data_2W4G
# 
_entry.id   2W4G 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2W4G         
PDBE  EBI-37781    
WWPDB D_1290037781 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB  1O19     unspecified            'MOLECULAR MODELS OF AVERAGED RIGOR CROSSBRIDGES FROMTOMOGRAMS OF INSECT FLIGHT MUSCLE' 
PDB  1I84     unspecified            
;CRYO-EM STRUCTURE OF THE HEAVY MEROMYOSIN SUBFRAGMENT OFCHICKEN GIZZARD SMOOTH MUSCLE MYOSIN WITH REGULATORY LIGHTCHAIN IN THE DEPHOSPHORYLATED STATE. ONLY C ALPHAS PROVIDEDFOR REGULATORY LIGHT CHAIN. ONLY BACKBONE ATOMS PROVIDEDFOR S2 FRAGMENT.
;
PDB  1ALM     unspecified            
;THE STRUCTURE OF THE ACTO-MYOSIN SUBFRAGMENT -ONE COMPLEX. RESULTS OF SEARCHES USING DATA FROM ELECTRON MICROSCOPY AND X-RAY CRYSTALLOGRAPHY. THEORETICAL MODEL, ALPHA CARBONS.
;
PDB  1O1E     unspecified            'MOLECULAR MODELS OF AVERAGED RIGOR CROSSBRIDGES FROMTOMOGRAMS OF INSECT FLIGHT MUSCLE' 
PDB  1O1B     unspecified            'MOLECULAR MODELS OF AVERAGED RIGOR CROSSBRIDGES FROMTOMOGRAMS OF INSECT FLIGHT MUSCLE' 
PDB  1O1D     unspecified            'MOLECULAR MODELS OF AVERAGED RIGOR CROSSBRIDGES FROMTOMOGRAMS OF INSECT FLIGHT MUSCLE' 
PDB  1O1C     unspecified            'MOLECULAR MODELS OF AVERAGED RIGOR CROSSBRIDGES FROMTOMOGRAMS OF INSECT FLIGHT MUSCLE' 
PDB  2W4A     unspecified            'ISOMETRICALLY CONTRACTING INSECT ASYNCHRONOUS FLIGHT MUSCLE' 
PDB  2MYS     unspecified            'MYOSIN SUBFRAGMENT-1, ALPHA CARBON COORDINATES ONLY FOR THE TWO LIGHT CHAINS' 
PDB  1O1G     unspecified            'MOLECULAR MODELS OF AVERAGED RIGOR CROSSBRIDGES FROMTOMOGRAMS OF INSECT FLIGHT MUSCLE' 
PDB  1MVW     unspecified            'MOLECULAR MODELS OF AVERAGED RIGOR CROSSBRIDGES FROMTOMOGRAMS OF INSECT FLIGHT MUSCLE' 
PDB  1M8Q     unspecified            'MOLECULAR MODELS OF AVERAGED RIGOR CROSSBRIDGES FROMTOMOGRAMS OF INSECT FLIGHT MUSCLE' 
PDB  1O1F     unspecified            'MOLECULAR MODELS OF AVERAGED RIGOR CROSSBRIDGES FROMTOMOGRAMS OF INSECT FLIGHT MUSCLE' 
PDB  1O18     unspecified            'MOLECULAR MODELS OF AVERAGED RIGOR CROSSBRIDGES FROMTOMOGRAMS OF INSECT FLIGHT MUSCLE' 
PDB  1O1A     unspecified            'MOLECULAR MODELS OF AVERAGED RIGOR CROSSBRIDGES FROMTOMOGRAMS OF INSECT FLIGHT MUSCLE' 
EMDB EMD-1584 'associated EM volume' 
'ELECTRON TOMOGRAPHY OF ISOMETRICALLY CONTRACTING INSECT FLIGHT MUSCLE QUICK FROZEN AFTER A QUICK RELEASE STEP' 
EMDB EMD-1585 'other EM volume'      
'ELECTRON TOMOGRAPHY OF ISOMETRICALLY CONTRACTING INSECT FLIGHT MUSCLE QUICK FROZEN AFTER A RAPID STRETCH TRANSIENT' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2W4G 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2008-11-25 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wu, S.'                 1  
'Liu, J.'                2  
'Reedy, M.C.'            3  
'Tregear, R.T.'          4  
'Winkler, H.'            5  
'Franzini-Armstrong, C.' 6  
'Sasaki, H.'             7  
'Lucaveche, C.'          8  
'Goldman, Y.E.'          9  
'Reedy, M.K.'            10 
'Taylor, K.A.'           11 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Electron Tomography of Cryofixed, Isometrically Contracting Insect Flight Muscle Reveals Novel Actin-Myosin Interactions' 
'Plos One'     5   12643 ?   2010 ?      US 1932-6203 ?    ? 20844746 10.1371/JOURNAL.PONE.0012643 
1       
'Methods for Identifying and Averaging Variable Molecular Conformations in Tomograms of Actively Contracting Insect Flight Muscle.' 
J.Struct.Biol. 168 485   502 2009 JSBIEM US 1047-8477 0803 ? 19698791 10.1016/j.jsb.2009.08.007    
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wu, S.'                 1  ? 
primary 'Liu, J.'                2  ? 
primary 'Reedy, M.C.'            3  ? 
primary 'Tregear, R.T.'          4  ? 
primary 'Winkler, H.'            5  ? 
primary 'Franzini-Armstrong, C.' 6  ? 
primary 'Sasaki, H.'             7  ? 
primary 'Lucaveche, C.'          8  ? 
primary 'Goldman, Y.E.'          9  ? 
primary 'Reedy, M.K.'            10 ? 
primary 'Taylor, K.A.'           11 ? 
1       'Wu, S.'                 12 ? 
1       'Liu, J.'                13 ? 
1       'Reedy, M.C.'            14 ? 
1       'Winkler, H.'            15 ? 
1       'Reedy, M.K.'            16 ? 
1       'Taylor, K.A.'           17 ? 
# 
_cell.entry_id           2W4G 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2W4G 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat 'MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM' 16958.186 1 ? ? 'RESIDUES, 16-165' ? 
2 polymer nat 'MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM'            16177.147 1 ? ? 'RESIDUES, 5-149'  ? 
3 polymer nat 'MYOSIN HEAVY CHAIN, SKELETAL MUSCLE, ADULT'               95898.125 1 ? ? 'RESIDUES, 5-844'  ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'FAST SKELETAL MYOSIN LIGHT CHAIN 2, MYOSIN S1, MLC-2, LC2F, G2, DTNB'                                            
2 'A2 CATALYTIC, ALKALI MYOSIN LIGHT CHAIN 3, MLC-3, MYOSIN LIGHT CHAIN 3F, SKELETAL-MUSCLE MYOSIN L-4 LIGHT CHAIN' 
3 'MYOSIN S1'                                                                                                       
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;NVFSMFDQTQIQDFKEAFTVIDQNRDGIIDKDDLRETFAAMGRLNVKNEELDAMIKEASGPINFTVFLTMFGEKLKGADP
EDVIMGAFKVLDPDGKGSIKKSFLEELLTTQCDRFTPEEIKNMWAAFPPDVAGNVDYKNICYVITHGEDK
;
;NVFSMFDQTQIQDFKEAFTVIDQNRDGIIDKDDLRETFAAMGRLNVKNEELDAMIKEASGPINFTVFLTMFGEKLKGADP
EDVIMGAFKVLDPDGKGSIKKSFLEELLTTQCDRFTPEEIKNMWAAFPPDVAGNVDYKNICYVITHGEDK
;
B ? 
2 'polypeptide(L)' no no 
;DEINDFKEAFLLFDRTGDAKITLSQVGDIVRALGQNPTNAEINKILGNPSKEEMNAKKITFEEFLPMLQAAANNKDQGTF
EDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMTEEEVEELMKGQEDSNGCINYEAFVKHIMSV
;
;DEINDFKEAFLLFDRTGDAKITLSQVGDIVRALGQNPTNAEINKILGNPSKEEMNAKKITFEEFLPMLQAAANNKDQGTF
EDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMTEEEVEELMKGQEDSNGCINYEAFVKHIMSV
;
C ? 
3 'polypeptide(L)' no no 
;DAEMAAFGEAAPYLRKSEKERIEAQNKPFDAKSSVFVVHPKESFVKGTIQSKEGGKVTVKTEGGETLTVKEDQVFSMNPP
KYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNPKVVLAYRGKKRQEAPPHIFSISDNAY
QFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAASGEKKKEEQSGKMQGTLEDQIISANPLLEAFGNAKTVRNDNS
SRFGKFIRIHFGATGKLASADIETYLLEKSRVTFQLPAERSYHIFYQIMSNKKPELIDMLLITTNPYDYHYVSQGEITVP
SIDDQEELMATDSAIDILGFSADEKTAIYKLTGAVMHYGNLKFKQKQREEQAEPDGTEVADKAAYLMGLNSAELLKALCY
PRVKVGNEFVTKGQTVSQVHNSVGALAKAVYEKMFLWMVIRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFT
NEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYDQHLGKSN
NFQKPKPAKGKAEAHFSLVHYAGTVDYNISGWLEKNKDPLNETVIGLYQKSSVKTLALLFATYGGEAEGGGGKKGGKKKG
SSFQTVSALFRENLNKLMANLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRVLYADFKQR
YRVLNASAIPEGQFMDSKKASEKLLGSIDVDHTQYRFGHTKVFFKAGLLGLLEEMRDDKLAEIITRTQARCRGFLMRVEY
RRMVERRESIFCIQYNVRSFMNVKHWPWMKLFFKIKPLLK
;
;DAEMAAFGEAAPYLRKSEKERIEAQNKPFDAKSSVFVVHPKESFVKGTIQSKEGGKVTVKTEGGETLTVKEDQVFSMNPP
KYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNPKVVLAYRGKKRQEAPPHIFSISDNAY
QFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAASGEKKKEEQSGKMQGTLEDQIISANPLLEAFGNAKTVRNDNS
SRFGKFIRIHFGATGKLASADIETYLLEKSRVTFQLPAERSYHIFYQIMSNKKPELIDMLLITTNPYDYHYVSQGEITVP
SIDDQEELMATDSAIDILGFSADEKTAIYKLTGAVMHYGNLKFKQKQREEQAEPDGTEVADKAAYLMGLNSAELLKALCY
PRVKVGNEFVTKGQTVSQVHNSVGALAKAVYEKMFLWMVIRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFT
NEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYDQHLGKSN
NFQKPKPAKGKAEAHFSLVHYAGTVDYNISGWLEKNKDPLNETVIGLYQKSSVKTLALLFATYGGEAEGGGGKKGGKKKG
SSFQTVSALFRENLNKLMANLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRVLYADFKQR
YRVLNASAIPEGQFMDSKKASEKLLGSIDVDHTQYRFGHTKVFFKAGLLGLLEEMRDDKLAEIITRTQARCRGFLMRVEY
RRMVERRESIFCIQYNVRSFMNVKHWPWMKLFFKIKPLLK
;
M ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASN n 
1 2   VAL n 
1 3   PHE n 
1 4   SER n 
1 5   MET n 
1 6   PHE n 
1 7   ASP n 
1 8   GLN n 
1 9   THR n 
1 10  GLN n 
1 11  ILE n 
1 12  GLN n 
1 13  ASP n 
1 14  PHE n 
1 15  LYS n 
1 16  GLU n 
1 17  ALA n 
1 18  PHE n 
1 19  THR n 
1 20  VAL n 
1 21  ILE n 
1 22  ASP n 
1 23  GLN n 
1 24  ASN n 
1 25  ARG n 
1 26  ASP n 
1 27  GLY n 
1 28  ILE n 
1 29  ILE n 
1 30  ASP n 
1 31  LYS n 
1 32  ASP n 
1 33  ASP n 
1 34  LEU n 
1 35  ARG n 
1 36  GLU n 
1 37  THR n 
1 38  PHE n 
1 39  ALA n 
1 40  ALA n 
1 41  MET n 
1 42  GLY n 
1 43  ARG n 
1 44  LEU n 
1 45  ASN n 
1 46  VAL n 
1 47  LYS n 
1 48  ASN n 
1 49  GLU n 
1 50  GLU n 
1 51  LEU n 
1 52  ASP n 
1 53  ALA n 
1 54  MET n 
1 55  ILE n 
1 56  LYS n 
1 57  GLU n 
1 58  ALA n 
1 59  SER n 
1 60  GLY n 
1 61  PRO n 
1 62  ILE n 
1 63  ASN n 
1 64  PHE n 
1 65  THR n 
1 66  VAL n 
1 67  PHE n 
1 68  LEU n 
1 69  THR n 
1 70  MET n 
1 71  PHE n 
1 72  GLY n 
1 73  GLU n 
1 74  LYS n 
1 75  LEU n 
1 76  LYS n 
1 77  GLY n 
1 78  ALA n 
1 79  ASP n 
1 80  PRO n 
1 81  GLU n 
1 82  ASP n 
1 83  VAL n 
1 84  ILE n 
1 85  MET n 
1 86  GLY n 
1 87  ALA n 
1 88  PHE n 
1 89  LYS n 
1 90  VAL n 
1 91  LEU n 
1 92  ASP n 
1 93  PRO n 
1 94  ASP n 
1 95  GLY n 
1 96  LYS n 
1 97  GLY n 
1 98  SER n 
1 99  ILE n 
1 100 LYS n 
1 101 LYS n 
1 102 SER n 
1 103 PHE n 
1 104 LEU n 
1 105 GLU n 
1 106 GLU n 
1 107 LEU n 
1 108 LEU n 
1 109 THR n 
1 110 THR n 
1 111 GLN n 
1 112 CYS n 
1 113 ASP n 
1 114 ARG n 
1 115 PHE n 
1 116 THR n 
1 117 PRO n 
1 118 GLU n 
1 119 GLU n 
1 120 ILE n 
1 121 LYS n 
1 122 ASN n 
1 123 MET n 
1 124 TRP n 
1 125 ALA n 
1 126 ALA n 
1 127 PHE n 
1 128 PRO n 
1 129 PRO n 
1 130 ASP n 
1 131 VAL n 
1 132 ALA n 
1 133 GLY n 
1 134 ASN n 
1 135 VAL n 
1 136 ASP n 
1 137 TYR n 
1 138 LYS n 
1 139 ASN n 
1 140 ILE n 
1 141 CYS n 
1 142 TYR n 
1 143 VAL n 
1 144 ILE n 
1 145 THR n 
1 146 HIS n 
1 147 GLY n 
1 148 GLU n 
1 149 ASP n 
1 150 LYS n 
2 1   ASP n 
2 2   GLU n 
2 3   ILE n 
2 4   ASN n 
2 5   ASP n 
2 6   PHE n 
2 7   LYS n 
2 8   GLU n 
2 9   ALA n 
2 10  PHE n 
2 11  LEU n 
2 12  LEU n 
2 13  PHE n 
2 14  ASP n 
2 15  ARG n 
2 16  THR n 
2 17  GLY n 
2 18  ASP n 
2 19  ALA n 
2 20  LYS n 
2 21  ILE n 
2 22  THR n 
2 23  LEU n 
2 24  SER n 
2 25  GLN n 
2 26  VAL n 
2 27  GLY n 
2 28  ASP n 
2 29  ILE n 
2 30  VAL n 
2 31  ARG n 
2 32  ALA n 
2 33  LEU n 
2 34  GLY n 
2 35  GLN n 
2 36  ASN n 
2 37  PRO n 
2 38  THR n 
2 39  ASN n 
2 40  ALA n 
2 41  GLU n 
2 42  ILE n 
2 43  ASN n 
2 44  LYS n 
2 45  ILE n 
2 46  LEU n 
2 47  GLY n 
2 48  ASN n 
2 49  PRO n 
2 50  SER n 
2 51  LYS n 
2 52  GLU n 
2 53  GLU n 
2 54  MET n 
2 55  ASN n 
2 56  ALA n 
2 57  LYS n 
2 58  LYS n 
2 59  ILE n 
2 60  THR n 
2 61  PHE n 
2 62  GLU n 
2 63  GLU n 
2 64  PHE n 
2 65  LEU n 
2 66  PRO n 
2 67  MET n 
2 68  LEU n 
2 69  GLN n 
2 70  ALA n 
2 71  ALA n 
2 72  ALA n 
2 73  ASN n 
2 74  ASN n 
2 75  LYS n 
2 76  ASP n 
2 77  GLN n 
2 78  GLY n 
2 79  THR n 
2 80  PHE n 
2 81  GLU n 
2 82  ASP n 
2 83  PHE n 
2 84  VAL n 
2 85  GLU n 
2 86  GLY n 
2 87  LEU n 
2 88  ARG n 
2 89  VAL n 
2 90  PHE n 
2 91  ASP n 
2 92  LYS n 
2 93  GLU n 
2 94  GLY n 
2 95  ASN n 
2 96  GLY n 
2 97  THR n 
2 98  VAL n 
2 99  MET n 
2 100 GLY n 
2 101 ALA n 
2 102 GLU n 
2 103 LEU n 
2 104 ARG n 
2 105 HIS n 
2 106 VAL n 
2 107 LEU n 
2 108 ALA n 
2 109 THR n 
2 110 LEU n 
2 111 GLY n 
2 112 GLU n 
2 113 LYS n 
2 114 MET n 
2 115 THR n 
2 116 GLU n 
2 117 GLU n 
2 118 GLU n 
2 119 VAL n 
2 120 GLU n 
2 121 GLU n 
2 122 LEU n 
2 123 MET n 
2 124 LYS n 
2 125 GLY n 
2 126 GLN n 
2 127 GLU n 
2 128 ASP n 
2 129 SER n 
2 130 ASN n 
2 131 GLY n 
2 132 CYS n 
2 133 ILE n 
2 134 ASN n 
2 135 TYR n 
2 136 GLU n 
2 137 ALA n 
2 138 PHE n 
2 139 VAL n 
2 140 LYS n 
2 141 HIS n 
2 142 ILE n 
2 143 MET n 
2 144 SER n 
2 145 VAL n 
3 1   ASP n 
3 2   ALA n 
3 3   GLU n 
3 4   MET n 
3 5   ALA n 
3 6   ALA n 
3 7   PHE n 
3 8   GLY n 
3 9   GLU n 
3 10  ALA n 
3 11  ALA n 
3 12  PRO n 
3 13  TYR n 
3 14  LEU n 
3 15  ARG n 
3 16  LYS n 
3 17  SER n 
3 18  GLU n 
3 19  LYS n 
3 20  GLU n 
3 21  ARG n 
3 22  ILE n 
3 23  GLU n 
3 24  ALA n 
3 25  GLN n 
3 26  ASN n 
3 27  LYS n 
3 28  PRO n 
3 29  PHE n 
3 30  ASP n 
3 31  ALA n 
3 32  LYS n 
3 33  SER n 
3 34  SER n 
3 35  VAL n 
3 36  PHE n 
3 37  VAL n 
3 38  VAL n 
3 39  HIS n 
3 40  PRO n 
3 41  LYS n 
3 42  GLU n 
3 43  SER n 
3 44  PHE n 
3 45  VAL n 
3 46  LYS n 
3 47  GLY n 
3 48  THR n 
3 49  ILE n 
3 50  GLN n 
3 51  SER n 
3 52  LYS n 
3 53  GLU n 
3 54  GLY n 
3 55  GLY n 
3 56  LYS n 
3 57  VAL n 
3 58  THR n 
3 59  VAL n 
3 60  LYS n 
3 61  THR n 
3 62  GLU n 
3 63  GLY n 
3 64  GLY n 
3 65  GLU n 
3 66  THR n 
3 67  LEU n 
3 68  THR n 
3 69  VAL n 
3 70  LYS n 
3 71  GLU n 
3 72  ASP n 
3 73  GLN n 
3 74  VAL n 
3 75  PHE n 
3 76  SER n 
3 77  MET n 
3 78  ASN n 
3 79  PRO n 
3 80  PRO n 
3 81  LYS n 
3 82  TYR n 
3 83  ASP n 
3 84  LYS n 
3 85  ILE n 
3 86  GLU n 
3 87  ASP n 
3 88  MET n 
3 89  ALA n 
3 90  MET n 
3 91  MET n 
3 92  THR n 
3 93  HIS n 
3 94  LEU n 
3 95  HIS n 
3 96  GLU n 
3 97  PRO n 
3 98  ALA n 
3 99  VAL n 
3 100 LEU n 
3 101 TYR n 
3 102 ASN n 
3 103 LEU n 
3 104 LYS n 
3 105 GLU n 
3 106 ARG n 
3 107 TYR n 
3 108 ALA n 
3 109 ALA n 
3 110 TRP n 
3 111 MET n 
3 112 ILE n 
3 113 TYR n 
3 114 THR n 
3 115 TYR n 
3 116 SER n 
3 117 GLY n 
3 118 LEU n 
3 119 PHE n 
3 120 CYS n 
3 121 VAL n 
3 122 THR n 
3 123 VAL n 
3 124 ASN n 
3 125 PRO n 
3 126 TYR n 
3 127 LYS n 
3 128 TRP n 
3 129 LEU n 
3 130 PRO n 
3 131 VAL n 
3 132 TYR n 
3 133 ASN n 
3 134 PRO n 
3 135 LYS n 
3 136 VAL n 
3 137 VAL n 
3 138 LEU n 
3 139 ALA n 
3 140 TYR n 
3 141 ARG n 
3 142 GLY n 
3 143 LYS n 
3 144 LYS n 
3 145 ARG n 
3 146 GLN n 
3 147 GLU n 
3 148 ALA n 
3 149 PRO n 
3 150 PRO n 
3 151 HIS n 
3 152 ILE n 
3 153 PHE n 
3 154 SER n 
3 155 ILE n 
3 156 SER n 
3 157 ASP n 
3 158 ASN n 
3 159 ALA n 
3 160 TYR n 
3 161 GLN n 
3 162 PHE n 
3 163 MET n 
3 164 LEU n 
3 165 THR n 
3 166 ASP n 
3 167 ARG n 
3 168 GLU n 
3 169 ASN n 
3 170 GLN n 
3 171 SER n 
3 172 ILE n 
3 173 LEU n 
3 174 ILE n 
3 175 THR n 
3 176 GLY n 
3 177 GLU n 
3 178 SER n 
3 179 GLY n 
3 180 ALA n 
3 181 GLY n 
3 182 LYS n 
3 183 THR n 
3 184 VAL n 
3 185 ASN n 
3 186 THR n 
3 187 LYS n 
3 188 ARG n 
3 189 VAL n 
3 190 ILE n 
3 191 GLN n 
3 192 TYR n 
3 193 PHE n 
3 194 ALA n 
3 195 THR n 
3 196 ILE n 
3 197 ALA n 
3 198 ALA n 
3 199 SER n 
3 200 GLY n 
3 201 GLU n 
3 202 LYS n 
3 203 LYS n 
3 204 LYS n 
3 205 GLU n 
3 206 GLU n 
3 207 GLN n 
3 208 SER n 
3 209 GLY n 
3 210 LYS n 
3 211 MET n 
3 212 GLN n 
3 213 GLY n 
3 214 THR n 
3 215 LEU n 
3 216 GLU n 
3 217 ASP n 
3 218 GLN n 
3 219 ILE n 
3 220 ILE n 
3 221 SER n 
3 222 ALA n 
3 223 ASN n 
3 224 PRO n 
3 225 LEU n 
3 226 LEU n 
3 227 GLU n 
3 228 ALA n 
3 229 PHE n 
3 230 GLY n 
3 231 ASN n 
3 232 ALA n 
3 233 LYS n 
3 234 THR n 
3 235 VAL n 
3 236 ARG n 
3 237 ASN n 
3 238 ASP n 
3 239 ASN n 
3 240 SER n 
3 241 SER n 
3 242 ARG n 
3 243 PHE n 
3 244 GLY n 
3 245 LYS n 
3 246 PHE n 
3 247 ILE n 
3 248 ARG n 
3 249 ILE n 
3 250 HIS n 
3 251 PHE n 
3 252 GLY n 
3 253 ALA n 
3 254 THR n 
3 255 GLY n 
3 256 LYS n 
3 257 LEU n 
3 258 ALA n 
3 259 SER n 
3 260 ALA n 
3 261 ASP n 
3 262 ILE n 
3 263 GLU n 
3 264 THR n 
3 265 TYR n 
3 266 LEU n 
3 267 LEU n 
3 268 GLU n 
3 269 LYS n 
3 270 SER n 
3 271 ARG n 
3 272 VAL n 
3 273 THR n 
3 274 PHE n 
3 275 GLN n 
3 276 LEU n 
3 277 PRO n 
3 278 ALA n 
3 279 GLU n 
3 280 ARG n 
3 281 SER n 
3 282 TYR n 
3 283 HIS n 
3 284 ILE n 
3 285 PHE n 
3 286 TYR n 
3 287 GLN n 
3 288 ILE n 
3 289 MET n 
3 290 SER n 
3 291 ASN n 
3 292 LYS n 
3 293 LYS n 
3 294 PRO n 
3 295 GLU n 
3 296 LEU n 
3 297 ILE n 
3 298 ASP n 
3 299 MET n 
3 300 LEU n 
3 301 LEU n 
3 302 ILE n 
3 303 THR n 
3 304 THR n 
3 305 ASN n 
3 306 PRO n 
3 307 TYR n 
3 308 ASP n 
3 309 TYR n 
3 310 HIS n 
3 311 TYR n 
3 312 VAL n 
3 313 SER n 
3 314 GLN n 
3 315 GLY n 
3 316 GLU n 
3 317 ILE n 
3 318 THR n 
3 319 VAL n 
3 320 PRO n 
3 321 SER n 
3 322 ILE n 
3 323 ASP n 
3 324 ASP n 
3 325 GLN n 
3 326 GLU n 
3 327 GLU n 
3 328 LEU n 
3 329 MET n 
3 330 ALA n 
3 331 THR n 
3 332 ASP n 
3 333 SER n 
3 334 ALA n 
3 335 ILE n 
3 336 ASP n 
3 337 ILE n 
3 338 LEU n 
3 339 GLY n 
3 340 PHE n 
3 341 SER n 
3 342 ALA n 
3 343 ASP n 
3 344 GLU n 
3 345 LYS n 
3 346 THR n 
3 347 ALA n 
3 348 ILE n 
3 349 TYR n 
3 350 LYS n 
3 351 LEU n 
3 352 THR n 
3 353 GLY n 
3 354 ALA n 
3 355 VAL n 
3 356 MET n 
3 357 HIS n 
3 358 TYR n 
3 359 GLY n 
3 360 ASN n 
3 361 LEU n 
3 362 LYS n 
3 363 PHE n 
3 364 LYS n 
3 365 GLN n 
3 366 LYS n 
3 367 GLN n 
3 368 ARG n 
3 369 GLU n 
3 370 GLU n 
3 371 GLN n 
3 372 ALA n 
3 373 GLU n 
3 374 PRO n 
3 375 ASP n 
3 376 GLY n 
3 377 THR n 
3 378 GLU n 
3 379 VAL n 
3 380 ALA n 
3 381 ASP n 
3 382 LYS n 
3 383 ALA n 
3 384 ALA n 
3 385 TYR n 
3 386 LEU n 
3 387 MET n 
3 388 GLY n 
3 389 LEU n 
3 390 ASN n 
3 391 SER n 
3 392 ALA n 
3 393 GLU n 
3 394 LEU n 
3 395 LEU n 
3 396 LYS n 
3 397 ALA n 
3 398 LEU n 
3 399 CYS n 
3 400 TYR n 
3 401 PRO n 
3 402 ARG n 
3 403 VAL n 
3 404 LYS n 
3 405 VAL n 
3 406 GLY n 
3 407 ASN n 
3 408 GLU n 
3 409 PHE n 
3 410 VAL n 
3 411 THR n 
3 412 LYS n 
3 413 GLY n 
3 414 GLN n 
3 415 THR n 
3 416 VAL n 
3 417 SER n 
3 418 GLN n 
3 419 VAL n 
3 420 HIS n 
3 421 ASN n 
3 422 SER n 
3 423 VAL n 
3 424 GLY n 
3 425 ALA n 
3 426 LEU n 
3 427 ALA n 
3 428 LYS n 
3 429 ALA n 
3 430 VAL n 
3 431 TYR n 
3 432 GLU n 
3 433 LYS n 
3 434 MET n 
3 435 PHE n 
3 436 LEU n 
3 437 TRP n 
3 438 MET n 
3 439 VAL n 
3 440 ILE n 
3 441 ARG n 
3 442 ILE n 
3 443 ASN n 
3 444 GLN n 
3 445 GLN n 
3 446 LEU n 
3 447 ASP n 
3 448 THR n 
3 449 LYS n 
3 450 GLN n 
3 451 PRO n 
3 452 ARG n 
3 453 GLN n 
3 454 TYR n 
3 455 PHE n 
3 456 ILE n 
3 457 GLY n 
3 458 VAL n 
3 459 LEU n 
3 460 ASP n 
3 461 ILE n 
3 462 ALA n 
3 463 GLY n 
3 464 PHE n 
3 465 GLU n 
3 466 ILE n 
3 467 PHE n 
3 468 ASP n 
3 469 PHE n 
3 470 ASN n 
3 471 SER n 
3 472 PHE n 
3 473 GLU n 
3 474 GLN n 
3 475 LEU n 
3 476 CYS n 
3 477 ILE n 
3 478 ASN n 
3 479 PHE n 
3 480 THR n 
3 481 ASN n 
3 482 GLU n 
3 483 LYS n 
3 484 LEU n 
3 485 GLN n 
3 486 GLN n 
3 487 PHE n 
3 488 PHE n 
3 489 ASN n 
3 490 HIS n 
3 491 HIS n 
3 492 MET n 
3 493 PHE n 
3 494 VAL n 
3 495 LEU n 
3 496 GLU n 
3 497 GLN n 
3 498 GLU n 
3 499 GLU n 
3 500 TYR n 
3 501 LYS n 
3 502 LYS n 
3 503 GLU n 
3 504 GLY n 
3 505 ILE n 
3 506 GLU n 
3 507 TRP n 
3 508 GLU n 
3 509 PHE n 
3 510 ILE n 
3 511 ASP n 
3 512 PHE n 
3 513 GLY n 
3 514 MET n 
3 515 ASP n 
3 516 LEU n 
3 517 ALA n 
3 518 ALA n 
3 519 CYS n 
3 520 ILE n 
3 521 GLU n 
3 522 LEU n 
3 523 ILE n 
3 524 GLU n 
3 525 LYS n 
3 526 PRO n 
3 527 MET n 
3 528 GLY n 
3 529 ILE n 
3 530 PHE n 
3 531 SER n 
3 532 ILE n 
3 533 LEU n 
3 534 GLU n 
3 535 GLU n 
3 536 GLU n 
3 537 CYS n 
3 538 MET n 
3 539 PHE n 
3 540 PRO n 
3 541 LYS n 
3 542 ALA n 
3 543 THR n 
3 544 ASP n 
3 545 THR n 
3 546 SER n 
3 547 PHE n 
3 548 LYS n 
3 549 ASN n 
3 550 LYS n 
3 551 LEU n 
3 552 TYR n 
3 553 ASP n 
3 554 GLN n 
3 555 HIS n 
3 556 LEU n 
3 557 GLY n 
3 558 LYS n 
3 559 SER n 
3 560 ASN n 
3 561 ASN n 
3 562 PHE n 
3 563 GLN n 
3 564 LYS n 
3 565 PRO n 
3 566 LYS n 
3 567 PRO n 
3 568 ALA n 
3 569 LYS n 
3 570 GLY n 
3 571 LYS n 
3 572 ALA n 
3 573 GLU n 
3 574 ALA n 
3 575 HIS n 
3 576 PHE n 
3 577 SER n 
3 578 LEU n 
3 579 VAL n 
3 580 HIS n 
3 581 TYR n 
3 582 ALA n 
3 583 GLY n 
3 584 THR n 
3 585 VAL n 
3 586 ASP n 
3 587 TYR n 
3 588 ASN n 
3 589 ILE n 
3 590 SER n 
3 591 GLY n 
3 592 TRP n 
3 593 LEU n 
3 594 GLU n 
3 595 LYS n 
3 596 ASN n 
3 597 LYS n 
3 598 ASP n 
3 599 PRO n 
3 600 LEU n 
3 601 ASN n 
3 602 GLU n 
3 603 THR n 
3 604 VAL n 
3 605 ILE n 
3 606 GLY n 
3 607 LEU n 
3 608 TYR n 
3 609 GLN n 
3 610 LYS n 
3 611 SER n 
3 612 SER n 
3 613 VAL n 
3 614 LYS n 
3 615 THR n 
3 616 LEU n 
3 617 ALA n 
3 618 LEU n 
3 619 LEU n 
3 620 PHE n 
3 621 ALA n 
3 622 THR n 
3 623 TYR n 
3 624 GLY n 
3 625 GLY n 
3 626 GLU n 
3 627 ALA n 
3 628 GLU n 
3 629 GLY n 
3 630 GLY n 
3 631 GLY n 
3 632 GLY n 
3 633 LYS n 
3 634 LYS n 
3 635 GLY n 
3 636 GLY n 
3 637 LYS n 
3 638 LYS n 
3 639 LYS n 
3 640 GLY n 
3 641 SER n 
3 642 SER n 
3 643 PHE n 
3 644 GLN n 
3 645 THR n 
3 646 VAL n 
3 647 SER n 
3 648 ALA n 
3 649 LEU n 
3 650 PHE n 
3 651 ARG n 
3 652 GLU n 
3 653 ASN n 
3 654 LEU n 
3 655 ASN n 
3 656 LYS n 
3 657 LEU n 
3 658 MET n 
3 659 ALA n 
3 660 ASN n 
3 661 LEU n 
3 662 ARG n 
3 663 SER n 
3 664 THR n 
3 665 HIS n 
3 666 PRO n 
3 667 HIS n 
3 668 PHE n 
3 669 VAL n 
3 670 ARG n 
3 671 CYS n 
3 672 ILE n 
3 673 ILE n 
3 674 PRO n 
3 675 ASN n 
3 676 GLU n 
3 677 THR n 
3 678 LYS n 
3 679 THR n 
3 680 PRO n 
3 681 GLY n 
3 682 ALA n 
3 683 MET n 
3 684 GLU n 
3 685 HIS n 
3 686 GLU n 
3 687 LEU n 
3 688 VAL n 
3 689 LEU n 
3 690 HIS n 
3 691 GLN n 
3 692 LEU n 
3 693 ARG n 
3 694 CYS n 
3 695 ASN n 
3 696 GLY n 
3 697 VAL n 
3 698 LEU n 
3 699 GLU n 
3 700 GLY n 
3 701 ILE n 
3 702 ARG n 
3 703 ILE n 
3 704 CYS n 
3 705 ARG n 
3 706 LYS n 
3 707 GLY n 
3 708 PHE n 
3 709 PRO n 
3 710 SER n 
3 711 ARG n 
3 712 VAL n 
3 713 LEU n 
3 714 TYR n 
3 715 ALA n 
3 716 ASP n 
3 717 PHE n 
3 718 LYS n 
3 719 GLN n 
3 720 ARG n 
3 721 TYR n 
3 722 ARG n 
3 723 VAL n 
3 724 LEU n 
3 725 ASN n 
3 726 ALA n 
3 727 SER n 
3 728 ALA n 
3 729 ILE n 
3 730 PRO n 
3 731 GLU n 
3 732 GLY n 
3 733 GLN n 
3 734 PHE n 
3 735 MET n 
3 736 ASP n 
3 737 SER n 
3 738 LYS n 
3 739 LYS n 
3 740 ALA n 
3 741 SER n 
3 742 GLU n 
3 743 LYS n 
3 744 LEU n 
3 745 LEU n 
3 746 GLY n 
3 747 SER n 
3 748 ILE n 
3 749 ASP n 
3 750 VAL n 
3 751 ASP n 
3 752 HIS n 
3 753 THR n 
3 754 GLN n 
3 755 TYR n 
3 756 ARG n 
3 757 PHE n 
3 758 GLY n 
3 759 HIS n 
3 760 THR n 
3 761 LYS n 
3 762 VAL n 
3 763 PHE n 
3 764 PHE n 
3 765 LYS n 
3 766 ALA n 
3 767 GLY n 
3 768 LEU n 
3 769 LEU n 
3 770 GLY n 
3 771 LEU n 
3 772 LEU n 
3 773 GLU n 
3 774 GLU n 
3 775 MET n 
3 776 ARG n 
3 777 ASP n 
3 778 ASP n 
3 779 LYS n 
3 780 LEU n 
3 781 ALA n 
3 782 GLU n 
3 783 ILE n 
3 784 ILE n 
3 785 THR n 
3 786 ARG n 
3 787 THR n 
3 788 GLN n 
3 789 ALA n 
3 790 ARG n 
3 791 CYS n 
3 792 ARG n 
3 793 GLY n 
3 794 PHE n 
3 795 LEU n 
3 796 MET n 
3 797 ARG n 
3 798 VAL n 
3 799 GLU n 
3 800 TYR n 
3 801 ARG n 
3 802 ARG n 
3 803 MET n 
3 804 VAL n 
3 805 GLU n 
3 806 ARG n 
3 807 ARG n 
3 808 GLU n 
3 809 SER n 
3 810 ILE n 
3 811 PHE n 
3 812 CYS n 
3 813 ILE n 
3 814 GLN n 
3 815 TYR n 
3 816 ASN n 
3 817 VAL n 
3 818 ARG n 
3 819 SER n 
3 820 PHE n 
3 821 MET n 
3 822 ASN n 
3 823 VAL n 
3 824 LYS n 
3 825 HIS n 
3 826 TRP n 
3 827 PRO n 
3 828 TRP n 
3 829 MET n 
3 830 LYS n 
3 831 LEU n 
3 832 PHE n 
3 833 PHE n 
3 834 LYS n 
3 835 ILE n 
3 836 LYS n 
3 837 PRO n 
3 838 LEU n 
3 839 LEU n 
3 840 LYS n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? CHICKEN 'GALLUS GALLUS' 9031 ? ? ? 'SKELETAL MUSCLE' ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? CHICKEN 'GALLUS GALLUS' 9031 ? ? ? 'SKELETAL MUSCLE' ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? CHICKEN 'GALLUS GALLUS' 9031 ? ? ? 'SKELETAL MUSCLE' ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP MLRS_CHICK 1 ? ? P02609 ? 
2 UNP MLE3_CHICK 2 ? ? P02605 ? 
3 UNP MYSS_CHICK 3 ? ? P13538 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2W4G B 1 ? 150 ? P02609 16 ? 165 ? 14 163 
2 2 2W4G C 1 ? 145 ? P02605 6  ? 150 ? 5  149 
3 3 2W4G M 1 ? 840 ? P13538 5  ? 844 ? 4  843 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2W4G ASP B 13  ? UNP P02609 GLU 28  conflict 26  1 
3 2W4G LYS M 135 ? UNP P02609 GLU 139 conflict 138 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2W4G 
_exptl.method            'ELECTRON MICROSCOPY' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 2W4G 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            35.00 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8758 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               8758 
_refine_hist.d_res_high                       35.00 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  2W4G 
_struct.title                     
'ISOMETRICALLY CONTRACTING INSECT ASYNCHRONOUS FLIGHT MUSCLE QUICK FROZEN AFTER A QUICK STRETCH STEP' 
_struct.pdbx_descriptor           
;MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM, MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM, MYOSIN HEAVY CHAIN, SKELETAL MUSCLE, ADULT
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2W4G 
_struct_keywords.pdbx_keywords   'CONTRACTILE PROTEIN' 
_struct_keywords.text            
;CONTRACTILE PROTEIN, METHYLATION, ATP-BINDING, ISOMETRIC CONTRACTION, MICROTOMY, FREEZE SUBSTITUTION, MUSCLE PROTEIN, CALMODULIN-BINDING, MOTOR PROTEIN, ACTIN-BINDING
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 7   ? ASP A 22  ? ASP B 20  ASP B 35  1 ? 16 
HELX_P HELX_P2  2  ASP A 30  ? MET A 41  ? ASP B 43  MET B 54  1 ? 12 
HELX_P HELX_P3  3  LYS A 47  ? GLU A 57  ? LYS B 60  GLU B 70  1 ? 11 
HELX_P HELX_P4  4  ASN A 63  ? LEU A 75  ? ASN B 76  LEU B 88  1 ? 13 
HELX_P HELX_P5  5  PRO A 80  ? ASP A 92  ? PRO B 93  ASP B 105 1 ? 13 
HELX_P HELX_P6  6  SER A 102 ? THR A 110 ? SER B 115 THR B 123 1 ? 9  
HELX_P HELX_P7  7  GLU A 118 ? PHE A 127 ? GLU B 131 PHE B 140 1 ? 10 
HELX_P HELX_P8  8  ASP A 136 ? GLY A 147 ? ASP B 149 GLY B 160 1 ? 12 
HELX_P HELX_P9  9  ASN B 4   ? LEU B 12  ? ASN C 8   LEU C 16  1 ? 9  
HELX_P HELX_P10 10 THR B 22  ? LEU B 33  ? THR C 26  LEU C 37  1 ? 12 
HELX_P HELX_P11 11 ALA B 40  ? ILE B 45  ? ALA C 44  ILE C 49  1 ? 6  
HELX_P HELX_P12 12 PRO B 49  ? ASN B 55  ? PRO C 53  ASN C 59  1 ? 7  
HELX_P HELX_P13 13 THR B 60  ? LYS B 75  ? THR C 64  LYS C 79  1 ? 16 
HELX_P HELX_P14 14 ASP B 76  ? THR B 79  ? ASP C 80  THR C 83  5 ? 4  
HELX_P HELX_P15 15 PHE B 80  ? PHE B 83  ? PHE C 84  PHE C 87  5 ? 4  
HELX_P HELX_P16 16 VAL B 84  ? ARG B 88  ? VAL C 88  ARG C 92  1 ? 5  
HELX_P HELX_P17 17 GLY B 100 ? LEU B 110 ? GLY C 104 LEU C 114 1 ? 11 
HELX_P HELX_P18 18 THR B 115 ? MET B 123 ? THR C 119 MET C 127 1 ? 9  
HELX_P HELX_P19 19 ALA B 137 ? SER B 144 ? ALA C 141 SER C 148 1 ? 8  
HELX_P HELX_P20 20 ALA C 10  ? ARG C 15  ? ALA M 13  ARG M 18  1 ? 6  
HELX_P HELX_P21 21 ARG C 21  ? ASN C 26  ? ARG M 24  ASN M 29  1 ? 6  
HELX_P HELX_P22 22 MET C 88  ? MET C 91  ? MET M 91  MET M 94  5 ? 4  
HELX_P HELX_P23 23 HIS C 95  ? ARG C 106 ? HIS M 98  ARG M 109 1 ? 12 
HELX_P HELX_P24 24 LEU C 129 ? ASN C 133 ? LEU M 132 ASN M 136 5 ? 5  
HELX_P HELX_P25 25 LYS C 135 ? TYR C 140 ? LYS M 138 TYR M 143 1 ? 6  
HELX_P HELX_P26 26 HIS C 151 ? ARG C 167 ? HIS M 154 ARG M 170 1 ? 17 
HELX_P HELX_P27 27 GLY C 181 ? ALA C 197 ? GLY M 184 ALA M 200 1 ? 17 
HELX_P HELX_P28 28 ASP C 217 ? GLY C 230 ? ASP M 220 GLY M 233 1 ? 14 
HELX_P HELX_P29 29 GLU C 268 ? THR C 273 ? GLU M 271 THR M 276 5 ? 6  
HELX_P HELX_P30 30 TYR C 282 ? MET C 289 ? TYR M 285 MET M 292 1 ? 8  
HELX_P HELX_P31 31 LYS C 293 ? LEU C 301 ? LYS M 296 LEU M 304 1 ? 9  
HELX_P HELX_P32 32 ASN C 305 ? TYR C 309 ? ASN M 308 TYR M 312 5 ? 5  
HELX_P HELX_P33 33 TYR C 309 ? SER C 313 ? TYR M 312 SER M 316 5 ? 5  
HELX_P HELX_P34 34 ASP C 323 ? LEU C 338 ? ASP M 326 LEU M 341 1 ? 16 
HELX_P HELX_P35 35 SER C 341 ? GLY C 359 ? SER M 344 GLY M 362 1 ? 19 
HELX_P HELX_P36 36 GLU C 378 ? GLY C 388 ? GLU M 381 GLY M 391 1 ? 11 
HELX_P HELX_P37 37 ASN C 390 ? TYR C 400 ? ASN M 393 TYR M 403 1 ? 11 
HELX_P HELX_P38 38 THR C 415 ? LEU C 446 ? THR M 418 LEU M 449 1 ? 32 
HELX_P HELX_P39 39 SER C 471 ? GLU C 503 ? SER M 474 GLU M 506 1 ? 33 
HELX_P HELX_P40 40 GLY C 513 ? LYS C 525 ? GLY M 516 LYS M 528 1 ? 13 
HELX_P HELX_P41 41 GLY C 528 ? CYS C 537 ? GLY M 531 CYS M 540 1 ? 10 
HELX_P HELX_P42 42 THR C 543 ? LEU C 556 ? THR M 546 LEU M 559 1 ? 14 
HELX_P HELX_P43 43 GLY C 591 ? ASP C 598 ? GLY M 594 ASP M 601 1 ? 8  
HELX_P HELX_P44 44 ASN C 601 ? LYS C 610 ? ASN M 604 LYS M 613 1 ? 10 
HELX_P HELX_P45 45 VAL C 613 ? PHE C 620 ? VAL M 616 PHE M 623 1 ? 8  
HELX_P HELX_P46 46 VAL C 646 ? SER C 663 ? VAL M 649 SER M 666 1 ? 18 
HELX_P HELX_P47 47 GLU C 684 ? GLY C 696 ? GLU M 687 GLY M 699 1 ? 13 
HELX_P HELX_P48 48 GLY C 696 ? ARG C 705 ? GLY M 699 ARG M 708 1 ? 10 
HELX_P HELX_P49 49 TYR C 714 ? GLN C 719 ? TYR M 717 GLN M 722 1 ? 6  
HELX_P HELX_P50 50 ARG C 722 ? ASN C 725 ? ARG M 725 ASN M 728 5 ? 4  
HELX_P HELX_P51 51 LYS C 738 ? LEU C 745 ? LYS M 741 LEU M 748 1 ? 8  
HELX_P HELX_P52 52 GLY C 767 ? ARG C 776 ? GLY M 770 ARG M 779 1 ? 10 
HELX_P HELX_P53 53 ASP C 777 ? LYS C 824 ? ASP M 780 LYS M 827 1 ? 48 
HELX_P HELX_P54 54 TRP C 826 ? LYS C 836 ? TRP M 829 LYS M 839 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
CA ? 2 ? 
CB ? 3 ? 
MA ? 5 ? 
MB ? 7 ? 
MC ? 7 ? 
MD ? 2 ? 
ME ? 2 ? 
MF ? 3 ? 
MG ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
CA 1 2 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
MA 1 2 ? anti-parallel 
MA 2 3 ? anti-parallel 
MA 3 4 ? anti-parallel 
MA 4 5 ? anti-parallel 
MB 1 2 ? anti-parallel 
MB 2 3 ? parallel      
MB 3 4 ? parallel      
MB 4 5 ? parallel      
MB 5 6 ? anti-parallel 
MB 6 7 ? anti-parallel 
MC 1 2 ? anti-parallel 
MC 2 3 ? parallel      
MC 3 4 ? parallel      
MC 4 5 ? parallel      
MC 5 6 ? anti-parallel 
MC 6 7 ? anti-parallel 
MD 1 2 ? anti-parallel 
ME 1 2 ? anti-parallel 
MF 1 2 ? anti-parallel 
MF 2 3 ? anti-parallel 
MG 1 2 ? anti-parallel 
MG 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
CA 1 VAL B 89  ? PHE B 90  ? VAL C 93  PHE C 94  
CA 2 ARG C 720 ? TYR C 721 ? ARG M 723 TYR M 724 
CB 1 THR B 97  ? MET B 99  ? THR C 101 MET C 103 
CB 2 CYS B 132 ? GLU B 136 ? CYS C 136 GLU C 140 
CB 3 ILE C 729 ? GLN C 733 ? ILE M 732 GLN M 736 
MA 1 LEU C 67  ? LYS C 70  ? LEU M 70  LYS M 73  
MA 2 LYS C 56  ? VAL C 59  ? LYS M 59  VAL M 62  
MA 3 PHE C 44  ? LYS C 52  ? PHE M 47  LYS M 55  
MA 4 SER C 34  ? VAL C 38  ? SER M 37  VAL M 41  
MA 5 VAL C 74  ? PHE C 75  ? VAL M 77  PHE M 78  
MB 1 TYR C 113 ? SER C 116 ? TYR M 116 SER M 119 
MB 2 PHE C 119 ? VAL C 123 ? PHE M 122 VAL M 126 
MB 3 HIS C 665 ? ILE C 672 ? HIS M 668 ILE M 675 
MB 4 GLN C 170 ? GLY C 176 ? GLN M 173 GLY M 179 
MB 5 TYR C 454 ? ALA C 462 ? TYR M 457 ALA M 465 
MB 6 GLY C 244 ? PHE C 251 ? GLY M 247 PHE M 254 
MB 7 ILE C 262 ? TYR C 265 ? ILE M 265 TYR M 268 
MC 1 TYR C 113 ? SER C 116 ? TYR M 116 SER M 119 
MC 2 PHE C 119 ? VAL C 123 ? PHE M 122 VAL M 126 
MC 3 HIS C 665 ? ILE C 672 ? HIS M 668 ILE M 675 
MC 4 GLN C 170 ? GLY C 176 ? GLN M 173 GLY M 179 
MC 5 TYR C 454 ? ALA C 462 ? TYR M 457 ALA M 465 
MC 6 GLY C 244 ? PHE C 251 ? GLY M 247 PHE M 254 
MC 7 LEU C 257 ? SER C 259 ? LEU M 260 SER M 262 
MD 1 ASN C 231 ? ALA C 232 ? ASN M 234 ALA M 235 
MD 2 SER C 240 ? SER C 241 ? SER M 243 SER M 244 
ME 1 PHE C 363 ? GLN C 365 ? PHE M 366 GLN M 368 
ME 2 ALA C 372 ? PRO C 374 ? ALA M 375 PRO M 377 
MF 1 PHE C 562 ? GLN C 563 ? PHE M 565 GLN M 566 
MF 2 PHE C 576 ? VAL C 579 ? PHE M 579 VAL M 582 
MF 3 THR C 584 ? TYR C 587 ? THR M 587 TYR M 590 
MG 1 ARG C 711 ? LEU C 713 ? ARG M 714 LEU M 716 
MG 2 LYS C 761 ? PHE C 764 ? LYS M 764 PHE M 767 
MG 3 TYR C 755 ? GLY C 758 ? TYR M 758 GLY M 761 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
CA 1 2 N PHE B 90  ? N PHE C 94  O ARG C 720 ? O ARG M 723 
CB 1 2 N VAL B 98  ? N VAL C 102 O ILE B 133 ? O ILE C 137 
CB 2 3 N GLU B 136 ? N GLU C 140 O GLY C 732 ? O GLY M 735 
MA 1 2 N VAL C 69  ? N VAL M 72  O VAL C 57  ? O VAL M 60  
MA 2 3 O THR C 58  ? O THR M 61  N GLN C 50  ? N GLN M 53  
MA 3 4 N GLY C 47  ? N GLY M 50  O VAL C 35  ? O VAL M 38  
MA 4 5 N PHE C 36  ? N PHE M 39  O PHE C 75  ? O PHE M 78  
MB 1 2 N SER C 116 ? N SER M 119 O PHE C 119 ? O PHE M 122 
MB 2 3 N THR C 122 ? N THR M 125 O ARG C 670 ? O ARG M 673 
MB 3 4 N HIS C 667 ? N HIS M 670 O SER C 171 ? O SER M 174 
MB 4 5 N GLN C 170 ? N GLN M 173 O PHE C 455 ? O PHE M 458 
MB 5 6 N ASP C 460 ? N ASP M 463 O LYS C 245 ? O LYS M 248 
MB 6 7 N PHE C 246 ? N PHE M 249 O GLU C 263 ? O GLU M 266 
MC 1 2 N SER C 116 ? N SER M 119 O PHE C 119 ? O PHE M 122 
MC 2 3 N THR C 122 ? N THR M 125 O ARG C 670 ? O ARG M 673 
MC 3 4 N HIS C 667 ? N HIS M 670 O SER C 171 ? O SER M 174 
MC 4 5 N GLN C 170 ? N GLN M 173 O PHE C 455 ? O PHE M 458 
MC 5 6 N ASP C 460 ? N ASP M 463 O LYS C 245 ? O LYS M 248 
MC 6 7 O HIS C 250 ? O HIS M 253 N ALA C 258 ? N ALA M 261 
MD 1 2 N ALA C 232 ? N ALA M 235 O SER C 240 ? O SER M 243 
ME 1 2 N LYS C 364 ? N LYS M 367 O GLU C 373 ? O GLU M 376 
MF 1 2 N GLN C 563 ? N GLN M 566 O SER C 577 ? O SER M 580 
MF 2 3 N LEU C 578 ? N LEU M 581 O VAL C 585 ? O VAL M 588 
MG 1 2 N VAL C 712 ? N VAL M 715 O VAL C 762 ? O VAL M 765 
MG 2 3 N PHE C 763 ? N PHE M 766 O ARG C 756 ? O ARG M 759 
# 
_database_PDB_matrix.entry_id          2W4G 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2W4G 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      N N   . ASN A 1 1   ? -128.785 -71.136 -11.257 1.00 0.00 ? 14  ASN B N   1  
ATOM 2      C CA  . ASN A 1 1   ? -128.643 -69.762 -10.730 1.00 0.00 ? 14  ASN B CA  1  
ATOM 3      C C   . ASN A 1 1   ? -129.658 -69.499 -9.602  1.00 0.00 ? 14  ASN B C   1  
ATOM 4      O O   . ASN A 1 1   ? -129.407 -68.917 -8.543  1.00 0.00 ? 14  ASN B O   1  
ATOM 5      C CB  . ASN A 1 1   ? -128.873 -68.763 -11.855 1.00 0.00 ? 14  ASN B CB  1  
ATOM 6      C CG  . ASN A 1 1   ? -127.719 -67.788 -12.062 1.00 0.00 ? 14  ASN B CG  1  
ATOM 7      O OD1 . ASN A 1 1   ? -126.656 -67.875 -11.466 1.00 0.00 ? 14  ASN B OD1 1  
ATOM 8      N ND2 . ASN A 1 1   ? -127.808 -66.801 -12.916 1.00 0.00 ? 14  ASN B ND2 1  
ATOM 9      N N   . VAL A 1 2   ? -130.815 -70.102 -9.869  1.00 0.00 ? 15  VAL B N   1  
ATOM 10     C CA  . VAL A 1 2   ? -131.997 -70.131 -9.020  1.00 0.00 ? 15  VAL B CA  1  
ATOM 11     C C   . VAL A 1 2   ? -131.977 -70.897 -7.692  1.00 0.00 ? 15  VAL B C   1  
ATOM 12     O O   . VAL A 1 2   ? -132.880 -70.763 -6.866  1.00 0.00 ? 15  VAL B O   1  
ATOM 13     C CB  . VAL A 1 2   ? -133.054 -70.577 -10.017 1.00 0.00 ? 15  VAL B CB  1  
ATOM 14     C CG1 . VAL A 1 2   ? -134.297 -71.278 -9.501  1.00 0.00 ? 15  VAL B CG1 1  
ATOM 15     C CG2 . VAL A 1 2   ? -133.271 -69.257 -10.721 1.00 0.00 ? 15  VAL B CG2 1  
ATOM 16     N N   . PHE A 1 3   ? -130.985 -71.746 -7.459  1.00 0.00 ? 16  PHE B N   1  
ATOM 17     C CA  . PHE A 1 3   ? -130.774 -72.216 -6.094  1.00 0.00 ? 16  PHE B CA  1  
ATOM 18     C C   . PHE A 1 3   ? -129.579 -71.523 -5.400  1.00 0.00 ? 16  PHE B C   1  
ATOM 19     O O   . PHE A 1 3   ? -129.424 -71.606 -4.188  1.00 0.00 ? 16  PHE B O   1  
ATOM 20     C CB  . PHE A 1 3   ? -130.570 -73.732 -6.097  1.00 0.00 ? 16  PHE B CB  1  
ATOM 21     C CG  . PHE A 1 3   ? -131.747 -74.516 -5.509  1.00 0.00 ? 16  PHE B CG  1  
ATOM 22     C CD1 . PHE A 1 3   ? -131.850 -75.871 -5.757  1.00 0.00 ? 16  PHE B CD1 1  
ATOM 23     C CD2 . PHE A 1 3   ? -132.713 -73.899 -4.725  1.00 0.00 ? 16  PHE B CD2 1  
ATOM 24     C CE1 . PHE A 1 3   ? -132.898 -76.599 -5.226  1.00 0.00 ? 16  PHE B CE1 1  
ATOM 25     C CE2 . PHE A 1 3   ? -133.754 -74.628 -4.198  1.00 0.00 ? 16  PHE B CE2 1  
ATOM 26     C CZ  . PHE A 1 3   ? -133.851 -75.982 -4.446  1.00 0.00 ? 16  PHE B CZ  1  
ATOM 27     N N   . SER A 1 4   ? -128.720 -70.802 -6.137  1.00 0.00 ? 17  SER B N   1  
ATOM 28     C CA  . SER A 1 4   ? -127.567 -70.082 -5.559  1.00 0.00 ? 17  SER B CA  1  
ATOM 29     C C   . SER A 1 4   ? -127.649 -68.779 -4.746  1.00 0.00 ? 17  SER B C   1  
ATOM 30     O O   . SER A 1 4   ? -126.752 -68.525 -3.944  1.00 0.00 ? 17  SER B O   1  
ATOM 31     C CB  . SER A 1 4   ? -126.529 -69.781 -6.633  1.00 0.00 ? 17  SER B CB  1  
ATOM 32     O OG  . SER A 1 4   ? -125.804 -70.951 -6.996  1.00 0.00 ? 17  SER B OG  1  
ATOM 33     N N   . MET A 1 5   ? -128.541 -67.809 -4.994  1.00 0.00 ? 18  MET B N   1  
ATOM 34     C CA  . MET A 1 5   ? -128.798 -66.708 -4.023  1.00 0.00 ? 18  MET B CA  1  
ATOM 35     C C   . MET A 1 5   ? -129.739 -67.444 -3.026  1.00 0.00 ? 18  MET B C   1  
ATOM 36     O O   . MET A 1 5   ? -129.274 -68.312 -2.294  1.00 0.00 ? 18  MET B O   1  
ATOM 37     C CB  . MET A 1 5   ? -129.524 -65.537 -4.723  1.00 0.00 ? 18  MET B CB  1  
ATOM 38     C CG  . MET A 1 5   ? -128.938 -65.095 -6.065  1.00 0.00 ? 18  MET B CG  1  
ATOM 39     S SD  . MET A 1 5   ? -130.150 -64.281 -7.136  1.00 0.00 ? 18  MET B SD  1  
ATOM 40     C CE  . MET A 1 5   ? -129.265 -62.795 -7.504  1.00 0.00 ? 18  MET B CE  1  
ATOM 41     N N   . PHE A 1 6   ? -131.046 -67.169 -2.944  1.00 0.00 ? 19  PHE B N   1  
ATOM 42     C CA  . PHE A 1 6   ? -132.047 -68.101 -2.393  1.00 0.00 ? 19  PHE B CA  1  
ATOM 43     C C   . PHE A 1 6   ? -131.918 -68.809 -1.037  1.00 0.00 ? 19  PHE B C   1  
ATOM 44     O O   . PHE A 1 6   ? -131.910 -70.037 -0.882  1.00 0.00 ? 19  PHE B O   1  
ATOM 45     C CB  . PHE A 1 6   ? -132.312 -69.134 -3.528  1.00 0.00 ? 19  PHE B CB  1  
ATOM 46     C CG  . PHE A 1 6   ? -132.538 -68.438 -4.870  1.00 0.00 ? 19  PHE B CG  1  
ATOM 47     C CD1 . PHE A 1 6   ? -131.473 -68.257 -5.729  1.00 0.00 ? 19  PHE B CD1 1  
ATOM 48     C CD2 . PHE A 1 6   ? -133.771 -67.919 -5.209  1.00 0.00 ? 19  PHE B CD2 1  
ATOM 49     C CE1 . PHE A 1 6   ? -131.620 -67.562 -6.903  1.00 0.00 ? 19  PHE B CE1 1  
ATOM 50     C CE2 . PHE A 1 6   ? -133.913 -67.221 -6.396  1.00 0.00 ? 19  PHE B CE2 1  
ATOM 51     C CZ  . PHE A 1 6   ? -132.845 -67.037 -7.243  1.00 0.00 ? 19  PHE B CZ  1  
ATOM 52     N N   . ASP A 1 7   ? -131.915 -67.977 -0.008  1.00 0.00 ? 20  ASP B N   1  
ATOM 53     C CA  . ASP A 1 7   ? -131.802 -68.410 1.372   1.00 0.00 ? 20  ASP B CA  1  
ATOM 54     C C   . ASP A 1 7   ? -132.984 -69.176 1.987   1.00 0.00 ? 20  ASP B C   1  
ATOM 55     O O   . ASP A 1 7   ? -134.145 -69.090 1.562   1.00 0.00 ? 20  ASP B O   1  
ATOM 56     C CB  . ASP A 1 7   ? -131.509 -67.179 2.228   1.00 0.00 ? 20  ASP B CB  1  
ATOM 57     C CG  . ASP A 1 7   ? -130.147 -66.528 2.012   1.00 0.00 ? 20  ASP B CG  1  
ATOM 58     O OD1 . ASP A 1 7   ? -129.677 -66.403 0.883   1.00 0.00 ? 20  ASP B OD1 1  
ATOM 59     O OD2 . ASP A 1 7   ? -129.548 -66.138 3.010   1.00 0.00 ? 20  ASP B OD2 1  
ATOM 60     N N   . GLN A 1 8   ? -132.745 -69.927 3.071   1.00 0.00 ? 21  GLN B N   1  
ATOM 61     C CA  . GLN A 1 8   ? -133.783 -70.696 3.771   1.00 0.00 ? 21  GLN B CA  1  
ATOM 62     C C   . GLN A 1 8   ? -135.067 -69.939 4.104   1.00 0.00 ? 21  GLN B C   1  
ATOM 63     O O   . GLN A 1 8   ? -136.154 -70.393 3.775   1.00 0.00 ? 21  GLN B O   1  
ATOM 64     C CB  . GLN A 1 8   ? -133.196 -71.265 5.044   1.00 0.00 ? 21  GLN B CB  1  
ATOM 65     C CG  . GLN A 1 8   ? -132.155 -72.315 4.671   1.00 0.00 ? 21  GLN B CG  1  
ATOM 66     C CD  . GLN A 1 8   ? -131.224 -72.802 5.776   1.00 0.00 ? 21  GLN B CD  1  
ATOM 67     O OE1 . GLN A 1 8   ? -131.171 -72.205 6.850   1.00 0.00 ? 21  GLN B OE1 1  
ATOM 68     N NE2 . GLN A 1 8   ? -130.525 -73.781 5.532   1.00 0.00 ? 21  GLN B NE2 1  
ATOM 69     N N   . THR A 1 9   ? -134.933 -68.696 4.586   1.00 0.00 ? 22  THR B N   1  
ATOM 70     C CA  . THR A 1 9   ? -136.073 -67.798 4.842   1.00 0.00 ? 22  THR B CA  1  
ATOM 71     C C   . THR A 1 9   ? -136.913 -67.560 3.582   1.00 0.00 ? 22  THR B C   1  
ATOM 72     O O   . THR A 1 9   ? -138.077 -67.934 3.559   1.00 0.00 ? 22  THR B O   1  
ATOM 73     C CB  . THR A 1 9   ? -135.618 -66.422 5.346   1.00 0.00 ? 22  THR B CB  1  
ATOM 74     O OG1 . THR A 1 9   ? -134.506 -66.016 4.545   1.00 0.00 ? 22  THR B OG1 1  
ATOM 75     C CG2 . THR A 1 9   ? -135.246 -66.459 6.818   1.00 0.00 ? 22  THR B CG2 1  
ATOM 76     N N   . GLN A 1 10  ? -136.326 -67.045 2.487   1.00 0.00 ? 23  GLN B N   1  
ATOM 77     C CA  . GLN A 1 10  ? -137.005 -66.908 1.186   1.00 0.00 ? 23  GLN B CA  1  
ATOM 78     C C   . GLN A 1 10  ? -137.775 -68.173 0.777   1.00 0.00 ? 23  GLN B C   1  
ATOM 79     O O   . GLN A 1 10  ? -138.965 -68.183 0.452   1.00 0.00 ? 23  GLN B O   1  
ATOM 80     C CB  . GLN A 1 10  ? -136.016 -66.652 0.056   1.00 0.00 ? 23  GLN B CB  1  
ATOM 81     C CG  . GLN A 1 10  ? -135.163 -65.398 0.057   1.00 0.00 ? 23  GLN B CG  1  
ATOM 82     C CD  . GLN A 1 10  ? -134.120 -65.415 -1.050  1.00 0.00 ? 23  GLN B CD  1  
ATOM 83     O OE1 . GLN A 1 10  ? -134.448 -65.662 -2.207  1.00 0.00 ? 23  GLN B OE1 1  
ATOM 84     N NE2 . GLN A 1 10  ? -132.949 -65.199 -0.756  1.00 0.00 ? 23  GLN B NE2 1  
ATOM 85     N N   . ILE A 1 11  ? -137.082 -69.316 0.852   1.00 0.00 ? 24  ILE B N   1  
ATOM 86     C CA  . ILE A 1 11  ? -137.680 -70.615 0.557   1.00 0.00 ? 24  ILE B CA  1  
ATOM 87     C C   . ILE A 1 11  ? -138.841 -70.960 1.508   1.00 0.00 ? 24  ILE B C   1  
ATOM 88     O O   . ILE A 1 11  ? -139.836 -71.554 1.082   1.00 0.00 ? 24  ILE B O   1  
ATOM 89     C CB  . ILE A 1 11  ? -136.575 -71.704 0.617   1.00 0.00 ? 24  ILE B CB  1  
ATOM 90     C CG1 . ILE A 1 11  ? -135.460 -71.409 -0.384  1.00 0.00 ? 24  ILE B CG1 1  
ATOM 91     C CG2 . ILE A 1 11  ? -137.163 -73.056 0.221   1.00 0.00 ? 24  ILE B CG2 1  
ATOM 92     C CD1 . ILE A 1 11  ? -134.236 -72.340 -0.247  1.00 0.00 ? 24  ILE B CD1 1  
ATOM 93     N N   . GLN A 1 12  ? -138.786 -70.661 2.806   1.00 0.00 ? 25  GLN B N   1  
ATOM 94     C CA  . GLN A 1 12  ? -139.913 -70.859 3.721   1.00 0.00 ? 25  GLN B CA  1  
ATOM 95     C C   . GLN A 1 12  ? -141.097 -69.949 3.417   1.00 0.00 ? 25  GLN B C   1  
ATOM 96     O O   . GLN A 1 12  ? -142.210 -70.468 3.297   1.00 0.00 ? 25  GLN B O   1  
ATOM 97     C CB  . GLN A 1 12  ? -139.416 -70.658 5.145   1.00 0.00 ? 25  GLN B CB  1  
ATOM 98     C CG  . GLN A 1 12  ? -138.611 -71.918 5.446   1.00 0.00 ? 25  GLN B CG  1  
ATOM 99     C CD  . GLN A 1 12  ? -137.780 -71.974 6.715   1.00 0.00 ? 25  GLN B CD  1  
ATOM 100    O OE1 . GLN A 1 12  ? -137.640 -70.990 7.440   1.00 0.00 ? 25  GLN B OE1 1  
ATOM 101    N NE2 . GLN A 1 12  ? -137.251 -73.063 6.943   1.00 0.00 ? 25  GLN B NE2 1  
ATOM 102    N N   . ASP A 1 13  ? -140.875 -68.660 3.132   1.00 0.00 ? 26  ASP B N   1  
ATOM 103    C CA  . ASP A 1 13  ? -141.910 -67.733 2.653   1.00 0.00 ? 26  ASP B CA  1  
ATOM 104    C C   . ASP A 1 13  ? -142.648 -68.350 1.452   1.00 0.00 ? 26  ASP B C   1  
ATOM 105    O O   . ASP A 1 13  ? -143.880 -68.473 1.400   1.00 0.00 ? 26  ASP B O   1  
ATOM 106    C CB  . ASP A 1 13  ? -141.288 -66.403 2.196   1.00 0.00 ? 26  ASP B CB  1  
ATOM 107    C CG  . ASP A 1 13  ? -140.413 -65.616 3.168   1.00 0.00 ? 26  ASP B CG  1  
ATOM 108    O OD1 . ASP A 1 13  ? -140.304 -65.958 4.342   1.00 0.00 ? 26  ASP B OD1 1  
ATOM 109    O OD2 . ASP A 1 13  ? -139.822 -64.637 2.726   1.00 0.00 ? 26  ASP B OD2 1  
ATOM 110    N N   . PHE A 1 14  ? -141.883 -68.845 0.469   1.00 0.00 ? 27  PHE B N   1  
ATOM 111    C CA  . PHE A 1 14  ? -142.442 -69.606 -0.653  1.00 0.00 ? 27  PHE B CA  1  
ATOM 112    C C   . PHE A 1 14  ? -143.199 -70.864 -0.208  1.00 0.00 ? 27  PHE B C   1  
ATOM 113    O O   . PHE A 1 14  ? -144.345 -71.051 -0.611  1.00 0.00 ? 27  PHE B O   1  
ATOM 114    C CB  . PHE A 1 14  ? -141.340 -70.042 -1.621  1.00 0.00 ? 27  PHE B CB  1  
ATOM 115    C CG  . PHE A 1 14  ? -140.625 -68.931 -2.383  1.00 0.00 ? 27  PHE B CG  1  
ATOM 116    C CD1 . PHE A 1 14  ? -139.244 -68.955 -2.449  1.00 0.00 ? 27  PHE B CD1 1  
ATOM 117    C CD2 . PHE A 1 14  ? -141.326 -67.912 -2.992  1.00 0.00 ? 27  PHE B CD2 1  
ATOM 118    C CE1 . PHE A 1 14  ? -138.569 -67.962 -3.124  1.00 0.00 ? 27  PHE B CE1 1  
ATOM 119    C CE2 . PHE A 1 14  ? -140.639 -66.924 -3.671  1.00 0.00 ? 27  PHE B CE2 1  
ATOM 120    C CZ  . PHE A 1 14  ? -139.263 -66.948 -3.734  1.00 0.00 ? 27  PHE B CZ  1  
ATOM 121    N N   . LYS A 1 15  ? -142.659 -71.759 0.631   1.00 0.00 ? 28  LYS B N   1  
ATOM 122    C CA  . LYS A 1 15  ? -143.378 -72.935 1.158   1.00 0.00 ? 28  LYS B CA  1  
ATOM 123    C C   . LYS A 1 15  ? -144.727 -72.617 1.820   1.00 0.00 ? 28  LYS B C   1  
ATOM 124    O O   . LYS A 1 15  ? -145.759 -73.238 1.528   1.00 0.00 ? 28  LYS B O   1  
ATOM 125    C CB  . LYS A 1 15  ? -142.513 -73.670 2.178   1.00 0.00 ? 28  LYS B CB  1  
ATOM 126    C CG  . LYS A 1 15  ? -141.282 -74.355 1.609   1.00 0.00 ? 28  LYS B CG  1  
ATOM 127    C CD  . LYS A 1 15  ? -140.367 -74.735 2.766   1.00 0.00 ? 28  LYS B CD  1  
ATOM 128    C CE  . LYS A 1 15  ? -139.059 -75.307 2.255   1.00 0.00 ? 28  LYS B CE  1  
ATOM 129    N NZ  . LYS A 1 15  ? -138.087 -75.423 3.325   1.00 0.00 ? 28  LYS B NZ  1  
ATOM 130    N N   . GLU A 1 16  ? -144.782 -71.613 2.693   1.00 0.00 ? 29  GLU B N   1  
ATOM 131    C CA  . GLU A 1 16  ? -146.031 -71.142 3.277   1.00 0.00 ? 29  GLU B CA  1  
ATOM 132    C C   . GLU A 1 16  ? -146.971 -70.610 2.189   1.00 0.00 ? 29  GLU B C   1  
ATOM 133    O O   . GLU A 1 16  ? -148.132 -71.002 2.107   1.00 0.00 ? 29  GLU B O   1  
ATOM 134    C CB  . GLU A 1 16  ? -145.757 -70.040 4.270   1.00 0.00 ? 29  GLU B CB  1  
ATOM 135    C CG  . GLU A 1 16  ? -144.954 -70.511 5.474   1.00 0.00 ? 29  GLU B CG  1  
ATOM 136    C CD  . GLU A 1 16  ? -144.635 -69.444 6.510   1.00 0.00 ? 29  GLU B CD  1  
ATOM 137    O OE1 . GLU A 1 16  ? -144.985 -68.276 6.328   1.00 0.00 ? 29  GLU B OE1 1  
ATOM 138    O OE2 . GLU A 1 16  ? -144.033 -69.804 7.519   1.00 0.00 ? 29  GLU B OE2 1  
ATOM 139    N N   . ALA A 1 17  ? -146.485 -69.783 1.250   1.00 0.00 ? 30  ALA B N   1  
ATOM 140    C CA  . ALA A 1 17  ? -147.287 -69.328 0.110   1.00 0.00 ? 30  ALA B CA  1  
ATOM 141    C C   . ALA A 1 17  ? -147.905 -70.454 -0.717  1.00 0.00 ? 30  ALA B C   1  
ATOM 142    O O   . ALA A 1 17  ? -149.086 -70.433 -1.052  1.00 0.00 ? 30  ALA B O   1  
ATOM 143    C CB  . ALA A 1 17  ? -146.435 -68.486 -0.827  1.00 0.00 ? 30  ALA B CB  1  
ATOM 144    N N   . PHE A 1 18  ? -147.117 -71.499 -1.000  1.00 0.00 ? 31  PHE B N   1  
ATOM 145    C CA  . PHE A 1 18  ? -147.609 -72.703 -1.667  1.00 0.00 ? 31  PHE B CA  1  
ATOM 146    C C   . PHE A 1 18  ? -148.704 -73.331 -0.812  1.00 0.00 ? 31  PHE B C   1  
ATOM 147    O O   . PHE A 1 18  ? -149.838 -73.346 -1.258  1.00 0.00 ? 31  PHE B O   1  
ATOM 148    C CB  . PHE A 1 18  ? -146.475 -73.720 -1.877  1.00 0.00 ? 31  PHE B CB  1  
ATOM 149    C CG  . PHE A 1 18  ? -145.286 -73.178 -2.671  1.00 0.00 ? 31  PHE B CG  1  
ATOM 150    C CD1 . PHE A 1 18  ? -144.036 -73.719 -2.452  1.00 0.00 ? 31  PHE B CD1 1  
ATOM 151    C CD2 . PHE A 1 18  ? -145.443 -72.136 -3.568  1.00 0.00 ? 31  PHE B CD2 1  
ATOM 152    C CE1 . PHE A 1 18  ? -142.947 -73.208 -3.126  1.00 0.00 ? 31  PHE B CE1 1  
ATOM 153    C CE2 . PHE A 1 18  ? -144.346 -71.633 -4.236  1.00 0.00 ? 31  PHE B CE2 1  
ATOM 154    C CZ  . PHE A 1 18  ? -143.101 -72.165 -4.016  1.00 0.00 ? 31  PHE B CZ  1  
ATOM 155    N N   . THR A 1 19  ? -148.486 -73.676 0.468   1.00 0.00 ? 32  THR B N   1  
ATOM 156    C CA  . THR A 1 19  ? -149.556 -74.246 1.310   1.00 0.00 ? 32  THR B CA  1  
ATOM 157    C C   . THR A 1 19  ? -150.835 -73.405 1.473   1.00 0.00 ? 32  THR B C   1  
ATOM 158    O O   . THR A 1 19  ? -151.894 -73.925 1.812   1.00 0.00 ? 32  THR B O   1  
ATOM 159    C CB  . THR A 1 19  ? -149.088 -74.562 2.750   1.00 0.00 ? 32  THR B CB  1  
ATOM 160    O OG1 . THR A 1 19  ? -148.640 -73.365 3.374   1.00 0.00 ? 32  THR B OG1 1  
ATOM 161    C CG2 . THR A 1 19  ? -147.972 -75.596 2.746   1.00 0.00 ? 32  THR B CG2 1  
ATOM 162    N N   . VAL A 1 20  ? -150.772 -72.077 1.297   1.00 0.00 ? 33  VAL B N   1  
ATOM 163    C CA  . VAL A 1 20  ? -151.988 -71.255 1.244   1.00 0.00 ? 33  VAL B CA  1  
ATOM 164    C C   . VAL A 1 20  ? -152.725 -71.375 -0.102  1.00 0.00 ? 33  VAL B C   1  
ATOM 165    O O   . VAL A 1 20  ? -153.954 -71.325 -0.153  1.00 0.00 ? 33  VAL B O   1  
ATOM 166    C CB  . VAL A 1 20  ? -151.571 -69.792 1.562   1.00 0.00 ? 33  VAL B CB  1  
ATOM 167    C CG1 . VAL A 1 20  ? -152.556 -68.723 1.087   1.00 0.00 ? 33  VAL B CG1 1  
ATOM 168    C CG2 . VAL A 1 20  ? -151.509 -69.716 3.073   1.00 0.00 ? 33  VAL B CG2 1  
ATOM 169    N N   . ILE A 1 21  ? -152.012 -71.497 -1.227  1.00 0.00 ? 34  ILE B N   1  
ATOM 170    C CA  . ILE A 1 21  ? -152.687 -71.735 -2.503  1.00 0.00 ? 34  ILE B CA  1  
ATOM 171    C C   . ILE A 1 21  ? -153.129 -73.216 -2.646  1.00 0.00 ? 34  ILE B C   1  
ATOM 172    O O   . ILE A 1 21  ? -154.160 -73.514 -3.248  1.00 0.00 ? 34  ILE B O   1  
ATOM 173    C CB  . ILE A 1 21  ? -151.738 -71.286 -3.656  1.00 0.00 ? 34  ILE B CB  1  
ATOM 174    C CG1 . ILE A 1 21  ? -151.240 -69.855 -3.470  1.00 0.00 ? 34  ILE B CG1 1  
ATOM 175    C CG2 . ILE A 1 21  ? -152.533 -71.308 -4.964  1.00 0.00 ? 34  ILE B CG2 1  
ATOM 176    C CD1 . ILE A 1 21  ? -150.131 -69.416 -4.451  1.00 0.00 ? 34  ILE B CD1 1  
ATOM 177    N N   . ASP A 1 22  ? -152.386 -74.159 -2.053  1.00 0.00 ? 35  ASP B N   1  
ATOM 178    C CA  . ASP A 1 22  ? -152.696 -75.592 -1.941  1.00 0.00 ? 35  ASP B CA  1  
ATOM 179    C C   . ASP A 1 22  ? -153.980 -75.935 -1.146  1.00 0.00 ? 35  ASP B C   1  
ATOM 180    O O   . ASP A 1 22  ? -153.947 -76.614 -0.111  1.00 0.00 ? 35  ASP B O   1  
ATOM 181    C CB  . ASP A 1 22  ? -151.494 -76.317 -1.277  1.00 0.00 ? 35  ASP B CB  1  
ATOM 182    C CG  . ASP A 1 22  ? -150.402 -76.924 -2.151  1.00 0.00 ? 35  ASP B CG  1  
ATOM 183    O OD1 . ASP A 1 22  ? -149.418 -76.250 -2.440  1.00 0.00 ? 35  ASP B OD1 1  
ATOM 184    O OD2 . ASP A 1 22  ? -150.519 -78.099 -2.503  1.00 0.00 ? 35  ASP B OD2 1  
ATOM 185    N N   . GLN A 1 23  ? -155.178 -75.551 -1.593  1.00 0.00 ? 36  GLN B N   1  
ATOM 186    C CA  . GLN A 1 23  ? -156.442 -75.801 -0.870  1.00 0.00 ? 36  GLN B CA  1  
ATOM 187    C C   . GLN A 1 23  ? -156.688 -77.185 -0.277  1.00 0.00 ? 36  GLN B C   1  
ATOM 188    O O   . GLN A 1 23  ? -157.094 -77.372 0.870   1.00 0.00 ? 36  GLN B O   1  
ATOM 189    C CB  . GLN A 1 23  ? -157.658 -75.621 -1.708  1.00 0.00 ? 36  GLN B CB  1  
ATOM 190    C CG  . GLN A 1 23  ? -158.085 -74.278 -2.163  1.00 0.00 ? 36  GLN B CG  1  
ATOM 191    C CD  . GLN A 1 23  ? -158.914 -74.481 -3.411  1.00 0.00 ? 36  GLN B CD  1  
ATOM 192    O OE1 . GLN A 1 23  ? -159.402 -75.539 -3.775  1.00 0.00 ? 36  GLN B OE1 1  
ATOM 193    N NE2 . GLN A 1 23  ? -158.980 -73.516 -4.276  1.00 0.00 ? 36  GLN B NE2 1  
ATOM 194    N N   . ASN A 1 24  ? -156.423 -78.183 -1.108  1.00 0.00 ? 37  ASN B N   1  
ATOM 195    C CA  . ASN A 1 24  ? -156.658 -79.569 -0.734  1.00 0.00 ? 37  ASN B CA  1  
ATOM 196    C C   . ASN A 1 24  ? -155.658 -80.206 0.234   1.00 0.00 ? 37  ASN B C   1  
ATOM 197    O O   . ASN A 1 24  ? -155.924 -81.263 0.804   1.00 0.00 ? 37  ASN B O   1  
ATOM 198    C CB  . ASN A 1 24  ? -156.735 -80.385 -2.022  1.00 0.00 ? 37  ASN B CB  1  
ATOM 199    C CG  . ASN A 1 24  ? -157.879 -79.935 -2.923  1.00 0.00 ? 37  ASN B CG  1  
ATOM 200    O OD1 . ASN A 1 24  ? -159.052 -80.156 -2.644  1.00 0.00 ? 37  ASN B OD1 1  
ATOM 201    N ND2 . ASN A 1 24  ? -157.669 -79.249 -4.019  1.00 0.00 ? 37  ASN B ND2 1  
ATOM 202    N N   . ARG A 1 25  ? -154.513 -79.562 0.509   1.00 0.00 ? 38  ARG B N   1  
ATOM 203    C CA  . ARG A 1 25  ? -153.387 -80.089 1.299   1.00 0.00 ? 38  ARG B CA  1  
ATOM 204    C C   . ARG A 1 25  ? -152.613 -81.287 0.722   1.00 0.00 ? 38  ARG B C   1  
ATOM 205    O O   . ARG A 1 25  ? -151.559 -81.663 1.239   1.00 0.00 ? 38  ARG B O   1  
ATOM 206    C CB  . ARG A 1 25  ? -153.829 -80.490 2.717   1.00 0.00 ? 38  ARG B CB  1  
ATOM 207    N N   . ASP A 1 26  ? -153.100 -81.889 -0.366  1.00 0.00 ? 39  ASP B N   1  
ATOM 208    C CA  . ASP A 1 26  ? -152.455 -82.964 -1.124  1.00 0.00 ? 39  ASP B CA  1  
ATOM 209    C C   . ASP A 1 26  ? -150.947 -82.869 -1.423  1.00 0.00 ? 39  ASP B C   1  
ATOM 210    O O   . ASP A 1 26  ? -150.203 -83.850 -1.354  1.00 0.00 ? 39  ASP B O   1  
ATOM 211    C CB  . ASP A 1 26  ? -153.200 -83.126 -2.451  1.00 0.00 ? 39  ASP B CB  1  
ATOM 212    C CG  . ASP A 1 26  ? -154.678 -83.500 -2.390  1.00 0.00 ? 39  ASP B CG  1  
ATOM 213    O OD1 . ASP A 1 26  ? -155.299 -83.379 -1.336  1.00 0.00 ? 39  ASP B OD1 1  
ATOM 214    O OD2 . ASP A 1 26  ? -155.212 -83.902 -3.416  1.00 0.00 ? 39  ASP B OD2 1  
ATOM 215    N N   . GLY A 1 27  ? -150.461 -81.685 -1.796  1.00 0.00 ? 40  GLY B N   1  
ATOM 216    C CA  . GLY A 1 27  ? -149.052 -81.480 -2.131  1.00 0.00 ? 40  GLY B CA  1  
ATOM 217    C C   . GLY A 1 27  ? -148.798 -80.912 -3.537  1.00 0.00 ? 40  GLY B C   1  
ATOM 218    O O   . GLY A 1 27  ? -147.682 -80.538 -3.923  1.00 0.00 ? 40  GLY B O   1  
ATOM 219    N N   . ILE A 1 28  ? -149.860 -80.918 -4.338  1.00 0.00 ? 41  ILE B N   1  
ATOM 220    C CA  . ILE A 1 28  ? -149.845 -80.404 -5.706  1.00 0.00 ? 41  ILE B CA  1  
ATOM 221    C C   . ILE A 1 28  ? -150.918 -79.315 -5.871  1.00 0.00 ? 41  ILE B C   1  
ATOM 222    O O   . ILE A 1 28  ? -152.083 -79.559 -5.563  1.00 0.00 ? 41  ILE B O   1  
ATOM 223    C CB  . ILE A 1 28  ? -150.155 -81.515 -6.754  1.00 0.00 ? 41  ILE B CB  1  
ATOM 224    C CG1 . ILE A 1 28  ? -149.417 -82.819 -6.477  1.00 0.00 ? 41  ILE B CG1 1  
ATOM 225    C CG2 . ILE A 1 28  ? -149.747 -80.961 -8.120  1.00 0.00 ? 41  ILE B CG2 1  
ATOM 226    C CD1 . ILE A 1 28  ? -149.677 -83.972 -7.470  1.00 0.00 ? 41  ILE B CD1 1  
ATOM 227    N N   . ILE A 1 29  ? -150.562 -78.100 -6.282  1.00 0.00 ? 42  ILE B N   1  
ATOM 228    C CA  . ILE A 1 29  ? -151.574 -77.098 -6.634  1.00 0.00 ? 42  ILE B CA  1  
ATOM 229    C C   . ILE A 1 29  ? -152.118 -77.360 -8.032  1.00 0.00 ? 42  ILE B C   1  
ATOM 230    O O   . ILE A 1 29  ? -151.335 -77.585 -8.959  1.00 0.00 ? 42  ILE B O   1  
ATOM 231    C CB  . ILE A 1 29  ? -150.976 -75.663 -6.586  1.00 0.00 ? 42  ILE B CB  1  
ATOM 232    C CG1 . ILE A 1 29  ? -151.037 -75.224 -5.154  1.00 0.00 ? 42  ILE B CG1 1  
ATOM 233    C CG2 . ILE A 1 29  ? -151.741 -74.625 -7.420  1.00 0.00 ? 42  ILE B CG2 1  
ATOM 234    C CD1 . ILE A 1 29  ? -150.159 -74.001 -4.848  1.00 0.00 ? 42  ILE B CD1 1  
ATOM 235    N N   . ASP A 1 30  ? -153.435 -77.277 -8.196  1.00 0.00 ? 43  ASP B N   1  
ATOM 236    C CA  . ASP A 1 30  ? -154.054 -77.381 -9.503  1.00 0.00 ? 43  ASP B CA  1  
ATOM 237    C C   . ASP A 1 30  ? -155.027 -76.237 -9.832  1.00 0.00 ? 43  ASP B C   1  
ATOM 238    O O   . ASP A 1 30  ? -155.090 -75.202 -9.154  1.00 0.00 ? 43  ASP B O   1  
ATOM 239    C CB  . ASP A 1 30  ? -154.784 -78.724 -9.600  1.00 0.00 ? 43  ASP B CB  1  
ATOM 240    C CG  . ASP A 1 30  ? -153.925 -79.956 -9.869  1.00 0.00 ? 43  ASP B CG  1  
ATOM 241    O OD1 . ASP A 1 30  ? -152.797 -79.839 -10.344 1.00 0.00 ? 43  ASP B OD1 1  
ATOM 242    O OD2 . ASP A 1 30  ? -154.408 -81.057 -9.636  1.00 0.00 ? 43  ASP B OD2 1  
ATOM 243    N N   . LYS A 1 31  ? -155.833 -76.362 -10.891 1.00 0.00 ? 44  LYS B N   1  
ATOM 244    C CA  . LYS A 1 31  ? -156.815 -75.336 -11.276 1.00 0.00 ? 44  LYS B CA  1  
ATOM 245    C C   . LYS A 1 31  ? -157.827 -74.994 -10.188 1.00 0.00 ? 44  LYS B C   1  
ATOM 246    O O   . LYS A 1 31  ? -158.139 -73.828 -9.961  1.00 0.00 ? 44  LYS B O   1  
ATOM 247    C CB  . LYS A 1 31  ? -157.613 -75.760 -12.508 1.00 0.00 ? 44  LYS B CB  1  
ATOM 248    C CG  . LYS A 1 31  ? -156.744 -75.893 -13.741 1.00 0.00 ? 44  LYS B CG  1  
ATOM 249    C CD  . LYS A 1 31  ? -157.514 -76.162 -15.014 1.00 0.00 ? 44  LYS B CD  1  
ATOM 250    C CE  . LYS A 1 31  ? -156.489 -76.350 -16.120 1.00 0.00 ? 44  LYS B CE  1  
ATOM 251    N NZ  . LYS A 1 31  ? -157.129 -76.350 -17.414 1.00 0.00 ? 44  LYS B NZ  1  
ATOM 252    N N   . ASP A 1 32  ? -158.307 -76.020 -9.495  1.00 0.00 ? 45  ASP B N   1  
ATOM 253    C CA  . ASP A 1 32  ? -159.244 -75.880 -8.393  1.00 0.00 ? 45  ASP B CA  1  
ATOM 254    C C   . ASP A 1 32  ? -158.633 -75.079 -7.240  1.00 0.00 ? 45  ASP B C   1  
ATOM 255    O O   . ASP A 1 32  ? -159.177 -74.024 -6.876  1.00 0.00 ? 45  ASP B O   1  
ATOM 256    C CB  . ASP A 1 32  ? -159.652 -77.312 -8.027  1.00 0.00 ? 45  ASP B CB  1  
ATOM 257    C CG  . ASP A 1 32  ? -160.324 -78.088 -9.165  1.00 0.00 ? 45  ASP B CG  1  
ATOM 258    O OD1 . ASP A 1 32  ? -160.481 -77.568 -10.284 1.00 0.00 ? 45  ASP B OD1 1  
ATOM 259    O OD2 . ASP A 1 32  ? -160.684 -79.241 -8.945  1.00 0.00 ? 45  ASP B OD2 1  
ATOM 260    N N   . ASP A 1 33  ? -157.429 -75.465 -6.795  1.00 0.00 ? 46  ASP B N   1  
ATOM 261    C CA  . ASP A 1 33  ? -156.656 -74.735 -5.791  1.00 0.00 ? 46  ASP B CA  1  
ATOM 262    C C   . ASP A 1 33  ? -156.473 -73.243 -6.115  1.00 0.00 ? 46  ASP B C   1  
ATOM 263    O O   . ASP A 1 33  ? -156.810 -72.358 -5.316  1.00 0.00 ? 46  ASP B O   1  
ATOM 264    C CB  . ASP A 1 33  ? -155.320 -75.464 -5.628  1.00 0.00 ? 46  ASP B CB  1  
ATOM 265    C CG  . ASP A 1 33  ? -155.539 -76.882 -5.124  1.00 0.00 ? 46  ASP B CG  1  
ATOM 266    O OD1 . ASP A 1 33  ? -155.803 -77.740 -5.955  1.00 0.00 ? 46  ASP B OD1 1  
ATOM 267    O OD2 . ASP A 1 33  ? -155.503 -77.146 -3.924  1.00 0.00 ? 46  ASP B OD2 1  
ATOM 268    N N   . LEU A 1 34  ? -156.089 -72.922 -7.349  1.00 0.00 ? 47  LEU B N   1  
ATOM 269    C CA  . LEU A 1 34  ? -156.065 -71.529 -7.807  1.00 0.00 ? 47  LEU B CA  1  
ATOM 270    C C   . LEU A 1 34  ? -157.444 -70.842 -7.754  1.00 0.00 ? 47  LEU B C   1  
ATOM 271    O O   . LEU A 1 34  ? -157.590 -69.778 -7.140  1.00 0.00 ? 47  LEU B O   1  
ATOM 272    C CB  . LEU A 1 34  ? -155.529 -71.479 -9.235  1.00 0.00 ? 47  LEU B CB  1  
ATOM 273    C CG  . LEU A 1 34  ? -154.105 -71.941 -9.518  1.00 0.00 ? 47  LEU B CG  1  
ATOM 274    C CD1 . LEU A 1 34  ? -153.885 -71.962 -11.018 1.00 0.00 ? 47  LEU B CD1 1  
ATOM 275    C CD2 . LEU A 1 34  ? -153.104 -71.021 -8.843  1.00 0.00 ? 47  LEU B CD2 1  
ATOM 276    N N   . ARG A 1 35  ? -158.506 -71.419 -8.338  1.00 0.00 ? 48  ARG B N   1  
ATOM 277    C CA  . ARG A 1 35  ? -159.870 -70.858 -8.301  1.00 0.00 ? 48  ARG B CA  1  
ATOM 278    C C   . ARG A 1 35  ? -160.379 -70.390 -6.938  1.00 0.00 ? 48  ARG B C   1  
ATOM 279    O O   . ARG A 1 35  ? -160.691 -69.210 -6.756  1.00 0.00 ? 48  ARG B O   1  
ATOM 280    C CB  . ARG A 1 35  ? -160.873 -71.878 -8.835  1.00 0.00 ? 48  ARG B CB  1  
ATOM 281    C CG  . ARG A 1 35  ? -160.727 -72.109 -10.323 1.00 0.00 ? 48  ARG B CG  1  
ATOM 282    C CD  . ARG A 1 35  ? -161.462 -73.353 -10.786 1.00 0.00 ? 48  ARG B CD  1  
ATOM 283    N NE  . ARG A 1 35  ? -161.084 -73.641 -12.162 1.00 0.00 ? 48  ARG B NE  1  
ATOM 284    C CZ  . ARG A 1 35  ? -161.749 -74.462 -12.939 1.00 0.00 ? 48  ARG B CZ  1  
ATOM 285    N NH1 . ARG A 1 35  ? -162.795 -75.119 -12.516 1.00 0.00 ? 48  ARG B NH1 1  
ATOM 286    N NH2 . ARG A 1 35  ? -161.358 -74.619 -14.168 1.00 0.00 ? 48  ARG B NH2 1  
ATOM 287    N N   . GLU A 1 36  ? -160.418 -71.248 -5.913  1.00 0.00 ? 49  GLU B N   1  
ATOM 288    C CA  . GLU A 1 36  ? -160.868 -70.751 -4.611  1.00 0.00 ? 49  GLU B CA  1  
ATOM 289    C C   . GLU A 1 36  ? -159.815 -69.911 -3.900  1.00 0.00 ? 49  GLU B C   1  
ATOM 290    O O   . GLU A 1 36  ? -160.217 -69.109 -3.057  1.00 0.00 ? 49  GLU B O   1  
ATOM 291    C CB  . GLU A 1 36  ? -161.278 -71.868 -3.667  1.00 0.00 ? 49  GLU B CB  1  
ATOM 292    C CG  . GLU A 1 36  ? -162.347 -72.807 -4.209  1.00 0.00 ? 49  GLU B CG  1  
ATOM 293    C CD  . GLU A 1 36  ? -162.561 -74.079 -3.398  1.00 0.00 ? 49  GLU B CD  1  
ATOM 294    O OE1 . GLU A 1 36  ? -162.176 -74.145 -2.227  1.00 0.00 ? 49  GLU B OE1 1  
ATOM 295    O OE2 . GLU A 1 36  ? -163.141 -75.014 -3.954  1.00 0.00 ? 49  GLU B OE2 1  
ATOM 296    N N   . THR A 1 37  ? -158.488 -69.941 -4.143  1.00 0.00 ? 50  THR B N   1  
ATOM 297    C CA  . THR A 1 37  ? -157.619 -68.922 -3.522  1.00 0.00 ? 50  THR B CA  1  
ATOM 298    C C   . THR A 1 37  ? -157.959 -67.540 -4.060  1.00 0.00 ? 50  THR B C   1  
ATOM 299    O O   . THR A 1 37  ? -158.086 -66.572 -3.304  1.00 0.00 ? 50  THR B O   1  
ATOM 300    C CB  . THR A 1 37  ? -156.119 -69.111 -3.770  1.00 0.00 ? 50  THR B CB  1  
ATOM 301    O OG1 . THR A 1 37  ? -155.814 -69.313 -5.146  1.00 0.00 ? 50  THR B OG1 1  
ATOM 302    C CG2 . THR A 1 37  ? -155.699 -70.294 -2.942  1.00 0.00 ? 50  THR B CG2 1  
ATOM 303    N N   . PHE A 1 38  ? -158.210 -67.420 -5.372  1.00 0.00 ? 51  PHE B N   1  
ATOM 304    C CA  . PHE A 1 38  ? -158.704 -66.171 -5.952  1.00 0.00 ? 51  PHE B CA  1  
ATOM 305    C C   . PHE A 1 38  ? -160.034 -65.735 -5.325  1.00 0.00 ? 51  PHE B C   1  
ATOM 306    O O   . PHE A 1 38  ? -160.188 -64.587 -4.898  1.00 0.00 ? 51  PHE B O   1  
ATOM 307    C CB  . PHE A 1 38  ? -158.927 -66.305 -7.453  1.00 0.00 ? 51  PHE B CB  1  
ATOM 308    C CG  . PHE A 1 38  ? -157.661 -66.483 -8.273  1.00 0.00 ? 51  PHE B CG  1  
ATOM 309    C CD1 . PHE A 1 38  ? -157.535 -67.571 -9.110  1.00 0.00 ? 51  PHE B CD1 1  
ATOM 310    C CD2 . PHE A 1 38  ? -156.640 -65.557 -8.190  1.00 0.00 ? 51  PHE B CD2 1  
ATOM 311    C CE1 . PHE A 1 38  ? -156.392 -67.740 -9.863  1.00 0.00 ? 51  PHE B CE1 1  
ATOM 312    C CE2 . PHE A 1 38  ? -155.508 -65.740 -8.947  1.00 0.00 ? 51  PHE B CE2 1  
ATOM 313    C CZ  . PHE A 1 38  ? -155.372 -66.825 -9.779  1.00 0.00 ? 51  PHE B CZ  1  
ATOM 314    N N   . ALA A 1 39  ? -160.998 -66.657 -5.227  1.00 0.00 ? 52  ALA B N   1  
ATOM 315    C CA  . ALA A 1 39  ? -162.272 -66.414 -4.545  1.00 0.00 ? 52  ALA B CA  1  
ATOM 316    C C   . ALA A 1 39  ? -162.131 -65.969 -3.078  1.00 0.00 ? 52  ALA B C   1  
ATOM 317    O O   . ALA A 1 39  ? -162.742 -64.988 -2.660  1.00 0.00 ? 52  ALA B O   1  
ATOM 318    C CB  . ALA A 1 39  ? -163.122 -67.671 -4.573  1.00 0.00 ? 52  ALA B CB  1  
ATOM 319    N N   . ALA A 1 40  ? -161.293 -66.630 -2.274  1.00 0.00 ? 53  ALA B N   1  
ATOM 320    C CA  . ALA A 1 40  ? -160.991 -66.231 -0.897  1.00 0.00 ? 53  ALA B CA  1  
ATOM 321    C C   . ALA A 1 40  ? -160.386 -64.821 -0.783  1.00 0.00 ? 53  ALA B C   1  
ATOM 322    O O   . ALA A 1 40  ? -160.640 -64.081 0.168   1.00 0.00 ? 53  ALA B O   1  
ATOM 323    C CB  . ALA A 1 40  ? -160.005 -67.209 -0.274  1.00 0.00 ? 53  ALA B CB  1  
ATOM 324    N N   . MET A 1 41  ? -159.560 -64.436 -1.756  1.00 0.00 ? 54  MET B N   1  
ATOM 325    C CA  . MET A 1 41  ? -159.050 -63.066 -1.844  1.00 0.00 ? 54  MET B CA  1  
ATOM 326    C C   . MET A 1 41  ? -160.035 -62.027 -2.428  1.00 0.00 ? 54  MET B C   1  
ATOM 327    O O   . MET A 1 41  ? -159.689 -60.859 -2.626  1.00 0.00 ? 54  MET B O   1  
ATOM 328    C CB  . MET A 1 41  ? -157.777 -63.040 -2.689  1.00 0.00 ? 54  MET B CB  1  
ATOM 329    C CG  . MET A 1 41  ? -156.632 -63.905 -2.167  1.00 0.00 ? 54  MET B CG  1  
ATOM 330    S SD  . MET A 1 41  ? -156.236 -63.608 -0.429  1.00 0.00 ? 54  MET B SD  1  
ATOM 331    C CE  . MET A 1 41  ? -155.248 -62.148 -0.588  1.00 0.00 ? 54  MET B CE  1  
ATOM 332    N N   . GLY A 1 42  ? -161.266 -62.421 -2.758  1.00 0.00 ? 55  GLY B N   1  
ATOM 333    C CA  . GLY A 1 42  ? -162.274 -61.511 -3.305  1.00 0.00 ? 55  GLY B CA  1  
ATOM 334    C C   . GLY A 1 42  ? -162.487 -61.583 -4.821  1.00 0.00 ? 55  GLY B C   1  
ATOM 335    O O   . GLY A 1 42  ? -163.468 -61.072 -5.375  1.00 0.00 ? 55  GLY B O   1  
ATOM 336    N N   . ARG A 1 43  ? -161.614 -62.259 -5.569  1.00 0.00 ? 56  ARG B N   1  
ATOM 337    C CA  . ARG A 1 43  ? -161.738 -62.330 -7.025  1.00 0.00 ? 56  ARG B CA  1  
ATOM 338    C C   . ARG A 1 43  ? -162.659 -63.434 -7.542  1.00 0.00 ? 56  ARG B C   1  
ATOM 339    O O   . ARG A 1 43  ? -162.292 -64.604 -7.668  1.00 0.00 ? 56  ARG B O   1  
ATOM 340    C CB  . ARG A 1 43  ? -160.386 -62.544 -7.686  1.00 0.00 ? 56  ARG B CB  1  
ATOM 341    C CG  . ARG A 1 43  ? -159.292 -61.556 -7.361  1.00 0.00 ? 56  ARG B CG  1  
ATOM 342    C CD  . ARG A 1 43  ? -158.127 -61.978 -8.227  1.00 0.00 ? 56  ARG B CD  1  
ATOM 343    N NE  . ARG A 1 43  ? -156.893 -61.357 -7.793  1.00 0.00 ? 56  ARG B NE  1  
ATOM 344    C CZ  . ARG A 1 43  ? -155.747 -61.581 -8.408  1.00 0.00 ? 56  ARG B CZ  1  
ATOM 345    N NH1 . ARG A 1 43  ? -155.661 -62.304 -9.488  1.00 0.00 ? 56  ARG B NH1 1  
ATOM 346    N NH2 . ARG A 1 43  ? -154.660 -61.065 -7.898  1.00 0.00 ? 56  ARG B NH2 1  
ATOM 347    N N   . LEU A 1 44  ? -163.887 -63.079 -7.898  1.00 0.00 ? 57  LEU B N   1  
ATOM 348    C CA  . LEU A 1 44  ? -164.842 -64.056 -8.423  1.00 0.00 ? 57  LEU B CA  1  
ATOM 349    C C   . LEU A 1 44  ? -164.917 -64.192 -9.952  1.00 0.00 ? 57  LEU B C   1  
ATOM 350    O O   . LEU A 1 44  ? -165.304 -65.218 -10.505 1.00 0.00 ? 57  LEU B O   1  
ATOM 351    C CB  . LEU A 1 44  ? -166.226 -63.717 -7.879  1.00 0.00 ? 57  LEU B CB  1  
ATOM 352    C CG  . LEU A 1 44  ? -166.397 -63.554 -6.368  1.00 0.00 ? 57  LEU B CG  1  
ATOM 353    C CD1 . LEU A 1 44  ? -167.826 -63.139 -6.082  1.00 0.00 ? 57  LEU B CD1 1  
ATOM 354    C CD2 . LEU A 1 44  ? -166.062 -64.850 -5.645  1.00 0.00 ? 57  LEU B CD2 1  
ATOM 355    N N   . ASN A 1 45  ? -164.450 -63.182 -10.678 1.00 0.00 ? 58  ASN B N   1  
ATOM 356    C CA  . ASN A 1 45  ? -164.552 -63.118 -12.141 1.00 0.00 ? 58  ASN B CA  1  
ATOM 357    C C   . ASN A 1 45  ? -163.524 -63.908 -12.980 1.00 0.00 ? 58  ASN B C   1  
ATOM 358    O O   . ASN A 1 45  ? -163.331 -63.628 -14.168 1.00 0.00 ? 58  ASN B O   1  
ATOM 359    C CB  . ASN A 1 45  ? -164.497 -61.642 -12.552 1.00 0.00 ? 58  ASN B CB  1  
ATOM 360    C CG  . ASN A 1 45  ? -165.383 -60.740 -11.704 1.00 0.00 ? 58  ASN B CG  1  
ATOM 361    O OD1 . ASN A 1 45  ? -166.564 -60.953 -11.505 1.00 0.00 ? 58  ASN B OD1 1  
ATOM 362    N ND2 . ASN A 1 45  ? -164.890 -59.704 -11.065 1.00 0.00 ? 58  ASN B ND2 1  
ATOM 363    N N   . VAL A 1 46  ? -162.900 -64.923 -12.389 1.00 0.00 ? 59  VAL B N   1  
ATOM 364    C CA  . VAL A 1 46  ? -161.804 -65.660 -13.033 1.00 0.00 ? 59  VAL B CA  1  
ATOM 365    C C   . VAL A 1 46  ? -162.215 -66.592 -14.182 1.00 0.00 ? 59  VAL B C   1  
ATOM 366    O O   . VAL A 1 46  ? -163.017 -67.516 -14.041 1.00 0.00 ? 59  VAL B O   1  
ATOM 367    C CB  . VAL A 1 46  ? -161.055 -66.474 -11.939 1.00 0.00 ? 59  VAL B CB  1  
ATOM 368    C CG1 . VAL A 1 46  ? -159.829 -67.144 -12.538 1.00 0.00 ? 59  VAL B CG1 1  
ATOM 369    C CG2 . VAL A 1 46  ? -160.597 -65.557 -10.812 1.00 0.00 ? 59  VAL B CG2 1  
ATOM 370    N N   . LYS A 1 47  ? -161.649 -66.383 -15.360 1.00 0.00 ? 60  LYS B N   1  
ATOM 371    C CA  . LYS A 1 47  ? -161.950 -67.209 -16.520 1.00 0.00 ? 60  LYS B CA  1  
ATOM 372    C C   . LYS A 1 47  ? -160.941 -68.339 -16.717 1.00 0.00 ? 60  LYS B C   1  
ATOM 373    O O   . LYS A 1 47  ? -159.737 -68.173 -16.510 1.00 0.00 ? 60  LYS B O   1  
ATOM 374    C CB  . LYS A 1 47  ? -161.988 -66.323 -17.757 1.00 0.00 ? 60  LYS B CB  1  
ATOM 375    C CG  . LYS A 1 47  ? -163.053 -65.258 -17.579 1.00 0.00 ? 60  LYS B CG  1  
ATOM 376    C CD  . LYS A 1 47  ? -162.972 -64.212 -18.657 1.00 0.00 ? 60  LYS B CD  1  
ATOM 377    C CE  . LYS A 1 47  ? -163.898 -63.095 -18.241 1.00 0.00 ? 60  LYS B CE  1  
ATOM 378    N NZ  . LYS A 1 47  ? -163.874 -62.065 -19.250 1.00 0.00 ? 60  LYS B NZ  1  
ATOM 379    N N   . ASN A 1 48  ? -161.377 -69.546 -17.108 1.00 0.00 ? 61  ASN B N   1  
ATOM 380    C CA  . ASN A 1 48  ? -160.456 -70.676 -17.319 1.00 0.00 ? 61  ASN B CA  1  
ATOM 381    C C   . ASN A 1 48  ? -159.153 -70.382 -18.065 1.00 0.00 ? 61  ASN B C   1  
ATOM 382    O O   . ASN A 1 48  ? -158.097 -70.730 -17.561 1.00 0.00 ? 61  ASN B O   1  
ATOM 383    C CB  . ASN A 1 48  ? -161.156 -71.810 -18.055 1.00 0.00 ? 61  ASN B CB  1  
ATOM 384    C CG  . ASN A 1 48  ? -162.248 -72.441 -17.218 1.00 0.00 ? 61  ASN B CG  1  
ATOM 385    O OD1 . ASN A 1 48  ? -162.044 -73.100 -16.200 1.00 0.00 ? 61  ASN B OD1 1  
ATOM 386    N ND2 . ASN A 1 48  ? -163.499 -72.291 -17.589 1.00 0.00 ? 61  ASN B ND2 1  
ATOM 387    N N   . GLU A 1 49  ? -159.162 -69.627 -19.167 1.00 0.00 ? 62  GLU B N   1  
ATOM 388    C CA  . GLU A 1 49  ? -157.944 -69.233 -19.884 1.00 0.00 ? 62  GLU B CA  1  
ATOM 389    C C   . GLU A 1 49  ? -156.831 -68.598 -19.042 1.00 0.00 ? 62  GLU B C   1  
ATOM 390    O O   . GLU A 1 49  ? -155.643 -68.859 -19.260 1.00 0.00 ? 62  GLU B O   1  
ATOM 391    C CB  . GLU A 1 49  ? -158.329 -68.271 -20.986 1.00 0.00 ? 62  GLU B CB  1  
ATOM 392    C CG  . GLU A 1 49  ? -159.133 -68.971 -22.066 1.00 0.00 ? 62  GLU B CG  1  
ATOM 393    C CD  . GLU A 1 49  ? -159.861 -68.025 -23.002 1.00 0.00 ? 62  GLU B CD  1  
ATOM 394    O OE1 . GLU A 1 49  ? -159.224 -67.172 -23.610 1.00 0.00 ? 62  GLU B OE1 1  
ATOM 395    O OE2 . GLU A 1 49  ? -161.080 -68.157 -23.101 1.00 0.00 ? 62  GLU B OE2 1  
ATOM 396    N N   . GLU A 1 50  ? -157.202 -67.833 -18.019 1.00 0.00 ? 63  GLU B N   1  
ATOM 397    C CA  . GLU A 1 50  ? -156.269 -67.220 -17.077 1.00 0.00 ? 63  GLU B CA  1  
ATOM 398    C C   . GLU A 1 50  ? -155.678 -68.290 -16.143 1.00 0.00 ? 63  GLU B C   1  
ATOM 399    O O   . GLU A 1 50  ? -154.457 -68.416 -15.997 1.00 0.00 ? 63  GLU B O   1  
ATOM 400    C CB  . GLU A 1 50  ? -157.033 -66.141 -16.306 1.00 0.00 ? 63  GLU B CB  1  
ATOM 401    C CG  . GLU A 1 50  ? -157.491 -65.001 -17.236 1.00 0.00 ? 63  GLU B CG  1  
ATOM 402    C CD  . GLU A 1 50  ? -158.819 -64.308 -16.925 1.00 0.00 ? 63  GLU B CD  1  
ATOM 403    O OE1 . GLU A 1 50  ? -159.432 -64.570 -15.893 1.00 0.00 ? 63  GLU B OE1 1  
ATOM 404    O OE2 . GLU A 1 50  ? -159.278 -63.518 -17.749 1.00 0.00 ? 63  GLU B OE2 1  
ATOM 405    N N   . LEU A 1 51  ? -156.516 -69.170 -15.582 1.00 0.00 ? 64  LEU B N   1  
ATOM 406    C CA  . LEU A 1 51  ? -156.080 -70.303 -14.742 1.00 0.00 ? 64  LEU B CA  1  
ATOM 407    C C   . LEU A 1 51  ? -155.141 -71.269 -15.481 1.00 0.00 ? 64  LEU B C   1  
ATOM 408    O O   . LEU A 1 51  ? -154.061 -71.666 -15.030 1.00 0.00 ? 64  LEU B O   1  
ATOM 409    C CB  . LEU A 1 51  ? -157.293 -71.084 -14.273 1.00 0.00 ? 64  LEU B CB  1  
ATOM 410    C CG  . LEU A 1 51  ? -158.300 -70.349 -13.419 1.00 0.00 ? 64  LEU B CG  1  
ATOM 411    C CD1 . LEU A 1 51  ? -159.669 -70.943 -13.638 1.00 0.00 ? 64  LEU B CD1 1  
ATOM 412    C CD2 . LEU A 1 51  ? -157.852 -70.396 -11.971 1.00 0.00 ? 64  LEU B CD2 1  
ATOM 413    N N   . ASP A 1 52  ? -155.575 -71.623 -16.687 1.00 0.00 ? 65  ASP B N   1  
ATOM 414    C CA  . ASP A 1 52  ? -154.813 -72.420 -17.626 1.00 0.00 ? 65  ASP B CA  1  
ATOM 415    C C   . ASP A 1 52  ? -153.491 -71.752 -18.002 1.00 0.00 ? 65  ASP B C   1  
ATOM 416    O O   . ASP A 1 52  ? -152.452 -72.408 -17.991 1.00 0.00 ? 65  ASP B O   1  
ATOM 417    C CB  . ASP A 1 52  ? -155.672 -72.635 -18.862 1.00 0.00 ? 65  ASP B CB  1  
ATOM 418    C CG  . ASP A 1 52  ? -156.696 -73.730 -18.662 1.00 0.00 ? 65  ASP B CG  1  
ATOM 419    O OD1 . ASP A 1 52  ? -157.548 -73.673 -17.777 1.00 0.00 ? 65  ASP B OD1 1  
ATOM 420    O OD2 . ASP A 1 52  ? -156.610 -74.740 -19.354 1.00 0.00 ? 65  ASP B OD2 1  
ATOM 421    N N   . ALA A 1 53  ? -153.463 -70.454 -18.340 1.00 0.00 ? 66  ALA B N   1  
ATOM 422    C CA  . ALA A 1 53  ? -152.222 -69.722 -18.615 1.00 0.00 ? 66  ALA B CA  1  
ATOM 423    C C   . ALA A 1 53  ? -151.187 -69.853 -17.493 1.00 0.00 ? 66  ALA B C   1  
ATOM 424    O O   . ALA A 1 53  ? -150.036 -70.189 -17.755 1.00 0.00 ? 66  ALA B O   1  
ATOM 425    C CB  . ALA A 1 53  ? -152.502 -68.241 -18.809 1.00 0.00 ? 66  ALA B CB  1  
ATOM 426    N N   . MET A 1 54  ? -151.641 -69.682 -16.244 1.00 0.00 ? 67  MET B N   1  
ATOM 427    C CA  . MET A 1 54  ? -150.826 -69.920 -15.052 1.00 0.00 ? 67  MET B CA  1  
ATOM 428    C C   . MET A 1 54  ? -150.165 -71.304 -15.055 1.00 0.00 ? 67  MET B C   1  
ATOM 429    O O   . MET A 1 54  ? -148.948 -71.462 -15.050 1.00 0.00 ? 67  MET B O   1  
ATOM 430    C CB  . MET A 1 54  ? -151.661 -69.864 -13.770 1.00 0.00 ? 67  MET B CB  1  
ATOM 431    C CG  . MET A 1 54  ? -152.535 -68.662 -13.516 1.00 0.00 ? 67  MET B CG  1  
ATOM 432    S SD  . MET A 1 54  ? -151.564 -67.166 -13.278 1.00 0.00 ? 67  MET B SD  1  
ATOM 433    C CE  . MET A 1 54  ? -150.995 -67.526 -11.645 1.00 0.00 ? 67  MET B CE  1  
ATOM 434    N N   . ILE A 1 55  ? -150.996 -72.355 -15.103 1.00 0.00 ? 68  ILE B N   1  
ATOM 435    C CA  . ILE A 1 55  ? -150.508 -73.736 -15.099 1.00 0.00 ? 68  ILE B CA  1  
ATOM 436    C C   . ILE A 1 55  ? -149.589 -74.098 -16.277 1.00 0.00 ? 68  ILE B C   1  
ATOM 437    O O   . ILE A 1 55  ? -148.527 -74.696 -16.086 1.00 0.00 ? 68  ILE B O   1  
ATOM 438    C CB  . ILE A 1 55  ? -151.767 -74.636 -15.022 1.00 0.00 ? 68  ILE B CB  1  
ATOM 439    C CG1 . ILE A 1 55  ? -152.234 -74.523 -13.576 1.00 0.00 ? 68  ILE B CG1 1  
ATOM 440    C CG2 . ILE A 1 55  ? -151.515 -76.094 -15.414 1.00 0.00 ? 68  ILE B CG2 1  
ATOM 441    C CD1 . ILE A 1 55  ? -153.360 -75.465 -13.133 1.00 0.00 ? 68  ILE B CD1 1  
ATOM 442    N N   . LYS A 1 56  ? -149.920 -73.667 -17.496 1.00 0.00 ? 69  LYS B N   1  
ATOM 443    C CA  . LYS A 1 56  ? -149.101 -73.889 -18.699 1.00 0.00 ? 69  LYS B CA  1  
ATOM 444    C C   . LYS A 1 56  ? -147.610 -73.545 -18.626 1.00 0.00 ? 69  LYS B C   1  
ATOM 445    O O   . LYS A 1 56  ? -146.800 -74.056 -19.402 1.00 0.00 ? 69  LYS B O   1  
ATOM 446    C CB  . LYS A 1 56  ? -149.666 -73.107 -19.874 1.00 0.00 ? 69  LYS B CB  1  
ATOM 447    C CG  . LYS A 1 56  ? -150.981 -73.629 -20.418 1.00 0.00 ? 69  LYS B CG  1  
ATOM 448    C CD  . LYS A 1 56  ? -151.537 -72.596 -21.377 1.00 0.00 ? 69  LYS B CD  1  
ATOM 449    C CE  . LYS A 1 56  ? -152.984 -72.917 -21.700 1.00 0.00 ? 69  LYS B CE  1  
ATOM 450    N NZ  . LYS A 1 56  ? -153.548 -71.886 -22.541 1.00 0.00 ? 69  LYS B NZ  1  
ATOM 451    N N   . GLU A 1 57  ? -147.223 -72.660 -17.705 1.00 0.00 ? 70  GLU B N   1  
ATOM 452    C CA  . GLU A 1 57  ? -145.818 -72.335 -17.496 1.00 0.00 ? 70  GLU B CA  1  
ATOM 453    C C   . GLU A 1 57  ? -144.958 -73.511 -17.022 1.00 0.00 ? 70  GLU B C   1  
ATOM 454    O O   . GLU A 1 57  ? -143.732 -73.538 -17.201 1.00 0.00 ? 70  GLU B O   1  
ATOM 455    C CB  . GLU A 1 57  ? -145.687 -71.230 -16.478 1.00 0.00 ? 70  GLU B CB  1  
ATOM 456    C CG  . GLU A 1 57  ? -146.309 -69.874 -16.824 1.00 0.00 ? 70  GLU B CG  1  
ATOM 457    C CD  . GLU A 1 57  ? -145.836 -68.771 -15.892 1.00 0.00 ? 70  GLU B CD  1  
ATOM 458    O OE1 . GLU A 1 57  ? -145.383 -69.046 -14.784 1.00 0.00 ? 70  GLU B OE1 1  
ATOM 459    O OE2 . GLU A 1 57  ? -145.770 -67.603 -16.258 1.00 0.00 ? 70  GLU B OE2 1  
ATOM 460    N N   . ALA A 1 58  ? -145.553 -74.529 -16.397 1.00 0.00 ? 71  ALA B N   1  
ATOM 461    C CA  . ALA A 1 58  ? -144.823 -75.712 -15.960 1.00 0.00 ? 71  ALA B CA  1  
ATOM 462    C C   . ALA A 1 58  ? -145.046 -76.963 -16.817 1.00 0.00 ? 71  ALA B C   1  
ATOM 463    O O   . ALA A 1 58  ? -146.118 -77.197 -17.363 1.00 0.00 ? 71  ALA B O   1  
ATOM 464    C CB  . ALA A 1 58  ? -145.220 -76.050 -14.533 1.00 0.00 ? 71  ALA B CB  1  
ATOM 465    N N   . SER A 1 59  ? -144.038 -77.827 -16.960 1.00 0.00 ? 72  SER B N   1  
ATOM 466    C CA  . SER A 1 59  ? -144.176 -79.054 -17.753 1.00 0.00 ? 72  SER B CA  1  
ATOM 467    C C   . SER A 1 59  ? -144.887 -80.229 -17.087 1.00 0.00 ? 72  SER B C   1  
ATOM 468    O O   . SER A 1 59  ? -145.357 -81.158 -17.740 1.00 0.00 ? 72  SER B O   1  
ATOM 469    C CB  . SER A 1 59  ? -142.816 -79.586 -18.183 1.00 0.00 ? 72  SER B CB  1  
ATOM 470    O OG  . SER A 1 59  ? -141.992 -79.851 -17.054 1.00 0.00 ? 72  SER B OG  1  
ATOM 471    N N   . GLY A 1 60  ? -144.942 -80.227 -15.759 1.00 0.00 ? 73  GLY B N   1  
ATOM 472    C CA  . GLY A 1 60  ? -145.574 -81.310 -15.013 1.00 0.00 ? 73  GLY B CA  1  
ATOM 473    C C   . GLY A 1 60  ? -146.584 -80.871 -13.952 1.00 0.00 ? 73  GLY B C   1  
ATOM 474    O O   . GLY A 1 60  ? -147.042 -79.724 -13.955 1.00 0.00 ? 73  GLY B O   1  
ATOM 475    N N   . PRO A 1 61  ? -146.951 -81.751 -13.007 1.00 0.00 ? 74  PRO B N   1  
ATOM 476    C CA  . PRO A 1 61  ? -147.712 -81.338 -11.814 1.00 0.00 ? 74  PRO B CA  1  
ATOM 477    C C   . PRO A 1 61  ? -147.015 -80.219 -11.038 1.00 0.00 ? 74  PRO B C   1  
ATOM 478    O O   . PRO A 1 61  ? -145.805 -80.320 -10.807 1.00 0.00 ? 74  PRO B O   1  
ATOM 479    C CB  . PRO A 1 61  ? -147.868 -82.616 -11.018 1.00 0.00 ? 74  PRO B CB  1  
ATOM 480    C CG  . PRO A 1 61  ? -146.656 -83.425 -11.404 1.00 0.00 ? 74  PRO B CG  1  
ATOM 481    C CD  . PRO A 1 61  ? -146.622 -83.168 -12.896 1.00 0.00 ? 74  PRO B CD  1  
ATOM 482    N N   . ILE A 1 62  ? -147.698 -79.191 -10.542 1.00 0.00 ? 75  ILE B N   1  
ATOM 483    C CA  . ILE A 1 62  ? -146.952 -78.050 -10.017 1.00 0.00 ? 75  ILE B CA  1  
ATOM 484    C C   . ILE A 1 62  ? -146.196 -78.192 -8.678  1.00 0.00 ? 75  ILE B C   1  
ATOM 485    O O   . ILE A 1 62  ? -145.572 -77.237 -8.236  1.00 0.00 ? 75  ILE B O   1  
ATOM 486    C CB  . ILE A 1 62  ? -147.897 -76.799 -9.982  1.00 0.00 ? 75  ILE B CB  1  
ATOM 487    C CG1 . ILE A 1 62  ? -149.088 -76.818 -10.949 1.00 0.00 ? 75  ILE B CG1 1  
ATOM 488    C CG2 . ILE A 1 62  ? -147.024 -75.650 -10.479 1.00 0.00 ? 75  ILE B CG2 1  
ATOM 489    C CD1 . ILE A 1 62  ? -149.984 -75.560 -10.886 1.00 0.00 ? 75  ILE B CD1 1  
ATOM 490    N N   . ASN A 1 63  ? -146.181 -79.373 -8.031  1.00 0.00 ? 76  ASN B N   1  
ATOM 491    C CA  . ASN A 1 63  ? -145.379 -79.733 -6.837  1.00 0.00 ? 76  ASN B CA  1  
ATOM 492    C C   . ASN A 1 63  ? -144.308 -78.807 -6.245  1.00 0.00 ? 76  ASN B C   1  
ATOM 493    O O   . ASN A 1 63  ? -143.474 -78.344 -7.012  1.00 0.00 ? 76  ASN B O   1  
ATOM 494    C CB  . ASN A 1 63  ? -144.624 -81.034 -7.057  1.00 0.00 ? 76  ASN B CB  1  
ATOM 495    C CG  . ASN A 1 63  ? -145.467 -82.239 -7.406  1.00 0.00 ? 76  ASN B CG  1  
ATOM 496    O OD1 . ASN A 1 63  ? -146.394 -82.602 -6.722  1.00 0.00 ? 76  ASN B OD1 1  
ATOM 497    N ND2 . ASN A 1 63  ? -145.239 -82.956 -8.479  1.00 0.00 ? 76  ASN B ND2 1  
ATOM 498    N N   . PHE A 1 64  ? -144.213 -78.570 -4.930  1.00 0.00 ? 77  PHE B N   1  
ATOM 499    C CA  . PHE A 1 64  ? -143.202 -77.696 -4.282  1.00 0.00 ? 77  PHE B CA  1  
ATOM 500    C C   . PHE A 1 64  ? -141.908 -77.322 -5.025  1.00 0.00 ? 77  PHE B C   1  
ATOM 501    O O   . PHE A 1 64  ? -141.597 -76.157 -5.250  1.00 0.00 ? 77  PHE B O   1  
ATOM 502    C CB  . PHE A 1 64  ? -142.796 -78.312 -2.941  1.00 0.00 ? 77  PHE B CB  1  
ATOM 503    C CG  . PHE A 1 64  ? -143.975 -78.530 -2.009  1.00 0.00 ? 77  PHE B CG  1  
ATOM 504    C CD1 . PHE A 1 64  ? -144.498 -79.804 -1.875  1.00 0.00 ? 77  PHE B CD1 1  
ATOM 505    C CD2 . PHE A 1 64  ? -144.532 -77.471 -1.322  1.00 0.00 ? 77  PHE B CD2 1  
ATOM 506    C CE1 . PHE A 1 64  ? -145.577 -80.017 -1.049  1.00 0.00 ? 77  PHE B CE1 1  
ATOM 507    C CE2 . PHE A 1 64  ? -145.616 -77.694 -0.497  1.00 0.00 ? 77  PHE B CE2 1  
ATOM 508    C CZ  . PHE A 1 64  ? -146.138 -78.959 -0.363  1.00 0.00 ? 77  PHE B CZ  1  
ATOM 509    N N   . THR A 1 65  ? -141.193 -78.337 -5.511  1.00 0.00 ? 78  THR B N   1  
ATOM 510    C CA  . THR A 1 65  ? -139.990 -78.168 -6.342  1.00 0.00 ? 78  THR B CA  1  
ATOM 511    C C   . THR A 1 65  ? -140.255 -77.524 -7.696  1.00 0.00 ? 78  THR B C   1  
ATOM 512    O O   . THR A 1 65  ? -139.575 -76.562 -8.039  1.00 0.00 ? 78  THR B O   1  
ATOM 513    C CB  . THR A 1 65  ? -139.290 -79.497 -6.651  1.00 0.00 ? 78  THR B CB  1  
ATOM 514    O OG1 . THR A 1 65  ? -140.305 -80.391 -7.121  1.00 0.00 ? 78  THR B OG1 1  
ATOM 515    C CG2 . THR A 1 65  ? -138.564 -80.061 -5.444  1.00 0.00 ? 78  THR B CG2 1  
ATOM 516    N N   . VAL A 1 66  ? -141.251 -77.986 -8.467  1.00 0.00 ? 79  VAL B N   1  
ATOM 517    C CA  . VAL A 1 66  ? -141.621 -77.401 -9.764  1.00 0.00 ? 79  VAL B CA  1  
ATOM 518    C C   . VAL A 1 66  ? -142.007 -75.926 -9.555  1.00 0.00 ? 79  VAL B C   1  
ATOM 519    O O   . VAL A 1 66  ? -141.575 -75.056 -10.302 1.00 0.00 ? 79  VAL B O   1  
ATOM 520    C CB  . VAL A 1 66  ? -142.799 -78.224 -10.364 1.00 0.00 ? 79  VAL B CB  1  
ATOM 521    C CG1 . VAL A 1 66  ? -143.332 -77.580 -11.640 1.00 0.00 ? 79  VAL B CG1 1  
ATOM 522    C CG2 . VAL A 1 66  ? -142.311 -79.625 -10.684 1.00 0.00 ? 79  VAL B CG2 1  
ATOM 523    N N   . PHE A 1 67  ? -142.785 -75.608 -8.515  1.00 0.00 ? 80  PHE B N   1  
ATOM 524    C CA  . PHE A 1 67  ? -143.028 -74.211 -8.128  1.00 0.00 ? 80  PHE B CA  1  
ATOM 525    C C   . PHE A 1 67  ? -141.729 -73.432 -7.884  1.00 0.00 ? 80  PHE B C   1  
ATOM 526    O O   . PHE A 1 67  ? -141.407 -72.469 -8.588  1.00 0.00 ? 80  PHE B O   1  
ATOM 527    C CB  . PHE A 1 67  ? -143.765 -74.036 -6.821  1.00 0.00 ? 80  PHE B CB  1  
ATOM 528    C CG  . PHE A 1 67  ? -145.164 -74.555 -6.645  1.00 0.00 ? 80  PHE B CG  1  
ATOM 529    C CD1 . PHE A 1 67  ? -145.352 -75.536 -5.704  1.00 0.00 ? 80  PHE B CD1 1  
ATOM 530    C CD2 . PHE A 1 67  ? -146.206 -74.071 -7.393  1.00 0.00 ? 80  PHE B CD2 1  
ATOM 531    C CE1 . PHE A 1 67  ? -146.601 -76.060 -5.492  1.00 0.00 ? 80  PHE B CE1 1  
ATOM 532    C CE2 . PHE A 1 67  ? -147.460 -74.593 -7.177  1.00 0.00 ? 80  PHE B CE2 1  
ATOM 533    C CZ  . PHE A 1 67  ? -147.644 -75.583 -6.233  1.00 0.00 ? 80  PHE B CZ  1  
ATOM 534    N N   . LEU A 1 68  ? -140.950 -73.818 -6.865  1.00 0.00 ? 81  LEU B N   1  
ATOM 535    C CA  . LEU A 1 68  ? -139.689 -73.170 -6.511  1.00 0.00 ? 81  LEU B CA  1  
ATOM 536    C C   . LEU A 1 68  ? -138.739 -72.954 -7.688  1.00 0.00 ? 81  LEU B C   1  
ATOM 537    O O   . LEU A 1 68  ? -138.202 -71.860 -7.859  1.00 0.00 ? 81  LEU B O   1  
ATOM 538    C CB  . LEU A 1 68  ? -138.970 -73.996 -5.443  1.00 0.00 ? 81  LEU B CB  1  
ATOM 539    C CG  . LEU A 1 68  ? -139.511 -73.951 -4.018  1.00 0.00 ? 81  LEU B CG  1  
ATOM 540    C CD1 . LEU A 1 68  ? -138.931 -75.096 -3.211  1.00 0.00 ? 81  LEU B CD1 1  
ATOM 541    C CD2 . LEU A 1 68  ? -139.165 -72.614 -3.389  1.00 0.00 ? 81  LEU B CD2 1  
ATOM 542    N N   . THR A 1 69  ? -138.586 -73.943 -8.573  1.00 0.00 ? 82  THR B N   1  
ATOM 543    C CA  . THR A 1 69  ? -137.791 -73.782 -9.787  1.00 0.00 ? 82  THR B CA  1  
ATOM 544    C C   . THR A 1 69  ? -138.439 -72.752 -10.709 1.00 0.00 ? 82  THR B C   1  
ATOM 545    O O   . THR A 1 69  ? -137.775 -71.772 -11.037 1.00 0.00 ? 82  THR B O   1  
ATOM 546    C CB  . THR A 1 69  ? -137.629 -75.087 -10.592 1.00 0.00 ? 82  THR B CB  1  
ATOM 547    O OG1 . THR A 1 69  ? -138.916 -75.634 -10.821 1.00 0.00 ? 82  THR B OG1 1  
ATOM 548    C CG2 . THR A 1 69  ? -136.766 -76.091 -9.846  1.00 0.00 ? 82  THR B CG2 1  
ATOM 549    N N   . MET A 1 70  ? -139.732 -72.833 -11.057 1.00 0.00 ? 83  MET B N   1  
ATOM 550    C CA  . MET A 1 70  ? -140.398 -71.816 -11.885 1.00 0.00 ? 83  MET B CA  1  
ATOM 551    C C   . MET A 1 70  ? -140.344 -70.367 -11.375 1.00 0.00 ? 83  MET B C   1  
ATOM 552    O O   . MET A 1 70  ? -140.234 -69.396 -12.136 1.00 0.00 ? 83  MET B O   1  
ATOM 553    C CB  . MET A 1 70  ? -141.886 -72.115 -12.093 1.00 0.00 ? 83  MET B CB  1  
ATOM 554    C CG  . MET A 1 70  ? -142.279 -73.409 -12.797 1.00 0.00 ? 83  MET B CG  1  
ATOM 555    S SD  . MET A 1 70  ? -141.230 -73.873 -14.199 1.00 0.00 ? 83  MET B SD  1  
ATOM 556    C CE  . MET A 1 70  ? -141.475 -72.497 -15.281 1.00 0.00 ? 83  MET B CE  1  
ATOM 557    N N   . PHE A 1 71  ? -140.455 -70.175 -10.062 1.00 0.00 ? 84  PHE B N   1  
ATOM 558    C CA  . PHE A 1 71  ? -140.385 -68.834 -9.470  1.00 0.00 ? 84  PHE B CA  1  
ATOM 559    C C   . PHE A 1 71  ? -138.983 -68.311 -9.283  1.00 0.00 ? 84  PHE B C   1  
