . ASP A 1 208 ? -26.756 2.257   28.307 1.00 35.21 ? 360  ASP A N   1 
ATOM   1387 C  CA  . ASP A 1 208 ? -26.127 3.564   28.456 1.00 35.67 ? 360  ASP A CA  1 
ATOM   1388 C  C   . ASP A 1 208 ? -25.457 4.022   27.166 1.00 35.43 ? 360  ASP A C   1 
ATOM   1389 O  O   . ASP A 1 208 ? -25.526 5.197   26.801 1.00 35.58 ? 360  ASP A O   1 
ATOM   1390 C  CB  . ASP A 1 208 ? -25.107 3.526   29.590 1.00 36.13 ? 360  ASP A CB  1 
ATOM   1391 C  CG  . ASP A 1 208 ? -25.755 3.325   30.934 1.00 37.13 ? 360  ASP A CG  1 
ATOM   1392 O  OD1 . ASP A 1 208 ? -26.378 4.272   31.432 1.00 40.03 ? 360  ASP A OD1 1 
ATOM   1393 O  OD2 . ASP A 1 208 ? -25.653 2.224   31.496 1.00 39.32 ? 360  ASP A OD2 1 
ATOM   1394 N  N   . LEU A 1 209 ? -24.812 3.084   26.483 1.00 35.05 ? 361  LEU A N   1 
ATOM   1395 C  CA  . LEU A 1 209 ? -24.134 3.362   25.225 1.00 34.80 ? 361  LEU A CA  1 
ATOM   1396 C  C   . LEU A 1 209 ? -23.836 2.065   24.478 1.00 34.38 ? 361  LEU A C   1 
ATOM   1397 O  O   . LEU A 1 209 ? -24.086 0.972   24.993 1.00 34.48 ? 361  LEU A O   1 
ATOM   1398 C  CB  . LEU A 1 209 ? -22.851 4.188   25.453 1.00 34.70 ? 361  LEU A CB  1 
ATOM   1399 C  CG  . LEU A 1 209 ? -21.571 3.596   26.052 1.00 35.27 ? 361  LEU A CG  1 
ATOM   1400 C  CD1 . LEU A 1 209 ? -20.458 4.632   26.001 1.00 35.42 ? 361  LEU A CD1 1 
ATOM   1401 C  CD2 . LEU A 1 209 ? -21.747 3.092   27.474 1.00 34.69 ? 361  LEU A CD2 1 
ATOM   1402 N  N   . PHE A 1 210 ? -23.325 2.203   23.256 1.00 33.77 ? 362  PHE A N   1 
ATOM   1403 C  CA  . PHE A 1 210 ? -22.882 1.067   22.459 1.00 32.91 ? 362  PHE A CA  1 
ATOM   1404 C  C   . PHE A 1 210 ? -21.372 1.145   22.244 1.00 32.83 ? 362  PHE A C   1 
ATOM   1405 O  O   . PHE A 1 210 ? -20.778 2.209   22.356 1.00 33.11 ? 362  PHE A O   1 
ATOM   1406 C  CB  . PHE A 1 210 ? -23.661 1.000   21.138 1.00 32.42 ? 362  PHE A CB  1 
ATOM   1407 C  CG  . PHE A 1 210 ? -25.141 0.723   21.320 1.00 31.30 ? 362  PHE A CG  1 
ATOM   1408 C  CD1 . PHE A 1 210 ? -25.659 -0.546  21.085 1.00 30.12 ? 362  PHE A CD1 1 
ATOM   1409 C  CD2 . PHE A 1 210 ? -26.010 1.730   21.734 1.00 30.88 ? 362  PHE A CD2 1 
ATOM   1410 C  CE1 . PHE A 1 210 ? -27.011 -0.819  21.268 1.00 29.54 ? 362  PHE A CE1 1 
ATOM   1411 C  CE2 . PHE A 1 210 ? -27.371 1.471   21.916 1.00 30.54 ? 362  PHE A CE2 1 
ATOM   1412 C  CZ  . PHE A 1 210 ? -27.870 0.188   21.683 1.00 30.52 ? 362  PHE A CZ  1 
ATOM   1413 N  N   . ALA A 1 211 ? -20.745 0.005   21.989 1.00 32.76 ? 363  ALA A N   1 
ATOM   1414 C  CA  . ALA A 1 211 ? -19.328 -0.040  21.637 1.00 32.36 ? 363  ALA A CA  1 
ATOM   1415 C  C   . ALA A 1 211 ? -19.113 -1.221  20.686 1.00 32.05 ? 363  ALA A C   1 
ATOM   1416 O  O   . ALA A 1 211 ? -19.996 -2.082  20.585 1.00 32.08 ? 363  ALA A O   1 
ATOM   1417 C  CB  . ALA A 1 211 ? -18.463 -0.172  22.892 1.00 32.32 ? 363  ALA A CB  1 
ATOM   1418 N  N   . PRO A 1 212 ? -17.972 -1.248  19.957 1.00 31.72 ? 364  PRO A N   1 
ATOM   1419 C  CA  . PRO A 1 212 ? -17.677 -2.357  19.040 1.00 31.48 ? 364  PRO A CA  1 
ATOM   1420 C  C   . PRO A 1 212 ? -17.853 -3.733  19.689 1.00 31.23 ? 364  PRO A C   1 
ATOM   1421 O  O   . PRO A 1 212 ? -17.234 -4.018  20.713 1.00 31.33 ? 364  PRO A O   1 
ATOM   1422 C  CB  . PRO A 1 212 ? -16.209 -2.120  18.667 1.00 31.50 ? 364  PRO A CB  1 
ATOM   1423 C  CG  . PRO A 1 212 ? -16.019 -0.660  18.795 1.00 31.75 ? 364  PRO A CG  1 
ATOM   1424 C  CD  . PRO A 1 212 ? -16.909 -0.219  19.927 1.00 31.76 ? 364  PRO A CD  1 
ATOM   1425 N  N   . GLY A 1 213 ? -18.701 -4.567  19.088 1.00 31.20 ? 365  GLY A N   1 
ATOM   1426 C  CA  . GLY A 1 213 ? -19.053 -5.871  19.650 1.00 30.59 ? 365  GLY A CA  1 
ATOM   1427 C  C   . GLY A 1 213 ? -19.171 -6.999  18.642 1.00 30.57 ? 365  GLY A C   1 
ATOM   1428 O  O   . GLY A 1 213 ? -19.652 -8.074  18.982 1.00 30.37 ? 365  GLY A O   1 
ATOM   1429 N  N   . GLU A 1 214 ? -18.750 -6.757  17.400 1.00 30.59 ? 366  GLU A N   1 
ATOM   1430 C  CA  . GLU A 1 214 ? -18.728 -7.798  16.365 1.00 30.63 ? 366  GLU A CA  1 
ATOM   1431 C  C   . GLU A 1 214 ? -17.339 -7.909  15.771 1.00 30.40 ? 366  GLU A C   1 
ATOM   1432 O  O   . GLU A 1 214 ? -16.673 -6.895  15.574 1.00 30.60 ? 366  GLU A O   1 
ATOM   1433 C  CB  . GLU A 1 214 ? -19.734 -7.496  15.243 1.00 30.60 ? 366  GLU A CB  1 
ATOM   1434 C  CG  . GLU A 1 214 ? -19.902 -8.634  14.232 1.00 30.70 ? 366  GLU A CG  1 
ATOM   1435 C  CD  . GLU A 1 214 ? -20.870 -8.299  13.118 1.00 31.70 ? 366  GLU A CD  1 
ATOM   1436 O  OE1 . GLU A 1 214 ? -22.055 -8.658  13.241 1.00 32.83 ? 366  GLU A OE1 1 
ATOM   1437 O  OE2 . GLU A 1 214 ? -20.451 -7.666  12.123 1.00 34.11 ? 366  GLU A OE2 1 
ATOM   1438 N  N   . ASP A 1 215 ? -16.922 -9.140  15.470 1.00 30.22 ? 367  ASP A N   1 
ATOM   1439 C  CA  . ASP A 1 215 ? -15.629 -9.422  14.842 1.00 30.47 ? 367  ASP A CA  1 
ATOM   1440 C  C   . ASP A 1 215 ? -14.447 -8.739  15.558 1.00 29.48 ? 367  ASP A C   1 
ATOM   1441 O  O   . ASP A 1 215 ? -13.661 -8.003  14.946 1.00 28.84 ? 367  ASP A O   1 
ATOM   1442 C  CB  . ASP A 1 215 ? -15.650 -9.075  13.340 1.00 31.12 ? 367  ASP A CB  1 
ATOM   1443 C  CG  . ASP A 1 215 ? -16.511 -10.036 12.513 1.00 34.96 ? 367  ASP A CG  1 
ATOM   1444 O  OD1 . ASP A 1 215 ? -16.993 -11.065 13.053 1.00 37.60 ? 367  ASP A OD1 1 
ATOM   1445 O  OD2 . ASP A 1 215 ? -16.700 -9.766  11.297 1.00 39.12 ? 367  ASP A OD2 1 
ATOM   1446 N  N   . ILE A 1 216 ? -14.344 -8.996  16.859 1.00 28.81 ? 368  ILE A N   1 
ATOM   1447 C  CA  . ILE A 1 216 ? -13.298 -8.422  17.711 1.00 28.20 ? 368  ILE A CA  1 
ATOM   1448 C  C   . ILE A 1 216 ? -12.113 -9.378  17.818 1.00 27.76 ? 368  ILE A C   1 
ATOM   1449 O  O   . ILE A 1 216 ? -12.219 -10.447 18.414 1.00 28.01 ? 368  ILE A O   1 
ATOM   1450 C  CB  . ILE A 1 216 ? -13.834 -8.089  19.138 1.00 28.32 ? 368  ILE A CB  1 
ATOM   1451 C  CG1 . ILE A 1 216 ? -15.133 -7.257  19.084 1.00 27.52 ? 368  ILE A CG1 1 
ATOM   1452 C  CG2 . ILE A 1 216 ? -12.722 -7.505  20.032 1.00 27.67 ? 368  ILE A CG2 1 
ATOM   1453 C  CD1 . ILE A 1 216 ? -15.059 -5.942  18.319 1.00 27.95 ? 368  ILE A CD1 1 
ATOM   1454 N  N   . ILE A 1 217 ? -10.995 -8.994  17.214 1.00 27.70 ? 369  ILE A N   1 
ATOM   1455 C  CA  . ILE A 1 217 ? -9.761  -9.768  17.293 1.00 27.39 ? 369  ILE A CA  1 
ATOM   1456 C  C   . ILE A 1 217 ? -9.205  -9.671  18.714 1.00 27.29 ? 369  ILE A C   1 
ATOM   1457 O  O   . ILE A 1 217 ? -9.085  -8.562  19.273 1.00 26.67 ? 369  ILE A O   1 
ATOM   1458 C  CB  . ILE A 1 217 ? -8.702  -9.283  16.262 1.00 27.60 ? 369  ILE A CB  1 
ATOM   1459 C  CG1 . ILE A 1 217 ? -9.219  -9.459  14.828 1.00 27.46 ? 369  ILE A CG1 1 
ATOM   1460 C  CG2 . ILE A 1 217 ? -7.368  -10.029 16.459 1.00 27.75 ? 369  ILE A CG2 1 
ATOM   1461 C  CD1 . ILE A 1 217 ? -8.381  -8.743  13.761 1.00 27.43 ? 369  ILE A CD1 1 
ATOM   1462 N  N   . GLY A 1 218 ? -8.886  -10.833 19.288 1.00 26.93 ? 370  GLY A N   1 
ATOM   1463 C  CA  . GLY A 1 218 ? -8.325  -10.913 20.625 1.00 27.38 ? 370  GLY A CA  1 
ATOM   1464 C  C   . GLY A 1 218 ? -7.696  -12.251 20.972 1.00 27.88 ? 370  GLY A C   1 
ATOM   1465 O  O   . GLY A 1 218 ? -7.769  -13.209 20.202 1.00 28.15 ? 370  GLY A O   1 
ATOM   1466 N  N   . ALA A 1 219 ? -7.085  -12.307 22.153 1.00 28.13 ? 371  ALA A N   1 
ATOM   1467 C  CA  . ALA A 1 219 ? -6.385  -13.493 22.648 1.00 28.19 ? 371  ALA A CA  1 
ATOM   1468 C  C   . ALA A 1 219 ? -7.219  -14.768 22.590 1.00 28.22 ? 371  ALA A C   1 
ATOM   1469 O  O   . ALA A 1 219 ? -8.332  -14.821 23.124 1.00 28.74 ? 371  ALA A O   1 
ATOM   1470 C  CB  . ALA A 1 219 ? -5.910  -13.248 24.071 1.00 28.05 ? 371  ALA A CB  1 
ATOM   1471 N  N   . SER A 1 220 ? -6.677  -15.791 21.940 1.00 28.16 ? 372  SER A N   1 
ATOM   1472 C  CA  . SER A 1 220 ? -7.293  -17.111 21.923 1.00 28.41 ? 372  SER A CA  1 
ATOM   1473 C  C   . SER A 1 220 ? -6.577  -18.044 22.895 1.00 28.73 ? 372  SER A C   1 
ATOM   1474 O  O   . SER A 1 220 ? -5.356  -18.063 22.949 1.00 29.15 ? 372  SER A O   1 
ATOM   1475 C  CB  . SER A 1 220 ? -7.262  -17.699 20.516 1.00 28.30 ? 372  SER A CB  1 
ATOM   1476 O  OG  . SER A 1 220 ? -7.841  -18.985 20.495 1.00 27.98 ? 372  SER A OG  1 
ATOM   1477 N  N   . SER A 1 221 ? -7.337  -18.822 23.657 1.00 29.02 ? 373  SER A N   1 
ATOM   1478 C  CA  . SER A 1 221 ? -6.746  -19.785 24.593 1.00 29.25 ? 373  SER A CA  1 
ATOM   1479 C  C   . SER A 1 221 ? -6.367  -21.088 23.890 1.00 29.25 ? 373  SER A C   1 
ATOM   1480 O  O   . SER A 1 221 ? -5.993  -22.061 24.537 1.00 29.43 ? 373  SER A O   1 
ATOM   1481 C  CB  . SER A 1 221 ? -7.687  -20.052 25.774 1.00 29.29 ? 373  SER A CB  1 
ATOM   1482 O  OG  . SER A 1 221 ? -8.989  -20.388 25.318 1.00 29.33 ? 373  SER A OG  1 
ATOM   1483 N  N   . HIS A 1 222 ? -6.467  -21.093 22.564 1.00 29.28 ? 374  HIS A N   1 
ATOM   1484 C  CA  . HIS A 1 222 ? -6.035  -22.214 21.746 1.00 29.47 ? 374  HIS A CA  1 
ATOM   1485 C  C   . HIS A 1 222 ? -4.526  -22.431 21.877 1.00 29.89 ? 374  HIS A C   1 
ATOM   1486 O  O   . HIS A 1 222 ? -4.042  -23.570 21.909 1.00 30.00 ? 374  HIS A O   1 
ATOM   1487 C  CB  . HIS A 1 222 ? -6.411  -21.964 20.288 1.00 29.40 ? 374  HIS A CB  1 
ATOM   1488 C  CG  . HIS A 1 222 ? -6.271  -23.170 19.416 1.00 29.62 ? 374  HIS A CG  1 
ATOM   1489 N  ND1 . HIS A 1 222 ? -5.054  -23.604 18.934 1.00 30.26 ? 374  HIS A ND1 1 
ATOM   1490 C  CD2 . HIS A 1 222 ? -7.195  -24.032 18.937 1.00 29.99 ? 374  HIS A CD2 1 
ATOM   1491 C  CE1 . HIS A 1 222 ? -5.236  -24.684 18.196 1.00 30.49 ? 374  HIS A CE1 1 
ATOM   1492 N  NE2 . HIS A 1 222 ? -6.526  -24.965 18.182 1.00 30.89 ? 374  HIS A NE2 1 
ATOM   1493 N  N   . CYS A 1 223 ? -3.790  -21.325 21.934 1.00 30.05 ? 375  CYS A N   1 
ATOM   1494 C  CA  . CYS A 1 223 ? -2.366  -21.337 22.227 1.00 30.28 ? 375  CYS A CA  1 
ATOM   1495 C  C   . CYS A 1 223 ? -1.992  -19.934 22.704 1.00 30.16 ? 375  CYS A C   1 
ATOM   1496 O  O   . CYS A 1 223 ? -2.792  -19.001 22.570 1.00 30.30 ? 375  CYS A O   1 
ATOM   1497 C  CB  . CYS A 1 223 ? -1.546  -21.796 21.005 1.00 30.35 ? 375  CYS A CB  1 
ATOM   1498 S  SG  . CYS A 1 223 ? -1.227  -20.577 19.701 1.00 31.71 ? 375  CYS A SG  1 
ATOM   1499 N  N   . SER A 1 224 ? -0.796  -19.778 23.266 1.00 29.81 ? 376  SER A N   1 
ATOM   1500 C  CA  . SER A 1 224 ? -0.439  -18.521 23.937 1.00 29.53 ? 376  SER A CA  1 
ATOM   1501 C  C   . SER A 1 224 ? -0.024  -17.403 22.992 1.00 28.93 ? 376  SER A C   1 
ATOM   1502 O  O   . SER A 1 224 ? 0.208   -16.283 23.429 1.00 28.77 ? 376  SER A O   1 
ATOM   1503 C  CB  . SER A 1 224 ? 0.605   -18.747 25.032 1.00 29.63 ? 376  SER A CB  1 
ATOM   1504 O  OG  . SER A 1 224 ? 1.389   -19.883 24.750 1.00 30.66 ? 376  SER A OG  1 
ATOM   1505 N  N   . THR A 1 225 ? 0.040   -17.710 21.701 1.00 28.64 ? 377  THR A N   1 
ATOM   1506 C  CA  . THR A 1 225 ? 0.320   -16.721 20.664 1.00 28.28 ? 377  THR A CA  1 
ATOM   1507 C  C   . THR A 1 225 ? -0.809  -16.741 19.625 1.00 28.19 ? 377  THR A C   1 
ATOM   1508 O  O   . THR A 1 225 ? -0.673  -16.226 18.511 1.00 28.05 ? 377  THR A O   1 
ATOM   1509 C  CB  . THR A 1 225 ? 1.711   -16.947 20.010 1.00 28.46 ? 377  THR A CB  1 
ATOM   1510 O  OG1 . THR A 1 225 ? 1.796   -18.278 19.486 1.00 28.79 ? 377  THR A OG1 1 
ATOM   1511 C  CG2 . THR A 1 225 ? 2.827   -16.735 21.034 1.00 27.51 ? 377  THR A CG2 1 
ATOM   1512 N  N   . CYS A 1 226 ? -1.936  -17.313 20.041 1.00 27.92 ? 378  CYS A N   1 
ATOM   1513 C  CA  . CYS A 1 226 ? -3.112  -17.503 19.200 1.00 27.71 ? 378  CYS A CA  1 
ATOM   1514 C  C   . CYS A 1 226 ? -4.143  -16.386 19.342 1.00 27.36 ? 378  CYS A C   1 
ATOM   1515 O  O   . CYS A 1 226 ? -4.339  -15.829 20.421 1.00 27.09 ? 378  CYS A O   1 
ATOM   1516 C  CB  . CYS A 1 226 ? -3.768  -18.846 19.522 1.00 27.94 ? 378  CYS A CB  1 
ATOM   1517 S  SG  . CYS A 1 226 ? -3.012  -20.280 18.732 1.00 28.86 ? 378  CYS A SG  1 
ATOM   1518 N  N   . PHE A 1 227 ? -4.804  -16.075 18.234 1.00 27.03 ? 379  PHE A N   1 
ATOM   1519 C  CA  . PHE A 1 227 ? -5.800  -15.020 18.186 1.00 27.04 ? 379  PHE A CA  1 
ATOM   1520 C  C   . PHE A 1 227 ? -7.094  -15.507 17.549 1.00 26.96 ? 379  PHE A C   1 
ATOM   1521 O  O   . PHE A 1 227 ? -7.096  -16.394 16.702 1.00 26.98 ? 379  PHE A O   1 
ATOM   1522 C  CB  . PHE A 1 227 ? -5.247  -13.800 17.440 1.00 26.83 ? 379  PHE A CB  1 
ATOM   1523 C  CG  . PHE A 1 227 ? -4.196  -13.070 18.204 1.00 26.65 ? 379  PHE A CG  1 
ATOM   1524 C  CD1 . PHE A 1 227 ? -4.541  -12.003 19.028 1.00 25.84 ? 379  PHE A CD1 1 
ATOM   1525 C  CD2 . PHE A 1 227 ? -2.860  -13.464 18.128 1.00 26.14 ? 379  PHE A CD2 1 
ATOM   1526 C  CE1 . PHE A 1 227 ? -3.574  -11.330 19.750 1.00 25.71 ? 379  PHE A CE1 1 
ATOM   1527 C  CE2 . PHE A 1 227 ? -1.886  -12.803 18.853 1.00 26.01 ? 379  PHE A CE2 1 
ATOM   1528 C  CZ  . PHE A 1 227 ? -2.242  -11.733 19.668 1.00 26.49 ? 379  PHE A CZ  1 
ATOM   1529 N  N   . VAL A 1 228 ? -8.197  -14.913 17.967 1.00 27.36 ? 380  VAL A N   1 
ATOM   1530 C  CA  . VAL A 1 228 ? -9.519  -15.345 17.520 1.00 27.54 ? 380  VAL A CA  1 
ATOM   1531 C  C   . VAL A 1 228 ? -10.400 -14.115 17.394 1.00 27.86 ? 380  VAL A C   1 
ATOM   1532 O  O   . VAL A 1 228 ? -10.183 -13.118 18.084 1.00 27.90 ? 380  VAL A O   1 
ATOM   1533 C  CB  . VAL A 1 228 ? -10.122 -16.425 18.494 1.00 27.31 ? 380  VAL A CB  1 
ATOM   1534 C  CG1 . VAL A 1 228 ? -10.634 -15.802 19.789 1.00 26.57 ? 380  VAL A CG1 1 
ATOM   1535 C  CG2 . VAL A 1 228 ? -11.184 -17.257 17.814 1.00 27.21 ? 380  VAL A CG2 1 
ATOM   1536 N  N   . SER A 1 229 ? -11.371 -14.176 16.493 1.00 28.60 ? 381  SER A N   1 
ATOM   1537 C  CA  . SER A 1 229 ? -12.372 -13.119 16.377 1.00 29.43 ? 381  SER A CA  1 
ATOM   1538 C  C   . SER A 1 229 ? -13.685 -13.516 17.069 1.00 29.41 ? 381  SER A C   1 
ATOM   1539 O  O   . SER A 1 229 ? -14.283 -14.528 16.722 1.00 29.71 ? 381  SER A O   1 
ATOM   1540 C  CB  . SER A 1 229 ? -12.619 -12.781 14.911 1.00 29.35 ? 381  SER A CB  1 
ATOM   1541 O  OG  . SER A 1 229 ? -13.747 -11.934 14.800 1.00 32.19 ? 381  SER A OG  1 
ATOM   1542 N  N   . GLN A 1 230 ? -14.119 -12.724 18.048 1.00 29.50 ? 382  GLN A N   1 
ATOM   1543 C  CA  . GLN A 1 230 ? -15.328 -13.039 18.824 1.00 29.87 ? 382  GLN A CA  1 
ATOM   1544 C  C   . GLN A 1 230 ? -16.330 -11.878 18.843 1.00 29.37 ? 382  GLN A C   1 
ATOM   1545 O  O   . GLN A 1 230 ? -15.956 -10.723 18.639 1.00 29.52 ? 382  GLN A O   1 
ATOM   1546 C  CB  . GLN A 1 230 ? -14.970 -13.501 20.253 1.00 29.43 ? 382  GLN A CB  1 
ATOM   1547 C  CG  . GLN A 1 230 ? -14.390 -14.917 20.326 1.00 30.09 ? 382  GLN A CG  1 
ATOM   1548 C  CD  . GLN A 1 230 ? -14.172 -15.438 21.757 1.00 31.80 ? 382  GLN A CD  1 
ATOM   1549 O  OE1 . GLN A 1 230 ? -14.694 -14.889 22.743 1.00 34.65 ? 382  GLN A OE1 1 
ATOM   1550 N  NE2 . GLN A 1 230 ? -13.403 -16.520 21.870 1.00 33.79 ? 382  GLN A NE2 1 
ATOM   1551 N  N   . SER A 1 231 ? -17.603 -12.192 19.080 1.00 29.22 ? 383  SER A N   1 
ATOM   1552 C  CA  . SER A 1 231 ? -18.670 -11.182 19.077 1.00 28.74 ? 383  SER A CA  1 
ATOM   1553 C  C   . SER A 1 231 ? -19.530 -11.272 20.330 1.00 28.76 ? 383  SER A C   1 
ATOM   1554 O  O   . SER A 1 231 ? -19.667 -12.342 20.912 1.00 29.09 ? 383  SER A O   1 
ATOM   1555 C  CB  . SER A 1 231 ? -19.560 -11.333 17.843 1.00 28.36 ? 383  SER A CB  1 
ATOM   1556 O  OG  . SER A 1 231 ? -18.824 -11.191 16.646 1.00 28.48 ? 383  SER A OG  1 
ATOM   1557 N  N   . GLY A 1 232 ? -20.095 -10.140 20.739 1.00 28.61 ? 384  GLY A N   1 
ATOM   1558 C  CA  . GLY A 1 232 ? -21.072 -10.092 21.822 1.00 28.72 ? 384  GLY A CA  1 
ATOM   1559 C  C   . GLY A 1 232 ? -21.054 -8.776  22.574 1.00 28.85 ? 384  GLY A C   1 
ATOM   1560 O  O   . GLY A 1 232 ? -20.166 -7.944  22.363 1.00 28.78 ? 384  GLY A O   1 
ATOM   1561 N  N   . THR A 1 233 ? -22.034 -8.583  23.454 1.00 29.04 ? 385  THR A N   1 
ATOM   1562 C  CA  . THR A 1 233 ? -22.059 -7.394  24.312 1.00 29.33 ? 385  THR A CA  1 
ATOM   1563 C  C   . THR A 1 233 ? -20.993 -7.473  25.412 1.00 29.05 ? 385  THR A C   1 
ATOM   1564 O  O   . THR A 1 233 ? -20.624 -6.452  25.981 1.00 29.41 ? 385  THR A O   1 
ATOM   1565 C  CB  . THR A 1 233 ? -23.464 -7.109  24.924 1.00 29.55 ? 385  THR A CB  1 
ATOM   1566 O  OG1 . THR A 1 233 ? -23.971 -8.291  25.560 1.00 30.04 ? 385  THR A OG1 1 
ATOM   1567 C  CG2 . THR A 1 233 ? -24.432 -6.652  23.858 1.00 28.65 ? 385  THR A CG2 1 
ATOM   1568 N  N   . SER A 1 234 ? -20.495 -8.677  25.694 1.00 28.83 ? 386  SER A N   1 
ATOM   1569 C  CA  . SER A 1 234 ? -19.299 -8.849  26.542 1.00 29.08 ? 386  SER A CA  1 
ATOM   1570 C  C   . SER A 1 234 ? -18.101 -8.100  25.973 1.00 29.13 ? 386  SER A C   1 
ATOM   1571 O  O   . SER A 1 234 ? -17.401 -7.397  26.701 1.00 29.58 ? 386  SER A O   1 
ATOM   1572 C  CB  . SER A 1 234 ? -18.917 -10.327 26.673 1.00 29.03 ? 386  SER A CB  1 
ATOM   1573 O  OG  . SER A 1 234 ? -19.779 -11.011 27.558 1.00 29.31 ? 386  SER A OG  1 
ATOM   1574 N  N   . GLN A 1 235 ? -17.867 -8.279  24.671 1.00 28.82 ? 387  GLN A N   1 
ATOM   1575 C  CA  . GLN A 1 235 ? -16.754 -7.656  23.965 1.00 28.91 ? 387  GLN A CA  1 
ATOM   1576 C  C   . GLN A 1 235 ? -16.928 -6.152  23.928 1.00 28.64 ? 387  GLN A C   1 
ATOM   1577 O  O   . GLN A 1 235 ? -15.952 -5.415  24.012 1.00 28.99 ? 387  GLN A O   1 
ATOM   1578 C  CB  . GLN A 1 235 ? -16.647 -8.198  22.526 1.00 28.90 ? 387  GLN A CB  1 
ATOM   1579 C  CG  . GLN A 1 235 ? -15.846 -9.481  22.389 1.00 29.39 ? 387  GLN A CG  1 
ATOM   1580 C  CD  . GLN A 1 235 ? -16.554 -10.703 22.944 1.00 30.98 ? 387  GLN A CD  1 
ATOM   1581 O  OE1 . GLN A 1 235 ? -17.787 -10.764 23.004 1.00 32.46 ? 387  GLN A OE1 1 
ATOM   1582 N  NE2 . GLN A 1 235 ? -15.773 -11.689 23.355 1.00 33.02 ? 387  GLN A NE2 1 
ATOM   1583 N  N   . ALA A 1 236 ? -18.176 -5.708  23.790 1.00 28.25 ? 388  ALA A N   1 
ATOM   1584 C  CA  . ALA A 1 236 ? -18.500 -4.290  23.775 1.00 27.86 ? 388  ALA A CA  1 
ATOM   1585 C  C   . ALA A 1 236 ? -18.248 -3.665  25.147 1.00 27.68 ? 388  ALA A C   1 
ATOM   1586 O  O   . ALA A 1 236 ? -17.692 -2.568  25.235 1.00 27.78 ? 388  ALA A O   1 
ATOM   1587 C  CB  . ALA A 1 236 ? -19.944 -4.073  23.330 1.00 27.50 ? 388  ALA A CB  1 
ATOM   1588 N  N   . ALA A 1 237 ? -18.660 -4.366  26.206 1.00 27.35 ? 389  ALA A N   1 
ATOM   1589 C  CA  . ALA A 1 237 ? -18.408 -3.923  27.581 1.00 27.16 ? 389  ALA A CA  1 
ATOM   1590 C  C   . ALA A 1 237 ? -16.906 -3.859  27.889 1.00 27.19 ? 389  ALA A C   1 
ATOM   1591 O  O   . ALA A 1 237 ? -16.435 -2.914  28.523 1.00 27.25 ? 389  ALA A O   1 
ATOM   1592 C  CB  . ALA A 1 237 ? -19.126 -4.827  28.572 1.00 26.90 ? 389  ALA A CB  1 
ATOM   1593 N  N   . ALA A 1 238 ? -16.160 -4.857  27.426 1.00 27.38 ? 390  ALA A N   1 
ATOM   1594 C  CA  . ALA A 1 238 ? -14.701 -4.867  27.569 1.00 27.85 ? 390  ALA A CA  1 
ATOM   1595 C  C   . ALA A 1 238 ? -14.036 -3.600  27.007 1.00 28.25 ? 390  ALA A C   1 
ATOM   1596 O  O   . ALA A 1 238 ? -13.064 -3.101  27.586 1.00 28.76 ? 390  ALA A O   1 
ATOM   1597 C  CB  . ALA A 1 238 ? -14.113 -6.121  26.927 1.00 27.43 ? 390  ALA A CB  1 
ATOM   1598 N  N   . HIS A 1 239 ? -14.556 -3.092  25.885 1.00 28.53 ? 391  HIS A N   1 
ATOM   1599 C  CA  . HIS A 1 239 ? -14.046 -1.870  25.247 1.00 28.85 ? 391  HIS A CA  1 
ATOM   1600 C  C   . HIS A 1 239 ? -14.258 -0.659  26.147 1.00 29.19 ? 391  HIS A C   1 
ATOM   1601 O  O   . HIS A 1 239 ? -13.372 0.178   26.294 1.00 29.25 ? 391  HIS A O   1 
ATOM   1602 C  CB  . HIS A 1 239 ? -14.758 -1.603  23.907 1.00 28.52 ? 391  HIS A CB  1 
ATOM   1603 C  CG  . HIS A 1 239 ? -14.183 -2.343  22.741 1.00 28.40 ? 391  HIS A CG  1 
ATOM   1604 N  ND1 . HIS A 1 239 ? -14.516 -3.649  22.449 1.00 28.38 ? 391  HIS A ND1 1 
ATOM   1605 C  CD2 . HIS A 1 239 ? -13.326 -1.947  21.767 1.00 27.73 ? 391  HIS A CD2 1 
ATOM   1606 C  CE1 . HIS A 1 239 ? -13.877 -4.031  21.357 1.00 27.39 ? 391  HIS A CE1 1 
ATOM   1607 N  NE2 . HIS A 1 239 ? -13.147 -3.018  20.926 1.00 27.15 ? 391  HIS A NE2 1 
ATOM   1608 N  N   . VAL A 1 240 ? -15.455 -0.562  26.718 1.00 29.65 ? 392  VAL A N   1 
ATOM   1609 C  CA  . VAL A 1 240 ? -15.797 0.530   27.624 1.00 30.05 ? 392  VAL A CA  1 
ATOM   1610 C  C   . VAL A 1 240 ? -14.999 0.446   28.936 1.00 30.47 ? 392  VAL A C   1 
ATOM   1611 O  O   . VAL A 1 240 ? -14.569 1.470   29.473 1.00 30.57 ? 392  VAL A O   1 
ATOM   1612 C  CB  . VAL A 1 240 ? -17.337 0.602   27.861 1.00 29.92 ? 392  VAL A CB  1 
ATOM   1613 C  CG1 . VAL A 1 240 ? -17.687 1.582   28.988 1.00 29.64 ? 392  VAL A CG1 1 
ATOM   1614 C  CG2 . VAL A 1 240 ? -18.037 1.002   26.572 1.00 29.15 ? 392  VAL A CG2 1 
ATOM   1615 N  N   . ALA A 1 241 ? -14.793 -0.775  29.434 1.00 30.94 ? 393  ALA A N   1 
ATOM   1616 C  CA  . ALA A 1 241 ? -13.935 -1.011  30.594 1.00 31.33 ? 393  ALA A CA  1 
ATOM   1617 C  C   . ALA A 1 241 ? -12.499 -0.566  30.303 1.00 32.08 ? 393  ALA A C   1 
ATOM   1618 O  O   . ALA A 1 241 ? -11.840 0.020   31.170 1.00 32.34 ? 393  ALA A O   1 
ATOM   1619 C  CB  . ALA A 1 241 ? -13.973 -2.479  31.006 1.00 31.24 ? 393  ALA A CB  1 
ATOM   1620 N  N   . GLY A 1 242 ? -12.029 -0.839  29.081 1.00 32.37 ? 394  GLY A N   1 
ATOM   1621 C  CA  . GLY A 1 242 ? -10.717 -0.381  28.621 1.00 32.91 ? 394  GLY A CA  1 
ATOM   1622 C  C   . GLY A 1 242 ? -10.614 1.134   28.524 1.00 33.24 ? 394  GLY A C   1 
ATOM   1623 O  O   . GLY A 1 242 ? -9.612  1.721   28.936 1.00 33.29 ? 394  GLY A O   1 
ATOM   1624 N  N   . ILE A 1 243 ? -11.656 1.759   27.980 1.00 33.74 ? 395  ILE A N   1 
ATOM   1625 C  CA  . ILE A 1 243 ? -11.734 3.213   27.853 1.00 34.22 ? 395  ILE A CA  1 
ATOM   1626 C  C   . ILE A 1 243 ? -11.749 3.888   29.225 1.00 34.92 ? 395  ILE A C   1 
ATOM   1627 O  O   . ILE A 1 243 ? -11.065 4.892   29.430 1.00 35.25 ? 395  ILE A O   1 
ATOM   1628 C  CB  . ILE A 1 243 ? -12.959 3.657   27.004 1.00 34.12 ? 395  ILE A CB  1 
ATOM   1629 C  CG1 . ILE A 1 243 ? -12.727 3.344   25.519 1.00 33.88 ? 395  ILE A CG1 1 
ATOM   1630 C  CG2 . ILE A 1 243 ? -13.242 5.149   27.190 1.00 34.11 ? 395  ILE A CG2 1 
ATOM   1631 C  CD1 . ILE A 1 243 ? -13.969 3.458   24.639 1.00 33.81 ? 395  ILE A CD1 1 
ATOM   1632 N  N   . ALA A 1 244 ? -12.522 3.328   30.156 1.00 35.70 ? 396  ALA A N   1 
ATOM   1633 C  CA  . ALA A 1 244 ? -12.583 3.831   31.530 1.00 36.03 ? 396  ALA A CA  1 
ATOM   1634 C  C   . ALA A 1 244 ? -11.222 3.738   32.209 1.00 36.53 ? 396  ALA A C   1 
ATOM   1635 O  O   . ALA A 1 244 ? -10.781 4.696   32.839 1.00 36.59 ? 396  ALA A O   1 
ATOM   1636 C  CB  . ALA A 1 244 ? -13.636 3.079   32.333 1.00 35.97 ? 396  ALA A CB  1 
ATOM   1637 N  N   . ALA A 1 245 ? -10.563 2.587   32.073 1.00 37.19 ? 397  ALA A N   1 
ATOM   1638 C  CA  . ALA A 1 245 ? -9.199  2.389   32.584 1.00 38.02 ? 397  ALA A CA  1 
ATOM   1639 C  C   . ALA A 1 245 ? -8.217  3.429   32.027 1.00 38.63 ? 397  ALA A C   1 
ATOM   1640 O  O   . ALA A 1 245 ? -7.390  3.968   32.760 1.00 38.65 ? 397  ALA A O   1 
ATOM   1641 C  CB  . ALA A 1 245 ? -8.715  0.974   32.272 1.00 37.62 ? 397  ALA A CB  1 
ATOM   1642 N  N   . MET A 1 246 ? -8.324  3.704   30.728 1.00 39.66 ? 398  MET A N   1 
ATOM   1643 C  CA  . MET A 1 246 ? -7.509  4.719   30.060 1.00 40.60 ? 398  MET A CA  1 
ATOM   1644 C  C   . MET A 1 246 ? -7.780  6.106   30.641 1.00 41.17 ? 398  MET A C   1 
ATOM   1645 O  O   . MET A 1 246 ? -6.847  6.854   30.944 1.00 41.28 ? 398  MET A O   1 
ATOM   1646 C  CB  . MET A 1 246 ? -7.783  4.723   28.550 1.00 40.60 ? 398  MET A CB  1 
ATOM   1647 C  CG  . MET A 1 246 ? -7.204  3.537   27.784 1.00 41.47 ? 398  MET A CG  1 
ATOM   1648 S  SD  . MET A 1 246 ? -5.396  3.547   27.654 1.00 43.92 ? 398  MET A SD  1 
ATOM   1649 C  CE  . MET A 1 246 ? -5.162  4.628   26.241 1.00 42.51 ? 398  MET A CE  1 
ATOM   1650 N  N   . MET A 1 247 ? -9.062  6.435   30.797 1.00 41.90 ? 399  MET A N   1 
ATOM   1651 C  CA  . MET A 1 247 ? -9.484  7.731   31.327 1.00 42.61 ? 399  MET A CA  1 
ATOM   1652 C  C   . MET A 1 247 ? -9.023  7.958   32.768 1.00 43.32 ? 399  MET A C   1 
ATOM   1653 O  O   . MET A 1 247 ? -8.743  9.093   33.166 1.00 43.58 ? 399  MET A O   1 
ATOM   1654 C  CB  . MET A 1 247 ? -11.005 7.869   31.247 1.00 42.52 ? 399  MET A CB  1 
ATOM   1655 C  CG  . MET A 1 247 ? -11.556 8.183   29.863 1.00 42.36 ? 399  MET A CG  1 
ATOM   1656 S  SD  . MET A 1 247 ? -13.363 8.283   29.882 1.00 42.54 ? 399  MET A SD  1 
ATOM   1657 C  CE  . MET A 1 247 ? -13.695 8.950   28.246 1.00 42.71 ? 399  MET A CE  1 
ATOM   1658 N  N   . LEU A 1 248 ? -8.942  6.874   33.535 1.00 44.01 ? 400  LEU A N   1 
ATOM   1659 C  CA  . LEU A 1 248 ? -8.615  6.944   34.957 1.00 44.81 ? 400  LEU A CA  1 
ATOM   1660 C  C   . LEU A 1 248 ? -7.111  6.850   35.234 1.00 45.37 ? 400  LEU A C   1 
ATOM   1661 O  O   . LEU A 1 248 ? -6.660  7.202   36.324 1.00 45.34 ? 400  LEU A O   1 
ATOM   1662 C  CB  . LEU A 1 248 ? -9.387  5.878   35.751 1.00 44.68 ? 400  LEU A CB  1 
ATOM   1663 C  CG  . LEU A 1 248 ? -10.921 5.984   35.817 1.00 44.68 ? 400  LEU A CG  1 
ATOM   1664 C  CD1 . LEU A 1 248 ? -11.532 4.695   36.341 1.00 44.52 ? 400  LEU A CD1 1 
ATOM   1665 C  CD2 . LEU A 1 248 ? -11.386 7.166   36.653 1.00 44.74 ? 400  LEU A CD2 1 
ATOM   1666 N  N   . SER A 1 249 ? -6.343  6.368   34.259 1.00 46.17 ? 401  SER A N   1 
ATOM   1667 C  CA  . SER A 1 249 ? -4.879  6.430   34.341 1.00 47.01 ? 401  SER A CA  1 
ATOM   1668 C  C   . SER A 1 249 ? -4.411  7.872   34.237 1.00 47.31 ? 401  SER A C   1 
ATOM   1669 O  O   . SER A 1 249 ? -3.511  8.297   34.964 1.00 47.50 ? 401  SER A O   1 
ATOM   1670 C  CB  . SER A 1 249 ? -4.223  5.600   33.237 1.00 47.06 ? 401  SER A CB  1 
ATOM   1671 O  OG  . SER A 1 249 ? -3.704  4.392   33.756 1.00 48.09 ? 401  SER A OG  1 
ATOM   1672 N  N   . ALA A 1 250 ? -5.039  8.610   33.326 1.00 47.85 ? 402  ALA A N   1 
ATOM   1673 C  CA  . ALA A 1 250 ? -4.721  10.009  33.083 1.00 48.36 ? 402  ALA A CA  1 
ATOM   1674 C  C   . ALA A 1 250 ? -5.351  10.916  34.140 1.00 48.68 ? 402  ALA A C   1 
ATOM   1675 O  O   . ALA A 1 250 ? -4.888  12.035  34.355 1.00 48.82 ? 402  ALA A O   1 
ATOM   1676 C  CB  . ALA A 1 250 ? -5.171  10.415  31.680 1.00 48.32 ? 402  ALA A CB  1 
ATOM   1677 N  N   . GLU A 1 251 ? -6.404  10.424  34.790 1.00 49.09 ? 403  GLU A N   1 
ATOM   1678 C  CA  . GLU A 1 251 ? -7.099  11.163  35.846 1.00 49.50 ? 403  GLU A CA  1 
ATOM   1679 C  C   . GLU A 1 251 ? -7.626  10.236  36.946 1.00 49.61 ? 403  GLU A C   1 
ATOM   1680 O  O   . GLU A 1 251 ? -8.805  9.865   36.930 1.00 49.56 ? 403  GLU A O   1 
ATOM   1681 C  CB  . GLU A 1 251 ? -8.260  11.967  35.264 1.00 49.61 ? 403  GLU A CB  1 
ATOM   1682 C  CG  . GLU A 1 251 ? -7.857  13.227  34.540 1.00 50.44 ? 403  GLU A CG  1 
ATOM   1683 C  CD  . GLU A 1 251 ? -8.870  14.331  34.720 1.00 51.85 ? 403  GLU A CD  1 
ATOM   1684 O  OE1 . GLU A 1 251 ? -9.165  15.019  33.723 1.00 52.80 ? 403  GLU A OE1 1 
ATOM   1685 O  OE2 . GLU A 1 251 ? -9.372  14.510  35.854 1.00 52.42 ? 403  GLU A OE2 1 