ATOM 560    O O   . PHE A 1 71  ? -138.713 -67.120 -9.449  1.00 0.00 ? 84  PHE B O   1  
ATOM 561    C CB  . PHE A 1 71  ? -141.108 -68.808 -8.123  1.00 0.00 ? 84  PHE B CB  1  
ATOM 562    C CG  . PHE A 1 71  ? -142.519 -69.335 -8.316  1.00 0.00 ? 84  PHE B CG  1  
ATOM 563    C CD1 . PHE A 1 71  ? -143.037 -70.229 -7.408  1.00 0.00 ? 84  PHE B CD1 1  
ATOM 564    C CD2 . PHE A 1 71  ? -143.240 -68.990 -9.445  1.00 0.00 ? 84  PHE B CD2 1  
ATOM 565    C CE1 . PHE A 1 71  ? -144.270 -70.784 -7.650  1.00 0.00 ? 84  PHE B CE1 1  
ATOM 566    C CE2 . PHE A 1 71  ? -144.466 -69.554 -9.670  1.00 0.00 ? 84  PHE B CE2 1  
ATOM 567    C CZ  . PHE A 1 71  ? -144.981 -70.457 -8.774  1.00 0.00 ? 84  PHE B CZ  1  
ATOM 568    N N   . GLY A 1 72  ? -138.059 -69.220 -8.990  1.00 0.00 ? 85  GLY B N   1  
ATOM 569    C CA  . GLY A 1 72  ? -136.660 -68.857 -8.993  1.00 0.00 ? 85  GLY B CA  1  
ATOM 570    C C   . GLY A 1 72  ? -136.271 -68.409 -10.402 1.00 0.00 ? 85  GLY B C   1  
ATOM 571    O O   . GLY A 1 72  ? -135.771 -67.300 -10.595 1.00 0.00 ? 85  GLY B O   1  
ATOM 572    N N   . GLU A 1 73  ? -136.519 -69.219 -11.440 1.00 0.00 ? 86  GLU B N   1  
ATOM 573    C CA  . GLU A 1 73  ? -136.201 -68.886 -12.832 1.00 0.00 ? 86  GLU B CA  1  
ATOM 574    C C   . GLU A 1 73  ? -136.573 -67.500 -13.366 1.00 0.00 ? 86  GLU B C   1  
ATOM 575    O O   . GLU A 1 73  ? -135.921 -66.949 -14.257 1.00 0.00 ? 86  GLU B O   1  
ATOM 576    C CB  . GLU A 1 73  ? -136.823 -69.907 -13.774 1.00 0.00 ? 86  GLU B CB  1  
ATOM 577    C CG  . GLU A 1 73  ? -136.021 -71.202 -13.830 1.00 0.00 ? 86  GLU B CG  1  
ATOM 578    C CD  . GLU A 1 73  ? -135.953 -71.808 -15.216 1.00 0.00 ? 86  GLU B CD  1  
ATOM 579    O OE1 . GLU A 1 73  ? -135.336 -71.185 -16.087 1.00 0.00 ? 86  GLU B OE1 1  
ATOM 580    O OE2 . GLU A 1 73  ? -136.477 -72.887 -15.432 1.00 0.00 ? 86  GLU B OE2 1  
ATOM 581    N N   . LYS A 1 74  ? -137.623 -66.902 -12.822 1.00 0.00 ? 87  LYS B N   1  
ATOM 582    C CA  . LYS A 1 74  ? -138.007 -65.538 -13.177 1.00 0.00 ? 87  LYS B CA  1  
ATOM 583    C C   . LYS A 1 74  ? -137.265 -64.449 -12.392 1.00 0.00 ? 87  LYS B C   1  
ATOM 584    O O   . LYS A 1 74  ? -137.068 -63.315 -12.842 1.00 0.00 ? 87  LYS B O   1  
ATOM 585    C CB  . LYS A 1 74  ? -139.507 -65.422 -12.978 1.00 0.00 ? 87  LYS B CB  1  
ATOM 586    C CG  . LYS A 1 74  ? -140.156 -66.395 -13.942 1.00 0.00 ? 87  LYS B CG  1  
ATOM 587    C CD  . LYS A 1 74  ? -141.634 -66.508 -13.740 1.00 0.00 ? 87  LYS B CD  1  
ATOM 588    C CE  . LYS A 1 74  ? -142.069 -67.491 -14.791 1.00 0.00 ? 87  LYS B CE  1  
ATOM 589    N NZ  . LYS A 1 74  ? -143.490 -67.416 -14.942 1.00 0.00 ? 87  LYS B NZ  1  
ATOM 590    N N   . LEU A 1 75  ? -136.799 -64.813 -11.203 1.00 0.00 ? 88  LEU B N   1  
ATOM 591    C CA  . LEU A 1 75  ? -136.019 -63.940 -10.336 1.00 0.00 ? 88  LEU B CA  1  
ATOM 592    C C   . LEU A 1 75  ? -134.509 -64.230 -10.347 1.00 0.00 ? 88  LEU B C   1  
ATOM 593    O O   . LEU A 1 75  ? -133.783 -63.890 -9.413  1.00 0.00 ? 88  LEU B O   1  
ATOM 594    C CB  . LEU A 1 75  ? -136.573 -64.083 -8.923  1.00 0.00 ? 88  LEU B CB  1  
ATOM 595    C CG  . LEU A 1 75  ? -137.995 -63.627 -8.621  1.00 0.00 ? 88  LEU B CG  1  
ATOM 596    C CD1 . LEU A 1 75  ? -138.448 -64.268 -7.328  1.00 0.00 ? 88  LEU B CD1 1  
ATOM 597    C CD2 . LEU A 1 75  ? -138.063 -62.108 -8.534  1.00 0.00 ? 88  LEU B CD2 1  
ATOM 598    N N   . LYS A 1 76  ? -133.952 -64.776 -11.438 1.00 0.00 ? 89  LYS B N   1  
ATOM 599    C CA  . LYS A 1 76  ? -132.519 -65.088 -11.594 1.00 0.00 ? 89  LYS B CA  1  
ATOM 600    C C   . LYS A 1 76  ? -131.464 -64.037 -11.210 1.00 0.00 ? 89  LYS B C   1  
ATOM 601    O O   . LYS A 1 76  ? -130.271 -64.304 -11.085 1.00 0.00 ? 89  LYS B O   1  
ATOM 602    C CB  . LYS A 1 76  ? -132.229 -65.490 -13.040 1.00 0.00 ? 89  LYS B CB  1  
ATOM 603    C CG  . LYS A 1 76  ? -132.714 -66.870 -13.401 1.00 0.00 ? 89  LYS B CG  1  
ATOM 604    C CD  . LYS A 1 76  ? -132.719 -67.136 -14.900 1.00 0.00 ? 89  LYS B CD  1  
ATOM 605    C CE  . LYS A 1 76  ? -133.437 -68.466 -14.991 1.00 0.00 ? 89  LYS B CE  1  
ATOM 606    N NZ  . LYS A 1 76  ? -133.912 -68.865 -16.295 1.00 0.00 ? 89  LYS B NZ  1  
ATOM 607    N N   . GLY A 1 77  ? -131.920 -62.793 -11.108 1.00 0.00 ? 90  GLY B N   1  
ATOM 608    C CA  . GLY A 1 77  ? -131.105 -61.670 -10.667 1.00 0.00 ? 90  GLY B CA  1  
ATOM 609    C C   . GLY A 1 77  ? -131.828 -60.854 -9.594  1.00 0.00 ? 90  GLY B C   1  
ATOM 610    O O   . GLY A 1 77  ? -131.949 -59.643 -9.708  1.00 0.00 ? 90  GLY B O   1  
ATOM 611    N N   . ALA A 1 78  ? -132.405 -61.528 -8.600  1.00 0.00 ? 91  ALA B N   1  
ATOM 612    C CA  . ALA A 1 78  ? -133.087 -60.868 -7.494  1.00 0.00 ? 91  ALA B CA  1  
ATOM 613    C C   . ALA A 1 78  ? -132.681 -61.299 -6.081  1.00 0.00 ? 91  ALA B C   1  
ATOM 614    O O   . ALA A 1 78  ? -132.777 -62.466 -5.699  1.00 0.00 ? 91  ALA B O   1  
ATOM 615    C CB  . ALA A 1 78  ? -134.587 -61.087 -7.604  1.00 0.00 ? 91  ALA B CB  1  
ATOM 616    N N   . ASP A 1 79  ? -132.215 -60.323 -5.317  1.00 0.00 ? 92  ASP B N   1  
ATOM 617    C CA  . ASP A 1 79  ? -131.806 -60.529 -3.938  1.00 0.00 ? 92  ASP B CA  1  
ATOM 618    C C   . ASP A 1 79  ? -132.914 -60.317 -2.887  1.00 0.00 ? 92  ASP B C   1  
ATOM 619    O O   . ASP A 1 79  ? -133.986 -59.750 -3.162  1.00 0.00 ? 92  ASP B O   1  
ATOM 620    C CB  . ASP A 1 79  ? -130.640 -59.585 -3.629  1.00 0.00 ? 92  ASP B CB  1  
ATOM 621    C CG  . ASP A 1 79  ? -129.397 -59.737 -4.494  1.00 0.00 ? 92  ASP B CG  1  
ATOM 622    O OD1 . ASP A 1 79  ? -128.955 -60.860 -4.731  1.00 0.00 ? 92  ASP B OD1 1  
ATOM 623    O OD2 . ASP A 1 79  ? -128.862 -58.711 -4.907  1.00 0.00 ? 92  ASP B OD2 1  
ATOM 624    N N   . PRO A 1 80  ? -132.709 -60.726 -1.628  1.00 0.00 ? 93  PRO B N   1  
ATOM 625    C CA  . PRO A 1 80  ? -133.560 -60.246 -0.533  1.00 0.00 ? 93  PRO B CA  1  
ATOM 626    C C   . PRO A 1 80  ? -133.370 -58.772 -0.153  1.00 0.00 ? 93  PRO B C   1  
ATOM 627    O O   . PRO A 1 80  ? -132.262 -58.237 -0.225  1.00 0.00 ? 93  PRO B O   1  
ATOM 628    C CB  . PRO A 1 80  ? -133.264 -61.197 0.613   1.00 0.00 ? 93  PRO B CB  1  
ATOM 629    C CG  . PRO A 1 80  ? -131.896 -61.732 0.293   1.00 0.00 ? 93  PRO B CG  1  
ATOM 630    C CD  . PRO A 1 80  ? -132.034 -61.948 -1.202  1.00 0.00 ? 93  PRO B CD  1  
ATOM 631    N N   . GLU A 1 81  ? -134.408 -58.061 0.300   1.00 0.00 ? 94  GLU B N   1  
ATOM 632    C CA  . GLU A 1 81  ? -134.322 -56.622 0.616   1.00 0.00 ? 94  GLU B CA  1  
ATOM 633    C C   . GLU A 1 81  ? -133.128 -56.030 1.349   1.00 0.00 ? 94  GLU B C   1  
ATOM 634    O O   . GLU A 1 81  ? -132.533 -55.069 0.845   1.00 0.00 ? 94  GLU B O   1  
ATOM 635    C CB  . GLU A 1 81  ? -135.579 -56.198 1.372   1.00 0.00 ? 94  GLU B CB  1  
ATOM 636    C CG  . GLU A 1 81  ? -136.188 -57.139 2.396   1.00 0.00 ? 94  GLU B CG  1  
ATOM 637    C CD  . GLU A 1 81  ? -137.692 -56.941 2.450   1.00 0.00 ? 94  GLU B CD  1  
ATOM 638    O OE1 . GLU A 1 81  ? -138.150 -55.823 2.666   1.00 0.00 ? 94  GLU B OE1 1  
ATOM 639    O OE2 . GLU A 1 81  ? -138.442 -57.886 2.194   1.00 0.00 ? 94  GLU B OE2 1  
ATOM 640    N N   . ASP A 1 82  ? -132.673 -56.577 2.477   1.00 0.00 ? 95  ASP B N   1  
ATOM 641    C CA  . ASP A 1 82  ? -131.459 -56.104 3.146   1.00 0.00 ? 95  ASP B CA  1  
ATOM 642    C C   . ASP A 1 82  ? -130.191 -56.033 2.285   1.00 0.00 ? 95  ASP B C   1  
ATOM 643    O O   . ASP A 1 82  ? -129.425 -55.055 2.314   1.00 0.00 ? 95  ASP B O   1  
ATOM 644    C CB  . ASP A 1 82  ? -131.185 -56.999 4.344   1.00 0.00 ? 95  ASP B CB  1  
ATOM 645    C CG  . ASP A 1 82  ? -132.322 -57.005 5.347   1.00 0.00 ? 95  ASP B CG  1  
ATOM 646    O OD1 . ASP A 1 82  ? -132.715 -55.929 5.798   1.00 0.00 ? 95  ASP B OD1 1  
ATOM 647    O OD2 . ASP A 1 82  ? -132.808 -58.089 5.646   1.00 0.00 ? 95  ASP B OD2 1  
ATOM 648    N N   . VAL A 1 83  ? -130.001 -57.046 1.430   1.00 0.00 ? 96  VAL B N   1  
ATOM 649    C CA  . VAL A 1 83  ? -128.861 -57.126 0.506   1.00 0.00 ? 96  VAL B CA  1  
ATOM 650    C C   . VAL A 1 83  ? -128.925 -55.977 -0.518  1.00 0.00 ? 96  VAL B C   1  
ATOM 651    O O   . VAL A 1 83  ? -127.958 -55.236 -0.749  1.00 0.00 ? 96  VAL B O   1  
ATOM 652    C CB  . VAL A 1 83  ? -128.894 -58.513 -0.191  1.00 0.00 ? 96  VAL B CB  1  
ATOM 653    C CG1 . VAL A 1 83  ? -127.806 -58.625 -1.253  1.00 0.00 ? 96  VAL B CG1 1  
ATOM 654    C CG2 . VAL A 1 83  ? -128.676 -59.598 0.856   1.00 0.00 ? 96  VAL B CG2 1  
ATOM 655    N N   . ILE A 1 84  ? -130.119 -55.741 -1.060  1.00 0.00 ? 97  ILE B N   1  
ATOM 656    C CA  . ILE A 1 84  ? -130.365 -54.636 -2.002  1.00 0.00 ? 97  ILE B CA  1  
ATOM 657    C C   . ILE A 1 84  ? -130.091 -53.276 -1.328  1.00 0.00 ? 97  ILE B C   1  
ATOM 658    O O   . ILE A 1 84  ? -129.373 -52.414 -1.845  1.00 0.00 ? 97  ILE B O   1  
ATOM 659    C CB  . ILE A 1 84  ? -131.827 -54.703 -2.501  1.00 0.00 ? 97  ILE B CB  1  
ATOM 660    C CG1 . ILE A 1 84  ? -132.154 -56.078 -3.072  1.00 0.00 ? 97  ILE B CG1 1  
ATOM 661    C CG2 . ILE A 1 84  ? -132.010 -53.678 -3.613  1.00 0.00 ? 97  ILE B CG2 1  
ATOM 662    C CD1 . ILE A 1 84  ? -133.641 -56.311 -3.397  1.00 0.00 ? 97  ILE B CD1 1  
ATOM 663    N N   . MET A 1 85  ? -130.615 -53.098 -0.111  1.00 0.00 ? 98  MET B N   1  
ATOM 664    C CA  . MET A 1 85  ? -130.332 -51.925 0.713   1.00 0.00 ? 98  MET B CA  1  
ATOM 665    C C   . MET A 1 85  ? -128.833 -51.695 0.934   1.00 0.00 ? 98  MET B C   1  
ATOM 666    O O   . MET A 1 85  ? -128.393 -50.557 1.009   1.00 0.00 ? 98  MET B O   1  
ATOM 667    C CB  . MET A 1 85  ? -130.982 -52.056 2.082   1.00 0.00 ? 98  MET B CB  1  
ATOM 668    C CG  . MET A 1 85  ? -132.499 -51.980 2.121   1.00 0.00 ? 98  MET B CG  1  
ATOM 669    S SD  . MET A 1 85  ? -133.132 -50.402 1.508   1.00 0.00 ? 98  MET B SD  1  
ATOM 670    C CE  . MET A 1 85  ? -132.598 -49.329 2.808   1.00 0.00 ? 98  MET B CE  1  
ATOM 671    N N   . GLY A 1 86  ? -128.012 -52.736 1.113   1.00 0.00 ? 99  GLY B N   1  
ATOM 672    C CA  . GLY A 1 86  ? -126.551 -52.606 1.227   1.00 0.00 ? 99  GLY B CA  1  
ATOM 673    C C   . GLY A 1 86  ? -125.898 -51.880 0.045   1.00 0.00 ? 99  GLY B C   1  
ATOM 674    O O   . GLY A 1 86  ? -125.101 -50.958 0.217   1.00 0.00 ? 99  GLY B O   1  
ATOM 675    N N   . ALA A 1 87  ? -126.288 -52.244 -1.175  1.00 0.00 ? 100 ALA B N   1  
ATOM 676    C CA  . ALA A 1 87  ? -125.818 -51.567 -2.386  1.00 0.00 ? 100 ALA B CA  1  
ATOM 677    C C   . ALA A 1 87  ? -126.096 -50.057 -2.376  1.00 0.00 ? 100 ALA B C   1  
ATOM 678    O O   . ALA A 1 87  ? -125.220 -49.223 -2.625  1.00 0.00 ? 100 ALA B O   1  
ATOM 679    C CB  . ALA A 1 87  ? -126.500 -52.216 -3.560  1.00 0.00 ? 100 ALA B CB  1  
ATOM 680    N N   . PHE A 1 88  ? -127.314 -49.690 -1.989  1.00 0.00 ? 101 PHE B N   1  
ATOM 681    C CA  . PHE A 1 88  ? -127.663 -48.285 -1.786  1.00 0.00 ? 101 PHE B CA  1  
ATOM 682    C C   . PHE A 1 88  ? -126.865 -47.674 -0.632  1.00 0.00 ? 101 PHE B C   1  
ATOM 683    O O   . PHE A 1 88  ? -126.194 -46.684 -0.855  1.00 0.00 ? 101 PHE B O   1  
ATOM 684    C CB  . PHE A 1 88  ? -129.161 -48.203 -1.538  1.00 0.00 ? 101 PHE B CB  1  
ATOM 685    C CG  . PHE A 1 88  ? -129.951 -48.770 -2.716  1.00 0.00 ? 101 PHE B CG  1  
ATOM 686    C CD1 . PHE A 1 88  ? -131.030 -49.601 -2.477  1.00 0.00 ? 101 PHE B CD1 1  
ATOM 687    C CD2 . PHE A 1 88  ? -129.608 -48.453 -4.018  1.00 0.00 ? 101 PHE B CD2 1  
ATOM 688    C CE1 . PHE A 1 88  ? -131.748 -50.111 -3.536  1.00 0.00 ? 101 PHE B CE1 1  
ATOM 689    C CE2 . PHE A 1 88  ? -130.331 -48.971 -5.065  1.00 0.00 ? 101 PHE B CE2 1  
ATOM 690    C CZ  . PHE A 1 88  ? -131.404 -49.797 -4.831  1.00 0.00 ? 101 PHE B CZ  1  
ATOM 691    N N   . LYS A 1 89  ? -126.768 -48.275 0.556   1.00 0.00 ? 102 LYS B N   1  
ATOM 692    C CA  . LYS A 1 89  ? -125.929 -47.797 1.667   1.00 0.00 ? 102 LYS B CA  1  
ATOM 693    C C   . LYS A 1 89  ? -124.441 -47.548 1.320   1.00 0.00 ? 102 LYS B C   1  
ATOM 694    O O   . LYS A 1 89  ? -123.744 -46.742 1.937   1.00 0.00 ? 102 LYS B O   1  
ATOM 695    C CB  . LYS A 1 89  ? -126.009 -48.805 2.823   1.00 0.00 ? 102 LYS B CB  1  
ATOM 696    C CG  . LYS A 1 89  ? -127.383 -48.915 3.489   1.00 0.00 ? 102 LYS B CG  1  
ATOM 697    C CD  . LYS A 1 89  ? -127.502 -50.203 4.309   1.00 0.00 ? 102 LYS B CD  1  
ATOM 698    C CE  . LYS A 1 89  ? -128.935 -50.399 4.814   1.00 0.00 ? 102 LYS B CE  1  
ATOM 699    N NZ  . LYS A 1 89  ? -129.130 -51.715 5.412   1.00 0.00 ? 102 LYS B NZ  1  
ATOM 700    N N   . VAL A 1 90  ? -123.897 -48.300 0.352   1.00 0.00 ? 103 VAL B N   1  
ATOM 701    C CA  . VAL A 1 90  ? -122.556 -48.061 -0.204  1.00 0.00 ? 103 VAL B CA  1  
ATOM 702    C C   . VAL A 1 90  ? -122.544 -46.788 -1.067  1.00 0.00 ? 103 VAL B C   1  
ATOM 703    O O   . VAL A 1 90  ? -121.602 -45.992 -1.068  1.00 0.00 ? 103 VAL B O   1  
ATOM 704    C CB  . VAL A 1 90  ? -122.135 -49.312 -1.038  1.00 0.00 ? 103 VAL B CB  1  
ATOM 705    C CG1 . VAL A 1 90  ? -120.903 -49.048 -1.899  1.00 0.00 ? 103 VAL B CG1 1  
ATOM 706    C CG2 . VAL A 1 90  ? -121.813 -50.431 -0.070  1.00 0.00 ? 103 VAL B CG2 1  
ATOM 707    N N   . LEU A 1 91  ? -123.595 -46.591 -1.869  1.00 0.00 ? 104 LEU B N   1  
ATOM 708    C CA  . LEU A 1 91  ? -123.765 -45.369 -2.650  1.00 0.00 ? 104 LEU B CA  1  
ATOM 709    C C   . LEU A 1 91  ? -124.108 -44.130 -1.813  1.00 0.00 ? 104 LEU B C   1  
ATOM 710    O O   . LEU A 1 91  ? -123.845 -42.994 -2.217  1.00 0.00 ? 104 LEU B O   1  
ATOM 711    C CB  . LEU A 1 91  ? -124.853 -45.548 -3.658  1.00 0.00 ? 104 LEU B CB  1  
ATOM 712    C CG  . LEU A 1 91  ? -124.906 -46.624 -4.696  1.00 0.00 ? 104 LEU B CG  1  
ATOM 713    C CD1 . LEU A 1 91  ? -126.312 -46.561 -5.251  1.00 0.00 ? 104 LEU B CD1 1  
ATOM 714    C CD2 . LEU A 1 91  ? -123.846 -46.460 -5.773  1.00 0.00 ? 104 LEU B CD2 1  
ATOM 715    N N   . ASP A 1 92  ? -124.737 -44.357 -0.662  1.00 0.00 ? 105 ASP B N   1  
ATOM 716    C CA  . ASP A 1 92  ? -125.044 -43.360 0.349   1.00 0.00 ? 105 ASP B CA  1  
ATOM 717    C C   . ASP A 1 92  ? -123.816 -42.893 1.148   1.00 0.00 ? 105 ASP B C   1  
ATOM 718    O O   . ASP A 1 92  ? -124.005 -42.034 2.001   1.00 0.00 ? 105 ASP B O   1  
ATOM 719    C CB  . ASP A 1 92  ? -126.072 -43.908 1.368   1.00 0.00 ? 105 ASP B CB  1  
ATOM 720    C CG  . ASP A 1 92  ? -127.506 -44.251 0.945   1.00 0.00 ? 105 ASP B CG  1  
ATOM 721    O OD1 . ASP A 1 92  ? -127.973 -43.816 -0.105  1.00 0.00 ? 105 ASP B OD1 1  
ATOM 722    O OD2 . ASP A 1 92  ? -128.174 -44.955 1.696   1.00 0.00 ? 105 ASP B OD2 1  
ATOM 723    N N   . PRO A 1 93  ? -122.556 -43.353 0.952   1.00 0.00 ? 106 PRO B N   1  
ATOM 724    C CA  . PRO A 1 93  ? -121.687 -43.830 2.049   1.00 0.00 ? 106 PRO B CA  1  
ATOM 725    C C   . PRO A 1 93  ? -121.621 -43.061 3.376   1.00 0.00 ? 106 PRO B C   1  
ATOM 726    O O   . PRO A 1 93  ? -121.378 -43.607 4.452   1.00 0.00 ? 106 PRO B O   1  
ATOM 727    C CB  . PRO A 1 93  ? -120.337 -43.961 1.376   1.00 0.00 ? 106 PRO B CB  1  
ATOM 728    C CG  . PRO A 1 93  ? -120.284 -42.755 0.483   1.00 0.00 ? 106 PRO B CG  1  
ATOM 729    C CD  . PRO A 1 93  ? -121.718 -42.626 -0.005  1.00 0.00 ? 106 PRO B CD  1  
ATOM 730    N N   . ASP A 1 94  ? -121.848 -41.757 3.260   1.00 0.00 ? 107 ASP B N   1  
ATOM 731    C CA  . ASP A 1 94  ? -122.021 -40.781 4.329   1.00 0.00 ? 107 ASP B CA  1  
ATOM 732    C C   . ASP A 1 94  ? -123.178 -41.129 5.294   1.00 0.00 ? 107 ASP B C   1  
ATOM 733    O O   . ASP A 1 94  ? -123.171 -40.803 6.487   1.00 0.00 ? 107 ASP B O   1  
ATOM 734    C CB  . ASP A 1 94  ? -122.259 -39.414 3.652   1.00 0.00 ? 107 ASP B CB  1  
ATOM 735    C CG  . ASP A 1 94  ? -121.324 -38.975 2.515   1.00 0.00 ? 107 ASP B CG  1  
ATOM 736    O OD1 . ASP A 1 94  ? -120.492 -39.750 2.045   1.00 0.00 ? 107 ASP B OD1 1  
ATOM 737    O OD2 . ASP A 1 94  ? -121.450 -37.838 2.073   1.00 0.00 ? 107 ASP B OD2 1  
ATOM 738    N N   . GLY A 1 95  ? -124.229 -41.795 4.811   1.00 0.00 ? 108 GLY B N   1  
ATOM 739    C CA  . GLY A 1 95  ? -125.340 -42.273 5.639   1.00 0.00 ? 108 GLY B CA  1  
ATOM 740    C C   . GLY A 1 95  ? -126.739 -41.648 5.467   1.00 0.00 ? 108 GLY B C   1  
ATOM 741    O O   . GLY A 1 95  ? -126.989 -40.661 4.781   1.00 0.00 ? 108 GLY B O   1  
ATOM 742    N N   . LYS A 1 96  ? -127.682 -42.230 6.208   1.00 0.00 ? 109 LYS B N   1  
ATOM 743    C CA  . LYS A 1 96  ? -129.112 -41.878 6.284   1.00 0.00 ? 109 LYS B CA  1  
ATOM 744    C C   . LYS A 1 96  ? -130.044 -41.282 5.213   1.00 0.00 ? 109 LYS B C   1  
ATOM 745    O O   . LYS A 1 96  ? -131.175 -41.787 5.087   1.00 0.00 ? 109 LYS B O   1  
ATOM 746    C CB  . LYS A 1 96  ? -129.310 -41.001 7.519   1.00 0.00 ? 109 LYS B CB  1  
ATOM 747    C CG  . LYS A 1 96  ? -129.076 -41.758 8.819   1.00 0.00 ? 109 LYS B CG  1  
ATOM 748    C CD  . LYS A 1 96  ? -129.406 -40.885 10.018  1.00 0.00 ? 109 LYS B CD  1  
ATOM 749    C CE  . LYS A 1 96  ? -129.000 -41.617 11.289  1.00 0.00 ? 109 LYS B CE  1  
ATOM 750    N NZ  . LYS A 1 96  ? -129.355 -40.846 12.462  1.00 0.00 ? 109 LYS B NZ  1  
ATOM 751    N N   . GLY A 1 97  ? -129.696 -40.209 4.504   1.00 0.00 ? 110 GLY B N   1  
ATOM 752    C CA  . GLY A 1 97  ? -130.571 -39.589 3.502   1.00 0.00 ? 110 GLY B CA  1  
ATOM 753    C C   . GLY A 1 97  ? -130.217 -40.063 2.103   1.00 0.00 ? 110 GLY B C   1  
ATOM 754    O O   . GLY A 1 97  ? -129.100 -39.798 1.650   1.00 0.00 ? 110 GLY B O   1  
ATOM 755    N N   . SER A 1 98  ? -131.133 -40.682 1.362   1.00 0.00 ? 111 SER B N   1  
ATOM 756    C CA  . SER A 1 98  ? -130.695 -41.284 0.113   1.00 0.00 ? 111 SER B CA  1  
ATOM 757    C C   . SER A 1 98  ? -130.481 -40.391 -1.123  1.00 0.00 ? 111 SER B C   1  
ATOM 758    O O   . SER A 1 98  ? -130.836 -39.215 -1.192  1.00 0.00 ? 111 SER B O   1  
ATOM 759    C CB  . SER A 1 98  ? -131.638 -42.459 -0.213  1.00 0.00 ? 111 SER B CB  1  
ATOM 760    O OG  . SER A 1 98  ? -133.055 -42.352 -0.241  1.00 0.00 ? 111 SER B OG  1  
ATOM 761    N N   . ILE A 1 99  ? -129.802 -40.965 -2.110  1.00 0.00 ? 112 ILE B N   1  
ATOM 762    C CA  . ILE A 1 99  ? -129.224 -40.263 -3.267  1.00 0.00 ? 112 ILE B CA  1  
ATOM 763    C C   . ILE A 1 99  ? -130.048 -39.453 -4.280  1.00 0.00 ? 112 ILE B C   1  
ATOM 764    O O   . ILE A 1 99  ? -131.266 -39.476 -4.342  1.00 0.00 ? 112 ILE B O   1  
ATOM 765    C CB  . ILE A 1 99  ? -128.342 -41.357 -3.976  1.00 0.00 ? 112 ILE B CB  1  
ATOM 766    C CG1 . ILE A 1 99  ? -127.348 -41.834 -2.958  1.00 0.00 ? 112 ILE B CG1 1  
ATOM 767    C CG2 . ILE A 1 99  ? -127.478 -40.892 -5.138  1.00 0.00 ? 112 ILE B CG2 1  
ATOM 768    C CD1 . ILE A 1 99  ? -127.243 -43.333 -3.155  1.00 0.00 ? 112 ILE B CD1 1  
ATOM 769    N N   . LYS A 1 100 ? -129.367 -38.668 -5.114  1.00 0.00 ? 113 LYS B N   1  
ATOM 770    C CA  . LYS A 1 100 ? -129.997 -37.839 -6.140  1.00 0.00 ? 113 LYS B CA  1  
ATOM 771    C C   . LYS A 1 100 ? -130.038 -38.340 -7.590  1.00 0.00 ? 113 LYS B C   1  
ATOM 772    O O   . LYS A 1 100 ? -129.119 -38.993 -8.114  1.00 0.00 ? 113 LYS B O   1  
ATOM 773    C CB  . LYS A 1 100 ? -129.320 -36.475 -6.140  1.00 0.00 ? 113 LYS B CB  1  
ATOM 774    C CG  . LYS A 1 100 ? -129.123 -35.847 -4.765  1.00 0.00 ? 113 LYS B CG  1  
ATOM 775    C CD  . LYS A 1 100 ? -128.155 -34.694 -4.911  1.00 0.00 ? 113 LYS B CD  1  
ATOM 776    C CE  . LYS A 1 100 ? -127.603 -34.249 -3.568  1.00 0.00 ? 113 LYS B CE  1  
ATOM 777    N NZ  . LYS A 1 100 ? -126.545 -33.284 -3.778  1.00 0.00 ? 113 LYS B NZ  1  
ATOM 778    N N   . LYS A 1 101 ? -131.140 -38.035 -8.268  1.00 0.00 ? 114 LYS B N   1  
ATOM 779    C CA  . LYS A 1 101 ? -131.259 -38.275 -9.703  1.00 0.00 ? 114 LYS B CA  1  
ATOM 780    C C   . LYS A 1 101 ? -130.419 -37.288 -10.538 1.00 0.00 ? 114 LYS B C   1  
ATOM 781    O O   . LYS A 1 101 ? -130.510 -36.062 -10.473 1.00 0.00 ? 114 LYS B O   1  
ATOM 782    C CB  . LYS A 1 101 ? -132.719 -38.195 -10.160 1.00 0.00 ? 114 LYS B CB  1  
ATOM 783    C CG  . LYS A 1 101 ? -133.674 -37.201 -9.511  1.00 0.00 ? 114 LYS B CG  1  
ATOM 784    C CD  . LYS A 1 101 ? -134.985 -37.038 -10.296 1.00 0.00 ? 114 LYS B CD  1  
ATOM 785    C CE  . LYS A 1 101 ? -135.493 -38.319 -10.960 1.00 0.00 ? 114 LYS B CE  1  
ATOM 786    N NZ  . LYS A 1 101 ? -136.877 -38.600 -10.627 1.00 0.00 ? 114 LYS B NZ  1  
ATOM 787    N N   . SER A 1 102 ? -129.378 -37.958 -11.021 1.00 0.00 ? 115 SER B N   1  
ATOM 788    C CA  . SER A 1 102 ? -128.266 -37.513 -11.881 1.00 0.00 ? 115 SER B CA  1  
ATOM 789    C C   . SER A 1 102 ? -127.105 -38.413 -11.493 1.00 0.00 ? 115 SER B C   1  
ATOM 790    O O   . SER A 1 102 ? -126.675 -39.270 -12.261 1.00 0.00 ? 115 SER B O   1  
ATOM 791    C CB  . SER A 1 102 ? -127.764 -36.072 -11.681 1.00 0.00 ? 115 SER B CB  1  
ATOM 792    O OG  . SER A 1 102 ? -127.519 -35.757 -10.317 1.00 0.00 ? 115 SER B OG  1  
ATOM 793    N N   . PHE A 1 103 ? -126.787 -38.417 -10.193 1.00 0.00 ? 116 PHE B N   1  
ATOM 794    C CA  . PHE A 1 103 ? -125.727 -39.234 -9.587  1.00 0.00 ? 116 PHE B CA  1  
ATOM 795    C C   . PHE A 1 103 ? -125.872 -40.719 -9.946  1.00 0.00 ? 116 PHE B C   1  
ATOM 796    O O   . PHE A 1 103 ? -124.963 -41.357 -10.479 1.00 0.00 ? 116 PHE B O   1  
ATOM 797    C CB  . PHE A 1 103 ? -125.758 -39.061 -8.056  1.00 0.00 ? 116 PHE B CB  1  
ATOM 798    C CG  . PHE A 1 103 ? -125.381 -37.668 -7.548  1.00 0.00 ? 116 PHE B CG  1  
ATOM 799    C CD1 . PHE A 1 103 ? -126.142 -36.567 -7.890  1.00 0.00 ? 116 PHE B CD1 1  
ATOM 800    C CD2 . PHE A 1 103 ? -124.274 -37.497 -6.749  1.00 0.00 ? 116 PHE B CD2 1  
ATOM 801    C CE1 . PHE A 1 103 ? -125.797 -35.304 -7.450  1.00 0.00 ? 116 PHE B CE1 1  
ATOM 802    C CE2 . PHE A 1 103 ? -123.929 -36.228 -6.306  1.00 0.00 ? 116 PHE B CE2 1  
ATOM 803    C CZ  . PHE A 1 103 ? -124.689 -35.136 -6.653  1.00 0.00 ? 116 PHE B CZ  1  
ATOM 804    N N   . LEU A 1 104 ? -127.054 -41.302 -9.731  1.00 0.00 ? 117 LEU B N   1  
ATOM 805    C CA  . LEU A 1 104 ? -127.265 -42.668 -10.206 1.00 0.00 ? 117 LEU B CA  1  
ATOM 806    C C   . LEU A 1 104 ? -127.589 -42.830 -11.689 1.00 0.00 ? 117 LEU B C   1  
ATOM 807    O O   . LEU A 1 104 ? -127.224 -43.855 -12.260 1.00 0.00 ? 117 LEU B O   1  
ATOM 808    C CB  . LEU A 1 104 ? -128.362 -43.357 -9.412  1.00 0.00 ? 117 LEU B CB  1  
ATOM 809    C CG  . LEU A 1 104 ? -128.011 -43.952 -8.046  1.00 0.00 ? 117 LEU B CG  1  
ATOM 810    C CD1 . LEU A 1 104 ? -128.590 -45.356 -8.029  1.00 0.00 ? 117 LEU B CD1 1  
ATOM 811    C CD2 . LEU A 1 104 ? -126.513 -44.042 -7.788  1.00 0.00 ? 117 LEU B CD2 1  
ATOM 812    N N   . GLU A 1 105 ? -128.185 -41.838 -12.373 1.00 0.00 ? 118 GLU B N   1  
ATOM 813    C CA  . GLU A 1 105 ? -128.451 -41.897 -13.830 1.00 0.00 ? 118 GLU B CA  1  
ATOM 814    C C   . GLU A 1 105 ? -127.143 -42.193 -14.563 1.00 0.00 ? 118 GLU B C   1  
ATOM 815    O O   . GLU A 1 105 ? -126.963 -43.214 -15.233 1.00 0.00 ? 118 GLU B O   1  
ATOM 816    C CB  . GLU A 1 105 ? -128.968 -40.576 -14.406 1.00 0.00 ? 118 GLU B CB  1  
ATOM 817    C CG  . GLU A 1 105 ? -129.982 -39.884 -13.528 1.00 0.00 ? 118 GLU B CG  1  
ATOM 818    C CD  . GLU A 1 105 ? -130.766 -38.700 -14.073 1.00 0.00 ? 118 GLU B CD  1  
ATOM 819    O OE1 . GLU A 1 105 ? -130.354 -38.086 -15.055 1.00 0.00 ? 118 GLU B OE1 1  
ATOM 820    O OE2 . GLU A 1 105 ? -131.791 -38.384 -13.470 1.00 0.00 ? 118 GLU B OE2 1  
ATOM 821    N N   . GLU A 1 106 ? -126.154 -41.354 -14.240 1.00 0.00 ? 119 GLU B N   1  
ATOM 822    C CA  . GLU A 1 106 ? -124.791 -41.528 -14.706 1.00 0.00 ? 119 GLU B CA  1  
ATOM 823    C C   . GLU A 1 106 ? -124.203 -42.862 -14.254 1.00 0.00 ? 119 GLU B C   1  
ATOM 824    O O   . GLU A 1 106 ? -123.791 -43.653 -15.095 1.00 0.00 ? 119 GLU B O   1  
ATOM 825    C CB  . GLU A 1 106 ? -123.886 -40.439 -14.177 1.00 0.00 ? 119 GLU B CB  1  
ATOM 826    C CG  . GLU A 1 106 ? -124.081 -39.059 -14.766 1.00 0.00 ? 119 GLU B CG  1  
ATOM 827    C CD  . GLU A 1 106 ? -123.118 -38.035 -14.181 1.00 0.00 ? 119 GLU B CD  1  
ATOM 828    O OE1 . GLU A 1 106 ? -121.916 -38.321 -14.097 1.00 0.00 ? 119 GLU B OE1 1  
ATOM 829    O OE2 . GLU A 1 106 ? -123.576 -36.956 -13.813 1.00 0.00 ? 119 GLU B OE2 1  
ATOM 830    N N   . LEU A 1 107 ? -124.143 -43.218 -12.968 1.00 0.00 ? 120 LEU B N   1  
ATOM 831    C CA  . LEU A 1 107 ? -123.585 -44.513 -12.562 1.00 0.00 ? 120 LEU B CA  1  
ATOM 832    C C   . LEU A 1 107 ? -124.227 -45.805 -13.098 1.00 0.00 ? 120 LEU B C   1  
ATOM 833    O O   . LEU A 1 107 ? -123.578 -46.849 -13.133 1.00 0.00 ? 120 LEU B O   1  
ATOM 834    C CB  . LEU A 1 107 ? -123.554 -44.574 -11.037 1.00 0.00 ? 120 LEU B CB  1  
ATOM 835    C CG  . LEU A 1 107 ? -122.659 -43.562 -10.314 1.00 0.00 ? 120 LEU B CG  1  
ATOM 836    C CD1 . LEU A 1 107 ? -122.765 -43.797 -8.820  1.00 0.00 ? 120 LEU B CD1 1  
ATOM 837    C CD2 . LEU A 1 107 ? -121.210 -43.705 -10.767 1.00 0.00 ? 120 LEU B CD2 1  
ATOM 838    N N   . LEU A 1 108 ? -125.496 -45.808 -13.497 1.00 0.00 ? 121 LEU B N   1  
ATOM 839    C CA  . LEU A 1 108 ? -126.089 -46.952 -14.186 1.00 0.00 ? 121 LEU B CA  1  
ATOM 840    C C   . LEU A 1 108 ? -125.708 -46.994 -15.675 1.00 0.00 ? 121 LEU B C   1  
ATOM 841    O O   . LEU A 1 108 ? -125.594 -48.057 -16.292 1.00 0.00 ? 121 LEU B O   1  
ATOM 842    C CB  . LEU A 1 108 ? -127.611 -46.902 -14.063 1.00 0.00 ? 121 LEU B CB  1  
ATOM 843    C CG  . LEU A 1 108 ? -128.269 -46.910 -12.682 1.00 0.00 ? 121 LEU B CG  1  
ATOM 844    C CD1 . LEU A 1 108 ? -129.768 -46.745 -12.863 1.00 0.00 ? 121 LEU B CD1 1  
ATOM 845    C CD2 . LEU A 1 108 ? -127.959 -48.200 -11.941 1.00 0.00 ? 121 LEU B CD2 1  
ATOM 846    N N   . THR A 1 109 ? -125.567 -45.833 -16.322 1.00 0.00 ? 122 THR B N   1  
ATOM 847    C CA  . THR A 1 109 ? -125.094 -45.786 -17.712 1.00 0.00 ? 122 THR B CA  1  
ATOM 848    C C   . THR A 1 109 ? -123.594 -45.888 -17.937 1.00 0.00 ? 122 THR B C   1  
ATOM 849    O O   . THR A 1 109 ? -123.146 -46.375 -18.969 1.00 0.00 ? 122 THR B O   1  
ATOM 850    C CB  . THR A 1 109 ? -125.440 -44.493 -18.480 1.00 0.00 ? 122 THR B CB  1  
ATOM 851    O OG1 . THR A 1 109 ? -125.145 -43.383 -17.636 1.00 0.00 ? 122 THR B OG1 1  
ATOM 852    C CG2 . THR A 1 109 ? -126.884 -44.475 -18.925 1.00 0.00 ? 122 THR B CG2 1  
ATOM 853    N N   . THR A 1 110 ? -122.788 -45.378 -17.001 1.00 0.00 ? 123 THR B N   1  
ATOM 854    C CA  . THR A 1 110 ? -121.349 -45.263 -17.226 1.00 0.00 ? 123 THR B CA  1  
ATOM 855    C C   . THR A 1 110 ? -120.463 -46.511 -17.202 1.00 0.00 ? 123 THR B C   1  
ATOM 856    O O   . THR A 1 110 ? -120.294 -47.123 -18.254 1.00 0.00 ? 123 THR B O   1  
ATOM 857    C CB  . THR A 1 110 ? -120.696 -44.229 -16.244 1.00 0.00 ? 123 THR B CB  1  
ATOM 858    O OG1 . THR A 1 110 ? -120.854 -44.635 -14.885 1.00 0.00 ? 123 THR B OG1 1  
ATOM 859    C CG2 . THR A 1 110 ? -121.265 -42.846 -16.529 1.00 0.00 ? 123 THR B CG2 1  
ATOM 860    N N   . GLN A 1 111 ? -119.765 -46.925 -16.141 1.00 0.00 ? 124 GLN B N   1  
ATOM 861    C CA  . GLN A 1 111 ? -118.958 -48.150 -16.133 1.00 0.00 ? 124 GLN B CA  1  
ATOM 862    C C   . GLN A 1 111 ? -119.777 -49.373 -16.598 1.00 0.00 ? 124 GLN B C   1  
ATOM 863    O O   . GLN A 1 111 ? -120.944 -49.487 -16.229 1.00 0.00 ? 124 GLN B O   1  
ATOM 864    C CB  . GLN A 1 111 ? -118.438 -48.306 -14.711 1.00 0.00 ? 124 GLN B CB  1  
ATOM 865    C CG  . GLN A 1 111 ? -117.376 -49.358 -14.454 1.00 0.00 ? 124 GLN B CG  1  
ATOM 866    C CD  . GLN A 1 111 ? -116.896 -49.316 -13.009 1.00 0.00 ? 124 GLN B CD  1  
ATOM 867    O OE1 . GLN A 1 111 ? -117.643 -49.502 -12.063 1.00 0.00 ? 124 GLN B OE1 1  
ATOM 868    N NE2 . GLN A 1 111 ? -115.657 -49.051 -12.675 1.00 0.00 ? 124 GLN B NE2 1  
ATOM 869    N N   . CYS A 1 112 ? -119.176 -50.287 -17.379 1.00 0.00 ? 125 CYS B N   1  
ATOM 870    C CA  . CYS A 1 112 ? -119.819 -51.387 -18.130 1.00 0.00 ? 125 CYS B CA  1  
ATOM 871    C C   . CYS A 1 112 ? -120.344 -50.915 -19.492 1.00 0.00 ? 125 CYS B C   1  
ATOM 872    O O   . CYS A 1 112 ? -119.914 -49.865 -19.974 1.00 0.00 ? 125 CYS B O   1  
ATOM 873    C CB  . CYS A 1 112 ? -121.030 -52.046 -17.426 1.00 0.00 ? 125 CYS B CB  1  
ATOM 874    S SG  . CYS A 1 112 ? -120.534 -53.381 -16.317 1.00 0.00 ? 125 CYS B SG  1  
ATOM 875    N N   . ASP A 1 113 ? -121.211 -51.655 -20.175 1.00 0.00 ? 126 ASP B N   1  
ATOM 876    C CA  . ASP A 1 113 ? -121.758 -51.272 -21.465 1.00 0.00 ? 126 ASP B CA  1  
ATOM 877    C C   . ASP A 1 113 ? -123.021 -50.417 -21.433 1.00 0.00 ? 126 ASP B C   1  
ATOM 878    O O   . ASP A 1 113 ? -123.168 -49.410 -22.126 1.00 0.00 ? 126 ASP B O   1  
ATOM 879    C CB  . ASP A 1 113 ? -121.998 -52.579 -22.249 1.00 0.00 ? 126 ASP B CB  1  
ATOM 880    C CG  . ASP A 1 113 ? -122.938 -53.611 -21.621 1.00 0.00 ? 126 ASP B CG  1  
ATOM 881    O OD1 . ASP A 1 113 ? -123.395 -54.489 -22.340 1.00 0.00 ? 126 ASP B OD1 1  
ATOM 882    O OD2 . ASP A 1 113 ? -123.221 -53.547 -20.422 1.00 0.00 ? 126 ASP B OD2 1  
ATOM 883    N N   . ARG A 1 114 ? -123.952 -50.809 -20.554 1.00 0.00 ? 127 ARG B N   1  
ATOM 884    C CA  . ARG A 1 114 ? -125.261 -50.183 -20.492 1.00 0.00 ? 127 ARG B CA  1  
ATOM 885    C C   . ARG A 1 114 ? -126.329 -50.632 -19.496 1.00 0.00 ? 127 ARG B C   1  
ATOM 886    O O   . ARG A 1 114 ? -126.702 -51.804 -19.385 1.00 0.00 ? 127 ARG B O   1  
ATOM 887    C CB  . ARG A 1 114 ? -125.981 -50.273 -21.847 1.00 0.00 ? 127 ARG B CB  1  
ATOM 888    C CG  . ARG A 1 114 ? -126.434 -49.011 -22.565 1.00 0.00 ? 127 ARG B CG  1  
ATOM 889    C CD  . ARG A 1 114 ? -127.030 -49.483 -23.890 1.00 0.00 ? 127 ARG B CD  1  
ATOM 890    N NE  . ARG A 1 114 ? -127.632 -48.406 -24.659 1.00 0.00 ? 127 ARG B NE  1  
ATOM 891    C CZ  . ARG A 1 114 ? -128.607 -48.599 -25.531 1.00 0.00 ? 127 ARG B CZ  1  
ATOM 892    N NH1 . ARG A 1 114 ? -129.063 -47.580 -26.215 1.00 0.00 ? 127 ARG B NH1 1  
ATOM 893    N NH2 . ARG A 1 114 ? -129.144 -49.770 -25.747 1.00 0.00 ? 127 ARG B NH2 1  
ATOM 894    N N   . PHE A 1 115 ? -126.795 -49.694 -18.690 1.00 0.00 ? 128 PHE B N   1  
ATOM 895    C CA  . PHE A 1 115 ? -128.169 -49.840 -18.247 1.00 0.00 ? 128 PHE B CA  1  
ATOM 896    C C   . PHE A 1 115 ? -128.813 -48.755 -19.100 1.00 0.00 ? 128 PHE B C   1  
ATOM 897    O O   . PHE A 1 115 ? -128.625 -47.548 -18.954 1.00 0.00 ? 128 PHE B O   1  
ATOM 898    C CB  . PHE A 1 115 ? -128.301 -49.595 -16.750 1.00 0.00 ? 128 PHE B CB  1  
ATOM 899    C CG  . PHE A 1 115 ? -128.291 -50.986 -16.148 1.00 0.00 ? 128 PHE B CG  1  
ATOM 900    C CD1 . PHE A 1 115 ? -127.127 -51.734 -16.174 1.00 0.00 ? 128 PHE B CD1 1  
ATOM 901    C CD2 . PHE A 1 115 ? -129.462 -51.526 -15.666 1.00 0.00 ? 128 PHE B CD2 1  
ATOM 902    C CE1 . PHE A 1 115 ? -127.140 -53.036 -15.725 1.00 0.00 ? 128 PHE B CE1 1  
ATOM 903    C CE2 . PHE A 1 115 ? -129.466 -52.822 -15.219 1.00 0.00 ? 128 PHE B CE2 1  
ATOM 904    C CZ  . PHE A 1 115 ? -128.308 -53.576 -15.252 1.00 0.00 ? 128 PHE B CZ  1  
ATOM 905    N N   . THR A 1 116 ? -129.488 -49.239 -20.142 1.00 0.00 ? 129 THR B N   1  
ATOM 906    C CA  . THR A 1 116 ? -129.935 -48.366 -21.234 1.00 0.00 ? 129 THR B CA  1  
ATOM 907    C C   . THR A 1 116 ? -130.816 -47.165 -20.881 1.00 0.00 ? 129 THR B C   1  
ATOM 908    O O   . THR A 1 116 ? -131.685 -47.237 -20.012 1.00 0.00 ? 129 THR B O   1  
ATOM 909    C CB  . THR A 1 116 ? -130.690 -49.171 -22.373 1.00 0.00 ? 129 THR B CB  1  
ATOM 910    O OG1 . THR A 1 116 ? -132.081 -49.038 -22.145 1.00 0.00 ? 129 THR B OG1 1  
ATOM 911    C CG2 . THR A 1 116 ? -130.265 -50.631 -22.460 1.00 0.00 ? 129 THR B CG2 1  
ATOM 912    N N   . PRO A 1 117 ? -130.674 -46.039 -21.591 1.00 0.00 ? 130 PRO B N   1  
ATOM 913    C CA  . PRO A 1 117 ? -131.621 -44.928 -21.442 1.00 0.00 ? 130 PRO B CA  1  
ATOM 914    C C   . PRO A 1 117 ? -133.110 -45.138 -21.748 1.00 0.00 ? 130 PRO B C   1  
ATOM 915    O O   . PRO A 1 117 ? -133.923 -44.208 -21.633 1.00 0.00 ? 130 PRO B O   1  
ATOM 916    C CB  . PRO A 1 117 ? -130.993 -43.818 -22.275 1.00 0.00 ? 130 PRO B CB  1  
ATOM 917    C CG  . PRO A 1 117 ? -129.841 -44.470 -22.997 1.00 0.00 ? 130 PRO B CG  1  
ATOM 918    C CD  . PRO A 1 117 ? -129.392 -45.439 -21.933 1.00 0.00 ? 130 PRO B CD  1  
ATOM 919    N N   . GLU A 1 118 ? -133.505 -46.351 -22.144 1.00 0.00 ? 131 GLU B N   1  
ATOM 920    C CA  . GLU A 1 118 ? -134.908 -46.737 -22.239 1.00 0.00 ? 131 GLU B CA  1  
ATOM 921    C C   . GLU A 1 118 ? -135.238 -47.293 -20.841 1.00 0.00 ? 131 GLU B C   1  
ATOM 922    O O   . GLU A 1 118 ? -136.084 -46.766 -20.115 1.00 0.00 ? 131 GLU B O   1  
ATOM 923    C CB  . GLU A 1 118 ? -135.081 -47.823 -23.294 1.00 0.00 ? 131 GLU B CB  1  
ATOM 924    C CG  . GLU A 1 118 ? -134.795 -47.305 -24.703 1.00 0.00 ? 131 GLU B CG  1  
ATOM 925    C CD  . GLU A 1 118 ? -134.677 -48.375 -25.778 1.00 0.00 ? 131 GLU B CD  1  
ATOM 926    O OE1 . GLU A 1 118 ? -135.447 -49.331 -25.781 1.00 0.00 ? 131 GLU B OE1 1  
ATOM 927    O OE2 . GLU A 1 118 ? -133.776 -48.247 -26.612 1.00 0.00 ? 131 GLU B OE2 1  
ATOM 928    N N   . GLU A 1 119 ? -134.461 -48.288 -20.377 1.00 0.00 ? 132 GLU B N   1  
ATOM 929    C CA  . GLU A 1 119 ? -134.554 -48.862 -19.019 1.00 0.00 ? 132 GLU B CA  1  
ATOM 930    C C   . GLU A 1 119 ? -134.586 -47.799 -17.914 1.00 0.00 ? 132 GLU B C   1  
ATOM 931    O O   . GLU A 1 119 ? -135.508 -47.759 -17.102 1.00 0.00 ? 132 GLU B O   1  
ATOM 932    C CB  . GLU A 1 119 ? -133.363 -49.799 -18.719 1.00 0.00 ? 132 GLU B CB  1  
ATOM 933    C CG  . GLU A 1 119 ? -133.213 -51.065 -19.575 1.00 0.00 ? 132 GLU B CG  1  
ATOM 934    C CD  . GLU A 1 119 ? -132.054 -51.997 -19.200 1.00 0.00 ? 132 GLU B CD  1  
ATOM 935    O OE1 . GLU A 1 119 ? -130.893 -51.614 -19.240 1.00 0.00 ? 132 GLU B OE1 1  
ATOM 936    O OE2 . GLU A 1 119 ? -132.293 -53.152 -18.873 1.00 0.00 ? 132 GLU B OE2 1  
ATOM 937    N N   . ILE A 1 120 ? -133.661 -46.835 -17.916 1.00 0.00 ? 133 ILE B N   1  
ATOM 938    C CA  . ILE A 1 120 ? -133.626 -45.745 -16.926 1.00 0.00 ? 133 ILE B CA  1  
ATOM 939    C C   . ILE A 1 120 ? -134.866 -44.831 -16.901 1.00 0.00 ? 133 ILE B C   1  
ATOM 940    O O   . ILE A 1 120 ? -135.365 -44.507 -15.821 1.00 0.00 ? 133 ILE B O   1  
ATOM 941    C CB  . ILE A 1 120 ? -132.311 -44.960 -17.204 1.00 0.00 ? 133 ILE B CB  1  
ATOM 942    C CG1 . ILE A 1 120 ? -131.154 -45.845 -16.759 1.00 0.00 ? 133 ILE B CG1 1  
ATOM 943    C CG2 . ILE A 1 120 ? -132.237 -43.653 -16.425 1.00 0.00 ? 133 ILE B CG2 1  
ATOM 944    C CD1 . ILE A 1 120 ? -129.759 -45.232 -16.970 1.00 0.00 ? 133 ILE B CD1 1  
ATOM 945    N N   . LYS A 1 121 ? -135.465 -44.410 -18.025 1.00 0.00 ? 134 LYS B N   1  
ATOM 946    C CA  . LYS A 1 121 ? -136.709 -43.629 -17.985 1.00 0.00 ? 134 LYS B CA  1  
ATOM 947    C C   . LYS A 1 121 ? -137.878 -44.437 -17.400 1.00 0.00 ? 134 LYS B C   1  
ATOM 948    O O   . LYS A 1 121 ? -138.647 -43.951 -16.565 1.00 0.00 ? 134 LYS B O   1  
ATOM 949    C CB  . LYS A 1 121 ? -137.070 -43.166 -19.387 1.00 0.00 ? 134 LYS B CB  1  
ATOM 950    C CG  . LYS A 1 121 ? -136.043 -42.175 -19.908 1.00 0.00 ? 134 LYS B CG  1  
ATOM 951    C CD  . LYS A 1 121 ? -136.371 -41.757 -21.324 1.00 0.00 ? 134 LYS B CD  1  
ATOM 952    C CE  . LYS A 1 121 ? -135.240 -40.892 -21.848 1.00 0.00 ? 134 LYS B CE  1  
ATOM 953    N NZ  . LYS A 1 121 ? -135.515 -40.487 -23.210 1.00 0.00 ? 134 LYS B NZ  1  
ATOM 954    N N   . ASN A 1 122 ? -137.963 -45.721 -17.766 1.00 0.00 ? 135 ASN B N   1  
ATOM 955    C CA  . ASN A 1 122 ? -138.925 -46.650 -17.157 1.00 0.00 ? 135 ASN B CA  1  
ATOM 956    C C   . ASN A 1 122 ? -138.709 -46.728 -15.643 1.00 0.00 ? 135 ASN B C   1  
ATOM 957    O O   . ASN A 1 122 ? -139.652 -46.703 -14.861 1.00 0.00 ? 135 ASN B O   1  
ATOM 958    C CB  . ASN A 1 122 ? -138.769 -48.061 -17.711 1.00 0.00 ? 135 ASN B CB  1  
ATOM 959    C CG  . ASN A 1 122 ? -138.989 -48.167 -19.206 1.00 0.00 ? 135 ASN B CG  1  
ATOM 960    O OD1 . ASN A 1 122 ? -139.985 -47.754 -19.768 1.00 0.00 ? 135 ASN B OD1 1  
ATOM 961    N ND2 . ASN A 1 122 ? -138.086 -48.732 -19.963 1.00 0.00 ? 135 ASN B ND2 1  
ATOM 962    N N   . MET A 1 123 ? -137.447 -46.805 -15.212 1.00 0.00 ? 136 MET B N   1  
ATOM 963    C CA  . MET A 1 123 ? -137.073 -46.693 -13.806 1.00 0.00 ? 136 MET B CA  1  
ATOM 964    C C   . MET A 1 123 ? -137.632 -45.427 -13.163 1.00 0.00 ? 136 MET B C   1  
ATOM 965    O O   . MET A 1 123 ? -138.439 -45.579 -12.265 1.00 0.00 ? 136 MET B O   1  
ATOM 966    C CB  . MET A 1 123 ? -135.564 -46.694 -13.660 1.00 0.00 ? 136 MET B CB  1  
ATOM 967    C CG  . MET A 1 123 ? -134.918 -48.047 -13.861 1.00 0.00 ? 136 MET B CG  1  
ATOM 968    S SD  . MET A 1 123 ? -135.369 -49.152 -12.505 1.00 0.00 ? 136 MET B SD  1  
ATOM 969    C CE  . MET A 1 123 ? -134.565 -48.258 -11.202 1.00 0.00 ? 136 MET B CE  1  
ATOM 970    N N   . TRP A 1 124 ? -137.371 -44.197 -13.609 1.00 0.00 ? 137 TRP B N   1  
ATOM 971    C CA  . TRP A 1 124 ? -137.965 -42.988 -13.011 1.00 0.00 ? 137 TRP B CA  1  
ATOM 972    C C   . TRP A 1 124 ? -139.504 -42.925 -12.945 1.00 0.00 ? 137 TRP B C   1  
ATOM 973    O O   . TRP A 1 124 ? -140.096 -42.224 -12.116 1.00 0.00 ? 137 TRP B O   1  
ATOM 974    C CB  . TRP A 1 124 ? -137.525 -41.717 -13.747 1.00 0.00 ? 137 TRP B CB  1  
ATOM 975    C CG  . TRP A 1 124 ? -136.033 -41.614 -14.024 1.00 0.00 ? 137 TRP B CG  1  
ATOM 976    C CD1 . TRP A 1 124 ? -135.604 -41.464 -15.312 1.00 0.00 ? 137 TRP B CD1 1  
ATOM 977    C CD2 . TRP A 1 124 ? -135.000 -41.696 -13.122 1.00 0.00 ? 137 TRP B CD2 1  
ATOM 978    N NE1 . TRP A 1 124 ? -134.304 -41.465 -15.224 1.00 0.00 ? 137 TRP B NE1 1  
ATOM 979    C CE2 . TRP A 1 124 ? -133.918 -41.602 -13.954 1.00 0.00 ? 137 TRP B CE2 1  
ATOM 980    C CE3 . TRP A 1 124 ? -134.776 -41.839 -11.779 1.00 0.00 ? 137 TRP B CE3 1  
ATOM 981    C CZ2 . TRP A 1 124 ? -132.643 -41.651 -13.454 1.00 0.00 ? 137 TRP B CZ2 1  
ATOM 982    C CZ3 . TRP A 1 124 ? -133.506 -41.884 -11.258 1.00 0.00 ? 137 TRP B CZ3 1  
ATOM 983    C CH2 . TRP A 1 124 ? -132.429 -41.791 -12.103 1.00 0.00 ? 137 TRP B CH2 1  
ATOM 984    N N   . ALA A 1 125 ? -140.162 -43.577 -13.903 1.00 0.00 ? 138 ALA B N   1  
ATOM 985    C CA  . ALA A 1 125 ? -141.618 -43.736 -13.890 1.00 0.00 ? 138 ALA B CA  1  
ATOM 986    C C   . ALA A 1 125 ? -142.190 -44.841 -12.980 1.00 0.00 ? 138 ALA B C   1  
ATOM 987    O O   . ALA A 1 125 ? -143.247 -44.688 -12.373 1.00 0.00 ? 138 ALA B O   1  
ATOM 988    C CB  . ALA A 1 125 ? -142.099 -44.000 -15.307 1.00 0.00 ? 138 ALA B CB  1  
ATOM 989    N N   . ALA A 1 126 ? -141.525 -45.999 -12.891 1.00 0.00 ? 139 ALA B N   1  
ATOM 990    C CA  . ALA A 1 126 ? -141.930 -47.148 -12.059 1.00 0.00 ? 139 ALA B CA  1  
ATOM 991    C C   . ALA A 1 126 ? -141.364 -47.236 -10.634 1.00 0.00 ? 139 ALA B C   1  
ATOM 992    O O   . ALA A 1 126 ? -141.722 -48.063 -9.792  1.00 0.00 ? 139 ALA B O   1  
ATOM 993    C CB  . ALA A 1 126 ? -141.562 -48.437 -12.764 1.00 0.00 ? 139 ALA B CB  1  
ATOM 994    N N   . PHE A 1 127 ? -140.334 -46.420 -10.500 1.00 0.00 ? 140 PHE B N   1  
ATOM 995    C CA  . PHE A 1 127 ? -139.707 -45.970 -9.266  1.00 0.00 ? 140 PHE B CA  1  
ATOM 996    C C   . PHE A 1 127 ? -139.754 -44.451 -9.487  1.00 0.00 ? 140 PHE B C   1  
ATOM 997    O O   . PHE A 1 127 ? -138.809 -43.826 -9.930  1.00 0.00 ? 140 PHE B O   1  
ATOM 998    C CB  . PHE A 1 127 ? -138.268 -46.493 -9.161  1.00 0.00 ? 140 PHE B CB  1  
ATOM 999    C CG  . PHE A 1 127 ? -138.326 -47.996 -8.992  1.00 0.00 ? 140 PHE B CG  1  
ATOM 1000   C CD1 . PHE A 1 127 ? -138.312 -48.804 -10.115 1.00 0.00 ? 140 PHE B CD1 1  
ATOM 1001   C CD2 . PHE A 1 127 ? -138.491 -48.532 -7.736  1.00 0.00 ? 140 PHE B CD2 1  
ATOM 1002   C CE1 . PHE A 1 127 ? -138.471 -50.161 -9.969  1.00 0.00 ? 140 PHE B CE1 1  
ATOM 1003   C CE2 . PHE A 1 127 ? -138.647 -49.890 -7.599  1.00 0.00 ? 140 PHE B CE2 1  
ATOM 1004   C CZ  . PHE A 1 127 ? -138.641 -50.699 -8.715  1.00 0.00 ? 140 PHE B CZ  1  
ATOM 1005   N N   . PRO A 1 128 ? -140.975 -43.888 -9.483  1.00 0.00 ? 141 PRO B N   1  
ATOM 1006   C CA  . PRO A 1 128 ? -141.313 -42.620 -8.883  1.00 0.00 ? 141 PRO B CA  1  
ATOM 1007   C C   . PRO A 1 128 ? -140.876 -41.151 -8.715  1.00 0.00 ? 141 PRO B C   1  
ATOM 1008   O O   . PRO A 1 128 ? -139.778 -40.623 -8.902  1.00 0.00 ? 141 PRO B O   1  
ATOM 1009   C CB  . PRO A 1 128 ? -141.694 -43.244 -7.556  1.00 0.00 ? 141 PRO B CB  1  
ATOM 1010   C CG  . PRO A 1 128 ? -142.626 -44.353 -7.887  1.00 0.00 ? 141 PRO B CG  1  
ATOM 1011   C CD  . PRO A 1 128 ? -142.318 -44.446 -9.361  1.00 0.00 ? 141 PRO B CD  1  
ATOM 1012   N N   . PRO A 1 129 ? -141.912 -40.439 -8.245  1.00 0.00 ? 142 PRO B N   1  
ATOM 1013   C CA  . PRO A 1 129 ? -141.903 -39.835 -6.907  1.00 0.00 ? 142 PRO B CA  1  
ATOM 1014   C C   . PRO A 1 129 ? -140.754 -40.220 -5.965  1.00 0.00 ? 142 PRO B C   1  
ATOM 1015   O O   . PRO A 1 129 ? -139.932 -39.339 -5.733  1.00 0.00 ? 142 PRO B O   1  
ATOM 1016   C CB  . PRO A 1 129 ? -143.284 -40.179 -6.374  1.00 0.00 ? 142 PRO B CB  1  
ATOM 1017   C CG  . PRO A 1 129 ? -144.125 -40.564 -7.588  1.00 0.00 ? 142 PRO B CG  1  
ATOM 1018   C CD  . PRO A 1 129 ? -143.244 -40.190 -8.777  1.00 0.00 ? 142 PRO B CD  1  
ATOM 1019   N N   . ASP A 1 130 ? -140.607 -41.454 -5.443  1.00 0.00 ? 143 ASP B N   1  
ATOM 1020   C CA  . ASP A 1 130 ? -139.435 -41.874 -4.674  1.00 0.00 ? 143 ASP B CA  1  
ATOM 1021   C C   . ASP A 1 130 ? -138.109 -41.416 -5.298  1.00 0.00 ? 143 ASP B C   1  
ATOM 1022   O O   . ASP A 1 130 ? -137.405 -40.546 -4.781  1.00 0.00 ? 143 ASP B O   1  
ATOM 1023   C CB  . ASP A 1 130 ? -139.488 -43.437 -4.490  1.00 0.00 ? 143 ASP B CB  1  
ATOM 1024   C CG  . ASP A 1 130 ? -139.146 -44.464 -5.572  1.00 0.00 ? 143 ASP B CG  1  
ATOM 1025   O OD1 . ASP A 1 130 ? -139.931 -45.370 -5.800  1.00 0.00 ? 143 ASP B OD1 1  
ATOM 1026   O OD2 . ASP A 1 130 ? -138.097 -44.395 -6.193  1.00 0.00 ? 143 ASP B OD2 1  
ATOM 1027   N N   . VAL A 1 131 ? -137.840 -41.812 -6.533  1.00 0.00 ? 144 VAL B N   1  
ATOM 1028   C CA  . VAL A 1 131 ? -136.669 -41.429 -7.298  1.00 0.00 ? 144 VAL B CA  1  
ATOM 1029   C C   . VAL A 1 131 ? -136.547 -39.917 -7.550  1.00 0.00 ? 144 VAL B C   1  
ATOM 1030   O O   . VAL A 1 131 ? -135.534 -39.400 -8.024  1.00 0.00 ? 144 VAL B O   1  
ATOM 1031   C CB  . VAL A 1 131 ? -136.814 -42.326 -8.534  1.00 0.00 ? 144 VAL B CB  1  
ATOM 1032   C CG1 . VAL A 1 131 ? -137.100 -41.499 -9.749  1.00 0.00 ? 144 VAL B CG1 1  
ATOM 1033   C CG2 . VAL A 1 131 ? -135.584 -43.178 -8.694  1.00 0.00 ? 144 VAL B CG2 1  
ATOM 1034   N N   . ALA A 1 132 ? -137.627 -39.150 -7.441  1.00 0.00 ? 145 ALA B N   1  
ATOM 1035   C CA  . ALA A 1 132 ? -137.552 -37.695 -7.513  1.00 0.00 ? 145 ALA B CA  1  
ATOM 1036   C C   . ALA A 1 132 ? -137.222 -36.994 -6.196  1.00 0.00 ? 145 ALA B C   1  
ATOM 1037   O O   . ALA A 1 132 ? -136.379 -36.109 -6.155  1.00 0.00 ? 145 ALA B O   1  
ATOM 1038   C CB  . ALA A 1 132 ? -138.868 -37.141 -8.029  1.00 0.00 ? 145 ALA B CB  1  
ATOM 1039   N N   . GLY A 1 133 ? -137.873 -37.432 -5.118  1.00 0.00 ? 146 GLY B N   1  
ATOM 1040   C CA  . GLY A 1 133 ? -137.721 -36.840 -3.791  1.00 0.00 ? 146 GLY B CA  1  
ATOM 1041   C C   . GLY A 1 133 ? -136.408 -37.094 -3.060  1.00 0.00 ? 146 GLY B C   1  
ATOM 1042   O O   . GLY A 1 133 ? -135.589 -36.202 -2.843  1.00 0.00 ? 146 GLY B O   1  
ATOM 1043   N N   . ASN A 1 134 ? -136.199 -38.324 -2.629  1.00 0.00 ? 147 ASN B N   1  
ATOM 1044   C CA  . ASN A 1 134 ? -134.995 -38.718 -1.903  1.00 0.00 ? 147 ASN B CA  1  
ATOM 1045   C C   . ASN A 1 134 ? -134.291 -39.829 -2.698  1.00 0.00 ? 147 ASN B C   1  
ATOM 1046   O O   . ASN A 1 134 ? -133.372 -40.463 -2.201  1.00 0.00 ? 147 ASN B O   1  
ATOM 1047   C CB  . ASN A 1 134 ? -135.569 -39.090 -0.497  1.00 0.00 ? 147 ASN B CB  1  
ATOM 1048   C CG  . ASN A 1 134 ? -134.987 -40.162 0.423   1.00 0.00 ? 147 ASN B CG  1  
ATOM 1049   O OD1 . ASN A 1 134 ? -133.931 -40.032 1.021   1.00 0.00 ? 147 ASN B OD1 1  
ATOM 1050   N ND2 . ASN A 1 134 ? -135.608 -41.283 0.730   1.00 0.00 ? 147 ASN B ND2 1  
ATOM 1051   N N   . VAL A 1 135 ? -134.664 -40.011 -3.987  1.00 0.00 ? 148 VAL B N   1  
ATOM 1052   C CA  . VAL A 1 135 ? -134.523 -41.262 -4.762  1.00 0.00 ? 148 VAL B CA  1  
ATOM 1053   C C   . VAL A 1 135 ? -134.664 -42.390 -3.741  1.00 0.00 ? 148 VAL B C   1  
ATOM 1054   O O   . VAL A 1 135 ? -133.763 -43.171 -3.442  1.00 0.00 ? 148 VAL B O   1  
ATOM 1055   C CB  . VAL A 1 135 ? -133.179 -41.447 -5.536  1.00 0.00 ? 148 VAL B CB  1  
ATOM 1056   C CG1 . VAL A 1 135 ? -133.255 -42.732 -6.334  1.00 0.00 ? 148 VAL B CG1 1  
ATOM 1057   C CG2 . VAL A 1 135 ? -132.980 -40.421 -6.627  1.00 0.00 ? 148 VAL B CG2 1  
ATOM 1058   N N   . ASP A 1 136 ? -135.815 -42.296 -3.059  1.00 0.00 ? 149 ASP B N   1  
ATOM 1059   C CA  . ASP A 1 136 ? -136.155 -43.093 -1.897  1.00 0.00 ? 149 ASP B CA  1  
ATOM 1060   C C   . ASP A 1 136 ? -135.773 -44.574 -1.919  1.00 0.00 ? 149 ASP B C   1  
ATOM 1061   O O   . ASP A 1 136 ? -136.587 -45.486 -1.979  1.00 0.00 ? 149 ASP B O   1  
ATOM 1062   C CB  . ASP A 1 136 ? -137.649 -42.914 -1.667  1.00 0.00 ? 149 ASP B CB  1  
ATOM 1063   C CG  . ASP A 1 136 ? -138.105 -41.535 -1.231  1.00 0.00 ? 149 ASP B CG  1  
ATOM 1064   O OD1 . ASP A 1 136 ? -138.044 -40.589 -2.006  1.00 0.00 ? 149 ASP B OD1 1  
ATOM 1065   O OD2 . ASP A 1 136 ? -138.479 -41.400 -0.072  1.00 0.00 ? 149 ASP B OD2 1  
ATOM 1066   N N   . TYR A 1 137 ? -134.482 -44.873 -1.756  1.00 0.00 ? 150 TYR B N   1  
ATOM 1067   C CA  . TYR A 1 137 ? -133.970 -46.238 -1.902  1.00 0.00 ? 150 TYR B CA  1  
ATOM 1068   C C   . TYR A 1 137 ? -134.552 -47.266 -0.956  1.00 0.00 ? 150 TYR B C   1  
ATOM 1069   O O   . TYR A 1 137 ? -134.791 -48.416 -1.308  1.00 0.00 ? 150 TYR B O   1  
ATOM 1070   C CB  . TYR A 1 137 ? -132.475 -46.283 -1.741  1.00 0.00 ? 150 TYR B CB  1  
ATOM 1071   C CG  . TYR A 1 137 ? -131.809 -45.604 -2.917  1.00 0.00 ? 150 TYR B CG  1  
ATOM 1072   C CD1 . TYR A 1 137 ? -131.110 -44.461 -2.660  1.00 0.00 ? 150 TYR B CD1 1  
ATOM 1073   C CD2 . TYR A 1 137 ? -131.940 -46.070 -4.208  1.00 0.00 ? 150 TYR B CD2 1  
ATOM 1074   C CE1 . TYR A 1 137 ? -130.548 -43.778 -3.692  1.00 0.00 ? 150 TYR B CE1 1  
ATOM 1075   C CE2 . TYR A 1 137 ? -131.361 -45.385 -5.250  1.00 0.00 ? 150 TYR B CE2 1  
ATOM 1076   C CZ  . TYR A 1 137 ? -130.669 -44.228 -4.971  1.00 0.00 ? 150 TYR B CZ  1  
ATOM 1077   O OH  . TYR A 1 137 ? -130.125 -43.459 -5.976  1.00 0.00 ? 150 TYR B OH  1  
ATOM 1078   N N   . LYS A 1 138 ? -134.870 -46.771 0.241   1.00 0.00 ? 151 LYS B N   1  
ATOM 1079   C CA  . LYS A 1 138 ? -135.600 -47.554 1.232   1.00 0.00 ? 151 LYS B CA  1  
ATOM 1080   C C   . LYS A 1 138 ? -136.928 -48.025 0.613   1.00 0.00 ? 151 LYS B C   1  
ATOM 1081   O O   . LYS A 1 138 ? -137.190 -49.217 0.465   1.00 0.00 ? 151 LYS B O   1  
ATOM 1082   C CB  . LYS A 1 138 ? -135.876 -46.684 2.463   1.00 0.00 ? 151 LYS B CB  1  
ATOM 1083   C CG  . LYS A 1 138 ? -134.610 -46.158 3.125   1.00 0.00 ? 151 LYS B CG  1  
ATOM 1084   C CD  . LYS A 1 138 ? -134.935 -45.377 4.385   1.00 0.00 ? 151 LYS B CD  1  
ATOM 1085   C CE  . LYS A 1 138 ? -133.650 -44.874 5.021   1.00 0.00 ? 151 LYS B CE  1  
ATOM 1086   N NZ  . LYS A 1 138 ? -133.941 -44.165 6.251   1.00 0.00 ? 151 LYS B NZ  1  
ATOM 1087   N N   . ASN A 1 139 ? -137.703 -47.067 0.095   1.00 0.00 ? 152 ASN B N   1  
ATOM 1088   C CA  . ASN A 1 139 ? -138.960 -47.331 -0.602  1.00 0.00 ? 152 ASN B CA  1  
ATOM 1089   C C   . ASN A 1 139 ? -138.770 -48.236 -1.834  1.00 0.00 ? 152 ASN B C   1  
ATOM 1090   O O   . ASN A 1 139 ? -139.349 -49.323 -1.907  1.00 0.00 ? 152 ASN B O   1  
ATOM 1091   C CB  . ASN A 1 139 ? -139.547 -45.971 -0.960  1.00 0.00 ? 152 ASN B CB  1  
ATOM 1092   C CG  . ASN A 1 139 ? -139.929 -45.127 0.254   1.00 0.00 ? 152 ASN B CG  1  
ATOM 1093   O OD1 . ASN A 1 139 ? -140.032 -45.576 1.387   1.00 0.00 ? 152 ASN B OD1 1  
ATOM 1094   N ND2 . ASN A 1 139 ? -140.093 -43.829 0.163   1.00 0.00 ? 152 ASN B ND2 1  
ATOM 1095   N N   . ILE A 1 140 ? -137.811 -47.913 -2.723  1.00 0.00 ? 153 ILE B N   1  
ATOM 1096   C CA  . ILE A 1 140 ? -137.403 -48.733 -3.881  1.00 0.00 ? 153 ILE B CA  1  
ATOM 1097   C C   . ILE A 1 140 ? -137.241 -50.217 -3.508  1.00 0.00 ? 153 ILE B C   1  
ATOM 1098   O O   . ILE A 1 140 ? -137.869 -51.109 -4.090  1.00 0.00 ? 153 ILE B O   1  
ATOM 1099   C CB  . ILE A 1 140 ? -136.051 -48.186 -4.466  1.00 0.00 ? 153 ILE B CB  1  
ATOM 1100   C CG1 . ILE A 1 140 ? -136.334 -46.891 -5.196  1.00 0.00 ? 153 ILE B CG1 1  
ATOM 1101   C CG2 . ILE A 1 140 ? -135.400 -49.176 -5.439  1.00 0.00 ? 153 ILE B CG2 1  
ATOM 1102   C CD1 . ILE A 1 140 ? -135.127 -46.203 -5.868  1.00 0.00 ? 153 ILE B CD1 1  
ATOM 1103   N N   . CYS A 1 141 ? -136.431 -50.510 -2.482  1.00 0.00 ? 154 CYS B N   1  
ATOM 1104   C CA  . CYS A 1 141 ? -136.260 -51.865 -1.962  1.00 0.00 ? 154 CYS B CA  1  
ATOM 1105   C C   . CYS A 1 141 ? -137.559 -52.519 -1.480  1.00 0.00 ? 154 CYS B C   1  
ATOM 1106   O O   . CYS A 1 141 ? -137.885 -53.638 -1.875  1.00 0.00 ? 154 CYS B O   1  
ATOM 1107   C CB  . CYS A 1 141 ? -135.297 -51.894 -0.793  1.00 0.00 ? 154 CYS B CB  1  
ATOM 1108   S SG  . CYS A 1 141 ? -133.616 -51.480 -1.302  1.00 0.00 ? 154 CYS B SG  1  
ATOM 1109   N N   . TYR A 1 142 ? -138.368 -51.831 -0.674  1.00 0.00 ? 155 TYR B N   1  
ATOM 1110   C CA  . TYR A 1 142 ? -139.653 -52.383 -0.248  1.00 0.00 ? 155 TYR B CA  1  
ATOM 1111   C C   . TYR A 1 142 ? -140.642 -52.658 -1.387  1.00 0.00 ? 155 TYR B C   1  
ATOM 1112   O O   . TYR A 1 142 ? -141.352 -53.662 -1.324  1.00 0.00 ? 155 TYR B O   1  
ATOM 1113   C CB  . TYR A 1 142 ? -140.329 -51.452 0.760   1.00 0.00 ? 155 TYR B CB  1  
ATOM 1114   C CG  . TYR A 1 142 ? -139.496 -51.193 2.015   1.00 0.00 ? 155 TYR B CG  1  
ATOM 1115   C CD1 . TYR A 1 142 ? -139.320 -49.892 2.440   1.00 0.00 ? 155 TYR B CD1 1  
ATOM 1116   C CD2 . TYR A 1 142 ? -138.895 -52.234 2.697   1.00 0.00 ? 155 TYR B CD2 1  
ATOM 1117   C CE1 . TYR A 1 142 ? -138.536 -49.625 3.540   1.00 0.00 ? 155 TYR B CE1 1  
ATOM 1118   C CE2 . TYR A 1 142 ? -138.112 -51.969 3.804   1.00 0.00 ? 155 TYR B CE2 1  
ATOM 1119   C CZ  . TYR A 1 142 ? -137.934 -50.670 4.215   1.00 0.00 ? 155 TYR B CZ  1  
ATOM 1120   O OH  . TYR A 1 142 ? -137.142 -50.397 5.314   1.00 0.00 ? 155 TYR B OH  1  
ATOM 1121   N N   . VAL A 1 143 ? -140.698 -51.852 -2.444  1.00 0.00 ? 156 VAL B N   1  
ATOM 1122   C CA  . VAL A 1 143 ? -141.551 -52.124 -3.606  1.00 0.00 ? 156 VAL B CA  1  
ATOM 1123   C C   . VAL A 1 143 ? -141.085 -53.302 -4.463  1.00 0.00 ? 156 VAL B C   1  
ATOM 1124   O O   . VAL A 1 143 ? -141.876 -54.071 -5.033  1.00 0.00 ? 156 VAL B O   1  
ATOM 1125   C CB  . VAL A 1 143 ? -141.640 -50.812 -4.437  1.00 0.00 ? 156 VAL B CB  1  
ATOM 1126   C CG1 . VAL A 1 143 ? -142.044 -50.984 -5.902  1.00 0.00 ? 156 VAL B CG1 1  
ATOM 1127   C CG2 . VAL A 1 143 ? -142.723 -49.997 -3.772  1.00 0.00 ? 156 VAL B CG2 1  
ATOM 1128   N N   . ILE A 1 144 ? -139.772 -53.481 -4.619  1.00 0.00 ? 157 ILE B N   1  
ATOM 1129   C CA  . ILE A 1 144 ? -139.299 -54.645 -5.363  1.00 0.00 ? 157 ILE B CA  1  
ATOM 1130   C C   . ILE A 1 144 ? -139.471 -55.960 -4.597  1.00 0.00 ? 157 ILE B C   1  
ATOM 1131   O O   . ILE A 1 144 ? -139.933 -56.966 -5.146  1.00 0.00 ? 157 ILE B O   1  
ATOM 1132   C CB  . ILE A 1 144 ? -137.821 -54.416 -5.786  1.00 0.00 ? 157 ILE B CB  1  
ATOM 1133   C CG1 . ILE A 1 144 ? -136.822 -54.017 -4.722  1.00 0.00 ? 157 ILE B CG1 1  
ATOM 1134   C CG2 . ILE A 1 144 ? -137.951 -53.323 -6.819  1.00 0.00 ? 157 ILE B CG2 1  
ATOM 1135   C CD1 . ILE A 1 144 ? -135.432 -53.606 -5.273  1.00 0.00 ? 157 ILE B CD1 1  
ATOM 1136   N N   . THR A 1 145 ? -139.202 -56.000 -3.296  1.00 0.00 ? 158 THR B N   1  
ATOM 1137   C CA  . THR A 1 145 ? -139.444 -57.224 -2.517  1.00 0.00 ? 158 THR B CA  1  
ATOM 1138   C C   . THR A 1 145 ? -140.905 -57.433 -2.120  1.00 0.00 ? 158 THR B C   1  
ATOM 1139   O O   . THR A 1 145 ? -141.435 -58.560 -2.111  1.00 0.00 ? 158 THR B O   1  
ATOM 1140   C CB  . THR A 1 145 ? -138.631 -57.236 -1.234  1.00 0.00 ? 158 THR B CB  1  
ATOM 1141   O OG1 . THR A 1 145 ? -139.021 -56.117 -0.434  1.00 0.00 ? 158 THR B OG1 1  
ATOM 1142   C CG2 . THR A 1 145 ? -137.154 -57.243 -1.572  1.00 0.00 ? 158 THR B CG2 1  
ATOM 1143   N N   . HIS A 1 146 ? -141.633 -56.361 -1.805  1.00 0.00 ? 159 HIS B N   1  
ATOM 1144   C CA  . HIS A 1 146 ? -143.029 -56.437 -1.368  1.00 0.00 ? 159 HIS B CA  1  
ATOM 1145   C C   . HIS A 1 146 ? -144.171 -55.936 -2.272  1.00 0.00 ? 159 HIS B C   1  
ATOM 1146   O O   . HIS A 1 146 ? -145.267 -55.670 -1.763  1.00 0.00 ? 159 HIS B O   1  
ATOM 1147   C CB  . HIS A 1 146 ? -143.158 -55.720 -0.022  1.00 0.00 ? 159 HIS B CB  1  
ATOM 1148   C CG  . HIS A 1 146 ? -142.299 -56.251 1.115   1.00 0.00 ? 159 HIS B CG  1  
ATOM 1149   N ND1 . HIS A 1 146 ? -141.486 -55.535 1.889   1.00 0.00 ? 159 HIS B ND1 1  
ATOM 1150   C CD2 . HIS A 1 146 ? -142.261 -57.551 1.555   1.00 0.00 ? 159 HIS B CD2 1  
ATOM 1151   C CE1 . HIS A 1 146 ? -140.993 -56.352 2.776   1.00 0.00 ? 159 HIS B CE1 1  
ATOM 1152   N NE2 . HIS A 1 146 ? -141.446 -57.558 2.573   1.00 0.00 ? 159 HIS B NE2 1  
ATOM 1153   N N   . GLY A 1 147 ? -144.020 -55.830 -3.591  1.00 0.00 ? 160 GLY B N   1  
ATOM 1154   C CA  . GLY A 1 147 ? -145.130 -55.407 -4.458  1.00 0.00 ? 160 GLY B CA  1  
ATOM 1155   C C   . GLY A 1 147 ? -145.170 -53.923 -4.826  1.00 0.00 ? 160 GLY B C   1  
ATOM 1156   O O   . GLY A 1 147 ? -144.596 -53.076 -4.148  1.00 0.00 ? 160 GLY B O   1  
ATOM 1157   N N   . GLU A 1 148 ? -145.898 -53.555 -5.879  1.00 0.00 ? 161 GLU B N   1  
ATOM 1158   C CA  . GLU A 1 148 ? -145.910 -52.182 -6.397  1.00 0.00 ? 161 GLU B CA  1  
ATOM 1159   C C   . GLU A 1 148 ? -146.727 -51.084 -5.702  1.00 0.00 ? 161 GLU B C   1  
ATOM 1160   O O   . GLU A 1 148 ? -146.351 -49.917 -5.700  1.00 0.00 ? 161 GLU B O   1  
ATOM 1161   C CB  . GLU A 1 148 ? -146.343 -52.214 -7.859  1.00 0.00 ? 161 GLU B CB  1  
ATOM 1162   C CG  . GLU A 1 148 ? -145.544 -53.219 -8.673  1.00 0.00 ? 161 GLU B CG  1  
ATOM 1163   C CD  . GLU A 1 148 ? -145.551 -52.977 -10.164 1.00 0.00 ? 161 GLU B CD  1  
ATOM 1164   O OE1 . GLU A 1 148 ? -144.763 -52.124 -10.600 1.00 0.00 ? 161 GLU B OE1 1  
ATOM 1165   O OE2 . GLU A 1 148 ? -146.252 -53.677 -10.890 1.00 0.00 ? 161 GLU B OE2 1  
ATOM 1166   N N   . ASP A 1 149 ? -147.882 -51.441 -5.154  1.00 0.00 ? 162 ASP B N   1  
ATOM 1167   C CA  . ASP A 1 149 ? -148.789 -50.515 -4.463  1.00 0.00 ? 162 ASP B CA  1  
ATOM 1168   C C   . ASP A 1 149 ? -148.291 -50.032 -3.091  1.00 0.00 ? 162 ASP B C   1  
ATOM 1169   O O   . ASP A 1 149 ? -148.471 -48.892 -2.652  1.00 0.00 ? 162 ASP B O   1  
ATOM 1170   C CB  . ASP A 1 149 ? -150.169 -51.184 -4.245  1.00 0.00 ? 162 ASP B CB  1  
ATOM 1171   C CG  . ASP A 1 149 ? -150.633 -52.324 -5.159  1.00 0.00 ? 162 ASP B CG  1  
ATOM 1172   O OD1 . ASP A 1 149 ? -150.092 -52.533 -6.240  1.00 0.00 ? 162 ASP B OD1 1  
ATOM 1173   O OD2 . ASP A 1 149 ? -151.544 -53.057 -4.763  1.00 0.00 ? 162 ASP B OD2 1  
ATOM 1174   N N   . LYS A 1 150 ? -147.730 -50.995 -2.359  1.00 0.00 ? 163 LYS B N   1  
ATOM 1175   C CA  . LYS A 1 150 ? -147.150 -50.801 -1.026  1.00 0.00 ? 163 LYS B CA  1  
ATOM 1176   C C   . LYS A 1 150 ? -146.001 -49.814 -0.846  1.00 0.00 ? 163 LYS B C   1  
ATOM 1177   O O   . LYS A 1 150 ? -145.173 -49.670 -1.732  1.00 0.00 ? 163 LYS B O   1  
ATOM 1178   N N   . ASP B 2 1   ? -95.226  -51.471 -25.517 1.00 0.00 ? 5   ASP C N   1  
ATOM 1179   C CA  . ASP B 2 1   ? -95.508  -51.485 -24.073 1.00 0.00 ? 5   ASP C CA  1  
ATOM 1180   C C   . ASP B 2 1   ? -95.781  -52.819 -23.313 1.00 0.00 ? 5   ASP C C   1  
ATOM 1181   O O   . ASP B 2 1   ? -95.934  -53.846 -23.977 1.00 0.00 ? 5   ASP C O   1  
ATOM 1182   C CB  . ASP B 2 1   ? -96.670  -50.476 -23.971 1.00 0.00 ? 5   ASP C CB  1  
ATOM 1183   C CG  . ASP B 2 1   ? -97.674  -50.712 -22.859 1.00 0.00 ? 5   ASP C CG  1  
ATOM 1184   O OD1 . ASP B 2 1   ? -97.630  -50.004 -21.863 1.00 0.00 ? 5   ASP C OD1 1  
ATOM 1185   O OD2 . ASP B 2 1   ? -98.483  -51.634 -22.980 1.00 0.00 ? 5   ASP C OD2 1  
ATOM 1186   N N   . GLU B 2 2   ? -95.856  -52.850 -21.948 1.00 0.00 ? 6   GLU C N   1  
ATOM 1187   C CA  . GLU B 2 2   ? -96.313  -54.002 -21.122 1.00 0.00 ? 6   GLU C CA  1  
ATOM 1188   C C   . GLU B 2 2   ? -96.508  -54.042 -19.571 1.00 0.00 ? 6   GLU C C   1  
ATOM 1189   O O   . GLU B 2 2   ? -95.789  -53.410 -18.804 1.00 0.00 ? 6   GLU C O   1  
ATOM 1190   C CB  . GLU B 2 2   ? -95.453  -55.233 -21.424 1.00 0.00 ? 6   GLU C CB  1  
ATOM 1191   C CG  . GLU B 2 2   ? -96.430  -56.274 -21.973 1.00 0.00 ? 6   GLU C CG  1  
ATOM 1192   C CD  . GLU B 2 2   ? -95.847  -57.316 -22.908 1.00 0.00 ? 6   GLU C CD  1  
ATOM 1193   O OE1 . GLU B 2 2   ? -94.672  -57.634 -22.931 1.00 0.00 ? 6   GLU C OE1 1  
ATOM 1194   O OE2 . GLU B 2 2   ? -96.640  -57.948 -23.740 1.00 0.00 ? 6   GLU C OE2 1  
ATOM 1195   N N   . ILE B 2 3   ? -97.495  -54.886 -19.166 1.00 0.00 ? 7   ILE C N   1  
ATOM 1196   C CA  . ILE B 2 3   ? -98.058  -55.298 -17.839 1.00 0.00 ? 7   ILE C CA  1  
ATOM 1197   C C   . ILE B 2 3   ? -99.541  -55.732 -18.095 1.00 0.00 ? 7   ILE C C   1  
ATOM 1198   O O   . ILE B 2 3   ? -100.031 -55.463 -19.200 1.00 0.00 ? 7   ILE C O   1  
ATOM 1199   C CB  . ILE B 2 3   ? -98.006  -54.119 -16.761 1.00 0.00 ? 7   ILE C CB  1  
ATOM 1200   C CG1 . ILE B 2 3   ? -96.690  -54.250 -15.979 1.00 0.00 ? 7   ILE C CG1 1  
ATOM 1201   C CG2 . ILE B 2 3   ? -99.113  -54.188 -15.700 1.00 0.00 ? 7   ILE C CG2 1  
ATOM 1202   C CD1 . ILE B 2 3   ? -96.415  -53.138 -14.938 1.00 0.00 ? 7   ILE C CD1 1  
ATOM 1203   N N   . ASN B 2 4   ? -100.340 -56.403 -17.238 1.00 0.00 ? 8   ASN C N   1  
ATOM 1204   C CA  . ASN B 2 4   ? -101.747 -56.711 -17.544 1.00 0.00 ? 8   ASN C CA  1  
ATOM 1205   C C   . ASN B 2 4   ? -102.833 -55.847 -16.879 1.00 0.00 ? 8   ASN C C   1  
ATOM 1206   O O   . ASN B 2 4   ? -103.508 -55.096 -17.591 1.00 0.00 ? 8   ASN C O   1  
ATOM 1207   C CB  . ASN B 2 4   ? -101.966 -58.196 -17.238 1.00 0.00 ? 8   ASN C CB  1  
ATOM 1208   C CG  . ASN B 2 4   ? -101.543 -59.130 -18.373 1.00 0.00 ? 8   ASN C CG  1  
ATOM 1209   O OD1 . ASN B 2 4   ? -101.240 -58.667 -19.486 1.00 0.00 ? 8   ASN C OD1 1  
ATOM 1210   N ND2 . ASN B 2 4   ? -101.536 -60.340 -18.153 1.00 0.00 ? 8   ASN C ND2 1  
ATOM 1211   N N   . ASP B 2 5   ? -102.996 -55.822 -15.552 1.00 0.00 ? 9   ASP C N   1  
ATOM 1212   C CA  . ASP B 2 5   ? -103.924 -54.981 -14.761 1.00 0.00 ? 9   ASP C CA  1  
ATOM 1213   C C   . ASP B 2 5   ? -104.420 -53.640 -15.337 1.00 0.00 ? 9   ASP C C   1  
ATOM 1214   O O   . ASP B 2 5   ? -105.599 -53.277 -15.313 1.00 0.00 ? 9   ASP C O   1  
ATOM 1215   C CB  . ASP B 2 5   ? -103.290 -54.645 -13.408 1.00 0.00 ? 9   ASP C CB  1  
ATOM 1216   C CG  . ASP B 2 5   ? -102.706 -55.761 -12.553 1.00 0.00 ? 9   ASP C CG  1  
ATOM 1217   O OD1 . ASP B 2 5   ? -102.137 -56.715 -13.090 1.00 0.00 ? 9   ASP C OD1 1  
ATOM 1218   O OD2 . ASP B 2 5   ? -102.763 -55.643 -11.334 1.00 0.00 ? 9   ASP C OD2 1  
ATOM 1219   N N   . PHE B 2 6   ? -103.517 -52.835 -15.908 1.00 0.00 ? 10  PHE C N   1  
ATOM 1220   C CA  . PHE B 2 6   ? -103.872 -51.551 -16.522 1.00 0.00 ? 10  PHE C CA  1  
ATOM 1221   C C   . PHE B 2 6   ? -104.932 -51.661 -17.628 1.00 0.00 ? 10  PHE C C   1  
ATOM 1222   O O   . PHE B 2 6   ? -105.845 -50.843 -17.734 1.00 0.00 ? 10  PHE C O   1  
ATOM 1223   C CB  . PHE B 2 6   ? -102.609 -50.887 -17.077 1.00 0.00 ? 10  PHE C CB  1  
ATOM 1224   C CG  . PHE B 2 6   ? -101.613 -50.531 -15.976 1.00 0.00 ? 10  PHE C CG  1  
ATOM 1225   C CD1 . PHE B 2 6   ? -100.287 -50.881 -16.111 1.00 0.00 ? 10  PHE C CD1 1  
ATOM 1226   C CD2 . PHE B 2 6   ? -102.033 -49.866 -14.838 1.00 0.00 ? 10  PHE C CD2 1  
ATOM 1227   C CE1 . PHE B 2 6   ? -99.389  -50.569 -15.107 1.00 0.00 ? 10  PHE C CE1 1  
ATOM 1228   C CE2 . PHE B 2 6   ? -101.131 -49.558 -13.841 1.00 0.00 ? 10  PHE C CE2 1  
ATOM 1229   C CZ  . PHE B 2 6   ? -99.810  -49.907 -13.974 1.00 0.00 ? 10  PHE C CZ  1  
ATOM 1230   N N   . LYS B 2 7   ? -104.917 -52.761 -18.379 1.00 0.00 ? 11  LYS C N   1  
ATOM 1231   C CA  . LYS B 2 7   ? -105.930 -53.049 -19.388 1.00 0.00 ? 11  LYS C CA  1  
ATOM 1232   C C   . LYS B 2 7   ? -107.296 -53.311 -18.741 1.00 0.00 ? 11  LYS C C   1  
ATOM 1233   O O   . LYS B 2 7   ? -108.334 -52.808 -19.180 1.00 0.00 ? 11  LYS C O   1  
ATOM 1234   C CB  . LYS B 2 7   ? -105.496 -54.264 -20.198 1.00 0.00 ? 11  LYS C CB  1  
ATOM 1235   C CG  . LYS B 2 7   ? -104.206 -54.003 -20.957 1.00 0.00 ? 11  LYS C CG  1  
ATOM 1236   C CD  . LYS B 2 7   ? -103.778 -55.271 -21.661 1.00 0.00 ? 11  LYS C CD  1  
ATOM 1237   C CE  . LYS B 2 7   ? -102.418 -55.064 -22.291 1.00 0.00 ? 11  LYS C CE  1  
ATOM 1238   N NZ  . LYS B 2 7   ? -101.978 -56.307 -22.889 1.00 0.00 ? 11  LYS C NZ  1  
ATOM 1239   N N   . GLU B 2 8   ? -107.304 -54.036 -17.619 1.00 0.00 ? 12  GLU C N   1  
ATOM 1240   C CA  . GLU B 2 8   ? -108.521 -54.270 -16.835 1.00 0.00 ? 12  GLU C CA  1  
ATOM 1241   C C   . GLU B 2 8   ? -109.099 -52.945 -16.310 1.00 0.00 ? 12  GLU C C   1  
ATOM 1242   O O   . GLU B 2 8   ? -110.292 -52.627 -16.435 1.00 0.00 ? 12  GLU C O   1  
ATOM 1243   C CB  . GLU B 2 8   ? -108.245 -55.166 -15.641 1.00 0.00 ? 12  GLU C CB  1  
ATOM 1244   C CG  . GLU B 2 8   ? -107.643 -56.529 -15.976 1.00 0.00 ? 12  GLU C CG  1  
ATOM 1245   C CD  . GLU B 2 8   ? -107.568 -57.533 -14.829 1.00 0.00 ? 12  GLU C CD  1  
ATOM 1246   O OE1 . GLU B 2 8   ? -107.952 -57.221 -13.697 1.00 0.00 ? 12  GLU C OE1 1  
ATOM 1247   O OE2 . GLU B 2 8   ? -107.138 -58.654 -15.090 1.00 0.00 ? 12  GLU C OE2 1  
ATOM 1248   N N   . ALA B 2 9   ? -108.223 -52.097 -15.772 1.00 0.00 ? 13  ALA C N   1  
ATOM 1249   C CA  . ALA B 2 9   ? -108.587 -50.748 -15.331 1.00 0.00 ? 13  ALA C CA  1  
ATOM 1250   C C   . ALA B 2 9   ? -109.129 -49.820 -16.420 1.00 0.00 ? 13  ALA C C   1  
ATOM 1251   O O   . ALA B 2 9   ? -110.009 -49.007 -16.137 1.00 0.00 ? 13  ALA C O   1  
ATOM 1252   C CB  . ALA B 2 9   ? -107.376 -50.071 -14.712 1.00 0.00 ? 13  ALA C CB  1  
ATOM 1253   N N   . PHE B 2 10  ? -108.650 -49.899 -17.672 1.00 0.00 ? 14  PHE C N   1  
ATOM 1254   C CA  . PHE B 2 10  ? -109.214 -49.103 -18.771 1.00 0.00 ? 14  PHE C CA  1  
ATOM 1255   C C   . PHE B 2 10  ? -110.729 -49.283 -18.939 1.00 0.00 ? 14  PHE C C   1  
ATOM 1256   O O   . PHE B 2 10  ? -111.477 -48.316 -18.808 1.00 0.00 ? 14  PHE C O   1  
ATOM 1257   C CB  . PHE B 2 10  ? -108.498 -49.446 -20.086 1.00 0.00 ? 14  PHE C CB  1  
ATOM 1258   C CG  . PHE B 2 10  ? -107.029 -49.029 -20.104 1.00 0.00 ? 14  PHE C CG  1  
ATOM 1259   C CD1 . PHE B 2 10  ? -106.106 -49.821 -20.760 1.00 0.00 ? 14  PHE C CD1 1  
ATOM 1260   C CD2 . PHE B 2 10  ? -106.605 -47.883 -19.457 1.00 0.00 ? 14  PHE C CD2 1  
ATOM 1261   C CE1 . PHE B 2 10  ? -104.775 -49.475 -20.762 1.00 0.00 ? 14  PHE C CE1 1  
ATOM 1262   C CE2 . PHE B 2 10  ? -105.270 -47.542 -19.465 1.00 0.00 ? 14  PHE C CE2 1  
ATOM 1263   C CZ  . PHE B 2 10  ? -104.357 -48.337 -20.116 1.00 0.00 ? 14  PHE C CZ  1  
ATOM 1264   N N   . LEU B 2 11  ? -111.227 -50.525 -19.011 1.00 0.00 ? 15  LEU C N   1  
ATOM 1265   C CA  . LEU B 2 11  ? -112.667 -50.806 -19.090 1.00 0.00 ? 15  LEU C CA  1  
ATOM 1266   C C   . LEU B 2 11  ? -113.524 -50.236 -17.949 1.00 0.00 ? 15  LEU C C   1  
ATOM 1267   O O   . LEU B 2 11  ? -114.717 -49.926 -18.048 1.00 0.00 ? 15  LEU C O   1  
ATOM 1268   C CB  . LEU B 2 11  ? -112.909 -52.304 -19.131 1.00 0.00 ? 15  LEU C CB  1  
ATOM 1269   C CG  . LEU B 2 11  ? -112.241 -53.167 -20.192 1.00 0.00 ? 15  LEU C CG  1  
ATOM 1270   C CD1 . LEU B 2 11  ? -112.604 -54.614 -19.930 1.00 0.00 ? 15  LEU C CD1 1  
ATOM 1271   C CD2 . LEU B 2 11  ? -112.694 -52.762 -21.582 1.00 0.00 ? 15  LEU C CD2 1  
ATOM 1272   N N   . LEU B 2 12  ? -112.906 -50.072 -16.779 1.00 0.00 ? 16  LEU C N   1  
ATOM 1273   C CA  . LEU B 2 12  ? -113.584 -49.484 -15.627 1.00 0.00 ? 16  LEU C CA  1  
ATOM 1274   C C   . LEU B 2 12  ? -113.897 -47.991 -15.790 1.00 0.00 ? 16  LEU C C   1  
ATOM 1275   O O   . LEU B 2 12  ? -114.713 -47.419 -15.062 1.00 0.00 ? 16  LEU C O   1  
ATOM 1276   C CB  . LEU B 2 12  ? -112.722 -49.698 -14.384 1.00 0.00 ? 16  LEU C CB  1  
ATOM 1277   C CG  . LEU B 2 12  ? -112.357 -51.124 -13.976 1.00 0.00 ? 16  LEU C CG  1  
ATOM 1278   C CD1 . LEU B 2 12  ? -111.515 -51.070 -12.716 1.00 0.00 ? 16  LEU C CD1 1  
ATOM 1279   C CD2 . LEU B 2 12  ? -113.613 -51.950 -13.725 1.00 0.00 ? 16  LEU C CD2 1  
ATOM 1280   N N   . PHE B 2 13  ? -113.253 -47.342 -16.761 1.00 0.00 ? 17  PHE C N   1  
ATOM 1281   C CA  . PHE B 2 13  ? -113.461 -45.934 -17.064 1.00 0.00 ? 17  PHE C CA  1  
ATOM 1282   C C   . PHE B 2 13  ? -113.956 -45.643 -18.490 1.00 0.00 ? 17  PHE C C   1  
ATOM 1283   O O   . PHE B 2 13  ? -113.973 -44.493 -18.938 1.00 0.00 ? 17  PHE C O   1  
ATOM 1284   C CB  . PHE B 2 13  ? -112.138 -45.207 -16.744 1.00 0.00 ? 17  PHE C CB  1  
ATOM 1285   C CG  . PHE B 2 13  ? -111.937 -45.179 -15.233 1.00 0.00 ? 17  PHE C CG  1  
ATOM 1286   C CD1 . PHE B 2 13  ? -111.315 -46.236 -14.589 1.00 0.00 ? 17  PHE C CD1 1  
ATOM 1287   C CD2 . PHE B 2 13  ? -112.462 -44.141 -14.493 1.00 0.00 ? 17  PHE C CD2 1  
ATOM 1288   C CE1 . PHE B 2 13  ? -111.237 -46.257 -13.216 1.00 0.00 ? 17  PHE C CE1 1  
ATOM 1289   C CE2 . PHE B 2 13  ? -112.376 -44.165 -13.116 1.00 0.00 ? 17  PHE C CE2 1  
ATOM 1290   C CZ  . PHE B 2 13  ? -111.771 -45.225 -12.477 1.00 0.00 ? 17  PHE C CZ  1  
ATOM 1291   N N   . ASP B 2 14  ? -114.471 -46.687 -19.152 1.00 0.00 ? 18  ASP C N   1  
ATOM 1292   C CA  . ASP B 2 14  ? -115.074 -46.608 -20.484 1.00 0.00 ? 18  ASP C CA  1  
ATOM 1293   C C   . ASP B 2 14  ? -116.303 -45.710 -20.621 1.00 0.00 ? 18  ASP C C   1  
ATOM 1294   O O   . ASP B 2 14  ? -116.460 -44.893 -21.527 1.00 0.00 ? 18  ASP C O   1  
ATOM 1295   C CB  . ASP B 2 14  ? -115.486 -47.992 -20.957 1.00 0.00 ? 18  ASP C CB  1  
ATOM 1296   C CG  . ASP B 2 14  ? -114.395 -48.883 -21.501 1.00 0.00 ? 18  ASP C CG  1  
ATOM 1297   O OD1 . ASP B 2 14  ? -113.252 -48.461 -21.671 1.00 0.00 ? 18  ASP C OD1 1  
ATOM 1298   O OD2 . ASP B 2 14  ? -114.718 -50.029 -21.786 1.00 0.00 ? 18  ASP C OD2 1  
ATOM 1299   N N   . ARG B 2 15  ? -117.245 -45.956 -19.708 1.00 0.00 ? 19  ARG C N   1  
ATOM 1300   C CA  . ARG B 2 15  ? -118.482 -45.195 -19.569 1.00 0.00 ? 19  ARG C CA  1  
ATOM 1301   C C   . ARG B 2 15  ? -119.398 -44.969 -20.786 1.00 0.00 ? 19  ARG C C   1  
ATOM 1302   O O   . ARG B 2 15  ? -120.047 -43.935 -20.982 1.00 0.00 ? 19  ARG C O   1  
ATOM 1303   C CB  . ARG B 2 15  ? -118.083 -43.859 -18.900 1.00 0.00 ? 19  ARG C CB  1  
ATOM 1304   C CG  . ARG B 2 15  ? -117.492 -44.092 -17.500 1.00 0.00 ? 19  ARG C CG  1  
ATOM 1305   C CD  . ARG B 2 15  ? -117.476 -42.825 -16.657 1.00 0.00 ? 19  ARG C CD  1  
ATOM 1306   N NE  . ARG B 2 15  ? -117.429 -43.142 -15.230 1.00 0.00 ? 19  ARG C NE  1  
ATOM 1307   C CZ  . ARG B 2 15  ? -117.947 -42.355 -14.300 1.00 0.00 ? 19  ARG C CZ  1  
ATOM 1308   N NH1 . ARG B 2 15  ? -118.627 -41.269 -14.590 1.00 0.00 ? 19  ARG C NH1 1  
ATOM 1309   N NH2 . ARG B 2 15  ? -117.772 -42.673 -13.049 1.00 0.00 ? 19  ARG C NH2 1  
ATOM 1310   N N   . THR B 2 16  ? -119.521 -46.081 -21.508 1.00 0.00 ? 20  THR C N   1  
ATOM 1311   C CA  . THR B 2 16  ? -120.224 -46.234 -22.800 1.00 0.00 ? 20  THR C CA  1  
ATOM 1312   C C   . THR B 2 16  ? -120.303 -47.728 -23.139 1.00 0.00 ? 20  THR C C   1  
ATOM 1313   O O   . THR B 2 16  ? -121.235 -48.232 -23.750 1.00 0.00 ? 20  THR C O   1  
ATOM 1314   C CB  . THR B 2 16  ? -119.519 -45.649 -24.051 1.00 0.00 ? 20  THR C CB  1  
ATOM 1315   O OG1 . THR B 2 16  ? -118.196 -46.180 -23.997 1.00 0.00 ? 20  THR C OG1 1  
ATOM 1316   C CG2 . THR B 2 16  ? -119.545 -44.131 -24.154 1.00 0.00 ? 20  THR C CG2 1  
ATOM 1317   N N   . GLY B 2 17  ? -119.205 -48.421 -22.808 1.00 0.00 ? 21  GLY C N   1  
ATOM 1318   C CA  . GLY B 2 17  ? -119.047 -49.864 -23.024 1.00 0.00 ? 21  GLY C CA  1  
ATOM 1319   C C   . GLY B 2 17  ? -118.224 -50.288 -24.245 1.00 0.00 ? 21  GLY C C   1  
ATOM 1320   O O   . GLY B 2 17  ? -117.937 -51.461 -24.482 1.00 0.00 ? 21  GLY C O   1  
ATOM 1321   N N   . ASP B 2 18  ? -117.767 -49.295 -24.992 1.00 0.00 ? 22  ASP C N   1  
ATOM 1322   C CA  . ASP B 2 18  ? -117.019 -49.455 -26.235 1.00 0.00 ? 22  ASP C CA  1  
ATOM 1323   C C   . ASP B 2 18  ? -115.520 -49.802 -26.160 1.00 0.00 ? 22  ASP C C   1  
ATOM 1324   O O   . ASP B 2 18  ? -114.883 -50.075 -27.189 1.00 0.00 ? 22  ASP C O   1  
ATOM 1325   C CB  . ASP B 2 18  ? -117.139 -48.165 -27.052 1.00 0.00 ? 22  ASP C CB  1  
ATOM 1326   C CG  . ASP B 2 18  ? -118.531 -47.616 -27.325 1.00 0.00 ? 22  ASP C CG  1  
ATOM 1327   O OD1 . ASP B 2 18  ? -119.431 -47.795 -26.505 1.00 0.00 ? 22  ASP C OD1 1  
ATOM 1328   O OD2 . ASP B 2 18  ? -118.697 -46.961 -28.344 1.00 0.00 ? 22  ASP C OD2 1  
ATOM 1329   N N   . ALA B 2 19  ? -114.913 -49.737 -24.968 1.00 0.00 ? 23  ALA C N   1  
ATOM 1330   C CA  . ALA B 2 19  ? -113.465 -49.886 -24.743 1.00 0.00 ? 23  ALA C CA  1  
ATOM 1331   C C   . ALA B 2 19  ? -112.556 -48.853 -25.433 1.00 0.00 ? 23  ALA C C   1  
ATOM 1332   O O   . ALA B 2 19  ? -111.356 -49.024 -25.676 1.00 0.00 ? 23  ALA C O   1  
ATOM 1333   C CB  . ALA B 2 19  ? -113.009 -51.290 -25.176 1.00 0.00 ? 23  ALA C CB  1  
ATOM 1334   N N   . LYS B 2 20  ? -113.184 -47.730 -25.795 1.00 0.00 ? 24  LYS C N   1  
ATOM 1335   C CA  . LYS B 2 20  ? -112.527 -46.592 -26.432 1.00 0.00 ? 24  LYS C CA  1  
ATOM 1336   C C   . LYS B 2 20  ? -112.684 -45.291 -25.641 1.00 0.00 ? 24  LYS C C   1  
ATOM 1337   O O   . LYS B 2 20  ? -113.637 -44.518 -25.806 1.00 0.00 ? 24  LYS C O   1  
ATOM 1338   C CB  . LYS B 2 20  ? -113.084 -46.381 -27.836 1.00 0.00 ? 24  LYS C CB  1  
ATOM 1339   C CG  . LYS B 2 20  ? -112.834 -47.526 -28.799 1.00 0.00 ? 24  LYS C CG  1  
ATOM 1340   C CD  . LYS B 2 20  ? -113.378 -47.132 -30.156 1.00 0.00 ? 24  LYS C CD  1  
ATOM 1341   C CE  . LYS B 2 20  ? -113.219 -48.299 -31.113 1.00 0.00 ? 24  LYS C CE  1  
ATOM 1342   N NZ  . LYS B 2 20  ? -113.677 -47.904 -32.427 1.00 0.00 ? 24  LYS C NZ  1  
ATOM 1343   N N   . ILE B 2 21  ? -111.702 -44.972 -24.811 1.00 0.00 ? 25  ILE C N   1  
ATOM 1344   C CA  . ILE B 2 21  ? -111.809 -43.809 -23.916 1.00 0.00 ? 25  ILE C CA  1  
ATOM 1345   C C   . ILE B 2 21  ? -111.413 -42.492 -24.602 1.00 0.00 ? 25  ILE C C   1  
ATOM 1346   O O   . ILE B 2 21  ? -110.653 -42.474 -25.570 1.00 0.00 ? 25  ILE C O   1  
ATOM 1347   C CB  . ILE B 2 21  ? -110.936 -44.151 -22.676 1.00 0.00 ? 25  ILE C CB  1  
ATOM 1348   C CG1 . ILE B 2 21  ? -111.611 -45.260 -21.899 1.00 0.00 ? 25  ILE C CG1 1  
ATOM 1349   C CG2 . ILE B 2 21  ? -110.722 -42.946 -21.787 1.00 0.00 ? 25  ILE C CG2 1  
ATOM 1350   C CD1 . ILE B 2 21  ? -110.599 -46.057 -21.057 1.00 0.00 ? 25  ILE C CD1 1  
ATOM 1351   N N   . THR B 2 22  ? -111.901 -41.329 -24.184 1.00 0.00 ? 26  THR C N   1  
ATOM 1352   C CA  . THR B 2 22  ? -111.590 -40.049 -24.839 1.00 0.00 ? 26  THR C CA  1  
ATOM 1353   C C   . THR B 2 22  ? -110.254 -39.357 -24.530 1.00 0.00 ? 26  THR C C   1  
ATOM 1354   O O   . THR B 2 22  ? -109.741 -39.405 -23.413 1.00 0.00 ? 26  THR C O   1  
ATOM 1355   C CB  . THR B 2 22  ? -112.675 -38.976 -24.560 1.00 0.00 ? 26  THR C CB  1  
ATOM 1356   O OG1 . THR B 2 22  ? -112.450 -38.502 -23.244 1.00 0.00 ? 26  THR C OG1 1  
ATOM 1357   C CG2 . THR B 2 22  ? -114.099 -39.501 -24.696 1.00 0.00 ? 26  THR C CG2 1  
ATOM 1358   N N   . LEU B 2 23  ? -109.727 -38.596 -25.496 1.00 0.00 ? 27  LEU C N   1  
ATOM 1359   C CA  . LEU B 2 23  ? -108.502 -37.791 -25.350 1.00 0.00 ? 27  LEU C CA  1  
ATOM 1360   C C   . LEU B 2 23  ? -108.446 -36.834 -24.146 1.00 0.00 ? 27  LEU C C   1  
ATOM 1361   O O   . LEU B 2 23  ? -107.415 -36.489 -23.582 1.00 0.00 ? 27  LEU C O   1  
ATOM 1362   C CB  . LEU B 2 23  ? -108.300 -36.971 -26.615 1.00 0.00 ? 27  LEU C CB  1  
ATOM 1363   N N   . SER B 2 24  ? -109.607 -36.422 -23.642 1.00 0.00 ? 28  SER C N   1  
ATOM 1364   C CA  . SER B 2 24  ? -109.671 -35.636 -22.411 1.00 0.00 ? 28  SER C CA  1  
ATOM 1365   C C   . SER B 2 24  ? -109.519 -36.544 -21.184 1.00 0.00 ? 28  SER C C   1  
ATOM 1366   O O   . SER B 2 24  ? -108.645 -36.318 -20.346 1.00 0.00 ? 28  SER C O   1  
ATOM 1367   C CB  . SER B 2 24  ? -110.995 -34.904 -22.315 1.00 0.00 ? 28  SER C CB  1  
ATOM 1368   O OG  . SER B 2 24  ? -112.035 -35.652 -22.937 1.00 0.00 ? 28  SER C OG  1  
ATOM 1369   N N   . GLN B 2 25  ? -110.258 -37.665 -21.098 1.00 0.00 ? 29  GLN C N   1  
ATOM 1370   C CA  . GLN B 2 25  ? -110.113 -38.633 -19.992 1.00 0.00 ? 29  GLN C CA  1  
ATOM 1371   C C   . GLN B 2 25  ? -108.708 -39.238 -19.854 1.00 0.00 ? 29  GLN C C   1  
ATOM 1372   O O   . GLN B 2 25  ? -108.279 -39.798 -18.836 1.00 0.00 ? 29  GLN C O   1  
ATOM 1373   C CB  . GLN B 2 25  ? -111.109 -39.769 -20.172 1.00 0.00 ? 29  GLN C CB  1  
ATOM 1374   C CG  . GLN B 2 25  ? -112.571 -39.419 -19.911 1.00 0.00 ? 29  GLN C CG  1  
ATOM 1375   C CD  . GLN B 2 25  ? -113.555 -40.266 -20.715 1.00 0.00 ? 29  GLN C CD  1  
ATOM 1376   O OE1 . GLN B 2 25  ? -113.196 -40.863 -21.719 1.00 0.00 ? 29  GLN C OE1 1  
ATOM 1377   N NE2 . GLN B 2 25  ? -114.843 -40.314 -20.510 1.00 0.00 ? 29  GLN C NE2 1  
ATOM 1378   N N   . VAL B 2 26  ? -107.983 -39.198 -20.965 1.00 0.00 ? 30  VAL C N   1  
ATOM 1379   C CA  . VAL B 2 26  ? -106.553 -39.496 -21.076 1.00 0.00 ? 30  VAL C CA  1  
ATOM 1380   C C   . VAL B 2 26  ? -105.676 -38.950 -19.937 1.00 0.00 ? 30  VAL C C   1  
ATOM 1381   O O   . VAL B 2 26  ? -104.952 -39.696 -19.255 1.00 0.00 ? 30  VAL C O   1  
ATOM 1382   C CB  . VAL B 2 26  ? -106.177 -38.940 -22.455 1.00 0.00 ? 30  VAL C CB  1  
ATOM 1383   C CG1 . VAL B 2 26  ? -104.719 -38.523 -22.626 1.00 0.00 ? 30  VAL C CG1 1  
ATOM 1384   C CG2 . VAL B 2 26  ? -106.649 -40.021 -23.399 1.00 0.00 ? 30  VAL C CG2 1  
ATOM 1385   N N   . GLY B 2 27  ? -105.805 -37.637 -19.715 1.00 0.00 ? 31  GLY C N   1  
ATOM 1386   C CA  . GLY B 2 27  ? -105.067 -36.912 -18.685 1.00 0.00 ? 31  GLY C CA  1  
ATOM 1387   C C   . GLY B 2 27  ? -105.385 -37.339 -17.254 1.00 0.00 ? 31  GLY C C   1  
ATOM 1388   O O   . GLY B 2 27  ? -104.545 -37.248 -16.354 1.00 0.00 ? 31  GLY C O   1  
ATOM 1389   N N   . ASP B 2 28  ? -106.610 -37.808 -17.029 1.00 0.00 ? 32  ASP C N   1  
ATOM 1390   C CA  . ASP B 2 28  ? -107.028 -38.305 -15.726 1.00 0.00 ? 32  ASP C CA  1  
ATOM 1391   C C   . ASP B 2 28  ? -106.661 -39.773 -15.466 1.00 0.00 ? 32  ASP C C   1  
ATOM 1392   O O   . ASP B 2 28  ? -106.058 -40.092 -14.437 1.00 0.00 ? 32  ASP C O   1  
ATOM 1393   C CB  . ASP B 2 28  ? -108.530 -38.078 -15.623 1.00 0.00 ? 32  ASP C CB  1  
ATOM 1394   C CG  . ASP B 2 28  ? -108.948 -36.630 -15.847 1.00 0.00 ? 32  ASP C CG  1  
ATOM 1395   O OD1 . ASP B 2 28  ? -108.373 -35.712 -15.253 1.00 0.00 ? 32  ASP C OD1 1  
ATOM 1396   O OD2 . ASP B 2 28  ? -109.848 -36.408 -16.645 1.00 0.00 ? 32  ASP C OD2 1  
ATOM 1397   N N   . ILE B 2 29  ? -106.889 -40.702 -16.405 1.00 0.00 ? 33  ILE C N   1  
ATOM 1398   C CA  . ILE B 2 29  ? -106.511 -42.114 -16.229 1.00 0.00 ? 33  ILE C CA  1  
ATOM 1399   C C   . ILE B 2 29  ? -105.015 -42.302 -15.929 1.00 0.00 ? 33  ILE C C   1  
ATOM 1400   O O   . ILE B 2 29  ? -104.617 -43.079 -15.054 1.00 0.00 ? 33  ILE C O   1  
ATOM 1401   C CB  . ILE B 2 29  ? -106.964 -42.875 -17.499 1.00 0.00 ? 33  ILE C CB  1  
ATOM 1402   C CG1 . ILE B 2 29  ? -108.486 -42.974 -17.425 1.00 0.00 ? 33  ILE C CG1 1  
ATOM 1403   C CG2 . ILE B 2 29  ? -106.385 -44.289 -17.590 1.00 0.00 ? 33  ILE C CG2 1  
ATOM 1404   C CD1 . ILE B 2 29  ? -109.154 -43.593 -18.658 1.00 0.00 ? 33  ILE C CD1 1  
ATOM 1405   N N   . VAL B 2 30  ? -104.163 -41.519 -16.596 1.00 0.00 ? 34  VAL C N   1  
ATOM 1406   C CA  . VAL B 2 30  ? -102.729 -41.497 -16.312 1.00 0.00 ? 34  VAL C CA  1  
ATOM 1407   C C   . VAL B 2 30  ? -102.322 -41.188 -14.862 1.00 0.00 ? 34  VAL C C   1  
ATOM 1408   O O   . VAL B 2 30  ? -101.305 -41.676 -14.357 1.00 0.00 ? 34  VAL C O   1  
ATOM 1409   C CB  . VAL B 2 30  ? -102.057 -40.460 -17.205 1.00 0.00 ? 34  VAL C CB  1  
ATOM 1410   N N   . ARG B 2 31  ? -103.147 -40.406 -14.164 1.00 0.00 ? 35  ARG C N   1  
ATOM 1411   C CA  . ARG B 2 31  ? -102.913 -39.996 -12.778 1.00 0.00 ? 35  ARG C CA  1  
ATOM 1412   C C   . ARG B 2 31  ? -103.032 -41.073 -11.704 1.00 0.00 ? 35  ARG C C   1  
ATOM 1413   O O   . ARG B 2 31  ? -102.332 -41.043 -10.684 1.00 0.00 ? 35  ARG C O   1  
ATOM 1414   C CB  . ARG B 2 31  ? -103.858 -38.857 -12.417 1.00 0.00 ? 35  ARG C CB  1  
ATOM 1415   C CG  . ARG B 2 31  ? -103.669 -37.616 -13.270 1.00 0.00 ? 35  ARG C CG  1  
ATOM 1416   C CD  . ARG B 2 31  ? -104.708 -36.567 -12.924 1.00 0.00 ? 35  ARG C CD  1  
ATOM 1417   N NE  . ARG B 2 31  ? -104.737 -35.503 -13.914 1.00 0.00 ? 35  ARG C NE  1  
ATOM 1418   C CZ  . ARG B 2 31  ? -105.764 -34.694 -14.062 1.00 0.00 ? 35  ARG C CZ  1  
ATOM 1419   N NH1 . ARG B 2 31  ? -106.806 -34.735 -13.267 1.00 0.00 ? 35  ARG C NH1 1  
ATOM 1420   N NH2 . ARG B 2 31  ? -105.760 -33.815 -15.025 1.00 0.00 ? 35  ARG C NH2 1  
ATOM 1421   N N   . ALA B 2 32  ? -103.974 -42.005 -11.872 1.00 0.00 ? 36  ALA C N   1  
ATOM 1422   C CA  . ALA B 2 32  ? -104.061 -43.125 -10.940 1.00 0.00 ? 36  ALA C CA  1  
ATOM 1423   C C   . ALA B 2 32  ? -103.205 -44.328 -11.282 1.00 0.00 ? 36  ALA C C   1  
ATOM 1424   O O   . ALA B 2 32  ? -102.892 -45.155 -10.424 1.00 0.00 ? 36  ALA C O   1  
ATOM 1425   C CB  . ALA B 2 32  ? -105.460 -43.623 -10.833 1.00 0.00 ? 36  ALA C CB  1  
ATOM 1426   N N   . LEU B 2 33  ? -102.823 -44.496 -12.553 1.00 0.00 ? 37  LEU C N   1  
ATOM 1427   C CA  . LEU B 2 33  ? -101.917 -45.574 -12.924 1.00 0.00 ? 37  LEU C CA  1  
ATOM 1428   C C   . LEU B 2 33  ? -100.448 -45.313 -12.540 1.00 0.00 ? 37  LEU C C   1  
ATOM 1429   O O   . LEU B 2 33  ? -99.529  -44.921 -13.273 1.00 0.00 ? 37  LEU C O   1  
ATOM 1430   C CB  . LEU B 2 33  ? -102.091 -45.820 -14.430 1.00 0.00 ? 37  LEU C CB  1  
ATOM 1431   C CG  . LEU B 2 33  ? -103.524 -46.090 -14.925 1.00 0.00 ? 37  LEU C CG  1  
ATOM 1432   C CD1 . LEU B 2 33  ? -103.450 -46.568 -16.353 1.00 0.00 ? 37  LEU C CD1 1  
ATOM 1433   C CD2 . LEU B 2 33  ? -104.226 -47.154 -14.094 1.00 0.00 ? 37  LEU C CD2 1  
ATOM 1434   N N   . GLY B 2 34  ? -100.287 -45.478 -11.229 1.00 0.00 ? 38  GLY C N   1  
ATOM 1435   C CA  . GLY B 2 34  ? -99.034  -45.330 -10.520 1.00 0.00 ? 38  GLY C CA  1  
ATOM 1436   C C   . GLY B 2 34  ? -98.567  -43.918 -10.177 1.00 0.00 ? 38  GLY C C   1  
ATOM 1437   O O   . GLY B 2 34  ? -98.521  -43.502 -9.013  1.00 0.00 ? 38  GLY C O   1  
ATOM 1438   N N   . GLN B 2 35  ? -98.222  -43.110 -11.176 1.00 0.00 ? 39  GLN C N   1  
ATOM 1439   C CA  . GLN B 2 35  ? -97.507  -41.873 -10.867 1.00 0.00 ? 39  GLN C CA  1  
ATOM 1440   C C   . GLN B 2 35  ? -97.945  -40.587 -11.588 1.00 0.00 ? 39  GLN C C   1  
ATOM 1441   O O   . GLN B 2 35  ? -98.350  -40.619 -12.746 1.00 0.00 ? 39  GLN C O   1  
ATOM 1442   C CB  . GLN B 2 35  ? -96.003  -42.122 -11.115 1.00 0.00 ? 39  GLN C CB  1  
ATOM 1443   C CG  . GLN B 2 35  ? -95.420  -43.556 -10.998 1.00 0.00 ? 39  GLN C CG  1  
ATOM 1444   C CD  . GLN B 2 35  ? -94.052  -43.757 -11.640 1.00 0.00 ? 39  GLN C CD  1  
ATOM 1445   O OE1 . GLN B 2 35  ? -93.060  -43.226 -11.200 1.00 0.00 ? 39  GLN C OE1 1  
ATOM 1446   N NE2 . GLN B 2 35  ? -93.827  -44.485 -12.715 1.00 0.00 ? 39  GLN C NE2 1  
ATOM 1447   N N   . ASN B 2 36  ? -97.782  -39.457 -10.900 1.00 0.00 ? 40  ASN C N   1  
ATOM 1448   C CA  . ASN B 2 36  ? -98.195  -38.108 -11.339 1.00 0.00 ? 40  ASN C CA  1  
ATOM 1449   C C   . ASN B 2 36  ? -97.781  -37.609 -12.740 1.00 0.00 ? 40  ASN C C   1  
ATOM 1450   O O   . ASN B 2 36  ? -96.667  -37.883 -13.194 1.00 0.00 ? 40  ASN C O   1  
ATOM 1451   C CB  . ASN B 2 36  ? -97.693  -37.063 -10.333 1.00 0.00 ? 40  ASN C CB  1  
ATOM 1452   C CG  . ASN B 2 36  ? -97.778  -37.477 -8.869  1.00 0.00 ? 40  ASN C CG  1  
ATOM 1453   O OD1 . ASN B 2 36  ? -98.783  -37.923 -8.340  1.00 0.00 ? 40  ASN C OD1 1  
ATOM 1454   N ND2 . ASN B 2 36  ? -96.705  -37.495 -8.112  1.00 0.00 ? 40  ASN C ND2 1  
ATOM 1455   N N   . PRO B 2 37  ? -98.662  -36.887 -13.450 1.00 0.00 ? 41  PRO C N   1  
ATOM 1456   C CA  . PRO B 2 37  ? -98.241  -36.014 -14.559 1.00 0.00 ? 41  PRO C CA  1  
ATOM 1457   C C   . PRO B 2 37  ? -98.821  -34.592 -14.530 1.00 0.00 ? 41  PRO C C   1  
ATOM 1458   O O   . PRO B 2 37  ? -99.999  -34.430 -14.182 1.00 0.00 ? 41  PRO C O   1  
ATOM 1459   C CB  . PRO B 2 37  ? -98.644  -36.798 -15.797 1.00 0.00 ? 41  PRO C CB  1  
ATOM 1460   C CG  . PRO B 2 37  ? -99.936  -37.441 -15.375 1.00 0.00 ? 41  PRO C CG  1  
ATOM 1461   C CD  . PRO B 2 37  ? -99.614  -37.877 -13.959 1.00 0.00 ? 41  PRO C CD  1  
ATOM 1462   N N   . THR B 2 38  ? -98.106  -33.505 -14.852 1.00 0.00 ? 42  THR C N   1  
ATOM 1463   C CA  . THR B 2 38  ? -98.727  -32.174 -14.810 1.00 0.00 ? 42  THR C CA  1  
ATOM 1464   C C   . THR B 2 38  ? -99.562  -31.813 -16.048 1.00 0.00 ? 42  THR C C   1  
ATOM 1465   O O   . THR B 2 38  ? -99.353  -32.294 -17.177 1.00 0.00 ? 42  THR C O   1  
ATOM 1466   C CB  . THR B 2 38  ? -97.731  -30.973 -14.681 1.00 0.00 ? 42  THR C CB  1  
ATOM 1467   O OG1 . THR B 2 38  ? -97.099  -30.798 -15.944 1.00 0.00 ? 42  THR C OG1 1  
ATOM 1468   C CG2 . THR B 2 38  ? -96.679  -31.197 -13.604 1.00 0.00 ? 42  THR C CG2 1  
ATOM 1469   N N   . ASN B 2 39  ? -100.536 -30.918 -15.900 1.00 0.00 ? 43  ASN C N   1  
ATOM 1470   C CA  . ASN B 2 39  ? -101.282 -30.440 -17.055 1.00 0.00 ? 43  ASN C CA  1  
ATOM 1471   C C   . ASN B 2 39  ? -100.564 -29.186 -17.569 1.00 0.00 ? 43  ASN C C   1  
ATOM 1472   O O   . ASN B 2 39  ? -100.621 -28.079 -17.052 1.00 0.00 ? 43  ASN C O   1  
ATOM 1473   C CB  . ASN B 2 39  ? -102.713 -30.058 -16.722 1.00 0.00 ? 43  ASN C CB  1  
ATOM 1474   C CG  . ASN B 2 39  ? -103.506 -31.100 -15.957 1.00 0.00 ? 43  ASN C CG  1  
ATOM 1475   O OD1 . ASN B 2 39  ? -103.782 -32.237 -16.325 1.00 0.00 ? 43  ASN C OD1 1  
ATOM 1476   N ND2 . ASN B 2 39  ? -103.993 -30.735 -14.802 1.00 0.00 ? 43  ASN C ND2 1  
ATOM 1477   N N   . ALA B 2 40  ? -99.994  -29.447 -18.734 1.00 0.00 ? 44  ALA C N   1  
ATOM 1478   C CA  . ALA B 2 40  ? -99.041  -28.620 -19.470 1.00 0.00 ? 44  ALA C CA  1  
ATOM 1479   C C   . ALA B 2 40  ? -98.176  -29.717 -20.065 1.00 0.00 ? 44  ALA C C   1  
ATOM 1480   O O   . ALA B 2 40  ? -98.037  -29.786 -21.280 1.00 0.00 ? 44  ALA C O   1  
ATOM 1481   C CB  . ALA B 2 40  ? -98.090  -27.772 -18.627 1.00 0.00 ? 44  ALA C CB  1  
ATOM 1482   N N   . GLU B 2 41  ? -97.635  -30.665 -19.285 1.00 0.00 ? 45  GLU C N   1  
ATOM 1483   C CA  . GLU B 2 41  ? -96.921  -31.809 -19.855 1.00 0.00 ? 45  GLU C CA  1  
ATOM 1484   C C   . GLU B 2 41  ? -97.788  -32.740 -20.690 1.00 0.00 ? 45  GLU C C   1  
ATOM 1485   O O   . GLU B 2 41  ? -97.440  -33.055 -21.828 1.00 0.00 ? 45  GLU C O   1  
ATOM 1486   C CB  . GLU B 2 41  ? -96.277  -32.623 -18.766 1.00 0.00 ? 45  GLU C CB  1  
ATOM 1487   C CG  . GLU B 2 41  ? -95.122  -31.832 -18.194 1.00 0.00 ? 45  GLU C CG  1  
ATOM 1488   C CD  . GLU B 2 41  ? -94.486  -32.429 -16.960 1.00 0.00 ? 45  GLU C CD  1  
ATOM 1489   O OE1 . GLU B 2 41  ? -95.188  -33.046 -16.155 1.00 0.00 ? 45  GLU C OE1 1  
ATOM 1490   O OE2 . GLU B 2 41  ? -93.289  -32.220 -16.815 1.00 0.00 ? 45  GLU C OE2 1  
ATOM 1491   N N   . ILE B 2 42  ? -98.961  -33.119 -20.164 1.00 0.00 ? 46  ILE C N   1  
ATOM 1492   C CA  . ILE B 2 42  ? -99.943  -33.902 -20.927 1.00 0.00 ? 46  ILE C CA  1  
ATOM 1493   C C   . ILE B 2 42  ? -100.367 -33.097 -22.175 1.00 0.00 ? 46  ILE C C   1  
ATOM 1494   O O   . ILE B 2 42  ? -100.316 -33.561 -23.314 1.00 0.00 ? 46  ILE C O   1  
ATOM 1495   C CB  . ILE B 2 42  ? -101.178 -34.198 -20.032 1.00 0.00 ? 46  ILE C CB  1  
ATOM 1496   C CG1 . ILE B 2 42  ? -100.767 -35.019 -18.815 1.00 0.00 ? 46  ILE C CG1 1  
ATOM 1497   C CG2 . ILE B 2 42  ? -102.211 -34.992 -20.834 1.00 0.00 ? 46  ILE C CG2 1  
ATOM 1498   C CD1 . ILE B 2 42  ? -101.846 -35.071 -17.713 1.00 0.00 ? 46  ILE C CD1 1  
ATOM 1499   N N   . ASN B 2 43  ? -100.706 -31.817 -21.958 1.00 0.00 ? 47  ASN C N   1  
ATOM 1500   C CA  . ASN B 2 43  ? -101.026 -30.882 -23.038 1.00 0.00 ? 47  ASN C CA  1  
ATOM 1501   C C   . ASN B 2 43  ? -99.908  -30.746 -24.090 1.00 0.00 ? 47  ASN C C   1  
ATOM 1502   O O   . ASN B 2 43  ? -100.182 -30.545 -25.262 1.00 0.00 ? 47  ASN C O   1  
ATOM 1503   C CB  . ASN B 2 43  ? -101.318 -29.482 -22.474 1.00 0.00 ? 47  ASN C CB  1  
ATOM 1504   C CG  . ASN B 2 43  ? -102.328 -29.428 -21.333 1.00 0.00 ? 47  ASN C CG  1  
ATOM 1505   O OD1 . ASN B 2 43  ? -103.086 -30.347 -21.070 1.00 0.00 ? 47  ASN C OD1 1  
ATOM 1506   N ND2 . ASN B 2 43  ? -102.372 -28.435 -20.474 1.00 0.00 ? 47  ASN C ND2 1  
ATOM 1507   N N   . LYS B 2 44  ? -98.620  -30.874 -23.737 1.00 0.00 ? 48  LYS C N   1  
ATOM 1508   C CA  . LYS B 2 44  ? -97.507  -30.800 -24.691 1.00 0.00 ? 48  LYS C CA  1  
ATOM 1509   C C   . LYS B 2 44  ? -97.467  -31.887 -25.767 1.00 0.00 ? 48  LYS C C   1  
ATOM 1510   O O   . LYS B 2 44  ? -97.715  -31.638 -26.954 1.00 0.00 ? 48  LYS C O   1  
ATOM 1511   C CB  . LYS B 2 44  ? -96.138  -30.875 -23.997 1.00 0.00 ? 48  LYS C CB  1  
ATOM 1512   C CG  . LYS B 2 44  ? -95.635  -29.738 -23.129 1.00 0.00 ? 48  LYS C CG  1  
ATOM 1513   C CD  . LYS B 2 44  ? -94.503  -30.310 -22.288 1.00 0.00 ? 48  LYS C CD  1  
ATOM 1514   C CE  . LYS B 2 44  ? -94.171  -29.409 -21.098 1.00 0.00 ? 48  LYS C CE  1  
ATOM 1515   N NZ  . LYS B 2 44  ? -93.275  -30.074 -20.165 1.00 0.00 ? 48  LYS C NZ  1  
ATOM 1516   N N   . ILE B 2 45  ? -97.164  -33.124 -25.383 1.00 0.00 ? 49  ILE C N   1  
ATOM 1517   C CA  . ILE B 2 45  ? -97.037  -34.152 -26.396 1.00 0.00 ? 49  ILE C CA  1  
ATOM 1518   C C   . ILE B 2 45  ? -98.127  -35.195 -26.463 1.00 0.00 ? 49  ILE C C   1  
ATOM 1519   O O   . ILE B 2 45  ? -98.593  -35.829 -25.528 1.00 0.00 ? 49  ILE C O   1  
ATOM 1520   C CB  . ILE B 2 45  ? -95.611  -34.767 -26.248 1.00 0.00 ? 49  ILE C CB  1  
ATOM 1521   C CG1 . ILE B 2 45  ? -94.839  -33.992 -27.319 1.00 0.00 ? 49  ILE C CG1 1  
ATOM 1522   C CG2 . ILE B 2 45  ? -95.466  -36.278 -26.453 1.00 0.00 ? 49  ILE C CG2 1  
ATOM 1523   C CD1 . ILE B 2 45  ? -93.368  -34.362 -27.575 1.00 0.00 ? 49  ILE C CD1 1  
ATOM 1524   N N   . LEU B 2 46  ? -98.515  -35.195 -27.741 1.00 0.00 ? 50  LEU C N   1  
ATOM 1525   C CA  . LEU B 2 46  ? -99.668  -35.881 -28.311 1.00 0.00 ? 50  LEU C CA  1  
ATOM 1526   C C   . LEU B 2 46  ? -100.961 -35.192 -27.872 1.00 0.00 ? 50  LEU C C   1  
ATOM 1527   O O   . LEU B 2 46  ? -101.789 -34.974 -28.746 1.00 0.00 ? 50  LEU C O   1  
ATOM 1528   C CB  . LEU B 2 46  ? -99.591  -37.365 -27.944 1.00 0.00 ? 50  LEU C CB  1  
ATOM 1529   C CG  . LEU B 2 46  ? -98.397  -37.972 -28.700 1.00 0.00 ? 50  LEU C CG  1  
ATOM 1530   C CD1 . LEU B 2 46  ? -97.692  -38.963 -27.810 1.00 0.00 ? 50  LEU C CD1 1  
ATOM 1531   C CD2 . LEU B 2 46  ? -98.873  -38.557 -30.013 1.00 0.00 ? 50  LEU C CD2 1  
ATOM 1532   N N   . GLY B 2 47  ? -101.091 -34.697 -26.635 1.00 0.00 ? 51  GLY C N   1  
ATOM 1533   C CA  . GLY B 2 47  ? -102.204 -33.826 -26.229 1.00 0.00 ? 51  GLY C CA  1  
ATOM 1534   C C   . GLY B 2 47  ? -102.457 -32.599 -27.129 1.00 0.00 ? 51  GLY C C   1  
ATOM 1535   O O   . GLY B 2 47  ? -103.552 -32.375 -27.649 1.00 0.00 ? 51  GLY C O   1  
ATOM 1536   N N   . ASN B 2 48  ? -101.453 -31.738 -27.355 1.00 0.00 ? 52  ASN C N   1  
ATOM 1537   C CA  . ASN B 2 48  ? -101.588 -30.593 -28.268 1.00 0.00 ? 52  ASN C CA  1  
ATOM 1538   C C   . ASN B 2 48  ? -102.083 -30.862 -29.703 1.00 0.00 ? 52  ASN C C   1  
ATOM 1539   O O   . ASN B 2 48  ? -102.758 -30.006 -30.293 1.00 0.00 ? 52  ASN C O   1  
ATOM 1540   C CB  . ASN B 2 48  ? -100.264 -29.839 -28.392 1.00 0.00 ? 52  ASN C CB  1  
ATOM 1541   C CG  . ASN B 2 48  ? -100.119 -28.586 -27.546 1.00 0.00 ? 52  ASN C CG  1  
ATOM 1542   O OD1 . ASN B 2 48  ? -101.051 -27.947 -27.089 1.00 0.00 ? 52  ASN C OD1 1  
ATOM 1543   N ND2 . ASN B 2 48  ? -98.925  -28.101 -27.307 1.00 0.00 ? 52  ASN C ND2 1  
ATOM 1544   N N   . PRO B 2 49  ? -101.779 -31.996 -30.359 1.00 0.00 ? 53  PRO C N   1  
ATOM 1545   C CA  . PRO B 2 49  ? -102.504 -32.295 -31.595 1.00 0.00 ? 53  PRO C CA  1  
ATOM 1546   C C   . PRO B 2 49  ? -103.871 -32.970 -31.506 1.00 0.00 ? 53  PRO C C   1  
ATOM 1547   O O   . PRO B 2 49  ? -103.957 -34.194 -31.532 1.00 0.00 ? 53  PRO C O   1  
ATOM 1548   C CB  . PRO B 2 49  ? -101.512 -33.097 -32.425 1.00 0.00 ? 53  PRO C CB  1  
ATOM 1549   C CG  . PRO B 2 49  ? -100.622 -33.747 -31.409 1.00 0.00 ? 53  PRO C CG  1  
ATOM 1550   C CD  . PRO B 2 49  ? -100.440 -32.572 -30.478 1.00 0.00 ? 53  PRO C CD  1  
ATOM 1551   N N   . SER B 2 50  ? -104.993 -32.240 -31.486 1.00 0.00 ? 54  SER C N   1  
ATOM 1552   C CA  . SER B 2 50  ? -106.345 -32.831 -31.381 1.00 0.00 ? 54  SER C CA  1  
ATOM 1553   C C   . SER B 2 50  ? -106.660 -34.038 -32.260 1.00 0.00 ? 54  SER C C   1  
ATOM 1554   O O   . SER B 2 50  ? -106.957 -35.104 -31.739 1.00 0.00 ? 54  SER C O   1  
ATOM 1555   C CB  . SER B 2 50  ? -107.441 -31.821 -31.687 1.00 0.00 ? 54  SER C CB  1  
ATOM 1556   O OG  . SER B 2 50  ? -107.377 -30.676 -30.859 1.00 0.00 ? 54  SER C OG  1  
ATOM 1557   N N   . LYS B 2 51  ? -106.578 -33.962 -33.597 1.00 0.00 ? 55  LYS C N   1  
ATOM 1558   C CA  . LYS B 2 51  ? -106.784 -35.131 -34.459 1.00 0.00 ? 55  LYS C CA  1  
ATOM 1559   C C   . LYS B 2 51  ? -105.801 -36.270 -34.179 1.00 0.00 ? 55  LYS C C   1  
ATOM 1560   O O   . LYS B 2 51  ? -106.232 -37.406 -34.023 1.00 0.00 ? 55  LYS C O   1  
ATOM 1561   C CB  . LYS B 2 51  ? -106.644 -34.772 -35.925 1.00 0.00 ? 55  LYS C CB  1  
ATOM 1562   C CG  . LYS B 2 51  ? -107.884 -35.049 -36.764 1.00 0.00 ? 55  LYS C CG  1  
ATOM 1563   C CD  . LYS B 2 51  ? -107.441 -35.257 -38.207 1.00 0.00 ? 55  LYS C CD  1  
ATOM 1564   C CE  . LYS B 2 51  ? -108.548 -35.063 -39.236 1.00 0.00 ? 55  LYS C CE  1  
ATOM 1565   N NZ  . LYS B 2 51  ? -109.709 -35.896 -38.997 1.00 0.00 ? 55  LYS C NZ  1  
ATOM 1566   N N   . GLU B 2 52  ? -104.492 -36.008 -34.088 1.00 0.00 ? 56  GLU C N   1  
ATOM 1567   C CA  . GLU B 2 52  ? -103.538 -37.056 -33.737 1.00 0.00 ? 56  GLU C CA  1  
ATOM 1568   C C   . GLU B 2 52  ? -103.826 -37.652 -32.363 1.00 0.00 ? 56  GLU C C   1  
ATOM 1569   O O   . GLU B 2 52  ? -104.079 -38.840 -32.337 1.00 0.00 ? 56  GLU C O   1  
ATOM 1570   C CB  . GLU B 2 52  ? -102.107 -36.551 -33.717 1.00 0.00 ? 56  GLU C CB  1  
ATOM 1571   C CG  . GLU B 2 52  ? -101.506 -36.308 -35.097 1.00 0.00 ? 56  GLU C CG  1  
ATOM 1572   C CD  . GLU B 2 52  ? -99.985  -36.181 -35.087 1.00 0.00 ? 56  GLU C CD  1  
ATOM 1573   O OE1 . GLU B 2 52  ? -99.351  -36.788 -35.950 1.00 0.00 ? 56  GLU C OE1 1  
ATOM 1574   O OE2 . GLU B 2 52  ? -99.427  -35.494 -34.233 1.00 0.00 ? 56  GLU C OE2 1  
ATOM 1575   N N   . GLU B 2 53  ? -103.940 -36.971 -31.220 1.00 0.00 ? 57  GLU C N   1  
ATOM 1576   C CA  . GLU B 2 53  ? -104.295 -37.601 -29.938 1.00 0.00 ? 57  GLU C CA  1  
ATOM 1577   C C   . GLU B 2 53  ? -105.661 -38.303 -29.980 1.00 0.00 ? 57  GLU C C   1  
ATOM 1578   O O   . GLU B 2 53  ? -105.875 -39.386 -29.419 1.00 0.00 ? 57  GLU C O   1  
ATOM 1579   C CB  . GLU B 2 53  ? -104.351 -36.584 -28.818 1.00 0.00 ? 57  GLU C CB  1  
ATOM 1580   C CG  . GLU B 2 53  ? -104.338 -37.296 -27.468 1.00 0.00 ? 57  GLU C CG  1  
ATOM 1581   C CD  . GLU B 2 53  ? -104.452 -36.403 -26.248 1.00 0.00 ? 57  GLU C CD  1  
ATOM 1582   O OE1 . GLU B 2 53  ? -103.695 -36.626 -25.302 1.00 0.00 ? 57  GLU C OE1 1  
ATOM 1583   O OE2 . GLU B 2 53  ? -105.293 -35.501 -26.239 1.00 0.00 ? 57  GLU C OE2 1  
ATOM 1584   N N   . MET B 2 54  ? -106.650 -37.765 -30.693 1.00 0.00 ? 58  MET C N   1  
ATOM 1585   C CA  . MET B 2 54  ? -107.892 -38.501 -30.909 1.00 0.00 ? 58  MET C CA  1  
ATOM 1586   C C   . MET B 2 54  ? -107.722 -39.803 -31.698 1.00 0.00 ? 58  MET C C   1  
ATOM 1587   O O   . MET B 2 54  ? -108.466 -40.754 -31.497 1.00 0.00 ? 58  MET C O   1  
ATOM 1588   C CB  . MET B 2 54  ? -108.926 -37.645 -31.631 1.00 0.00 ? 58  MET C CB  1  
ATOM 1589   C CG  . MET B 2 54  ? -109.572 -36.637 -30.694 1.00 0.00 ? 58  MET C CG  1  
ATOM 1590   S SD  . MET B 2 54  ? -111.287 -36.285 -31.162 1.00 0.00 ? 58  MET C SD  1  
ATOM 1591   C CE  . MET B 2 54  ? -111.896 -35.637 -29.635 1.00 0.00 ? 58  MET C CE  1  
ATOM 1592   N N   . ASN B 2 55  ? -106.727 -39.839 -32.575 1.00 0.00 ? 59  ASN C N   1  
ATOM 1593   C CA  . ASN B 2 55  ? -106.279 -41.040 -33.277 1.00 0.00 ? 59  ASN C CA  1  
ATOM 1594   C C   . ASN B 2 55  ? -104.987 -41.652 -32.692 1.00 0.00 ? 59  ASN C C   1  
ATOM 1595   O O   . ASN B 2 55  ? -104.295 -42.401 -33.374 1.00 0.00 ? 59  ASN C O   1  
ATOM 1596   C CB  . ASN B 2 55  ? -106.083 -40.673 -34.739 1.00 0.00 ? 59  ASN C CB  1  
ATOM 1597   C CG  . ASN B 2 55  ? -106.843 -41.537 -35.724 1.00 0.00 ? 59  ASN C CG  1  
ATOM 1598   O OD1 . ASN B 2 55  ? -107.968 -41.974 -35.546 1.00 0.00 ? 59  ASN C OD1 1  
ATOM 1599   N ND2 . ASN B 2 55  ? -106.330 -41.797 -36.903 1.00 0.00 ? 59  ASN C ND2 1  
ATOM 1600   N N   . ALA B 2 56  ? -104.609 -41.185 -31.489 1.00 0.00 ? 60  ALA C N   1  
ATOM 1601   C CA  . ALA B 2 56  ? -103.466 -41.658 -30.691 1.00 0.00 ? 60  ALA C CA  1  
ATOM 1602   C C   . ALA B 2 56  ? -103.669 -41.768 -29.163 1.00 0.00 ? 60  ALA C C   1  
ATOM 1603   O O   . ALA B 2 56  ? -102.735 -41.756 -28.363 1.00 0.00 ? 60  ALA C O   1  
ATOM 1604   C CB  . ALA B 2 56  ? -102.250 -40.759 -30.917 1.00 0.00 ? 60  ALA C CB  1  
ATOM 1605   N N   . LYS B 2 57  ? -104.929 -41.818 -28.708 1.00 0.00 ? 61  LYS C N   1  
ATOM 1606   C CA  . LYS B 2 57  ? -105.356 -42.142 -27.333 1.00 0.00 ? 61  LYS C CA  1  
ATOM 1607   C C   . LYS B 2 57  ? -106.867 -42.010 -27.107 1.00 0.00 ? 61  LYS C C   1  
ATOM 1608   O O   . LYS B 2 57  ? -107.397 -42.613 -26.171 1.00 0.00 ? 61  LYS C O   1  
ATOM 1609   C CB  . LYS B 2 57  ? -104.671 -41.293 -26.245 1.00 0.00 ? 61  LYS C CB  1  
ATOM 1610   C CG  . LYS B 2 57  ? -104.463 -42.183 -25.000 1.00 0.00 ? 61  LYS C CG  1  
ATOM 1611   C CD  . LYS B 2 57  ? -103.596 -41.523 -23.939 1.00 0.00 ? 61  LYS C CD  1  
ATOM 1612   C CE  . LYS B 2 57  ? -103.744 -41.843 -22.441 1.00 0.00 ? 61  LYS C CE  1  
ATOM 1613   N NZ  . LYS B 2 57  ? -103.365 -43.166 -21.998 1.00 0.00 ? 61  LYS C NZ  1  
ATOM 1614   N N   . LYS B 2 58  ? -107.635 -41.257 -27.907 1.00 0.00 ? 62  LYS C N   1  
ATOM 1615   C CA  . LYS B 2 58  ? -109.114 -41.302 -27.869 1.00 0.00 ? 62  LYS C CA  1  
ATOM 1616   C C   . LYS B 2 58  ? -109.560 -42.541 -28.660 1.00 0.00 ? 62  LYS C C   1  
ATOM 1617   O O   . LYS B 2 58  ? -110.287 -42.574 -29.657 1.00 0.00 ? 62  LYS C O   1  
ATOM 1618   C CB  . LYS B 2 58  ? -109.692 -40.056 -28.495 1.00 0.00 ? 62  LYS C CB  1  
ATOM 1619   C CG  . LYS B 2 58  ? -111.204 -39.998 -28.490 1.00 0.00 ? 62  LYS C CG  1  
ATOM 1620   C CD  . LYS B 2 58  ? -111.689 -39.603 -29.874 1.00 0.00 ? 62  LYS C CD  1  
ATOM 1621   C CE  . LYS B 2 58  ? -113.200 -39.542 -29.945 1.00 0.00 ? 62  LYS C CE  1  
ATOM 1622   N NZ  . LYS B 2 58  ? -113.702 -38.821 -28.794 1.00 0.00 ? 62  LYS C NZ  1  
ATOM 1623   N N   . ILE B 2 59  ? -109.182 -43.609 -27.999 1.00 0.00 ? 63  ILE C N   1  
ATOM 1624   C CA  . ILE B 2 59  ? -109.003 -44.865 -28.673 1.00 0.00 ? 63  ILE C CA  1  
ATOM 1625   C C   . ILE B 2 59  ? -109.050 -46.085 -27.768 1.00 0.00 ? 63  ILE C C   1  
ATOM 1626   O O   . ILE B 2 59  ? -109.536 -46.085 -26.641 1.00 0.00 ? 63  ILE C O   1  
ATOM 1627   C CB  . ILE B 2 59  ? -107.649 -44.590 -29.429 1.00 0.00 ? 63  ILE C CB  1  
ATOM 1628   C CG1 . ILE B 2 59  ? -107.899 -44.959 -30.843 1.00 0.00 ? 63  ILE C CG1 1  
ATOM 1629   C CG2 . ILE B 2 59  ? -106.426 -45.255 -28.832 1.00 0.00 ? 63  ILE C CG2 1  
ATOM 1630   C CD1 . ILE B 2 59  ? -107.438 -43.737 -31.605 1.00 0.00 ? 63  ILE C CD1 1  
ATOM 1631   N N   . THR B 2 60  ? -108.590 -47.163 -28.370 1.00 0.00 ? 64  THR C N   1  
ATOM 1632   C CA  . THR B 2 60  ? -108.345 -48.433 -27.729 1.00 0.00 ? 64  THR C CA  1  
ATOM 1633   C C   . THR B 2 60  ? -107.049 -48.414 -26.919 1.00 0.00 ? 64  THR C C   1  
ATOM 1634   O O   . THR B 2 60  ? -106.239 -47.481 -26.887 1.00 0.00 ? 64  THR C O   1  
ATOM 1635   C CB  . THR B 2 60  ? -108.255 -49.517 -28.805 1.00 0.00 ? 64  THR C CB  1  
ATOM 1636   O OG1 . THR B 2 60  ? -107.453 -48.969 -29.850 1.00 0.00 ? 64  THR C OG1 1  
ATOM 1637   C CG2 . THR B 2 60  ? -109.614 -49.930 -29.346 1.00 0.00 ? 64  THR C CG2 1  
ATOM 1638   N N   . PHE B 2 61  ? -106.725 -49.534 -26.311 1.00 0.00 ? 65  PHE C N   1  
ATOM 1639   C CA  . PHE B 2 61  ? -105.584 -49.671 -25.411 1.00 0.00 ? 65  PHE C CA  1  
ATOM 1640   C C   . PHE B 2 61  ? -104.213 -49.389 -26.048 1.00 0.00 ? 65  PHE C C   1  
ATOM 1641   O O   . PHE B 2 61  ? -103.304 -48.844 -25.421 1.00 0.00 ? 65  PHE C O   1  
ATOM 1642   C CB  . PHE B 2 61  ? -105.669 -51.087 -24.821 1.00 0.00 ? 65  PHE C CB  1  
ATOM 1643   C CG  . PHE B 2 61  ? -106.970 -51.437 -24.065 1.00 0.00 ? 65  PHE C CG  1  
ATOM 1644   C CD1 . PHE B 2 61  ? -108.210 -50.896 -24.383 1.00 0.00 ? 65  PHE C CD1 1  
ATOM 1645   C CD2 . PHE B 2 61  ? -106.906 -52.345 -23.033 1.00 0.00 ? 65  PHE C CD2 1  
ATOM 1646   C CE1 . PHE B 2 61  ? -109.349 -51.247 -23.698 1.00 0.00 ? 65  PHE C CE1 1  
ATOM 1647   C CE2 . PHE B 2 61  ? -108.051 -52.691 -22.347 1.00 0.00 ? 65  PHE C CE2 1  
ATOM 1648   C CZ  . PHE B 2 61  ? -109.270 -52.154 -22.671 1.00 0.00 ? 65  PHE C CZ  1  
ATOM 1649   N N   . GLU B 2 62  ? -104.195 -49.540 -27.375 1.00 0.00 ? 66  GLU C N   1  
ATOM 1650   C CA  . GLU B 2 62  ? -103.029 -49.399 -28.249 1.00 0.00 ? 66  GLU C CA  1  
ATOM 1651   C C   . GLU B 2 62  ? -102.201 -48.130 -28.177 1.00 0.00 ? 66  GLU C C   1  
ATOM 1652   O O   . GLU B 2 62  ? -100.991 -48.128 -28.384 1.00 0.00 ? 66  GLU C O   1  
ATOM 1653   C CB  . GLU B 2 62  ? -103.495 -49.601 -29.673 1.00 0.00 ? 66  GLU C CB  1  
ATOM 1654   C CG  . GLU B 2 62  ? -103.843 -51.062 -29.879 1.00 0.00 ? 66  GLU C CG  1  
ATOM 1655   C CD  . GLU B 2 62  ? -104.739 -51.348 -31.069 1.00 0.00 ? 66  GLU C CD  1  
ATOM 1656   O OE1 . GLU B 2 62  ? -104.442 -50.918 -32.181 1.00 0.00 ? 66  GLU C OE1 1  
ATOM 1657   O OE2 . GLU B 2 62  ? -105.760 -51.997 -30.860 1.00 0.00 ? 66  GLU C OE2 1  
ATOM 1658   N N   . GLU B 2 63  ? -102.881 -47.044 -27.831 1.00 0.00 ? 67  GLU C N   1  
ATOM 1659   C CA  . GLU B 2 63  ? -102.225 -45.760 -27.678 1.00 0.00 ? 67  GLU C CA  1  
ATOM 1660   C C   . GLU B 2 63  ? -102.292 -45.246 -26.245 1.00 0.00 ? 67  GLU C C   1  
ATOM 1661   O O   . GLU B 2 63  ? -101.453 -44.468 -25.769 1.00 0.00 ? 67  GLU C O   1  
ATOM 1662   C CB  . GLU B 2 63  ? -102.885 -44.890 -28.701 1.00 0.00 ? 67  GLU C CB  1  
ATOM 1663   C CG  . GLU B 2 63  ? -102.341 -45.347 -30.054 1.00 0.00 ? 67  GLU C CG  1  
ATOM 1664   C CD  . GLU B 2 63  ? -103.117 -44.953 -31.290 1.00 0.00 ? 67  GLU C CD  1  
ATOM 1665   O OE1 . GLU B 2 63  ? -104.346 -44.970 -31.250 1.00 0.00 ? 67  GLU C OE1 1  
ATOM 1666   O OE2 . GLU B 2 63  ? -102.475 -44.639 -32.287 1.00 0.00 ? 67  GLU C OE2 1  
ATOM 1667   N N   . PHE B 2 64  ? -103.250 -45.767 -25.456 1.00 0.00 ? 68  PHE C N   1  
ATOM 1668   C CA  . PHE B 2 64  ? -103.249 -45.529 -24.017 1.00 0.00 ? 68  PHE C CA  1  
ATOM 1669   C C   . PHE B 2 64  ? -101.945 -45.899 -23.347 1.00 0.00 ? 68  PHE C C   1  
ATOM 1670   O O   . PHE B 2 64  ? -101.311 -45.031 -22.741 1.00 0.00 ? 68  PHE C O   1  
ATOM 1671   C CB  . PHE B 2 64  ? -104.287 -46.323 -23.231 1.00 0.00 ? 68  PHE C CB  1  
ATOM 1672   C CG  . PHE B 2 64  ? -105.691 -45.836 -23.440 1.00 0.00 ? 68  PHE C CG  1  
ATOM 1673   C CD1 . PHE B 2 64  ? -106.611 -46.711 -23.944 1.00 0.00 ? 68  PHE C CD1 1  
ATOM 1674   C CD2 . PHE B 2 64  ? -106.019 -44.528 -23.174 1.00 0.00 ? 68  PHE C CD2 1  
ATOM 1675   C CE1 . PHE B 2 64  ? -107.877 -46.264 -24.208 1.00 0.00 ? 68  PHE C CE1 1  
ATOM 1676   C CE2 . PHE B 2 64  ? -107.285 -44.084 -23.437 1.00 0.00 ? 68  PHE C CE2 1  
ATOM 1677   C CZ  . PHE B 2 64  ? -108.199 -44.961 -23.956 1.00 0.00 ? 68  PHE C CZ  1  
ATOM 1678   N N   . LEU B 2 65  ? -101.586 -47.159 -23.543 1.00 0.00 ? 69  LEU C N   1  
ATOM 1679   C CA  . LEU B 2 65  ? -100.403 -47.775 -22.978 1.00 0.00 ? 69  LEU C CA  1  
ATOM 1680   C C   . LEU B 2 65  ? -99.075  -47.108 -23.386 1.00 0.00 ? 69  LEU C C   1  
ATOM 1681   O O   . LEU B 2 65  ? -98.402  -46.571 -22.490 1.00 0.00 ? 69  LEU C O   1  
ATOM 1682   C CB  . LEU B 2 65  ? -100.551 -49.238 -23.382 1.00 0.00 ? 69  LEU C CB  1  
ATOM 1683   C CG  . LEU B 2 65  ? -101.625 -50.098 -22.712 1.00 0.00 ? 69  LEU C CG  1  
ATOM 1684   C CD1 . LEU B 2 65  ? -101.811 -51.378 -23.510 1.00 0.00 ? 69  LEU C CD1 1  
ATOM 1685   C CD2 . LEU B 2 65  ? -101.224 -50.402 -21.278 1.00 0.00 ? 69  LEU C CD2 1  
ATOM 1686   N N   . PRO B 2 66  ? -98.713  -46.913 -24.677 1.00 0.00 ? 70  PRO C N   1  
ATOM 1687   C CA  . PRO B 2 66  ? -97.613  -45.994 -25.000 1.00 0.00 ? 70  PRO C CA  1  
ATOM 1688   C C   . PRO B 2 66  ? -97.645  -44.572 -24.433 1.00 0.00 ? 70  PRO C C   1  
ATOM 1689   O O   . PRO B 2 66  ? -96.617  -44.115 -23.935 1.00 0.00 ? 70  PRO C O   1  
ATOM 1690   C CB  . PRO B 2 66  ? -97.524  -45.973 -26.504 1.00 0.00 ? 70  PRO C CB  1  
ATOM 1691   C CG  . PRO B 2 66  ? -98.809  -46.568 -26.961 1.00 0.00 ? 70  PRO C CG  1  
ATOM 1692   C CD  . PRO B 2 66  ? -98.986  -47.637 -25.913 1.00 0.00 ? 70  PRO C CD  1  
ATOM 1693   N N   . MET B 2 67  ? -98.753  -43.798 -24.427 1.00 0.00 ? 71  MET C N   1  
ATOM 1694   C CA  . MET B 2 67  ? -98.765  -42.487 -23.748 1.00 0.00 ? 71  MET C CA  1  
ATOM 1695   C C   . MET B 2 67  ? -98.415  -42.564 -22.256 1.00 0.00 ? 71  MET C C   1  
ATOM 1696   O O   . MET B 2 67  ? -97.631  -41.794 -21.698 1.00 0.00 ? 71  MET C O   1  
ATOM 1697   C CB  . MET B 2 67  ? -100.123 -41.825 -23.781 1.00 0.00 ? 71  MET C CB  1  
ATOM 1698   C CG  . MET B 2 67  ? -100.540 -41.113 -25.047 1.00 0.00 ? 71  MET C CG  1  
ATOM 1699   S SD  . MET B 2 67  ? -99.446  -39.758 -25.485 1.00 0.00 ? 71  MET C SD  1  
ATOM 1700   C CE  . MET B 2 67  ? -99.947  -38.550 -24.296 1.00 0.00 ? 71  MET C CE  1  
ATOM 1701   N N   . LEU B 2 68  ? -99.030  -43.542 -21.583 1.00 0.00 ? 72  LEU C N   1  
ATOM 1702   C CA  . LEU B 2 68  ? -98.782  -43.781 -20.163 1.00 0.00 ? 72  LEU C CA  1  
ATOM 1703   C C   . LEU B 2 68  ? -97.319  -44.099 -19.847 1.00 0.00 ? 72  LEU C C   1  
ATOM 1704   O O   . LEU B 2 68  ? -96.724  -43.589 -18.885 1.00 0.00 ? 72  LEU C O   1  
ATOM 1705   C CB  . LEU B 2 68  ? -99.626  -44.937 -19.662 1.00 0.00 ? 72  LEU C CB  1  
ATOM 1706   C CG  . LEU B 2 68  ? -101.132 -44.853 -19.781 1.00 0.00 ? 72  LEU C CG  1  
ATOM 1707   C CD1 . LEU B 2 68  ? -101.685 -46.198 -19.401 1.00 0.00 ? 72  LEU C CD1 1  
ATOM 1708   C CD2 . LEU B 2 68  ? -101.704 -43.741 -18.931 1.00 0.00 ? 72  LEU C CD2 1  
ATOM 1709   N N   . GLN B 2 69  ? -96.691  -44.939 -20.673 1.00 0.00 ? 73  GLN C N   1  
ATOM 1710   C CA  . GLN B 2 69  ? -95.256  -45.191 -20.562 1.00 0.00 ? 73  GLN C CA  1  
ATOM 1711   C C   . GLN B 2 69  ? -94.406  -43.935 -20.778 1.00 0.00 ? 73  GLN C C   1  
ATOM 1712   O O   . GLN B 2 69  ? -93.486  -43.649 -20.005 1.00 0.00 ? 73  GLN C O   1  
ATOM 1713   C CB  . GLN B 2 69  ? -94.809  -46.217 -21.573 1.00 0.00 ? 73  GLN C CB  1  
ATOM 1714   C CG  . GLN B 2 69  ? -95.352  -47.567 -21.195 1.00 0.00 ? 73  GLN C CG  1  
ATOM 1715   C CD  . GLN B 2 69  ? -94.483  -48.718 -21.655 1.00 0.00 ? 73  GLN C CD  1  
ATOM 1716   O OE1 . GLN B 2 69  ? -93.415  -48.591 -22.239 1.00 0.00 ? 73  GLN C OE1 1  
ATOM 1717   N NE2 . GLN B 2 69  ? -94.867  -49.935 -21.406 1.00 0.00 ? 73  GLN C NE2 1  
ATOM 1718   N N   . ALA B 2 70  ? -94.727  -43.121 -21.786 1.00 0.00 ? 74  ALA C N   1  
ATOM 1719   C CA  . ALA B 2 70  ? -94.063  -41.829 -21.987 1.00 0.00 ? 74  ALA C CA  1  
ATOM 1720   C C   . ALA B 2 70  ? -94.039  -40.958 -20.726 1.00 0.00 ? 74  ALA C C   1  
ATOM 1721   O O   . ALA B 2 70  ? -92.997  -40.435 -20.325 1.00 0.00 ? 74  ALA C O   1  
ATOM 1722   C CB  . ALA B 2 70  ? -94.754  -41.052 -23.091 1.00 0.00 ? 74  ALA C CB  1  
ATOM 1723   N N   . ALA B 2 71  ? -95.183  -40.856 -20.042 1.00 0.00 ? 75  ALA C N   1  
ATOM 1724   C CA  . ALA B 2 71  ? -95.235  -40.209 -18.732 1.00 0.00 ? 75  ALA C CA  1  
ATOM 1725   C C   . ALA B 2 71  ? -94.364  -40.944 -17.707 1.00 0.00 ? 75  ALA C C   1  
ATOM 1726   O O   . ALA B 2 71  ? -93.603  -40.313 -16.973 1.00 0.00 ? 75  ALA C O   1  
ATOM 1727   C CB  . ALA B 2 71  ? -96.672  -40.185 -18.224 1.00 0.00 ? 75  ALA C CB  1  
ATOM 1728   N N   . ALA B 2 72  ? -94.424  -42.289 -17.625 1.00 0.00 ? 76  ALA C N   1  
ATOM 1729   C CA  . ALA B 2 72  ? -93.581  -43.092 -16.721 1.00 0.00 ? 76  ALA C CA  1  
ATOM 1730   C C   . ALA B 2 72  ? -92.089  -42.758 -16.657 1.00 0.00 ? 76  ALA C C   1  
ATOM 1731   O O   . ALA B 2 72  ? -91.506  -42.782 -15.582 1.00 0.00 ? 76  ALA C O   1  
ATOM 1732   C CB  . ALA B 2 72  ? -93.699  -44.570 -17.058 1.00 0.00 ? 76  ALA C CB  1  
ATOM 1733   N N   . ASN B 2 73  ? -91.520  -42.362 -17.795 1.00 0.00 ? 77  ASN C N   1  
ATOM 1734   C CA  . ASN B 2 73  ? -90.134  -41.897 -17.874 1.00 0.00 ? 77  ASN C CA  1  
ATOM 1735   C C   . ASN B 2 73  ? -89.770  -40.622 -17.090 1.00 0.00 ? 77  ASN C C   1  
ATOM 1736   O O   . ASN B 2 73  ? -88.702  -40.530 -16.501 1.00 0.00 ? 77  ASN C O   1  
ATOM 1737   C CB  . ASN B 2 73  ? -89.744  -41.637 -19.320 1.00 0.00 ? 77  ASN C CB  1  
ATOM 1738   C CG  . ASN B 2 73  ? -90.030  -42.800 -20.253 1.00 0.00 ? 77  ASN C CG  1  
ATOM 1739   O OD1 . ASN B 2 73  ? -89.458  -43.875 -20.191 1.00 0.00 ? 77  ASN C OD1 1  
ATOM 1740   N ND2 . ASN B 2 73  ? -90.954  -42.673 -21.172 1.00 0.00 ? 77  ASN C ND2 1  
ATOM 1741   N N   . ASN B 2 74  ? -90.613  -39.584 -17.058 1.00 0.00 ? 78  ASN C N   1  
ATOM 1742   C CA  . ASN B 2 74  ? -90.289  -38.344 -16.334 1.00 0.00 ? 78  ASN C CA  1  
ATOM 1743   C C   . ASN B 2 74  ? -90.589  -38.343 -14.833 1.00 0.00 ? 78  ASN C C   1  
ATOM 1744   O O   . ASN B 2 74  ? -90.202  -37.454 -14.065 1.00 0.00 ? 78  ASN C O   1  
ATOM 1745   C CB  . ASN B 2 74  ? -91.048  -37.162 -16.926 1.00 0.00 ? 78  ASN C CB  1  
ATOM 1746   C CG  . ASN B 2 74  ? -90.838  -36.975 -18.416 1.00 0.00 ? 78  ASN C CG  1  
ATOM 1747   O OD1 . ASN B 2 74  ? -89.748  -36.765 -18.921 1.00 0.00 ? 78  ASN C OD1 1  
ATOM 1748   N ND2 . ASN B 2 74  ? -91.857  -37.044 -19.236 1.00 0.00 ? 78  ASN C ND2 1  
ATOM 1749   N N   . LYS B 2 75  ? -91.285  -39.377 -14.378 1.00 0.00 ? 79  LYS C N   1  
ATOM 1750   C CA  . LYS B 2 75  ? -91.782  -39.435 -13.013 1.00 0.00 ? 79  LYS C CA  1  
ATOM 1751   C C   . LYS B 2 75  ? -90.815  -39.495 -11.820 1.00 0.00 ? 79  LYS C C   1  
ATOM 1752   O O   . LYS B 2 75  ? -91.253  -39.377 -10.666 1.00 0.00 ? 79  LYS C O   1  
ATOM 1753   C CB  . LYS B 2 75  ? -92.774  -40.584 -13.000 1.00 0.00 ? 79  LYS C CB  1  
ATOM 1754   C CG  . LYS B 2 75  ? -94.060  -40.193 -13.745 1.00 0.00 ? 79  LYS C CG  1  
ATOM 1755   C CD  . LYS B 2 75  ? -94.787  -41.468 -14.113 1.00 0.00 ? 79  LYS C CD  1  
ATOM 1756   C CE  . LYS B 2 75  ? -96.184  -41.365 -14.711 1.00 0.00 ? 79  LYS C CE  1  
ATOM 1757   N NZ  . LYS B 2 75  ? -96.718  -42.706 -14.894 1.00 0.00 ? 79  LYS C NZ  1  
ATOM 1758   N N   . ASP B 2 76  ? -89.494  -39.541 -12.040 1.00 0.00 ? 80  ASP C N   1  
ATOM 1759   C CA  . ASP B 2 76  ? -88.460  -39.383 -11.003 1.00 0.00 ? 80  ASP C CA  1  
ATOM 1760   C C   . ASP B 2 76  ? -88.687  -38.169 -10.079 1.00 0.00 ? 80  ASP C C   1  
ATOM 1761   O O   . ASP B 2 76  ? -88.438  -38.154 -8.871  1.00 0.00 ? 80  ASP C O   1  
ATOM 1762   C CB  . ASP B 2 76  ? -87.104  -39.252 -11.693 1.00 0.00 ? 80  ASP C CB  1  
ATOM 1763   C CG  . ASP B 2 76  ? -86.635  -40.461 -12.495 1.00 0.00 ? 80  ASP C CG  1  
ATOM 1764   O OD1 . ASP B 2 76  ? -87.463  -41.237 -12.975 1.00 0.00 ? 80  ASP C OD1 1  
ATOM 1765   O OD2 . ASP B 2 76  ? -85.428  -40.617 -12.642 1.00 0.00 ? 80  ASP C OD2 1  
ATOM 1766   N N   . GLN B 2 77  ? -89.322  -37.122 -10.640 1.00 0.00 ? 81  GLN C N   1  
ATOM 1767   C CA  . GLN B 2 77  ? -89.765  -35.935 -9.893  1.00 0.00 ? 81  GLN C CA  1  
ATOM 1768   C C   . GLN B 2 77  ? -90.728  -36.211 -8.715  1.00 0.00 ? 81  GLN C C   1  
ATOM 1769   O O   . GLN B 2 77  ? -91.205  -35.319 -7.996  1.00 0.00 ? 81  GLN C O   1  
ATOM 1770   C CB  . GLN B 2 77  ? -90.463  -34.971 -10.838 1.00 0.00 ? 81  GLN C CB  1  
ATOM 1771   C CG  . GLN B 2 77  ? -89.658  -34.390 -11.994 1.00 0.00 ? 81  GLN C CG  1  
ATOM 1772   C CD  . GLN B 2 77  ? -90.500  -33.427 -12.822 1.00 0.00 ? 81  GLN C CD  1  
ATOM 1773   O OE1 . GLN B 2 77  ? -91.354  -32.718 -12.313 1.00 0.00 ? 81  GLN C OE1 1  
ATOM 1774   N NE2 . GLN B 2 77  ? -90.340  -33.282 -14.117 1.00 0.00 ? 81  GLN C NE2 1  
ATOM 1775   N N   . GLY B 2 78  ? -91.126  -37.472 -8.515  1.00 0.00 ? 82  GLY C N   1  
ATOM 1776   C CA  . GLY B 2 78  ? -91.883  -37.923 -7.349  1.00 0.00 ? 82  GLY C CA  1  
ATOM 1777   C C   . GLY B 2 78  ? -91.132  -37.719 -6.027  1.00 0.00 ? 82  GLY C C   1  
ATOM 1778   O O   . GLY B 2 78  ? -91.733  -37.795 -4.951  1.00 0.00 ? 82  GLY C O   1  
ATOM 1779   N N   . THR B 2 79  ? -89.831  -37.415 -6.074  1.00 0.00 ? 83  THR C N   1  
ATOM 1780   C CA  . THR B 2 79  ? -88.987  -37.070 -4.916  1.00 0.00 ? 83  THR C CA  1  
ATOM 1781   C C   . THR B 2 79  ? -89.649  -36.112 -3.925  1.00 0.00 ? 83  THR C C   1  
ATOM 1782   O O   . THR B 2 79  ? -90.091  -35.010 -4.252  1.00 0.00 ? 83  THR C O   1  
ATOM 1783   C CB  . THR B 2 79  ? -87.675  -36.405 -5.364  1.00 0.00 ? 83  THR C CB  1  
ATOM 1784   O OG1 . THR B 2 79  ? -88.039  -35.419 -6.330  1.00 0.00 ? 83  THR C OG1 1  
ATOM 1785   C CG2 . THR B 2 79  ? -86.677  -37.399 -5.935  1.00 0.00 ? 83  THR C CG2 1  
ATOM 1786   N N   . PHE B 2 80  ? -89.842  -36.521 -2.678  1.00 0.00 ? 84  PHE C N   1  
ATOM 1787   C CA  . PHE B 2 80  ? -90.546  -35.693 -1.700  1.00 0.00 ? 84  PHE C CA  1  
ATOM 1788   C C   . PHE B 2 80  ? -89.737  -34.552 -1.100  1.00 0.00 ? 84  PHE C C   1  
ATOM 1789   O O   . PHE B 2 80  ? -90.343  -33.585 -0.645  1.00 0.00 ? 84  PHE C O   1  
ATOM 1790   C CB  . PHE B 2 80  ? -91.038  -36.486 -0.492  1.00 0.00 ? 84  PHE C CB  1  
ATOM 1791   C CG  . PHE B 2 80  ? -91.901  -37.725 -0.694  1.00 0.00 ? 84  PHE C CG  1  
ATOM 1792   C CD1 . PHE B 2 80  ? -91.719  -38.595 -1.756  1.00 0.00 ? 84  PHE C CD1 1  
ATOM 1793   C CD2 . PHE B 2 80  ? -92.859  -38.003 0.264   1.00 0.00 ? 84  PHE C CD2 1  
ATOM 1794   C CE1 . PHE B 2 80  ? -92.480  -39.738 -1.850  1.00 0.00 ? 84  PHE C CE1 1  
ATOM 1795   C CE2 . PHE B 2 80  ? -93.611  -39.152 0.161   1.00 0.00 ? 84  PHE C CE2 1  
ATOM 1796   C CZ  . PHE B 2 80  ? -93.427  -40.018 -0.894  1.00 0.00 ? 84  PHE C CZ  1  
ATOM 1797   N N   . GLU B 2 81  ? -88.406  -34.642 -1.146  1.00 0.00 ? 85  GLU C N   1  
ATOM 1798   C CA  . GLU B 2 81  ? -87.475  -33.677 -0.539  1.00 0.00 ? 85  GLU C CA  1  
ATOM 1799   C C   . GLU B 2 81  ? -87.894  -32.202 -0.634  1.00 0.00 ? 85  GLU C C   1  
ATOM 1800   O O   . GLU B 2 81  ? -88.442  -31.635 0.320   1.00 0.00 ? 85  GLU C O   1  
ATOM 1801   C CB  . GLU B 2 81  ? -86.118  -33.962 -1.188  1.00 0.00 ? 85  GLU C CB  1  
ATOM 1802   C CG  . GLU B 2 81  ? -85.608  -35.318 -0.686  1.00 0.00 ? 85  GLU C CG  1  
ATOM 1803   C CD  . GLU B 2 81  ? -84.853  -36.157 -1.703  1.00 0.00 ? 85  GLU C CD  1  
ATOM 1804   O OE1 . GLU B 2 81  ? -83.750  -35.779 -2.088  1.00 0.00 ? 85  GLU C OE1 1  
ATOM 1805   O OE2 . GLU B 2 81  ? -85.392  -37.187 -2.101  1.00 0.00 ? 85  GLU C OE2 1  
ATOM 1806   N N   . ASP B 2 82  ? -87.933  -31.655 -1.845  1.00 0.00 ? 86  ASP C N   1  
ATOM 1807   C CA  . ASP B 2 82  ? -88.382  -30.286 -2.098  1.00 0.00 ? 86  ASP C CA  1  
ATOM 1808   C C   . ASP B 2 82  ? -89.829  -29.957 -1.661  1.00 0.00 ? 86  ASP C C   1  
ATOM 1809   O O   . ASP B 2 82  ? -90.204  -28.838 -1.294  1.00 0.00 ? 86  ASP C O   1  
ATOM 1810   C CB  . ASP B 2 82  ? -88.265  -29.999 -3.599  1.00 0.00 ? 86  ASP C CB  1  
ATOM 1811   C CG  . ASP B 2 82  ? -86.941  -30.349 -4.264  1.00 0.00 ? 86  ASP C CG  1  
ATOM 1812   O OD1 . ASP B 2 82  ? -86.581  -31.526 -4.272  1.00 0.00 ? 86  ASP C OD1 1  
ATOM 1813   O OD2 . ASP B 2 82  ? -86.298  -29.458 -4.807  1.00 0.00 ? 86  ASP C OD2 1  
ATOM 1814   N N   . PHE B 2 83  ? -90.696  -30.966 -1.557  1.00 0.00 ? 87  PHE C N   1  
ATOM 1815   C CA  . PHE B 2 83  ? -92.130  -30.740 -1.374  1.00 0.00 ? 87  PHE C CA  1  
ATOM 1816   C C   . PHE B 2 83  ? -92.789  -30.712 -0.004  1.00 0.00 ? 87  PHE C C   1  
ATOM 1817   O O   . PHE B 2 83  ? -94.008  -30.703 0.138   1.00 0.00 ? 87  PHE C O   1  
ATOM 1818   C CB  . PHE B 2 83  ? -92.808  -31.738 -2.319  1.00 0.00 ? 87  PHE C CB  1  
ATOM 1819   C CG  . PHE B 2 83  ? -92.390  -31.339 -3.729  1.00 0.00 ? 87  PHE C CG  1  
ATOM 1820   C CD1 . PHE B 2 83  ? -91.407  -32.046 -4.389  1.00 0.00 ? 87  PHE C CD1 1  
ATOM 1821   C CD2 . PHE B 2 83  ? -92.939  -30.210 -4.307  1.00 0.00 ? 87  PHE C CD2 1  
ATOM 1822   C CE1 . PHE B 2 83  ? -90.969  -31.629 -5.625  1.00 0.00 ? 87  PHE C CE1 1  
ATOM 1823   C CE2 . PHE B 2 83  ? -92.487  -29.802 -5.540  1.00 0.00 ? 87  PHE C CE2 1  
ATOM 1824   C CZ  . PHE B 2 83  ? -91.504  -30.503 -6.199  1.00 0.00 ? 87  PHE C CZ  1  
ATOM 1825   N N   . VAL B 2 84  ? -91.956  -30.698 1.034   1.00 0.00 ? 88  VAL C N   1  
ATOM 1826   C CA  . VAL B 2 84  ? -92.389  -30.369 2.394   1.00 0.00 ? 88  VAL C CA  1  
ATOM 1827   C C   . VAL B 2 84  ? -91.770  -28.977 2.631   1.00 0.00 ? 88  VAL C C   1  
ATOM 1828   O O   . VAL B 2 84  ? -92.367  -28.027 3.154   1.00 0.00 ? 88  VAL C O   1  
ATOM 1829   C CB  . VAL B 2 84  ? -91.833  -31.353 3.459   1.00 0.00 ? 88  VAL C CB  1  
ATOM 1830   C CG1 . VAL B 2 84  ? -92.321  -30.925 4.844   1.00 0.00 ? 88  VAL C CG1 1  
ATOM 1831   C CG2 . VAL B 2 84  ? -92.285  -32.770 3.175   1.00 0.00 ? 88  VAL C CG2 1  
ATOM 1832   N N   . GLU B 2 85  ? -90.519  -28.838 2.185   1.00 0.00 ? 89  GLU C N   1  
ATOM 1833   C CA  . GLU B 2 85  ? -89.755  -27.592 2.240   1.00 0.00 ? 89  GLU C CA  1  
ATOM 1834   C C   . GLU B 2 85  ? -90.390  -26.381 1.548   1.00 0.00 ? 89  GLU C C   1  
ATOM 1835   O O   . GLU B 2 85  ? -90.516  -25.300 2.143   1.00 0.00 ? 89  GLU C O   1  
ATOM 1836   C CB  . GLU B 2 85  ? -88.386  -27.822 1.630   1.00 0.00 ? 89  GLU C CB  1  
ATOM 1837   C CG  . GLU B 2 85  ? -87.560  -28.823 2.423   1.00 0.00 ? 89  GLU C CG  1  
ATOM 1838   C CD  . GLU B 2 85  ? -86.137  -29.067 1.925   1.00 0.00 ? 89  GLU C CD  1  
ATOM 1839   O OE1 . GLU B 2 85  ? -85.606  -28.264 1.158   1.00 0.00 ? 89  GLU C OE1 1  
ATOM 1840   O OE2 . GLU B 2 85  ? -85.552  -30.059 2.346   1.00 0.00 ? 89  GLU C OE2 1  
ATOM 1841   N N   . GLY B 2 86  ? -90.846  -26.554 0.304   1.00 0.00 ? 90  GLY C N   1  
ATOM 1842   C CA  . GLY B 2 86  ? -91.552  -25.520 -0.455  1.00 0.00 ? 90  GLY C CA  1  
ATOM 1843   C C   . GLY B 2 86  ? -92.770  -24.977 0.268   1.00 0.00 ? 90  GLY C C   1  
ATOM 1844   O O   . GLY B 2 86  ? -93.028  -23.775 0.306   1.00 0.00 ? 90  GLY C O   1  
ATOM 1845   N N   . LEU B 2 87  ? -93.478  -25.899 0.919   1.00 0.00 ? 91  LEU C N   1  
ATOM 1846   C CA  . LEU B 2 87  ? -94.599  -25.539 1.759   1.00 0.00 ? 91  LEU C CA  1  
ATOM 1847   C C   . LEU B 2 87  ? -94.116  -24.698 2.933   1.00 0.00 ? 91  LEU C C   1  
ATOM 1848   O O   . LEU B 2 87  ? -94.505  -23.547 2.986   1.00 0.00 ? 91  LEU C O   1  
ATOM 1849   C CB  . LEU B 2 87  ? -95.274  -26.835 2.170   1.00 0.00 ? 91  LEU C CB  1  
ATOM 1850   C CG  . LEU B 2 87  ? -96.127  -27.532 1.114   1.00 0.00 ? 91  LEU C CG  1  
ATOM 1851   C CD1 . LEU B 2 87  ? -96.959  -28.600 1.791   1.00 0.00 ? 91  LEU C CD1 1  
ATOM 1852   C CD2 . LEU B 2 87  ? -97.091  -26.554 0.450   1.00 0.00 ? 91  LEU C CD2 1  
ATOM 1853   N N   . ARG B 2 88  ? -93.202  -25.116 3.823   1.00 0.00 ? 92  ARG C N   1  
ATOM 1854   C CA  . ARG B 2 88  ? -92.673  -24.249 4.899   1.00 0.00 ? 92  ARG C CA  1  
ATOM 1855   C C   . ARG B 2 88  ? -92.295  -22.809 4.492   1.00 0.00 ? 92  ARG C C   1  
ATOM 1856   O O   . ARG B 2 88  ? -92.233  -21.894 5.306   1.00 0.00 ? 92  ARG C O   1  
ATOM 1857   C CB  . ARG B 2 88  ? -91.445  -24.902 5.527   1.00 0.00 ? 92  ARG C CB  1  
ATOM 1858   C CG  . ARG B 2 88  ? -91.668  -26.210 6.281   1.00 0.00 ? 92  ARG C CG  1  
ATOM 1859   C CD  . ARG B 2 88  ? -90.310  -26.744 6.734   1.00 0.00 ? 92  ARG C CD  1  
ATOM 1860   N NE  . ARG B 2 88  ? -90.403  -27.971 7.510   1.00 0.00 ? 92  ARG C NE  1  
ATOM 1861   C CZ  . ARG B 2 88  ? -89.342  -28.660 7.898   1.00 0.00 ? 92  ARG C CZ  1  
ATOM 1862   N NH1 . ARG B 2 88  ? -88.123  -28.313 7.579   1.00 0.00 ? 92  ARG C NH1 1  
ATOM 1863   N NH2 . ARG B 2 88  ? -89.504  -29.724 8.618   1.00 0.00 ? 92  ARG C NH2 1  
ATOM 1864   N N   . VAL B 2 89  ? -91.948  -22.555 3.228   1.00 0.00 ? 93  VAL C N   1  
ATOM 1865   C CA  . VAL B 2 89  ? -91.662  -21.207 2.733   1.00 0.00 ? 93  VAL C CA  1  
ATOM 1866   C C   . VAL B 2 89  ? -92.855  -20.243 2.741   1.00 0.00 ? 93  VAL C C   1  
ATOM 1867   O O   . VAL B 2 89  ? -92.654  -19.039 2.916   1.00 0.00 ? 93  VAL C O   1  
ATOM 1868   C CB  . VAL B 2 89  ? -91.056  -21.377 1.316   1.00 0.00 ? 93  VAL C CB  1  
ATOM 1869   C CG1 . VAL B 2 89  ? -90.882  -20.063 0.560   1.00 0.00 ? 93  VAL C CG1 1  
ATOM 1870   C CG2 . VAL B 2 89  ? -89.701  -22.034 1.510   1.00 0.00 ? 93  VAL C CG2 1  
ATOM 1871   N N   . PHE B 2 90  ? -94.095  -20.723 2.624   1.00 0.00 ? 94  PHE C N   1  
ATOM 1872   C CA  . PHE B 2 90  ? -95.253  -19.844 2.663   1.00 0.00 ? 94  PHE C CA  1  
ATOM 1873   C C   . PHE B 2 90  ? -95.529  -19.346 4.102   1.00 0.00 ? 94  PHE C C   1  
ATOM 1874   O O   . PHE B 2 90  ? -95.407  -18.146 4.348   1.00 0.00 ? 94  PHE C O   1  
ATOM 1875   C CB  . PHE B 2 90  ? -96.459  -20.599 2.083   1.00 0.00 ? 94  PHE C CB  1  
ATOM 1876   C CG  . PHE B 2 90  ? -96.289  -21.025 0.626   1.00 0.00 ? 94  PHE C CG  1  
ATOM 1877   C CD1 . PHE B 2 90  ? -95.982  -22.336 0.310   1.00 0.00 ? 94  PHE C CD1 1  
ATOM 1878   C CD2 . PHE B 2 90  ? -96.433  -20.092 -0.385  1.00 0.00 ? 94  PHE C CD2 1  
ATOM 1879   C CE1 . PHE B 2 90  ? -95.820  -22.708 -1.010  1.00 0.00 ? 94  PHE C CE1 1  
ATOM 1880   C CE2 . PHE B 2 90  ? -96.272  -20.475 -1.699  1.00 0.00 ? 94  PHE C CE2 1  
ATOM 1881   C CZ  . PHE B 2 90  ? -95.964  -21.781 -2.014  1.00 0.00 ? 94  PHE C CZ  1  
ATOM 1882   N N   . ASP B 2 91  ? -95.764  -20.211 5.096   1.00 0.00 ? 95  ASP C N   1  
ATOM 1883   C CA  . ASP B 2 91  ? -96.039  -19.746 6.464   1.00 0.00 ? 95  ASP C CA  1  
ATOM 1884   C C   . ASP B 2 91  ? -95.065  -20.104 7.631   1.00 0.00 ? 95  ASP C C   1  
ATOM 1885   O O   . ASP B 2 91  ? -95.435  -20.540 8.732   1.00 0.00 ? 95  ASP C O   1  
ATOM 1886   C CB  . ASP B 2 91  ? -97.457  -20.213 6.800   1.00 0.00 ? 95  ASP C CB  1  
ATOM 1887   C CG  . ASP B 2 91  ? -98.572  -20.085 5.772   1.00 0.00 ? 95  ASP C CG  1  
ATOM 1888   O OD1 . ASP B 2 91  ? -98.484  -20.621 4.670   1.00 0.00 ? 95  ASP C OD1 1  
ATOM 1889   O OD2 . ASP B 2 91  ? -99.614  -19.556 6.124   1.00 0.00 ? 95  ASP C OD2 1  
ATOM 1890   N N   . LYS B 2 92  ? -93.742  -19.970 7.475   1.00 0.00 ? 96  LYS C N   1  
ATOM 1891   C CA  . LYS B 2 92  ? -92.731  -20.253 8.518   1.00 0.00 ? 96  LYS C CA  1  
ATOM 1892   C C   . LYS B 2 92  ? -92.638  -19.482 9.860   1.00 0.00 ? 96  LYS C C   1  
ATOM 1893   O O   . LYS B 2 92  ? -91.834  -18.549 9.999   1.00 0.00 ? 96  LYS C O   1  
ATOM 1894   C CB  . LYS B 2 92  ? -91.352  -20.163 7.865   1.00 0.00 ? 96  LYS C CB  1  
ATOM 1895   C CG  . LYS B 2 92  ? -90.497  -21.408 7.717   1.00 0.00 ? 96  LYS C CG  1  
ATOM 1896   C CD  . LYS B 2 92  ? -89.403  -20.979 6.749   1.00 0.00 ? 96  LYS C CD  1  
ATOM 1897   C CE  . LYS B 2 92  ? -89.022  -22.099 5.798   1.00 0.00 ? 96  LYS C CE  1  
ATOM 1898   N NZ  . LYS B 2 92  ? -88.429  -21.566 4.589   1.00 0.00 ? 96  LYS C NZ  1  
ATOM 1899   N N   . GLU B 2 93  ? -93.350  -19.896 10.911  1.00 0.00 ? 97  GLU C N   1  
ATOM 1900   C CA  . GLU B 2 93  ? -93.304  -19.234 12.227  1.00 0.00 ? 97  GLU C CA  1  
ATOM 1901   C C   . GLU B 2 93  ? -93.159  -20.225 13.403  1.00 0.00 ? 97  GLU C C   1  
ATOM 1902   O O   . GLU B 2 93  ? -93.894  -20.260 14.392  1.00 0.00 ? 97  GLU C O   1  
ATOM 1903   C CB  . GLU B 2 93  ? -94.576  -18.394 12.393  1.00 0.00 ? 97  GLU C CB  1  
ATOM 1904   C CG  . GLU B 2 93  ? -94.640  -17.150 11.493  1.00 0.00 ? 97  GLU C CG  1  
ATOM 1905   C CD  . GLU B 2 93  ? -95.998  -16.457 11.352  1.00 0.00 ? 97  GLU C CD  1  
ATOM 1906   O OE1 . GLU B 2 93  ? -96.986  -16.890 11.941  1.00 0.00 ? 97  GLU C OE1 1  
ATOM 1907   O OE2 . GLU B 2 93  ? -96.059  -15.460 10.636  1.00 0.00 ? 97  GLU C OE2 1  
ATOM 1908   N N   . GLY B 2 94  ? -92.147  -21.086 13.326  1.00 0.00 ? 98  GLY C N   1  
ATOM 1909   C CA  . GLY B 2 94  ? -91.912  -22.119 14.334  1.00 0.00 ? 98  GLY C CA  1  
ATOM 1910   C C   . GLY B 2 94  ? -92.008  -23.528 13.746  1.00 0.00 ? 98  GLY C C   1  
ATOM 1911   O O   . GLY B 2 94  ? -91.110  -23.967 13.031  1.00 0.00 ? 98  GLY C O   1  
ATOM 1912   N N   . ASN B 2 95  ? -93.087  -24.266 14.015  1.00 0.00 ? 99  ASN C N   1  
ATOM 1913   C CA  . ASN B 2 95  ? -93.277  -25.597 13.422  1.00 0.00 ? 99  ASN C CA  1  
ATOM 1914   C C   . ASN B 2 95  ? -93.728  -25.562 11.955  1.00 0.00 ? 99  ASN C C   1  
ATOM 1915   O O   . ASN B 2 95  ? -93.703  -24.491 11.352  1.00 0.00 ? 99  ASN C O   1  
ATOM 1916   C CB  . ASN B 2 95  ? -94.299  -26.359 14.261  1.00 0.00 ? 99  ASN C CB  1  
ATOM 1917   C CG  . ASN B 2 95  ? -93.730  -26.743 15.614  1.00 0.00 ? 99  ASN C CG  1  
ATOM 1918   O OD1 . ASN B 2 95  ? -92.755  -27.457 15.719  1.00 0.00 ? 99  ASN C OD1 1  
ATOM 1919   N ND2 . ASN B 2 95  ? -94.217  -26.338 16.763  1.00 0.00 ? 99  ASN C ND2 1  
ATOM 1920   N N   . GLY B 2 96  ? -94.125  -26.650 11.284  1.00 0.00 ? 100 GLY C N   1  
ATOM 1921   C CA  . GLY B 2 96  ? -94.679  -26.546 9.923   1.00 0.00 ? 100 GLY C CA  1  
ATOM 1922   C C   . GLY B 2 96  ? -96.065  -25.888 9.869   1.00 0.00 ? 100 GLY C C   1  
ATOM 1923   O O   . GLY B 2 96  ? -97.056  -26.491 9.455   1.00 0.00 ? 100 GLY C O   1  
ATOM 1924   N N   . THR B 2 97  ? -96.132  -24.619 10.245  1.00 0.00 ? 101 THR C N   1  
ATOM 1925   C CA  . THR B 2 97  ? -97.354  -23.823 10.340  1.00 0.00 ? 101 THR C CA  1  
ATOM 1926   C C   . THR B 2 97  ? -97.845  -23.280 9.017   1.00 0.00 ? 101 THR C C   1  
ATOM 1927   O O   . THR B 2 97  ? -97.044  -22.795 8.230   1.00 0.00 ? 101 THR C O   1  
ATOM 1928   C CB  . THR B 2 97  ? -97.134  -22.623 11.291  1.00 0.00 ? 101 THR C CB  1  
ATOM 1929   O OG1 . THR B 2 97  ? -95.820  -22.108 11.071  1.00 0.00 ? 101 THR C OG1 1  
ATOM 1930   C CG2 . THR B 2 97  ? -97.293  -23.039 12.745  1.00 0.00 ? 101 THR C CG2 1  
ATOM 1931   N N   . VAL B 2 98  ? -99.116  -23.461 8.688   1.00 0.00 ? 102 VAL C N   1  
ATOM 1932   C CA  . VAL B 2 98  ? -99.751  -22.874 7.492   1.00 0.00 ? 102 VAL C CA  1  
ATOM 1933   C C   . VAL B 2 98  ? -101.011 -22.101 7.879   1.00 0.00 ? 102 VAL C C   1  
ATOM 1934   O O   . VAL B 2 98  ? -101.546 -22.329 8.957   1.00 0.00 ? 102 VAL C O   1  
ATOM 1935   C CB  . VAL B 2 98  ? -100.327 -23.864 6.459   1.00 0.00 ? 102 VAL C CB  1  
ATOM 1936   C CG1 . VAL B 2 98  ? -100.178 -23.254 5.097   1.00 0.00 ? 102 VAL C CG1 1  
ATOM 1937   C CG2 . VAL B 2 98  ? -99.732  -25.232 6.594   1.00 0.00 ? 102 VAL C CG2 1  
ATOM 1938   N N   . MET B 2 99  ? -101.585 -21.250 7.047   1.00 0.00 ? 103 MET C N   1  
ATOM 1939   C CA  . MET B 2 99  ? -102.925 -20.744 7.278   1.00 0.00 ? 103 MET C CA  1  
ATOM 1940   C C   . MET B 2 99  ? -103.834 -21.234 6.161   1.00 0.00 ? 103 MET C C   1  
ATOM 1941   O O   . MET B 2 99  ? -103.466 -21.260 4.978   1.00 0.00 ? 103 MET C O   1  
ATOM 1942   C CB  . MET B 2 99  ? -102.950 -19.225 7.302   1.00 0.00 ? 103 MET C CB  1  
ATOM 1943   C CG  . MET B 2 99  ? -102.315 -18.664 8.565   1.00 0.00 ? 103 MET C CG  1  
ATOM 1944   S SD  . MET B 2 99  ? -103.083 -19.330 10.060  1.00 0.00 ? 103 MET C SD  1  
ATOM 1945   C CE  . MET B 2 99  ? -104.453 -18.223 10.237  1.00 0.00 ? 103 MET C CE  1  
ATOM 1946   N N   . GLY B 2 100 ? -105.042 -21.697 6.507   1.00 0.00 ? 104 GLY C N   1  
ATOM 1947   C CA  . GLY B 2 100 ? -106.016 -22.196 5.531   1.00 0.00 ? 104 GLY C CA  1  
ATOM 1948   C C   . GLY B 2 100 ? -106.144 -21.336 4.269   1.00 0.00 ? 104 GLY C C   1  
ATOM 1949   O O   . GLY B 2 100 ? -105.901 -21.751 3.139   1.00 0.00 ? 104 GLY C O   1  
ATOM 1950   N N   . ALA B 2 101 ? -106.432 -20.056 4.488   1.00 0.00 ? 105 ALA C N   1  
ATOM 1951   C CA  . ALA B 2 101 ? -106.551 -19.069 3.419   1.00 0.00 ? 105 ALA C CA  1  
ATOM 1952   C C   . ALA B 2 101 ? -105.421 -18.986 2.395   1.00 0.00 ? 105 ALA C C   1  
ATOM 1953   O O   . ALA B 2 101 ? -105.699 -18.895 1.192   1.00 0.00 ? 105 ALA C O   1  
ATOM 1954   C CB  . ALA B 2 101 ? -106.693 -17.700 4.034   1.00 0.00 ? 105 ALA C CB  1  
ATOM 1955   N N   . GLU B 2 102 ? -104.176 -19.047 2.854   1.00 0.00 ? 106 GLU C N   1  
ATOM 1956   C CA  . GLU B 2 102 ? -103.016 -18.995 1.980   1.00 0.00 ? 106 GLU C CA  1  
ATOM 1957   C C   . GLU B 2 102 ? -102.920 -20.230 1.096   1.00 0.00 ? 106 GLU C C   1  
ATOM 1958   O O   . GLU B 2 102 ? -103.035 -20.060 -0.120  1.00 0.00 ? 106 GLU C O   1  
ATOM 1959   C CB  . GLU B 2 102 ? -101.802 -18.791 2.884   1.00 0.00 ? 106 GLU C CB  1  
ATOM 1960   C CG  . GLU B 2 102 ? -101.978 -17.322 3.279   1.00 0.00 ? 106 GLU C CG  1  
ATOM 1961   C CD  . GLU B 2 102 ? -101.167 -16.757 4.430   1.00 0.00 ? 106 GLU C CD  1  
ATOM 1962   O OE1 . GLU B 2 102 ? -100.019 -16.380 4.205   1.00 0.00 ? 106 GLU C OE1 1  
ATOM 1963   O OE2 . GLU B 2 102 ? -101.733 -16.611 5.509   1.00 0.00 ? 106 GLU C OE2 1  
ATOM 1964   N N   . LEU B 2 103 ? -102.898 -21.472 1.603   1.00 0.00 ? 107 LEU C N   1  
ATOM 1965   C CA  . LEU B 2 103 ? -102.922 -22.642 0.710   1.00 0.00 ? 107 LEU C CA  1  
ATOM 1966   C C   . LEU B 2 103 ? -104.160 -22.696 -0.197  1.00 0.00 ? 107 LEU C C   1  
ATOM 1967   O O   . LEU B 2 103 ? -104.017 -22.862 -1.405  1.00 0.00 ? 107 LEU C O   1  
ATOM 1968   C CB  . LEU B 2 103 ? -102.879 -23.964 1.478   1.00 0.00 ? 107 LEU C CB  1  
ATOM 1969   C CG  . LEU B 2 103 ? -101.577 -24.423 2.121   1.00 0.00 ? 107 LEU C CG  1  
ATOM 1970   C CD1 . LEU B 2 103 ? -101.726 -25.879 2.514   1.00 0.00 ? 107 LEU C CD1 1  
ATOM 1971   C CD2 . LEU B 2 103 ? -100.410 -24.304 1.149   1.00 0.00 ? 107 LEU C CD2 1  
ATOM 1972   N N   . ARG B 2 104 ? -105.373 -22.442 0.323   1.00 0.00 ? 108 ARG C N   1  
ATOM 1973   C CA  . ARG B 2 104 ? -106.603 -22.399 -0.481  1.00 0.00 ? 108 ARG C CA  1  
ATOM 1974   C C   . ARG B 2 104 ? -106.550 -21.484 -1.702  1.00 0.00 ? 108 ARG C C   1  
ATOM 1975   O O   . ARG B 2 104 ? -106.849 -21.896 -2.817  1.00 0.00 ? 108 ARG C O   1  
ATOM 1976   C CB  . ARG B 2 104 ? -107.790 -21.936 0.360   1.00 0.00 ? 108 ARG C CB  1  
ATOM 1977   C CG  . ARG B 2 104 ? -108.146 -22.899 1.469   1.00 0.00 ? 108 ARG C CG  1  
ATOM 1978   C CD  . ARG B 2 104 ? -109.106 -22.296 2.483   1.00 0.00 ? 108 ARG C CD  1  
ATOM 1979   N NE  . ARG B 2 104 ? -109.022 -23.012 3.755   1.00 0.00 ? 108 ARG C NE  1  
ATOM 1980   C CZ  . ARG B 2 104 ? -109.771 -22.760 4.803   1.00 0.00 ? 108 ARG C CZ  1  
ATOM 1981   N NH1 . ARG B 2 104 ? -110.691 -21.835 4.782   1.00 0.00 ? 108 ARG C NH1 1  
ATOM 1982   N NH2 . ARG B 2 104 ? -109.597 -23.448 5.885   1.00 0.00 ? 108 ARG C NH2 1  
ATOM 1983   N N   . HIS B 2 105 ? -106.167 -20.210 -1.543  1.00 0.00 ? 109 HIS C N   1  
ATOM 1984   C CA  . HIS B 2 105 ? -106.057 -19.340 -2.712  1.00 0.00 ? 109 HIS C CA  1  
ATOM 1985   C C   . HIS B 2 105 ? -104.844 -19.659 -3.577  1.00 0.00 ? 109 HIS C C   1  
ATOM 1986   O O   . HIS B 2 105 ? -105.015 -19.846 -4.774  1.00 0.00 ? 109 HIS C O   1  
ATOM 1987   C CB  . HIS B 2 105 ? -105.976 -17.878 -2.311  1.00 0.00 ? 109 HIS C CB  1  
ATOM 1988   C CG  . HIS B 2 105 ? -107.271 -17.458 -1.640  1.00 0.00 ? 109 HIS C CG  1  
ATOM 1989   N ND1 . HIS B 2 105 ? -107.499 -17.462 -0.339  1.00 0.00 ? 109 HIS C ND1 1  
ATOM 1990   C CD2 . HIS B 2 105 ? -108.414 -17.031 -2.273  1.00 0.00 ? 109 HIS C CD2 1  
ATOM 1991   C CE1 . HIS B 2 105 ? -108.720 -17.057 -0.149  1.00 0.00 ? 109 HIS C CE1 1  
ATOM 1992   N NE2 . HIS B 2 105 ? -109.267 -16.794 -1.307  1.00 0.00 ? 109 HIS C NE2 1  
ATOM 1993   N N   . VAL B 2 106 ? -103.645 -19.851 -3.014  1.00 0.00 ? 110 VAL C N   1  
ATOM 1994   C CA  . VAL B 2 106 ? -102.448 -20.178 -3.789  1.00 0.00 ? 110 VAL C CA  1  
ATOM 1995   C C   . VAL B 2 106 ? -102.622 -21.414 -4.692  1.00 0.00 ? 110 VAL C C   1  
ATOM 1996   O O   . VAL B 2 106 ? -102.200 -21.444 -5.849  1.00 0.00 ? 110 VAL C O   1  
ATOM 1997   C CB  . VAL B 2 106 ? -101.299 -20.331 -2.749  1.00 0.00 ? 110 VAL C CB  1  
ATOM 1998   C CG1 . VAL B 2 106 ? -100.101 -21.113 -3.255  1.00 0.00 ? 110 VAL C CG1 1  
ATOM 1999   C CG2 . VAL B 2 106 ? -100.849 -18.923 -2.385  1.00 0.00 ? 110 VAL C CG2 1  
ATOM 2000   N N   . LEU B 2 107 ? -103.336 -22.434 -4.208  1.00 0.00 ? 111 LEU C N   1  
ATOM 2001   C CA  . LEU B 2 107 ? -103.624 -23.610 -5.015  1.00 0.00 ? 111 LEU C CA  1  
ATOM 2002   C C   . LEU B 2 107 ? -104.945 -23.595 -5.796  1.00 0.00 ? 111 LEU C C   1  
ATOM 2003   O O   . LEU B 2 107 ? -105.446 -24.627 -6.221  1.00 0.00 ? 111 LEU C O   1  
ATOM 2004   C CB  . LEU B 2 107 ? -103.554 -24.839 -4.100  1.00 0.00 ? 111 LEU C CB  1  
ATOM 2005   C CG  . LEU B 2 107 ? -102.241 -25.082 -3.343  1.00 0.00 ? 111 LEU C CG  1  
ATOM 2006   C CD1 . LEU B 2 107 ? -102.380 -26.353 -2.531  1.00 0.00 ? 111 LEU C CD1 1  
ATOM 2007   C CD2 . LEU B 2 107 ? -101.069 -25.199 -4.305  1.00 0.00 ? 111 LEU C CD2 1  
ATOM 2008   N N   . ALA B 2 108 ? -105.523 -22.416 -6.021  1.00 0.00 ? 112 ALA C N   1  
ATOM 2009   C CA  . ALA B 2 108 ? -106.716 -22.239 -6.853  1.00 0.00 ? 112 ALA C CA  1  
ATOM 2010   C C   . ALA B 2 108 ? -106.461 -21.180 -7.936  1.00 0.00 ? 112 ALA C C   1  
ATOM 2011   O O   . ALA B 2 108 ? -106.829 -21.318 -9.104  1.00 0.00 ? 112 ALA C O   1  
ATOM 2012   C CB  . ALA B 2 108 ? -107.893 -21.775 -6.005  1.00 0.00 ? 112 ALA C CB  1  
ATOM 2013   N N   . THR B 2 109 ? -105.751 -20.116 -7.552  1.00 0.00 ? 113 THR C N   1  
ATOM 2014   C CA  . THR B 2 109 ? -105.395 -18.995 -8.426  1.00 0.00 ? 113 THR C CA  1  
ATOM 2015   C C   . THR B 2 109 ? -104.055 -19.066 -9.162  1.00 0.00 ? 113 THR C C   1  
ATOM 2016   O O   . THR B 2 109 ? -103.870 -18.411 -10.189 1.00 0.00 ? 113 THR C O   1  
ATOM 2017   C CB  . THR B 2 109 ? -105.359 -17.662 -7.656  1.00 0.00 ? 113 THR C CB  1  
ATOM 2018   O OG1 . THR B 2 109 ? -104.438 -17.838 -6.580  1.00 0.00 ? 113 THR C OG1 1  
ATOM 2019   C CG2 . THR B 2 109 ? -106.718 -17.255 -7.105  1.00 0.00 ? 113 THR C CG2 1  
ATOM 2020   N N   . LEU B 2 110 ? -103.060 -19.805 -8.670  1.00 0.00 ? 114 LEU C N   1  
ATOM 2021   C CA  . LEU B 2 110 ? -101.735 -19.788 -9.291  1.00 0.00 ? 114 LEU C CA  1  
ATOM 2022   C C   . LEU B 2 110 ? -101.256 -20.959 -10.157 1.00 0.00 ? 114 LEU C C   1  
ATOM 2023   O O   . LEU B 2 110 ? -101.700 -22.100 -10.020 1.00 0.00 ? 114 LEU C O   1  
ATOM 2024   C CB  . LEU B 2 110 ? -100.719 -19.543 -8.177  1.00 0.00 ? 114 LEU C CB  1  
ATOM 2025   C CG  . LEU B 2 110 ? -100.836 -18.210 -7.432  1.00 0.00 ? 114 LEU C CG  1  
ATOM 2026   C CD1 . LEU B 2 110 ? -99.934  -18.199 -6.221  1.00 0.00 ? 114 LEU C CD1 1  
ATOM 2027   C CD2 . LEU B 2 110 ? -100.462 -17.079 -8.371  1.00 0.00 ? 114 LEU C CD2 1  
ATOM 2028   N N   . GLY B 2 111 ? -100.328 -20.691 -11.080 1.00 0.00 ? 115 GLY C N   1  
ATOM 2029   C CA  . GLY B 2 111 ? -99.756  -21.702 -11.978 1.00 0.00 ? 115 GLY C CA  1  
ATOM 2030   C C   . GLY B 2 111 ? -100.754 -22.522 -12.803 1.00 0.00 ? 115 GLY C C   1  
ATOM 2031   O O   . GLY B 2 111 ? -101.321 -22.064 -13.793 1.00 0.00 ? 115 GLY C O   1  
ATOM 2032   N N   . GLU B 2 112 ? -101.021 -23.739 -12.341 1.00 0.00 ? 116 GLU C N   1  
ATOM 2033   C CA  . GLU B 2 112 ? -101.947 -24.639 -13.011 1.00 0.00 ? 116 GLU C CA  1  
ATOM 2034   C C   . GLU B 2 112 ? -103.406 -24.552 -12.545 1.00 0.00 ? 116 GLU C C   1  
ATOM 2035   O O   . GLU B 2 112 ? -104.256 -25.316 -13.033 1.00 0.00 ? 116 GLU C O   1  
ATOM 2036   C CB  . GLU B 2 112 ? -101.481 -26.082 -12.841 1.00 0.00 ? 116 GLU C CB  1  
ATOM 2037   C CG  . GLU B 2 112 ? -100.286 -26.664 -13.578 1.00 0.00 ? 116 GLU C CG  1  
ATOM 2038   C CD  . GLU B 2 112 ? -100.028 -28.119 -13.204 1.00 0.00 ? 116 GLU C CD  1  
ATOM 2039   O OE1 . GLU B 2 112 ? -100.705 -29.016 -13.705 1.00 0.00 ? 116 GLU C OE1 1  
ATOM 2040   O OE2 . GLU B 2 112 ? -99.162  -28.383 -12.379 1.00 0.00 ? 116 GLU C OE2 1  
ATOM 2041   N N   . LYS B 2 113 ? -103.741 -23.685 -11.572 1.00 0.00 ? 117 LYS C N   1  
ATOM 2042   C CA  . LYS B 2 113 ? -105.076 -23.539 -10.952 1.00 0.00 ? 117 LYS C CA  1  
ATOM 2043   C C   . LYS B 2 113 ? -105.493 -24.799 -10.174 1.00 0.00 ? 117 LYS C C   1  
ATOM 2044   O O   . LYS B 2 113 ? -104.683 -25.681 -9.934  1.00 0.00 ? 117 LYS C O   1  
ATOM 2045   C CB  . LYS B 2 113 ? -106.180 -23.266 -11.997 1.00 0.00 ? 117 LYS C CB  1  
ATOM 2046   C CG  . LYS B 2 113 ? -105.980 -22.096 -12.940 1.00 0.00 ? 117 LYS C CG  1  
ATOM 2047   C CD  . LYS B 2 113 ? -106.914 -22.283 -14.127 1.00 0.00 ? 117 LYS C CD  1  
ATOM 2048   C CE  . LYS B 2 113 ? -106.584 -21.262 -15.202 1.00 0.00 ? 117 LYS C CE  1  
ATOM 2049   N NZ  . LYS B 2 113 ? -107.383 -21.502 -16.388 1.00 0.00 ? 117 LYS C NZ  1  
ATOM 2050   N N   . MET B 2 114 ? -106.705 -24.904 -9.670  1.00 0.00 ? 118 MET C N   1  
ATOM 2051   C CA  . MET B 2 114 ? -107.352 -26.117 -9.142  1.00 0.00 ? 118 MET C CA  1  
ATOM 2052   C C   . MET B 2 114 ? -108.754 -25.631 -8.821  1.00 0.00 ? 118 MET C C   1  
ATOM 2053   O O   . MET B 2 114 ? -108.897 -24.488 -8.362  1.00 0.00 ? 118 MET C O   1  
ATOM 2054   C CB  . MET B 2 114 ? -106.827 -26.686 -7.815  1.00 0.00 ? 118 MET C CB  1  
ATOM 2055   C CG  . MET B 2 114 ? -105.580 -27.561 -7.824  1.00 0.00 ? 118 MET C CG  1  
ATOM 2056   S SD  . MET B 2 114 ? -105.703 -28.857 -9.071  1.00 0.00 ? 118 MET C SD  1  
ATOM 2057   C CE  . MET B 2 114 ? -106.687 -29.993 -8.148  1.00 0.00 ? 118 MET C CE  1  
ATOM 2058   N N   . THR B 2 115 ? -109.841 -26.349 -9.062  1.00 0.00 ? 119 THR C N   1  
ATOM 2059   C CA  . THR B 2 115 ? -111.154 -25.786 -8.741  1.00 0.00 ? 119 THR C CA  1  
ATOM 2060   C C   . THR B 2 115 ? -111.345 -25.668 -7.235  1.00 0.00 ? 119 THR C C   1  
ATOM 2061   O O   . THR B 2 115 ? -110.801 -26.455 -6.452  1.00 0.00 ? 119 THR C O   1  
ATOM 2062   C CB  . THR B 2 115 ? -112.366 -26.618 -9.285  1.00 0.00 ? 119 THR C CB  1  
ATOM 2063   O OG1 . THR B 2 115 ? -112.602 -27.713 -8.407  1.00 0.00 ? 119 THR C OG1 1  
ATOM 2064   C CG2 . THR B 2 115 ? -112.129 -27.079 -10.717 1.00 0.00 ? 119 THR C CG2 1  
ATOM 2065   N N   . GLU B 2 116 ? -112.080 -24.655 -6.784  1.00 0.00 ? 120 GLU C N   1  
ATOM 2066   C CA  . GLU B 2 116 ? -112.362 -24.476 -5.358  1.00 0.00 ? 120 GLU C CA  1  
ATOM 2067   C C   . GLU B 2 116 ? -112.892 -25.758 -4.718  1.00 0.00 ? 120 GLU C C   1  
ATOM 2068   O O   . GLU B 2 116 ? -112.325 -26.246 -3.751  1.00 0.00 ? 120 GLU C O   1  
ATOM 2069   C CB  . GLU B 2 116 ? -113.331 -23.306 -5.231  1.00 0.00 ? 120 GLU C CB  1  
ATOM 2070   C CG  . GLU B 2 116 ? -112.609 -22.044 -5.731  1.00 0.00 ? 120 GLU C CG  1  
ATOM 2071   C CD  . GLU B 2 116 ? -113.410 -20.752 -5.833  1.00 0.00 ? 120 GLU C CD  1  
ATOM 2072   O OE1 . GLU B 2 116 ? -114.625 -20.796 -5.999  1.00 0.00 ? 120 GLU C OE1 1  
ATOM 2073   O OE2 . GLU B 2 116 ? -112.791 -19.689 -5.778  1.00 0.00 ? 120 GLU C OE2 1  
ATOM 2074   N N   . GLU B 2 117 ? -113.813 -26.434 -5.421  1.00 0.00 ? 121 GLU C N   1  
ATOM 2075   C CA  . GLU B 2 117 ? -114.316 -27.771 -5.070  1.00 0.00 ? 121 GLU C CA  1  
ATOM 2076   C C   . GLU B 2 117 ? -113.186 -28.779 -4.789  1.00 0.00 ? 121 GLU C C   1  
ATOM 2077   O O   . GLU B 2 117 ? -113.048 -29.314 -3.684  1.00 0.00 ? 121 GLU C O   1  
ATOM 2078   C CB  . GLU B 2 117 ? -115.170 -28.312 -6.213  1.00 0.00 ? 121 GLU C CB  1  
ATOM 2079   C CG  . GLU B 2 117 ? -116.285 -27.382 -6.683  1.00 0.00 ? 121 GLU C CG  1  
ATOM 2080   C CD  . GLU B 2 117 ? -116.882 -27.674 -8.054  1.00 0.00 ? 121 GLU C CD  1  
ATOM 2081   O OE1 . GLU B 2 117 ? -116.467 -28.619 -8.729  1.00 0.00 ? 121 GLU C OE1 1  
ATOM 2082   O OE2 . GLU B 2 117 ? -117.762 -26.927 -8.462  1.00 0.00 ? 121 GLU C OE2 1  
ATOM 2083   N N   . GLU B 2 118 ? -112.266 -28.999 -5.739  1.00 0.00 ? 122 GLU C N   1  
ATOM 2084   C CA  . GLU B 2 118 ? -111.104 -29.878 -5.551  1.00 0.00 ? 122 GLU C CA  1  
ATOM 2085   C C   . GLU B 2 118 ? -110.195 -29.463 -4.384  1.00 0.00 ? 122 GLU C C   1  
ATOM 2086   O O   . GLU B 2 118 ? -109.735 -30.287 -3.586  1.00 0.00 ? 122 GLU C O   1  
ATOM 2087   C CB  . GLU B 2 118 ? -110.264 -29.914 -6.823  1.00 0.00 ? 122 GLU C CB  1  
ATOM 2088   C CG  . GLU B 2 118 ? -110.948 -30.486 -8.070  1.00 0.00 ? 122 GLU C CG  1  
ATOM 2089   C CD  . GLU B 2 118 ? -110.165 -30.290 -9.369  1.00 0.00 ? 122 GLU C CD  1  
ATOM 2090   O OE1 . GLU B 2 118 ? -109.679 -29.191 -9.620  1.00 0.00 ? 122 GLU C OE1 1  
ATOM 2091   O OE2 . GLU B 2 118 ? -110.052 -31.230 -10.147 1.00 0.00 ? 122 GLU C OE2 1  
ATOM 2092   N N   . VAL B 2 119 ? -109.914 -28.165 -4.202  1.00 0.00 ? 123 VAL C N   1  
ATOM 2093   C CA  . VAL B 2 119 ? -109.123 -27.688 -3.056  1.00 0.00 ? 123 VAL C CA  1  
ATOM 2094   C C   . VAL B 2 119 ? -109.850 -27.953 -1.724  1.00 0.00 ? 123 VAL C C   1  
ATOM 2095   O O   . VAL B 2 119 ? -109.255 -28.519 -0.803  1.00 0.00 ? 123 VAL C O   1  
ATOM 2096   C CB  . VAL B 2 119 ? -108.833 -26.171 -3.213  1.00 0.00 ? 123 VAL C CB  1  
ATOM 2097   C CG1 . VAL B 2 119 ? -108.067 -25.634 -2.012  1.00 0.00 ? 123 VAL C CG1 1  
ATOM 2098   C CG2 . VAL B 2 119 ? -107.989 -25.953 -4.449  1.00 0.00 ? 123 VAL C CG2 1  
ATOM 2099   N N   . GLU B 2 120 ? -111.139 -27.628 -1.581  1.00 0.00 ? 124 GLU C N   1  
ATOM 2100   C CA  . GLU B 2 120 ? -111.961 -27.953 -0.409  1.00 0.00 ? 124 GLU C CA  1  
ATOM 2101   C C   . GLU B 2 120 ? -111.884 -29.457 -0.083  1.00 0.00 ? 124 GLU C C   1  
ATOM 2102   O O   . GLU B 2 120 ? -111.716 -29.898 1.060   1.00 0.00 ? 124 GLU C O   1  
ATOM 2103   C CB  . GLU B 2 120 ? -113.411 -27.576 -0.676  1.00 0.00 ? 124 GLU C CB  1  
ATOM 2104   C CG  . GLU B 2 120 ? -113.675 -26.074 -0.764  1.00 0.00 ? 124 GLU C CG  1  
ATOM 2105   C CD  . GLU B 2 120 ? -114.962 -25.695 -1.489  1.00 0.00 ? 124 GLU C CD  1  
ATOM 2106   O OE1 . GLU B 2 120 ? -115.995 -26.328 -1.281  1.00 0.00 ? 124 GLU C OE1 1  
ATOM 2107   O OE2 . GLU B 2 120 ? -114.926 -24.753 -2.278  1.00 0.00 ? 124 GLU C OE2 1  
ATOM 2108   N N   . GLU B 2 121 ? -111.937 -30.271 -1.136  1.00 0.00 ? 125 GLU C N   1  
ATOM 2109   C CA  . GLU B 2 121 ? -111.688 -31.705 -1.053  1.00 0.00 ? 125 GLU C CA  1  
ATOM 2110   C C   . GLU B 2 121 ? -110.278 -32.185 -0.708  1.00 0.00 ? 125 GLU C C   1  
ATOM 2111   O O   . GLU B 2 121 ? -110.069 -33.358 -0.365  1.00 0.00 ? 125 GLU C O   1  
ATOM 2112   C CB  . GLU B 2 121 ? -112.043 -32.369 -2.358  1.00 0.00 ? 125 GLU C CB  1  
ATOM 2113   C CG  . GLU B 2 121 ? -113.479 -32.820 -2.438  1.00 0.00 ? 125 GLU C CG  1  
ATOM 2114   C CD  . GLU B 2 121 ? -113.621 -33.978 -3.409  1.00 0.00 ? 125 GLU C CD  1  
ATOM 2115   O OE1 . GLU B 2 121 ? -113.048 -35.032 -3.131  1.00 0.00 ? 125 GLU C OE1 1  
ATOM 2116   O OE2 . GLU B 2 121 ? -114.283 -33.833 -4.421  1.00 0.00 ? 125 GLU C OE2 1  
ATOM 2117   N N   . LEU B 2 122 ? -109.237 -31.391 -0.938  1.00 0.00 ? 126 LEU C N   1  
ATOM 2118   C CA  . LEU B 2 122 ? -107.900 -31.702 -0.427  1.00 0.00 ? 126 LEU C CA  1  
ATOM 2119   C C   . LEU B 2 122 ? -107.817 -31.393 1.070   1.00 0.00 ? 126 LEU C C   1  
ATOM 2120   O O   . LEU B 2 122 ? -107.264 -32.144 1.881   1.00 0.00 ? 126 LEU C O   1  
ATOM 2121   C CB  . LEU B 2 122 ? -106.875 -30.894 -1.211  1.00 0.00 ? 126 LEU C CB  1  
ATOM 2122   C CG  . LEU B 2 122 ? -106.710 -31.339 -2.660  1.00 0.00 ? 126 LEU C CG  1  
ATOM 2123   C CD1 . LEU B 2 122 ? -106.029 -30.243 -3.456  1.00 0.00 ? 126 LEU C CD1 1  
ATOM 2124   C CD2 . LEU B 2 122 ? -105.951 -32.656 -2.694  1.00 0.00 ? 126 LEU C CD2 1  
ATOM 2125   N N   . MET B 2 123 ? -108.503 -30.334 1.475   1.00 0.00 ? 127 MET C N   1  
ATOM 2126   C CA  . MET B 2 123 ? -108.635 -29.947 2.882   1.00 0.00 ? 127 MET C CA  1  
ATOM 2127   C C   . MET B 2 123 ? -109.643 -30.790 3.697   1.00 0.00 ? 127 MET C C   1  
ATOM 2128   O O   . MET B 2 123 ? -110.244 -30.351 4.682   1.00 0.00 ? 127 MET C O   1  
ATOM 2129   C CB  . MET B 2 123 ? -109.036 -28.491 2.935   1.00 0.00 ? 127 MET C CB  1  
ATOM 2130   C CG  . MET B 2 123 ? -108.176 -27.556 2.099   1.00 0.00 ? 127 MET C CG  1  
ATOM 2131   S SD  . MET B 2 123 ? -108.604 -25.820 2.348   1.00 0.00 ? 127 MET C SD  1  
ATOM 2132   C CE  . MET B 2 123 ? -110.346 -25.895 2.676   1.00 0.00 ? 127 MET C CE  1  
ATOM 2133   N N   . LYS B 2 124 ? -109.785 -32.085 3.384   1.00 0.00 ? 128 LYS C N   1  
ATOM 2134   C CA  . LYS B 2 124 ? -110.729 -33.002 4.034   1.00 0.00 ? 128 LYS C CA  1  
ATOM 2135   C C   . LYS B 2 124 ? -110.534 -33.264 5.533   1.00 0.00 ? 128 LYS C C   1  
ATOM 2136   O O   . LYS B 2 124 ? -110.001 -34.298 5.941   1.00 0.00 ? 128 LYS C O   1  
ATOM 2137   C CB  . LYS B 2 124 ? -110.692 -34.352 3.290   1.00 0.00 ? 128 LYS C CB  1  
ATOM 2138   C CG  . LYS B 2 124 ? -111.621 -34.475 2.092   1.00 0.00 ? 128 LYS C CG  1  
ATOM 2139   C CD  . LYS B 2 124 ? -111.295 -35.732 1.278   1.00 0.00 ? 128 LYS C CD  1  
ATOM 2140   C CE  . LYS B 2 124 ? -112.140 -35.733 0.006   1.00 0.00 ? 128 LYS C CE  1  
ATOM 2141   N NZ  . LYS B 2 124 ? -111.326 -35.864 -1.188  1.00 0.00 ? 128 LYS C NZ  1  
ATOM 2142   N N   . GLY B 2 125 ? -110.896 -32.310 6.398   1.00 0.00 ? 129 GLY C N   1  
ATOM 2143   C CA  . GLY B 2 125 ? -110.740 -32.461 7.849   1.00 0.00 ? 129 GLY C CA  1  
ATOM 2144   C C   . GLY B 2 125 ? -109.289 -32.613 8.324   1.00 0.00 ? 129 GLY C C   1  
ATOM 2145   O O   . GLY B 2 125 ? -108.928 -33.459 9.127   1.00 0.00 ? 129 GLY C O   1  
ATOM 2146   N N   . GLN B 2 126 ? -108.404 -31.853 7.679   1.00 0.00 ? 130 GLN C N   1  
ATOM 2147   C CA  . GLN B 2 126 ? -106.992 -31.802 8.062   1.00 0.00 ? 130 GLN C CA  1  
ATOM 2148   C C   . GLN B 2 126 ? -106.574 -30.413 8.584   1.00 0.00 ? 130 GLN C C   1  
ATOM 2149   O O   . GLN B 2 126 ? -105.462 -30.173 9.067   1.00 0.00 ? 130 GLN C O   1  
ATOM 2150   C CB  . GLN B 2 126 ? -106.145 -32.215 6.852   1.00 0.00 ? 130 GLN C CB  1  
ATOM 2151   C CG  . GLN B 2 126 ? -106.322 -33.693 6.491   1.00 0.00 ? 130 GLN C CG  1  
ATOM 2152   C CD  . GLN B 2 126 ? -105.361 -34.248 5.449   1.00 0.00 ? 130 GLN C CD  1  
ATOM 2153   O OE1 . GLN B 2 126 ? -104.142 -34.181 5.559   1.00 0.00 ? 130 GLN C OE1 1  
ATOM 2154   N NE2 . GLN B 2 126 ? -105.807 -34.930 4.418   1.00 0.00 ? 130 GLN C NE2 1  
ATOM 2155   N N   . GLU B 2 127 ? -107.538 -29.496 8.477   1.00 0.00 ? 131 GLU C N   1  
ATOM 2156   C CA  . GLU B 2 127 ? -107.449 -28.114 8.932   1.00 0.00 ? 131 GLU C CA  1  
ATOM 2157   C C   . GLU B 2 127 ? -108.591 -27.730 9.877   1.00 0.00 ? 131 GLU C C   1  
ATOM 2158   O O   . GLU B 2 127 ? -109.509 -26.960 9.569   1.00 0.00 ? 131 GLU C O   1  
ATOM 2159   C CB  . GLU B 2 127 ? -107.502 -27.099 7.782   1.00 0.00 ? 131 GLU C CB  1  
ATOM 2160   C CG  . GLU B 2 127 ? -107.691 -27.534 6.343   1.00 0.00 ? 131 GLU C CG  1  
ATOM 2161   C CD  . GLU B 2 127 ? -107.194 -26.461 5.384   1.00 0.00 ? 131 GLU C CD  1  
ATOM 2162   O OE1 . GLU B 2 127 ? -107.760 -25.369 5.336   1.00 0.00 ? 131 GLU C OE1 1  
ATOM 2163   O OE2 . GLU B 2 127 ? -106.229 -26.713 4.676   1.00 0.00 ? 131 GLU C OE2 1  
ATOM 2164   N N   . ASP B 2 128 ? -108.579 -28.340 11.050  1.00 0.00 ? 132 ASP C N   1  
ATOM 2165   C CA  . ASP B 2 128 ? -109.571 -28.028 12.062  1.00 0.00 ? 132 ASP C CA  1  
ATOM 2166   C C   . ASP B 2 128 ? -109.616 -26.580 12.560  1.00 0.00 ? 132 ASP C C   1  
ATOM 2167   O O   . ASP B 2 128 ? -108.766 -25.737 12.256  1.00 0.00 ? 132 ASP C O   1  
ATOM 2168   C CB  . ASP B 2 128 ? -109.338 -28.988 13.223  1.00 0.00 ? 132 ASP C CB  1  
ATOM 2169   C CG  . ASP B 2 128 ? -109.668 -30.443 12.912  1.00 0.00 ? 132 ASP C CG  1  
ATOM 2170   O OD1 . ASP B 2 128 ? -109.657 -30.839 11.745  1.00 0.00 ? 132 ASP C OD1 1  
ATOM 2171   O OD2 . ASP B 2 128 ? -109.932 -31.165 13.862  1.00 0.00 ? 132 ASP C OD2 1  
ATOM 2172   N N   . SER B 2 129 ? -110.609 -26.255 13.387  1.00 0.00 ? 133 SER C N   1  
ATOM 2173   C CA  . SER B 2 129 ? -110.847 -24.913 13.960  1.00 0.00 ? 133 SER C CA  1  
ATOM 2174   C C   . SER B 2 129 ? -109.727 -23.904 14.260  1.00 0.00 ? 133 SER C C   1  
ATOM 2175   O O   . SER B 2 129 ? -109.947 -22.697 14.281  1.00 0.00 ? 133 SER C O   1  
ATOM 2176   C CB  . SER B 2 129 ? -111.620 -25.050 15.259  1.00 0.00 ? 133 SER C CB  1  
ATOM 2177   O OG  . SER B 2 129 ? -110.893 -25.827 16.204  1.00 0.00 ? 133 SER C OG  1  
ATOM 2178   N N   . ASN B 2 130 ? -108.493 -24.374 14.423  1.00 0.00 ? 134 ASN C N   1  
ATOM 2179   C CA  . ASN B 2 130 ? -107.324 -23.554 14.735  1.00 0.00 ? 134 ASN C CA  1  
ATOM 2180   C C   . ASN B 2 130 ? -106.864 -22.548 13.668  1.00 0.00 ? 134 ASN C C   1  
ATOM 2181   O O   . ASN B 2 130 ? -105.975 -21.729 13.919  1.00 0.00 ? 134 ASN C O   1  
ATOM 2182   C CB  . ASN B 2 130 ? -106.154 -24.482 15.072  1.00 0.00 ? 134 ASN C CB  1  
ATOM 2183   C CG  . ASN B 2 130 ? -106.507 -25.542 16.109  1.00 0.00 ? 134 ASN C CG  1  
ATOM 2184   O OD1 . ASN B 2 130 ? -106.864 -25.279 17.246  1.00 0.00 ? 134 ASN C OD1 1  
ATOM 2185   N ND2 . ASN B 2 130 ? -106.476 -26.824 15.819  1.00 0.00 ? 134 ASN C ND2 1  
ATOM 2186   N N   . GLY B 2 131 ? -107.351 -22.600 12.422  1.00 0.00 ? 135 GLY C N   1  
ATOM 2187   C CA  . GLY B 2 131 ? -106.950 -21.655 11.369  1.00 0.00 ? 135 GLY C CA  1  
ATOM 2188   C C   . GLY B 2 131 ? -105.646 -22.041 10.665  1.00 0.00 ? 135 GLY C C   1  
ATOM 2189   O O   . GLY B 2 131 ? -105.485 -21.965 9.442   1.00 0.00 ? 135 GLY C O   1  
ATOM 2190   N N   . CYS B 2 132 ? -104.681 -22.409 11.508  1.00 0.00 ? 136 CYS C N   1  
ATOM 2191   C CA  . CYS B 2 132 ? -103.407 -22.957 11.094  1.00 0.00 ? 136 CYS C CA  1  
ATOM 2192   C C   . CYS B 2 132 ? -103.437 -24.439 10.759  1.00 0.00 ? 136 CYS C C   1  
ATOM 2193   O O   . CYS B 2 132 ? -103.976 -25.290 11.469  1.00 0.00 ? 136 CYS C O   1  
ATOM 2194   C CB  . CYS B 2 132 ? -102.338 -22.791 12.162  1.00 0.00 ? 136 CYS C CB  1  
ATOM 2195   S SG  . CYS B 2 132 ? -101.954 -21.064 12.550  1.00 0.00 ? 136 CYS C SG  1  
ATOM 2196   N N   . ILE B 2 133 ? -102.796 -24.741 9.650   1.00 0.00 ? 137 ILE C N   1  
ATOM 2197   C CA  . ILE B 2 133 ? -102.680 -26.105 9.169   1.00 0.00 ? 137 ILE C CA  1  
ATOM 2198   C C   . ILE B 2 133 ? -101.275 -26.676 9.419   1.00 0.00 ? 137 ILE C C   1  
ATOM 2199   O O   . ILE B 2 133 ? -100.320 -25.908 9.463   1.00 0.00 ? 137 ILE C O   1  
ATOM 2200   C CB  . ILE B 2 133 ? -103.071 -26.100 7.663   1.00 0.00 ? 137 ILE C CB  1  
ATOM 2201   C CG1 . ILE B 2 133 ? -103.543 -24.805 7.017   1.00 0.00 ? 137 ILE C CG1 1  
ATOM 2202   C CG2 . ILE B 2 133 ? -104.265 -26.973 7.665   1.00 0.00 ? 137 ILE C CG2 1  
ATOM 2203   C CD1 . ILE B 2 133 ? -103.665 -24.907 5.481   1.00 0.00 ? 137 ILE C CD1 1  
ATOM 2204   N N   . ASN B 2 134 ? -101.043 -27.979 9.637   1.00 0.00 ? 138 ASN C N   1  
ATOM 2205   C CA  . ASN B 2 134 ? -99.679  -28.497 9.866   1.00 0.00 ? 138 ASN C CA  1  
ATOM 2206   C C   . ASN B 2 134 ? -98.959  -29.160 8.674   1.00 0.00 ? 138 ASN C C   1  
ATOM 2207   O O   . ASN B 2 134 ? -98.991  -30.380 8.479   1.00 0.00 ? 138 ASN C O   1  
ATOM 2208   C CB  . ASN B 2 134 ? -99.709  -29.497 11.023  1.00 0.00 ? 138 ASN C CB  1  
ATOM 2209   C CG  . ASN B 2 134 ? -100.109 -28.876 12.349  1.00 0.00 ? 138 ASN C CG  1  
ATOM 2210   O OD1 . ASN B 2 134 ? -99.465  -27.998 12.894  1.00 0.00 ? 138 ASN C OD1 1  
ATOM 2211   N ND2 . ASN B 2 134 ? -101.193 -29.283 12.961  1.00 0.00 ? 138 ASN C ND2 1  
ATOM 2212   N N   . TYR B 2 135 ? -98.254  -28.374 7.850   1.00 0.00 ? 139 TYR C N   1  
ATOM 2213   C CA  . TYR B 2 135 ? -97.553  -28.803 6.621   1.00 0.00 ? 139 TYR C CA  1  
ATOM 2214   C C   . TYR B 2 135 ? -97.051  -30.238 6.436   1.00 0.00 ? 139 TYR C C   1  
ATOM 2215   O O   . TYR B 2 135 ? -97.437  -30.989 5.527   1.00 0.00 ? 139 TYR C O   1  
ATOM 2216   C CB  . TYR B 2 135 ? -96.331  -27.939 6.375   1.00 0.00 ? 139 TYR C CB  1  
ATOM 2217   C CG  . TYR B 2 135 ? -96.555  -26.555 5.808   1.00 0.00 ? 139 TYR C CG  1  
ATOM 2218   C CD1 . TYR B 2 135 ? -95.915  -25.493 6.403   1.00 0.00 ? 139 TYR C CD1 1  
ATOM 2219   C CD2 . TYR B 2 135 ? -97.338  -26.367 4.688   1.00 0.00 ? 139 TYR C CD2 1  
ATOM 2220   C CE1 . TYR B 2 135 ? -96.049  -24.231 5.874   1.00 0.00 ? 139 TYR C CE1 1  
ATOM 2221   C CE2 . TYR B 2 135 ? -97.475  -25.099 4.152   1.00 0.00 ? 139 TYR C CE2 1  
ATOM 2222   C CZ  . TYR B 2 135 ? -96.817  -24.052 4.753   1.00 0.00 ? 139 TYR C CZ  1  
ATOM 2223   O OH  . TYR B 2 135 ? -96.866  -22.798 4.196   1.00 0.00 ? 139 TYR C OH  1  
ATOM 2224   N N   . GLU B 2 136 ? -96.219  -30.643 7.387   1.00 0.00 ? 140 GLU C N   1  
ATOM 2225   C CA  . GLU B 2 136 ? -95.558  -31.948 7.410   1.00 0.00 ? 140 GLU C CA  1  
ATOM 2226   C C   . GLU B 2 136 ? -96.508  -33.137 7.328   1.00 0.00 ? 140 GLU C C   1  
ATOM 2227   O O   . GLU B 2 136 ? -96.242  -34.172 6.704   1.00 0.00 ? 140 GLU C O   1  
ATOM 2228   C CB  . GLU B 2 136 ? -94.748  -32.103 8.673   1.00 0.00 ? 140 GLU C CB  1  
ATOM 2229   C CG  . GLU B 2 136 ? -93.853  -30.904 8.918   1.00 0.00 ? 140 GLU C CG  1  
ATOM 2230   C CD  . GLU B 2 136 ? -92.718  -31.110 9.901   1.00 0.00 ? 140 GLU C CD  1  
ATOM 2231   O OE1 . GLU B 2 136 ? -92.682  -32.102 10.626  1.00 0.00 ? 140 GLU C OE1 1  
ATOM 2232   O OE2 . GLU B 2 136 ? -91.838  -30.262 9.884   1.00 0.00 ? 140 GLU C OE2 1  
ATOM 2233   N N   . ALA B 2 137 ? -97.676  -32.994 7.944   1.00 0.00 ? 141 ALA C N   1  
ATOM 2234   C CA  . ALA B 2 137 ? -98.695  -34.031 7.890   1.00 0.00 ? 141 ALA C CA  1  
ATOM 2235   C C   . ALA B 2 137 ? -99.424  -34.046 6.550   1.00 0.00 ? 141 ALA C C   1  
ATOM 2236   O O   . ALA B 2 137 ? -99.820  -35.109 6.064   1.00 0.00 ? 141 ALA C O   1  
ATOM 2237   C CB  . ALA B 2 137 ? -99.715  -33.809 8.987   1.00 0.00 ? 141 ALA C CB  1  
ATOM 2238   N N   . PHE B 2 138 ? -99.613  -32.898 5.892   1.00 0.00 ? 142 PHE C N   1  
ATOM 2239   C CA  . PHE B 2 138 ? -100.300 -32.874 4.598   1.00 0.00 ? 142 PHE C CA  1  
ATOM 2240   C C   . PHE B 2 138 ? -99.521  -33.539 3.512   1.00 0.00 ? 142 PHE C C   1  
ATOM 2241   O O   . PHE B 2 138 ? -100.079 -34.424 2.886   1.00 0.00 ? 142 PHE C O   1  
ATOM 2242   C CB  . PHE B 2 138 ? -100.599 -31.474 4.092   1.00 0.00 ? 142 PHE C CB  1  
ATOM 2243   C CG  . PHE B 2 138 ? -101.345 -30.760 5.174   1.00 0.00 ? 142 PHE C CG  1  
ATOM 2244   C CD1 . PHE B 2 138 ? -100.917 -29.509 5.540   1.00 0.00 ? 142 PHE C CD1 1  
ATOM 2245   C CD2 . PHE B 2 138 ? -102.365 -31.412 5.845   1.00 0.00 ? 142 PHE C CD2 1  
ATOM 2246   C CE1 . PHE B 2 138 ? -101.522 -28.923 6.612   1.00 0.00 ? 142 PHE C CE1 1  
ATOM 2247   C CE2 . PHE B 2 138 ? -102.958 -30.814 6.915   1.00 0.00 ? 142 PHE C CE2 1  
ATOM 2248   C CZ  . PHE B 2 138 ? -102.526 -29.580 7.291   1.00 0.00 ? 142 PHE C CZ  1  
ATOM 2249   N N   . VAL B 2 139 ? -98.235  -33.241 3.343   1.00 0.00 ? 143 VAL C N   1  
ATOM 2250   C CA  . VAL B 2 139 ? -97.429  -33.926 2.331   1.00 0.00 ? 143 VAL C CA  1  
ATOM 2251   C C   . VAL B 2 139 ? -97.507  -35.444 2.543   1.00 0.00 ? 143 VAL C C   1  
ATOM 2252   O O   . VAL B 2 139 ? -97.755  -36.172 1.590   1.00 0.00 ? 143 VAL C O   1  
ATOM 2253   C CB  . VAL B 2 139 ? -95.963  -33.464 2.411   1.00 0.00 ? 143 VAL C CB  1  
ATOM 2254   C CG1 . VAL B 2 139 ? -95.148  -34.087 1.282   1.00 0.00 ? 143 VAL C CG1 1  
ATOM 2255   C CG2 . VAL B 2 139 ? -95.913  -31.957 2.309   1.00 0.00 ? 143 VAL C CG2 1  
ATOM 2256   N N   . LYS B 2 140 ? -97.434  -35.944 3.782   1.00 0.00 ? 144 LYS C N   1  
ATOM 2257   C CA  . LYS B 2 140 ? -97.666  -37.364 4.056   1.00 0.00 ? 144 LYS C CA  1  
ATOM 2258   C C   . LYS B 2 140 ? -99.072  -37.849 3.640   1.00 0.00 ? 144 LYS C C   1  
ATOM 2259   O O   . LYS B 2 140 ? -99.186  -38.817 2.896   1.00 0.00 ? 144 LYS C O   1  
ATOM 2260   C CB  . LYS B 2 140 ? -97.439  -37.618 5.552   1.00 0.00 ? 144 LYS C CB  1  
ATOM 2261   C CG  . LYS B 2 140 ? -95.997  -37.332 5.962   1.00 0.00 ? 144 LYS C CG  1  
ATOM 2262   C CD  . LYS B 2 140 ? -95.807  -37.324 7.475   1.00 0.00 ? 144 LYS C CD  1  
ATOM 2263   C CE  . LYS B 2 140 ? -94.430  -36.739 7.792   1.00 0.00 ? 144 LYS C CE  1  
ATOM 2264   N NZ  . LYS B 2 140 ? -94.231  -36.585 9.223   1.00 0.00 ? 144 LYS C NZ  1  
ATOM 2265   N N   . HIS B 2 141 ? -100.179 -37.203 4.028   1.00 0.00 ? 145 HIS C N   1  
ATOM 2266   C CA  . HIS B 2 141 ? -101.540 -37.600 3.598   1.00 0.00 ? 145 HIS C CA  1  
ATOM 2267   C C   . HIS B 2 141 ? -101.897 -37.418 2.116   1.00 0.00 ? 145 HIS C C   1  
ATOM 2268   O O   . HIS B 2 141 ? -102.862 -37.965 1.591   1.00 0.00 ? 145 HIS C O   1  
ATOM 2269   C CB  . HIS B 2 141 ? -102.631 -36.845 4.336   1.00 0.00 ? 145 HIS C CB  1  
ATOM 2270   C CG  . HIS B 2 141 ? -102.566 -36.881 5.851   1.00 0.00 ? 145 HIS C CG  1  
ATOM 2271   N ND1 . HIS B 2 141 ? -102.285 -35.855 6.642   1.00 0.00 ? 145 HIS C ND1 1  
ATOM 2272   C CD2 . HIS B 2 141 ? -102.824 -37.958 6.658   1.00 0.00 ? 145 HIS C CD2 1  
ATOM 2273   C CE1 . HIS B 2 141 ? -102.358 -36.246 7.881   1.00 0.00 ? 145 HIS C CE1 1  
ATOM 2274   N NE2 . HIS B 2 141 ? -102.684 -37.512 7.878   1.00 0.00 ? 145 HIS C NE2 1  
ATOM 2275   N N   . ILE B 2 142 ? -101.191 -36.492 1.477   1.00 0.00 ? 146 ILE C N   1  
ATOM 2276   C CA  . ILE B 2 142 ? -101.282 -36.223 0.049   1.00 0.00 ? 146 ILE C CA  1  
ATOM 2277   C C   . ILE B 2 142 ? -100.519 -37.368 -0.626  1.00 0.00 ? 146 ILE C C   1  
ATOM 2278   O O   . ILE B 2 142 ? -101.107 -38.182 -1.328  1.00 0.00 ? 146 ILE C O   1  
ATOM 2279   C CB  . ILE B 2 142 ? -100.681 -34.790 -0.133  1.00 0.00 ? 146 ILE C CB  1  
ATOM 2280   C CG1 . ILE B 2 142 ? -101.823 -33.817 0.135   1.00 0.00 ? 146 ILE C CG1 1  
ATOM 2281   C CG2 . ILE B 2 142 ? -100.083 -34.527 -1.501  1.00 0.00 ? 146 ILE C CG2 1  
ATOM 2282   C CD1 . ILE B 2 142 ? -101.405 -32.333 0.202   1.00 0.00 ? 146 ILE C CD1 1  
ATOM 2283   N N   . MET B 2 143 ? -99.232  -37.563 -0.351  1.00 0.00 ? 147 MET C N   1  
ATOM 2284   C CA  . MET B 2 143 ? -98.462  -38.655 -0.934  1.00 0.00 ? 147 MET C CA  1  
ATOM 2285   C C   . MET B 2 143 ? -98.904  -40.080 -0.561  1.00 0.00 ? 147 MET C C   1  
ATOM 2286   O O   . MET B 2 143 ? -98.533  -41.040 -1.231  1.00 0.00 ? 147 MET C O   1  
ATOM 2287   C CB  . MET B 2 143 ? -96.991  -38.472 -0.572  1.00 0.00 ? 147 MET C CB  1  
ATOM 2288   C CG  . MET B 2 143 ? -96.345  -37.141 -0.995  1.00 0.00 ? 147 MET C CG  1  
ATOM 2289   S SD  . MET B 2 143 ? -96.413  -36.699 -2.748  1.00 0.00 ? 147 MET C SD  1  
ATOM 2290   C CE  . MET B 2 143 ? -95.209  -37.808 -3.422  1.00 0.00 ? 147 MET C CE  1  
ATOM 2291   N N   . SER B 2 144 ? -99.735  -40.225 0.477   1.00 0.00 ? 148 SER C N   1  
ATOM 2292   C CA  . SER B 2 144 ? -100.280 -41.507 0.953   1.00 0.00 ? 148 SER C CA  1  
ATOM 2293   C C   . SER B 2 144 ? -101.303 -42.308 0.133   1.00 0.00 ? 148 SER C C   1  
ATOM 2294   O O   . SER B 2 144 ? -102.073 -43.119 0.690   1.00 0.00 ? 148 SER C O   1  
ATOM 2295   C CB  . SER B 2 144 ? -100.920 -41.340 2.340   1.00 0.00 ? 148 SER C CB  1  
ATOM 2296   O OG  . SER B 2 144 ? -102.221 -40.756 2.332   1.00 0.00 ? 148 SER C OG  1  
ATOM 2297   N N   . VAL B 2 145 ? -101.486 -42.057 -1.160  1.00 0.00 ? 149 VAL C N   1  
ATOM 2298   C CA  . VAL B 2 145 ? -102.381 -42.913 -1.918  1.00 0.00 ? 149 VAL C CA  1  
ATOM 2299   C C   . VAL B 2 145 ? -101.621 -44.090 -2.538  1.00 0.00 ? 149 VAL C C   1  
ATOM 2300   O O   . VAL B 2 145 ? -100.966 -43.925 -3.572  1.00 0.00 ? 149 VAL C O   1  
ATOM 2301   C CB  . VAL B 2 145 ? -103.105 -42.125 -3.028  1.00 0.00 ? 149 VAL C CB  1  
ATOM 2302   C CG1 . VAL B 2 145 ? -104.124 -43.061 -3.651  1.00 0.00 ? 149 VAL C CG1 1  
ATOM 2303   C CG2 . VAL B 2 145 ? -103.850 -40.909 -2.504  1.00 0.00 ? 149 VAL C CG2 1  
ATOM 2304   N N   . ASP C 3 1   ? -97.933  2.025   7.884   1.00 0.00 ? 4   ASP M N   1  
ATOM 2305   C CA  . ASP C 3 1   ? -98.946  3.055   7.701   1.00 0.00 ? 4   ASP M CA  1  
ATOM 2306   C C   . ASP C 3 1   ? -99.740  3.228   8.958   1.00 0.00 ? 4   ASP M C   1  
ATOM 2307   O O   . ASP C 3 1   ? -99.753  4.315   9.527   1.00 0.00 ? 4   ASP M O   1  
ATOM 2308   C CB  . ASP C 3 1   ? -99.844  2.752   6.507   1.00 0.00 ? 4   ASP M CB  1  
ATOM 2309   C CG  . ASP C 3 1   ? -99.085  2.899   5.215   1.00 0.00 ? 4   ASP M CG  1  
ATOM 2310   O OD1 . ASP C 3 1   ? -97.920  2.255   5.203   1.00 0.00 ? 4   ASP M OD1 1  
ATOM 2311   O OD2 . ASP C 3 1   ? -99.462  3.603   4.283   1.00 0.00 ? 4   ASP M OD2 1  
ATOM 2312   N N   . ALA C 3 2   ? -100.400 2.122   9.340   1.00 0.00 ? 5   ALA M N   1  
ATOM 2313   C CA  . ALA C 3 2   ? -101.184 2.099   10.552  1.00 0.00 ? 5   ALA M CA  1  
ATOM 2314   C C   . ALA C 3 2   ? -100.259 2.439   11.705  1.00 0.00 ? 5   ALA M C   1  
ATOM 2315   O O   . ALA C 3 2   ? -100.483 3.341   12.512  1.00 0.00 ? 5   ALA M O   1  
ATOM 2316   C CB  . ALA C 3 2   ? -101.790 0.704   10.727  1.00 0.00 ? 5   ALA M CB  1  
ATOM 2317   N N   . GLU C 3 3   ? -99.145  1.708   11.734  1.00 0.00 ? 6   GLU M N   1  
ATOM 2318   C CA  . GLU C 3 3   ? -98.113  1.882   12.739  1.00 0.00 ? 6   GLU M CA  1  
ATOM 2319   C C   . GLU C 3 3   ? -97.653  3.314   12.819  1.00 0.00 ? 6   GLU M C   1  
ATOM 2320   O O   . GLU C 3 3   ? -97.800  3.999   13.839  1.00 0.00 ? 6   GLU M O   1  
ATOM 2321   C CB  . GLU C 3 3   ? -96.902  1.010   12.408  1.00 0.00 ? 6   GLU M CB  1  
ATOM 2322   C CG  . GLU C 3 3   ? -97.087  -0.450  12.853  1.00 0.00 ? 6   GLU M CG  1  
ATOM 2323   C CD  . GLU C 3 3   ? -95.809  -1.259  12.762  1.00 0.00 ? 6   GLU M CD  1  
ATOM 2324   O OE1 . GLU C 3 3   ? -94.861  -0.636  12.087  1.00 0.00 ? 6   GLU M OE1 1  
ATOM 2325   O OE2 . GLU C 3 3   ? -95.663  -2.380  13.262  1.00 0.00 ? 6   GLU M OE2 1  
ATOM 2326   N N   . MET C 3 4   ? -97.049  3.760   11.722  1.00 0.00 ? 7   MET M N   1  
ATOM 2327   C CA  . MET C 3 4   ? -96.559  5.104   11.614  1.00 0.00 ? 7   MET M CA  1  
ATOM 2328   C C   . MET C 3 4   ? -97.649  6.117   11.861  1.00 0.00 ? 7   MET M C   1  
ATOM 2329   O O   . MET C 3 4   ? -98.648  6.179   11.170  1.00 0.00 ? 7   MET M O   1  
ATOM 2330   C CB  . MET C 3 4   ? -95.832  5.406   10.297  1.00 0.00 ? 7   MET M CB  1  
ATOM 2331   C CG  . MET C 3 4   ? -95.033  4.208   9.783   1.00 0.00 ? 7   MET M CG  1  
ATOM 2332   S SD  . MET C 3 4   ? -93.217  4.422   9.783   1.00 0.00 ? 7   MET M SD  1  
ATOM 2333   C CE  . MET C 3 4   ? -93.016  5.703   8.522   1.00 0.00 ? 7   MET M CE  1  
ATOM 2334   N N   . ALA C 3 5   ? -97.392  6.892   12.875  1.00 0.00 ? 8   ALA M N   1  
ATOM 2335   C CA  . ALA C 3 5   ? -98.252  7.934   13.304  1.00 0.00 ? 8   ALA M CA  1  
ATOM 2336   C C   . ALA C 3 5   ? -97.382  8.810   14.151  1.00 0.00 ? 8   ALA M C   1  
ATOM 2337   O O   . ALA C 3 5   ? -97.315  10.026  13.923  1.00 0.00 ? 8   ALA M O   1  
ATOM 2338   C CB  . ALA C 3 5   ? -99.356  7.330   14.145  1.00 0.00 ? 8   ALA M CB  1  
ATOM 2339   N N   . ALA C 3 6   ? -96.703  8.102   15.086  1.00 0.00 ? 9   ALA M N   1  
ATOM 2340   C CA  . ALA C 3 6   ? -95.772  8.690   16.025  1.00 0.00 ? 9   ALA M CA  1  
ATOM 2341   C C   . ALA C 3 6   ? -94.907  9.709   15.291  1.00 0.00 ? 9   ALA M C   1  
ATOM 2342   O O   . ALA C 3 6   ? -94.815  10.877  15.673  1.00 0.00 ? 9   ALA M O   1  
ATOM 2343   C CB  . ALA C 3 6   ? -94.932  7.584   16.642  1.00 0.00 ? 9   ALA M CB  1  
ATOM 2344   N N   . PHE C 3 7   ? -94.340  9.220   14.172  1.00 0.00 ? 10  PHE M N   1  
ATOM 2345   C CA  . PHE C 3 7   ? -93.506  10.041  13.326  1.00 0.00 ? 10  PHE M CA  1  
ATOM 2346   C C   . PHE C 3 7   ? -94.392  10.910  12.489  1.00 0.00 ? 10  PHE M C   1  
ATOM 2347   O O   . PHE C 3 7   ? -94.321  12.133  12.453  1.00 0.00 ? 10  PHE M O   1  
ATOM 2348   C CB  . PHE C 3 7   ? -92.758  9.131   12.343  1.00 0.00 ? 10  PHE M CB  1  
ATOM 2349   C CG  . PHE C 3 7   ? -92.288  7.849   12.976  1.00 0.00 ? 10  PHE M CG  1  
ATOM 2350   C CD1 . PHE C 3 7   ? -93.126  6.736   12.983  1.00 0.00 ? 10  PHE M CD1 1  
ATOM 2351   C CD2 . PHE C 3 7   ? -91.019  7.731   13.544  1.00 0.00 ? 10  PHE M CD2 1  
ATOM 2352   C CE1 . PHE C 3 7   ? -92.708  5.535   13.553  1.00 0.00 ? 10  PHE M CE1 1  
ATOM 2353   C CE2 . PHE C 3 7   ? -90.592  6.538   14.116  1.00 0.00 ? 10  PHE M CE2 1  
ATOM 2354   C CZ  . PHE C 3 7   ? -91.452  5.441   14.137  1.00 0.00 ? 10  PHE M CZ  1  
ATOM 2355   N N   . GLY C 3 8   ? -95.263  10.193  11.791  1.00 0.00 ? 11  GLY M N   1  
ATOM 2356   C CA  . GLY C 3 8   ? -96.193  10.803  10.913  1.00 0.00 ? 11  GLY M CA  1  
ATOM 2357   C C   . GLY C 3 8   ? -95.446  11.682  9.929   1.00 0.00 ? 11  GLY M C   1  
ATOM 2358   O O   . GLY C 3 8   ? -95.056  11.232  8.851   1.00 0.00 ? 11  GLY M O   1  
ATOM 2359   N N   . GLU C 3 9   ? -95.190  12.918  10.350  1.00 0.00 ? 12  GLU M N   1  
ATOM 2360   C CA  . GLU C 3 9   ? -94.514  13.866  9.497   1.00 0.00 ? 12  GLU M CA  1  
ATOM 2361   C C   . GLU C 3 9   ? -93.134  13.422  9.048   1.00 0.00 ? 12  GLU M C   1  
ATOM 2362   O O   . GLU C 3 9   ? -92.768  13.692  7.884   1.00 0.00 ? 12  GLU M O   1  
ATOM 2363   C CB  . GLU C 3 9   ? -94.593  15.302  10.046  1.00 0.00 ? 12  GLU M CB  1  
ATOM 2364   C CG  . GLU C 3 9   ? -95.393  16.271  9.134   1.00 0.00 ? 12  GLU M CG  1  
ATOM 2365   C CD  . GLU C 3 9   ? -96.796  16.593  9.612   1.00 0.00 ? 12  GLU M CD  1  
ATOM 2366   O OE1 . GLU C 3 9   ? -97.637  15.757  9.911   1.00 0.00 ? 12  GLU M OE1 1  
ATOM 2367   O OE2 . GLU C 3 9   ? -97.013  17.882  9.676   1.00 0.00 ? 12  GLU M OE2 1  
ATOM 2368   N N   . ALA C 3 10  ? -92.447  12.653  9.889   1.00 0.00 ? 13  ALA M N   1  
ATOM 2369   C CA  . ALA C 3 10  ? -91.108  12.192  9.576   1.00 0.00 ? 13  ALA M CA  1  
ATOM 2370   C C   . ALA C 3 10  ? -91.109  10.956  8.693   1.00 0.00 ? 13  ALA M C   1  
ATOM 2371   O O   . ALA C 3 10  ? -90.203  10.753  7.844   1.00 0.00 ? 13  ALA M O   1  
ATOM 2372   C CB  . ALA C 3 10  ? -90.372  12.008  10.888  1.00 0.00 ? 13  ALA M CB  1  
ATOM 2373   N N   . ALA C 3 11  ? -92.192  10.195  8.876   1.00 0.00 ? 14  ALA M N   1  
ATOM 2374   C CA  . ALA C 3 11  ? -92.458  8.933   8.214   1.00 0.00 ? 14  ALA M CA  1  
ATOM 2375   C C   . ALA C 3 11  ? -91.869  8.787   6.834   1.00 0.00 ? 14  ALA M C   1  
ATOM 2376   O O   . ALA C 3 11  ? -91.157  7.839   6.541   1.00 0.00 ? 14  ALA M O   1  
ATOM 2377   C CB  . ALA C 3 11  ? -93.921  8.747   8.212   1.00 0.00 ? 14  ALA M CB  1  
ATOM 2378   N N   . PRO C 3 12  ? -92.204  9.716   5.975   1.00 0.00 ? 15  PRO M N   1  
ATOM 2379   C CA  . PRO C 3 12  ? -91.733  9.656   4.605   1.00 0.00 ? 15  PRO M CA  1  
ATOM 2380   C C   . PRO C 3 12  ? -90.227  9.544   4.461   1.00 0.00 ? 15  PRO M C   1  
ATOM 2381   O O   . PRO C 3 12  ? -89.755  9.064   3.403   1.00 0.00 ? 15  PRO M O   1  
ATOM 2382   C CB  . PRO C 3 12  ? -92.327  10.899  3.883   1.00 0.00 ? 15  PRO M CB  1  
ATOM 2383   C CG  . PRO C 3 12  ? -93.083  11.703  4.965   1.00 0.00 ? 15  PRO M CG  1  
ATOM 2384   C CD  . PRO C 3 12  ? -92.994  10.934  6.282   1.00 0.00 ? 15  PRO M CD  1  
ATOM 2385   N N   . TYR C 3 13  ? -89.496  9.983   5.498   1.00 0.00 ? 16  TYR M N   1  
ATOM 2386   C CA  . TYR C 3 13  ? -88.031  9.990   5.496   1.00 0.00 ? 16  TYR M CA  1  
ATOM 2387   C C   . TYR C 3 13  ? -87.424  8.823   6.233   1.00 0.00 ? 16  TYR M C   1  
ATOM 2388   O O   . TYR C 3 13  ? -86.201  8.618   6.195   1.00 0.00 ? 16  TYR M O   1  
ATOM 2389   C CB  . TYR C 3 13  ? -87.492  11.309  6.067   1.00 0.00 ? 16  TYR M CB  1  
ATOM 2390   C CG  . TYR C 3 13  ? -88.089  12.523  5.373   1.00 0.00 ? 16  TYR M CG  1  
ATOM 2391   C CD1 . TYR C 3 13  ? -87.759  12.839  4.054   1.00 0.00 ? 16  TYR M CD1 1  
ATOM 2392   C CD2 . TYR C 3 13  ? -88.991  13.342  6.046   1.00 0.00 ? 16  TYR M CD2 1  
ATOM 2393   C CE1 . TYR C 3 13  ? -88.305  13.954  3.422   1.00 0.00 ? 16  TYR M CE1 1  
ATOM 2394   C CE2 . TYR C 3 13  ? -89.543  14.478  5.435   1.00 0.00 ? 16  TYR M CE2 1  
ATOM 2395   C CZ  . TYR C 3 13  ? -89.201  14.769  4.114   1.00 0.00 ? 16  TYR M CZ  1  
ATOM 2396   O OH  . TYR C 3 13  ? -89.763  15.869  3.509   1.00 0.00 ? 16  TYR M OH  1  
ATOM 2397   N N   . LEU C 3 14  ? -88.314  8.066   6.875   1.00 0.00 ? 17  LEU M N   1  
ATOM 2398   C CA  . LEU C 3 14  ? -87.999  6.872   7.644   1.00 0.00 ? 17  LEU M CA  1  
ATOM 2399   C C   . LEU C 3 14  ? -88.405  5.603   6.935   1.00 0.00 ? 17  LEU M C   1  
ATOM 2400   O O   . LEU C 3 14  ? -87.606  4.683   6.762   1.00 0.00 ? 17  LEU M O   1  
ATOM 2401   C CB  . LEU C 3 14  ? -88.833  6.905   8.941   1.00 0.00 ? 17  LEU M CB  1  
ATOM 2402   C CG  . LEU C 3 14  ? -88.063  7.510   10.098  1.00 0.00 ? 17  LEU M CG  1  
ATOM 2403   C CD1 . LEU C 3 14  ? -87.046  8.435   9.518   1.00 0.00 ? 17  LEU M CD1 1  
ATOM 2404   C CD2 . LEU C 3 14  ? -88.927  8.261   11.130  1.00 0.00 ? 17  LEU M CD2 1  
ATOM 2405   N N   . ARG C 3 15  ? -89.670  5.626   6.507   1.00 0.00 ? 18  ARG M N   1  
ATOM 2406   C CA  . ARG C 3 15  ? -90.295  4.551   5.778   1.00 0.00 ? 18  ARG M CA  1  
ATOM 2407   C C   . ARG C 3 15  ? -91.138  5.039   4.650   1.00 0.00 ? 18  ARG M C   1  
ATOM 2408   O O   . ARG C 3 15  ? -91.469  6.213   4.635   1.00 0.00 ? 18  ARG M O   1  