ATOM   1686 N  N   . PRO A 1 252 ? -6.756  9.861   37.907 1.00 49.76 ? 404  PRO A N   1 
ATOM   1687 C  CA  . PRO A 1 252 ? -7.146  8.955   38.995 1.00 49.82 ? 404  PRO A CA  1 
ATOM   1688 C  C   . PRO A 1 252 ? -8.253  9.499   39.901 1.00 49.94 ? 404  PRO A C   1 
ATOM   1689 O  O   . PRO A 1 252 ? -8.977  8.719   40.524 1.00 49.79 ? 404  PRO A O   1 
ATOM   1690 C  CB  . PRO A 1 252 ? -5.845  8.777   39.790 1.00 49.86 ? 404  PRO A CB  1 
ATOM   1691 C  CG  . PRO A 1 252 ? -4.751  9.150   38.835 1.00 49.84 ? 404  PRO A CG  1 
ATOM   1692 C  CD  . PRO A 1 252 ? -5.338  10.252  38.012 1.00 49.80 ? 404  PRO A CD  1 
ATOM   1693 N  N   . GLU A 1 253 ? -8.389  10.821  39.954 1.00 50.18 ? 405  GLU A N   1 
ATOM   1694 C  CA  . GLU A 1 253 ? -9.308  11.467  40.892 1.00 50.43 ? 405  GLU A CA  1 
ATOM   1695 C  C   . GLU A 1 253 ? -10.688 11.791  40.308 1.00 50.14 ? 405  GLU A C   1 
ATOM   1696 O  O   . GLU A 1 253 ? -11.479 12.495  40.937 1.00 50.23 ? 405  GLU A O   1 
ATOM   1697 C  CB  . GLU A 1 253 ? -8.663  12.723  41.491 1.00 50.46 ? 405  GLU A CB  1 
ATOM   1698 C  CG  . GLU A 1 253 ? -7.595  12.443  42.544 1.00 50.74 ? 405  GLU A CG  1 
ATOM   1699 C  CD  . GLU A 1 253 ? -6.892  13.711  43.015 1.00 51.17 ? 405  GLU A CD  1 
ATOM   1700 O  OE1 . GLU A 1 253 ? -6.444  14.505  42.156 1.00 52.47 ? 405  GLU A OE1 1 
ATOM   1701 O  OE2 . GLU A 1 253 ? -6.783  13.915  44.244 1.00 51.60 ? 405  GLU A OE2 1 
ATOM   1702 N  N   . LEU A 1 254 ? -10.974 11.274  39.115 1.00 49.92 ? 406  LEU A N   1 
ATOM   1703 C  CA  . LEU A 1 254 ? -12.313 11.381  38.533 1.00 49.67 ? 406  LEU A CA  1 
ATOM   1704 C  C   . LEU A 1 254 ? -13.337 10.639  39.386 1.00 49.44 ? 406  LEU A C   1 
ATOM   1705 O  O   . LEU A 1 254 ? -13.076 9.529   39.862 1.00 49.40 ? 406  LEU A O   1 
ATOM   1706 C  CB  . LEU A 1 254 ? -12.345 10.810  37.111 1.00 49.67 ? 406  LEU A CB  1 
ATOM   1707 C  CG  . LEU A 1 254 ? -11.937 11.665  35.911 1.00 49.97 ? 406  LEU A CG  1 
ATOM   1708 C  CD1 . LEU A 1 254 ? -11.901 10.803  34.659 1.00 50.05 ? 406  LEU A CD1 1 
ATOM   1709 C  CD2 . LEU A 1 254 ? -12.869 12.859  35.711 1.00 50.42 ? 406  LEU A CD2 1 
ATOM   1710 N  N   . THR A 1 255 ? -14.496 11.262  39.583 1.00 49.18 ? 407  THR A N   1 
ATOM   1711 C  CA  . THR A 1 255 ? -15.620 10.604  40.247 1.00 48.91 ? 407  THR A CA  1 
ATOM   1712 C  C   . THR A 1 255 ? -16.386 9.756   39.227 1.00 48.72 ? 407  THR A C   1 
ATOM   1713 O  O   . THR A 1 255 ? -16.155 9.873   38.019 1.00 48.67 ? 407  THR A O   1 
ATOM   1714 C  CB  . THR A 1 255 ? -16.565 11.620  40.929 1.00 48.97 ? 407  THR A CB  1 
ATOM   1715 O  OG1 . THR A 1 255 ? -17.038 12.568  39.963 1.00 48.94 ? 407  THR A OG1 1 
ATOM   1716 C  CG2 . THR A 1 255 ? -15.844 12.359  42.055 1.00 48.92 ? 407  THR A CG2 1 
ATOM   1717 N  N   . LEU A 1 256 ? -17.281 8.898   39.713 1.00 48.38 ? 408  LEU A N   1 
ATOM   1718 C  CA  . LEU A 1 256 ? -18.085 8.044   38.838 1.00 48.05 ? 408  LEU A CA  1 
ATOM   1719 C  C   . LEU A 1 256 ? -19.017 8.870   37.949 1.00 47.85 ? 408  LEU A C   1 
ATOM   1720 O  O   . LEU A 1 256 ? -19.174 8.572   36.761 1.00 47.81 ? 408  LEU A O   1 
ATOM   1721 C  CB  . LEU A 1 256 ? -18.876 7.011   39.654 1.00 48.04 ? 408  LEU A CB  1 
ATOM   1722 C  CG  . LEU A 1 256 ? -19.913 6.131   38.942 1.00 48.05 ? 408  LEU A CG  1 
ATOM   1723 C  CD1 . LEU A 1 256 ? -19.286 5.226   37.872 1.00 47.92 ? 408  LEU A CD1 1 
ATOM   1724 C  CD2 . LEU A 1 256 ? -20.683 5.307   39.956 1.00 48.06 ? 408  LEU A CD2 1 
ATOM   1725 N  N   . ALA A 1 257 ? -19.615 9.911   38.527 1.00 47.54 ? 409  ALA A N   1 
ATOM   1726 C  CA  . ALA A 1 257 ? -20.517 10.794  37.792 1.00 47.27 ? 409  ALA A CA  1 
ATOM   1727 C  C   . ALA A 1 257 ? -19.798 11.552  36.672 1.00 47.10 ? 409  ALA A C   1 
ATOM   1728 O  O   . ALA A 1 257 ? -20.364 11.757  35.595 1.00 47.10 ? 409  ALA A O   1 
ATOM   1729 C  CB  . ALA A 1 257 ? -21.213 11.756  38.742 1.00 47.18 ? 409  ALA A CB  1 
ATOM   1730 N  N   . GLU A 1 258 ? -18.552 11.948  36.931 1.00 46.87 ? 410  GLU A N   1 
ATOM   1731 C  CA  . GLU A 1 258 ? -17.741 12.687  35.961 1.00 46.83 ? 410  GLU A CA  1 
ATOM   1732 C  C   . GLU A 1 258 ? -17.253 11.813  34.801 1.00 46.67 ? 410  GLU A C   1 
ATOM   1733 O  O   . GLU A 1 258 ? -17.206 12.269  33.652 1.00 46.55 ? 410  GLU A O   1 
ATOM   1734 C  CB  . GLU A 1 258 ? -16.549 13.354  36.653 1.00 46.81 ? 410  GLU A CB  1 
ATOM   1735 C  CG  . GLU A 1 258 ? -16.913 14.573  37.501 1.00 47.14 ? 410  GLU A CG  1 
ATOM   1736 C  CD  . GLU A 1 258 ? -15.763 15.062  38.373 1.00 47.27 ? 410  GLU A CD  1 
ATOM   1737 O  OE1 . GLU A 1 258 ? -14.779 14.312  38.572 1.00 47.65 ? 410  GLU A OE1 1 
ATOM   1738 O  OE2 . GLU A 1 258 ? -15.849 16.207  38.866 1.00 48.27 ? 410  GLU A OE2 1 
ATOM   1739 N  N   . LEU A 1 259 ? -16.884 10.568  35.114 1.00 46.48 ? 411  LEU A N   1 
ATOM   1740 C  CA  . LEU A 1 259 ? -16.429 9.598   34.118 1.00 46.30 ? 411  LEU A CA  1 
ATOM   1741 C  C   . LEU A 1 259 ? -17.557 9.247   33.148 1.00 46.23 ? 411  LEU A C   1 
ATOM   1742 O  O   . LEU A 1 259 ? -17.350 9.174   31.936 1.00 46.03 ? 411  LEU A O   1 
ATOM   1743 C  CB  . LEU A 1 259 ? -15.914 8.327   34.801 1.00 46.24 ? 411  LEU A CB  1 
ATOM   1744 C  CG  . LEU A 1 259 ? -15.336 7.253   33.873 1.00 46.52 ? 411  LEU A CG  1 
ATOM   1745 C  CD1 . LEU A 1 259 ? -13.833 7.421   33.708 1.00 46.99 ? 411  LEU A CD1 1 
ATOM   1746 C  CD2 . LEU A 1 259 ? -15.654 5.873   34.389 1.00 46.44 ? 411  LEU A CD2 1 
ATOM   1747 N  N   . ARG A 1 260 ? -18.747 9.044   33.706 1.00 46.18 ? 412  ARG A N   1 
ATOM   1748 C  CA  . ARG A 1 260 ? -19.944 8.720   32.945 1.00 46.30 ? 412  ARG A CA  1 
ATOM   1749 C  C   . ARG A 1 260 ? -20.308 9.839   31.968 1.00 46.04 ? 412  ARG A C   1 
ATOM   1750 O  O   . ARG A 1 260 ? -20.643 9.575   30.808 1.00 46.04 ? 412  ARG A O   1 
ATOM   1751 C  CB  . ARG A 1 260 ? -21.096 8.439   33.906 1.00 46.46 ? 412  ARG A CB  1 
ATOM   1752 C  CG  . ARG A 1 260 ? -22.111 7.460   33.373 1.00 47.68 ? 412  ARG A CG  1 
ATOM   1753 C  CD  . ARG A 1 260 ? -22.677 6.601   34.495 1.00 48.75 ? 412  ARG A CD  1 
ATOM   1754 N  NE  . ARG A 1 260 ? -23.604 5.602   33.970 1.00 48.99 ? 412  ARG A NE  1 
ATOM   1755 C  CZ  . ARG A 1 260 ? -24.340 4.791   34.718 1.00 49.59 ? 412  ARG A CZ  1 
ATOM   1756 N  NH1 . ARG A 1 260 ? -24.269 4.845   36.043 1.00 49.95 ? 412  ARG A NH1 1 
ATOM   1757 N  NH2 . ARG A 1 260 ? -25.153 3.922   34.137 1.00 50.49 ? 412  ARG A NH2 1 
ATOM   1758 N  N   . GLN A 1 261 ? -20.228 11.081  32.448 1.00 45.91 ? 413  GLN A N   1 
ATOM   1759 C  CA  A GLN A 1 261 ? -20.493 12.232  31.593 0.50 45.73 ? 413  GLN A CA  1 
ATOM   1760 C  CA  B GLN A 1 261 ? -20.457 12.290  31.645 0.50 45.71 ? 413  GLN A CA  1 
ATOM   1761 C  C   . GLN A 1 261 ? -19.392 12.453  30.557 1.00 45.56 ? 413  GLN A C   1 
ATOM   1762 O  O   . GLN A 1 261 ? -19.679 12.911  29.452 1.00 45.49 ? 413  GLN A O   1 
ATOM   1763 C  CB  A GLN A 1 261 ? -20.779 13.491  32.417 0.50 45.77 ? 413  GLN A CB  1 
ATOM   1764 C  CB  B GLN A 1 261 ? -20.516 13.522  32.571 0.50 45.72 ? 413  GLN A CB  1 
ATOM   1765 C  CG  A GLN A 1 261 ? -22.207 13.540  32.980 0.50 45.93 ? 413  GLN A CG  1 
ATOM   1766 C  CG  B GLN A 1 261 ? -19.830 14.811  32.069 0.50 45.85 ? 413  GLN A CG  1 
ATOM   1767 C  CD  A GLN A 1 261 ? -23.280 13.225  31.934 0.50 46.20 ? 413  GLN A CD  1 
ATOM   1768 C  CD  B GLN A 1 261 ? -20.633 15.571  31.021 0.50 45.88 ? 413  GLN A CD  1 
ATOM   1769 O  OE1 A GLN A 1 261 ? -24.068 12.292  32.101 0.50 46.05 ? 413  GLN A OE1 1 
ATOM   1770 O  OE1 B GLN A 1 261 ? -21.850 15.728  31.138 0.50 46.05 ? 413  GLN A OE1 1 
ATOM   1771 N  NE2 A GLN A 1 261 ? -23.303 13.995  30.848 0.50 46.07 ? 413  GLN A NE2 1 
ATOM   1772 N  NE2 B GLN A 1 261 ? -19.945 16.060  29.997 0.50 45.64 ? 413  GLN A NE2 1 
ATOM   1773 N  N   . ARG A 1 262 ? -18.157 12.088  30.900 1.00 45.37 ? 414  ARG A N   1 
ATOM   1774 C  CA  . ARG A 1 262 ? -17.026 12.116  29.974 1.00 45.19 ? 414  ARG A CA  1 
ATOM   1775 C  C   . ARG A 1 262 ? -17.242 11.094  28.853 1.00 44.97 ? 414  ARG A C   1 
ATOM   1776 O  O   . ARG A 1 262 ? -16.938 11.362  27.691 1.00 44.89 ? 414  ARG A O   1 
ATOM   1777 C  CB  . ARG A 1 262 ? -15.743 11.763  30.723 1.00 45.37 ? 414  ARG A CB  1 
ATOM   1778 C  CG  . ARG A 1 262 ? -14.523 12.576  30.358 1.00 46.15 ? 414  ARG A CG  1 
ATOM   1779 C  CD  . ARG A 1 262 ? -14.470 13.826  31.205 1.00 48.15 ? 414  ARG A CD  1 
ATOM   1780 N  NE  . ARG A 1 262 ? -13.124 14.110  31.692 1.00 49.24 ? 414  ARG A NE  1 
ATOM   1781 C  CZ  . ARG A 1 262 ? -12.844 15.010  32.632 1.00 50.11 ? 414  ARG A CZ  1 
ATOM   1782 N  NH1 . ARG A 1 262 ? -11.589 15.197  33.010 1.00 50.48 ? 414  ARG A NH1 1 
ATOM   1783 N  NH2 . ARG A 1 262 ? -13.813 15.725  33.197 1.00 50.38 ? 414  ARG A NH2 1 
ATOM   1784 N  N   . LEU A 1 263 ? -17.767 9.923   29.221 1.00 44.60 ? 415  LEU A N   1 
ATOM   1785 C  CA  . LEU A 1 263 ? -18.082 8.863   28.269 1.00 44.24 ? 415  LEU A CA  1 
ATOM   1786 C  C   . LEU A 1 263 ? -19.157 9.272   27.265 1.00 44.00 ? 415  LEU A C   1 
ATOM   1787 O  O   . LEU A 1 263 ? -18.979 9.079   26.056 1.00 43.80 ? 415  LEU A O   1 
ATOM   1788 C  CB  . LEU A 1 263 ? -18.497 7.584   28.999 1.00 44.19 ? 415  LEU A CB  1 
ATOM   1789 C  CG  . LEU A 1 263 ? -17.355 6.694   29.489 1.00 44.28 ? 415  LEU A CG  1 
ATOM   1790 C  CD1 . LEU A 1 263 ? -17.848 5.740   30.559 1.00 44.26 ? 415  LEU A CD1 1 
ATOM   1791 C  CD2 . LEU A 1 263 ? -16.726 5.930   28.326 1.00 44.32 ? 415  LEU A CD2 1 
ATOM   1792 N  N   . ILE A 1 264 ? -20.264 9.824   27.769 1.00 43.58 ? 416  ILE A N   1 
ATOM   1793 C  CA  . ILE A 1 264 ? -21.353 10.322  26.919 1.00 43.33 ? 416  ILE A CA  1 
ATOM   1794 C  C   . ILE A 1 264 ? -20.858 11.447  25.998 1.00 43.12 ? 416  ILE A C   1 
ATOM   1795 O  O   . ILE A 1 264 ? -21.118 11.438  24.789 1.00 43.08 ? 416  ILE A O   1 
ATOM   1796 C  CB  . ILE A 1 264 ? -22.580 10.784  27.762 1.00 43.31 ? 416  ILE A CB  1 
ATOM   1797 C  CG1 . ILE A 1 264 ? -23.252 9.578   28.428 1.00 43.17 ? 416  ILE A CG1 1 
ATOM   1798 C  CG2 . ILE A 1 264 ? -23.586 11.562  26.900 1.00 43.12 ? 416  ILE A CG2 1 
ATOM   1799 C  CD1 . ILE A 1 264 ? -24.333 9.936   29.447 1.00 43.50 ? 416  ILE A CD1 1 
ATOM   1800 N  N   . HIS A 1 265 ? -20.120 12.392  26.577 1.00 42.81 ? 417  HIS A N   1 
ATOM   1801 C  CA  . HIS A 1 265 ? -19.582 13.524  25.838 1.00 42.52 ? 417  HIS A CA  1 
ATOM   1802 C  C   . HIS A 1 265 ? -18.705 13.107  24.652 1.00 42.30 ? 417  HIS A C   1 
ATOM   1803 O  O   . HIS A 1 265 ? -18.853 13.646  23.551 1.00 42.34 ? 417  HIS A O   1 
ATOM   1804 C  CB  . HIS A 1 265 ? -18.802 14.454  26.773 1.00 42.59 ? 417  HIS A CB  1 
ATOM   1805 C  CG  . HIS A 1 265 ? -18.281 15.683  26.099 1.00 42.87 ? 417  HIS A CG  1 
ATOM   1806 N  ND1 . HIS A 1 265 ? -19.042 16.821  25.939 1.00 42.83 ? 417  HIS A ND1 1 
ATOM   1807 C  CD2 . HIS A 1 265 ? -17.084 15.946  25.524 1.00 43.13 ? 417  HIS A CD2 1 
ATOM   1808 C  CE1 . HIS A 1 265 ? -18.332 17.735  25.302 1.00 43.45 ? 417  HIS A CE1 1 
ATOM   1809 N  NE2 . HIS A 1 265 ? -17.141 17.230  25.038 1.00 43.29 ? 417  HIS A NE2 1 
ATOM   1810 N  N   . PHE A 1 266 ? -17.802 12.155  24.874 1.00 41.74 ? 418  PHE A N   1 
ATOM   1811 C  CA  . PHE A 1 266 ? -16.822 11.795  23.849 1.00 41.45 ? 418  PHE A CA  1 
ATOM   1812 C  C   . PHE A 1 266 ? -17.264 10.695  22.884 1.00 40.92 ? 418  PHE A C   1 
ATOM   1813 O  O   . PHE A 1 266 ? -16.542 10.367  21.940 1.00 40.88 ? 418  PHE A O   1 
ATOM   1814 C  CB  . PHE A 1 266 ? -15.446 11.516  24.473 1.00 41.57 ? 418  PHE A CB  1 
ATOM   1815 C  CG  . PHE A 1 266 ? -14.753 12.760  24.954 1.00 42.20 ? 418  PHE A CG  1 
ATOM   1816 C  CD1 . PHE A 1 266 ? -14.292 13.712  24.041 1.00 42.41 ? 418  PHE A CD1 1 
ATOM   1817 C  CD2 . PHE A 1 266 ? -14.582 12.998  26.316 1.00 42.66 ? 418  PHE A CD2 1 
ATOM   1818 C  CE1 . PHE A 1 266 ? -13.664 14.881  24.475 1.00 42.49 ? 418  PHE A CE1 1 
ATOM   1819 C  CE2 . PHE A 1 266 ? -13.955 14.162  26.764 1.00 42.85 ? 418  PHE A CE2 1 
ATOM   1820 C  CZ  . PHE A 1 266 ? -13.491 15.105  25.838 1.00 42.76 ? 418  PHE A CZ  1 
ATOM   1821 N  N   . SER A 1 267 ? -18.454 10.147  23.121 1.00 40.43 ? 419  SER A N   1 
ATOM   1822 C  CA  . SER A 1 267 ? -19.079 9.172   22.223 1.00 39.95 ? 419  SER A CA  1 
ATOM   1823 C  C   . SER A 1 267 ? -19.482 9.785   20.889 1.00 39.33 ? 419  SER A C   1 
ATOM   1824 O  O   . SER A 1 267 ? -19.788 10.983  20.816 1.00 39.15 ? 419  SER A O   1 
ATOM   1825 C  CB  . SER A 1 267 ? -20.323 8.581   22.876 1.00 39.89 ? 419  SER A CB  1 
ATOM   1826 O  OG  . SER A 1 267 ? -19.967 7.799   23.994 1.00 41.22 ? 419  SER A OG  1 
ATOM   1827 N  N   . ALA A 1 268 ? -19.487 8.958   19.842 1.00 38.52 ? 420  ALA A N   1 
ATOM   1828 C  CA  . ALA A 1 268 ? -20.047 9.359   18.550 1.00 37.85 ? 420  ALA A CA  1 
ATOM   1829 C  C   . ALA A 1 268 ? -21.568 9.370   18.637 1.00 37.35 ? 420  ALA A C   1 
ATOM   1830 O  O   . ALA A 1 268 ? -22.177 8.452   19.176 1.00 37.18 ? 420  ALA A O   1 
ATOM   1831 C  CB  . ALA A 1 268 ? -19.583 8.436   17.442 1.00 37.83 ? 420  ALA A CB  1 
ATOM   1832 N  N   . LYS A 1 269 ? -22.177 10.419  18.101 1.00 37.05 ? 421  LYS A N   1 
ATOM   1833 C  CA  . LYS A 1 269 ? -23.611 10.622  18.259 1.00 36.46 ? 421  LYS A CA  1 
ATOM   1834 C  C   . LYS A 1 269 ? -24.353 10.522  16.943 1.00 35.85 ? 421  LYS A C   1 
ATOM   1835 O  O   . LYS A 1 269 ? -23.802 10.845  15.889 1.00 35.58 ? 421  LYS A O   1 
ATOM   1836 C  CB  . LYS A 1 269 ? -23.881 11.960  18.956 1.00 36.63 ? 421  LYS A CB  1 
ATOM   1837 C  CG  . LYS A 1 269 ? -23.209 12.027  20.324 1.00 37.15 ? 421  LYS A CG  1 
ATOM   1838 C  CD  . LYS A 1 269 ? -23.475 13.304  21.082 1.00 38.15 ? 421  LYS A CD  1 
ATOM   1839 C  CE  . LYS A 1 269 ? -22.830 13.229  22.467 1.00 38.55 ? 421  LYS A CE  1 
ATOM   1840 N  NZ  . LYS A 1 269 ? -21.345 13.054  22.388 1.00 38.58 ? 421  LYS A NZ  1 
ATOM   1841 N  N   . ASP A 1 270 ? -25.594 10.035  17.033 1.00 35.44 ? 422  ASP A N   1 
ATOM   1842 C  CA  A ASP A 1 270 ? -26.507 9.927   15.889 0.50 35.15 ? 422  ASP A CA  1 
ATOM   1843 C  CA  B ASP A 1 270 ? -26.508 9.918   15.893 0.50 35.15 ? 422  ASP A CA  1 
ATOM   1844 C  C   . ASP A 1 270 ? -25.861 9.240   14.675 1.00 35.00 ? 422  ASP A C   1 
ATOM   1845 O  O   . ASP A 1 270 ? -25.934 9.739   13.552 1.00 34.91 ? 422  ASP A O   1 
ATOM   1846 C  CB  A ASP A 1 270 ? -27.080 11.305  15.516 0.50 35.06 ? 422  ASP A CB  1 
ATOM   1847 C  CB  B ASP A 1 270 ? -27.113 11.287  15.544 0.50 35.06 ? 422  ASP A CB  1 
ATOM   1848 C  CG  A ASP A 1 270 ? -28.438 11.212  14.833 0.50 34.95 ? 422  ASP A CG  1 
ATOM   1849 C  CG  B ASP A 1 270 ? -27.818 11.937  16.730 0.50 34.99 ? 422  ASP A CG  1 
ATOM   1850 O  OD1 A ASP A 1 270 ? -29.286 10.421  15.302 0.50 35.43 ? 422  ASP A OD1 1 
ATOM   1851 O  OD1 B ASP A 1 270 ? -28.400 11.208  17.566 0.50 34.31 ? 422  ASP A OD1 1 
ATOM   1852 O  OD2 A ASP A 1 270 ? -28.662 11.932  13.835 0.50 33.93 ? 422  ASP A OD2 1 
ATOM   1853 O  OD2 B ASP A 1 270 ? -27.795 13.185  16.821 0.50 34.99 ? 422  ASP A OD2 1 
ATOM   1854 N  N   . VAL A 1 271 ? -25.230 8.094   14.914 1.00 34.76 ? 423  VAL A N   1 
ATOM   1855 C  CA  . VAL A 1 271 ? -24.535 7.355   13.860 1.00 34.71 ? 423  VAL A CA  1 
ATOM   1856 C  C   . VAL A 1 271 ? -25.169 5.965   13.676 1.00 34.57 ? 423  VAL A C   1 
ATOM   1857 O  O   . VAL A 1 271 ? -24.930 5.281   12.679 1.00 34.72 ? 423  VAL A O   1 
ATOM   1858 C  CB  . VAL A 1 271 ? -22.983 7.312   14.128 1.00 34.74 ? 423  VAL A CB  1 
ATOM   1859 C  CG1 . VAL A 1 271 ? -22.568 6.117   15.001 1.00 34.59 ? 423  VAL A CG1 1 
ATOM   1860 C  CG2 . VAL A 1 271 ? -22.214 7.318   12.850 1.00 34.65 ? 423  VAL A CG2 1 
ATOM   1861 N  N   . ILE A 1 272 ? -25.991 5.576   14.648 1.00 34.35 ? 424  ILE A N   1 
ATOM   1862 C  CA  . ILE A 1 272 ? -26.773 4.340   14.602 1.00 33.82 ? 424  ILE A CA  1 
ATOM   1863 C  C   . ILE A 1 272 ? -28.127 4.614   13.945 1.00 34.04 ? 424  ILE A C   1 
ATOM   1864 O  O   . ILE A 1 272 ? -28.819 5.580   14.297 1.00 33.84 ? 424  ILE A O   1 
ATOM   1865 C  CB  . ILE A 1 272 ? -27.015 3.754   16.037 1.00 33.70 ? 424  ILE A CB  1 
ATOM   1866 C  CG1 . ILE A 1 272 ? -25.686 3.569   16.790 1.00 33.53 ? 424  ILE A CG1 1 
ATOM   1867 C  CG2 . ILE A 1 272 ? -27.836 2.455   15.976 1.00 32.72 ? 424  ILE A CG2 1 
ATOM   1868 C  CD1 . ILE A 1 272 ? -25.830 3.255   18.282 1.00 33.02 ? 424  ILE A CD1 1 
ATOM   1869 N  N   . ASN A 1 273 ? -28.501 3.764   12.994 1.00 34.25 ? 425  ASN A N   1 
ATOM   1870 C  CA  . ASN A 1 273 ? -29.837 3.815   12.411 1.00 34.58 ? 425  ASN A CA  1 
ATOM   1871 C  C   . ASN A 1 273 ? -30.831 3.167   13.365 1.00 34.98 ? 425  ASN A C   1 
ATOM   1872 O  O   . ASN A 1 273 ? -30.974 1.937   13.408 1.00 34.96 ? 425  ASN A O   1 
ATOM   1873 C  CB  . ASN A 1 273 ? -29.870 3.158   11.027 1.00 34.39 ? 425  ASN A CB  1 
ATOM   1874 C  CG  . ASN A 1 273 ? -29.035 3.912   9.998  1.00 34.19 ? 425  ASN A CG  1 
ATOM   1875 O  OD1 . ASN A 1 273 ? -28.836 5.123   10.108 1.00 33.56 ? 425  ASN A OD1 1 
ATOM   1876 N  ND2 . ASN A 1 273 ? -28.549 3.194   8.987  1.00 33.24 ? 425  ASN A ND2 1 
ATOM   1877 N  N   . GLU A 1 274 ? -31.504 4.013   14.140 1.00 35.50 ? 426  GLU A N   1 
ATOM   1878 C  CA  . GLU A 1 274 ? -32.397 3.566   15.213 1.00 36.15 ? 426  GLU A CA  1 
ATOM   1879 C  C   . GLU A 1 274 ? -33.668 2.850   14.726 1.00 36.13 ? 426  GLU A C   1 
ATOM   1880 O  O   . GLU A 1 274 ? -34.443 2.356   15.543 1.00 36.45 ? 426  GLU A O   1 
ATOM   1881 C  CB  . GLU A 1 274 ? -32.725 4.728   16.178 1.00 36.33 ? 426  GLU A CB  1 
ATOM   1882 C  CG  . GLU A 1 274 ? -33.652 5.825   15.623 1.00 38.03 ? 426  GLU A CG  1 
ATOM   1883 C  CD  . GLU A 1 274 ? -32.930 6.961   14.881 1.00 40.67 ? 426  GLU A CD  1 
ATOM   1884 O  OE1 . GLU A 1 274 ? -31.779 6.777   14.416 1.00 40.53 ? 426  GLU A OE1 1 
ATOM   1885 O  OE2 . GLU A 1 274 ? -33.538 8.054   14.751 1.00 41.84 ? 426  GLU A OE2 1 
ATOM   1886 N  N   . ALA A 1 275 ? -33.861 2.775   13.408 1.00 35.92 ? 427  ALA A N   1 
ATOM   1887 C  CA  . ALA A 1 275 ? -34.938 1.970   12.807 1.00 35.97 ? 427  ALA A CA  1 
ATOM   1888 C  C   . ALA A 1 275 ? -34.847 0.474   13.160 1.00 36.07 ? 427  ALA A C   1 
ATOM   1889 O  O   . ALA A 1 275 ? -35.858 -0.234  13.142 1.00 36.06 ? 427  ALA A O   1 
ATOM   1890 C  CB  . ALA A 1 275 ? -34.966 2.158   11.291 1.00 35.57 ? 427  ALA A CB  1 
ATOM   1891 N  N   . TRP A 1 276 ? -33.633 0.018   13.472 1.00 36.19 ? 428  TRP A N   1 
ATOM   1892 C  CA  . TRP A 1 276 ? -33.338 -1.370  13.861 1.00 36.41 ? 428  TRP A CA  1 
ATOM   1893 C  C   . TRP A 1 276 ? -34.008 -1.757  15.183 1.00 36.62 ? 428  TRP A C   1 
ATOM   1894 O  O   . TRP A 1 276 ? -34.327 -2.932  15.402 1.00 36.54 ? 428  TRP A O   1 
ATOM   1895 C  CB  . TRP A 1 276 ? -31.816 -1.544  13.977 1.00 36.30 ? 428  TRP A CB  1 
ATOM   1896 C  CG  . TRP A 1 276 ? -31.297 -2.966  14.136 1.00 36.46 ? 428  TRP A CG  1 
ATOM   1897 C  CD1 . TRP A 1 276 ? -30.881 -3.801  13.132 1.00 36.31 ? 428  TRP A CD1 1 
ATOM   1898 C  CD2 . TRP A 1 276 ? -31.098 -3.693  15.366 1.00 36.02 ? 428  TRP A CD2 1 
ATOM   1899 N  NE1 . TRP A 1 276 ? -30.451 -5.001  13.657 1.00 35.87 ? 428  TRP A NE1 1 
ATOM   1900 C  CE2 . TRP A 1 276 ? -30.573 -4.963  15.022 1.00 36.18 ? 428  TRP A CE2 1 
ATOM   1901 C  CE3 . TRP A 1 276 ? -31.323 -3.399  16.721 1.00 35.86 ? 428  TRP A CE3 1 
ATOM   1902 C  CZ2 . TRP A 1 276 ? -30.264 -5.939  15.987 1.00 36.27 ? 428  TRP A CZ2 1 
ATOM   1903 C  CZ3 . TRP A 1 276 ? -31.015 -4.370  17.682 1.00 35.94 ? 428  TRP A CZ3 1 
ATOM   1904 C  CH2 . TRP A 1 276 ? -30.488 -5.622  17.306 1.00 36.35 ? 428  TRP A CH2 1 
ATOM   1905 N  N   . PHE A 1 277 ? -34.193 -0.771  16.062 1.00 36.95 ? 429  PHE A N   1 
ATOM   1906 C  CA  . PHE A 1 277 ? -34.839 -0.983  17.361 1.00 37.29 ? 429  PHE A CA  1 
ATOM   1907 C  C   . PHE A 1 277 ? -36.360 -1.004  17.191 1.00 37.82 ? 429  PHE A C   1 
ATOM   1908 O  O   . PHE A 1 277 ? -36.880 -0.416  16.237 1.00 37.88 ? 429  PHE A O   1 
ATOM   1909 C  CB  . PHE A 1 277 ? -34.452 0.116   18.364 1.00 36.87 ? 429  PHE A CB  1 
ATOM   1910 C  CG  . PHE A 1 277 ? -32.966 0.308   18.537 1.00 36.70 ? 429  PHE A CG  1 
ATOM   1911 C  CD1 . PHE A 1 277 ? -32.141 -0.756  18.910 1.00 35.96 ? 429  PHE A CD1 1 
ATOM   1912 C  CD2 . PHE A 1 277 ? -32.391 1.567   18.351 1.00 35.81 ? 429  PHE A CD2 1 
ATOM   1913 C  CE1 . PHE A 1 277 ? -30.764 -0.570  19.075 1.00 35.50 ? 429  PHE A CE1 1 
ATOM   1914 C  CE2 . PHE A 1 277 ? -31.010 1.763   18.518 1.00 34.98 ? 429  PHE A CE2 1 
ATOM   1915 C  CZ  . PHE A 1 277 ? -30.200 0.695   18.880 1.00 35.25 ? 429  PHE A CZ  1 
ATOM   1916 N  N   . PRO A 1 278 ? -37.083 -1.681  18.108 1.00 38.39 ? 430  PRO A N   1 
ATOM   1917 C  CA  . PRO A 1 278 ? -38.544 -1.588  18.052 1.00 38.76 ? 430  PRO A CA  1 
ATOM   1918 C  C   . PRO A 1 278 ? -38.975 -0.136  18.271 1.00 39.44 ? 430  PRO A C   1 
ATOM   1919 O  O   . PRO A 1 278 ? -38.264 0.618   18.948 1.00 39.45 ? 430  PRO A O   1 
ATOM   1920 C  CB  . PRO A 1 278 ? -39.003 -2.472  19.219 1.00 38.60 ? 430  PRO A CB  1 
ATOM   1921 C  CG  . PRO A 1 278 ? -37.847 -3.350  19.533 1.00 38.18 ? 430  PRO A CG  1 
ATOM   1922 C  CD  . PRO A 1 278 ? -36.629 -2.546  19.214 1.00 38.19 ? 430  PRO A CD  1 
ATOM   1923 N  N   . GLU A 1 279 ? -40.111 0.259   17.693 1.00 40.23 ? 431  GLU A N   1 
ATOM   1924 C  CA  . GLU A 1 279 ? -40.574 1.646   17.792 1.00 41.06 ? 431  GLU A CA  1 
ATOM   1925 C  C   . GLU A 1 279 ? -40.734 2.096   19.251 1.00 41.25 ? 431  GLU A C   1 
ATOM   1926 O  O   . GLU A 1 279 ? -40.440 3.249   19.587 1.00 41.22 ? 431  GLU A O   1 
ATOM   1927 C  CB  . GLU A 1 279 ? -41.867 1.858   17.004 1.00 41.26 ? 431  GLU A CB  1 
ATOM   1928 C  CG  . GLU A 1 279 ? -42.075 3.311   16.598 1.00 42.87 ? 431  GLU A CG  1 
ATOM   1929 C  CD  . GLU A 1 279 ? -43.488 3.608   16.140 1.00 44.99 ? 431  GLU A CD  1 
ATOM   1930 O  OE1 . GLU A 1 279 ? -43.924 3.041   15.112 1.00 45.79 ? 431  GLU A OE1 1 
ATOM   1931 O  OE2 . GLU A 1 279 ? -44.157 4.431   16.804 1.00 45.95 ? 431  GLU A OE2 1 
ATOM   1932 N  N   . ASP A 1 280 ? -41.197 1.172   20.097 1.00 41.61 ? 432  ASP A N   1 
ATOM   1933 C  CA  . ASP A 1 280 ? -41.174 1.301   21.563 1.00 41.99 ? 432  ASP A CA  1 
ATOM   1934 C  C   . ASP A 1 280 ? -39.907 1.946   22.110 1.00 41.80 ? 432  ASP A C   1 
ATOM   1935 O  O   . ASP A 1 280 ? -39.962 2.816   22.982 1.00 41.90 ? 432  ASP A O   1 
ATOM   1936 C  CB  . ASP A 1 280 ? -41.253 -0.091  22.205 1.00 42.25 ? 432  ASP A CB  1 
ATOM   1937 C  CG  . ASP A 1 280 ? -42.666 -0.524  22.514 1.00 43.37 ? 432  ASP A CG  1 
ATOM   1938 O  OD1 . ASP A 1 280 ? -43.622 0.196   22.159 1.00 44.75 ? 432  ASP A OD1 1 
ATOM   1939 O  OD2 . ASP A 1 280 ? -42.815 -1.602  23.127 1.00 45.14 ? 432  ASP A OD2 1 
ATOM   1940 N  N   . GLN A 1 281 ? -38.768 1.496   21.588 1.00 41.43 ? 433  GLN A N   1 
ATOM   1941 C  CA  . GLN A 1 281 ? -37.480 1.664   22.246 1.00 41.12 ? 433  GLN A CA  1 
ATOM   1942 C  C   . GLN A 1 281 ? -36.585 2.740   21.634 1.00 40.90 ? 433  GLN A C   1 
ATOM   1943 O  O   . GLN A 1 281 ? -35.542 3.068   22.199 1.00 40.86 ? 433  GLN A O   1 
ATOM   1944 C  CB  . GLN A 1 281 ? -36.742 0.320   22.255 1.00 41.17 ? 433  GLN A CB  1 
ATOM   1945 C  CG  . GLN A 1 281 ? -37.572 -0.864  22.762 1.00 41.40 ? 433  GLN A CG  1 
ATOM   1946 C  CD  . GLN A 1 281 ? -37.692 -0.916  24.282 1.00 41.97 ? 433  GLN A CD  1 
ATOM   1947 O  OE1 . GLN A 1 281 ? -36.972 -0.229  25.005 1.00 42.44 ? 433  GLN A OE1 1 
ATOM   1948 N  NE2 . GLN A 1 281 ? -38.606 -1.744  24.768 1.00 42.26 ? 433  GLN A NE2 1 
ATOM   1949 N  N   . ARG A 1 282 ? -36.992 3.292   20.497 1.00 40.61 ? 434  ARG A N   1 
ATOM   1950 C  CA  . ARG A 1 282 ? -36.139 4.213   19.735 1.00 40.49 ? 434  ARG A CA  1 
ATOM   1951 C  C   . ARG A 1 282 ? -35.856 5.545   20.427 1.00 40.57 ? 434  ARG A C   1 
ATOM   1952 O  O   . ARG A 1 282 ? -34.785 6.124   20.249 1.00 40.93 ? 434  ARG A O   1 
ATOM   1953 C  CB  . ARG A 1 282 ? -36.720 4.459   18.344 1.00 40.25 ? 434  ARG A CB  1 
ATOM   1954 C  CG  . ARG A 1 282 ? -36.725 3.225   17.481 1.00 39.61 ? 434  ARG A CG  1 
ATOM   1955 C  CD  . ARG A 1 282 ? -37.504 3.427   16.205 1.00 38.09 ? 434  ARG A CD  1 
ATOM   1956 N  NE  . ARG A 1 282 ? -37.636 2.167   15.483 1.00 36.99 ? 434  ARG A NE  1 
ATOM   1957 C  CZ  . ARG A 1 282 ? -38.569 1.914   14.573 1.00 36.46 ? 434  ARG A CZ  1 
ATOM   1958 N  NH1 . ARG A 1 282 ? -39.469 2.835   14.262 1.00 36.06 ? 434  ARG A NH1 1 
ATOM   1959 N  NH2 . ARG A 1 282 ? -38.604 0.731   13.978 1.00 36.45 ? 434  ARG A NH2 1 
ATOM   1960 N  N   . VAL A 1 283 ? -36.812 6.027   21.210 1.00 40.56 ? 435  VAL A N   1 
ATOM   1961 C  CA  . VAL A 1 283 ? -36.661 7.310   21.895 1.00 40.50 ? 435  VAL A CA  1 
ATOM   1962 C  C   . VAL A 1 283 ? -35.715 7.181   23.090 1.00 40.32 ? 435  VAL A C   1 
ATOM   1963 O  O   . VAL A 1 283 ? -34.904 8.074   23.349 1.00 40.35 ? 435  VAL A O   1 
ATOM   1964 C  CB  . VAL A 1 283 ? -38.035 7.889   22.333 1.00 40.56 ? 435  VAL A CB  1 
ATOM   1965 C  CG1 . VAL A 1 283 ? -37.869 9.229   23.046 1.00 40.75 ? 435  VAL A CG1 1 
ATOM   1966 C  CG2 . VAL A 1 283 ? -38.950 8.046   21.127 1.00 40.66 ? 435  VAL A CG2 1 
ATOM   1967 N  N   . LEU A 1 284 ? -35.802 6.055   23.793 1.00 39.97 ? 436  LEU A N   1 
ATOM   1968 C  CA  . LEU A 1 284 ? -35.068 5.879   25.041 1.00 39.71 ? 436  LEU A CA  1 
ATOM   1969 C  C   . LEU A 1 284 ? -33.700 5.199   24.898 1.00 39.25 ? 436  LEU A C   1 
ATOM   1970 O  O   . LEU A 1 284 ? -32.843 5.354   25.776 1.00 39.31 ? 436  LEU A O   1 
ATOM   1971 C  CB  . LEU A 1 284 ? -35.944 5.174   26.083 1.00 39.91 ? 436  LEU A CB  1 
ATOM   1972 C  CG  . LEU A 1 284 ? -37.153 5.980   26.594 1.00 40.56 ? 436  LEU A CG  1 
ATOM   1973 C  CD1 . LEU A 1 284 ? -38.073 5.104   27.441 1.00 40.87 ? 436  LEU A CD1 1 
ATOM   1974 C  CD2 . LEU A 1 284 ? -36.743 7.247   27.365 1.00 39.98 ? 436  LEU A CD2 1 
ATOM   1975 N  N   . THR A 1 285 ? -33.501 4.461   23.802 1.00 38.54 ? 437  THR A N   1 
ATOM   1976 C  CA  . THR A 1 285 ? -32.203 3.857   23.477 1.00 37.72 ? 437  THR A CA  1 
ATOM   1977 C  C   . THR A 1 285 ? -31.237 4.952   23.036 1.00 37.31 ? 437  THR A C   1 
ATOM   1978 O  O   . THR A 1 285 ? -31.520 5.669   22.077 1.00 37.34 ? 437  THR A O   1 
ATOM   1979 C  CB  . THR A 1 285 ? -32.307 2.804   22.347 1.00 37.63 ? 437  THR A CB  1 
ATOM   1980 O  OG1 . THR A 1 285 ? -33.368 1.888   22.632 1.00 37.71 ? 437  THR A OG1 1 
ATOM   1981 C  CG2 . THR A 1 285 ? -31.012 2.029   22.206 1.00 37.04 ? 437  THR A CG2 1 
ATOM   1982 N  N   . PRO A 1 286 ? -30.097 5.089   23.739 1.00 36.96 ? 438  PRO A N   1 
ATOM   1983 C  CA  . PRO A 1 286 ? -29.139 6.145   23.411 1.00 36.54 ? 438  PRO A CA  1 
ATOM   1984 C  C   . PRO A 1 286 ? -28.419 5.886   22.092 1.00 36.04 ? 438  PRO A C   1 
ATOM   1985 O  O   . PRO A 1 286 ? -27.960 4.764   21.837 1.00 35.81 ? 438  PRO A O   1 
ATOM   1986 C  CB  . PRO A 1 286 ? -28.142 6.106   24.582 1.00 36.70 ? 438  PRO A CB  1 
ATOM   1987 C  CG  . PRO A 1 286 ? -28.771 5.233   25.622 1.00 36.97 ? 438  PRO A CG  1 
ATOM   1988 C  CD  . PRO A 1 286 ? -29.637 4.277   24.878 1.00 36.88 ? 438  PRO A CD  1 
ATOM   1989 N  N   . ASN A 1 287 ? -28.342 6.920   21.260 1.00 35.29 ? 439  ASN A N   1 
ATOM   1990 C  CA  . ASN A 1 287 ? -27.627 6.827   20.000 1.00 34.80 ? 439  ASN A CA  1 
ATOM   1991 C  C   . ASN A 1 287 ? -26.180 7.269   20.200 1.00 34.80 ? 439  ASN A C   1 
ATOM   1992 O  O   . ASN A 1 287 ? -25.771 8.355   19.784 1.00 34.76 ? 439  ASN A O   1 
ATOM   1993 C  CB  . ASN A 1 287 ? -28.335 7.626   18.899 1.00 34.49 ? 439  ASN A CB  1 
ATOM   1994 C  CG  . ASN A 1 287 ? -28.030 7.097   17.510 1.00 33.30 ? 439  ASN A CG  1 
ATOM   1995 O  OD1 . ASN A 1 287 ? -26.880 6.827   17.181 1.00 32.00 ? 439  ASN A OD1 1 
ATOM   1996 N  ND2 . ASN A 1 287 ? -29.059 6.957   16.686 1.00 32.21 ? 439  ASN A ND2 1 
ATOM   1997 N  N   . LEU A 1 288 ? -25.423 6.405   20.870 1.00 34.95 ? 440  LEU A N   1 
ATOM   1998 C  CA  . LEU A 1 288 ? -24.064 6.701   21.296 1.00 34.89 ? 440  LEU A CA  1 
ATOM   1999 C  C   . LEU A 1 288 ? -23.174 5.509   21.031 1.00 35.22 ? 440  LEU A C   1 
ATOM   2000 O  O   . LEU A 1 288 ? -23.547 4.374   21.336 1.00 35.49 ? 440  LEU A O   1 
ATOM   2001 C  CB  . LEU A 1 288 ? -24.030 7.023   22.792 1.00 34.64 ? 440  LEU A CB  1 
ATOM   2002 C  CG  . LEU A 1 288 ? -24.853 8.188   23.353 1.00 34.06 ? 440  LEU A CG  1 
ATOM   2003 C  CD1 . LEU A 1 288 ? -24.814 8.188   24.885 1.00 32.61 ? 440  LEU A CD1 1 
ATOM   2004 C  CD2 . LEU A 1 288 ? -24.383 9.527   22.790 1.00 32.76 ? 440  LEU A CD2 1 
ATOM   2005 N  N   . VAL A 1 289 ? -22.010 5.765   20.439 1.00 35.56 ? 441  VAL A N   1 
ATOM   2006 C  CA  . VAL A 1 289 ? -20.979 4.743   20.288 1.00 36.04 ? 441  VAL A CA  1 
ATOM   2007 C  C   . VAL A 1 289 ? -19.703 5.234   20.965 1.00 36.41 ? 441  VAL A C   1 
ATOM   2008 O  O   . VAL A 1 289 ? -19.167 6.277   20.596 1.00 36.22 ? 441  VAL A O   1 
ATOM   2009 C  CB  . VAL A 1 289 ? -20.709 4.370   18.803 1.00 35.98 ? 441  VAL A CB  1 
ATOM   2010 C  CG1 . VAL A 1 289 ? -19.546 3.386   18.702 1.00 35.77 ? 441  VAL A CG1 1 
ATOM   2011 C  CG2 . VAL A 1 289 ? -21.952 3.774   18.162 1.00 36.02 ? 441  VAL A CG2 1 
ATOM   2012 N  N   . ALA A 1 290 ? -19.238 4.470   21.954 1.00 37.11 ? 442  ALA A N   1 
ATOM   2013 C  CA  . ALA A 1 290 ? -18.081 4.833   22.776 1.00 38.12 ? 442  ALA A CA  1 
ATOM   2014 C  C   . ALA A 1 290 ? -16.825 5.185   21.981 1.00 38.92 ? 442  ALA A C   1 
ATOM   2015 O  O   . ALA A 1 290 ? -16.515 4.568   20.957 1.00 38.69 ? 442  ALA A O   1 
ATOM   2016 C  CB  . ALA A 1 290 ? -17.772 3.725   23.786 1.00 37.79 ? 442  ALA A CB  1 
ATOM   2017 N  N   . ALA A 1 291 ? -16.112 6.189   22.476 1.00 40.17 ? 443  ALA A N   1 
ATOM   2018 C  CA  . ALA A 1 291 ? -14.822 6.580   21.925 1.00 41.60 ? 443  ALA A CA  1 
ATOM   2019 C  C   . ALA A 1 291 ? -13.922 7.126   23.027 1.00 42.60 ? 443  ALA A C   1 
ATOM   2020 O  O   . ALA A 1 291 ? -14.404 7.614   24.049 1.00 42.67 ? 443  ALA A O   1 
ATOM   2021 C  CB  . ALA A 1 291 ? -15.005 7.613   20.805 1.00 41.31 ? 443  ALA A CB  1 
ATOM   2022 N  N   . LEU A 1 292 ? -12.615 7.017   22.818 1.00 44.26 ? 444  LEU A N   1 
ATOM   2023 C  CA  . LEU A 1 292 ? -11.620 7.656   23.673 1.00 45.87 ? 444  LEU A CA  1 
ATOM   2024 C  C   . LEU A 1 292 ? -11.597 9.180   23.450 1.00 47.17 ? 444  LEU A C   1 
ATOM   2025 O  O   . LEU A 1 292 ? -11.977 9.653   22.372 1.00 47.19 ? 444  LEU A O   1 
ATOM   2026 C  CB  . LEU A 1 292 ? -10.234 7.076   23.372 1.00 45.80 ? 444  LEU A CB  1 
ATOM   2027 C  CG  . LEU A 1 292 ? -9.858  5.722   23.972 1.00 46.15 ? 444  LEU A CG  1 
ATOM   2028 C  CD1 . LEU A 1 292 ? -8.729  5.085   23.176 1.00 46.47 ? 444  LEU A CD1 1 
ATOM   2029 C  CD2 . LEU A 1 292 ? -9.477  5.870   25.445 1.00 45.87 ? 444  LEU A CD2 1 
ATOM   2030 N  N   . PRO A 1 293 ? -11.172 9.954   24.475 1.00 48.47 ? 445  PRO A N   1 
ATOM   2031 C  CA  . PRO A 1 293 ? -10.842 11.375  24.290 1.00 49.50 ? 445  PRO A CA  1 
ATOM   2032 C  C   . PRO A 1 293 ? -9.687  11.579  23.298 1.00 50.65 ? 445  PRO A C   1 
ATOM   2033 O  O   . PRO A 1 293 ? -8.809  10.713  23.203 1.00 50.94 ? 445  PRO A O   1 
ATOM   2034 C  CB  . PRO A 1 293 ? -10.407 11.821  25.690 1.00 49.50 ? 445  PRO A CB  1 
ATOM   2035 C  CG  . PRO A 1 293 ? -10.047 10.560  26.406 1.00 49.06 ? 445  PRO A CG  1 
ATOM   2036 C  CD  . PRO A 1 293 ? -11.011 9.545   25.881 1.00 48.63 ? 445  PRO A CD  1 
ATOM   2037 N  N   . PRO A 1 294 ? -9.695  12.706  22.549 1.00 51.54 ? 446  PRO A N   1 
ATOM   2038 C  CA  . PRO A 1 294 ? -8.621  13.028  21.592 1.00 52.19 ? 446  PRO A CA  1 
ATOM   2039 C  C   . PRO A 1 294 ? -7.262  13.338  22.242 1.00 52.85 ? 446  PRO A C   1 
ATOM   2040 O  O   . PRO A 1 294 ? -7.184  13.554  23.460 1.00 52.87 ? 446  PRO A O   1 
ATOM   2041 C  CB  . PRO A 1 294 ? -9.160  14.271  20.861 1.00 52.18 ? 446  PRO A CB  1 
ATOM   2042 C  CG  . PRO A 1 294 ? -10.637 14.298  21.156 1.00 51.91 ? 446  PRO A CG  1 
ATOM   2043 C  CD  . PRO A 1 294 ? -10.750 13.735  22.535 1.00 51.56 ? 446  PRO A CD  1 
ATOM   2044 N  N   . SER A 1 295 ? -6.207  13.348  21.422 1.00 53.60 ? 447  SER A N   1 
ATOM   2045 C  CA  . SER A 1 295 ? -4.852  13.716  21.867 1.00 54.14 ? 447  SER A CA  1 
ATOM   2046 C  C   . SER A 1 295 ? -4.395  15.041  21.251 1.00 54.32 ? 447  SER A C   1 
ATOM   2047 O  O   . SER A 1 295 ? -5.119  16.040  21.278 1.00 54.58 ? 447  SER A O   1 
ATOM   2048 C  CB  . SER A 1 295 ? -3.838  12.607  21.539 1.00 54.19 ? 447  SER A CB  1 
ATOM   2049 O  OG  . SER A 1 295 ? -3.907  11.540  22.473 1.00 54.45 ? 447  SER A OG  1 
ATOM   2050 N  N   . LEU B 2 21  ? 10.529  -8.652  -4.489 1.00 43.60 ? 286  LEU E N   1 
ATOM   2051 C  CA  . LEU B 2 21  ? 9.704   -9.782  -4.044 1.00 42.78 ? 286  LEU E CA  1 
ATOM   2052 C  C   . LEU B 2 21  ? 9.530   -9.845  -2.531 1.00 42.36 ? 286  LEU E C   1 
ATOM   2053 O  O   . LEU B 2 21  ? 10.432  -9.468  -1.779 1.00 42.40 ? 286  LEU E O   1 
ATOM   2054 C  CB  . LEU B 2 21  ? 10.326  -11.104 -4.518 1.00 42.79 ? 286  LEU E CB  1 
ATOM   2055 C  CG  . LEU B 2 21  ? 10.708  -11.293 -5.989 1.00 42.95 ? 286  LEU E CG  1 
ATOM   2056 C  CD1 . LEU B 2 21  ? 11.772  -12.378 -6.145 1.00 43.38 ? 286  LEU E CD1 1 
ATOM   2057 C  CD2 . LEU B 2 21  ? 9.489   -11.589 -6.863 1.00 42.65 ? 286  LEU E CD2 1 
ATOM   2058 N  N   . TYR B 2 22  ? 8.366   -10.327 -2.099 1.00 41.63 ? 287  TYR E N   1 
ATOM   2059 C  CA  . TYR B 2 22  ? 8.087   -10.578 -0.687 1.00 40.94 ? 287  TYR E CA  1 
ATOM   2060 C  C   . TYR B 2 22  ? 8.907   -11.764 -0.171 1.00 40.92 ? 287  TYR E C   1 
ATOM   2061 O  O   . TYR B 2 22  ? 8.967   -12.817 -0.809 1.00 40.56 ? 287  TYR E O   1 
ATOM   2062 C  CB  . TYR B 2 22  ? 6.593   -10.843 -0.478 1.00 40.45 ? 287  TYR E CB  1 
ATOM   2063 C  CG  . TYR B 2 22  ? 6.216   -11.129 0.960  1.00 40.07 ? 287  TYR E CG  1 
ATOM   2064 C  CD1 . TYR B 2 22  ? 6.148   -12.436 1.436  1.00 38.79 ? 287  TYR E CD1 1 
ATOM   2065 C  CD2 . TYR B 2 22  ? 5.939   -10.089 1.848  1.00 39.98 ? 287  TYR E CD2 1 
ATOM   2066 C  CE1 . TYR B 2 22  ? 5.820   -12.702 2.754  1.00 39.08 ? 287  TYR E CE1 1 
ATOM   2067 C  CE2 . TYR B 2 22  ? 5.599   -10.346 3.169  1.00 39.40 ? 287  TYR E CE2 1 
ATOM   2068 C  CZ  . TYR B 2 22  ? 5.542   -11.654 3.614  1.00 39.37 ? 287  TYR E CZ  1 
ATOM   2069 O  OH  . TYR B 2 22  ? 5.201   -11.914 4.918  1.00 39.30 ? 287  TYR E OH  1 
ATOM   2070 N  N   . PHE B 2 23  ? 9.529   -11.591 0.991  1.00 41.11 ? 288  PHE E N   1 
ATOM   2071 C  CA  . PHE B 2 23  ? 10.342  -12.655 1.570  1.00 41.40 ? 288  PHE E CA  1 
ATOM   2072 C  C   . PHE B 2 23  ? 9.679   -13.398 2.746  1.00 41.75 ? 288  PHE E C   1 
ATOM   2073 O  O   . PHE B 2 23  ? 9.167   -14.501 2.546  1.00 41.76 ? 288  PHE E O   1 
ATOM   2074 C  CB  . PHE B 2 23  ? 11.775  -12.172 1.878  1.00 41.14 ? 288  PHE E CB  1 
ATOM   2075 C  CG  . PHE B 2 23  ? 12.684  -13.251 2.417  1.00 40.99 ? 288  PHE E CG  1 
ATOM   2076 C  CD1 . PHE B 2 23  ? 12.735  -14.512 1.820  1.00 40.44 ? 288  PHE E CD1 1 
ATOM   2077 C  CD2 . PHE B 2 23  ? 13.491  -13.002 3.523  1.00 40.40 ? 288  PHE E CD2 1 
ATOM   2078 C  CE1 . PHE B 2 23  ? 13.567  -15.504 2.319  1.00 40.02 ? 288  PHE E CE1 1 
ATOM   2079 C  CE2 . PHE B 2 23  ? 14.330  -13.990 4.031  1.00 40.47 ? 288  PHE E CE2 1 
ATOM   2080 C  CZ  . PHE B 2 23  ? 14.368  -15.243 3.428  1.00 40.72 ? 288  PHE E CZ  1 
ATOM   2081 N  N   . GLN B 2 24  ? 9.655   -12.814 3.946  1.00 42.44 ? 289  GLN E N   1 
ATOM   2082 C  CA  . GLN B 2 24  ? 9.277   -13.607 5.128  1.00 43.05 ? 289  GLN E CA  1 
ATOM   2083 C  C   . GLN B 2 24  ? 8.165   -13.147 6.066  1.00 44.25 ? 289  GLN E C   1 
ATOM   2084 O  O   . GLN B 2 24  ? 7.349   -13.972 6.530  1.00 44.70 ? 289  GLN E O   1 
ATOM   2085 C  CB  . GLN B 2 24  ? 10.508  -13.993 5.940  1.00 42.80 ? 289  GLN E CB  1 
ATOM   2086 C  CG  . GLN B 2 24  ? 11.158  -15.257 5.434  1.00 41.42 ? 289  GLN E CG  1 
ATOM   2087 C  CD  . GLN B 2 24  ? 12.090  -15.864 6.433  1.00 40.18 ? 289  GLN E CD  1 
ATOM   2088 O  OE1 . GLN B 2 24  ? 12.941  -15.182 7.003  1.00 40.82 ? 289  GLN E OE1 1 
ATOM   2089 N  NE2 . GLN B 2 24  ? 11.949  -17.162 6.649  1.00 39.72 ? 289  GLN E NE2 1 
ATOM   2090 N  N   . GLY B 2 25  ? 8.125   -11.857 6.375  1.00 44.93 ? 290  GLY E N   1 
ATOM   2091 C  CA  . GLY B 2 25  ? 7.122   -11.377 7.328  1.00 46.01 ? 290  GLY E CA  1 
ATOM   2092 C  C   . GLY B 2 25  ? 7.683   -10.281 8.201  1.00 46.72 ? 290  GLY E C   1 
ATOM   2093 O  O   . GLY B 2 25  ? 7.394   -9.095  7.983  1.00 47.26 ? 290  GLY E O   1 
ATOM   2094 N  N   . ALA B 2 26  ? 8.476   -10.687 9.189  1.00 46.69 ? 291  ALA E N   1 
ATOM   2095 C  CA  . ALA B 2 26  ? 9.288   -9.779  10.001 1.00 47.14 ? 291  ALA E CA  1 
ATOM   2096 C  C   . ALA B 2 26  ? 9.613   -10.386 11.362 1.00 47.41 ? 291  ALA E C   1 
ATOM   2097 O  O   . ALA B 2 26  ? 10.603  -11.113 11.503 1.00 47.87 ? 291  ALA E O   1 
ATOM   2098 C  CB  . ALA B 2 26  ? 8.642   -8.389  10.159 1.00 46.70 ? 291  ALA E CB  1 
ATOM   2099 N  N   . MET B 2 27  ? 8.757   -10.122 12.344 1.00 47.31 ? 292  MET E N   1 
ATOM   2100 C  CA  . MET B 2 27  ? 9.104   -10.274 13.754 1.00 47.64 ? 292  MET E CA  1 
ATOM   2101 C  C   . MET B 2 27  ? 8.781   -8.907  14.331 1.00 46.53 ? 292  MET E C   1 
ATOM   2102 O  O   . MET B 2 27  ? 9.317   -7.888  13.883 1.00 46.61 ? 292  MET E O   1 
ATOM   2103 C  CB  . MET B 2 27  ? 10.597  -10.576 13.931 1.00 47.69 ? 292  MET E CB  1 
ATOM   2104 C  CG  . MET B 2 27  ? 10.919  -11.528 15.058 1.00 48.69 ? 292  MET E CG  1 
ATOM   2105 S  SD  . MET B 2 27  ? 12.539  -12.290 14.827 1.00 49.78 ? 292  MET E SD  1 
ATOM   2106 C  CE  . MET B 2 27  ? 12.771  -13.064 16.437 1.00 49.18 ? 292  MET E CE  1 
ATOM   2107 N  N   . GLY B 2 28  ? 7.881   -8.881  15.301 1.00 45.61 ? 293  GLY E N   1 
ATOM   2108 C  CA  . GLY B 2 28  ? 7.299   -7.618  15.734 1.00 44.49 ? 293  GLY E CA  1 
ATOM   2109 C  C   . GLY B 2 28  ? 6.078   -7.278  14.899 1.00 43.39 ? 293  GLY E C   1 
ATOM   2110 O  O   . GLY B 2 28  ? 5.321   -6.370  15.241 1.00 43.65 ? 293  GLY E O   1 
ATOM   2111 N  N   . THR B 2 29  ? 5.892   -8.001  13.795 1.00 42.12 ? 294  THR E N   1 
ATOM   2112 C  CA  . THR B 2 29  ? 4.654   -7.923  13.020 1.00 40.73 ? 294  THR E CA  1 
ATOM   2113 C  C   . THR B 2 29  ? 3.714   -9.050  13.433 1.00 39.72 ? 294  THR E C   1 
ATOM   2114 O  O   . THR B 2 29  ? 4.055   -10.234 13.343 1.00 39.39 ? 294  THR E O   1 
ATOM   2115 C  CB  . THR B 2 29  ? 4.912   -7.940  11.492 1.00 40.83 ? 294  THR E CB  1 
ATOM   2116 O  OG1 . THR B 2 29  ? 5.633   -6.759  11.125 1.00 40.79 ? 294  THR E OG1 1 
ATOM   2117 C  CG2 . THR B 2 29  ? 3.597   -7.975  10.713 1.00 40.16 ? 294  THR E CG2 1 
ATOM   2118 N  N   . ASN B 2 30  ? 2.543   -8.651  13.921 1.00 38.64 ? 295  ASN E N   1 
ATOM   2119 C  CA  . ASN B 2 30  ? 1.467   -9.564  14.262 1.00 37.48 ? 295  ASN E CA  1 
ATOM   2120 C  C   . ASN B 2 30  ? 0.421   -9.549  13.144 1.00 37.14 ? 295  ASN E C   1 
ATOM   2121 O  O   . ASN B 2 30  ? -0.411  -8.644  13.073 1.00 36.86 ? 295  ASN E O   1 
ATOM   2122 C  CB  . ASN B 2 30  ? 0.857   -9.168  15.612 1.00 37.09 ? 295  ASN E CB  1 
ATOM   2123 C  CG  . ASN B 2 30  ? -0.162  -10.182 16.127 1.00 35.86 ? 295  ASN E CG  1 
ATOM   2124 O  OD1 . ASN B 2 30  ? -0.632  -11.045 15.392 1.00 33.98 ? 295  ASN E OD1 1 
ATOM   2125 N  ND2 . ASN B 2 30  ? -0.507  -10.069 17.399 1.00 34.61 ? 295  ASN E ND2 1 
ATOM   2126 N  N   . GLU B 2 31  ? 0.480   -10.551 12.268 1.00 36.82 ? 296  GLU E N   1 
ATOM   2127 C  CA  . GLU B 2 31  ? -0.383  -10.602 11.082 1.00 36.40 ? 296  GLU E CA  1 
ATOM   2128 C  C   . GLU B 2 31  ? -1.840  -10.884 11.415 1.00 35.94 ? 296  GLU E C   1 
ATOM   2129 O  O   . GLU B 2 31  ? -2.720  -10.673 10.581 1.00 36.21 ? 296  GLU E O   1 
ATOM   2130 C  CB  . GLU B 2 31  ? 0.116   -11.632 10.070 1.00 36.53 ? 296  GLU E CB  1 
ATOM   2131 C  CG  . GLU B 2 31  ? 1.428   -11.282 9.395  1.00 37.22 ? 296  GLU E CG  1 
ATOM   2132 C  CD  . GLU B 2 31  ? 2.646   -11.759 10.178 1.00 38.20 ? 296  GLU E CD  1 
ATOM   2133 O  OE1 . GLU B 2 31  ? 2.491   -12.184 11.348 1.00 37.89 ? 296  GLU E OE1 1 
ATOM   2134 O  OE2 . GLU B 2 31  ? 3.765   -11.703 9.622  1.00 38.63 ? 296  GLU E OE2 1 
ATOM   2135 N  N   . CYS B 2 32  ? -2.093  -11.354 12.634 1.00 35.34 ? 297  CYS E N   1 
ATOM   2136 C  CA  . CYS B 2 32  ? -3.454  -11.610 13.097 1.00 34.59 ? 297  CYS E CA  1 
ATOM   2137 C  C   . CYS B 2 32  ? -4.238  -10.323 13.319 1.00 34.46 ? 297  CYS E C   1 
ATOM   2138 O  O   . CYS B 2 32  ? -5.461  -10.342 13.326 1.00 34.46 ? 297  CYS E O   1 
ATOM   2139 C  CB  . CYS B 2 32  ? -3.443  -12.441 14.376 1.00 34.29 ? 297  CYS E CB  1 
ATOM   2140 S  SG  . CYS B 2 32  ? -2.592  -14.012 14.222 1.00 32.73 ? 297  CYS E SG  1 
ATOM   2141 N  N   . LEU B 2 33  ? -3.521  -9.217  13.505 1.00 34.47 ? 298  LEU E N   1 
ATOM   2142 C  CA  . LEU B 2 33  ? -4.118  -7.894  13.702 1.00 34.41 ? 298  LEU E CA  1 
ATOM   2143 C  C   . LEU B 2 33  ? -4.809  -7.367  12.440 1.00 34.74 ? 298  LEU E C   1 
ATOM   2144 O  O   . LEU B 2 33  ? -5.627  -6.448  12.518 1.00 34.68 ? 298  LEU E O   1 
ATOM   2145 C  CB  . LEU B 2 33  ? -3.056  -6.896  14.173 1.00 34.25 ? 298  LEU E CB  1 
ATOM   2146 C  CG  . LEU B 2 33  ? -2.372  -7.131  15.525 1.00 33.98 ? 298  LEU E CG  1 
ATOM   2147 C  CD1 . LEU B 2 33  ? -1.318  -6.059  15.780 1.00 32.17 ? 298  LEU E CD1 1 
ATOM   2148 C  CD2 . LEU B 2 33  ? -3.385  -7.191  16.677 1.00 32.34 ? 298  LEU E CD2 1 
ATOM   2149 N  N   . ASP B 2 34  ? -4.476  -7.930  11.295 1.00 35.26 ? 299  ASP E N   1 
ATOM   2150 C  CA  . ASP B 2 34  ? -5.195  -7.667  10.076 1.00 35.80 ? 299  ASP E CA  1 
ATOM   2151 C  C   . ASP B 2 34  ? -6.206  -8.740  9.743  1.00 36.23 ? 299  ASP E C   1 
ATOM   2152 O  O   . ASP B 2 34  ? -5.891  -9.687  9.082  1.00 36.23 ? 299  ASP E O   1 
ATOM   2153 C  CB  . ASP B 2 34  ? -4.214  -7.482  8.937  1.00 35.95 ? 299  ASP E CB  1 
ATOM   2154 C  CG  . ASP B 2 34  ? -4.874  -7.131  7.643  1.00 36.37 ? 299  ASP E CG  1 
ATOM   2155 O  OD1 . ASP B 2 34  ? -5.995  -6.645  7.629  1.00 36.32 ? 299  ASP E OD1 1 
ATOM   2156 O  OD2 . ASP B 2 34  ? -4.252  -7.330  6.619  1.00 37.74 ? 299  ASP E OD2 1 
ATOM   2157 N  N   . ASN B 2 35  ? -7.441  -8.548  10.185 1.00 36.87 ? 300  ASN E N   1 
ATOM   2158 C  CA  . ASN B 2 35  ? -8.549  -9.423  9.872  1.00 37.53 ? 300  ASN E CA  1 
ATOM   2159 C  C   . ASN B 2 35  ? -8.276  -10.853 10.218 1.00 37.69 ? 300  ASN E C   1 
ATOM   2160 O  O   . ASN B 2 35  ? -8.454  -11.727 9.439  1.00 39.08 ? 300  ASN E O   1 
ATOM   2161 C  CB  . ASN B 2 35  ? -9.030  -9.234  8.437  1.00 37.70 ? 300  ASN E CB  1 
ATOM   2162 C  CG  . ASN B 2 35  ? -10.259 -10.035 8.110  1.00 38.30 ? 300  ASN E CG  1 
ATOM   2163 O  OD1 . ASN B 2 35  ? -11.193 -10.088 8.866  1.00 39.81 ? 300  ASN E OD1 1 
ATOM   2164 N  ND2 . ASN B 2 35  ? -10.255 -10.654 6.970  1.00 36.54 ? 300  ASN E ND2 1 
ATOM   2165 N  N   . ASN B 2 36  ? -7.865  -11.050 11.449 1.00 37.39 ? 301  ASN E N   1 
ATOM   2166 C  CA  . ASN B 2 36  ? -7.392  -12.306 11.956 1.00 36.81 ? 301  ASN E CA  1 
ATOM   2167 C  C   . ASN B 2 36  ? -6.526  -13.106 11.035 1.00 36.60 ? 301  ASN E C   1 
ATOM   2168 O  O   . ASN B 2 36  ? -6.607  -14.292 10.989 1.00 36.69 ? 301  ASN E O   1 
ATOM   2169 C  CB  . ASN B 2 36  ? -8.545  -13.124 12.471 1.00 36.82 ? 301  ASN E CB  1 
ATOM   2170 C  CG  . ASN B 2 36  ? -8.162  -14.015 13.597 1.00 37.00 ? 301  ASN E CG  1 
ATOM   2171 O  OD1 . ASN B 2 36  ? -7.342  -13.683 14.400 1.00 36.55 ? 301  ASN E OD1 1 
ATOM   2172 N  ND2 . ASN B 2 36  ? -8.754  -15.158 13.644 1.00 36.63 ? 301  ASN E ND2 1 
ATOM   2173 N  N   . GLY B 2 37  ? -5.670  -12.446 10.299 1.00 36.17 ? 302  GLY E N   1 
ATOM   2174 C  CA  . GLY B 2 37  ? -4.777  -13.195 9.413  1.00 35.71 ? 302  GLY E CA  1 
ATOM   2175 C  C   . GLY B 2 37  ? -5.472  -13.725 8.158  1.00 35.53 ? 302  GLY E C   1 
ATOM   2176 O  O   . GLY B 2 37  ? -4.839  -14.350 7.302  1.00 35.35 ? 302  GLY E O   1 
ATOM   2177 N  N   . GLY B 2 38  ? -6.772  -13.452 8.038  1.00 35.05 ? 303  GLY E N   1 
ATOM   2178 C  CA  . GLY B 2 38  ? -7.611  -14.055 7.005  1.00 34.31 ? 303  GLY E CA  1 
ATOM   2179 C  C   . GLY B 2 38  ? -8.038  -15.468 7.374  1.00 34.04 ? 303  GLY E C   1 
ATOM   2180 O  O   . GLY B 2 38  ? -8.630  -16.176 6.559  1.00 33.93 ? 303  GLY E O   1 
ATOM   2181 N  N   . CYS B 2 39  ? -7.723  -15.878 8.605  1.00 33.79 ? 304  CYS E N   1 
ATOM   2182 C  CA  . CYS B 2 39  ? -8.073  -17.201 9.119  1.00 33.30 ? 304  CYS E CA  1 
ATOM   2183 C  C   . CYS B 2 39  ? -9.539  -17.210 9.510  1.00 33.12 ? 304  CYS E C   1 
ATOM   2184 O  O   . CYS B 2 39  ? -10.044 -16.215 10.034 1.00 33.41 ? 304  CYS E O   1 
ATOM   2185 C  CB  . CYS B 2 39  ? -7.203  -17.563 10.334 1.00 32.93 ? 304  CYS E CB  1 
ATOM   2186 S  SG  . CYS B 2 39  ? -5.416  -17.475 10.073 1.00 32.83 ? 304  CYS E SG  1 
ATOM   2187 N  N   . SER B 2 40  ? -10.219 -18.327 9.255  1.00 32.89 ? 305  SER E N   1 
ATOM   2188 C  CA  . SER B 2 40  ? -11.650 -18.444 9.550  1.00 32.52 ? 305  SER E CA  1 
ATOM   2189 C  C   . SER B 2 40  ? -11.889 -18.664 11.037 1.00 32.70 ? 305  SER E C   1 
ATOM   2190 O  O   . SER B 2 40  ? -12.961 -18.361 11.551 1.00 32.92 ? 305  SER E O   1 
ATOM   2191 C  CB  . SER B 2 40  ? -12.290 -19.582 8.746  1.00 32.37 ? 305  SER E CB  1 
ATOM   2192 O  OG  . SER B 2 40  ? -11.825 -20.853 9.166  1.00 30.76 ? 305  SER E OG  1 
ATOM   2193 N  N   . HIS B 2 41  ? -10.886 -19.202 11.722 1.00 32.85 ? 306  HIS E N   1 
ATOM   2194 C  CA  . HIS B 2 41  ? -11.017 -19.507 13.136 1.00 32.62 ? 306  HIS E CA  1 
ATOM   2195 C  C   . HIS B 2 41  ? -9.859  -18.922 13.934 1.00 32.66 ? 306  HIS E C   1 
ATOM   2196 O  O   . HIS B 2 41  ? -9.904  -17.755 14.326 1.00 32.90 ? 306  HIS E O   1 
ATOM   2197 C  CB  . HIS B 2 41  ? -11.157 -21.019 13.343 1.00 32.59 ? 306  HIS E CB  1 
ATOM   2198 C  CG  . HIS B 2 41  ? -12.465 -21.566 12.862 1.00 32.53 ? 306  HIS E CG  1 
ATOM   2199 N  ND1 . HIS B 2 41  ? -12.753 -21.740 11.525 1.00 32.45 ? 306  HIS E ND1 1 
ATOM   2200 C  CD2 . HIS B 2 41  ? -13.570 -21.962 13.539 1.00 31.71 ? 306  HIS E CD2 1 
ATOM   2201 C  CE1 . HIS B 2 41  ? -13.976 -22.225 11.400 1.00 31.64 ? 306  HIS E CE1 1 
ATOM   2202 N  NE2 . HIS B 2 41  ? -14.492 -22.369 12.607 1.00 31.21 ? 306  HIS E NE2 1 
ATOM   2203 N  N   . VAL B 2 42  ? -8.817  -19.721 14.147 1.00 32.55 ? 307  VAL E N   1 
ATOM   2204 C  CA  . VAL B 2 42  ? -7.681  -19.314 14.960 1.00 32.33 ? 307  VAL E CA  1 
ATOM   2205 C  C   . VAL B 2 42  ? -6.502  -18.856 14.101 1.00 32.49 ? 307  VAL E C   1 
ATOM   2206 O  O   . VAL B 2 42  ? -6.094  -19.542 13.163 1.00 32.37 ? 307  VAL E O   1 
ATOM   2207 C  CB  . VAL B 2 42  ? -7.239  -20.452 15.925 1.00 32.46 ? 307  VAL E CB  1 
ATOM   2208 C  CG1 . VAL B 2 42  ? -5.954  -20.088 16.649 1.00 31.28 ? 307  VAL E CG1 1 
ATOM   2209 C  CG2 . VAL B 2 42  ? -8.355  -20.765 16.928 1.00 31.98 ? 307  VAL E CG2 1 
ATOM   2210 N  N   . CYS B 2 43  ? -5.968  -17.686 14.440 1.00 32.18 ? 308  CYS E N   1 
ATOM   2211 C  CA  . CYS B 2 43  ? -4.750  -17.188 13.838 1.00 32.16 ? 308  CYS E CA  1 
ATOM   2212 C  C   . CYS B 2 43  ? -3.615  -17.331 14.851 1.00 32.02 ? 308  CYS E C   1 
ATOM   2213 O  O   . CYS B 2 43  ? -3.737  -16.911 15.999 1.00 31.83 ? 308  CYS E O   1 
ATOM   2214 C  CB  . CYS B 2 43  ? -4.936  -15.727 13.397 1.00 32.35 ? 308  CYS E CB  1 
ATOM   2215 S  SG  . CYS B 2 43  ? -3.483  -14.938 12.639 1.00 32.50 ? 308  CYS E SG  1 
ATOM   2216 N  N   . ASN B 2 44  ? -2.529  -17.963 14.424 1.00 32.06 ? 309  ASN E N   1 
ATOM   2217 C  CA  . ASN B 2 44  ? -1.351  -18.153 15.261 1.00 32.19 ? 309  ASN E CA  1 
ATOM   2218 C  C   . ASN B 2 44  ? -0.216  -17.243 14.802 1.00 32.00 ? 309  ASN E C   1 
ATOM   2219 O  O   . ASN B 2 44  ? 0.353   -17.437 13.719 1.00 31.88 ? 309  ASN E O   1 
ATOM   2220 C  CB  . ASN B 2 44  ? -0.924  -19.625 15.221 1.00 32.45 ? 309  ASN E CB  1 
ATOM   2221 C  CG  . ASN B 2 44  ? 0.155   -19.973 16.243 1.00 32.66 ? 309  ASN E CG  1 
ATOM   2222 O  OD1 . ASN B 2 44  ? 0.720   -21.061 16.188 1.00 34.50 ? 309  ASN E OD1 1 
ATOM   2223 N  ND2 . ASN B 2 44  ? 0.433   -19.071 17.177 1.00 32.58 ? 309  ASN E ND2 1 
ATOM   2224 N  N   . ASP B 2 45  ? 0.096   -16.244 15.624 1.00 31.85 ? 310  ASP E N   1 
ATOM   2225 C  CA  . ASP B 2 45  ? 1.174   -15.306 15.320 1.00 31.80 ? 310  ASP E CA  1 
ATOM   2226 C  C   . ASP B 2 45  ? 2.532   -15.919 15.636 1.00 31.82 ? 310  ASP E C   1 
ATOM   2227 O  O   . ASP B 2 45  ? 2.957   -15.969 16.794 1.00 31.59 ? 310  ASP E O   1 
ATOM   2228 C  CB  . ASP B 2 45  ? 1.000   -13.978 16.066 1.00 31.85 ? 310  ASP E CB  1 
ATOM   2229 C  CG  . ASP B 2 45  ? 2.056   -12.948 15.684 1.00 31.39 ? 310  ASP E CG  1 
ATOM   2230 O  OD1 . ASP B 2 45  ? 2.420   -12.112 16.531 1.00 31.31 ? 310  ASP E OD1 1 
ATOM   2231 O  OD2 . ASP B 2 45  ? 2.525   -12.973 14.531 1.00 31.63 ? 310  ASP E OD2 1 
ATOM   2232 N  N   . LEU B 2 46  ? 3.209   -16.366 14.584 1.00 32.10 ? 311  LEU E N   1 
ATOM   2233 C  CA  . LEU B 2 46  ? 4.499   -17.027 14.706 1.00 32.15 ? 311  LEU E CA  1 
ATOM   2234 C  C   . LEU B 2 46  ? 5.655   -16.038 14.828 1.00 32.68 ? 311  LEU E C   1 
ATOM   2235 O  O   . LEU B 2 46  ? 5.507   -14.858 14.509 1.00 32.90 ? 311  LEU E O   1 
ATOM   2236 C  CB  . LEU B 2 46  ? 4.708   -17.967 13.517 1.00 32.08 ? 311  LEU E CB  1 
ATOM   2237 C  CG  . LEU B 2 46  ? 3.772   -19.176 13.430 1.00 31.39 ? 311  LEU E CG  1 
ATOM   2238 C  CD1 . LEU B 2 46  ? 4.026   -19.941 12.152 1.00 30.55 ? 311  LEU E CD1 1 
ATOM   2239 C  CD2 . LEU B 2 46  ? 3.921   -20.087 14.652 1.00 31.48 ? 311  LEU E CD2 1 
ATOM   2240 N  N   . LYS B 2 47  ? 6.793   -16.525 15.320 1.00 33.18 ? 312  LYS E N   1 
ATOM   2241 C  CA  . LYS B 2 47  ? 8.054   -15.778 15.320 1.00 33.84 ? 312  LYS E CA  1 
ATOM   2242 C  C   . LYS B 2 47  ? 8.261   -15.079 13.974 1.00 33.66 ? 312  LYS E C   1 
ATOM   2243 O  O   . LYS B 2 47  ? 8.441   -13.859 13.906 1.00 33.56 ? 312  LYS E O   1 
ATOM   2244 C  CB  . LYS B 2 47  ? 9.212   -16.740 15.577 1.00 34.32 ? 312  LYS E CB  1 
ATOM   2245 C  CG  . LYS B 2 47  ? 9.627   -16.899 17.030 1.00 36.15 ? 312  LYS E CG  1 
ATOM   2246 C  CD  . LYS B 2 47  ? 10.941  -16.168 17.293 1.00 39.86 ? 312  LYS E CD  1 
ATOM   2247 C  CE  . LYS B 2 47  ? 12.128  -16.777 16.518 1.00 41.08 ? 312  LYS E CE  1 
ATOM   2248 N  NZ  . LYS B 2 47  ? 13.163  -17.390 17.416 1.00 41.57 ? 312  LYS E NZ  1 
ATOM   2249 N  N   . ILE B 2 48  ? 8.224   -15.877 12.911 1.00 33.45 ? 313  ILE E N   1 
ATOM   2250 C  CA  . ILE B 2 48  ? 8.288   -15.383 11.545 1.00 33.18 ? 313  ILE E CA  1 
ATOM   2251 C  C   . ILE B 2 48  ? 7.006   -15.789 10.821 1.00 33.07 ? 313  ILE E C   1 
ATOM   2252 O  O   . ILE B 2 48  ? 6.675   -16.980 10.736 1.00 33.09 ? 313  ILE E O   1 
ATOM   2253 C  CB  . ILE B 2 48  ? 9.538   -15.918 10.807 1.00 33.20 ? 313  ILE E CB  1 
ATOM   2254 C  CG1 . ILE B 2 48  ? 10.808  -15.379 11.474 1.00 32.90 ? 313  ILE E CG1 1 
ATOM   2255 C  CG2 . ILE B 2 48  ? 9.498   -15.532 9.318  1.00 33.52 ? 313  ILE E CG2 1 
ATOM   2256 C  CD1 . ILE B 2 48  ? 12.084  -15.933 10.913 1.00 34.01 ? 313  ILE E CD1 1 
ATOM   2257 N  N   . GLY B 2 49  ? 6.275   -14.793 10.329 1.00 32.61 ? 314  GLY E N   1 
ATOM   2258 C  CA  . GLY B 2 49  ? 5.007   -15.030 9.649  1.00 32.63 ? 314  GLY E CA  1 
ATOM   2259 C  C   . GLY B 2 49  ? 3.905   -15.451 10.600 1.00 32.56 ? 314  GLY E C   1 
ATOM   2260 O  O   . GLY B 2 49  ? 3.861   -15.016 11.750 1.00 32.70 ? 314  GLY E O   1 
ATOM   2261 N  N   . TYR B 2 50  ? 3.011   -16.300 10.108 1.00 32.76 ? 315  TYR E N   1 
ATOM   2262 C  CA  . TYR B 2 50  ? 1.900   -16.805 10.895 1.00 32.89 ? 315  TYR E CA  1 
ATOM   2263 C  C   . TYR B 2 50  ? 1.303   -18.035 10.220 1.00 33.21 ? 315  TYR E C   1 
ATOM   2264 O  O   . TYR B 2 50  ? 1.726   -18.429 9.128  1.00 33.62 ? 315  TYR E O   1 
ATOM   2265 C  CB  . TYR B 2 50  ? 0.832   -15.718 11.088 1.00 32.79 ? 315  TYR E CB  1 
ATOM   2266 C  CG  . TYR B 2 50  ? -0.011  -15.443 9.859  1.00 32.70 ? 315  TYR E CG  1 
ATOM   2267 C  CD1 . TYR B 2 50  ? 0.530   -14.791 8.745  1.00 32.68 ? 315  TYR E CD1 1 
ATOM   2268 C  CD2 . TYR B 2 50  ? -1.351  -15.833 9.810  1.00 31.34 ? 315  TYR E CD2 1 
ATOM   2269 C  CE1 . TYR B 2 50  ? -0.244  -14.531 7.614  1.00 32.41 ? 315  TYR E CE1 1 
ATOM   2270 C  CE2 . TYR B 2 50  ? -2.127  -15.583 8.688  1.00 31.45 ? 315  TYR E CE2 1 
ATOM   2271 C  CZ  . TYR B 2 50  ? -1.571  -14.933 7.592  1.00 32.42 ? 315  TYR E CZ  1 
ATOM   2272 O  OH  . TYR B 2 50  ? -2.344  -14.677 6.475  1.00 33.11 ? 315  TYR E OH  1 
ATOM   2273 N  N   . GLU B 2 51  ? 0.319   -18.634 10.882 1.00 33.20 ? 316  GLU E N   1 
ATOM   2274 C  CA  . GLU B 2 51  ? -0.406  -19.775 10.347 1.00 33.26 ? 316  GLU E CA  1 
ATOM   2275 C  C   . GLU B 2 51  ? -1.857  -19.752 10.841 1.00 33.24 ? 316  GLU E C   1 
ATOM   2276 O  O   . GLU B 2 51  ? -2.172  -19.108 11.847 1.00 33.04 ? 316  GLU E O   1 
ATOM   2277 C  CB  . GLU B 2 51  ? 0.285   -21.083 10.745 1.00 33.05 ? 316  GLU E CB  1 
ATOM   2278 C  CG  . GLU B 2 51  ? 0.350   -21.307 12.255 1.00 33.17 ? 316  GLU E CG  1 
ATOM   2279 C  CD  . GLU B 2 51  ? 1.121   -22.550 12.651 1.00 33.33 ? 316  GLU E CD  1 
ATOM   2280 O  OE1 . GLU B 2 51  ? 1.012   -22.951 13.831 1.00 32.30 ? 316  GLU E OE1 1 
ATOM   2281 O  OE2 . GLU B 2 51  ? 1.844   -23.113 11.796 1.00 34.25 ? 316  GLU E OE2 1 
ATOM   2282 N  N   . CYS B 2 52  ? -2.735  -20.441 10.123 1.00 33.54 ? 317  CYS E N   1 
ATOM   2283 C  CA  . CYS B 2 52  ? -4.132  -20.572 10.546 1.00 34.12 ? 317  CYS E CA  1 
ATOM   2284 C  C   . CYS B 2 52  ? -4.346  -21.925 11.201 1.00 34.54 ? 317  CYS E C   1 
ATOM   2285 O  O   . CYS B 2 52  ? -3.828  -22.941 10.740 1.00 34.80 ? 317  CYS E O   1 
ATOM   2286 C  CB  . CYS B 2 52  ? -5.092  -20.408 9.371  1.00 33.68 ? 317  CYS E CB  1 