ATOM 2409   C CB  . ARG C 3 15  ? -91.115  3.690   6.717   1.00 0.00 ? 18  ARG M CB  1  
ATOM 2410   C CG  . ARG C 3 15  ? -90.646  2.222   6.733   1.00 0.00 ? 18  ARG M CG  1  
ATOM 2411   C CD  . ARG C 3 15  ? -91.309  1.347   7.816   1.00 0.00 ? 18  ARG M CD  1  
ATOM 2412   N NE  . ARG C 3 15  ? -90.520  0.174   8.200   1.00 0.00 ? 18  ARG M NE  1  
ATOM 2413   C CZ  . ARG C 3 15  ? -90.783  -0.590  9.250   1.00 0.00 ? 18  ARG M CZ  1  
ATOM 2414   N NH1 . ARG C 3 15  ? -91.820  -0.355  10.068  1.00 0.00 ? 18  ARG M NH1 1  
ATOM 2415   N NH2 . ARG C 3 15  ? -90.021  -1.637  9.497   1.00 0.00 ? 18  ARG M NH2 1  
ATOM 2416   N N   . LYS C 3 16  ? -91.477  4.134   3.722   1.00 0.00 ? 19  LYS M N   1  
ATOM 2417   C CA  . LYS C 3 16  ? -92.300  4.478   2.570   1.00 0.00 ? 19  LYS M CA  1  
ATOM 2418   C C   . LYS C 3 16  ? -93.718  3.932   2.658   1.00 0.00 ? 19  LYS M C   1  
ATOM 2419   O O   . LYS C 3 16  ? -94.005  2.990   3.388   1.00 0.00 ? 19  LYS M O   1  
ATOM 2420   C CB  . LYS C 3 16  ? -91.648  4.132   1.282   1.00 0.00 ? 19  LYS M CB  1  
ATOM 2421   C CG  . LYS C 3 16  ? -90.701  5.202   0.748   1.00 0.00 ? 19  LYS M CG  1  
ATOM 2422   C CD  . LYS C 3 16  ? -91.303  6.598   0.716   1.00 0.00 ? 19  LYS M CD  1  
ATOM 2423   C CE  . LYS C 3 16  ? -90.746  7.438   -0.433  1.00 0.00 ? 19  LYS M CE  1  
ATOM 2424   N NZ  . LYS C 3 16  ? -90.945  8.887   -0.274  1.00 0.00 ? 19  LYS M NZ  1  
ATOM 2425   N N   . SER C 3 17  ? -94.651  4.567   1.936   1.00 0.00 ? 20  SER M N   1  
ATOM 2426   C CA  . SER C 3 17  ? -96.030  4.114   2.003   1.00 0.00 ? 20  SER M CA  1  
ATOM 2427   C C   . SER C 3 17  ? -96.126  2.665   1.617   1.00 0.00 ? 20  SER M C   1  
ATOM 2428   O O   . SER C 3 17  ? -95.448  2.183   0.697   1.00 0.00 ? 20  SER M O   1  
ATOM 2429   C CB  . SER C 3 17  ? -96.955  4.958   1.158   1.00 0.00 ? 20  SER M CB  1  
ATOM 2430   O OG  . SER C 3 17  ? -97.360  4.204   0.032   1.00 0.00 ? 20  SER M OG  1  
ATOM 2431   N N   . GLU C 3 18  ? -96.992  1.974   2.310   1.00 0.00 ? 21  GLU M N   1  
ATOM 2432   C CA  . GLU C 3 18  ? -97.227  0.545   2.098   1.00 0.00 ? 21  GLU M CA  1  
ATOM 2433   C C   . GLU C 3 18  ? -97.558  0.109   0.702   1.00 0.00 ? 21  GLU M C   1  
ATOM 2434   O O   . GLU C 3 18  ? -97.841  -1.036  0.514   1.00 0.00 ? 21  GLU M O   1  
ATOM 2435   C CB  . GLU C 3 18  ? -98.284  0.000   3.058   1.00 0.00 ? 21  GLU M CB  1  
ATOM 2436   C CG  . GLU C 3 18  ? -98.122  -1.495  3.320   1.00 0.00 ? 21  GLU M CG  1  
ATOM 2437   C CD  . GLU C 3 18  ? -98.993  -1.914  4.486   1.00 0.00 ? 21  GLU M CD  1  
ATOM 2438   O OE1 . GLU C 3 18  ? -99.534  -1.138  5.262   1.00 0.00 ? 21  GLU M OE1 1  
ATOM 2439   O OE2 . GLU C 3 18  ? -99.160  -3.212  4.571   1.00 0.00 ? 21  GLU M OE2 1  
ATOM 2440   N N   . LYS C 3 19  ? -97.529  0.981   -0.276  1.00 0.00 ? 22  LYS M N   1  
ATOM 2441   C CA  . LYS C 3 19  ? -97.808  0.485   -1.589  1.00 0.00 ? 22  LYS M CA  1  
ATOM 2442   C C   . LYS C 3 19  ? -96.627  0.854   -2.443  1.00 0.00 ? 22  LYS M C   1  
ATOM 2443   O O   . LYS C 3 19  ? -96.280  0.169   -3.404  1.00 0.00 ? 22  LYS M O   1  
ATOM 2444   C CB  . LYS C 3 19  ? -99.204  0.747   -2.125  1.00 0.00 ? 22  LYS M CB  1  
ATOM 2445   C CG  . LYS C 3 19  ? -99.721  2.168   -1.932  1.00 0.00 ? 22  LYS M CG  1  
ATOM 2446   C CD  . LYS C 3 19  ? -100.181 2.793   -3.251  1.00 0.00 ? 22  LYS M CD  1  
ATOM 2447   C CE  . LYS C 3 19  ? -99.927  4.305   -3.301  1.00 0.00 ? 22  LYS M CE  1  
ATOM 2448   N NZ  . LYS C 3 19  ? -99.789  4.818   -4.664  1.00 0.00 ? 22  LYS M NZ  1  
ATOM 2449   N N   . GLU C 3 20  ? -95.966  1.935   -1.948  1.00 0.00 ? 23  GLU M N   1  
ATOM 2450   C CA  . GLU C 3 20  ? -94.769  2.409   -2.596  1.00 0.00 ? 23  GLU M CA  1  
ATOM 2451   C C   . GLU C 3 20  ? -93.801  1.257   -2.511  1.00 0.00 ? 23  GLU M C   1  
ATOM 2452   O O   . GLU C 3 20  ? -92.983  0.935   -3.421  1.00 0.00 ? 23  GLU M O   1  
ATOM 2453   C CB  . GLU C 3 20  ? -94.232  3.639   -1.862  1.00 0.00 ? 23  GLU M CB  1  
ATOM 2454   C CG  . GLU C 3 20  ? -94.485  4.905   -2.696  1.00 0.00 ? 23  GLU M CG  1  
ATOM 2455   C CD  . GLU C 3 20  ? -94.587  6.118   -1.805  1.00 0.00 ? 23  GLU M CD  1  
ATOM 2456   O OE1 . GLU C 3 20  ? -94.931  5.826   -0.555  1.00 0.00 ? 23  GLU M OE1 1  
ATOM 2457   O OE2 . GLU C 3 20  ? -94.306  7.241   -2.198  1.00 0.00 ? 23  GLU M OE2 1  
ATOM 2458   N N   . ARG C 3 21  ? -93.977  0.585   -1.383  1.00 0.00 ? 24  ARG M N   1  
ATOM 2459   C CA  . ARG C 3 21  ? -93.198  -0.582  -1.080  1.00 0.00 ? 24  ARG M CA  1  
ATOM 2460   C C   . ARG C 3 21  ? -93.647  -1.639  -2.061  1.00 0.00 ? 24  ARG M C   1  
ATOM 2461   O O   . ARG C 3 21  ? -92.912  -2.084  -2.971  1.00 0.00 ? 24  ARG M O   1  
ATOM 2462   C CB  . ARG C 3 21  ? -93.557  -1.042  0.329   1.00 0.00 ? 24  ARG M CB  1  
ATOM 2463   C CG  . ARG C 3 21  ? -92.908  -0.256  1.452   1.00 0.00 ? 24  ARG M CG  1  
ATOM 2464   C CD  . ARG C 3 21  ? -92.961  -0.956  2.824   1.00 0.00 ? 24  ARG M CD  1  
ATOM 2465   N NE  . ARG C 3 21  ? -93.737  -0.197  3.810   1.00 0.00 ? 24  ARG M NE  1  
ATOM 2466   C CZ  . ARG C 3 21  ? -94.516  -0.754  4.739   1.00 0.00 ? 24  ARG M CZ  1  
ATOM 2467   N NH1 . ARG C 3 21  ? -94.607  -2.067  4.882   1.00 0.00 ? 24  ARG M NH1 1  
ATOM 2468   N NH2 . ARG C 3 21  ? -95.187  0.035   5.584   1.00 0.00 ? 24  ARG M NH2 1  
ATOM 2469   N N   . ILE C 3 22  ? -94.911  -2.007  -1.848  1.00 0.00 ? 25  ILE M N   1  
ATOM 2470   C CA  . ILE C 3 22  ? -95.610  -2.998  -2.627  1.00 0.00 ? 25  ILE M CA  1  
ATOM 2471   C C   . ILE C 3 22  ? -95.458  -2.858  -4.128  1.00 0.00 ? 25  ILE M C   1  
ATOM 2472   O O   . ILE C 3 22  ? -95.334  -3.822  -4.840  1.00 0.00 ? 25  ILE M O   1  
ATOM 2473   C CB  . ILE C 3 22  ? -97.061  -2.992  -2.274  1.00 0.00 ? 25  ILE M CB  1  
ATOM 2474   C CG1 . ILE C 3 22  ? -97.236  -3.405  -0.815  1.00 0.00 ? 25  ILE M CG1 1  
ATOM 2475   C CG2 . ILE C 3 22  ? -97.686  -4.009  -3.148  1.00 0.00 ? 25  ILE M CG2 1  
ATOM 2476   C CD1 . ILE C 3 22  ? -98.580  -4.081  -0.568  1.00 0.00 ? 25  ILE M CD1 1  
ATOM 2477   N N   . GLU C 3 23  ? -95.502  -1.634  -4.596  1.00 0.00 ? 26  GLU M N   1  
ATOM 2478   C CA  . GLU C 3 23  ? -95.341  -1.349  -5.986  1.00 0.00 ? 26  GLU M CA  1  
ATOM 2479   C C   . GLU C 3 23  ? -93.916  -1.554  -6.443  1.00 0.00 ? 26  GLU M C   1  
ATOM 2480   O O   . GLU C 3 23  ? -93.584  -1.552  -7.646  1.00 0.00 ? 26  GLU M O   1  
ATOM 2481   C CB  . GLU C 3 23  ? -95.691  0.108   -6.269  1.00 0.00 ? 26  GLU M CB  1  
ATOM 2482   C CG  . GLU C 3 23  ? -97.173  0.420   -6.066  1.00 0.00 ? 26  GLU M CG  1  
ATOM 2483   C CD  . GLU C 3 23  ? -97.515  1.819   -6.486  1.00 0.00 ? 26  GLU M CD  1  
ATOM 2484   O OE1 . GLU C 3 23  ? -96.876  2.173   -7.596  1.00 0.00 ? 26  GLU M OE1 1  
ATOM 2485   O OE2 . GLU C 3 23  ? -98.190  2.578   -5.814  1.00 0.00 ? 26  GLU M OE2 1  
ATOM 2486   N N   . ALA C 3 24  ? -93.029  -1.649  -5.466  1.00 0.00 ? 27  ALA M N   1  
ATOM 2487   C CA  . ALA C 3 24  ? -91.628  -1.806  -5.748  1.00 0.00 ? 27  ALA M CA  1  
ATOM 2488   C C   . ALA C 3 24  ? -91.108  -3.225  -5.643  1.00 0.00 ? 27  ALA M C   1  
ATOM 2489   O O   . ALA C 3 24  ? -90.274  -3.650  -6.439  1.00 0.00 ? 27  ALA M O   1  
ATOM 2490   C CB  . ALA C 3 24  ? -90.835  -0.885  -4.845  1.00 0.00 ? 27  ALA M CB  1  
ATOM 2491   N N   . GLN C 3 25  ? -91.594  -3.935  -4.626  1.00 0.00 ? 28  GLN M N   1  
ATOM 2492   C CA  . GLN C 3 25  ? -91.171  -5.304  -4.412  1.00 0.00 ? 28  GLN M CA  1  
ATOM 2493   C C   . GLN C 3 25  ? -91.857  -6.267  -5.379  1.00 0.00 ? 28  GLN M C   1  
ATOM 2494   O O   . GLN C 3 25  ? -91.307  -7.300  -5.740  1.00 0.00 ? 28  GLN M O   1  
ATOM 2495   C CB  . GLN C 3 25  ? -91.437  -5.727  -2.966  1.00 0.00 ? 28  GLN M CB  1  
ATOM 2496   C CG  . GLN C 3 25  ? -91.123  -4.659  -1.940  1.00 0.00 ? 28  GLN M CG  1  
ATOM 2497   C CD  . GLN C 3 25  ? -91.123  -5.235  -0.538  1.00 0.00 ? 28  GLN M CD  1  
ATOM 2498   O OE1 . GLN C 3 25  ? -91.700  -6.314  -0.314  1.00 0.00 ? 28  GLN M OE1 1  
ATOM 2499   N NE2 . GLN C 3 25  ? -90.514  -4.485  0.389   1.00 0.00 ? 28  GLN M NE2 1  
ATOM 2500   N N   . ASN C 3 26  ? -93.090  -5.920  -5.734  1.00 0.00 ? 29  ASN M N   1  
ATOM 2501   C CA  . ASN C 3 26  ? -93.907  -6.732  -6.599  1.00 0.00 ? 29  ASN M CA  1  
ATOM 2502   C C   . ASN C 3 26  ? -93.915  -6.136  -7.987  1.00 0.00 ? 29  ASN M C   1  
ATOM 2503   O O   . ASN C 3 26  ? -94.789  -5.412  -8.399  1.00 0.00 ? 29  ASN M O   1  
ATOM 2504   C CB  . ASN C 3 26  ? -95.324  -6.935  -6.034  1.00 0.00 ? 29  ASN M CB  1  
ATOM 2505   C CG  . ASN C 3 26  ? -95.318  -7.430  -4.605  1.00 0.00 ? 29  ASN M CG  1  
ATOM 2506   O OD1 . ASN C 3 26  ? -94.954  -8.596  -4.323  1.00 0.00 ? 29  ASN M OD1 1  
ATOM 2507   N ND2 . ASN C 3 26  ? -95.757  -6.574  -3.708  1.00 0.00 ? 29  ASN M ND2 1  
ATOM 2508   N N   . LYS C 3 27  ? -92.856  -6.451  -8.710  1.00 0.00 ? 30  LYS M N   1  
ATOM 2509   C CA  . LYS C 3 27  ? -92.677  -5.984  -10.044 1.00 0.00 ? 30  LYS M CA  1  
ATOM 2510   C C   . LYS C 3 27  ? -91.908  -7.014  -10.837 1.00 0.00 ? 30  LYS M C   1  
ATOM 2511   O O   . LYS C 3 27  ? -91.383  -7.972  -10.267 1.00 0.00 ? 30  LYS M O   1  
ATOM 2512   C CB  . LYS C 3 27  ? -92.129  -4.568  -10.137 1.00 0.00 ? 30  LYS M CB  1  
ATOM 2513   C CG  . LYS C 3 27  ? -90.620  -4.479  -10.024 1.00 0.00 ? 30  LYS M CG  1  
ATOM 2514   C CD  . LYS C 3 27  ? -89.972  -3.377  -10.858 1.00 0.00 ? 30  LYS M CD  1  
ATOM 2515   C CE  . LYS C 3 27  ? -89.308  -2.252  -10.038 1.00 0.00 ? 30  LYS M CE  1  
ATOM 2516   N NZ  . LYS C 3 27  ? -88.521  -1.291  -10.854 1.00 0.00 ? 30  LYS M NZ  1  
ATOM 2517   N N   . PRO C 3 28  ? -91.916  -6.892  -12.156 1.00 0.00 ? 31  PRO M N   1  
ATOM 2518   C CA  . PRO C 3 28  ? -91.238  -7.849  -13.000 1.00 0.00 ? 31  PRO M CA  1  
ATOM 2519   C C   . PRO C 3 28  ? -89.739  -7.845  -12.806 1.00 0.00 ? 31  PRO M C   1  
ATOM 2520   O O   . PRO C 3 28  ? -89.113  -6.785  -12.756 1.00 0.00 ? 31  PRO M O   1  
ATOM 2521   C CB  . PRO C 3 28  ? -91.537  -7.466  -14.437 1.00 0.00 ? 31  PRO M CB  1  
ATOM 2522   C CG  . PRO C 3 28  ? -92.467  -6.281  -14.404 1.00 0.00 ? 31  PRO M CG  1  
ATOM 2523   C CD  . PRO C 3 28  ? -92.792  -6.008  -12.945 1.00 0.00 ? 31  PRO M CD  1  
ATOM 2524   N N   . PHE C 3 29  ? -89.160  -9.050  -12.768 1.00 0.00 ? 32  PHE M N   1  
ATOM 2525   C CA  . PHE C 3 29  ? -87.726  -9.222  -12.638 1.00 0.00 ? 32  PHE M CA  1  
ATOM 2526   C C   . PHE C 3 29  ? -87.141  -10.408 -13.427 1.00 0.00 ? 32  PHE M C   1  
ATOM 2527   O O   . PHE C 3 29  ? -87.584  -11.551 -13.318 1.00 0.00 ? 32  PHE M O   1  
ATOM 2528   C CB  . PHE C 3 29  ? -87.350  -9.371  -11.137 1.00 0.00 ? 32  PHE M CB  1  
ATOM 2529   C CG  . PHE C 3 29  ? -85.876  -9.023  -10.895 1.00 0.00 ? 32  PHE M CG  1  
ATOM 2530   C CD1 . PHE C 3 29  ? -85.417  -7.715  -11.033 1.00 0.00 ? 32  PHE M CD1 1  
ATOM 2531   C CD2 . PHE C 3 29  ? -84.962  -10.010 -10.568 1.00 0.00 ? 32  PHE M CD2 1  
ATOM 2532   C CE1 . PHE C 3 29  ? -84.066  -7.370  -10.878 1.00 0.00 ? 32  PHE M CE1 1  
ATOM 2533   C CE2 . PHE C 3 29  ? -83.614  -9.692  -10.401 1.00 0.00 ? 32  PHE M CE2 1  
ATOM 2534   C CZ  . PHE C 3 29  ? -83.173  -8.376  -10.533 1.00 0.00 ? 32  PHE M CZ  1  
ATOM 2535   N N   . ASP C 3 30  ? -86.068  -10.152 -14.183 1.00 0.00 ? 33  ASP M N   1  
ATOM 2536   C CA  . ASP C 3 30  ? -85.387  -11.234 -14.905 1.00 0.00 ? 33  ASP M CA  1  
ATOM 2537   C C   . ASP C 3 30  ? -83.969  -11.466 -14.392 1.00 0.00 ? 33  ASP M C   1  
ATOM 2538   O O   . ASP C 3 30  ? -82.952  -10.991 -14.896 1.00 0.00 ? 33  ASP M O   1  
ATOM 2539   C CB  . ASP C 3 30  ? -85.364  -11.059 -16.426 1.00 0.00 ? 33  ASP M CB  1  
ATOM 2540   C CG  . ASP C 3 30  ? -85.587  -12.356 -17.091 1.00 0.00 ? 33  ASP M CG  1  
ATOM 2541   O OD1 . ASP C 3 30  ? -84.777  -13.279 -16.611 1.00 0.00 ? 33  ASP M OD1 1  
ATOM 2542   O OD2 . ASP C 3 30  ? -86.466  -12.539 -17.912 1.00 0.00 ? 33  ASP M OD2 1  
ATOM 2543   N N   . ALA C 3 31  ? -83.881  -12.315 -13.399 1.00 0.00 ? 34  ALA M N   1  
ATOM 2544   C CA  . ALA C 3 31  ? -82.611  -12.617 -12.788 1.00 0.00 ? 34  ALA M CA  1  
ATOM 2545   C C   . ALA C 3 31  ? -81.437  -12.929 -13.738 1.00 0.00 ? 34  ALA M C   1  
ATOM 2546   O O   . ALA C 3 31  ? -80.412  -12.300 -13.747 1.00 0.00 ? 34  ALA M O   1  
ATOM 2547   C CB  . ALA C 3 31  ? -82.857  -13.717 -11.808 1.00 0.00 ? 34  ALA M CB  1  
ATOM 2548   N N   . LYS C 3 32  ? -81.604  -13.978 -14.509 1.00 0.00 ? 35  LYS M N   1  
ATOM 2549   C CA  . LYS C 3 32  ? -80.581  -14.430 -15.409 1.00 0.00 ? 35  LYS M CA  1  
ATOM 2550   C C   . LYS C 3 32  ? -80.024  -13.363 -16.325 1.00 0.00 ? 35  LYS M C   1  
ATOM 2551   O O   . LYS C 3 32  ? -78.953  -13.516 -16.904 1.00 0.00 ? 35  LYS M O   1  
ATOM 2552   C CB  . LYS C 3 32  ? -81.094  -15.614 -16.221 1.00 0.00 ? 35  LYS M CB  1  
ATOM 2553   C CG  . LYS C 3 32  ? -82.103  -16.434 -15.442 1.00 0.00 ? 35  LYS M CG  1  
ATOM 2554   C CD  . LYS C 3 32  ? -82.061  -17.898 -15.828 1.00 0.00 ? 35  LYS M CD  1  
ATOM 2555   C CE  . LYS C 3 32  ? -82.244  -18.842 -14.653 1.00 0.00 ? 35  LYS M CE  1  
ATOM 2556   N NZ  . LYS C 3 32  ? -83.357  -19.777 -14.847 1.00 0.00 ? 35  LYS M NZ  1  
ATOM 2557   N N   . SER C 3 33  ? -80.731  -12.258 -16.473 1.00 0.00 ? 36  SER M N   1  
ATOM 2558   C CA  . SER C 3 33  ? -80.230  -11.247 -17.391 1.00 0.00 ? 36  SER M CA  1  
ATOM 2559   C C   . SER C 3 33  ? -79.848  -9.966  -16.727 1.00 0.00 ? 36  SER M C   1  
ATOM 2560   O O   . SER C 3 33  ? -78.854  -9.400  -17.165 1.00 0.00 ? 36  SER M O   1  
ATOM 2561   C CB  . SER C 3 33  ? -81.144  -10.994 -18.592 1.00 0.00 ? 36  SER M CB  1  
ATOM 2562   O OG  . SER C 3 33  ? -82.516  -11.246 -18.271 1.00 0.00 ? 36  SER M OG  1  
ATOM 2563   N N   . SER C 3 34  ? -80.652  -9.571  -15.707 1.00 0.00 ? 37  SER M N   1  
ATOM 2564   C CA  . SER C 3 34  ? -80.372  -8.334  -14.971 1.00 0.00 ? 37  SER M CA  1  
ATOM 2565   C C   . SER C 3 34  ? -79.079  -8.417  -14.129 1.00 0.00 ? 37  SER M C   1  
ATOM 2566   O O   . SER C 3 34  ? -78.815  -9.354  -13.375 1.00 0.00 ? 37  SER M O   1  
ATOM 2567   C CB  . SER C 3 34  ? -81.580  -7.762  -14.249 1.00 0.00 ? 37  SER M CB  1  
ATOM 2568   O OG  . SER C 3 34  ? -82.677  -8.638  -14.299 1.00 0.00 ? 37  SER M OG  1  
ATOM 2569   N N   . VAL C 3 35  ? -78.240  -7.396  -14.236 1.00 0.00 ? 38  VAL M N   1  
ATOM 2570   C CA  . VAL C 3 35  ? -76.970  -7.418  -13.557 1.00 0.00 ? 38  VAL M CA  1  
ATOM 2571   C C   . VAL C 3 35  ? -76.367  -6.047  -13.292 1.00 0.00 ? 38  VAL M C   1  
ATOM 2572   O O   . VAL C 3 35  ? -76.814  -5.061  -13.890 1.00 0.00 ? 38  VAL M O   1  
ATOM 2573   C CB  . VAL C 3 35  ? -76.064  -8.121  -14.559 1.00 0.00 ? 38  VAL M CB  1  
ATOM 2574   C CG1 . VAL C 3 35  ? -74.668  -7.577  -14.587 1.00 0.00 ? 38  VAL M CG1 1  
ATOM 2575   C CG2 . VAL C 3 35  ? -76.094  -9.628  -14.310 1.00 0.00 ? 38  VAL M CG2 1  
ATOM 2576   N N   . PHE C 3 36  ? -75.340  -6.036  -12.426 1.00 0.00 ? 39  PHE M N   1  
ATOM 2577   C CA  . PHE C 3 36  ? -74.527  -4.839  -12.092 1.00 0.00 ? 39  PHE M CA  1  
ATOM 2578   C C   . PHE C 3 36  ? -73.220  -5.020  -12.802 1.00 0.00 ? 39  PHE M C   1  
ATOM 2579   O O   . PHE C 3 36  ? -72.772  -6.145  -12.999 1.00 0.00 ? 39  PHE M O   1  
ATOM 2580   C CB  . PHE C 3 36  ? -74.142  -4.720  -10.622 1.00 0.00 ? 39  PHE M CB  1  
ATOM 2581   C CG  . PHE C 3 36  ? -75.224  -4.144  -9.776  1.00 0.00 ? 39  PHE M CG  1  
ATOM 2582   C CD1 . PHE C 3 36  ? -75.702  -2.871  -10.041 1.00 0.00 ? 39  PHE M CD1 1  
ATOM 2583   C CD2 . PHE C 3 36  ? -75.828  -4.878  -8.760  1.00 0.00 ? 39  PHE M CD2 1  
ATOM 2584   C CE1 . PHE C 3 36  ? -76.750  -2.326  -9.310  1.00 0.00 ? 39  PHE M CE1 1  
ATOM 2585   C CE2 . PHE C 3 36  ? -76.887  -4.349  -8.030  1.00 0.00 ? 39  PHE M CE2 1  
ATOM 2586   C CZ  . PHE C 3 36  ? -77.339  -3.073  -8.284  1.00 0.00 ? 39  PHE M CZ  1  
ATOM 2587   N N   . VAL C 3 37  ? -72.560  -3.948  -13.198 1.00 0.00 ? 40  VAL M N   1  
ATOM 2588   C CA  . VAL C 3 37  ? -71.276  -4.148  -13.895 1.00 0.00 ? 40  VAL M CA  1  
ATOM 2589   C C   . VAL C 3 37  ? -70.277  -3.013  -13.697 1.00 0.00 ? 40  VAL M C   1  
ATOM 2590   O O   . VAL C 3 37  ? -70.643  -1.868  -13.413 1.00 0.00 ? 40  VAL M O   1  
ATOM 2591   C CB  . VAL C 3 37  ? -71.431  -4.349  -15.378 1.00 0.00 ? 40  VAL M CB  1  
ATOM 2592   C CG1 . VAL C 3 37  ? -71.460  -2.983  -16.042 1.00 0.00 ? 40  VAL M CG1 1  
ATOM 2593   C CG2 . VAL C 3 37  ? -70.218  -5.111  -15.876 1.00 0.00 ? 40  VAL M CG2 1  
ATOM 2594   N N   . VAL C 3 38  ? -69.019  -3.380  -13.950 1.00 0.00 ? 41  VAL M N   1  
ATOM 2595   C CA  . VAL C 3 38  ? -67.893  -2.491  -13.832 1.00 0.00 ? 41  VAL M CA  1  
ATOM 2596   C C   . VAL C 3 38  ? -68.057  -1.383  -14.805 1.00 0.00 ? 41  VAL M C   1  
ATOM 2597   O O   . VAL C 3 38  ? -68.747  -1.590  -15.786 1.00 0.00 ? 41  VAL M O   1  
ATOM 2598   C CB  . VAL C 3 38  ? -66.650  -3.226  -14.182 1.00 0.00 ? 41  VAL M CB  1  
ATOM 2599   C CG1 . VAL C 3 38  ? -65.810  -2.441  -15.187 1.00 0.00 ? 41  VAL M CG1 1  
ATOM 2600   C CG2 . VAL C 3 38  ? -65.905  -3.383  -12.874 1.00 0.00 ? 41  VAL M CG2 1  
ATOM 2601   N N   . HIS C 3 39  ? -67.372  -0.262  -14.560 1.00 0.00 ? 42  HIS M N   1  
ATOM 2602   C CA  . HIS C 3 39  ? -67.502  0.814   -15.509 1.00 0.00 ? 42  HIS M CA  1  
ATOM 2603   C C   . HIS C 3 39  ? -66.411  1.838   -15.355 1.00 0.00 ? 42  HIS M C   1  
ATOM 2604   O O   . HIS C 3 39  ? -66.275  2.488   -14.326 1.00 0.00 ? 42  HIS M O   1  
ATOM 2605   C CB  . HIS C 3 39  ? -68.925  1.352   -15.519 1.00 0.00 ? 42  HIS M CB  1  
ATOM 2606   C CG  . HIS C 3 39  ? -69.177  2.459   -16.475 1.00 0.00 ? 42  HIS M CG  1  
ATOM 2607   N ND1 . HIS C 3 39  ? -68.224  3.420   -16.735 1.00 0.00 ? 42  HIS M ND1 1  
ATOM 2608   C CD2 . HIS C 3 39  ? -70.309  2.785   -17.148 1.00 0.00 ? 42  HIS M CD2 1  
ATOM 2609   C CE1 . HIS C 3 39  ? -68.795  4.285   -17.587 1.00 0.00 ? 42  HIS M CE1 1  
ATOM 2610   N NE2 . HIS C 3 39  ? -70.050  3.934   -17.856 1.00 0.00 ? 42  HIS M NE2 1  
ATOM 2611   N N   . PRO C 3 40  ? -65.619  1.954   -16.399 1.00 0.00 ? 43  PRO M N   1  
ATOM 2612   C CA  . PRO C 3 40  ? -64.507  2.841   -16.451 1.00 0.00 ? 43  PRO M CA  1  
ATOM 2613   C C   . PRO C 3 40  ? -64.740  4.259   -15.925 1.00 0.00 ? 43  PRO M C   1  
ATOM 2614   O O   . PRO C 3 40  ? -63.976  4.763   -15.096 1.00 0.00 ? 43  PRO M O   1  
ATOM 2615   C CB  . PRO C 3 40  ? -63.941  2.774   -17.873 1.00 0.00 ? 43  PRO M CB  1  
ATOM 2616   C CG  . PRO C 3 40  ? -64.642  1.614   -18.558 1.00 0.00 ? 43  PRO M CG  1  
ATOM 2617   C CD  . PRO C 3 40  ? -65.753  1.151   -17.636 1.00 0.00 ? 43  PRO M CD  1  
ATOM 2618   N N   . LYS C 3 41  ? -65.822  4.912   -16.354 1.00 0.00 ? 44  LYS M N   1  
ATOM 2619   C CA  . LYS C 3 41  ? -66.092  6.259   -15.877 1.00 0.00 ? 44  LYS M CA  1  
ATOM 2620   C C   . LYS C 3 41  ? -66.876  6.231   -14.567 1.00 0.00 ? 44  LYS M C   1  
ATOM 2621   O O   . LYS C 3 41  ? -66.389  6.591   -13.492 1.00 0.00 ? 44  LYS M O   1  
ATOM 2622   C CB  . LYS C 3 41  ? -66.665  7.204   -16.938 1.00 0.00 ? 44  LYS M CB  1  
ATOM 2623   C CG  . LYS C 3 41  ? -65.642  8.217   -17.452 1.00 0.00 ? 44  LYS M CG  1  
ATOM 2624   C CD  . LYS C 3 41  ? -65.221  8.025   -18.921 1.00 0.00 ? 44  LYS M CD  1  
ATOM 2625   C CE  . LYS C 3 41  ? -64.135  9.005   -19.360 1.00 0.00 ? 44  LYS M CE  1  
ATOM 2626   N NZ  . LYS C 3 41  ? -63.691  8.822   -20.755 1.00 0.00 ? 44  LYS M NZ  1  
ATOM 2627   N N   . GLU C 3 42  ? -68.104  5.720   -14.624 1.00 0.00 ? 45  GLU M N   1  
ATOM 2628   C CA  . GLU C 3 42  ? -68.871  5.572   -13.409 1.00 0.00 ? 45  GLU M CA  1  
ATOM 2629   C C   . GLU C 3 42  ? -68.491  4.232   -12.832 1.00 0.00 ? 45  GLU M C   1  
ATOM 2630   O O   . GLU C 3 42  ? -68.335  3.263   -13.558 1.00 0.00 ? 45  GLU M O   1  
ATOM 2631   C CB  . GLU C 3 42  ? -70.367  5.700   -13.642 1.00 0.00 ? 45  GLU M CB  1  
ATOM 2632   C CG  . GLU C 3 42  ? -70.817  7.149   -13.432 1.00 0.00 ? 45  GLU M CG  1  
ATOM 2633   C CD  . GLU C 3 42  ? -72.000  7.501   -14.292 1.00 0.00 ? 45  GLU M CD  1  
ATOM 2634   O OE1 . GLU C 3 42  ? -73.135  7.493   -13.802 1.00 0.00 ? 45  GLU M OE1 1  
ATOM 2635   O OE2 . GLU C 3 42  ? -71.689  7.734   -15.577 1.00 0.00 ? 45  GLU M OE2 1  
ATOM 2636   N N   . SER C 3 43  ? -68.316  4.186   -11.523 1.00 0.00 ? 46  SER M N   1  
ATOM 2637   C CA  . SER C 3 43  ? -67.854  2.989   -10.826 1.00 0.00 ? 46  SER M CA  1  
ATOM 2638   C C   . SER C 3 43  ? -68.456  1.647   -11.225 1.00 0.00 ? 46  SER M C   1  
ATOM 2639   O O   . SER C 3 43  ? -67.762  0.684   -11.586 1.00 0.00 ? 46  SER M O   1  
ATOM 2640   C CB  . SER C 3 43  ? -67.878  3.158   -9.329  1.00 0.00 ? 46  SER M CB  1  
ATOM 2641   O OG  . SER C 3 43  ? -66.542  3.466   -8.925  1.00 0.00 ? 46  SER M OG  1  
ATOM 2642   N N   . PHE C 3 44  ? -69.750  1.577   -11.044 1.00 0.00 ? 47  PHE M N   1  
ATOM 2643   C CA  . PHE C 3 44  ? -70.553  0.390   -11.326 1.00 0.00 ? 47  PHE M CA  1  
ATOM 2644   C C   . PHE C 3 44  ? -71.900  0.884   -11.769 1.00 0.00 ? 47  PHE M C   1  
ATOM 2645   O O   . PHE C 3 44  ? -72.620  1.540   -11.034 1.00 0.00 ? 47  PHE M O   1  
ATOM 2646   C CB  . PHE C 3 44  ? -70.927  -0.383  -10.064 1.00 0.00 ? 47  PHE M CB  1  
ATOM 2647   C CG  . PHE C 3 44  ? -69.846  -1.227  -9.479  1.00 0.00 ? 47  PHE M CG  1  
ATOM 2648   C CD1 . PHE C 3 44  ? -69.452  -2.398  -10.111 1.00 0.00 ? 47  PHE M CD1 1  
ATOM 2649   C CD2 . PHE C 3 44  ? -69.227  -0.879  -8.285  1.00 0.00 ? 47  PHE M CD2 1  
ATOM 2650   C CE1 . PHE C 3 44  ? -68.442  -3.191  -9.572  1.00 0.00 ? 47  PHE M CE1 1  
ATOM 2651   C CE2 . PHE C 3 44  ? -68.217  -1.653  -7.738  1.00 0.00 ? 47  PHE M CE2 1  
ATOM 2652   C CZ  . PHE C 3 44  ? -67.828  -2.817  -8.381  1.00 0.00 ? 47  PHE M CZ  1  
ATOM 2653   N N   . VAL C 3 45  ? -72.321  0.529   -12.939 1.00 0.00 ? 48  VAL M N   1  
ATOM 2654   C CA  . VAL C 3 45  ? -73.635  0.954   -13.315 1.00 0.00 ? 48  VAL M CA  1  
ATOM 2655   C C   . VAL C 3 45  ? -74.394  -0.307  -13.606 1.00 0.00 ? 48  VAL M C   1  
ATOM 2656   O O   . VAL C 3 45  ? -73.759  -1.370  -13.614 1.00 0.00 ? 48  VAL M O   1  
ATOM 2657   C CB  . VAL C 3 45  ? -73.610  1.936   -14.444 1.00 0.00 ? 48  VAL M CB  1  
ATOM 2658   C CG1 . VAL C 3 45  ? -72.984  1.261   -15.626 1.00 0.00 ? 48  VAL M CG1 1  
ATOM 2659   C CG2 . VAL C 3 45  ? -75.056  2.360   -14.714 1.00 0.00 ? 48  VAL M CG2 1  
ATOM 2660   N N   . LYS C 3 46  ? -75.738  -0.219  -13.726 1.00 0.00 ? 49  LYS M N   1  
ATOM 2661   C CA  . LYS C 3 46  ? -76.526  -1.411  -14.000 1.00 0.00 ? 49  LYS M CA  1  
ATOM 2662   C C   . LYS C 3 46  ? -76.800  -1.645  -15.474 1.00 0.00 ? 49  LYS M C   1  
ATOM 2663   O O   . LYS C 3 46  ? -76.793  -0.730  -16.306 1.00 0.00 ? 49  LYS M O   1  
ATOM 2664   C CB  . LYS C 3 46  ? -77.835  -1.506  -13.293 1.00 0.00 ? 49  LYS M CB  1  
ATOM 2665   C CG  . LYS C 3 46  ? -78.038  -0.502  -12.219 1.00 0.00 ? 49  LYS M CG  1  
ATOM 2666   C CD  . LYS C 3 46  ? -79.503  -0.340  -11.901 1.00 0.00 ? 49  LYS M CD  1  
ATOM 2667   C CE  . LYS C 3 46  ? -79.863  -0.628  -10.463 1.00 0.00 ? 49  LYS M CE  1  
ATOM 2668   N NZ  . LYS C 3 46  ? -81.314  -0.463  -10.254 1.00 0.00 ? 49  LYS M NZ  1  
ATOM 2669   N N   . GLY C 3 47  ? -77.101  -2.903  -15.783 1.00 0.00 ? 50  GLY M N   1  
ATOM 2670   C CA  . GLY C 3 47  ? -77.386  -3.254  -17.139 1.00 0.00 ? 50  GLY M CA  1  
ATOM 2671   C C   . GLY C 3 47  ? -78.008  -4.608  -17.260 1.00 0.00 ? 50  GLY M C   1  
ATOM 2672   O O   . GLY C 3 47  ? -78.179  -5.310  -16.256 1.00 0.00 ? 50  GLY M O   1  
ATOM 2673   N N   . THR C 3 48  ? -78.291  -4.930  -18.526 1.00 0.00 ? 51  THR M N   1  
ATOM 2674   C CA  . THR C 3 48  ? -78.879  -6.175  -18.908 1.00 0.00 ? 51  THR M CA  1  
ATOM 2675   C C   . THR C 3 48  ? -77.854  -6.955  -19.728 1.00 0.00 ? 51  THR M C   1  
ATOM 2676   O O   . THR C 3 48  ? -77.134  -6.424  -20.585 1.00 0.00 ? 51  THR M O   1  
ATOM 2677   C CB  . THR C 3 48  ? -80.145  -5.929  -19.702 1.00 0.00 ? 51  THR M CB  1  
ATOM 2678   O OG1 . THR C 3 48  ? -81.001  -5.083  -18.955 1.00 0.00 ? 51  THR M OG1 1  
ATOM 2679   C CG2 . THR C 3 48  ? -80.748  -7.286  -20.006 1.00 0.00 ? 51  THR M CG2 1  
ATOM 2680   N N   . ILE C 3 49  ? -77.718  -8.229  -19.398 1.00 0.00 ? 52  ILE M N   1  
ATOM 2681   C CA  . ILE C 3 49  ? -76.816  -9.056  -20.151 1.00 0.00 ? 52  ILE M CA  1  
ATOM 2682   C C   . ILE C 3 49  ? -77.393  -9.346  -21.537 1.00 0.00 ? 52  ILE M C   1  
ATOM 2683   O O   . ILE C 3 49  ? -78.520  -9.796  -21.681 1.00 0.00 ? 52  ILE M O   1  
ATOM 2684   C CB  . ILE C 3 49  ? -76.601  -10.392 -19.502 1.00 0.00 ? 52  ILE M CB  1  
ATOM 2685   C CG1 . ILE C 3 49  ? -76.353  -10.218 -18.023 1.00 0.00 ? 52  ILE M CG1 1  
ATOM 2686   C CG2 . ILE C 3 49  ? -75.440  -11.063 -20.212 1.00 0.00 ? 52  ILE M CG2 1  
ATOM 2687   C CD1 . ILE C 3 49  ? -75.628  -8.914  -17.708 1.00 0.00 ? 52  ILE M CD1 1  
ATOM 2688   N N   . GLN C 3 50  ? -76.564  -9.103  -22.545 1.00 0.00 ? 53  GLN M N   1  
ATOM 2689   C CA  . GLN C 3 50  ? -76.955  -9.329  -23.908 1.00 0.00 ? 53  GLN M CA  1  
ATOM 2690   C C   . GLN C 3 50  ? -76.457  -10.682 -24.362 1.00 0.00 ? 53  GLN M C   1  
ATOM 2691   O O   . GLN C 3 50  ? -77.207  -11.603 -24.643 1.00 0.00 ? 53  GLN M O   1  
ATOM 2692   C CB  . GLN C 3 50  ? -76.397  -8.247  -24.860 1.00 0.00 ? 53  GLN M CB  1  
ATOM 2693   C CG  . GLN C 3 50  ? -76.798  -6.819  -24.485 1.00 0.00 ? 53  GLN M CG  1  
ATOM 2694   C CD  . GLN C 3 50  ? -78.107  -6.333  -25.098 1.00 0.00 ? 53  GLN M CD  1  
ATOM 2695   O OE1 . GLN C 3 50  ? -78.152  -5.902  -26.270 1.00 0.00 ? 53  GLN M OE1 1  
ATOM 2696   N NE2 . GLN C 3 50  ? -79.185  -6.384  -24.308 1.00 0.00 ? 53  GLN M NE2 1  
ATOM 2697   N N   . SER C 3 51  ? -75.155  -10.808 -24.428 1.00 0.00 ? 54  SER M N   1  
ATOM 2698   C CA  . SER C 3 51  ? -74.609  -12.059 -24.892 1.00 0.00 ? 54  SER M CA  1  
ATOM 2699   C C   . SER C 3 51  ? -73.660  -12.656 -23.893 1.00 0.00 ? 54  SER M C   1  
ATOM 2700   O O   . SER C 3 51  ? -73.606  -12.220 -22.759 1.00 0.00 ? 54  SER M O   1  
ATOM 2701   C CB  . SER C 3 51  ? -73.927  -11.862 -26.226 1.00 0.00 ? 54  SER M CB  1  
ATOM 2702   O OG  . SER C 3 51  ? -73.226  -10.630 -26.207 1.00 0.00 ? 54  SER M OG  1  
ATOM 2703   N N   . LYS C 3 52  ? -72.907  -13.651 -24.337 1.00 0.00 ? 55  LYS M N   1  
ATOM 2704   C CA  . LYS C 3 52  ? -71.931  -14.300 -23.488 1.00 0.00 ? 55  LYS M CA  1  
ATOM 2705   C C   . LYS C 3 52  ? -70.753  -14.814 -24.315 1.00 0.00 ? 55  LYS M C   1  
ATOM 2706   O O   . LYS C 3 52  ? -70.896  -15.753 -25.080 1.00 0.00 ? 55  LYS M O   1  
ATOM 2707   C CB  . LYS C 3 52  ? -72.539  -15.330 -22.534 1.00 0.00 ? 55  LYS M CB  1  
ATOM 2708   C CG  . LYS C 3 52  ? -72.073  -15.169 -21.074 1.00 0.00 ? 55  LYS M CG  1  
ATOM 2709   C CD  . LYS C 3 52  ? -73.014  -15.685 -19.989 1.00 0.00 ? 55  LYS M CD  1  
ATOM 2710   C CE  . LYS C 3 52  ? -72.335  -16.409 -18.817 1.00 0.00 ? 55  LYS M CE  1  
ATOM 2711   N NZ  . LYS C 3 52  ? -71.935  -15.569 -17.655 1.00 0.00 ? 55  LYS M NZ  1  
ATOM 2712   N N   . GLU C 3 53  ? -69.594  -14.157 -24.156 1.00 0.00 ? 56  GLU M N   1  
ATOM 2713   C CA  . GLU C 3 53  ? -68.375  -14.497 -24.883 1.00 0.00 ? 56  GLU M CA  1  
ATOM 2714   C C   . GLU C 3 53  ? -67.535  -15.660 -24.314 1.00 0.00 ? 56  GLU M C   1  
ATOM 2715   O O   . GLU C 3 53  ? -66.303  -15.797 -24.580 1.00 0.00 ? 56  GLU M O   1  
ATOM 2716   C CB  . GLU C 3 53  ? -67.516  -13.235 -25.211 1.00 0.00 ? 56  GLU M CB  1  
ATOM 2717   C CG  . GLU C 3 53  ? -68.081  -12.372 -26.369 1.00 0.00 ? 56  GLU M CG  1  
ATOM 2718   C CD  . GLU C 3 53  ? -67.207  -12.391 -27.604 1.00 0.00 ? 56  GLU M CD  1  
ATOM 2719   O OE1 . GLU C 3 53  ? -66.971  -13.587 -28.067 1.00 0.00 ? 56  GLU M OE1 1  
ATOM 2720   O OE2 . GLU C 3 53  ? -66.775  -11.375 -28.131 1.00 0.00 ? 56  GLU M OE2 1  
ATOM 2721   N N   . GLY C 3 54  ? -68.199  -16.532 -23.553 1.00 0.00 ? 57  GLY M N   1  
ATOM 2722   C CA  . GLY C 3 54  ? -67.593  -17.713 -22.949 1.00 0.00 ? 57  GLY M CA  1  
ATOM 2723   C C   . GLY C 3 54  ? -66.798  -17.442 -21.676 1.00 0.00 ? 57  GLY M C   1  
ATOM 2724   O O   . GLY C 3 54  ? -66.431  -18.393 -20.946 1.00 0.00 ? 57  GLY M O   1  
ATOM 2725   N N   . GLY C 3 55  ? -66.535  -16.148 -21.418 1.00 0.00 ? 58  GLY M N   1  
ATOM 2726   C CA  . GLY C 3 55  ? -65.771  -15.694 -20.267 1.00 0.00 ? 58  GLY M CA  1  
ATOM 2727   C C   . GLY C 3 55  ? -65.534  -14.212 -20.382 1.00 0.00 ? 58  GLY M C   1  
ATOM 2728   O O   . GLY C 3 55  ? -64.592  -13.635 -19.833 1.00 0.00 ? 58  GLY M O   1  
ATOM 2729   N N   . LYS C 3 56  ? -66.441  -13.631 -21.147 1.00 0.00 ? 59  LYS M N   1  
ATOM 2730   C CA  . LYS C 3 56  ? -66.532  -12.225 -21.435 1.00 0.00 ? 59  LYS M CA  1  
ATOM 2731   C C   . LYS C 3 56  ? -67.997  -11.946 -21.428 1.00 0.00 ? 59  LYS M C   1  
ATOM 2732   O O   . LYS C 3 56  ? -68.818  -12.834 -21.637 1.00 0.00 ? 59  LYS M O   1  
ATOM 2733   C CB  . LYS C 3 56  ? -66.014  -11.868 -22.810 1.00 0.00 ? 59  LYS M CB  1  
ATOM 2734   C CG  . LYS C 3 56  ? -64.515  -11.988 -22.988 1.00 0.00 ? 59  LYS M CG  1  
ATOM 2735   C CD  . LYS C 3 56  ? -64.176  -12.270 -24.448 1.00 0.00 ? 59  LYS M CD  1  
ATOM 2736   C CE  . LYS C 3 56  ? -62.957  -11.498 -24.927 1.00 0.00 ? 59  LYS M CE  1  
ATOM 2737   N NZ  . LYS C 3 56  ? -62.574  -11.867 -26.315 1.00 0.00 ? 59  LYS M NZ  1  
ATOM 2738   N N   . VAL C 3 57  ? -68.340  -10.700 -21.208 1.00 0.00 ? 60  VAL M N   1  
ATOM 2739   C CA  . VAL C 3 57  ? -69.728  -10.414 -21.182 1.00 0.00 ? 60  VAL M CA  1  
ATOM 2740   C C   . VAL C 3 57  ? -70.034  -9.111  -21.826 1.00 0.00 ? 60  VAL M C   1  
ATOM 2741   O O   . VAL C 3 57  ? -69.303  -8.156  -21.616 1.00 0.00 ? 60  VAL M O   1  
ATOM 2742   C CB  . VAL C 3 57  ? -70.202  -10.401 -19.737 1.00 0.00 ? 60  VAL M CB  1  
ATOM 2743   C CG1 . VAL C 3 57  ? -71.643  -9.959  -19.733 1.00 0.00 ? 60  VAL M CG1 1  
ATOM 2744   C CG2 . VAL C 3 57  ? -70.032  -11.800 -19.089 1.00 0.00 ? 60  VAL M CG2 1  
ATOM 2745   N N   . THR C 3 58  ? -71.096  -9.099  -22.617 1.00 0.00 ? 61  THR M N   1  
ATOM 2746   C CA  . THR C 3 58  ? -71.525  -7.874  -23.252 1.00 0.00 ? 61  THR M CA  1  
ATOM 2747   C C   . THR C 3 58  ? -72.787  -7.442  -22.592 1.00 0.00 ? 61  THR M C   1  
ATOM 2748   O O   . THR C 3 58  ? -73.716  -8.218  -22.502 1.00 0.00 ? 61  THR M O   1  
ATOM 2749   C CB  . THR C 3 58  ? -71.801  -8.047  -24.726 1.00 0.00 ? 61  THR M CB  1  
ATOM 2750   O OG1 . THR C 3 58  ? -71.558  -9.393  -25.044 1.00 0.00 ? 61  THR M OG1 1  
ATOM 2751   C CG2 . THR C 3 58  ? -70.918  -7.080  -25.501 1.00 0.00 ? 61  THR M CG2 1  
ATOM 2752   N N   . VAL C 3 59  ? -72.814  -6.178  -22.157 1.00 0.00 ? 62  VAL M N   1  
ATOM 2753   C CA  . VAL C 3 59  ? -74.011  -5.715  -21.508 1.00 0.00 ? 62  VAL M CA  1  
ATOM 2754   C C   . VAL C 3 59  ? -74.510  -4.370  -21.958 1.00 0.00 ? 62  VAL M C   1  
ATOM 2755   O O   . VAL C 3 59  ? -73.741  -3.466  -22.292 1.00 0.00 ? 62  VAL M O   1  
ATOM 2756   C CB  . VAL C 3 59  ? -73.805  -5.624  -20.023 1.00 0.00 ? 62  VAL M CB  1  
ATOM 2757   C CG1 . VAL C 3 59  ? -75.092  -5.373  -19.294 1.00 0.00 ? 62  VAL M CG1 1  
ATOM 2758   C CG2 . VAL C 3 59  ? -73.160  -6.893  -19.544 1.00 0.00 ? 62  VAL M CG2 1  
ATOM 2759   N N   . LYS C 3 60  ? -75.816  -4.243  -21.900 1.00 0.00 ? 63  LYS M N   1  
ATOM 2760   C CA  . LYS C 3 60  ? -76.439  -2.991  -22.219 1.00 0.00 ? 63  LYS M CA  1  
ATOM 2761   C C   . LYS C 3 60  ? -76.375  -2.198  -20.967 1.00 0.00 ? 63  LYS M C   1  
ATOM 2762   O O   . LYS C 3 60  ? -76.001  -2.703  -19.940 1.00 0.00 ? 63  LYS M O   1  
ATOM 2763   C CB  . LYS C 3 60  ? -77.865  -3.091  -22.684 1.00 0.00 ? 63  LYS M CB  1  
ATOM 2764   C CG  . LYS C 3 60  ? -78.219  -1.901  -23.552 1.00 0.00 ? 63  LYS M CG  1  
ATOM 2765   C CD  . LYS C 3 60  ? -79.634  -1.976  -24.151 1.00 0.00 ? 63  LYS M CD  1  
ATOM 2766   C CE  . LYS C 3 60  ? -79.802  -1.085  -25.383 1.00 0.00 ? 63  LYS M CE  1  
ATOM 2767   N NZ  . LYS C 3 60  ? -80.895  -1.502  -26.268 1.00 0.00 ? 63  LYS M NZ  1  
ATOM 2768   N N   . THR C 3 61  ? -76.740  -0.963  -21.056 1.00 0.00 ? 64  THR M N   1  
ATOM 2769   C CA  . THR C 3 61  ? -76.647  -0.122  -19.897 1.00 0.00 ? 64  THR M CA  1  
ATOM 2770   C C   . THR C 3 61  ? -77.968  0.494   -19.623 1.00 0.00 ? 64  THR M C   1  
ATOM 2771   O O   . THR C 3 61  ? -78.945  0.329   -20.341 1.00 0.00 ? 64  THR M O   1  
ATOM 2772   C CB  . THR C 3 61  ? -75.596  0.958   -20.245 1.00 0.00 ? 64  THR M CB  1  
ATOM 2773   O OG1 . THR C 3 61  ? -74.374  0.319   -20.514 1.00 0.00 ? 64  THR M OG1 1  
ATOM 2774   C CG2 . THR C 3 61  ? -75.383  2.019   -19.173 1.00 0.00 ? 64  THR M CG2 1  
ATOM 2775   N N   . GLU C 3 62  ? -77.945  1.226   -18.565 1.00 0.00 ? 65  GLU M N   1  
ATOM 2776   C CA  . GLU C 3 62  ? -79.034  2.027   -18.130 1.00 0.00 ? 65  GLU M CA  1  
ATOM 2777   C C   . GLU C 3 62  ? -78.549  3.427   -18.354 1.00 0.00 ? 65  GLU M C   1  
ATOM 2778   O O   . GLU C 3 62  ? -77.916  4.024   -17.497 1.00 0.00 ? 65  GLU M O   1  
ATOM 2779   C CB  . GLU C 3 62  ? -79.395  1.743   -16.691 1.00 0.00 ? 65  GLU M CB  1  
ATOM 2780   C CG  . GLU C 3 62  ? -80.744  1.026   -16.613 1.00 0.00 ? 65  GLU M CG  1  
ATOM 2781   C CD  . GLU C 3 62  ? -81.457  1.329   -15.318 1.00 0.00 ? 65  GLU M CD  1  
ATOM 2782   O OE1 . GLU C 3 62  ? -80.768  2.143   -14.560 1.00 0.00 ? 65  GLU M OE1 1  
ATOM 2783   O OE2 . GLU C 3 62  ? -82.561  0.884   -15.010 1.00 0.00 ? 65  GLU M OE2 1  
ATOM 2784   N N   . GLY C 3 63  ? -78.808  3.847   -19.569 1.00 0.00 ? 66  GLY M N   1  
ATOM 2785   C CA  . GLY C 3 63  ? -78.419  5.140   -20.106 1.00 0.00 ? 66  GLY M CA  1  
ATOM 2786   C C   . GLY C 3 63  ? -78.163  4.881   -21.550 1.00 0.00 ? 66  GLY M C   1  
ATOM 2787   O O   . GLY C 3 63  ? -78.307  5.777   -22.407 1.00 0.00 ? 66  GLY M O   1  
ATOM 2788   N N   . GLY C 3 64  ? -77.843  3.580   -21.790 1.00 0.00 ? 67  GLY M N   1  
ATOM 2789   C CA  . GLY C 3 64  ? -77.649  3.098   -23.136 1.00 0.00 ? 67  GLY M CA  1  
ATOM 2790   C C   . GLY C 3 64  ? -76.191  3.101   -23.438 1.00 0.00 ? 67  GLY M C   1  
ATOM 2791   O O   . GLY C 3 64  ? -75.615  4.128   -23.774 1.00 0.00 ? 67  GLY M O   1  
ATOM 2792   N N   . GLU C 3 65  ? -75.605  1.916   -23.265 1.00 0.00 ? 68  GLU M N   1  
ATOM 2793   C CA  . GLU C 3 65  ? -74.186  1.739   -23.511 1.00 0.00 ? 68  GLU M CA  1  
ATOM 2794   C C   . GLU C 3 65  ? -73.961  0.262   -23.580 1.00 0.00 ? 68  GLU M C   1  
ATOM 2795   O O   . GLU C 3 65  ? -74.699  -0.546  -22.972 1.00 0.00 ? 68  GLU M O   1  
ATOM 2796   C CB  . GLU C 3 65  ? -73.264  2.421   -22.460 1.00 0.00 ? 68  GLU M CB  1  
ATOM 2797   C CG  . GLU C 3 65  ? -71.748  2.366   -22.821 1.00 0.00 ? 68  GLU M CG  1  
ATOM 2798   C CD  . GLU C 3 65  ? -70.975  3.655   -22.563 1.00 0.00 ? 68  GLU M CD  1  
ATOM 2799   O OE1 . GLU C 3 65  ? -70.810  4.129   -21.433 1.00 0.00 ? 68  GLU M OE1 1  
ATOM 2800   O OE2 . GLU C 3 65  ? -70.460  4.183   -23.667 1.00 0.00 ? 68  GLU M OE2 1  
ATOM 2801   N N   . THR C 3 66  ? -72.960  -0.094  -24.366 1.00 0.00 ? 69  THR M N   1  
ATOM 2802   C CA  . THR C 3 66  ? -72.684  -1.483  -24.500 1.00 0.00 ? 69  THR M CA  1  
ATOM 2803   C C   . THR C 3 66  ? -71.206  -1.706  -24.255 1.00 0.00 ? 69  THR M C   1  
ATOM 2804   O O   . THR C 3 66  ? -70.360  -1.026  -24.849 1.00 0.00 ? 69  THR M O   1  
ATOM 2805   C CB  . THR C 3 66  ? -73.220  -1.942  -25.869 1.00 0.00 ? 69  THR M CB  1  
ATOM 2806   O OG1 . THR C 3 66  ? -73.476  -0.786  -26.641 1.00 0.00 ? 69  THR M OG1 1  
ATOM 2807   C CG2 . THR C 3 66  ? -74.533  -2.663  -25.660 1.00 0.00 ? 69  THR M CG2 1  
ATOM 2808   N N   . LEU C 3 67  ? -70.903  -2.628  -23.319 1.00 0.00 ? 70  LEU M N   1  
ATOM 2809   C CA  . LEU C 3 67  ? -69.533  -2.938  -22.933 1.00 0.00 ? 70  LEU M CA  1  
ATOM 2810   C C   . LEU C 3 67  ? -69.298  -4.428  -22.827 1.00 0.00 ? 70  LEU M C   1  
ATOM 2811   O O   . LEU C 3 67  ? -70.163  -5.149  -22.322 1.00 0.00 ? 70  LEU M O   1  
ATOM 2812   C CB  . LEU C 3 67  ? -69.264  -2.362  -21.526 1.00 0.00 ? 70  LEU M CB  1  
ATOM 2813   C CG  . LEU C 3 67  ? -68.299  -1.181  -21.519 1.00 0.00 ? 70  LEU M CG  1  
ATOM 2814   C CD1 . LEU C 3 67  ? -69.080  0.099   -21.256 1.00 0.00 ? 70  LEU M CD1 1  
ATOM 2815   C CD2 . LEU C 3 67  ? -67.242  -1.390  -20.452 1.00 0.00 ? 70  LEU M CD2 1  
ATOM 2816   N N   . THR C 3 68  ? -68.131  -4.892  -23.257 1.00 0.00 ? 71  THR M N   1  
ATOM 2817   C CA  . THR C 3 68  ? -67.855  -6.311  -23.119 1.00 0.00 ? 71  THR M CA  1  
ATOM 2818   C C   . THR C 3 68  ? -66.822  -6.423  -22.057 1.00 0.00 ? 71  THR M C   1  
ATOM 2819   O O   . THR C 3 68  ? -65.676  -6.086  -22.278 1.00 0.00 ? 71  THR M O   1  
ATOM 2820   C CB  . THR C 3 68  ? -67.357  -7.050  -24.358 1.00 0.00 ? 71  THR M CB  1  
ATOM 2821   O OG1 . THR C 3 68  ? -68.138  -6.693  -25.464 1.00 0.00 ? 71  THR M OG1 1  
ATOM 2822   C CG2 . THR C 3 68  ? -67.446  -8.549  -24.066 1.00 0.00 ? 71  THR M CG2 1  
ATOM 2823   N N   . VAL C 3 69  ? -67.272  -6.850  -20.917 1.00 0.00 ? 72  VAL M N   1  
ATOM 2824   C CA  . VAL C 3 69  ? -66.414  -6.934  -19.779 1.00 0.00 ? 72  VAL M CA  1  
ATOM 2825   C C   . VAL C 3 69  ? -66.301  -8.361  -19.226 1.00 0.00 ? 72  VAL M C   1  
ATOM 2826   O O   . VAL C 3 69  ? -67.216  -9.171  -19.393 1.00 0.00 ? 72  VAL M O   1  
ATOM 2827   C CB  . VAL C 3 69  ? -66.951  -5.892  -18.808 1.00 0.00 ? 72  VAL M CB  1  
ATOM 2828   C CG1 . VAL C 3 69  ? -67.545  -6.505  -17.560 1.00 0.00 ? 72  VAL M CG1 1  
ATOM 2829   C CG2 . VAL C 3 69  ? -65.986  -4.728  -18.534 1.00 0.00 ? 72  VAL M CG2 1  
ATOM 2830   N N   . LYS C 3 70  ? -65.163  -8.669  -18.589 1.00 0.00 ? 73  LYS M N   1  
ATOM 2831   C CA  . LYS C 3 70  ? -64.853  -9.975  -17.995 1.00 0.00 ? 73  LYS M CA  1  
ATOM 2832   C C   . LYS C 3 70  ? -66.042  -10.633 -17.332 1.00 0.00 ? 73  LYS M C   1  
ATOM 2833   O O   . LYS C 3 70  ? -67.099  -10.052 -17.170 1.00 0.00 ? 73  LYS M O   1  
ATOM 2834   C CB  . LYS C 3 70  ? -63.734  -9.866  -16.960 1.00 0.00 ? 73  LYS M CB  1  
ATOM 2835   C CG  . LYS C 3 70  ? -62.417  -10.569 -17.343 1.00 0.00 ? 73  LYS M CG  1  
ATOM 2836   C CD  . LYS C 3 70  ? -61.273  -9.583  -17.596 1.00 0.00 ? 73  LYS M CD  1  
ATOM 2837   C CE  . LYS C 3 70  ? -60.572  -9.112  -16.331 1.00 0.00 ? 73  LYS M CE  1  
ATOM 2838   N NZ  . LYS C 3 70  ? -59.099  -9.100  -16.446 1.00 0.00 ? 73  LYS M NZ  1  
ATOM 2839   N N   . GLU C 3 71  ? -65.843  -11.873 -16.922 1.00 0.00 ? 74  GLU M N   1  
ATOM 2840   C CA  . GLU C 3 71  ? -66.906  -12.579 -16.245 1.00 0.00 ? 74  GLU M CA  1  
ATOM 2841   C C   . GLU C 3 71  ? -67.071  -12.039 -14.839 1.00 0.00 ? 74  GLU M C   1  
ATOM 2842   O O   . GLU C 3 71  ? -68.187  -11.955 -14.315 1.00 0.00 ? 74  GLU M O   1  
ATOM 2843   C CB  . GLU C 3 71  ? -66.713  -14.073 -16.206 1.00 0.00 ? 74  GLU M CB  1  
ATOM 2844   C CG  . GLU C 3 71  ? -68.070  -14.780 -16.050 1.00 0.00 ? 74  GLU M CG  1  
ATOM 2845   C CD  . GLU C 3 71  ? -68.129  -16.004 -16.930 1.00 0.00 ? 74  GLU M CD  1  
ATOM 2846   O OE1 . GLU C 3 71  ? -67.460  -16.148 -17.943 1.00 0.00 ? 74  GLU M OE1 1  
ATOM 2847   O OE2 . GLU C 3 71  ? -68.978  -16.883 -16.449 1.00 0.00 ? 74  GLU M OE2 1  
ATOM 2848   N N   . ASP C 3 72  ? -65.934  -11.684 -14.238 1.00 0.00 ? 75  ASP M N   1  
ATOM 2849   C CA  . ASP C 3 72  ? -66.012  -11.112 -12.911 1.00 0.00 ? 75  ASP M CA  1  
ATOM 2850   C C   . ASP C 3 72  ? -65.971  -9.607  -12.806 1.00 0.00 ? 75  ASP M C   1  
ATOM 2851   O O   . ASP C 3 72  ? -65.407  -9.035  -11.910 1.00 0.00 ? 75  ASP M O   1  
ATOM 2852   C CB  . ASP C 3 72  ? -65.767  -11.916 -11.645 1.00 0.00 ? 75  ASP M CB  1  
ATOM 2853   C CG  . ASP C 3 72  ? -66.914  -11.703 -10.664 1.00 0.00 ? 75  ASP M CG  1  
ATOM 2854   O OD1 . ASP C 3 72  ? -67.983  -12.480 -10.871 1.00 0.00 ? 75  ASP M OD1 1  
ATOM 2855   O OD2 . ASP C 3 72  ? -66.905  -10.868 -9.758  1.00 0.00 ? 75  ASP M OD2 1  
ATOM 2856   N N   . GLN C 3 73  ? -66.569  -8.998  -13.791 1.00 0.00 ? 76  GLN M N   1  
ATOM 2857   C CA  . GLN C 3 73  ? -66.669  -7.577  -13.848 1.00 0.00 ? 76  GLN M CA  1  
ATOM 2858   C C   . GLN C 3 73  ? -68.166  -7.344  -13.829 1.00 0.00 ? 76  GLN M C   1  
ATOM 2859   O O   . GLN C 3 73  ? -68.721  -6.225  -13.804 1.00 0.00 ? 76  GLN M O   1  
ATOM 2860   C CB  . GLN C 3 73  ? -65.921  -7.070  -15.119 1.00 0.00 ? 76  GLN M CB  1  
ATOM 2861   C CG  . GLN C 3 73  ? -64.960  -5.880  -14.841 1.00 0.00 ? 76  GLN M CG  1  
ATOM 2862   C CD  . GLN C 3 73  ? -63.492  -6.228  -14.977 1.00 0.00 ? 76  GLN M CD  1  
ATOM 2863   O OE1 . GLN C 3 73  ? -62.867  -5.903  -15.989 1.00 0.00 ? 76  GLN M OE1 1  
ATOM 2864   N NE2 . GLN C 3 73  ? -62.938  -6.903  -13.963 1.00 0.00 ? 76  GLN M NE2 1  
ATOM 2865   N N   . VAL C 3 74  ? -68.797  -8.522  -13.755 1.00 0.00 ? 77  VAL M N   1  
ATOM 2866   C CA  . VAL C 3 74  ? -70.226  -8.737  -13.754 1.00 0.00 ? 77  VAL M CA  1  
ATOM 2867   C C   . VAL C 3 74  ? -70.725  -9.292  -12.418 1.00 0.00 ? 77  VAL M C   1  
ATOM 2868   O O   . VAL C 3 74  ? -70.285  -10.302 -11.938 1.00 0.00 ? 77  VAL M O   1  
ATOM 2869   C CB  . VAL C 3 74  ? -70.643  -9.686  -14.867 1.00 0.00 ? 77  VAL M CB  1  
ATOM 2870   C CG1 . VAL C 3 74  ? -71.911  -10.417 -14.475 1.00 0.00 ? 77  VAL M CG1 1  
ATOM 2871   C CG2 . VAL C 3 74  ? -70.848  -8.972  -16.177 1.00 0.00 ? 77  VAL M CG2 1  
ATOM 2872   N N   . PHE C 3 75  ? -71.723  -8.630  -11.879 1.00 0.00 ? 78  PHE M N   1  
ATOM 2873   C CA  . PHE C 3 75  ? -72.326  -8.964  -10.609 1.00 0.00 ? 78  PHE M CA  1  
ATOM 2874   C C   . PHE C 3 75  ? -73.839  -8.948  -10.644 1.00 0.00 ? 78  PHE M C   1  
ATOM 2875   O O   . PHE C 3 75  ? -74.509  -8.008  -11.140 1.00 0.00 ? 78  PHE M O   1  
ATOM 2876   C CB  . PHE C 3 75  ? -71.891  -7.955  -9.485  1.00 0.00 ? 78  PHE M CB  1  
ATOM 2877   C CG  . PHE C 3 75  ? -70.416  -7.643  -9.458  1.00 0.00 ? 78  PHE M CG  1  
ATOM 2878   C CD1 . PHE C 3 75  ? -69.888  -6.624  -10.241 1.00 0.00 ? 78  PHE M CD1 1  
ATOM 2879   C CD2 . PHE C 3 75  ? -69.560  -8.395  -8.662  1.00 0.00 ? 78  PHE M CD2 1  
ATOM 2880   C CE1 . PHE C 3 75  ? -68.525  -6.329  -10.230 1.00 0.00 ? 78  PHE M CE1 1  
ATOM 2881   C CE2 . PHE C 3 75  ? -68.184  -8.135  -8.646  1.00 0.00 ? 78  PHE M CE2 1  
ATOM 2882   C CZ  . PHE C 3 75  ? -67.682  -7.097  -9.428  1.00 0.00 ? 78  PHE M CZ  1  
ATOM 2883   N N   . SER C 3 76  ? -74.398  -10.006 -10.077 1.00 0.00 ? 79  SER M N   1  
ATOM 2884   C CA  . SER C 3 76  ? -75.823  -10.212 -9.986  1.00 0.00 ? 79  SER M CA  1  
ATOM 2885   C C   . SER C 3 76  ? -76.532  -9.019  -9.399  1.00 0.00 ? 79  SER M C   1  
ATOM 2886   O O   . SER C 3 76  ? -75.895  -8.081  -8.944  1.00 0.00 ? 79  SER M O   1  
ATOM 2887   C CB  . SER C 3 76  ? -76.208  -11.530 -9.279  1.00 0.00 ? 79  SER M CB  1  
ATOM 2888   O OG  . SER C 3 76  ? -76.113  -12.559 -10.272 1.00 0.00 ? 79  SER M OG  1  
ATOM 2889   N N   . MET C 3 77  ? -77.858  -9.051  -9.462  1.00 0.00 ? 80  MET M N   1  
ATOM 2890   C CA  . MET C 3 77  ? -78.703  -7.991  -8.980  1.00 0.00 ? 80  MET M CA  1  
ATOM 2891   C C   . MET C 3 77  ? -79.868  -8.539  -8.171  1.00 0.00 ? 80  MET M C   1  
ATOM 2892   O O   . MET C 3 77  ? -80.607  -9.439  -8.524  1.00 0.00 ? 80  MET M O   1  
ATOM 2893   C CB  . MET C 3 77  ? -79.200  -7.160  -10.162 1.00 0.00 ? 80  MET M CB  1  
ATOM 2894   C CG  . MET C 3 77  ? -80.120  -6.025  -9.765  1.00 0.00 ? 80  MET M CG  1  
ATOM 2895   S SD  . MET C 3 77  ? -80.349  -4.863  -11.114 1.00 0.00 ? 80  MET M SD  1  
ATOM 2896   C CE  . MET C 3 77  ? -81.992  -4.278  -10.585 1.00 0.00 ? 80  MET M CE  1  
ATOM 2897   N N   . ASN C 3 78  ? -80.048  -8.027  -6.992  1.00 0.00 ? 81  ASN M N   1  
ATOM 2898   C CA  . ASN C 3 78  ? -81.070  -8.512  -6.129  1.00 0.00 ? 81  ASN M CA  1  
ATOM 2899   C C   . ASN C 3 78  ? -82.467  -8.361  -6.647  1.00 0.00 ? 81  ASN M C   1  
ATOM 2900   O O   . ASN C 3 78  ? -82.799  -7.335  -7.253  1.00 0.00 ? 81  ASN M O   1  
ATOM 2901   C CB  . ASN C 3 78  ? -80.983  -7.852  -4.749  1.00 0.00 ? 81  ASN M CB  1  
ATOM 2902   C CG  . ASN C 3 78  ? -79.703  -8.209  -4.000  1.00 0.00 ? 81  ASN M CG  1  
ATOM 2903   O OD1 . ASN C 3 78  ? -79.570  -9.267  -3.319  1.00 0.00 ? 81  ASN M OD1 1  
ATOM 2904   N ND2 . ASN C 3 78  ? -78.719  -7.314  -4.126  1.00 0.00 ? 81  ASN M ND2 1  
ATOM 2905   N N   . PRO C 3 79  ? -83.297  -9.381  -6.353  1.00 0.00 ? 82  PRO M N   1  
ATOM 2906   C CA  . PRO C 3 79  ? -84.678  -9.354  -6.746  1.00 0.00 ? 82  PRO M CA  1  
ATOM 2907   C C   . PRO C 3 79  ? -85.228  -8.105  -6.119  1.00 0.00 ? 82  PRO M C   1  
ATOM 2908   O O   . PRO C 3 79  ? -84.695  -7.565  -5.158  1.00 0.00 ? 82  PRO M O   1  
ATOM 2909   C CB  . PRO C 3 79  ? -85.405  -10.507 -6.105  1.00 0.00 ? 82  PRO M CB  1  
ATOM 2910   C CG  . PRO C 3 79  ? -84.469  -10.982 -5.053  1.00 0.00 ? 82  PRO M CG  1  
ATOM 2911   C CD  . PRO C 3 79  ? -83.099  -10.390 -5.332  1.00 0.00 ? 82  PRO M CD  1  
ATOM 2912   N N   . PRO C 3 80  ? -86.266  -7.648  -6.717  1.00 0.00 ? 83  PRO M N   1  
ATOM 2913   C CA  . PRO C 3 80  ? -86.920  -6.440  -6.319  1.00 0.00 ? 83  PRO M CA  1  
ATOM 2914   C C   . PRO C 3 80  ? -87.363  -6.464  -4.862  1.00 0.00 ? 83  PRO M C   1  
ATOM 2915   O O   . PRO C 3 80  ? -87.580  -5.437  -4.189  1.00 0.00 ? 83  PRO M O   1  
ATOM 2916   C CB  . PRO C 3 80  ? -88.046  -6.218  -7.306  1.00 0.00 ? 83  PRO M CB  1  
ATOM 2917   C CG  . PRO C 3 80  ? -87.789  -7.175  -8.463  1.00 0.00 ? 83  PRO M CG  1  
ATOM 2918   C CD  . PRO C 3 80  ? -86.666  -8.110  -8.055  1.00 0.00 ? 83  PRO M CD  1  
ATOM 2919   N N   . LYS C 3 81  ? -87.477  -7.667  -4.341  1.00 0.00 ? 84  LYS M N   1  
ATOM 2920   C CA  . LYS C 3 81  ? -87.915  -7.808  -2.959  1.00 0.00 ? 84  LYS M CA  1  
ATOM 2921   C C   . LYS C 3 81  ? -87.018  -7.022  -2.030  1.00 0.00 ? 84  LYS M C   1  
ATOM 2922   O O   . LYS C 3 81  ? -87.400  -6.605  -0.955  1.00 0.00 ? 84  LYS M O   1  
ATOM 2923   C CB  . LYS C 3 81  ? -87.981  -9.273  -2.533  1.00 0.00 ? 84  LYS M CB  1  
ATOM 2924   C CG  . LYS C 3 81  ? -87.928  -9.436  -1.028  1.00 0.00 ? 84  LYS M CG  1  
ATOM 2925   C CD  . LYS C 3 81  ? -87.668  -10.870 -0.514  1.00 0.00 ? 84  LYS M CD  1  
ATOM 2926   C CE  . LYS C 3 81  ? -87.498  -10.875 1.008   1.00 0.00 ? 84  LYS M CE  1  
ATOM 2927   N NZ  . LYS C 3 81  ? -88.178  -11.932 1.711   1.00 0.00 ? 84  LYS M NZ  1  
ATOM 2928   N N   . TYR C 3 82  ? -85.797  -6.813  -2.480  1.00 0.00 ? 85  TYR M N   1  
ATOM 2929   C CA  . TYR C 3 82  ? -84.807  -6.057  -1.728  1.00 0.00 ? 85  TYR M CA  1  
ATOM 2930   C C   . TYR C 3 82  ? -84.594  -4.723  -2.379  1.00 0.00 ? 85  TYR M C   1  
ATOM 2931   O O   . TYR C 3 82  ? -83.587  -4.507  -3.039  1.00 0.00 ? 85  TYR M O   1  
ATOM 2932   C CB  . TYR C 3 82  ? -83.485  -6.795  -1.780  1.00 0.00 ? 85  TYR M CB  1  
ATOM 2933   C CG  . TYR C 3 82  ? -83.571  -8.250  -1.401  1.00 0.00 ? 85  TYR M CG  1  
ATOM 2934   C CD1 . TYR C 3 82  ? -83.835  -8.651  -0.091  1.00 0.00 ? 85  TYR M CD1 1  
ATOM 2935   C CD2 . TYR C 3 82  ? -83.420  -9.240  -2.363  1.00 0.00 ? 85  TYR M CD2 1  
ATOM 2936   C CE1 . TYR C 3 82  ? -83.923  -9.990  0.269   1.00 0.00 ? 85  TYR M CE1 1  
ATOM 2937   C CE2 . TYR C 3 82  ? -83.492  -10.596 -2.031  1.00 0.00 ? 85  TYR M CE2 1  
ATOM 2938   C CZ  . TYR C 3 82  ? -83.722  -10.962 -0.698  1.00 0.00 ? 85  TYR M CZ  1  
ATOM 2939   O OH  . TYR C 3 82  ? -83.780  -12.275 -0.297  1.00 0.00 ? 85  TYR M OH  1  
ATOM 2940   N N   . ASP C 3 83  ? -85.547  -3.824  -2.197  1.00 0.00 ? 86  ASP M N   1  
ATOM 2941   C CA  . ASP C 3 83  ? -85.421  -2.574  -2.876  1.00 0.00 ? 86  ASP M CA  1  
ATOM 2942   C C   . ASP C 3 83  ? -84.604  -1.570  -2.101  1.00 0.00 ? 86  ASP M C   1  
ATOM 2943   O O   . ASP C 3 83  ? -83.504  -1.155  -2.536  1.00 0.00 ? 86  ASP M O   1  
ATOM 2944   C CB  . ASP C 3 83  ? -86.833  -2.054  -3.257  1.00 0.00 ? 86  ASP M CB  1  
ATOM 2945   C CG  . ASP C 3 83  ? -86.730  -0.996  -4.317  1.00 0.00 ? 86  ASP M CG  1  
ATOM 2946   O OD1 . ASP C 3 83  ? -85.828  -1.246  -5.270  1.00 0.00 ? 86  ASP M OD1 1  
ATOM 2947   O OD2 . ASP C 3 83  ? -87.366  0.008   -4.237  1.00 0.00 ? 86  ASP M OD2 1  
ATOM 2948   N N   . LYS C 3 84  ? -85.211  -1.162  -0.963  1.00 0.00 ? 87  LYS M N   1  
ATOM 2949   C CA  . LYS C 3 84  ? -84.581  -0.194  -0.106  1.00 0.00 ? 87  LYS M CA  1  
ATOM 2950   C C   . LYS C 3 84  ? -84.544  -0.700  1.307   1.00 0.00 ? 87  LYS M C   1  
ATOM 2951   O O   . LYS C 3 84  ? -85.033  -0.065  2.242   1.00 0.00 ? 87  LYS M O   1  
ATOM 2952   C CB  . LYS C 3 84  ? -85.172  1.168   -0.222  1.00 0.00 ? 87  LYS M CB  1  
ATOM 2953   C CG  . LYS C 3 84  ? -85.114  1.721   -1.647  1.00 0.00 ? 87  LYS M CG  1  
ATOM 2954   C CD  . LYS C 3 84  ? -86.098  2.869   -1.862  1.00 0.00 ? 87  LYS M CD  1  
ATOM 2955   C CE  . LYS C 3 84  ? -86.434  3.064   -3.315  1.00 0.00 ? 87  LYS M CE  1  
ATOM 2956   N NZ  . LYS C 3 84  ? -87.887  3.061   -3.538  1.00 0.00 ? 87  LYS M NZ  1  
ATOM 2957   N N   . ILE C 3 85  ? -83.958  -1.882  1.364   1.00 0.00 ? 88  ILE M N   1  
ATOM 2958   C CA  . ILE C 3 85  ? -83.759  -2.691  2.521   1.00 0.00 ? 88  ILE M CA  1  
ATOM 2959   C C   . ILE C 3 85  ? -83.138  -1.917  3.651   1.00 0.00 ? 88  ILE M C   1  
ATOM 2960   O O   . ILE C 3 85  ? -82.101  -1.311  3.491   1.00 0.00 ? 88  ILE M O   1  
ATOM 2961   C CB  . ILE C 3 85  ? -82.877  -3.858  2.128   1.00 0.00 ? 88  ILE M CB  1  
ATOM 2962   C CG1 . ILE C 3 85  ? -83.683  -4.858  1.403   1.00 0.00 ? 88  ILE M CG1 1  
ATOM 2963   C CG2 . ILE C 3 85  ? -82.269  -4.490  3.362   1.00 0.00 ? 88  ILE M CG2 1  
ATOM 2964   C CD1 . ILE C 3 85  ? -84.018  -5.811  2.496   1.00 0.00 ? 88  ILE M CD1 1  
ATOM 2965   N N   . GLU C 3 86  ? -83.798  -2.021  4.775   1.00 0.00 ? 89  GLU M N   1  
ATOM 2966   C CA  . GLU C 3 86  ? -83.349  -1.426  5.991   1.00 0.00 ? 89  GLU M CA  1  
ATOM 2967   C C   . GLU C 3 86  ? -81.979  -1.915  6.400   1.00 0.00 ? 89  GLU M C   1  
ATOM 2968   O O   . GLU C 3 86  ? -81.089  -1.130  6.731   1.00 0.00 ? 89  GLU M O   1  
ATOM 2969   C CB  . GLU C 3 86  ? -84.453  -1.526  7.061   1.00 0.00 ? 89  GLU M CB  1  
ATOM 2970   C CG  . GLU C 3 86  ? -85.647  -0.608  6.659   1.00 0.00 ? 89  GLU M CG  1  
ATOM 2971   C CD  . GLU C 3 86  ? -86.776  -0.680  7.612   1.00 0.00 ? 89  GLU M CD  1  
ATOM 2972   O OE1 . GLU C 3 86  ? -86.661  -1.674  8.476   1.00 0.00 ? 89  GLU M OE1 1  
ATOM 2973   O OE2 . GLU C 3 86  ? -87.698  0.108   7.574   1.00 0.00 ? 89  GLU M OE2 1  
ATOM 2974   N N   . ASP C 3 87  ? -81.762  -3.218  6.140   1.00 0.00 ? 90  ASP M N   1  
ATOM 2975   C CA  . ASP C 3 87  ? -80.534  -3.896  6.494   1.00 0.00 ? 90  ASP M CA  1  
ATOM 2976   C C   . ASP C 3 87  ? -79.979  -4.598  5.314   1.00 0.00 ? 90  ASP M C   1  
ATOM 2977   O O   . ASP C 3 87  ? -80.346  -5.723  5.055   1.00 0.00 ? 90  ASP M O   1  
ATOM 2978   C CB  . ASP C 3 87  ? -80.829  -4.943  7.560   1.00 0.00 ? 90  ASP M CB  1  
ATOM 2979   C CG  . ASP C 3 87  ? -79.637  -5.531  8.218   1.00 0.00 ? 90  ASP M CG  1  
ATOM 2980   O OD1 . ASP C 3 87  ? -78.562  -5.517  7.470   1.00 0.00 ? 90  ASP M OD1 1  
ATOM 2981   O OD2 . ASP C 3 87  ? -79.683  -5.966  9.377   1.00 0.00 ? 90  ASP M OD2 1  
ATOM 2982   N N   . MET C 3 88  ? -79.056  -3.963  4.638   1.00 0.00 ? 91  MET M N   1  
ATOM 2983   C CA  . MET C 3 88  ? -78.470  -4.532  3.475   1.00 0.00 ? 91  MET M CA  1  
ATOM 2984   C C   . MET C 3 88  ? -77.940  -5.884  3.676   1.00 0.00 ? 91  MET M C   1  
ATOM 2985   O O   . MET C 3 88  ? -77.890  -6.666  2.751   1.00 0.00 ? 91  MET M O   1  
ATOM 2986   C CB  . MET C 3 88  ? -77.422  -3.617  2.909   1.00 0.00 ? 91  MET M CB  1  
ATOM 2987   C CG  . MET C 3 88  ? -77.918  -2.171  2.902   1.00 0.00 ? 91  MET M CG  1  
ATOM 2988   S SD  . MET C 3 88  ? -76.753  -1.053  2.201   1.00 0.00 ? 91  MET M SD  1  
ATOM 2989   C CE  . MET C 3 88  ? -76.253  -0.309  3.742   1.00 0.00 ? 91  MET M CE  1  
ATOM 2990   N N   . ALA C 3 89  ? -77.632  -6.179  4.896   1.00 0.00 ? 92  ALA M N   1  
ATOM 2991   C CA  . ALA C 3 89  ? -77.076  -7.498  5.229   1.00 0.00 ? 92  ALA M CA  1  
ATOM 2992   C C   . ALA C 3 89  ? -78.113  -8.592  5.204   1.00 0.00 ? 92  ALA M C   1  
ATOM 2993   O O   . ALA C 3 89  ? -77.939  -9.707  5.623   1.00 0.00 ? 92  ALA M O   1  
ATOM 2994   C CB  . ALA C 3 89  ? -76.324  -7.478  6.552   1.00 0.00 ? 92  ALA M CB  1  
ATOM 2995   N N   . MET C 3 90  ? -79.287  -8.240  4.708   1.00 0.00 ? 93  MET M N   1  
ATOM 2996   C CA  . MET C 3 90  ? -80.311  -9.229  4.628   1.00 0.00 ? 93  MET M CA  1  
ATOM 2997   C C   . MET C 3 90  ? -80.455  -9.631  3.187   1.00 0.00 ? 93  MET M C   1  
ATOM 2998   O O   . MET C 3 90  ? -81.043  -10.635 2.846   1.00 0.00 ? 93  MET M O   1  
ATOM 2999   C CB  . MET C 3 90  ? -81.610  -8.778  5.258   1.00 0.00 ? 93  MET M CB  1  
ATOM 3000   C CG  . MET C 3 90  ? -81.745  -9.372  6.672   1.00 0.00 ? 93  MET M CG  1  
ATOM 3001   S SD  . MET C 3 90  ? -83.113  -8.612  7.574   1.00 0.00 ? 93  MET M SD  1  
ATOM 3002   C CE  . MET C 3 90  ? -82.502  -8.910  9.262   1.00 0.00 ? 93  MET M CE  1  
ATOM 3003   N N   . MET C 3 91  ? -79.837  -8.831  2.353   1.00 0.00 ? 94  MET M N   1  
ATOM 3004   C CA  . MET C 3 91  ? -79.766  -9.086  0.962   1.00 0.00 ? 94  MET M CA  1  
ATOM 3005   C C   . MET C 3 91  ? -79.158  -10.431 0.740   1.00 0.00 ? 94  MET M C   1  
ATOM 3006   O O   . MET C 3 91  ? -78.408  -10.891 1.591   1.00 0.00 ? 94  MET M O   1  
ATOM 3007   C CB  . MET C 3 91  ? -78.851  -8.086  0.256   1.00 0.00 ? 94  MET M CB  1  
ATOM 3008   C CG  . MET C 3 91  ? -79.492  -6.677  0.086   1.00 0.00 ? 94  MET M CG  1  
ATOM 3009   S SD  . MET C 3 91  ? -78.229  -5.398  -0.019  1.00 0.00 ? 94  MET M SD  1  
ATOM 3010   C CE  . MET C 3 91  ? -77.759  -5.460  -1.749  1.00 0.00 ? 94  MET M CE  1  
ATOM 3011   N N   . THR C 3 92  ? -79.506  -11.069 -0.392  1.00 0.00 ? 95  THR M N   1  
ATOM 3012   C CA  . THR C 3 92  ? -78.992  -12.388 -0.710  1.00 0.00 ? 95  THR M CA  1  
ATOM 3013   C C   . THR C 3 92  ? -77.879  -12.220 -1.658  1.00 0.00 ? 95  THR M C   1  
ATOM 3014   O O   . THR C 3 92  ? -77.453  -13.197 -2.231  1.00 0.00 ? 95  THR M O   1  
ATOM 3015   C CB  . THR C 3 92  ? -80.028  -13.328 -1.361  1.00 0.00 ? 95  THR M CB  1  
ATOM 3016   O OG1 . THR C 3 92  ? -79.493  -14.650 -1.457  1.00 0.00 ? 95  THR M OG1 1  
ATOM 3017   C CG2 . THR C 3 92  ? -80.258  -12.862 -2.758  1.00 0.00 ? 95  THR M CG2 1  
ATOM 3018   N N   . HIS C 3 93  ? -77.546  -10.943 -1.869  1.00 0.00 ? 96  HIS M N   1  
ATOM 3019   C CA  . HIS C 3 93  ? -76.470  -10.601 -2.767  1.00 0.00 ? 96  HIS M CA  1  
ATOM 3020   C C   . HIS C 3 93  ? -75.552  -9.547  -2.179  1.00 0.00 ? 96  HIS M C   1  
ATOM 3021   O O   . HIS C 3 93  ? -75.785  -8.359  -2.302  1.00 0.00 ? 96  HIS M O   1  
ATOM 3022   C CB  . HIS C 3 93  ? -76.941  -10.216 -4.127  1.00 0.00 ? 96  HIS M CB  1  
ATOM 3023   C CG  . HIS C 3 93  ? -77.203  -11.384 -5.042  1.00 0.00 ? 96  HIS M CG  1  
ATOM 3024   N ND1 . HIS C 3 93  ? -78.378  -12.101 -4.977  1.00 0.00 ? 96  HIS M ND1 1  
ATOM 3025   C CD2 . HIS C 3 93  ? -76.453  -11.878 -6.065  1.00 0.00 ? 96  HIS M CD2 1  
ATOM 3026   C CE1 . HIS C 3 93  ? -78.320  -13.004 -5.957  1.00 0.00 ? 96  HIS M CE1 1  
ATOM 3027   N NE2 . HIS C 3 93  ? -77.169  -12.888 -6.617  1.00 0.00 ? 96  HIS M NE2 1  
ATOM 3028   N N   . LEU C 3 94  ? -74.522  -10.088 -1.534  1.00 0.00 ? 97  LEU M N   1  
ATOM 3029   C CA  . LEU C 3 94  ? -73.486  -9.389  -0.845  1.00 0.00 ? 97  LEU M CA  1  
ATOM 3030   C C   . LEU C 3 94  ? -72.323  -9.100  -1.777  1.00 0.00 ? 97  LEU M C   1  
ATOM 3031   O O   . LEU C 3 94  ? -71.401  -9.857  -1.961  1.00 0.00 ? 97  LEU M O   1  
ATOM 3032   C CB  . LEU C 3 94  ? -73.100  -10.211 0.350   1.00 0.00 ? 97  LEU M CB  1  
ATOM 3033   C CG  . LEU C 3 94  ? -74.039  -9.957  1.526   1.00 0.00 ? 97  LEU M CG  1  
ATOM 3034   C CD1 . LEU C 3 94  ? -75.173  -9.132  1.080   1.00 0.00 ? 97  LEU M CD1 1  
ATOM 3035   C CD2 . LEU C 3 94  ? -74.511  -11.280 2.111   1.00 0.00 ? 97  LEU M CD2 1  
ATOM 3036   N N   . HIS C 3 95  ? -72.469  -7.983  -2.444  1.00 0.00 ? 98  HIS M N   1  
ATOM 3037   C CA  . HIS C 3 95  ? -71.538  -7.492  -3.410  1.00 0.00 ? 98  HIS M CA  1  
ATOM 3038   C C   . HIS C 3 95  ? -71.064  -6.178  -2.978  1.00 0.00 ? 98  HIS M C   1  
ATOM 3039   O O   . HIS C 3 95  ? -71.705  -5.593  -2.147  1.00 0.00 ? 98  HIS M O   1  
ATOM 3040   C CB  . HIS C 3 95  ? -72.285  -6.781  -4.503  1.00 0.00 ? 98  HIS M CB  1  
ATOM 3041   C CG  . HIS C 3 95  ? -72.944  -7.638  -5.448  1.00 0.00 ? 98  HIS M CG  1  
ATOM 3042   N ND1 . HIS C 3 95  ? -74.296  -7.591  -5.574  1.00 0.00 ? 98  HIS M ND1 1  
ATOM 3043   C CD2 . HIS C 3 95  ? -72.429  -8.470  -6.343  1.00 0.00 ? 98  HIS M CD2 1  
ATOM 3044   C CE1 . HIS C 3 95  ? -74.616  -8.455  -6.494  1.00 0.00 ? 98  HIS M CE1 1  
ATOM 3045   N NE2 . HIS C 3 95  ? -73.515  -8.989  -7.000  1.00 0.00 ? 98  HIS M NE2 1  
ATOM 3046   N N   . GLU C 3 96  ? -70.262  -5.637  -3.858  1.00 0.00 ? 99  GLU M N   1  
ATOM 3047   C CA  . GLU C 3 96  ? -69.817  -4.297  -3.669  1.00 0.00 ? 99  GLU M CA  1  
ATOM 3048   C C   . GLU C 3 96  ? -70.889  -3.346  -4.226  1.00 0.00 ? 99  GLU M C   1  
ATOM 3049   O O   . GLU C 3 96  ? -71.395  -2.468  -3.536  1.00 0.00 ? 99  GLU M O   1  
ATOM 3050   C CB  . GLU C 3 96  ? -68.429  -4.064  -4.300  1.00 0.00 ? 99  GLU M CB  1  
ATOM 3051   C CG  . GLU C 3 96  ? -67.558  -3.068  -3.491  1.00 0.00 ? 99  GLU M CG  1  
ATOM 3052   C CD  . GLU C 3 96  ? -66.086  -3.110  -3.840  1.00 0.00 ? 99  GLU M CD  1  
ATOM 3053   O OE1 . GLU C 3 96  ? -65.271  -3.859  -3.309  1.00 0.00 ? 99  GLU M OE1 1  
ATOM 3054   O OE2 . GLU C 3 96  ? -65.743  -2.224  -4.756  1.00 0.00 ? 99  GLU M OE2 1  
ATOM 3055   N N   . PRO C 3 97  ? -71.334  -3.586  -5.470  1.00 0.00 ? 100 PRO M N   1  
ATOM 3056   C CA  . PRO C 3 97  ? -72.317  -2.757  -6.083  1.00 0.00 ? 100 PRO M CA  1  
ATOM 3057   C C   . PRO C 3 97  ? -73.673  -2.680  -5.392  1.00 0.00 ? 100 PRO M C   1  
ATOM 3058   O O   . PRO C 3 97  ? -74.237  -1.631  -5.159  1.00 0.00 ? 100 PRO M O   1  
ATOM 3059   C CB  . PRO C 3 97  ? -72.481  -3.241  -7.473  1.00 0.00 ? 100 PRO M CB  1  
ATOM 3060   C CG  . PRO C 3 97  ? -71.367  -4.221  -7.741  1.00 0.00 ? 100 PRO M CG  1  
ATOM 3061   C CD  . PRO C 3 97  ? -70.887  -4.633  -6.392  1.00 0.00 ? 100 PRO M CD  1  
ATOM 3062   N N   . ALA C 3 98  ? -74.199  -3.819  -5.054  1.00 0.00 ? 101 ALA M N   1  
ATOM 3063   C CA  . ALA C 3 98  ? -75.471  -3.832  -4.394  1.00 0.00 ? 101 ALA M CA  1  
ATOM 3064   C C   . ALA C 3 98  ? -75.539  -3.002  -3.153  1.00 0.00 ? 101 ALA M C   1  
ATOM 3065   O O   . ALA C 3 98  ? -76.597  -2.501  -2.750  1.00 0.00 ? 101 ALA M O   1  
ATOM 3066   C CB  . ALA C 3 98  ? -75.851  -5.242  -4.067  1.00 0.00 ? 101 ALA M CB  1  
ATOM 3067   N N   . VAL C 3 99  ? -74.392  -2.801  -2.537  1.00 0.00 ? 102 VAL M N   1  
ATOM 3068   C CA  . VAL C 3 99  ? -74.394  -2.011  -1.328  1.00 0.00 ? 102 VAL M CA  1  
ATOM 3069   C C   . VAL C 3 99  ? -74.406  -0.555  -1.644  1.00 0.00 ? 102 VAL M C   1  
ATOM 3070   O O   . VAL C 3 99  ? -75.048  0.259   -1.033  1.00 0.00 ? 102 VAL M O   1  
ATOM 3071   C CB  . VAL C 3 99  ? -73.232  -2.372  -0.466  1.00 0.00 ? 102 VAL M CB  1  
ATOM 3072   C CG1 . VAL C 3 99  ? -73.102  -1.276  0.530   1.00 0.00 ? 102 VAL M CG1 1  
ATOM 3073   C CG2 . VAL C 3 99  ? -73.541  -3.751  0.169   1.00 0.00 ? 102 VAL M CG2 1  
ATOM 3074   N N   . LEU C 3 100 ? -73.643  -0.234  -2.629  1.00 0.00 ? 103 LEU M N   1  
ATOM 3075   C CA  . LEU C 3 100 ? -73.565  1.153   -3.057  1.00 0.00 ? 103 LEU M CA  1  
ATOM 3076   C C   . LEU C 3 100 ? -74.962  1.532   -3.487  1.00 0.00 ? 103 LEU M C   1  
ATOM 3077   O O   . LEU C 3 100 ? -75.617  2.456   -3.000  1.00 0.00 ? 103 LEU M O   1  
ATOM 3078   C CB  . LEU C 3 100 ? -72.519  1.243   -4.198  1.00 0.00 ? 103 LEU M CB  1  
ATOM 3079   C CG  . LEU C 3 100 ? -72.702  2.469   -5.032  1.00 0.00 ? 103 LEU M CG  1  
ATOM 3080   C CD1 . LEU C 3 100 ? -72.871  3.607   -4.086  1.00 0.00 ? 103 LEU M CD1 1  
ATOM 3081   C CD2 . LEU C 3 100 ? -71.442  2.616   -5.829  1.00 0.00 ? 103 LEU M CD2 1  
ATOM 3082   N N   . TYR C 3 101 ? -75.494  0.697   -4.355  1.00 0.00 ? 104 TYR M N   1  
ATOM 3083   C CA  . TYR C 3 101 ? -76.793  0.922   -4.930  1.00 0.00 ? 104 TYR M CA  1  
ATOM 3084   C C   . TYR C 3 101 ? -77.936  1.028   -3.982  1.00 0.00 ? 104 TYR M C   1  
ATOM 3085   O O   . TYR C 3 101 ? -78.809  1.770   -4.221  1.00 0.00 ? 104 TYR M O   1  
ATOM 3086   C CB  . TYR C 3 101 ? -76.989  0.103   -6.186  1.00 0.00 ? 104 TYR M CB  1  
ATOM 3087   C CG  . TYR C 3 101 ? -76.376  0.722   -7.420  1.00 0.00 ? 104 TYR M CG  1  
ATOM 3088   C CD1 . TYR C 3 101 ? -77.141  1.651   -8.116  1.00 0.00 ? 104 TYR M CD1 1  
ATOM 3089   C CD2 . TYR C 3 101 ? -75.102  0.438   -7.920  1.00 0.00 ? 104 TYR M CD2 1  
ATOM 3090   C CE1 . TYR C 3 101 ? -76.660  2.284   -9.260  1.00 0.00 ? 104 TYR M CE1 1  
ATOM 3091   C CE2 . TYR C 3 101 ? -74.608  1.037   -9.087  1.00 0.00 ? 104 TYR M CE2 1  
ATOM 3092   C CZ  . TYR C 3 101 ? -75.392  1.973   -9.759  1.00 0.00 ? 104 TYR M CZ  1  
ATOM 3093   O OH  . TYR C 3 101 ? -74.907  2.558   -10.929 1.00 0.00 ? 104 TYR M OH  1  
ATOM 3094   N N   . ASN C 3 102 ? -77.917  0.306   -2.864  1.00 0.00 ? 105 ASN M N   1  
ATOM 3095   C CA  . ASN C 3 102 ? -79.009  0.370   -1.900  1.00 0.00 ? 105 ASN M CA  1  
ATOM 3096   C C   . ASN C 3 102 ? -79.012  1.651   -1.164  1.00 0.00 ? 105 ASN M C   1  
ATOM 3097   O O   . ASN C 3 102 ? -80.032  2.238   -0.866  1.00 0.00 ? 105 ASN M O   1  
ATOM 3098   C CB  . ASN C 3 102 ? -79.049  -0.809  -0.964  1.00 0.00 ? 105 ASN M CB  1  
ATOM 3099   C CG  . ASN C 3 102 ? -80.343  -0.930  -0.134  1.00 0.00 ? 105 ASN M CG  1  
ATOM 3100   O OD1 . ASN C 3 102 ? -81.380  -1.424  -0.568  1.00 0.00 ? 105 ASN M OD1 1  
ATOM 3101   N ND2 . ASN C 3 102 ? -80.301  -0.518  1.096   1.00 0.00 ? 105 ASN M ND2 1  
ATOM 3102   N N   . LEU C 3 103 ? -77.832  2.083   -0.850  1.00 0.00 ? 106 LEU M N   1  
ATOM 3103   C CA  . LEU C 3 103 ? -77.684  3.298   -0.065  1.00 0.00 ? 106 LEU M CA  1  
ATOM 3104   C C   . LEU C 3 103 ? -78.252  4.391   -0.888  1.00 0.00 ? 106 LEU M C   1  
ATOM 3105   O O   . LEU C 3 103 ? -79.246  5.041   -0.537  1.00 0.00 ? 106 LEU M O   1  
ATOM 3106   C CB  . LEU C 3 103 ? -76.161  3.541   0.082   1.00 0.00 ? 106 LEU M CB  1  
ATOM 3107   C CG  . LEU C 3 103 ? -75.623  3.382   1.509   1.00 0.00 ? 106 LEU M CG  1  
ATOM 3108   C CD1 . LEU C 3 103 ? -76.530  2.481   2.360   1.00 0.00 ? 106 LEU M CD1 1  
ATOM 3109   C CD2 . LEU C 3 103 ? -74.226  2.853   1.394   1.00 0.00 ? 106 LEU M CD2 1  
ATOM 3110   N N   . LYS C 3 104 ? -77.666  4.469   -2.084  1.00 0.00 ? 107 LYS M N   1  
ATOM 3111   C CA  . LYS C 3 104 ? -78.029  5.436   -3.113  1.00 0.00 ? 107 LYS M CA  1  
ATOM 3112   C C   . LYS C 3 104 ? -79.514  5.533   -3.366  1.00 0.00 ? 107 LYS M C   1  
ATOM 3113   O O   . LYS C 3 104 ? -80.091  6.616   -3.358  1.00 0.00 ? 107 LYS M O   1  
ATOM 3114   C CB  . LYS C 3 104 ? -77.349  5.149   -4.453  1.00 0.00 ? 107 LYS M CB  1  
ATOM 3115   C CG  . LYS C 3 104 ? -77.693  6.165   -5.535  1.00 0.00 ? 107 LYS M CG  1  
ATOM 3116   C CD  . LYS C 3 104 ? -76.818  5.970   -6.798  1.00 0.00 ? 107 LYS M CD  1  
ATOM 3117   C CE  . LYS C 3 104 ? -76.945  7.124   -7.795  1.00 0.00 ? 107 LYS M CE  1  
ATOM 3118   N NZ  . LYS C 3 104 ? -76.284  6.868   -9.077  1.00 0.00 ? 107 LYS M NZ  1  
ATOM 3119   N N   . GLU C 3 105 ? -80.183  4.412   -3.562  1.00 0.00 ? 108 GLU M N   1  
ATOM 3120   C CA  . GLU C 3 105 ? -81.596  4.488   -3.847  1.00 0.00 ? 108 GLU M CA  1  
ATOM 3121   C C   . GLU C 3 105 ? -82.427  5.079   -2.739  1.00 0.00 ? 108 GLU M C   1  
ATOM 3122   O O   . GLU C 3 105 ? -83.306  5.882   -3.023  1.00 0.00 ? 108 GLU M O   1  
ATOM 3123   C CB  . GLU C 3 105 ? -82.184  3.204   -4.428  1.00 0.00 ? 108 GLU M CB  1  
ATOM 3124   C CG  . GLU C 3 105 ? -81.814  2.964   -5.920  1.00 0.00 ? 108 GLU M CG  1  
ATOM 3125   C CD  . GLU C 3 105 ? -81.921  1.519   -6.353  1.00 0.00 ? 108 GLU M CD  1  
ATOM 3126   O OE1 . GLU C 3 105 ? -82.645  0.730   -5.554  1.00 0.00 ? 108 GLU M OE1 1  
ATOM 3127   O OE2 . GLU C 3 105 ? -81.356  1.128   -7.361  1.00 0.00 ? 108 GLU M OE2 1  
ATOM 3128   N N   . ARG C 3 106 ? -82.120  4.710   -1.485  1.00 0.00 ? 109 ARG M N   1  
ATOM 3129   C CA  . ARG C 3 106 ? -82.914  5.196   -0.383  1.00 0.00 ? 109 ARG M CA  1  
ATOM 3130   C C   . ARG C 3 106 ? -82.579  6.556   0.068   1.00 0.00 ? 109 ARG M C   1  
ATOM 3131   O O   . ARG C 3 106 ? -83.151  7.079   1.038   1.00 0.00 ? 109 ARG M O   1  
ATOM 3132   C CB  . ARG C 3 106 ? -83.127  4.215   0.759   1.00 0.00 ? 109 ARG M CB  1  
ATOM 3133   C CG  . ARG C 3 106 ? -82.013  3.210   0.967   1.00 0.00 ? 109 ARG M CG  1  
ATOM 3134   C CD  . ARG C 3 106 ? -82.070  2.689   2.404   1.00 0.00 ? 109 ARG M CD  1  
ATOM 3135   N NE  . ARG C 3 106 ? -83.421  2.323   2.814   1.00 0.00 ? 109 ARG M NE  1  
ATOM 3136   C CZ  . ARG C 3 106 ? -83.928  2.620   3.977   1.00 0.00 ? 109 ARG M CZ  1  
ATOM 3137   N NH1 . ARG C 3 106 ? -83.184  3.250   4.860   1.00 0.00 ? 109 ARG M NH1 1  
ATOM 3138   N NH2 . ARG C 3 106 ? -85.188  2.241   4.340   1.00 0.00 ? 109 ARG M NH2 1  
ATOM 3139   N N   . TYR C 3 107 ? -81.682  7.150   -0.688  1.00 0.00 ? 110 TYR M N   1  
ATOM 3140   C CA  . TYR C 3 107 ? -81.188  8.482   -0.400  1.00 0.00 ? 110 TYR M CA  1  
ATOM 3141   C C   . TYR C 3 107 ? -81.880  9.420   -1.344  1.00 0.00 ? 110 TYR M C   1  
ATOM 3142   O O   . TYR C 3 107 ? -82.450  10.459  -0.978  1.00 0.00 ? 110 TYR M O   1  
ATOM 3143   C CB  . TYR C 3 107 ? -79.677  8.464   -0.589  1.00 0.00 ? 110 TYR M CB  1  
ATOM 3144   C CG  . TYR C 3 107 ? -79.015  9.794   -0.387  1.00 0.00 ? 110 TYR M CG  1  
ATOM 3145   C CD1 . TYR C 3 107 ? -79.129  10.452  0.831   1.00 0.00 ? 110 TYR M CD1 1  
ATOM 3146   C CD2 . TYR C 3 107 ? -78.300  10.394  -1.418  1.00 0.00 ? 110 TYR M CD2 1  
ATOM 3147   C CE1 . TYR C 3 107 ? -78.551  11.710  1.009   1.00 0.00 ? 110 TYR M CE1 1  
ATOM 3148   C CE2 . TYR C 3 107 ? -77.717  11.655  -1.256  1.00 0.00 ? 110 TYR M CE2 1  
ATOM 3149   C CZ  . TYR C 3 107 ? -77.834  12.307  -0.029  1.00 0.00 ? 110 TYR M CZ  1  
ATOM 3150   O OH  . TYR C 3 107 ? -77.243  13.532  0.168   1.00 0.00 ? 110 TYR M OH  1  
ATOM 3151   N N   . ALA C 3 108 ? -81.975  8.952   -2.586  1.00 0.00 ? 111 ALA M N   1  
ATOM 3152   C CA  . ALA C 3 108 ? -82.676  9.683   -3.639  1.00 0.00 ? 111 ALA M CA  1  
ATOM 3153   C C   . ALA C 3 108 ? -84.150  9.798   -3.252  1.00 0.00 ? 111 ALA M C   1  
ATOM 3154   O O   . ALA C 3 108 ? -84.916  10.485  -3.877  1.00 0.00 ? 111 ALA M O   1  
ATOM 3155   C CB  . ALA C 3 108 ? -82.570  8.903   -4.931  1.00 0.00 ? 111 ALA M CB  1  
ATOM 3156   N N   . ALA C 3 109 ? -84.499  9.034   -2.205  1.00 0.00 ? 112 ALA M N   1  
ATOM 3157   C CA  . ALA C 3 109 ? -85.820  8.993   -1.665  1.00 0.00 ? 112 ALA M CA  1  
ATOM 3158   C C   . ALA C 3 109 ? -85.810  9.658   -0.326  1.00 0.00 ? 112 ALA M C   1  
ATOM 3159   O O   . ALA C 3 109 ? -86.770  9.656   0.449   1.00 0.00 ? 112 ALA M O   1  
ATOM 3160   C CB  . ALA C 3 109 ? -86.301  7.580   -1.515  1.00 0.00 ? 112 ALA M CB  1  
ATOM 3161   N N   . TRP C 3 110 ? -84.675  10.241  -0.060  1.00 0.00 ? 113 TRP M N   1  
ATOM 3162   C CA  . TRP C 3 110 ? -84.492  10.947  1.189   1.00 0.00 ? 113 TRP M CA  1  
ATOM 3163   C C   . TRP C 3 110 ? -84.530  10.089  2.401   1.00 0.00 ? 113 TRP M C   1  
ATOM 3164   O O   . TRP C 3 110 ? -84.970  10.517  3.445   1.00 0.00 ? 113 TRP M O   1  
ATOM 3165   C CB  . TRP C 3 110 ? -85.221  12.257  1.298   1.00 0.00 ? 113 TRP M CB  1  
ATOM 3166   C CG  . TRP C 3 110 ? -84.528  13.278  0.447   1.00 0.00 ? 113 TRP M CG  1  
ATOM 3167   C CD1 . TRP C 3 110 ? -83.262  13.771  0.597   1.00 0.00 ? 113 TRP M CD1 1  
ATOM 3168   C CD2 . TRP C 3 110 ? -85.061  13.906  -0.713  1.00 0.00 ? 113 TRP M CD2 1  
ATOM 3169   N NE1 . TRP C 3 110 ? -82.984  14.699  -0.393  1.00 0.00 ? 113 TRP M NE1 1  
ATOM 3170   C CE2 . TRP C 3 110 ? -84.063  14.787  -1.219  1.00 0.00 ? 113 TRP M CE2 1  
ATOM 3171   C CE3 . TRP C 3 110 ? -86.261  13.776  -1.384  1.00 0.00 ? 113 TRP M CE3 1  
ATOM 3172   C CZ2 . TRP C 3 110 ? -84.256  15.526  -2.375  1.00 0.00 ? 113 TRP M CZ2 1  
ATOM 3173   C CZ3 . TRP C 3 110 ? -86.468  14.518  -2.530  1.00 0.00 ? 113 TRP M CZ3 1  
ATOM 3174   C CH2 . TRP C 3 110 ? -85.474  15.384  -3.020  1.00 0.00 ? 113 TRP M CH2 1  
ATOM 3175   N N   . MET C 3 111 ? -83.983  8.878   2.334   1.00 0.00 ? 114 MET M N   1  
ATOM 3176   C CA  . MET C 3 111 ? -83.818  8.140   3.557   1.00 0.00 ? 114 MET M CA  1  
ATOM 3177   C C   . MET C 3 111 ? -82.309  8.078   3.887   1.00 0.00 ? 114 MET M C   1  
ATOM 3178   O O   . MET C 3 111 ? -81.450  7.538   3.145   1.00 0.00 ? 114 MET M O   1  
ATOM 3179   C CB  . MET C 3 111 ? -84.528  6.854   3.597   1.00 0.00 ? 114 MET M CB  1  
ATOM 3180   C CG  . MET C 3 111 ? -86.029  6.934   3.350   1.00 0.00 ? 114 MET M CG  1  
ATOM 3181   S SD  . MET C 3 111 ? -86.469  5.883   1.948   1.00 0.00 ? 114 MET M SD  1  
ATOM 3182   C CE  . MET C 3 111 ? -87.367  4.646   2.836   1.00 0.00 ? 114 MET M CE  1  
ATOM 3183   N N   . ILE C 3 112 ? -81.939  8.774   4.947   1.00 0.00 ? 115 ILE M N   1  
ATOM 3184   C CA  . ILE C 3 112 ? -80.544  8.855   5.339   1.00 0.00 ? 115 ILE M CA  1  
ATOM 3185   C C   . ILE C 3 112 ? -80.059  7.723   6.227   1.00 0.00 ? 115 ILE M C   1  
ATOM 3186   O O   . ILE C 3 112 ? -78.872  7.515   6.355   1.00 0.00 ? 115 ILE M O   1  
ATOM 3187   C CB  . ILE C 3 112 ? -80.219  10.178  5.980   1.00 0.00 ? 115 ILE M CB  1  
ATOM 3188   C CG1 . ILE C 3 112 ? -80.933  10.313  7.296   1.00 0.00 ? 115 ILE M CG1 1  
ATOM 3189   C CG2 . ILE C 3 112 ? -80.576  11.299  5.045   1.00 0.00 ? 115 ILE M CG2 1  
ATOM 3190   C CD1 . ILE C 3 112 ? -80.626  11.672  7.940   1.00 0.00 ? 115 ILE M CD1 1  
ATOM 3191   N N   . TYR C 3 113 ? -80.957  6.999   6.838   1.00 0.00 ? 116 TYR M N   1  
ATOM 3192   C CA  . TYR C 3 113 ? -80.555  5.916   7.681   1.00 0.00 ? 116 TYR M CA  1  
ATOM 3193   C C   . TYR C 3 113 ? -80.883  4.572   7.187   1.00 0.00 ? 116 TYR M C   1  
ATOM 3194   O O   . TYR C 3 113 ? -82.012  4.132   7.255   1.00 0.00 ? 116 TYR M O   1  
ATOM 3195   C CB  . TYR C 3 113 ? -81.225  5.939   9.048   1.00 0.00 ? 116 TYR M CB  1  
ATOM 3196   C CG  . TYR C 3 113 ? -80.899  7.246   9.642   1.00 0.00 ? 116 TYR M CG  1  
ATOM 3197   C CD1 . TYR C 3 113 ? -79.582  7.626   9.883   1.00 0.00 ? 116 TYR M CD1 1  
ATOM 3198   C CD2 . TYR C 3 113 ? -81.920  8.124   9.963   1.00 0.00 ? 116 TYR M CD2 1  
ATOM 3199   C CE1 . TYR C 3 113 ? -79.277  8.841   10.483  1.00 0.00 ? 116 TYR M CE1 1  
ATOM 3200   C CE2 . TYR C 3 113 ? -81.598  9.385   10.462  1.00 0.00 ? 116 TYR M CE2 1  
ATOM 3201   C CZ  . TYR C 3 113 ? -80.311  9.711   10.822  1.00 0.00 ? 116 TYR M CZ  1  
ATOM 3202   O OH  . TYR C 3 113 ? -80.037  10.952  11.375  1.00 0.00 ? 116 TYR M OH  1  
ATOM 3203   N N   . THR C 3 114 ? -79.822  3.912   6.795   1.00 0.00 ? 117 THR M N   1  
ATOM 3204   C CA  . THR C 3 114 ? -79.933  2.545   6.359   1.00 0.00 ? 117 THR M CA  1  
ATOM 3205   C C   . THR C 3 114 ? -78.932  1.672   7.137   1.00 0.00 ? 117 THR M C   1  
ATOM 3206   O O   . THR C 3 114 ? -77.851  2.097   7.415   1.00 0.00 ? 117 THR M O   1  
ATOM 3207   C CB  . THR C 3 114 ? -79.744  2.591   4.833   1.00 0.00 ? 117 THR M CB  1  
ATOM 3208   O OG1 . THR C 3 114 ? -79.181  1.408   4.368   1.00 0.00 ? 117 THR M OG1 1  
ATOM 3209   C CG2 . THR C 3 114 ? -78.882  3.776   4.448   1.00 0.00 ? 117 THR M CG2 1  
ATOM 3210   N N   . TYR C 3 115 ? -79.298  0.482   7.649   1.00 0.00 ? 118 TYR M N   1  
ATOM 3211   C CA  . TYR C 3 115 ? -78.352  -0.375  8.402   1.00 0.00 ? 118 TYR M CA  1  
ATOM 3212   C C   . TYR C 3 115 ? -77.629  -1.321  7.475   1.00 0.00 ? 118 TYR M C   1  
ATOM 3213   O O   . TYR C 3 115 ? -78.192  -1.709  6.436   1.00 0.00 ? 118 TYR M O   1  
ATOM 3214   C CB  . TYR C 3 115 ? -78.966  -1.328  9.380   1.00 0.00 ? 118 TYR M CB  1  
ATOM 3215   C CG  . TYR C 3 115 ? -79.876  -0.794  10.462  1.00 0.00 ? 118 TYR M CG  1  
ATOM 3216   C CD1 . TYR C 3 115 ? -79.328  -0.067  11.505  1.00 0.00 ? 118 TYR M CD1 1  
ATOM 3217   C CD2 . TYR C 3 115 ? -81.237  -1.082  10.480  1.00 0.00 ? 118 TYR M CD2 1  
ATOM 3218   C CE1 . TYR C 3 115 ? -80.144  0.426   12.522  1.00 0.00 ? 118 TYR M CE1 1  
ATOM 3219   C CE2 . TYR C 3 115 ? -82.069  -0.602  11.477  1.00 0.00 ? 118 TYR M CE2 1  
ATOM 3220   C CZ  . TYR C 3 115 ? -81.506  0.167   12.510  1.00 0.00 ? 118 TYR M CZ  1  
ATOM 3221   O OH  . TYR C 3 115 ? -82.328  0.673   13.557  1.00 0.00 ? 118 TYR M OH  1  
ATOM 3222   N N   . SER C 3 116 ? -76.380  -1.692  7.852   1.00 0.00 ? 119 SER M N   1  
ATOM 3223   C CA  . SER C 3 116 ? -75.540  -2.619  7.064   1.00 0.00 ? 119 SER M CA  1  
ATOM 3224   C C   . SER C 3 116 ? -74.924  -3.633  7.953   1.00 0.00 ? 119 SER M C   1  
ATOM 3225   O O   . SER C 3 116 ? -73.738  -3.781  8.044   1.00 0.00 ? 119 SER M O   1  
ATOM 3226   C CB  . SER C 3 116 ? -74.515  -2.004  6.181   1.00 0.00 ? 119 SER M CB  1  
ATOM 3227   O OG  . SER C 3 116 ? -73.688  -3.009  5.650   1.00 0.00 ? 119 SER M OG  1  
ATOM 3228   N N   . GLY C 3 117 ? -75.748  -4.320  8.689   1.00 0.00 ? 120 GLY M N   1  
ATOM 3229   C CA  . GLY C 3 117 ? -75.290  -5.286  9.601   1.00 0.00 ? 120 GLY M CA  1  
ATOM 3230   C C   . GLY C 3 117 ? -75.529  -4.728  10.945  1.00 0.00 ? 120 GLY M C   1  
ATOM 3231   O O   . GLY C 3 117 ? -76.637  -4.662  11.419  1.00 0.00 ? 120 GLY M O   1  
ATOM 3232   N N   . LEU C 3 118 ? -74.475  -4.337  11.588  1.00 0.00 ? 121 LEU M N   1  
ATOM 3233   C CA  . LEU C 3 118 ? -74.616  -3.812  12.922  1.00 0.00 ? 121 LEU M CA  1  
ATOM 3234   C C   . LEU C 3 118 ? -74.563  -2.326  12.831  1.00 0.00 ? 121 LEU M C   1  
ATOM 3235   O O   . LEU C 3 118 ? -74.990  -1.574  13.719  1.00 0.00 ? 121 LEU M O   1  
ATOM 3236   C CB  . LEU C 3 118 ? -73.431  -4.233  13.784  1.00 0.00 ? 121 LEU M CB  1  
ATOM 3237   C CG  . LEU C 3 118 ? -73.564  -5.618  14.391  1.00 0.00 ? 121 LEU M CG  1  
ATOM 3238   C CD1 . LEU C 3 118 ? -72.300  -6.419  14.185  1.00 0.00 ? 121 LEU M CD1 1  
ATOM 3239   C CD2 . LEU C 3 118 ? -73.692  -5.515  15.890  1.00 0.00 ? 121 LEU M CD2 1  
ATOM 3240   N N   . PHE C 3 119 ? -73.944  -1.926  11.743  1.00 0.00 ? 122 PHE M N   1  
ATOM 3241   C CA  . PHE C 3 119 ? -73.795  -0.519  11.508  1.00 0.00 ? 122 PHE M CA  1  
ATOM 3242   C C   . PHE C 3 119 ? -75.060  0.206   11.303  1.00 0.00 ? 122 PHE M C   1  
ATOM 3243   O O   . PHE C 3 119 ? -76.075  -0.297  10.903  1.00 0.00 ? 122 PHE M O   1  
ATOM 3244   C CB  . PHE C 3 119 ? -73.039  -0.306  10.227  1.00 0.00 ? 122 PHE M CB  1  
ATOM 3245   C CG  . PHE C 3 119 ? -71.671  -0.899  10.297  1.00 0.00 ? 122 PHE M CG  1  
ATOM 3246   C CD1 . PHE C 3 119 ? -70.832  -0.599  11.358  1.00 0.00 ? 122 PHE M CD1 1  
ATOM 3247   C CD2 . PHE C 3 119 ? -71.204  -1.728  9.273   1.00 0.00 ? 122 PHE M CD2 1  
ATOM 3248   C CE1 . PHE C 3 119 ? -69.536  -1.141  11.405  1.00 0.00 ? 122 PHE M CE1 1  
ATOM 3249   C CE2 . PHE C 3 119 ? -69.925  -2.284  9.301   1.00 0.00 ? 122 PHE M CE2 1  
ATOM 3250   C CZ  . PHE C 3 119 ? -69.094  -1.983  10.384  1.00 0.00 ? 122 PHE M CZ  1  
ATOM 3251   N N   . CYS C 3 120 ? -74.934  1.468   11.406  1.00 0.00 ? 123 CYS M N   1  
ATOM 3252   C CA  . CYS C 3 120 ? -76.011  2.371   11.171  1.00 0.00 ? 123 CYS M CA  1  
ATOM 3253   C C   . CYS C 3 120 ? -75.479  3.407   10.250  1.00 0.00 ? 123 CYS M C   1  
ATOM 3254   O O   . CYS C 3 120 ? -74.945  4.395   10.631  1.00 0.00 ? 123 CYS M O   1  
ATOM 3255   C CB  . CYS C 3 120 ? -76.607  2.979   12.412  1.00 0.00 ? 123 CYS M CB  1  
ATOM 3256   S SG  . CYS C 3 120 ? -77.855  4.116   11.940  1.00 0.00 ? 123 CYS M SG  1  
ATOM 3257   N N   . VAL C 3 121 ? -75.579  3.102   8.977   1.00 0.00 ? 124 VAL M N   1  
ATOM 3258   C CA  . VAL C 3 121 ? -75.118  4.041   8.035   1.00 0.00 ? 124 VAL M CA  1  
ATOM 3259   C C   . VAL C 3 121 ? -75.912  5.311   8.095   1.00 0.00 ? 124 VAL M C   1  
ATOM 3260   O O   . VAL C 3 121 ? -77.080  5.283   8.374   1.00 0.00 ? 124 VAL M O   1  
ATOM 3261   C CB  . VAL C 3 121 ? -75.039  3.384   6.687   1.00 0.00 ? 124 VAL M CB  1  
ATOM 3262   C CG1 . VAL C 3 121 ? -74.238  4.213   5.711   1.00 0.00 ? 124 VAL M CG1 1  
ATOM 3263   C CG2 . VAL C 3 121 ? -74.382  2.027   6.816   1.00 0.00 ? 124 VAL M CG2 1  
ATOM 3264   N N   . THR C 3 122 ? -75.265  6.439   7.872   1.00 0.00 ? 125 THR M N   1  
ATOM 3265   C CA  . THR C 3 122 ? -75.896  7.775   7.882   1.00 0.00 ? 125 THR M CA  1  
ATOM 3266   C C   . THR C 3 122 ? -75.332  8.649   6.780   1.00 0.00 ? 125 THR M C   1  
ATOM 3267   O O   . THR C 3 122 ? -74.149  8.922   6.677   1.00 0.00 ? 125 THR M O   1  
ATOM 3268   C CB  . THR C 3 122 ? -75.634  8.547   9.162   1.00 0.00 ? 125 THR M CB  1  
ATOM 3269   O OG1 . THR C 3 122 ? -76.569  8.142   10.108  1.00 0.00 ? 125 THR M OG1 1  
ATOM 3270   C CG2 . THR C 3 122 ? -75.812  10.012  8.786   1.00 0.00 ? 125 THR M CG2 1  
ATOM 3271   N N   . VAL C 3 123 ? -76.213  9.157   5.965   1.00 0.00 ? 126 VAL M N   1  
ATOM 3272   C CA  . VAL C 3 123 ? -75.783  10.002  4.862   1.00 0.00 ? 126 VAL M CA  1  
ATOM 3273   C C   . VAL C 3 123 ? -76.189  11.452  5.050   1.00 0.00 ? 126 VAL M C   1  
ATOM 3274   O O   . VAL C 3 123 ? -77.339  11.726  5.415   1.00 0.00 ? 126 VAL M O   1  
ATOM 3275   C CB  . VAL C 3 123 ? -76.298  9.422   3.589   1.00 0.00 ? 126 VAL M CB  1  
ATOM 3276   C CG1 . VAL C 3 123 ? -75.339  9.673   2.466   1.00 0.00 ? 126 VAL M CG1 1  
ATOM 3277   C CG2 . VAL C 3 123 ? -76.453  7.915   3.746   1.00 0.00 ? 126 VAL M CG2 1  
ATOM 3278   N N   . ASN C 3 124 ? -75.227  12.374  4.808   1.00 0.00 ? 127 ASN M N   1  
ATOM 3279   C CA  . ASN C 3 124 ? -75.464  13.807  4.954   1.00 0.00 ? 127 ASN M CA  1  
ATOM 3280   C C   . ASN C 3 124 ? -76.602  14.327  4.085   1.00 0.00 ? 127 ASN M C   1  
ATOM 3281   O O   . ASN C 3 124 ? -76.518  14.330  2.862   1.00 0.00 ? 127 ASN M O   1  
ATOM 3282   C CB  . ASN C 3 124 ? -74.178  14.592  4.696   1.00 0.00 ? 127 ASN M CB  1  
ATOM 3283   C CG  . ASN C 3 124 ? -74.101  15.844  5.567   1.00 0.00 ? 127 ASN M CG  1  
ATOM 3284   O OD1 . ASN C 3 124 ? -73.036  16.518  5.631   1.00 0.00 ? 127 ASN M OD1 1  
ATOM 3285   N ND2 . ASN C 3 124 ? -75.260  16.168  6.189   1.00 0.00 ? 127 ASN M ND2 1  
ATOM 3286   N N   . PRO C 3 125 ? -77.696  14.792  4.689   1.00 0.00 ? 128 PRO M N   1  
ATOM 3287   C CA  . PRO C 3 125 ? -78.817  15.249  3.893   1.00 0.00 ? 128 PRO M CA  1  
ATOM 3288   C C   . PRO C 3 125 ? -78.482  16.457  3.037   1.00 0.00 ? 128 PRO M C   1  
ATOM 3289   O O   . PRO C 3 125 ? -78.834  16.561  1.856   1.00 0.00 ? 128 PRO M O   1  
ATOM 3290   C CB  . PRO C 3 125 ? -79.956  15.613  4.844   1.00 0.00 ? 128 PRO M CB  1  
ATOM 3291   C CG  . PRO C 3 125 ? -79.403  15.492  6.251   1.00 0.00 ? 128 PRO M CG  1  
ATOM 3292   C CD  . PRO C 3 125 ? -77.958  15.006  6.127   1.00 0.00 ? 128 PRO M CD  1  
ATOM 3293   N N   . TYR C 3 126 ? -77.833  17.388  3.643   1.00 0.00 ? 129 TYR M N   1  
ATOM 3294   C CA  . TYR C 3 126 ? -77.428  18.640  3.007   1.00 0.00 ? 129 TYR M CA  1  
ATOM 3295   C C   . TYR C 3 126 ? -78.559  19.584  2.872   1.00 0.00 ? 129 TYR M C   1  
ATOM 3296   O O   . TYR C 3 126 ? -78.514  20.586  2.106   1.00 0.00 ? 129 TYR M O   1  
ATOM 3297   C CB  . TYR C 3 126 ? -76.787  18.441  1.669   1.00 0.00 ? 129 TYR M CB  1  
ATOM 3298   C CG  . TYR C 3 126 ? -75.379  18.085  1.911   1.00 0.00 ? 129 TYR M CG  1  
ATOM 3299   C CD1 . TYR C 3 126 ? -74.695  18.540  3.028   1.00 0.00 ? 129 TYR M CD1 1  
ATOM 3300   C CD2 . TYR C 3 126 ? -74.770  17.247  0.990   1.00 0.00 ? 129 TYR M CD2 1  
ATOM 3301   C CE1 . TYR C 3 126 ? -73.372  18.142  3.256   1.00 0.00 ? 129 TYR M CE1 1  
ATOM 3302   C CE2 . TYR C 3 126 ? -73.447  16.859  1.190   1.00 0.00 ? 129 TYR M CE2 1  
ATOM 3303   C CZ  . TYR C 3 126 ? -72.761  17.314  2.314   1.00 0.00 ? 129 TYR M CZ  1  
ATOM 3304   O OH  . TYR C 3 126 ? -71.464  16.907  2.541   1.00 0.00 ? 129 TYR M OH  1  
ATOM 3305   N N   . LYS C 3 127 ? -79.529  19.271  3.680   1.00 0.00 ? 130 LYS M N   1  
ATOM 3306   C CA  . LYS C 3 127 ? -80.739  20.027  3.783   1.00 0.00 ? 130 LYS M CA  1  
ATOM 3307   C C   . LYS C 3 127 ? -81.432  19.655  5.088   1.00 0.00 ? 130 LYS M C   1  
ATOM 3308   O O   . LYS C 3 127 ? -80.902  18.853  5.828   1.00 0.00 ? 130 LYS M O   1  
ATOM 3309   C CB  . LYS C 3 127 ? -81.579  19.900  2.532   1.00 0.00 ? 130 LYS M CB  1  
ATOM 3310   C CG  . LYS C 3 127 ? -82.792  18.990  2.616   1.00 0.00 ? 130 LYS M CG  1  
ATOM 3311   C CD  . LYS C 3 127 ? -83.575  19.076  1.309   1.00 0.00 ? 130 LYS M CD  1  
ATOM 3312   C CE  . LYS C 3 127 ? -84.655  18.040  1.146   1.00 0.00 ? 130 LYS M CE  1  
ATOM 3313   N NZ  . LYS C 3 127 ? -85.879  18.627  0.620   1.00 0.00 ? 130 LYS M NZ  1  
ATOM 3314   N N   . TRP C 3 128 ? -82.599  20.228  5.393   1.00 0.00 ? 131 TRP M N   1  
ATOM 3315   C CA  . TRP C 3 128 ? -83.294  19.977  6.664   1.00 0.00 ? 131 TRP M CA  1  
ATOM 3316   C C   . TRP C 3 128 ? -84.318  18.858  6.617   1.00 0.00 ? 131 TRP M C   1  
ATOM 3317   O O   . TRP C 3 128 ? -84.988  18.668  5.623   1.00 0.00 ? 131 TRP M O   1  
ATOM 3318   C CB  . TRP C 3 128 ? -83.951  21.222  7.307   1.00 0.00 ? 131 TRP M CB  1  
ATOM 3319   C CG  . TRP C 3 128 ? -84.455  21.042  8.739   1.00 0.00 ? 131 TRP M CG  1  
ATOM 3320   C CD1 . TRP C 3 128 ? -83.745  21.206  9.883   1.00 0.00 ? 131 TRP M CD1 1  
ATOM 3321   C CD2 . TRP C 3 128 ? -85.773  20.679  9.163   1.00 0.00 ? 131 TRP M CD2 1  
ATOM 3322   N NE1 . TRP C 3 128 ? -84.510  20.951  10.987  1.00 0.00 ? 131 TRP M NE1 1  
ATOM 3323   C CE2 . TRP C 3 128 ? -85.757  20.611  10.572  1.00 0.00 ? 131 TRP M CE2 1  
ATOM 3324   C CE3 . TRP C 3 128 ? -86.937  20.329  8.470   1.00 0.00 ? 131 TRP M CE3 1  
ATOM 3325   C CZ2 . TRP C 3 128 ? -86.877  20.251  11.318  1.00 0.00 ? 131 TRP M CZ2 1  
ATOM 3326   C CZ3 . TRP C 3 128 ? -88.049  20.013  9.223   1.00 0.00 ? 131 TRP M CZ3 1  
ATOM 3327   C CH2 . TRP C 3 128 ? -88.020  19.963  10.623  1.00 0.00 ? 131 TRP M CH2 1  
ATOM 3328   N N   . LEU C 3 129 ? -84.445  18.173  7.762   1.00 0.00 ? 132 LEU M N   1  
ATOM 3329   C CA  . LEU C 3 129 ? -85.374  17.054  7.862   1.00 0.00 ? 132 LEU M CA  1  
ATOM 3330   C C   . LEU C 3 129 ? -86.066  17.003  9.246   1.00 0.00 ? 132 LEU M C   1  
ATOM 3331   O O   . LEU C 3 129 ? -85.500  17.282  10.320  1.00 0.00 ? 132 LEU M O   1  
ATOM 3332   C CB  . LEU C 3 129 ? -84.667  15.715  7.579   1.00 0.00 ? 132 LEU M CB  1  
ATOM 3333   C CG  . LEU C 3 129 ? -84.497  15.365  6.117   1.00 0.00 ? 132 LEU M CG  1  
ATOM 3334   C CD1 . LEU C 3 129 ? -83.477  16.235  5.461   1.00 0.00 ? 132 LEU M CD1 1  
ATOM 3335   C CD2 . LEU C 3 129 ? -83.916  13.949  6.047   1.00 0.00 ? 132 LEU M CD2 1  
ATOM 3336   N N   . PRO C 3 130 ? -87.329  16.592  9.209   1.00 0.00 ? 133 PRO M N   1  
ATOM 3337   C CA  . PRO C 3 130 ? -88.128  16.446  10.412  1.00 0.00 ? 133 PRO M CA  1  
ATOM 3338   C C   . PRO C 3 130 ? -87.715  15.251  11.212  1.00 0.00 ? 133 PRO M C   1  
ATOM 3339   O O   . PRO C 3 130 ? -88.510  14.770  11.995  1.00 0.00 ? 133 PRO M O   1  
ATOM 3340   C CB  . PRO C 3 130 ? -89.527  16.087  9.927   1.00 0.00 ? 133 PRO M CB  1  
ATOM 3341   C CG  . PRO C 3 130 ? -89.406  15.691  8.424   1.00 0.00 ? 133 PRO M CG  1  
ATOM 3342   C CD  . PRO C 3 130 ? -88.057  16.196  7.944   1.00 0.00 ? 133 PRO M CD  1  
ATOM 3343   N N   . VAL C 3 131 ? -86.519  14.739  10.988  1.00 0.00 ? 134 VAL M N   1  
ATOM 3344   C CA  . VAL C 3 131 ? -86.098  13.521  11.671  1.00 0.00 ? 134 VAL M CA  1  
ATOM 3345   C C   . VAL C 3 131 ? -85.691  13.674  13.111  1.00 0.00 ? 134 VAL M C   1  
ATOM 3346   O O   . VAL C 3 131 ? -85.793  12.773  13.925  1.00 0.00 ? 134 VAL M O   1  
ATOM 3347   C CB  . VAL C 3 131 ? -84.959  12.895  10.940  1.00 0.00 ? 134 VAL M CB  1  
ATOM 3348   C CG1 . VAL C 3 131 ? -84.421  11.705  11.732  1.00 0.00 ? 134 VAL M CG1 1  
ATOM 3349   C CG2 . VAL C 3 131 ? -85.433  12.468  9.544   1.00 0.00 ? 134 VAL M CG2 1  
ATOM 3350   N N   . TYR C 3 132 ? -85.171  14.833  13.434  1.00 0.00 ? 135 TYR M N   1  
ATOM 3351   C CA  . TYR C 3 132 ? -84.643  15.025  14.745  1.00 0.00 ? 135 TYR M CA  1  
ATOM 3352   C C   . TYR C 3 132 ? -85.767  15.478  15.616  1.00 0.00 ? 135 TYR M C   1  
ATOM 3353   O O   . TYR C 3 132 ? -85.597  15.835  16.794  1.00 0.00 ? 135 TYR M O   1  
ATOM 3354   C CB  . TYR C 3 132 ? -83.445  15.973  14.617  1.00 0.00 ? 135 TYR M CB  1  
ATOM 3355   C CG  . TYR C 3 132 ? -82.343  15.327  13.806  1.00 0.00 ? 135 TYR M CG  1  
ATOM 3356   C CD1 . TYR C 3 132 ? -82.614  14.696  12.592  1.00 0.00 ? 135 TYR M CD1 1  
ATOM 3357   C CD2 . TYR C 3 132 ? -81.012  15.351  14.226  1.00 0.00 ? 135 TYR M CD2 1  
ATOM 3358   C CE1 . TYR C 3 132 ? -81.649  14.077  11.809  1.00 0.00 ? 135 TYR M CE1 1  
ATOM 3359   C CE2 . TYR C 3 132 ? -80.018  14.754  13.456  1.00 0.00 ? 135 TYR M CE2 1  
ATOM 3360   C CZ  . TYR C 3 132 ? -80.333  14.115  12.269  1.00 0.00 ? 135 TYR M CZ  1  
ATOM 3361   O OH  . TYR C 3 132 ? -79.321  13.539  11.551  1.00 0.00 ? 135 TYR M OH  1  
ATOM 3362   N N   . ASN C 3 133 ? -86.917  15.374  14.954  1.00 0.00 ? 136 ASN M N   1  
ATOM 3363   C CA  . ASN C 3 133 ? -88.237  15.710  15.470  1.00 0.00 ? 136 ASN M CA  1  
ATOM 3364   C C   . ASN C 3 133 ? -88.589  15.077  16.760  1.00 0.00 ? 136 ASN M C   1  
ATOM 3365   O O   . ASN C 3 133 ? -88.679  13.856  16.945  1.00 0.00 ? 136 ASN M O   1  
ATOM 3366   C CB  . ASN C 3 133 ? -89.408  15.376  14.543  1.00 0.00 ? 136 ASN M CB  1  
ATOM 3367   C CG  . ASN C 3 133 ? -89.956  16.587  13.861  1.00 0.00 ? 136 ASN M CG  1  
ATOM 3368   O OD1 . ASN C 3 133 ? -91.154  16.660  13.650  1.00 0.00 ? 136 ASN M OD1 1  
ATOM 3369   N ND2 . ASN C 3 133 ? -89.040  17.524  13.526  1.00 0.00 ? 136 ASN M ND2 1  
ATOM 3370   N N   . PRO C 3 134 ? -88.959  16.004  17.579  1.00 0.00 ? 137 PRO M N   1  
ATOM 3371   C CA  . PRO C 3 134 ? -89.350  15.831  18.936  1.00 0.00 ? 137 PRO M CA  1  
ATOM 3372   C C   . PRO C 3 134 ? -90.467  14.825  19.047  1.00 0.00 ? 137 PRO M C   1  
ATOM 3373   O O   . PRO C 3 134 ? -90.832  14.487  20.144  1.00 0.00 ? 137 PRO M O   1  
ATOM 3374   C CB  . PRO C 3 134 ? -89.854  17.181  19.369  1.00 0.00 ? 137 PRO M CB  1  
ATOM 3375   C CG  . PRO C 3 134 ? -89.999  18.033  18.106  1.00 0.00 ? 137 PRO M CG  1  
ATOM 3376   C CD  . PRO C 3 134 ? -89.563  17.176  16.934  1.00 0.00 ? 137 PRO M CD  1  
ATOM 3377   N N   . LYS C 3 135 ? -90.964  14.333  17.941  1.00 0.00 ? 138 LYS M N   1  
ATOM 3378   C CA  . LYS C 3 135 ? -92.003  13.326  18.068  1.00 0.00 ? 138 LYS M CA  1  
ATOM 3379   C C   . LYS C 3 135 ? -91.350  12.010  17.942  1.00 0.00 ? 138 LYS M C   1  
ATOM 3380   O O   . LYS C 3 135 ? -91.762  10.981  18.489  1.00 0.00 ? 138 LYS M O   1  
ATOM 3381   C CB  . LYS C 3 135 ? -92.903  13.262  16.894  1.00 0.00 ? 138 LYS M CB  1  
ATOM 3382   C CG  . LYS C 3 135 ? -93.684  14.502  16.717  1.00 0.00 ? 138 LYS M CG  1  
ATOM 3383   C CD  . LYS C 3 135 ? -93.729  14.843  15.267  1.00 0.00 ? 138 LYS M CD  1  
ATOM 3384   C CE  . LYS C 3 135 ? -94.614  16.056  15.116  1.00 0.00 ? 138 LYS M CE  1  
ATOM 3385   N NZ  . LYS C 3 135 ? -95.614  15.867  14.077  1.00 0.00 ? 138 LYS M NZ  1  
ATOM 3386   N N   . VAL C 3 136 ? -90.327  12.028  17.108  1.00 0.00 ? 139 VAL M N   1  
ATOM 3387   C CA  . VAL C 3 136 ? -89.597  10.828  16.803  1.00 0.00 ? 139 VAL M CA  1  
ATOM 3388   C C   . VAL C 3 136 ? -88.933  10.237  18.018  1.00 0.00 ? 139 VAL M C   1  
ATOM 3389   O O   . VAL C 3 136 ? -89.033  9.044   18.253  1.00 0.00 ? 139 VAL M O   1  
ATOM 3390   C CB  . VAL C 3 136 ? -88.592  11.065  15.736  1.00 0.00 ? 139 VAL M CB  1  
ATOM 3391   C CG1 . VAL C 3 136 ? -87.942  9.710   15.449  1.00 0.00 ? 139 VAL M CG1 1  
ATOM 3392   C CG2 . VAL C 3 136 ? -89.306  11.632  14.507  1.00 0.00 ? 139 VAL M CG2 1  
ATOM 3393   N N   . VAL C 3 137 ? -88.283  11.152  18.730  1.00 0.00 ? 140 VAL M N   1  
ATOM 3394   C CA  . VAL C 3 137 ? -87.587  10.879  19.947  1.00 0.00 ? 140 VAL M CA  1  
ATOM 3395   C C   . VAL C 3 137 ? -88.358  9.892   20.824  1.00 0.00 ? 140 VAL M C   1  
ATOM 3396   O O   . VAL C 3 137 ? -87.817  8.879   21.300  1.00 0.00 ? 140 VAL M O   1  
ATOM 3397   C CB  . VAL C 3 137 ? -87.346  12.236  20.609  1.00 0.00 ? 140 VAL M CB  1  
ATOM 3398   C CG1 . VAL C 3 137 ? -87.245  12.044  22.082  1.00 0.00 ? 140 VAL M CG1 1  
ATOM 3399   C CG2 . VAL C 3 137 ? -86.060  12.906  20.080  1.00 0.00 ? 140 VAL M CG2 1  
ATOM 3400   N N   . LEU C 3 138 ? -89.663  10.139  20.969  1.00 0.00 ? 141 LEU M N   1  
ATOM 3401   C CA  . LEU C 3 138 ? -90.546  9.291   21.765  1.00 0.00 ? 141 LEU M CA  1  
ATOM 3402   C C   . LEU C 3 138 ? -90.786  7.989   21.084  1.00 0.00 ? 141 LEU M C   1  
ATOM 3403   O O   . LEU C 3 138 ? -90.837  6.928   21.696  1.00 0.00 ? 141 LEU M O   1  
ATOM 3404   C CB  . LEU C 3 138 ? -92.009  9.799   21.771  1.00 0.00 ? 141 LEU M CB  1  
ATOM 3405   C CG  . LEU C 3 138 ? -92.244  11.149  22.406  1.00 0.00 ? 141 LEU M CG  1  
ATOM 3406   C CD1 . LEU C 3 138 ? -91.829  12.213  21.397  1.00 0.00 ? 141 LEU M CD1 1  
ATOM 3407   C CD2 . LEU C 3 138 ? -93.732  11.231  22.753  1.00 0.00 ? 141 LEU M CD2 1  
ATOM 3408   N N   . ALA C 3 139 ? -91.060  8.137   19.799  1.00 0.00 ? 142 ALA M N   1  
ATOM 3409   C CA  . ALA C 3 139 ? -91.383  7.014   18.966  1.00 0.00 ? 142 ALA M CA  1  
ATOM 3410   C C   . ALA C 3 139 ? -90.372  5.900   19.073  1.00 0.00 ? 142 ALA M C   1  
ATOM 3411   O O   . ALA C 3 139 ? -90.750  4.732   19.154  1.00 0.00 ? 142 ALA M O   1  
ATOM 3412   C CB  . ALA C 3 139 ? -91.539  7.456   17.545  1.00 0.00 ? 142 ALA M CB  1  
ATOM 3413   N N   . TYR C 3 140 ? -89.098  6.305   19.074  1.00 0.00 ? 143 TYR M N   1  
ATOM 3414   C CA  . TYR C 3 140 ? -88.016  5.383   19.124  1.00 0.00 ? 143 TYR M CA  1  
ATOM 3415   C C   . TYR C 3 140 ? -87.719  4.885   20.530  1.00 0.00 ? 143 TYR M C   1  
ATOM 3416   O O   . TYR C 3 140 ? -86.848  4.063   20.769  1.00 0.00 ? 143 TYR M O   1  
ATOM 3417   C CB  . TYR C 3 140 ? -86.782  6.001   18.458  1.00 0.00 ? 143 TYR M CB  1  
ATOM 3418   C CG  . TYR C 3 140 ? -86.754  5.727   16.966  1.00 0.00 ? 143 TYR M CG  1  
ATOM 3419   C CD1 . TYR C 3 140 ? -86.558  4.438   16.482  1.00 0.00 ? 143 TYR M CD1 1  
ATOM 3420   C CD2 . TYR C 3 140 ? -86.935  6.748   16.034  1.00 0.00 ? 143 TYR M CD2 1  
ATOM 3421   C CE1 . TYR C 3 140 ? -86.517  4.155   15.122  1.00 0.00 ? 143 TYR M CE1 1  
ATOM 3422   C CE2 . TYR C 3 140 ? -86.868  6.491   14.670  1.00 0.00 ? 143 TYR M CE2 1  
ATOM 3423   C CZ  . TYR C 3 140 ? -86.656  5.194   14.212  1.00 0.00 ? 143 TYR M CZ  1  
ATOM 3424   O OH  . TYR C 3 140 ? -86.665  4.912   12.845  1.00 0.00 ? 143 TYR M OH  1  
ATOM 3425   N N   . ARG C 3 141 ? -88.531  5.386   21.423  1.00 0.00 ? 144 ARG M N   1  
ATOM 3426   C CA  . ARG C 3 141 ? -88.419  5.096   22.825  1.00 0.00 ? 144 ARG M CA  1  
ATOM 3427   C C   . ARG C 3 141 ? -89.076  3.793   23.244  1.00 0.00 ? 144 ARG M C   1  
ATOM 3428   O O   . ARG C 3 141 ? -90.284  3.687   23.231  1.00 0.00 ? 144 ARG M O   1  
ATOM 3429   C CB  . ARG C 3 141 ? -88.928  6.301   23.590  1.00 0.00 ? 144 ARG M CB  1  
ATOM 3430   C CG  . ARG C 3 141 ? -88.715  6.217   25.092  1.00 0.00 ? 144 ARG M CG  1  
ATOM 3431   C CD  . ARG C 3 141 ? -87.350  5.694   25.462  1.00 0.00 ? 144 ARG M CD  1  
ATOM 3432   N NE  . ARG C 3 141 ? -87.388  4.957   26.710  1.00 0.00 ? 144 ARG M NE  1  
ATOM 3433   C CZ  . ARG C 3 141 ? -86.667  3.852   26.945  1.00 0.00 ? 144 ARG M CZ  1  
ATOM 3434   N NH1 . ARG C 3 141 ? -85.842  3.359   26.024  1.00 0.00 ? 144 ARG M NH1 1  
ATOM 3435   N NH2 . ARG C 3 141 ? -86.808  3.241   28.113  1.00 0.00 ? 144 ARG M NH2 1  
ATOM 3436   N N   . GLY C 3 142 ? -88.234  2.809   23.607  1.00 0.00 ? 145 GLY M N   1  
ATOM 3437   C CA  . GLY C 3 142 ? -88.615  1.478   24.072  1.00 0.00 ? 145 GLY M CA  1  
ATOM 3438   C C   . GLY C 3 142 ? -88.783  0.436   22.940  1.00 0.00 ? 145 GLY M C   1  
ATOM 3439   O O   . GLY C 3 142 ? -89.343  -0.644  23.144  1.00 0.00 ? 145 GLY M O   1  
ATOM 3440   N N   . LYS C 3 143 ? -88.256  0.746   21.765  1.00 0.00 ? 146 LYS M N   1  
ATOM 3441   C CA  . LYS C 3 143 ? -88.355  -0.063  20.557  1.00 0.00 ? 146 LYS M CA  1  
ATOM 3442   C C   . LYS C 3 143 ? -87.123  -0.796  20.046  1.00 0.00 ? 146 LYS M C   1  
ATOM 3443   O O   . LYS C 3 143 ? -86.150  -0.148  19.684  1.00 0.00 ? 146 LYS M O   1  
ATOM 3444   C CB  . LYS C 3 143 ? -88.666  0.925   19.438  1.00 0.00 ? 146 LYS M CB  1  
ATOM 3445   C CG  . LYS C 3 143 ? -90.099  0.921   18.983  1.00 0.00 ? 146 LYS M CG  1  
ATOM 3446   C CD  . LYS C 3 143 ? -91.072  1.053   20.146  1.00 0.00 ? 146 LYS M CD  1  
ATOM 3447   C CE  . LYS C 3 143 ? -92.279  1.889   19.795  1.00 0.00 ? 146 LYS M CE  1  
ATOM 3448   N NZ  . LYS C 3 143 ? -92.569  1.886   18.354  1.00 0.00 ? 146 LYS M NZ  1  
ATOM 3449   N N   . LYS C 3 144 ? -87.198  -2.127  19.926  1.00 0.00 ? 147 LYS M N   1  
ATOM 3450   C CA  . LYS C 3 144 ? -86.080  -2.835  19.306  1.00 0.00 ? 147 LYS M CA  1  
ATOM 3451   C C   . LYS C 3 144 ? -85.942  -2.373  17.855  1.00 0.00 ? 147 LYS M C   1  
ATOM 3452   O O   . LYS C 3 144 ? -86.923  -1.888  17.277  1.00 0.00 ? 147 LYS M O   1  
ATOM 3453   C CB  . LYS C 3 144 ? -86.326  -4.323  19.363  1.00 0.00 ? 147 LYS M CB  1  
ATOM 3454   C CG  . LYS C 3 144 ? -86.642  -4.720  20.799  1.00 0.00 ? 147 LYS M CG  1  
ATOM 3455   C CD  . LYS C 3 144 ? -85.481  -4.419  21.723  1.00 0.00 ? 147 LYS M CD  1  
ATOM 3456   C CE  . LYS C 3 144 ? -85.666  -4.910  23.150  1.00 0.00 ? 147 LYS M CE  1  
ATOM 3457   N NZ  . LYS C 3 144 ? -86.053  -6.326  23.268  1.00 0.00 ? 147 LYS M NZ  1  
ATOM 3458   N N   . ARG C 3 145 ? -84.759  -2.517  17.254  1.00 0.00 ? 148 ARG M N   1  
ATOM 3459   C CA  . ARG C 3 145 ? -84.591  -2.010  15.907  1.00 0.00 ? 148 ARG M CA  1  
ATOM 3460   C C   . ARG C 3 145 ? -85.345  -2.752  14.853  1.00 0.00 ? 148 ARG M C   1  
ATOM 3461   O O   . ARG C 3 145 ? -85.215  -2.458  13.661  1.00 0.00 ? 148 ARG M O   1  
ATOM 3462   C CB  . ARG C 3 145 ? -83.159  -1.806  15.524  1.00 0.00 ? 148 ARG M CB  1  
ATOM 3463   C CG  . ARG C 3 145 ? -82.444  -3.123  15.462  1.00 0.00 ? 148 ARG M CG  1  
ATOM 3464   C CD  . ARG C 3 145 ? -81.006  -2.973  14.871  1.00 0.00 ? 148 ARG M CD  1  
ATOM 3465   N NE  . ARG C 3 145 ? -80.847  -3.708  13.618  1.00 0.00 ? 148 ARG M NE  1  
ATOM 3466   C CZ  . ARG C 3 145 ? -79.727  -3.739  12.927  1.00 0.00 ? 148 ARG M CZ  1  
ATOM 3467   N NH1 . ARG C 3 145 ? -78.654  -3.046  13.335  1.00 0.00 ? 148 ARG M NH1 1  
ATOM 3468   N NH2 . ARG C 3 145 ? -79.736  -4.466  11.789  1.00 0.00 ? 148 ARG M NH2 1  
ATOM 3469   N N   . GLN C 3 146 ? -86.159  -3.690  15.297  1.00 0.00 ? 149 GLN M N   1  
ATOM 3470   C CA  . GLN C 3 146 ? -86.940  -4.465  14.345  1.00 0.00 ? 149 GLN M CA  1  
ATOM 3471   C C   . GLN C 3 146 ? -88.381  -4.007  14.371  1.00 0.00 ? 149 GLN M C   1  
ATOM 3472   O O   . GLN C 3 146 ? -89.170  -4.265  13.455  1.00 0.00 ? 149 GLN M O   1  
ATOM 3473   C CB  . GLN C 3 146 ? -86.761  -5.967  14.524  1.00 0.00 ? 149 GLN M CB  1  
ATOM 3474   C CG  . GLN C 3 146 ? -85.292  -6.414  14.670  1.00 0.00 ? 149 GLN M CG  1  
ATOM 3475   C CD  . GLN C 3 146 ? -85.009  -7.198  15.935  1.00 0.00 ? 149 GLN M CD  1  
ATOM 3476   O OE1 . GLN C 3 146 ? -84.012  -7.962  15.963  1.00 0.00 ? 149 GLN M OE1 1  
ATOM 3477   N NE2 . GLN C 3 146 ? -85.893  -7.048  16.937  1.00 0.00 ? 149 GLN M NE2 1  
ATOM 3478   N N   . GLU C 3 147 ? -88.687  -3.257  15.425  1.00 0.00 ? 150 GLU M N   1  
ATOM 3479   C CA  . GLU C 3 147 ? -89.988  -2.644  15.647  1.00 0.00 ? 150 GLU M CA  1  
ATOM 3480   C C   . GLU C 3 147 ? -90.087  -1.251  15.026  1.00 0.00 ? 150 GLU M C   1  
ATOM 3481   O O   . GLU C 3 147 ? -91.158  -0.652  15.072  1.00 0.00 ? 150 GLU M O   1  
ATOM 3482   C CB  . GLU C 3 147 ? -90.169  -2.538  17.181  1.00 0.00 ? 150 GLU M CB  1  
ATOM 3483   C CG  . GLU C 3 147 ? -90.098  -3.938  17.819  1.00 0.00 ? 150 GLU M CG  1  
ATOM 3484   C CD  . GLU C 3 147 ? -90.274  -3.929  19.310  1.00 0.00 ? 150 GLU M CD  1  
ATOM 3485   O OE1 . GLU C 3 147 ? -90.273  -2.722  19.815  1.00 0.00 ? 150 GLU M OE1 1  
ATOM 3486   O OE2 . GLU C 3 147 ? -90.379  -4.956  19.958  1.00 0.00 ? 150 GLU M OE2 1  
ATOM 3487   N N   . ALA C 3 148 ? -88.977  -0.741  14.513  1.00 0.00 ? 151 ALA M N   1  
ATOM 3488   C CA  . ALA C 3 148 ? -88.893  0.540   13.889  1.00 0.00 ? 151 ALA M CA  1  
ATOM 3489   C C   . ALA C 3 148 ? -87.825  0.616   12.774  1.00 0.00 ? 151 ALA M C   1  
ATOM 3490   O O   . ALA C 3 148 ? -86.830  -0.157  12.737  1.00 0.00 ? 151 ALA M O   1  
ATOM 3491   C CB  . ALA C 3 148 ? -88.652  1.518   14.983  1.00 0.00 ? 151 ALA M CB  1  
ATOM 3492   N N   . PRO C 3 149 ? -88.019  1.573   11.870  1.00 0.00 ? 152 PRO M N   1  
ATOM 3493   C CA  . PRO C 3 149 ? -87.146  1.774   10.732  1.00 0.00 ? 152 PRO M CA  1  
ATOM 3494   C C   . PRO C 3 149 ? -85.756  2.295   11.120  1.00 0.00 ? 152 PRO M C   1  
ATOM 3495   O O   . PRO C 3 149 ? -85.560  2.850   12.159  1.00 0.00 ? 152 PRO M O   1  
ATOM 3496   C CB  . PRO C 3 149 ? -87.869  2.826   9.871   1.00 0.00 ? 152 PRO M CB  1  
ATOM 3497   C CG  . PRO C 3 149 ? -88.905  3.514   10.752  1.00 0.00 ? 152 PRO M CG  1  
ATOM 3498   C CD  . PRO C 3 149 ? -88.933  2.741   12.070  1.00 0.00 ? 152 PRO M CD  1  
ATOM 3499   N N   . PRO C 3 150 ? -84.794  2.123   10.239  1.00 0.00 ? 153 PRO M N   1  
ATOM 3500   C CA  . PRO C 3 150 ? -83.455  2.587   10.460  1.00 0.00 ? 153 PRO M CA  1  
ATOM 3501   C C   . PRO C 3 150 ? -83.322  4.054   10.818  1.00 0.00 ? 153 PRO M C   1  
ATOM 3502   O O   . PRO C 3 150 ? -83.653  4.955   10.051  1.00 0.00 ? 153 PRO M O   1  
ATOM 3503   C CB  . PRO C 3 150 ? -82.646  2.261   9.214   1.00 0.00 ? 153 PRO M CB  1  
ATOM 3504   C CG  . PRO C 3 150 ? -83.472  1.201   8.470   1.00 0.00 ? 153 PRO M CG  1  
ATOM 3505   C CD  . PRO C 3 150 ? -84.757  1.008   9.245   1.00 0.00 ? 153 PRO M CD  1  
ATOM 3506   N N   . HIS C 3 151 ? -82.757  4.218   12.021  1.00 0.00 ? 154 HIS M N   1  
ATOM 3507   C CA  . HIS C 3 151 ? -82.481  5.477   12.664  1.00 0.00 ? 154 HIS M CA  1  
ATOM 3508   C C   . HIS C 3 151 ? -81.568  5.370   13.908  1.00 0.00 ? 154 HIS M C   1  
ATOM 3509   O O   . HIS C 3 151 ? -81.590  4.465   14.707  1.00 0.00 ? 154 HIS M O   1  
ATOM 3510   C CB  . HIS C 3 151 ? -83.762  6.078   13.165  1.00 0.00 ? 154 HIS M CB  1  
ATOM 3511   C CG  . HIS C 3 151 ? -83.648  7.528   13.357  1.00 0.00 ? 154 HIS M CG  1  
ATOM 3512   N ND1 . HIS C 3 151 ? -84.652  8.226   13.947  1.00 0.00 ? 154 HIS M ND1 1  
ATOM 3513   C CD2 . HIS C 3 151 ? -82.676  8.406   13.011  1.00 0.00 ? 154 HIS M CD2 1  
ATOM 3514   C CE1 . HIS C 3 151 ? -84.315  9.493   13.888  1.00 0.00 ? 154 HIS M CE1 1  
ATOM 3515   N NE2 . HIS C 3 151 ? -83.109  9.645   13.404  1.00 0.00 ? 154 HIS M NE2 1  
ATOM 3516   N N   . ILE C 3 152 ? -80.825  6.415   14.113  1.00 0.00 ? 155 ILE M N   1  
ATOM 3517   C CA  . ILE C 3 152 ? -79.851  6.622   15.154  1.00 0.00 ? 155 ILE M CA  1  
ATOM 3518   C C   . ILE C 3 152 ? -80.410  6.582   16.532  1.00 0.00 ? 155 ILE M C   1  
ATOM 3519   O O   . ILE C 3 152 ? -79.697  6.268   17.495  1.00 0.00 ? 155 ILE M O   1  
ATOM 3520   C CB  . ILE C 3 152 ? -79.220  7.968   14.957  1.00 0.00 ? 155 ILE M CB  1  
ATOM 3521   C CG1 . ILE C 3 152 ? -77.804  7.825   14.459  1.00 0.00 ? 155 ILE M CG1 1  
ATOM 3522   C CG2 . ILE C 3 152 ? -79.298  8.728   16.221  1.00 0.00 ? 155 ILE M CG2 1  
ATOM 3523   C CD1 . ILE C 3 152 ? -77.196  9.172   14.072  1.00 0.00 ? 155 ILE M CD1 1  
ATOM 3524   N N   . PHE C 3 153 ? -81.640  6.999   16.678  1.00 0.00 ? 156 PHE M N   1  
ATOM 3525   C CA  . PHE C 3 153 ? -82.179  6.932   17.967  1.00 0.00 ? 156 PHE M CA  1  
ATOM 3526   C C   . PHE C 3 153 ? -82.407  5.452   18.213  1.00 0.00 ? 156 PHE M C   1  
ATOM 3527   O O   . PHE C 3 153 ? -82.517  5.011   19.356  1.00 0.00 ? 156 PHE M O   1  
ATOM 3528   C CB  . PHE C 3 153 ? -83.495  7.646   18.121  1.00 0.00 ? 156 PHE M CB  1  
ATOM 3529   C CG  . PHE C 3 153 ? -83.442  9.107   17.879  1.00 0.00 ? 156 PHE M CG  1  
ATOM 3530   C CD1 . PHE C 3 153 ? -82.861  10.001  18.765  1.00 0.00 ? 156 PHE M CD1 1  
ATOM 3531   C CD2 . PHE C 3 153 ? -83.949  9.687   16.738  1.00 0.00 ? 156 PHE M CD2 1  
ATOM 3532   C CE1 . PHE C 3 153 ? -82.828  11.379  18.562  1.00 0.00 ? 156 PHE M CE1 1  
ATOM 3533   C CE2 . PHE C 3 153 ? -83.859  11.043  16.441  1.00 0.00 ? 156 PHE M CE2 1  
ATOM 3534   C CZ  . PHE C 3 153 ? -83.314  11.920  17.377  1.00 0.00 ? 156 PHE M CZ  1  
ATOM 3535   N N   . SER C 3 154 ? -82.425  4.667   17.149  1.00 0.00 ? 157 SER M N   1  
ATOM 3536   C CA  . SER C 3 154 ? -82.663  3.264   17.402  1.00 0.00 ? 157 SER M CA  1  
ATOM 3537   C C   . SER C 3 154 ? -81.521  2.751   18.156  1.00 0.00 ? 157 SER M C   1  
ATOM 3538   O O   . SER C 3 154 ? -81.714  2.073   19.147  1.00 0.00 ? 157 SER M O   1  
ATOM 3539   C CB  . SER C 3 154 ? -82.891  2.399   16.143  1.00 0.00 ? 157 SER M CB  1  
ATOM 3540   O OG  . SER C 3 154 ? -83.921  1.438   16.368  1.00 0.00 ? 157 SER M OG  1  
ATOM 3541   N N   . ILE C 3 155 ? -80.353  3.106   17.626  1.00 0.00 ? 158 ILE M N   1  
ATOM 3542   C CA  . ILE C 3 155 ? -79.124  2.634   18.210  1.00 0.00 ? 158 ILE M CA  1  
ATOM 3543   C C   . ILE C 3 155 ? -79.049  3.130   19.644  1.00 0.00 ? 158 ILE M C   1  
ATOM 3544   O O   . ILE C 3 155 ? -78.860  2.374   20.603  1.00 0.00 ? 158 ILE M O   1  
ATOM 3545   C CB  . ILE C 3 155 ? -77.946  3.160   17.393  1.00 0.00 ? 158 ILE M CB  1  
ATOM 3546   C CG1 . ILE C 3 155 ? -77.424  2.105   16.444  1.00 0.00 ? 158 ILE M CG1 1  
ATOM 3547   C CG2 . ILE C 3 155 ? -76.785  3.461   18.309  1.00 0.00 ? 158 ILE M CG2 1  
ATOM 3548   C CD1 . ILE C 3 155 ? -77.901  2.281   15.011  1.00 0.00 ? 158 ILE M CD1 1  
ATOM 3549   N N   . SER C 3 156 ? -79.265  4.428   19.756  1.00 0.00 ? 159 SER M N   1  
ATOM 3550   C CA  . SER C 3 156 ? -79.192  5.148   20.980  1.00 0.00 ? 159 SER M CA  1  
ATOM 3551   C C   . SER C 3 156 ? -80.180  4.739   22.016  1.00 0.00 ? 159 SER M C   1  
ATOM 3552   O O   . SER C 3 156 ? -79.991  4.964   23.190  1.00 0.00 ? 159 SER M O   1  
ATOM 3553   C CB  . SER C 3 156 ? -79.204  6.657   20.742  1.00 0.00 ? 159 SER M CB  1  
ATOM 3554   O OG  . SER C 3 156 ? -80.427  7.137   21.173  1.00 0.00 ? 159 SER M OG  1  
ATOM 3555   N N   . ASP C 3 157 ? -81.241  4.167   21.612  1.00 0.00 ? 160 ASP M N   1  
ATOM 3556   C CA  . ASP C 3 157 ? -82.201  3.798   22.645  1.00 0.00 ? 160 ASP M CA  1  
ATOM 3557   C C   . ASP C 3 157 ? -81.893  2.410   23.099  1.00 0.00 ? 160 ASP M C   1  
ATOM 3558   O O   . ASP C 3 157 ? -81.912  2.051   24.277  1.00 0.00 ? 160 ASP M O   1  
ATOM 3559   C CB  . ASP C 3 157 ? -83.653  3.914   22.158  1.00 0.00 ? 160 ASP M CB  1  
ATOM 3560   C CG  . ASP C 3 157 ? -84.625  4.001   23.301  1.00 0.00 ? 160 ASP M CG  1  
ATOM 3561   O OD1 . ASP C 3 157 ? -84.964  3.015   23.935  1.00 0.00 ? 160 ASP M OD1 1  
ATOM 3562   O OD2 . ASP C 3 157 ? -85.078  5.220   23.520  1.00 0.00 ? 160 ASP M OD2 1  
ATOM 3563   N N   . ASN C 3 158 ? -81.563  1.612   22.114  1.00 0.00 ? 161 ASN M N   1  
ATOM 3564   C CA  . ASN C 3 158 ? -81.288  0.243   22.379  1.00 0.00 ? 161 ASN M CA  1  
ATOM 3565   C C   . ASN C 3 158 ? -80.168  0.118   23.341  1.00 0.00 ? 161 ASN M C   1  
ATOM 3566   O O   . ASN C 3 158 ? -80.143  -0.760  24.225  1.00 0.00 ? 161 ASN M O   1  
ATOM 3567   C CB  . ASN C 3 158 ? -81.047  -0.519  21.106  1.00 0.00 ? 161 ASN M CB  1  
ATOM 3568   C CG  . ASN C 3 158 ? -82.364  -1.033  20.629  1.00 0.00 ? 161 ASN M CG  1  
ATOM 3569   O OD1 . ASN C 3 158 ? -82.761  -2.187  20.923  1.00 0.00 ? 161 ASN M OD1 1  
ATOM 3570   N ND2 . ASN C 3 158 ? -83.009  -0.126  19.949  1.00 0.00 ? 161 ASN M ND2 1  
ATOM 3571   N N   . ALA C 3 159 ? -79.237  1.049   23.195  1.00 0.00 ? 162 ALA M N   1  
ATOM 3572   C CA  . ALA C 3 159 ? -78.084  1.070   24.080  1.00 0.00 ? 162 ALA M CA  1  
ATOM 3573   C C   . ALA C 3 159 ? -78.541  1.142   25.504  1.00 0.00 ? 162 ALA M C   1  
ATOM 3574   O O   . ALA C 3 159 ? -78.246  0.284   26.333  1.00 0.00 ? 162 ALA M O   1  
ATOM 3575   C CB  . ALA C 3 159 ? -77.308  2.283   23.794  1.00 0.00 ? 162 ALA M CB  1  
ATOM 3576   N N   . TYR C 3 160 ? -79.337  2.167   25.710  1.00 0.00 ? 163 TYR M N   1  
ATOM 3577   C CA  . TYR C 3 160 ? -79.978  2.449   26.974  1.00 0.00 ? 163 TYR M CA  1  
ATOM 3578   C C   . TYR C 3 160 ? -80.691  1.237   27.522  1.00 0.00 ? 163 TYR M C   1  
ATOM 3579   O O   . TYR C 3 160 ? -80.512  0.851   28.660  1.00 0.00 ? 163 TYR M O   1  
ATOM 3580   C CB  . TYR C 3 160 ? -81.022  3.543   26.812  1.00 0.00 ? 163 TYR M CB  1  
ATOM 3581   C CG  . TYR C 3 160 ? -81.405  4.150   28.120  1.00 0.00 ? 163 TYR M CG  1  
ATOM 3582   C CD1 . TYR C 3 160 ? -80.494  4.815   28.944  1.00 0.00 ? 163 TYR M CD1 1  
ATOM 3583   C CD2 . TYR C 3 160 ? -82.730  4.068   28.534  1.00 0.00 ? 163 TYR M CD2 1  
ATOM 3584   C CE1 . TYR C 3 160 ? -80.904  5.382   30.140  1.00 0.00 ? 163 TYR M CE1 1  
ATOM 3585   C CE2 . TYR C 3 160 ? -83.150  4.621   29.737  1.00 0.00 ? 163 TYR M CE2 1  
ATOM 3586   C CZ  . TYR C 3 160 ? -82.229  5.286   30.539  1.00 0.00 ? 163 TYR M CZ  1  
ATOM 3587   O OH  . TYR C 3 160 ? -82.642  5.842   31.729  1.00 0.00 ? 163 TYR M OH  1  
ATOM 3588   N N   . GLN C 3 161 ? -81.501  0.672   26.672  1.00 0.00 ? 164 GLN M N   1  
ATOM 3589   C CA  . GLN C 3 161 ? -82.288  -0.493  27.021  1.00 0.00 ? 164 GLN M CA  1  
ATOM 3590   C C   . GLN C 3 161 ? -81.336  -1.489  27.590  1.00 0.00 ? 164 GLN M C   1  
ATOM 3591   O O   . GLN C 3 161 ? -81.227  -1.705  28.781  1.00 0.00 ? 164 GLN M O   1  
ATOM 3592   C CB  . GLN C 3 161 ? -82.848  -1.081  25.730  1.00 0.00 ? 164 GLN M CB  1  
ATOM 3593   C CG  . GLN C 3 161 ? -84.226  -0.537  25.324  1.00 0.00 ? 164 GLN M CG  1  
ATOM 3594   C CD  . GLN C 3 161 ? -84.790  -1.446  24.258  1.00 0.00 ? 164 GLN M CD  1  
ATOM 3595   O OE1 . GLN C 3 161 ? -85.696  -2.242  24.525  1.00 0.00 ? 164 GLN M OE1 1  
ATOM 3596   N NE2 . GLN C 3 161 ? -84.187  -1.382  23.064  1.00 0.00 ? 164 GLN M NE2 1  
ATOM 3597   N N   . PHE C 3 162 ? -80.577  -1.991  26.654  1.00 0.00 ? 165 PHE M N   1  
ATOM 3598   C CA  . PHE C 3 162 ? -79.552  -2.932  26.850  1.00 0.00 ? 165 PHE M CA  1  
ATOM 3599   C C   . PHE C 3 162 ? -78.749  -2.625  28.075  1.00 0.00 ? 165 PHE M C   1  
ATOM 3600   O O   . PHE C 3 162 ? -78.295  -3.502  28.799  1.00 0.00 ? 165 PHE M O   1  
ATOM 3601   C CB  . PHE C 3 162 ? -78.692  -2.631  25.672  1.00 0.00 ? 165 PHE M CB  1  
ATOM 3602   C CG  . PHE C 3 162 ? -78.979  -3.617  24.613  1.00 0.00 ? 165 PHE M CG  1  
ATOM 3603   C CD1 . PHE C 3 162 ? -79.106  -4.959  24.947  1.00 0.00 ? 165 PHE M CD1 1  
ATOM 3604   C CD2 . PHE C 3 162 ? -79.103  -3.224  23.286  1.00 0.00 ? 165 PHE M CD2 1  
ATOM 3605   C CE1 . PHE C 3 162 ? -79.345  -5.915  23.966  1.00 0.00 ? 165 PHE M CE1 1  
ATOM 3606   C CE2 . PHE C 3 162 ? -79.328  -4.163  22.289  1.00 0.00 ? 165 PHE M CE2 1  
ATOM 3607   C CZ  . PHE C 3 162 ? -79.443  -5.502  22.645  1.00 0.00 ? 165 PHE M CZ  1  
ATOM 3608   N N   . MET C 3 163 ? -78.599  -1.341  28.301  1.00 0.00 ? 166 MET M N   1  
ATOM 3609   C CA  . MET C 3 163 ? -77.833  -0.921  29.415  1.00 0.00 ? 166 MET M CA  1  
ATOM 3610   C C   . MET C 3 163 ? -78.495  -1.454  30.648  1.00 0.00 ? 166 MET M C   1  
ATOM 3611   O O   . MET C 3 163 ? -77.920  -2.266  31.358  1.00 0.00 ? 166 MET M O   1  
ATOM 3612   C CB  . MET C 3 163 ? -77.638  0.613   29.425  1.00 0.00 ? 166 MET M CB  1  
ATOM 3613   C CG  . MET C 3 163 ? -76.774  1.166   30.547  1.00 0.00 ? 166 MET M CG  1  
ATOM 3614   S SD  . MET C 3 163 ? -77.334  2.806   31.133  1.00 0.00 ? 166 MET M SD  1  
ATOM 3615   C CE  . MET C 3 163 ? -75.689  3.523   31.267  1.00 0.00 ? 166 MET M CE  1  
ATOM 3616   N N   . LEU C 3 164 ? -79.752  -1.095  30.838  1.00 0.00 ? 167 LEU M N   1  
ATOM 3617   C CA  . LEU C 3 164 ? -80.468  -1.593  32.009  1.00 0.00 ? 167 LEU M CA  1  
ATOM 3618   C C   . LEU C 3 164 ? -80.821  -3.089  31.970  1.00 0.00 ? 167 LEU M C   1  
ATOM 3619   O O   . LEU C 3 164 ? -80.914  -3.784  32.943  1.00 0.00 ? 167 LEU M O   1  
ATOM 3620   C CB  . LEU C 3 164 ? -81.707  -0.766  32.393  1.00 0.00 ? 167 LEU M CB  1  
ATOM 3621   C CG  . LEU C 3 164 ? -81.622  0.722   32.093  1.00 0.00 ? 167 LEU M CG  1  
ATOM 3622   C CD1 . LEU C 3 164 ? -82.843  1.146   31.318  1.00 0.00 ? 167 LEU M CD1 1  
ATOM 3623   C CD2 . LEU C 3 164 ? -81.594  1.533   33.392  1.00 0.00 ? 167 LEU M CD2 1  
ATOM 3624   N N   . THR C 3 165 ? -81.091  -3.632  30.793  1.00 0.00 ? 168 THR M N   1  
ATOM 3625   C CA  . THR C 3 165 ? -81.444  -5.023  30.684  1.00 0.00 ? 168 THR M CA  1  
ATOM 3626   C C   . THR C 3 165 ? -80.329  -5.990  31.049  1.00 0.00 ? 168 THR M C   1  
ATOM 3627   O O   . THR C 3 165 ? -80.562  -6.897  31.841  1.00 0.00 ? 168 THR M O   1  
ATOM 3628   C CB  . THR C 3 165 ? -81.919  -5.296  29.250  1.00 0.00 ? 168 THR M CB  1  
ATOM 3629   O OG1 . THR C 3 165 ? -83.092  -4.568  28.965  1.00 0.00 ? 168 THR M OG1 1  
ATOM 3630   C CG2 . THR C 3 165 ? -82.106  -6.788  29.039  1.00 0.00 ? 168 THR M CG2 1  
ATOM 3631   N N   . ASP C 3 166 ? -79.156  -5.796  30.428  1.00 0.00 ? 169 ASP M N   1  
ATOM 3632   C CA  . ASP C 3 166 ? -77.994  -6.649  30.625  1.00 0.00 ? 169 ASP M CA  1  
ATOM 3633   C C   . ASP C 3 166 ? -77.038  -6.234  31.776  1.00 0.00 ? 169 ASP M C   1  
ATOM 3634   O O   . ASP C 3 166 ? -76.125  -6.952  32.243  1.00 0.00 ? 169 ASP M O   1  
ATOM 3635   C CB  . ASP C 3 166 ? -77.220  -6.824  29.322  1.00 0.00 ? 169 ASP M CB  1  
ATOM 3636   C CG  . ASP C 3 166 ? -78.048  -6.879  28.084  1.00 0.00 ? 169 ASP M CG  1  
ATOM 3637   O OD1 . ASP C 3 166 ? -79.326  -7.053  28.342  1.00 0.00 ? 169 ASP M OD1 1  
ATOM 3638   O OD2 . ASP C 3 166 ? -77.543  -6.800  26.969  1.00 0.00 ? 169 ASP M OD2 1  
ATOM 3639   N N   . ARG C 3 167 ? -77.212  -5.016  32.259  1.00 0.00 ? 170 ARG M N   1  
ATOM 3640   C CA  . ARG C 3 167 ? -76.363  -4.513  33.325  1.00 0.00 ? 170 ARG M CA  1  
ATOM 3641   C C   . ARG C 3 167 ? -74.911  -4.416  32.886  1.00 0.00 ? 170 ARG M C   1  
ATOM 3642   O O   . ARG C 3 167 ? -74.010  -4.668  33.683  1.00 0.00 ? 170 ARG M O   1  
ATOM 3643   C CB  . ARG C 3 167 ? -76.472  -5.379  34.542  1.00 0.00 ? 170 ARG M CB  1  
ATOM 3644   C CG  . ARG C 3 167 ? -77.873  -5.480  35.102  1.00 0.00 ? 170 ARG M CG  1  
ATOM 3645   C CD  . ARG C 3 167 ? -77.977  -5.181  36.575  1.00 0.00 ? 170 ARG M CD  1  
ATOM 3646   N NE  . ARG C 3 167 ? -78.180  -6.380  37.402  1.00 0.00 ? 170 ARG M NE  1  
ATOM 3647   C CZ  . ARG C 3 167 ? -78.311  -6.361  38.747  1.00 0.00 ? 170 ARG M CZ  1  
ATOM 3648   N NH1 . ARG C 3 167 ? -78.276  -5.222  39.468  1.00 0.00 ? 170 ARG M NH1 1  
ATOM 3649   N NH2 . ARG C 3 167 ? -78.493  -7.530  39.394  1.00 0.00 ? 170 ARG M NH2 1  
ATOM 3650   N N   . GLU C 3 168 ? -74.731  -4.031  31.634  1.00 0.00 ? 171 GLU M N   1  
ATOM 3651   C CA  . GLU C 3 168 ? -73.432  -3.841  31.023  1.00 0.00 ? 171 GLU M CA  1  
ATOM 3652   C C   . GLU C 3 168 ? -73.291  -2.443  30.521  1.00 0.00 ? 171 GLU M C   1  
ATOM 3653   O O   . GLU C 3 168 ? -74.278  -1.776  30.264  1.00 0.00 ? 171 GLU M O   1  
ATOM 3654   C CB  . GLU C 3 168 ? -73.274  -4.789  29.831  1.00 0.00 ? 171 GLU M CB  1  
ATOM 3655   C CG  . GLU C 3 168 ? -73.524  -6.255  30.193  1.00 0.00 ? 171 GLU M CG  1  
ATOM 3656   C CD  . GLU C 3 168 ? -73.044  -7.235  29.128  1.00 0.00 ? 171 GLU M CD  1  
ATOM 3657   O OE1 . GLU C 3 168 ? -72.959  -6.763  27.919  1.00 0.00 ? 171 GLU M OE1 1  
ATOM 3658   O OE2 . GLU C 3 168 ? -72.821  -8.413  29.365  1.00 0.00 ? 171 GLU M OE2 1  
ATOM 3659   N N   . ASN C 3 169 ? -72.053  -2.005  30.415  1.00 0.00 ? 172 ASN M N   1  
ATOM 3660   C CA  . ASN C 3 169 ? -71.892  -0.653  29.894  1.00 0.00 ? 172 ASN M CA  1  
ATOM 3661   C C   . ASN C 3 169 ? -71.916  -0.723  28.401  1.00 0.00 ? 172 ASN M C   1  
ATOM 3662   O O   . ASN C 3 169 ? -71.698  -1.807  27.798  1.00 0.00 ? 172 ASN M O   1  
ATOM 3663   C CB  . ASN C 3 169 ? -70.744  0.201   30.447  1.00 0.00 ? 172 ASN M CB  1  
ATOM 3664   C CG  . ASN C 3 169 ? -70.423  0.020   31.911  1.00 0.00 ? 172 ASN M CG  1  
ATOM 3665   O OD1 . ASN C 3 169 ? -71.050  0.612   32.827  1.00 0.00 ? 172 ASN M OD1 1  
ATOM 3666   N ND2 . ASN C 3 169 ? -69.420  -0.791  32.139  1.00 0.00 ? 172 ASN M ND2 1  
ATOM 3667   N N   . GLN C 3 170 ? -72.180  0.449   27.835  1.00 0.00 ? 173 GLN M N   1  
ATOM 3668   C CA  . GLN C 3 170 ? -72.332  0.532   26.402  1.00 0.00 ? 173 GLN M CA  1  
ATOM 3669   C C   . GLN C 3 170 ? -71.400  1.512   25.732  1.00 0.00 ? 173 GLN M C   1  
ATOM 3670   O O   . GLN C 3 170 ? -70.680  2.247   26.406  1.00 0.00 ? 173 GLN M O   1  
ATOM 3671   C CB  . GLN C 3 170 ? -73.814  0.924   26.233  1.00 0.00 ? 173 GLN M CB  1  
ATOM 3672   C CG  . GLN C 3 170 ? -74.756  -0.096  25.502  1.00 0.00 ? 173 GLN M CG  1  
ATOM 3673   C CD  . GLN C 3 170 ? -74.925  -1.449  26.119  1.00 0.00 ? 173 GLN M CD  1  
ATOM 3674   O OE1 . GLN C 3 170 ? -75.059  -2.460  25.380  1.00 0.00 ? 173 GLN M OE1 1  
ATOM 3675   N NE2 . GLN C 3 170 ? -74.891  -1.496  27.448  1.00 0.00 ? 173 GLN M NE2 1  
ATOM 3676   N N   . SER C 3 171 ? -71.420  1.489   24.389  1.00 0.00 ? 174 SER M N   1  
ATOM 3677   C CA  . SER C 3 171 ? -70.643  2.439   23.596  1.00 0.00 ? 174 SER M CA  1  
ATOM 3678   C C   . SER C 3 171 ? -71.259  2.611   22.243  1.00 0.00 ? 174 SER M C   1  
ATOM 3679   O O   . SER C 3 171 ? -71.968  1.745   21.761  1.00 0.00 ? 174 SER M O   1  
ATOM 3680   C CB  . SER C 3 171 ? -69.204  2.065   23.423  1.00 0.00 ? 174 SER M CB  1  
ATOM 3681   O OG  . SER C 3 171 ? -69.175  0.929   22.606  1.00 0.00 ? 174 SER M OG  1  
ATOM 3682   N N   . ILE C 3 172 ? -70.933  3.738   21.659  1.00 0.00 ? 175 ILE M N   1  
ATOM 3683   C CA  . ILE C 3 172 ? -71.379  4.125   20.377  1.00 0.00 ? 175 ILE M CA  1  
ATOM 3684   C C   . ILE C 3 172 ? -70.194  4.679   19.660  1.00 0.00 ? 175 ILE M C   1  
ATOM 3685   O O   . ILE C 3 172 ? -69.582  5.603   20.123  1.00 0.00 ? 175 ILE M O   1  
ATOM 3686   C CB  . ILE C 3 172 ? -72.506  5.122   20.383  1.00 0.00 ? 175 ILE M CB  1  
ATOM 3687   C CG1 . ILE C 3 172 ? -73.811  4.467   20.724  1.00 0.00 ? 175 ILE M CG1 1  
ATOM 3688   C CG2 . ILE C 3 172 ? -72.597  5.618   18.977  1.00 0.00 ? 175 ILE M CG2 1  
ATOM 3689   C CD1 . ILE C 3 172 ? -74.460  5.205   21.884  1.00 0.00 ? 175 ILE M CD1 1  
ATOM 3690   N N   . LEU C 3 173 ? -69.844  4.090   18.554  1.00 0.00 ? 176 LEU M N   1  
ATOM 3691   C CA  . LEU C 3 173 ? -68.728  4.573   17.860  1.00 0.00 ? 176 LEU M CA  1  
ATOM 3692   C C   . LEU C 3 173 ? -69.073  5.248   16.606  1.00 0.00 ? 176 LEU M C   1  
ATOM 3693   O O   . LEU C 3 173 ? -69.484  4.546   15.700  1.00 0.00 ? 176 LEU M O   1  
ATOM 3694   C CB  . LEU C 3 173 ? -67.750  3.443   17.637  1.00 0.00 ? 176 LEU M CB  1  
ATOM 3695   C CG  . LEU C 3 173 ? -67.301  2.851   18.951  1.00 0.00 ? 176 LEU M CG  1  
ATOM 3696   C CD1 . LEU C 3 173 ? -68.377  1.989   19.538  1.00 0.00 ? 176 LEU M CD1 1  
ATOM 3697   C CD2 . LEU C 3 173 ? -66.012  2.160   18.745  1.00 0.00 ? 176 LEU M CD2 1  
ATOM 3698   N N   . ILE C 3 174 ? -68.952  6.596   16.605  1.00 0.00 ? 177 ILE M N   1  
ATOM 3699   C CA  . ILE C 3 174 ? -69.272  7.363   15.428  1.00 0.00 ? 177 ILE M CA  1  
ATOM 3700   C C   . ILE C 3 174 ? -68.007  7.639   14.645  1.00 0.00 ? 177 ILE M C   1  
ATOM 3701   O O   . ILE C 3 174 ? -67.043  7.990   15.181  1.00 0.00 ? 177 ILE M O   1  
ATOM 3702   C CB  . ILE C 3 174 ? -70.039  8.587   15.755  1.00 0.00 ? 177 ILE M CB  1  
ATOM 3703   C CG1 . ILE C 3 174 ? -71.413  8.229   16.228  1.00 0.00 ? 177 ILE M CG1 1  
ATOM 3704   C CG2 . ILE C 3 174 ? -70.194  9.413   14.488  1.00 0.00 ? 177 ILE M CG2 1  
ATOM 3705   C CD1 . ILE C 3 174 ? -71.786  8.701   17.635  1.00 0.00 ? 177 ILE M CD1 1  
ATOM 3706   N N   . THR C 3 175 ? -68.017  7.442   13.360  1.00 0.00 ? 178 THR M N   1  
ATOM 3707   C CA  . THR C 3 175 ? -66.856  7.640   12.576  1.00 0.00 ? 178 THR M CA  1  
ATOM 3708   C C   . THR C 3 175 ? -67.159  7.933   11.123  1.00 0.00 ? 178 THR M C   1  
ATOM 3709   O O   . THR C 3 175 ? -68.144  7.415   10.576  1.00 0.00 ? 178 THR M O   1  
ATOM 3710   C CB  . THR C 3 175 ? -66.060  6.356   12.665  1.00 0.00 ? 178 THR M CB  1  
ATOM 3711   O OG1 . THR C 3 175 ? -64.865  6.479   13.482  1.00 0.00 ? 178 THR M OG1 1  
ATOM 3712   C CG2 . THR C 3 175 ? -65.882  5.755   11.283  1.00 0.00 ? 178 THR M CG2 1  
ATOM 3713   N N   . GLY C 3 176 ? -66.341  8.840   10.513  1.00 0.00 ? 179 GLY M N   1  
ATOM 3714   C CA  . GLY C 3 176 ? -66.472  9.199   9.092   1.00 0.00 ? 179 GLY M CA  1  
ATOM 3715   C C   . GLY C 3 176 ? -65.466  10.267  8.684   1.00 0.00 ? 179 GLY M C   1  
ATOM 3716   O O   . GLY C 3 176 ? -64.797  10.830  9.526   1.00 0.00 ? 179 GLY M O   1  
ATOM 3717   N N   . GLU C 3 177 ? -65.389  10.603  7.394   1.00 0.00 ? 180 GLU M N   1  
ATOM 3718   C CA  . GLU C 3 177 ? -64.482  11.663  6.969   1.00 0.00 ? 180 GLU M CA  1  
ATOM 3719   C C   . GLU C 3 177 ? -64.962  13.066  7.378   1.00 0.00 ? 180 GLU M C   1  
ATOM 3720   O O   . GLU C 3 177 ? -66.115  13.290  7.735   1.00 0.00 ? 180 GLU M O   1  
ATOM 3721   C CB  . GLU C 3 177 ? -64.035  11.708  5.477   1.00 0.00 ? 180 GLU M CB  1  
ATOM 3722   C CG  . GLU C 3 177 ? -64.162  10.412  4.700   1.00 0.00 ? 180 GLU M CG  1  
ATOM 3723   C CD  . GLU C 3 177 ? -63.388  10.350  3.411   1.00 0.00 ? 180 GLU M CD  1  
ATOM 3724   O OE1 . GLU C 3 177 ? -63.405  11.461  2.791   1.00 0.00 ? 180 GLU M OE1 1  
ATOM 3725   O OE2 . GLU C 3 177 ? -62.878  9.329   2.938   1.00 0.00 ? 180 GLU M OE2 1  
ATOM 3726   N N   . SER C 3 178 ? -64.032  13.987  7.266   1.00 0.00 ? 181 SER M N   1  
ATOM 3727   C CA  . SER C 3 178 ? -64.169  15.375  7.605   1.00 0.00 ? 181 SER M CA  1  
ATOM 3728   C C   . SER C 3 178 ? -65.534  15.960  7.336   1.00 0.00 ? 181 SER M C   1  
ATOM 3729   O O   . SER C 3 178 ? -66.059  16.699  8.171   1.00 0.00 ? 181 SER M O   1  
ATOM 3730   C CB  . SER C 3 178 ? -63.085  16.214  6.954   1.00 0.00 ? 181 SER M CB  1  
ATOM 3731   O OG  . SER C 3 178 ? -62.885  17.430  7.667   1.00 0.00 ? 181 SER M OG  1  
ATOM 3732   N N   . GLY C 3 179 ? -66.107  15.611  6.211   1.00 0.00 ? 182 GLY M N   1  
ATOM 3733   C CA  . GLY C 3 179 ? -67.416  16.224  5.905   1.00 0.00 ? 182 GLY M CA  1  
ATOM 3734   C C   . GLY C 3 179 ? -68.625  15.373  6.174   1.00 0.00 ? 182 GLY M C   1  
ATOM 3735   O O   . GLY C 3 179 ? -69.755  15.776  5.911   1.00 0.00 ? 182 GLY M O   1  
ATOM 3736   N N   . ALA C 3 180 ? -68.421  14.174  6.698   1.00 0.00 ? 183 ALA M N   1  
ATOM 3737   C CA  . ALA C 3 180 ? -69.514  13.275  6.958   1.00 0.00 ? 183 ALA M CA  1  
ATOM 3738   C C   . ALA C 3 180 ? -70.561  13.783  7.938   1.00 0.00 ? 183 ALA M C   1  
ATOM 3739   O O   . ALA C 3 180 ? -71.698  13.300  7.938   1.00 0.00 ? 183 ALA M O   1  
ATOM 3740   C CB  . ALA C 3 180 ? -69.066  11.870  7.294   1.00 0.00 ? 183 ALA M CB  1  
ATOM 3741   N N   . GLY C 3 181 ? -70.162  14.708  8.830   1.00 0.00 ? 184 GLY M N   1  
ATOM 3742   C CA  . GLY C 3 181 ? -71.093  15.281  9.802   1.00 0.00 ? 184 GLY M CA  1  
ATOM 3743   C C   . GLY C 3 181 ? -71.314  14.442  11.037  1.00 0.00 ? 184 GLY M C   1  
ATOM 3744   O O   . GLY C 3 181 ? -72.444  14.095  11.389  1.00 0.00 ? 184 GLY M O   1  
ATOM 3745   N N   . LYS C 3 182 ? -70.220  14.127  11.753  1.00 0.00 ? 185 LYS M N   1  
ATOM 3746   C CA  . LYS C 3 182 ? -70.359  13.321  12.940  1.00 0.00 ? 185 LYS M CA  1  
ATOM 3747   C C   . LYS C 3 182 ? -70.777  14.101  14.173  1.00 0.00 ? 185 LYS M C   1  
ATOM 3748   O O   . LYS C 3 182 ? -71.675  13.669  14.917  1.00 0.00 ? 185 LYS M O   1  
ATOM 3749   C CB  . LYS C 3 182 ? -69.125  12.563  13.217  1.00 0.00 ? 185 LYS M CB  1  
ATOM 3750   C CG  . LYS C 3 182 ? -68.180  12.547  12.018  1.00 0.00 ? 185 LYS M CG  1  
ATOM 3751   C CD  . LYS C 3 182 ? -66.801  11.987  12.369  1.00 0.00 ? 185 LYS M CD  1  
ATOM 3752   C CE  . LYS C 3 182 ? -65.726  12.648  11.526  1.00 0.00 ? 185 LYS M CE  1  
ATOM 3753   N NZ  . LYS C 3 182 ? -65.134  13.806  12.166  1.00 0.00 ? 185 LYS M NZ  1  
ATOM 3754   N N   . THR C 3 183 ? -70.120  15.253  14.420  1.00 0.00 ? 186 THR M N   1  
ATOM 3755   C CA  . THR C 3 183 ? -70.393  16.123  15.586  1.00 0.00 ? 186 THR M CA  1  
ATOM 3756   C C   . THR C 3 183 ? -71.859  16.267  15.783  1.00 0.00 ? 186 THR M C   1  
ATOM 3757   O O   . THR C 3 183 ? -72.395  16.057  16.879  1.00 0.00 ? 186 THR M O   1  
ATOM 3758   C CB  . THR C 3 183 ? -69.775  17.539  15.479  1.00 0.00 ? 186 THR M CB  1  
ATOM 3759   O OG1 . THR C 3 183 ? -68.681  17.587  14.598  1.00 0.00 ? 186 THR M OG1 1  
ATOM 3760   C CG2 . THR C 3 183 ? -69.390  18.053  16.875  1.00 0.00 ? 186 THR M CG2 1  
ATOM 3761   N N   . VAL C 3 184 ? -72.460  16.549  14.627  1.00 0.00 ? 187 VAL M N   1  
ATOM 3762   C CA  . VAL C 3 184 ? -73.905  16.700  14.489  1.00 0.00 ? 187 VAL M CA  1  
ATOM 3763   C C   . VAL C 3 184 ? -74.629  15.520  15.058  1.00 0.00 ? 187 VAL M C   1  
ATOM 3764   O O   . VAL C 3 184 ? -75.534  15.646  15.819  1.00 0.00 ? 187 VAL M O   1  
ATOM 3765   C CB  . VAL C 3 184 ? -74.248  16.800  13.045  1.00 0.00 ? 187 VAL M CB  1  
ATOM 3766   C CG1 . VAL C 3 184 ? -75.406  17.744  12.957  1.00 0.00 ? 187 VAL M CG1 1  
ATOM 3767   C CG2 . VAL C 3 184 ? -73.028  17.216  12.201  1.00 0.00 ? 187 VAL M CG2 1  
ATOM 3768   N N   . ASN C 3 185 ? -74.189  14.321  14.685  1.00 0.00 ? 188 ASN M N   1  
ATOM 3769   C CA  . ASN C 3 185 ? -74.830  13.151  15.188  1.00 0.00 ? 188 ASN M CA  1  
ATOM 3770   C C   . ASN C 3 185 ? -74.563  13.001  16.645  1.00 0.00 ? 188 ASN M C   1  
ATOM 3771   O O   . ASN C 3 185 ? -75.458  12.804  17.458  1.00 0.00 ? 188 ASN M O   1  
ATOM 3772   C CB  . ASN C 3 185 ? -74.333  11.902  14.495  1.00 0.00 ? 188 ASN M CB  1  
ATOM 3773   C CG  . ASN C 3 185 ? -74.814  11.805  13.073  1.00 0.00 ? 188 ASN M CG  1  
ATOM 3774   O OD1 . ASN C 3 185 ? -76.002  11.996  12.795  1.00 0.00 ? 188 ASN M OD1 1  
ATOM 3775   N ND2 . ASN C 3 185 ? -73.919  11.514  12.156  1.00 0.00 ? 188 ASN M ND2 1  
ATOM 3776   N N   . THR C 3 186 ? -73.293  13.130  16.956  1.00 0.00 ? 189 THR M N   1  
ATOM 3777   C CA  . THR C 3 186 ? -72.819  12.940  18.309  1.00 0.00 ? 189 THR M CA  1  
ATOM 3778   C C   . THR C 3 186 ? -73.613  13.770  19.239  1.00 0.00 ? 189 THR M C   1  
ATOM 3779   O O   . THR C 3 186 ? -74.241  13.272  20.171  1.00 0.00 ? 189 THR M O   1  
ATOM 3780   C CB  . THR C 3 186 ? -71.369  13.314  18.394  1.00 0.00 ? 189 THR M CB  1  
ATOM 3781   O OG1 . THR C 3 186 ? -70.783  12.979  17.132  1.00 0.00 ? 189 THR M OG1 1  
ATOM 3782   C CG2 . THR C 3 186 ? -70.787  12.542  19.525  1.00 0.00 ? 189 THR M CG2 1  
ATOM 3783   N N   . LYS C 3 187 ? -73.705  15.034  18.869  1.00 0.00 ? 190 LYS M N   1  
ATOM 3784   C CA  . LYS C 3 187 ? -74.456  15.954  19.647  1.00 0.00 ? 190 LYS M CA  1  
ATOM 3785   C C   . LYS C 3 187 ? -75.847  15.459  19.795  1.00 0.00 ? 190 LYS M C   1  
ATOM 3786   O O   . LYS C 3 187 ? -76.347  15.288  20.898  1.00 0.00 ? 190 LYS M O   1  
ATOM 3787   C CB  . LYS C 3 187 ? -74.551  17.279  18.954  1.00 0.00 ? 190 LYS M CB  1  
ATOM 3788   C CG  . LYS C 3 187 ? -73.205  18.063  18.894  1.00 0.00 ? 190 LYS M CG  1  
ATOM 3789   C CD  . LYS C 3 187 ? -73.388  19.586  18.946  1.00 0.00 ? 190 LYS M CD  1  
ATOM 3790   C CE  . LYS C 3 187 ? -72.912  20.296  17.674  1.00 0.00 ? 190 LYS M CE  1  
ATOM 3791   N NZ  . LYS C 3 187 ? -73.691  21.499  17.302  1.00 0.00 ? 190 LYS M NZ  1  
ATOM 3792   N N   . ARG C 3 188 ? -76.403  15.131  18.635  1.00 0.00 ? 191 ARG M N   1  
ATOM 3793   C CA  . ARG C 3 188 ? -77.797  14.659  18.576  1.00 0.00 ? 191 ARG M CA  1  
ATOM 3794   C C   . ARG C 3 188 ? -78.050  13.415  19.385  1.00 0.00 ? 191 ARG M C   1  
ATOM 3795   O O   . ARG C 3 188 ? -79.098  13.228  19.959  1.00 0.00 ? 191 ARG M O   1  
ATOM 3796   C CB  . ARG C 3 188 ? -78.408  14.639  17.202  1.00 0.00 ? 191 ARG M CB  1  
ATOM 3797   C CG  . ARG C 3 188 ? -79.580  15.605  17.006  1.00 0.00 ? 191 ARG M CG  1  
ATOM 3798   C CD  . ARG C 3 188 ? -79.295  16.907  16.228  1.00 0.00 ? 191 ARG M CD  1  
ATOM 3799   N NE  . ARG C 3 188 ? -78.856  18.002  17.119  1.00 0.00 ? 191 ARG M NE  1  
ATOM 3800   C CZ  . ARG C 3 188 ? -78.179  19.105  16.737  1.00 0.00 ? 191 ARG M CZ  1  
ATOM 3801   N NH1 . ARG C 3 188 ? -77.869  19.335  15.450  1.00 0.00 ? 191 ARG M NH1 1  
ATOM 3802   N NH2 . ARG C 3 188 ? -77.821  20.025  17.660  1.00 0.00 ? 191 ARG M NH2 1  
ATOM 3803   N N   . VAL C 3 189 ? -77.043  12.588  19.506  1.00 0.00 ? 192 VAL M N   1  
ATOM 3804   C CA  . VAL C 3 189 ? -77.200  11.396  20.300  1.00 0.00 ? 192 VAL M CA  1  
ATOM 3805   C C   . VAL C 3 189 ? -77.273  11.790  21.749  1.00 0.00 ? 192 VAL M C   1  
ATOM 3806   O O   . VAL C 3 189 ? -78.072  11.334  22.554  1.00 0.00 ? 192 VAL M O   1  
ATOM 3807   C CB  . VAL C 3 189 ? -76.012  10.498  20.178  1.00 0.00 ? 192 VAL M CB  1  
ATOM 3808   C CG1 . VAL C 3 189 ? -76.317  9.448   21.190  1.00 0.00 ? 192 VAL M CG1 1  
ATOM 3809   C CG2 . VAL C 3 189 ? -75.915  9.893   18.776  1.00 0.00 ? 192 VAL M CG2 1  
ATOM 3810   N N   . ILE C 3 190 ? -76.367  12.691  22.065  1.00 0.00 ? 193 ILE M N   1  
ATOM 3811   C CA  . ILE C 3 190 ? -76.236  13.188  23.416  1.00 0.00 ? 193 ILE M CA  1  
ATOM 3812   C C   . ILE C 3 190 ? -77.531  13.794  23.941  1.00 0.00 ? 193 ILE M C   1  
ATOM 3813   O O   . ILE C 3 190 ? -77.966  13.471  25.061  1.00 0.00 ? 193 ILE M O   1  
ATOM 3814   C CB  . ILE C 3 190 ? -75.060  14.142  23.529  1.00 0.00 ? 193 ILE M CB  1  
ATOM 3815   C CG1 . ILE C 3 190 ? -73.800  13.368  23.180  1.00 0.00 ? 193 ILE M CG1 1  
ATOM 3816   C CG2 . ILE C 3 190 ? -74.922  14.665  24.955  1.00 0.00 ? 193 ILE M CG2 1  
ATOM 3817   C CD1 . ILE C 3 190 ? -72.749  13.258  24.287  1.00 0.00 ? 193 ILE M CD1 1  
ATOM 3818   N N   . GLN C 3 191 ? -78.135  14.684  23.144  1.00 0.00 ? 194 GLN M N   1  
ATOM 3819   C CA  . GLN C 3 191 ? -79.407  15.278  23.539  1.00 0.00 ? 194 GLN M CA  1  
ATOM 3820   C C   . GLN C 3 191 ? -80.343  14.176  23.921  1.00 0.00 ? 194 GLN M C   1  
ATOM 3821   O O   . GLN C 3 191 ? -80.947  14.184  24.978  1.00 0.00 ? 194 GLN M O   1  
ATOM 3822   C CB  . GLN C 3 191 ? -80.124  16.084  22.431  1.00 0.00 ? 194 GLN M CB  1  
ATOM 3823   C CG  . GLN C 3 191 ? -79.148  16.941  21.609  1.00 0.00 ? 194 GLN M CG  1  
ATOM 3824   C CD  . GLN C 3 191 ? -79.350  18.383  21.964  1.00 0.00 ? 194 GLN M CD  1  
ATOM 3825   O OE1 . GLN C 3 191 ? -78.826  19.296  21.269  1.00 0.00 ? 194 GLN M OE1 1  
ATOM 3826   N NE2 . GLN C 3 191 ? -80.172  18.579  23.033  1.00 0.00 ? 194 GLN M NE2 1  
ATOM 3827   N N   . TYR C 3 192 ? -80.355  13.189  23.039  1.00 0.00 ? 195 TYR M N   1  
ATOM 3828   C CA  . TYR C 3 192 ? -81.189  12.024  23.225  1.00 0.00 ? 195 TYR M CA  1  
ATOM 3829   C C   . TYR C 3 192 ? -81.076  11.442  24.612  1.00 0.00 ? 195 TYR M C   1  
ATOM 3830   O O   . TYR C 3 192 ? -82.037  11.258  25.306  1.00 0.00 ? 195 TYR M O   1  
ATOM 3831   C CB  . TYR C 3 192 ? -80.868  10.929  22.277  1.00 0.00 ? 195 TYR M CB  1  
ATOM 3832   C CG  . TYR C 3 192 ? -81.934  9.938   22.246  1.00 0.00 ? 195 TYR M CG  1  
ATOM 3833   C CD1 . TYR C 3 192 ? -83.146  10.213  21.640  1.00 0.00 ? 195 TYR M CD1 1  
ATOM 3834   C CD2 . TYR C 3 192 ? -81.814  8.760   22.950  1.00 0.00 ? 195 TYR M CD2 1  
ATOM 3835   C CE1 . TYR C 3 192 ? -84.163  9.271   21.520  1.00 0.00 ? 195 TYR M CE1 1  
ATOM 3836   C CE2 . TYR C 3 192 ? -82.851  7.832   22.939  1.00 0.00 ? 195 TYR M CE2 1  
ATOM 3837   C CZ  . TYR C 3 192 ? -84.023  8.094   22.233  1.00 0.00 ? 195 TYR M CZ  1  
ATOM 3838   O OH  . TYR C 3 192 ? -85.070  7.204   22.250  1.00 0.00 ? 195 TYR M OH  1  
ATOM 3839   N N   . PHE C 3 193 ? -79.863  11.200  25.045  1.00 0.00 ? 196 PHE M N   1  
ATOM 3840   C CA  . PHE C 3 193 ? -79.677  10.671  26.370  1.00 0.00 ? 196 PHE M CA  1  
ATOM 3841   C C   . PHE C 3 193 ? -80.232  11.574  27.405  1.00 0.00 ? 196 PHE M C   1  
ATOM 3842   O O   . PHE C 3 193 ? -81.010  11.191  28.259  1.00 0.00 ? 196 PHE M O   1  
ATOM 3843   C CB  . PHE C 3 193 ? -78.250  10.238  26.670  1.00 0.00 ? 196 PHE M CB  1  
ATOM 3844   C CG  . PHE C 3 193 ? -77.996  8.924   25.970  1.00 0.00 ? 196 PHE M CG  1  
ATOM 3845   C CD1 . PHE C 3 193 ? -78.771  7.826   26.323  1.00 0.00 ? 196 PHE M CD1 1  
ATOM 3846   C CD2 . PHE C 3 193 ? -77.087  8.778   24.926  1.00 0.00 ? 196 PHE M CD2 1  
ATOM 3847   C CE1 . PHE C 3 193 ? -78.631  6.595   25.691  1.00 0.00 ? 196 PHE M CE1 1  
ATOM 3848   C CE2 . PHE C 3 193 ? -76.931  7.558   24.276  1.00 0.00 ? 196 PHE M CE2 1  
ATOM 3849   C CZ  . PHE C 3 193 ? -77.719  6.474   24.650  1.00 0.00 ? 196 PHE M CZ  1  
ATOM 3850   N N   . ALA C 3 194 ? -79.843  12.806  27.291  1.00 0.00 ? 197 ALA M N   1  
ATOM 3851   C CA  . ALA C 3 194 ? -80.243  13.799  28.288  1.00 0.00 ? 197 ALA M CA  1  
ATOM 3852   C C   . ALA C 3 194 ? -81.752  13.834  28.417  1.00 0.00 ? 197 ALA M C   1  
ATOM 3853   O O   . ALA C 3 194 ? -82.297  13.716  29.486  1.00 0.00 ? 197 ALA M O   1  
ATOM 3854   C CB  . ALA C 3 194 ? -79.660  15.184  28.029  1.00 0.00 ? 197 ALA M CB  1  
ATOM 3855   N N   . THR C 3 195 ? -82.435  13.903  27.287  1.00 0.00 ? 198 THR M N   1  
ATOM 3856   C CA  . THR C 3 195 ? -83.893  13.959  27.290  1.00 0.00 ? 198 THR M CA  1  
ATOM 3857   C C   . THR C 3 195 ? -84.538  12.745  27.940  1.00 0.00 ? 198 THR M C   1  
ATOM 3858   O O   . THR C 3 195 ? -85.184  12.805  28.965  1.00 0.00 ? 198 THR M O   1  
ATOM 3859   C CB  . THR C 3 195 ? -84.463  14.151  25.871  1.00 0.00 ? 198 THR M CB  1  
ATOM 3860   O OG1 . THR C 3 195 ? -83.450  13.841  24.955  1.00 0.00 ? 198 THR M OG1 1  
ATOM 3861   C CG2 . THR C 3 195 ? -84.779  15.628  25.719  1.00 0.00 ? 198 THR M CG2 1  
ATOM 3862   N N   . ILE C 3 196 ? -84.406  11.616  27.271  1.00 0.00 ? 199 ILE M N   1  
ATOM 3863   C CA  . ILE C 3 196 ? -84.981  10.372  27.724  1.00 0.00 ? 199 ILE M CA  1  
ATOM 3864   C C   . ILE C 3 196 ? -84.590  9.871   29.117  1.00 0.00 ? 199 ILE M C   1  
ATOM 3865   O O   . ILE C 3 196 ? -85.056  8.840   29.551  1.00 0.00 ? 199 ILE M O   1  
ATOM 3866   C CB  . ILE C 3 196 ? -84.844  9.251   26.736  1.00 0.00 ? 199 ILE M CB  1  
ATOM 3867   C CG1 . ILE C 3 196 ? -83.640  8.389   27.157  1.00 0.00 ? 199 ILE M CG1 1  
ATOM 3868   C CG2 . ILE C 3 196 ? -84.721  9.770   25.308  1.00 0.00 ? 199 ILE M CG2 1  
ATOM 3869   C CD1 . ILE C 3 196 ? -82.946  7.823   25.933  1.00 0.00 ? 199 ILE M CD1 1  
ATOM 3870   N N   . ALA C 3 197 ? -83.750  10.554  29.859  1.00 0.00 ? 200 ALA M N   1  
ATOM 3871   C CA  . ALA C 3 197 ? -83.459  10.034  31.178  1.00 0.00 ? 200 ALA M CA  1  
ATOM 3872   C C   . ALA C 3 197 ? -82.881  11.091  32.115  1.00 0.00 ? 200 ALA M C   1  
ATOM 3873   O O   . ALA C 3 197 ? -81.819  10.915  32.722  1.00 0.00 ? 200 ALA M O   1  
ATOM 3874   C CB  . ALA C 3 197 ? -82.488  8.897   30.987  1.00 0.00 ? 200 ALA M CB  1  
ATOM 3875   N N   . ALA C 3 198 ? -83.597  12.214  32.241  1.00 0.00 ? 201 ALA M N   1  
ATOM 3876   C CA  . ALA C 3 198 ? -83.172  13.371  33.035  1.00 0.00 ? 201 ALA M CA  1  
ATOM 3877   C C   . ALA C 3 198 ? -83.606  13.457  34.503  1.00 0.00 ? 201 ALA M C   1  
ATOM 3878   O O   . ALA C 3 198 ? -84.774  13.250  34.830  1.00 0.00 ? 201 ALA M O   1  
ATOM 3879   C CB  . ALA C 3 198 ? -83.565  14.640  32.311  1.00 0.00 ? 201 ALA M CB  1  
ATOM 3880   N N   . SER C 3 199 ? -82.646  13.817  35.371  1.00 0.00 ? 202 SER M N   1  
ATOM 3881   C CA  . SER C 3 199 ? -82.890  13.985  36.810  1.00 0.00 ? 202 SER M CA  1  
ATOM 3882   C C   . SER C 3 199 ? -82.506  15.367  37.366  1.00 0.00 ? 202 SER M C   1  
ATOM 3883   O O   . SER C 3 199 ? -81.888  15.459  38.442  1.00 0.00 ? 202 SER M O   1  
ATOM 3884   C CB  . SER C 3 199 ? -82.304  12.867  37.667  1.00 0.00 ? 202 SER M CB  1  
ATOM 3885   O OG  . SER C 3 199 ? -83.293  12.185  38.457  1.00 0.00 ? 202 SER M OG  1  
ATOM 3886   N N   . GLY C 3 200 ? -82.899  16.420  36.610  1.00 0.00 ? 203 GLY M N   1  
ATOM 3887   C CA  . GLY C 3 200 ? -82.664  17.812  36.983  1.00 0.00 ? 203 GLY M CA  1  
ATOM 3888   C C   . GLY C 3 200 ? -84.008  18.378  37.435  1.00 0.00 ? 203 GLY M C   1  
ATOM 3889   O O   . GLY C 3 200 ? -84.594  19.253  36.815  1.00 0.00 ? 203 GLY M O   1  
ATOM 3890   N N   . GLU C 3 201 ? -84.485  17.776  38.523  1.00 0.00 ? 204 GLU M N   1  
ATOM 3891   C CA  . GLU C 3 201 ? -85.780  18.040  39.138  1.00 0.00 ? 204 GLU M CA  1  
ATOM 3892   C C   . GLU C 3 201 ? -86.083  19.510  39.349  1.00 0.00 ? 204 GLU M C   1  
ATOM 3893   O O   . GLU C 3 201 ? -87.080  19.993  38.788  1.00 0.00 ? 204 GLU M O   1  
ATOM 3894   C CB  . GLU C 3 201 ? -86.038  17.129  40.357  1.00 0.00 ? 204 GLU M CB  1  
ATOM 3895   C CG  . GLU C 3 201 ? -86.126  15.629  39.920  1.00 0.00 ? 204 GLU M CG  1  
ATOM 3896   C CD  . GLU C 3 201 ? -85.969  14.669  41.063  1.00 0.00 ? 204 GLU M CD  1  
ATOM 3897   O OE1 . GLU C 3 201 ? -86.857  14.532  41.924  1.00 0.00 ? 204 GLU M OE1 1  
ATOM 3898   O OE2 . GLU C 3 201 ? -84.800  14.010  41.033  1.00 0.00 ? 204 GLU M OE2 1  
ATOM 3899   N N   . LEU C 3 215 ? -75.957  21.671  32.764  1.00 0.00 ? 218 LEU M N   1  
ATOM 3900   C CA  . LEU C 3 215 ? -75.270  20.635  32.035  1.00 0.00 ? 218 LEU M CA  1  
ATOM 3901   C C   . LEU C 3 215 ? -75.269  20.937  30.556  1.00 0.00 ? 218 LEU M C   1  
ATOM 3902   O O   . LEU C 3 215 ? -74.276  21.100  29.850  1.00 0.00 ? 218 LEU M O   1  
ATOM 3903   C CB  . LEU C 3 215 ? -76.055  19.339  32.226  1.00 0.00 ? 218 LEU M CB  1  
ATOM 3904   C CG  . LEU C 3 215 ? -75.147  18.234  32.756  1.00 0.00 ? 218 LEU M CG  1  
ATOM 3905   C CD1 . LEU C 3 215 ? -75.894  16.953  33.108  1.00 0.00 ? 218 LEU M CD1 1  
ATOM 3906   C CD2 . LEU C 3 215 ? -74.219  17.951  31.630  1.00 0.00 ? 218 LEU M CD2 1  
ATOM 3907   N N   . GLU C 3 216 ? -76.493  21.073  30.129  1.00 0.00 ? 219 GLU M N   1  
ATOM 3908   C CA  . GLU C 3 216 ? -76.847  21.363  28.780  1.00 0.00 ? 219 GLU M CA  1  
ATOM 3909   C C   . GLU C 3 216 ? -76.001  22.431  28.129  1.00 0.00 ? 219 GLU M C   1  
ATOM 3910   O O   . GLU C 3 216 ? -75.880  22.531  26.929  1.00 0.00 ? 219 GLU M O   1  
ATOM 3911   C CB  . GLU C 3 216 ? -78.332  21.729  28.762  1.00 0.00 ? 219 GLU M CB  1  
ATOM 3912   C CG  . GLU C 3 216 ? -79.164  20.580  29.359  1.00 0.00 ? 219 GLU M CG  1  
ATOM 3913   C CD  . GLU C 3 216 ? -79.580  20.734  30.761  1.00 0.00 ? 219 GLU M CD  1  
ATOM 3914   O OE1 . GLU C 3 216 ? -80.309  21.812  30.926  1.00 0.00 ? 219 GLU M OE1 1  
ATOM 3915   O OE2 . GLU C 3 216 ? -79.248  19.932  31.643  1.00 0.00 ? 219 GLU M OE2 1  
ATOM 3916   N N   . ASP C 3 217 ? -75.402  23.253  28.923  1.00 0.00 ? 220 ASP M N   1  
ATOM 3917   C CA  . ASP C 3 217 ? -74.549  24.316  28.381  1.00 0.00 ? 220 ASP M CA  1  
ATOM 3918   C C   . ASP C 3 217 ? -73.111  23.888  28.452  1.00 0.00 ? 220 ASP M C   1  
ATOM 3919   O O   . ASP C 3 217 ? -72.357  24.077  27.493  1.00 0.00 ? 220 ASP M O   1  
ATOM 3920   C CB  . ASP C 3 217 ? -74.650  25.667  29.115  1.00 0.00 ? 220 ASP M CB  1  
ATOM 3921   C CG  . ASP C 3 217 ? -76.051  26.116  29.498  1.00 0.00 ? 220 ASP M CG  1  
ATOM 3922   O OD1 . ASP C 3 217 ? -76.905  26.055  28.507  1.00 0.00 ? 220 ASP M OD1 1  
ATOM 3923   O OD2 . ASP C 3 217 ? -76.345  26.560  30.616  1.00 0.00 ? 220 ASP M OD2 1  
ATOM 3924   N N   . GLN C 3 218 ? -72.742  23.363  29.645  1.00 0.00 ? 221 GLN M N   1  
ATOM 3925   C CA  . GLN C 3 218 ? -71.379  22.898  29.875  1.00 0.00 ? 221 GLN M CA  1  
ATOM 3926   C C   . GLN C 3 218 ? -71.086  21.955  28.768  1.00 0.00 ? 221 GLN M C   1  
ATOM 3927   O O   . GLN C 3 218 ? -70.089  22.085  28.070  1.00 0.00 ? 221 GLN M O   1  
ATOM 3928   C CB  . GLN C 3 218 ? -71.205  22.158  31.190  1.00 0.00 ? 221 GLN M CB  1  
ATOM 3929   C CG  . GLN C 3 218 ? -72.407  22.296  32.141  1.00 0.00 ? 221 GLN M CG  1  
ATOM 3930   C CD  . GLN C 3 218 ? -72.046  22.805  33.525  1.00 0.00 ? 221 GLN M CD  1  
ATOM 3931   O OE1 . GLN C 3 218 ? -70.888  22.759  33.938  1.00 0.00 ? 221 GLN M OE1 1  
ATOM 3932   N NE2 . GLN C 3 218 ? -73.055  23.242  34.284  1.00 0.00 ? 221 GLN M NE2 1  
ATOM 3933   N N   . ILE C 3 219 ? -72.065  21.079  28.613  1.00 0.00 ? 222 ILE M N   1  
ATOM 3934   C CA  . ILE C 3 219 ? -72.085  20.044  27.598  1.00 0.00 ? 222 ILE M CA  1  
ATOM 3935   C C   . ILE C 3 219 ? -71.677  20.689  26.304  1.00 0.00 ? 222 ILE M C   1  
ATOM 3936   O O   . ILE C 3 219 ? -70.776  20.329  25.600  1.00 0.00 ? 222 ILE M O   1  
ATOM 3937   C CB  . ILE C 3 219 ? -73.513  19.593  27.435  1.00 0.00 ? 222 ILE M CB  1  
ATOM 3938   C CG1 . ILE C 3 219 ? -73.953  18.672  28.565  1.00 0.00 ? 222 ILE M CG1 1  
ATOM 3939   C CG2 . ILE C 3 219 ? -73.598  18.880  26.131  1.00 0.00 ? 222 ILE M CG2 1  
ATOM 3940   C CD1 . ILE C 3 219 ? -73.369  17.304  28.372  1.00 0.00 ? 222 ILE M CD1 1  
ATOM 3941   N N   . ILE C 3 220 ? -72.365  21.746  26.024  1.00 0.00 ? 223 ILE M N   1  
ATOM 3942   C CA  . ILE C 3 220 ? -72.133  22.479  24.819  1.00 0.00 ? 223 ILE M CA  1  
ATOM 3943   C C   . ILE C 3 220 ? -70.832  23.254  24.872  1.00 0.00 ? 223 ILE M C   1  
ATOM 3944   O O   . ILE C 3 220 ? -69.954  23.093  24.045  1.00 0.00 ? 223 ILE M O   1  
ATOM 3945   C CB  . ILE C 3 220 ? -73.307  23.378  24.545  1.00 0.00 ? 223 ILE M CB  1  
ATOM 3946   C CG1 . ILE C 3 220 ? -74.550  22.512  24.320  1.00 0.00 ? 223 ILE M CG1 1  
ATOM 3947   C CG2 . ILE C 3 220 ? -72.972  24.141  23.309  1.00 0.00 ? 223 ILE M CG2 1  
ATOM 3948   C CD1 . ILE C 3 220 ? -75.383  22.944  23.125  1.00 0.00 ? 223 ILE M CD1 1  
ATOM 3949   N N   . SER C 3 221 ? -70.734  24.112  25.870  1.00 0.00 ? 224 SER M N   1  
ATOM 3950   C CA  . SER C 3 221 ? -69.572  24.977  26.036  1.00 0.00 ? 224 SER M CA  1  
ATOM 3951   C C   . SER C 3 221 ? -68.285  24.244  25.872  1.00 0.00 ? 224 SER M C   1  
ATOM 3952   O O   . SER C 3 221 ? -67.283  24.821  25.540  1.00 0.00 ? 224 SER M O   1  
ATOM 3953   C CB  . SER C 3 221 ? -69.586  25.719  27.337  1.00 0.00 ? 224 SER M CB  1  
ATOM 3954   O OG  . SER C 3 221 ? -70.508  26.771  27.156  1.00 0.00 ? 224 SER M OG  1  
ATOM 3955   N N   . ALA C 3 222 ? -68.361  22.934  26.071  1.00 0.00 ? 225 ALA M N   1  
ATOM 3956   C CA  . ALA C 3 222 ? -67.202  22.098  25.975  1.00 0.00 ? 225 ALA M CA  1  
ATOM 3957   C C   . ALA C 3 222 ? -66.465  22.307  24.699  1.00 0.00 ? 225 ALA M C   1  
ATOM 3958   O O   . ALA C 3 222 ? -65.286  22.608  24.652  1.00 0.00 ? 225 ALA M O   1  
ATOM 3959   C CB  . ALA C 3 222 ? -67.514  20.635  26.100  1.00 0.00 ? 225 ALA M CB  1  
ATOM 3960   N N   . ASN C 3 223 ? -67.209  22.146  23.642  1.00 0.00 ? 226 ASN M N   1  
ATOM 3961   C CA  . ASN C 3 223 ? -66.668  22.216  22.290  1.00 0.00 ? 226 ASN M CA  1  
ATOM 3962   C C   . ASN C 3 223 ? -65.715  23.350  22.013  1.00 0.00 ? 226 ASN M C   1  
ATOM 3963   O O   . ASN C 3 223 ? -64.555  23.140  21.709  1.00 0.00 ? 226 ASN M O   1  
ATOM 3964   C CB  . ASN C 3 223 ? -67.737  22.111  21.181  1.00 0.00 ? 226 ASN M CB  1  
ATOM 3965   C CG  . ASN C 3 223 ? -68.936  21.274  21.566  1.00 0.00 ? 226 ASN M CG  1  
ATOM 3966   O OD1 . ASN C 3 223 ? -68.800  20.105  21.932  1.00 0.00 ? 226 ASN M OD1 1  
ATOM 3967   N ND2 . ASN C 3 223 ? -70.118  21.886  21.442  1.00 0.00 ? 226 ASN M ND2 1  
ATOM 3968   N N   . PRO C 3 224 ? -66.247  24.557  22.110  1.00 0.00 ? 227 PRO M N   1  
ATOM 3969   C CA  . PRO C 3 224 ? -65.509  25.777  21.857  1.00 0.00 ? 227 PRO M CA  1  
ATOM 3970   C C   . PRO C 3 224 ? -64.193  25.974  22.615  1.00 0.00 ? 227 PRO M C   1  
ATOM 3971   O O   . PRO C 3 224 ? -63.374  26.867  22.309  1.00 0.00 ? 227 PRO M O   1  
ATOM 3972   C CB  . PRO C 3 224 ? -66.461  26.926  22.151  1.00 0.00 ? 227 PRO M CB  1  
ATOM 3973   C CG  . PRO C 3 224 ? -67.750  26.318  22.673  1.00 0.00 ? 227 PRO M CG  1  
ATOM 3974   C CD  . PRO C 3 224 ? -67.619  24.800  22.595  1.00 0.00 ? 227 PRO M CD  1  
ATOM 3975   N N   . LEU C 3 225 ? -63.934  25.105  23.571  1.00 0.00 ? 228 LEU M N   1  
ATOM 3976   C CA  . LEU C 3 225 ? -62.677  25.198  24.309  1.00 0.00 ? 228 LEU M CA  1  
ATOM 3977   C C   . LEU C 3 225 ? -61.713  24.274  23.582  1.00 0.00 ? 228 LEU M C   1  
ATOM 3978   O O   . LEU C 3 225 ? -60.696  24.683  23.048  1.00 0.00 ? 228 LEU M O   1  
ATOM 3979   C CB  . LEU C 3 225 ? -62.905  24.697  25.736  1.00 0.00 ? 228 LEU M CB  1  
ATOM 3980   C CG  . LEU C 3 225 ? -61.689  24.684  26.569  1.00 0.00 ? 228 LEU M CG  1  
ATOM 3981   C CD1 . LEU C 3 225 ? -61.220  26.078  26.735  1.00 0.00 ? 228 LEU M CD1 1  
ATOM 3982   C CD2 . LEU C 3 225 ? -62.119  24.156  27.883  1.00 0.00 ? 228 LEU M CD2 1  
ATOM 3983   N N   . LEU C 3 226 ? -62.130  23.019  23.506  1.00 0.00 ? 229 LEU M N   1  
ATOM 3984   C CA  . LEU C 3 226 ? -61.419  21.987  22.820  1.00 0.00 ? 229 LEU M CA  1  
ATOM 3985   C C   . LEU C 3 226 ? -60.988  22.430  21.446  1.00 0.00 ? 229 LEU M C   1  
ATOM 3986   O O   . LEU C 3 226 ? -59.844  22.181  21.023  1.00 0.00 ? 229 LEU M O   1  
ATOM 3987   C CB  . LEU C 3 226 ? -62.315  20.745  22.704  1.00 0.00 ? 229 LEU M CB  1  
ATOM 3988   C CG  . LEU C 3 226 ? -62.068  19.738  23.831  1.00 0.00 ? 229 LEU M CG  1  
ATOM 3989   C CD1 . LEU C 3 226 ? -61.403  20.362  25.002  1.00 0.00 ? 229 LEU M CD1 1  
ATOM 3990   C CD2 . LEU C 3 226 ? -63.342  19.143  24.303  1.00 0.00 ? 229 LEU M CD2 1  
ATOM 3991   N N   . GLU C 3 227 ? -61.902  23.122  20.779  1.00 0.00 ? 230 GLU M N   1  
ATOM 3992   C CA  . GLU C 3 227 ? -61.736  23.640  19.408  1.00 0.00 ? 230 GLU M CA  1  
ATOM 3993   C C   . GLU C 3 227 ? -60.644  24.691  19.310  1.00 0.00 ? 230 GLU M C   1  
ATOM 3994   O O   . GLU C 3 227 ? -59.937  24.834  18.323  1.00 0.00 ? 230 GLU M O   1  
ATOM 3995   C CB  . GLU C 3 227 ? -63.046  24.243  18.901  1.00 0.00 ? 230 GLU M CB  1  
ATOM 3996   C CG  . GLU C 3 227 ? -64.173  23.241  18.637  1.00 0.00 ? 230 GLU M CG  1  
ATOM 3997   C CD  . GLU C 3 227 ? -65.080  23.653  17.499  1.00 0.00 ? 230 GLU M CD  1  
ATOM 3998   O OE1 . GLU C 3 227 ? -64.908  24.635  16.792  1.00 0.00 ? 230 GLU M OE1 1  
ATOM 3999   O OE2 . GLU C 3 227 ? -66.099  22.840  17.348  1.00 0.00 ? 230 GLU M OE2 1  
ATOM 4000   N N   . ALA C 3 228 ? -60.512  25.475  20.363  1.00 0.00 ? 231 ALA M N   1  
ATOM 4001   C CA  . ALA C 3 228 ? -59.451  26.469  20.361  1.00 0.00 ? 231 ALA M CA  1  
ATOM 4002   C C   . ALA C 3 228 ? -58.114  25.871  20.448  1.00 0.00 ? 231 ALA M C   1  
ATOM 4003   O O   . ALA C 3 228 ? -57.200  26.511  19.938  1.00 0.00 ? 231 ALA M O   1  
ATOM 4004   C CB  . ALA C 3 228 ? -59.589  27.422  21.506  1.00 0.00 ? 231 ALA M CB  1  
ATOM 4005   N N   . PHE C 3 229 ? -58.078  24.702  21.118  1.00 0.00 ? 232 PHE M N   1  
ATOM 4006   C CA  . PHE C 3 229 ? -56.864  23.934  21.352  1.00 0.00 ? 232 PHE M CA  1  
ATOM 4007   C C   . PHE C 3 229 ? -56.612  22.765  20.475  1.00 0.00 ? 232 PHE M C   1  
ATOM 4008   O O   . PHE C 3 229 ? -55.478  22.495  20.172  1.00 0.00 ? 232 PHE M O   1  
ATOM 4009   C CB  . PHE C 3 229 ? -56.755  23.446  22.749  1.00 0.00 ? 232 PHE M CB  1  
ATOM 4010   C CG  . PHE C 3 229 ? -56.684  24.568  23.768  1.00 0.00 ? 232 PHE M CG  1  
ATOM 4011   C CD1 . PHE C 3 229 ? -55.472  25.165  24.131  1.00 0.00 ? 232 PHE M CD1 1  
ATOM 4012   C CD2 . PHE C 3 229 ? -57.848  25.034  24.350  1.00 0.00 ? 232 PHE M CD2 1  
ATOM 4013   C CE1 . PHE C 3 229 ? -55.433  26.201  25.055  1.00 0.00 ? 232 PHE M CE1 1  
ATOM 4014   C CE2 . PHE C 3 229 ? -57.821  26.068  25.293  1.00 0.00 ? 232 PHE M CE2 1  
ATOM 4015   C CZ  . PHE C 3 229 ? -56.612  26.643  25.648  1.00 0.00 ? 232 PHE M CZ  1  
ATOM 4016   N N   . GLY C 3 230 ? -57.657  22.078  20.075  1.00 0.00 ? 233 GLY M N   1  
ATOM 4017   C CA  . GLY C 3 230 ? -57.491  20.956  19.171  1.00 0.00 ? 233 GLY M CA  1  
ATOM 4018   C C   . GLY C 3 230 ? -57.961  21.177  17.762  1.00 0.00 ? 233 GLY M C   1  
ATOM 4019   O O   . GLY C 3 230 ? -58.113  20.215  17.058  1.00 0.00 ? 233 GLY M O   1  
ATOM 4020   N N   . ASN C 3 231 ? -58.242  22.420  17.342  1.00 0.00 ? 234 ASN M N   1  
ATOM 4021   C CA  . ASN C 3 231 ? -58.705  22.732  15.990  1.00 0.00 ? 234 ASN M CA  1  
ATOM 4022   C C   . ASN C 3 231 ? -57.846  23.758  15.315  1.00 0.00 ? 234 ASN M C   1  
ATOM 4023   O O   . ASN C 3 231 ? -57.239  24.562  15.940  1.00 0.00 ? 234 ASN M O   1  
ATOM 4024   C CB  . ASN C 3 231 ? -60.169  23.190  15.898  1.00 0.00 ? 234 ASN M CB  1  
ATOM 4025   C CG  . ASN C 3 231 ? -61.218  22.060  15.871  1.00 0.00 ? 234 ASN M CG  1  
ATOM 4026   O OD1 . ASN C 3 231 ? -61.194  21.111  16.642  1.00 0.00 ? 234 ASN M OD1 1  
ATOM 4027   N ND2 . ASN C 3 231 ? -62.170  22.154  14.967  1.00 0.00 ? 234 ASN M ND2 1  
ATOM 4028   N N   . ALA C 3 232 ? -57.826  23.710  14.008  1.00 0.00 ? 235 ALA M N   1  
ATOM 4029   C CA  . ALA C 3 232 ? -57.030  24.610  13.246  1.00 0.00 ? 235 ALA M CA  1  
ATOM 4030   C C   . ALA C 3 232 ? -57.410  24.693  11.785  1.00 0.00 ? 235 ALA M C   1  
ATOM 4031   O O   . ALA C 3 232 ? -58.090  23.890  11.234  1.00 0.00 ? 235 ALA M O   1  
ATOM 4032   C CB  . ALA C 3 232 ? -55.635  24.016  13.356  1.00 0.00 ? 235 ALA M CB  1  
ATOM 4033   N N   . LYS C 3 233 ? -56.912  25.685  11.108  1.00 0.00 ? 236 LYS M N   1  
ATOM 4034   C CA  . LYS C 3 233 ? -57.138  25.835  9.721   1.00 0.00 ? 236 LYS M CA  1  
ATOM 4035   C C   . LYS C 3 233 ? -56.346  24.892  8.934   1.00 0.00 ? 236 LYS M C   1  
ATOM 4036   O O   . LYS C 3 233 ? -55.160  25.093  8.867   1.00 0.00 ? 236 LYS M O   1  
ATOM 4037   C CB  . LYS C 3 233 ? -56.831  27.233  9.167   1.00 0.00 ? 236 LYS M CB  1  
ATOM 4038   C CG  . LYS C 3 233 ? -57.380  27.333  7.730   1.00 0.00 ? 236 LYS M CG  1  
ATOM 4039   C CD  . LYS C 3 233 ? -56.421  27.929  6.713   1.00 0.00 ? 236 LYS M CD  1  
ATOM 4040   C CE  . LYS C 3 233 ? -57.039  28.231  5.351   1.00 0.00 ? 236 LYS M CE  1  
ATOM 4041   N NZ  . LYS C 3 233 ? -56.025  28.259  4.295   1.00 0.00 ? 236 LYS M NZ  1  
ATOM 4042   N N   . THR C 3 234 ? -57.009  23.963  8.331   1.00 0.00 ? 237 THR M N   1  
ATOM 4043   C CA  . THR C 3 234 ? -56.423  22.965  7.451   1.00 0.00 ? 237 THR M CA  1  
ATOM 4044   C C   . THR C 3 234 ? -56.612  23.523  6.068   1.00 0.00 ? 237 THR M C   1  
ATOM 4045   O O   . THR C 3 234 ? -57.433  24.409  5.855   1.00 0.00 ? 237 THR M O   1  
ATOM 4046   C CB  . THR C 3 234 ? -57.158  21.634  7.553   1.00 0.00 ? 237 THR M CB  1  
ATOM 4047   O OG1 . THR C 3 234 ? -57.018  21.080  8.814   1.00 0.00 ? 237 THR M OG1 1  
ATOM 4048   C CG2 . THR C 3 234 ? -56.724  20.638  6.484   1.00 0.00 ? 237 THR M CG2 1  
ATOM 4049   N N   . VAL C 3 235 ? -55.877  22.991  5.125   1.00 0.00 ? 238 VAL M N   1  
ATOM 4050   C CA  . VAL C 3 235 ? -55.987  23.434  3.751   1.00 0.00 ? 238 VAL M CA  1  
ATOM 4051   C C   . VAL C 3 235 ? -57.351  23.037  3.160   1.00 0.00 ? 238 VAL M C   1  
ATOM 4052   O O   . VAL C 3 235 ? -57.821  23.581  2.194   1.00 0.00 ? 238 VAL M O   1  
ATOM 4053   C CB  . VAL C 3 235 ? -54.798  22.902  2.937   1.00 0.00 ? 238 VAL M CB  1  
ATOM 4054   C CG1 . VAL C 3 235 ? -54.803  21.412  2.837   1.00 0.00 ? 238 VAL M CG1 1  
ATOM 4055   C CG2 . VAL C 3 235 ? -54.724  23.522  1.553   1.00 0.00 ? 238 VAL M CG2 1  
ATOM 4056   N N   . ARG C 3 236 ? -58.022  22.106  3.815   1.00 0.00 ? 239 ARG M N   1  
ATOM 4057   C CA  . ARG C 3 236 ? -59.327  21.608  3.410   1.00 0.00 ? 239 ARG M CA  1  
ATOM 4058   C C   . ARG C 3 236 ? -60.470  22.310  4.132   1.00 0.00 ? 239 ARG M C   1  
ATOM 4059   O O   . ARG C 3 236 ? -61.397  22.832  3.525   1.00 0.00 ? 239 ARG M O   1  
ATOM 4060   C CB  . ARG C 3 236 ? -59.474  20.117  3.678   1.00 0.00 ? 239 ARG M CB  1  
ATOM 4061   C CG  . ARG C 3 236 ? -59.049  19.280  2.469   1.00 0.00 ? 239 ARG M CG  1  
ATOM 4062   C CD  . ARG C 3 236 ? -59.946  18.099  2.275   1.00 0.00 ? 239 ARG M CD  1  
ATOM 4063   N NE  . ARG C 3 236 ? -59.411  17.175  1.294   1.00 0.00 ? 239 ARG M NE  1  
ATOM 4064   C CZ  . ARG C 3 236 ? -59.833  15.921  1.167   1.00 0.00 ? 239 ARG M CZ  1  
ATOM 4065   N NH1 . ARG C 3 236 ? -60.766  15.415  1.984   1.00 0.00 ? 239 ARG M NH1 1  
ATOM 4066   N NH2 . ARG C 3 236 ? -59.288  15.146  0.244   1.00 0.00 ? 239 ARG M NH2 1  
ATOM 4067   N N   . ASN C 3 237 ? -60.397  22.304  5.447   1.00 0.00 ? 240 ASN M N   1  
ATOM 4068   C CA  . ASN C 3 237 ? -61.366  22.955  6.286   1.00 0.00 ? 240 ASN M CA  1  
ATOM 4069   C C   . ASN C 3 237 ? -60.726  24.206  6.908   1.00 0.00 ? 240 ASN M C   1  
ATOM 4070   O O   . ASN C 3 237 ? -59.521  24.418  6.797   1.00 0.00 ? 240 ASN M O   1  
ATOM 4071   C CB  . ASN C 3 237 ? -61.882  22.057  7.371   1.00 0.00 ? 240 ASN M CB  1  
ATOM 4072   C CG  . ASN C 3 237 ? -63.186  22.506  7.903   1.00 0.00 ? 240 ASN M CG  1  
ATOM 4073   O OD1 . ASN C 3 237 ? -63.586  23.597  7.586   1.00 0.00 ? 240 ASN M OD1 1  
ATOM 4074   N ND2 . ASN C 3 237 ? -63.834  21.677  8.708   1.00 0.00 ? 240 ASN M ND2 1  
ATOM 4075   N N   . ASP C 3 238 ? -61.526  25.044  7.529   1.00 0.00 ? 241 ASP M N   1  
ATOM 4076   C CA  . ASP C 3 238 ? -61.028  26.277  8.134   1.00 0.00 ? 241 ASP M CA  1  
ATOM 4077   C C   . ASP C 3 238 ? -61.006  26.120  9.612   1.00 0.00 ? 241 ASP M C   1  
ATOM 4078   O O   . ASP C 3 238 ? -60.353  26.879  10.300  1.00 0.00 ? 241 ASP M O   1  
ATOM 4079   C CB  . ASP C 3 238 ? -61.882  27.506  7.790   1.00 0.00 ? 241 ASP M CB  1  
ATOM 4080   C CG  . ASP C 3 238 ? -61.292  28.176  6.623   1.00 0.00 ? 241 ASP M CG  1  
ATOM 4081   O OD1 . ASP C 3 238 ? -60.203  27.502  6.225   1.00 0.00 ? 241 ASP M OD1 1  
ATOM 4082   O OD2 . ASP C 3 238 ? -61.758  29.198  6.124   1.00 0.00 ? 241 ASP M OD2 1  
ATOM 4083   N N   . ASN C 3 239 ? -61.746  25.104  10.037  1.00 0.00 ? 242 ASN M N   1  
ATOM 4084   C CA  . ASN C 3 239 ? -61.886  24.667  11.417  1.00 0.00 ? 242 ASN M CA  1  
ATOM 4085   C C   . ASN C 3 239 ? -61.822  23.168  11.475  1.00 0.00 ? 242 ASN M C   1  
ATOM 4086   O O   . ASN C 3 239 ? -62.796  22.570  11.900  1.00 0.00 ? 242 ASN M O   1  
ATOM 4087   C CB  . ASN C 3 239 ? -63.177  25.094  12.047  1.00 0.00 ? 242 ASN M CB  1  
ATOM 4088   C CG  . ASN C 3 239 ? -63.141  25.289  13.534  1.00 0.00 ? 242 ASN M CG  1  
ATOM 4089   O OD1 . ASN C 3 239 ? -62.221  25.896  14.078  1.00 0.00 ? 242 ASN M OD1 1  
ATOM 4090   N ND2 . ASN C 3 239 ? -64.123  24.863  14.280  1.00 0.00 ? 242 ASN M ND2 1  
ATOM 4091   N N   . SER C 3 240 ? -60.682  22.555  11.066  1.00 0.00 ? 243 SER M N   1  
ATOM 4092   C CA  . SER C 3 240 ? -60.563  21.114  11.077  1.00 0.00 ? 243 SER M CA  1  
ATOM 4093   C C   . SER C 3 240 ? -60.272  20.545  12.422  1.00 0.00 ? 243 SER M C   1  
ATOM 4094   O O   . SER C 3 240 ? -59.543  21.122  13.209  1.00 0.00 ? 243 SER M O   1  
ATOM 4095   C CB  . SER C 3 240 ? -59.547  20.643  10.100  1.00 0.00 ? 243 SER M CB  1  
ATOM 4096   O OG  . SER C 3 240 ? -59.878  19.347  9.606   1.00 0.00 ? 243 SER M OG  1  
ATOM 4097   N N   . SER C 3 241 ? -60.893  19.404  12.705  1.00 0.00 ? 244 SER M N   1  
ATOM 4098   C CA  . SER C 3 241 ? -60.713  18.694  13.975  1.00 0.00 ? 244 SER M CA  1  
ATOM 4099   C C   . SER C 3 241 ? -59.361  17.979  13.950  1.00 0.00 ? 244 SER M C   1  
ATOM 4100   O O   . SER C 3 241 ? -59.154  17.045  13.188  1.00 0.00 ? 244 SER M O   1  
ATOM 4101   C CB  . SER C 3 241 ? -61.820  17.677  14.159  1.00 0.00 ? 244 SER M CB  1  
ATOM 4102   O OG  . SER C 3 241 ? -62.468  17.904  15.407  1.00 0.00 ? 244 SER M OG  1  
ATOM 4103   N N   . ARG C 3 242 ? -58.395  18.372  14.787  1.00 0.00 ? 245 ARG M N   1  
ATOM 4104   C CA  . ARG C 3 242 ? -57.132  17.699  14.738  1.00 0.00 ? 245 ARG M CA  1  
ATOM 4105   C C   . ARG C 3 242 ? -56.972  16.637  15.722  1.00 0.00 ? 245 ARG M C   1  
ATOM 4106   O O   . ARG C 3 242 ? -55.885  16.256  15.986  1.00 0.00 ? 245 ARG M O   1  
ATOM 4107   C CB  . ARG C 3 242 ? -55.972  18.565  14.536  1.00 0.00 ? 245 ARG M CB  1  
ATOM 4108   C CG  . ARG C 3 242 ? -56.286  19.433  13.367  1.00 0.00 ? 245 ARG M CG  1  
ATOM 4109   C CD  . ARG C 3 242 ? -55.544  18.999  12.126  1.00 0.00 ? 245 ARG M CD  1  
ATOM 4110   N NE  . ARG C 3 242 ? -56.322  18.352  11.093  1.00 0.00 ? 245 ARG M NE  1  
ATOM 4111   C CZ  . ARG C 3 242 ? -55.838  17.389  10.327  1.00 0.00 ? 245 ARG M CZ  1  
ATOM 4112   N NH1 . ARG C 3 242 ? -54.591  16.959  10.497  1.00 0.00 ? 245 ARG M NH1 1  
ATOM 4113   N NH2 . ARG C 3 242 ? -56.615  16.826  9.389   1.00 0.00 ? 245 ARG M NH2 1  
ATOM 4114   N N   . PHE C 3 243 ? -60.593  17.796  16.364  1.00 0.00 ? 246 PHE M N   1  
ATOM 4115   C CA  . PHE C 3 243 ? -60.145  16.892  17.394  1.00 0.00 ? 246 PHE M CA  1  
ATOM 4116   C C   . PHE C 3 243 ? -61.125  15.772  17.637  1.00 0.00 ? 246 PHE M C   1  
ATOM 4117   O O   . PHE C 3 243 ? -62.281  15.825  17.222  1.00 0.00 ? 246 PHE M O   1  
ATOM 4118   C CB  . PHE C 3 243 ? -59.959  17.703  18.639  1.00 0.00 ? 246 PHE M CB  1  
ATOM 4119   C CG  . PHE C 3 243 ? -61.241  18.197  19.219  1.00 0.00 ? 246 PHE M CG  1  
ATOM 4120   C CD1 . PHE C 3 243 ? -61.776  19.423  18.808  1.00 0.00 ? 246 PHE M CD1 1  
ATOM 4121   C CD2 . PHE C 3 243 ? -61.933  17.433  20.147  1.00 0.00 ? 246 PHE M CD2 1  
ATOM 4122   C CE1 . PHE C 3 243 ? -62.986  19.873  19.338  1.00 0.00 ? 246 PHE M CE1 1  
ATOM 4123   C CE2 . PHE C 3 243 ? -63.138  17.887  20.702  1.00 0.00 ? 246 PHE M CE2 1  
ATOM 4124   C CZ  . PHE C 3 243 ? -63.666  19.097  20.282  1.00 0.00 ? 246 PHE M CZ  1  
ATOM 4125   N N   . GLY C 3 244 ? -60.669  14.745  18.352  1.00 0.00 ? 247 GLY M N   1  
ATOM 4126   C CA  . GLY C 3 244 ? -61.484  13.575  18.656  1.00 0.00 ? 247 GLY M CA  1  
ATOM 4127   C C   . GLY C 3 244 ? -62.034  13.628  20.034  1.00 0.00 ? 247 GLY M C   1  
ATOM 4128   O O   . GLY C 3 244 ? -61.584  14.393  20.851  1.00 0.00 ? 247 GLY M O   1  
ATOM 4129   N N   . LYS C 3 245 ? -63.027  12.802  20.334  1.00 0.00 ? 248 LYS M N   1  
ATOM 4130   C CA  . LYS C 3 245 ? -63.545  12.888  21.674  1.00 0.00 ? 248 LYS M CA  1  
ATOM 4131   C C   . LYS C 3 245 ? -64.334  11.723  22.174  1.00 0.00 ? 248 LYS M C   1  
ATOM 4132   O O   . LYS C 3 245 ? -64.934  11.024  21.396  1.00 0.00 ? 248 LYS M O   1  
ATOM 4133   C CB  . LYS C 3 245 ? -64.246  14.199  21.929  1.00 0.00 ? 248 LYS M CB  1  
ATOM 4134   C CG  . LYS C 3 245 ? -65.739  14.069  22.062  1.00 0.00 ? 248 LYS M CG  1  
ATOM 4135   C CD  . LYS C 3 245 ? -66.425  15.374  22.399  1.00 0.00 ? 248 LYS M CD  1  
ATOM 4136   C CE  . LYS C 3 245 ? -67.760  15.536  21.646  1.00 0.00 ? 248 LYS M CE  1  
ATOM 4137   N NZ  . LYS C 3 245 ? -68.187  16.915  21.306  1.00 0.00 ? 248 LYS M NZ  1  
ATOM 4138   N N   . PHE C 3 246 ? -64.303  11.585  23.503  1.00 0.00 ? 249 PHE M N   1  
ATOM 4139   C CA  . PHE C 3 246 ? -64.935  10.519  24.185  1.00 0.00 ? 249 PHE M CA  1  
ATOM 4140   C C   . PHE C 3 246 ? -65.594  10.929  25.452  1.00 0.00 ? 249 PHE M C   1  
ATOM 4141   O O   . PHE C 3 246 ? -64.927  11.327  26.375  1.00 0.00 ? 249 PHE M O   1  
ATOM 4142   C CB  . PHE C 3 246 ? -63.909  9.448   24.447  1.00 0.00 ? 249 PHE M CB  1  
ATOM 4143   C CG  . PHE C 3 246 ? -64.433  8.123   24.956  1.00 0.00 ? 249 PHE M CG  1  
ATOM 4144   C CD1 . PHE C 3 246 ? -65.366  7.391   24.229  1.00 0.00 ? 249 PHE M CD1 1  
ATOM 4145   C CD2 . PHE C 3 246 ? -63.976  7.579   26.162  1.00 0.00 ? 249 PHE M CD2 1  
ATOM 4146   C CE1 . PHE C 3 246 ? -65.838  6.175   24.711  1.00 0.00 ? 249 PHE M CE1 1  
ATOM 4147   C CE2 . PHE C 3 246 ? -64.442  6.361   26.666  1.00 0.00 ? 249 PHE M CE2 1  
ATOM 4148   C CZ  . PHE C 3 246 ? -65.387  5.651   25.926  1.00 0.00 ? 249 PHE M CZ  1  
ATOM 4149   N N   . ILE C 3 247 ? -66.913  10.859  25.456  1.00 0.00 ? 250 ILE M N   1  
ATOM 4150   C CA  . ILE C 3 247 ? -67.750  11.183  26.582  1.00 0.00 ? 250 ILE M CA  1  
ATOM 4151   C C   . ILE C 3 247 ? -68.321  10.007  27.306  1.00 0.00 ? 250 ILE M C   1  
ATOM 4152   O O   . ILE C 3 247 ? -68.896  9.086   26.723  1.00 0.00 ? 250 ILE M O   1  
ATOM 4153   C CB  . ILE C 3 247 ? -68.927  12.019  26.185  1.00 0.00 ? 250 ILE M CB  1  
ATOM 4154   C CG1 . ILE C 3 247 ? -68.498  13.072  25.176  1.00 0.00 ? 250 ILE M CG1 1  
ATOM 4155   C CG2 . ILE C 3 247 ? -69.463  12.690  27.466  1.00 0.00 ? 250 ILE M CG2 1  
ATOM 4156   C CD1 . ILE C 3 247 ? -69.647  13.489  24.263  1.00 0.00 ? 250 ILE M CD1 1  
ATOM 4157   N N   . ARG C 3 248 ? -68.250  10.053  28.621  1.00 0.00 ? 251 ARG M N   1  
ATOM 4158   C CA  . ARG C 3 248 ? -68.808  8.955   29.325  1.00 0.00 ? 251 ARG M CA  1  
ATOM 4159   C C   . ARG C 3 248 ? -70.024  9.399   30.047  1.00 0.00 ? 251 ARG M C   1  
ATOM 4160   O O   . ARG C 3 248 ? -69.912  10.090  31.004  1.00 0.00 ? 251 ARG M O   1  
ATOM 4161   C CB  . ARG C 3 248 ? -67.847  8.355   30.317  1.00 0.00 ? 251 ARG M CB  1  
ATOM 4162   C CG  . ARG C 3 248 ? -66.822  7.473   29.622  1.00 0.00 ? 251 ARG M CG  1  
ATOM 4163   C CD  . ARG C 3 248 ? -65.515  7.576   30.356  1.00 0.00 ? 251 ARG M CD  1  
ATOM 4164   N NE  . ARG C 3 248 ? -65.136  6.335   31.028  1.00 0.00 ? 251 ARG M NE  1  
ATOM 4165   C CZ  . ARG C 3 248 ? -64.970  6.245   32.345  1.00 0.00 ? 251 ARG M CZ  1  
ATOM 4166   N NH1 . ARG C 3 248 ? -65.188  7.299   33.070  1.00 0.00 ? 251 ARG M NH1 1  
ATOM 4167   N NH2 . ARG C 3 248 ? -64.589  5.085   32.915  1.00 0.00 ? 251 ARG M NH2 1  
ATOM 4168   N N   . ILE C 3 249 ? -71.172  9.011   29.571  1.00 0.00 ? 252 ILE M N   1  
ATOM 4169   C CA  . ILE C 3 249 ? -72.335  9.408   30.292  1.00 0.00 ? 252 ILE M CA  1  
ATOM 4170   C C   . ILE C 3 249 ? -72.642  8.385   31.295  1.00 0.00 ? 252 ILE M C   1  
ATOM 4171   O O   . ILE C 3 249 ? -72.997  7.248   30.952  1.00 0.00 ? 252 ILE M O   1  
ATOM 4172   C CB  . ILE C 3 249 ? -73.545  9.809   29.474  1.00 0.00 ? 252 ILE M CB  1  
ATOM 4173   C CG1 . ILE C 3 249 ? -73.188  10.983  28.612  1.00 0.00 ? 252 ILE M CG1 1  
ATOM 4174   C CG2 . ILE C 3 249 ? -74.580  10.241  30.474  1.00 0.00 ? 252 ILE M CG2 1  
ATOM 4175   C CD1 . ILE C 3 249 ? -73.584  10.761  27.157  1.00 0.00 ? 252 ILE M CD1 1  
ATOM 4176   N N   . HIS C 3 250 ? -72.450  8.807   32.503  1.00 0.00 ? 253 HIS M N   1  
ATOM 4177   C CA  . HIS C 3 250 ? -72.604  7.909   33.607  1.00 0.00 ? 253 HIS M CA  1  
ATOM 4178   C C   . HIS C 3 250 ? -74.006  7.903   34.095  1.00 0.00 ? 253 HIS M C   1  
ATOM 4179   O O   . HIS C 3 250 ? -74.439  8.819   34.755  1.00 0.00 ? 253 HIS M O   1  
ATOM 4180   C CB  . HIS C 3 250 ? -71.647  8.252   34.725  1.00 0.00 ? 253 HIS M CB  1  
ATOM 4181   C CG  . HIS C 3 250 ? -70.250  7.826   34.458  1.00 0.00 ? 253 HIS M CG  1  
ATOM 4182   N ND1 . HIS C 3 250 ? -69.370  8.651   33.758  1.00 0.00 ? 253 HIS M ND1 1  
ATOM 4183   C CD2 . HIS C 3 250 ? -69.573  6.667   34.827  1.00 0.00 ? 253 HIS M CD2 1  
ATOM 4184   C CE1 . HIS C 3 250 ? -68.186  7.992   33.713  1.00 0.00 ? 253 HIS M CE1 1  
ATOM 4185   N NE2 . HIS C 3 250 ? -68.288  6.818   34.344  1.00 0.00 ? 253 HIS M NE2 1  
ATOM 4186   N N   . PHE C 3 251 ? -74.687  6.839   33.758  1.00 0.00 ? 254 PHE M N   1  
ATOM 4187   C CA  . PHE C 3 251 ? -76.034  6.719   34.196  1.00 0.00 ? 254 PHE M CA  1  
ATOM 4188   C C   . PHE C 3 251 ? -76.063  6.201   35.603  1.00 0.00 ? 254 PHE M C   1  
ATOM 4189   O O   . PHE C 3 251 ? -75.123  5.580   36.084  1.00 0.00 ? 254 PHE M O   1  
ATOM 4190   C CB  . PHE C 3 251 ? -76.851  5.890   33.241  1.00 0.00 ? 254 PHE M CB  1  
ATOM 4191   C CG  . PHE C 3 251 ? -77.035  6.673   31.947  1.00 0.00 ? 254 PHE M CG  1  
ATOM 4192   C CD1 . PHE C 3 251 ? -78.010  7.657   31.846  1.00 0.00 ? 254 PHE M CD1 1  
ATOM 4193   C CD2 . PHE C 3 251 ? -76.182  6.459   30.860  1.00 0.00 ? 254 PHE M CD2 1  
ATOM 4194   C CE1 . PHE C 3 251 ? -78.158  8.384   30.667  1.00 0.00 ? 254 PHE M CE1 1  
ATOM 4195   C CE2 . PHE C 3 251 ? -76.333  7.156   29.660  1.00 0.00 ? 254 PHE M CE2 1  
ATOM 4196   C CZ  . PHE C 3 251 ? -77.330  8.131   29.576  1.00 0.00 ? 254 PHE M CZ  1  
ATOM 4197   N N   . GLY C 3 252 ? -77.137  6.501   36.310  1.00 0.00 ? 255 GLY M N   1  
ATOM 4198   C CA  . GLY C 3 252 ? -77.281  6.066   37.678  1.00 0.00 ? 255 GLY M CA  1  
ATOM 4199   C C   . GLY C 3 252 ? -77.762  4.617   37.788  1.00 0.00 ? 255 GLY M C   1  
ATOM 4200   O O   . GLY C 3 252 ? -77.683  3.842   36.838  1.00 0.00 ? 255 GLY M O   1  
ATOM 4201   N N   . ALA C 3 253 ? -78.278  4.258   38.972  1.00 0.00 ? 256 ALA M N   1  
ATOM 4202   C CA  . ALA C 3 253 ? -78.766  2.928   39.287  1.00 0.00 ? 256 ALA M CA  1  
ATOM 4203   C C   . ALA C 3 253 ? -80.190  2.737   38.813  1.00 0.00 ? 256 ALA M C   1  
ATOM 4204   O O   . ALA C 3 253 ? -80.614  1.699   38.307  1.00 0.00 ? 256 ALA M O   1  
ATOM 4205   C CB  . ALA C 3 253 ? -78.767  2.737   40.798  1.00 0.00 ? 256 ALA M CB  1  
ATOM 4206   N N   . THR C 3 254 ? -80.945  3.776   39.082  1.00 0.00 ? 257 THR M N   1  
ATOM 4207   C CA  . THR C 3 254 ? -82.320  3.858   38.676  1.00 0.00 ? 257 THR M CA  1  
ATOM 4208   C C   . THR C 3 254 ? -82.288  3.731   37.176  1.00 0.00 ? 257 THR M C   1  
ATOM 4209   O O   . THR C 3 254 ? -82.872  2.849   36.582  1.00 0.00 ? 257 THR M O   1  
ATOM 4210   C CB  . THR C 3 254 ? -82.855  5.263   39.040  1.00 0.00 ? 257 THR M CB  1  
ATOM 4211   O OG1 . THR C 3 254 ? -81.948  6.246   38.549  1.00 0.00 ? 257 THR M OG1 1  
ATOM 4212   C CG2 . THR C 3 254 ? -82.977  5.407   40.556  1.00 0.00 ? 257 THR M CG2 1  
ATOM 4213   N N   . GLY C 3 255 ? -81.554  4.634   36.567  1.00 0.00 ? 258 GLY M N   1  
ATOM 4214   C CA  . GLY C 3 255 ? -81.426  4.697   35.138  1.00 0.00 ? 258 GLY M CA  1  
ATOM 4215   C C   . GLY C 3 255 ? -81.363  6.196   34.745  1.00 0.00 ? 258 GLY M C   1  
ATOM 4216   O O   . GLY C 3 255 ? -81.363  6.610   33.596  1.00 0.00 ? 258 GLY M O   1  
ATOM 4217   N N   . LYS C 3 256 ? -81.355  7.060   35.753  1.00 0.00 ? 259 LYS M N   1  
ATOM 4218   C CA  . LYS C 3 256 ? -81.325  8.480   35.524  1.00 0.00 ? 259 LYS M CA  1  
ATOM 4219   C C   . LYS C 3 256 ? -79.891  9.024   35.577  1.00 0.00 ? 259 LYS M C   1  
ATOM 4220   O O   . LYS C 3 256 ? -79.074  8.555   36.361  1.00 0.00 ? 259 LYS M O   1  
ATOM 4221   C CB  . LYS C 3 256 ? -82.220  9.258   36.477  1.00 0.00 ? 259 LYS M CB  1  
ATOM 4222   C CG  . LYS C 3 256 ? -83.627  8.754   36.652  1.00 0.00 ? 259 LYS M CG  1  
ATOM 4223   C CD  . LYS C 3 256 ? -84.521  9.098   35.481  1.00 0.00 ? 259 LYS M CD  1  
ATOM 4224   C CE  . LYS C 3 256 ? -85.624  8.071   35.277  1.00 0.00 ? 259 LYS M CE  1  
ATOM 4225   N NZ  . LYS C 3 256 ? -85.911  7.844   33.850  1.00 0.00 ? 259 LYS M NZ  1  
ATOM 4226   N N   . LEU C 3 257 ? -79.648  10.026  34.725  1.00 0.00 ? 260 LEU M N   1  
ATOM 4227   C CA  . LEU C 3 257 ? -78.351  10.713  34.586  1.00 0.00 ? 260 LEU M CA  1  
ATOM 4228   C C   . LEU C 3 257 ? -77.620  10.956  35.884  1.00 0.00 ? 260 LEU M C   1  
ATOM 4229   O O   . LEU C 3 257 ? -78.242  11.306  36.888  1.00 0.00 ? 260 LEU M O   1  
ATOM 4230   C CB  . LEU C 3 257 ? -78.585  12.055  33.892  1.00 0.00 ? 260 LEU M CB  1  
ATOM 4231   C CG  . LEU C 3 257 ? -78.450  11.999  32.392  1.00 0.00 ? 260 LEU M CG  1  
ATOM 4232   C CD1 . LEU C 3 257 ? -78.737  13.355  31.812  1.00 0.00 ? 260 LEU M CD1 1  
ATOM 4233   C CD2 . LEU C 3 257 ? -77.042  11.601  32.001  1.00 0.00 ? 260 LEU M CD2 1  
ATOM 4234   N N   . ALA C 3 258 ? -76.287  10.781  35.875  1.00 0.00 ? 261 ALA M N   1  
ATOM 4235   C CA  . ALA C 3 258 ? -75.462  10.988  37.090  1.00 0.00 ? 261 ALA M CA  1  
ATOM 4236   C C   . ALA C 3 258 ? -74.123  11.706  36.856  1.00 0.00 ? 261 ALA M C   1  
ATOM 4237   O O   . ALA C 3 258 ? -73.711  12.514  37.677  1.00 0.00 ? 261 ALA M O   1  
ATOM 4238   C CB  . ALA C 3 258 ? -75.287  9.699   37.846  1.00 0.00 ? 261 ALA M CB  1  
ATOM 4239   N N   . SER C 3 259 ? -73.424  11.398  35.753  1.00 0.00 ? 262 SER M N   1  
ATOM 4240   C CA  . SER C 3 259 ? -72.163  12.049  35.442  1.00 0.00 ? 262 SER M CA  1  
ATOM 4241   C C   . SER C 3 259 ? -71.787  11.929  33.998  1.00 0.00 ? 262 SER M C   1  
ATOM 4242   O O   . SER C 3 259 ? -72.371  11.125  33.247  1.00 0.00 ? 262 SER M O   1  
ATOM 4243   C CB  . SER C 3 259 ? -70.984  11.591  36.278  1.00 0.00 ? 262 SER M CB  1  
ATOM 4244   O OG  . SER C 3 259 ? -71.405  11.414  37.612  1.00 0.00 ? 262 SER M OG  1  
ATOM 4245   N N   . ALA C 3 260 ? -70.783  12.730  33.666  1.00 0.00 ? 263 ALA M N   1  
ATOM 4246   C CA  . ALA C 3 260 ? -70.202  12.796  32.338  1.00 0.00 ? 263 ALA M CA  1  
ATOM 4247   C C   . ALA C 3 260 ? -68.689  12.871  32.425  1.00 0.00 ? 263 ALA M C   1  
ATOM 4248   O O   . ALA C 3 260 ? -68.102  13.127  33.462  1.00 0.00 ? 263 ALA M O   1  
ATOM 4249   C CB  . ALA C 3 260 ? -70.890  13.810  31.407  1.00 0.00 ? 263 ALA M CB  1  
ATOM 4250   N N   . ASP C 3 261 ? -68.054  12.666  31.291  1.00 0.00 ? 264 ASP M N   1  
ATOM 4251   C CA  . ASP C 3 261 ? -66.617  12.595  31.260  1.00 0.00 ? 264 ASP M CA  1  
ATOM 4252   C C   . ASP C 3 261 ? -65.997  12.853  29.905  1.00 0.00 ? 264 ASP M C   1  
ATOM 4253   O O   . ASP C 3 261 ? -65.962  11.960  29.073  1.00 0.00 ? 264 ASP M O   1  
ATOM 4254   C CB  . ASP C 3 261 ? -66.475  11.089  31.348  1.00 0.00 ? 264 ASP M CB  1  
ATOM 4255   C CG  . ASP C 3 261 ? -65.313  10.750  32.102  1.00 0.00 ? 264 ASP M CG  1  
ATOM 4256   O OD1 . ASP C 3 261 ? -64.192  10.713  31.610  1.00 0.00 ? 264 ASP M OD1 1  
ATOM 4257   O OD2 . ASP C 3 261 ? -65.646  10.502  33.338  1.00 0.00 ? 264 ASP M OD2 1  