ATOM   2287 S  SG  . CYS B 2 52  ? -5.051  -18.800 8.576  1.00 33.75 ? 317  CYS E SG  1 
ATOM   2288 N  N   . LEU B 2 53  ? -5.101  -21.919 12.289 1.00 35.22 ? 318  LEU E N   1 
ATOM   2289 C  CA  . LEU B 2 53  ? -5.380  -23.125 13.054 1.00 35.95 ? 318  LEU E CA  1 
ATOM   2290 C  C   . LEU B 2 53  ? -6.886  -23.402 13.120 1.00 36.91 ? 318  LEU E C   1 
ATOM   2291 O  O   . LEU B 2 53  ? -7.708  -22.516 12.877 1.00 36.60 ? 318  LEU E O   1 
ATOM   2292 C  CB  . LEU B 2 53  ? -4.760  -23.007 14.451 1.00 35.47 ? 318  LEU E CB  1 
ATOM   2293 C  CG  . LEU B 2 53  ? -3.399  -23.646 14.780 1.00 34.97 ? 318  LEU E CG  1 
ATOM   2294 C  CD1 . LEU B 2 53  ? -2.492  -23.897 13.575 1.00 33.47 ? 318  LEU E CD1 1 
ATOM   2295 C  CD2 . LEU B 2 53  ? -2.674  -22.818 15.826 1.00 33.33 ? 318  LEU E CD2 1 
ATOM   2296 N  N   . CYS B 2 54  ? -7.229  -24.647 13.435 1.00 38.53 ? 319  CYS E N   1 
ATOM   2297 C  CA  . CYS B 2 54  ? -8.614  -25.111 13.469 1.00 40.00 ? 319  CYS E CA  1 
ATOM   2298 C  C   . CYS B 2 54  ? -8.946  -25.768 14.808 1.00 40.59 ? 319  CYS E C   1 
ATOM   2299 O  O   . CYS B 2 54  ? -8.052  -26.275 15.485 1.00 40.53 ? 319  CYS E O   1 
ATOM   2300 C  CB  . CYS B 2 54  ? -8.854  -26.116 12.337 1.00 40.09 ? 319  CYS E CB  1 
ATOM   2301 S  SG  . CYS B 2 54  ? -8.741  -25.424 10.670 1.00 42.93 ? 319  CYS E SG  1 
ATOM   2302 N  N   . PRO B 2 55  ? -10.234 -25.755 15.204 1.00 41.40 ? 320  PRO E N   1 
ATOM   2303 C  CA  . PRO B 2 55  ? -10.648 -26.602 16.326 1.00 42.06 ? 320  PRO E CA  1 
ATOM   2304 C  C   . PRO B 2 55  ? -10.730 -28.081 15.919 1.00 42.73 ? 320  PRO E C   1 
ATOM   2305 O  O   . PRO B 2 55  ? -10.700 -28.397 14.724 1.00 42.71 ? 320  PRO E O   1 
ATOM   2306 C  CB  . PRO B 2 55  ? -12.037 -26.063 16.681 1.00 42.07 ? 320  PRO E CB  1 
ATOM   2307 C  CG  . PRO B 2 55  ? -12.551 -25.475 15.419 1.00 41.81 ? 320  PRO E CG  1 
ATOM   2308 C  CD  . PRO B 2 55  ? -11.351 -24.952 14.672 1.00 41.47 ? 320  PRO E CD  1 
ATOM   2309 N  N   . ASP B 2 56  ? -10.826 -28.969 16.909 1.00 43.49 ? 321  ASP E N   1 
ATOM   2310 C  CA  . ASP B 2 56  ? -10.929 -30.412 16.668 1.00 44.20 ? 321  ASP E CA  1 
ATOM   2311 C  C   . ASP B 2 56  ? -12.108 -30.749 15.760 1.00 44.44 ? 321  ASP E C   1 
ATOM   2312 O  O   . ASP B 2 56  ? -13.203 -30.202 15.926 1.00 44.54 ? 321  ASP E O   1 
ATOM   2313 C  CB  . ASP B 2 56  ? -11.064 -31.176 17.993 1.00 44.40 ? 321  ASP E CB  1 
ATOM   2314 C  CG  . ASP B 2 56  ? -9.803  -31.107 18.850 1.00 45.09 ? 321  ASP E CG  1 
ATOM   2315 O  OD1 . ASP B 2 56  ? -9.931  -30.839 20.067 1.00 45.64 ? 321  ASP E OD1 1 
ATOM   2316 O  OD2 . ASP B 2 56  ? -8.691  -31.323 18.312 1.00 44.76 ? 321  ASP E OD2 1 
ATOM   2317 N  N   . GLY B 2 57  ? -11.873 -31.644 14.802 1.00 44.67 ? 322  GLY E N   1 
ATOM   2318 C  CA  . GLY B 2 57  ? -12.915 -32.087 13.873 1.00 44.91 ? 322  GLY E CA  1 
ATOM   2319 C  C   . GLY B 2 57  ? -13.019 -31.246 12.612 1.00 45.07 ? 322  GLY E C   1 
ATOM   2320 O  O   . GLY B 2 57  ? -14.019 -31.319 11.891 1.00 45.13 ? 322  GLY E O   1 
ATOM   2321 N  N   . PHE B 2 58  ? -11.982 -30.451 12.349 1.00 45.11 ? 323  PHE E N   1 
ATOM   2322 C  CA  . PHE B 2 58  ? -11.929 -29.563 11.189 1.00 45.02 ? 323  PHE E CA  1 
ATOM   2323 C  C   . PHE B 2 58  ? -10.603 -29.708 10.454 1.00 44.81 ? 323  PHE E C   1 
ATOM   2324 O  O   . PHE B 2 58  ? -9.570  -29.955 11.069 1.00 44.69 ? 323  PHE E O   1 
ATOM   2325 C  CB  . PHE B 2 58  ? -12.095 -28.102 11.625 1.00 45.26 ? 323  PHE E CB  1 
ATOM   2326 C  CG  . PHE B 2 58  ? -13.509 -27.713 11.950 1.00 45.58 ? 323  PHE E CG  1 
ATOM   2327 C  CD1 . PHE B 2 58  ? -14.056 -27.996 13.200 1.00 45.78 ? 323  PHE E CD1 1 
ATOM   2328 C  CD2 . PHE B 2 58  ? -14.291 -27.045 11.010 1.00 46.37 ? 323  PHE E CD2 1 
ATOM   2329 C  CE1 . PHE B 2 58  ? -15.366 -27.629 13.504 1.00 46.02 ? 323  PHE E CE1 1 
ATOM   2330 C  CE2 . PHE B 2 58  ? -15.603 -26.672 11.304 1.00 45.86 ? 323  PHE E CE2 1 
ATOM   2331 C  CZ  . PHE B 2 58  ? -16.141 -26.966 12.553 1.00 45.93 ? 323  PHE E CZ  1 
ATOM   2332 N  N   . GLN B 2 59  ? -10.648 -29.545 9.135  1.00 44.66 ? 324  GLN E N   1 
ATOM   2333 C  CA  . GLN B 2 59  ? -9.456  -29.551 8.300  0.50 44.47 ? 324  GLN E CA  1 
ATOM   2334 C  C   . GLN B 2 59  ? -9.254  -28.164 7.720  1.00 44.39 ? 324  GLN E C   1 
ATOM   2335 O  O   . GLN B 2 59  ? -10.216 -27.523 7.286  1.00 44.36 ? 324  GLN E O   1 
ATOM   2336 C  CB  . GLN B 2 59  ? -9.595  -30.558 7.156  0.50 44.45 ? 324  GLN E CB  1 
ATOM   2337 C  CG  . GLN B 2 59  ? -9.494  -32.012 7.571  0.50 44.63 ? 324  GLN E CG  1 
ATOM   2338 C  CD  . GLN B 2 59  ? -9.075  -32.910 6.423  0.50 44.86 ? 324  GLN E CD  1 
ATOM   2339 O  OE1 . GLN B 2 59  ? -9.879  -33.681 5.899  0.50 44.89 ? 324  GLN E OE1 1 
ATOM   2340 N  NE2 . GLN B 2 59  ? -7.812  -32.807 6.019  0.50 44.67 ? 324  GLN E NE2 1 
ATOM   2341 N  N   . LEU B 2 60  ? -8.004  -27.706 7.702  1.00 44.11 ? 325  LEU E N   1 
ATOM   2342 C  CA  . LEU B 2 60  ? -7.684  -26.413 7.111  1.00 43.89 ? 325  LEU E CA  1 
ATOM   2343 C  C   . LEU B 2 60  ? -7.598  -26.529 5.594  1.00 43.92 ? 325  LEU E C   1 
ATOM   2344 O  O   . LEU B 2 60  ? -6.807  -27.311 5.071  1.00 44.02 ? 325  LEU E O   1 
ATOM   2345 C  CB  . LEU B 2 60  ? -6.379  -25.854 7.685  1.00 43.79 ? 325  LEU E CB  1 
ATOM   2346 C  CG  . LEU B 2 60  ? -6.098  -24.379 7.379  1.00 43.22 ? 325  LEU E CG  1 
ATOM   2347 C  CD1 . LEU B 2 60  ? -7.101  -23.474 8.081  1.00 41.80 ? 325  LEU E CD1 1 
ATOM   2348 C  CD2 . LEU B 2 60  ? -4.680  -24.022 7.771  1.00 41.92 ? 325  LEU E CD2 1 
ATOM   2349 N  N   . VAL B 2 61  ? -8.419  -25.750 4.897  1.00 43.93 ? 326  VAL E N   1 
ATOM   2350 C  CA  . VAL B 2 61  ? -8.467  -25.768 3.435  1.00 44.03 ? 326  VAL E CA  1 
ATOM   2351 C  C   . VAL B 2 61  ? -7.883  -24.464 2.878  1.00 44.12 ? 326  VAL E C   1 
ATOM   2352 O  O   . VAL B 2 61  ? -8.214  -23.378 3.357  1.00 44.30 ? 326  VAL E O   1 
ATOM   2353 C  CB  . VAL B 2 61  ? -9.925  -25.988 2.908  1.00 43.95 ? 326  VAL E CB  1 
ATOM   2354 C  CG1 . VAL B 2 61  ? -9.946  -26.139 1.390  1.00 43.64 ? 326  VAL E CG1 1 
ATOM   2355 C  CG2 . VAL B 2 61  ? -10.566 -27.209 3.566  1.00 43.70 ? 326  VAL E CG2 1 
ATOM   2356 N  N   . ALA B 2 62  ? -7.015  -24.586 1.871  1.00 44.16 ? 327  ALA E N   1 
ATOM   2357 C  CA  . ALA B 2 62  ? -6.366  -23.437 1.219  1.00 44.33 ? 327  ALA E CA  1 
ATOM   2358 C  C   . ALA B 2 62  ? -5.620  -22.544 2.215  1.00 44.45 ? 327  ALA E C   1 
ATOM   2359 O  O   . ALA B 2 62  ? -5.539  -21.322 2.037  1.00 44.38 ? 327  ALA E O   1 
ATOM   2360 C  CB  . ALA B 2 62  ? -7.378  -22.623 0.386  1.00 44.29 ? 327  ALA E CB  1 
ATOM   2361 N  N   . GLN B 2 63  ? -5.091  -23.183 3.261  1.00 44.63 ? 328  GLN E N   1 
ATOM   2362 C  CA  . GLN B 2 63  ? -4.270  -22.554 4.307  1.00 44.58 ? 328  GLN E CA  1 
ATOM   2363 C  C   . GLN B 2 63  ? -5.027  -21.546 5.193  1.00 44.81 ? 328  GLN E C   1 
ATOM   2364 O  O   . GLN B 2 63  ? -4.443  -20.974 6.114  1.00 44.80 ? 328  GLN E O   1 
ATOM   2365 C  CB  . GLN B 2 63  ? -2.965  -21.961 3.722  1.00 44.51 ? 328  GLN E CB  1 
ATOM   2366 C  CG  . GLN B 2 63  ? -2.073  -22.993 3.008  1.00 44.12 ? 328  GLN E CG  1 
ATOM   2367 C  CD  . GLN B 2 63  ? -0.695  -22.461 2.567  1.00 44.60 ? 328  GLN E CD  1 
ATOM   2368 O  OE1 . GLN B 2 63  ? 0.321   -23.151 2.710  1.00 42.80 ? 328  GLN E OE1 1 
ATOM   2369 N  NE2 . GLN B 2 63  ? -0.663  -21.246 2.020  1.00 44.53 ? 328  GLN E NE2 1 
ATOM   2370 N  N   . ARG B 2 64  ? -6.328  -21.371 4.948  1.00 45.08 ? 329  ARG E N   1 
ATOM   2371 C  CA  . ARG B 2 64  ? -7.105  -20.304 5.598  1.00 45.45 ? 329  ARG E CA  1 
ATOM   2372 C  C   . ARG B 2 64  ? -8.412  -20.741 6.262  1.00 45.47 ? 329  ARG E C   1 
ATOM   2373 O  O   . ARG B 2 64  ? -8.737  -20.257 7.345  1.00 45.29 ? 329  ARG E O   1 
ATOM   2374 C  CB  . ARG B 2 64  ? -7.404  -19.163 4.611  1.00 45.64 ? 329  ARG E CB  1 
ATOM   2375 C  CG  . ARG B 2 64  ? -6.176  -18.420 4.076  1.00 46.86 ? 329  ARG E CG  1 
ATOM   2376 C  CD  . ARG B 2 64  ? -5.543  -17.524 5.123  1.00 48.62 ? 329  ARG E CD  1 
ATOM   2377 N  NE  . ARG B 2 64  ? -4.341  -16.856 4.620  1.00 51.58 ? 329  ARG E NE  1 
ATOM   2378 C  CZ  . ARG B 2 64  ? -3.102  -17.354 4.681  1.00 52.09 ? 329  ARG E CZ  1 
ATOM   2379 N  NH1 . ARG B 2 64  ? -2.870  -18.541 5.223  1.00 52.54 ? 329  ARG E NH1 1 
ATOM   2380 N  NH2 . ARG B 2 64  ? -2.082  -16.656 4.196  1.00 52.93 ? 329  ARG E NH2 1 
ATOM   2381 N  N   . ARG B 2 65  ? -9.148  -21.648 5.618  1.00 45.63 ? 330  ARG E N   1 
ATOM   2382 C  CA  . ARG B 2 65  ? -10.515 -21.994 6.043  1.00 46.18 ? 330  ARG E CA  1 
ATOM   2383 C  C   . ARG B 2 65  ? -10.674 -23.409 6.600  1.00 45.90 ? 330  ARG E C   1 
ATOM   2384 O  O   . ARG B 2 65  ? -10.305 -24.388 5.951  1.00 45.82 ? 330  ARG E O   1 
ATOM   2385 C  CB  . ARG B 2 65  ? -11.509 -21.799 4.891  1.00 46.01 ? 330  ARG E CB  1 
ATOM   2386 C  CG  . ARG B 2 65  ? -11.562 -20.390 4.320  1.00 46.99 ? 330  ARG E CG  1 
ATOM   2387 C  CD  . ARG B 2 65  ? -12.413 -20.327 3.046  1.00 47.37 ? 330  ARG E CD  1 
ATOM   2388 N  NE  . ARG B 2 65  ? -11.792 -21.024 1.912  1.00 49.56 ? 330  ARG E NE  1 
ATOM   2389 C  CZ  . ARG B 2 65  ? -12.197 -22.200 1.431  1.00 49.81 ? 330  ARG E CZ  1 
ATOM   2390 N  NH1 . ARG B 2 65  ? -11.568 -22.746 0.395  1.00 50.00 ? 330  ARG E NH1 1 
ATOM   2391 N  NH2 . ARG B 2 65  ? -13.229 -22.832 1.980  1.00 49.26 ? 330  ARG E NH2 1 
ATOM   2392 N  N   . CYS B 2 66  ? -11.245 -23.503 7.797  1.00 45.88 ? 331  CYS E N   1 
ATOM   2393 C  CA  . CYS B 2 66  ? -11.576 -24.791 8.396  1.00 45.98 ? 331  CYS E CA  1 
ATOM   2394 C  C   . CYS B 2 66  ? -12.925 -25.281 7.882  1.00 46.49 ? 331  CYS E C   1 
ATOM   2395 O  O   . CYS B 2 66  ? -13.861 -24.492 7.712  1.00 46.21 ? 331  CYS E O   1 
ATOM   2396 C  CB  . CYS B 2 66  ? -11.608 -24.696 9.921  1.00 45.68 ? 331  CYS E CB  1 
ATOM   2397 S  SG  . CYS B 2 66  ? -10.159 -23.936 10.643 1.00 44.70 ? 331  CYS E SG  1 
ATOM   2398 N  N   . GLU B 2 67  ? -13.008 -26.588 7.636  1.00 47.07 ? 332  GLU E N   1 
ATOM   2399 C  CA  . GLU B 2 67  ? -14.215 -27.215 7.102  1.00 47.92 ? 332  GLU E CA  1 
ATOM   2400 C  C   . GLU B 2 67  ? -14.483 -28.567 7.759  1.00 47.79 ? 332  GLU E C   1 
ATOM   2401 O  O   . GLU B 2 67  ? -13.550 -29.267 8.160  1.00 47.92 ? 332  GLU E O   1 
ATOM   2402 C  CB  . GLU B 2 67  ? -14.108 -27.367 5.582  1.00 47.83 ? 332  GLU E CB  1 
ATOM   2403 C  CG  . GLU B 2 67  ? -14.296 -26.052 4.820  1.00 48.77 ? 332  GLU E CG  1 
ATOM   2404 C  CD  . GLU B 2 67  ? -14.078 -26.176 3.318  1.00 49.25 ? 332  GLU E CD  1 
ATOM   2405 O  OE1 . GLU B 2 67  ? -14.008 -27.316 2.798  1.00 50.87 ? 332  GLU E OE1 1 
ATOM   2406 O  OE2 . GLU B 2 67  ? -13.980 -25.119 2.655  1.00 50.62 ? 332  GLU E OE2 1 
ATOM   2407 N  N   . THR C 3 23  ? -43.562 -5.375  54.257 1.00 49.82 ? 61   THR P N   1 
ATOM   2408 C  CA  . THR C 3 23  ? -43.585 -6.816  54.517 1.00 48.69 ? 61   THR P CA  1 
ATOM   2409 C  C   . THR C 3 23  ? -42.487 -7.437  53.660 1.00 47.49 ? 61   THR P C   1 
ATOM   2410 O  O   . THR C 3 23  ? -42.211 -6.944  52.562 1.00 47.75 ? 61   THR P O   1 
ATOM   2411 C  CB  . THR C 3 23  ? -44.967 -7.445  54.176 1.00 48.97 ? 61   THR P CB  1 
ATOM   2412 O  OG1 . THR C 3 23  ? -46.019 -6.626  54.709 1.00 48.85 ? 61   THR P OG1 1 
ATOM   2413 C  CG2 . THR C 3 23  ? -45.091 -8.857  54.758 1.00 49.13 ? 61   THR P CG2 1 
ATOM   2414 N  N   . ALA C 3 24  ? -41.848 -8.489  54.168 1.00 45.75 ? 62   ALA P N   1 
ATOM   2415 C  CA  . ALA C 3 24  ? -40.805 -9.183  53.423 1.00 44.22 ? 62   ALA P CA  1 
ATOM   2416 C  C   . ALA C 3 24  ? -41.381 -9.865  52.178 1.00 43.09 ? 62   ALA P C   1 
ATOM   2417 O  O   . ALA C 3 24  ? -42.377 -10.585 52.259 1.00 42.88 ? 62   ALA P O   1 
ATOM   2418 C  CB  . ALA C 3 24  ? -40.098 -10.185 54.309 1.00 44.23 ? 62   ALA P CB  1 
ATOM   2419 N  N   . THR C 3 25  ? -40.753 -9.619  51.031 1.00 41.67 ? 63   THR P N   1 
ATOM   2420 C  CA  . THR C 3 25  ? -41.219 -10.165 49.754 1.00 40.29 ? 63   THR P CA  1 
ATOM   2421 C  C   . THR C 3 25  ? -40.276 -11.238 49.193 1.00 39.16 ? 63   THR P C   1 
ATOM   2422 O  O   . THR C 3 25  ? -39.083 -11.240 49.482 1.00 38.89 ? 63   THR P O   1 
ATOM   2423 C  CB  . THR C 3 25  ? -41.455 -9.045  48.703 1.00 40.50 ? 63   THR P CB  1 
ATOM   2424 O  OG1 . THR C 3 25  ? -40.256 -8.274  48.531 1.00 40.19 ? 63   THR P OG1 1 
ATOM   2425 C  CG2 . THR C 3 25  ? -42.606 -8.122  49.138 1.00 40.00 ? 63   THR P CG2 1 
ATOM   2426 N  N   . PHE C 3 26  ? -40.835 -12.160 48.414 1.00 38.10 ? 64   PHE P N   1 
ATOM   2427 C  CA  . PHE C 3 26  ? -40.062 -13.204 47.752 1.00 37.00 ? 64   PHE P CA  1 
ATOM   2428 C  C   . PHE C 3 26  ? -39.864 -12.860 46.280 1.00 36.60 ? 64   PHE P C   1 
ATOM   2429 O  O   . PHE C 3 26  ? -40.787 -12.397 45.616 1.00 36.27 ? 64   PHE P O   1 
ATOM   2430 C  CB  . PHE C 3 26  ? -40.732 -14.576 47.907 1.00 36.75 ? 64   PHE P CB  1 
ATOM   2431 C  CG  . PHE C 3 26  ? -40.048 -15.680 47.134 1.00 36.61 ? 64   PHE P CG  1 
ATOM   2432 C  CD1 . PHE C 3 26  ? -38.779 -16.133 47.507 1.00 35.74 ? 64   PHE P CD1 1 
ATOM   2433 C  CD2 . PHE C 3 26  ? -40.668 -16.258 46.023 1.00 35.82 ? 64   PHE P CD2 1 
ATOM   2434 C  CE1 . PHE C 3 26  ? -38.138 -17.139 46.790 1.00 35.29 ? 64   PHE P CE1 1 
ATOM   2435 C  CE2 . PHE C 3 26  ? -40.037 -17.271 45.301 1.00 35.65 ? 64   PHE P CE2 1 
ATOM   2436 C  CZ  . PHE C 3 26  ? -38.767 -17.710 45.685 1.00 35.87 ? 64   PHE P CZ  1 
ATOM   2437 N  N   . HIS C 3 27  ? -38.649 -13.078 45.781 1.00 36.29 ? 65   HIS P N   1 
ATOM   2438 C  CA  . HIS C 3 27  ? -38.314 -12.761 44.390 1.00 35.74 ? 65   HIS P CA  1 
ATOM   2439 C  C   . HIS C 3 27  ? -37.696 -13.963 43.687 1.00 35.73 ? 65   HIS P C   1 
ATOM   2440 O  O   . HIS C 3 27  ? -36.961 -14.739 44.296 1.00 35.85 ? 65   HIS P O   1 
ATOM   2441 C  CB  . HIS C 3 27  ? -37.390 -11.545 44.319 1.00 35.38 ? 65   HIS P CB  1 
ATOM   2442 C  CG  . HIS C 3 27  ? -37.915 -10.356 45.058 1.00 34.56 ? 65   HIS P CG  1 
ATOM   2443 N  ND1 . HIS C 3 27  ? -38.645 -9.361  44.447 1.00 34.31 ? 65   HIS P ND1 1 
ATOM   2444 C  CD2 . HIS C 3 27  ? -37.848 -10.022 46.368 1.00 34.24 ? 65   HIS P CD2 1 
ATOM   2445 C  CE1 . HIS C 3 27  ? -38.992 -8.456  45.343 1.00 34.08 ? 65   HIS P CE1 1 
ATOM   2446 N  NE2 . HIS C 3 27  ? -38.522 -8.834  46.519 1.00 34.31 ? 65   HIS P NE2 1 
ATOM   2447 N  N   . ARG C 3 28  ? -38.038 -14.124 42.413 1.00 35.41 ? 66   ARG P N   1 
ATOM   2448 C  CA  . ARG C 3 28  ? -37.515 -15.203 41.582 1.00 35.36 ? 66   ARG P CA  1 
ATOM   2449 C  C   . ARG C 3 28  ? -37.301 -14.680 40.165 1.00 34.87 ? 66   ARG P C   1 
ATOM   2450 O  O   . ARG C 3 28  ? -37.833 -13.633 39.791 1.00 34.76 ? 66   ARG P O   1 
ATOM   2451 C  CB  . ARG C 3 28  ? -38.461 -16.414 41.559 1.00 35.59 ? 66   ARG P CB  1 
ATOM   2452 C  CG  . ARG C 3 28  ? -39.933 -16.046 41.433 1.00 37.35 ? 66   ARG P CG  1 
ATOM   2453 C  CD  . ARG C 3 28  ? -40.734 -17.025 40.594 1.00 39.40 ? 66   ARG P CD  1 
ATOM   2454 N  NE  . ARG C 3 28  ? -40.419 -16.920 39.176 1.00 40.60 ? 66   ARG P NE  1 
ATOM   2455 C  CZ  . ARG C 3 28  ? -41.184 -17.385 38.190 1.00 41.17 ? 66   ARG P CZ  1 
ATOM   2456 N  NH1 . ARG C 3 28  ? -42.340 -17.985 38.452 1.00 41.62 ? 66   ARG P NH1 1 
ATOM   2457 N  NH2 . ARG C 3 28  ? -40.787 -17.243 36.933 1.00 41.33 ? 66   ARG P NH2 1 
ATOM   2458 N  N   . CYS C 3 29  ? -36.513 -15.416 39.391 1.00 33.95 ? 67   CYS P N   1 
ATOM   2459 C  CA  . CYS C 3 29  ? -36.273 -15.091 37.997 1.00 33.84 ? 67   CYS P CA  1 
ATOM   2460 C  C   . CYS C 3 29  ? -37.544 -15.263 37.161 1.00 33.89 ? 67   CYS P C   1 
ATOM   2461 O  O   . CYS C 3 29  ? -38.228 -16.289 37.252 1.00 33.93 ? 67   CYS P O   1 
ATOM   2462 C  CB  . CYS C 3 29  ? -35.139 -15.960 37.451 1.00 33.73 ? 67   CYS P CB  1 
ATOM   2463 S  SG  . CYS C 3 29  ? -34.594 -15.505 35.818 1.00 32.59 ? 67   CYS P SG  1 
ATOM   2464 N  N   . ALA C 3 30  ? -37.851 -14.244 36.359 1.00 33.89 ? 68   ALA P N   1 
ATOM   2465 C  CA  . ALA C 3 30  ? -39.026 -14.253 35.490 1.00 34.00 ? 68   ALA P CA  1 
ATOM   2466 C  C   . ALA C 3 30  ? -38.918 -15.294 34.382 1.00 34.03 ? 68   ALA P C   1 
ATOM   2467 O  O   . ALA C 3 30  ? -39.932 -15.700 33.814 1.00 34.22 ? 68   ALA P O   1 
ATOM   2468 C  CB  . ALA C 3 30  ? -39.271 -12.866 34.897 1.00 34.09 ? 68   ALA P CB  1 
ATOM   2469 N  N   . LYS C 3 31  ? -37.690 -15.720 34.082 1.00 34.11 ? 69   LYS P N   1 
ATOM   2470 C  CA  A LYS C 3 31  ? -37.462 -16.747 33.070 0.50 34.18 ? 69   LYS P CA  1 
ATOM   2471 C  CA  B LYS C 3 31  ? -37.445 -16.748 33.068 0.50 33.80 ? 69   LYS P CA  1 
ATOM   2472 C  C   . LYS C 3 31  ? -37.240 -18.100 33.743 1.00 33.85 ? 69   LYS P C   1 
ATOM   2473 O  O   . LYS C 3 31  ? -36.165 -18.377 34.275 1.00 33.84 ? 69   LYS P O   1 
ATOM   2474 C  CB  A LYS C 3 31  ? -36.308 -16.347 32.138 0.50 34.31 ? 69   LYS P CB  1 
ATOM   2475 C  CB  B LYS C 3 31  ? -36.243 -16.381 32.184 0.50 33.72 ? 69   LYS P CB  1 
ATOM   2476 C  CG  A LYS C 3 31  ? -36.373 -14.873 31.743 0.50 35.10 ? 69   LYS P CG  1 
ATOM   2477 C  CG  B LYS C 3 31  ? -36.033 -17.322 31.004 0.50 32.67 ? 69   LYS P CG  1 
ATOM   2478 C  CD  A LYS C 3 31  ? -36.023 -14.610 30.280 0.50 35.82 ? 69   LYS P CD  1 
ATOM   2479 C  CD  B LYS C 3 31  ? -35.340 -16.637 29.849 0.50 31.36 ? 69   LYS P CD  1 
ATOM   2480 C  CE  A LYS C 3 31  ? -36.793 -13.391 29.743 0.50 34.72 ? 69   LYS P CE  1 
ATOM   2481 C  CE  B LYS C 3 31  ? -35.401 -17.503 28.598 0.50 31.13 ? 69   LYS P CE  1 
ATOM   2482 N  NZ  A LYS C 3 31  ? -36.722 -12.207 30.654 0.50 34.11 ? 69   LYS P NZ  1 
ATOM   2483 N  NZ  B LYS C 3 31  ? -34.626 -16.915 27.472 0.50 31.28 ? 69   LYS P NZ  1 
ATOM   2484 N  N   . ASP C 3 32  ? -38.287 -18.926 33.713 1.00 33.87 ? 70   ASP P N   1 
ATOM   2485 C  CA  . ASP C 3 32  ? -38.340 -20.220 34.412 1.00 33.89 ? 70   ASP P CA  1 
ATOM   2486 C  C   . ASP C 3 32  ? -37.108 -21.114 34.242 1.00 33.17 ? 70   ASP P C   1 
ATOM   2487 O  O   . ASP C 3 32  ? -36.588 -21.618 35.235 1.00 33.35 ? 70   ASP P O   1 
ATOM   2488 C  CB  . ASP C 3 32  ? -39.623 -20.984 34.061 1.00 34.38 ? 70   ASP P CB  1 
ATOM   2489 C  CG  . ASP C 3 32  ? -40.843 -20.463 34.817 1.00 37.12 ? 70   ASP P CG  1 
ATOM   2490 O  OD1 . ASP C 3 32  ? -41.450 -19.475 34.350 1.00 38.95 ? 70   ASP P OD1 1 
ATOM   2491 O  OD2 . ASP C 3 32  ? -41.196 -21.051 35.877 1.00 40.32 ? 70   ASP P OD2 1 
ATOM   2492 N  N   . PRO C 3 33  ? -36.644 -21.325 32.991 1.00 32.38 ? 71   PRO P N   1 
ATOM   2493 C  CA  . PRO C 3 33  ? -35.438 -22.124 32.773 1.00 31.67 ? 71   PRO P CA  1 
ATOM   2494 C  C   . PRO C 3 33  ? -34.193 -21.687 33.551 1.00 30.98 ? 71   PRO P C   1 
ATOM   2495 O  O   . PRO C 3 33  ? -33.320 -22.512 33.796 1.00 30.69 ? 71   PRO P O   1 
ATOM   2496 C  CB  . PRO C 3 33  ? -35.198 -21.968 31.265 1.00 31.77 ? 71   PRO P CB  1 
ATOM   2497 C  CG  . PRO C 3 33  ? -36.562 -21.778 30.708 1.00 31.98 ? 71   PRO P CG  1 
ATOM   2498 C  CD  . PRO C 3 33  ? -37.233 -20.892 31.707 1.00 32.26 ? 71   PRO P CD  1 
ATOM   2499 N  N   . TRP C 3 34  ? -34.109 -20.414 33.927 1.00 30.20 ? 72   TRP P N   1 
ATOM   2500 C  CA  . TRP C 3 34  ? -32.910 -19.883 34.581 1.00 29.79 ? 72   TRP P CA  1 
ATOM   2501 C  C   . TRP C 3 34  ? -33.005 -19.856 36.106 1.00 30.07 ? 72   TRP P C   1 
ATOM   2502 O  O   . TRP C 3 34  ? -32.066 -19.438 36.781 1.00 30.53 ? 72   TRP P O   1 
ATOM   2503 C  CB  . TRP C 3 34  ? -32.594 -18.470 34.083 1.00 29.31 ? 72   TRP P CB  1 
ATOM   2504 C  CG  . TRP C 3 34  ? -32.259 -18.347 32.619 1.00 28.77 ? 72   TRP P CG  1 
ATOM   2505 C  CD1 . TRP C 3 34  ? -32.058 -19.362 31.715 1.00 28.20 ? 72   TRP P CD1 1 
ATOM   2506 C  CD2 . TRP C 3 34  ? -32.041 -17.129 31.905 1.00 28.06 ? 72   TRP P CD2 1 
ATOM   2507 N  NE1 . TRP C 3 34  ? -31.753 -18.841 30.484 1.00 27.78 ? 72   TRP P NE1 1 
ATOM   2508 C  CE2 . TRP C 3 34  ? -31.730 -17.474 30.573 1.00 27.39 ? 72   TRP P CE2 1 
ATOM   2509 C  CE3 . TRP C 3 34  ? -32.083 -15.775 32.261 1.00 28.91 ? 72   TRP P CE3 1 
ATOM   2510 C  CZ2 . TRP C 3 34  ? -31.461 -16.516 29.598 1.00 28.45 ? 72   TRP P CZ2 1 
ATOM   2511 C  CZ3 . TRP C 3 34  ? -31.812 -14.821 31.287 1.00 28.30 ? 72   TRP P CZ3 1 
ATOM   2512 C  CH2 . TRP C 3 34  ? -31.511 -15.199 29.973 1.00 28.65 ? 72   TRP P CH2 1 
ATOM   2513 N  N   . ARG C 3 35  ? -34.146 -20.281 36.639 1.00 29.96 ? 73   ARG P N   1 
ATOM   2514 C  CA  . ARG C 3 35  ? -34.352 -20.357 38.078 1.00 29.76 ? 73   ARG P CA  1 
ATOM   2515 C  C   . ARG C 3 35  ? -33.472 -21.444 38.676 1.00 29.91 ? 73   ARG P C   1 
ATOM   2516 O  O   . ARG C 3 35  ? -33.234 -22.481 38.052 1.00 29.92 ? 73   ARG P O   1 
ATOM   2517 C  CB  . ARG C 3 35  ? -35.818 -20.667 38.398 1.00 29.49 ? 73   ARG P CB  1 
ATOM   2518 C  CG  . ARG C 3 35  ? -36.815 -19.610 37.959 1.00 29.02 ? 73   ARG P CG  1 
ATOM   2519 C  CD  . ARG C 3 35  ? -38.240 -20.021 38.313 1.00 29.22 ? 73   ARG P CD  1 
ATOM   2520 N  NE  . ARG C 3 35  ? -38.445 -20.151 39.757 1.00 29.22 ? 73   ARG P NE  1 
ATOM   2521 C  CZ  . ARG C 3 35  ? -39.613 -20.419 40.337 1.00 29.43 ? 73   ARG P CZ  1 
ATOM   2522 N  NH1 . ARG C 3 35  ? -39.693 -20.510 41.666 1.00 28.76 ? 73   ARG P NH1 1 
ATOM   2523 N  NH2 . ARG C 3 35  ? -40.701 -20.586 39.595 1.00 28.58 ? 73   ARG P NH2 1 
ATOM   2524 N  N   . LEU C 3 36  ? -32.988 -21.198 39.888 1.00 30.22 ? 74   LEU P N   1 
ATOM   2525 C  CA  . LEU C 3 36  ? -32.285 -22.219 40.645 1.00 30.42 ? 74   LEU P CA  1 
ATOM   2526 C  C   . LEU C 3 36  ? -32.964 -22.412 41.992 1.00 30.99 ? 74   LEU P C   1 
ATOM   2527 O  O   . LEU C 3 36  ? -32.459 -21.931 43.010 1.00 31.18 ? 74   LEU P O   1 
ATOM   2528 C  CB  . LEU C 3 36  ? -30.812 -21.848 40.819 1.00 30.34 ? 74   LEU P CB  1 
ATOM   2529 C  CG  . LEU C 3 36  ? -29.944 -21.738 39.566 1.00 29.01 ? 74   LEU P CG  1 
ATOM   2530 C  CD1 . LEU C 3 36  ? -28.601 -21.125 39.947 1.00 28.27 ? 74   LEU P CD1 1 
ATOM   2531 C  CD2 . LEU C 3 36  ? -29.768 -23.107 38.898 1.00 28.32 ? 74   LEU P CD2 1 
ATOM   2532 N  N   . PRO C 3 37  ? -34.121 -23.123 42.004 1.00 31.42 ? 75   PRO P N   1 
ATOM   2533 C  CA  . PRO C 3 37  ? -34.907 -23.267 43.238 1.00 31.52 ? 75   PRO P CA  1 
ATOM   2534 C  C   . PRO C 3 37  ? -34.179 -24.061 44.314 1.00 31.42 ? 75   PRO P C   1 
ATOM   2535 O  O   . PRO C 3 37  ? -33.392 -24.954 44.002 1.00 31.65 ? 75   PRO P O   1 
ATOM   2536 C  CB  . PRO C 3 37  ? -36.164 -24.026 42.787 1.00 31.42 ? 75   PRO P CB  1 
ATOM   2537 C  CG  . PRO C 3 37  ? -36.130 -24.041 41.303 1.00 31.72 ? 75   PRO P CG  1 
ATOM   2538 C  CD  . PRO C 3 37  ? -34.728 -23.853 40.875 1.00 31.10 ? 75   PRO P CD  1 
ATOM   2539 N  N   . GLY C 3 38  ? -34.450 -23.731 45.572 1.00 31.58 ? 76   GLY P N   1 
ATOM   2540 C  CA  . GLY C 3 38  ? -33.842 -24.435 46.694 1.00 31.58 ? 76   GLY P CA  1 
ATOM   2541 C  C   . GLY C 3 38  ? -32.626 -23.721 47.253 1.00 31.46 ? 76   GLY P C   1 
ATOM   2542 O  O   . GLY C 3 38  ? -32.083 -24.120 48.282 1.00 31.79 ? 76   GLY P O   1 
ATOM   2543 N  N   . THR C 3 39  ? -32.203 -22.664 46.571 1.00 31.08 ? 77   THR P N   1 
ATOM   2544 C  CA  . THR C 3 39  ? -31.135 -21.815 47.056 1.00 30.94 ? 77   THR P CA  1 
ATOM   2545 C  C   . THR C 3 39  ? -31.628 -20.374 47.059 1.00 30.54 ? 77   THR P C   1 
ATOM   2546 O  O   . THR C 3 39  ? -32.170 -19.890 46.067 1.00 30.01 ? 77   THR P O   1 
ATOM   2547 C  CB  . THR C 3 39  ? -29.862 -21.980 46.201 1.00 31.06 ? 77   THR P CB  1 
ATOM   2548 O  OG1 . THR C 3 39  ? -29.519 -23.371 46.138 1.00 31.48 ? 77   THR P OG1 1 
ATOM   2549 C  CG2 . THR C 3 39  ? -28.712 -21.217 46.792 1.00 30.15 ? 77   THR P CG2 1 
ATOM   2550 N  N   . TYR C 3 40  ? -31.444 -19.707 48.193 1.00 30.45 ? 78   TYR P N   1 
ATOM   2551 C  CA  . TYR C 3 40  ? -32.036 -18.397 48.419 1.00 30.79 ? 78   TYR P CA  1 
ATOM   2552 C  C   . TYR C 3 40  ? -31.056 -17.469 49.097 1.00 31.13 ? 78   TYR P C   1 
ATOM   2553 O  O   . TYR C 3 40  ? -30.312 -17.878 49.989 1.00 31.12 ? 78   TYR P O   1 
ATOM   2554 C  CB  . TYR C 3 40  ? -33.323 -18.512 49.264 1.00 30.39 ? 78   TYR P CB  1 
ATOM   2555 C  CG  . TYR C 3 40  ? -34.261 -19.582 48.758 1.00 29.65 ? 78   TYR P CG  1 
ATOM   2556 C  CD1 . TYR C 3 40  ? -35.186 -19.302 47.745 1.00 29.01 ? 78   TYR P CD1 1 
ATOM   2557 C  CD2 . TYR C 3 40  ? -34.202 -20.882 49.263 1.00 27.68 ? 78   TYR P CD2 1 
ATOM   2558 C  CE1 . TYR C 3 40  ? -36.029 -20.283 47.254 1.00 28.74 ? 78   TYR P CE1 1 
ATOM   2559 C  CE2 . TYR C 3 40  ? -35.044 -21.873 48.779 1.00 28.89 ? 78   TYR P CE2 1 
ATOM   2560 C  CZ  . TYR C 3 40  ? -35.953 -21.564 47.771 1.00 29.89 ? 78   TYR P CZ  1 
ATOM   2561 O  OH  . TYR C 3 40  ? -36.794 -22.532 47.288 1.00 30.64 ? 78   TYR P OH  1 
ATOM   2562 N  N   . VAL C 3 41  ? -31.052 -16.219 48.650 1.00 31.65 ? 79   VAL P N   1 
ATOM   2563 C  CA  . VAL C 3 41  ? -30.323 -15.170 49.340 1.00 31.93 ? 79   VAL P CA  1 
ATOM   2564 C  C   . VAL C 3 41  ? -31.336 -14.454 50.212 1.00 32.27 ? 79   VAL P C   1 
ATOM   2565 O  O   . VAL C 3 41  ? -32.269 -13.823 49.708 1.00 32.39 ? 79   VAL P O   1 
ATOM   2566 C  CB  . VAL C 3 41  ? -29.640 -14.176 48.368 1.00 31.92 ? 79   VAL P CB  1 
ATOM   2567 C  CG1 . VAL C 3 41  ? -28.793 -13.161 49.144 1.00 31.81 ? 79   VAL P CG1 1 
ATOM   2568 C  CG2 . VAL C 3 41  ? -28.782 -14.922 47.350 1.00 32.04 ? 79   VAL P CG2 1 
ATOM   2569 N  N   . VAL C 3 42  ? -31.168 -14.599 51.522 1.00 32.77 ? 80   VAL P N   1 
ATOM   2570 C  CA  . VAL C 3 42  ? -31.972 -13.882 52.492 1.00 33.06 ? 80   VAL P CA  1 
ATOM   2571 C  C   . VAL C 3 42  ? -31.292 -12.534 52.714 1.00 33.67 ? 80   VAL P C   1 
ATOM   2572 O  O   . VAL C 3 42  ? -30.184 -12.466 53.249 1.00 33.70 ? 80   VAL P O   1 
ATOM   2573 C  CB  . VAL C 3 42  ? -32.113 -14.667 53.819 1.00 32.95 ? 80   VAL P CB  1 
ATOM   2574 C  CG1 . VAL C 3 42  ? -33.018 -13.925 54.788 1.00 32.57 ? 80   VAL P CG1 1 
ATOM   2575 C  CG2 . VAL C 3 42  ? -32.649 -16.075 53.563 1.00 32.66 ? 80   VAL P CG2 1 
ATOM   2576 N  N   . VAL C 3 43  ? -31.951 -11.469 52.273 1.00 34.32 ? 81   VAL P N   1 
ATOM   2577 C  CA  . VAL C 3 43  ? -31.388 -10.125 52.355 1.00 35.14 ? 81   VAL P CA  1 
ATOM   2578 C  C   . VAL C 3 43  ? -32.026 -9.362  53.509 1.00 35.71 ? 81   VAL P C   1 
ATOM   2579 O  O   . VAL C 3 43  ? -33.250 -9.213  53.567 1.00 35.58 ? 81   VAL P O   1 
ATOM   2580 C  CB  . VAL C 3 43  ? -31.576 -9.337  51.034 1.00 34.96 ? 81   VAL P CB  1 
ATOM   2581 C  CG1 . VAL C 3 43  ? -30.952 -7.946  51.140 1.00 35.11 ? 81   VAL P CG1 1 
ATOM   2582 C  CG2 . VAL C 3 43  ? -30.974 -10.105 49.866 1.00 34.88 ? 81   VAL P CG2 1 
ATOM   2583 N  N   . LEU C 3 44  ? -31.183 -8.877  54.416 1.00 36.53 ? 82   LEU P N   1 
ATOM   2584 C  CA  . LEU C 3 44  ? -31.650 -8.170  55.601 1.00 37.65 ? 82   LEU P CA  1 
ATOM   2585 C  C   . LEU C 3 44  ? -31.680 -6.666  55.380 1.00 38.63 ? 82   LEU P C   1 
ATOM   2586 O  O   . LEU C 3 44  ? -31.075 -6.162  54.431 1.00 38.54 ? 82   LEU P O   1 
ATOM   2587 C  CB  . LEU C 3 44  ? -30.797 -8.534  56.818 1.00 37.38 ? 82   LEU P CB  1 
ATOM   2588 C  CG  . LEU C 3 44  ? -30.683 -10.031 57.136 1.00 37.26 ? 82   LEU P CG  1 
ATOM   2589 C  CD1 . LEU C 3 44  ? -29.999 -10.222 58.457 1.00 37.06 ? 82   LEU P CD1 1 
ATOM   2590 C  CD2 . LEU C 3 44  ? -32.043 -10.734 57.145 1.00 36.95 ? 82   LEU P CD2 1 
ATOM   2591 N  N   . LYS C 3 45  ? -32.394 -5.956  56.254 1.00 39.95 ? 83   LYS P N   1 
ATOM   2592 C  CA  . LYS C 3 45  ? -32.513 -4.503  56.157 1.00 41.30 ? 83   LYS P CA  1 
ATOM   2593 C  C   . LYS C 3 45  ? -31.148 -3.819  56.258 1.00 42.41 ? 83   LYS P C   1 
ATOM   2594 O  O   . LYS C 3 45  ? -30.222 -4.353  56.865 1.00 42.54 ? 83   LYS P O   1 
ATOM   2595 C  CB  . LYS C 3 45  ? -33.508 -3.962  57.181 1.00 41.04 ? 83   LYS P CB  1 
ATOM   2596 C  CG  . LYS C 3 45  ? -34.947 -4.147  56.751 1.00 41.14 ? 83   LYS P CG  1 
ATOM   2597 C  CD  . LYS C 3 45  ? -35.897 -4.094  57.932 1.00 41.86 ? 83   LYS P CD  1 
ATOM   2598 C  CE  . LYS C 3 45  ? -37.320 -4.403  57.499 1.00 42.56 ? 83   LYS P CE  1 
ATOM   2599 N  NZ  . LYS C 3 45  ? -38.264 -4.463  58.654 1.00 43.51 ? 83   LYS P NZ  1 
ATOM   2600 N  N   . GLU C 3 46  ? -31.051 -2.637  55.654 1.00 43.78 ? 84   GLU P N   1 
ATOM   2601 C  CA  . GLU C 3 46  ? -29.777 -1.989  55.312 1.00 45.36 ? 84   GLU P CA  1 
ATOM   2602 C  C   . GLU C 3 46  ? -28.686 -1.928  56.398 1.00 45.73 ? 84   GLU P C   1 
ATOM   2603 O  O   . GLU C 3 46  ? -27.533 -2.295  56.140 1.00 46.08 ? 84   GLU P O   1 
ATOM   2604 C  CB  . GLU C 3 46  ? -30.047 -0.589  54.753 1.00 45.62 ? 84   GLU P CB  1 
ATOM   2605 C  CG  . GLU C 3 46  ? -28.857 0.058   54.071 1.00 47.69 ? 84   GLU P CG  1 
ATOM   2606 C  CD  . GLU C 3 46  ? -29.067 1.544   53.842 1.00 50.65 ? 84   GLU P CD  1 
ATOM   2607 O  OE1 . GLU C 3 46  ? -30.240 1.963   53.688 1.00 51.68 ? 84   GLU P OE1 1 
ATOM   2608 O  OE2 . GLU C 3 46  ? -28.062 2.293   53.819 1.00 51.65 ? 84   GLU P OE2 1 
ATOM   2609 N  N   . GLU C 3 47  ? -29.036 -1.457  57.589 1.00 46.04 ? 85   GLU P N   1 
ATOM   2610 C  CA  . GLU C 3 47  ? -28.029 -1.236  58.627 1.00 46.52 ? 85   GLU P CA  1 
ATOM   2611 C  C   . GLU C 3 47  ? -27.975 -2.333  59.693 1.00 46.48 ? 85   GLU P C   1 
ATOM   2612 O  O   . GLU C 3 47  ? -27.553 -2.093  60.829 1.00 46.52 ? 85   GLU P O   1 
ATOM   2613 C  CB  . GLU C 3 47  ? -28.180 0.164   59.236 1.00 46.75 ? 85   GLU P CB  1 
ATOM   2614 C  CG  . GLU C 3 47  ? -27.544 1.259   58.371 1.00 47.95 ? 85   GLU P CG  1 
ATOM   2615 C  CD  . GLU C 3 47  ? -28.140 2.641   58.598 1.00 49.80 ? 85   GLU P CD  1 
ATOM   2616 O  OE1 . GLU C 3 47  ? -28.268 3.399   57.609 1.00 50.46 ? 85   GLU P OE1 1 
ATOM   2617 O  OE2 . GLU C 3 47  ? -28.477 2.974   59.756 1.00 50.44 ? 85   GLU P OE2 1 
ATOM   2618 N  N   . THR C 3 48  ? -28.384 -3.539  59.295 1.00 46.39 ? 86   THR P N   1 
ATOM   2619 C  CA  . THR C 3 48  ? -28.308 -4.744  60.129 1.00 46.30 ? 86   THR P CA  1 
ATOM   2620 C  C   . THR C 3 48  ? -26.847 -5.143  60.360 1.00 46.19 ? 86   THR P C   1 
ATOM   2621 O  O   . THR C 3 48  ? -26.061 -5.216  59.415 1.00 46.27 ? 86   THR P O   1 
ATOM   2622 C  CB  . THR C 3 48  ? -29.078 -5.925  59.471 1.00 46.32 ? 86   THR P CB  1 
ATOM   2623 O  OG1 . THR C 3 48  ? -30.417 -5.517  59.161 1.00 46.35 ? 86   THR P OG1 1 
ATOM   2624 C  CG2 . THR C 3 48  ? -29.135 -7.138  60.390 1.00 46.38 ? 86   THR P CG2 1 
ATOM   2625 N  N   . HIS C 3 49  ? -26.490 -5.393  61.617 1.00 46.00 ? 87   HIS P N   1 
ATOM   2626 C  CA  . HIS C 3 49  ? -25.124 -5.780  61.967 1.00 45.93 ? 87   HIS P CA  1 
ATOM   2627 C  C   . HIS C 3 49  ? -24.843 -7.252  61.660 1.00 45.43 ? 87   HIS P C   1 
ATOM   2628 O  O   . HIS C 3 49  ? -25.770 -8.055  61.534 1.00 45.35 ? 87   HIS P O   1 
ATOM   2629 C  CB  . HIS C 3 49  ? -24.832 -5.458  63.438 1.00 46.24 ? 87   HIS P CB  1 
ATOM   2630 C  CG  . HIS C 3 49  ? -24.895 -3.993  63.753 1.00 47.61 ? 87   HIS P CG  1 
ATOM   2631 N  ND1 . HIS C 3 49  ? -25.781 -3.464  64.668 1.00 48.69 ? 87   HIS P ND1 1 
ATOM   2632 C  CD2 . HIS C 3 49  ? -24.196 -2.943  63.256 1.00 48.19 ? 87   HIS P CD2 1 
ATOM   2633 C  CE1 . HIS C 3 49  ? -25.615 -2.154  64.732 1.00 48.88 ? 87   HIS P CE1 1 
ATOM   2634 N  NE2 . HIS C 3 49  ? -24.661 -1.813  63.883 1.00 48.86 ? 87   HIS P NE2 1 
ATOM   2635 N  N   . LEU C 3 50  ? -23.560 -7.589  61.531 1.00 44.82 ? 88   LEU P N   1 
ATOM   2636 C  CA  . LEU C 3 50  ? -23.122 -8.958  61.252 1.00 44.33 ? 88   LEU P CA  1 
ATOM   2637 C  C   . LEU C 3 50  ? -23.602 -9.952  62.317 1.00 44.23 ? 88   LEU P C   1 
ATOM   2638 O  O   . LEU C 3 50  ? -24.016 -11.073 61.994 1.00 44.32 ? 88   LEU P O   1 
ATOM   2639 C  CB  . LEU C 3 50  ? -21.595 -9.004  61.110 1.00 44.39 ? 88   LEU P CB  1 
ATOM   2640 C  CG  . LEU C 3 50  ? -20.878 -10.355 61.000 1.00 44.40 ? 88   LEU P CG  1 
ATOM   2641 C  CD1 . LEU C 3 50  ? -21.313 -11.128 59.757 1.00 44.70 ? 88   LEU P CD1 1 
ATOM   2642 C  CD2 . LEU C 3 50  ? -19.370 -10.164 61.022 1.00 44.12 ? 88   LEU P CD2 1 
ATOM   2643 N  N   . SER C 3 51  ? -23.552 -9.533  63.580 1.00 43.79 ? 89   SER P N   1 
ATOM   2644 C  CA  . SER C 3 51  ? -24.029 -10.353 64.688 1.00 43.49 ? 89   SER P CA  1 
ATOM   2645 C  C   . SER C 3 51  ? -25.523 -10.666 64.552 1.00 43.18 ? 89   SER P C   1 
ATOM   2646 O  O   . SER C 3 51  ? -25.964 -11.774 64.874 1.00 43.14 ? 89   SER P O   1 
ATOM   2647 C  CB  . SER C 3 51  ? -23.739 -9.667  66.027 1.00 43.56 ? 89   SER P CB  1 
ATOM   2648 O  OG  . SER C 3 51  ? -24.344 -8.387  66.089 1.00 43.73 ? 89   SER P OG  1 
ATOM   2649 N  N   . GLN C 3 52  ? -26.290 -9.690  64.066 1.00 42.74 ? 90   GLN P N   1 
ATOM   2650 C  CA  . GLN C 3 52  ? -27.731 -9.856  63.850 1.00 42.46 ? 90   GLN P CA  1 
ATOM   2651 C  C   . GLN C 3 52  ? -28.035 -10.818 62.698 1.00 41.68 ? 90   GLN P C   1 
ATOM   2652 O  O   . GLN C 3 52  ? -29.000 -11.580 62.772 1.00 41.93 ? 90   GLN P O   1 
ATOM   2653 C  CB  . GLN C 3 52  ? -28.412 -8.502  63.615 1.00 42.39 ? 90   GLN P CB  1 
ATOM   2654 C  CG  . GLN C 3 52  ? -28.382 -7.565  64.822 1.00 43.05 ? 90   GLN P CG  1 
ATOM   2655 C  CD  . GLN C 3 52  ? -28.935 -6.174  64.521 1.00 43.19 ? 90   GLN P CD  1 
ATOM   2656 O  OE1 . GLN C 3 52  ? -28.488 -5.494  63.589 1.00 43.83 ? 90   GLN P OE1 1 
ATOM   2657 N  NE2 . GLN C 3 52  ? -29.906 -5.742  65.324 1.00 43.79 ? 90   GLN P NE2 1 
ATOM   2658 N  N   . SER C 3 53  ? -27.202 -10.776 61.654 1.00 40.99 ? 91   SER P N   1 
ATOM   2659 C  CA  A SER C 3 53  ? -27.348 -11.652 60.488 0.50 40.65 ? 91   SER P CA  1 
ATOM   2660 C  CA  B SER C 3 53  ? -27.354 -11.648 60.491 0.50 40.55 ? 91   SER P CA  1 
ATOM   2661 C  C   . SER C 3 53  ? -27.098 -13.111 60.849 1.00 40.35 ? 91   SER P C   1 
ATOM   2662 O  O   . SER C 3 53  ? -27.805 -14.010 60.377 1.00 40.28 ? 91   SER P O   1 
ATOM   2663 C  CB  A SER C 3 53  ? -26.393 -11.229 59.363 0.50 40.64 ? 91   SER P CB  1 
ATOM   2664 C  CB  B SER C 3 53  ? -26.415 -11.202 59.364 0.50 40.53 ? 91   SER P CB  1 
ATOM   2665 O  OG  A SER C 3 53  ? -26.709 -9.941  58.867 0.50 40.65 ? 91   SER P OG  1 
ATOM   2666 O  OG  B SER C 3 53  ? -26.647 -11.939 58.179 0.50 39.93 ? 91   SER P OG  1 
ATOM   2667 N  N   . GLU C 3 54  ? -26.084 -13.333 61.680 1.00 39.98 ? 92   GLU P N   1 
ATOM   2668 C  CA  . GLU C 3 54  ? -25.738 -14.663 62.160 1.00 39.65 ? 92   GLU P CA  1 
ATOM   2669 C  C   . GLU C 3 54  ? -26.819 -15.196 63.098 1.00 39.17 ? 92   GLU P C   1 
ATOM   2670 O  O   . GLU C 3 54  ? -27.143 -16.377 63.042 1.00 39.39 ? 92   GLU P O   1 
ATOM   2671 C  CB  . GLU C 3 54  ? -24.357 -14.649 62.827 1.00 39.70 ? 92   GLU P CB  1 
ATOM   2672 C  CG  . GLU C 3 54  ? -23.209 -14.578 61.821 1.00 40.49 ? 92   GLU P CG  1 
ATOM   2673 C  CD  . GLU C 3 54  ? -21.916 -13.996 62.385 1.00 41.84 ? 92   GLU P CD  1 
ATOM   2674 O  OE1 . GLU C 3 54  ? -21.880 -13.564 63.559 1.00 42.16 ? 92   GLU P OE1 1 
ATOM   2675 O  OE2 . GLU C 3 54  ? -20.919 -13.963 61.633 1.00 43.43 ? 92   GLU P OE2 1 
ATOM   2676 N  N   . ARG C 3 55  ? -27.381 -14.313 63.929 1.00 38.86 ? 93   ARG P N   1 
ATOM   2677 C  CA  A ARG C 3 55  ? -28.479 -14.671 64.830 0.50 38.76 ? 93   ARG P CA  1 
ATOM   2678 C  CA  B ARG C 3 55  ? -28.482 -14.661 64.835 0.50 38.80 ? 93   ARG P CA  1 
ATOM   2679 C  C   . ARG C 3 55  ? -29.729 -15.106 64.060 1.00 38.63 ? 93   ARG P C   1 
ATOM   2680 O  O   . ARG C 3 55  ? -30.382 -16.088 64.424 1.00 38.51 ? 93   ARG P O   1 
ATOM   2681 C  CB  A ARG C 3 55  ? -28.801 -13.516 65.794 0.50 38.72 ? 93   ARG P CB  1 
ATOM   2682 C  CB  B ARG C 3 55  ? -28.814 -13.478 65.761 0.50 38.75 ? 93   ARG P CB  1 
ATOM   2683 C  CG  A ARG C 3 55  ? -28.183 -13.675 67.182 0.50 38.74 ? 93   ARG P CG  1 
ATOM   2684 C  CG  B ARG C 3 55  ? -29.759 -13.815 66.919 0.50 38.97 ? 93   ARG P CG  1 
ATOM   2685 C  CD  A ARG C 3 55  ? -28.659 -12.614 68.175 0.50 38.75 ? 93   ARG P CD  1 
ATOM   2686 C  CD  B ARG C 3 55  ? -30.199 -12.571 67.688 0.50 38.79 ? 93   ARG P CD  1 
ATOM   2687 N  NE  A ARG C 3 55  ? -27.643 -11.592 68.434 0.50 39.00 ? 93   ARG P NE  1 
ATOM   2688 N  NE  B ARG C 3 55  ? -31.181 -12.895 68.723 0.50 39.24 ? 93   ARG P NE  1 
ATOM   2689 C  CZ  A ARG C 3 55  ? -27.723 -10.320 68.048 0.50 38.85 ? 93   ARG P CZ  1 
ATOM   2690 C  CZ  B ARG C 3 55  ? -31.707 -12.020 69.580 0.50 39.32 ? 93   ARG P CZ  1 
ATOM   2691 N  NH1 A ARG C 3 55  ? -28.779 -9.876  67.380 0.50 38.68 ? 93   ARG P NH1 1 
ATOM   2692 N  NH1 B ARG C 3 55  ? -31.356 -10.740 69.544 0.50 39.46 ? 93   ARG P NH1 1 
ATOM   2693 N  NH2 A ARG C 3 55  ? -26.740 -9.482  68.342 0.50 39.14 ? 93   ARG P NH2 1 
ATOM   2694 N  NH2 B ARG C 3 55  ? -32.591 -12.429 70.481 0.50 38.72 ? 93   ARG P NH2 1 
ATOM   2695 N  N   . THR C 3 56  ? -30.047 -14.375 62.993 1.00 38.53 ? 94   THR P N   1 
ATOM   2696 C  CA  . THR C 3 56  ? -31.194 -14.674 62.130 1.00 38.37 ? 94   THR P CA  1 
ATOM   2697 C  C   . THR C 3 56  ? -30.999 -15.997 61.382 1.00 38.10 ? 94   THR P C   1 
ATOM   2698 O  O   . THR C 3 56  ? -31.943 -16.780 61.237 1.00 38.18 ? 94   THR P O   1 
ATOM   2699 C  CB  . THR C 3 56  ? -31.467 -13.506 61.147 1.00 38.44 ? 94   THR P CB  1 
ATOM   2700 O  OG1 . THR C 3 56  ? -31.728 -12.312 61.897 1.00 38.80 ? 94   THR P OG1 1 
ATOM   2701 C  CG2 . THR C 3 56  ? -32.665 -13.799 60.229 1.00 38.48 ? 94   THR P CG2 1 
ATOM   2702 N  N   . ALA C 3 57  ? -29.772 -16.247 60.933 1.00 37.85 ? 95   ALA P N   1 
ATOM   2703 C  CA  . ALA C 3 57  ? -29.431 -17.495 60.254 1.00 37.64 ? 95   ALA P CA  1 
ATOM   2704 C  C   . ALA C 3 57  ? -29.590 -18.675 61.202 1.00 37.49 ? 95   ALA P C   1 
ATOM   2705 O  O   . ALA C 3 57  ? -30.164 -19.701 60.834 1.00 37.43 ? 95   ALA P O   1 
ATOM   2706 C  CB  . ALA C 3 57  ? -28.009 -17.435 59.688 1.00 37.62 ? 95   ALA P CB  1 
ATOM   2707 N  N   . ARG C 3 58  ? -29.095 -18.510 62.429 1.00 37.36 ? 96   ARG P N   1 
ATOM   2708 C  CA  . ARG C 3 58  ? -29.252 -19.512 63.475 1.00 37.22 ? 96   ARG P CA  1 
ATOM   2709 C  C   . ARG C 3 58  ? -30.715 -19.774 63.849 1.00 36.56 ? 96   ARG P C   1 
ATOM   2710 O  O   . ARG C 3 58  ? -31.107 -20.927 64.057 1.00 36.37 ? 96   ARG P O   1 
ATOM   2711 C  CB  . ARG C 3 58  ? -28.404 -19.155 64.702 1.00 37.76 ? 96   ARG P CB  1 
ATOM   2712 C  CG  . ARG C 3 58  ? -27.178 -20.060 64.866 1.00 39.36 ? 96   ARG P CG  1 
ATOM   2713 C  CD  . ARG C 3 58  ? -25.972 -19.379 65.527 1.00 41.90 ? 96   ARG P CD  1 
ATOM   2714 N  NE  . ARG C 3 58  ? -26.323 -18.376 66.537 1.00 42.91 ? 96   ARG P NE  1 
ATOM   2715 C  CZ  . ARG C 3 58  ? -25.896 -17.112 66.519 1.00 43.17 ? 96   ARG P CZ  1 
ATOM   2716 N  NH1 . ARG C 3 58  ? -25.085 -16.690 65.555 1.00 42.49 ? 96   ARG P NH1 1 
ATOM   2717 N  NH2 . ARG C 3 58  ? -26.264 -16.272 67.478 1.00 42.93 ? 96   ARG P NH2 1 
ATOM   2718 N  N   . ARG C 3 59  ? -31.518 -18.711 63.912 1.00 35.95 ? 97   ARG P N   1 
ATOM   2719 C  CA  . ARG C 3 59  ? -32.967 -18.839 64.132 1.00 35.36 ? 97   ARG P CA  1 
ATOM   2720 C  C   . ARG C 3 59  ? -33.644 -19.654 63.022 1.00 35.18 ? 97   ARG P C   1 
ATOM   2721 O  O   . ARG C 3 59  ? -34.419 -20.571 63.311 1.00 35.23 ? 97   ARG P O   1 
ATOM   2722 C  CB  . ARG C 3 59  ? -33.624 -17.463 64.295 1.00 35.32 ? 97   ARG P CB  1 
ATOM   2723 C  CG  . ARG C 3 59  ? -35.093 -17.515 64.677 1.00 35.13 ? 97   ARG P CG  1 
ATOM   2724 C  CD  . ARG C 3 59  ? -35.321 -16.754 65.956 1.00 36.03 ? 97   ARG P CD  1 
ATOM   2725 N  NE  . ARG C 3 59  ? -36.121 -15.546 65.804 1.00 36.15 ? 97   ARG P NE  1 
ATOM   2726 C  CZ  . ARG C 3 59  ? -36.254 -14.618 66.749 1.00 35.37 ? 97   ARG P CZ  1 
ATOM   2727 N  NH1 . ARG C 3 59  ? -35.616 -14.738 67.906 1.00 34.14 ? 97   ARG P NH1 1 
ATOM   2728 N  NH2 . ARG C 3 59  ? -37.017 -13.554 66.528 1.00 35.81 ? 97   ARG P NH2 1 
ATOM   2729 N  N   . LEU C 3 60  ? -33.330 -19.335 61.766 1.00 34.76 ? 98   LEU P N   1 
ATOM   2730 C  CA  . LEU C 3 60  ? -33.823 -20.104 60.621 1.00 34.66 ? 98   LEU P CA  1 
ATOM   2731 C  C   . LEU C 3 60  ? -33.546 -21.608 60.771 1.00 34.55 ? 98   LEU P C   1 
ATOM   2732 O  O   . LEU C 3 60  ? -34.463 -22.424 60.653 1.00 34.64 ? 98   LEU P O   1 
ATOM   2733 C  CB  . LEU C 3 60  ? -33.238 -19.568 59.304 1.00 34.43 ? 98   LEU P CB  1 
ATOM   2734 C  CG  . LEU C 3 60  ? -33.502 -20.336 57.995 1.00 34.57 ? 98   LEU P CG  1 
ATOM   2735 C  CD1 . LEU C 3 60  ? -34.979 -20.614 57.768 1.00 34.64 ? 98   LEU P CD1 1 
ATOM   2736 C  CD2 . LEU C 3 60  ? -32.932 -19.594 56.791 1.00 34.67 ? 98   LEU P CD2 1 
ATOM   2737 N  N   . GLN C 3 61  ? -32.288 -21.957 61.033 1.00 34.35 ? 99   GLN P N   1 
ATOM   2738 C  CA  . GLN C 3 61  ? -31.877 -23.350 61.226 1.00 34.63 ? 99   GLN P CA  1 
ATOM   2739 C  C   . GLN C 3 61  ? -32.609 -24.019 62.388 1.00 34.34 ? 99   GLN P C   1 
ATOM   2740 O  O   . GLN C 3 61  ? -33.120 -25.131 62.244 1.00 34.40 ? 99   GLN P O   1 
ATOM   2741 C  CB  . GLN C 3 61  ? -30.358 -23.448 61.444 1.00 34.79 ? 99   GLN P CB  1 
ATOM   2742 C  CG  . GLN C 3 61  ? -29.532 -22.928 60.276 1.00 35.96 ? 99   GLN P CG  1 
ATOM   2743 C  CD  . GLN C 3 61  ? -28.179 -23.612 60.143 1.00 37.70 ? 99   GLN P CD  1 
ATOM   2744 O  OE1 . GLN C 3 61  ? -27.304 -23.466 60.999 1.00 38.42 ? 99   GLN P OE1 1 
ATOM   2745 N  NE2 . GLN C 3 61  ? -27.997 -24.348 59.048 1.00 38.03 ? 99   GLN P NE2 1 
ATOM   2746 N  N   . ALA C 3 62  ? -32.660 -23.332 63.529 1.00 33.96 ? 100  ALA P N   1 
ATOM   2747 C  CA  . ALA C 3 62  ? -33.307 -23.858 64.729 1.00 33.63 ? 100  ALA P CA  1 
ATOM   2748 C  C   . ALA C 3 62  ? -34.811 -24.080 64.547 1.00 33.20 ? 100  ALA P C   1 
ATOM   2749 O  O   . ALA C 3 62  ? -35.311 -25.154 64.884 1.00 33.16 ? 100  ALA P O   1 
ATOM   2750 C  CB  . ALA C 3 62  ? -33.023 -22.957 65.940 1.00 33.78 ? 100  ALA P CB  1 
ATOM   2751 N  N   . GLN C 3 63  ? -35.512 -23.081 63.999 1.00 32.82 ? 101  GLN P N   1 
ATOM   2752 C  CA  . GLN C 3 63  ? -36.956 -23.182 63.719 1.00 32.45 ? 101  GLN P CA  1 
ATOM   2753 C  C   . GLN C 3 63  ? -37.283 -24.305 62.743 1.00 32.55 ? 101  GLN P C   1 
ATOM   2754 O  O   . GLN C 3 63  ? -38.254 -25.042 62.943 1.00 32.49 ? 101  GLN P O   1 
ATOM   2755 C  CB  . GLN C 3 63  ? -37.528 -21.859 63.193 1.00 32.31 ? 101  GLN P CB  1 
ATOM   2756 C  CG  . GLN C 3 63  ? -37.644 -20.756 64.252 1.00 32.20 ? 101  GLN P CG  1 
ATOM   2757 C  CD  . GLN C 3 63  ? -38.185 -19.440 63.710 1.00 32.41 ? 101  GLN P CD  1 
ATOM   2758 O  OE1 . GLN C 3 63  ? -38.223 -19.212 62.498 1.00 31.93 ? 101  GLN P OE1 1 
ATOM   2759 N  NE2 . GLN C 3 63  ? -38.594 -18.556 64.616 1.00 31.82 ? 101  GLN P NE2 1 
ATOM   2760 N  N   . ALA C 3 64  ? -36.462 -24.434 61.697 1.00 32.57 ? 102  ALA P N   1 
ATOM   2761 C  CA  . ALA C 3 64  ? -36.664 -25.445 60.658 1.00 32.47 ? 102  ALA P CA  1 
ATOM   2762 C  C   . ALA C 3 64  ? -36.448 -26.872 61.180 1.00 32.41 ? 102  ALA P C   1 
ATOM   2763 O  O   . ALA C 3 64  ? -37.286 -27.743 60.960 1.00 32.61 ? 102  ALA P O   1 
ATOM   2764 C  CB  . ALA C 3 64  ? -35.768 -25.159 59.450 1.00 32.51 ? 102  ALA P CB  1 
ATOM   2765 N  N   . ALA C 3 65  ? -35.332 -27.093 61.876 1.00 32.42 ? 103  ALA P N   1 
ATOM   2766 C  CA  . ALA C 3 65  ? -35.007 -28.385 62.491 1.00 32.25 ? 103  ALA P CA  1 
ATOM   2767 C  C   . ALA C 3 65  ? -36.150 -28.937 63.351 1.00 32.23 ? 103  ALA P C   1 
ATOM   2768 O  O   . ALA C 3 65  ? -36.505 -30.113 63.253 1.00 32.24 ? 103  ALA P O   1 
ATOM   2769 C  CB  . ALA C 3 65  ? -33.722 -28.271 63.315 1.00 31.98 ? 103  ALA P CB  1 
ATOM   2770 N  N   . ARG C 3 66  ? -36.724 -28.074 64.182 1.00 32.32 ? 104  ARG P N   1 
ATOM   2771 C  CA  . ARG C 3 66  ? -37.823 -28.448 65.071 1.00 32.32 ? 104  ARG P CA  1 
ATOM   2772 C  C   . ARG C 3 66  ? -39.111 -28.781 64.301 1.00 32.67 ? 104  ARG P C   1 
ATOM   2773 O  O   . ARG C 3 66  ? -39.968 -29.516 64.794 1.00 32.65 ? 104  ARG P O   1 
ATOM   2774 C  CB  . ARG C 3 66  ? -38.045 -27.346 66.115 1.00 32.23 ? 104  ARG P CB  1 
ATOM   2775 C  CG  . ARG C 3 66  ? -36.869 -27.213 67.089 1.00 31.25 ? 104  ARG P CG  1 
ATOM   2776 C  CD  . ARG C 3 66  ? -36.832 -25.873 67.815 1.00 30.79 ? 104  ARG P CD  1 
ATOM   2777 N  NE  . ARG C 3 66  ? -38.007 -25.658 68.659 1.00 30.84 ? 104  ARG P NE  1 
ATOM   2778 C  CZ  . ARG C 3 66  ? -38.192 -26.194 69.863 1.00 30.01 ? 104  ARG P CZ  1 
ATOM   2779 N  NH1 . ARG C 3 66  ? -37.282 -26.997 70.392 1.00 29.67 ? 104  ARG P NH1 1 
ATOM   2780 N  NH2 . ARG C 3 66  ? -39.300 -25.927 70.538 1.00 29.15 ? 104  ARG P NH2 1 
ATOM   2781 N  N   . ARG C 3 67  ? -39.229 -28.257 63.083 1.00 32.90 ? 105  ARG P N   1 
ATOM   2782 C  CA  . ARG C 3 67  ? -40.334 -28.621 62.196 1.00 33.07 ? 105  ARG P CA  1 
ATOM   2783 C  C   . ARG C 3 67  ? -39.957 -29.776 61.255 1.00 32.95 ? 105  ARG P C   1 
ATOM   2784 O  O   . ARG C 3 67  ? -40.752 -30.181 60.416 1.00 33.05 ? 105  ARG P O   1 
ATOM   2785 C  CB  . ARG C 3 67  ? -40.823 -27.398 61.417 1.00 33.10 ? 105  ARG P CB  1 
ATOM   2786 C  CG  . ARG C 3 67  ? -41.397 -26.314 62.314 1.00 34.07 ? 105  ARG P CG  1 
ATOM   2787 C  CD  . ARG C 3 67  ? -41.823 -25.096 61.533 1.00 35.58 ? 105  ARG P CD  1 
ATOM   2788 N  NE  . ARG C 3 67  ? -41.593 -23.882 62.313 1.00 36.61 ? 105  ARG P NE  1 
ATOM   2789 C  CZ  . ARG C 3 67  ? -42.053 -22.676 61.988 1.00 36.92 ? 105  ARG P CZ  1 
ATOM   2790 N  NH1 . ARG C 3 67  ? -42.791 -22.513 60.891 1.00 36.17 ? 105  ARG P NH1 1 
ATOM   2791 N  NH2 . ARG C 3 67  ? -41.773 -21.633 62.767 1.00 35.54 ? 105  ARG P NH2 1 
ATOM   2792 N  N   . GLY C 3 68  ? -38.739 -30.292 61.403 1.00 33.01 ? 106  GLY P N   1 
ATOM   2793 C  CA  . GLY C 3 68  ? -38.293 -31.485 60.683 1.00 32.84 ? 106  GLY P CA  1 
ATOM   2794 C  C   . GLY C 3 68  ? -37.485 -31.250 59.420 1.00 32.88 ? 106  GLY P C   1 
ATOM   2795 O  O   . GLY C 3 68  ? -37.384 -32.147 58.577 1.00 32.89 ? 106  GLY P O   1 
ATOM   2796 N  N   . TYR C 3 69  ? -36.896 -30.061 59.292 1.00 32.82 ? 107  TYR P N   1 
ATOM   2797 C  CA  . TYR C 3 69  ? -36.170 -29.681 58.076 1.00 32.87 ? 107  TYR P CA  1 
ATOM   2798 C  C   . TYR C 3 69  ? -34.678 -29.393 58.273 1.00 33.29 ? 107  TYR P C   1 
ATOM   2799 O  O   . TYR C 3 69  ? -34.276 -28.658 59.180 1.00 33.31 ? 107  TYR P O   1 
ATOM   2800 C  CB  . TYR C 3 69  ? -36.807 -28.451 57.435 1.00 32.59 ? 107  TYR P CB  1 
ATOM   2801 C  CG  . TYR C 3 69  ? -38.177 -28.650 56.832 1.00 32.16 ? 107  TYR P CG  1 
ATOM   2802 C  CD1 . TYR C 3 69  ? -38.337 -28.773 55.450 1.00 31.01 ? 107  TYR P CD1 1 
ATOM   2803 C  CD2 . TYR C 3 69  ? -39.323 -28.670 57.639 1.00 32.30 ? 107  TYR P CD2 1 
ATOM   2804 C  CE1 . TYR C 3 69  ? -39.591 -28.933 54.883 1.00 30.53 ? 107  TYR P CE1 1 
ATOM   2805 C  CE2 . TYR C 3 69  ? -40.591 -28.837 57.078 1.00 32.26 ? 107  TYR P CE2 1 
ATOM   2806 C  CZ  . TYR C 3 69  ? -40.712 -28.965 55.697 1.00 31.70 ? 107  TYR P CZ  1 
ATOM   2807 O  OH  . TYR C 3 69  ? -41.956 -29.120 55.137 1.00 31.89 ? 107  TYR P OH  1 
ATOM   2808 N  N   . LEU C 3 70  ? -33.868 -29.955 57.385 1.00 33.75 ? 108  LEU P N   1 
ATOM   2809 C  CA  . LEU C 3 70  ? -32.462 -29.592 57.278 1.00 33.92 ? 108  LEU P CA  1 
ATOM   2810 C  C   . LEU C 3 70  ? -32.319 -28.293 56.467 1.00 34.10 ? 108  LEU P C   1 
ATOM   2811 O  O   . LEU C 3 70  ? -32.905 -28.148 55.392 1.00 33.58 ? 108  LEU P O   1 
ATOM   2812 C  CB  . LEU C 3 70  ? -31.692 -30.719 56.586 1.00 33.90 ? 108  LEU P CB  1 
ATOM   2813 C  CG  . LEU C 3 70  ? -30.194 -30.968 56.804 1.00 34.59 ? 108  LEU P CG  1 
ATOM   2814 C  CD1 . LEU C 3 70  ? -29.520 -30.963 55.458 1.00 32.84 ? 108  LEU P CD1 1 
ATOM   2815 C  CD2 . LEU C 3 70  ? -29.504 -29.965 57.745 1.00 35.71 ? 108  LEU P CD2 1 
ATOM   2816 N  N   . THR C 3 71  ? -31.553 -27.346 57.002 1.00 34.46 ? 109  THR P N   1 
ATOM   2817 C  CA  . THR C 3 71  ? -31.138 -26.161 56.258 1.00 34.71 ? 109  THR P CA  1 
ATOM   2818 C  C   . THR C 3 71  ? -29.616 -26.074 56.289 1.00 35.11 ? 109  THR P C   1 
ATOM   2819 O  O   . THR C 3 71  ? -28.979 -26.454 57.282 1.00 35.38 ? 109  THR P O   1 
ATOM   2820 C  CB  . THR C 3 71  ? -31.708 -24.851 56.848 1.00 34.75 ? 109  THR P CB  1 
ATOM   2821 O  OG1 . THR C 3 71  ? -31.260 -24.696 58.199 1.00 35.33 ? 109  THR P OG1 1 
ATOM   2822 C  CG2 . THR C 3 71  ? -33.229 -24.833 56.806 1.00 33.85 ? 109  THR P CG2 1 
ATOM   2823 N  N   . LYS C 3 72  ? -29.039 -25.576 55.202 1.00 35.14 ? 110  LYS P N   1 
ATOM   2824 C  CA  . LYS C 3 72  ? -27.599 -25.389 55.100 1.00 35.04 ? 110  LYS P CA  1 
ATOM   2825 C  C   . LYS C 3 72  ? -27.292 -23.923 54.854 1.00 34.93 ? 110  LYS P C   1 
ATOM   2826 O  O   . LYS C 3 72  ? -27.702 -23.362 53.840 1.00 34.89 ? 110  LYS P O   1 
ATOM   2827 C  CB  . LYS C 3 72  ? -27.028 -26.244 53.967 1.00 35.10 ? 110  LYS P CB  1 
ATOM   2828 C  CG  . LYS C 3 72  ? -27.134 -27.740 54.207 1.00 35.82 ? 110  LYS P CG  1 
ATOM   2829 C  CD  . LYS C 3 72  ? -26.681 -28.529 52.992 1.00 37.10 ? 110  LYS P CD  1 
ATOM   2830 C  CE  . LYS C 3 72  ? -26.704 -30.020 53.282 1.00 38.09 ? 110  LYS P CE  1 
ATOM   2831 N  NZ  . LYS C 3 72  ? -26.703 -30.839 52.039 1.00 39.13 ? 110  LYS P NZ  1 
ATOM   2832 N  N   . ILE C 3 73  ? -26.593 -23.297 55.794 1.00 34.99 ? 111  ILE P N   1 
ATOM   2833 C  CA  . ILE C 3 73  ? -26.086 -21.945 55.585 1.00 35.16 ? 111  ILE P CA  1 
ATOM   2834 C  C   . ILE C 3 73  ? -24.757 -22.045 54.828 1.00 35.15 ? 111  ILE P C   1 
ATOM   2835 O  O   . ILE C 3 73  ? -23.776 -22.565 55.357 1.00 35.18 ? 111  ILE P O   1 
ATOM   2836 C  CB  . ILE C 3 73  ? -25.918 -21.162 56.915 1.00 35.01 ? 111  ILE P CB  1 
ATOM   2837 C  CG1 . ILE C 3 73  ? -27.201 -21.232 57.772 1.00 35.33 ? 111  ILE P CG1 1 
ATOM   2838 C  CG2 . ILE C 3 73  ? -25.456 -19.720 56.648 1.00 34.80 ? 111  ILE P CG2 1 
ATOM   2839 C  CD1 . ILE C 3 73  ? -28.489 -20.675 57.133 1.00 35.06 ? 111  ILE P CD1 1 
ATOM   2840 N  N   . LEU C 3 74  ? -24.750 -21.571 53.583 1.00 35.08 ? 112  LEU P N   1 
ATOM   2841 C  CA  . LEU C 3 74  ? -23.589 -21.703 52.704 1.00 35.06 ? 112  LEU P CA  1 
ATOM   2842 C  C   . LEU C 3 74  ? -22.627 -20.528 52.821 1.00 35.09 ? 112  LEU P C   1 
ATOM   2843 O  O   . LEU C 3 74  ? -21.417 -20.677 52.623 1.00 34.59 ? 112  LEU P O   1 
ATOM   2844 C  CB  . LEU C 3 74  ? -24.022 -21.837 51.244 1.00 35.02 ? 112  LEU P CB  1 
ATOM   2845 C  CG  . LEU C 3 74  ? -24.949 -22.955 50.764 1.00 35.87 ? 112  LEU P CG  1 
ATOM   2846 C  CD1 . LEU C 3 74  ? -24.999 -22.939 49.233 1.00 35.67 ? 112  LEU P CD1 1 
ATOM   2847 C  CD2 . LEU C 3 74  ? -24.515 -24.331 51.279 1.00 36.29 ? 112  LEU P CD2 1 
ATOM   2848 N  N   . HIS C 3 75  ? -23.179 -19.360 53.126 1.00 35.21 ? 113  HIS P N   1 
ATOM   2849 C  CA  . HIS C 3 75  ? -22.408 -18.133 53.155 1.00 35.45 ? 113  HIS P CA  1 
ATOM   2850 C  C   . HIS C 3 75  ? -23.151 -17.071 53.941 1.00 35.88 ? 113  HIS P C   1 
ATOM   2851 O  O   . HIS C 3 75  ? -24.357 -16.921 53.805 1.00 35.92 ? 113  HIS P O   1 
ATOM   2852 C  CB  . HIS C 3 75  ? -22.154 -17.636 51.729 1.00 35.26 ? 113  HIS P CB  1 
ATOM   2853 C  CG  . HIS C 3 75  ? -21.162 -16.520 51.649 1.00 34.79 ? 113  HIS P CG  1 
ATOM   2854 N  ND1 . HIS C 3 75  ? -21.538 -15.198 51.560 1.00 34.53 ? 113  HIS P ND1 1 
ATOM   2855 C  CD2 . HIS C 3 75  ? -19.808 -16.528 51.658 1.00 33.90 ? 113  HIS P CD2 1 
ATOM   2856 C  CE1 . HIS C 3 75  ? -20.457 -14.439 51.514 1.00 33.98 ? 113  HIS P CE1 1 
ATOM   2857 N  NE2 . HIS C 3 75  ? -19.395 -15.221 51.570 1.00 33.33 ? 113  HIS P NE2 1 
ATOM   2858 N  N   . VAL C 3 76  ? -22.415 -16.341 54.767 1.00 36.75 ? 114  VAL P N   1 
ATOM   2859 C  CA  . VAL C 3 76  ? -22.952 -15.194 55.473 1.00 37.40 ? 114  VAL P CA  1 
ATOM   2860 C  C   . VAL C 3 76  ? -22.280 -13.969 54.890 1.00 38.22 ? 114  VAL P C   1 
ATOM   2861 O  O   . VAL C 3 76  ? -21.052 -13.901 54.816 1.00 38.27 ? 114  VAL P O   1 
ATOM   2862 C  CB  . VAL C 3 76  ? -22.702 -15.276 57.007 1.00 37.25 ? 114  VAL P CB  1 
ATOM   2863 C  CG1 . VAL C 3 76  ? -23.192 -14.011 57.704 1.00 37.17 ? 114  VAL P CG1 1 
ATOM   2864 C  CG2 . VAL C 3 76  ? -23.379 -16.507 57.603 1.00 36.20 ? 114  VAL P CG2 1 
ATOM   2865 N  N   . PHE C 3 77  ? -23.090 -13.012 54.455 1.00 39.42 ? 115  PHE P N   1 
ATOM   2866 C  CA  . PHE C 3 77  ? -22.563 -11.785 53.866 1.00 40.64 ? 115  PHE P CA  1 
ATOM   2867 C  C   . PHE C 3 77  ? -22.159 -10.764 54.924 1.00 41.82 ? 115  PHE P C   1 
ATOM   2868 O  O   . PHE C 3 77  ? -22.876 -10.538 55.906 1.00 42.22 ? 115  PHE P O   1 
ATOM   2869 C  CB  . PHE C 3 77  ? -23.574 -11.169 52.894 1.00 40.29 ? 115  PHE P CB  1 
ATOM   2870 C  CG  . PHE C 3 77  ? -23.764 -11.962 51.630 1.00 39.73 ? 115  PHE P CG  1 
ATOM   2871 C  CD1 . PHE C 3 77  ? -22.902 -11.789 50.544 1.00 39.30 ? 115  PHE P CD1 1 
ATOM   2872 C  CD2 . PHE C 3 77  ? -24.807 -12.876 51.519 1.00 38.46 ? 115  PHE P CD2 1 
ATOM   2873 C  CE1 . PHE C 3 77  ? -23.077 -12.522 49.370 1.00 38.81 ? 115  PHE P CE1 1 
ATOM   2874 C  CE2 . PHE C 3 77  ? -24.991 -13.612 50.352 1.00 38.34 ? 115  PHE P CE2 1 
ATOM   2875 C  CZ  . PHE C 3 77  ? -24.126 -13.437 49.276 1.00 38.91 ? 115  PHE P CZ  1 
ATOM   2876 N  N   . HIS C 3 78  ? -20.978 -10.187 54.731 1.00 43.26 ? 116  HIS P N   1 
ATOM   2877 C  CA  . HIS C 3 78  ? -20.569 -8.980  55.438 1.00 44.50 ? 116  HIS P CA  1 
ATOM   2878 C  C   . HIS C 3 78  ? -19.630 -8.144  54.579 1.00 44.68 ? 116  HIS P C   1 
ATOM   2879 O  O   . HIS C 3 78  ? -18.428 -8.407  54.503 1.00 45.12 ? 116  HIS P O   1 
ATOM   2880 C  CB  . HIS C 3 78  ? -19.970 -9.263  56.830 1.00 45.12 ? 116  HIS P CB  1 
ATOM   2881 C  CG  . HIS C 3 78  ? -19.038 -10.440 56.891 1.00 47.01 ? 116  HIS P CG  1 
ATOM   2882 N  ND1 . HIS C 3 78  ? -17.681 -10.329 56.670 1.00 48.10 ? 116  HIS P ND1 1 
ATOM   2883 C  CD2 . HIS C 3 78  ? -19.262 -11.739 57.211 1.00 48.19 ? 116  HIS P CD2 1 
ATOM   2884 C  CE1 . HIS C 3 78  ? -17.113 -11.513 56.826 1.00 48.89 ? 116  HIS P CE1 1 
ATOM   2885 N  NE2 . HIS C 3 78  ? -18.050 -12.385 57.157 1.00 49.29 ? 116  HIS P NE2 1 
ATOM   2886 N  N   . GLY C 3 79  ? -20.201 -7.141  53.919 1.00 44.65 ? 117  GLY P N   1 