ATOM 4258   N N   . ILE C 3 262 ? -65.429  13.985  29.671  1.00 0.00 ? 265 ILE M N   1  
ATOM 4259   C CA  . ILE C 3 262 ? -64.798  14.141  28.376  1.00 0.00 ? 265 ILE M CA  1  
ATOM 4260   C C   . ILE C 3 262 ? -63.343  13.892  28.320  1.00 0.00 ? 265 ILE M C   1  
ATOM 4261   O O   . ILE C 3 262 ? -62.633  14.126  29.315  1.00 0.00 ? 265 ILE M O   1  
ATOM 4262   C CB  . ILE C 3 262 ? -65.020  15.531  27.892  1.00 0.00 ? 265 ILE M CB  1  
ATOM 4263   C CG1 . ILE C 3 262 ? -66.532  15.803  28.052  1.00 0.00 ? 265 ILE M CG1 1  
ATOM 4264   C CG2 . ILE C 3 262 ? -64.535  15.644  26.461  1.00 0.00 ? 265 ILE M CG2 1  
ATOM 4265   C CD1 . ILE C 3 262 ? -66.924  17.198  27.624  1.00 0.00 ? 265 ILE M CD1 1  
ATOM 4266   N N   . GLU C 3 263 ? -62.899  13.492  27.134  1.00 0.00 ? 266 GLU M N   1  
ATOM 4267   C CA  . GLU C 3 263 ? -61.507  13.265  26.825  1.00 0.00 ? 266 GLU M CA  1  
ATOM 4268   C C   . GLU C 3 263 ? -61.217  13.625  25.395  1.00 0.00 ? 266 GLU M C   1  
ATOM 4269   O O   . GLU C 3 263 ? -62.003  13.348  24.502  1.00 0.00 ? 266 GLU M O   1  
ATOM 4270   C CB  . GLU C 3 263 ? -60.960  11.936  27.232  1.00 0.00 ? 266 GLU M CB  1  
ATOM 4271   C CG  . GLU C 3 263 ? -59.457  11.936  27.515  1.00 0.00 ? 266 GLU M CG  1  
ATOM 4272   C CD  . GLU C 3 263 ? -59.057  10.646  28.148  1.00 0.00 ? 266 GLU M CD  1  
ATOM 4273   O OE1 . GLU C 3 263 ? -59.302  10.401  29.306  1.00 0.00 ? 266 GLU M OE1 1  
ATOM 4274   O OE2 . GLU C 3 263 ? -58.518  9.796   27.289  1.00 0.00 ? 266 GLU M OE2 1  
ATOM 4275   N N   . THR C 3 264 ? -60.141  14.353  25.217  1.00 0.00 ? 267 THR M N   1  
ATOM 4276   C CA  . THR C 3 264 ? -59.779  14.861  23.923  1.00 0.00 ? 267 THR M CA  1  
ATOM 4277   C C   . THR C 3 264 ? -58.538  14.195  23.373  1.00 0.00 ? 267 THR M C   1  
ATOM 4278   O O   . THR C 3 264 ? -57.635  13.889  24.122  1.00 0.00 ? 267 THR M O   1  
ATOM 4279   C CB  . THR C 3 264 ? -59.482  16.325  24.115  1.00 0.00 ? 267 THR M CB  1  
ATOM 4280   O OG1 . THR C 3 264 ? -60.718  16.949  24.411  1.00 0.00 ? 267 THR M OG1 1  
ATOM 4281   C CG2 . THR C 3 264 ? -58.619  16.843  22.939  1.00 0.00 ? 267 THR M CG2 1  
ATOM 4282   N N   . TYR C 3 265 ? -58.529  14.012  22.073  1.00 0.00 ? 268 TYR M N   1  
ATOM 4283   C CA  . TYR C 3 265 ? -57.453  13.356  21.379  1.00 0.00 ? 268 TYR M CA  1  
ATOM 4284   C C   . TYR C 3 265 ? -57.076  14.129  20.137  1.00 0.00 ? 268 TYR M C   1  
ATOM 4285   O O   . TYR C 3 265 ? -57.872  14.577  19.391  1.00 0.00 ? 268 TYR M O   1  
ATOM 4286   C CB  . TYR C 3 265 ? -57.837  11.923  20.901  1.00 0.00 ? 268 TYR M CB  1  
ATOM 4287   C CG  . TYR C 3 265 ? -58.464  11.015  21.951  1.00 0.00 ? 268 TYR M CG  1  
ATOM 4288   C CD1 . TYR C 3 265 ? -57.677  10.366  22.879  1.00 0.00 ? 268 TYR M CD1 1  
ATOM 4289   C CD2 . TYR C 3 265 ? -59.832  10.816  22.038  1.00 0.00 ? 268 TYR M CD2 1  
ATOM 4290   C CE1 . TYR C 3 265 ? -58.201  9.554   23.877  1.00 0.00 ? 268 TYR M CE1 1  
ATOM 4291   C CE2 . TYR C 3 265 ? -60.379  10.032  23.045  1.00 0.00 ? 268 TYR M CE2 1  
ATOM 4292   C CZ  . TYR C 3 265 ? -59.577  9.385   23.963  1.00 0.00 ? 268 TYR M CZ  1  
ATOM 4293   O OH  . TYR C 3 265 ? -60.147  8.610   24.954  1.00 0.00 ? 268 TYR M OH  1  
ATOM 4294   N N   . LEU C 3 266 ? -55.822  14.202  19.897  1.00 0.00 ? 269 LEU M N   1  
ATOM 4295   C CA  . LEU C 3 266 ? -55.286  14.779  18.717  1.00 0.00 ? 269 LEU M CA  1  
ATOM 4296   C C   . LEU C 3 266 ? -55.875  16.058  18.205  1.00 0.00 ? 269 LEU M C   1  
ATOM 4297   O O   . LEU C 3 266 ? -56.619  16.023  17.293  1.00 0.00 ? 269 LEU M O   1  
ATOM 4298   C CB  . LEU C 3 266 ? -55.389  13.740  17.642  1.00 0.00 ? 269 LEU M CB  1  
ATOM 4299   C CG  . LEU C 3 266 ? -54.448  12.585  17.932  1.00 0.00 ? 269 LEU M CG  1  
ATOM 4300   C CD1 . LEU C 3 266 ? -55.042  11.346  17.316  1.00 0.00 ? 269 LEU M CD1 1  
ATOM 4301   C CD2 . LEU C 3 266 ? -53.115  12.799  17.270  1.00 0.00 ? 269 LEU M CD2 1  
ATOM 4302   N N   . LEU C 3 267 ? -55.486  17.152  18.777  1.00 0.00 ? 270 LEU M N   1  
ATOM 4303   C CA  . LEU C 3 267 ? -55.944  18.411  18.389  1.00 0.00 ? 270 LEU M CA  1  
ATOM 4304   C C   . LEU C 3 267 ? -55.107  18.982  17.281  1.00 0.00 ? 270 LEU M C   1  
ATOM 4305   O O   . LEU C 3 267 ? -53.919  18.877  17.328  1.00 0.00 ? 270 LEU M O   1  
ATOM 4306   C CB  . LEU C 3 267 ? -56.045  19.339  19.606  1.00 0.00 ? 270 LEU M CB  1  
ATOM 4307   C CG  . LEU C 3 267 ? -56.571  20.744  19.235  1.00 0.00 ? 270 LEU M CG  1  
ATOM 4308   C CD1 . LEU C 3 267 ? -58.044  20.670  18.949  1.00 0.00 ? 270 LEU M CD1 1  
ATOM 4309   C CD2 . LEU C 3 267 ? -56.308  21.728  20.338  1.00 0.00 ? 270 LEU M CD2 1  
ATOM 4310   N N   . GLU C 3 268 ? -52.965  16.048  17.034  1.00 0.00 ? 271 GLU M N   1  
ATOM 4311   C CA  . GLU C 3 268 ? -51.936  16.448  16.116  1.00 0.00 ? 271 GLU M CA  1  
ATOM 4312   C C   . GLU C 3 268 ? -50.910  17.296  16.787  1.00 0.00 ? 271 GLU M C   1  
ATOM 4313   O O   . GLU C 3 268 ? -50.921  18.506  16.582  1.00 0.00 ? 271 GLU M O   1  
ATOM 4314   C CB  . GLU C 3 268 ? -52.433  17.079  14.790  1.00 0.00 ? 271 GLU M CB  1  
ATOM 4315   C CG  . GLU C 3 268 ? -51.541  16.720  13.581  1.00 0.00 ? 271 GLU M CG  1  
ATOM 4316   C CD  . GLU C 3 268 ? -51.859  17.325  12.225  1.00 0.00 ? 271 GLU M CD  1  
ATOM 4317   O OE1 . GLU C 3 268 ? -52.996  17.971  12.228  1.00 0.00 ? 271 GLU M OE1 1  
ATOM 4318   O OE2 . GLU C 3 268 ? -51.135  17.206  11.213  1.00 0.00 ? 271 GLU M OE2 1  
ATOM 4319   N N   . LYS C 3 269 ? -50.019  16.669  17.560  1.00 0.00 ? 272 LYS M N   1  
ATOM 4320   C CA  . LYS C 3 269 ? -48.959  17.348  18.316  1.00 0.00 ? 272 LYS M CA  1  
ATOM 4321   C C   . LYS C 3 269 ? -48.044  18.198  17.447  1.00 0.00 ? 272 LYS M C   1  
ATOM 4322   O O   . LYS C 3 269 ? -47.505  19.208  17.833  1.00 0.00 ? 272 LYS M O   1  
ATOM 4323   C CB  . LYS C 3 269 ? -48.072  16.351  18.994  1.00 0.00 ? 272 LYS M CB  1  
ATOM 4324   C CG  . LYS C 3 269 ? -48.629  15.751  20.263  1.00 0.00 ? 272 LYS M CG  1  
ATOM 4325   C CD  . LYS C 3 269 ? -47.586  14.912  20.990  1.00 0.00 ? 272 LYS M CD  1  
ATOM 4326   C CE  . LYS C 3 269 ? -48.031  13.502  21.319  1.00 0.00 ? 272 LYS M CE  1  
ATOM 4327   N NZ  . LYS C 3 269 ? -46.959  12.741  21.970  1.00 0.00 ? 272 LYS M NZ  1  
ATOM 4328   N N   . SER C 3 270 ? -47.834  17.745  16.263  1.00 0.00 ? 273 SER M N   1  
ATOM 4329   C CA  . SER C 3 270 ? -46.985  18.464  15.346  1.00 0.00 ? 273 SER M CA  1  
ATOM 4330   C C   . SER C 3 270 ? -47.379  19.917  15.035  1.00 0.00 ? 273 SER M C   1  
ATOM 4331   O O   . SER C 3 270 ? -46.511  20.739  14.762  1.00 0.00 ? 273 SER M O   1  
ATOM 4332   C CB  . SER C 3 270 ? -46.901  17.647  14.076  1.00 0.00 ? 273 SER M CB  1  
ATOM 4333   O OG  . SER C 3 270 ? -47.571  16.434  14.353  1.00 0.00 ? 273 SER M OG  1  
ATOM 4334   N N   . ARG C 3 271 ? -48.681  20.269  15.018  1.00 0.00 ? 274 ARG M N   1  
ATOM 4335   C CA  . ARG C 3 271 ? -49.110  21.613  14.685  1.00 0.00 ? 274 ARG M CA  1  
ATOM 4336   C C   . ARG C 3 271 ? -48.436  22.577  15.612  1.00 0.00 ? 274 ARG M C   1  
ATOM 4337   O O   . ARG C 3 271 ? -47.983  23.610  15.177  1.00 0.00 ? 274 ARG M O   1  
ATOM 4338   C CB  . ARG C 3 271 ? -50.598  21.828  14.691  1.00 0.00 ? 274 ARG M CB  1  
ATOM 4339   C CG  . ARG C 3 271 ? -51.334  21.181  13.552  1.00 0.00 ? 274 ARG M CG  1  
ATOM 4340   C CD  . ARG C 3 271 ? -52.609  21.903  13.096  1.00 0.00 ? 274 ARG M CD  1  
ATOM 4341   N NE  . ARG C 3 271 ? -52.566  22.263  11.669  1.00 0.00 ? 274 ARG M NE  1  
ATOM 4342   C CZ  . ARG C 3 271 ? -52.583  21.394  10.652  1.00 0.00 ? 274 ARG M CZ  1  
ATOM 4343   N NH1 . ARG C 3 271 ? -52.628  20.060  10.850  1.00 0.00 ? 274 ARG M NH1 1  
ATOM 4344   N NH2 . ARG C 3 271 ? -52.509  21.889  9.396   1.00 0.00 ? 274 ARG M NH2 1  
ATOM 4345   N N   . VAL C 3 272 ? -48.418  22.204  16.900  1.00 0.00 ? 275 VAL M N   1  
ATOM 4346   C CA  . VAL C 3 272 ? -47.815  23.000  17.909  1.00 0.00 ? 275 VAL M CA  1  
ATOM 4347   C C   . VAL C 3 272 ? -46.444  23.527  17.546  1.00 0.00 ? 275 VAL M C   1  
ATOM 4348   O O   . VAL C 3 272 ? -46.048  24.548  18.046  1.00 0.00 ? 275 VAL M O   1  
ATOM 4349   C CB  . VAL C 3 272 ? -47.639  22.197  19.159  1.00 0.00 ? 275 VAL M CB  1  
ATOM 4350   C CG1 . VAL C 3 272 ? -47.104  23.073  20.291  1.00 0.00 ? 275 VAL M CG1 1  
ATOM 4351   C CG2 . VAL C 3 272 ? -48.978  21.688  19.563  1.00 0.00 ? 275 VAL M CG2 1  
ATOM 4352   N N   . THR C 3 273 ? -45.742  22.832  16.678  1.00 0.00 ? 276 THR M N   1  
ATOM 4353   C CA  . THR C 3 273 ? -44.352  23.155  16.327  1.00 0.00 ? 276 THR M CA  1  
ATOM 4354   C C   . THR C 3 273 ? -44.167  23.424  14.872  1.00 0.00 ? 276 THR M C   1  
ATOM 4355   O O   . THR C 3 273 ? -43.187  23.965  14.424  1.00 0.00 ? 276 THR M O   1  
ATOM 4356   C CB  . THR C 3 273 ? -43.546  21.893  16.650  1.00 0.00 ? 276 THR M CB  1  
ATOM 4357   O OG1 . THR C 3 273 ? -43.328  21.830  18.016  1.00 0.00 ? 276 THR M OG1 1  
ATOM 4358   C CG2 . THR C 3 273 ? -42.229  21.838  15.924  1.00 0.00 ? 276 THR M CG2 1  
ATOM 4359   N N   . PHE C 3 274 ? -45.126  22.960  14.119  1.00 0.00 ? 277 PHE M N   1  
ATOM 4360   C CA  . PHE C 3 274 ? -45.075  23.066  12.709  1.00 0.00 ? 277 PHE M CA  1  
ATOM 4361   C C   . PHE C 3 274 ? -46.378  23.352  12.115  1.00 0.00 ? 277 PHE M C   1  
ATOM 4362   O O   . PHE C 3 274 ? -47.404  23.273  12.766  1.00 0.00 ? 277 PHE M O   1  
ATOM 4363   C CB  . PHE C 3 274 ? -44.803  21.685  12.213  1.00 0.00 ? 277 PHE M CB  1  
ATOM 4364   C CG  . PHE C 3 274 ? -44.538  21.487  10.755  1.00 0.00 ? 277 PHE M CG  1  
ATOM 4365   C CD1 . PHE C 3 274 ? -43.356  21.937  10.187  1.00 0.00 ? 277 PHE M CD1 1  
ATOM 4366   C CD2 . PHE C 3 274 ? -45.433  20.744  9.995   1.00 0.00 ? 277 PHE M CD2 1  
ATOM 4367   C CE1 . PHE C 3 274 ? -43.073  21.715  8.839   1.00 0.00 ? 277 PHE M CE1 1  
ATOM 4368   C CE2 . PHE C 3 274 ? -45.156  20.508  8.656   1.00 0.00 ? 277 PHE M CE2 1  
ATOM 4369   C CZ  . PHE C 3 274 ? -43.985  20.993  8.090   1.00 0.00 ? 277 PHE M CZ  1  
ATOM 4370   N N   . GLN C 3 275 ? -46.279  23.628  10.836  1.00 0.00 ? 278 GLN M N   1  
ATOM 4371   C CA  . GLN C 3 275 ? -47.396  23.990  10.035  1.00 0.00 ? 278 GLN M CA  1  
ATOM 4372   C C   . GLN C 3 275 ? -47.041  24.085  8.558   1.00 0.00 ? 278 GLN M C   1  
ATOM 4373   O O   . GLN C 3 275 ? -46.057  24.595  8.066   1.00 0.00 ? 278 GLN M O   1  
ATOM 4374   C CB  . GLN C 3 275 ? -48.144  25.270  10.480  1.00 0.00 ? 278 GLN M CB  1  
ATOM 4375   C CG  . GLN C 3 275 ? -47.212  26.493  10.572  1.00 0.00 ? 278 GLN M CG  1  
ATOM 4376   C CD  . GLN C 3 275 ? -47.157  26.931  11.984  1.00 0.00 ? 278 GLN M CD  1  
ATOM 4377   O OE1 . GLN C 3 275 ? -46.809  28.082  12.247  1.00 0.00 ? 278 GLN M OE1 1  
ATOM 4378   N NE2 . GLN C 3 275 ? -47.567  25.959  12.835  1.00 0.00 ? 278 GLN M NE2 1  
ATOM 4379   N N   . LEU C 3 276 ? -47.916  23.502  7.780   1.00 0.00 ? 279 LEU M N   1  
ATOM 4380   C CA  . LEU C 3 276 ? -47.755  23.582  6.373   1.00 0.00 ? 279 LEU M CA  1  
ATOM 4381   C C   . LEU C 3 276 ? -48.057  25.026  5.955   1.00 0.00 ? 279 LEU M C   1  
ATOM 4382   O O   . LEU C 3 276 ? -48.667  25.808  6.673   1.00 0.00 ? 279 LEU M O   1  
ATOM 4383   C CB  . LEU C 3 276 ? -48.638  22.602  5.599   1.00 0.00 ? 279 LEU M CB  1  
ATOM 4384   C CG  . LEU C 3 276 ? -48.135  21.171  5.559   1.00 0.00 ? 279 LEU M CG  1  
ATOM 4385   C CD1 . LEU C 3 276 ? -49.190  20.246  5.054   1.00 0.00 ? 279 LEU M CD1 1  
ATOM 4386   C CD2 . LEU C 3 276 ? -47.077  21.058  4.510   1.00 0.00 ? 279 LEU M CD2 1  
ATOM 4387   N N   . PRO C 3 277 ? -47.625  25.337  4.769   1.00 0.00 ? 280 PRO M N   1  
ATOM 4388   C CA  . PRO C 3 277 ? -47.713  26.636  4.144   1.00 0.00 ? 280 PRO M CA  1  
ATOM 4389   C C   . PRO C 3 277 ? -49.060  27.256  3.980   1.00 0.00 ? 280 PRO M C   1  
ATOM 4390   O O   . PRO C 3 277 ? -49.205  28.493  3.981   1.00 0.00 ? 280 PRO M O   1  
ATOM 4391   C CB  . PRO C 3 277 ? -47.060  26.497  2.776   1.00 0.00 ? 280 PRO M CB  1  
ATOM 4392   C CG  . PRO C 3 277 ? -46.342  25.161  2.772   1.00 0.00 ? 280 PRO M CG  1  
ATOM 4393   C CD  . PRO C 3 277 ? -46.768  24.407  4.018   1.00 0.00 ? 280 PRO M CD  1  
ATOM 4394   N N   . ALA C 3 278 ? -50.075  26.437  3.772   1.00 0.00 ? 281 ALA M N   1  
ATOM 4395   C CA  . ALA C 3 278 ? -51.400  27.008  3.628   1.00 0.00 ? 281 ALA M CA  1  
ATOM 4396   C C   . ALA C 3 278 ? -52.226  26.826  4.875   1.00 0.00 ? 281 ALA M C   1  
ATOM 4397   O O   . ALA C 3 278 ? -53.421  27.141  4.898   1.00 0.00 ? 281 ALA M O   1  
ATOM 4398   C CB  . ALA C 3 278 ? -52.138  26.362  2.494   1.00 0.00 ? 281 ALA M CB  1  
ATOM 4399   N N   . GLU C 3 279 ? -51.580  26.267  5.890   1.00 0.00 ? 282 GLU M N   1  
ATOM 4400   C CA  . GLU C 3 279 ? -52.264  25.974  7.116   1.00 0.00 ? 282 GLU M CA  1  
ATOM 4401   C C   . GLU C 3 279 ? -51.805  26.825  8.268   1.00 0.00 ? 282 GLU M C   1  
ATOM 4402   O O   . GLU C 3 279 ? -50.987  27.727  8.205   1.00 0.00 ? 282 GLU M O   1  
ATOM 4403   C CB  . GLU C 3 279 ? -52.097  24.508  7.570   1.00 0.00 ? 282 GLU M CB  1  
ATOM 4404   C CG  . GLU C 3 279 ? -51.760  23.559  6.417   1.00 0.00 ? 282 GLU M CG  1  
ATOM 4405   C CD  . GLU C 3 279 ? -52.277  22.158  6.614   1.00 0.00 ? 282 GLU M CD  1  
ATOM 4406   O OE1 . GLU C 3 279 ? -51.532  21.453  7.429   1.00 0.00 ? 282 GLU M OE1 1  
ATOM 4407   O OE2 . GLU C 3 279 ? -53.256  21.709  6.088   1.00 0.00 ? 282 GLU M OE2 1  
ATOM 4408   N N   . ARG C 3 280 ? -52.344  26.470  9.388   1.00 0.00 ? 283 ARG M N   1  
ATOM 4409   C CA  . ARG C 3 280 ? -51.992  27.154  10.559  1.00 0.00 ? 283 ARG M CA  1  
ATOM 4410   C C   . ARG C 3 280 ? -52.168  26.341  11.804  1.00 0.00 ? 283 ARG M C   1  
ATOM 4411   O O   . ARG C 3 280 ? -52.713  25.275  11.843  1.00 0.00 ? 283 ARG M O   1  
ATOM 4412   C CB  . ARG C 3 280 ? -52.615  28.470  10.603  1.00 0.00 ? 283 ARG M CB  1  
ATOM 4413   C CG  . ARG C 3 280 ? -53.831  28.492  11.413  1.00 0.00 ? 283 ARG M CG  1  
ATOM 4414   C CD  . ARG C 3 280 ? -54.381  29.927  11.429  1.00 0.00 ? 283 ARG M CD  1  
ATOM 4415   N NE  . ARG C 3 280 ? -55.617  29.991  12.191  1.00 0.00 ? 283 ARG M NE  1  
ATOM 4416   C CZ  . ARG C 3 280 ? -56.099  31.143  12.598  1.00 0.00 ? 283 ARG M CZ  1  
ATOM 4417   N NH1 . ARG C 3 280 ? -55.456  32.311  12.379  1.00 0.00 ? 283 ARG M NH1 1  
ATOM 4418   N NH2 . ARG C 3 280 ? -57.231  31.144  13.289  1.00 0.00 ? 283 ARG M NH2 1  
ATOM 4419   N N   . SER C 3 281 ? -51.603  26.808  12.863  1.00 0.00 ? 284 SER M N   1  
ATOM 4420   C CA  . SER C 3 281 ? -51.686  26.083  14.072  1.00 0.00 ? 284 SER M CA  1  
ATOM 4421   C C   . SER C 3 281 ? -52.999  26.280  14.724  1.00 0.00 ? 284 SER M C   1  
ATOM 4422   O O   . SER C 3 281 ? -53.859  26.995  14.183  1.00 0.00 ? 284 SER M O   1  
ATOM 4423   C CB  . SER C 3 281 ? -50.540  26.392  14.998  1.00 0.00 ? 284 SER M CB  1  
ATOM 4424   O OG  . SER C 3 281 ? -50.490  25.406  15.957  1.00 0.00 ? 284 SER M OG  1  
ATOM 4425   N N   . TYR C 3 282 ? -53.095  25.680  15.930  1.00 0.00 ? 285 TYR M N   1  
ATOM 4426   C CA  . TYR C 3 282 ? -54.274  25.731  16.713  1.00 0.00 ? 285 TYR M CA  1  
ATOM 4427   C C   . TYR C 3 282 ? -54.787  27.138  16.796  1.00 0.00 ? 285 TYR M C   1  
ATOM 4428   O O   . TYR C 3 282 ? -54.101  28.077  16.505  1.00 0.00 ? 285 TYR M O   1  
ATOM 4429   C CB  . TYR C 3 282 ? -53.984  25.062  18.010  1.00 0.00 ? 285 TYR M CB  1  
ATOM 4430   C CG  . TYR C 3 282 ? -53.756  23.596  17.759  1.00 0.00 ? 285 TYR M CG  1  
ATOM 4431   C CD1 . TYR C 3 282 ? -54.845  22.766  17.487  1.00 0.00 ? 285 TYR M CD1 1  
ATOM 4432   C CD2 . TYR C 3 282 ? -52.478  23.037  17.726  1.00 0.00 ? 285 TYR M CD2 1  
ATOM 4433   C CE1 . TYR C 3 282 ? -54.676  21.405  17.274  1.00 0.00 ? 285 TYR M CE1 1  
ATOM 4434   C CE2 . TYR C 3 282 ? -52.268  21.688  17.454  1.00 0.00 ? 285 TYR M CE2 1  
ATOM 4435   C CZ  . TYR C 3 282 ? -53.374  20.872  17.212  1.00 0.00 ? 285 TYR M CZ  1  
ATOM 4436   O OH  . TYR C 3 282 ? -53.193  19.529  16.978  1.00 0.00 ? 285 TYR M OH  1  
ATOM 4437   N N   . HIS C 3 283 ? -56.043  27.328  17.059  1.00 0.00 ? 286 HIS M N   1  
ATOM 4438   C CA  . HIS C 3 283 ? -56.561  28.664  17.044  1.00 0.00 ? 286 HIS M CA  1  
ATOM 4439   C C   . HIS C 3 283 ? -56.080  29.541  18.155  1.00 0.00 ? 286 HIS M C   1  
ATOM 4440   O O   . HIS C 3 283 ? -55.711  30.686  17.928  1.00 0.00 ? 286 HIS M O   1  
ATOM 4441   C CB  . HIS C 3 283 ? -58.068  28.682  17.102  1.00 0.00 ? 286 HIS M CB  1  
ATOM 4442   C CG  . HIS C 3 283 ? -58.710  27.972  15.975  1.00 0.00 ? 286 HIS M CG  1  
ATOM 4443   N ND1 . HIS C 3 283 ? -58.197  28.078  14.687  1.00 0.00 ? 286 HIS M ND1 1  
ATOM 4444   C CD2 . HIS C 3 283 ? -59.785  27.145  15.971  1.00 0.00 ? 286 HIS M CD2 1  
ATOM 4445   C CE1 . HIS C 3 283 ? -58.995  27.312  13.920  1.00 0.00 ? 286 HIS M CE1 1  
ATOM 4446   N NE2 . HIS C 3 283 ? -59.951  26.737  14.659  1.00 0.00 ? 286 HIS M NE2 1  
ATOM 4447   N N   . ILE C 3 284 ? -56.134  28.941  19.349  1.00 0.00 ? 287 ILE M N   1  
ATOM 4448   C CA  . ILE C 3 284 ? -55.801  29.602  20.560  1.00 0.00 ? 287 ILE M CA  1  
ATOM 4449   C C   . ILE C 3 284 ? -54.760  30.673  20.444  1.00 0.00 ? 287 ILE M C   1  
ATOM 4450   O O   . ILE C 3 284 ? -54.907  31.819  20.809  1.00 0.00 ? 287 ILE M O   1  
ATOM 4451   C CB  . ILE C 3 284 ? -55.601  28.659  21.679  1.00 0.00 ? 287 ILE M CB  1  
ATOM 4452   C CG1 . ILE C 3 284 ? -55.527  29.521  22.907  1.00 0.00 ? 287 ILE M CG1 1  
ATOM 4453   C CG2 . ILE C 3 284 ? -54.401  27.850  21.370  1.00 0.00 ? 287 ILE M CG2 1  
ATOM 4454   C CD1 . ILE C 3 284 ? -56.600  29.154  23.922  1.00 0.00 ? 287 ILE M CD1 1  
ATOM 4455   N N   . PHE C 3 285 ? -53.729  30.307  19.781  1.00 0.00 ? 288 PHE M N   1  
ATOM 4456   C CA  . PHE C 3 285 ? -52.559  31.175  19.611  1.00 0.00 ? 288 PHE M CA  1  
ATOM 4457   C C   . PHE C 3 285 ? -52.959  32.384  18.949  1.00 0.00 ? 288 PHE M C   1  
ATOM 4458   O O   . PHE C 3 285 ? -52.658  33.439  19.418  1.00 0.00 ? 288 PHE M O   1  
ATOM 4459   C CB  . PHE C 3 285 ? -51.449  30.508  18.818  1.00 0.00 ? 288 PHE M CB  1  
ATOM 4460   C CG  . PHE C 3 285 ? -50.842  29.316  19.544  1.00 0.00 ? 288 PHE M CG  1  
ATOM 4461   C CD1 . PHE C 3 285 ? -50.134  29.485  20.732  1.00 0.00 ? 288 PHE M CD1 1  
ATOM 4462   C CD2 . PHE C 3 285 ? -51.001  28.031  19.041  1.00 0.00 ? 288 PHE M CD2 1  
ATOM 4463   C CE1 . PHE C 3 285 ? -49.567  28.400  21.380  1.00 0.00 ? 288 PHE M CE1 1  
ATOM 4464   C CE2 . PHE C 3 285 ? -50.476  26.927  19.705  1.00 0.00 ? 288 PHE M CE2 1  
ATOM 4465   C CZ  . PHE C 3 285 ? -49.747  27.123  20.868  1.00 0.00 ? 288 PHE M CZ  1  
ATOM 4466   N N   . TYR C 3 286 ? -53.656  32.222  17.850  1.00 0.00 ? 289 TYR M N   1  
ATOM 4467   C CA  . TYR C 3 286 ? -54.080  33.383  17.085  1.00 0.00 ? 289 TYR M CA  1  
ATOM 4468   C C   . TYR C 3 286 ? -55.178  34.075  17.798  1.00 0.00 ? 289 TYR M C   1  
ATOM 4469   O O   . TYR C 3 286 ? -55.269  35.260  17.678  1.00 0.00 ? 289 TYR M O   1  
ATOM 4470   C CB  . TYR C 3 286 ? -54.429  33.034  15.706  1.00 0.00 ? 289 TYR M CB  1  
ATOM 4471   C CG  . TYR C 3 286 ? -53.352  32.218  15.086  1.00 0.00 ? 289 TYR M CG  1  
ATOM 4472   C CD1 . TYR C 3 286 ? -52.195  32.807  14.615  1.00 0.00 ? 289 TYR M CD1 1  
ATOM 4473   C CD2 . TYR C 3 286 ? -53.501  30.840  14.973  1.00 0.00 ? 289 TYR M CD2 1  
ATOM 4474   C CE1 . TYR C 3 286 ? -51.196  32.050  14.020  1.00 0.00 ? 289 TYR M CE1 1  
ATOM 4475   C CE2 . TYR C 3 286 ? -52.509  30.063  14.396  1.00 0.00 ? 289 TYR M CE2 1  
ATOM 4476   C CZ  . TYR C 3 286 ? -51.346  30.663  13.948  1.00 0.00 ? 289 TYR M CZ  1  
ATOM 4477   O OH  . TYR C 3 286 ? -50.329  29.858  13.402  1.00 0.00 ? 289 TYR M OH  1  
ATOM 4478   N N   . GLN C 3 287 ? -55.916  33.342  18.596  1.00 0.00 ? 290 GLN M N   1  
ATOM 4479   C CA  . GLN C 3 287 ? -56.983  33.947  19.330  1.00 0.00 ? 290 GLN M CA  1  
ATOM 4480   C C   . GLN C 3 287 ? -56.345  35.003  20.230  1.00 0.00 ? 290 GLN M C   1  
ATOM 4481   O O   . GLN C 3 287 ? -56.561  36.196  20.097  1.00 0.00 ? 290 GLN M O   1  
ATOM 4482   C CB  . GLN C 3 287 ? -57.669  32.884  20.197  1.00 0.00 ? 290 GLN M CB  1  
ATOM 4483   C CG  . GLN C 3 287 ? -59.144  32.900  20.140  1.00 0.00 ? 290 GLN M CG  1  
ATOM 4484   C CD  . GLN C 3 287 ? -59.666  31.474  20.205  1.00 0.00 ? 290 GLN M CD  1  
ATOM 4485   O OE1 . GLN C 3 287 ? -59.830  30.857  19.167  1.00 0.00 ? 290 GLN M OE1 1  
ATOM 4486   N NE2 . GLN C 3 287 ? -59.880  30.928  21.391  1.00 0.00 ? 290 GLN M NE2 1  
ATOM 4487   N N   . ILE C 3 288 ? -55.517  34.526  21.135  1.00 0.00 ? 291 ILE M N   1  
ATOM 4488   C CA  . ILE C 3 288 ? -54.786  35.280  22.120  1.00 0.00 ? 291 ILE M CA  1  
ATOM 4489   C C   . ILE C 3 288 ? -54.023  36.521  21.622  1.00 0.00 ? 291 ILE M C   1  
ATOM 4490   O O   . ILE C 3 288 ? -53.904  37.537  22.292  1.00 0.00 ? 291 ILE M O   1  
ATOM 4491   C CB  . ILE C 3 288 ? -53.721  34.375  22.716  1.00 0.00 ? 291 ILE M CB  1  
ATOM 4492   C CG1 . ILE C 3 288 ? -54.303  33.469  23.756  1.00 0.00 ? 291 ILE M CG1 1  
ATOM 4493   C CG2 . ILE C 3 288 ? -52.684  35.205  23.363  1.00 0.00 ? 291 ILE M CG2 1  
ATOM 4494   C CD1 . ILE C 3 288 ? -53.174  33.153  24.752  1.00 0.00 ? 291 ILE M CD1 1  
ATOM 4495   N N   . MET C 3 289 ? -53.331  36.381  20.527  1.00 0.00 ? 292 MET M N   1  
ATOM 4496   C CA  . MET C 3 289 ? -52.582  37.485  19.963  1.00 0.00 ? 292 MET M CA  1  
ATOM 4497   C C   . MET C 3 289 ? -53.482  38.463  19.208  1.00 0.00 ? 292 MET M C   1  
ATOM 4498   O O   . MET C 3 289 ? -53.035  39.454  18.624  1.00 0.00 ? 292 MET M O   1  
ATOM 4499   C CB  . MET C 3 289 ? -51.469  36.963  19.021  1.00 0.00 ? 292 MET M CB  1  
ATOM 4500   C CG  . MET C 3 289 ? -50.440  36.143  19.752  1.00 0.00 ? 292 MET M CG  1  
ATOM 4501   S SD  . MET C 3 289 ? -49.422  35.207  18.607  1.00 0.00 ? 292 MET M SD  1  
ATOM 4502   C CE  . MET C 3 289 ? -48.868  36.496  17.546  1.00 0.00 ? 292 MET M CE  1  
ATOM 4503   N N   . SER C 3 290 ? -54.769  38.142  19.185  1.00 0.00 ? 293 SER M N   1  
ATOM 4504   C CA  . SER C 3 290 ? -55.733  38.975  18.494  1.00 0.00 ? 293 SER M CA  1  
ATOM 4505   C C   . SER C 3 290 ? -55.851  40.316  19.151  1.00 0.00 ? 293 SER M C   1  
ATOM 4506   O O   . SER C 3 290 ? -56.095  41.293  18.466  1.00 0.00 ? 293 SER M O   1  
ATOM 4507   C CB  . SER C 3 290 ? -57.099  38.359  18.397  1.00 0.00 ? 293 SER M CB  1  
ATOM 4508   O OG  . SER C 3 290 ? -57.682  38.528  19.673  1.00 0.00 ? 293 SER M OG  1  
ATOM 4509   N N   . ASN C 3 291 ? -55.701  40.327  20.470  1.00 0.00 ? 294 ASN M N   1  
ATOM 4510   C CA  . ASN C 3 291 ? -55.736  41.505  21.312  1.00 0.00 ? 294 ASN M CA  1  
ATOM 4511   C C   . ASN C 3 291 ? -57.090  41.910  21.818  1.00 0.00 ? 294 ASN M C   1  
ATOM 4512   O O   . ASN C 3 291 ? -57.312  43.055  22.072  1.00 0.00 ? 294 ASN M O   1  
ATOM 4513   C CB  . ASN C 3 291 ? -55.159  42.724  20.588  1.00 0.00 ? 294 ASN M CB  1  
ATOM 4514   C CG  . ASN C 3 291 ? -54.208  43.601  21.374  1.00 0.00 ? 294 ASN M CG  1  
ATOM 4515   O OD1 . ASN C 3 291 ? -53.195  44.040  20.831  1.00 0.00 ? 294 ASN M OD1 1  
ATOM 4516   N ND2 . ASN C 3 291 ? -54.542  43.856  22.650  1.00 0.00 ? 294 ASN M ND2 1  
ATOM 4517   N N   . LYS C 3 292 ? -57.963  41.017  22.075  1.00 0.00 ? 295 LYS M N   1  
ATOM 4518   C CA  . LYS C 3 292 ? -59.234  41.464  22.585  1.00 0.00 ? 295 LYS M CA  1  
ATOM 4519   C C   . LYS C 3 292 ? -59.235  41.690  24.102  1.00 0.00 ? 295 LYS M C   1  
ATOM 4520   O O   . LYS C 3 292 ? -60.040  42.379  24.729  1.00 0.00 ? 295 LYS M O   1  
ATOM 4521   C CB  . LYS C 3 292 ? -60.357  40.557  22.151  1.00 0.00 ? 295 LYS M CB  1  
ATOM 4522   C CG  . LYS C 3 292 ? -61.689  41.154  22.574  1.00 0.00 ? 295 LYS M CG  1  
ATOM 4523   C CD  . LYS C 3 292 ? -62.594  41.580  21.419  1.00 0.00 ? 295 LYS M CD  1  
ATOM 4524   C CE  . LYS C 3 292 ? -63.789  42.450  21.847  1.00 0.00 ? 295 LYS M CE  1  
ATOM 4525   N NZ  . LYS C 3 292 ? -63.776  43.822  21.361  1.00 0.00 ? 295 LYS M NZ  1  
ATOM 4526   N N   . LYS C 3 293 ? -58.259  41.082  24.703  1.00 0.00 ? 296 LYS M N   1  
ATOM 4527   C CA  . LYS C 3 293 ? -57.969  41.055  26.125  1.00 0.00 ? 296 LYS M CA  1  
ATOM 4528   C C   . LYS C 3 293 ? -56.496  41.411  26.270  1.00 0.00 ? 296 LYS M C   1  
ATOM 4529   O O   . LYS C 3 293 ? -55.681  40.557  26.556  1.00 0.00 ? 296 LYS M O   1  
ATOM 4530   C CB  . LYS C 3 293 ? -58.142  39.645  26.642  1.00 0.00 ? 296 LYS M CB  1  
ATOM 4531   C CG  . LYS C 3 293 ? -59.550  39.070  26.615  1.00 0.00 ? 296 LYS M CG  1  
ATOM 4532   C CD  . LYS C 3 293 ? -59.860  38.284  27.885  1.00 0.00 ? 296 LYS M CD  1  
ATOM 4533   C CE  . LYS C 3 293 ? -61.149  38.707  28.558  1.00 0.00 ? 296 LYS M CE  1  
ATOM 4534   N NZ  . LYS C 3 293 ? -61.636  37.745  29.542  1.00 0.00 ? 296 LYS M NZ  1  
ATOM 4535   N N   . PRO C 3 294 ? -56.165  42.692  26.027  1.00 0.00 ? 297 PRO M N   1  
ATOM 4536   C CA  . PRO C 3 294 ? -54.770  43.135  26.039  1.00 0.00 ? 297 PRO M CA  1  
ATOM 4537   C C   . PRO C 3 294 ? -53.891  42.703  27.213  1.00 0.00 ? 297 PRO M C   1  
ATOM 4538   O O   . PRO C 3 294 ? -52.696  42.482  27.025  1.00 0.00 ? 297 PRO M O   1  
ATOM 4539   C CB  . PRO C 3 294 ? -54.794  44.633  25.785  1.00 0.00 ? 297 PRO M CB  1  
ATOM 4540   C CG  . PRO C 3 294 ? -56.245  45.064  25.793  1.00 0.00 ? 297 PRO M CG  1  
ATOM 4541   C CD  . PRO C 3 294 ? -57.092  43.821  25.980  1.00 0.00 ? 297 PRO M CD  1  
ATOM 4542   N N   . GLU C 3 295 ? -54.464  42.550  28.425  1.00 0.00 ? 298 GLU M N   1  
ATOM 4543   C CA  . GLU C 3 295 ? -53.718  42.111  29.591  1.00 0.00 ? 298 GLU M CA  1  
ATOM 4544   C C   . GLU C 3 295 ? -52.955  40.884  29.326  1.00 0.00 ? 298 GLU M C   1  
ATOM 4545   O O   . GLU C 3 295 ? -51.786  40.722  29.706  1.00 0.00 ? 298 GLU M O   1  
ATOM 4546   C CB  . GLU C 3 295 ? -54.641  41.751  30.713  1.00 0.00 ? 298 GLU M CB  1  
ATOM 4547   C CG  . GLU C 3 295 ? -55.982  42.554  30.603  1.00 0.00 ? 298 GLU M CG  1  
ATOM 4548   C CD  . GLU C 3 295 ? -57.045  41.651  30.067  1.00 0.00 ? 298 GLU M CD  1  
ATOM 4549   O OE1 . GLU C 3 295 ? -57.289  40.599  30.618  1.00 0.00 ? 298 GLU M OE1 1  
ATOM 4550   O OE2 . GLU C 3 295 ? -57.653  42.139  29.012  1.00 0.00 ? 298 GLU M OE2 1  
ATOM 4551   N N   . LEU C 3 296 ? -53.647  39.996  28.669  1.00 0.00 ? 299 LEU M N   1  
ATOM 4552   C CA  . LEU C 3 296 ? -53.136  38.682  28.258  1.00 0.00 ? 299 LEU M CA  1  
ATOM 4553   C C   . LEU C 3 296 ? -51.781  38.779  27.583  1.00 0.00 ? 299 LEU M C   1  
ATOM 4554   O O   . LEU C 3 296 ? -50.858  38.035  27.902  1.00 0.00 ? 299 LEU M O   1  
ATOM 4555   C CB  . LEU C 3 296 ? -54.121  37.994  27.342  1.00 0.00 ? 299 LEU M CB  1  
ATOM 4556   C CG  . LEU C 3 296 ? -54.901  36.903  28.024  1.00 0.00 ? 299 LEU M CG  1  
ATOM 4557   C CD1 . LEU C 3 296 ? -55.453  37.383  29.318  1.00 0.00 ? 299 LEU M CD1 1  
ATOM 4558   C CD2 . LEU C 3 296 ? -56.019  36.517  27.125  1.00 0.00 ? 299 LEU M CD2 1  
ATOM 4559   N N   . ILE C 3 297 ? -51.681  39.723  26.637  1.00 0.00 ? 300 ILE M N   1  
ATOM 4560   C CA  . ILE C 3 297 ? -50.464  39.942  25.893  1.00 0.00 ? 300 ILE M CA  1  
ATOM 4561   C C   . ILE C 3 297 ? -49.240  40.289  26.778  1.00 0.00 ? 300 ILE M C   1  
ATOM 4562   O O   . ILE C 3 297 ? -48.086  39.861  26.595  1.00 0.00 ? 300 ILE M O   1  
ATOM 4563   C CB  . ILE C 3 297 ? -50.733  40.989  24.802  1.00 0.00 ? 300 ILE M CB  1  
ATOM 4564   C CG1 . ILE C 3 297 ? -50.978  40.379  23.442  1.00 0.00 ? 300 ILE M CG1 1  
ATOM 4565   C CG2 . ILE C 3 297 ? -49.524  41.890  24.701  1.00 0.00 ? 300 ILE M CG2 1  
ATOM 4566   C CD1 . ILE C 3 297 ? -52.410  40.079  23.216  1.00 0.00 ? 300 ILE M CD1 1  
ATOM 4567   N N   . ASP C 3 298 ? -49.509  41.109  27.794  1.00 0.00 ? 301 ASP M N   1  
ATOM 4568   C CA  . ASP C 3 298 ? -48.521  41.576  28.715  1.00 0.00 ? 301 ASP M CA  1  
ATOM 4569   C C   . ASP C 3 298 ? -48.330  40.533  29.797  1.00 0.00 ? 301 ASP M C   1  
ATOM 4570   O O   . ASP C 3 298 ? -47.311  40.328  30.390  1.00 0.00 ? 301 ASP M O   1  
ATOM 4571   C CB  . ASP C 3 298 ? -48.938  42.942  29.324  1.00 0.00 ? 301 ASP M CB  1  
ATOM 4572   C CG  . ASP C 3 298 ? -49.103  44.049  28.312  1.00 0.00 ? 301 ASP M CG  1  
ATOM 4573   O OD1 . ASP C 3 298 ? -47.964  44.494  27.801  1.00 0.00 ? 301 ASP M OD1 1  
ATOM 4574   O OD2 . ASP C 3 298 ? -50.200  44.511  28.005  1.00 0.00 ? 301 ASP M OD2 1  
ATOM 4575   N N   . MET C 3 299 ? -49.392  39.862  30.064  1.00 0.00 ? 302 MET M N   1  
ATOM 4576   C CA  . MET C 3 299 ? -49.382  38.837  31.066  1.00 0.00 ? 302 MET M CA  1  
ATOM 4577   C C   . MET C 3 299 ? -48.483  37.671  30.635  1.00 0.00 ? 302 MET M C   1  
ATOM 4578   O O   . MET C 3 299 ? -47.724  37.094  31.409  1.00 0.00 ? 302 MET M O   1  
ATOM 4579   C CB  . MET C 3 299 ? -50.834  38.333  31.310  1.00 0.00 ? 302 MET M CB  1  
ATOM 4580   C CG  . MET C 3 299 ? -50.892  36.907  31.892  1.00 0.00 ? 302 MET M CG  1  
ATOM 4581   S SD  . MET C 3 299 ? -52.356  36.614  32.892  1.00 0.00 ? 302 MET M SD  1  
ATOM 4582   C CE  . MET C 3 299 ? -53.251  35.593  31.772  1.00 0.00 ? 302 MET M CE  1  
ATOM 4583   N N   . LEU C 3 300 ? -48.602  37.330  29.357  1.00 0.00 ? 303 LEU M N   1  
ATOM 4584   C CA  . LEU C 3 300 ? -47.861  36.231  28.764  1.00 0.00 ? 303 LEU M CA  1  
ATOM 4585   C C   . LEU C 3 300 ? -46.507  36.676  28.302  1.00 0.00 ? 303 LEU M C   1  
ATOM 4586   O O   . LEU C 3 300 ? -45.625  35.897  28.034  1.00 0.00 ? 303 LEU M O   1  
ATOM 4587   C CB  . LEU C 3 300 ? -48.618  35.677  27.604  1.00 0.00 ? 303 LEU M CB  1  
ATOM 4588   C CG  . LEU C 3 300 ? -49.610  34.610  28.052  1.00 0.00 ? 303 LEU M CG  1  
ATOM 4589   C CD1 . LEU C 3 300 ? -50.191  34.949  29.407  1.00 0.00 ? 303 LEU M CD1 1  
ATOM 4590   C CD2 . LEU C 3 300 ? -50.731  34.444  27.037  1.00 0.00 ? 303 LEU M CD2 1  
ATOM 4591   N N   . LEU C 3 301 ? -46.356  37.960  28.143  1.00 0.00 ? 304 LEU M N   1  
ATOM 4592   C CA  . LEU C 3 301 ? -45.106  38.510  27.717  1.00 0.00 ? 304 LEU M CA  1  
ATOM 4593   C C   . LEU C 3 301 ? -44.834  38.284  26.285  1.00 0.00 ? 304 LEU M C   1  
ATOM 4594   O O   . LEU C 3 301 ? -43.735  37.906  25.945  1.00 0.00 ? 304 LEU M O   1  
ATOM 4595   C CB  . LEU C 3 301 ? -43.909  38.035  28.530  1.00 0.00 ? 304 LEU M CB  1  
ATOM 4596   C CG  . LEU C 3 301 ? -44.094  38.347  30.048  1.00 0.00 ? 304 LEU M CG  1  
ATOM 4597   C CD1 . LEU C 3 301 ? -43.333  37.342  30.912  1.00 0.00 ? 304 LEU M CD1 1  
ATOM 4598   C CD2 . LEU C 3 301 ? -43.627  39.732  30.390  1.00 0.00 ? 304 LEU M CD2 1  
ATOM 4599   N N   . ILE C 3 302 ? -45.847  38.543  25.466  1.00 0.00 ? 305 ILE M N   1  
ATOM 4600   C CA  . ILE C 3 302 ? -45.661  38.356  24.051  1.00 0.00 ? 305 ILE M CA  1  
ATOM 4601   C C   . ILE C 3 302 ? -46.067  39.595  23.321  1.00 0.00 ? 305 ILE M C   1  
ATOM 4602   O O   . ILE C 3 302 ? -46.535  40.557  23.875  1.00 0.00 ? 305 ILE M O   1  
ATOM 4603   C CB  . ILE C 3 302 ? -46.592  37.309  23.520  1.00 0.00 ? 305 ILE M CB  1  
ATOM 4604   C CG1 . ILE C 3 302 ? -47.848  37.381  24.313  1.00 0.00 ? 305 ILE M CG1 1  
ATOM 4605   C CG2 . ILE C 3 302 ? -46.013  35.943  23.614  1.00 0.00 ? 305 ILE M CG2 1  
ATOM 4606   C CD1 . ILE C 3 302 ? -48.908  36.537  23.728  1.00 0.00 ? 305 ILE M CD1 1  
ATOM 4607   N N   . THR C 3 303 ? -45.960  39.480  22.043  1.00 0.00 ? 306 THR M N   1  
ATOM 4608   C CA  . THR C 3 303 ? -46.415  40.514  21.204  1.00 0.00 ? 306 THR M CA  1  
ATOM 4609   C C   . THR C 3 303 ? -47.702  40.100  20.541  1.00 0.00 ? 306 THR M C   1  
ATOM 4610   O O   . THR C 3 303 ? -48.286  39.102  20.897  1.00 0.00 ? 306 THR M O   1  
ATOM 4611   C CB  . THR C 3 303 ? -45.399  40.866  20.193  1.00 0.00 ? 306 THR M CB  1  
ATOM 4612   O OG1 . THR C 3 303 ? -44.853  39.703  19.740  1.00 0.00 ? 306 THR M OG1 1  
ATOM 4613   C CG2 . THR C 3 303 ? -44.434  41.732  20.916  1.00 0.00 ? 306 THR M CG2 1  
ATOM 4614   N N   . THR C 3 304 ? -48.157  40.905  19.596  1.00 0.00 ? 307 THR M N   1  
ATOM 4615   C CA  . THR C 3 304 ? -49.414  40.689  18.857  1.00 0.00 ? 307 THR M CA  1  
ATOM 4616   C C   . THR C 3 304 ? -49.136  40.203  17.417  1.00 0.00 ? 307 THR M C   1  
ATOM 4617   O O   . THR C 3 304 ? -50.075  39.803  16.723  1.00 0.00 ? 307 THR M O   1  
ATOM 4618   C CB  . THR C 3 304 ? -50.257  42.002  18.779  1.00 0.00 ? 307 THR M CB  1  
ATOM 4619   O OG1 . THR C 3 304 ? -49.548  43.088  18.279  1.00 0.00 ? 307 THR M OG1 1  
ATOM 4620   C CG2 . THR C 3 304 ? -50.859  42.382  20.075  1.00 0.00 ? 307 THR M CG2 1  
ATOM 4621   N N   . ASN C 3 305 ? -47.873  40.271  17.001  1.00 0.00 ? 308 ASN M N   1  
ATOM 4622   C CA  . ASN C 3 305 ? -47.314  39.860  15.742  1.00 0.00 ? 308 ASN M CA  1  
ATOM 4623   C C   . ASN C 3 305 ? -46.728  38.490  15.841  1.00 0.00 ? 308 ASN M C   1  
ATOM 4624   O O   . ASN C 3 305 ? -45.701  38.299  16.513  1.00 0.00 ? 308 ASN M O   1  
ATOM 4625   C CB  . ASN C 3 305 ? -46.175  40.841  15.323  1.00 0.00 ? 308 ASN M CB  1  
ATOM 4626   C CG  . ASN C 3 305 ? -45.506  40.432  14.049  1.00 0.00 ? 308 ASN M CG  1  
ATOM 4627   O OD1 . ASN C 3 305 ? -45.861  39.424  13.414  1.00 0.00 ? 308 ASN M OD1 1  
ATOM 4628   N ND2 . ASN C 3 305 ? -44.475  41.151  13.679  1.00 0.00 ? 308 ASN M ND2 1  
ATOM 4629   N N   . PRO C 3 306 ? -47.359  37.527  15.183  1.00 0.00 ? 309 PRO M N   1  
ATOM 4630   C CA  . PRO C 3 306 ? -47.038  36.122  15.240  1.00 0.00 ? 309 PRO M CA  1  
ATOM 4631   C C   . PRO C 3 306 ? -45.764  35.764  14.624  1.00 0.00 ? 309 PRO M C   1  
ATOM 4632   O O   . PRO C 3 306 ? -45.190  34.699  14.817  1.00 0.00 ? 309 PRO M O   1  
ATOM 4633   C CB  . PRO C 3 306 ? -48.025  35.492  14.372  1.00 0.00 ? 309 PRO M CB  1  
ATOM 4634   C CG  . PRO C 3 306 ? -49.166  36.434  14.188  1.00 0.00 ? 309 PRO M CG  1  
ATOM 4635   C CD  . PRO C 3 306 ? -48.738  37.720  14.778  1.00 0.00 ? 309 PRO M CD  1  
ATOM 4636   N N   . TYR C 3 307 ? -45.289  36.668  13.831  1.00 0.00 ? 310 TYR M N   1  
ATOM 4637   C CA  . TYR C 3 307 ? -44.025  36.349  13.232  1.00 0.00 ? 310 TYR M CA  1  
ATOM 4638   C C   . TYR C 3 307 ? -42.890  36.415  14.217  1.00 0.00 ? 310 TYR M C   1  
ATOM 4639   O O   . TYR C 3 307 ? -41.733  36.354  13.797  1.00 0.00 ? 310 TYR M O   1  
ATOM 4640   C CB  . TYR C 3 307 ? -43.776  37.257  12.038  1.00 0.00 ? 310 TYR M CB  1  
ATOM 4641   C CG  . TYR C 3 307 ? -44.682  36.952  10.929  1.00 0.00 ? 310 TYR M CG  1  
ATOM 4642   C CD1 . TYR C 3 307 ? -44.417  35.841  10.112  1.00 0.00 ? 310 TYR M CD1 1  
ATOM 4643   C CD2 . TYR C 3 307 ? -45.781  37.770  10.687  1.00 0.00 ? 310 TYR M CD2 1  
ATOM 4644   C CE1 . TYR C 3 307 ? -45.214  35.564  9.000   1.00 0.00 ? 310 TYR M CE1 1  
ATOM 4645   C CE2 . TYR C 3 307 ? -46.555  37.551  9.541   1.00 0.00 ? 310 TYR M CE2 1  
ATOM 4646   C CZ  . TYR C 3 307 ? -46.268  36.444  8.733   1.00 0.00 ? 310 TYR M CZ  1  
ATOM 4647   O OH  . TYR C 3 307 ? -47.144  36.171  7.756   1.00 0.00 ? 310 TYR M OH  1  
ATOM 4648   N N   . ASP C 3 308 ? -43.230  36.529  15.514  1.00 0.00 ? 311 ASP M N   1  
ATOM 4649   C CA  . ASP C 3 308 ? -42.273  36.588  16.628  1.00 0.00 ? 311 ASP M CA  1  
ATOM 4650   C C   . ASP C 3 308 ? -42.196  35.230  17.286  1.00 0.00 ? 311 ASP M C   1  
ATOM 4651   O O   . ASP C 3 308 ? -41.427  35.005  18.191  1.00 0.00 ? 311 ASP M O   1  
ATOM 4652   C CB  . ASP C 3 308 ? -42.866  37.555  17.652  1.00 0.00 ? 311 ASP M CB  1  
ATOM 4653   C CG  . ASP C 3 308 ? -42.480  38.998  17.464  1.00 0.00 ? 311 ASP M CG  1  
ATOM 4654   O OD1 . ASP C 3 308 ? -41.581  39.259  16.546  1.00 0.00 ? 311 ASP M OD1 1  
ATOM 4655   O OD2 . ASP C 3 308 ? -42.965  39.890  18.119  1.00 0.00 ? 311 ASP M OD2 1  
ATOM 4656   N N   . TYR C 3 309 ? -43.054  34.337  16.796  1.00 0.00 ? 312 TYR M N   1  
ATOM 4657   C CA  . TYR C 3 309 ? -43.168  33.038  17.286  1.00 0.00 ? 312 TYR M CA  1  
ATOM 4658   C C   . TYR C 3 309 ? -43.214  32.063  16.198  1.00 0.00 ? 312 TYR M C   1  
ATOM 4659   O O   . TYR C 3 309 ? -44.266  31.643  15.770  1.00 0.00 ? 312 TYR M O   1  
ATOM 4660   C CB  . TYR C 3 309 ? -44.293  32.893  18.283  1.00 0.00 ? 312 TYR M CB  1  
ATOM 4661   C CG  . TYR C 3 309 ? -44.280  34.063  19.207  1.00 0.00 ? 312 TYR M CG  1  
ATOM 4662   C CD1 . TYR C 3 309 ? -44.796  35.274  18.784  1.00 0.00 ? 312 TYR M CD1 1  
ATOM 4663   C CD2 . TYR C 3 309 ? -43.737  34.004  20.470  1.00 0.00 ? 312 TYR M CD2 1  
ATOM 4664   C CE1 . TYR C 3 309 ? -44.794  36.392  19.607  1.00 0.00 ? 312 TYR M CE1 1  
ATOM 4665   C CE2 . TYR C 3 309 ? -43.749  35.099  21.330  1.00 0.00 ? 312 TYR M CE2 1  
ATOM 4666   C CZ  . TYR C 3 309 ? -44.282  36.300  20.890  1.00 0.00 ? 312 TYR M CZ  1  
ATOM 4667   O OH  . TYR C 3 309 ? -44.330  37.389  21.701  1.00 0.00 ? 312 TYR M OH  1  
ATOM 4668   N N   . HIS C 3 310 ? -42.004  31.734  15.778  1.00 0.00 ? 313 HIS M N   1  
ATOM 4669   C CA  . HIS C 3 310 ? -41.708  30.747  14.760  1.00 0.00 ? 313 HIS M CA  1  
ATOM 4670   C C   . HIS C 3 310 ? -42.618  29.491  14.737  1.00 0.00 ? 313 HIS M C   1  
ATOM 4671   O O   . HIS C 3 310 ? -43.127  29.042  13.720  1.00 0.00 ? 313 HIS M O   1  
ATOM 4672   C CB  . HIS C 3 310 ? -40.342  30.303  15.149  1.00 0.00 ? 313 HIS M CB  1  
ATOM 4673   C CG  . HIS C 3 310 ? -39.807  29.220  14.321  1.00 0.00 ? 313 HIS M CG  1  
ATOM 4674   N ND1 . HIS C 3 310 ? -39.790  29.328  12.916  1.00 0.00 ? 313 HIS M ND1 1  
ATOM 4675   C CD2 . HIS C 3 310 ? -39.264  28.026  14.701  1.00 0.00 ? 313 HIS M CD2 1  
ATOM 4676   C CE1 . HIS C 3 310 ? -39.230  28.190  12.478  1.00 0.00 ? 313 HIS M CE1 1  
ATOM 4677   N NE2 . HIS C 3 310 ? -38.907  27.390  13.519  1.00 0.00 ? 313 HIS M NE2 1  
ATOM 4678   N N   . TYR C 3 311 ? -42.833  28.892  15.877  1.00 0.00 ? 314 TYR M N   1  
ATOM 4679   C CA  . TYR C 3 311 ? -43.626  27.737  16.084  1.00 0.00 ? 314 TYR M CA  1  
ATOM 4680   C C   . TYR C 3 311 ? -44.994  27.908  15.484  1.00 0.00 ? 314 TYR M C   1  
ATOM 4681   O O   . TYR C 3 311 ? -45.533  26.943  15.014  1.00 0.00 ? 314 TYR M O   1  
ATOM 4682   C CB  . TYR C 3 311 ? -43.802  27.423  17.595  1.00 0.00 ? 314 TYR M CB  1  
ATOM 4683   C CG  . TYR C 3 311 ? -42.684  26.619  18.267  1.00 0.00 ? 314 TYR M CG  1  
ATOM 4684   C CD1 . TYR C 3 311 ? -41.555  26.268  17.533  1.00 0.00 ? 314 TYR M CD1 1  
ATOM 4685   C CD2 . TYR C 3 311 ? -42.746  26.208  19.597  1.00 0.00 ? 314 TYR M CD2 1  
ATOM 4686   C CE1 . TYR C 3 311 ? -40.534  25.519  18.098  1.00 0.00 ? 314 TYR M CE1 1  
ATOM 4687   C CE2 . TYR C 3 311 ? -41.742  25.424  20.186  1.00 0.00 ? 314 TYR M CE2 1  
ATOM 4688   C CZ  . TYR C 3 311 ? -40.628  25.082  19.422  1.00 0.00 ? 314 TYR M CZ  1  
ATOM 4689   O OH  . TYR C 3 311 ? -39.656  24.283  19.979  1.00 0.00 ? 314 TYR M OH  1  
ATOM 4690   N N   . VAL C 3 312 ? -45.551  29.116  15.561  1.00 0.00 ? 315 VAL M N   1  
ATOM 4691   C CA  . VAL C 3 312 ? -46.900  29.410  15.094  1.00 0.00 ? 315 VAL M CA  1  
ATOM 4692   C C   . VAL C 3 312 ? -47.104  30.299  13.870  1.00 0.00 ? 315 VAL M C   1  
ATOM 4693   O O   . VAL C 3 312 ? -48.197  30.630  13.514  1.00 0.00 ? 315 VAL M O   1  
ATOM 4694   C CB  . VAL C 3 312 ? -47.774  29.844  16.249  1.00 0.00 ? 315 VAL M CB  1  
ATOM 4695   C CG1 . VAL C 3 312 ? -47.429  28.987  17.431  1.00 0.00 ? 315 VAL M CG1 1  
ATOM 4696   C CG2 . VAL C 3 312 ? -47.505  31.258  16.601  1.00 0.00 ? 315 VAL M CG2 1  
ATOM 4697   N N   . SER C 3 313 ? -46.072  30.604  13.130  1.00 0.00 ? 316 SER M N   1  
ATOM 4698   C CA  . SER C 3 313 ? -46.310  31.376  11.952  1.00 0.00 ? 316 SER M CA  1  
ATOM 4699   C C   . SER C 3 313 ? -45.529  30.808  10.814  1.00 0.00 ? 316 SER M C   1  
ATOM 4700   O O   . SER C 3 313 ? -44.934  31.569  10.058  1.00 0.00 ? 316 SER M O   1  
ATOM 4701   C CB  . SER C 3 313 ? -45.813  32.762  12.181  1.00 0.00 ? 316 SER M CB  1  
ATOM 4702   O OG  . SER C 3 313 ? -44.410  32.602  12.130  1.00 0.00 ? 316 SER M OG  1  
ATOM 4703   N N   . GLN C 3 314 ? -45.469  29.511  10.734  1.00 0.00 ? 317 GLN M N   1  
ATOM 4704   C CA  . GLN C 3 314 ? -44.710  28.907  9.670   1.00 0.00 ? 317 GLN M CA  1  
ATOM 4705   C C   . GLN C 3 314 ? -45.609  28.833  8.463   1.00 0.00 ? 317 GLN M C   1  
ATOM 4706   O O   . GLN C 3 314 ? -45.174  28.734  7.300   1.00 0.00 ? 317 GLN M O   1  
ATOM 4707   C CB  . GLN C 3 314 ? -44.264  27.504  10.011  1.00 0.00 ? 317 GLN M CB  1  
ATOM 4708   C CG  . GLN C 3 314 ? -43.089  27.398  10.977  1.00 0.00 ? 317 GLN M CG  1  
ATOM 4709   C CD  . GLN C 3 314 ? -42.804  25.945  11.164  1.00 0.00 ? 317 GLN M CD  1  
ATOM 4710   O OE1 . GLN C 3 314 ? -42.422  25.211  10.234  1.00 0.00 ? 317 GLN M OE1 1  
ATOM 4711   N NE2 . GLN C 3 314 ? -43.044  25.532  12.378  1.00 0.00 ? 317 GLN M NE2 1  
ATOM 4712   N N   . GLY C 3 315 ? -46.892  28.822  8.753   1.00 0.00 ? 318 GLY M N   1  
ATOM 4713   C CA  . GLY C 3 315 ? -47.838  28.726  7.682   1.00 0.00 ? 318 GLY M CA  1  
ATOM 4714   C C   . GLY C 3 315 ? -48.520  30.034  7.550   1.00 0.00 ? 318 GLY M C   1  
ATOM 4715   O O   . GLY C 3 315 ? -47.885  30.996  7.163   1.00 0.00 ? 318 GLY M O   1  
ATOM 4716   N N   . GLU C 3 316 ? -49.811  30.068  7.901   1.00 0.00 ? 319 GLU M N   1  
ATOM 4717   C CA  . GLU C 3 316 ? -50.598  31.250  7.782   1.00 0.00 ? 319 GLU M CA  1  
ATOM 4718   C C   . GLU C 3 316 ? -50.969  31.721  9.171   1.00 0.00 ? 319 GLU M C   1  
ATOM 4719   O O   . GLU C 3 316 ? -50.930  30.958  10.114  1.00 0.00 ? 319 GLU M O   1  
ATOM 4720   C CB  . GLU C 3 316 ? -51.876  31.044  6.923   1.00 0.00 ? 319 GLU M CB  1  
ATOM 4721   C CG  . GLU C 3 316 ? -51.611  30.734  5.437   1.00 0.00 ? 319 GLU M CG  1  
ATOM 4722   C CD  . GLU C 3 316 ? -52.281  31.688  4.483   1.00 0.00 ? 319 GLU M CD  1  
ATOM 4723   O OE1 . GLU C 3 316 ? -52.883  32.708  5.071   1.00 0.00 ? 319 GLU M OE1 1  
ATOM 4724   O OE2 . GLU C 3 316 ? -52.250  31.548  3.263   1.00 0.00 ? 319 GLU M OE2 1  
ATOM 4725   N N   . ILE C 3 317 ? -51.346  32.987  9.273   1.00 0.00 ? 320 ILE M N   1  
ATOM 4726   C CA  . ILE C 3 317 ? -51.700  33.608  10.530  1.00 0.00 ? 320 ILE M CA  1  
ATOM 4727   C C   . ILE C 3 317 ? -53.146  34.034  10.605  1.00 0.00 ? 320 ILE M C   1  
ATOM 4728   O O   . ILE C 3 317 ? -53.727  34.140  11.712  1.00 0.00 ? 320 ILE M O   1  
ATOM 4729   C CB  . ILE C 3 317 ? -51.018  34.921  10.648  1.00 0.00 ? 320 ILE M CB  1  
ATOM 4730   C CG1 . ILE C 3 317 ? -49.511  34.805  10.694  1.00 0.00 ? 320 ILE M CG1 1  
ATOM 4731   C CG2 . ILE C 3 317 ? -51.621  35.800  11.742  1.00 0.00 ? 320 ILE M CG2 1  
ATOM 4732   C CD1 . ILE C 3 317 ? -48.989  35.919  9.782   1.00 0.00 ? 320 ILE M CD1 1  
ATOM 4733   N N   . THR C 3 318 ? -53.648  34.490  9.470   1.00 0.00 ? 321 THR M N   1  
ATOM 4734   C CA  . THR C 3 318 ? -55.024  34.936  9.469   1.00 0.00 ? 321 THR M CA  1  
ATOM 4735   C C   . THR C 3 318 ? -55.906  34.232  8.445   1.00 0.00 ? 321 THR M C   1  
ATOM 4736   O O   . THR C 3 318 ? -55.436  33.881  7.366   1.00 0.00 ? 321 THR M O   1  
ATOM 4737   C CB  . THR C 3 318 ? -55.108  36.431  9.340   1.00 0.00 ? 321 THR M CB  1  
ATOM 4738   O OG1 . THR C 3 318 ? -56.401  36.861  9.776   1.00 0.00 ? 321 THR M OG1 1  
ATOM 4739   C CG2 . THR C 3 318 ? -54.843  36.801  7.891   1.00 0.00 ? 321 THR M CG2 1  
ATOM 4740   N N   . VAL C 3 319 ? -57.143  34.026  8.882   1.00 0.00 ? 322 VAL M N   1  
ATOM 4741   C CA  . VAL C 3 319 ? -58.204  33.399  8.094   1.00 0.00 ? 322 VAL M CA  1  
ATOM 4742   C C   . VAL C 3 319 ? -59.429  34.290  8.139   1.00 0.00 ? 322 VAL M C   1  
ATOM 4743   O O   . VAL C 3 319 ? -59.959  34.559  9.229   1.00 0.00 ? 322 VAL M O   1  
ATOM 4744   C CB  . VAL C 3 319 ? -58.538  32.021  8.623   1.00 0.00 ? 322 VAL M CB  1  
ATOM 4745   C CG1 . VAL C 3 319 ? -59.726  31.486  7.835   1.00 0.00 ? 322 VAL M CG1 1  
ATOM 4746   C CG2 . VAL C 3 319 ? -57.341  31.155  8.432   1.00 0.00 ? 322 VAL M CG2 1  
ATOM 4747   N N   . PRO C 3 320 ? -59.842  34.724  6.943   1.00 0.00 ? 323 PRO M N   1  
ATOM 4748   C CA  . PRO C 3 320 ? -60.952  35.643  6.743   1.00 0.00 ? 323 PRO M CA  1  
ATOM 4749   C C   . PRO C 3 320 ? -62.276  35.216  7.345   1.00 0.00 ? 323 PRO M C   1  
ATOM 4750   O O   . PRO C 3 320 ? -62.991  36.039  7.931   1.00 0.00 ? 323 PRO M O   1  
ATOM 4751   C CB  . PRO C 3 320 ? -61.062  35.867  5.256   1.00 0.00 ? 323 PRO M CB  1  
ATOM 4752   C CG  . PRO C 3 320 ? -59.872  35.142  4.627   1.00 0.00 ? 323 PRO M CG  1  
ATOM 4753   C CD  . PRO C 3 320 ? -59.274  34.252  5.665   1.00 0.00 ? 323 PRO M CD  1  
ATOM 4754   N N   . SER C 3 321 ? -62.591  33.918  7.229   1.00 0.00 ? 324 SER M N   1  
ATOM 4755   C CA  . SER C 3 321 ? -63.812  33.391  7.760   1.00 0.00 ? 324 SER M CA  1  
ATOM 4756   C C   . SER C 3 321 ? -63.863  33.255  9.273   1.00 0.00 ? 324 SER M C   1  
ATOM 4757   O O   . SER C 3 321 ? -64.896  32.874  9.807   1.00 0.00 ? 324 SER M O   1  
ATOM 4758   C CB  . SER C 3 321 ? -64.213  32.101  7.069   1.00 0.00 ? 324 SER M CB  1  
ATOM 4759   O OG  . SER C 3 321 ? -63.657  30.968  7.709   1.00 0.00 ? 324 SER M OG  1  
ATOM 4760   N N   . ILE C 3 322 ? -62.736  33.540  9.950   1.00 0.00 ? 325 ILE M N   1  
ATOM 4761   C CA  . ILE C 3 322 ? -62.626  33.434  11.409  1.00 0.00 ? 325 ILE M CA  1  
ATOM 4762   C C   . ILE C 3 322 ? -62.314  34.758  12.067  1.00 0.00 ? 325 ILE M C   1  
ATOM 4763   O O   . ILE C 3 322 ? -61.494  35.523  11.568  1.00 0.00 ? 325 ILE M O   1  
ATOM 4764   C CB  . ILE C 3 322 ? -61.562  32.421  11.789  1.00 0.00 ? 325 ILE M CB  1  
ATOM 4765   C CG1 . ILE C 3 322 ? -61.064  31.727  10.547  1.00 0.00 ? 325 ILE M CG1 1  
ATOM 4766   C CG2 . ILE C 3 322 ? -62.209  31.376  12.639  1.00 0.00 ? 325 ILE M CG2 1  
ATOM 4767   C CD1 . ILE C 3 322 ? -60.042  30.660  10.816  1.00 0.00 ? 325 ILE M CD1 1  
ATOM 4768   N N   . ASP C 3 323 ? -63.011  35.024  13.185  1.00 0.00 ? 326 ASP M N   1  
ATOM 4769   C CA  . ASP C 3 323 ? -62.847  36.259  13.960  1.00 0.00 ? 326 ASP M CA  1  
ATOM 4770   C C   . ASP C 3 323 ? -62.224  35.911  15.296  1.00 0.00 ? 326 ASP M C   1  
ATOM 4771   O O   . ASP C 3 323 ? -62.915  35.646  16.283  1.00 0.00 ? 326 ASP M O   1  
ATOM 4772   C CB  . ASP C 3 323 ? -64.164  37.047  14.174  1.00 0.00 ? 326 ASP M CB  1  
ATOM 4773   C CG  . ASP C 3 323 ? -63.967  38.499  14.609  1.00 0.00 ? 326 ASP M CG  1  
ATOM 4774   O OD1 . ASP C 3 323 ? -62.794  39.048  14.340  1.00 0.00 ? 326 ASP M OD1 1  
ATOM 4775   O OD2 . ASP C 3 323 ? -64.829  39.142  15.176  1.00 0.00 ? 326 ASP M OD2 1  
ATOM 4776   N N   . ASP C 3 324 ? -60.897  35.843  15.277  1.00 0.00 ? 327 ASP M N   1  
ATOM 4777   C CA  . ASP C 3 324 ? -60.099  35.454  16.416  1.00 0.00 ? 327 ASP M CA  1  
ATOM 4778   C C   . ASP C 3 324 ? -60.494  36.198  17.697  1.00 0.00 ? 327 ASP M C   1  
ATOM 4779   O O   . ASP C 3 324 ? -60.412  35.690  18.836  1.00 0.00 ? 327 ASP M O   1  
ATOM 4780   C CB  . ASP C 3 324 ? -58.623  35.579  16.126  1.00 0.00 ? 327 ASP M CB  1  
ATOM 4781   C CG  . ASP C 3 324 ? -58.167  34.898  14.879  1.00 0.00 ? 327 ASP M CG  1  
ATOM 4782   O OD1 . ASP C 3 324 ? -58.472  33.602  14.947  1.00 0.00 ? 327 ASP M OD1 1  
ATOM 4783   O OD2 . ASP C 3 324 ? -57.664  35.493  13.906  1.00 0.00 ? 327 ASP M OD2 1  
ATOM 4784   N N   . GLN C 3 325 ? -60.927  37.417  17.521  1.00 0.00 ? 328 GLN M N   1  
ATOM 4785   C CA  . GLN C 3 325 ? -61.311  38.267  18.627  1.00 0.00 ? 328 GLN M CA  1  
ATOM 4786   C C   . GLN C 3 325 ? -62.534  37.786  19.343  1.00 0.00 ? 328 GLN M C   1  
ATOM 4787   O O   . GLN C 3 325 ? -62.596  37.864  20.550  1.00 0.00 ? 328 GLN M O   1  
ATOM 4788   C CB  . GLN C 3 325 ? -61.537  39.675  18.129  1.00 0.00 ? 328 GLN M CB  1  
ATOM 4789   C CG  . GLN C 3 325 ? -60.488  40.162  17.130  1.00 0.00 ? 328 GLN M CG  1  
ATOM 4790   C CD  . GLN C 3 325 ? -60.127  41.585  17.448  1.00 0.00 ? 328 GLN M CD  1  
ATOM 4791   O OE1 . GLN C 3 325 ? -60.199  41.967  18.628  1.00 0.00 ? 328 GLN M OE1 1  
ATOM 4792   N NE2 . GLN C 3 325 ? -59.746  42.358  16.408  1.00 0.00 ? 328 GLN M NE2 1  
ATOM 4793   N N   . GLU C 3 326 ? -63.508  37.319  18.572  1.00 0.00 ? 329 GLU M N   1  
ATOM 4794   C CA  . GLU C 3 326 ? -64.808  36.836  19.095  1.00 0.00 ? 329 GLU M CA  1  
ATOM 4795   C C   . GLU C 3 326 ? -64.648  35.502  19.817  1.00 0.00 ? 329 GLU M C   1  
ATOM 4796   O O   . GLU C 3 326 ? -65.141  35.202  20.915  1.00 0.00 ? 329 GLU M O   1  
ATOM 4797   C CB  . GLU C 3 326 ? -65.766  36.641  17.915  1.00 0.00 ? 329 GLU M CB  1  
ATOM 4798   C CG  . GLU C 3 326 ? -67.068  37.452  18.015  1.00 0.00 ? 329 GLU M CG  1  
ATOM 4799   C CD  . GLU C 3 326 ? -67.814  37.421  16.712  1.00 0.00 ? 329 GLU M CD  1  
ATOM 4800   O OE1 . GLU C 3 326 ? -68.502  36.309  16.562  1.00 0.00 ? 329 GLU M OE1 1  
ATOM 4801   O OE2 . GLU C 3 326 ? -67.747  38.339  15.896  1.00 0.00 ? 329 GLU M OE2 1  
ATOM 4802   N N   . GLU C 3 327 ? -63.861  34.686  19.179  1.00 0.00 ? 330 GLU M N   1  
ATOM 4803   C CA  . GLU C 3 327 ? -63.595  33.391  19.690  1.00 0.00 ? 330 GLU M CA  1  
ATOM 4804   C C   . GLU C 3 327 ? -62.902  33.406  21.012  1.00 0.00 ? 330 GLU M C   1  
ATOM 4805   O O   . GLU C 3 327 ? -63.282  32.641  21.897  1.00 0.00 ? 330 GLU M O   1  
ATOM 4806   C CB  . GLU C 3 327 ? -62.819  32.670  18.633  1.00 0.00 ? 330 GLU M CB  1  
ATOM 4807   C CG  . GLU C 3 327 ? -63.507  32.970  17.291  1.00 0.00 ? 330 GLU M CG  1  
ATOM 4808   C CD  . GLU C 3 327 ? -64.754  32.108  17.089  1.00 0.00 ? 330 GLU M CD  1  
ATOM 4809   O OE1 . GLU C 3 327 ? -65.495  32.006  18.189  1.00 0.00 ? 330 GLU M OE1 1  
ATOM 4810   O OE2 . GLU C 3 327 ? -65.030  31.599  16.029  1.00 0.00 ? 330 GLU M OE2 1  
ATOM 4811   N N   . LEU C 3 328 ? -61.913  34.298  21.112  1.00 0.00 ? 331 LEU M N   1  
ATOM 4812   C CA  . LEU C 3 328 ? -61.147  34.459  22.328  1.00 0.00 ? 331 LEU M CA  1  
ATOM 4813   C C   . LEU C 3 328 ? -62.042  34.539  23.527  1.00 0.00 ? 331 LEU M C   1  
ATOM 4814   O O   . LEU C 3 328 ? -61.870  33.884  24.538  1.00 0.00 ? 331 LEU M O   1  
ATOM 4815   C CB  . LEU C 3 328 ? -60.266  35.635  22.318  1.00 0.00 ? 331 LEU M CB  1  
ATOM 4816   C CG  . LEU C 3 328 ? -59.018  35.387  23.154  1.00 0.00 ? 331 LEU M CG  1  
ATOM 4817   C CD1 . LEU C 3 328 ? -57.799  36.116  22.576  1.00 0.00 ? 331 LEU M CD1 1  
ATOM 4818   C CD2 . LEU C 3 328 ? -59.253  35.889  24.527  1.00 0.00 ? 331 LEU M CD2 1  
ATOM 4819   N N   . MET C 3 329 ? -63.107  35.267  23.350  1.00 0.00 ? 332 MET M N   1  
ATOM 4820   C CA  . MET C 3 329 ? -64.077  35.365  24.430  1.00 0.00 ? 332 MET M CA  1  
ATOM 4821   C C   . MET C 3 329 ? -64.863  34.138  24.578  1.00 0.00 ? 332 MET M C   1  
ATOM 4822   O O   . MET C 3 329 ? -65.177  33.733  25.688  1.00 0.00 ? 332 MET M O   1  
ATOM 4823   C CB  . MET C 3 329 ? -65.099  36.348  24.099  1.00 0.00 ? 332 MET M CB  1  
ATOM 4824   C CG  . MET C 3 329 ? -64.421  37.477  23.395  1.00 0.00 ? 332 MET M CG  1  
ATOM 4825   S SD  . MET C 3 329 ? -63.959  38.669  24.652  1.00 0.00 ? 332 MET M SD  1  
ATOM 4826   C CE  . MET C 3 329 ? -64.274  40.018  23.480  1.00 0.00 ? 332 MET M CE  1  
ATOM 4827   N N   . ALA C 3 330 ? -65.264  33.605  23.418  1.00 0.00 ? 333 ALA M N   1  
ATOM 4828   C CA  . ALA C 3 330 ? -66.049  32.385  23.442  1.00 0.00 ? 333 ALA M CA  1  
ATOM 4829   C C   . ALA C 3 330 ? -65.354  31.351  24.290  1.00 0.00 ? 333 ALA M C   1  
ATOM 4830   O O   . ALA C 3 330 ? -65.850  30.693  25.227  1.00 0.00 ? 333 ALA M O   1  
ATOM 4831   C CB  . ALA C 3 330 ? -66.119  31.879  22.063  1.00 0.00 ? 333 ALA M CB  1  
ATOM 4832   N N   . THR C 3 331 ? -64.107  31.264  23.944  1.00 0.00 ? 334 THR M N   1  
ATOM 4833   C CA  . THR C 3 331 ? -63.210  30.390  24.595  1.00 0.00 ? 334 THR M CA  1  
ATOM 4834   C C   . THR C 3 331 ? -63.156  30.702  26.024  1.00 0.00 ? 334 THR M C   1  
ATOM 4835   O O   . THR C 3 331 ? -63.446  29.879  26.870  1.00 0.00 ? 334 THR M O   1  
ATOM 4836   C CB  . THR C 3 331 ? -61.871  30.653  24.012  1.00 0.00 ? 334 THR M CB  1  
ATOM 4837   O OG1 . THR C 3 331 ? -61.849  30.320  22.616  1.00 0.00 ? 334 THR M OG1 1  
ATOM 4838   C CG2 . THR C 3 331 ? -60.961  29.867  24.883  1.00 0.00 ? 334 THR M CG2 1  
ATOM 4839   N N   . ASP C 3 332 ? -62.818  31.944  26.263  1.00 0.00 ? 335 ASP M N   1  
ATOM 4840   C CA  . ASP C 3 332 ? -62.670  32.473  27.627  1.00 0.00 ? 335 ASP M CA  1  
ATOM 4841   C C   . ASP C 3 332 ? -63.841  32.104  28.512  1.00 0.00 ? 335 ASP M C   1  
ATOM 4842   O O   . ASP C 3 332 ? -63.734  31.337  29.474  1.00 0.00 ? 335 ASP M O   1  
ATOM 4843   C CB  . ASP C 3 332 ? -62.500  33.977  27.573  1.00 0.00 ? 335 ASP M CB  1  
ATOM 4844   C CG  . ASP C 3 332 ? -61.860  34.450  28.804  1.00 0.00 ? 335 ASP M CG  1  
ATOM 4845   O OD1 . ASP C 3 332 ? -62.283  34.106  29.852  1.00 0.00 ? 335 ASP M OD1 1  
ATOM 4846   O OD2 . ASP C 3 332 ? -60.829  35.229  28.648  1.00 0.00 ? 335 ASP M OD2 1  
ATOM 4847   N N   . SER C 3 333 ? -64.986  32.577  28.067  1.00 0.00 ? 336 SER M N   1  
ATOM 4848   C CA  . SER C 3 333 ? -66.261  32.335  28.727  1.00 0.00 ? 336 SER M CA  1  
ATOM 4849   C C   . SER C 3 333 ? -66.563  30.866  28.938  1.00 0.00 ? 336 SER M C   1  
ATOM 4850   O O   . SER C 3 333 ? -67.102  30.505  29.956  1.00 0.00 ? 336 SER M O   1  
ATOM 4851   C CB  . SER C 3 333 ? -67.383  32.987  27.968  1.00 0.00 ? 336 SER M CB  1  
ATOM 4852   O OG  . SER C 3 333 ? -66.884  34.040  27.156  1.00 0.00 ? 336 SER M OG  1  
ATOM 4853   N N   . ALA C 3 334 ? -66.216  30.039  27.962  1.00 0.00 ? 337 ALA M N   1  
ATOM 4854   C CA  . ALA C 3 334 ? -66.424  28.652  28.077  1.00 0.00 ? 337 ALA M CA  1  
ATOM 4855   C C   . ALA C 3 334 ? -65.662  28.061  29.261  1.00 0.00 ? 337 ALA M C   1  
ATOM 4856   O O   . ALA C 3 334 ? -66.119  27.177  30.033  1.00 0.00 ? 337 ALA M O   1  
ATOM 4857   C CB  . ALA C 3 334 ? -65.972  28.006  26.816  1.00 0.00 ? 337 ALA M CB  1  
ATOM 4858   N N   . ILE C 3 335 ? -64.438  28.562  29.420  1.00 0.00 ? 338 ILE M N   1  
ATOM 4859   C CA  . ILE C 3 335 ? -63.585  28.049  30.483  1.00 0.00 ? 338 ILE M CA  1  
ATOM 4860   C C   . ILE C 3 335 ? -64.264  28.148  31.815  1.00 0.00 ? 338 ILE M C   1  
ATOM 4861   O O   . ILE C 3 335 ? -64.409  27.220  32.560  1.00 0.00 ? 338 ILE M O   1  
ATOM 4862   C CB  . ILE C 3 335 ? -62.329  28.855  30.516  1.00 0.00 ? 338 ILE M CB  1  
ATOM 4863   C CG1 . ILE C 3 335 ? -61.482  28.432  29.337  1.00 0.00 ? 338 ILE M CG1 1  
ATOM 4864   C CG2 . ILE C 3 335 ? -61.635  28.544  31.848  1.00 0.00 ? 338 ILE M CG2 1  
ATOM 4865   C CD1 . ILE C 3 335 ? -60.157  29.163  29.243  1.00 0.00 ? 338 ILE M CD1 1  
ATOM 4866   N N   . ASP C 3 336 ? -64.726  29.350  32.037  1.00 0.00 ? 339 ASP M N   1  
ATOM 4867   C CA  . ASP C 3 336 ? -65.469  29.717  33.211  1.00 0.00 ? 339 ASP M CA  1  
ATOM 4868   C C   . ASP C 3 336 ? -66.639  28.803  33.439  1.00 0.00 ? 339 ASP M C   1  
ATOM 4869   O O   . ASP C 3 336 ? -66.764  28.173  34.486  1.00 0.00 ? 339 ASP M O   1  
ATOM 4870   C CB  . ASP C 3 336 ? -65.934  31.174  33.120  1.00 0.00 ? 339 ASP M CB  1  
ATOM 4871   C CG  . ASP C 3 336 ? -64.777  32.148  33.112  1.00 0.00 ? 339 ASP M CG  1  
ATOM 4872   O OD1 . ASP C 3 336 ? -64.057  32.041  34.205  1.00 0.00 ? 339 ASP M OD1 1  
ATOM 4873   O OD2 . ASP C 3 336 ? -64.548  32.928  32.188  1.00 0.00 ? 339 ASP M OD2 1  
ATOM 4874   N N   . ILE C 3 337 ? -67.498  28.711  32.446  1.00 0.00 ? 340 ILE M N   1  
ATOM 4875   C CA  . ILE C 3 337 ? -68.681  27.876  32.557  1.00 0.00 ? 340 ILE M CA  1  
ATOM 4876   C C   . ILE C 3 337 ? -68.327  26.505  32.861  1.00 0.00 ? 340 ILE M C   1  
ATOM 4877   O O   . ILE C 3 337 ? -69.032  25.828  33.576  1.00 0.00 ? 340 ILE M O   1  
ATOM 4878   C CB  . ILE C 3 337 ? -69.474  27.879  31.274  1.00 0.00 ? 340 ILE M CB  1  
ATOM 4879   C CG1 . ILE C 3 337 ? -70.121  29.267  31.149  1.00 0.00 ? 340 ILE M CG1 1  
ATOM 4880   C CG2 . ILE C 3 337 ? -70.476  26.802  31.396  1.00 0.00 ? 340 ILE M CG2 1  
ATOM 4881   C CD1 . ILE C 3 337 ? -70.907  29.460  29.861  1.00 0.00 ? 340 ILE M CD1 1  
ATOM 4882   N N   . LEU C 3 338 ? -67.202  26.168  32.278  1.00 0.00 ? 341 LEU M N   1  
ATOM 4883   C CA  . LEU C 3 338 ? -66.705  24.864  32.524  1.00 0.00 ? 341 LEU M CA  1  
ATOM 4884   C C   . LEU C 3 338 ? -66.241  24.644  33.970  1.00 0.00 ? 341 LEU M C   1  
ATOM 4885   O O   . LEU C 3 338 ? -65.945  23.560  34.403  1.00 0.00 ? 341 LEU M O   1  
ATOM 4886   C CB  . LEU C 3 338 ? -65.957  24.272  31.327  1.00 0.00 ? 341 LEU M CB  1  
ATOM 4887   C CG  . LEU C 3 338 ? -66.969  23.943  30.230  1.00 0.00 ? 341 LEU M CG  1  
ATOM 4888   C CD1 . LEU C 3 338 ? -66.481  24.259  28.833  1.00 0.00 ? 341 LEU M CD1 1  
ATOM 4889   C CD2 . LEU C 3 338 ? -67.524  22.531  30.308  1.00 0.00 ? 341 LEU M CD2 1  
ATOM 4890   N N   . GLY C 3 339 ? -66.273  25.713  34.762  1.00 0.00 ? 342 GLY M N   1  
ATOM 4891   C CA  . GLY C 3 339 ? -65.931  25.596  36.185  1.00 0.00 ? 342 GLY M CA  1  
ATOM 4892   C C   . GLY C 3 339 ? -64.462  25.651  36.566  1.00 0.00 ? 342 GLY M C   1  
ATOM 4893   O O   . GLY C 3 339 ? -64.090  25.343  37.718  1.00 0.00 ? 342 GLY M O   1  
ATOM 4894   N N   . PHE C 3 340 ? -63.632  26.027  35.603  1.00 0.00 ? 343 PHE M N   1  
ATOM 4895   C CA  . PHE C 3 340 ? -62.232  26.081  35.903  1.00 0.00 ? 343 PHE M CA  1  
ATOM 4896   C C   . PHE C 3 340 ? -61.928  27.201  36.883  1.00 0.00 ? 343 PHE M C   1  
ATOM 4897   O O   . PHE C 3 340 ? -62.450  28.302  36.775  1.00 0.00 ? 343 PHE M O   1  
ATOM 4898   C CB  . PHE C 3 340 ? -61.487  26.343  34.614  1.00 0.00 ? 343 PHE M CB  1  
ATOM 4899   C CG  . PHE C 3 340 ? -61.242  25.097  33.828  1.00 0.00 ? 343 PHE M CG  1  
ATOM 4900   C CD1 . PHE C 3 340 ? -60.141  24.247  33.973  1.00 0.00 ? 343 PHE M CD1 1  
ATOM 4901   C CD2 . PHE C 3 340 ? -62.100  24.836  32.774  1.00 0.00 ? 343 PHE M CD2 1  
ATOM 4902   C CE1 . PHE C 3 340 ? -59.918  23.148  33.149  1.00 0.00 ? 343 PHE M CE1 1  
ATOM 4903   C CE2 . PHE C 3 340 ? -61.890  23.746  31.931  1.00 0.00 ? 343 PHE M CE2 1  
ATOM 4904   C CZ  . PHE C 3 340 ? -60.797  22.891  32.109  1.00 0.00 ? 343 PHE M CZ  1  
ATOM 4905   N N   . SER C 3 341 ? -60.937  26.961  37.719  1.00 0.00 ? 344 SER M N   1  
ATOM 4906   C CA  . SER C 3 341 ? -60.445  27.976  38.629  1.00 0.00 ? 344 SER M CA  1  
ATOM 4907   C C   . SER C 3 341 ? -59.692  29.061  37.883  1.00 0.00 ? 344 SER M C   1  
ATOM 4908   O O   . SER C 3 341 ? -59.076  28.787  36.854  1.00 0.00 ? 344 SER M O   1  
ATOM 4909   C CB  . SER C 3 341 ? -59.489  27.301  39.570  1.00 0.00 ? 344 SER M CB  1  
ATOM 4910   O OG  . SER C 3 341 ? -59.243  28.152  40.653  1.00 0.00 ? 344 SER M OG  1  
ATOM 4911   N N   . ALA C 3 342 ? -59.747  30.296  38.370  1.00 0.00 ? 345 ALA M N   1  
ATOM 4912   C CA  . ALA C 3 342 ? -59.125  31.388  37.617  1.00 0.00 ? 345 ALA M CA  1  
ATOM 4913   C C   . ALA C 3 342 ? -57.664  31.120  37.392  1.00 0.00 ? 345 ALA M C   1  
ATOM 4914   O O   . ALA C 3 342 ? -57.079  31.283  36.301  1.00 0.00 ? 345 ALA M O   1  
ATOM 4915   C CB  . ALA C 3 342 ? -59.424  32.714  38.225  1.00 0.00 ? 345 ALA M CB  1  
ATOM 4916   N N   . ASP C 3 343 ? -57.097  30.660  38.469  1.00 0.00 ? 346 ASP M N   1  
ATOM 4917   C CA  . ASP C 3 343 ? -55.742  30.221  38.525  1.00 0.00 ? 346 ASP M CA  1  
ATOM 4918   C C   . ASP C 3 343 ? -55.486  29.228  37.358  1.00 0.00 ? 346 ASP M C   1  
ATOM 4919   O O   . ASP C 3 343 ? -54.576  29.379  36.512  1.00 0.00 ? 346 ASP M O   1  
ATOM 4920   C CB  . ASP C 3 343 ? -55.724  29.472  39.854  1.00 0.00 ? 346 ASP M CB  1  
ATOM 4921   C CG  . ASP C 3 343 ? -54.399  29.397  40.513  1.00 0.00 ? 346 ASP M CG  1  
ATOM 4922   O OD1 . ASP C 3 343 ? -53.811  30.376  40.982  1.00 0.00 ? 346 ASP M OD1 1  
ATOM 4923   O OD2 . ASP C 3 343 ? -53.959  28.139  40.601  1.00 0.00 ? 346 ASP M OD2 1  
ATOM 4924   N N   . GLU C 3 344 ? -56.307  28.159  37.292  1.00 0.00 ? 347 GLU M N   1  
ATOM 4925   C CA  . GLU C 3 344 ? -56.160  27.193  36.252  1.00 0.00 ? 347 GLU M CA  1  
ATOM 4926   C C   . GLU C 3 344 ? -56.364  27.895  34.967  1.00 0.00 ? 347 GLU M C   1  
ATOM 4927   O O   . GLU C 3 344 ? -55.613  27.726  34.043  1.00 0.00 ? 347 GLU M O   1  
ATOM 4928   C CB  . GLU C 3 344 ? -57.209  26.088  36.351  1.00 0.00 ? 347 GLU M CB  1  
ATOM 4929   C CG  . GLU C 3 344 ? -57.018  25.179  37.582  1.00 0.00 ? 347 GLU M CG  1  
ATOM 4930   C CD  . GLU C 3 344 ? -58.093  24.159  37.748  1.00 0.00 ? 347 GLU M CD  1  
ATOM 4931   O OE1 . GLU C 3 344 ? -59.282  24.556  37.313  1.00 0.00 ? 347 GLU M OE1 1  
ATOM 4932   O OE2 . GLU C 3 344 ? -57.846  23.079  38.260  1.00 0.00 ? 347 GLU M OE2 1  
ATOM 4933   N N   . LYS C 3 345 ? -57.382  28.743  34.979  1.00 0.00 ? 348 LYS M N   1  
ATOM 4934   C CA  . LYS C 3 345 ? -57.688  29.511  33.790  1.00 0.00 ? 348 LYS M CA  1  
ATOM 4935   C C   . LYS C 3 345 ? -56.555  30.438  33.494  1.00 0.00 ? 348 LYS M C   1  
ATOM 4936   O O   . LYS C 3 345 ? -56.419  30.944  32.422  1.00 0.00 ? 348 LYS M O   1  
ATOM 4937   C CB  . LYS C 3 345 ? -59.066  30.121  33.768  1.00 0.00 ? 348 LYS M CB  1  
ATOM 4938   C CG  . LYS C 3 345 ? -59.081  31.446  33.075  1.00 0.00 ? 348 LYS M CG  1  
ATOM 4939   C CD  . LYS C 3 345 ? -60.415  32.159  33.222  1.00 0.00 ? 348 LYS M CD  1  
ATOM 4940   C CE  . LYS C 3 345 ? -60.669  33.110  32.042  1.00 0.00 ? 348 LYS M CE  1  
ATOM 4941   N NZ  . LYS C 3 345 ? -61.740  34.081  32.281  1.00 0.00 ? 348 LYS M NZ  1  
ATOM 4942   N N   . THR C 3 346 ? -55.701  30.573  34.475  1.00 0.00 ? 349 THR M N   1  
ATOM 4943   C CA  . THR C 3 346 ? -54.524  31.396  34.335  1.00 0.00 ? 349 THR M CA  1  
ATOM 4944   C C   . THR C 3 346 ? -53.361  30.484  33.879  1.00 0.00 ? 349 THR M C   1  
ATOM 4945   O O   . THR C 3 346 ? -52.600  30.803  33.002  1.00 0.00 ? 349 THR M O   1  
ATOM 4946   C CB  . THR C 3 346 ? -54.218  32.125  35.664  1.00 0.00 ? 349 THR M CB  1  
ATOM 4947   O OG1 . THR C 3 346 ? -55.236  33.059  36.024  1.00 0.00 ? 349 THR M OG1 1  
ATOM 4948   C CG2 . THR C 3 346 ? -52.920  32.856  35.538  1.00 0.00 ? 349 THR M CG2 1  
ATOM 4949   N N   . ALA C 3 347 ? -53.292  29.270  34.424  1.00 0.00 ? 350 ALA M N   1  
ATOM 4950   C CA  . ALA C 3 347 ? -52.291  28.353  34.046  1.00 0.00 ? 350 ALA M CA  1  
ATOM 4951   C C   . ALA C 3 347 ? -52.341  28.094  32.562  1.00 0.00 ? 350 ALA M C   1  
ATOM 4952   O O   . ALA C 3 347 ? -51.382  28.158  31.803  1.00 0.00 ? 350 ALA M O   1  
ATOM 4953   C CB  . ALA C 3 347 ? -52.528  27.091  34.801  1.00 0.00 ? 350 ALA M CB  1  
ATOM 4954   N N   . ILE C 3 348 ? -53.518  27.841  32.137  1.00 0.00 ? 351 ILE M N   1  
ATOM 4955   C CA  . ILE C 3 348 ? -53.831  27.545  30.745  1.00 0.00 ? 351 ILE M CA  1  
ATOM 4956   C C   . ILE C 3 348 ? -53.264  28.609  29.891  1.00 0.00 ? 351 ILE M C   1  
ATOM 4957   O O   . ILE C 3 348 ? -52.577  28.355  28.921  1.00 0.00 ? 351 ILE M O   1  
ATOM 4958   C CB  . ILE C 3 348 ? -55.333  27.652  30.544  1.00 0.00 ? 351 ILE M CB  1  
ATOM 4959   C CG1 . ILE C 3 348 ? -56.073  26.555  31.321  1.00 0.00 ? 351 ILE M CG1 1  
ATOM 4960   C CG2 . ILE C 3 348 ? -55.686  27.741  29.090  1.00 0.00 ? 351 ILE M CG2 1  
ATOM 4961   C CD1 . ILE C 3 348 ? -57.079  25.767  30.555  1.00 0.00 ? 351 ILE M CD1 1  
ATOM 4962   N N   . TYR C 3 349 ? -53.604  29.818  30.232  1.00 0.00 ? 352 TYR M N   1  
ATOM 4963   C CA  . TYR C 3 349 ? -53.114  30.852  29.387  1.00 0.00 ? 352 TYR M CA  1  
ATOM 4964   C C   . TYR C 3 349 ? -51.629  30.879  29.508  1.00 0.00 ? 352 TYR M C   1  
ATOM 4965   O O   . TYR C 3 349 ? -50.965  30.540  28.541  1.00 0.00 ? 352 TYR M O   1  
ATOM 4966   C CB  . TYR C 3 349 ? -53.702  32.279  29.456  1.00 0.00 ? 352 TYR M CB  1  
ATOM 4967   C CG  . TYR C 3 349 ? -55.090  32.524  28.892  1.00 0.00 ? 352 TYR M CG  1  
ATOM 4968   C CD1 . TYR C 3 349 ? -55.448  32.525  27.547  1.00 0.00 ? 352 TYR M CD1 1  
ATOM 4969   C CD2 . TYR C 3 349 ? -56.069  32.851  29.810  1.00 0.00 ? 352 TYR M CD2 1  
ATOM 4970   C CE1 . TYR C 3 349 ? -56.745  32.794  27.121  1.00 0.00 ? 352 TYR M CE1 1  
ATOM 4971   C CE2 . TYR C 3 349 ? -57.384  33.095  29.426  1.00 0.00 ? 352 TYR M CE2 1  
ATOM 4972   C CZ  . TYR C 3 349 ? -57.713  33.095  28.074  1.00 0.00 ? 352 TYR M CZ  1  
ATOM 4973   O OH  . TYR C 3 349 ? -59.014  33.413  27.704  1.00 0.00 ? 352 TYR M OH  1  
ATOM 4974   N N   . LYS C 3 350 ? -51.113  31.215  30.671  1.00 0.00 ? 353 LYS M N   1  
ATOM 4975   C CA  . LYS C 3 350 ? -49.666  31.313  30.913  1.00 0.00 ? 353 LYS M CA  1  
ATOM 4976   C C   . LYS C 3 350 ? -48.887  30.153  30.297  1.00 0.00 ? 353 LYS M C   1  
ATOM 4977   O O   . LYS C 3 350 ? -47.802  30.293  29.697  1.00 0.00 ? 353 LYS M O   1  
ATOM 4978   C CB  . LYS C 3 350 ? -49.320  31.380  32.387  1.00 0.00 ? 353 LYS M CB  1  
ATOM 4979   C CG  . LYS C 3 350 ? -49.428  32.758  33.044  1.00 0.00 ? 353 LYS M CG  1  
ATOM 4980   C CD  . LYS C 3 350 ? -49.243  32.691  34.589  1.00 0.00 ? 353 LYS M CD  1  
ATOM 4981   C CE  . LYS C 3 350 ? -48.028  33.409  35.143  1.00 0.00 ? 353 LYS M CE  1  
ATOM 4982   N NZ  . LYS C 3 350 ? -47.726  32.922  36.464  1.00 0.00 ? 353 LYS M NZ  1  
ATOM 4983   N N   . LEU C 3 351 ? -49.464  28.958  30.402  1.00 0.00 ? 354 LEU M N   1  
ATOM 4984   C CA  . LEU C 3 351 ? -48.826  27.776  29.879  1.00 0.00 ? 354 LEU M CA  1  
ATOM 4985   C C   . LEU C 3 351 ? -48.790  27.736  28.359  1.00 0.00 ? 354 LEU M C   1  
ATOM 4986   O O   . LEU C 3 351 ? -47.902  27.202  27.718  1.00 0.00 ? 354 LEU M O   1  
ATOM 4987   C CB  . LEU C 3 351 ? -49.599  26.591  30.375  1.00 0.00 ? 354 LEU M CB  1  
ATOM 4988   C CG  . LEU C 3 351 ? -48.807  25.708  31.311  1.00 0.00 ? 354 LEU M CG  1  
ATOM 4989   C CD1 . LEU C 3 351 ? -47.639  26.517  31.828  1.00 0.00 ? 354 LEU M CD1 1  
ATOM 4990   C CD2 . LEU C 3 351 ? -49.839  25.366  32.376  1.00 0.00 ? 354 LEU M CD2 1  
ATOM 4991   N N   . THR C 3 352 ? -49.811  28.296  27.743  1.00 0.00 ? 355 THR M N   1  
ATOM 4992   C CA  . THR C 3 352 ? -49.928  28.320  26.302  1.00 0.00 ? 355 THR M CA  1  
ATOM 4993   C C   . THR C 3 352 ? -48.977  29.300  25.675  1.00 0.00 ? 355 THR M C   1  
ATOM 4994   O O   . THR C 3 352 ? -48.719  29.241  24.526  1.00 0.00 ? 355 THR M O   1  
ATOM 4995   C CB  . THR C 3 352 ? -51.378  28.620  25.901  1.00 0.00 ? 355 THR M CB  1  
ATOM 4996   O OG1 . THR C 3 352 ? -52.186  27.587  26.425  1.00 0.00 ? 355 THR M OG1 1  
ATOM 4997   C CG2 . THR C 3 352 ? -51.489  28.782  24.406  1.00 0.00 ? 355 THR M CG2 1  
ATOM 4998   N N   . GLY C 3 353 ? -48.445  30.210  26.463  1.00 0.00 ? 356 GLY M N   1  
ATOM 4999   C CA  . GLY C 3 353 ? -47.529  31.224  25.970  1.00 0.00 ? 356 GLY M CA  1  
ATOM 5000   C C   . GLY C 3 353 ? -46.122  30.770  26.149  1.00 0.00 ? 356 GLY M C   1  
ATOM 5001   O O   . GLY C 3 353 ? -45.253  31.099  25.329  1.00 0.00 ? 356 GLY M O   1  
ATOM 5002   N N   . ALA C 3 354 ? -45.893  30.018  27.237  1.00 0.00 ? 357 ALA M N   1  
ATOM 5003   C CA  . ALA C 3 354 ? -44.554  29.484  27.477  1.00 0.00 ? 357 ALA M CA  1  
ATOM 5004   C C   . ALA C 3 354 ? -44.064  28.748  26.224  1.00 0.00 ? 357 ALA M C   1  
ATOM 5005   O O   . ALA C 3 354 ? -42.975  28.938  25.689  1.00 0.00 ? 357 ALA M O   1  
ATOM 5006   C CB  . ALA C 3 354 ? -44.643  28.553  28.604  1.00 0.00 ? 357 ALA M CB  1  
ATOM 5007   N N   . VAL C 3 355 ? -44.958  27.934  25.753  1.00 0.00 ? 358 VAL M N   1  
ATOM 5008   C CA  . VAL C 3 355 ? -44.790  27.105  24.577  1.00 0.00 ? 358 VAL M CA  1  
ATOM 5009   C C   . VAL C 3 355 ? -44.394  27.935  23.386  1.00 0.00 ? 358 VAL M C   1  
ATOM 5010   O O   . VAL C 3 355 ? -43.571  27.618  22.619  1.00 0.00 ? 358 VAL M O   1  
ATOM 5011   C CB  . VAL C 3 355 ? -46.046  26.280  24.357  1.00 0.00 ? 358 VAL M CB  1  
ATOM 5012   C CG1 . VAL C 3 355 ? -45.975  25.616  23.055  1.00 0.00 ? 358 VAL M CG1 1  
ATOM 5013   C CG2 . VAL C 3 355 ? -46.250  25.269  25.473  1.00 0.00 ? 358 VAL M CG2 1  
ATOM 5014   N N   . MET C 3 356 ? -44.972  29.057  23.216  1.00 0.00 ? 359 MET M N   1  
ATOM 5015   C CA  . MET C 3 356 ? -44.627  29.951  22.092  1.00 0.00 ? 359 MET M CA  1  
ATOM 5016   C C   . MET C 3 356 ? -43.218  30.371  22.227  1.00 0.00 ? 359 MET M C   1  
ATOM 5017   O O   . MET C 3 356 ? -42.501  30.393  21.242  1.00 0.00 ? 359 MET M O   1  
ATOM 5018   C CB  . MET C 3 356 ? -45.421  31.268  22.152  1.00 0.00 ? 359 MET M CB  1  
ATOM 5019   C CG  . MET C 3 356 ? -46.950  31.126  22.158  1.00 0.00 ? 359 MET M CG  1  
ATOM 5020   S SD  . MET C 3 356 ? -47.738  32.359  21.146  1.00 0.00 ? 359 MET M SD  1  
ATOM 5021   C CE  . MET C 3 356 ? -48.756  32.989  22.418  1.00 0.00 ? 359 MET M CE  1  
ATOM 5022   N N   . HIS C 3 357 ? -42.905  30.753  23.449  1.00 0.00 ? 360 HIS M N   1  
ATOM 5023   C CA  . HIS C 3 357 ? -41.567  31.210  23.863  1.00 0.00 ? 360 HIS M CA  1  
ATOM 5024   C C   . HIS C 3 357 ? -40.500  30.177  23.654  1.00 0.00 ? 360 HIS M C   1  
ATOM 5025   O O   . HIS C 3 357 ? -39.400  30.486  23.281  1.00 0.00 ? 360 HIS M O   1  
ATOM 5026   C CB  . HIS C 3 357 ? -41.492  31.623  25.282  1.00 0.00 ? 360 HIS M CB  1  
ATOM 5027   C CG  . HIS C 3 357 ? -42.032  32.994  25.458  1.00 0.00 ? 360 HIS M CG  1  
ATOM 5028   N ND1 . HIS C 3 357 ? -43.115  33.283  26.290  1.00 0.00 ? 360 HIS M ND1 1  
ATOM 5029   C CD2 . HIS C 3 357 ? -41.617  34.159  24.878  1.00 0.00 ? 360 HIS M CD2 1  
ATOM 5030   C CE1 . HIS C 3 357 ? -43.362  34.590  26.190  1.00 0.00 ? 360 HIS M CE1 1  
ATOM 5031   N NE2 . HIS C 3 357 ? -42.454  35.129  25.357  1.00 0.00 ? 360 HIS M NE2 1  
ATOM 5032   N N   . TYR C 3 358 ? -40.831  28.952  23.933  1.00 0.00 ? 361 TYR M N   1  
ATOM 5033   C CA  . TYR C 3 358 ? -39.872  27.904  23.765  1.00 0.00 ? 361 TYR M CA  1  
ATOM 5034   C C   . TYR C 3 358 ? -39.298  27.880  22.367  1.00 0.00 ? 361 TYR M C   1  
ATOM 5035   O O   . TYR C 3 358 ? -38.091  27.758  22.117  1.00 0.00 ? 361 TYR M O   1  
ATOM 5036   C CB  . TYR C 3 358 ? -40.527  26.580  24.028  1.00 0.00 ? 361 TYR M CB  1  
ATOM 5037   C CG  . TYR C 3 358 ? -40.488  26.148  25.465  1.00 0.00 ? 361 TYR M CG  1  
ATOM 5038   C CD1 . TYR C 3 358 ? -40.583  27.055  26.524  1.00 0.00 ? 361 TYR M CD1 1  
ATOM 5039   C CD2 . TYR C 3 358 ? -40.346  24.786  25.733  1.00 0.00 ? 361 TYR M CD2 1  
ATOM 5040   C CE1 . TYR C 3 358 ? -40.524  26.579  27.834  1.00 0.00 ? 361 TYR M CE1 1  
ATOM 5041   C CE2 . TYR C 3 358 ? -40.284  24.302  27.039  1.00 0.00 ? 361 TYR M CE2 1  
ATOM 5042   C CZ  . TYR C 3 358 ? -40.380  25.219  28.087  1.00 0.00 ? 361 TYR M CZ  1  
ATOM 5043   O OH  . TYR C 3 358 ? -40.389  24.857  29.394  1.00 0.00 ? 361 TYR M OH  1  
ATOM 5044   N N   . GLY C 3 359 ? -40.167  27.983  21.438  1.00 0.00 ? 362 GLY M N   1  
ATOM 5045   C CA  . GLY C 3 359 ? -39.784  27.976  20.049  1.00 0.00 ? 362 GLY M CA  1  
ATOM 5046   C C   . GLY C 3 359 ? -38.908  29.129  19.717  1.00 0.00 ? 362 GLY M C   1  
ATOM 5047   O O   . GLY C 3 359 ? -38.381  29.173  18.582  1.00 0.00 ? 362 GLY M O   1  
ATOM 5048   N N   . ASN C 3 360 ? -38.772  30.042  20.687  1.00 0.00 ? 363 ASN M N   1  
ATOM 5049   C CA  . ASN C 3 360 ? -37.899  31.222  20.523  1.00 0.00 ? 363 ASN M CA  1  
ATOM 5050   C C   . ASN C 3 360 ? -36.582  31.024  21.239  1.00 0.00 ? 363 ASN M C   1  
ATOM 5051   O O   . ASN C 3 360 ? -35.644  31.754  21.047  1.00 0.00 ? 363 ASN M O   1  
ATOM 5052   C CB  . ASN C 3 360 ? -38.470  32.559  20.912  1.00 0.00 ? 363 ASN M CB  1  
ATOM 5053   C CG  . ASN C 3 360 ? -39.366  33.113  19.870  1.00 0.00 ? 363 ASN M CG  1  
ATOM 5054   O OD1 . ASN C 3 360 ? -39.531  32.465  18.812  1.00 0.00 ? 363 ASN M OD1 1  
ATOM 5055   N ND2 . ASN C 3 360 ? -39.941  34.238  20.244  1.00 0.00 ? 363 ASN M ND2 1  
ATOM 5056   N N   . LEU C 3 361 ? -36.557  29.989  22.045  1.00 0.00 ? 364 LEU M N   1  
ATOM 5057   C CA  . LEU C 3 361 ? -35.371  29.652  22.764  1.00 0.00 ? 364 LEU M CA  1  
ATOM 5058   C C   . LEU C 3 361 ? -34.295  29.318  21.757  1.00 0.00 ? 364 LEU M C   1  
ATOM 5059   O O   . LEU C 3 361 ? -34.487  28.461  20.907  1.00 0.00 ? 364 LEU M O   1  
ATOM 5060   C CB  . LEU C 3 361 ? -35.651  28.499  23.720  1.00 0.00 ? 364 LEU M CB  1  
ATOM 5061   C CG  . LEU C 3 361 ? -35.476  28.826  25.169  1.00 0.00 ? 364 LEU M CG  1  
ATOM 5062   C CD1 . LEU C 3 361 ? -36.547  29.744  25.591  1.00 0.00 ? 364 LEU M CD1 1  
ATOM 5063   C CD2 . LEU C 3 361 ? -35.650  27.591  25.967  1.00 0.00 ? 364 LEU M CD2 1  
ATOM 5064   N N   . LYS C 3 362 ? -33.170  30.004  21.902  1.00 0.00 ? 365 LYS M N   1  
ATOM 5065   C CA  . LYS C 3 362 ? -32.024  29.877  21.021  1.00 0.00 ? 365 LYS M CA  1  
ATOM 5066   C C   . LYS C 3 362 ? -30.780  29.451  21.745  1.00 0.00 ? 365 LYS M C   1  
ATOM 5067   O O   . LYS C 3 362 ? -30.572  29.807  22.898  1.00 0.00 ? 365 LYS M O   1  
ATOM 5068   C CB  . LYS C 3 362 ? -31.726  31.227  20.450  1.00 0.00 ? 365 LYS M CB  1  
ATOM 5069   C CG  . LYS C 3 362 ? -31.723  31.236  18.938  1.00 0.00 ? 365 LYS M CG  1  
ATOM 5070   C CD  . LYS C 3 362 ? -33.129  31.224  18.366  1.00 0.00 ? 365 LYS M CD  1  
ATOM 5071   C CE  . LYS C 3 362 ? -33.552  29.830  17.885  1.00 0.00 ? 365 LYS M CE  1  
ATOM 5072   N NZ  . LYS C 3 362 ? -34.589  29.791  16.851  1.00 0.00 ? 365 LYS M NZ  1  
ATOM 5073   N N   . PHE C 3 363 ? -29.955  28.751  21.001  1.00 0.00 ? 366 PHE M N   1  
ATOM 5074   C CA  . PHE C 3 363 ? -28.701  28.230  21.519  1.00 0.00 ? 366 PHE M CA  1  
ATOM 5075   C C   . PHE C 3 363 ? -27.570  28.375  20.540  1.00 0.00 ? 366 PHE M C   1  
ATOM 5076   O O   . PHE C 3 363 ? -27.789  28.571  19.318  1.00 0.00 ? 366 PHE M O   1  
ATOM 5077   C CB  . PHE C 3 363 ? -28.862  26.739  21.832  1.00 0.00 ? 366 PHE M CB  1  
ATOM 5078   C CG  . PHE C 3 363 ? -29.863  26.506  22.921  1.00 0.00 ? 366 PHE M CG  1  
ATOM 5079   C CD1 . PHE C 3 363 ? -29.486  26.492  24.263  1.00 0.00 ? 366 PHE M CD1 1  
ATOM 5080   C CD2 . PHE C 3 363 ? -31.211  26.332  22.591  1.00 0.00 ? 366 PHE M CD2 1  
ATOM 5081   C CE1 . PHE C 3 363 ? -30.415  26.346  25.293  1.00 0.00 ? 366 PHE M CE1 1  
ATOM 5082   C CE2 . PHE C 3 363 ? -32.152  26.156  23.608  1.00 0.00 ? 366 PHE M CE2 1  
ATOM 5083   C CZ  . PHE C 3 363 ? -31.768  26.162  24.957  1.00 0.00 ? 366 PHE M CZ  1  
ATOM 5084   N N   . LYS C 3 364 ? -26.359  28.244  21.101  1.00 0.00 ? 367 LYS M N   1  
ATOM 5085   C CA  . LYS C 3 364 ? -25.081  28.300  20.378  1.00 0.00 ? 367 LYS M CA  1  
ATOM 5086   C C   . LYS C 3 364 ? -24.014  27.338  20.899  1.00 0.00 ? 367 LYS M C   1  
ATOM 5087   O O   . LYS C 3 364 ? -23.956  26.935  22.045  1.00 0.00 ? 367 LYS M O   1  
ATOM 5088   C CB  . LYS C 3 364 ? -24.505  29.689  20.224  1.00 0.00 ? 367 LYS M CB  1  
ATOM 5089   C CG  . LYS C 3 364 ? -23.922  30.290  21.485  1.00 0.00 ? 367 LYS M CG  1  
ATOM 5090   C CD  . LYS C 3 364 ? -23.682  31.801  21.362  1.00 0.00 ? 367 LYS M CD  1  
ATOM 5091   C CE  . LYS C 3 364 ? -23.242  32.440  22.673  1.00 0.00 ? 367 LYS M CE  1  
ATOM 5092   N NZ  . LYS C 3 364 ? -23.003  33.885  22.537  1.00 0.00 ? 367 LYS M NZ  1  
ATOM 5093   N N   . GLN C 3 365 ? -23.185  26.943  19.987  1.00 0.00 ? 368 GLN M N   1  
ATOM 5094   C CA  . GLN C 3 365 ? -22.070  26.028  20.216  1.00 0.00 ? 368 GLN M CA  1  
ATOM 5095   C C   . GLN C 3 365 ? -21.032  26.640  21.108  1.00 0.00 ? 368 GLN M C   1  
ATOM 5096   O O   . GLN C 3 365 ? -20.533  27.757  20.910  1.00 0.00 ? 368 GLN M O   1  
ATOM 5097   C CB  . GLN C 3 365 ? -21.275  25.824  18.913  1.00 0.00 ? 368 GLN M CB  1  
ATOM 5098   C CG  . GLN C 3 365 ? -21.575  24.486  18.218  1.00 0.00 ? 368 GLN M CG  1  
ATOM 5099   C CD  . GLN C 3 365 ? -20.337  24.108  17.441  1.00 0.00 ? 368 GLN M CD  1  
ATOM 5100   O OE1 . GLN C 3 365 ? -20.158  24.538  16.324  1.00 0.00 ? 368 GLN M OE1 1  
ATOM 5101   N NE2 . GLN C 3 365 ? -19.434  23.387  18.076  1.00 0.00 ? 368 GLN M NE2 1  
ATOM 5102   N N   . LYS C 3 366 ? -20.675  25.895  22.094  1.00 0.00 ? 369 LYS M N   1  
ATOM 5103   C CA  . LYS C 3 366 ? -19.645  26.353  22.985  1.00 0.00 ? 369 LYS M CA  1  
ATOM 5104   C C   . LYS C 3 366 ? -18.387  26.287  22.135  1.00 0.00 ? 369 LYS M C   1  
ATOM 5105   O O   . LYS C 3 366 ? -18.278  25.426  21.256  1.00 0.00 ? 369 LYS M O   1  
ATOM 5106   C CB  . LYS C 3 366 ? -19.597  25.374  24.153  1.00 0.00 ? 369 LYS M CB  1  
ATOM 5107   C CG  . LYS C 3 366 ? -18.797  25.837  25.351  1.00 0.00 ? 369 LYS M CG  1  
ATOM 5108   C CD  . LYS C 3 366 ? -18.801  24.818  26.484  1.00 0.00 ? 369 LYS M CD  1  
ATOM 5109   C CE  . LYS C 3 366 ? -17.446  24.125  26.716  1.00 0.00 ? 369 LYS M CE  1  
ATOM 5110   N NZ  . LYS C 3 366 ? -17.421  23.364  27.981  1.00 0.00 ? 369 LYS M NZ  1  
ATOM 5111   N N   . GLN C 3 367 ? -17.466  27.223  22.349  1.00 0.00 ? 370 GLN M N   1  
ATOM 5112   C CA  . GLN C 3 367 ? -16.217  27.264  21.580  1.00 0.00 ? 370 GLN M CA  1  
ATOM 5113   C C   . GLN C 3 367 ? -15.309  26.063  21.784  1.00 0.00 ? 370 GLN M C   1  
ATOM 5114   O O   . GLN C 3 367 ? -15.028  25.683  22.913  1.00 0.00 ? 370 GLN M O   1  
ATOM 5115   C CB  . GLN C 3 367 ? -15.375  28.502  21.952  1.00 0.00 ? 370 GLN M CB  1  
ATOM 5116   C CG  . GLN C 3 367 ? -15.816  29.762  21.210  1.00 0.00 ? 370 GLN M CG  1  
ATOM 5117   C CD  . GLN C 3 367 ? -15.000  30.956  21.658  1.00 0.00 ? 370 GLN M CD  1  
ATOM 5118   O OE1 . GLN C 3 367 ? -13.772  31.032  21.441  1.00 0.00 ? 370 GLN M OE1 1  
ATOM 5119   N NE2 . GLN C 3 367 ? -15.640  31.895  22.327  1.00 0.00 ? 370 GLN M NE2 1  
ATOM 5120   N N   . ARG C 3 368 ? -14.828  25.521  20.657  1.00 0.00 ? 371 ARG M N   1  
ATOM 5121   C CA  . ARG C 3 368 ? -13.911  24.395  20.665  1.00 0.00 ? 371 ARG M CA  1  
ATOM 5122   C C   . ARG C 3 368 ? -14.551  23.138  21.186  1.00 0.00 ? 371 ARG M C   1  
ATOM 5123   O O   . ARG C 3 368 ? -13.909  22.100  21.338  1.00 0.00 ? 371 ARG M O   1  
ATOM 5124   C CB  . ARG C 3 368 ? -12.687  24.698  21.512  1.00 0.00 ? 371 ARG M CB  1  
ATOM 5125   C CG  . ARG C 3 368 ? -12.183  26.118  21.384  1.00 0.00 ? 371 ARG M CG  1  
ATOM 5126   C CD  . ARG C 3 368 ? -10.766  26.205  21.905  1.00 0.00 ? 371 ARG M CD  1  
ATOM 5127   N NE  . ARG C 3 368 ? -10.271  27.562  22.054  1.00 0.00 ? 371 ARG M NE  1  
ATOM 5128   C CZ  . ARG C 3 368 ? -9.040   27.777  22.532  1.00 0.00 ? 371 ARG M CZ  1  
ATOM 5129   N NH1 . ARG C 3 368 ? -8.259   26.792  22.948  1.00 0.00 ? 371 ARG M NH1 1  
ATOM 5130   N NH2 . ARG C 3 368 ? -8.583   29.028  22.654  1.00 0.00 ? 371 ARG M NH2 1  
ATOM 5131   N N   . GLU C 3 369 ? -15.810  23.271  21.448  1.00 0.00 ? 372 GLU M N   1  
ATOM 5132   C CA  . GLU C 3 369 ? -16.597  22.178  21.947  1.00 0.00 ? 372 GLU M CA  1  
ATOM 5133   C C   . GLU C 3 369 ? -17.787  22.077  21.022  1.00 0.00 ? 372 GLU M C   1  
ATOM 5134   O O   . GLU C 3 369 ? -18.122  23.032  20.310  1.00 0.00 ? 372 GLU M O   1  
ATOM 5135   C CB  . GLU C 3 369 ? -17.046  22.412  23.412  1.00 0.00 ? 372 GLU M CB  1  
ATOM 5136   C CG  . GLU C 3 369 ? -16.222  21.642  24.443  1.00 0.00 ? 372 GLU M CG  1  
ATOM 5137   C CD  . GLU C 3 369 ? -17.055  20.707  25.275  1.00 0.00 ? 372 GLU M CD  1  
ATOM 5138   O OE1 . GLU C 3 369 ? -17.326  19.559  24.948  1.00 0.00 ? 372 GLU M OE1 1  
ATOM 5139   O OE2 . GLU C 3 369 ? -17.443  21.281  26.377  1.00 0.00 ? 372 GLU M OE2 1  
ATOM 5140   N N   . GLU C 3 370 ? -18.383  20.916  21.038  1.00 0.00 ? 373 GLU M N   1  
ATOM 5141   C CA  . GLU C 3 370 ? -19.534  20.634  20.223  1.00 0.00 ? 373 GLU M CA  1  
ATOM 5142   C C   . GLU C 3 370 ? -20.769  20.703  21.109  1.00 0.00 ? 373 GLU M C   1  
ATOM 5143   O O   . GLU C 3 370 ? -21.815  20.162  20.802  1.00 0.00 ? 373 GLU M O   1  
ATOM 5144   C CB  . GLU C 3 370 ? -19.435  19.206  19.670  1.00 0.00 ? 373 GLU M CB  1  
ATOM 5145   C CG  . GLU C 3 370 ? -19.550  19.137  18.148  1.00 0.00 ? 373 GLU M CG  1  
ATOM 5146   C CD  . GLU C 3 370 ? -19.142  17.794  17.652  1.00 0.00 ? 373 GLU M CD  1  
ATOM 5147   O OE1 . GLU C 3 370 ? -19.663  16.824  18.366  1.00 0.00 ? 373 GLU M OE1 1  
ATOM 5148   O OE2 . GLU C 3 370 ? -18.283  17.647  16.773  1.00 0.00 ? 373 GLU M OE2 1  
ATOM 5149   N N   . GLN C 3 371 ? -20.608  21.371  22.243  1.00 0.00 ? 374 GLN M N   1  
ATOM 5150   C CA  . GLN C 3 371 ? -21.696  21.475  23.141  1.00 0.00 ? 374 GLN M CA  1  
ATOM 5151   C C   . GLN C 3 371 ? -22.521  22.666  22.892  1.00 0.00 ? 374 GLN M C   1  
ATOM 5152   O O   . GLN C 3 371 ? -22.072  23.669  22.311  1.00 0.00 ? 374 GLN M O   1  
ATOM 5153   C CB  . GLN C 3 371 ? -21.310  21.310  24.613  1.00 0.00 ? 374 GLN M CB  1  
ATOM 5154   C CG  . GLN C 3 371 ? -22.488  21.490  25.624  1.00 0.00 ? 374 GLN M CG  1  
ATOM 5155   C CD  . GLN C 3 371 ? -22.909  20.198  26.247  1.00 0.00 ? 374 GLN M CD  1  
ATOM 5156   O OE1 . GLN C 3 371 ? -22.164  19.218  26.129  1.00 0.00 ? 374 GLN M OE1 1  
ATOM 5157   N NE2 . GLN C 3 371 ? -24.093  20.226  26.877  1.00 0.00 ? 374 GLN M NE2 1  
ATOM 5158   N N   . ALA C 3 372 ? -23.739  22.531  23.384  1.00 0.00 ? 375 ALA M N   1  
ATOM 5159   C CA  . ALA C 3 372 ? -24.710  23.564  23.315  1.00 0.00 ? 375 ALA M CA  1  
ATOM 5160   C C   . ALA C 3 372 ? -24.630  24.379  24.563  1.00 0.00 ? 375 ALA M C   1  
ATOM 5161   O O   . ALA C 3 372 ? -24.506  23.830  25.676  1.00 0.00 ? 375 ALA M O   1  
ATOM 5162   C CB  . ALA C 3 372 ? -26.104  22.965  23.108  1.00 0.00 ? 375 ALA M CB  1  
ATOM 5163   N N   . GLU C 3 373 ? -24.642  25.662  24.336  1.00 0.00 ? 376 GLU M N   1  
ATOM 5164   C CA  . GLU C 3 373 ? -24.630  26.629  25.375  1.00 0.00 ? 376 GLU M CA  1  
ATOM 5165   C C   . GLU C 3 373 ? -25.705  27.665  25.015  1.00 0.00 ? 376 GLU M C   1  
ATOM 5166   O O   . GLU C 3 373 ? -25.975  27.964  23.861  1.00 0.00 ? 376 GLU M O   1  
ATOM 5167   C CB  . GLU C 3 373 ? -23.214  27.169  25.709  1.00 0.00 ? 376 GLU M CB  1  
ATOM 5168   C CG  . GLU C 3 373 ? -22.795  28.472  24.959  1.00 0.00 ? 376 GLU M CG  1  
ATOM 5169   C CD  . GLU C 3 373 ? -21.830  29.317  25.741  1.00 0.00 ? 376 GLU M CD  1  
ATOM 5170   O OE1 . GLU C 3 373 ? -22.024  29.278  27.056  1.00 0.00 ? 376 GLU M OE1 1  
ATOM 5171   O OE2 . GLU C 3 373 ? -20.982  29.989  25.186  1.00 0.00 ? 376 GLU M OE2 1  
ATOM 5172   N N   . PRO C 3 374 ? -26.447  28.114  26.024  1.00 0.00 ? 377 PRO M N   1  
ATOM 5173   C CA  . PRO C 3 374 ? -27.495  29.073  25.844  1.00 0.00 ? 377 PRO M CA  1  
ATOM 5174   C C   . PRO C 3 374 ? -27.042  30.319  25.119  1.00 0.00 ? 377 PRO M C   1  
ATOM 5175   O O   . PRO C 3 374 ? -25.989  30.856  25.397  1.00 0.00 ? 377 PRO M O   1  
ATOM 5176   C CB  . PRO C 3 374 ? -27.961  29.481  27.200  1.00 0.00 ? 377 PRO M CB  1  
ATOM 5177   C CG  . PRO C 3 374 ? -27.180  28.624  28.164  1.00 0.00 ? 377 PRO M CG  1  
ATOM 5178   C CD  . PRO C 3 374 ? -26.131  27.859  27.441  1.00 0.00 ? 377 PRO M CD  1  
ATOM 5179   N N   . ASP C 3 375 ? -27.863  30.779  24.194  1.00 0.00 ? 378 ASP M N   1  
ATOM 5180   C CA  . ASP C 3 375 ? -27.551  31.961  23.444  1.00 0.00 ? 378 ASP M CA  1  
ATOM 5181   C C   . ASP C 3 375 ? -28.248  33.167  24.046  1.00 0.00 ? 378 ASP M C   1  
ATOM 5182   O O   . ASP C 3 375 ? -28.645  34.048  23.327  1.00 0.00 ? 378 ASP M O   1  