ATOM   2887 C  CA  . GLY C 3 79  ? -19.428 -6.225  53.101 1.00 44.47 ? 117  GLY P CA  1 
ATOM   2888 C  C   . GLY C 3 79  ? -20.303 -5.409  52.172 1.00 44.31 ? 117  GLY P C   1 
ATOM   2889 O  O   . GLY C 3 79  ? -20.353 -4.177  52.274 1.00 44.62 ? 117  GLY P O   1 
ATOM   2890 N  N   . LEU C 3 80  ? -20.980 -6.087  51.253 1.00 43.63 ? 118  LEU P N   1 
ATOM   2891 C  CA  . LEU C 3 80  ? -21.847 -5.389  50.320 1.00 43.13 ? 118  LEU P CA  1 
ATOM   2892 C  C   . LEU C 3 80  ? -23.219 -5.180  50.934 1.00 42.64 ? 118  LEU P C   1 
ATOM   2893 O  O   . LEU C 3 80  ? -23.694 -4.049  51.036 1.00 42.87 ? 118  LEU P O   1 
ATOM   2894 C  CB  . LEU C 3 80  ? -21.951 -6.126  48.977 1.00 43.26 ? 118  LEU P CB  1 
ATOM   2895 C  CG  . LEU C 3 80  ? -20.894 -5.836  47.906 1.00 43.16 ? 118  LEU P CG  1 
ATOM   2896 C  CD1 . LEU C 3 80  ? -21.332 -6.406  46.576 1.00 42.56 ? 118  LEU P CD1 1 
ATOM   2897 C  CD2 . LEU C 3 80  ? -20.620 -4.348  47.763 1.00 43.52 ? 118  LEU P CD2 1 
ATOM   2898 N  N   . LEU C 3 81  ? -23.841 -6.275  51.359 1.00 41.81 ? 119  LEU P N   1 
ATOM   2899 C  CA  . LEU C 3 81  ? -25.182 -6.225  51.927 1.00 41.22 ? 119  LEU P CA  1 
ATOM   2900 C  C   . LEU C 3 81  ? -25.331 -7.179  53.117 1.00 40.54 ? 119  LEU P C   1 
ATOM   2901 O  O   . LEU C 3 81  ? -24.584 -8.159  53.223 1.00 40.51 ? 119  LEU P O   1 
ATOM   2902 C  CB  . LEU C 3 81  ? -26.232 -6.514  50.842 1.00 41.31 ? 119  LEU P CB  1 
ATOM   2903 C  CG  . LEU C 3 81  ? -25.923 -7.612  49.817 1.00 41.70 ? 119  LEU P CG  1 
ATOM   2904 C  CD1 . LEU C 3 81  ? -26.452 -8.970  50.272 1.00 41.60 ? 119  LEU P CD1 1 
ATOM   2905 C  CD2 . LEU C 3 81  ? -26.491 -7.228  48.455 1.00 41.86 ? 119  LEU P CD2 1 
ATOM   2906 N  N   . PRO C 3 82  ? -26.282 -6.882  54.028 1.00 39.69 ? 120  PRO P N   1 
ATOM   2907 C  CA  . PRO C 3 82  ? -26.567 -7.802  55.122 1.00 38.89 ? 120  PRO P CA  1 
ATOM   2908 C  C   . PRO C 3 82  ? -27.413 -8.973  54.639 1.00 38.18 ? 120  PRO P C   1 
ATOM   2909 O  O   . PRO C 3 82  ? -28.418 -8.774  53.949 1.00 37.93 ? 120  PRO P O   1 
ATOM   2910 C  CB  . PRO C 3 82  ? -27.372 -6.946  56.117 1.00 38.89 ? 120  PRO P CB  1 
ATOM   2911 C  CG  . PRO C 3 82  ? -27.383 -5.549  55.566 1.00 39.19 ? 120  PRO P CG  1 
ATOM   2912 C  CD  . PRO C 3 82  ? -27.129 -5.678  54.101 1.00 39.80 ? 120  PRO P CD  1 
ATOM   2913 N  N   . GLY C 3 83  ? -26.997 -10.183 54.992 1.00 37.39 ? 121  GLY P N   1 
ATOM   2914 C  CA  . GLY C 3 83  ? -27.766 -11.372 54.671 1.00 36.64 ? 121  GLY P CA  1 
ATOM   2915 C  C   . GLY C 3 83  ? -26.941 -12.636 54.614 1.00 36.08 ? 121  GLY P C   1 
ATOM   2916 O  O   . GLY C 3 83  ? -25.789 -12.663 55.041 1.00 36.13 ? 121  GLY P O   1 
ATOM   2917 N  N   . PHE C 3 84  ? -27.543 -13.689 54.075 1.00 35.54 ? 122  PHE P N   1 
ATOM   2918 C  CA  . PHE C 3 84  ? -26.888 -14.990 53.992 1.00 34.92 ? 122  PHE P CA  1 
ATOM   2919 C  C   . PHE C 3 84  ? -27.468 -15.847 52.872 1.00 34.49 ? 122  PHE P C   1 
ATOM   2920 O  O   . PHE C 3 84  ? -28.586 -15.618 52.413 1.00 34.07 ? 122  PHE P O   1 
ATOM   2921 C  CB  . PHE C 3 84  ? -26.938 -15.730 55.347 1.00 34.88 ? 122  PHE P CB  1 
ATOM   2922 C  CG  . PHE C 3 84  ? -28.327 -15.883 55.921 1.00 34.50 ? 122  PHE P CG  1 
ATOM   2923 C  CD1 . PHE C 3 84  ? -28.842 -14.930 56.797 1.00 33.72 ? 122  PHE P CD1 1 
ATOM   2924 C  CD2 . PHE C 3 84  ? -29.108 -17.002 55.608 1.00 34.69 ? 122  PHE P CD2 1 
ATOM   2925 C  CE1 . PHE C 3 84  ? -30.123 -15.074 57.341 1.00 34.53 ? 122  PHE P CE1 1 
ATOM   2926 C  CE2 . PHE C 3 84  ? -30.386 -17.161 56.147 1.00 34.50 ? 122  PHE P CE2 1 
ATOM   2927 C  CZ  . PHE C 3 84  ? -30.898 -16.192 57.015 1.00 34.74 ? 122  PHE P CZ  1 
ATOM   2928 N  N   . LEU C 3 85  ? -26.678 -16.819 52.431 1.00 34.28 ? 123  LEU P N   1 
ATOM   2929 C  CA  . LEU C 3 85  ? -27.079 -17.752 51.389 1.00 34.00 ? 123  LEU P CA  1 
ATOM   2930 C  C   . LEU C 3 85  ? -27.455 -19.086 52.039 1.00 33.98 ? 123  LEU P C   1 
ATOM   2931 O  O   . LEU C 3 85  ? -26.648 -19.683 52.761 1.00 34.06 ? 123  LEU P O   1 
ATOM   2932 C  CB  . LEU C 3 85  ? -25.945 -17.914 50.370 1.00 33.99 ? 123  LEU P CB  1 
ATOM   2933 C  CG  . LEU C 3 85  ? -26.052 -18.895 49.193 1.00 34.29 ? 123  LEU P CG  1 
ATOM   2934 C  CD1 . LEU C 3 85  ? -27.177 -18.511 48.245 1.00 34.66 ? 123  LEU P CD1 1 
ATOM   2935 C  CD2 . LEU C 3 85  ? -24.731 -18.981 48.449 1.00 33.76 ? 123  LEU P CD2 1 
ATOM   2936 N  N   . VAL C 3 86  ? -28.690 -19.530 51.804 1.00 33.65 ? 124  VAL P N   1 
ATOM   2937 C  CA  . VAL C 3 86  ? -29.204 -20.762 52.410 1.00 33.23 ? 124  VAL P CA  1 
ATOM   2938 C  C   . VAL C 3 86  ? -29.718 -21.762 51.378 1.00 33.37 ? 124  VAL P C   1 
ATOM   2939 O  O   . VAL C 3 86  ? -30.360 -21.387 50.397 1.00 33.71 ? 124  VAL P O   1 
ATOM   2940 C  CB  . VAL C 3 86  ? -30.310 -20.469 53.486 1.00 33.41 ? 124  VAL P CB  1 
ATOM   2941 C  CG1 . VAL C 3 86  ? -31.497 -19.692 52.887 1.00 32.28 ? 124  VAL P CG1 1 
ATOM   2942 C  CG2 . VAL C 3 86  ? -30.778 -21.758 54.186 1.00 32.11 ? 124  VAL P CG2 1 
ATOM   2943 N  N   . LYS C 3 87  ? -29.436 -23.037 51.623 1.00 33.49 ? 125  LYS P N   1 
ATOM   2944 C  CA  . LYS C 3 87  ? -29.980 -24.139 50.840 1.00 33.56 ? 125  LYS P CA  1 
ATOM   2945 C  C   . LYS C 3 87  ? -31.024 -24.863 51.701 1.00 33.56 ? 125  LYS P C   1 
ATOM   2946 O  O   . LYS C 3 87  ? -30.721 -25.294 52.823 1.00 33.47 ? 125  LYS P O   1 
ATOM   2947 C  CB  . LYS C 3 87  ? -28.854 -25.090 50.447 1.00 33.69 ? 125  LYS P CB  1 
ATOM   2948 C  CG  . LYS C 3 87  ? -28.835 -25.453 48.988 1.00 34.94 ? 125  LYS P CG  1 
ATOM   2949 C  CD  . LYS C 3 87  ? -27.508 -26.078 48.573 1.00 35.20 ? 125  LYS P CD  1 
ATOM   2950 C  CE  . LYS C 3 87  ? -27.342 -25.998 47.061 1.00 36.72 ? 125  LYS P CE  1 
ATOM   2951 N  NZ  . LYS C 3 87  ? -26.150 -26.742 46.563 1.00 37.22 ? 125  LYS P NZ  1 
ATOM   2952 N  N   . MET C 3 88  ? -32.251 -24.973 51.187 1.00 33.35 ? 126  MET P N   1 
ATOM   2953 C  CA  . MET C 3 88  ? -33.384 -25.507 51.965 1.00 33.35 ? 126  MET P CA  1 
ATOM   2954 C  C   . MET C 3 88  ? -34.598 -25.853 51.095 1.00 33.05 ? 126  MET P C   1 
ATOM   2955 O  O   . MET C 3 88  ? -34.608 -25.607 49.891 1.00 33.08 ? 126  MET P O   1 
ATOM   2956 C  CB  . MET C 3 88  ? -33.811 -24.508 53.057 1.00 33.00 ? 126  MET P CB  1 
ATOM   2957 C  CG  . MET C 3 88  ? -34.550 -23.276 52.532 1.00 33.27 ? 126  MET P CG  1 
ATOM   2958 S  SD  . MET C 3 88  ? -34.851 -22.011 53.776 1.00 33.95 ? 126  MET P SD  1 
ATOM   2959 C  CE  . MET C 3 88  ? -35.879 -20.865 52.849 1.00 33.13 ? 126  MET P CE  1 
ATOM   2960 N  N   . SER C 3 89  ? -35.621 -26.415 51.728 1.00 33.11 ? 127  SER P N   1 
ATOM   2961 C  CA  . SER C 3 89  ? -36.918 -26.621 51.088 1.00 32.81 ? 127  SER P CA  1 
ATOM   2962 C  C   . SER C 3 89  ? -37.654 -25.291 50.902 1.00 32.60 ? 127  SER P C   1 
ATOM   2963 O  O   . SER C 3 89  ? -37.575 -24.400 51.753 1.00 32.56 ? 127  SER P O   1 
ATOM   2964 C  CB  . SER C 3 89  ? -37.773 -27.581 51.912 1.00 32.48 ? 127  SER P CB  1 
ATOM   2965 O  OG  . SER C 3 89  ? -38.994 -27.869 51.256 1.00 32.65 ? 127  SER P OG  1 
ATOM   2966 N  N   . GLY C 3 90  ? -38.364 -25.169 49.784 1.00 32.44 ? 128  GLY P N   1 
ATOM   2967 C  CA  . GLY C 3 90  ? -39.233 -24.025 49.533 1.00 32.23 ? 128  GLY P CA  1 
ATOM   2968 C  C   . GLY C 3 90  ? -40.398 -23.912 50.505 1.00 32.16 ? 128  GLY P C   1 
ATOM   2969 O  O   . GLY C 3 90  ? -40.952 -22.826 50.664 1.00 32.21 ? 128  GLY P O   1 
ATOM   2970 N  N   . ASP C 3 91  ? -40.776 -25.028 51.142 1.00 32.17 ? 129  ASP P N   1 
ATOM   2971 C  CA  . ASP C 3 91  ? -41.783 -25.037 52.226 1.00 32.19 ? 129  ASP P CA  1 
ATOM   2972 C  C   . ASP C 3 91  ? -41.466 -24.017 53.309 1.00 32.18 ? 129  ASP P C   1 
ATOM   2973 O  O   . ASP C 3 91  ? -42.367 -23.557 54.019 1.00 32.64 ? 129  ASP P O   1 
ATOM   2974 C  CB  . ASP C 3 91  ? -41.851 -26.399 52.928 1.00 31.97 ? 129  ASP P CB  1 
ATOM   2975 C  CG  . ASP C 3 91  ? -42.276 -27.523 52.019 1.00 32.71 ? 129  ASP P CG  1 
ATOM   2976 O  OD1 . ASP C 3 91  ? -42.580 -27.267 50.832 1.00 34.66 ? 129  ASP P OD1 1 
ATOM   2977 O  OD2 . ASP C 3 91  ? -42.304 -28.677 52.507 1.00 31.62 ? 129  ASP P OD2 1 
ATOM   2978 N  N   . LEU C 3 92  ? -40.183 -23.696 53.454 1.00 31.83 ? 130  LEU P N   1 
ATOM   2979 C  CA  . LEU C 3 92  ? -39.709 -22.898 54.577 1.00 31.77 ? 130  LEU P CA  1 
ATOM   2980 C  C   . LEU C 3 92  ? -39.642 -21.415 54.271 1.00 31.83 ? 130  LEU P C   1 
ATOM   2981 O  O   . LEU C 3 92  ? -39.215 -20.628 55.118 1.00 32.05 ? 130  LEU P O   1 
ATOM   2982 C  CB  . LEU C 3 92  ? -38.340 -23.399 55.050 1.00 31.66 ? 130  LEU P CB  1 
ATOM   2983 C  CG  . LEU C 3 92  ? -38.254 -24.840 55.555 1.00 30.54 ? 130  LEU P CG  1 
ATOM   2984 C  CD1 . LEU C 3 92  ? -36.789 -25.209 55.735 1.00 29.35 ? 130  LEU P CD1 1 
ATOM   2985 C  CD2 . LEU C 3 92  ? -39.046 -25.030 56.853 1.00 28.72 ? 130  LEU P CD2 1 
ATOM   2986 N  N   . LEU C 3 93  ? -40.071 -21.035 53.069 1.00 31.90 ? 131  LEU P N   1 
ATOM   2987 C  CA  . LEU C 3 93  ? -40.083 -19.628 52.666 1.00 31.99 ? 131  LEU P CA  1 
ATOM   2988 C  C   . LEU C 3 93  ? -41.019 -18.784 53.543 1.00 32.09 ? 131  LEU P C   1 
ATOM   2989 O  O   . LEU C 3 93  ? -40.699 -17.656 53.885 1.00 31.83 ? 131  LEU P O   1 
ATOM   2990 C  CB  . LEU C 3 93  ? -40.399 -19.480 51.168 1.00 31.59 ? 131  LEU P CB  1 
ATOM   2991 C  CG  . LEU C 3 93  ? -39.241 -19.845 50.218 1.00 31.35 ? 131  LEU P CG  1 
ATOM   2992 C  CD1 . LEU C 3 93  ? -39.682 -19.976 48.757 1.00 30.47 ? 131  LEU P CD1 1 
ATOM   2993 C  CD2 . LEU C 3 93  ? -38.083 -18.861 50.343 1.00 30.34 ? 131  LEU P CD2 1 
ATOM   2994 N  N   . GLU C 3 94  ? -42.159 -19.350 53.919 1.00 32.85 ? 132  GLU P N   1 
ATOM   2995 C  CA  . GLU C 3 94  ? -43.101 -18.689 54.822 1.00 33.68 ? 132  GLU P CA  1 
ATOM   2996 C  C   . GLU C 3 94  ? -42.455 -18.301 56.146 1.00 33.52 ? 132  GLU P C   1 
ATOM   2997 O  O   . GLU C 3 94  ? -42.566 -17.151 56.581 1.00 33.48 ? 132  GLU P O   1 
ATOM   2998 C  CB  . GLU C 3 94  ? -44.283 -19.599 55.114 1.00 34.10 ? 132  GLU P CB  1 
ATOM   2999 C  CG  . GLU C 3 94  ? -45.608 -19.098 54.614 1.00 37.38 ? 132  GLU P CG  1 
ATOM   3000 C  CD  . GLU C 3 94  ? -46.755 -19.705 55.385 1.00 40.33 ? 132  GLU P CD  1 
ATOM   3001 O  OE1 . GLU C 3 94  ? -46.908 -19.373 56.580 1.00 42.14 ? 132  GLU P OE1 1 
ATOM   3002 O  OE2 . GLU C 3 94  ? -47.496 -20.522 54.801 1.00 42.28 ? 132  GLU P OE2 1 
ATOM   3003 N  N   . LEU C 3 95  ? -41.786 -19.264 56.779 1.00 33.27 ? 133  LEU P N   1 
ATOM   3004 C  CA  . LEU C 3 95  ? -41.147 -19.021 58.062 1.00 33.56 ? 133  LEU P CA  1 
ATOM   3005 C  C   . LEU C 3 95  ? -39.991 -18.035 57.931 1.00 33.52 ? 133  LEU P C   1 
ATOM   3006 O  O   . LEU C 3 95  ? -39.834 -17.154 58.778 1.00 33.56 ? 133  LEU P O   1 
ATOM   3007 C  CB  . LEU C 3 95  ? -40.731 -20.339 58.761 1.00 33.56 ? 133  LEU P CB  1 
ATOM   3008 C  CG  . LEU C 3 95  ? -39.341 -20.990 58.793 1.00 33.76 ? 133  LEU P CG  1 
ATOM   3009 C  CD1 . LEU C 3 95  ? -38.271 -20.123 59.445 1.00 34.14 ? 133  LEU P CD1 1 
ATOM   3010 C  CD2 . LEU C 3 95  ? -39.427 -22.304 59.544 1.00 33.65 ? 133  LEU P CD2 1 
ATOM   3011 N  N   . ALA C 3 96  ? -39.213 -18.174 56.854 1.00 33.34 ? 134  ALA P N   1 
ATOM   3012 C  CA  . ALA C 3 96  ? -38.044 -17.338 56.611 1.00 33.13 ? 134  ALA P CA  1 
ATOM   3013 C  C   . ALA C 3 96  ? -38.412 -15.873 56.356 1.00 33.13 ? 134  ALA P C   1 
ATOM   3014 O  O   . ALA C 3 96  ? -37.727 -14.964 56.824 1.00 32.95 ? 134  ALA P O   1 
ATOM   3015 C  CB  . ALA C 3 96  ? -37.227 -17.897 55.466 1.00 33.21 ? 134  ALA P CB  1 
ATOM   3016 N  N   . LEU C 3 97  ? -39.505 -15.658 55.627 1.00 33.27 ? 135  LEU P N   1 
ATOM   3017 C  CA  . LEU C 3 97  ? -40.044 -14.321 55.388 1.00 33.24 ? 135  LEU P CA  1 
ATOM   3018 C  C   . LEU C 3 97  ? -40.552 -13.661 56.671 1.00 33.50 ? 135  LEU P C   1 
ATOM   3019 O  O   . LEU C 3 97  ? -40.717 -12.440 56.722 1.00 33.59 ? 135  LEU P O   1 
ATOM   3020 C  CB  . LEU C 3 97  ? -41.156 -14.370 54.330 1.00 33.18 ? 135  LEU P CB  1 
ATOM   3021 C  CG  . LEU C 3 97  ? -40.758 -14.599 52.863 1.00 32.75 ? 135  LEU P CG  1 
ATOM   3022 C  CD1 . LEU C 3 97  ? -41.997 -14.827 51.988 1.00 31.70 ? 135  LEU P CD1 1 
ATOM   3023 C  CD2 . LEU C 3 97  ? -39.916 -13.452 52.316 1.00 31.49 ? 135  LEU P CD2 1 
ATOM   3024 N  N   . LYS C 3 98  ? -40.781 -14.469 57.706 1.00 33.71 ? 136  LYS P N   1 
ATOM   3025 C  CA  . LYS C 3 98  ? -41.262 -13.970 58.999 1.00 33.96 ? 136  LYS P CA  1 
ATOM   3026 C  C   . LYS C 3 98  ? -40.139 -13.730 60.000 1.00 34.02 ? 136  LYS P C   1 
ATOM   3027 O  O   . LYS C 3 98  ? -40.387 -13.263 61.110 1.00 34.05 ? 136  LYS P O   1 
ATOM   3028 C  CB  . LYS C 3 98  ? -42.300 -14.922 59.597 1.00 34.05 ? 136  LYS P CB  1 
ATOM   3029 C  CG  . LYS C 3 98  ? -43.670 -14.818 58.959 1.00 34.33 ? 136  LYS P CG  1 
ATOM   3030 C  CD  . LYS C 3 98  ? -44.533 -16.011 59.328 1.00 35.98 ? 136  LYS P CD  1 
ATOM   3031 C  CE  . LYS C 3 98  ? -45.907 -15.906 58.675 1.00 37.49 ? 136  LYS P CE  1 
ATOM   3032 N  NZ  . LYS C 3 98  ? -46.861 -16.923 59.202 1.00 39.33 ? 136  LYS P NZ  1 
ATOM   3033 N  N   . LEU C 3 99  ? -38.907 -14.045 59.598 1.00 34.15 ? 137  LEU P N   1 
ATOM   3034 C  CA  . LEU C 3 99  ? -37.730 -13.846 60.437 1.00 33.86 ? 137  LEU P CA  1 
ATOM   3035 C  C   . LEU C 3 99  ? -37.439 -12.360 60.640 1.00 34.41 ? 137  LEU P C   1 
ATOM   3036 O  O   . LEU C 3 99  ? -37.775 -11.539 59.783 1.00 34.51 ? 137  LEU P O   1 
ATOM   3037 C  CB  . LEU C 3 99  ? -36.514 -14.551 59.828 1.00 33.57 ? 137  LEU P CB  1 
ATOM   3038 C  CG  . LEU C 3 99  ? -36.405 -16.075 59.903 1.00 32.50 ? 137  LEU P CG  1 
ATOM   3039 C  CD1 . LEU C 3 99  ? -35.301 -16.571 58.993 1.00 32.13 ? 137  LEU P CD1 1 
ATOM   3040 C  CD2 . LEU C 3 99  ? -36.151 -16.525 61.320 1.00 31.77 ? 137  LEU P CD2 1 
ATOM   3041 N  N   . PRO C 3 100 ? -36.829 -12.001 61.788 1.00 34.89 ? 138  PRO P N   1 
ATOM   3042 C  CA  . PRO C 3 100 ? -36.529 -10.583 62.013 1.00 35.11 ? 138  PRO P CA  1 
ATOM   3043 C  C   . PRO C 3 100 ? -35.440 -10.037 61.086 1.00 35.28 ? 138  PRO P C   1 
ATOM   3044 O  O   . PRO C 3 100 ? -34.572 -10.787 60.629 1.00 35.58 ? 138  PRO P O   1 
ATOM   3045 C  CB  . PRO C 3 100 ? -36.078 -10.541 63.479 1.00 35.09 ? 138  PRO P CB  1 
ATOM   3046 C  CG  . PRO C 3 100 ? -35.598 -11.926 63.772 1.00 35.14 ? 138  PRO P CG  1 
ATOM   3047 C  CD  . PRO C 3 100 ? -36.426 -12.846 62.930 1.00 34.76 ? 138  PRO P CD  1 
ATOM   3048 N  N   . HIS C 3 101 ? -35.518 -8.736  60.811 1.00 35.31 ? 139  HIS P N   1 
ATOM   3049 C  CA  . HIS C 3 101 ? -34.547 -8.001  59.988 1.00 35.47 ? 139  HIS P CA  1 
ATOM   3050 C  C   . HIS C 3 101 ? -34.662 -8.250  58.482 1.00 34.96 ? 139  HIS P C   1 
ATOM   3051 O  O   . HIS C 3 101 ? -34.025 -7.549  57.693 1.00 35.10 ? 139  HIS P O   1 
ATOM   3052 C  CB  . HIS C 3 101 ? -33.100 -8.236  60.464 1.00 35.81 ? 139  HIS P CB  1 
ATOM   3053 C  CG  . HIS C 3 101 ? -32.917 -8.069  61.939 1.00 36.76 ? 139  HIS P CG  1 
ATOM   3054 N  ND1 . HIS C 3 101 ? -32.953 -6.838  62.559 1.00 37.53 ? 139  HIS P ND1 1 
ATOM   3055 C  CD2 . HIS C 3 101 ? -32.709 -8.980  62.920 1.00 37.33 ? 139  HIS P CD2 1 
ATOM   3056 C  CE1 . HIS C 3 101 ? -32.772 -6.998  63.858 1.00 37.54 ? 139  HIS P CE1 1 
ATOM   3057 N  NE2 . HIS C 3 101 ? -32.622 -8.288  64.103 1.00 37.70 ? 139  HIS P NE2 1 
ATOM   3058 N  N   . VAL C 3 102 ? -35.465 -9.237  58.089 1.00 34.35 ? 140  VAL P N   1 
ATOM   3059 C  CA  . VAL C 3 102 ? -35.582 -9.623  56.678 1.00 33.80 ? 140  VAL P CA  1 
ATOM   3060 C  C   . VAL C 3 102 ? -36.217 -8.513  55.832 1.00 33.40 ? 140  VAL P C   1 
ATOM   3061 O  O   . VAL C 3 102 ? -37.309 -8.028  56.133 1.00 33.38 ? 140  VAL P O   1 
ATOM   3062 C  CB  . VAL C 3 102 ? -36.326 -10.979 56.490 1.00 33.92 ? 140  VAL P CB  1 
ATOM   3063 C  CG1 . VAL C 3 102 ? -36.514 -11.314 54.998 1.00 33.34 ? 140  VAL P CG1 1 
ATOM   3064 C  CG2 . VAL C 3 102 ? -35.570 -12.107 57.186 1.00 33.42 ? 140  VAL P CG2 1 
ATOM   3065 N  N   . ASP C 3 103 ? -35.496 -8.110  54.790 1.00 32.77 ? 141  ASP P N   1 
ATOM   3066 C  CA  . ASP C 3 103 ? -35.988 -7.161  53.801 1.00 32.38 ? 141  ASP P CA  1 
ATOM   3067 C  C   . ASP C 3 103 ? -36.710 -7.920  52.679 1.00 31.89 ? 141  ASP P C   1 
ATOM   3068 O  O   . ASP C 3 103 ? -37.883 -7.665  52.392 1.00 31.64 ? 141  ASP P O   1 
ATOM   3069 C  CB  . ASP C 3 103 ? -34.817 -6.339  53.244 1.00 32.53 ? 141  ASP P CB  1 
ATOM   3070 C  CG  . ASP C 3 103 ? -35.264 -5.069  52.519 1.00 32.89 ? 141  ASP P CG  1 
ATOM   3071 O  OD1 . ASP C 3 103 ? -36.460 -4.713  52.561 1.00 33.01 ? 141  ASP P OD1 1 
ATOM   3072 O  OD2 . ASP C 3 103 ? -34.397 -4.416  51.900 1.00 34.01 ? 141  ASP P OD2 1 
ATOM   3073 N  N   . TYR C 3 104 ? -35.995 -8.855  52.057 1.00 31.45 ? 142  TYR P N   1 
ATOM   3074 C  CA  . TYR C 3 104 ? -36.551 -9.715  51.015 1.00 31.13 ? 142  TYR P CA  1 
ATOM   3075 C  C   . TYR C 3 104 ? -35.741 -10.996 50.846 1.00 30.85 ? 142  TYR P C   1 
ATOM   3076 O  O   . TYR C 3 104 ? -34.618 -11.110 51.342 1.00 30.51 ? 142  TYR P O   1 
ATOM   3077 C  CB  . TYR C 3 104 ? -36.676 -8.977  49.671 1.00 31.03 ? 142  TYR P CB  1 
ATOM   3078 C  CG  . TYR C 3 104 ? -35.379 -8.445  49.107 1.00 31.07 ? 142  TYR P CG  1 
ATOM   3079 C  CD1 . TYR C 3 104 ? -34.879 -7.206  49.510 1.00 31.38 ? 142  TYR P CD1 1 
ATOM   3080 C  CD2 . TYR C 3 104 ? -34.658 -9.170  48.151 1.00 31.38 ? 142  TYR P CD2 1 
ATOM   3081 C  CE1 . TYR C 3 104 ? -33.688 -6.706  48.983 1.00 31.70 ? 142  TYR P CE1 1 
ATOM   3082 C  CE2 . TYR C 3 104 ? -33.467 -8.678  47.620 1.00 30.82 ? 142  TYR P CE2 1 
ATOM   3083 C  CZ  . TYR C 3 104 ? -32.991 -7.446  48.042 1.00 31.05 ? 142  TYR P CZ  1 
ATOM   3084 O  OH  . TYR C 3 104 ? -31.819 -6.950  47.532 1.00 31.06 ? 142  TYR P OH  1 
ATOM   3085 N  N   . ILE C 3 105 ? -36.335 -11.958 50.146 1.00 30.78 ? 143  ILE P N   1 
ATOM   3086 C  CA  . ILE C 3 105 ? -35.671 -13.216 49.831 1.00 30.57 ? 143  ILE P CA  1 
ATOM   3087 C  C   . ILE C 3 105 ? -35.710 -13.432 48.324 1.00 30.49 ? 143  ILE P C   1 
ATOM   3088 O  O   . ILE C 3 105 ? -36.762 -13.332 47.693 1.00 30.28 ? 143  ILE P O   1 
ATOM   3089 C  CB  . ILE C 3 105 ? -36.295 -14.414 50.594 1.00 30.40 ? 143  ILE P CB  1 
ATOM   3090 C  CG1 . ILE C 3 105 ? -36.126 -14.213 52.111 1.00 30.71 ? 143  ILE P CG1 1 
ATOM   3091 C  CG2 . ILE C 3 105 ? -35.655 -15.731 50.148 1.00 30.32 ? 143  ILE P CG2 1 
ATOM   3092 C  CD1 . ILE C 3 105 ? -36.819 -15.240 52.986 1.00 30.37 ? 143  ILE P CD1 1 
ATOM   3093 N  N   . GLU C 3 106 ? -34.544 -13.704 47.753 1.00 30.56 ? 144  GLU P N   1 
ATOM   3094 C  CA  . GLU C 3 106 ? -34.442 -13.960 46.324 1.00 30.51 ? 144  GLU P CA  1 
ATOM   3095 C  C   . GLU C 3 106 ? -33.923 -15.364 46.052 1.00 30.34 ? 144  GLU P C   1 
ATOM   3096 O  O   . GLU C 3 106 ? -32.869 -15.761 46.551 1.00 30.09 ? 144  GLU P O   1 
ATOM   3097 C  CB  . GLU C 3 106 ? -33.566 -12.911 45.633 1.00 30.34 ? 144  GLU P CB  1 
ATOM   3098 C  CG  . GLU C 3 106 ? -33.487 -13.090 44.125 1.00 31.29 ? 144  GLU P CG  1 
ATOM   3099 C  CD  . GLU C 3 106 ? -32.887 -11.896 43.413 1.00 33.61 ? 144  GLU P CD  1 
ATOM   3100 O  OE1 . GLU C 3 106 ? -33.021 -10.752 43.913 1.00 33.17 ? 144  GLU P OE1 1 
ATOM   3101 O  OE2 . GLU C 3 106 ? -32.267 -12.109 42.346 1.00 35.25 ? 144  GLU P OE2 1 
ATOM   3102 N  N   . GLU C 3 107 ? -34.692 -16.106 45.259 1.00 30.27 ? 145  GLU P N   1 
ATOM   3103 C  CA  . GLU C 3 107 ? -34.281 -17.409 44.768 1.00 30.13 ? 145  GLU P CA  1 
ATOM   3104 C  C   . GLU C 3 107 ? -33.134 -17.239 43.771 1.00 29.91 ? 145  GLU P C   1 
ATOM   3105 O  O   . GLU C 3 107 ? -33.196 -16.387 42.885 1.00 29.86 ? 145  GLU P O   1 
ATOM   3106 C  CB  . GLU C 3 107 ? -35.468 -18.089 44.105 1.00 29.90 ? 145  GLU P CB  1 
ATOM   3107 C  CG  . GLU C 3 107 ? -35.250 -19.521 43.695 1.00 30.05 ? 145  GLU P CG  1 
ATOM   3108 C  CD  . GLU C 3 107 ? -36.336 -19.981 42.759 1.00 30.88 ? 145  GLU P CD  1 
ATOM   3109 O  OE1 . GLU C 3 107 ? -36.204 -19.742 41.539 1.00 30.64 ? 145  GLU P OE1 1 
ATOM   3110 O  OE2 . GLU C 3 107 ? -37.337 -20.559 43.248 1.00 31.25 ? 145  GLU P OE2 1 
ATOM   3111 N  N   . ASP C 3 108 ? -32.092 -18.051 43.928 1.00 29.76 ? 146  ASP P N   1 
ATOM   3112 C  CA  . ASP C 3 108 ? -30.910 -17.999 43.061 1.00 29.28 ? 146  ASP P CA  1 
ATOM   3113 C  C   . ASP C 3 108 ? -31.307 -18.234 41.600 1.00 29.18 ? 146  ASP P C   1 
ATOM   3114 O  O   . ASP C 3 108 ? -32.328 -18.863 41.307 1.00 29.32 ? 146  ASP P O   1 
ATOM   3115 C  CB  . ASP C 3 108 ? -29.893 -19.054 43.515 1.00 28.94 ? 146  ASP P CB  1 
ATOM   3116 C  CG  . ASP C 3 108 ? -28.447 -18.720 43.126 1.00 29.36 ? 146  ASP P CG  1 
ATOM   3117 O  OD1 . ASP C 3 108 ? -28.168 -17.644 42.546 1.00 29.27 ? 146  ASP P OD1 1 
ATOM   3118 O  OD2 . ASP C 3 108 ? -27.563 -19.558 43.428 1.00 29.68 ? 146  ASP P OD2 1 
ATOM   3119 N  N   . SER C 3 109 ? -30.506 -17.709 40.683 1.00 28.99 ? 147  SER P N   1 
ATOM   3120 C  CA  . SER C 3 109 ? -30.713 -17.942 39.260 1.00 28.66 ? 147  SER P CA  1 
ATOM   3121 C  C   . SER C 3 109 ? -29.384 -17.951 38.501 1.00 28.31 ? 147  SER P C   1 
ATOM   3122 O  O   . SER C 3 109 ? -28.353 -17.557 39.045 1.00 28.07 ? 147  SER P O   1 
ATOM   3123 C  CB  . SER C 3 109 ? -31.704 -16.931 38.665 1.00 28.79 ? 147  SER P CB  1 
ATOM   3124 O  OG  . SER C 3 109 ? -31.426 -15.601 39.074 1.00 29.22 ? 147  SER P OG  1 
ATOM   3125 N  N   . SER C 3 110 ? -29.436 -18.419 37.255 1.00 27.94 ? 148  SER P N   1 
ATOM   3126 C  CA  . SER C 3 110 ? -28.282 -18.512 36.362 1.00 27.25 ? 148  SER P CA  1 
ATOM   3127 C  C   . SER C 3 110 ? -27.877 -17.187 35.725 1.00 26.68 ? 148  SER P C   1 
ATOM   3128 O  O   . SER C 3 110 ? -28.720 -16.342 35.436 1.00 26.52 ? 148  SER P O   1 
ATOM   3129 C  CB  . SER C 3 110 ? -28.571 -19.517 35.249 1.00 27.12 ? 148  SER P CB  1 
ATOM   3130 O  OG  . SER C 3 110 ? -28.755 -20.813 35.778 1.00 28.08 ? 148  SER P OG  1 
ATOM   3131 N  N   . VAL C 3 111 ? -26.569 -17.024 35.521 1.00 26.09 ? 149  VAL P N   1 
ATOM   3132 C  CA  . VAL C 3 111 ? -26.011 -15.950 34.699 1.00 25.16 ? 149  VAL P CA  1 
ATOM   3133 C  C   . VAL C 3 111 ? -25.172 -16.585 33.600 1.00 24.80 ? 149  VAL P C   1 
ATOM   3134 O  O   . VAL C 3 111 ? -24.701 -17.718 33.740 1.00 24.67 ? 149  VAL P O   1 
ATOM   3135 C  CB  . VAL C 3 111 ? -25.207 -14.877 35.518 1.00 25.25 ? 149  VAL P CB  1 
ATOM   3136 C  CG1 . VAL C 3 111 ? -26.114 -14.185 36.534 1.00 24.86 ? 149  VAL P CG1 1 
ATOM   3137 C  CG2 . VAL C 3 111 ? -23.981 -15.471 36.206 1.00 24.69 ? 149  VAL P CG2 1 
ATOM   3138 N  N   . PHE C 3 112 ? -25.012 -15.869 32.497 1.00 24.30 ? 150  PHE P N   1 
ATOM   3139 C  CA  . PHE C 3 112 ? -24.381 -16.436 31.317 1.00 24.50 ? 150  PHE P CA  1 
ATOM   3140 C  C   . PHE C 3 112 ? -23.418 -15.445 30.714 1.00 24.22 ? 150  PHE P C   1 
ATOM   3141 O  O   . PHE C 3 112 ? -23.726 -14.253 30.634 1.00 24.29 ? 150  PHE P O   1 
ATOM   3142 C  CB  . PHE C 3 112 ? -25.431 -16.825 30.256 1.00 24.70 ? 150  PHE P CB  1 
ATOM   3143 C  CG  . PHE C 3 112 ? -26.507 -17.734 30.773 1.00 25.41 ? 150  PHE P CG  1 
ATOM   3144 C  CD1 . PHE C 3 112 ? -26.339 -19.116 30.750 1.00 26.38 ? 150  PHE P CD1 1 
ATOM   3145 C  CD2 . PHE C 3 112 ? -27.686 -17.209 31.305 1.00 26.22 ? 150  PHE P CD2 1 
ATOM   3146 C  CE1 . PHE C 3 112 ? -27.337 -19.962 31.246 1.00 26.64 ? 150  PHE P CE1 1 
ATOM   3147 C  CE2 . PHE C 3 112 ? -28.680 -18.046 31.811 1.00 25.32 ? 150  PHE P CE2 1 
ATOM   3148 C  CZ  . PHE C 3 112 ? -28.505 -19.425 31.772 1.00 25.72 ? 150  PHE P CZ  1 
ATOM   3149 N  N   . ALA C 3 113 ? -22.258 -15.954 30.303 1.00 23.66 ? 151  ALA P N   1 
ATOM   3150 C  CA  . ALA C 3 113 ? -21.336 -15.245 29.424 1.00 23.65 ? 151  ALA P CA  1 
ATOM   3151 C  C   . ALA C 3 113 ? -22.063 -14.669 28.205 1.00 23.71 ? 151  ALA P C   1 
ATOM   3152 O  O   . ALA C 3 113 ? -22.818 -15.374 27.531 1.00 23.38 ? 151  ALA P O   1 
ATOM   3153 C  CB  . ALA C 3 113 ? -20.238 -16.190 28.967 1.00 23.31 ? 151  ALA P CB  1 
ATOM   3154 N  N   . GLN C 3 114 ? -21.818 -13.390 27.931 1.00 24.08 ? 152  GLN P N   1 
ATOM   3155 C  CA  . GLN C 3 114 ? -22.418 -12.704 26.794 1.00 24.58 ? 152  GLN P CA  1 
ATOM   3156 C  C   . GLN C 3 114 ? -21.397 -12.474 25.681 1.00 25.11 ? 152  GLN P C   1 
ATOM   3157 O  O   . GLN C 3 114 ? -21.533 -11.608 24.806 1.00 25.20 ? 152  GLN P O   1 
ATOM   3158 C  CB  . GLN C 3 114 ? -23.072 -11.392 27.249 1.00 24.74 ? 152  GLN P CB  1 
ATOM   3159 C  CG  . GLN C 3 114 ? -24.270 -11.586 28.186 1.00 24.25 ? 152  GLN P CG  1 
ATOM   3160 C  CD  . GLN C 3 114 ? -25.369 -12.432 27.559 1.00 24.96 ? 152  GLN P CD  1 
ATOM   3161 O  OE1 . GLN C 3 114 ? -26.079 -11.991 26.656 1.00 26.01 ? 152  GLN P OE1 1 
ATOM   3162 N  NE2 . GLN C 3 114 ? -25.512 -13.653 28.040 1.00 25.74 ? 152  GLN P NE2 1 
ATOM   3163 O  OXT . GLN C 3 114 ? -20.382 -13.176 25.626 1.00 25.71 ? 152  GLN P OXT 1 
HETATM 3164 CA CA  . CA  D 4 .   ? -27.438 0.891   33.481 1.00 86.28 ? 1448 CA  A CA  1 
HETATM 3165 CA CA  . CA  E 4 .   ? 4.414   -12.903 12.933 1.00 52.89 ? 1333 CA  E CA  1 
HETATM 3166 O  O   . HOH F 5 .   ? -12.934 1.244   12.183 1.00 44.46 ? 2001 HOH A O   1 
HETATM 3167 O  O   . HOH F 5 .   ? -10.576 -5.896  12.490 1.00 32.44 ? 2002 HOH A O   1 
HETATM 3168 O  O   . HOH F 5 .   ? -9.130  -5.600  19.123 1.00 29.38 ? 2003 HOH A O   1 
HETATM 3169 O  O   . HOH F 5 .   ? -11.289 -6.705  15.288 1.00 32.02 ? 2004 HOH A O   1 
HETATM 3170 O  O   . HOH F 5 .   ? -3.646  12.466  18.357 1.00 62.55 ? 2005 HOH A O   1 
HETATM 3171 O  O   . HOH F 5 .   ? -0.143  7.513   34.578 1.00 61.20 ? 2006 HOH A O   1 
HETATM 3172 O  O   . HOH F 5 .   ? -2.788  6.094   37.488 1.00 73.99 ? 2007 HOH A O   1 
HETATM 3173 O  O   . HOH F 5 .   ? -12.000 -14.685 35.474 1.00 42.30 ? 2008 HOH A O   1 
HETATM 3174 O  O   . HOH F 5 .   ? -10.840 -23.795 34.292 1.00 52.23 ? 2009 HOH A O   1 
HETATM 3175 O  O   . HOH F 5 .   ? -3.216  -19.666 33.471 1.00 53.15 ? 2010 HOH A O   1 
HETATM 3176 O  O   . HOH F 5 .   ? -6.187  -9.363  22.761 1.00 28.97 ? 2011 HOH A O   1 
HETATM 3177 O  O   . HOH F 5 .   ? -0.732  -7.319  28.756 1.00 44.39 ? 2012 HOH A O   1 
HETATM 3178 O  O   . HOH F 5 .   ? 0.882   -10.282 22.109 1.00 40.53 ? 2013 HOH A O   1 
HETATM 3179 O  O   . HOH F 5 .   ? 2.244   -8.695  28.385 1.00 48.15 ? 2014 HOH A O   1 
HETATM 3180 O  O   . HOH F 5 .   ? 3.485   -16.286 26.313 1.00 56.97 ? 2015 HOH A O   1 
HETATM 3181 O  O   . HOH F 5 .   ? 4.645   -13.011 26.846 1.00 46.80 ? 2016 HOH A O   1 
HETATM 3182 O  O   . HOH F 5 .   ? -0.325  -13.056 34.000 1.00 50.65 ? 2017 HOH A O   1 
HETATM 3183 O  O   . HOH F 5 .   ? -0.396  -7.905  37.562 1.00 49.98 ? 2018 HOH A O   1 
HETATM 3184 O  O   . HOH F 5 .   ? 0.065   -10.669 37.393 1.00 63.95 ? 2019 HOH A O   1 
HETATM 3185 O  O   . HOH F 5 .   ? -9.690  -17.020 39.914 1.00 37.98 ? 2020 HOH A O   1 
HETATM 3186 O  O   . HOH F 5 .   ? -13.181 -21.230 45.838 1.00 51.25 ? 2021 HOH A O   1 
HETATM 3187 O  O   . HOH F 5 .   ? -13.114 -18.738 46.443 1.00 48.30 ? 2022 HOH A O   1 
HETATM 3188 O  O   . HOH F 5 .   ? -16.360 -21.454 46.620 1.00 54.16 ? 2023 HOH A O   1 
HETATM 3189 O  O   . HOH F 5 .   ? -9.890  -20.762 37.965 1.00 47.57 ? 2024 HOH A O   1 
HETATM 3190 O  O   . HOH F 5 .   ? -16.404 -18.779 47.104 1.00 57.22 ? 2025 HOH A O   1 
HETATM 3191 O  O   . HOH F 5 .   ? -21.639 -20.763 47.459 1.00 38.94 ? 2026 HOH A O   1 
HETATM 3192 O  O   . HOH F 5 .   ? -20.224 -23.408 44.067 1.00 48.44 ? 2027 HOH A O   1 
HETATM 3193 O  O   . HOH F 5 .   ? -16.952 -23.448 42.709 1.00 42.77 ? 2028 HOH A O   1 
HETATM 3194 O  O   . HOH F 5 .   ? -14.991 -19.897 28.266 1.00 41.76 ? 2029 HOH A O   1 
HETATM 3195 O  O   . HOH F 5 .   ? 1.761   -2.995  24.126 1.00 49.39 ? 2030 HOH A O   1 
HETATM 3196 O  O   . HOH F 5 .   ? 4.378   -4.663  22.591 1.00 58.41 ? 2031 HOH A O   1 
HETATM 3197 O  O   . HOH F 5 .   ? 0.167   -3.404  18.469 1.00 54.22 ? 2032 HOH A O   1 
HETATM 3198 O  O   . HOH F 5 .   ? 2.367   -4.284  20.367 1.00 62.82 ? 2033 HOH A O   1 
HETATM 3199 O  O   . HOH F 5 .   ? 3.909   -8.424  17.822 1.00 47.41 ? 2034 HOH A O   1 
HETATM 3200 O  O   . HOH F 5 .   ? -4.177  -0.357  18.619 1.00 48.46 ? 2035 HOH A O   1 
HETATM 3201 O  O   . HOH F 5 .   ? -1.938  2.132   26.999 1.00 53.67 ? 2036 HOH A O   1 
HETATM 3202 O  O   . HOH F 5 .   ? -23.033 -23.174 42.551 1.00 51.61 ? 2037 HOH A O   1 
HETATM 3203 O  O   . HOH F 5 .   ? -2.783  -7.346  38.686 1.00 55.80 ? 2038 HOH A O   1 
HETATM 3204 O  O   . HOH F 5 .   ? -9.464  -16.654 37.148 1.00 37.03 ? 2039 HOH A O   1 
HETATM 3205 O  O   . HOH F 5 .   ? -14.521 -26.389 38.795 1.00 62.19 ? 2040 HOH A O   1 
HETATM 3206 O  O   . HOH F 5 .   ? -14.338 -21.346 33.194 1.00 38.92 ? 2041 HOH A O   1 
HETATM 3207 O  O   . HOH F 5 .   ? -21.229 -18.070 39.667 1.00 35.55 ? 2042 HOH A O   1 
HETATM 3208 O  O   . HOH F 5 .   ? -17.576 -20.208 27.724 1.00 48.67 ? 2043 HOH A O   1 
HETATM 3209 O  O   . HOH F 5 .   ? -22.078 -20.456 41.547 1.00 43.97 ? 2044 HOH A O   1 
HETATM 3210 O  O   . HOH F 5 .   ? -23.212 -19.931 45.238 1.00 42.00 ? 2045 HOH A O   1 
HETATM 3211 O  O   . HOH F 5 .   ? -15.417 -15.465 49.666 1.00 53.01 ? 2046 HOH A O   1 
HETATM 3212 O  O   . HOH F 5 .   ? -16.489 -13.040 49.327 1.00 39.65 ? 2047 HOH A O   1 
HETATM 3213 O  O   . HOH F 5 .   ? -7.584  -9.445  44.807 1.00 55.72 ? 2048 HOH A O   1 
HETATM 3214 O  O   . HOH F 5 .   ? -38.767 -9.905  37.840 1.00 45.04 ? 2049 HOH A O   1 
HETATM 3215 O  O   . HOH F 5 .   ? -26.982 -10.068 10.073 1.00 58.81 ? 2050 HOH A O   1 
HETATM 3216 O  O   . HOH F 5 .   ? -20.820 -14.610 16.043 1.00 46.24 ? 2051 HOH A O   1 
HETATM 3217 O  O   . HOH F 5 .   ? -12.833 3.550   41.526 1.00 61.28 ? 2052 HOH A O   1 
HETATM 3218 O  O   . HOH F 5 .   ? -38.414 -8.763  34.864 1.00 41.46 ? 2053 HOH A O   1 
HETATM 3219 O  O   . HOH F 5 .   ? -37.667 -6.050  42.480 1.00 57.63 ? 2054 HOH A O   1 
HETATM 3220 O  O   . HOH F 5 .   ? -33.938 -3.361  41.680 1.00 44.48 ? 2055 HOH A O   1 
HETATM 3221 O  O   . HOH F 5 .   ? -36.077 -11.771 36.289 1.00 36.15 ? 2056 HOH A O   1 
HETATM 3222 O  O   . HOH F 5 .   ? -35.377 -10.501 41.297 1.00 47.04 ? 2057 HOH A O   1 
HETATM 3223 O  O   . HOH F 5 .   ? -32.230 -3.691  43.588 1.00 34.84 ? 2058 HOH A O   1 
HETATM 3224 O  O   . HOH F 5 .   ? -29.270 -2.435  10.471 1.00 49.36 ? 2059 HOH A O   1 
HETATM 3225 O  O   . HOH F 5 .   ? -27.528 -1.089  47.683 1.00 66.98 ? 2060 HOH A O   1 
HETATM 3226 O  O   . HOH F 5 .   ? -25.748 -7.619  10.280 1.00 46.76 ? 2061 HOH A O   1 
HETATM 3227 O  O   . HOH F 5 .   ? -14.133 -3.773  9.273  1.00 49.29 ? 2062 HOH A O   1 
HETATM 3228 O  O   . HOH F 5 .   ? -15.575 7.095   41.797 1.00 49.55 ? 2063 HOH A O   1 
HETATM 3229 O  O   . HOH F 5 .   ? -21.068 -15.137 18.679 1.00 46.50 ? 2064 HOH A O   1 
HETATM 3230 O  O   . HOH F 5 .   ? -20.407 2.019   38.256 1.00 41.60 ? 2065 HOH A O   1 
HETATM 3231 O  O   . HOH F 5 .   ? -26.118 -7.726  32.134 1.00 41.38 ? 2066 HOH A O   1 
HETATM 3232 O  O   . HOH F 5 .   ? -24.533 -14.733 23.831 1.00 45.60 ? 2067 HOH A O   1 
HETATM 3233 O  O   . HOH F 5 .   ? -32.734 -6.463  11.526 1.00 53.92 ? 2068 HOH A O   1 
HETATM 3234 O  O   . HOH F 5 .   ? -35.257 -5.147  17.544 1.00 53.60 ? 2069 HOH A O   1 
HETATM 3235 O  O   . HOH F 5 .   ? -32.030 -10.389 14.830 1.00 53.51 ? 2070 HOH A O   1 
HETATM 3236 O  O   . HOH F 5 .   ? -35.696 -10.067 15.425 1.00 54.81 ? 2071 HOH A O   1 
HETATM 3237 O  O   . HOH F 5 .   ? -14.522 15.834  42.825 1.00 58.85 ? 2072 HOH A O   1 
HETATM 3238 O  O   . HOH F 5 .   ? -33.432 -1.135  28.416 1.00 40.62 ? 2073 HOH A O   1 
HETATM 3239 O  O   . HOH F 5 .   ? -35.477 -2.294  35.475 1.00 51.32 ? 2074 HOH A O   1 
HETATM 3240 O  O   . HOH F 5 .   ? -36.614 -10.643 33.879 1.00 36.25 ? 2075 HOH A O   1 
HETATM 3241 O  O   . HOH F 5 .   ? -30.989 1.545   34.198 1.00 57.71 ? 2076 HOH A O   1 
HETATM 3242 O  O   . HOH F 5 .   ? -27.704 6.385   39.112 1.00 60.72 ? 2077 HOH A O   1 
HETATM 3243 O  O   . HOH F 5 .   ? -19.391 0.333   15.861 1.00 33.55 ? 2078 HOH A O   1 
HETATM 3244 O  O   . HOH F 5 .   ? -24.876 -3.362  9.258  1.00 41.47 ? 2079 HOH A O   1 
HETATM 3245 O  O   . HOH F 5 .   ? -17.306 -1.047  7.008  1.00 48.04 ? 2080 HOH A O   1 
HETATM 3246 O  O   . HOH F 5 .   ? -20.104 4.163   10.232 1.00 32.23 ? 2081 HOH A O   1 
HETATM 3247 O  O   . HOH F 5 .   ? -27.464 -4.472  12.194 1.00 46.14 ? 2082 HOH A O   1 
HETATM 3248 O  O   . HOH F 5 .   ? -26.948 -13.920 11.243 1.00 46.02 ? 2083 HOH A O   1 
HETATM 3249 O  O   . HOH F 5 .   ? -34.698 -15.415 15.485 1.00 48.88 ? 2084 HOH A O   1 
HETATM 3250 O  O   . HOH F 5 .   ? -24.287 -7.295  12.995 1.00 34.23 ? 2085 HOH A O   1 
HETATM 3251 O  O   . HOH F 5 .   ? -21.492 -6.630  9.942  1.00 48.86 ? 2086 HOH A O   1 
HETATM 3252 O  O   . HOH F 5 .   ? -18.501 -5.803  12.123 1.00 47.89 ? 2087 HOH A O   1 
HETATM 3253 O  O   . HOH F 5 .   ? -13.648 -8.241  11.159 1.00 61.15 ? 2088 HOH A O   1 
HETATM 3254 O  O   . HOH F 5 .   ? -16.341 -6.836  10.801 1.00 48.82 ? 2089 HOH A O   1 
HETATM 3255 O  O   . HOH F 5 .   ? -19.242 -12.017 12.271 1.00 54.91 ? 2090 HOH A O   1 
HETATM 3256 O  O   . HOH F 5 .   ? -8.350  -8.014  21.826 1.00 33.95 ? 2091 HOH A O   1 
HETATM 3257 O  O   . HOH F 5 .   ? -9.768  -16.937 24.060 1.00 33.45 ? 2092 HOH A O   1 
HETATM 3258 O  O   . HOH F 5 .   ? -4.490  -26.824 15.962 1.00 45.74 ? 2093 HOH A O   1 
HETATM 3259 O  O   . HOH F 5 .   ? -7.582  -26.240 21.111 1.00 56.39 ? 2094 HOH A O   1 
HETATM 3260 O  O   . HOH F 5 .   ? 4.242   -20.071 18.356 1.00 47.29 ? 2095 HOH A O   1 
HETATM 3261 O  O   . HOH F 5 .   ? 2.132   -20.529 20.959 1.00 35.68 ? 2096 HOH A O   1 
HETATM 3262 O  O   . HOH F 5 .   ? -18.244 -15.058 19.305 1.00 33.33 ? 2097 HOH A O   1 
HETATM 3263 O  O   . HOH F 5 .   ? -22.325 -13.768 20.574 1.00 49.11 ? 2098 HOH A O   1 
HETATM 3264 O  O   . HOH F 5 .   ? -8.185  13.803  38.353 1.00 62.81 ? 2099 HOH A O   1 
HETATM 3265 O  O   . HOH F 5 .   ? -13.135 14.547  40.571 1.00 69.14 ? 2100 HOH A O   1 
HETATM 3266 O  O   . HOH F 5 .   ? -13.174 17.277  37.224 1.00 66.02 ? 2101 HOH A O   1 
HETATM 3267 O  O   . HOH F 5 .   ? -27.872 4.120   33.955 1.00 47.20 ? 2102 HOH A O   1 
HETATM 3268 O  O   . HOH F 5 .   ? -19.232 18.567  29.469 1.00 57.12 ? 2103 HOH A O   1 
HETATM 3269 O  O   . HOH F 5 .   ? -16.826 15.995  21.597 1.00 62.92 ? 2104 HOH A O   1 
HETATM 3270 O  O   . HOH F 5 .   ? -20.989 16.118  21.785 1.00 67.95 ? 2105 HOH A O   1 
HETATM 3271 O  O   . HOH F 5 .   ? -26.610 12.924  12.412 1.00 50.28 ? 2106 HOH A O   1 
HETATM 3272 O  O   . HOH F 5 .   ? -25.647 14.617  17.061 1.00 62.20 ? 2107 HOH A O   1 
HETATM 3273 O  O   . HOH F 5 .   ? -28.842 0.345   8.661  1.00 40.22 ? 2108 HOH A O   1 
HETATM 3274 O  O   . HOH F 5 .   ? -29.597 -0.115  11.935 1.00 56.36 ? 2109 HOH A O   1 
HETATM 3275 O  O   . HOH F 5 .   ? -33.033 4.885   11.385 1.00 61.11 ? 2110 HOH A O   1 
HETATM 3276 O  O   . HOH F 5 .   ? -37.462 -3.041  14.303 1.00 69.20 ? 2111 HOH A O   1 
HETATM 3277 O  O   . HOH F 5 .   ? -24.375 6.765   17.489 1.00 41.81 ? 2112 HOH A O   1 
HETATM 3278 O  O   . HOH F 5 .   ? -29.247 9.601   22.305 1.00 55.01 ? 2113 HOH A O   1 
HETATM 3279 O  O   . HOH F 5 .   ? -16.557 5.261   18.354 1.00 38.95 ? 2114 HOH A O   1 
HETATM 3280 O  O   . HOH F 5 .   ? -16.805 7.417   24.946 1.00 45.87 ? 2115 HOH A O   1 
HETATM 3281 O  O   . HOH F 5 .   ? -7.781  17.916  21.499 1.00 61.07 ? 2116 HOH A O   1 
HETATM 3282 O  O   . HOH F 5 .   ? -1.976  9.598   21.173 1.00 61.10 ? 2117 HOH A O   1 
HETATM 3283 O  O   . HOH G 5 .   ? 11.569  -4.641  -3.555 1.00 74.97 ? 2001 HOH E O   1 
HETATM 3284 O  O   . HOH G 5 .   ? 3.858   -10.209 6.975  1.00 54.89 ? 2002 HOH E O   1 
HETATM 3285 O  O   . HOH G 5 .   ? 9.054   -16.249 0.666  1.00 31.79 ? 2003 HOH E O   1 
HETATM 3286 O  O   . HOH G 5 .   ? 9.423   -9.382  2.720  1.00 40.07 ? 2004 HOH E O   1 
HETATM 3287 O  O   . HOH G 5 .   ? 11.840  -10.342 4.794  1.00 42.71 ? 2005 HOH E O   1 
HETATM 3288 O  O   . HOH G 5 .   ? 7.212   -16.578 7.057  1.00 40.88 ? 2006 HOH E O   1 
HETATM 3289 O  O   . HOH G 5 .   ? 5.519   -12.089 14.785 1.00 39.56 ? 2007 HOH E O   1 
HETATM 3290 O  O   . HOH G 5 .   ? -0.759  -6.706  11.127 1.00 50.69 ? 2008 HOH E O   1 
HETATM 3291 O  O   . HOH G 5 .   ? 2.097   -5.789  14.703 1.00 48.15 ? 2009 HOH E O   1 
HETATM 3292 O  O   . HOH G 5 .   ? 5.970   -12.010 10.848 1.00 33.58 ? 2010 HOH E O   1 
HETATM 3293 O  O   . HOH G 5 .   ? -4.371  -10.690 6.641  1.00 57.59 ? 2011 HOH E O   1 
HETATM 3294 O  O   . HOH G 5 .   ? -14.101 -10.102 8.988  1.00 48.40 ? 2012 HOH E O   1 
HETATM 3295 O  O   . HOH G 5 .   ? -8.073  -6.126  11.178 1.00 33.34 ? 2013 HOH E O   1 
HETATM 3296 O  O   . HOH G 5 .   ? -11.556 -10.683 11.854 1.00 37.84 ? 2014 HOH E O   1 
HETATM 3297 O  O   . HOH G 5 .   ? -11.914 -13.741 11.726 1.00 56.27 ? 2015 HOH E O   1 
HETATM 3298 O  O   . HOH G 5 .   ? -12.037 -16.216 14.448 1.00 38.66 ? 2016 HOH E O   1 
HETATM 3299 O  O   . HOH G 5 .   ? 4.689   -10.619 16.485 1.00 38.28 ? 2017 HOH E O   1 
HETATM 3300 O  O   . HOH G 5 .   ? 5.391   -15.830 18.040 1.00 45.71 ? 2018 HOH E O   1 
HETATM 3301 O  O   . HOH G 5 .   ? 5.734   -13.134 17.191 1.00 39.80 ? 2019 HOH E O   1 
HETATM 3302 O  O   . HOH G 5 .   ? 6.915   -19.236 16.553 1.00 34.63 ? 2020 HOH E O   1 
HETATM 3303 O  O   . HOH G 5 .   ? 6.030   -18.983 9.221  1.00 41.68 ? 2021 HOH E O   1 
HETATM 3304 O  O   . HOH G 5 .   ? 3.893   -20.146 8.721  1.00 91.09 ? 2022 HOH E O   1 
HETATM 3305 O  O   . HOH G 5 .   ? 2.131   -20.719 7.388  1.00 39.65 ? 2023 HOH E O   1 
HETATM 3306 O  O   . HOH G 5 .   ? 4.166   -17.421 7.216  1.00 37.59 ? 2024 HOH E O   1 
HETATM 3307 O  O   . HOH G 5 .   ? 0.934   -26.187 11.946 1.00 54.78 ? 2025 HOH E O   1 
HETATM 3308 O  O   . HOH G 5 .   ? 2.881   -22.800 9.345  1.00 36.89 ? 2026 HOH E O   1 
HETATM 3309 O  O   . HOH G 5 .   ? -1.885  -21.338 7.654  1.00 36.82 ? 2027 HOH E O   1 
HETATM 3310 O  O   . HOH G 5 .   ? -8.258  -20.789 10.881 1.00 29.50 ? 2028 HOH E O   1 
HETATM 3311 O  O   . HOH G 5 .   ? -10.633 -27.731 19.314 1.00 56.36 ? 2029 HOH E O   1 
HETATM 3312 O  O   . HOH G 5 .   ? 0.052   -25.996 3.445  1.00 35.52 ? 2030 HOH E O   1 
HETATM 3313 O  O   . HOH G 5 .   ? -4.599  -25.878 3.919  1.00 41.33 ? 2031 HOH E O   1 
HETATM 3314 O  O   . HOH G 5 .   ? -5.521  -14.674 3.513  1.00 54.05 ? 2032 HOH E O   1 
HETATM 3315 O  O   . HOH G 5 .   ? -0.399  -19.501 5.592  1.00 61.47 ? 2033 HOH E O   1 
HETATM 3316 O  O   . HOH H 5 .   ? -44.810 -12.055 52.166 1.00 52.28 ? 2001 HOH P O   1 
HETATM 3317 O  O   . HOH H 5 .   ? -39.528 -5.932  49.815 1.00 45.76 ? 2002 HOH P O   1 
HETATM 3318 O  O   . HOH H 5 .   ? -43.649 -12.416 48.226 1.00 41.22 ? 2003 HOH P O   1 
HETATM 3319 O  O   . HOH H 5 .   ? -40.022 -11.988 41.478 1.00 46.61 ? 2004 HOH P O   1 
HETATM 3320 O  O   . HOH H 5 .   ? -41.376 -13.647 37.941 1.00 53.82 ? 2005 HOH P O   1 
HETATM 3321 O  O   . HOH H 5 .   ? -35.065 -17.421 40.556 1.00 37.37 ? 2006 HOH P O   1 
HETATM 3322 O  O   . HOH H 5 .   ? -34.454 -14.138 27.353 1.00 43.68 ? 2007 HOH P O   1 
HETATM 3323 O  O   . HOH H 5 .   ? -31.871 -25.428 41.808 1.00 47.63 ? 2008 HOH P O   1 
HETATM 3324 O  O   . HOH H 5 .   ? -30.500 -25.704 45.723 1.00 44.32 ? 2009 HOH P O   1 
HETATM 3325 O  O   . HOH H 5 .   ? -38.391 -22.032 45.215 1.00 38.44 ? 2010 HOH P O   1 
HETATM 3326 O  O   . HOH H 5 .   ? -31.498 -0.918  58.324 1.00 60.69 ? 2011 HOH P O   1 
HETATM 3327 O  O   . HOH H 5 .   ? -31.475 -4.690  61.538 1.00 65.16 ? 2012 HOH P O   1 
HETATM 3328 O  O   . HOH H 5 .   ? -30.914 -8.071  67.248 1.00 82.28 ? 2013 HOH P O   1 
HETATM 3329 O  O   . HOH H 5 .   ? -32.567 -26.606 59.991 1.00 39.28 ? 2014 HOH P O   1 
HETATM 3330 O  O   . HOH H 5 .   ? -39.322 -31.016 67.125 1.00 42.70 ? 2015 HOH P O   1 
HETATM 3331 O  O   . HOH H 5 .   ? -42.879 -18.431 61.949 1.00 42.48 ? 2016 HOH P O   1 
HETATM 3332 O  O   . HOH H 5 .   ? -43.780 -19.982 59.938 1.00 45.75 ? 2017 HOH P O   1 
HETATM 3333 O  O   . HOH H 5 .   ? -41.219 -32.747 57.463 1.00 65.16 ? 2018 HOH P O   1 
HETATM 3334 O  O   . HOH H 5 .   ? -40.961 -33.344 62.600 1.00 52.16 ? 2019 HOH P O   1 
HETATM 3335 O  O   . HOH H 5 .   ? -27.952 -33.370 52.700 1.00 55.38 ? 2020 HOH P O   1 
HETATM 3336 O  O   . HOH H 5 .   ? -25.278 -24.969 57.690 1.00 41.41 ? 2021 HOH P O   1 
HETATM 3337 O  O   . HOH H 5 .   ? -18.216 -19.045 50.408 1.00 60.46 ? 2022 HOH P O   1 
HETATM 3338 O  O   . HOH H 5 .   ? -19.492 -17.845 55.610 1.00 50.10 ? 2023 HOH P O   1 
HETATM 3339 O  O   . HOH H 5 .   ? -15.032 -8.349  56.109 1.00 57.49 ? 2024 HOH P O   1 
HETATM 3340 O  O   . HOH H 5 .   ? -42.666 -22.023 56.261 1.00 34.45 ? 2025 HOH P O   1 
HETATM 3341 O  O   . HOH H 5 .   ? -42.648 -26.271 48.402 1.00 40.98 ? 2026 HOH P O   1 
HETATM 3342 O  O   . HOH H 5 .   ? -42.609 -30.923 51.178 1.00 44.36 ? 2027 HOH P O   1 
HETATM 3343 O  O   . HOH H 5 .   ? -44.384 -15.394 55.384 1.00 39.08 ? 2028 HOH P O   1 
HETATM 3344 O  O   . HOH H 5 .   ? -40.043 -17.557 61.343 1.00 35.18 ? 2029 HOH P O   1 
HETATM 3345 O  O   . HOH H 5 .   ? -39.753 -10.327 58.735 1.00 48.91 ? 2030 HOH P O   1 
HETATM 3346 O  O   . HOH H 5 .   ? -39.040 -7.877  58.293 1.00 50.50 ? 2031 HOH P O   1 
HETATM 3347 O  O   . HOH H 5 .   ? -38.985 -5.594  54.387 1.00 59.67 ? 2032 HOH P O   1 
HETATM 3348 O  O   . HOH H 5 .   ? -31.193 -4.634  48.634 1.00 53.35 ? 2033 HOH P O   1 
HETATM 3349 O  O   . HOH H 5 .   ? -34.564 -12.809 40.521 1.00 46.41 ? 2034 HOH P O   1 
HETATM 3350 O  O   . HOH H 5 .   ? -27.212 -22.080 43.230 1.00 36.79 ? 2035 HOH P O   1 
HETATM 3351 O  O   . HOH H 5 .   ? -31.404 -14.728 41.366 1.00 35.74 ? 2036 HOH P O   1 
HETATM 3352 O  O   . HOH H 5 .   ? -32.999 -13.404 38.404 1.00 56.64 ? 2037 HOH P O   1 
HETATM 3353 O  O   . HOH H 5 .   ? -31.157 -15.311 35.878 1.00 36.43 ? 2038 HOH P O   1 
HETATM 3354 O  O   . HOH H 5 .   ? -26.316 -21.564 36.636 1.00 36.26 ? 2039 HOH P O   1 
HETATM 3355 O  O   . HOH H 5 .   ? -23.602 -17.971 27.323 1.00 34.15 ? 2040 HOH P O   1 
HETATM 3356 O  O   . HOH H 5 .   ? -21.508 -14.515 22.925 1.00 40.60 ? 2041 HOH P O   1 
HETATM 3357 O  O   . HOH H 5 .   ? -18.647 -13.352 23.482 1.00 45.51 ? 2042 HOH P O   1 
HETATM 3358 O  O   . HOH H 5 .   ? -26.327 -15.307 26.162 1.00 53.77 ? 2043 HOH P O   1 
HETATM 3359 O  O   . HOH H 5 .   ? -42.279 -32.817 53.043 1.00 53.55 ? 2044 HOH P O   1 
HETATM 3360 O  O   . HOH H 5 .   ? -45.152 -16.315 52.784 1.00 42.92 ? 2045 HOH P O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   153 153 SER SER A . n 
A 1 2   ILE 2   154 154 ILE ILE A . n 
A 1 3   PRO 3   155 155 PRO PRO A . n 
A 1 4   TRP 4   156 156 TRP TRP A . n 
A 1 5   ASN 5   157 157 ASN ASN A . n 
A 1 6   LEU 6   158 158 LEU LEU A . n 
A 1 7   GLU 7   159 159 GLU GLU A . n 
A 1 8   ARG 8   160 160 ARG ARG A . n 
A 1 9   ILE 9   161 161 ILE ILE A . n 
A 1 10  THR 10  162 162 THR THR A . n 
A 1 11  PRO 11  163 163 PRO PRO A . n 
A 1 12  PRO 12  164 164 PRO PRO A . n 
A 1 13  ARG 13  165 165 ARG ARG A . n 
A 1 14  TYR 14  166 ?   ?   ?   A . n 
A 1 15  ARG 15  167 ?   ?   ?   A . n 
A 1 16  ALA 16  168 ?   ?   ?   A . n 
A 1 17  ASP 17  169 ?   ?   ?   A . n 
A 1 18  GLU 18  170 ?   ?   ?   A . n 
A 1 19  TYR 19  171 ?   ?   ?   A . n 
A 1 20  GLN 20  172 ?   ?   ?   A . n 
A 1 21  PRO 21  173 ?   ?   ?   A . n 
A 1 22  PRO 22  174 ?   ?   ?   A . n 
A 1 23  ASP 23  175 ?   ?   ?   A . n 
A 1 24  GLY 24  176 ?   ?   ?   A . n 
A 1 25  GLY 25  177 ?   ?   ?   A . n 
A 1 26  SER 26  178 178 SER SER A . n 
A 1 27  LEU 27  179 179 LEU LEU A . n 
A 1 28  VAL 28  180 180 VAL VAL A . n 
A 1 29  GLU 29  181 181 GLU GLU A . n 
A 1 30  VAL 30  182 182 VAL VAL A . n 
A 1 31  TYR 31  183 183 TYR TYR A . n 
A 1 32  LEU 32  184 184 LEU LEU A . n 
A 1 33  LEU 33  185 185 LEU LEU A . n 
A 1 34  ASP 34  186 186 ASP ASP A . n 
A 1 35  THR 35  187 187 THR THR A . n 
A 1 36  SER 36  188 188 SER SER A . n 
A 1 37  ILE 37  189 189 ILE ILE A . n 
A 1 38  GLN 38  190 190 GLN GLN A . n 
A 1 39  SER 39  191 191 SER SER A . n 
A 1 40  ASP 40  192 192 ASP ASP A . n 
A 1 41  HIS 41  193 193 HIS HIS A . n 
A 1 42  ARG 42  194 194 ARG ARG A . n 
A 1 43  GLU 43  195 195 GLU GLU A . n 
A 1 44  ILE 44  196 196 ILE ILE A . n 
A 1 45  GLU 45  197 197 GLU GLU A . n 
A 1 46  GLY 46  198 198 GLY GLY A . n 
A 1 47  ARG 47  199 199 ARG ARG A . n 
A 1 48  VAL 48  200 200 VAL VAL A . n 
A 1 49  MET 49  201 201 MET MET A . n 
A 1 50  VAL 50  202 202 VAL VAL A . n 
A 1 51  THR 51  203 203 THR THR A . n 
A 1 52  ASP 52  204 204 ASP ASP A . n 
A 1 53  PHE 53  205 205 PHE PHE A . n 
A 1 54  GLU 54  206 206 GLU GLU A . n 
A 1 55  ASN 55  207 207 ASN ASN A . n 
A 1 56  VAL 56  208 208 VAL VAL A . n 
A 1 57  PRO 57  209 209 PRO PRO A . n 
A 1 58  GLU 58  210 210 GLU GLU A . n 
A 1 59  GLU 59  211 211 GLU GLU A . n 
A 1 60  ASP 60  212 212 ASP ASP A . n 
A 1 61  GLY 61  213 ?   ?   ?   A . n 
A 1 62  THR 62  214 ?   ?   ?   A . n 
A 1 63  ARG 63  215 ?   ?   ?   A . n 
A 1 64  PHE 64  216 ?   ?   ?   A . n 
A 1 65  HIS 65  217 ?   ?   ?   A . n 
A 1 66  ARG 66  218 ?   ?   ?   A . n 
A 1 67  GLN 67  219 ?   ?   ?   A . n 
A 1 68  ALA 68  220 ?   ?   ?   A . n 
A 1 69  SER 69  221 221 SER SER A . n 
A 1 70  LYS 70  222 222 LYS LYS A . n 
A 1 71  CYS 71  223 223 CYS CYS A . n 
A 1 72  ASP 72  224 224 ASP ASP A . n 
A 1 73  SER 73  225 225 SER SER A . n 
A 1 74  HIS 74  226 226 HIS HIS A . n 
A 1 75  GLY 75  227 227 GLY GLY A . n 
A 1 76  THR 76  228 228 THR THR A . n 
A 1 77  HIS 77  229 229 HIS HIS A . n 
A 1 78  LEU 78  230 230 LEU LEU A . n 
A 1 79  ALA 79  231 231 ALA ALA A . n 
A 1 80  GLY 80  232 232 GLY GLY A . n 
A 1 81  VAL 81  233 233 VAL VAL A . n 
A 1 82  VAL 82  234 234 VAL VAL A . n 
A 1 83  SER 83  235 235 SER SER A . n 
A 1 84  GLY 84  236 236 GLY GLY A . n 
A 1 85  ARG 85  237 237 ARG ARG A . n 
A 1 86  ASP 86  238 238 ASP ASP A . n 
A 1 87  ALA 87  239 239 ALA ALA A . n 
A 1 88  GLY 88  240 240 GLY GLY A . n 
A 1 89  VAL 89  241 241 VAL VAL A . n 
A 1 90  ALA 90  242 242 ALA ALA A . n 
A 1 91  LYS 91  243 243 LYS LYS A . n 
A 1 92  GLY 92  244 244 GLY GLY A . n 
A 1 93  ALA 93  245 245 ALA ALA A . n 
A 1 94  SER 94  246 246 SER SER A . n 
A 1 95  MET 95  247 247 MET MET A . n 
A 1 96  ARG 96  248 248 ARG ARG A . n 
A 1 97  SER 97  249 249 SER SER A . n 
A 1 98  LEU 98  250 250 LEU LEU A . n 
A 1 99  ARG 99  251 251 ARG ARG A . n 
A 1 100 VAL 100 252 252 VAL VAL A . n 
A 1 101 LEU 101 253 253 LEU LEU A . n 
A 1 102 ASN 102 254 254 ASN ASN A . n 
A 1 103 CYS 103 255 255 CYS CYS A . n 
A 1 104 GLN 104 256 256 GLN GLN A . n 
A 1 105 GLY 105 257 257 GLY GLY A . n 
A 1 106 LYS 106 258 258 LYS LYS A . n 
A 1 107 GLY 107 259 259 GLY GLY A . n 
A 1 108 THR 108 260 260 THR THR A . n 
A 1 109 VAL 109 261 261 VAL VAL A . n 
A 1 110 SER 110 262 262 SER SER A . n 
A 1 111 GLY 111 263 263 GLY GLY A . n 
A 1 112 THR 112 264 264 THR THR A . n 
A 1 113 LEU 113 265 265 LEU LEU A . n 
A 1 114 ILE 114 266 266 ILE ILE A . n 
A 1 115 GLY 115 267 267 GLY GLY A . n 
A 1 116 LEU 116 268 268 LEU LEU A . n 
A 1 117 GLU 117 269 269 GLU GLU A . n 
A 1 118 PHE 118 270 270 PHE PHE A . n 
A 1 119 ILE 119 271 271 ILE ILE A . n 
A 1 120 ARG 120 272 272 ARG ARG A . n 
A 1 121 LYS 121 273 273 LYS LYS A . n 
A 1 122 SER 122 274 274 SER SER A . n 
A 1 123 GLN 123 275 275 GLN GLN A . n 
A 1 124 LEU 124 276 276 LEU LEU A . n 
A 1 125 VAL 125 277 277 VAL VAL A . n 
A 1 126 GLN 126 278 278 GLN GLN A . n 
A 1 127 PRO 127 279 279 PRO PRO A . n 
A 1 128 VAL 128 280 280 VAL VAL A . n 
A 1 129 GLY 129 281 281 GLY GLY A . n 
A 1 130 PRO 130 282 282 PRO PRO A . n 
A 1 131 LEU 131 283 283 LEU LEU A . n 
A 1 132 VAL 132 284 284 VAL VAL A . n 
A 1 133 VAL 133 285 285 VAL VAL A . n 
A 1 134 LEU 134 286 286 LEU LEU A . n 
A 1 135 LEU 135 287 287 LEU LEU A . n 
A 1 136 PRO 136 288 288 PRO PRO A . n 
A 1 137 LEU 137 289 289 LEU LEU A . n 
A 1 138 ALA 138 290 290 ALA ALA A . n 
A 1 139 GLY 139 291 291 GLY GLY A . n 
A 1 140 GLY 140 292 292 GLY GLY A . n 
A 1 141 TYR 141 293 293 TYR TYR A . n 
A 1 142 SER 142 294 294 SER SER A . n 
A 1 143 ARG 143 295 295 ARG ARG A . n 
A 1 144 VAL 144 296 296 VAL VAL A . n 
A 1 145 LEU 145 297 297 LEU LEU A . n 
A 1 146 ASN 146 298 298 ASN ASN A . n 
A 1 147 ALA 147 299 299 ALA ALA A . n 
A 1 148 ALA 148 300 300 ALA ALA A . n 
A 1 149 CYS 149 301 301 CYS CYS A . n 
A 1 150 GLN 150 302 302 GLN GLN A . n 
A 1 151 ARG 151 303 303 ARG ARG A . n 
A 1 152 LEU 152 304 304 LEU LEU A . n 
A 1 153 ALA 153 305 305 ALA ALA A . n 
A 1 154 ARG 154 306 306 ARG ARG A . n 
A 1 155 ALA 155 307 307 ALA ALA A . n 
A 1 156 GLY 156 308 308 GLY GLY A . n 
A 1 157 VAL 157 309 309 VAL VAL A . n 
A 1 158 VAL 158 310 310 VAL VAL A . n 
A 1 159 LEU 159 311 311 LEU LEU A . n 
A 1 160 VAL 160 312 312 VAL VAL A . n 
A 1 161 THR 161 313 313 THR THR A . n 
A 1 162 ALA 162 314 314 ALA ALA A . n 
A 1 163 ALA 163 315 315 ALA ALA A . n 
A 1 164 GLY 164 316 316 GLY GLY A . n 
A 1 165 ASN 165 317 317 ASN ASN A . n 
A 1 166 PHE 166 318 318 PHE PHE A . n 
A 1 167 ARG 167 319 319 ARG ARG A . n 
A 1 168 ASP 168 320 320 ASP ASP A . n 
A 1 169 ASP 169 321 321 ASP ASP A . n 
A 1 170 ALA 170 322 322 ALA ALA A . n 
A 1 171 CYS 171 323 323 CYS CYS A . n 
A 1 172 LEU 172 324 324 LEU LEU A . n 
A 1 173 TYR 173 325 325 TYR TYR A . n 
A 1 174 SER 174 326 326 SER SER A . n 
A 1 175 PRO 175 327 327 PRO PRO A . n 
A 1 176 ALA 176 328 328 ALA ALA A . n 
A 1 177 SER 177 329 329 SER SER A . n 
A 1 178 ALA 178 330 330 ALA ALA A . n 
A 1 179 PRO 179 331 331 PRO PRO A . n 
A 1 180 GLU 180 332 332 GLU GLU A . n 
A 1 181 VAL 181 333 333 VAL VAL A . n 
A 1 182 ILE 182 334 334 ILE ILE A . n 
A 1 183 THR 183 335 335 THR THR A . n 
A 1 184 VAL 184 336 336 VAL VAL A . n 
A 1 185 GLY 185 337 337 GLY GLY A . n 
A 1 186 ALA 186 338 338 ALA ALA A . n 
A 1 187 THR 187 339 339 THR THR A . n 
A 1 188 ASN 188 340 340 ASN ASN A . n 
A 1 189 ALA 189 341 341 ALA ALA A . n 
A 1 190 GLN 190 342 342 GLN GLN A . n 
A 1 191 ASP 191 343 343 ASP ASP A . n 
A 1 192 GLN 192 344 344 GLN GLN A . n 
A 1 193 PRO 193 345 345 PRO PRO A . n 
A 1 194 VAL 194 346 346 VAL VAL A . n 
A 1 195 THR 195 347 347 THR THR A . n 
A 1 196 LEU 196 348 348 LEU LEU A . n 
A 1 197 GLY 197 349 349 GLY GLY A . n 
A 1 198 THR 198 350 350 THR THR A . n 
A 1 199 LEU 199 351 351 LEU LEU A . n 
A 1 200 GLY 200 352 352 GLY GLY A . n 
A 1 201 THR 201 353 353 THR THR A . n 
A 1 202 ASN 202 354 354 ASN ASN A . n 
A 1 203 PHE 203 355 355 PHE PHE A . n 
A 1 204 GLY 204 356 356 GLY GLY A . n 
A 1 205 ARG 205 357 357 ARG ARG A . n 
A 1 206 CYS 206 358 358 CYS CYS A . n 
A 1 207 VAL 207 359 359 VAL VAL A . n 
A 1 208 ASP 208 360 360 ASP ASP A . n 
A 1 209 LEU 209 361 361 LEU LEU A . n 
A 1 210 PHE 210 362 362 PHE PHE A . n 
A 1 211 ALA 211 363 363 ALA ALA A . n 
A 1 212 PRO 212 364 364 PRO PRO A . n 
A 1 213 GLY 213 365 365 GLY GLY A . n 
A 1 214 GLU 214 366 366 GLU GLU A . n 
A 1 215 ASP 215 367 367 ASP ASP A . n 
A 1 216 ILE 216 368 368 ILE ILE A . n 
A 1 217 ILE 217 369 369 ILE ILE A . n 
A 1 218 GLY 218 370 370 GLY GLY A . n 
A 1 219 ALA 219 371 371 ALA ALA A . n 
A 1 220 SER 220 372 372 SER SER A . n 
A 1 221 SER 221 373 373 SER SER A . n 
A 1 222 HIS 222 374 374 HIS HIS A . n 
A 1 223 CYS 223 375 375 CYS CYS A . n 
A 1 224 SER 224 376 376 SER SER A . n 
A 1 225 THR 225 377 377 THR THR A . n 
A 1 226 CYS 226 378 378 CYS CYS A . n 
A 1 227 PHE 227 379 379 PHE PHE A . n 
A 1 228 VAL 228 380 380 VAL VAL A . n 
A 1 229 SER 229 381 381 SER SER A . n 
A 1 230 GLN 230 382 382 GLN GLN A . n 
A 1 231 SER 231 383 383 SER SER A . n 
A 1 232 GLY 232 384 384 GLY GLY A . n 
A 1 233 THR 233 385 385 THR THR A . n 
A 1 234 SER 234 386 386 SER SER A . n 
A 1 235 GLN 235 387 387 GLN GLN A . n 
A 1 236 ALA 236 388 388 ALA ALA A . n 
A 1 237 ALA 237 389 389 ALA ALA A . n 
A 1 238 ALA 238 390 390 ALA ALA A . n 
A 1 239 HIS 239 391 391 HIS HIS A . n 
A 1 240 VAL 240 392 392 VAL VAL A . n 
A 1 241 ALA 241 393 393 ALA ALA A . n 
A 1 242 GLY 242 394 394 GLY GLY A . n 
A 1 243 ILE 243 395 395 ILE ILE A . n 
A 1 244 ALA 244 396 396 ALA ALA A . n 
A 1 245 ALA 245 397 397 ALA ALA A . n 
A 1 246 MET 246 398 398 MET MET A . n 
A 1 247 MET 247 399 399 MET MET A . n 
A 1 248 LEU 248 400 400 LEU LEU A . n 
A 1 249 SER 249 401 401 SER SER A . n 
A 1 250 ALA 250 402 402 ALA ALA A . n 
A 1 251 GLU 251 403 403 GLU GLU A . n 
A 1 252 PRO 252 404 404 PRO PRO A . n 
A 1 253 GLU 253 405 405 GLU GLU A . n 
A 1 254 LEU 254 406 406 LEU LEU A . n 
A 1 255 THR 255 407 407 THR THR A . n 
A 1 256 LEU 256 408 408 LEU LEU A . n 
A 1 257 ALA 257 409 409 ALA ALA A . n 
A 1 258 GLU 258 410 410 GLU GLU A . n 
A 1 259 LEU 259 411 411 LEU LEU A . n 
A 1 260 ARG 260 412 412 ARG ARG A . n 
A 1 261 GLN 261 413 413 GLN GLN A . n 
A 1 262 ARG 262 414 414 ARG ARG A . n 
A 1 263 LEU 263 415 415 LEU LEU A . n 
A 1 264 ILE 264 416 416 ILE ILE A . n 
A 1 265 HIS 265 417 417 HIS HIS A . n 
A 1 266 PHE 266 418 418 PHE PHE A . n 
A 1 267 SER 267 419 419 SER SER A . n 
A 1 268 ALA 268 420 420 ALA ALA A . n 
A 1 269 LYS 269 421 421 LYS LYS A . n 
A 1 270 ASP 270 422 422 ASP ASP A . n 
A 1 271 VAL 271 423 423 VAL VAL A . n 
A 1 272 ILE 272 424 424 ILE ILE A . n 
A 1 273 ASN 273 425 425 ASN ASN A . n 
A 1 274 GLU 274 426 426 GLU GLU A . n 
A 1 275 ALA 275 427 427 ALA ALA A . n 
A 1 276 TRP 276 428 428 TRP TRP A . n 
A 1 277 PHE 277 429 429 PHE PHE A . n 
A 1 278 PRO 278 430 430 PRO PRO A . n 
A 1 279 GLU 279 431 431 GLU GLU A . n 
A 1 280 ASP 280 432 432 ASP ASP A . n 
A 1 281 GLN 281 433 433 GLN GLN A . n 
A 1 282 ARG 282 434 434 ARG ARG A . n 
A 1 283 VAL 283 435 435 VAL VAL A . n 
A 1 284 LEU 284 436 436 LEU LEU A . n 
A 1 285 THR 285 437 437 THR THR A . n 
A 1 286 PRO 286 438 438 PRO PRO A . n 
A 1 287 ASN 287 439 439 ASN ASN A . n 