ATOM 5183   C CB  . ASP C 3 375 ? -27.934  31.772  21.986  1.00 0.00 ? 378 ASP M CB  1  
ATOM 5184   C CG  . ASP C 3 375 ? -27.242  32.744  21.040  1.00 0.00 ? 378 ASP M CG  1  
ATOM 5185   O OD1 . ASP C 3 375 ? -26.603  33.678  21.659  1.00 0.00 ? 378 ASP M OD1 1  
ATOM 5186   O OD2 . ASP C 3 375 ? -27.250  32.698  19.807  1.00 0.00 ? 378 ASP M OD2 1  
ATOM 5187   N N   . GLY C 3 376 ? -28.482  33.170  25.356  1.00 0.00 ? 379 GLY M N   1  
ATOM 5188   C CA  . GLY C 3 376 ? -29.143  34.306  25.982  1.00 0.00 ? 379 GLY M CA  1  
ATOM 5189   C C   . GLY C 3 376 ? -30.172  33.871  26.996  1.00 0.00 ? 379 GLY M C   1  
ATOM 5190   O O   . GLY C 3 376 ? -30.730  32.795  26.876  1.00 0.00 ? 379 GLY M O   1  
ATOM 5191   N N   . THR C 3 377 ? -30.410  34.757  27.967  1.00 0.00 ? 380 THR M N   1  
ATOM 5192   C CA  . THR C 3 377 ? -31.423  34.522  28.989  1.00 0.00 ? 380 THR M CA  1  
ATOM 5193   C C   . THR C 3 377 ? -32.407  35.665  28.976  1.00 0.00 ? 380 THR M C   1  
ATOM 5194   O O   . THR C 3 377 ? -32.580  36.389  29.940  1.00 0.00 ? 380 THR M O   1  
ATOM 5195   C CB  . THR C 3 377 ? -30.851  34.343  30.375  1.00 0.00 ? 380 THR M CB  1  
ATOM 5196   O OG1 . THR C 3 377 ? -29.968  35.429  30.603  1.00 0.00 ? 380 THR M OG1 1  
ATOM 5197   C CG2 . THR C 3 377 ? -30.244  32.985  30.459  1.00 0.00 ? 380 THR M CG2 1  
ATOM 5198   N N   . GLU C 3 378 ? -33.040  35.782  27.850  1.00 0.00 ? 381 GLU M N   1  
ATOM 5199   C CA  . GLU C 3 378 ? -34.025  36.794  27.574  1.00 0.00 ? 381 GLU M CA  1  
ATOM 5200   C C   . GLU C 3 378 ? -35.375  36.112  27.608  1.00 0.00 ? 381 GLU M C   1  
ATOM 5201   O O   . GLU C 3 378 ? -36.233  36.464  28.366  1.00 0.00 ? 381 GLU M O   1  
ATOM 5202   C CB  . GLU C 3 378 ? -33.736  37.346  26.150  1.00 0.00 ? 381 GLU M CB  1  
ATOM 5203   C CG  . GLU C 3 378 ? -33.951  38.865  25.988  1.00 0.00 ? 381 GLU M CG  1  
ATOM 5204   C CD  . GLU C 3 378 ? -34.610  39.234  24.663  1.00 0.00 ? 381 GLU M CD  1  
ATOM 5205   O OE1 . GLU C 3 378 ? -34.180  38.495  23.631  1.00 0.00 ? 381 GLU M OE1 1  
ATOM 5206   O OE2 . GLU C 3 378 ? -35.461  40.111  24.545  1.00 0.00 ? 381 GLU M OE2 1  
ATOM 5207   N N   . VAL C 3 379 ? -35.432  35.041  26.810  1.00 0.00 ? 382 VAL M N   1  
ATOM 5208   C CA  . VAL C 3 379 ? -36.587  34.259  26.608  1.00 0.00 ? 382 VAL M CA  1  
ATOM 5209   C C   . VAL C 3 379 ? -36.745  33.207  27.632  1.00 0.00 ? 382 VAL M C   1  
ATOM 5210   O O   . VAL C 3 379 ? -37.852  32.881  28.040  1.00 0.00 ? 382 VAL M O   1  
ATOM 5211   C CB  . VAL C 3 379 ? -36.593  33.718  25.208  1.00 0.00 ? 382 VAL M CB  1  
ATOM 5212   C CG1 . VAL C 3 379 ? -37.918  33.032  24.923  1.00 0.00 ? 382 VAL M CG1 1  
ATOM 5213   C CG2 . VAL C 3 379 ? -36.432  34.856  24.203  1.00 0.00 ? 382 VAL M CG2 1  
ATOM 5214   N N   . ALA C 3 380 ? -35.655  32.679  28.033  1.00 0.00 ? 383 ALA M N   1  
ATOM 5215   C CA  . ALA C 3 380 ? -35.717  31.612  28.982  1.00 0.00 ? 383 ALA M CA  1  
ATOM 5216   C C   . ALA C 3 380 ? -36.380  32.128  30.197  1.00 0.00 ? 383 ALA M C   1  
ATOM 5217   O O   . ALA C 3 380 ? -37.234  31.516  30.800  1.00 0.00 ? 383 ALA M O   1  
ATOM 5218   C CB  . ALA C 3 380 ? -34.336  31.158  29.272  1.00 0.00 ? 383 ALA M CB  1  
ATOM 5219   N N   . ASP C 3 381 ? -36.062  33.362  30.449  1.00 0.00 ? 384 ASP M N   1  
ATOM 5220   C CA  . ASP C 3 381 ? -36.495  34.083  31.637  1.00 0.00 ? 384 ASP M CA  1  
ATOM 5221   C C   . ASP C 3 381 ? -37.984  34.094  31.703  1.00 0.00 ? 384 ASP M C   1  
ATOM 5222   O O   . ASP C 3 381 ? -38.593  33.878  32.761  1.00 0.00 ? 384 ASP M O   1  
ATOM 5223   C CB  . ASP C 3 381 ? -35.961  35.525  31.584  1.00 0.00 ? 384 ASP M CB  1  
ATOM 5224   C CG  . ASP C 3 381 ? -34.563  35.682  32.060  1.00 0.00 ? 384 ASP M CG  1  
ATOM 5225   O OD1 . ASP C 3 381 ? -34.091  34.614  32.655  1.00 0.00 ? 384 ASP M OD1 1  
ATOM 5226   O OD2 . ASP C 3 381 ? -33.964  36.694  31.936  1.00 0.00 ? 384 ASP M OD2 1  
ATOM 5227   N N   . LYS C 3 382 ? -38.555  34.384  30.541  1.00 0.00 ? 385 LYS M N   1  
ATOM 5228   C CA  . LYS C 3 382 ? -40.004  34.464  30.401  1.00 0.00 ? 385 LYS M CA  1  
ATOM 5229   C C   . LYS C 3 382 ? -40.620  33.106  30.489  1.00 0.00 ? 385 LYS M C   1  
ATOM 5230   O O   . LYS C 3 382 ? -41.611  32.862  31.187  1.00 0.00 ? 385 LYS M O   1  
ATOM 5231   C CB  . LYS C 3 382 ? -40.334  35.174  29.120  1.00 0.00 ? 385 LYS M CB  1  
ATOM 5232   C CG  . LYS C 3 382 ? -39.501  36.446  28.948  1.00 0.00 ? 385 LYS M CG  1  
ATOM 5233   C CD  . LYS C 3 382 ? -39.623  37.127  27.587  1.00 0.00 ? 385 LYS M CD  1  
ATOM 5234   C CE  . LYS C 3 382 ? -39.194  38.595  27.626  1.00 0.00 ? 385 LYS M CE  1  
ATOM 5235   N NZ  . LYS C 3 382 ? -38.936  39.222  26.309  1.00 0.00 ? 385 LYS M NZ  1  
ATOM 5236   N N   . ALA C 3 383 ? -40.032  32.176  29.770  1.00 0.00 ? 386 ALA M N   1  
ATOM 5237   C CA  . ALA C 3 383 ? -40.575  30.851  29.781  1.00 0.00 ? 386 ALA M CA  1  
ATOM 5238   C C   . ALA C 3 383 ? -40.502  30.361  31.189  1.00 0.00 ? 386 ALA M C   1  
ATOM 5239   O O   . ALA C 3 383 ? -41.451  29.872  31.747  1.00 0.00 ? 386 ALA M O   1  
ATOM 5240   C CB  . ALA C 3 383 ? -39.833  29.992  28.790  1.00 0.00 ? 386 ALA M CB  1  
ATOM 5241   N N   . ALA C 3 384 ? -39.410  30.602  31.826  1.00 0.00 ? 387 ALA M N   1  
ATOM 5242   C CA  . ALA C 3 384 ? -39.192  30.155  33.181  1.00 0.00 ? 387 ALA M CA  1  
ATOM 5243   C C   . ALA C 3 384 ? -40.204  30.693  34.165  1.00 0.00 ? 387 ALA M C   1  
ATOM 5244   O O   . ALA C 3 384 ? -40.721  30.015  34.996  1.00 0.00 ? 387 ALA M O   1  
ATOM 5245   C CB  . ALA C 3 384 ? -37.788  30.476  33.650  1.00 0.00 ? 387 ALA M CB  1  
ATOM 5246   N N   . TYR C 3 385 ? -40.470  31.958  34.075  1.00 0.00 ? 388 TYR M N   1  
ATOM 5247   C CA  . TYR C 3 385 ? -41.369  32.638  34.962  1.00 0.00 ? 388 TYR M CA  1  
ATOM 5248   C C   . TYR C 3 385 ? -42.816  32.212  34.760  1.00 0.00 ? 388 TYR M C   1  
ATOM 5249   O O   . TYR C 3 385 ? -43.596  31.968  35.699  1.00 0.00 ? 388 TYR M O   1  
ATOM 5250   C CB  . TYR C 3 385 ? -41.221  34.158  34.727  1.00 0.00 ? 388 TYR M CB  1  
ATOM 5251   C CG  . TYR C 3 385 ? -42.385  34.989  35.225  1.00 0.00 ? 388 TYR M CG  1  
ATOM 5252   C CD1 . TYR C 3 385 ? -42.560  35.270  36.575  1.00 0.00 ? 388 TYR M CD1 1  
ATOM 5253   C CD2 . TYR C 3 385 ? -43.283  35.545  34.318  1.00 0.00 ? 388 TYR M CD2 1  
ATOM 5254   C CE1 . TYR C 3 385 ? -43.624  36.069  37.020  1.00 0.00 ? 388 TYR M CE1 1  
ATOM 5255   C CE2 . TYR C 3 385 ? -44.350  36.325  34.748  1.00 0.00 ? 388 TYR M CE2 1  
ATOM 5256   C CZ  . TYR C 3 385 ? -44.528  36.592  36.114  1.00 0.00 ? 388 TYR M CZ  1  
ATOM 5257   O OH  . TYR C 3 385 ? -45.596  37.389  36.500  1.00 0.00 ? 388 TYR M OH  1  
ATOM 5258   N N   . LEU C 3 386 ? -43.177  32.124  33.513  1.00 0.00 ? 389 LEU M N   1  
ATOM 5259   C CA  . LEU C 3 386 ? -44.498  31.769  33.090  1.00 0.00 ? 389 LEU M CA  1  
ATOM 5260   C C   . LEU C 3 386 ? -44.860  30.398  33.511  1.00 0.00 ? 389 LEU M C   1  
ATOM 5261   O O   . LEU C 3 386 ? -46.034  30.126  33.668  1.00 0.00 ? 389 LEU M O   1  
ATOM 5262   C CB  . LEU C 3 386 ? -44.606  31.860  31.574  1.00 0.00 ? 389 LEU M CB  1  
ATOM 5263   C CG  . LEU C 3 386 ? -45.444  32.964  31.027  1.00 0.00 ? 389 LEU M CG  1  
ATOM 5264   C CD1 . LEU C 3 386 ? -45.631  34.190  31.882  1.00 0.00 ? 389 LEU M CD1 1  
ATOM 5265   C CD2 . LEU C 3 386 ? -44.825  33.435  29.754  1.00 0.00 ? 389 LEU M CD2 1  
ATOM 5266   N N   . MET C 3 387 ? -43.845  29.534  33.665  1.00 0.00 ? 390 MET M N   1  
ATOM 5267   C CA  . MET C 3 387 ? -44.084  28.157  34.081  1.00 0.00 ? 390 MET M CA  1  
ATOM 5268   C C   . MET C 3 387 ? -43.836  27.951  35.580  1.00 0.00 ? 390 MET M C   1  
ATOM 5269   O O   . MET C 3 387 ? -44.042  26.876  36.106  1.00 0.00 ? 390 MET M O   1  
ATOM 5270   C CB  . MET C 3 387 ? -43.204  27.190  33.299  1.00 0.00 ? 390 MET M CB  1  
ATOM 5271   C CG  . MET C 3 387 ? -43.588  27.079  31.843  1.00 0.00 ? 390 MET M CG  1  
ATOM 5272   S SD  . MET C 3 387 ? -42.562  25.936  30.862  1.00 0.00 ? 390 MET M SD  1  
ATOM 5273   C CE  . MET C 3 387 ? -43.871  24.953  30.161  1.00 0.00 ? 390 MET M CE  1  
ATOM 5274   N N   . GLY C 3 388 ? -43.326  28.959  36.262  1.00 0.00 ? 391 GLY M N   1  
ATOM 5275   C CA  . GLY C 3 388 ? -43.027  28.843  37.676  1.00 0.00 ? 391 GLY M CA  1  
ATOM 5276   C C   . GLY C 3 388 ? -41.745  28.058  37.885  1.00 0.00 ? 391 GLY M C   1  
ATOM 5277   O O   . GLY C 3 388 ? -41.656  27.229  38.793  1.00 0.00 ? 391 GLY M O   1  
ATOM 5278   N N   . LEU C 3 389 ? -40.769  28.367  37.033  1.00 0.00 ? 392 LEU M N   1  
ATOM 5279   C CA  . LEU C 3 389 ? -39.466  27.748  36.971  1.00 0.00 ? 392 LEU M CA  1  
ATOM 5280   C C   . LEU C 3 389 ? -38.334  28.766  37.253  1.00 0.00 ? 392 LEU M C   1  
ATOM 5281   O O   . LEU C 3 389 ? -38.548  29.975  37.399  1.00 0.00 ? 392 LEU M O   1  
ATOM 5282   C CB  . LEU C 3 389 ? -39.226  27.302  35.513  1.00 0.00 ? 392 LEU M CB  1  
ATOM 5283   C CG  . LEU C 3 389 ? -39.225  25.813  35.255  1.00 0.00 ? 392 LEU M CG  1  
ATOM 5284   C CD1 . LEU C 3 389 ? -40.230  25.106  36.105  1.00 0.00 ? 392 LEU M CD1 1  
ATOM 5285   C CD2 . LEU C 3 389 ? -39.525  25.522  33.825  1.00 0.00 ? 392 LEU M CD2 1  
ATOM 5286   N N   . ASN C 3 390 ? -37.114  28.262  37.234  1.00 0.00 ? 393 ASN M N   1  
ATOM 5287   C CA  . ASN C 3 390 ? -35.938  29.025  37.414  1.00 0.00 ? 393 ASN M CA  1  
ATOM 5288   C C   . ASN C 3 390 ? -35.109  28.964  36.122  1.00 0.00 ? 393 ASN M C   1  
ATOM 5289   O O   . ASN C 3 390 ? -34.719  27.899  35.618  1.00 0.00 ? 393 ASN M O   1  
ATOM 5290   C CB  . ASN C 3 390 ? -35.152  28.435  38.606  1.00 0.00 ? 393 ASN M CB  1  
ATOM 5291   C CG  . ASN C 3 390 ? -33.890  29.193  38.899  1.00 0.00 ? 393 ASN M CG  1  
ATOM 5292   O OD1 . ASN C 3 390 ? -33.085  29.459  38.005  1.00 0.00 ? 393 ASN M OD1 1  
ATOM 5293   N ND2 . ASN C 3 390 ? -33.758  29.588  40.166  1.00 0.00 ? 393 ASN M ND2 1  
ATOM 5294   N N   . SER C 3 391 ? -34.884  30.117  35.541  1.00 0.00 ? 394 SER M N   1  
ATOM 5295   C CA  . SER C 3 391 ? -34.169  30.286  34.277  1.00 0.00 ? 394 SER M CA  1  
ATOM 5296   C C   . SER C 3 391 ? -32.973  29.393  34.137  1.00 0.00 ? 394 SER M C   1  
ATOM 5297   O O   . SER C 3 391 ? -32.805  28.679  33.147  1.00 0.00 ? 394 SER M O   1  
ATOM 5298   C CB  . SER C 3 391 ? -33.659  31.712  34.078  1.00 0.00 ? 394 SER M CB  1  
ATOM 5299   O OG  . SER C 3 391 ? -34.473  32.427  33.207  1.00 0.00 ? 394 SER M OG  1  
ATOM 5300   N N   . ALA C 3 392 ? -32.136  29.421  35.145  1.00 0.00 ? 395 ALA M N   1  
ATOM 5301   C CA  . ALA C 3 392 ? -30.870  28.709  35.130  1.00 0.00 ? 395 ALA M CA  1  
ATOM 5302   C C   . ALA C 3 392 ? -31.022  27.240  35.084  1.00 0.00 ? 395 ALA M C   1  
ATOM 5303   O O   . ALA C 3 392 ? -30.507  26.579  34.192  1.00 0.00 ? 395 ALA M O   1  
ATOM 5304   C CB  . ALA C 3 392 ? -30.058  29.079  36.364  1.00 0.00 ? 395 ALA M CB  1  
ATOM 5305   N N   . GLU C 3 393 ? -31.625  26.772  36.159  1.00 0.00 ? 396 GLU M N   1  
ATOM 5306   C CA  . GLU C 3 393 ? -31.832  25.400  36.429  1.00 0.00 ? 396 GLU M CA  1  
ATOM 5307   C C   . GLU C 3 393 ? -32.360  24.789  35.198  1.00 0.00 ? 396 GLU M C   1  
ATOM 5308   O O   . GLU C 3 393 ? -31.897  23.700  34.781  1.00 0.00 ? 396 GLU M O   1  
ATOM 5309   C CB  . GLU C 3 393 ? -32.824  25.284  37.601  1.00 0.00 ? 396 GLU M CB  1  
ATOM 5310   C CG  . GLU C 3 393 ? -32.156  25.433  38.956  1.00 0.00 ? 396 GLU M CG  1  
ATOM 5311   C CD  . GLU C 3 393 ? -33.015  24.952  40.077  1.00 0.00 ? 396 GLU M CD  1  
ATOM 5312   O OE1 . GLU C 3 393 ? -34.239  24.725  39.705  1.00 0.00 ? 396 GLU M OE1 1  
ATOM 5313   O OE2 . GLU C 3 393 ? -32.615  24.809  41.222  1.00 0.00 ? 396 GLU M OE2 1  
ATOM 5314   N N   . LEU C 3 394 ? -33.222  25.581  34.561  1.00 0.00 ? 397 LEU M N   1  
ATOM 5315   C CA  . LEU C 3 394 ? -33.886  25.181  33.320  1.00 0.00 ? 397 LEU M CA  1  
ATOM 5316   C C   . LEU C 3 394 ? -32.883  25.022  32.162  1.00 0.00 ? 397 LEU M C   1  
ATOM 5317   O O   . LEU C 3 394 ? -32.826  24.023  31.432  1.00 0.00 ? 397 LEU M O   1  
ATOM 5318   C CB  . LEU C 3 394 ? -35.018  26.134  32.920  1.00 0.00 ? 397 LEU M CB  1  
ATOM 5319   C CG  . LEU C 3 394 ? -35.483  25.875  31.507  1.00 0.00 ? 397 LEU M CG  1  
ATOM 5320   C CD1 . LEU C 3 394 ? -36.242  24.550  31.419  1.00 0.00 ? 397 LEU M CD1 1  
ATOM 5321   C CD2 . LEU C 3 394 ? -36.364  26.977  31.070  1.00 0.00 ? 397 LEU M CD2 1  
ATOM 5322   N N   . LEU C 3 395 ? -32.075  26.041  31.936  1.00 0.00 ? 398 LEU M N   1  
ATOM 5323   C CA  . LEU C 3 395 ? -31.138  26.009  30.844  1.00 0.00 ? 398 LEU M CA  1  
ATOM 5324   C C   . LEU C 3 395 ? -30.056  24.978  30.982  1.00 0.00 ? 398 LEU M C   1  
ATOM 5325   O O   . LEU C 3 395 ? -29.347  24.555  30.047  1.00 0.00 ? 398 LEU M O   1  
ATOM 5326   C CB  . LEU C 3 395 ? -30.537  27.371  30.694  1.00 0.00 ? 398 LEU M CB  1  
ATOM 5327   C CG  . LEU C 3 395 ? -31.268  28.247  29.670  1.00 0.00 ? 398 LEU M CG  1  
ATOM 5328   C CD1 . LEU C 3 395 ? -32.714  27.976  29.836  1.00 0.00 ? 398 LEU M CD1 1  
ATOM 5329   C CD2 . LEU C 3 395 ? -30.914  29.712  29.930  1.00 0.00 ? 398 LEU M CD2 1  
ATOM 5330   N N   . LYS C 3 396 ? -29.821  24.567  32.228  1.00 0.00 ? 399 LYS M N   1  
ATOM 5331   C CA  . LYS C 3 396 ? -28.815  23.578  32.512  1.00 0.00 ? 399 LYS M CA  1  
ATOM 5332   C C   . LYS C 3 396 ? -29.312  22.226  32.054  1.00 0.00 ? 399 LYS M C   1  
ATOM 5333   O O   . LYS C 3 396 ? -28.747  21.586  31.172  1.00 0.00 ? 399 LYS M O   1  
ATOM 5334   C CB  . LYS C 3 396 ? -28.573  23.498  33.996  1.00 0.00 ? 399 LYS M CB  1  
ATOM 5335   C CG  . LYS C 3 396 ? -27.109  23.753  34.369  1.00 0.00 ? 399 LYS M CG  1  
ATOM 5336   C CD  . LYS C 3 396 ? -26.462  22.614  35.150  1.00 0.00 ? 399 LYS M CD  1  
ATOM 5337   C CE  . LYS C 3 396 ? -24.932  22.620  35.093  1.00 0.00 ? 399 LYS M CE  1  
ATOM 5338   N NZ  . LYS C 3 396 ? -24.300  21.592  35.951  1.00 0.00 ? 399 LYS M NZ  1  
ATOM 5339   N N   . ALA C 3 397 ? -30.385  21.844  32.732  1.00 0.00 ? 400 ALA M N   1  
ATOM 5340   C CA  . ALA C 3 397 ? -31.114  20.614  32.486  1.00 0.00 ? 400 ALA M CA  1  
ATOM 5341   C C   . ALA C 3 397 ? -31.248  20.390  31.004  1.00 0.00 ? 400 ALA M C   1  
ATOM 5342   O O   . ALA C 3 397 ? -31.017  19.313  30.489  1.00 0.00 ? 400 ALA M O   1  
ATOM 5343   C CB  . ALA C 3 397 ? -32.464  20.747  33.119  1.00 0.00 ? 400 ALA M CB  1  
ATOM 5344   N N   . LEU C 3 398 ? -31.582  21.464  30.319  1.00 0.00 ? 401 LEU M N   1  
ATOM 5345   C CA  . LEU C 3 398 ? -31.728  21.435  28.881  1.00 0.00 ? 401 LEU M CA  1  
ATOM 5346   C C   . LEU C 3 398 ? -30.436  21.127  28.151  1.00 0.00 ? 401 LEU M C   1  
ATOM 5347   O O   . LEU C 3 398 ? -30.456  20.309  27.209  1.00 0.00 ? 401 LEU M O   1  
ATOM 5348   C CB  . LEU C 3 398 ? -32.268  22.784  28.406  1.00 0.00 ? 401 LEU M CB  1  
ATOM 5349   C CG  . LEU C 3 398 ? -33.515  22.706  27.518  1.00 0.00 ? 401 LEU M CG  1  
ATOM 5350   C CD1 . LEU C 3 398 ? -34.583  21.692  27.965  1.00 0.00 ? 401 LEU M CD1 1  
ATOM 5351   C CD2 . LEU C 3 398 ? -34.318  23.982  27.661  1.00 0.00 ? 401 LEU M CD2 1  
ATOM 5352   N N   . CYS C 3 399 ? -29.348  21.819  28.573  1.00 0.00 ? 402 CYS M N   1  
ATOM 5353   C CA  . CYS C 3 399 ? -28.027  21.722  27.974  1.00 0.00 ? 402 CYS M CA  1  
ATOM 5354   C C   . CYS C 3 399 ? -27.208  20.533  28.469  1.00 0.00 ? 402 CYS M C   1  
ATOM 5355   O O   . CYS C 3 399 ? -26.532  19.898  27.709  1.00 0.00 ? 402 CYS M O   1  
ATOM 5356   C CB  . CYS C 3 399 ? -27.265  22.974  28.321  1.00 0.00 ? 402 CYS M CB  1  
ATOM 5357   S SG  . CYS C 3 399 ? -27.683  24.293  27.237  1.00 0.00 ? 402 CYS M SG  1  
ATOM 5358   N N   . TYR C 3 400 ? -27.275  20.278  29.767  1.00 0.00 ? 403 TYR M N   1  
ATOM 5359   C CA  . TYR C 3 400 ? -26.555  19.218  30.413  1.00 0.00 ? 403 TYR M CA  1  
ATOM 5360   C C   . TYR C 3 400 ? -27.490  18.272  31.101  1.00 0.00 ? 403 TYR M C   1  
ATOM 5361   O O   . TYR C 3 400 ? -27.483  18.117  32.357  1.00 0.00 ? 403 TYR M O   1  
ATOM 5362   C CB  . TYR C 3 400 ? -25.595  19.781  31.465  1.00 0.00 ? 403 TYR M CB  1  
ATOM 5363   C CG  . TYR C 3 400 ? -24.597  20.645  30.797  1.00 0.00 ? 403 TYR M CG  1  
ATOM 5364   C CD1 . TYR C 3 400 ? -23.628  20.048  29.983  1.00 0.00 ? 403 TYR M CD1 1  
ATOM 5365   C CD2 . TYR C 3 400 ? -24.663  22.037  30.861  1.00 0.00 ? 403 TYR M CD2 1  
ATOM 5366   C CE1 . TYR C 3 400 ? -22.708  20.822  29.276  1.00 0.00 ? 403 TYR M CE1 1  
ATOM 5367   C CE2 . TYR C 3 400 ? -23.733  22.826  30.171  1.00 0.00 ? 403 TYR M CE2 1  
ATOM 5368   C CZ  . TYR C 3 400 ? -22.758  22.213  29.378  1.00 0.00 ? 403 TYR M CZ  1  
ATOM 5369   O OH  . TYR C 3 400 ? -21.840  22.941  28.694  1.00 0.00 ? 403 TYR M OH  1  
ATOM 5370   N N   . PRO C 3 401 ? -28.280  17.652  30.286  1.00 0.00 ? 404 PRO M N   1  
ATOM 5371   C CA  . PRO C 3 401 ? -29.238  16.652  30.714  1.00 0.00 ? 404 PRO M CA  1  
ATOM 5372   C C   . PRO C 3 401 ? -28.582  15.681  31.622  1.00 0.00 ? 404 PRO M C   1  
ATOM 5373   O O   . PRO C 3 401 ? -27.647  15.013  31.222  1.00 0.00 ? 404 PRO M O   1  
ATOM 5374   C CB  . PRO C 3 401 ? -29.616  15.873  29.427  1.00 0.00 ? 404 PRO M CB  1  
ATOM 5375   C CG  . PRO C 3 401 ? -28.723  16.423  28.304  1.00 0.00 ? 404 PRO M CG  1  
ATOM 5376   C CD  . PRO C 3 401 ? -28.065  17.706  28.819  1.00 0.00 ? 404 PRO M CD  1  
ATOM 5377   N N   . ARG C 3 402 ? -29.037  15.605  32.865  1.00 0.00 ? 405 ARG M N   1  
ATOM 5378   C CA  . ARG C 3 402 ? -28.482  14.644  33.828  1.00 0.00 ? 405 ARG M CA  1  
ATOM 5379   C C   . ARG C 3 402 ? -29.344  13.399  33.926  1.00 0.00 ? 405 ARG M C   1  
ATOM 5380   O O   . ARG C 3 402 ? -30.436  13.352  34.508  1.00 0.00 ? 405 ARG M O   1  
ATOM 5381   C CB  . ARG C 3 402 ? -28.003  15.179  35.182  1.00 0.00 ? 405 ARG M CB  1  
ATOM 5382   C CG  . ARG C 3 402 ? -28.982  14.881  36.316  1.00 0.00 ? 405 ARG M CG  1  
ATOM 5383   C CD  . ARG C 3 402 ? -28.534  15.435  37.674  1.00 0.00 ? 405 ARG M CD  1  
ATOM 5384   N NE  . ARG C 3 402 ? -29.644  15.711  38.584  1.00 0.00 ? 405 ARG M NE  1  
ATOM 5385   C CZ  . ARG C 3 402 ? -29.798  16.865  39.264  1.00 0.00 ? 405 ARG M CZ  1  
ATOM 5386   N NH1 . ARG C 3 402 ? -28.893  17.859  39.154  1.00 0.00 ? 405 ARG M NH1 1  
ATOM 5387   N NH2 . ARG C 3 402 ? -30.861  17.021  40.092  1.00 0.00 ? 405 ARG M NH2 1  
ATOM 5388   N N   . VAL C 3 403 ? -28.823  12.410  33.243  1.00 0.00 ? 406 VAL M N   1  
ATOM 5389   C CA  . VAL C 3 403 ? -29.341  11.075  33.028  1.00 0.00 ? 406 VAL M CA  1  
ATOM 5390   C C   . VAL C 3 403 ? -29.011  10.119  34.193  1.00 0.00 ? 406 VAL M C   1  
ATOM 5391   O O   . VAL C 3 403 ? -28.389  10.516  35.156  1.00 0.00 ? 406 VAL M O   1  
ATOM 5392   C CB  . VAL C 3 403 ? -28.650  10.607  31.765  1.00 0.00 ? 406 VAL M CB  1  
ATOM 5393   C CG1 . VAL C 3 403 ? -29.039  9.195   31.348  1.00 0.00 ? 406 VAL M CG1 1  
ATOM 5394   C CG2 . VAL C 3 403 ? -28.958  11.613  30.673  1.00 0.00 ? 406 VAL M CG2 1  
ATOM 5395   N N   . LYS C 3 404 ? -29.454  8.858   34.065  1.00 0.00 ? 407 LYS M N   1  
ATOM 5396   C CA  . LYS C 3 404 ? -29.254  7.799   35.066  1.00 0.00 ? 407 LYS M CA  1  
ATOM 5397   C C   . LYS C 3 404 ? -29.020  6.376   34.502  1.00 0.00 ? 407 LYS M C   1  
ATOM 5398   O O   . LYS C 3 404 ? -29.831  5.498   34.783  1.00 0.00 ? 407 LYS M O   1  
ATOM 5399   N N   . VAL C 3 405 ? -27.891  6.188   33.765  1.00 0.00 ? 408 VAL M N   1  
ATOM 5400   C CA  . VAL C 3 405 ? -27.416  4.932   33.130  1.00 0.00 ? 408 VAL M CA  1  
ATOM 5401   C C   . VAL C 3 405 ? -26.600  4.054   34.086  1.00 0.00 ? 408 VAL M C   1  
ATOM 5402   O O   . VAL C 3 405 ? -25.504  4.371   34.545  1.00 0.00 ? 408 VAL M O   1  
ATOM 5403   C CB  . VAL C 3 405 ? -26.588  5.215   31.875  1.00 0.00 ? 408 VAL M CB  1  
ATOM 5404   C CG1 . VAL C 3 405 ? -25.702  4.003   31.544  1.00 0.00 ? 408 VAL M CG1 1  
ATOM 5405   C CG2 . VAL C 3 405 ? -27.496  5.579   30.703  1.00 0.00 ? 408 VAL M CG2 1  
ATOM 5406   N N   . GLY C 3 406 ? -27.153  2.901   34.390  1.00 0.00 ? 409 GLY M N   1  
ATOM 5407   C CA  . GLY C 3 406 ? -26.554  1.973   35.321  1.00 0.00 ? 409 GLY M CA  1  
ATOM 5408   C C   . GLY C 3 406 ? -27.437  2.025   36.550  1.00 0.00 ? 409 GLY M C   1  
ATOM 5409   O O   . GLY C 3 406 ? -28.651  1.783   36.451  1.00 0.00 ? 409 GLY M O   1  
ATOM 5410   N N   . ASN C 3 407 ? -26.871  2.383   37.695  1.00 0.00 ? 410 ASN M N   1  
ATOM 5411   C CA  . ASN C 3 407 ? -27.652  2.490   38.925  1.00 0.00 ? 410 ASN M CA  1  
ATOM 5412   C C   . ASN C 3 407 ? -27.572  3.879   39.530  1.00 0.00 ? 410 ASN M C   1  
ATOM 5413   O O   . ASN C 3 407 ? -28.103  4.164   40.618  1.00 0.00 ? 410 ASN M O   1  
ATOM 5414   C CB  . ASN C 3 407 ? -27.436  1.360   39.972  1.00 0.00 ? 410 ASN M CB  1  
ATOM 5415   C CG  . ASN C 3 407 ? -26.029  0.767   40.089  1.00 0.00 ? 410 ASN M CG  1  
ATOM 5416   O OD1 . ASN C 3 407 ? -25.298  0.567   39.102  1.00 0.00 ? 410 ASN M OD1 1  
ATOM 5417   N ND2 . ASN C 3 407 ? -25.634  0.361   41.322  1.00 0.00 ? 410 ASN M ND2 1  
ATOM 5418   N N   . GLU C 3 408 ? -26.945  4.765   38.758  1.00 0.00 ? 411 GLU M N   1  
ATOM 5419   C CA  . GLU C 3 408 ? -26.737  6.132   39.157  1.00 0.00 ? 411 GLU M CA  1  
ATOM 5420   C C   . GLU C 3 408 ? -27.361  7.113   38.171  1.00 0.00 ? 411 GLU M C   1  
ATOM 5421   O O   . GLU C 3 408 ? -28.265  6.780   37.429  1.00 0.00 ? 411 GLU M O   1  
ATOM 5422   C CB  . GLU C 3 408 ? -25.250  6.419   39.287  1.00 0.00 ? 411 GLU M CB  1  
ATOM 5423   C CG  . GLU C 3 408 ? -24.480  5.975   38.038  1.00 0.00 ? 411 GLU M CG  1  
ATOM 5424   C CD  . GLU C 3 408 ? -23.187  5.244   38.366  1.00 0.00 ? 411 GLU M CD  1  
ATOM 5425   O OE1 . GLU C 3 408 ? -23.412  4.035   38.910  1.00 0.00 ? 411 GLU M OE1 1  
ATOM 5426   O OE2 . GLU C 3 408 ? -22.056  5.726   38.165  1.00 0.00 ? 411 GLU M OE2 1  
ATOM 5427   N N   . PHE C 3 409 ? -26.843  8.327   38.243  1.00 0.00 ? 412 PHE M N   1  
ATOM 5428   C CA  . PHE C 3 409 ? -27.274  9.427   37.434  1.00 0.00 ? 412 PHE M CA  1  
ATOM 5429   C C   . PHE C 3 409 ? -26.075  10.156  36.799  1.00 0.00 ? 412 PHE M C   1  
ATOM 5430   O O   . PHE C 3 409 ? -25.395  10.970  37.394  1.00 0.00 ? 412 PHE M O   1  
ATOM 5431   C CB  . PHE C 3 409 ? -28.293  10.334  38.137  1.00 0.00 ? 412 PHE M CB  1  
ATOM 5432   N N   . VAL C 3 410 ? -25.864  9.827   35.522  1.00 0.00 ? 413 VAL M N   1  
ATOM 5433   C CA  . VAL C 3 410 ? -24.794  10.315  34.679  1.00 0.00 ? 413 VAL M CA  1  
ATOM 5434   C C   . VAL C 3 410 ? -25.102  11.555  33.877  1.00 0.00 ? 413 VAL M C   1  
ATOM 5435   O O   . VAL C 3 410 ? -25.903  11.510  32.949  1.00 0.00 ? 413 VAL M O   1  
ATOM 5436   C CB  . VAL C 3 410 ? -24.525  9.231   33.663  1.00 0.00 ? 413 VAL M CB  1  
ATOM 5437   C CG1 . VAL C 3 410 ? -23.266  9.542   32.889  1.00 0.00 ? 413 VAL M CG1 1  
ATOM 5438   C CG2 . VAL C 3 410 ? -24.488  7.880   34.366  1.00 0.00 ? 413 VAL M CG2 1  
ATOM 5439   N N   . THR C 3 411 ? -24.395  12.625  34.166  1.00 0.00 ? 414 THR M N   1  
ATOM 5440   C CA  . THR C 3 411 ? -24.618  13.860  33.426  1.00 0.00 ? 414 THR M CA  1  
ATOM 5441   C C   . THR C 3 411 ? -24.103  13.841  31.998  1.00 0.00 ? 414 THR M C   1  
ATOM 5442   O O   . THR C 3 411 ? -22.913  13.715  31.756  1.00 0.00 ? 414 THR M O   1  
ATOM 5443   C CB  . THR C 3 411 ? -24.133  15.090  34.195  1.00 0.00 ? 414 THR M CB  1  
ATOM 5444   O OG1 . THR C 3 411 ? -25.122  15.425  35.183  1.00 0.00 ? 414 THR M OG1 1  
ATOM 5445   C CG2 . THR C 3 411 ? -23.949  16.247  33.245  1.00 0.00 ? 414 THR M CG2 1  
ATOM 5446   N N   . LYS C 3 412 ? -25.059  13.995  31.075  1.00 0.00 ? 415 LYS M N   1  
ATOM 5447   C CA  . LYS C 3 412 ? -24.861  13.981  29.626  1.00 0.00 ? 415 LYS M CA  1  
ATOM 5448   C C   . LYS C 3 412 ? -24.972  15.325  28.958  1.00 0.00 ? 415 LYS M C   1  
ATOM 5449   O O   . LYS C 3 412 ? -25.863  16.139  29.245  1.00 0.00 ? 415 LYS M O   1  
ATOM 5450   C CB  . LYS C 3 412 ? -25.820  13.023  28.954  1.00 0.00 ? 415 LYS M CB  1  
ATOM 5451   C CG  . LYS C 3 412 ? -25.509  11.557  29.208  1.00 0.00 ? 415 LYS M CG  1  
ATOM 5452   C CD  . LYS C 3 412 ? -25.300  10.749  27.926  1.00 0.00 ? 415 LYS M CD  1  
ATOM 5453   C CE  . LYS C 3 412 ? -24.615  9.415   28.194  1.00 0.00 ? 415 LYS M CE  1  
ATOM 5454   N NZ  . LYS C 3 412 ? -24.496  8.547   27.005  1.00 0.00 ? 415 LYS M NZ  1  
ATOM 5455   N N   . GLY C 3 413 ? -24.067  15.530  28.013  1.00 0.00 ? 416 GLY M N   1  
ATOM 5456   C CA  . GLY C 3 413 ? -24.016  16.745  27.237  1.00 0.00 ? 416 GLY M CA  1  
ATOM 5457   C C   . GLY C 3 413 ? -24.685  16.606  25.870  1.00 0.00 ? 416 GLY M C   1  
ATOM 5458   O O   . GLY C 3 413 ? -24.559  15.612  25.143  1.00 0.00 ? 416 GLY M O   1  
ATOM 5459   N N   . GLN C 3 414 ? -25.374  17.669  25.481  1.00 0.00 ? 417 GLN M N   1  
ATOM 5460   C CA  . GLN C 3 414 ? -26.063  17.684  24.223  1.00 0.00 ? 417 GLN M CA  1  
ATOM 5461   C C   . GLN C 3 414 ? -25.556  18.686  23.224  1.00 0.00 ? 417 GLN M C   1  
ATOM 5462   O O   . GLN C 3 414 ? -24.873  19.629  23.564  1.00 0.00 ? 417 GLN M O   1  
ATOM 5463   C CB  . GLN C 3 414 ? -27.543  17.851  24.482  1.00 0.00 ? 417 GLN M CB  1  
ATOM 5464   C CG  . GLN C 3 414 ? -28.173  16.527  25.053  1.00 0.00 ? 417 GLN M CG  1  
ATOM 5465   C CD  . GLN C 3 414 ? -29.632  16.363  24.723  1.00 0.00 ? 417 GLN M CD  1  
ATOM 5466   O OE1 . GLN C 3 414 ? -30.426  17.153  25.415  1.00 0.00 ? 417 GLN M OE1 1  
ATOM 5467   N NE2 . GLN C 3 414 ? -30.044  15.577  23.896  1.00 0.00 ? 417 GLN M NE2 1  
ATOM 5468   N N   . THR C 3 415 ? -25.921  18.448  21.973  1.00 0.00 ? 418 THR M N   1  
ATOM 5469   C CA  . THR C 3 415 ? -25.561  19.291  20.866  1.00 0.00 ? 418 THR M CA  1  
ATOM 5470   C C   . THR C 3 415 ? -26.623  20.330  20.639  1.00 0.00 ? 418 THR M C   1  
ATOM 5471   O O   . THR C 3 415 ? -27.727  20.218  21.171  1.00 0.00 ? 418 THR M O   1  
ATOM 5472   C CB  . THR C 3 415 ? -25.511  18.460  19.592  1.00 0.00 ? 418 THR M CB  1  
ATOM 5473   O OG1 . THR C 3 415 ? -24.767  17.304  19.844  1.00 0.00 ? 418 THR M OG1 1  
ATOM 5474   C CG2 . THR C 3 415 ? -24.901  19.277  18.472  1.00 0.00 ? 418 THR M CG2 1  
ATOM 5475   N N   . VAL C 3 416 ? -26.287  21.299  19.807  1.00 0.00 ? 419 VAL M N   1  
ATOM 5476   C CA  . VAL C 3 416 ? -27.191  22.356  19.494  1.00 0.00 ? 419 VAL M CA  1  
ATOM 5477   C C   . VAL C 3 416 ? -28.447  21.709  18.901  1.00 0.00 ? 419 VAL M C   1  
ATOM 5478   O O   . VAL C 3 416 ? -29.552  21.842  19.378  1.00 0.00 ? 419 VAL M O   1  
ATOM 5479   C CB  . VAL C 3 416 ? -26.536  23.315  18.525  1.00 0.00 ? 419 VAL M CB  1  
ATOM 5480   C CG1 . VAL C 3 416 ? -27.415  24.498  18.227  1.00 0.00 ? 419 VAL M CG1 1  
ATOM 5481   C CG2 . VAL C 3 416 ? -25.176  23.761  19.063  1.00 0.00 ? 419 VAL M CG2 1  
ATOM 5482   N N   . SER C 3 417 ? -28.243  20.911  17.887  1.00 0.00 ? 420 SER M N   1  
ATOM 5483   C CA  . SER C 3 417 ? -29.344  20.193  17.230  1.00 0.00 ? 420 SER M CA  1  
ATOM 5484   C C   . SER C 3 417 ? -30.141  19.363  18.176  1.00 0.00 ? 420 SER M C   1  
ATOM 5485   O O   . SER C 3 417 ? -31.293  19.129  17.950  1.00 0.00 ? 420 SER M O   1  
ATOM 5486   C CB  . SER C 3 417 ? -28.867  19.296  16.096  1.00 0.00 ? 420 SER M CB  1  
ATOM 5487   O OG  . SER C 3 417 ? -28.358  20.074  15.027  1.00 0.00 ? 420 SER M OG  1  
ATOM 5488   N N   . GLN C 3 418 ? -29.513  18.882  19.225  1.00 0.00 ? 421 GLN M N   1  
ATOM 5489   C CA  . GLN C 3 418 ? -30.187  18.040  20.173  1.00 0.00 ? 421 GLN M CA  1  
ATOM 5490   C C   . GLN C 3 418 ? -31.114  18.812  21.094  1.00 0.00 ? 421 GLN M C   1  
ATOM 5491   O O   . GLN C 3 418 ? -32.199  18.314  21.528  1.00 0.00 ? 421 GLN M O   1  
ATOM 5492   C CB  . GLN C 3 418 ? -29.198  17.227  21.012  1.00 0.00 ? 421 GLN M CB  1  
ATOM 5493   C CG  . GLN C 3 418 ? -28.134  16.519  20.179  1.00 0.00 ? 421 GLN M CG  1  
ATOM 5494   C CD  . GLN C 3 418 ? -27.464  15.430  20.949  1.00 0.00 ? 421 GLN M CD  1  
ATOM 5495   O OE1 . GLN C 3 418 ? -26.617  15.647  21.789  1.00 0.00 ? 421 GLN M OE1 1  
ATOM 5496   N NE2 . GLN C 3 418 ? -27.879  14.230  20.615  1.00 0.00 ? 421 GLN M NE2 1  
ATOM 5497   N N   . VAL C 3 419 ? -30.717  20.044  21.362  1.00 0.00 ? 422 VAL M N   1  
ATOM 5498   C CA  . VAL C 3 419 ? -31.485  20.870  22.268  1.00 0.00 ? 422 VAL M CA  1  
ATOM 5499   C C   . VAL C 3 419 ? -32.726  21.338  21.614  1.00 0.00 ? 422 VAL M C   1  
ATOM 5500   O O   . VAL C 3 419 ? -33.799  21.049  22.104  1.00 0.00 ? 422 VAL M O   1  
ATOM 5501   C CB  . VAL C 3 419 ? -30.733  22.004  22.871  1.00 0.00 ? 422 VAL M CB  1  
ATOM 5502   C CG1 . VAL C 3 419 ? -31.608  22.573  23.975  1.00 0.00 ? 422 VAL M CG1 1  
ATOM 5503   C CG2 . VAL C 3 419 ? -29.385  21.492  23.429  1.00 0.00 ? 422 VAL M CG2 1  
ATOM 5504   N N   . HIS C 3 420 ? -32.517  21.982  20.478  1.00 0.00 ? 423 HIS M N   1  
ATOM 5505   C CA  . HIS C 3 420 ? -33.617  22.531  19.693  1.00 0.00 ? 423 HIS M CA  1  
ATOM 5506   C C   . HIS C 3 420 ? -34.694  21.495  19.547  1.00 0.00 ? 423 HIS M C   1  
ATOM 5507   O O   . HIS C 3 420 ? -35.881  21.752  19.691  1.00 0.00 ? 423 HIS M O   1  
ATOM 5508   C CB  . HIS C 3 420 ? -33.200  23.090  18.305  1.00 0.00 ? 423 HIS M CB  1  
ATOM 5509   C CG  . HIS C 3 420 ? -32.488  24.440  18.299  1.00 0.00 ? 423 HIS M CG  1  
ATOM 5510   N ND1 . HIS C 3 420 ? -32.699  25.415  19.270  1.00 0.00 ? 423 HIS M ND1 1  
ATOM 5511   C CD2 . HIS C 3 420 ? -31.575  24.957  17.412  1.00 0.00 ? 423 HIS M CD2 1  
ATOM 5512   C CE1 . HIS C 3 420 ? -31.896  26.464  18.980  1.00 0.00 ? 423 HIS M CE1 1  
ATOM 5513   N NE2 . HIS C 3 420 ? -31.186  26.211  17.861  1.00 0.00 ? 423 HIS M NE2 1  
ATOM 5514   N N   . ASN C 3 421 ? -34.265  20.260  19.349  1.00 0.00 ? 424 ASN M N   1  
ATOM 5515   C CA  . ASN C 3 421 ? -35.194  19.171  19.190  1.00 0.00 ? 424 ASN M CA  1  
ATOM 5516   C C   . ASN C 3 421 ? -35.805  18.811  20.531  1.00 0.00 ? 424 ASN M C   1  
ATOM 5517   O O   . ASN C 3 421 ? -37.023  18.593  20.626  1.00 0.00 ? 424 ASN M O   1  
ATOM 5518   C CB  . ASN C 3 421 ? -34.657  17.947  18.390  1.00 0.00 ? 424 ASN M CB  1  
ATOM 5519   C CG  . ASN C 3 421 ? -34.340  18.151  16.907  1.00 0.00 ? 424 ASN M CG  1  
ATOM 5520   O OD1 . ASN C 3 421 ? -33.639  17.346  16.327  1.00 0.00 ? 424 ASN M OD1 1  
ATOM 5521   N ND2 . ASN C 3 421 ? -34.863  19.232  16.300  1.00 0.00 ? 424 ASN M ND2 1  
ATOM 5522   N N   . SER C 3 422 ? -35.030  18.820  21.610  1.00 0.00 ? 425 SER M N   1  
ATOM 5523   C CA  . SER C 3 422 ? -35.673  18.445  22.882  1.00 0.00 ? 425 SER M CA  1  
ATOM 5524   C C   . SER C 3 422 ? -36.701  19.438  23.365  1.00 0.00 ? 425 SER M C   1  
ATOM 5525   O O   . SER C 3 422 ? -37.745  19.128  23.939  1.00 0.00 ? 425 SER M O   1  
ATOM 5526   C CB  . SER C 3 422 ? -34.778  17.928  23.995  1.00 0.00 ? 425 SER M CB  1  
ATOM 5527   O OG  . SER C 3 422 ? -33.926  18.946  24.449  1.00 0.00 ? 425 SER M OG  1  
ATOM 5528   N N   . VAL C 3 423 ? -36.392  20.664  23.145  1.00 0.00 ? 426 VAL M N   1  
ATOM 5529   C CA  . VAL C 3 423 ? -37.256  21.750  23.501  1.00 0.00 ? 426 VAL M CA  1  
ATOM 5530   C C   . VAL C 3 423 ? -38.600  21.507  22.851  1.00 0.00 ? 426 VAL M C   1  
ATOM 5531   O O   . VAL C 3 423 ? -39.636  21.384  23.484  1.00 0.00 ? 426 VAL M O   1  
ATOM 5532   C CB  . VAL C 3 423 ? -36.667  23.081  23.015  1.00 0.00 ? 426 VAL M CB  1  
ATOM 5533   C CG1 . VAL C 3 423 ? -37.653  24.216  23.228  1.00 0.00 ? 426 VAL M CG1 1  
ATOM 5534   C CG2 . VAL C 3 423 ? -35.421  23.390  23.758  1.00 0.00 ? 426 VAL M CG2 1  
ATOM 5535   N N   . GLY C 3 424 ? -38.538  21.358  21.554  1.00 0.00 ? 427 GLY M N   1  
ATOM 5536   C CA  . GLY C 3 424 ? -39.692  21.073  20.767  1.00 0.00 ? 427 GLY M CA  1  
ATOM 5537   C C   . GLY C 3 424 ? -40.442  19.891  21.325  1.00 0.00 ? 427 GLY M C   1  
ATOM 5538   O O   . GLY C 3 424 ? -41.675  19.820  21.354  1.00 0.00 ? 427 GLY M O   1  
ATOM 5539   N N   . ALA C 3 425 ? -39.698  18.930  21.840  1.00 0.00 ? 428 ALA M N   1  
ATOM 5540   C CA  . ALA C 3 425 ? -40.381  17.802  22.412  1.00 0.00 ? 428 ALA M CA  1  
ATOM 5541   C C   . ALA C 3 425 ? -41.149  18.121  23.640  1.00 0.00 ? 428 ALA M C   1  
ATOM 5542   O O   . ALA C 3 425 ? -42.240  17.547  23.853  1.00 0.00 ? 428 ALA M O   1  
ATOM 5543   C CB  . ALA C 3 425 ? -39.549  16.622  22.671  1.00 0.00 ? 428 ALA M CB  1  
ATOM 5544   N N   . LEU C 3 426 ? -40.599  19.018  24.449  1.00 0.00 ? 429 LEU M N   1  
ATOM 5545   C CA  . LEU C 3 426 ? -41.375  19.377  25.647  1.00 0.00 ? 429 LEU M CA  1  
ATOM 5546   C C   . LEU C 3 426 ? -42.586  20.227  25.298  1.00 0.00 ? 429 LEU M C   1  
ATOM 5547   O O   . LEU C 3 426 ? -43.705  19.920  25.753  1.00 0.00 ? 429 LEU M O   1  
ATOM 5548   C CB  . LEU C 3 426 ? -40.476  20.013  26.690  1.00 0.00 ? 429 LEU M CB  1  
ATOM 5549   C CG  . LEU C 3 426 ? -39.333  19.056  27.018  1.00 0.00 ? 429 LEU M CG  1  
ATOM 5550   C CD1 . LEU C 3 426 ? -38.101  19.792  27.372  1.00 0.00 ? 429 LEU M CD1 1  
ATOM 5551   C CD2 . LEU C 3 426 ? -39.817  18.222  28.161  1.00 0.00 ? 429 LEU M CD2 1  
ATOM 5552   N N   . ALA C 3 427 ? -42.366  21.237  24.424  1.00 0.00 ? 430 ALA M N   1  
ATOM 5553   C CA  . ALA C 3 427 ? -43.373  22.122  23.952  1.00 0.00 ? 430 ALA M CA  1  
ATOM 5554   C C   . ALA C 3 427 ? -44.582  21.319  23.591  1.00 0.00 ? 430 ALA M C   1  
ATOM 5555   O O   . ALA C 3 427 ? -45.687  21.502  24.106  1.00 0.00 ? 430 ALA M O   1  
ATOM 5556   C CB  . ALA C 3 427 ? -42.935  22.832  22.682  1.00 0.00 ? 430 ALA M CB  1  
ATOM 5557   N N   . LYS C 3 428 ? -44.343  20.319  22.761  1.00 0.00 ? 431 LYS M N   1  
ATOM 5558   C CA  . LYS C 3 428 ? -45.422  19.439  22.346  1.00 0.00 ? 431 LYS M CA  1  
ATOM 5559   C C   . LYS C 3 428 ? -45.956  18.655  23.513  1.00 0.00 ? 431 LYS M C   1  
ATOM 5560   O O   . LYS C 3 428 ? -47.146  18.486  23.688  1.00 0.00 ? 431 LYS M O   1  
ATOM 5561   C CB  . LYS C 3 428 ? -45.022  18.424  21.285  1.00 0.00 ? 431 LYS M CB  1  
ATOM 5562   C CG  . LYS C 3 428 ? -44.771  18.932  19.902  1.00 0.00 ? 431 LYS M CG  1  
ATOM 5563   C CD  . LYS C 3 428 ? -43.479  18.446  19.328  1.00 0.00 ? 431 LYS M CD  1  
ATOM 5564   C CE  . LYS C 3 428 ? -43.599  17.233  18.434  1.00 0.00 ? 431 LYS M CE  1  
ATOM 5565   N NZ  . LYS C 3 428 ? -42.405  16.974  17.640  1.00 0.00 ? 431 LYS M NZ  1  
ATOM 5566   N N   . ALA C 3 429 ? -45.052  18.050  24.272  1.00 0.00 ? 432 ALA M N   1  
ATOM 5567   C CA  . ALA C 3 429 ? -45.452  17.241  25.406  1.00 0.00 ? 432 ALA M CA  1  
ATOM 5568   C C   . ALA C 3 429 ? -46.383  17.986  26.335  1.00 0.00 ? 432 ALA M C   1  
ATOM 5569   O O   . ALA C 3 429 ? -47.446  17.540  26.693  1.00 0.00 ? 432 ALA M O   1  
ATOM 5570   C CB  . ALA C 3 429 ? -44.267  16.908  26.201  1.00 0.00 ? 432 ALA M CB  1  
ATOM 5571   N N   . VAL C 3 430 ? -45.941  19.155  26.735  1.00 0.00 ? 433 VAL M N   1  
ATOM 5572   C CA  . VAL C 3 430 ? -46.707  20.017  27.615  1.00 0.00 ? 433 VAL M CA  1  
ATOM 5573   C C   . VAL C 3 430 ? -48.080  20.395  27.128  1.00 0.00 ? 433 VAL M C   1  
ATOM 5574   O O   . VAL C 3 430 ? -49.080  20.304  27.850  1.00 0.00 ? 433 VAL M O   1  
ATOM 5575   C CB  . VAL C 3 430 ? -45.958  21.291  27.883  1.00 0.00 ? 433 VAL M CB  1  
ATOM 5576   C CG1 . VAL C 3 430 ? -46.716  22.104  28.900  1.00 0.00 ? 433 VAL M CG1 1  
ATOM 5577   C CG2 . VAL C 3 430 ? -44.573  20.981  28.413  1.00 0.00 ? 433 VAL M CG2 1  
ATOM 5578   N N   . TYR C 3 431 ? -48.116  20.840  25.879  1.00 0.00 ? 434 TYR M N   1  
ATOM 5579   C CA  . TYR C 3 431 ? -49.379  21.204  25.246  1.00 0.00 ? 434 TYR M CA  1  
ATOM 5580   C C   . TYR C 3 431 ? -50.378  20.081  25.317  1.00 0.00 ? 434 TYR M C   1  
ATOM 5581   O O   . TYR C 3 431 ? -51.479  20.242  25.803  1.00 0.00 ? 434 TYR M O   1  
ATOM 5582   C CB  . TYR C 3 431 ? -49.136  21.328  23.835  1.00 0.00 ? 434 TYR M CB  1  
ATOM 5583   C CG  . TYR C 3 431 ? -50.298  22.019  23.219  1.00 0.00 ? 434 TYR M CG  1  
ATOM 5584   C CD1 . TYR C 3 431 ? -50.382  23.401  23.250  1.00 0.00 ? 434 TYR M CD1 1  
ATOM 5585   C CD2 . TYR C 3 431 ? -51.312  21.311  22.609  1.00 0.00 ? 434 TYR M CD2 1  
ATOM 5586   C CE1 . TYR C 3 431 ? -51.454  24.054  22.653  1.00 0.00 ? 434 TYR M CE1 1  
ATOM 5587   C CE2 . TYR C 3 431 ? -52.395  21.941  21.998  1.00 0.00 ? 434 TYR M CE2 1  
ATOM 5588   C CZ  . TYR C 3 431 ? -52.468  23.324  22.048  1.00 0.00 ? 434 TYR M CZ  1  
ATOM 5589   O OH  . TYR C 3 431 ? -53.525  23.969  21.478  1.00 0.00 ? 434 TYR M OH  1  
ATOM 5590   N N   . GLU C 3 432 ? -49.923  18.911  24.815  1.00 0.00 ? 435 GLU M N   1  
ATOM 5591   C CA  . GLU C 3 432 ? -50.722  17.726  24.839  1.00 0.00 ? 435 GLU M CA  1  
ATOM 5592   C C   . GLU C 3 432 ? -51.356  17.477  26.147  1.00 0.00 ? 435 GLU M C   1  
ATOM 5593   O O   . GLU C 3 432 ? -52.551  17.704  26.309  1.00 0.00 ? 435 GLU M O   1  
ATOM 5594   C CB  . GLU C 3 432 ? -49.983  16.493  24.480  1.00 0.00 ? 435 GLU M CB  1  
ATOM 5595   C CG  . GLU C 3 432 ? -50.905  15.287  24.749  1.00 0.00 ? 435 GLU M CG  1  
ATOM 5596   C CD  . GLU C 3 432 ? -50.385  14.045  24.075  1.00 0.00 ? 435 GLU M CD  1  
ATOM 5597   O OE1 . GLU C 3 432 ? -49.113  13.911  24.238  1.00 0.00 ? 435 GLU M OE1 1  
ATOM 5598   O OE2 . GLU C 3 432 ? -51.059  13.277  23.423  1.00 0.00 ? 435 GLU M OE2 1  
ATOM 5599   N N   . LYS C 3 433 ? -50.544  17.041  27.075  1.00 0.00 ? 436 LYS M N   1  
ATOM 5600   C CA  . LYS C 3 433 ? -50.910  16.795  28.482  1.00 0.00 ? 436 LYS M CA  1  
ATOM 5601   C C   . LYS C 3 433 ? -51.977  17.743  28.976  1.00 0.00 ? 436 LYS M C   1  
ATOM 5602   O O   . LYS C 3 433 ? -53.043  17.356  29.437  1.00 0.00 ? 436 LYS M O   1  
ATOM 5603   C CB  . LYS C 3 433 ? -49.752  17.059  29.383  1.00 0.00 ? 436 LYS M CB  1  
ATOM 5604   C CG  . LYS C 3 433 ? -49.088  15.818  29.910  1.00 0.00 ? 436 LYS M CG  1  
ATOM 5605   C CD  . LYS C 3 433 ? -47.891  15.457  29.074  1.00 0.00 ? 436 LYS M CD  1  
ATOM 5606   C CE  . LYS C 3 433 ? -47.751  13.961  28.924  1.00 0.00 ? 436 LYS M CE  1  
ATOM 5607   N NZ  . LYS C 3 433 ? -46.481  13.587  28.275  1.00 0.00 ? 436 LYS M NZ  1  
ATOM 5608   N N   . MET C 3 434 ? -51.684  19.005  28.792  1.00 0.00 ? 437 MET M N   1  
ATOM 5609   C CA  . MET C 3 434 ? -52.576  20.075  29.182  1.00 0.00 ? 437 MET M CA  1  
ATOM 5610   C C   . MET C 3 434 ? -53.921  19.850  28.584  1.00 0.00 ? 437 MET M C   1  
ATOM 5611   O O   . MET C 3 434 ? -54.965  19.876  29.234  1.00 0.00 ? 437 MET M O   1  
ATOM 5612   C CB  . MET C 3 434 ? -52.055  21.411  28.664  1.00 0.00 ? 437 MET M CB  1  
ATOM 5613   C CG  . MET C 3 434 ? -52.995  22.560  29.014  1.00 0.00 ? 437 MET M CG  1  
ATOM 5614   S SD  . MET C 3 434 ? -52.095  24.141  28.897  1.00 0.00 ? 437 MET M SD  1  
ATOM 5615   C CE  . MET C 3 434 ? -52.447  24.804  27.307  1.00 0.00 ? 437 MET M CE  1  
ATOM 5616   N N   . PHE C 3 435 ? -53.881  19.636  27.305  1.00 0.00 ? 438 PHE M N   1  
ATOM 5617   C CA  . PHE C 3 435 ? -55.097  19.389  26.573  1.00 0.00 ? 438 PHE M CA  1  
ATOM 5618   C C   . PHE C 3 435 ? -55.827  18.245  27.159  1.00 0.00 ? 438 PHE M C   1  
ATOM 5619   O O   . PHE C 3 435 ? -57.013  18.237  27.294  1.00 0.00 ? 438 PHE M O   1  
ATOM 5620   C CB  . PHE C 3 435 ? -54.744  19.050  25.163  1.00 0.00 ? 438 PHE M CB  1  
ATOM 5621   C CG  . PHE C 3 435 ? -55.949  18.754  24.343  1.00 0.00 ? 438 PHE M CG  1  
ATOM 5622   C CD1 . PHE C 3 435 ? -56.647  19.787  23.758  1.00 0.00 ? 438 PHE M CD1 1  
ATOM 5623   C CD2 . PHE C 3 435 ? -56.361  17.455  24.115  1.00 0.00 ? 438 PHE M CD2 1  
ATOM 5624   C CE1 . PHE C 3 435 ? -57.754  19.532  22.951  1.00 0.00 ? 438 PHE M CE1 1  
ATOM 5625   C CE2 . PHE C 3 435 ? -57.463  17.184  23.305  1.00 0.00 ? 438 PHE M CE2 1  
ATOM 5626   C CZ  . PHE C 3 435 ? -58.158  18.235  22.745  1.00 0.00 ? 438 PHE M CZ  1  
ATOM 5627   N N   . LEU C 3 436 ? -55.053  17.228  27.546  1.00 0.00 ? 439 LEU M N   1  
ATOM 5628   C CA  . LEU C 3 436 ? -55.668  16.058  28.151  1.00 0.00 ? 439 LEU M CA  1  
ATOM 5629   C C   . LEU C 3 436 ? -56.327  16.433  29.454  1.00 0.00 ? 439 LEU M C   1  
ATOM 5630   O O   . LEU C 3 436 ? -57.447  16.121  29.758  1.00 0.00 ? 439 LEU M O   1  
ATOM 5631   C CB  . LEU C 3 436 ? -54.667  14.915  28.349  1.00 0.00 ? 439 LEU M CB  1  
ATOM 5632   C CG  . LEU C 3 436 ? -54.377  14.084  27.104  1.00 0.00 ? 439 LEU M CG  1  
ATOM 5633   C CD1 . LEU C 3 436 ? -54.615  14.969  25.934  1.00 0.00 ? 439 LEU M CD1 1  
ATOM 5634   C CD2 . LEU C 3 436 ? -52.906  13.740  27.116  1.00 0.00 ? 439 LEU M CD2 1  
ATOM 5635   N N   . TRP C 3 437 ? -55.600  17.186  30.234  1.00 0.00 ? 440 TRP M N   1  
ATOM 5636   C CA  . TRP C 3 437 ? -56.068  17.635  31.516  1.00 0.00 ? 440 TRP M CA  1  
ATOM 5637   C C   . TRP C 3 437 ? -57.382  18.382  31.409  1.00 0.00 ? 440 TRP M C   1  
ATOM 5638   O O   . TRP C 3 437 ? -58.330  18.097  32.140  1.00 0.00 ? 440 TRP M O   1  
ATOM 5639   C CB  . TRP C 3 437 ? -55.041  18.586  32.049  1.00 0.00 ? 440 TRP M CB  1  
ATOM 5640   C CG  . TRP C 3 437 ? -55.423  19.275  33.316  1.00 0.00 ? 440 TRP M CG  1  
ATOM 5641   C CD1 . TRP C 3 437 ? -55.636  18.679  34.482  1.00 0.00 ? 440 TRP M CD1 1  
ATOM 5642   C CD2 . TRP C 3 437 ? -55.537  20.687  33.585  1.00 0.00 ? 440 TRP M CD2 1  
ATOM 5643   N NE1 . TRP C 3 437 ? -55.923  19.614  35.435  1.00 0.00 ? 440 TRP M NE1 1  
ATOM 5644   C CE2 . TRP C 3 437 ? -55.853  20.839  34.914  1.00 0.00 ? 440 TRP M CE2 1  
ATOM 5645   C CE3 . TRP C 3 437 ? -55.436  21.830  32.797  1.00 0.00 ? 440 TRP M CE3 1  
ATOM 5646   C CZ2 . TRP C 3 437 ? -56.070  22.067  35.464  1.00 0.00 ? 440 TRP M CZ2 1  
ATOM 5647   C CZ3 . TRP C 3 437 ? -55.671  23.057  33.316  1.00 0.00 ? 440 TRP M CZ3 1  
ATOM 5648   C CH2 . TRP C 3 437 ? -55.956  23.165  34.642  1.00 0.00 ? 440 TRP M CH2 1  
ATOM 5649   N N   . MET C 3 438 ? -57.388  19.369  30.512  1.00 0.00 ? 441 MET M N   1  
ATOM 5650   C CA  . MET C 3 438 ? -58.568  20.190  30.301  1.00 0.00 ? 441 MET M CA  1  
ATOM 5651   C C   . MET C 3 438 ? -59.755  19.313  30.111  1.00 0.00 ? 441 MET M C   1  
ATOM 5652   O O   . MET C 3 438 ? -60.794  19.505  30.707  1.00 0.00 ? 441 MET M O   1  
ATOM 5653   C CB  . MET C 3 438 ? -58.366  21.031  29.071  1.00 0.00 ? 441 MET M CB  1  
ATOM 5654   C CG  . MET C 3 438 ? -58.010  22.421  29.416  1.00 0.00 ? 441 MET M CG  1  
ATOM 5655   S SD  . MET C 3 438 ? -57.807  23.408  27.964  1.00 0.00 ? 441 MET M SD  1  
ATOM 5656   C CE  . MET C 3 438 ? -56.519  22.532  27.123  1.00 0.00 ? 441 MET M CE  1  
ATOM 5657   N N   . VAL C 3 439 ? -59.539  18.301  29.275  1.00 0.00 ? 442 VAL M N   1  
ATOM 5658   C CA  . VAL C 3 439 ? -60.623  17.366  29.032  1.00 0.00 ? 442 VAL M CA  1  
ATOM 5659   C C   . VAL C 3 439 ? -61.089  16.736  30.319  1.00 0.00 ? 442 VAL M C   1  
ATOM 5660   O O   . VAL C 3 439 ? -62.257  16.785  30.647  1.00 0.00 ? 442 VAL M O   1  
ATOM 5661   C CB  . VAL C 3 439 ? -60.247  16.290  28.078  1.00 0.00 ? 442 VAL M CB  1  
ATOM 5662   C CG1 . VAL C 3 439 ? -61.348  15.310  28.061  1.00 0.00 ? 442 VAL M CG1 1  
ATOM 5663   C CG2 . VAL C 3 439 ? -60.054  16.906  26.723  1.00 0.00 ? 442 VAL M CG2 1  
ATOM 5664   N N   . ILE C 3 440 ? -60.161  16.201  31.074  1.00 0.00 ? 443 ILE M N   1  
ATOM 5665   C CA  . ILE C 3 440 ? -60.487  15.608  32.355  1.00 0.00 ? 443 ILE M CA  1  
ATOM 5666   C C   . ILE C 3 440 ? -61.251  16.559  33.244  1.00 0.00 ? 443 ILE M C   1  
ATOM 5667   O O   . ILE C 3 440 ? -62.241  16.247  33.835  1.00 0.00 ? 443 ILE M O   1  
ATOM 5668   C CB  . ILE C 3 440 ? -59.238  15.315  33.130  1.00 0.00 ? 443 ILE M CB  1  
ATOM 5669   C CG1 . ILE C 3 440 ? -58.591  14.036  32.709  1.00 0.00 ? 443 ILE M CG1 1  
ATOM 5670   C CG2 . ILE C 3 440 ? -59.631  15.262  34.560  1.00 0.00 ? 443 ILE M CG2 1  
ATOM 5671   C CD1 . ILE C 3 440 ? -57.092  14.143  32.750  1.00 0.00 ? 443 ILE M CD1 1  
ATOM 5672   N N   . ARG C 3 441 ? -60.726  17.734  33.367  1.00 0.00 ? 444 ARG M N   1  
ATOM 5673   C CA  . ARG C 3 441 ? -61.371  18.697  34.194  1.00 0.00 ? 444 ARG M CA  1  
ATOM 5674   C C   . ARG C 3 441 ? -62.784  18.949  33.728  1.00 0.00 ? 444 ARG M C   1  
ATOM 5675   O O   . ARG C 3 441 ? -63.733  19.076  34.493  1.00 0.00 ? 444 ARG M O   1  
ATOM 5676   C CB  . ARG C 3 441 ? -60.520  19.970  34.365  1.00 0.00 ? 444 ARG M CB  1  
ATOM 5677   C CG  . ARG C 3 441 ? -59.419  19.747  35.378  1.00 0.00 ? 444 ARG M CG  1  
ATOM 5678   C CD  . ARG C 3 441 ? -59.870  19.890  36.853  1.00 0.00 ? 444 ARG M CD  1  
ATOM 5679   N NE  . ARG C 3 441 ? -60.449  21.198  37.103  1.00 0.00 ? 444 ARG M NE  1  
ATOM 5680   C CZ  . ARG C 3 441 ? -61.743  21.387  37.367  1.00 0.00 ? 444 ARG M CZ  1  
ATOM 5681   N NH1 . ARG C 3 441 ? -62.582  20.356  37.435  1.00 0.00 ? 444 ARG M NH1 1  
ATOM 5682   N NH2 . ARG C 3 441 ? -62.183  22.633  37.560  1.00 0.00 ? 444 ARG M NH2 1  
ATOM 5683   N N   . ILE C 3 442 ? -62.951  18.934  32.419  1.00 0.00 ? 445 ILE M N   1  
ATOM 5684   C CA  . ILE C 3 442 ? -64.270  19.159  31.855  1.00 0.00 ? 445 ILE M CA  1  
ATOM 5685   C C   . ILE C 3 442 ? -65.159  18.043  32.383  1.00 0.00 ? 445 ILE M C   1  
ATOM 5686   O O   . ILE C 3 442 ? -66.105  18.252  33.074  1.00 0.00 ? 445 ILE M O   1  
ATOM 5687   C CB  . ILE C 3 442 ? -64.164  19.139  30.333  1.00 0.00 ? 445 ILE M CB  1  
ATOM 5688   C CG1 . ILE C 3 442 ? -63.371  20.295  29.855  1.00 0.00 ? 445 ILE M CG1 1  
ATOM 5689   C CG2 . ILE C 3 442 ? -65.467  19.235  29.689  1.00 0.00 ? 445 ILE M CG2 1  
ATOM 5690   C CD1 . ILE C 3 442 ? -63.381  20.450  28.352  1.00 0.00 ? 445 ILE M CD1 1  
ATOM 5691   N N   . ASN C 3 443 ? -64.757  16.819  32.073  1.00 0.00 ? 446 ASN M N   1  
ATOM 5692   C CA  . ASN C 3 443 ? -65.412  15.605  32.472  1.00 0.00 ? 446 ASN M CA  1  
ATOM 5693   C C   . ASN C 3 443 ? -65.819  15.690  33.936  1.00 0.00 ? 446 ASN M C   1  
ATOM 5694   O O   . ASN C 3 443 ? -66.882  15.220  34.355  1.00 0.00 ? 446 ASN M O   1  
ATOM 5695   C CB  . ASN C 3 443 ? -64.433  14.426  32.409  1.00 0.00 ? 446 ASN M CB  1  
ATOM 5696   C CG  . ASN C 3 443 ? -64.302  13.708  31.090  1.00 0.00 ? 446 ASN M CG  1  
ATOM 5697   O OD1 . ASN C 3 443 ? -65.227  13.709  30.293  1.00 0.00 ? 446 ASN M OD1 1  
ATOM 5698   N ND2 . ASN C 3 443 ? -63.178  13.038  30.853  1.00 0.00 ? 446 ASN M ND2 1  
ATOM 5699   N N   . GLN C 3 444 ? -64.931  16.294  34.718  1.00 0.00 ? 447 GLN M N   1  
ATOM 5700   C CA  . GLN C 3 444 ? -65.187  16.408  36.127  1.00 0.00 ? 447 GLN M CA  1  
ATOM 5701   C C   . GLN C 3 444 ? -66.371  17.215  36.518  1.00 0.00 ? 447 GLN M C   1  
ATOM 5702   O O   . GLN C 3 444 ? -67.145  16.929  37.413  1.00 0.00 ? 447 GLN M O   1  
ATOM 5703   C CB  . GLN C 3 444 ? -64.103  16.100  37.166  1.00 0.00 ? 447 GLN M CB  1  
ATOM 5704   C CG  . GLN C 3 444 ? -63.014  17.163  37.329  1.00 0.00 ? 447 GLN M CG  1  
ATOM 5705   C CD  . GLN C 3 444 ? -61.684  16.618  37.874  1.00 0.00 ? 447 GLN M CD  1  
ATOM 5706   O OE1 . GLN C 3 444 ? -61.104  17.161  38.804  1.00 0.00 ? 447 GLN M OE1 1  
ATOM 5707   N NE2 . GLN C 3 444 ? -61.127  15.608  37.225  1.00 0.00 ? 447 GLN M NE2 1  
ATOM 5708   N N   . GLN C 3 445 ? -66.566  18.248  35.764  1.00 0.00 ? 448 GLN M N   1  
ATOM 5709   C CA  . GLN C 3 445 ? -67.708  19.073  36.014  1.00 0.00 ? 448 GLN M CA  1  
ATOM 5710   C C   . GLN C 3 445 ? -68.926  18.356  35.487  1.00 0.00 ? 448 GLN M C   1  
ATOM 5711   O O   . GLN C 3 445 ? -70.005  18.406  36.071  1.00 0.00 ? 448 GLN M O   1  
ATOM 5712   C CB  . GLN C 3 445 ? -67.588  20.408  35.264  1.00 0.00 ? 448 GLN M CB  1  
ATOM 5713   C CG  . GLN C 3 445 ? -67.768  21.614  36.201  1.00 0.00 ? 448 GLN M CG  1  
ATOM 5714   C CD  . GLN C 3 445 ? -66.563  21.829  37.118  1.00 0.00 ? 448 GLN M CD  1  
ATOM 5715   O OE1 . GLN C 3 445 ? -66.712  21.761  38.361  1.00 0.00 ? 448 GLN M OE1 1  
ATOM 5716   N NE2 . GLN C 3 445 ? -65.421  22.112  36.508  1.00 0.00 ? 448 GLN M NE2 1  
ATOM 5717   N N   . LEU C 3 446 ? -68.727  17.710  34.351  1.00 0.00 ? 449 LEU M N   1  
ATOM 5718   C CA  . LEU C 3 446 ? -69.793  16.988  33.679  1.00 0.00 ? 449 LEU M CA  1  
ATOM 5719   C C   . LEU C 3 446 ? -70.210  15.749  34.446  1.00 0.00 ? 449 LEU M C   1  
ATOM 5720   O O   . LEU C 3 446 ? -70.867  14.889  33.901  1.00 0.00 ? 449 LEU M O   1  
ATOM 5721   C CB  . LEU C 3 446 ? -69.389  16.611  32.253  1.00 0.00 ? 449 LEU M CB  1  
ATOM 5722   C CG  . LEU C 3 446 ? -69.746  17.691  31.277  1.00 0.00 ? 449 LEU M CG  1  
ATOM 5723   C CD1 . LEU C 3 446 ? -69.749  18.982  32.059  1.00 0.00 ? 449 LEU M CD1 1  
ATOM 5724   C CD2 . LEU C 3 446 ? -68.726  17.659  30.139  1.00 0.00 ? 449 LEU M CD2 1  
ATOM 5725   N N   . ASP C 3 447 ? -68.730  16.465  37.546  1.00 0.00 ? 450 ASP M N   1  
ATOM 5726   C CA  . ASP C 3 447 ? -68.487  15.459  38.577  1.00 0.00 ? 450 ASP M CA  1  
ATOM 5727   C C   . ASP C 3 447 ? -69.473  15.637  39.688  1.00 0.00 ? 450 ASP M C   1  
ATOM 5728   O O   . ASP C 3 447 ? -69.486  16.682  40.374  1.00 0.00 ? 450 ASP M O   1  
ATOM 5729   C CB  . ASP C 3 447 ? -67.115  15.550  39.228  1.00 0.00 ? 450 ASP M CB  1  
ATOM 5730   C CG  . ASP C 3 447 ? -66.583  14.237  39.738  1.00 0.00 ? 450 ASP M CG  1  
ATOM 5731   O OD1 . ASP C 3 447 ? -67.271  13.223  39.325  1.00 0.00 ? 450 ASP M OD1 1  
ATOM 5732   O OD2 . ASP C 3 447 ? -65.625  14.128  40.499  1.00 0.00 ? 450 ASP M OD2 1  
ATOM 5733   N N   . THR C 3 448 ? -70.220  14.574  39.906  1.00 0.00 ? 451 THR M N   1  
ATOM 5734   C CA  . THR C 3 448 ? -71.176  14.644  40.972  1.00 0.00 ? 451 THR M CA  1  
ATOM 5735   C C   . THR C 3 448 ? -70.823  13.590  41.962  1.00 0.00 ? 451 THR M C   1  
ATOM 5736   O O   . THR C 3 448 ? -69.936  12.774  41.661  1.00 0.00 ? 451 THR M O   1  
ATOM 5737   C CB  . THR C 3 448 ? -72.642  14.571  40.513  1.00 0.00 ? 451 THR M CB  1  
ATOM 5738   O OG1 . THR C 3 448 ? -72.842  13.443  39.712  1.00 0.00 ? 451 THR M OG1 1  
ATOM 5739   C CG2 . THR C 3 448 ? -73.025  15.823  39.743  1.00 0.00 ? 451 THR M CG2 1  
ATOM 5740   N N   . LYS C 3 449 ? -71.466  13.676  43.110  1.00 0.00 ? 452 LYS M N   1  
ATOM 5741   C CA  . LYS C 3 449 ? -71.259  12.734  44.177  1.00 0.00 ? 452 LYS M CA  1  
ATOM 5742   C C   . LYS C 3 449 ? -72.133  11.501  44.017  1.00 0.00 ? 452 LYS M C   1  
ATOM 5743   O O   . LYS C 3 449 ? -71.702  10.405  44.393  1.00 0.00 ? 452 LYS M O   1  
ATOM 5744   C CB  . LYS C 3 449 ? -71.434  13.380  45.562  1.00 0.00 ? 452 LYS M CB  1  
ATOM 5745   C CG  . LYS C 3 449 ? -70.142  13.957  46.147  1.00 0.00 ? 452 LYS M CG  1  
ATOM 5746   C CD  . LYS C 3 449 ? -70.372  14.920  47.309  1.00 0.00 ? 452 LYS M CD  1  
ATOM 5747   C CE  . LYS C 3 449 ? -69.667  14.491  48.594  1.00 0.00 ? 452 LYS M CE  1  
ATOM 5748   N NZ  . LYS C 3 449 ? -70.497  14.614  49.805  1.00 0.00 ? 452 LYS M NZ  1  
ATOM 5749   N N   . GLN C 3 450 ? -73.357  11.686  43.463  1.00 0.00 ? 453 GLN M N   1  
ATOM 5750   C CA  . GLN C 3 450 ? -74.296  10.583  43.233  1.00 0.00 ? 453 GLN M CA  1  
ATOM 5751   C C   . GLN C 3 450 ? -73.641  9.346   42.646  1.00 0.00 ? 453 GLN M C   1  
ATOM 5752   O O   . GLN C 3 450 ? -72.711  9.452   41.851  1.00 0.00 ? 453 GLN M O   1  
ATOM 5753   C CB  . GLN C 3 450 ? -75.508  10.960  42.377  1.00 0.00 ? 453 GLN M CB  1  
ATOM 5754   C CG  . GLN C 3 450 ? -75.597  12.451  42.093  1.00 0.00 ? 453 GLN M CG  1  
ATOM 5755   C CD  . GLN C 3 450 ? -76.889  12.831  41.363  1.00 0.00 ? 453 GLN M CD  1  
ATOM 5756   O OE1 . GLN C 3 450 ? -77.185  14.038  41.195  1.00 0.00 ? 453 GLN M OE1 1  
ATOM 5757   N NE2 . GLN C 3 450 ? -77.644  11.816  40.930  1.00 0.00 ? 453 GLN M NE2 1  
ATOM 5758   N N   . PRO C 3 451 ? -74.142  8.183   43.052  1.00 0.00 ? 454 PRO M N   1  
ATOM 5759   C CA  . PRO C 3 451 ? -73.579  6.919   42.619  1.00 0.00 ? 454 PRO M CA  1  
ATOM 5760   C C   . PRO C 3 451 ? -73.786  6.710   41.152  1.00 0.00 ? 454 PRO M C   1  
ATOM 5761   O O   . PRO C 3 451 ? -74.737  7.256   40.598  1.00 0.00 ? 454 PRO M O   1  
ATOM 5762   C CB  . PRO C 3 451 ? -74.274  5.811   43.406  1.00 0.00 ? 454 PRO M CB  1  
ATOM 5763   C CG  . PRO C 3 451 ? -75.276  6.486   44.343  1.00 0.00 ? 454 PRO M CG  1  
ATOM 5764   C CD  . PRO C 3 451 ? -75.155  7.990   44.129  1.00 0.00 ? 454 PRO M CD  1  
ATOM 5765   N N   . ARG C 3 452 ? -72.869  5.912   40.590  1.00 0.00 ? 455 ARG M N   1  
ATOM 5766   C CA  . ARG C 3 452 ? -72.850  5.558   39.178  1.00 0.00 ? 455 ARG M CA  1  
ATOM 5767   C C   . ARG C 3 452 ? -72.756  4.038   39.063  1.00 0.00 ? 455 ARG M C   1  
ATOM 5768   O O   . ARG C 3 452 ? -71.969  3.398   39.767  1.00 0.00 ? 455 ARG M O   1  
ATOM 5769   C CB  . ARG C 3 452 ? -71.697  6.259   38.470  1.00 0.00 ? 455 ARG M CB  1  
ATOM 5770   C CG  . ARG C 3 452 ? -71.440  7.683   38.984  1.00 0.00 ? 455 ARG M CG  1  
ATOM 5771   C CD  . ARG C 3 452 ? -69.986  8.146   38.865  1.00 0.00 ? 455 ARG M CD  1  
ATOM 5772   N NE  . ARG C 3 452 ? -69.439  8.748   40.090  1.00 0.00 ? 455 ARG M NE  1  
ATOM 5773   C CZ  . ARG C 3 452 ? -68.248  9.361   40.170  1.00 0.00 ? 455 ARG M CZ  1  
ATOM 5774   N NH1 . ARG C 3 452 ? -67.408  9.450   39.117  1.00 0.00 ? 455 ARG M NH1 1  
ATOM 5775   N NH2 . ARG C 3 452 ? -67.855  9.865   41.360  1.00 0.00 ? 455 ARG M NH2 1  
ATOM 5776   N N   . GLN C 3 453 ? -73.597  3.449   38.172  1.00 0.00 ? 456 GLN M N   1  
ATOM 5777   C CA  . GLN C 3 453 ? -73.544  2.008   38.057  1.00 0.00 ? 456 GLN M CA  1  
ATOM 5778   C C   . GLN C 3 453 ? -73.059  1.564   36.702  1.00 0.00 ? 456 GLN M C   1  
ATOM 5779   O O   . GLN C 3 453 ? -72.434  0.509   36.548  1.00 0.00 ? 456 GLN M O   1  
ATOM 5780   C CB  . GLN C 3 453 ? -74.890  1.393   38.410  1.00 0.00 ? 456 GLN M CB  1  
ATOM 5781   C CG  . GLN C 3 453 ? -75.052  1.209   39.930  1.00 0.00 ? 456 GLN M CG  1  
ATOM 5782   C CD  . GLN C 3 453 ? -75.356  -0.229  40.307  1.00 0.00 ? 456 GLN M CD  1  
ATOM 5783   O OE1 . GLN C 3 453 ? -74.489  -1.112  40.131  1.00 0.00 ? 456 GLN M OE1 1  
ATOM 5784   N NE2 . GLN C 3 453 ? -76.583  -0.441  40.780  1.00 0.00 ? 456 GLN M NE2 1  
ATOM 5785   N N   . TYR C 3 454 ? -73.370  2.397   35.718  1.00 0.00 ? 457 TYR M N   1  
ATOM 5786   C CA  . TYR C 3 454 ? -72.951  2.167   34.338  1.00 0.00 ? 457 TYR M CA  1  
ATOM 5787   C C   . TYR C 3 454 ? -72.871  3.446   33.571  1.00 0.00 ? 457 TYR M C   1  
ATOM 5788   O O   . TYR C 3 454 ? -73.399  4.504   33.957  1.00 0.00 ? 457 TYR M O   1  
ATOM 5789   C CB  . TYR C 3 454 ? -73.832  1.218   33.563  1.00 0.00 ? 457 TYR M CB  1  
ATOM 5790   C CG  . TYR C 3 454 ? -74.883  0.533   34.375  1.00 0.00 ? 457 TYR M CG  1  
ATOM 5791   C CD1 . TYR C 3 454 ? -74.602  -0.621  35.102  1.00 0.00 ? 457 TYR M CD1 1  
ATOM 5792   C CD2 . TYR C 3 454 ? -76.174  1.063   34.419  1.00 0.00 ? 457 TYR M CD2 1  
ATOM 5793   C CE1 . TYR C 3 454 ? -75.579  -1.249  35.874  1.00 0.00 ? 457 TYR M CE1 1  
ATOM 5794   C CE2 . TYR C 3 454 ? -77.176  0.442   35.173  1.00 0.00 ? 457 TYR M CE2 1  
ATOM 5795   C CZ  . TYR C 3 454 ? -76.869  -0.701  35.905  1.00 0.00 ? 457 TYR M CZ  1  
ATOM 5796   O OH  . TYR C 3 454 ? -77.833  -1.323  36.657  1.00 0.00 ? 457 TYR M OH  1  
ATOM 5797   N N   . PHE C 3 455 ? -72.231  3.341   32.409  1.00 0.00 ? 458 PHE M N   1  
ATOM 5798   C CA  . PHE C 3 455 ? -72.055  4.509   31.569  1.00 0.00 ? 458 PHE M CA  1  
ATOM 5799   C C   . PHE C 3 455 ? -72.252  4.135   30.131  1.00 0.00 ? 458 PHE M C   1  
ATOM 5800   O O   . PHE C 3 455 ? -72.263  2.975   29.749  1.00 0.00 ? 458 PHE M O   1  
ATOM 5801   C CB  . PHE C 3 455 ? -70.694  5.171   31.800  1.00 0.00 ? 458 PHE M CB  1  
ATOM 5802   C CG  . PHE C 3 455 ? -69.546  4.395   31.196  1.00 0.00 ? 458 PHE M CG  1  
ATOM 5803   C CD1 . PHE C 3 455 ? -69.171  4.576   29.860  1.00 0.00 ? 458 PHE M CD1 1  
ATOM 5804   C CD2 . PHE C 3 455 ? -68.829  3.465   31.955  1.00 0.00 ? 458 PHE M CD2 1  
ATOM 5805   C CE1 . PHE C 3 455 ? -68.107  3.844   29.303  1.00 0.00 ? 458 PHE M CE1 1  
ATOM 5806   C CE2 . PHE C 3 455 ? -67.762  2.738   31.415  1.00 0.00 ? 458 PHE M CE2 1  
ATOM 5807   C CZ  . PHE C 3 455 ? -67.399  2.911   30.071  1.00 0.00 ? 458 PHE M CZ  1  
ATOM 5808   N N   . ILE C 3 456 ? -72.414  5.155   29.313  1.00 0.00 ? 459 ILE M N   1  
ATOM 5809   C CA  . ILE C 3 456 ? -72.562  4.939   27.900  1.00 0.00 ? 459 ILE M CA  1  
ATOM 5810   C C   . ILE C 3 456 ? -71.569  5.830   27.195  1.00 0.00 ? 459 ILE M C   1  
ATOM 5811   O O   . ILE C 3 456 ? -71.688  7.044   27.248  1.00 0.00 ? 459 ILE M O   1  
ATOM 5812   C CB  . ILE C 3 456 ? -73.969  5.232   27.455  1.00 0.00 ? 459 ILE M CB  1  
ATOM 5813   C CG1 . ILE C 3 456 ? -74.821  4.025   27.696  1.00 0.00 ? 459 ILE M CG1 1  
ATOM 5814   C CG2 . ILE C 3 456 ? -74.024  5.626   25.994  1.00 0.00 ? 459 ILE M CG2 1  
ATOM 5815   C CD1 . ILE C 3 456 ? -76.262  4.486   27.674  1.00 0.00 ? 459 ILE M CD1 1  
ATOM 5816   N N   . GLY C 3 457 ? -70.587  5.203   26.595  1.00 0.00 ? 460 GLY M N   1  
ATOM 5817   C CA  . GLY C 3 457 ? -69.561  5.939   25.933  1.00 0.00 ? 460 GLY M CA  1  
ATOM 5818   C C   . GLY C 3 457 ? -69.865  6.238   24.504  1.00 0.00 ? 460 GLY M C   1  
ATOM 5819   O O   . GLY C 3 457 ? -70.256  5.387   23.702  1.00 0.00 ? 460 GLY M O   1  
ATOM 5820   N N   . VAL C 3 458 ? -69.645  7.513   24.204  1.00 0.00 ? 461 VAL M N   1  
ATOM 5821   C CA  . VAL C 3 458 ? -69.847  8.041   22.905  1.00 0.00 ? 461 VAL M CA  1  
ATOM 5822   C C   . VAL C 3 458 ? -68.517  8.524   22.374  1.00 0.00 ? 461 VAL M C   1  
ATOM 5823   O O   . VAL C 3 458 ? -67.948  9.496   22.800  1.00 0.00 ? 461 VAL M O   1  
ATOM 5824   C CB  . VAL C 3 458 ? -70.929  9.105   22.910  1.00 0.00 ? 461 VAL M CB  1  
ATOM 5825   C CG1 . VAL C 3 458 ? -71.283  9.505   21.494  1.00 0.00 ? 461 VAL M CG1 1  
ATOM 5826   C CG2 . VAL C 3 458 ? -72.162  8.469   23.461  1.00 0.00 ? 461 VAL M CG2 1  
ATOM 5827   N N   . LEU C 3 459 ? -68.002  7.806   21.426  1.00 0.00 ? 462 LEU M N   1  
ATOM 5828   C CA  . LEU C 3 459 ? -66.743  8.076   20.827  1.00 0.00 ? 462 LEU M CA  1  
ATOM 5829   C C   . LEU C 3 459 ? -66.881  8.700   19.457  1.00 0.00 ? 462 LEU M C   1  
ATOM 5830   O O   . LEU C 3 459 ? -67.523  8.170   18.560  1.00 0.00 ? 462 LEU M O   1  
ATOM 5831   C CB  . LEU C 3 459 ? -65.910  6.785   20.765  1.00 0.00 ? 462 LEU M CB  1  
ATOM 5832   C CG  . LEU C 3 459 ? -64.864  6.769   19.658  1.00 0.00 ? 462 LEU M CG  1  
ATOM 5833   C CD1 . LEU C 3 459 ? -63.539  7.260   20.185  1.00 0.00 ? 462 LEU M CD1 1  
ATOM 5834   C CD2 . LEU C 3 459 ? -64.620  5.417   19.065  1.00 0.00 ? 462 LEU M CD2 1  
ATOM 5835   N N   . ASP C 3 460 ? -66.244  9.842   19.296  1.00 0.00 ? 463 ASP M N   1  
ATOM 5836   C CA  . ASP C 3 460 ? -66.202  10.601  18.067  1.00 0.00 ? 463 ASP M CA  1  
ATOM 5837   C C   . ASP C 3 460 ? -64.746  10.877  17.726  1.00 0.00 ? 463 ASP M C   1  
ATOM 5838   O O   . ASP C 3 460 ? -64.053  11.586  18.488  1.00 0.00 ? 463 ASP M O   1  
ATOM 5839   C CB  . ASP C 3 460 ? -66.946  11.924  18.265  1.00 0.00 ? 463 ASP M CB  1  
ATOM 5840   C CG  . ASP C 3 460 ? -66.792  12.991  17.224  1.00 0.00 ? 463 ASP M CG  1  
ATOM 5841   O OD1 . ASP C 3 460 ? -65.801  13.094  16.529  1.00 0.00 ? 463 ASP M OD1 1  
ATOM 5842   O OD2 . ASP C 3 460 ? -67.802  13.827  17.200  1.00 0.00 ? 463 ASP M OD2 1  
ATOM 5843   N N   . ILE C 3 461 ? -64.316  10.349  16.608  1.00 0.00 ? 464 ILE M N   1  
ATOM 5844   C CA  . ILE C 3 461 ? -62.985  10.417  16.084  1.00 0.00 ? 464 ILE M CA  1  
ATOM 5845   C C   . ILE C 3 461 ? -63.075  10.254  14.580  1.00 0.00 ? 464 ILE M C   1  
ATOM 5846   O O   . ILE C 3 461 ? -64.053  9.875   14.011  1.00 0.00 ? 464 ILE M O   1  
ATOM 5847   C CB  . ILE C 3 461 ? -62.072  9.308   16.644  1.00 0.00 ? 464 ILE M CB  1  
ATOM 5848   C CG1 . ILE C 3 461 ? -61.907  9.438   18.114  1.00 0.00 ? 464 ILE M CG1 1  
ATOM 5849   C CG2 . ILE C 3 461 ? -60.679  9.334   16.096  1.00 0.00 ? 464 ILE M CG2 1  
ATOM 5850   C CD1 . ILE C 3 461 ? -60.872  8.455   18.612  1.00 0.00 ? 464 ILE M CD1 1  
ATOM 5851   N N   . ALA C 3 462 ? -61.991  10.505  13.924  1.00 0.00 ? 465 ALA M N   1  
ATOM 5852   C CA  . ALA C 3 462 ? -61.905  10.321  12.515  1.00 0.00 ? 465 ALA M CA  1  
ATOM 5853   C C   . ALA C 3 462 ? -61.600  8.908   12.059  1.00 0.00 ? 465 ALA M C   1  
ATOM 5854   O O   . ALA C 3 462 ? -61.073  8.065   12.787  1.00 0.00 ? 465 ALA M O   1  
ATOM 5855   C CB  . ALA C 3 462 ? -60.899  11.285  11.957  1.00 0.00 ? 465 ALA M CB  1  
ATOM 5856   N N   . GLY C 3 463 ? -61.947  8.695   10.798  1.00 0.00 ? 466 GLY M N   1  
ATOM 5857   C CA  . GLY C 3 463 ? -61.734  7.423   10.221  1.00 0.00 ? 466 GLY M CA  1  
ATOM 5858   C C   . GLY C 3 463 ? -60.628  7.498   9.267   1.00 0.00 ? 466 GLY M C   1  
ATOM 5859   O O   . GLY C 3 463 ? -60.275  8.569   8.804   1.00 0.00 ? 466 GLY M O   1  
ATOM 5860   N N   . PHE C 3 464 ? -60.109  6.329   9.023   1.00 0.00 ? 467 PHE M N   1  
ATOM 5861   C CA  . PHE C 3 464 ? -59.045  6.077   8.110   1.00 0.00 ? 467 PHE M CA  1  
ATOM 5862   C C   . PHE C 3 464 ? -59.275  6.844   6.844   1.00 0.00 ? 467 PHE M C   1  
ATOM 5863   O O   . PHE C 3 464 ? -60.255  6.673   6.106   1.00 0.00 ? 467 PHE M O   1  
ATOM 5864   C CB  . PHE C 3 464 ? -59.053  4.554   7.904   1.00 0.00 ? 467 PHE M CB  1  
ATOM 5865   C CG  . PHE C 3 464 ? -57.835  3.913   7.318   1.00 0.00 ? 467 PHE M CG  1  
ATOM 5866   C CD1 . PHE C 3 464 ? -57.516  4.069   5.969   1.00 0.00 ? 467 PHE M CD1 1  
ATOM 5867   C CD2 . PHE C 3 464 ? -57.016  3.119   8.108   1.00 0.00 ? 467 PHE M CD2 1  
ATOM 5868   C CE1 . PHE C 3 464 ? -56.391  3.464   5.418   1.00 0.00 ? 467 PHE M CE1 1  
ATOM 5869   C CE2 . PHE C 3 464 ? -55.892  2.482   7.581   1.00 0.00 ? 467 PHE M CE2 1  
ATOM 5870   C CZ  . PHE C 3 464 ? -55.582  2.680   6.239   1.00 0.00 ? 467 PHE M CZ  1  
ATOM 5871   N N   . GLU C 3 465 ? -58.379  7.781   6.640   1.00 0.00 ? 468 GLU M N   1  
ATOM 5872   C CA  . GLU C 3 465 ? -58.371  8.637   5.479   1.00 0.00 ? 468 GLU M CA  1  
ATOM 5873   C C   . GLU C 3 465 ? -57.019  8.411   4.807   1.00 0.00 ? 468 GLU M C   1  
ATOM 5874   O O   . GLU C 3 465 ? -55.951  8.188   5.420   1.00 0.00 ? 468 GLU M O   1  
ATOM 5875   C CB  . GLU C 3 465 ? -58.652  10.112  5.805   1.00 0.00 ? 468 GLU M CB  1  
ATOM 5876   C CG  . GLU C 3 465 ? -60.192  10.370  5.738   1.00 0.00 ? 468 GLU M CG  1  
ATOM 5877   C CD  . GLU C 3 465 ? -60.606  11.808  5.663   1.00 0.00 ? 468 GLU M CD  1  
ATOM 5878   O OE1 . GLU C 3 465 ? -60.561  12.409  6.829   1.00 0.00 ? 468 GLU M OE1 1  
ATOM 5879   O OE2 . GLU C 3 465 ? -61.004  12.318  4.613   1.00 0.00 ? 468 GLU M OE2 1  
ATOM 5880   N N   . ILE C 3 466 ? -57.076  8.356   3.503   1.00 0.00 ? 469 ILE M N   1  
ATOM 5881   C CA  . ILE C 3 466 ? -55.866  8.141   2.785   1.00 0.00 ? 469 ILE M CA  1  
ATOM 5882   C C   . ILE C 3 466 ? -55.549  9.347   1.965   1.00 0.00 ? 469 ILE M C   1  
ATOM 5883   O O   . ILE C 3 466 ? -56.394  9.810   1.224   1.00 0.00 ? 469 ILE M O   1  
ATOM 5884   C CB  . ILE C 3 466 ? -56.002  6.944   1.867   1.00 0.00 ? 469 ILE M CB  1  
ATOM 5885   C CG1 . ILE C 3 466 ? -56.245  5.669   2.664   1.00 0.00 ? 469 ILE M CG1 1  
ATOM 5886   C CG2 . ILE C 3 466 ? -54.749  6.772   1.049   1.00 0.00 ? 469 ILE M CG2 1  
ATOM 5887   C CD1 . ILE C 3 466 ? -56.913  4.598   1.840   1.00 0.00 ? 469 ILE M CD1 1  
ATOM 5888   N N   . PHE C 3 467 ? -54.360  9.831   2.076   1.00 0.00 ? 470 PHE M N   1  
ATOM 5889   C CA  . PHE C 3 467 ? -54.018  10.966  1.280   1.00 0.00 ? 470 PHE M CA  1  
ATOM 5890   C C   . PHE C 3 467 ? -52.805  10.681  0.482   1.00 0.00 ? 470 PHE M C   1  
ATOM 5891   O O   . PHE C 3 467 ? -52.030  9.791   0.832   1.00 0.00 ? 470 PHE M O   1  
ATOM 5892   C CB  . PHE C 3 467 ? -53.765  12.175  2.133   1.00 0.00 ? 470 PHE M CB  1  
ATOM 5893   C CG  . PHE C 3 467 ? -54.864  12.420  3.130   1.00 0.00 ? 470 PHE M CG  1  
ATOM 5894   C CD1 . PHE C 3 467 ? -56.118  12.874  2.727   1.00 0.00 ? 470 PHE M CD1 1  
ATOM 5895   C CD2 . PHE C 3 467 ? -54.598  12.269  4.487   1.00 0.00 ? 470 PHE M CD2 1  
ATOM 5896   C CE1 . PHE C 3 467 ? -57.100  13.160  3.676   1.00 0.00 ? 470 PHE M CE1 1  
ATOM 5897   C CE2 . PHE C 3 467 ? -55.559  12.540  5.459   1.00 0.00 ? 470 PHE M CE2 1  
ATOM 5898   C CZ  . PHE C 3 467 ? -56.810  12.987  5.041   1.00 0.00 ? 470 PHE M CZ  1  
ATOM 5899   N N   . ASP C 3 468 ? -52.640  11.441  -0.576  1.00 0.00 ? 471 ASP M N   1  
ATOM 5900   C CA  . ASP C 3 468 ? -51.472  11.218  -1.391  1.00 0.00 ? 471 ASP M CA  1  
ATOM 5901   C C   . ASP C 3 468 ? -50.278  11.486  -0.515  1.00 0.00 ? 471 ASP M C   1  
ATOM 5902   O O   . ASP C 3 468 ? -49.203  10.946  -0.747  1.00 0.00 ? 471 ASP M O   1  
ATOM 5903   C CB  . ASP C 3 468 ? -51.424  12.137  -2.610  1.00 0.00 ? 471 ASP M CB  1  
ATOM 5904   C CG  . ASP C 3 468 ? -52.511  13.151  -2.507  1.00 0.00 ? 471 ASP M CG  1  
ATOM 5905   O OD1 . ASP C 3 468 ? -53.708  12.636  -2.663  1.00 0.00 ? 471 ASP M OD1 1  
ATOM 5906   O OD2 . ASP C 3 468 ? -52.295  14.294  -2.206  1.00 0.00 ? 471 ASP M OD2 1  
ATOM 5907   N N   . PHE C 3 469 ? -50.554  12.337  0.497   1.00 0.00 ? 472 PHE M N   1  
ATOM 5908   C CA  . PHE C 3 469 ? -49.549  12.689  1.467   1.00 0.00 ? 472 PHE M CA  1  
ATOM 5909   C C   . PHE C 3 469 ? -49.900  12.243  2.869   1.00 0.00 ? 472 PHE M C   1  
ATOM 5910   O O   . PHE C 3 469 ? -50.726  12.854  3.494   1.00 0.00 ? 472 PHE M O   1  
ATOM 5911   C CB  . PHE C 3 469 ? -49.325  14.157  1.504   1.00 0.00 ? 472 PHE M CB  1  
ATOM 5912   C CG  . PHE C 3 469 ? -48.099  14.543  2.310   1.00 0.00 ? 472 PHE M CG  1  
ATOM 5913   C CD1 . PHE C 3 469 ? -46.831  14.407  1.748   1.00 0.00 ? 472 PHE M CD1 1  
ATOM 5914   C CD2 . PHE C 3 469 ? -48.211  15.029  3.609   1.00 0.00 ? 472 PHE M CD2 1  
ATOM 5915   C CE1 . PHE C 3 469 ? -45.693  14.751  2.487   1.00 0.00 ? 472 PHE M CE1 1  
ATOM 5916   C CE2 . PHE C 3 469 ? -47.076  15.376  4.357   1.00 0.00 ? 472 PHE M CE2 1  
ATOM 5917   C CZ  . PHE C 3 469 ? -45.819  15.224  3.789   1.00 0.00 ? 472 PHE M CZ  1  
ATOM 5918   N N   . ASN C 3 470 ? -49.211  11.223  3.364   1.00 0.00 ? 473 ASN M N   1  
ATOM 5919   C CA  . ASN C 3 470 ? -49.487  10.760  4.682   1.00 0.00 ? 473 ASN M CA  1  
ATOM 5920   C C   . ASN C 3 470 ? -48.326  10.977  5.610   1.00 0.00 ? 473 ASN M C   1  
ATOM 5921   O O   . ASN C 3 470 ? -47.250  10.445  5.425   1.00 0.00 ? 473 ASN M O   1  
ATOM 5922   C CB  . ASN C 3 470 ? -49.889  9.296   4.677   1.00 0.00 ? 473 ASN M CB  1  
ATOM 5923   C CG  . ASN C 3 470 ? -50.986  9.207   3.677   1.00 0.00 ? 473 ASN M CG  1  
ATOM 5924   O OD1 . ASN C 3 470 ? -52.094  9.591   3.962   1.00 0.00 ? 473 ASN M OD1 1  
ATOM 5925   N ND2 . ASN C 3 470 ? -50.613  8.785   2.488   1.00 0.00 ? 473 ASN M ND2 1  
ATOM 5926   N N   . SER C 3 471 ? -48.577  11.795  6.584   1.00 0.00 ? 474 SER M N   1  
ATOM 5927   C CA  . SER C 3 471 ? -47.561  12.063  7.544   1.00 0.00 ? 474 SER M CA  1  
ATOM 5928   C C   . SER C 3 471 ? -47.935  11.482  8.874   1.00 0.00 ? 474 SER M C   1  
ATOM 5929   O O   . SER C 3 471 ? -48.911  10.731  9.001   1.00 0.00 ? 474 SER M O   1  
ATOM 5930   C CB  . SER C 3 471 ? -47.156  13.516  7.659   1.00 0.00 ? 474 SER M CB  1  
ATOM 5931   O OG  . SER C 3 471 ? -45.767  13.525  8.017   1.00 0.00 ? 474 SER M OG  1  
ATOM 5932   N N   . PHE C 3 472 ? -47.119  11.857  9.845   1.00 0.00 ? 475 PHE M N   1  
ATOM 5933   C CA  . PHE C 3 472 ? -47.196  11.368  11.204  1.00 0.00 ? 475 PHE M CA  1  
ATOM 5934   C C   . PHE C 3 472 ? -48.585  11.305  11.748  1.00 0.00 ? 475 PHE M C   1  
ATOM 5935   O O   . PHE C 3 472 ? -49.020  10.319  12.328  1.00 0.00 ? 475 PHE M O   1  
ATOM 5936   C CB  . PHE C 3 472 ? -46.371  12.287  12.056  1.00 0.00 ? 475 PHE M CB  1  
ATOM 5937   C CG  . PHE C 3 472 ? -46.413  11.991  13.500  1.00 0.00 ? 475 PHE M CG  1  
ATOM 5938   C CD1 . PHE C 3 472 ? -45.961  10.780  14.027  1.00 0.00 ? 475 PHE M CD1 1  
ATOM 5939   C CD2 . PHE C 3 472 ? -46.806  12.978  14.396  1.00 0.00 ? 475 PHE M CD2 1  
ATOM 5940   C CE1 . PHE C 3 472 ? -45.947  10.530  15.408  1.00 0.00 ? 475 PHE M CE1 1  
ATOM 5941   C CE2 . PHE C 3 472 ? -46.812  12.748  15.783  1.00 0.00 ? 475 PHE M CE2 1  
ATOM 5942   C CZ  . PHE C 3 472 ? -46.363  11.526  16.298  1.00 0.00 ? 475 PHE M CZ  1  
ATOM 5943   N N   . GLU C 3 473 ? -49.280  12.398  11.584  1.00 0.00 ? 476 GLU M N   1  
ATOM 5944   C CA  . GLU C 3 473 ? -50.653  12.487  12.098  1.00 0.00 ? 476 GLU M CA  1  
ATOM 5945   C C   . GLU C 3 473 ? -51.554  11.386  11.532  1.00 0.00 ? 476 GLU M C   1  
ATOM 5946   O O   . GLU C 3 473 ? -52.417  10.830  12.200  1.00 0.00 ? 476 GLU M O   1  
ATOM 5947   C CB  . GLU C 3 473 ? -51.225  13.881  11.892  1.00 0.00 ? 476 GLU M CB  1  
ATOM 5948   C CG  . GLU C 3 473 ? -50.168  15.031  12.079  1.00 0.00 ? 476 GLU M CG  1  
ATOM 5949   C CD  . GLU C 3 473 ? -49.264  15.285  10.908  1.00 0.00 ? 476 GLU M CD  1  
ATOM 5950   O OE1 . GLU C 3 473 ? -49.852  15.430  9.703   1.00 0.00 ? 476 GLU M OE1 1  
ATOM 5951   O OE2 . GLU C 3 473 ? -48.082  15.322  11.035  1.00 0.00 ? 476 GLU M OE2 1  
ATOM 5952   N N   . GLN C 3 474 ? -51.313  11.023  10.273  1.00 0.00 ? 477 GLN M N   1  
ATOM 5953   C CA  . GLN C 3 474 ? -52.075  10.013  9.613   1.00 0.00 ? 477 GLN M CA  1  
ATOM 5954   C C   . GLN C 3 474 ? -51.864  8.640   10.226  1.00 0.00 ? 477 GLN M C   1  
ATOM 5955   O O   . GLN C 3 474 ? -52.749  7.804   10.424  1.00 0.00 ? 477 GLN M O   1  
ATOM 5956   C CB  . GLN C 3 474 ? -51.802  10.018  8.153   1.00 0.00 ? 477 GLN M CB  1  
ATOM 5957   C CG  . GLN C 3 474 ? -52.619  11.092  7.468   1.00 0.00 ? 477 GLN M CG  1  
ATOM 5958   C CD  . GLN C 3 474 ? -52.004  12.491  7.564   1.00 0.00 ? 477 GLN M CD  1  
ATOM 5959   O OE1 . GLN C 3 474 ? -50.902  12.770  7.047   1.00 0.00 ? 477 GLN M OE1 1  
ATOM 5960   N NE2 . GLN C 3 474 ? -52.714  13.369  8.267   1.00 0.00 ? 477 GLN M NE2 1  
ATOM 5961   N N   . LEU C 3 475 ? -50.619  8.377   10.502  1.00 0.00 ? 478 LEU M N   1  
ATOM 5962   C CA  . LEU C 3 475 ? -50.290  7.119   11.145  1.00 0.00 ? 478 LEU M CA  1  
ATOM 5963   C C   . LEU C 3 475 ? -51.078  6.997   12.460  1.00 0.00 ? 478 LEU M C   1  
ATOM 5964   O O   . LEU C 3 475 ? -51.774  6.054   12.732  1.00 0.00 ? 478 LEU M O   1  
ATOM 5965   C CB  . LEU C 3 475 ? -48.810  7.124   11.484  1.00 0.00 ? 478 LEU M CB  1  
ATOM 5966   C CG  . LEU C 3 475 ? -48.402  5.909   12.258  1.00 0.00 ? 478 LEU M CG  1  
ATOM 5967   C CD1 . LEU C 3 475 ? -48.688  4.756   11.270  1.00 0.00 ? 478 LEU M CD1 1  
ATOM 5968   C CD2 . LEU C 3 475 ? -46.908  6.060   12.529  1.00 0.00 ? 478 LEU M CD2 1  
ATOM 5969   N N   . CYS C 3 476 ? -50.990  8.036   13.297  1.00 0.00 ? 479 CYS M N   1  
ATOM 5970   C CA  . CYS C 3 476 ? -51.652  8.021   14.566  1.00 0.00 ? 479 CYS M CA  1  
ATOM 5971   C C   . CYS C 3 476 ? -53.140  7.738   14.416  1.00 0.00 ? 479 CYS M C   1  
ATOM 5972   O O   . CYS C 3 476 ? -53.747  6.895   15.103  1.00 0.00 ? 479 CYS M O   1  
ATOM 5973   C CB  . CYS C 3 476 ? -51.410  9.161   15.529  1.00 0.00 ? 479 CYS M CB  1  
ATOM 5974   S SG  . CYS C 3 476 ? -49.770  9.658   15.705  1.00 0.00 ? 479 CYS M SG  1  
ATOM 5975   N N   . ILE C 3 477 ? -53.765  8.396   13.467  1.00 0.00 ? 480 ILE M N   1  
ATOM 5976   C CA  . ILE C 3 477 ? -55.187  8.184   13.288  1.00 0.00 ? 480 ILE M CA  1  
ATOM 5977   C C   . ILE C 3 477 ? -55.478  6.821   12.712  1.00 0.00 ? 480 ILE M C   1  
ATOM 5978   O O   . ILE C 3 477 ? -56.321  6.096   13.205  1.00 0.00 ? 480 ILE M O   1  
ATOM 5979   C CB  . ILE C 3 477 ? -55.866  9.261   12.497  1.00 0.00 ? 480 ILE M CB  1  
ATOM 5980   C CG1 . ILE C 3 477 ? -57.010  9.828   13.308  1.00 0.00 ? 480 ILE M CG1 1  
ATOM 5981   C CG2 . ILE C 3 477 ? -56.509  8.544   11.355  1.00 0.00 ? 480 ILE M CG2 1  
ATOM 5982   C CD1 . ILE C 3 477 ? -56.690  11.216  13.835  1.00 0.00 ? 480 ILE M CD1 1  
ATOM 5983   N N   . ASN C 3 478 ? -54.754  6.466   11.647  1.00 0.00 ? 481 ASN M N   1  
ATOM 5984   C CA  . ASN C 3 478 ? -54.963  5.184   11.002  1.00 0.00 ? 481 ASN M CA  1  
ATOM 5985   C C   . ASN C 3 478 ? -54.801  4.078   11.995  1.00 0.00 ? 481 ASN M C   1  
ATOM 5986   O O   . ASN C 3 478 ? -55.608  3.163   12.053  1.00 0.00 ? 481 ASN M O   1  
ATOM 5987   C CB  . ASN C 3 478 ? -53.983  4.998   9.854   1.00 0.00 ? 481 ASN M CB  1  
ATOM 5988   C CG  . ASN C 3 478 ? -54.278  6.067   8.808   1.00 0.00 ? 481 ASN M CG  1  
ATOM 5989   O OD1 . ASN C 3 478 ? -53.846  6.085   7.652   1.00 0.00 ? 481 ASN M OD1 1  
ATOM 5990   N ND2 . ASN C 3 478 ? -55.084  6.990   9.218   1.00 0.00 ? 481 ASN M ND2 1  
ATOM 5991   N N   . PHE C 3 479 ? -53.779  4.212   12.782  1.00 0.00 ? 482 PHE M N   1  
ATOM 5992   C CA  . PHE C 3 479 ? -53.520  3.223   13.782  1.00 0.00 ? 482 PHE M CA  1  
ATOM 5993   C C   . PHE C 3 479 ? -54.692  3.107   14.710  1.00 0.00 ? 482 PHE M C   1  
ATOM 5994   O O   . PHE C 3 479 ? -55.063  2.069   15.112  1.00 0.00 ? 482 PHE M O   1  
ATOM 5995   C CB  . PHE C 3 479 ? -52.318  3.695   14.585  1.00 0.00 ? 482 PHE M CB  1  
ATOM 5996   C CG  . PHE C 3 479 ? -52.020  2.744   15.711  1.00 0.00 ? 482 PHE M CG  1  
ATOM 5997   C CD1 . PHE C 3 479 ? -51.960  1.367   15.511  1.00 0.00 ? 482 PHE M CD1 1  
ATOM 5998   C CD2 . PHE C 3 479 ? -51.750  3.263   16.968  1.00 0.00 ? 482 PHE M CD2 1  
ATOM 5999   C CE1 . PHE C 3 479 ? -51.646  0.519   16.577  1.00 0.00 ? 482 PHE M CE1 1  
ATOM 6000   C CE2 . PHE C 3 479 ? -51.431  2.427   18.029  1.00 0.00 ? 482 PHE M CE2 1  
ATOM 6001   C CZ  . PHE C 3 479 ? -51.371  1.056   17.828  1.00 0.00 ? 482 PHE M CZ  1  
ATOM 6002   N N   . THR C 3 480 ? -55.311  4.255   15.008  1.00 0.00 ? 483 THR M N   1  
ATOM 6003   C CA  . THR C 3 480 ? -56.421  4.227   15.902  1.00 0.00 ? 483 THR M CA  1  
ATOM 6004   C C   . THR C 3 480 ? -57.515  3.426   15.289  1.00 0.00 ? 483 THR M C   1  
ATOM 6005   O O   . THR C 3 480 ? -58.106  2.543   15.867  1.00 0.00 ? 483 THR M O   1  
ATOM 6006   C CB  . THR C 3 480 ? -56.938  5.608   16.185  1.00 0.00 ? 483 THR M CB  1  
ATOM 6007   O OG1 . THR C 3 480 ? -55.808  6.356   16.463  1.00 0.00 ? 483 THR M OG1 1  
ATOM 6008   C CG2 . THR C 3 480 ? -57.893  5.530   17.315  1.00 0.00 ? 483 THR M CG2 1  
ATOM 6009   N N   . ASN C 3 481 ? -57.774  3.731   14.040  1.00 0.00 ? 484 ASN M N   1  
ATOM 6010   C CA  . ASN C 3 481 ? -58.839  3.055   13.325  1.00 0.00 ? 484 ASN M CA  1  
ATOM 6011   C C   . ASN C 3 481 ? -58.559  1.571   13.101  1.00 0.00 ? 484 ASN M C   1  
ATOM 6012   O O   . ASN C 3 481 ? -59.413  0.717   13.247  1.00 0.00 ? 484 ASN M O   1  
ATOM 6013   C CB  . ASN C 3 481 ? -59.220  3.783   12.021  1.00 0.00 ? 484 ASN M CB  1  
ATOM 6014   C CG  . ASN C 3 481 ? -60.180  4.948   12.204  1.00 0.00 ? 484 ASN M CG  1  
ATOM 6015   O OD1 . ASN C 3 481 ? -61.320  4.810   12.644  1.00 0.00 ? 484 ASN M OD1 1  
ATOM 6016   N ND2 . ASN C 3 481 ? -59.744  6.118   11.835  1.00 0.00 ? 484 ASN M ND2 1  
ATOM 6017   N N   . GLU C 3 482 ? -57.354  1.217   12.723  1.00 0.00 ? 485 GLU M N   1  
ATOM 6018   C CA  . GLU C 3 482 ? -57.118  -0.176  12.477  1.00 0.00 ? 485 GLU M CA  1  
ATOM 6019   C C   . GLU C 3 482 ? -57.358  -1.004  13.718  1.00 0.00 ? 485 GLU M C   1  
ATOM 6020   O O   . GLU C 3 482 ? -57.631  -2.179  13.718  1.00 0.00 ? 485 GLU M O   1  
ATOM 6021   C CB  . GLU C 3 482 ? -55.716  -0.470  11.996  1.00 0.00 ? 485 GLU M CB  1  
ATOM 6022   C CG  . GLU C 3 482 ? -55.643  -1.844  11.376  1.00 0.00 ? 485 GLU M CG  1  
ATOM 6023   C CD  . GLU C 3 482 ? -55.006  -1.822  10.033  1.00 0.00 ? 485 GLU M CD  1  
ATOM 6024   O OE1 . GLU C 3 482 ? -54.525  -0.660  9.746   1.00 0.00 ? 485 GLU M OE1 1  
ATOM 6025   O OE2 . GLU C 3 482 ? -54.979  -2.795  9.299   1.00 0.00 ? 485 GLU M OE2 1  
ATOM 6026   N N   . LYS C 3 483 ? -57.340  -0.378  14.842  1.00 0.00 ? 486 LYS M N   1  
ATOM 6027   C CA  . LYS C 3 483 ? -57.536  -1.010  16.106  1.00 0.00 ? 486 LYS M CA  1  
ATOM 6028   C C   . LYS C 3 483 ? -59.003  -1.187  16.316  1.00 0.00 ? 486 LYS M C   1  
ATOM 6029   O O   . LYS C 3 483 ? -59.478  -2.254  16.620  1.00 0.00 ? 486 LYS M O   1  
ATOM 6030   C CB  . LYS C 3 483 ? -56.911  -0.190  17.247  1.00 0.00 ? 486 LYS M CB  1  
ATOM 6031   C CG  . LYS C 3 483 ? -55.535  -0.649  17.707  1.00 0.00 ? 486 LYS M CG  1  
ATOM 6032   C CD  . LYS C 3 483 ? -55.198  -0.341  19.170  1.00 0.00 ? 486 LYS M CD  1  
ATOM 6033   C CE  . LYS C 3 483 ? -54.374  -1.435  19.819  1.00 0.00 ? 486 LYS M CE  1  
ATOM 6034   N NZ  . LYS C 3 483 ? -54.185  -1.309  21.260  1.00 0.00 ? 486 LYS M NZ  1  
ATOM 6035   N N   . LEU C 3 484 ? -59.719  -0.072  16.162  1.00 0.00 ? 487 LEU M N   1  
ATOM 6036   C CA  . LEU C 3 484 ? -61.169  0.038   16.285  1.00 0.00 ? 487 LEU M CA  1  
ATOM 6037   C C   . LEU C 3 484 ? -61.862  -1.036  15.449  1.00 0.00 ? 487 LEU M C   1  
ATOM 6038   O O   . LEU C 3 484 ? -62.757  -1.765  15.868  1.00 0.00 ? 487 LEU M O   1  
ATOM 6039   C CB  . LEU C 3 484 ? -61.546  1.396   15.744  1.00 0.00 ? 487 LEU M CB  1  
ATOM 6040   C CG  . LEU C 3 484 ? -61.852  2.495   16.772  1.00 0.00 ? 487 LEU M CG  1  
ATOM 6041   C CD1 . LEU C 3 484 ? -61.478  2.206   18.162  1.00 0.00 ? 487 LEU M CD1 1  
ATOM 6042   C CD2 . LEU C 3 484 ? -61.168  3.747   16.346  1.00 0.00 ? 487 LEU M CD2 1  
ATOM 6043   N N   . GLN C 3 485 ? -61.355  -1.188  14.227  1.00 0.00 ? 488 GLN M N   1  
ATOM 6044   C CA  . GLN C 3 485 ? -61.818  -2.191  13.287  1.00 0.00 ? 488 GLN M CA  1  
ATOM 6045   C C   . GLN C 3 485 ? -61.738  -3.614  13.823  1.00 0.00 ? 488 GLN M C   1  
ATOM 6046   O O   . GLN C 3 485 ? -62.715  -4.342  13.797  1.00 0.00 ? 488 GLN M O   1  
ATOM 6047   C CB  . GLN C 3 485 ? -61.043  -2.143  11.984  1.00 0.00 ? 488 GLN M CB  1  
ATOM 6048   C CG  . GLN C 3 485 ? -61.752  -2.956  10.924  1.00 0.00 ? 488 GLN M CG  1  
ATOM 6049   C CD  . GLN C 3 485 ? -63.203  -2.593  10.827  1.00 0.00 ? 488 GLN M CD  1  
ATOM 6050   O OE1 . GLN C 3 485 ? -63.550  -1.404  10.704  1.00 0.00 ? 488 GLN M OE1 1  
ATOM 6051   N NE2 . GLN C 3 485 ? -64.043  -3.612  10.989  1.00 0.00 ? 488 GLN M NE2 1  
ATOM 6052   N N   . GLN C 3 486 ? -60.558  -3.989  14.306  1.00 0.00 ? 489 GLN M N   1  
ATOM 6053   C CA  . GLN C 3 486 ? -60.313  -5.278  14.881  1.00 0.00 ? 489 GLN M CA  1  
ATOM 6054   C C   . GLN C 3 486 ? -61.215  -5.500  16.009  1.00 0.00 ? 489 GLN M C   1  
ATOM 6055   O O   . GLN C 3 486 ? -61.648  -6.601  16.281  1.00 0.00 ? 489 GLN M O   1  
ATOM 6056   C CB  . GLN C 3 486 ? -58.888  -5.460  15.341  1.00 0.00 ? 489 GLN M CB  1  
ATOM 6057   C CG  . GLN C 3 486 ? -58.561  -6.906  15.819  1.00 0.00 ? 489 GLN M CG  1  
ATOM 6058   C CD  . GLN C 3 486 ? -57.154  -7.054  16.403  1.00 0.00 ? 489 GLN M CD  1  
ATOM 6059   O OE1 . GLN C 3 486 ? -56.785  -6.317  17.347  1.00 0.00 ? 489 GLN M OE1 1  
ATOM 6060   N NE2 . GLN C 3 486 ? -56.365  -7.993  15.821  1.00 0.00 ? 489 GLN M NE2 1  
ATOM 6061   N N   . PHE C 3 487 ? -61.551  -4.369  16.610  1.00 0.00 ? 490 PHE M N   1  
ATOM 6062   C CA  . PHE C 3 487 ? -62.417  -4.370  17.797  1.00 0.00 ? 490 PHE M CA  1  
ATOM 6063   C C   . PHE C 3 487 ? -63.795  -4.831  17.457  1.00 0.00 ? 490 PHE M C   1  
ATOM 6064   O O   . PHE C 3 487 ? -64.490  -5.537  18.170  1.00 0.00 ? 490 PHE M O   1  
ATOM 6065   C CB  . PHE C 3 487 ? -62.518  -2.978  18.347  1.00 0.00 ? 490 PHE M CB  1  
ATOM 6066   C CG  . PHE C 3 487 ? -63.453  -2.893  19.517  1.00 0.00 ? 490 PHE M CG  1  
ATOM 6067   C CD1 . PHE C 3 487 ? -63.330  -3.722  20.618  1.00 0.00 ? 490 PHE M CD1 1  
ATOM 6068   C CD2 . PHE C 3 487 ? -64.494  -1.972  19.520  1.00 0.00 ? 490 PHE M CD2 1  
ATOM 6069   C CE1 . PHE C 3 487 ? -64.193  -3.647  21.708  1.00 0.00 ? 490 PHE M CE1 1  
ATOM 6070   C CE2 . PHE C 3 487 ? -65.383  -1.891  20.590  1.00 0.00 ? 490 PHE M CE2 1  
ATOM 6071   C CZ  . PHE C 3 487 ? -65.232  -2.729  21.692  1.00 0.00 ? 490 PHE M CZ  1  
ATOM 6072   N N   . PHE C 3 488 ? -64.180  -4.443  16.271  1.00 0.00 ? 491 PHE M N   1  
ATOM 6073   C CA  . PHE C 3 488 ? -65.444  -4.821  15.710  1.00 0.00 ? 491 PHE M CA  1  
ATOM 6074   C C   . PHE C 3 488 ? -65.429  -6.275  15.233  1.00 0.00 ? 491 PHE M C   1  
ATOM 6075   O O   . PHE C 3 488 ? -66.164  -7.105  15.722  1.00 0.00 ? 491 PHE M O   1  
ATOM 6076   C CB  . PHE C 3 488 ? -65.626  -3.886  14.577  1.00 0.00 ? 491 PHE M CB  1  
ATOM 6077   C CG  . PHE C 3 488 ? -66.759  -4.235  13.682  1.00 0.00 ? 491 PHE M CG  1  
ATOM 6078   C CD1 . PHE C 3 488 ? -68.054  -3.831  14.025  1.00 0.00 ? 491 PHE M CD1 1  
ATOM 6079   C CD2 . PHE C 3 488 ? -66.537  -4.931  12.501  1.00 0.00 ? 491 PHE M CD2 1  
ATOM 6080   C CE1 . PHE C 3 488 ? -69.135  -4.134  13.203  1.00 0.00 ? 491 PHE M CE1 1  
ATOM 6081   C CE2 . PHE C 3 488 ? -67.615  -5.259  11.663  1.00 0.00 ? 491 PHE M CE2 1  
ATOM 6082   C CZ  . PHE C 3 488 ? -68.891  -4.845  12.017  1.00 0.00 ? 491 PHE M CZ  1  
ATOM 6083   N N   . ASN C 3 489 ? -64.531  -6.550  14.283  1.00 0.00 ? 492 ASN M N   1  
ATOM 6084   C CA  . ASN C 3 489 ? -64.343  -7.871  13.693  1.00 0.00 ? 492 ASN M CA  1  
ATOM 6085   C C   . ASN C 3 489 ? -64.403  -8.982  14.718  1.00 0.00 ? 492 ASN M C   1  
ATOM 6086   O O   . ASN C 3 489 ? -64.716  -10.105 14.457  1.00 0.00 ? 492 ASN M O   1  
ATOM 6087   C CB  . ASN C 3 489 ? -62.979  -7.999  12.999  1.00 0.00 ? 492 ASN M CB  1  
ATOM 6088   C CG  . ASN C 3 489 ? -62.879  -7.226  11.730  1.00 0.00 ? 492 ASN M CG  1  
ATOM 6089   O OD1 . ASN C 3 489 ? -63.446  -6.179  11.651  1.00 0.00 ? 492 ASN M OD1 1  
ATOM 6090   N ND2 . ASN C 3 489 ? -62.062  -7.716  10.801  1.00 0.00 ? 492 ASN M ND2 1  
ATOM 6091   N N   . HIS C 3 490 ? -64.003  -8.635  15.916  1.00 0.00 ? 493 HIS M N   1  
ATOM 6092   C CA  . HIS C 3 490 ? -64.020  -9.605  16.957  1.00 0.00 ? 493 HIS M CA  1  
ATOM 6093   C C   . HIS C 3 490 ? -65.404  -9.741  17.525  1.00 0.00 ? 493 HIS M C   1  
ATOM 6094   O O   . HIS C 3 490 ? -65.976  -10.834 17.594  1.00 0.00 ? 493 HIS M O   1  
ATOM 6095   C CB  . HIS C 3 490 ? -63.004  -9.176  18.040  1.00 0.00 ? 493 HIS M CB  1  
ATOM 6096   C CG  . HIS C 3 490 ? -62.977  -10.047 19.264  1.00 0.00 ? 493 HIS M CG  1  
ATOM 6097   N ND1 . HIS C 3 490 ? -61.973  -10.964 19.487  1.00 0.00 ? 493 HIS M ND1 1  
ATOM 6098   C CD2 . HIS C 3 490 ? -63.783  -10.112 20.314  1.00 0.00 ? 493 HIS M CD2 1  
ATOM 6099   C CE1 . HIS C 3 490 ? -62.219  -11.523 20.663  1.00 0.00 ? 493 HIS M CE1 1  
ATOM 6100   N NE2 . HIS C 3 490 ? -63.300  -11.021 21.205  1.00 0.00 ? 493 HIS M NE2 1  
ATOM 6101   N N   . HIS C 3 491 ? -65.973  -8.600  17.875  1.00 0.00 ? 494 HIS M N   1  
ATOM 6102   C CA  . HIS C 3 491 ? -67.310  -8.523  18.457  1.00 0.00 ? 494 HIS M CA  1  
ATOM 6103   C C   . HIS C 3 491 ? -68.254  -9.250  17.554  1.00 0.00 ? 494 HIS M C   1  
ATOM 6104   O O   . HIS C 3 491 ? -69.149  -9.918  17.943  1.00 0.00 ? 494 HIS M O   1  
ATOM 6105   C CB  . HIS C 3 491 ? -67.732  -7.090  18.531  1.00 0.00 ? 494 HIS M CB  1  
ATOM 6106   C CG  . HIS C 3 491 ? -69.131  -6.894  18.960  1.00 0.00 ? 494 HIS M CG  1  