A 1 288 LEU 288 440 440 LEU LEU A . n 
A 1 289 VAL 289 441 441 VAL VAL A . n 
A 1 290 ALA 290 442 442 ALA ALA A . n 
A 1 291 ALA 291 443 443 ALA ALA A . n 
A 1 292 LEU 292 444 444 LEU LEU A . n 
A 1 293 PRO 293 445 445 PRO PRO A . n 
A 1 294 PRO 294 446 446 PRO PRO A . n 
A 1 295 SER 295 447 447 SER SER A . n 
A 1 296 THR 296 448 ?   ?   ?   A . n 
A 1 297 HIS 297 449 ?   ?   ?   A . n 
A 1 298 GLY 298 450 ?   ?   ?   A . n 
A 1 299 ALA 299 451 ?   ?   ?   A . n 
A 1 300 ALA 300 452 ?   ?   ?   A . n 
A 1 301 GLY 301 453 ?   ?   ?   A . n 
A 1 302 THR 302 454 ?   ?   ?   A . n 
A 1 303 ALA 303 455 ?   ?   ?   A . n 
A 1 304 ALA 304 456 ?   ?   ?   A . n 
A 1 305 ALA 305 457 ?   ?   ?   A . n 
A 1 306 SER 306 458 ?   ?   ?   A . n 
A 1 307 HIS 307 459 ?   ?   ?   A . n 
A 1 308 HIS 308 460 ?   ?   ?   A . n 
A 1 309 HIS 309 461 ?   ?   ?   A . n 
A 1 310 HIS 310 462 ?   ?   ?   A . n 
A 1 311 HIS 311 463 ?   ?   ?   A . n 
A 1 312 HIS 312 464 ?   ?   ?   A . n 
B 2 1   MET 1   266 ?   ?   ?   E . n 
B 2 2   LYS 2   267 ?   ?   ?   E . n 
B 2 3   HIS 3   268 ?   ?   ?   E . n 
B 2 4   HIS 4   269 ?   ?   ?   E . n 
B 2 5   HIS 5   270 ?   ?   ?   E . n 
B 2 6   HIS 6   271 ?   ?   ?   E . n 
B 2 7   HIS 7   272 ?   ?   ?   E . n 
B 2 8   HIS 8   273 ?   ?   ?   E . n 
B 2 9   PRO 9   274 ?   ?   ?   E . n 
B 2 10  MET 10  275 ?   ?   ?   E . n 
B 2 11  SER 11  276 ?   ?   ?   E . n 
B 2 12  ASP 12  277 ?   ?   ?   E . n 
B 2 13  TYR 13  278 ?   ?   ?   E . n 
B 2 14  ASP 14  279 ?   ?   ?   E . n 
B 2 15  ILE 15  280 ?   ?   ?   E . n 
B 2 16  PRO 16  281 ?   ?   ?   E . n 
B 2 17  THR 17  282 ?   ?   ?   E . n 
B 2 18  THR 18  283 ?   ?   ?   E . n 
B 2 19  GLU 19  284 ?   ?   ?   E . n 
B 2 20  ASN 20  285 ?   ?   ?   E . n 
B 2 21  LEU 21  286 286 LEU LEU E . n 
B 2 22  TYR 22  287 287 TYR TYR E . n 
B 2 23  PHE 23  288 288 PHE PHE E . n 
B 2 24  GLN 24  289 289 GLN GLN E . n 
B 2 25  GLY 25  290 290 GLY GLY E . n 
B 2 26  ALA 26  291 291 ALA ALA E . n 
B 2 27  MET 27  292 292 MET MET E . n 
B 2 28  GLY 28  293 293 GLY GLY E . n 
B 2 29  THR 29  294 294 THR THR E . n 
B 2 30  ASN 30  295 295 ASN ASN E . n 
B 2 31  GLU 31  296 296 GLU GLU E . n 
B 2 32  CYS 32  297 297 CYS CYS E . n 
B 2 33  LEU 33  298 298 LEU LEU E . n 
B 2 34  ASP 34  299 299 ASP ASP E . n 
B 2 35  ASN 35  300 300 ASN ASN E . n 
B 2 36  ASN 36  301 301 ASN ASN E . n 
B 2 37  GLY 37  302 302 GLY GLY E . n 
B 2 38  GLY 38  303 303 GLY GLY E . n 
B 2 39  CYS 39  304 304 CYS CYS E . n 
B 2 40  SER 40  305 305 SER SER E . n 
B 2 41  HIS 41  306 306 HIS HIS E . n 
B 2 42  VAL 42  307 307 VAL VAL E . n 
B 2 43  CYS 43  308 308 CYS CYS E . n 
B 2 44  ASN 44  309 309 ASN ASN E . n 
B 2 45  ASP 45  310 310 ASP ASP E . n 
B 2 46  LEU 46  311 311 LEU LEU E . n 
B 2 47  LYS 47  312 312 LYS LYS E . n 
B 2 48  ILE 48  313 313 ILE ILE E . n 
B 2 49  GLY 49  314 314 GLY GLY E . n 
B 2 50  TYR 50  315 315 TYR TYR E . n 
B 2 51  GLU 51  316 316 GLU GLU E . n 
B 2 52  CYS 52  317 317 CYS CYS E . n 
B 2 53  LEU 53  318 318 LEU LEU E . n 
B 2 54  CYS 54  319 319 CYS CYS E . n 
B 2 55  PRO 55  320 320 PRO PRO E . n 
B 2 56  ASP 56  321 321 ASP ASP E . n 
B 2 57  GLY 57  322 322 GLY GLY E . n 
B 2 58  PHE 58  323 323 PHE PHE E . n 
B 2 59  GLN 59  324 324 GLN GLN E . n 
B 2 60  LEU 60  325 325 LEU LEU E . n 
B 2 61  VAL 61  326 326 VAL VAL E . n 
B 2 62  ALA 62  327 327 ALA ALA E . n 
B 2 63  GLN 63  328 328 GLN GLN E . n 
B 2 64  ARG 64  329 329 ARG ARG E . n 
B 2 65  ARG 65  330 330 ARG ARG E . n 
B 2 66  CYS 66  331 331 CYS CYS E . n 
B 2 67  GLU 67  332 332 GLU GLU E . n 
B 2 68  ASP 68  333 ?   ?   ?   E . n 
B 2 69  ILE 69  334 ?   ?   ?   E . n 
B 2 70  ASP 70  335 ?   ?   ?   E . n 
B 2 71  GLU 71  336 ?   ?   ?   E . n 
B 2 72  CYS 72  337 ?   ?   ?   E . n 
B 2 73  GLN 73  338 ?   ?   ?   E . n 
B 2 74  ASP 74  339 ?   ?   ?   E . n 
B 2 75  PRO 75  340 ?   ?   ?   E . n 
B 2 76  ASP 76  341 ?   ?   ?   E . n 
B 2 77  THR 77  342 ?   ?   ?   E . n 
B 2 78  CYS 78  343 ?   ?   ?   E . n 
B 2 79  SER 79  344 ?   ?   ?   E . n 
B 2 80  GLN 80  345 ?   ?   ?   E . n 
B 2 81  LEU 81  346 ?   ?   ?   E . n 
B 2 82  CYS 82  347 ?   ?   ?   E . n 
B 2 83  VAL 83  348 ?   ?   ?   E . n 
B 2 84  ASN 84  349 ?   ?   ?   E . n 
B 2 85  LEU 85  350 ?   ?   ?   E . n 
B 2 86  GLU 86  351 ?   ?   ?   E . n 
B 2 87  GLY 87  352 ?   ?   ?   E . n 
B 2 88  GLY 88  353 ?   ?   ?   E . n 
B 2 89  TYR 89  354 ?   ?   ?   E . n 
B 2 90  LYS 90  355 ?   ?   ?   E . n 
B 2 91  CYS 91  356 ?   ?   ?   E . n 
B 2 92  GLN 92  357 ?   ?   ?   E . n 
B 2 93  CYS 93  358 ?   ?   ?   E . n 
B 2 94  GLU 94  359 ?   ?   ?   E . n 
B 2 95  GLU 95  360 ?   ?   ?   E . n 
B 2 96  GLY 96  361 ?   ?   ?   E . n 
B 2 97  PHE 97  362 ?   ?   ?   E . n 
B 2 98  GLN 98  363 ?   ?   ?   E . n 
B 2 99  LEU 99  364 ?   ?   ?   E . n 
B 2 100 ASP 100 365 ?   ?   ?   E . n 
B 2 101 PRO 101 366 ?   ?   ?   E . n 
B 2 102 HIS 102 367 ?   ?   ?   E . n 
B 2 103 THR 103 368 ?   ?   ?   E . n 
B 2 104 LYS 104 369 ?   ?   ?   E . n 
B 2 105 ALA 105 370 ?   ?   ?   E . n 
B 2 106 CYS 106 371 ?   ?   ?   E . n 
B 2 107 LYS 107 372 ?   ?   ?   E . n 
C 3 1   MET 1   39  ?   ?   ?   P . n 
C 3 2   LYS 2   40  ?   ?   ?   P . n 
C 3 3   GLY 3   41  ?   ?   ?   P . n 
C 3 4   SER 4   42  ?   ?   ?   P . n 
C 3 5   LYS 5   43  ?   ?   ?   P . n 
C 3 6   GLY 6   44  ?   ?   ?   P . n 
C 3 7   SER 7   45  ?   ?   ?   P . n 
C 3 8   LYS 8   46  ?   ?   ?   P . n 
C 3 9   GLY 9   47  ?   ?   ?   P . n 
C 3 10  SER 10  48  ?   ?   ?   P . n 
C 3 11  LYS 11  49  ?   ?   ?   P . n 
C 3 12  PRO 12  50  ?   ?   ?   P . n 
C 3 13  MET 13  51  ?   ?   ?   P . n 
C 3 14  SER 14  52  ?   ?   ?   P . n 
C 3 15  ALA 15  53  ?   ?   ?   P . n 
C 3 16  GLU 16  54  ?   ?   ?   P . n 
C 3 17  ALA 17  55  ?   ?   ?   P . n 
C 3 18  PRO 18  56  ?   ?   ?   P . n 
C 3 19  GLU 19  57  ?   ?   ?   P . n 
C 3 20  HIS 20  58  ?   ?   ?   P . n 
C 3 21  GLY 21  59  ?   ?   ?   P . n 
C 3 22  THR 22  60  ?   ?   ?   P . n 
C 3 23  THR 23  61  61  THR THR P . n 
C 3 24  ALA 24  62  62  ALA ALA P . n 
C 3 25  THR 25  63  63  THR THR P . n 
C 3 26  PHE 26  64  64  PHE PHE P . n 
C 3 27  HIS 27  65  65  HIS HIS P . n 
C 3 28  ARG 28  66  66  ARG ARG P . n 
C 3 29  CYS 29  67  67  CYS CYS P . n 
C 3 30  ALA 30  68  68  ALA ALA P . n 
C 3 31  LYS 31  69  69  LYS LYS P . n 
C 3 32  ASP 32  70  70  ASP ASP P . n 
C 3 33  PRO 33  71  71  PRO PRO P . n 
C 3 34  TRP 34  72  72  TRP TRP P . n 
C 3 35  ARG 35  73  73  ARG ARG P . n 
C 3 36  LEU 36  74  74  LEU LEU P . n 
C 3 37  PRO 37  75  75  PRO PRO P . n 
C 3 38  GLY 38  76  76  GLY GLY P . n 
C 3 39  THR 39  77  77  THR THR P . n 
C 3 40  TYR 40  78  78  TYR TYR P . n 
C 3 41  VAL 41  79  79  VAL VAL P . n 
C 3 42  VAL 42  80  80  VAL VAL P . n 
C 3 43  VAL 43  81  81  VAL VAL P . n 
C 3 44  LEU 44  82  82  LEU LEU P . n 
C 3 45  LYS 45  83  83  LYS LYS P . n 
C 3 46  GLU 46  84  84  GLU GLU P . n 
C 3 47  GLU 47  85  85  GLU GLU P . n 
C 3 48  THR 48  86  86  THR THR P . n 
C 3 49  HIS 49  87  87  HIS HIS P . n 
C 3 50  LEU 50  88  88  LEU LEU P . n 
C 3 51  SER 51  89  89  SER SER P . n 
C 3 52  GLN 52  90  90  GLN GLN P . n 
C 3 53  SER 53  91  91  SER SER P . n 
C 3 54  GLU 54  92  92  GLU GLU P . n 
C 3 55  ARG 55  93  93  ARG ARG P . n 
C 3 56  THR 56  94  94  THR THR P . n 
C 3 57  ALA 57  95  95  ALA ALA P . n 
C 3 58  ARG 58  96  96  ARG ARG P . n 
C 3 59  ARG 59  97  97  ARG ARG P . n 
C 3 60  LEU 60  98  98  LEU LEU P . n 
C 3 61  GLN 61  99  99  GLN GLN P . n 
C 3 62  ALA 62  100 100 ALA ALA P . n 
C 3 63  GLN 63  101 101 GLN GLN P . n 
C 3 64  ALA 64  102 102 ALA ALA P . n 
C 3 65  ALA 65  103 103 ALA ALA P . n 
C 3 66  ARG 66  104 104 ARG ARG P . n 
C 3 67  ARG 67  105 105 ARG ARG P . n 
C 3 68  GLY 68  106 106 GLY GLY P . n 
C 3 69  TYR 69  107 107 TYR TYR P . n 
C 3 70  LEU 70  108 108 LEU LEU P . n 
C 3 71  THR 71  109 109 THR THR P . n 
C 3 72  LYS 72  110 110 LYS LYS P . n 
C 3 73  ILE 73  111 111 ILE ILE P . n 
C 3 74  LEU 74  112 112 LEU LEU P . n 
C 3 75  HIS 75  113 113 HIS HIS P . n 
C 3 76  VAL 76  114 114 VAL VAL P . n 
C 3 77  PHE 77  115 115 PHE PHE P . n 
C 3 78  HIS 78  116 116 HIS HIS P . n 
C 3 79  GLY 79  117 117 GLY GLY P . n 
C 3 80  LEU 80  118 118 LEU LEU P . n 
C 3 81  LEU 81  119 119 LEU LEU P . n 
C 3 82  PRO 82  120 120 PRO PRO P . n 
C 3 83  GLY 83  121 121 GLY GLY P . n 
C 3 84  PHE 84  122 122 PHE PHE P . n 
C 3 85  LEU 85  123 123 LEU LEU P . n 
C 3 86  VAL 86  124 124 VAL VAL P . n 
C 3 87  LYS 87  125 125 LYS LYS P . n 
C 3 88  MET 88  126 126 MET MET P . n 
C 3 89  SER 89  127 127 SER SER P . n 
C 3 90  GLY 90  128 128 GLY GLY P . n 
C 3 91  ASP 91  129 129 ASP ASP P . n 
C 3 92  LEU 92  130 130 LEU LEU P . n 
C 3 93  LEU 93  131 131 LEU LEU P . n 
C 3 94  GLU 94  132 132 GLU GLU P . n 
C 3 95  LEU 95  133 133 LEU LEU P . n 
C 3 96  ALA 96  134 134 ALA ALA P . n 
C 3 97  LEU 97  135 135 LEU LEU P . n 
C 3 98  LYS 98  136 136 LYS LYS P . n 
C 3 99  LEU 99  137 137 LEU LEU P . n 
C 3 100 PRO 100 138 138 PRO PRO P . n 
C 3 101 HIS 101 139 139 HIS HIS P . n 
C 3 102 VAL 102 140 140 VAL VAL P . n 
C 3 103 ASP 103 141 141 ASP ASP P . n 
C 3 104 TYR 104 142 142 TYR TYR P . n 
C 3 105 ILE 105 143 143 ILE ILE P . n 
C 3 106 GLU 106 144 144 GLU GLU P . n 
C 3 107 GLU 107 145 145 GLU GLU P . n 
C 3 108 ASP 108 146 146 ASP ASP P . n 
C 3 109 SER 109 147 147 SER SER P . n 
C 3 110 SER 110 148 148 SER SER P . n 
C 3 111 VAL 111 149 149 VAL VAL P . n 
C 3 112 PHE 112 150 150 PHE PHE P . n 
C 3 113 ALA 113 151 151 ALA ALA P . n 
C 3 114 GLN 114 152 152 GLN GLN P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 CA  1   1448 1448 CA  CA  A . 
E 4 CA  1   1333 1333 CA  CA  E . 
F 5 HOH 1   2001 2001 HOH HOH A . 
F 5 HOH 2   2002 2002 HOH HOH A . 
F 5 HOH 3   2003 2003 HOH HOH A . 
F 5 HOH 4   2004 2004 HOH HOH A . 
F 5 HOH 5   2005 2005 HOH HOH A . 
F 5 HOH 6   2006 2006 HOH HOH A . 
F 5 HOH 7   2007 2007 HOH HOH A . 
F 5 HOH 8   2008 2008 HOH HOH A . 
F 5 HOH 9   2009 2009 HOH HOH A . 
F 5 HOH 10  2010 2010 HOH HOH A . 
F 5 HOH 11  2011 2011 HOH HOH A . 
F 5 HOH 12  2012 2012 HOH HOH A . 
F 5 HOH 13  2013 2013 HOH HOH A . 
F 5 HOH 14  2014 2014 HOH HOH A . 
F 5 HOH 15  2015 2015 HOH HOH A . 
F 5 HOH 16  2016 2016 HOH HOH A . 
F 5 HOH 17  2017 2017 HOH HOH A . 
F 5 HOH 18  2018 2018 HOH HOH A . 
F 5 HOH 19  2019 2019 HOH HOH A . 
F 5 HOH 20  2020 2020 HOH HOH A . 
F 5 HOH 21  2021 2021 HOH HOH A . 
F 5 HOH 22  2022 2022 HOH HOH A . 
F 5 HOH 23  2023 2023 HOH HOH A . 
F 5 HOH 24  2024 2024 HOH HOH A . 
F 5 HOH 25  2025 2025 HOH HOH A . 
F 5 HOH 26  2026 2026 HOH HOH A . 
F 5 HOH 27  2027 2027 HOH HOH A . 
F 5 HOH 28  2028 2028 HOH HOH A . 
F 5 HOH 29  2029 2029 HOH HOH A . 
F 5 HOH 30  2030 2030 HOH HOH A . 
F 5 HOH 31  2031 2031 HOH HOH A . 
F 5 HOH 32  2032 2032 HOH HOH A . 
F 5 HOH 33  2033 2033 HOH HOH A . 
F 5 HOH 34  2034 2034 HOH HOH A . 
F 5 HOH 35  2035 2035 HOH HOH A . 
F 5 HOH 36  2036 2036 HOH HOH A . 
F 5 HOH 37  2037 2037 HOH HOH A . 
F 5 HOH 38  2038 2038 HOH HOH A . 
F 5 HOH 39  2039 2039 HOH HOH A . 
F 5 HOH 40  2040 2040 HOH HOH A . 
F 5 HOH 41  2041 2041 HOH HOH A . 
F 5 HOH 42  2042 2042 HOH HOH A . 
F 5 HOH 43  2043 2043 HOH HOH A . 
F 5 HOH 44  2044 2044 HOH HOH A . 
F 5 HOH 45  2045 2045 HOH HOH A . 
F 5 HOH 46  2046 2046 HOH HOH A . 
F 5 HOH 47  2047 2047 HOH HOH A . 
F 5 HOH 48  2048 2048 HOH HOH A . 
F 5 HOH 49  2049 2049 HOH HOH A . 
F 5 HOH 50  2050 2050 HOH HOH A . 
F 5 HOH 51  2051 2051 HOH HOH A . 
F 5 HOH 52  2052 2052 HOH HOH A . 
F 5 HOH 53  2053 2053 HOH HOH A . 
F 5 HOH 54  2054 2054 HOH HOH A . 
F 5 HOH 55  2055 2055 HOH HOH A . 
F 5 HOH 56  2056 2056 HOH HOH A . 
F 5 HOH 57  2057 2057 HOH HOH A . 
F 5 HOH 58  2058 2058 HOH HOH A . 
F 5 HOH 59  2059 2059 HOH HOH A . 
F 5 HOH 60  2060 2060 HOH HOH A . 
F 5 HOH 61  2061 2061 HOH HOH A . 
F 5 HOH 62  2062 2062 HOH HOH A . 
F 5 HOH 63  2063 2063 HOH HOH A . 
F 5 HOH 64  2064 2064 HOH HOH A . 
F 5 HOH 65  2065 2065 HOH HOH A . 
F 5 HOH 66  2066 2066 HOH HOH A . 
F 5 HOH 67  2067 2067 HOH HOH A . 
F 5 HOH 68  2068 2068 HOH HOH A . 
F 5 HOH 69  2069 2069 HOH HOH A . 
F 5 HOH 70  2070 2070 HOH HOH A . 
F 5 HOH 71  2071 2071 HOH HOH A . 
F 5 HOH 72  2072 2072 HOH HOH A . 
F 5 HOH 73  2073 2073 HOH HOH A . 
F 5 HOH 74  2074 2074 HOH HOH A . 
F 5 HOH 75  2075 2075 HOH HOH A . 
F 5 HOH 76  2076 2076 HOH HOH A . 
F 5 HOH 77  2077 2077 HOH HOH A . 
F 5 HOH 78  2078 2078 HOH HOH A . 
F 5 HOH 79  2079 2079 HOH HOH A . 
F 5 HOH 80  2080 2080 HOH HOH A . 
F 5 HOH 81  2081 2081 HOH HOH A . 
F 5 HOH 82  2082 2082 HOH HOH A . 
F 5 HOH 83  2083 2083 HOH HOH A . 
F 5 HOH 84  2084 2084 HOH HOH A . 
F 5 HOH 85  2085 2085 HOH HOH A . 
F 5 HOH 86  2086 2086 HOH HOH A . 
F 5 HOH 87  2087 2087 HOH HOH A . 
F 5 HOH 88  2088 2088 HOH HOH A . 
F 5 HOH 89  2089 2089 HOH HOH A . 
F 5 HOH 90  2090 2090 HOH HOH A . 
F 5 HOH 91  2091 2091 HOH HOH A . 
F 5 HOH 92  2092 2092 HOH HOH A . 
F 5 HOH 93  2093 2093 HOH HOH A . 
F 5 HOH 94  2094 2094 HOH HOH A . 
F 5 HOH 95  2095 2095 HOH HOH A . 
F 5 HOH 96  2096 2096 HOH HOH A . 
F 5 HOH 97  2097 2097 HOH HOH A . 
F 5 HOH 98  2098 2098 HOH HOH A . 
F 5 HOH 99  2099 2099 HOH HOH A . 
F 5 HOH 100 2100 2100 HOH HOH A . 
F 5 HOH 101 2101 2101 HOH HOH A . 
F 5 HOH 102 2102 2102 HOH HOH A . 
F 5 HOH 103 2103 2103 HOH HOH A . 
F 5 HOH 104 2104 2104 HOH HOH A . 
F 5 HOH 105 2105 2105 HOH HOH A . 
F 5 HOH 106 2106 2106 HOH HOH A . 
F 5 HOH 107 2107 2107 HOH HOH A . 
F 5 HOH 108 2108 2108 HOH HOH A . 
F 5 HOH 109 2109 2109 HOH HOH A . 
F 5 HOH 110 2110 2110 HOH HOH A . 
F 5 HOH 111 2111 2111 HOH HOH A . 
F 5 HOH 112 2112 2112 HOH HOH A . 
F 5 HOH 113 2113 2113 HOH HOH A . 
F 5 HOH 114 2114 2114 HOH HOH A . 
F 5 HOH 115 2115 2115 HOH HOH A . 
F 5 HOH 116 2116 2116 HOH HOH A . 
F 5 HOH 117 2117 2117 HOH HOH A . 
G 5 HOH 1   2001 2001 HOH HOH E . 
G 5 HOH 2   2002 2002 HOH HOH E . 
G 5 HOH 3   2003 2003 HOH HOH E . 
G 5 HOH 4   2004 2004 HOH HOH E . 
G 5 HOH 5   2005 2005 HOH HOH E . 
G 5 HOH 6   2006 2006 HOH HOH E . 
G 5 HOH 7   2007 2007 HOH HOH E . 
G 5 HOH 8   2008 2008 HOH HOH E . 
G 5 HOH 9   2009 2009 HOH HOH E . 
G 5 HOH 10  2010 2010 HOH HOH E . 
G 5 HOH 11  2011 2011 HOH HOH E . 
G 5 HOH 12  2012 2012 HOH HOH E . 
G 5 HOH 13  2013 2013 HOH HOH E . 
G 5 HOH 14  2014 2014 HOH HOH E . 
G 5 HOH 15  2015 2015 HOH HOH E . 
G 5 HOH 16  2016 2016 HOH HOH E . 
G 5 HOH 17  2017 2017 HOH HOH E . 
G 5 HOH 18  2018 2018 HOH HOH E . 
G 5 HOH 19  2019 2019 HOH HOH E . 
G 5 HOH 20  2020 2020 HOH HOH E . 
G 5 HOH 21  2021 2021 HOH HOH E . 
G 5 HOH 22  2022 2022 HOH HOH E . 
G 5 HOH 23  2023 2023 HOH HOH E . 
G 5 HOH 24  2024 2024 HOH HOH E . 
G 5 HOH 25  2025 2025 HOH HOH E . 
G 5 HOH 26  2026 2026 HOH HOH E . 
G 5 HOH 27  2027 2027 HOH HOH E . 
G 5 HOH 28  2028 2028 HOH HOH E . 
G 5 HOH 29  2029 2029 HOH HOH E . 
G 5 HOH 30  2030 2030 HOH HOH E . 
G 5 HOH 31  2031 2031 HOH HOH E . 
G 5 HOH 32  2032 2032 HOH HOH E . 
G 5 HOH 33  2033 2033 HOH HOH E . 
H 5 HOH 1   2001 2001 HOH HOH P . 
H 5 HOH 2   2002 2002 HOH HOH P . 
H 5 HOH 3   2003 2003 HOH HOH P . 
H 5 HOH 4   2004 2004 HOH HOH P . 
H 5 HOH 5   2005 2005 HOH HOH P . 
H 5 HOH 6   2006 2006 HOH HOH P . 
H 5 HOH 7   2007 2007 HOH HOH P . 
H 5 HOH 8   2008 2008 HOH HOH P . 
H 5 HOH 9   2009 2009 HOH HOH P . 
H 5 HOH 10  2010 2010 HOH HOH P . 
H 5 HOH 11  2011 2011 HOH HOH P . 
H 5 HOH 12  2012 2012 HOH HOH P . 
H 5 HOH 13  2013 2013 HOH HOH P . 
H 5 HOH 14  2014 2014 HOH HOH P . 
H 5 HOH 15  2015 2015 HOH HOH P . 
H 5 HOH 16  2016 2016 HOH HOH P . 
H 5 HOH 17  2017 2017 HOH HOH P . 
H 5 HOH 18  2018 2018 HOH HOH P . 
H 5 HOH 19  2019 2019 HOH HOH P . 
H 5 HOH 20  2020 2020 HOH HOH P . 
H 5 HOH 21  2021 2021 HOH HOH P . 
H 5 HOH 22  2022 2022 HOH HOH P . 
H 5 HOH 23  2023 2023 HOH HOH P . 
H 5 HOH 24  2024 2024 HOH HOH P . 
H 5 HOH 25  2025 2025 HOH HOH P . 
H 5 HOH 26  2026 2026 HOH HOH P . 
H 5 HOH 27  2027 2027 HOH HOH P . 
H 5 HOH 28  2028 2028 HOH HOH P . 
H 5 HOH 29  2029 2029 HOH HOH P . 
H 5 HOH 30  2030 2030 HOH HOH P . 
H 5 HOH 31  2031 2031 HOH HOH P . 
H 5 HOH 32  2032 2032 HOH HOH P . 
H 5 HOH 33  2033 2033 HOH HOH P . 
H 5 HOH 34  2034 2034 HOH HOH P . 
H 5 HOH 35  2035 2035 HOH HOH P . 
H 5 HOH 36  2036 2036 HOH HOH P . 
H 5 HOH 37  2037 2037 HOH HOH P . 
H 5 HOH 38  2038 2038 HOH HOH P . 
H 5 HOH 39  2039 2039 HOH HOH P . 
H 5 HOH 40  2040 2040 HOH HOH P . 
H 5 HOH 41  2041 2041 HOH HOH P . 
H 5 HOH 42  2042 2042 HOH HOH P . 
H 5 HOH 43  2043 2043 HOH HOH P . 
H 5 HOH 44  2044 2044 HOH HOH P . 
H 5 HOH 45  2045 2045 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4140  ? 
1 MORE         -27.1 ? 
1 'SSA (A^2)'  22100 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A ALA 178 ? A ALA 330  ? 1_555 CA ? D CA . ? A CA 1448 ? 1_555 OG1 ? A THR 183 ? A THR 335  ? 1_555 101.1 ? 
2  O   ? A ALA 178 ? A ALA 330  ? 1_555 CA ? D CA . ? A CA 1448 ? 1_555 OD2 ? A ASP 208 ? A ASP 360  ? 1_555 143.2 ? 
3  OG1 ? A THR 183 ? A THR 335  ? 1_555 CA ? D CA . ? A CA 1448 ? 1_555 OD2 ? A ASP 208 ? A ASP 360  ? 1_555 77.1  ? 
4  O   ? A ALA 178 ? A ALA 330  ? 1_555 CA ? D CA . ? A CA 1448 ? 1_555 O   ? A VAL 181 ? A VAL 333  ? 1_555 76.5  ? 
5  OG1 ? A THR 183 ? A THR 335  ? 1_555 CA ? D CA . ? A CA 1448 ? 1_555 O   ? A VAL 181 ? A VAL 333  ? 1_555 79.9  ? 
6  OD2 ? A ASP 208 ? A ASP 360  ? 1_555 CA ? D CA . ? A CA 1448 ? 1_555 O   ? A VAL 181 ? A VAL 333  ? 1_555 67.0  ? 
7  O   ? B LEU 46  ? E LEU 311  ? 1_555 CA ? E CA . ? E CA 1333 ? 1_555 OE1 ? B GLU 31  ? E GLU 296  ? 1_555 147.7 ? 
8  O   ? B LEU 46  ? E LEU 311  ? 1_555 CA ? E CA . ? E CA 1333 ? 1_555 O   ? B GLY 49  ? E GLY 314  ? 1_555 75.9  ? 
9  OE1 ? B GLU 31  ? E GLU 296  ? 1_555 CA ? E CA . ? E CA 1333 ? 1_555 O   ? B GLY 49  ? E GLY 314  ? 1_555 77.3  ? 
10 O   ? B LEU 46  ? E LEU 311  ? 1_555 CA ? E CA . ? E CA 1333 ? 1_555 O   ? B THR 29  ? E THR 294  ? 1_555 131.7 ? 
11 OE1 ? B GLU 31  ? E GLU 296  ? 1_555 CA ? E CA . ? E CA 1333 ? 1_555 O   ? B THR 29  ? E THR 294  ? 1_555 73.9  ? 
12 O   ? B GLY 49  ? E GLY 314  ? 1_555 CA ? E CA . ? E CA 1333 ? 1_555 O   ? B THR 29  ? E THR 294  ? 1_555 151.1 ? 
13 O   ? B LEU 46  ? E LEU 311  ? 1_555 CA ? E CA . ? E CA 1333 ? 1_555 O   ? G HOH .   ? E HOH 2010 ? 1_555 116.2 ? 
14 OE1 ? B GLU 31  ? E GLU 296  ? 1_555 CA ? E CA . ? E CA 1333 ? 1_555 O   ? G HOH .   ? E HOH 2010 ? 1_555 82.3  ? 
15 O   ? B GLY 49  ? E GLY 314  ? 1_555 CA ? E CA . ? E CA 1333 ? 1_555 O   ? G HOH .   ? E HOH 2010 ? 1_555 92.4  ? 
16 O   ? B THR 29  ? E THR 294  ? 1_555 CA ? E CA . ? E CA 1333 ? 1_555 O   ? G HOH .   ? E HOH 2010 ? 1_555 82.6  ? 
17 O   ? B LEU 46  ? E LEU 311  ? 1_555 CA ? E CA . ? E CA 1333 ? 1_555 O   ? G HOH .   ? E HOH 2007 ? 1_555 66.3  ? 
18 OE1 ? B GLU 31  ? E GLU 296  ? 1_555 CA ? E CA . ? E CA 1333 ? 1_555 O   ? G HOH .   ? E HOH 2007 ? 1_555 138.5 ? 
19 O   ? B GLY 49  ? E GLY 314  ? 1_555 CA ? E CA . ? E CA 1333 ? 1_555 O   ? G HOH .   ? E HOH 2007 ? 1_555 142.2 ? 
20 O   ? B THR 29  ? E THR 294  ? 1_555 CA ? E CA . ? E CA 1333 ? 1_555 O   ? G HOH .   ? E HOH 2007 ? 1_555 66.2  ? 
21 O   ? G HOH .   ? E HOH 2010 ? 1_555 CA ? E CA . ? E CA 1333 ? 1_555 O   ? G HOH .   ? E HOH 2007 ? 1_555 102.9 ? 
22 O   ? B LEU 46  ? E LEU 311  ? 1_555 CA ? E CA . ? E CA 1333 ? 1_555 OD2 ? B ASP 45  ? E ASP 310  ? 1_555 85.0  ? 
23 OE1 ? B GLU 31  ? E GLU 296  ? 1_555 CA ? E CA . ? E CA 1333 ? 1_555 OD2 ? B ASP 45  ? E ASP 310  ? 1_555 80.6  ? 
24 O   ? B GLY 49  ? E GLY 314  ? 1_555 CA ? E CA . ? E CA 1333 ? 1_555 OD2 ? B ASP 45  ? E ASP 310  ? 1_555 96.5  ? 
25 O   ? B THR 29  ? E THR 294  ? 1_555 CA ? E CA . ? E CA 1333 ? 1_555 OD2 ? B ASP 45  ? E ASP 310  ? 1_555 80.2  ? 
26 O   ? G HOH .   ? E HOH 2010 ? 1_555 CA ? E CA . ? E CA 1333 ? 1_555 OD2 ? B ASP 45  ? E ASP 310  ? 1_555 158.5 ? 
27 O   ? G HOH .   ? E HOH 2007 ? 1_555 CA ? E CA . ? E CA 1333 ? 1_555 OD2 ? B ASP 45  ? E ASP 310  ? 1_555 81.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-11-18 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -17.5340 -4.8119  29.7306 0.0120  0.1705 0.0026 -0.0392 -0.0155 0.0276 1.0865 0.9599 2.0706 0.0081 
-0.4229 -0.5206 0.0845 -0.1333 -0.0763 0.0915 -0.1030 -0.0444 -0.3855 0.0865 0.0185 
'X-RAY DIFFRACTION' 2 ? refined -2.2835  -17.6688 9.5314  -0.0884 0.1789 0.0852 0.0042  -0.0278 0.0469 1.6947 1.9088 3.7452 
-1.1428 -1.5496 1.0470  0.0701 0.0526  -0.2411 0.0181 -0.1103 0.0766  -0.0809 0.0759 0.0402 
'X-RAY DIFFRACTION' 3 ? refined -32.4374 -16.0863 52.1126 0.0105  0.2078 0.0296 -0.0584 0.0223  0.0277 0.7216 0.6658 3.8875 0.0188 
-0.7481 -0.7061 0.1288 0.0023  0.0033  0.1669 -0.1406 0.0284  -0.3461 0.2414 0.0117 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 153 ? ? A 447 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 E 285 ? ? E 332 ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 P 60  ? ? P 152 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0019 ? 1 
MOSFLM 'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
PHASER phasing          .        ? 4 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;
SHEET
THE SHEET STRUCTURE OF THIS MOLECULE IS BIFURCATED. IN
ORDER TO REPRESENT THIS FEATURE IN THE SHEET RECORDS BELOW,
TWO SHEETS ARE DEFINED.
;
# 
_pdbx_entry_details.entry_id             2W2Q 
_pdbx_entry_details.compound_details     'ENGINEERED RESIDUE IN CHAIN A, ASP 374 TO HIS' 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;HUMAN PCSK9 PRODOMAIN. THE FIRST 14 RESIDUES IN THE
SEQUENCE ARE A RESULT OF THE CLONING PROCEDURE. THE 15TH
RESIDUE CORRESPONDS TO ALA53 OF WT PCSK9
HUMAN LDLR EGF-AB DOMAINS. THE FIRST 27 RESIDUES IN THE
SEQUENCE ARE A 6HIS TAG AND A LINKER FROM THE CLONING
PROCEDURE. THE 28TH RESIDUE CORRESPONDS TO GLY293 OF WT
LDLR
HUMAN PCSK9 CATALYTIC DOMAIN. THE LAST 13 RESIDUES ARE A
LINKER AND A 6HIS TAG, RESULTING FROM THE CLONING
PROCEDURE. THE FIRST RESIDUE CORRESPONDS TO SER153 OF WT
PCSK9.
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 186 ? ? -159.33 -154.09 
2  1 ALA A 242 ? ? -110.21 72.21   
3  1 ALA A 245 ? ? -21.26  127.13  
4  1 ASN A 254 ? ? -75.73  -168.55 
5  1 GLN A 278 ? ? -114.61 76.93   
6  1 VAL A 280 ? ? -102.49 -112.08 
7  1 LEU A 287 ? ? -119.94 79.23   
8  1 ASN A 317 ? ? -108.16 44.04   
9  1 LEU A 351 ? ? -122.05 -138.22 
10 1 PHE E 288 ? ? -104.10 -77.49  
11 1 ALA E 291 ? ? 156.07  -90.93  
12 1 MET E 292 ? ? 125.48  120.64  
13 1 HIS E 306 ? ? -128.97 -93.40  
14 1 HIS P 139 ? ? 75.40   -10.03  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ARG 165 ? CG  ? A ARG 13 CG  
2 1 Y 1 A ARG 165 ? CD  ? A ARG 13 CD  
3 1 Y 1 A ARG 165 ? NE  ? A ARG 13 NE  
4 1 Y 1 A ARG 165 ? CZ  ? A ARG 13 CZ  
5 1 Y 1 A ARG 165 ? NH1 ? A ARG 13 NH1 
6 1 Y 1 A ARG 165 ? NH2 ? A ARG 13 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A TYR 166 ? A TYR 14  
2   1 Y 1 A ARG 167 ? A ARG 15  
3   1 Y 1 A ALA 168 ? A ALA 16  
4   1 Y 1 A ASP 169 ? A ASP 17  
5   1 Y 1 A GLU 170 ? A GLU 18  
6   1 Y 1 A TYR 171 ? A TYR 19  
7   1 Y 1 A GLN 172 ? A GLN 20  
8   1 Y 1 A PRO 173 ? A PRO 21  
9   1 Y 1 A PRO 174 ? A PRO 22  
10  1 Y 1 A ASP 175 ? A ASP 23  
11  1 Y 1 A GLY 176 ? A GLY 24  
12  1 Y 1 A GLY 177 ? A GLY 25  
13  1 Y 1 A GLY 213 ? A GLY 61  
14  1 Y 1 A THR 214 ? A THR 62  
15  1 Y 1 A ARG 215 ? A ARG 63  
16  1 Y 1 A PHE 216 ? A PHE 64  
17  1 Y 1 A HIS 217 ? A HIS 65  
18  1 Y 1 A ARG 218 ? A ARG 66  
19  1 Y 1 A GLN 219 ? A GLN 67  
20  1 Y 1 A ALA 220 ? A ALA 68  
21  1 Y 1 A THR 448 ? A THR 296 
22  1 Y 1 A HIS 449 ? A HIS 297 
23  1 Y 1 A GLY 450 ? A GLY 298 
24  1 Y 1 A ALA 451 ? A ALA 299 
25  1 Y 1 A ALA 452 ? A ALA 300 
26  1 Y 1 A GLY 453 ? A GLY 301 
27  1 Y 1 A THR 454 ? A THR 302 
28  1 Y 1 A ALA 455 ? A ALA 303 
29  1 Y 1 A ALA 456 ? A ALA 304 
30  1 Y 1 A ALA 457 ? A ALA 305 
31  1 Y 1 A SER 458 ? A SER 306 
32  1 Y 1 A HIS 459 ? A HIS 307 
33  1 Y 1 A HIS 460 ? A HIS 308 
34  1 Y 1 A HIS 461 ? A HIS 309 
35  1 Y 1 A HIS 462 ? A HIS 310 
36  1 Y 1 A HIS 463 ? A HIS 311 
37  1 Y 1 A HIS 464 ? A HIS 312 
38  1 Y 1 E MET 266 ? B MET 1   
39  1 Y 1 E LYS 267 ? B LYS 2   
40  1 Y 1 E HIS 268 ? B HIS 3   
41  1 Y 1 E HIS 269 ? B HIS 4   
42  1 Y 1 E HIS 270 ? B HIS 5   
43  1 Y 1 E HIS 271 ? B HIS 6   
44  1 Y 1 E HIS 272 ? B HIS 7   
45  1 Y 1 E HIS 273 ? B HIS 8   
46  1 Y 1 E PRO 274 ? B PRO 9   
47  1 Y 1 E MET 275 ? B MET 10  
48  1 Y 1 E SER 276 ? B SER 11  
49  1 Y 1 E ASP 277 ? B ASP 12  
50  1 Y 1 E TYR 278 ? B TYR 13  
51  1 Y 1 E ASP 279 ? B ASP 14  
52  1 Y 1 E ILE 280 ? B ILE 15  
53  1 Y 1 E PRO 281 ? B PRO 16  
54  1 Y 1 E THR 282 ? B THR 17  
55  1 Y 1 E THR 283 ? B THR 18  
56  1 Y 1 E GLU 284 ? B GLU 19  
57  1 Y 1 E ASN 285 ? B ASN 20  
58  1 Y 1 E ASP 333 ? B ASP 68  
59  1 Y 1 E ILE 334 ? B ILE 69  
60  1 Y 1 E ASP 335 ? B ASP 70  
61  1 Y 1 E GLU 336 ? B GLU 71  
62  1 Y 1 E CYS 337 ? B CYS 72  
63  1 Y 1 E GLN 338 ? B GLN 73  
64  1 Y 1 E ASP 339 ? B ASP 74  
65  1 Y 1 E PRO 340 ? B PRO 75  
66  1 Y 1 E ASP 341 ? B ASP 76  
67  1 Y 1 E THR 342 ? B THR 77  
68  1 Y 1 E CYS 343 ? B CYS 78  
69  1 Y 1 E SER 344 ? B SER 79  
70  1 Y 1 E GLN 345 ? B GLN 80  
71  1 Y 1 E LEU 346 ? B LEU 81  
72  1 Y 1 E CYS 347 ? B CYS 82  
73  1 Y 1 E VAL 348 ? B VAL 83  
74  1 Y 1 E ASN 349 ? B ASN 84  
75  1 Y 1 E LEU 350 ? B LEU 85  
76  1 Y 1 E GLU 351 ? B GLU 86  
77  1 Y 1 E GLY 352 ? B GLY 87  
78  1 Y 1 E GLY 353 ? B GLY 88  
79  1 Y 1 E TYR 354 ? B TYR 89  
80  1 Y 1 E LYS 355 ? B LYS 90  
81  1 Y 1 E CYS 356 ? B CYS 91  
82  1 Y 1 E GLN 357 ? B GLN 92  
83  1 Y 1 E CYS 358 ? B CYS 93  
84  1 Y 1 E GLU 359 ? B GLU 94  
85  1 Y 1 E GLU 360 ? B GLU 95  
86  1 Y 1 E GLY 361 ? B GLY 96  
87  1 Y 1 E PHE 362 ? B PHE 97  
88  1 Y 1 E GLN 363 ? B GLN 98  
89  1 Y 1 E LEU 364 ? B LEU 99  
90  1 Y 1 E ASP 365 ? B ASP 100 
91  1 Y 1 E PRO 366 ? B PRO 101 
92  1 Y 1 E HIS 367 ? B HIS 102 
93  1 Y 1 E THR 368 ? B THR 103 
94  1 Y 1 E LYS 369 ? B LYS 104 
95  1 Y 1 E ALA 370 ? B ALA 105 
96  1 Y 1 E CYS 371 ? B CYS 106 
97  1 Y 1 E LYS 372 ? B LYS 107 
98  1 Y 1 P MET 39  ? C MET 1   
99  1 Y 1 P LYS 40  ? C LYS 2   
100 1 Y 1 P GLY 41  ? C GLY 3   
101 1 Y 1 P SER 42  ? C SER 4   
102 1 Y 1 P LYS 43  ? C LYS 5   
103 1 Y 1 P GLY 44  ? C GLY 6   
104 1 Y 1 P SER 45  ? C SER 7   
105 1 Y 1 P LYS 46  ? C LYS 8   
106 1 Y 1 P GLY 47  ? C GLY 9   
107 1 Y 1 P SER 48  ? C SER 10  
108 1 Y 1 P LYS 49  ? C LYS 11  
109 1 Y 1 P PRO 50  ? C PRO 12  
110 1 Y 1 P MET 51  ? C MET 13  
111 1 Y 1 P SER 52  ? C SER 14  
112 1 Y 1 P ALA 53  ? C ALA 15  
113 1 Y 1 P GLU 54  ? C GLU 16  
114 1 Y 1 P ALA 55  ? C ALA 17  
115 1 Y 1 P PRO 56  ? C PRO 18  
116 1 Y 1 P GLU 57  ? C GLU 19  
117 1 Y 1 P HIS 58  ? C HIS 20  
118 1 Y 1 P GLY 59  ? C GLY 21  
119 1 Y 1 P THR 60  ? C THR 22  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'CALCIUM ION' CA  
5 water         HOH 
#