ATOM 6107   N ND1 . HIS C 3 491 ? -69.498  -7.076  20.275  1.00 0.00 ? 494 HIS M ND1 1  
ATOM 6108   C CD2 . HIS C 3 491 ? -70.221  -6.438  18.288  1.00 0.00 ? 494 HIS M CD2 1  
ATOM 6109   C CE1 . HIS C 3 491 ? -70.812  -6.777  20.373  1.00 0.00 ? 494 HIS M CE1 1  
ATOM 6110   N NE2 . HIS C 3 491 ? -71.290  -6.395  19.196  1.00 0.00 ? 494 HIS M NE2 1  
ATOM 6111   N N   . MET C 3 492 ? -67.953  -9.212  16.295  1.00 0.00 ? 495 MET M N   1  
ATOM 6112   C CA  . MET C 3 492 ? -68.781  -9.875  15.345  1.00 0.00 ? 495 MET M CA  1  
ATOM 6113   C C   . MET C 3 492 ? -68.552  -11.363 15.346  1.00 0.00 ? 495 MET M C   1  
ATOM 6114   O O   . MET C 3 492 ? -69.439  -12.195 15.137  1.00 0.00 ? 495 MET M O   1  
ATOM 6115   C CB  . MET C 3 492 ? -68.645  -9.278  13.924  1.00 0.00 ? 495 MET M CB  1  
ATOM 6116   C CG  . MET C 3 492 ? -70.017  -8.965  13.313  1.00 0.00 ? 495 MET M CG  1  
ATOM 6117   S SD  . MET C 3 492 ? -69.932  -9.240  11.582  1.00 0.00 ? 495 MET M SD  1  
ATOM 6118   C CE  . MET C 3 492 ? -71.516  -8.413  11.200  1.00 0.00 ? 495 MET M CE  1  
ATOM 6119   N N   . PHE C 3 493 ? -67.327  -11.720 15.634  1.00 0.00 ? 496 PHE M N   1  
ATOM 6120   C CA  . PHE C 3 493 ? -66.991  -13.089 15.647  1.00 0.00 ? 496 PHE M CA  1  
ATOM 6121   C C   . PHE C 3 493 ? -67.586  -13.703 16.851  1.00 0.00 ? 496 PHE M C   1  
ATOM 6122   O O   . PHE C 3 493 ? -68.135  -14.725 16.813  1.00 0.00 ? 496 PHE M O   1  
ATOM 6123   C CB  . PHE C 3 493 ? -65.509  -13.164 15.766  1.00 0.00 ? 496 PHE M CB  1  
ATOM 6124   C CG  . PHE C 3 493 ? -64.984  -14.454 16.330  1.00 0.00 ? 496 PHE M CG  1  
ATOM 6125   C CD1 . PHE C 3 493 ? -64.764  -14.578 17.694  1.00 0.00 ? 496 PHE M CD1 1  
ATOM 6126   C CD2 . PHE C 3 493 ? -64.601  -15.503 15.487  1.00 0.00 ? 496 PHE M CD2 1  
ATOM 6127   C CE1 . PHE C 3 493 ? -64.195  -15.735 18.225  1.00 0.00 ? 496 PHE M CE1 1  
ATOM 6128   C CE2 . PHE C 3 493 ? -64.039  -16.670 15.977  1.00 0.00 ? 496 PHE M CE2 1  
ATOM 6129   C CZ  . PHE C 3 493 ? -63.872  -16.776 17.351  1.00 0.00 ? 496 PHE M CZ  1  
ATOM 6130   N N   . VAL C 3 494 ? -67.520  -13.017 17.888  1.00 0.00 ? 497 VAL M N   1  
ATOM 6131   C CA  . VAL C 3 494 ? -68.118  -13.482 19.090  1.00 0.00 ? 497 VAL M CA  1  
ATOM 6132   C C   . VAL C 3 494 ? -69.586  -13.651 18.913  1.00 0.00 ? 497 VAL M C   1  
ATOM 6133   O O   . VAL C 3 494 ? -70.157  -14.658 19.229  1.00 0.00 ? 497 VAL M O   1  
ATOM 6134   C CB  . VAL C 3 494 ? -67.908  -12.402 20.128  1.00 0.00 ? 497 VAL M CB  1  
ATOM 6135   C CG1 . VAL C 3 494 ? -68.784  -12.751 21.303  1.00 0.00 ? 497 VAL M CG1 1  
ATOM 6136   C CG2 . VAL C 3 494 ? -66.412  -12.298 20.413  1.00 0.00 ? 497 VAL M CG2 1  
ATOM 6137   N N   . LEU C 3 495 ? -70.197  -12.596 18.396  1.00 0.00 ? 498 LEU M N   1  
ATOM 6138   C CA  . LEU C 3 495 ? -71.623  -12.473 18.124  1.00 0.00 ? 498 LEU M CA  1  
ATOM 6139   C C   . LEU C 3 495 ? -72.154  -13.560 17.201  1.00 0.00 ? 498 LEU M C   1  
ATOM 6140   O O   . LEU C 3 495 ? -73.111  -14.254 17.507  1.00 0.00 ? 498 LEU M O   1  
ATOM 6141   C CB  . LEU C 3 495 ? -71.879  -11.108 17.459  1.00 0.00 ? 498 LEU M CB  1  
ATOM 6142   C CG  . LEU C 3 495 ? -73.143  -10.437 17.921  1.00 0.00 ? 498 LEU M CG  1  
ATOM 6143   C CD1 . LEU C 3 495 ? -72.880  -9.734  19.236  1.00 0.00 ? 498 LEU M CD1 1  
ATOM 6144   C CD2 . LEU C 3 495 ? -73.590  -9.469  16.833  1.00 0.00 ? 498 LEU M CD2 1  
ATOM 6145   N N   . GLU C 3 496 ? -71.511  -13.679 16.039  1.00 0.00 ? 499 GLU M N   1  
ATOM 6146   C CA  . GLU C 3 496 ? -71.876  -14.679 15.053  1.00 0.00 ? 499 GLU M CA  1  
ATOM 6147   C C   . GLU C 3 496 ? -72.015  -16.066 15.686  1.00 0.00 ? 499 GLU M C   1  
ATOM 6148   O O   . GLU C 3 496 ? -73.043  -16.732 15.647  1.00 0.00 ? 499 GLU M O   1  
ATOM 6149   C CB  . GLU C 3 496 ? -70.742  -14.805 14.097  1.00 0.00 ? 499 GLU M CB  1  
ATOM 6150   C CG  . GLU C 3 496 ? -70.937  -14.040 12.832  1.00 0.00 ? 499 GLU M CG  1  
ATOM 6151   C CD  . GLU C 3 496 ? -72.196  -14.464 12.163  1.00 0.00 ? 499 GLU M CD  1  
ATOM 6152   O OE1 . GLU C 3 496 ? -73.284  -14.141 12.608  1.00 0.00 ? 499 GLU M OE1 1  
ATOM 6153   O OE2 . GLU C 3 496 ? -72.023  -15.145 11.051  1.00 0.00 ? 499 GLU M OE2 1  
ATOM 6154   N N   . GLN C 3 497 ? -70.918  -16.484 16.254  1.00 0.00 ? 500 GLN M N   1  
ATOM 6155   C CA  . GLN C 3 497 ? -70.742  -17.726 16.914  1.00 0.00 ? 500 GLN M CA  1  
ATOM 6156   C C   . GLN C 3 497 ? -71.804  -18.057 17.965  1.00 0.00 ? 500 GLN M C   1  
ATOM 6157   O O   . GLN C 3 497 ? -72.054  -19.199 18.331  1.00 0.00 ? 500 GLN M O   1  
ATOM 6158   C CB  . GLN C 3 497 ? -69.253  -17.899 17.341  1.00 0.00 ? 500 GLN M CB  1  
ATOM 6159   C CG  . GLN C 3 497 ? -68.947  -18.869 18.488  1.00 0.00 ? 500 GLN M CG  1  
ATOM 6160   C CD  . GLN C 3 497 ? -67.492  -18.810 18.940  1.00 0.00 ? 500 GLN M CD  1  
ATOM 6161   O OE1 . GLN C 3 497 ? -67.150  -18.114 19.956  1.00 0.00 ? 500 GLN M OE1 1  
ATOM 6162   N NE2 . GLN C 3 497 ? -66.656  -19.584 18.182  1.00 0.00 ? 500 GLN M NE2 1  
ATOM 6163   N N   . GLU C 3 498 ? -72.519  -17.054 18.414  1.00 0.00 ? 501 GLU M N   1  
ATOM 6164   C CA  . GLU C 3 498 ? -73.543  -17.306 19.395  1.00 0.00 ? 501 GLU M CA  1  
ATOM 6165   C C   . GLU C 3 498 ? -74.723  -17.907 18.665  1.00 0.00 ? 501 GLU M C   1  
ATOM 6166   O O   . GLU C 3 498 ? -75.355  -18.838 19.147  1.00 0.00 ? 501 GLU M O   1  
ATOM 6167   C CB  . GLU C 3 498 ? -74.009  -15.992 20.032  1.00 0.00 ? 501 GLU M CB  1  
ATOM 6168   C CG  . GLU C 3 498 ? -74.078  -16.011 21.563  1.00 0.00 ? 501 GLU M CG  1  
ATOM 6169   C CD  . GLU C 3 498 ? -74.209  -14.618 22.116  1.00 0.00 ? 501 GLU M CD  1  
ATOM 6170   O OE1 . GLU C 3 498 ? -73.313  -13.801 21.647  1.00 0.00 ? 501 GLU M OE1 1  
ATOM 6171   O OE2 . GLU C 3 498 ? -75.051  -14.287 22.920  1.00 0.00 ? 501 GLU M OE2 1  
ATOM 6172   N N   . GLU C 3 499 ? -75.016  -17.349 17.486  1.00 0.00 ? 502 GLU M N   1  
ATOM 6173   C CA  . GLU C 3 499 ? -76.151  -17.808 16.690  1.00 0.00 ? 502 GLU M CA  1  
ATOM 6174   C C   . GLU C 3 499 ? -75.973  -19.264 16.375  1.00 0.00 ? 502 GLU M C   1  
ATOM 6175   O O   . GLU C 3 499 ? -76.769  -20.099 16.779  1.00 0.00 ? 502 GLU M O   1  
ATOM 6176   C CB  . GLU C 3 499 ? -76.377  -17.017 15.365  1.00 0.00 ? 502 GLU M CB  1  
ATOM 6177   C CG  . GLU C 3 499 ? -77.842  -17.069 14.863  1.00 0.00 ? 502 GLU M CG  1  
ATOM 6178   C CD  . GLU C 3 499 ? -78.743  -16.240 15.732  1.00 0.00 ? 502 GLU M CD  1  
ATOM 6179   O OE1 . GLU C 3 499 ? -78.391  -15.159 16.171  1.00 0.00 ? 502 GLU M OE1 1  
ATOM 6180   O OE2 . GLU C 3 499 ? -79.897  -16.821 16.003  1.00 0.00 ? 502 GLU M OE2 1  
ATOM 6181   N N   . TYR C 3 500 ? -74.887  -19.564 15.679  1.00 0.00 ? 503 TYR M N   1  
ATOM 6182   C CA  . TYR C 3 500 ? -74.639  -20.947 15.358  1.00 0.00 ? 503 TYR M CA  1  
ATOM 6183   C C   . TYR C 3 500 ? -74.677  -21.874 16.583  1.00 0.00 ? 503 TYR M C   1  
ATOM 6184   O O   . TYR C 3 500 ? -74.742  -23.086 16.464  1.00 0.00 ? 503 TYR M O   1  
ATOM 6185   C CB  . TYR C 3 500 ? -73.305  -21.050 14.623  1.00 0.00 ? 503 TYR M CB  1  
ATOM 6186   C CG  . TYR C 3 500 ? -73.234  -20.162 13.411  1.00 0.00 ? 503 TYR M CG  1  
ATOM 6187   C CD1 . TYR C 3 500 ? -74.332  -19.862 12.622  1.00 0.00 ? 503 TYR M CD1 1  
ATOM 6188   C CD2 . TYR C 3 500 ? -72.006  -19.658 13.031  1.00 0.00 ? 503 TYR M CD2 1  
ATOM 6189   C CE1 . TYR C 3 500 ? -74.196  -19.105 11.469  1.00 0.00 ? 503 TYR M CE1 1  
ATOM 6190   C CE2 . TYR C 3 500 ? -71.857  -18.869 11.900  1.00 0.00 ? 503 TYR M CE2 1  
ATOM 6191   C CZ  . TYR C 3 500 ? -72.965  -18.590 11.116  1.00 0.00 ? 503 TYR M CZ  1  
ATOM 6192   O OH  . TYR C 3 500 ? -72.874  -17.838 9.966   1.00 0.00 ? 503 TYR M OH  1  
ATOM 6193   N N   . LYS C 3 501 ? -74.669  -21.281 17.759  1.00 0.00 ? 504 LYS M N   1  
ATOM 6194   C CA  . LYS C 3 501 ? -74.656  -22.009 18.998  1.00 0.00 ? 504 LYS M CA  1  
ATOM 6195   C C   . LYS C 3 501 ? -76.073  -22.099 19.500  1.00 0.00 ? 504 LYS M C   1  
ATOM 6196   O O   . LYS C 3 501 ? -76.531  -23.127 20.009  1.00 0.00 ? 504 LYS M O   1  
ATOM 6197   C CB  . LYS C 3 501 ? -73.724  -21.367 20.003  1.00 0.00 ? 504 LYS M CB  1  
ATOM 6198   C CG  . LYS C 3 501 ? -73.865  -21.925 21.412  1.00 0.00 ? 504 LYS M CG  1  
ATOM 6199   C CD  . LYS C 3 501 ? -72.592  -22.624 21.904  1.00 0.00 ? 504 LYS M CD  1  
ATOM 6200   C CE  . LYS C 3 501 ? -72.844  -23.529 23.110  1.00 0.00 ? 504 LYS M CE  1  
ATOM 6201   N NZ  . LYS C 3 501 ? -71.815  -23.398 24.155  1.00 0.00 ? 504 LYS M NZ  1  
ATOM 6202   N N   . LYS C 3 502 ? -76.780  -20.995 19.303  1.00 0.00 ? 505 LYS M N   1  
ATOM 6203   C CA  . LYS C 3 502 ? -78.186  -20.878 19.671  1.00 0.00 ? 505 LYS M CA  1  
ATOM 6204   C C   . LYS C 3 502 ? -78.996  -21.839 18.775  1.00 0.00 ? 505 LYS M C   1  
ATOM 6205   O O   . LYS C 3 502 ? -79.741  -22.723 19.190  1.00 0.00 ? 505 LYS M O   1  
ATOM 6206   C CB  . LYS C 3 502 ? -78.624  -19.461 19.422  1.00 0.00 ? 505 LYS M CB  1  
ATOM 6207   C CG  . LYS C 3 502 ? -79.537  -18.918 20.480  1.00 0.00 ? 505 LYS M CG  1  
ATOM 6208   C CD  . LYS C 3 502 ? -79.832  -17.424 20.291  1.00 0.00 ? 505 LYS M CD  1  
ATOM 6209   C CE  . LYS C 3 502 ? -79.276  -16.568 21.413  1.00 0.00 ? 505 LYS M CE  1  
ATOM 6210   N NZ  . LYS C 3 502 ? -79.206  -15.150 21.074  1.00 0.00 ? 505 LYS M NZ  1  
ATOM 6211   N N   . GLU C 3 503 ? -78.785  -21.724 17.478  1.00 0.00 ? 506 GLU M N   1  
ATOM 6212   C CA  . GLU C 3 503 ? -79.452  -22.563 16.520  1.00 0.00 ? 506 GLU M CA  1  
ATOM 6213   C C   . GLU C 3 503 ? -78.952  -23.989 16.543  1.00 0.00 ? 506 GLU M C   1  
ATOM 6214   O O   . GLU C 3 503 ? -79.711  -24.947 16.499  1.00 0.00 ? 506 GLU M O   1  
ATOM 6215   C CB  . GLU C 3 503 ? -79.295  -21.976 15.102  1.00 0.00 ? 506 GLU M CB  1  
ATOM 6216   C CG  . GLU C 3 503 ? -80.534  -21.214 14.574  1.00 0.00 ? 506 GLU M CG  1  
ATOM 6217   C CD  . GLU C 3 503 ? -81.332  -20.483 15.632  1.00 0.00 ? 506 GLU M CD  1  
ATOM 6218   O OE1 . GLU C 3 503 ? -80.967  -20.266 16.753  1.00 0.00 ? 506 GLU M OE1 1  
ATOM 6219   O OE2 . GLU C 3 503 ? -82.521  -20.091 15.241  1.00 0.00 ? 506 GLU M OE2 1  
ATOM 6220   N N   . GLY C 3 504 ? -77.682  -24.163 16.579  1.00 0.00 ? 507 GLY M N   1  
ATOM 6221   C CA  . GLY C 3 504 ? -77.316  -25.536 16.562  1.00 0.00 ? 507 GLY M CA  1  
ATOM 6222   C C   . GLY C 3 504 ? -76.665  -25.836 15.260  1.00 0.00 ? 507 GLY M C   1  
ATOM 6223   O O   . GLY C 3 504 ? -76.522  -26.994 14.848  1.00 0.00 ? 507 GLY M O   1  
ATOM 6224   N N   . ILE C 3 505 ? -76.259  -24.782 14.576  1.00 0.00 ? 508 ILE M N   1  
ATOM 6225   C CA  . ILE C 3 505 ? -75.556  -25.027 13.348  1.00 0.00 ? 508 ILE M CA  1  
ATOM 6226   C C   . ILE C 3 505 ? -74.144  -25.438 13.698  1.00 0.00 ? 508 ILE M C   1  
ATOM 6227   O O   . ILE C 3 505 ? -73.640  -25.237 14.787  1.00 0.00 ? 508 ILE M O   1  
ATOM 6228   C CB  . ILE C 3 505 ? -75.558  -23.819 12.408  1.00 0.00 ? 508 ILE M CB  1  
ATOM 6229   C CG1 . ILE C 3 505 ? -76.943  -23.252 12.277  1.00 0.00 ? 508 ILE M CG1 1  
ATOM 6230   C CG2 . ILE C 3 505 ? -75.124  -24.212 10.986  1.00 0.00 ? 508 ILE M CG2 1  
ATOM 6231   C CD1 . ILE C 3 505 ? -76.908  -21.992 11.418  1.00 0.00 ? 508 ILE M CD1 1  
ATOM 6232   N N   . GLU C 3 506 ? -73.477  -26.078 12.766  1.00 0.00 ? 509 GLU M N   1  
ATOM 6233   C CA  . GLU C 3 506 ? -72.150  -26.488 12.999  1.00 0.00 ? 509 GLU M CA  1  
ATOM 6234   C C   . GLU C 3 506 ? -71.176  -25.742 12.116  1.00 0.00 ? 509 GLU M C   1  
ATOM 6235   O O   . GLU C 3 506 ? -70.880  -26.235 11.018  1.00 0.00 ? 509 GLU M O   1  
ATOM 6236   C CB  . GLU C 3 506 ? -72.017  -27.984 12.740  1.00 0.00 ? 509 GLU M CB  1  
ATOM 6237   C CG  . GLU C 3 506 ? -71.319  -28.757 13.862  1.00 0.00 ? 509 GLU M CG  1  
ATOM 6238   C CD  . GLU C 3 506 ? -71.138  -30.211 13.499  1.00 0.00 ? 509 GLU M CD  1  
ATOM 6239   O OE1 . GLU C 3 506 ? -72.255  -30.906 13.589  1.00 0.00 ? 509 GLU M OE1 1  
ATOM 6240   O OE2 . GLU C 3 506 ? -70.075  -30.683 13.118  1.00 0.00 ? 509 GLU M OE2 1  
ATOM 6241   N N   . TRP C 3 507 ? -70.754  -24.564 12.594  1.00 0.00 ? 510 TRP M N   1  
ATOM 6242   C CA  . TRP C 3 507 ? -69.837  -23.722 11.860  1.00 0.00 ? 510 TRP M CA  1  
ATOM 6243   C C   . TRP C 3 507 ? -68.631  -23.365 12.714  1.00 0.00 ? 510 TRP M C   1  
ATOM 6244   O O   . TRP C 3 507 ? -68.762  -22.804 13.800  1.00 0.00 ? 510 TRP M O   1  
ATOM 6245   C CB  . TRP C 3 507 ? -70.581  -22.444 11.347  1.00 0.00 ? 510 TRP M CB  1  
ATOM 6246   C CG  . TRP C 3 507 ? -69.934  -21.792 10.173  1.00 0.00 ? 510 TRP M CG  1  
ATOM 6247   C CD1 . TRP C 3 507 ? -69.580  -20.463 10.074  1.00 0.00 ? 510 TRP M CD1 1  
ATOM 6248   C CD2 . TRP C 3 507 ? -69.430  -22.416 8.998   1.00 0.00 ? 510 TRP M CD2 1  
ATOM 6249   N NE1 . TRP C 3 507 ? -68.899  -20.212 8.903   1.00 0.00 ? 510 TRP M NE1 1  
ATOM 6250   C CE2 . TRP C 3 507 ? -68.782  -21.397 8.224   1.00 0.00 ? 510 TRP M CE2 1  
ATOM 6251   C CE3 . TRP C 3 507 ? -69.446  -23.717 8.535   1.00 0.00 ? 510 TRP M CE3 1  
ATOM 6252   C CZ2 . TRP C 3 507 ? -68.209  -21.678 6.995   1.00 0.00 ? 510 TRP M CZ2 1  
ATOM 6253   C CZ3 . TRP C 3 507 ? -68.875  -24.008 7.311   1.00 0.00 ? 510 TRP M CZ3 1  
ATOM 6254   C CH2 . TRP C 3 507 ? -68.283  -22.987 6.549   1.00 0.00 ? 510 TRP M CH2 1  
ATOM 6255   N N   . GLU C 3 508 ? -67.405  -23.705 12.243  1.00 0.00 ? 511 GLU M N   1  
ATOM 6256   C CA  . GLU C 3 508 ? -66.237  -23.330 13.004  1.00 0.00 ? 511 GLU M CA  1  
ATOM 6257   C C   . GLU C 3 508 ? -65.470  -22.262 12.309  1.00 0.00 ? 511 GLU M C   1  
ATOM 6258   O O   . GLU C 3 508 ? -65.359  -22.248 11.073  1.00 0.00 ? 511 GLU M O   1  
ATOM 6259   C CB  . GLU C 3 508 ? -65.322  -24.434 13.540  1.00 0.00 ? 511 GLU M CB  1  
ATOM 6260   C CG  . GLU C 3 508 ? -65.936  -25.409 14.549  1.00 0.00 ? 511 GLU M CG  1  
ATOM 6261   C CD  . GLU C 3 508 ? -65.451  -26.783 14.170  1.00 0.00 ? 511 GLU M CD  1  
ATOM 6262   O OE1 . GLU C 3 508 ? -64.572  -26.739 13.173  1.00 0.00 ? 511 GLU M OE1 1  
ATOM 6263   O OE2 . GLU C 3 508 ? -65.831  -27.796 14.733  1.00 0.00 ? 511 GLU M OE2 1  
ATOM 6264   N N   . PHE C 3 509 ? -65.018  -21.316 13.119  1.00 0.00 ? 512 PHE M N   1  
ATOM 6265   C CA  . PHE C 3 509 ? -64.292  -20.246 12.559  1.00 0.00 ? 512 PHE M CA  1  
ATOM 6266   C C   . PHE C 3 509 ? -63.452  -19.533 13.600  1.00 0.00 ? 512 PHE M C   1  
ATOM 6267   O O   . PHE C 3 509 ? -63.781  -19.462 14.777  1.00 0.00 ? 512 PHE M O   1  
ATOM 6268   C CB  . PHE C 3 509 ? -65.244  -19.364 11.713  1.00 0.00 ? 512 PHE M CB  1  
ATOM 6269   C CG  . PHE C 3 509 ? -66.380  -18.744 12.540  1.00 0.00 ? 512 PHE M CG  1  
ATOM 6270   C CD1 . PHE C 3 509 ? -67.504  -19.490 12.911  1.00 0.00 ? 512 PHE M CD1 1  
ATOM 6271   C CD2 . PHE C 3 509 ? -66.325  -17.426 12.977  1.00 0.00 ? 512 PHE M CD2 1  
ATOM 6272   C CE1 . PHE C 3 509 ? -68.522  -18.930 13.688  1.00 0.00 ? 512 PHE M CE1 1  
ATOM 6273   C CE2 . PHE C 3 509 ? -67.311  -16.836 13.757  1.00 0.00 ? 512 PHE M CE2 1  
ATOM 6274   C CZ  . PHE C 3 509 ? -68.419  -17.597 14.117  1.00 0.00 ? 512 PHE M CZ  1  
ATOM 6275   N N   . ILE C 3 510 ? -62.370  -19.037 13.061  1.00 0.00 ? 513 ILE M N   1  
ATOM 6276   C CA  . ILE C 3 510 ? -61.340  -18.280 13.701  1.00 0.00 ? 513 ILE M CA  1  
ATOM 6277   C C   . ILE C 3 510 ? -61.799  -16.819 13.865  1.00 0.00 ? 513 ILE M C   1  
ATOM 6278   O O   . ILE C 3 510 ? -62.503  -16.276 13.014  1.00 0.00 ? 513 ILE M O   1  
ATOM 6279   C CB  . ILE C 3 510 ? -60.201  -18.382 12.683  1.00 0.00 ? 513 ILE M CB  1  
ATOM 6280   C CG1 . ILE C 3 510 ? -59.090  -19.160 13.223  1.00 0.00 ? 513 ILE M CG1 1  
ATOM 6281   C CG2 . ILE C 3 510 ? -59.749  -17.084 12.108  1.00 0.00 ? 513 ILE M CG2 1  
ATOM 6282   C CD1 . ILE C 3 510 ? -58.351  -19.865 12.110  1.00 0.00 ? 513 ILE M CD1 1  
ATOM 6283   N N   . ASP C 3 511 ? -61.355  -16.172 14.939  1.00 0.00 ? 514 ASP M N   1  
ATOM 6284   C CA  . ASP C 3 511 ? -61.636  -14.777 15.245  1.00 0.00 ? 514 ASP M CA  1  
ATOM 6285   C C   . ASP C 3 511 ? -61.399  -13.948 14.028  1.00 0.00 ? 514 ASP M C   1  
ATOM 6286   O O   . ASP C 3 511 ? -60.514  -14.196 13.315  1.00 0.00 ? 514 ASP M O   1  
ATOM 6287   C CB  . ASP C 3 511 ? -60.722  -14.276 16.337  1.00 0.00 ? 514 ASP M CB  1  
ATOM 6288   C CG  . ASP C 3 511 ? -61.086  -12.928 16.903  1.00 0.00 ? 514 ASP M CG  1  
ATOM 6289   O OD1 . ASP C 3 511 ? -61.220  -11.963 16.199  1.00 0.00 ? 514 ASP M OD1 1  
ATOM 6290   O OD2 . ASP C 3 511 ? -61.213  -12.864 18.218  1.00 0.00 ? 514 ASP M OD2 1  
ATOM 6291   N N   . PHE C 3 512 ? -62.249  -12.980 13.710  1.00 0.00 ? 515 PHE M N   1  
ATOM 6292   C CA  . PHE C 3 512 ? -61.981  -12.219 12.506  1.00 0.00 ? 515 PHE M CA  1  
ATOM 6293   C C   . PHE C 3 512 ? -61.015  -11.127 12.758  1.00 0.00 ? 515 PHE M C   1  
ATOM 6294   O O   . PHE C 3 512 ? -60.497  -10.533 11.841  1.00 0.00 ? 515 PHE M O   1  
ATOM 6295   C CB  . PHE C 3 512 ? -63.181  -11.621 11.813  1.00 0.00 ? 515 PHE M CB  1  
ATOM 6296   C CG  . PHE C 3 512 ? -64.211  -12.657 11.528  1.00 0.00 ? 515 PHE M CG  1  
ATOM 6297   C CD1 . PHE C 3 512 ? -64.072  -13.569 10.487  1.00 0.00 ? 515 PHE M CD1 1  
ATOM 6298   C CD2 . PHE C 3 512 ? -65.309  -12.740 12.377  1.00 0.00 ? 515 PHE M CD2 1  
ATOM 6299   C CE1 . PHE C 3 512 ? -65.064  -14.517 10.261  1.00 0.00 ? 515 PHE M CE1 1  
ATOM 6300   C CE2 . PHE C 3 512 ? -66.304  -13.687 12.184  1.00 0.00 ? 515 PHE M CE2 1  
ATOM 6301   C CZ  . PHE C 3 512 ? -66.163  -14.574 11.112  1.00 0.00 ? 515 PHE M CZ  1  
ATOM 6302   N N   . GLY C 3 513 ? -60.768  -10.845 14.017  1.00 0.00 ? 516 GLY M N   1  
ATOM 6303   C CA  . GLY C 3 513 ? -59.818  -9.805  14.333  1.00 0.00 ? 516 GLY M CA  1  
ATOM 6304   C C   . GLY C 3 513 ? -58.402  -10.149 13.846  1.00 0.00 ? 516 GLY M C   1  
ATOM 6305   O O   . GLY C 3 513 ? -57.691  -9.369  13.213  1.00 0.00 ? 516 GLY M O   1  
ATOM 6306   N N   . MET C 3 514 ? -58.011  -11.334 14.179  1.00 0.00 ? 517 MET M N   1  
ATOM 6307   C CA  . MET C 3 514 ? -56.754  -11.933 13.909  1.00 0.00 ? 517 MET M CA  1  
ATOM 6308   C C   . MET C 3 514 ? -56.143  -11.496 12.645  1.00 0.00 ? 517 MET M C   1  
ATOM 6309   O O   . MET C 3 514 ? -54.977  -11.334 12.529  1.00 0.00 ? 517 MET M O   1  
ATOM 6310   C CB  . MET C 3 514 ? -56.855  -13.448 13.900  1.00 0.00 ? 517 MET M CB  1  
ATOM 6311   C CG  . MET C 3 514 ? -55.550  -14.172 13.587  1.00 0.00 ? 517 MET M CG  1  
ATOM 6312   S SD  . MET C 3 514 ? -55.439  -15.804 14.465  1.00 0.00 ? 517 MET M SD  1  
ATOM 6313   C CE  . MET C 3 514 ? -53.799  -16.217 13.871  1.00 0.00 ? 517 MET M CE  1  
ATOM 6314   N N   . ASP C 3 515 ? -56.979  -11.235 11.694  1.00 0.00 ? 518 ASP M N   1  
ATOM 6315   C CA  . ASP C 3 515 ? -56.393  -10.863 10.413  1.00 0.00 ? 518 ASP M CA  1  
ATOM 6316   C C   . ASP C 3 515 ? -55.588  -9.595  10.511  1.00 0.00 ? 518 ASP M C   1  
ATOM 6317   O O   . ASP C 3 515 ? -54.645  -9.377  9.760   1.00 0.00 ? 518 ASP M O   1  
ATOM 6318   C CB  . ASP C 3 515 ? -57.497  -10.675 9.372   1.00 0.00 ? 518 ASP M CB  1  
ATOM 6319   C CG  . ASP C 3 515 ? -57.693  -11.864 8.522   1.00 0.00 ? 518 ASP M CG  1  
ATOM 6320   O OD1 . ASP C 3 515 ? -56.631  -12.094 7.737   1.00 0.00 ? 518 ASP M OD1 1  
ATOM 6321   O OD2 . ASP C 3 515 ? -58.718  -12.552 8.618   1.00 0.00 ? 518 ASP M OD2 1  
ATOM 6322   N N   . LEU C 3 516 ? -55.973  -8.752  11.460  1.00 0.00 ? 519 LEU M N   1  
ATOM 6323   C CA  . LEU C 3 516 ? -55.301  -7.478  11.582  1.00 0.00 ? 519 LEU M CA  1  
ATOM 6324   C C   . LEU C 3 516 ? -54.157  -7.398  12.542  1.00 0.00 ? 519 LEU M C   1  
ATOM 6325   O O   . LEU C 3 516 ? -53.355  -6.463  12.514  1.00 0.00 ? 519 LEU M O   1  
ATOM 6326   C CB  . LEU C 3 516 ? -56.304  -6.375  11.931  1.00 0.00 ? 519 LEU M CB  1  
ATOM 6327   C CG  . LEU C 3 516 ? -57.417  -6.201  10.934  1.00 0.00 ? 519 LEU M CG  1  
ATOM 6328   C CD1 . LEU C 3 516 ? -58.336  -7.357  11.071  1.00 0.00 ? 519 LEU M CD1 1  
ATOM 6329   C CD2 . LEU C 3 516 ? -58.185  -4.976  11.378  1.00 0.00 ? 519 LEU M CD2 1  
ATOM 6330   N N   . ALA C 3 517 ? -54.040  -8.371  13.424  1.00 0.00 ? 520 ALA M N   1  
ATOM 6331   C CA  . ALA C 3 517 ? -52.982  -8.371  14.410  1.00 0.00 ? 520 ALA M CA  1  
ATOM 6332   C C   . ALA C 3 517 ? -51.613  -8.130  13.820  1.00 0.00 ? 520 ALA M C   1  
ATOM 6333   O O   . ALA C 3 517 ? -50.778  -7.496  14.412  1.00 0.00 ? 520 ALA M O   1  
ATOM 6334   C CB  . ALA C 3 517 ? -53.032  -9.611  15.200  1.00 0.00 ? 520 ALA M CB  1  
ATOM 6335   N N   . ALA C 3 518 ? -51.382  -8.577  12.615  1.00 0.00 ? 521 ALA M N   1  
ATOM 6336   C CA  . ALA C 3 518 ? -50.133  -8.372  11.965  1.00 0.00 ? 521 ALA M CA  1  
ATOM 6337   C C   . ALA C 3 518 ? -49.799  -6.919  11.924  1.00 0.00 ? 521 ALA M C   1  
ATOM 6338   O O   . ALA C 3 518 ? -48.787  -6.513  12.468  1.00 0.00 ? 521 ALA M O   1  
ATOM 6339   C CB  . ALA C 3 518 ? -50.126  -8.883  10.565  1.00 0.00 ? 521 ALA M CB  1  
ATOM 6340   N N   . CYS C 3 519 ? -50.696  -6.124  11.356  1.00 0.00 ? 522 CYS M N   1  
ATOM 6341   C CA  . CYS C 3 519 ? -50.418  -4.702  11.257  1.00 0.00 ? 522 CYS M CA  1  
ATOM 6342   C C   . CYS C 3 519 ? -50.257  -4.015  12.595  1.00 0.00 ? 522 CYS M C   1  
ATOM 6343   O O   . CYS C 3 519 ? -49.337  -3.265  12.836  1.00 0.00 ? 522 CYS M O   1  
ATOM 6344   C CB  . CYS C 3 519 ? -51.213  -3.941  10.254  1.00 0.00 ? 522 CYS M CB  1  
ATOM 6345   S SG  . CYS C 3 519 ? -50.668  -2.276  10.072  1.00 0.00 ? 522 CYS M SG  1  
ATOM 6346   N N   . ILE C 3 520 ? -51.165  -4.301  13.486  1.00 0.00 ? 523 ILE M N   1  
ATOM 6347   C CA  . ILE C 3 520 ? -51.031  -3.696  14.799  1.00 0.00 ? 523 ILE M CA  1  
ATOM 6348   C C   . ILE C 3 520 ? -49.701  -3.967  15.488  1.00 0.00 ? 523 ILE M C   1  
ATOM 6349   O O   . ILE C 3 520 ? -49.048  -3.006  15.887  1.00 0.00 ? 523 ILE M O   1  
ATOM 6350   C CB  . ILE C 3 520 ? -52.156  -4.086  15.646  1.00 0.00 ? 523 ILE M CB  1  
ATOM 6351   C CG1 . ILE C 3 520 ? -53.330  -3.415  15.045  1.00 0.00 ? 523 ILE M CG1 1  
ATOM 6352   C CG2 . ILE C 3 520 ? -51.843  -3.697  17.054  1.00 0.00 ? 523 ILE M CG2 1  
ATOM 6353   C CD1 . ILE C 3 520 ? -54.564  -4.230  15.296  1.00 0.00 ? 523 ILE M CD1 1  
ATOM 6354   N N   . GLU C 3 521 ? -49.289  -5.249  15.574  1.00 0.00 ? 524 GLU M N   1  
ATOM 6355   C CA  . GLU C 3 521 ? -48.018  -5.543  16.234  1.00 0.00 ? 524 GLU M CA  1  
ATOM 6356   C C   . GLU C 3 521 ? -46.865  -4.699  15.691  1.00 0.00 ? 524 GLU M C   1  
ATOM 6357   O O   . GLU C 3 521 ? -46.040  -4.158  16.420  1.00 0.00 ? 524 GLU M O   1  
ATOM 6358   C CB  . GLU C 3 521 ? -47.605  -7.042  16.487  1.00 0.00 ? 524 GLU M CB  1  
ATOM 6359   C CG  . GLU C 3 521 ? -48.646  -8.153  16.327  1.00 0.00 ? 524 GLU M CG  1  
ATOM 6360   C CD  . GLU C 3 521 ? -49.165  -8.780  17.607  1.00 0.00 ? 524 GLU M CD  1  
ATOM 6361   O OE1 . GLU C 3 521 ? -49.923  -7.963  18.330  1.00 0.00 ? 524 GLU M OE1 1  
ATOM 6362   O OE2 . GLU C 3 521 ? -49.010  -9.952  17.890  1.00 0.00 ? 524 GLU M OE2 1  
ATOM 6363   N N   . LEU C 3 522 ? -46.809  -4.542  14.395  1.00 0.00 ? 525 LEU M N   1  
ATOM 6364   C CA  . LEU C 3 522 ? -45.751  -3.833  13.682  1.00 0.00 ? 525 LEU M CA  1  
ATOM 6365   C C   . LEU C 3 522 ? -45.654  -2.389  14.141  1.00 0.00 ? 525 LEU M C   1  
ATOM 6366   O O   . LEU C 3 522 ? -44.599  -1.776  14.130  1.00 0.00 ? 525 LEU M O   1  
ATOM 6367   C CB  . LEU C 3 522 ? -46.091  -3.875  12.183  1.00 0.00 ? 525 LEU M CB  1  
ATOM 6368   C CG  . LEU C 3 522 ? -45.066  -3.314  11.242  1.00 0.00 ? 525 LEU M CG  1  
ATOM 6369   C CD1 . LEU C 3 522 ? -43.989  -4.326  11.078  1.00 0.00 ? 525 LEU M CD1 1  
ATOM 6370   C CD2 . LEU C 3 522 ? -45.706  -3.082  9.894   1.00 0.00 ? 525 LEU M CD2 1  
ATOM 6371   N N   . ILE C 3 523 ? -46.783  -1.832  14.524  1.00 0.00 ? 526 ILE M N   1  
ATOM 6372   C CA  . ILE C 3 523 ? -46.800  -0.459  14.967  1.00 0.00 ? 526 ILE M CA  1  
ATOM 6373   C C   . ILE C 3 523 ? -46.526  -0.278  16.436  1.00 0.00 ? 526 ILE M C   1  
ATOM 6374   O O   . ILE C 3 523 ? -45.618  0.441   16.813  1.00 0.00 ? 526 ILE M O   1  
ATOM 6375   C CB  . ILE C 3 523 ? -48.142  0.144   14.641  1.00 0.00 ? 526 ILE M CB  1  
ATOM 6376   C CG1 . ILE C 3 523 ? -48.368  0.132   13.152  1.00 0.00 ? 526 ILE M CG1 1  
ATOM 6377   C CG2 . ILE C 3 523 ? -48.205  1.522   15.181  1.00 0.00 ? 526 ILE M CG2 1  
ATOM 6378   C CD1 . ILE C 3 523 ? -49.619  0.910   12.700  1.00 0.00 ? 526 ILE M CD1 1  
ATOM 6379   N N   . GLU C 3 524 ? -47.309  -0.976  17.251  1.00 0.00 ? 527 GLU M N   1  
ATOM 6380   C CA  . GLU C 3 524 ? -47.275  -0.876  18.695  1.00 0.00 ? 527 GLU M CA  1  
ATOM 6381   C C   . GLU C 3 524 ? -46.302  -1.737  19.474  1.00 0.00 ? 527 GLU M C   1  
ATOM 6382   O O   . GLU C 3 524 ? -46.029  -1.492  20.647  1.00 0.00 ? 527 GLU M O   1  
ATOM 6383   C CB  . GLU C 3 524 ? -48.707  -0.920  19.292  1.00 0.00 ? 527 GLU M CB  1  
ATOM 6384   C CG  . GLU C 3 524 ? -49.284  -2.327  19.472  1.00 0.00 ? 527 GLU M CG  1  
ATOM 6385   C CD  . GLU C 3 524 ? -50.500  -2.318  20.368  1.00 0.00 ? 527 GLU M CD  1  
ATOM 6386   O OE1 . GLU C 3 524 ? -50.997  -1.112  20.520  1.00 0.00 ? 527 GLU M OE1 1  
ATOM 6387   O OE2 . GLU C 3 524 ? -50.954  -3.306  20.863  1.00 0.00 ? 527 GLU M OE2 1  
ATOM 6388   N N   . LYS C 3 525 ? -45.827  -2.803  18.889  1.00 0.00 ? 528 LYS M N   1  
ATOM 6389   C CA  . LYS C 3 525 ? -44.928  -3.686  19.583  1.00 0.00 ? 528 LYS M CA  1  
ATOM 6390   C C   . LYS C 3 525 ? -43.582  -3.021  19.738  1.00 0.00 ? 528 LYS M C   1  
ATOM 6391   O O   . LYS C 3 525 ? -43.358  -2.017  19.047  1.00 0.00 ? 528 LYS M O   1  
ATOM 6392   C CB  . LYS C 3 525 ? -44.823  -5.036  18.889  1.00 0.00 ? 528 LYS M CB  1  
ATOM 6393   C CG  . LYS C 3 525 ? -45.833  -6.059  19.427  1.00 0.00 ? 528 LYS M CG  1  
ATOM 6394   C CD  . LYS C 3 525 ? -45.276  -7.481  19.373  1.00 0.00 ? 528 LYS M CD  1  
ATOM 6395   C CE  . LYS C 3 525 ? -46.138  -8.459  20.148  1.00 0.00 ? 528 LYS M CE  1  
ATOM 6396   N NZ  . LYS C 3 525 ? -45.366  -9.584  20.736  1.00 0.00 ? 528 LYS M NZ  1  
ATOM 6397   N N   . PRO C 3 526 ? -42.751  -3.606  20.624  1.00 0.00 ? 529 PRO M N   1  
ATOM 6398   C CA  . PRO C 3 526 ? -41.433  -3.098  20.951  1.00 0.00 ? 529 PRO M CA  1  
ATOM 6399   C C   . PRO C 3 526 ? -40.439  -2.765  19.846  1.00 0.00 ? 529 PRO M C   1  
ATOM 6400   O O   . PRO C 3 526 ? -39.777  -1.730  19.897  1.00 0.00 ? 529 PRO M O   1  
ATOM 6401   C CB  . PRO C 3 526 ? -40.788  -4.055  21.923  1.00 0.00 ? 529 PRO M CB  1  
ATOM 6402   C CG  . PRO C 3 526 ? -41.896  -4.960  22.375  1.00 0.00 ? 529 PRO M CG  1  
ATOM 6403   C CD  . PRO C 3 526 ? -43.085  -4.772  21.446  1.00 0.00 ? 529 PRO M CD  1  
ATOM 6404   N N   . MET C 3 527 ? -40.245  -3.630  18.862  1.00 0.00 ? 530 MET M N   1  
ATOM 6405   C CA  . MET C 3 527 ? -39.248  -3.150  17.912  1.00 0.00 ? 530 MET M CA  1  
ATOM 6406   C C   . MET C 3 527 ? -39.913  -2.504  16.736  1.00 0.00 ? 530 MET M C   1  
ATOM 6407   O O   . MET C 3 527 ? -39.292  -2.218  15.733  1.00 0.00 ? 530 MET M O   1  
ATOM 6408   C CB  . MET C 3 527 ? -38.156  -4.195  17.587  1.00 0.00 ? 530 MET M CB  1  
ATOM 6409   C CG  . MET C 3 527 ? -37.008  -4.230  18.582  1.00 0.00 ? 530 MET M CG  1  
ATOM 6410   S SD  . MET C 3 527 ? -35.532  -3.355  18.026  1.00 0.00 ? 530 MET M SD  1  
ATOM 6411   C CE  . MET C 3 527 ? -35.620  -2.022  19.232  1.00 0.00 ? 530 MET M CE  1  
ATOM 6412   N N   . GLY C 3 528 ? -41.208  -2.233  16.922  1.00 0.00 ? 531 GLY M N   1  
ATOM 6413   C CA  . GLY C 3 528 ? -42.068  -1.622  15.917  1.00 0.00 ? 531 GLY M CA  1  
ATOM 6414   C C   . GLY C 3 528 ? -41.925  -0.108  15.788  1.00 0.00 ? 531 GLY M C   1  
ATOM 6415   O O   . GLY C 3 528 ? -41.409  0.573   16.665  1.00 0.00 ? 531 GLY M O   1  
ATOM 6416   N N   . ILE C 3 529 ? -42.436  0.401   14.673  1.00 0.00 ? 532 ILE M N   1  
ATOM 6417   C CA  . ILE C 3 529 ? -42.396  1.797   14.256  1.00 0.00 ? 532 ILE M CA  1  
ATOM 6418   C C   . ILE C 3 529 ? -42.315  2.838   15.332  1.00 0.00 ? 532 ILE M C   1  
ATOM 6419   O O   . ILE C 3 529 ? -41.404  3.630   15.405  1.00 0.00 ? 532 ILE M O   1  
ATOM 6420   C CB  . ILE C 3 529 ? -43.523  2.087   13.297  1.00 0.00 ? 532 ILE M CB  1  
ATOM 6421   C CG1 . ILE C 3 529 ? -43.539  0.946   12.284  1.00 0.00 ? 532 ILE M CG1 1  
ATOM 6422   C CG2 . ILE C 3 529 ? -43.371  3.442   12.650  1.00 0.00 ? 532 ILE M CG2 1  
ATOM 6423   C CD1 . ILE C 3 529 ? -43.736  1.352   10.861  1.00 0.00 ? 532 ILE M CD1 1  
ATOM 6424   N N   . PHE C 3 530 ? -43.311  2.851   16.171  1.00 0.00 ? 533 PHE M N   1  
ATOM 6425   C CA  . PHE C 3 530 ? -43.321  3.806   17.275  1.00 0.00 ? 533 PHE M CA  1  
ATOM 6426   C C   . PHE C 3 530 ? -42.062  3.765   18.103  1.00 0.00 ? 533 PHE M C   1  
ATOM 6427   O O   . PHE C 3 530 ? -41.411  4.778   18.257  1.00 0.00 ? 533 PHE M O   1  
ATOM 6428   C CB  . PHE C 3 530 ? -44.597  3.784   18.117  1.00 0.00 ? 533 PHE M CB  1  
ATOM 6429   C CG  . PHE C 3 530 ? -45.724  4.499   17.393  1.00 0.00 ? 533 PHE M CG  1  
ATOM 6430   C CD1 . PHE C 3 530 ? -45.445  5.627   16.651  1.00 0.00 ? 533 PHE M CD1 1  
ATOM 6431   C CD2 . PHE C 3 530 ? -47.049  4.074   17.483  1.00 0.00 ? 533 PHE M CD2 1  
ATOM 6432   C CE1 . PHE C 3 530 ? -46.448  6.310   15.986  1.00 0.00 ? 533 PHE M CE1 1  
ATOM 6433   C CE2 . PHE C 3 530 ? -48.053  4.745   16.821  1.00 0.00 ? 533 PHE M CE2 1  
ATOM 6434   C CZ  . PHE C 3 530 ? -47.740  5.857   16.063  1.00 0.00 ? 533 PHE M CZ  1  
ATOM 6435   N N   . SER C 3 531 ? -41.691  2.558   18.570  1.00 0.00 ? 534 SER M N   1  
ATOM 6436   C CA  . SER C 3 531 ? -40.481  2.424   19.346  1.00 0.00 ? 534 SER M CA  1  
ATOM 6437   C C   . SER C 3 531 ? -39.269  3.010   18.652  1.00 0.00 ? 534 SER M C   1  
ATOM 6438   O O   . SER C 3 531 ? -38.632  3.942   19.178  1.00 0.00 ? 534 SER M O   1  
ATOM 6439   C CB  . SER C 3 531 ? -40.205  1.026   19.768  1.00 0.00 ? 534 SER M CB  1  
ATOM 6440   O OG  . SER C 3 531 ? -39.736  0.990   21.107  1.00 0.00 ? 534 SER M OG  1  
ATOM 6441   N N   . ILE C 3 532 ? -38.974  2.466   17.481  1.00 0.00 ? 535 ILE M N   1  
ATOM 6442   C CA  . ILE C 3 532 ? -37.876  2.993   16.678  1.00 0.00 ? 535 ILE M CA  1  
ATOM 6443   C C   . ILE C 3 532 ? -38.018  4.512   16.553  1.00 0.00 ? 535 ILE M C   1  
ATOM 6444   O O   . ILE C 3 532 ? -37.093  5.270   16.673  1.00 0.00 ? 535 ILE M O   1  
ATOM 6445   C CB  . ILE C 3 532 ? -37.791  2.276   15.340  1.00 0.00 ? 535 ILE M CB  1  
ATOM 6446   C CG1 . ILE C 3 532 ? -37.295  0.868   15.571  1.00 0.00 ? 535 ILE M CG1 1  
ATOM 6447   C CG2 . ILE C 3 532 ? -36.971  3.025   14.389  1.00 0.00 ? 535 ILE M CG2 1  
ATOM 6448   C CD1 . ILE C 3 532 ? -37.573  0.028   14.365  1.00 0.00 ? 535 ILE M CD1 1  
ATOM 6449   N N   . LEU C 3 533 ? -39.273  4.948   16.501  1.00 0.00 ? 536 LEU M N   1  
ATOM 6450   C CA  . LEU C 3 533 ? -39.532  6.339   16.453  1.00 0.00 ? 536 LEU M CA  1  
ATOM 6451   C C   . LEU C 3 533 ? -39.218  7.024   17.752  1.00 0.00 ? 536 LEU M C   1  
ATOM 6452   O O   . LEU C 3 533 ? -38.595  8.025   17.817  1.00 0.00 ? 536 LEU M O   1  
ATOM 6453   C CB  . LEU C 3 533 ? -40.928  6.691   16.035  1.00 0.00 ? 536 LEU M CB  1  
ATOM 6454   C CG  . LEU C 3 533 ? -41.015  8.189   15.820  1.00 0.00 ? 536 LEU M CG  1  
ATOM 6455   C CD1 . LEU C 3 533 ? -39.836  8.554   14.969  1.00 0.00 ? 536 LEU M CD1 1  
ATOM 6456   C CD2 . LEU C 3 533 ? -42.313  8.518   15.081  1.00 0.00 ? 536 LEU M CD2 1  
ATOM 6457   N N   . GLU C 3 534 ? -39.660  6.456   18.816  1.00 0.00 ? 537 GLU M N   1  
ATOM 6458   C CA  . GLU C 3 534 ? -39.434  7.079   20.104  1.00 0.00 ? 537 GLU M CA  1  
ATOM 6459   C C   . GLU C 3 534 ? -38.094  6.828   20.720  1.00 0.00 ? 537 GLU M C   1  
ATOM 6460   O O   . GLU C 3 534 ? -37.816  7.351   21.785  1.00 0.00 ? 537 GLU M O   1  
ATOM 6461   C CB  . GLU C 3 534 ? -40.574  6.897   21.140  1.00 0.00 ? 537 GLU M CB  1  
ATOM 6462   C CG  . GLU C 3 534 ? -41.486  5.716   20.893  1.00 0.00 ? 537 GLU M CG  1  
ATOM 6463   C CD  . GLU C 3 534 ? -42.740  5.808   21.669  1.00 0.00 ? 537 GLU M CD  1  
ATOM 6464   O OE1 . GLU C 3 534 ? -42.861  5.376   22.785  1.00 0.00 ? 537 GLU M OE1 1  
ATOM 6465   O OE2 . GLU C 3 534 ? -43.683  6.385   21.020  1.00 0.00 ? 537 GLU M OE2 1  
ATOM 6466   N N   . GLU C 3 535 ? -37.273  6.037   20.065  1.00 0.00 ? 538 GLU M N   1  
ATOM 6467   C CA  . GLU C 3 535 ? -35.964  5.766   20.678  1.00 0.00 ? 538 GLU M CA  1  
ATOM 6468   C C   . GLU C 3 535 ? -35.074  6.826   20.155  1.00 0.00 ? 538 GLU M C   1  
ATOM 6469   O O   . GLU C 3 535 ? -34.511  7.610   20.906  1.00 0.00 ? 538 GLU M O   1  
ATOM 6470   C CB  . GLU C 3 535 ? -35.431  4.439   20.208  1.00 0.00 ? 538 GLU M CB  1  
ATOM 6471   C CG  . GLU C 3 535 ? -34.686  3.658   21.281  1.00 0.00 ? 538 GLU M CG  1  
ATOM 6472   C CD  . GLU C 3 535 ? -33.753  2.648   20.630  1.00 0.00 ? 538 GLU M CD  1  
ATOM 6473   O OE1 . GLU C 3 535 ? -33.967  2.428   19.340  1.00 0.00 ? 538 GLU M OE1 1  
ATOM 6474   O OE2 . GLU C 3 535 ? -32.870  2.093   21.186  1.00 0.00 ? 538 GLU M OE2 1  
ATOM 6475   N N   . GLU C 3 536 ? -35.018  6.816   18.820  1.00 0.00 ? 539 GLU M N   1  
ATOM 6476   C CA  . GLU C 3 536 ? -34.220  7.785   18.083  1.00 0.00 ? 539 GLU M CA  1  
ATOM 6477   C C   . GLU C 3 536 ? -34.419  9.217   18.623  1.00 0.00 ? 539 GLU M C   1  
ATOM 6478   O O   . GLU C 3 536 ? -33.557  10.088  18.551  1.00 0.00 ? 539 GLU M O   1  
ATOM 6479   C CB  . GLU C 3 536 ? -34.508  7.660   16.588  1.00 0.00 ? 539 GLU M CB  1  
ATOM 6480   C CG  . GLU C 3 536 ? -33.278  7.875   15.694  1.00 0.00 ? 539 GLU M CG  1  
ATOM 6481   C CD  . GLU C 3 536 ? -32.359  6.717   15.689  1.00 0.00 ? 539 GLU M CD  1  
ATOM 6482   O OE1 . GLU C 3 536 ? -32.718  5.775   16.517  1.00 0.00 ? 539 GLU M OE1 1  
ATOM 6483   O OE2 . GLU C 3 536 ? -31.381  6.688   14.989  1.00 0.00 ? 539 GLU M OE2 1  
ATOM 6484   N N   . CYS C 3 537 ? -35.567  9.446   19.209  1.00 0.00 ? 540 CYS M N   1  
ATOM 6485   C CA  . CYS C 3 537 ? -35.867  10.742  19.735  1.00 0.00 ? 540 CYS M CA  1  
ATOM 6486   C C   . CYS C 3 537 ? -34.988  11.032  20.899  1.00 0.00 ? 540 CYS M C   1  
ATOM 6487   O O   . CYS C 3 537 ? -34.998  12.135  21.410  1.00 0.00 ? 540 CYS M O   1  
ATOM 6488   C CB  . CYS C 3 537 ? -37.342  10.808  20.166  1.00 0.00 ? 540 CYS M CB  1  
ATOM 6489   S SG  . CYS C 3 537 ? -38.389  11.142  18.845  1.00 0.00 ? 540 CYS M SG  1  
ATOM 6490   N N   . MET C 3 538 ? -34.270  10.004  21.330  1.00 0.00 ? 541 MET M N   1  
ATOM 6491   C CA  . MET C 3 538 ? -33.378  10.104  22.518  1.00 0.00 ? 541 MET M CA  1  
ATOM 6492   C C   . MET C 3 538 ? -31.940  10.387  22.114  1.00 0.00 ? 541 MET M C   1  
ATOM 6493   O O   . MET C 3 538 ? -31.095  10.736  22.916  1.00 0.00 ? 541 MET M O   1  
ATOM 6494   C CB  . MET C 3 538 ? -33.441  8.802   23.315  1.00 0.00 ? 541 MET M CB  1  
ATOM 6495   C CG  . MET C 3 538 ? -34.369  8.828   24.500  1.00 0.00 ? 541 MET M CG  1  
ATOM 6496   S SD  . MET C 3 538 ? -34.891  7.146   24.992  1.00 0.00 ? 541 MET M SD  1  
ATOM 6497   C CE  . MET C 3 538 ? -33.338  6.238   25.061  1.00 0.00 ? 541 MET M CE  1  
ATOM 6498   N N   . PHE C 3 539 ? -31.670  10.211  20.829  1.00 0.00 ? 542 PHE M N   1  
ATOM 6499   C CA  . PHE C 3 539 ? -30.390  10.432  20.240  1.00 0.00 ? 542 PHE M CA  1  
ATOM 6500   C C   . PHE C 3 539 ? -30.265  11.905  19.817  1.00 0.00 ? 542 PHE M C   1  
ATOM 6501   O O   . PHE C 3 539 ? -30.839  12.344  18.834  1.00 0.00 ? 542 PHE M O   1  
ATOM 6502   C CB  . PHE C 3 539 ? -30.199  9.502   19.038  1.00 0.00 ? 542 PHE M CB  1  
ATOM 6503   C CG  . PHE C 3 539 ? -29.794  8.099   19.459  1.00 0.00 ? 542 PHE M CG  1  
ATOM 6504   C CD1 . PHE C 3 539 ? -30.714  7.185   19.977  1.00 0.00 ? 542 PHE M CD1 1  
ATOM 6505   C CD2 . PHE C 3 539 ? -28.469  7.682   19.332  1.00 0.00 ? 542 PHE M CD2 1  
ATOM 6506   C CE1 . PHE C 3 539 ? -30.326  5.905   20.378  1.00 0.00 ? 542 PHE M CE1 1  
ATOM 6507   C CE2 . PHE C 3 539 ? -28.065  6.406   19.711  1.00 0.00 ? 542 PHE M CE2 1  
ATOM 6508   C CZ  . PHE C 3 539 ? -28.998  5.515   20.221  1.00 0.00 ? 542 PHE M CZ  1  
ATOM 6509   N N   . PRO C 3 540 ? -29.481  12.621  20.560  1.00 0.00 ? 543 PRO M N   1  
ATOM 6510   C CA  . PRO C 3 540 ? -29.245  14.039  20.390  1.00 0.00 ? 543 PRO M CA  1  
ATOM 6511   C C   . PRO C 3 540 ? -28.824  14.435  19.006  1.00 0.00 ? 543 PRO M C   1  
ATOM 6512   O O   . PRO C 3 540 ? -28.845  15.596  18.682  1.00 0.00 ? 543 PRO M O   1  
ATOM 6513   C CB  . PRO C 3 540 ? -28.178  14.404  21.397  1.00 0.00 ? 543 PRO M CB  1  
ATOM 6514   C CG  . PRO C 3 540 ? -27.723  13.116  22.106  1.00 0.00 ? 543 PRO M CG  1  
ATOM 6515   C CD  . PRO C 3 540 ? -28.536  11.989  21.512  1.00 0.00 ? 543 PRO M CD  1  
ATOM 6516   N N   . LYS C 3 541 ? -28.450  13.512  18.207  1.00 0.00 ? 544 LYS M N   1  
ATOM 6517   C CA  . LYS C 3 541 ? -27.914  13.832  16.876  1.00 0.00 ? 544 LYS M CA  1  
ATOM 6518   C C   . LYS C 3 541 ? -28.460  12.883  15.822  1.00 0.00 ? 544 LYS M C   1  
ATOM 6519   O O   . LYS C 3 541 ? -27.770  12.430  14.896  1.00 0.00 ? 544 LYS M O   1  
ATOM 6520   C CB  . LYS C 3 541 ? -26.371  13.797  16.853  1.00 0.00 ? 544 LYS M CB  1  
ATOM 6521   C CG  . LYS C 3 541 ? -25.682  15.135  17.075  1.00 0.00 ? 544 LYS M CG  1  
ATOM 6522   C CD  . LYS C 3 541 ? -24.186  15.101  16.793  1.00 0.00 ? 544 LYS M CD  1  
ATOM 6523   C CE  . LYS C 3 541 ? -23.615  16.445  16.310  1.00 0.00 ? 544 LYS M CE  1  
ATOM 6524   N NZ  . LYS C 3 541 ? -22.157  16.435  16.002  1.00 0.00 ? 544 LYS M NZ  1  
ATOM 6525   N N   . ALA C 3 542 ? -29.739  12.565  15.969  1.00 0.00 ? 545 ALA M N   1  
ATOM 6526   C CA  . ALA C 3 542 ? -30.382  11.676  15.014  1.00 0.00 ? 545 ALA M CA  1  
ATOM 6527   C C   . ALA C 3 542 ? -31.045  12.471  13.911  1.00 0.00 ? 545 ALA M C   1  
ATOM 6528   O O   . ALA C 3 542 ? -31.338  13.656  14.055  1.00 0.00 ? 545 ALA M O   1  
ATOM 6529   C CB  . ALA C 3 542 ? -31.378  10.777  15.708  1.00 0.00 ? 545 ALA M CB  1  
ATOM 6530   N N   . THR C 3 543 ? -31.319  11.797  12.810  1.00 0.00 ? 546 THR M N   1  
ATOM 6531   C CA  . THR C 3 543 ? -31.939  12.460  11.681  1.00 0.00 ? 546 THR M CA  1  
ATOM 6532   C C   . THR C 3 543 ? -33.167  11.694  11.295  1.00 0.00 ? 546 THR M C   1  
ATOM 6533   O O   . THR C 3 543 ? -33.304  10.520  11.654  1.00 0.00 ? 546 THR M O   1  
ATOM 6534   C CB  . THR C 3 543 ? -31.005  12.350  10.480  1.00 0.00 ? 546 THR M CB  1  
ATOM 6535   O OG1 . THR C 3 543 ? -29.739  12.836  10.751  1.00 0.00 ? 546 THR M OG1 1  
ATOM 6536   C CG2 . THR C 3 543 ? -31.627  12.944  9.228   1.00 0.00 ? 546 THR M CG2 1  
ATOM 6537   N N   . ASP C 3 544 ? -34.002  12.361  10.526  1.00 0.00 ? 547 ASP M N   1  
ATOM 6538   C CA  . ASP C 3 544 ? -35.190  11.727  10.008  1.00 0.00 ? 547 ASP M CA  1  
ATOM 6539   C C   . ASP C 3 544 ? -34.615  10.539  9.215   1.00 0.00 ? 547 ASP M C   1  
ATOM 6540   O O   . ASP C 3 544 ? -34.937  9.373   9.378   1.00 0.00 ? 547 ASP M O   1  
ATOM 6541   C CB  . ASP C 3 544 ? -35.989  12.729  9.101   1.00 0.00 ? 547 ASP M CB  1  
ATOM 6542   C CG  . ASP C 3 544 ? -36.831  13.761  9.841   1.00 0.00 ? 547 ASP M CG  1  
ATOM 6543   O OD1 . ASP C 3 544 ? -36.974  13.601  11.123  1.00 0.00 ? 547 ASP M OD1 1  
ATOM 6544   O OD2 . ASP C 3 544 ? -37.394  14.678  9.286   1.00 0.00 ? 547 ASP M OD2 1  
ATOM 6545   N N   . THR C 3 545 ? -33.583  10.862  8.454   1.00 0.00 ? 548 THR M N   1  
ATOM 6546   C CA  . THR C 3 545 ? -32.859  9.898   7.649   1.00 0.00 ? 548 THR M CA  1  
ATOM 6547   C C   . THR C 3 545 ? -32.319  8.780   8.504   1.00 0.00 ? 548 THR M C   1  
ATOM 6548   O O   . THR C 3 545 ? -32.319  7.632   8.162   1.00 0.00 ? 548 THR M O   1  
ATOM 6549   C CB  . THR C 3 545 ? -31.715  10.598  6.953   1.00 0.00 ? 548 THR M CB  1  
ATOM 6550   O OG1 . THR C 3 545 ? -32.170  11.258  5.795   1.00 0.00 ? 548 THR M OG1 1  
ATOM 6551   C CG2 . THR C 3 545 ? -30.736  9.541   6.582   1.00 0.00 ? 548 THR M CG2 1  
ATOM 6552   N N   . SER C 3 546 ? -31.794  9.150   9.652   1.00 0.00 ? 549 SER M N   1  
ATOM 6553   C CA  . SER C 3 546 ? -31.274  8.155   10.562  1.00 0.00 ? 549 SER M CA  1  
ATOM 6554   C C   . SER C 3 546 ? -32.383  7.188   10.899  1.00 0.00 ? 549 SER M C   1  
ATOM 6555   O O   . SER C 3 546 ? -32.334  6.003   10.615  1.00 0.00 ? 549 SER M O   1  
ATOM 6556   C CB  . SER C 3 546 ? -30.777  8.819   11.838  1.00 0.00 ? 549 SER M CB  1  
ATOM 6557   O OG  . SER C 3 546 ? -31.686  8.495   12.883  1.00 0.00 ? 549 SER M OG  1  
ATOM 6558   N N   . PHE C 3 547 ? -33.427  7.755   11.477  1.00 0.00 ? 550 PHE M N   1  
ATOM 6559   C CA  . PHE C 3 547 ? -34.632  7.058   11.865  1.00 0.00 ? 550 PHE M CA  1  
ATOM 6560   C C   . PHE C 3 547 ? -35.090  6.135   10.789  1.00 0.00 ? 550 PHE M C   1  
ATOM 6561   O O   . PHE C 3 547 ? -35.343  4.970   11.052  1.00 0.00 ? 550 PHE M O   1  
ATOM 6562   C CB  . PHE C 3 547 ? -35.690  8.112   12.026  1.00 0.00 ? 550 PHE M CB  1  
ATOM 6563   C CG  . PHE C 3 547 ? -37.106  7.636   12.093  1.00 0.00 ? 550 PHE M CG  1  
ATOM 6564   C CD1 . PHE C 3 547 ? -37.498  6.573   12.939  1.00 0.00 ? 550 PHE M CD1 1  
ATOM 6565   C CD2 . PHE C 3 547 ? -38.075  8.331   11.345  1.00 0.00 ? 550 PHE M CD2 1  
ATOM 6566   C CE1 . PHE C 3 547 ? -38.860  6.246   13.024  1.00 0.00 ? 550 PHE M CE1 1  
ATOM 6567   C CE2 . PHE C 3 547 ? -39.415  7.969   11.384  1.00 0.00 ? 550 PHE M CE2 1  
ATOM 6568   C CZ  . PHE C 3 547 ? -39.788  6.914   12.218  1.00 0.00 ? 550 PHE M CZ  1  
ATOM 6569   N N   . LYS C 3 548 ? -35.138  6.693   9.589   1.00 0.00 ? 551 LYS M N   1  
ATOM 6570   C CA  . LYS C 3 548 ? -35.589  5.927   8.426   1.00 0.00 ? 551 LYS M CA  1  
ATOM 6571   C C   . LYS C 3 548 ? -34.839  4.617   8.326   1.00 0.00 ? 551 LYS M C   1  
ATOM 6572   O O   . LYS C 3 548 ? -35.424  3.545   8.367   1.00 0.00 ? 551 LYS M O   1  
ATOM 6573   C CB  . LYS C 3 548 ? -35.594  6.748   7.130   1.00 0.00 ? 551 LYS M CB  1  
ATOM 6574   C CG  . LYS C 3 548 ? -35.700  5.899   5.854   1.00 0.00 ? 551 LYS M CG  1  
ATOM 6575   C CD  . LYS C 3 548 ? -35.661  6.718   4.572   1.00 0.00 ? 551 LYS M CD  1  
ATOM 6576   C CE  . LYS C 3 548 ? -34.290  6.711   3.884   1.00 0.00 ? 551 LYS M CE  1  
ATOM 6577   N NZ  . LYS C 3 548 ? -33.957  8.002   3.251   1.00 0.00 ? 551 LYS M NZ  1  
ATOM 6578   N N   . ASN C 3 549 ? -33.531  4.710   8.228   1.00 0.00 ? 552 ASN M N   1  
ATOM 6579   C CA  . ASN C 3 549 ? -32.710  3.523   8.083   1.00 0.00 ? 552 ASN M CA  1  
ATOM 6580   C C   . ASN C 3 549 ? -32.975  2.513   9.174   1.00 0.00 ? 552 ASN M C   1  
ATOM 6581   O O   . ASN C 3 549 ? -33.069  1.279   8.986   1.00 0.00 ? 552 ASN M O   1  
ATOM 6582   C CB  . ASN C 3 549 ? -31.190  3.849   7.990   1.00 0.00 ? 552 ASN M CB  1  
ATOM 6583   C CG  . ASN C 3 549 ? -30.895  4.691   6.761   1.00 0.00 ? 552 ASN M CG  1  
ATOM 6584   O OD1 . ASN C 3 549 ? -31.054  4.230   5.624   1.00 0.00 ? 552 ASN M OD1 1  
ATOM 6585   N ND2 . ASN C 3 549 ? -30.501  5.924   6.987   1.00 0.00 ? 552 ASN M ND2 1  
ATOM 6586   N N   . LYS C 3 550 ? -33.157  3.020   10.377  1.00 0.00 ? 553 LYS M N   1  
ATOM 6587   C CA  . LYS C 3 550 ? -33.372  2.107   11.481  1.00 0.00 ? 553 LYS M CA  1  
ATOM 6588   C C   . LYS C 3 550 ? -34.648  1.365   11.278  1.00 0.00 ? 553 LYS M C   1  
ATOM 6589   O O   . LYS C 3 550 ? -34.810  0.214   11.612  1.00 0.00 ? 553 LYS M O   1  
ATOM 6590   C CB  . LYS C 3 550 ? -33.288  2.804   12.823  1.00 0.00 ? 553 LYS M CB  1  
ATOM 6591   C CG  . LYS C 3 550 ? -31.861  2.850   13.355  1.00 0.00 ? 553 LYS M CG  1  
ATOM 6592   C CD  . LYS C 3 550 ? -31.665  3.754   14.573  1.00 0.00 ? 553 LYS M CD  1  
ATOM 6593   C CE  . LYS C 3 550 ? -30.738  3.161   15.607  1.00 0.00 ? 553 LYS M CE  1  
ATOM 6594   N NZ  . LYS C 3 550 ? -30.143  4.153   16.494  1.00 0.00 ? 553 LYS M NZ  1  
ATOM 6595   N N   . LEU C 3 551 ? -35.564  2.062   10.657  1.00 0.00 ? 554 LEU M N   1  
ATOM 6596   C CA  . LEU C 3 551 ? -36.839  1.497   10.379  1.00 0.00 ? 554 LEU M CA  1  
ATOM 6597   C C   . LEU C 3 551 ? -36.662  0.340   9.429   1.00 0.00 ? 554 LEU M C   1  
ATOM 6598   O O   . LEU C 3 551 ? -37.209  -0.734  9.601   1.00 0.00 ? 554 LEU M O   1  
ATOM 6599   C CB  . LEU C 3 551 ? -37.730  2.576   9.712   1.00 0.00 ? 554 LEU M CB  1  
ATOM 6600   C CG  . LEU C 3 551 ? -39.140  2.596   10.280  1.00 0.00 ? 554 LEU M CG  1  
ATOM 6601   C CD1 . LEU C 3 551 ? -39.142  2.462   11.828  1.00 0.00 ? 554 LEU M CD1 1  
ATOM 6602   C CD2 . LEU C 3 551 ? -39.823  3.883   9.929   1.00 0.00 ? 554 LEU M CD2 1  
ATOM 6603   N N   . TYR C 3 552 ? -35.839  0.555   8.422   1.00 0.00 ? 555 TYR M N   1  
ATOM 6604   C CA  . TYR C 3 552 ? -35.697  -0.500  7.415   1.00 0.00 ? 555 TYR M CA  1  
ATOM 6605   C C   . TYR C 3 552 ? -34.914  -1.686  7.876   1.00 0.00 ? 555 TYR M C   1  
ATOM 6606   O O   . TYR C 3 552 ? -35.454  -2.806  7.809   1.00 0.00 ? 555 TYR M O   1  
ATOM 6607   C CB  . TYR C 3 552 ? -35.041  -0.093  6.119   1.00 0.00 ? 555 TYR M CB  1  
ATOM 6608   C CG  . TYR C 3 552 ? -35.770  0.885   5.222   1.00 0.00 ? 555 TYR M CG  1  
ATOM 6609   C CD1 . TYR C 3 552 ? -36.992  0.617   4.608   1.00 0.00 ? 555 TYR M CD1 1  
ATOM 6610   C CD2 . TYR C 3 552 ? -35.107  2.071   4.907   1.00 0.00 ? 555 TYR M CD2 1  
ATOM 6611   C CE1 . TYR C 3 552 ? -37.561  1.540   3.728   1.00 0.00 ? 555 TYR M CE1 1  
ATOM 6612   C CE2 . TYR C 3 552 ? -35.657  3.009   4.031   1.00 0.00 ? 555 TYR M CE2 1  
ATOM 6613   C CZ  . TYR C 3 552 ? -36.887  2.732   3.444   1.00 0.00 ? 555 TYR M CZ  1  
ATOM 6614   O OH  . TYR C 3 552 ? -37.439  3.660   2.589   1.00 0.00 ? 555 TYR M OH  1  
ATOM 6615   N N   . ASP C 3 553 ? -33.658  -1.418  8.211   1.00 0.00 ? 556 ASP M N   1  
ATOM 6616   C CA  . ASP C 3 553 ? -32.714  -2.446  8.647   1.00 0.00 ? 556 ASP M CA  1  
ATOM 6617   C C   . ASP C 3 553 ? -33.389  -3.507  9.491   1.00 0.00 ? 556 ASP M C   1  
ATOM 6618   O O   . ASP C 3 553 ? -33.056  -4.696  9.448   1.00 0.00 ? 556 ASP M O   1  
ATOM 6619   C CB  . ASP C 3 553 ? -31.527  -1.859  9.446   1.00 0.00 ? 556 ASP M CB  1  
ATOM 6620   C CG  . ASP C 3 553 ? -30.460  -1.260  8.601   1.00 0.00 ? 556 ASP M CG  1  
ATOM 6621   O OD1 . ASP C 3 553 ? -30.841  -1.064  7.352   1.00 0.00 ? 556 ASP M OD1 1  
ATOM 6622   O OD2 . ASP C 3 553 ? -29.349  -1.001  9.029   1.00 0.00 ? 556 ASP M OD2 1  
ATOM 6623   N N   . GLN C 3 554 ? -34.390  -3.038  10.237  1.00 0.00 ? 557 GLN M N   1  
ATOM 6624   C CA  . GLN C 3 554 ? -35.122  -3.906  11.151  1.00 0.00 ? 557 GLN M CA  1  
ATOM 6625   C C   . GLN C 3 554 ? -36.426  -4.469  10.647  1.00 0.00 ? 557 GLN M C   1  
ATOM 6626   O O   . GLN C 3 554 ? -36.874  -5.542  11.112  1.00 0.00 ? 557 GLN M O   1  
ATOM 6627   C CB  . GLN C 3 554 ? -35.358  -3.214  12.499  1.00 0.00 ? 557 GLN M CB  1  
ATOM 6628   C CG  . GLN C 3 554 ? -36.473  -3.900  13.294  1.00 0.00 ? 557 GLN M CG  1  
ATOM 6629   C CD  . GLN C 3 554 ? -35.952  -4.947  14.254  1.00 0.00 ? 557 GLN M CD  1  
ATOM 6630   O OE1 . GLN C 3 554 ? -34.796  -4.618  14.737  1.00 0.00 ? 557 GLN M OE1 1  
ATOM 6631   N NE2 . GLN C 3 554 ? -36.606  -5.947  14.589  1.00 0.00 ? 557 GLN M NE2 1  
ATOM 6632   N N   . HIS C 3 555 ? -37.122  -3.784  9.758   1.00 0.00 ? 558 HIS M N   1  
ATOM 6633   C CA  . HIS C 3 555 ? -38.400  -4.361  9.356   1.00 0.00 ? 558 HIS M CA  1  
ATOM 6634   C C   . HIS C 3 555 ? -38.426  -4.827  7.927   1.00 0.00 ? 558 HIS M C   1  
ATOM 6635   O O   . HIS C 3 555 ? -39.149  -5.748  7.560   1.00 0.00 ? 558 HIS M O   1  
ATOM 6636   C CB  . HIS C 3 555 ? -39.569  -3.405  9.616   1.00 0.00 ? 558 HIS M CB  1  
ATOM 6637   C CG  . HIS C 3 555 ? -39.852  -3.256  11.062  1.00 0.00 ? 558 HIS M CG  1  
ATOM 6638   N ND1 . HIS C 3 555 ? -40.409  -4.250  11.792  1.00 0.00 ? 558 HIS M ND1 1  
ATOM 6639   C CD2 . HIS C 3 555 ? -39.635  -2.195  11.896  1.00 0.00 ? 558 HIS M CD2 1  
ATOM 6640   C CE1 . HIS C 3 555 ? -40.519  -3.809  13.060  1.00 0.00 ? 558 HIS M CE1 1  
ATOM 6641   N NE2 . HIS C 3 555 ? -40.052  -2.589  13.149  1.00 0.00 ? 558 HIS M NE2 1  
ATOM 6642   N N   . LEU C 3 556 ? -37.645  -4.161  7.104   1.00 0.00 ? 559 LEU M N   1  
ATOM 6643   C CA  . LEU C 3 556 ? -37.632  -4.507  5.712   1.00 0.00 ? 559 LEU M CA  1  
ATOM 6644   C C   . LEU C 3 556 ? -37.138  -5.896  5.389   1.00 0.00 ? 559 LEU M C   1  
ATOM 6645   O O   . LEU C 3 556 ? -36.055  -6.365  5.796   1.00 0.00 ? 559 LEU M O   1  
ATOM 6646   C CB  . LEU C 3 556 ? -36.957  -3.483  4.814   1.00 0.00 ? 559 LEU M CB  1  
ATOM 6647   C CG  . LEU C 3 556 ? -37.380  -3.743  3.383   1.00 0.00 ? 559 LEU M CG  1  
ATOM 6648   C CD1 . LEU C 3 556 ? -37.479  -2.412  2.620   1.00 0.00 ? 559 LEU M CD1 1  
ATOM 6649   C CD2 . LEU C 3 556 ? -36.380  -4.712  2.743   1.00 0.00 ? 559 LEU M CD2 1  
ATOM 6650   N N   . GLY C 3 557 ? -37.950  -6.548  4.579   1.00 0.00 ? 560 GLY M N   1  
ATOM 6651   C CA  . GLY C 3 557 ? -37.722  -7.900  4.120   1.00 0.00 ? 560 GLY M CA  1  
ATOM 6652   C C   . GLY C 3 557 ? -38.160  -8.922  5.157   1.00 0.00 ? 560 GLY M C   1  
ATOM 6653   O O   . GLY C 3 557 ? -38.495  -10.054 4.851   1.00 0.00 ? 560 GLY M O   1  
ATOM 6654   N N   . LYS C 3 558 ? -38.145  -8.496  6.407   1.00 0.00 ? 561 LYS M N   1  
ATOM 6655   C CA  . LYS C 3 558 ? -38.486  -9.342  7.523   1.00 0.00 ? 561 LYS M CA  1  
ATOM 6656   C C   . LYS C 3 558 ? -39.950  -9.239  7.876   1.00 0.00 ? 561 LYS M C   1  
ATOM 6657   O O   . LYS C 3 558 ? -40.530  -10.133 8.503   1.00 0.00 ? 561 LYS M O   1  
ATOM 6658   C CB  . LYS C 3 558 ? -37.657  -8.966  8.745   1.00 0.00 ? 561 LYS M CB  1  
ATOM 6659   C CG  . LYS C 3 558 ? -36.611  -9.993  9.109   1.00 0.00 ? 561 LYS M CG  1  
ATOM 6660   C CD  . LYS C 3 558 ? -36.650  -10.321 10.602  1.00 0.00 ? 561 LYS M CD  1  
ATOM 6661   C CE  . LYS C 3 558 ? -35.579  -9.618  11.423  1.00 0.00 ? 561 LYS M CE  1  
ATOM 6662   N NZ  . LYS C 3 558 ? -35.810  -9.794  12.870  1.00 0.00 ? 561 LYS M NZ  1  
ATOM 6663   N N   . SER C 3 559 ? -40.555  -8.141  7.444   1.00 0.00 ? 562 SER M N   1  
ATOM 6664   C CA  . SER C 3 559 ? -41.962  -7.913  7.724   1.00 0.00 ? 562 SER M CA  1  
ATOM 6665   C C   . SER C 3 559 ? -42.773  -7.661  6.485   1.00 0.00 ? 562 SER M C   1  
ATOM 6666   O O   . SER C 3 559 ? -42.352  -6.942  5.581   1.00 0.00 ? 562 SER M O   1  
ATOM 6667   C CB  . SER C 3 559 ? -42.226  -6.864  8.769   1.00 0.00 ? 562 SER M CB  1  
ATOM 6668   O OG  . SER C 3 559 ? -42.381  -7.544  10.001  1.00 0.00 ? 562 SER M OG  1  
ATOM 6669   N N   . ASN C 3 560 ? -43.890  -8.362  6.435   1.00 0.00 ? 563 ASN M N   1  
ATOM 6670   C CA  . ASN C 3 560 ? -44.753  -8.417  5.284   1.00 0.00 ? 563 ASN M CA  1  
ATOM 6671   C C   . ASN C 3 560 ? -45.596  -7.161  5.110   1.00 0.00 ? 563 ASN M C   1  
ATOM 6672   O O   . ASN C 3 560 ? -45.850  -6.679  4.000   1.00 0.00 ? 563 ASN M O   1  
ATOM 6673   C CB  . ASN C 3 560 ? -45.660  -9.653  5.395   1.00 0.00 ? 563 ASN M CB  1  
ATOM 6674   C CG  . ASN C 3 560 ? -46.085  -10.248 4.073   1.00 0.00 ? 563 ASN M CG  1  
ATOM 6675   O OD1 . ASN C 3 560 ? -46.668  -11.355 4.042   1.00 0.00 ? 563 ASN M OD1 1  
ATOM 6676   N ND2 . ASN C 3 560 ? -45.763  -9.524  2.988   1.00 0.00 ? 563 ASN M ND2 1  
ATOM 6677   N N   . ASN C 3 561 ? -46.056  -6.645  6.214   1.00 0.00 ? 564 ASN M N   1  
ATOM 6678   C CA  . ASN C 3 561 ? -46.900  -5.482  6.147   1.00 0.00 ? 564 ASN M CA  1  
ATOM 6679   C C   . ASN C 3 561 ? -46.083  -4.248  5.881   1.00 0.00 ? 564 ASN M C   1  
ATOM 6680   O O   . ASN C 3 561 ? -46.619  -3.160  5.583   1.00 0.00 ? 564 ASN M O   1  
ATOM 6681   C CB  . ASN C 3 561 ? -47.694  -5.394  7.425   1.00 0.00 ? 564 ASN M CB  1  
ATOM 6682   C CG  . ASN C 3 561 ? -48.660  -6.551  7.432   1.00 0.00 ? 564 ASN M CG  1  
ATOM 6683   O OD1 . ASN C 3 561 ? -48.477  -7.439  8.272   1.00 0.00 ? 564 ASN M OD1 1  
ATOM 6684   N ND2 . ASN C 3 561 ? -49.588  -6.561  6.466   1.00 0.00 ? 564 ASN M ND2 1  
ATOM 6685   N N   . PHE C 3 562 ? -44.794  -4.475  5.992   1.00 0.00 ? 565 PHE M N   1  
ATOM 6686   C CA  . PHE C 3 562 ? -43.790  -3.446  5.776   1.00 0.00 ? 565 PHE M CA  1  
ATOM 6687   C C   . PHE C 3 562 ? -43.304  -3.479  4.336   1.00 0.00 ? 565 PHE M C   1  
ATOM 6688   O O   . PHE C 3 562 ? -43.033  -4.519  3.750   1.00 0.00 ? 565 PHE M O   1  
ATOM 6689   C CB  . PHE C 3 562 ? -42.628  -3.641  6.759   1.00 0.00 ? 565 PHE M CB  1  
ATOM 6690   C CG  . PHE C 3 562 ? -41.820  -2.398  6.892   1.00 0.00 ? 565 PHE M CG  1  
ATOM 6691   C CD1 . PHE C 3 562 ? -42.286  -1.310  7.637   1.00 0.00 ? 565 PHE M CD1 1  
ATOM 6692   C CD2 . PHE C 3 562 ? -40.592  -2.302  6.257   1.00 0.00 ? 565 PHE M CD2 1  
ATOM 6693   C CE1 . PHE C 3 562 ? -41.538  -0.144  7.707   1.00 0.00 ? 565 PHE M CE1 1  
ATOM 6694   C CE2 . PHE C 3 562 ? -39.829  -1.142  6.326   1.00 0.00 ? 565 PHE M CE2 1  
ATOM 6695   C CZ  . PHE C 3 562 ? -40.310  -0.055  7.047   1.00 0.00 ? 565 PHE M CZ  1  
ATOM 6696   N N   . GLN C 3 563 ? -43.264  -2.313  3.732   1.00 0.00 ? 566 GLN M N   1  
ATOM 6697   C CA  . GLN C 3 563 ? -42.918  -2.225  2.340   1.00 0.00 ? 566 GLN M CA  1  
ATOM 6698   C C   . GLN C 3 563 ? -42.272  -0.883  2.018   1.00 0.00 ? 566 GLN M C   1  
ATOM 6699   O O   . GLN C 3 563 ? -42.478  0.086   2.743   1.00 0.00 ? 566 GLN M O   1  
ATOM 6700   C CB  . GLN C 3 563 ? -44.198  -2.419  1.483   1.00 0.00 ? 566 GLN M CB  1  
ATOM 6701   C CG  . GLN C 3 563 ? -44.593  -3.896  1.279   1.00 0.00 ? 566 GLN M CG  1  
ATOM 6702   C CD  . GLN C 3 563 ? -45.532  -4.080  0.083   1.00 0.00 ? 566 GLN M CD  1  
ATOM 6703   O OE1 . GLN C 3 563 ? -45.399  -3.387  -0.948  1.00 0.00 ? 566 GLN M OE1 1  
ATOM 6704   N NE2 . GLN C 3 563 ? -46.486  -5.008  0.248   1.00 0.00 ? 566 GLN M NE2 1  
ATOM 6705   N N   . LYS C 3 564 ? -41.549  -0.839  0.909   1.00 0.00 ? 567 LYS M N   1  
ATOM 6706   C CA  . LYS C 3 564 ? -40.939  0.385   0.435   1.00 0.00 ? 567 LYS M CA  1  
ATOM 6707   C C   . LYS C 3 564 ? -41.823  0.944   -0.650  1.00 0.00 ? 567 LYS M C   1  
ATOM 6708   O O   . LYS C 3 564 ? -42.304  0.195   -1.494  1.00 0.00 ? 567 LYS M O   1  
ATOM 6709   C CB  . LYS C 3 564 ? -39.493  0.238   -0.034  1.00 0.00 ? 567 LYS M CB  1  
ATOM 6710   C CG  . LYS C 3 564 ? -39.298  -0.659  -1.245  1.00 0.00 ? 567 LYS M CG  1  
ATOM 6711   C CD  . LYS C 3 564 ? -37.834  -0.986  -1.529  1.00 0.00 ? 567 LYS M CD  1  
ATOM 6712   C CE  . LYS C 3 564 ? -37.637  -2.144  -2.501  1.00 0.00 ? 567 LYS M CE  1  
ATOM 6713   N NZ  . LYS C 3 564 ? -36.230  -2.451  -2.811  1.00 0.00 ? 567 LYS M NZ  1  
ATOM 6714   N N   . PRO C 3 565 ? -42.098  2.244   -0.586  1.00 0.00 ? 568 PRO M N   1  
ATOM 6715   C CA  . PRO C 3 565 ? -42.974  2.898   -1.527  1.00 0.00 ? 568 PRO M CA  1  
ATOM 6716   C C   . PRO C 3 565 ? -42.598  2.745   -2.981  1.00 0.00 ? 568 PRO M C   1  
ATOM 6717   O O   . PRO C 3 565 ? -41.418  2.770   -3.342  1.00 0.00 ? 568 PRO M O   1  
ATOM 6718   C CB  . PRO C 3 565 ? -42.987  4.384   -1.175  1.00 0.00 ? 568 PRO M CB  1  
ATOM 6719   C CG  . PRO C 3 565 ? -41.957  4.592   -0.063  1.00 0.00 ? 568 PRO M CG  1  
ATOM 6720   C CD  . PRO C 3 565 ? -41.374  3.225   0.265   1.00 0.00 ? 568 PRO M CD  1  
ATOM 6721   N N   . LYS C 3 566 ? -43.669  2.629   -3.776  1.00 0.00 ? 569 LYS M N   1  
ATOM 6722   C CA  . LYS C 3 566 ? -43.661  2.523   -5.218  1.00 0.00 ? 569 LYS M CA  1  
ATOM 6723   C C   . LYS C 3 566 ? -43.877  3.917   -5.798  1.00 0.00 ? 569 LYS M C   1  
ATOM 6724   O O   . LYS C 3 566 ? -45.012  4.422   -5.816  1.00 0.00 ? 569 LYS M O   1  
ATOM 6725   C CB  . LYS C 3 566 ? -44.784  1.578   -5.649  1.00 0.00 ? 569 LYS M CB  1  
ATOM 6726   C CG  . LYS C 3 566 ? -45.015  1.525   -7.158  1.00 0.00 ? 569 LYS M CG  1  
ATOM 6727   C CD  . LYS C 3 566 ? -46.471  1.220   -7.523  1.00 0.00 ? 569 LYS M CD  1  
ATOM 6728   C CE  . LYS C 3 566 ? -46.669  0.071   -8.518  1.00 0.00 ? 569 LYS M CE  1  
ATOM 6729   N NZ  . LYS C 3 566 ? -48.033  -0.521  -8.470  1.00 0.00 ? 569 LYS M NZ  1  
ATOM 6730   N N   . PRO C 3 567 ? -42.798  4.573   -6.251  1.00 0.00 ? 570 PRO M N   1  
ATOM 6731   C CA  . PRO C 3 567 ? -42.906  5.918   -6.788  1.00 0.00 ? 570 PRO M CA  1  
ATOM 6732   C C   . PRO C 3 567 ? -44.020  6.071   -7.836  1.00 0.00 ? 570 PRO M C   1  
ATOM 6733   O O   . PRO C 3 567 ? -44.230  5.169   -8.661  1.00 0.00 ? 570 PRO M O   1  
ATOM 6734   C CB  . PRO C 3 567 ? -41.516  6.289   -7.329  1.00 0.00 ? 570 PRO M CB  1  
ATOM 6735   C CG  . PRO C 3 567 ? -40.559  5.133   -7.032  1.00 0.00 ? 570 PRO M CG  1  
ATOM 6736   C CD  . PRO C 3 567 ? -41.407  4.021   -6.425  1.00 0.00 ? 570 PRO M CD  1  
ATOM 6737   N N   . ALA C 3 568 ? -44.754  7.203   -7.765  1.00 0.00 ? 571 ALA M N   1  
ATOM 6738   C CA  . ALA C 3 568 ? -45.850  7.526   -8.669  1.00 0.00 ? 571 ALA M CA  1  
ATOM 6739   C C   . ALA C 3 568 ? -46.038  9.050   -8.809  1.00 0.00 ? 571 ALA M C   1  
ATOM 6740   O O   . ALA C 3 568 ? -47.146  9.599   -8.655  1.00 0.00 ? 571 ALA M O   1  
ATOM 6741   C CB  . ALA C 3 568 ? -47.128  6.818   -8.226  1.00 0.00 ? 571 ALA M CB  1  
ATOM 6742   N N   . ALA C 3 572 ? -46.672  13.581  -3.548  1.00 0.00 ? 575 ALA M N   1  
ATOM 6743   C CA  . ALA C 3 572 ? -45.280  13.754  -3.178  1.00 0.00 ? 575 ALA M CA  1  
ATOM 6744   C C   . ALA C 3 572 ? -44.462  12.461  -3.094  1.00 0.00 ? 575 ALA M C   1  
ATOM 6745   O O   . ALA C 3 572 ? -44.660  11.515  -3.853  1.00 0.00 ? 575 ALA M O   1  
ATOM 6746   C CB  . ALA C 3 572 ? -45.116  14.552  -1.901  1.00 0.00 ? 575 ALA M CB  1  
ATOM 6747   N N   . GLU C 3 573 ? -43.526  12.450  -2.143  1.00 0.00 ? 576 GLU M N   1  
ATOM 6748   C CA  . GLU C 3 573 ? -42.604  11.355  -1.888  1.00 0.00 ? 576 GLU M CA  1  
ATOM 6749   C C   . GLU C 3 573 ? -43.131  10.366  -0.849  1.00 0.00 ? 576 GLU M C   1  
ATOM 6750   O O   . GLU C 3 573 ? -44.154  10.584  -0.241  1.00 0.00 ? 576 GLU M O   1  
ATOM 6751   C CB  . GLU C 3 573 ? -41.301  11.946  -1.352  1.00 0.00 ? 576 GLU M CB  1  
ATOM 6752   C CG  . GLU C 3 573 ? -40.002  11.470  -2.046  1.00 0.00 ? 576 GLU M CG  1  
ATOM 6753   C CD  . GLU C 3 573 ? -38.777  12.041  -1.362  1.00 0.00 ? 576 GLU M CD  1  
ATOM 6754   O OE1 . GLU C 3 573 ? -38.862  13.361  -1.112  1.00 0.00 ? 576 GLU M OE1 1  
ATOM 6755   O OE2 . GLU C 3 573 ? -37.806  11.338  -1.037  1.00 0.00 ? 576 GLU M OE2 1  
ATOM 6756   N N   . ALA C 3 574 ? -42.391  9.287   -0.613  1.00 0.00 ? 577 ALA M N   1  
ATOM 6757   C CA  . ALA C 3 574 ? -42.859  8.337   0.348   1.00 0.00 ? 577 ALA M CA  1  
ATOM 6758   C C   . ALA C 3 574 ? -41.698  7.538   0.909   1.00 0.00 ? 577 ALA M C   1  
ATOM 6759   O O   . ALA C 3 574 ? -40.759  7.228   0.198   1.00 0.00 ? 577 ALA M O   1  
ATOM 6760   C CB  . ALA C 3 574 ? -43.882  7.442   -0.316  1.00 0.00 ? 577 ALA M CB  1  
ATOM 6761   N N   . HIS C 3 575 ? -41.781  7.161   2.173   1.00 0.00 ? 578 HIS M N   1  
ATOM 6762   C CA  . HIS C 3 575 ? -40.685  6.420   2.716   1.00 0.00 ? 578 HIS M CA  1  
ATOM 6763   C C   . HIS C 3 575 ? -41.060  5.056   3.113   1.00 0.00 ? 578 HIS M C   1  
ATOM 6764   O O   . HIS C 3 575 ? -40.225  4.179   3.262   1.00 0.00 ? 578 HIS M O   1  
ATOM 6765   C CB  . HIS C 3 575 ? -40.045  7.101   3.905   1.00 0.00 ? 578 HIS M CB  1  
ATOM 6766   C CG  . HIS C 3 575 ? -39.789  8.531   3.598   1.00 0.00 ? 578 HIS M CG  1  
ATOM 6767   N ND1 . HIS C 3 575 ? -38.527  9.022   3.454   1.00 0.00 ? 578 HIS M ND1 1  
ATOM 6768   C CD2 . HIS C 3 575 ? -40.678  9.536   3.386   1.00 0.00 ? 578 HIS M CD2 1  
ATOM 6769   C CE1 . HIS C 3 575 ? -38.651  10.291  3.158   1.00 0.00 ? 578 HIS M CE1 1  
ATOM 6770   N NE2 . HIS C 3 575 ? -39.925  10.642  3.127   1.00 0.00 ? 578 HIS M NE2 1  
ATOM 6771   N N   . PHE C 3 576 ? -42.337  4.881   3.313   1.00 0.00 ? 579 PHE M N   1  
ATOM 6772   C CA  . PHE C 3 576 ? -42.730  3.566   3.686   1.00 0.00 ? 579 PHE M CA  1  
ATOM 6773   C C   . PHE C 3 576 ? -44.194  3.416   3.711   1.00 0.00 ? 579 PHE M C   1  
ATOM 6774   O O   . PHE C 3 576 ? -44.911  4.302   4.111   1.00 0.00 ? 579 PHE M O   1  
ATOM 6775   C CB  . PHE C 3 576 ? -42.107  3.057   4.963   1.00 0.00 ? 579 PHE M CB  1  
ATOM 6776   C CG  . PHE C 3 576 ? -42.819  3.562   6.189   1.00 0.00 ? 579 PHE M CG  1  
ATOM 6777   C CD1 . PHE C 3 576 ? -43.907  2.884   6.710   1.00 0.00 ? 579 PHE M CD1 1  
ATOM 6778   C CD2 . PHE C 3 576 ? -42.387  4.716   6.838   1.00 0.00 ? 579 PHE M CD2 1  
ATOM 6779   C CE1 . PHE C 3 576 ? -44.532  3.359   7.860   1.00 0.00 ? 579 PHE M CE1 1  
ATOM 6780   C CE2 . PHE C 3 576 ? -43.000  5.199   7.986   1.00 0.00 ? 579 PHE M CE2 1  
ATOM 6781   C CZ  . PHE C 3 576 ? -44.077  4.499   8.489   1.00 0.00 ? 579 PHE M CZ  1  
ATOM 6782   N N   . SER C 3 577 ? -44.566  2.287   3.192   1.00 0.00 ? 580 SER M N   1  
ATOM 6783   C CA  . SER C 3 577 ? -45.918  1.947   3.076   1.00 0.00 ? 580 SER M CA  1  
ATOM 6784   C C   . SER C 3 577 ? -46.183  0.849   4.050   1.00 0.00 ? 580 SER M C   1  
ATOM 6785   O O   . SER C 3 577 ? -45.359  0.070   4.411   1.00 0.00 ? 580 SER M O   1  
ATOM 6786   C CB  . SER C 3 577 ? -46.271  1.592   1.660   1.00 0.00 ? 580 SER M CB  1  
ATOM 6787   O OG  . SER C 3 577 ? -45.146  1.154   0.983   1.00 0.00 ? 580 SER M OG  1  
ATOM 6788   N N   . LEU C 3 578 ? -47.399  0.852   4.484   1.00 0.00 ? 581 LEU M N   1  
ATOM 6789   C CA  . LEU C 3 578 ? -47.950  -0.123  5.369   1.00 0.00 ? 581 LEU M CA  1  
ATOM 6790   C C   . LEU C 3 578 ? -49.193  -0.739  4.763   1.00 0.00 ? 581 LEU M C   1  
ATOM 6791   O O   . LEU C 3 578 ? -49.925  -0.152  3.952   1.00 0.00 ? 581 LEU M O   1  
ATOM 6792   C CB  . LEU C 3 578 ? -48.365  0.558   6.665   1.00 0.00 ? 581 LEU M CB  1  
ATOM 6793   C CG  . LEU C 3 578 ? -47.436  0.177   7.775   1.00 0.00 ? 581 LEU M CG  1  
ATOM 6794   C CD1 . LEU C 3 578 ? -46.071  0.702   7.413   1.00 0.00 ? 581 LEU M CD1 1  
ATOM 6795   C CD2 . LEU C 3 578 ? -47.905  0.732   9.122   1.00 0.00 ? 581 LEU M CD2 1  
ATOM 6796   N N   . VAL C 3 579 ? -49.475  -1.930  5.187   1.00 0.00 ? 582 VAL M N   1  
ATOM 6797   C CA  . VAL C 3 579 ? -50.626  -2.624  4.685   1.00 0.00 ? 582 VAL M CA  1  
ATOM 6798   C C   . VAL C 3 579 ? -51.747  -2.756  5.701   1.00 0.00 ? 582 VAL M C   1  
ATOM 6799   O O   . VAL C 3 579 ? -51.905  -3.772  6.398   1.00 0.00 ? 582 VAL M O   1  
ATOM 6800   C CB  . VAL C 3 579 ? -50.195  -3.961  4.106   1.00 0.00 ? 582 VAL M CB  1  
ATOM 6801   C CG1 . VAL C 3 579 ? -51.387  -4.681  3.527   1.00 0.00 ? 582 VAL M CG1 1  
ATOM 6802   C CG2 . VAL C 3 579 ? -49.241  -3.657  2.986   1.00 0.00 ? 582 VAL M CG2 1  
ATOM 6803   N N   . HIS C 3 580 ? -52.542  -1.705  5.782   1.00 0.00 ? 583 HIS M N   1  
ATOM 6804   C CA  . HIS C 3 580 ? -53.654  -1.637  6.709   1.00 0.00 ? 583 HIS M CA  1  
ATOM 6805   C C   . HIS C 3 580 ? -54.837  -2.390  6.128   1.00 0.00 ? 583 HIS M C   1  
ATOM 6806   O O   . HIS C 3 580 ? -54.872  -2.690  4.947   1.00 0.00 ? 583 HIS M O   1  
ATOM 6807   C CB  . HIS C 3 580 ? -54.088  -0.170  6.982   1.00 0.00 ? 583 HIS M CB  1  
ATOM 6808   C CG  . HIS C 3 580 ? -53.060  0.774   7.530   1.00 0.00 ? 583 HIS M CG  1  
ATOM 6809   N ND1 . HIS C 3 580 ? -53.048  1.132   8.859   1.00 0.00 ? 583 HIS M ND1 1  
ATOM 6810   C CD2 . HIS C 3 580 ? -52.058  1.446   6.931   1.00 0.00 ? 583 HIS M CD2 1  
ATOM 6811   C CE1 . HIS C 3 580 ? -52.083  2.042   9.034   1.00 0.00 ? 583 HIS M CE1 1  
ATOM 6812   N NE2 . HIS C 3 580 ? -51.458  2.252   7.918   1.00 0.00 ? 583 HIS M NE2 1  
ATOM 6813   N N   . TYR C 3 581 ? -55.858  -2.676  6.964   1.00 0.00 ? 584 TYR M N   1  
ATOM 6814   C CA  . TYR C 3 581 ? -57.010  -3.392  6.446   1.00 0.00 ? 584 TYR M CA  1  
ATOM 6815   C C   . TYR C 3 581 ? -57.657  -2.714  5.242   1.00 0.00 ? 584 TYR M C   1  
ATOM 6816   O O   . TYR C 3 581 ? -58.094  -3.374  4.302   1.00 0.00 ? 584 TYR M O   1  
ATOM 6817   C CB  . TYR C 3 581 ? -58.043  -3.652  7.528   1.00 0.00 ? 584 TYR M CB  1  
ATOM 6818   C CG  . TYR C 3 581 ? -58.754  -2.392  7.944   1.00 0.00 ? 584 TYR M CG  1  
ATOM 6819   C CD1 . TYR C 3 581 ? -59.752  -1.842  7.149   1.00 0.00 ? 584 TYR M CD1 1  
ATOM 6820   C CD2 . TYR C 3 581 ? -58.452  -1.782  9.160   1.00 0.00 ? 584 TYR M CD2 1  
ATOM 6821   C CE1 . TYR C 3 581 ? -60.391  -0.660  7.500   1.00 0.00 ? 584 TYR M CE1 1  
ATOM 6822   C CE2 . TYR C 3 581 ? -59.118  -0.629  9.567   1.00 0.00 ? 584 TYR M CE2 1  
ATOM 6823   C CZ  . TYR C 3 581 ? -60.080  -0.064  8.729   1.00 0.00 ? 584 TYR M CZ  1  
ATOM 6824   O OH  . TYR C 3 581 ? -60.711  1.074   9.131   1.00 0.00 ? 584 TYR M OH  1  
ATOM 6825   N N   . ALA C 3 582 ? -57.735  -1.364  5.316   1.00 0.00 ? 585 ALA M N   1  
ATOM 6826   C CA  . ALA C 3 582 ? -58.341  -0.554  4.253   1.00 0.00 ? 585 ALA M CA  1  
ATOM 6827   C C   . ALA C 3 582 ? -57.521  -0.506  2.965   1.00 0.00 ? 585 ALA M C   1  
ATOM 6828   O O   . ALA C 3 582 ? -58.048  -0.354  1.826   1.00 0.00 ? 585 ALA M O   1  
ATOM 6829   C CB  . ALA C 3 582 ? -58.693  0.810   4.753   1.00 0.00 ? 585 ALA M CB  1  
ATOM 6830   N N   . GLY C 3 583 ? -56.222  -0.689  3.148   1.00 0.00 ? 586 GLY M N   1  
ATOM 6831   C CA  . GLY C 3 583 ? -55.294  -0.698  2.044   1.00 0.00 ? 586 GLY M CA  1  
ATOM 6832   C C   . GLY C 3 583 ? -53.903  -0.266  2.430   1.00 0.00 ? 586 GLY M C   1  
ATOM 6833   O O   . GLY C 3 583 ? -53.500  -0.291  3.610   1.00 0.00 ? 586 GLY M O   1  
ATOM 6834   N N   . THR C 3 584 ? -53.135  0.105   1.389   1.00 0.00 ? 587 THR M N   1  
ATOM 6835   C CA  . THR C 3 584 ? -51.749  0.521   1.489   1.00 0.00 ? 587 THR M CA  1  
ATOM 6836   C C   . THR C 3 584 ? -51.605  1.989   1.669   1.00 0.00 ? 587 THR M C   1  
ATOM 6837   O O   . THR C 3 584 ? -52.087  2.770   0.844   1.00 0.00 ? 587 THR M O   1  
ATOM 6838   C CB  . THR C 3 584 ? -50.971  0.207   0.228   1.00 0.00 ? 587 THR M CB  1  
ATOM 6839   O OG1 . THR C 3 584 ? -50.756  -1.199  0.164   1.00 0.00 ? 587 THR M OG1 1  
ATOM 6840   C CG2 . THR C 3 584 ? -49.640  0.942   0.291   1.00 0.00 ? 587 THR M CG2 1  
ATOM 6841   N N   . VAL C 3 585 ? -50.912  2.351   2.726   1.00 0.00 ? 588 VAL M N   1  
ATOM 6842   C CA  . VAL C 3 585 ? -50.712  3.767   2.970   1.00 0.00 ? 588 VAL M CA  1  
ATOM 6843   C C   . VAL C 3 585 ? -49.227  4.092   2.846   1.00 0.00 ? 588 VAL M C   1  
ATOM 6844   O O   . VAL C 3 585 ? -48.342  3.407   3.373   1.00 0.00 ? 588 VAL M O   1  
ATOM 6845   C CB  . VAL C 3 585 ? -51.375  4.260   4.234   1.00 0.00 ? 588 VAL M CB  1  
ATOM 6846   C CG1 . VAL C 3 585 ? -51.197  5.758   4.366   1.00 0.00 ? 588 VAL M CG1 1  
ATOM 6847   C CG2 . VAL C 3 585 ? -52.878  3.930   4.221   1.00 0.00 ? 588 VAL M CG2 1  
ATOM 6848   N N   . ASP C 3 586 ? -48.979  5.089   2.031   1.00 0.00 ? 589 ASP M N   1  
ATOM 6849   C CA  . ASP C 3 586 ? -47.642  5.560   1.752   1.00 0.00 ? 589 ASP M CA  1  
ATOM 6850   C C   . ASP C 3 586 ? -47.319  6.693   2.701   1.00 0.00 ? 589 ASP M C   1  
ATOM 6851   O O   . ASP C 3 586 ? -47.920  7.772   2.653   1.00 0.00 ? 589 ASP M O   1  
ATOM 6852   C CB  . ASP C 3 586 ? -47.516  5.997   0.285   1.00 0.00 ? 589 ASP M CB  1  
ATOM 6853   C CG  . ASP C 3 586 ? -47.703  4.862   -0.677  1.00 0.00 ? 589 ASP M CG  1  
ATOM 6854   O OD1 . ASP C 3 586 ? -46.725  3.991   -0.618  1.00 0.00 ? 589 ASP M OD1 1  
ATOM 6855   O OD2 . ASP C 3 586 ? -48.673  4.781   -1.417  1.00 0.00 ? 589 ASP M OD2 1  
ATOM 6856   N N   . TYR C 3 587 ? -46.388  6.414   3.613   1.00 0.00 ? 590 TYR M N   1  
ATOM 6857   C CA  . TYR C 3 587 ? -46.024  7.370   4.667   1.00 0.00 ? 590 TYR M CA  1  
ATOM 6858   C C   . TYR C 3 587 ? -44.718  8.083   4.415   1.00 0.00 ? 590 TYR M C   1  
ATOM 6859   O O   . TYR C 3 587 ? -43.719  7.467   4.032   1.00 0.00 ? 590 TYR M O   1  
ATOM 6860   C CB  . TYR C 3 587 ? -46.087  6.779   6.117   1.00 0.00 ? 590 TYR M CB  1  
ATOM 6861   C CG  . TYR C 3 587 ? -47.413  6.201   6.613   1.00 0.00 ? 590 TYR M CG  1  
ATOM 6862   C CD1 . TYR C 3 587 ? -48.326  7.044   7.257   1.00 0.00 ? 590 TYR M CD1 1  
ATOM 6863   C CD2 . TYR C 3 587 ? -47.771  4.844   6.555   1.00 0.00 ? 590 TYR M CD2 1  
ATOM 6864   C CE1 . TYR C 3 587 ? -49.533  6.585   7.779   1.00 0.00 ? 590 TYR M CE1 1  
ATOM 6865   C CE2 . TYR C 3 587 ? -48.989  4.372   7.057   1.00 0.00 ? 590 TYR M CE2 1  
ATOM 6866   C CZ  . TYR C 3 587 ? -49.877  5.245   7.650   1.00 0.00 ? 590 TYR M CZ  1  
ATOM 6867   O OH  . TYR C 3 587 ? -51.068  4.678   8.109   1.00 0.00 ? 590 TYR M OH  1  
ATOM 6868   N N   . ASN C 3 588 ? -44.761  9.393   4.654   1.00 0.00 ? 591 ASN M N   1  
ATOM 6869   C CA  . ASN C 3 588 ? -43.621  10.299  4.553   1.00 0.00 ? 591 ASN M CA  1  
ATOM 6870   C C   . ASN C 3 588 ? -43.170  10.666  5.933   1.00 0.00 ? 591 ASN M C   1  
ATOM 6871   O O   . ASN C 3 588 ? -43.935  11.219  6.724   1.00 0.00 ? 591 ASN M O   1  
ATOM 6872   C CB  . ASN C 3 588 ? -43.939  11.578  3.805   1.00 0.00 ? 591 ASN M CB  1  
ATOM 6873   C CG  . ASN C 3 588 ? -42.817  12.584  3.874   1.00 0.00 ? 591 ASN M CG  1  
ATOM 6874   O OD1 . ASN C 3 588 ? -42.544  13.143  4.938   1.00 0.00 ? 591 ASN M OD1 1  
ATOM 6875   N ND2 . ASN C 3 588 ? -42.163  12.842  2.750   1.00 0.00 ? 591 ASN M ND2 1  
ATOM 6876   N N   . ILE C 3 589 ? -41.930  10.386  6.206   1.00 0.00 ? 592 ILE M N   1  
ATOM 6877   C CA  . ILE C 3 589 ? -41.275  10.580  7.504   1.00 0.00 ? 592 ILE M CA  1  
ATOM 6878   C C   . ILE C 3 589 ? -40.488  11.853  7.591   1.00 0.00 ? 592 ILE M C   1  
ATOM 6879   O O   . ILE C 3 589 ? -39.270  11.859  7.591   1.00 0.00 ? 592 ILE M O   1  
ATOM 6880   C CB  . ILE C 3 589 ? -40.279  9.442   7.543   1.00 0.00 ? 592 ILE M CB  1  
ATOM 6881   C CG1 . ILE C 3 589 ? -41.008  8.144   7.357   1.00 0.00 ? 592 ILE M CG1 1  
ATOM 6882   C CG2 . ILE C 3 589 ? -39.501  9.398   8.787   1.00 0.00 ? 592 ILE M CG2 1  
ATOM 6883   C CD1 . ILE C 3 589 ? -40.023  7.079   6.900   1.00 0.00 ? 592 ILE M CD1 1  
ATOM 6884   N N   . SER C 3 590 ? -41.111  12.982  7.618   1.00 0.00 ? 593 SER M N   1  
ATOM 6885   C CA  . SER C 3 590 ? -40.237  14.122  7.628   1.00 0.00 ? 593 SER M CA  1  
ATOM 6886   C C   . SER C 3 590 ? -40.729  15.188  8.555   1.00 0.00 ? 593 SER M C   1  
ATOM 6887   O O   . SER C 3 590 ? -41.555  15.978  8.197   1.00 0.00 ? 593 SER M O   1  
ATOM 6888   C CB  . SER C 3 590 ? -39.869  14.650  6.266   1.00 0.00 ? 593 SER M CB  1  
ATOM 6889   O OG  . SER C 3 590 ? -40.652  15.788  5.955   1.00 0.00 ? 593 SER M OG  1  
ATOM 6890   N N   . GLY C 3 591 ? -40.175  15.159  9.742   1.00 0.00 ? 594 GLY M N   1  
ATOM 6891   C CA  . GLY C 3 591 ? -40.503  16.133  10.735  1.00 0.00 ? 594 GLY M CA  1  
ATOM 6892   C C   . GLY C 3 591 ? -40.859  15.403  11.949  1.00 0.00 ? 594 GLY M C   1  
ATOM 6893   O O   . GLY C 3 591 ? -41.050  15.943  13.070  1.00 0.00 ? 594 GLY M O   1  
ATOM 6894   N N   . TRP C 3 592 ? -40.945  14.099  11.662  1.00 0.00 ? 595 TRP M N   1  
ATOM 6895   C CA  . TRP C 3 592 ? -41.417  13.215  12.699  1.00 0.00 ? 595 TRP M CA  1  
ATOM 6896   C C   . TRP C 3 592 ? -40.655  13.347  13.961  1.00 0.00 ? 595 TRP M C   1  
ATOM 6897   O O   . TRP C 3 592 ? -41.247  13.584  15.032  1.00 0.00 ? 595 TRP M O   1  
ATOM 6898   C CB  . TRP C 3 592 ? -41.495  11.808  12.210  1.00 0.00 ? 595 TRP M CB  1  
ATOM 6899   C CG  . TRP C 3 592 ? -42.490  11.680  11.130  1.00 0.00 ? 595 TRP M CG  1  
ATOM 6900   C CD1 . TRP C 3 592 ? -42.798  12.596  10.203  1.00 0.00 ? 595 TRP M CD1 1  
ATOM 6901   C CD2 . TRP C 3 592 ? -43.235  10.516  10.830  1.00 0.00 ? 595 TRP M CD2 1  
ATOM 6902   N NE1 . TRP C 3 592 ? -43.762  12.099  9.348   1.00 0.00 ? 595 TRP M NE1 1  
ATOM 6903   C CE2 . TRP C 3 592 ? -44.033  10.816  9.714   1.00 0.00 ? 595 TRP M CE2 1  
ATOM 6904   C CE3 . TRP C 3 592 ? -43.294  9.271   11.411  1.00 0.00 ? 595 TRP M CE3 1  
ATOM 6905   C CZ2 . TRP C 3 592 ? -44.890  9.897   9.164   1.00 0.00 ? 595 TRP M CZ2 1  
ATOM 6906   C CZ3 . TRP C 3 592 ? -44.138  8.368   10.875  1.00 0.00 ? 595 TRP M CZ3 1  
ATOM 6907   C CH2 . TRP C 3 592 ? -44.920  8.675   9.775   1.00 0.00 ? 595 TRP M CH2 1  
ATOM 6908   N N   . LEU C 3 593 ? -39.340  13.235  13.774  1.00 0.00 ? 596 LEU M N   1  
ATOM 6909   C CA  . LEU C 3 593 ? -38.434  13.290  14.934  1.00 0.00 ? 596 LEU M CA  1  
ATOM 6910   C C   . LEU C 3 593 ? -38.751  14.476  15.798  1.00 0.00 ? 596 LEU M C   1  
ATOM 6911   O O   . LEU C 3 593 ? -39.011  14.340  16.980  1.00 0.00 ? 596 LEU M O   1  
ATOM 6912   C CB  . LEU C 3 593 ? -37.000  13.331  14.470  1.00 0.00 ? 596 LEU M CB  1  
ATOM 6913   C CG  . LEU C 3 593 ? -36.207  12.094  14.878  1.00 0.00 ? 596 LEU M CG  1  
ATOM 6914   C CD1 . LEU C 3 593 ? -36.881  10.871  14.319  1.00 0.00 ? 596 LEU M CD1 1  
ATOM 6915   C CD2 . LEU C 3 593 ? -34.776  12.126  14.346  1.00 0.00 ? 596 LEU M CD2 1  
ATOM 6916   N N   . GLU C 3 594 ? -38.819  15.616  15.163  1.00 0.00 ? 597 GLU M N   1  
ATOM 6917   C CA  . GLU C 3 594 ? -39.170  16.868  15.827  1.00 0.00 ? 597 GLU M CA  1  
ATOM 6918   C C   . GLU C 3 594 ? -40.527  16.892  16.463  1.00 0.00 ? 597 GLU M C   1  
ATOM 6919   O O   . GLU C 3 594 ? -40.666  17.120  17.666  1.00 0.00 ? 597 GLU M O   1  
ATOM 6920   C CB  . GLU C 3 594 ? -39.205  17.925  14.761  1.00 0.00 ? 597 GLU M CB  1  
ATOM 6921   C CG  . GLU C 3 594 ? -38.022  18.882  14.883  1.00 0.00 ? 597 GLU M CG  1  
ATOM 6922   C CD  . GLU C 3 594 ? -38.516  20.245  15.249  1.00 0.00 ? 597 GLU M CD  1  
ATOM 6923   O OE1 . GLU C 3 594 ? -39.668  20.535  14.690  1.00 0.00 ? 597 GLU M OE1 1  
ATOM 6924   O OE2 . GLU C 3 594 ? -37.936  20.993  16.038  1.00 0.00 ? 597 GLU M OE2 1  
ATOM 6925   N N   . LYS C 3 595 ? -41.518  16.712  15.585  1.00 0.00 ? 598 LYS M N   1  
ATOM 6926   C CA  . LYS C 3 595 ? -42.915  16.707  15.962  1.00 0.00 ? 598 LYS M CA  1  
ATOM 6927   C C   . LYS C 3 595 ? -43.095  15.845  17.131  1.00 0.00 ? 598 LYS M C   1  
ATOM 6928   O O   . LYS C 3 595 ? -43.822  16.170  18.026  1.00 0.00 ? 598 LYS M O   1  
ATOM 6929   C CB  . LYS C 3 595 ? -43.745  16.115  14.862  1.00 0.00 ? 598 LYS M CB  1  
ATOM 6930   C CG  . LYS C 3 595 ? -44.765  17.099  14.299  1.00 0.00 ? 598 LYS M CG  1  
ATOM 6931   C CD  . LYS C 3 595 ? -45.565  16.462  13.195  1.00 0.00 ? 598 LYS M CD  1  
ATOM 6932   C CE  . LYS C 3 595 ? -45.907  17.390  12.053  1.00 0.00 ? 598 LYS M CE  1  
ATOM 6933   N NZ  . LYS C 3 595 ? -45.770  16.757  10.726  1.00 0.00 ? 598 LYS M NZ  1  
ATOM 6934   N N   . ASN C 3 596 ? -42.336  14.765  17.104  1.00 0.00 ? 599 ASN M N   1  
ATOM 6935   C CA  . ASN C 3 596 ? -42.408  13.827  18.180  1.00 0.00 ? 599 ASN M CA  1  
ATOM 6936   C C   . ASN C 3 596 ? -41.665  14.302  19.454  1.00 0.00 ? 599 ASN M C   1  
ATOM 6937   O O   . ASN C 3 596 ? -41.897  13.823  20.545  1.00 0.00 ? 599 ASN M O   1  
ATOM 6938   C CB  . ASN C 3 596 ? -42.043  12.423  17.716  1.00 0.00 ? 599 ASN M CB  1  
ATOM 6939   C CG  . ASN C 3 596 ? -42.812  11.302  18.459  1.00 0.00 ? 599 ASN M CG  1  
ATOM 6940   O OD1 . ASN C 3 596 ? -43.916  11.475  18.917  1.00 0.00 ? 599 ASN M OD1 1  
ATOM 6941   N ND2 . ASN C 3 596 ? -42.297  10.099  18.608  1.00 0.00 ? 599 ASN M ND2 1  
ATOM 6942   N N   . LYS C 3 597 ? -40.836  15.293  19.371  1.00 0.00 ? 600 LYS M N   1  
ATOM 6943   C CA  . LYS C 3 597 ? -40.065  15.729  20.547  1.00 0.00 ? 600 LYS M CA  1  
ATOM 6944   C C   . LYS C 3 597 ? -40.699  16.857  21.330  1.00 0.00 ? 600 LYS M C   1  
ATOM 6945   O O   . LYS C 3 597 ? -40.431  17.086  22.508  1.00 0.00 ? 600 LYS M O   1  
ATOM 6946   C CB  . LYS C 3 597 ? -38.664  16.174  20.147  1.00 0.00 ? 600 LYS M CB  1  
ATOM 6947   C CG  . LYS C 3 597 ? -37.741  15.021  19.796  1.00 0.00 ? 600 LYS M CG  1  
ATOM 6948   C CD  . LYS C 3 597 ? -36.291  15.360  19.945  1.00 0.00 ? 600 LYS M CD  1  
ATOM 6949   C CE  . LYS C 3 597 ? -35.428  14.733  18.888  1.00 0.00 ? 600 LYS M CE  1  
ATOM 6950   N NZ  . LYS C 3 597 ? -33.969  15.035  19.001  1.00 0.00 ? 600 LYS M NZ  1  
ATOM 6951   N N   . ASP C 3 598 ? -41.584  17.550  20.656  1.00 0.00 ? 601 ASP M N   1  
ATOM 6952   C CA  . ASP C 3 598 ? -42.261  18.680  21.219  1.00 0.00 ? 601 ASP M CA  1  
ATOM 6953   C C   . ASP C 3 598 ? -41.309  19.617  21.887  1.00 0.00 ? 601 ASP M C   1  
ATOM 6954   O O   . ASP C 3 598 ? -41.425  19.843  23.062  1.00 0.00 ? 601 ASP M O   1  
ATOM 6955   C CB  . ASP C 3 598 ? -43.477  18.406  22.079  1.00 0.00 ? 601 ASP M CB  1  
ATOM 6956   C CG  . ASP C 3 598 ? -44.437  19.533  21.876  1.00 0.00 ? 601 ASP M CG  1  
ATOM 6957   O OD1 . ASP C 3 598 ? -44.231  20.117  20.693  1.00 0.00 ? 601 ASP M OD1 1  
ATOM 6958   O OD2 . ASP C 3 598 ? -45.281  19.879  22.738  1.00 0.00 ? 601 ASP M OD2 1  
ATOM 6959   N N   . PRO C 3 599 ? -39.521  10.173  23.691  1.00 0.00 ? 602 PRO M N   1  
ATOM 6960   C CA  . PRO C 3 599 ? -38.361  10.611  24.419  1.00 0.00 ? 602 PRO M CA  1  
ATOM 6961   C C   . PRO C 3 599 ? -38.492  12.043  24.922  1.00 0.00 ? 602 PRO M C   1  
ATOM 6962   O O   . PRO C 3 599 ? -38.657  12.937  24.131  1.00 0.00 ? 602 PRO M O   1  
ATOM 6963   C CB  . PRO C 3 599 ? -37.235  10.582  23.438  1.00 0.00 ? 602 PRO M CB  1  
ATOM 6964   C CG  . PRO C 3 599 ? -37.743  10.114  22.109  1.00 0.00 ? 602 PRO M CG  1  
ATOM 6965   C CD  . PRO C 3 599 ? -39.229  9.905   22.272  1.00 0.00 ? 602 PRO M CD  1  
ATOM 6966   N N   . LEU C 3 600 ? -38.338  12.199  26.233  1.00 0.00 ? 603 LEU M N   1  
ATOM 6967   C CA  . LEU C 3 600 ? -38.449  13.479  26.907  1.00 0.00 ? 603 LEU M CA  1  
ATOM 6968   C C   . LEU C 3 600 ? -37.308  13.668  27.918  1.00 0.00 ? 603 LEU M C   1  
ATOM 6969   O O   . LEU C 3 600 ? -37.005  12.775  28.705  1.00 0.00 ? 603 LEU M O   1  
ATOM 6970   C CB  . LEU C 3 600 ? -39.803  13.589  27.670  1.00 0.00 ? 603 LEU M CB  1  
ATOM 6971   C CG  . LEU C 3 600 ? -40.927  14.321  26.943  1.00 0.00 ? 603 LEU M CG  1  
ATOM 6972   C CD1 . LEU C 3 600 ? -40.971  13.947  25.476  1.00 0.00 ? 603 LEU M CD1 1  
ATOM 6973   C CD2 . LEU C 3 600 ? -42.212  13.915  27.559  1.00 0.00 ? 603 LEU M CD2 1  
ATOM 6974   N N   . ASN C 3 601 ? -36.670  14.838  27.937  1.00 0.00 ? 604 ASN M N   1  
ATOM 6975   C CA  . ASN C 3 601 ? -35.601  15.116  28.881  1.00 0.00 ? 604 ASN M CA  1  
ATOM 6976   C C   . ASN C 3 601 ? -36.128  15.180  30.270  1.00 0.00 ? 604 ASN M C   1  
ATOM 6977   O O   . ASN C 3 601 ? -36.638  16.098  30.822  1.00 0.00 ? 604 ASN M O   1  
ATOM 6978   C CB  . ASN C 3 601 ? -34.574  16.204  28.478  1.00 0.00 ? 604 ASN M CB  1  
ATOM 6979   C CG  . ASN C 3 601 ? -34.002  17.140  29.459  1.00 0.00 ? 604 ASN M CG  1  
ATOM 6980   O OD1 . ASN C 3 601 ? -34.308  17.129  30.675  1.00 0.00 ? 604 ASN M OD1 1  
ATOM 6981   N ND2 . ASN C 3 601 ? -33.124  17.992  28.933  1.00 0.00 ? 604 ASN M ND2 1  
ATOM 6982   N N   . GLU C 3 602 ? -35.896  14.107  30.928  1.00 0.00 ? 605 GLU M N   1  
ATOM 6983   C CA  . GLU C 3 602 ? -36.347  13.885  32.268  1.00 0.00 ? 605 GLU M CA  1  
ATOM 6984   C C   . GLU C 3 602 ? -35.859  14.852  33.324  1.00 0.00 ? 605 GLU M C   1  
ATOM 6985   O O   . GLU C 3 602 ? -36.494  15.029  34.345  1.00 0.00 ? 605 GLU M O   1  
ATOM 6986   C CB  . GLU C 3 602 ? -36.328  12.379  32.628  1.00 0.00 ? 605 GLU M CB  1  
ATOM 6987   C CG  . GLU C 3 602 ? -37.487  11.612  31.890  1.00 0.00 ? 605 GLU M CG  1  
ATOM 6988   C CD  . GLU C 3 602 ? -37.169  10.214  31.441  1.00 0.00 ? 605 GLU M CD  1  
ATOM 6989   O OE1 . GLU C 3 602 ? -36.615  10.132  30.246  1.00 0.00 ? 605 GLU M OE1 1  
ATOM 6990   O OE2 . GLU C 3 602 ? -37.440  9.236   32.118  1.00 0.00 ? 605 GLU M OE2 1  
ATOM 6991   N N   . THR C 3 603 ? -34.764  15.548  33.033  1.00 0.00 ? 606 THR M N   1  
ATOM 6992   C CA  . THR C 3 603 ? -34.256  16.488  33.995  1.00 0.00 ? 606 THR M CA  1  
ATOM 6993   C C   . THR C 3 603 ? -35.214  17.628  34.115  1.00 0.00 ? 606 THR M C   1  
ATOM 6994   O O   . THR C 3 603 ? -35.661  18.014  35.182  1.00 0.00 ? 606 THR M O   1  
ATOM 6995   C CB  . THR C 3 603 ? -32.938  17.018  33.536  1.00 0.00 ? 606 THR M CB  1  
ATOM 6996   O OG1 . THR C 3 603 ? -32.064  15.919  33.549  1.00 0.00 ? 606 THR M OG1 1  
ATOM 6997   C CG2 . THR C 3 603 ? -32.478  18.078  34.488  1.00 0.00 ? 606 THR M CG2 1  
ATOM 6998   N N   . VAL C 3 604 ? -35.584  18.113  32.949  1.00 0.00 ? 607 VAL M N   1  
ATOM 6999   C CA  . VAL C 3 604 ? -36.545  19.199  32.827  1.00 0.00 ? 607 VAL M CA  1  
ATOM 7000   C C   . VAL C 3 604 ? -37.893  18.866  33.457  1.00 0.00 ? 607 VAL M C   1  
ATOM 7001   O O   . VAL C 3 604 ? -38.465  19.620  34.244  1.00 0.00 ? 607 VAL M O   1  
ATOM 7002   C CB  . VAL C 3 604 ? -36.739  19.641  31.414  1.00 0.00 ? 607 VAL M CB  1  
ATOM 7003   C CG1 . VAL C 3 604 ? -37.558  20.863  31.445  1.00 0.00 ? 607 VAL M CG1 1  
ATOM 7004   C CG2 . VAL C 3 604 ? -35.396  19.915  30.784  1.00 0.00 ? 607 VAL M CG2 1  
ATOM 7005   N N   . ILE C 3 605 ? -38.378  17.714  33.095  1.00 0.00 ? 608 ILE M N   1  
ATOM 7006   C CA  . ILE C 3 605 ? -39.639  17.241  33.590  1.00 0.00 ? 608 ILE M CA  1  
ATOM 7007   C C   . ILE C 3 605 ? -39.599  17.312  35.077  1.00 0.00 ? 608 ILE M C   1  
ATOM 7008   O O   . ILE C 3 605 ? -40.574  17.615  35.761  1.00 0.00 ? 608 ILE M O   1  
ATOM 7009   C CB  . ILE C 3 605 ? -39.864  15.826  33.133  1.00 0.00 ? 608 ILE M CB  1  
ATOM 7010   C CG1 . ILE C 3 605 ? -39.761  15.823  31.632  1.00 0.00 ? 608 ILE M CG1 1  
ATOM 7011   C CG2 . ILE C 3 605 ? -41.252  15.435  33.540  1.00 0.00 ? 608 ILE M CG2 1  
ATOM 7012   C CD1 . ILE C 3 605 ? -40.912  15.096  30.967  1.00 0.00 ? 608 ILE M CD1 1  
ATOM 7013   N N   . GLY C 3 606 ? -38.375  17.135  35.560  1.00 0.00 ? 609 GLY M N   1  
ATOM 7014   C CA  . GLY C 3 606 ? -38.158  17.166  36.996  1.00 0.00 ? 609 GLY M CA  1  
ATOM 7015   C C   . GLY C 3 606 ? -38.621  18.488  37.499  1.00 0.00 ? 609 GLY M C   1  
ATOM 7016   O O   . GLY C 3 606 ? -39.581  18.610  38.261  1.00 0.00 ? 609 GLY M O   1  
ATOM 7017   N N   . LEU C 3 607 ? -38.064  19.512  36.878  1.00 0.00 ? 610 LEU M N   1  
ATOM 7018   C CA  . LEU C 3 607 ? -38.388  20.888  37.226  1.00 0.00 ? 610 LEU M CA  1  
ATOM 7019   C C   . LEU C 3 607 ? -39.877  21.136  37.193  1.00 0.00 ? 610 LEU M C   1  
ATOM 7020   O O   . LEU C 3 607 ? -40.419  21.795  38.078  1.00 0.00 ? 610 LEU M O   1  
ATOM 7021   C CB  . LEU C 3 607 ? -37.715  21.876  36.274  1.00 0.00 ? 610 LEU M CB  1  
ATOM 7022   C CG  . LEU C 3 607 ? -36.228  22.130  36.561  1.00 0.00 ? 610 LEU M CG  1  
ATOM 7023   C CD1 . LEU C 3 607 ? -35.594  20.903  37.120  1.00 0.00 ? 610 LEU M CD1 1  
ATOM 7024   C CD2 . LEU C 3 607 ? -35.484  22.616  35.309  1.00 0.00 ? 610 LEU M CD2 1  
ATOM 7025   N N   . TYR C 3 608 ? -40.523  20.619  36.153  1.00 0.00 ? 611 TYR M N   1  
ATOM 7026   C CA  . TYR C 3 608 ? -41.950  20.840  36.019  1.00 0.00 ? 611 TYR M CA  1  
ATOM 7027   C C   . TYR C 3 608 ? -42.597  20.270  37.237  1.00 0.00 ? 611 TYR M C   1  
ATOM 7028   O O   . TYR C 3 608 ? -43.393  20.874  37.923  1.00 0.00 ? 611 TYR M O   1  
ATOM 7029   C CB  . TYR C 3 608 ? -42.553  20.154  34.787  1.00 0.00 ? 611 TYR M CB  1  
ATOM 7030   C CG  . TYR C 3 608 ? -42.119  20.681  33.462  1.00 0.00 ? 611 TYR M CG  1  
ATOM 7031   C CD1 . TYR C 3 608 ? -41.343  21.809  33.299  1.00 0.00 ? 611 TYR M CD1 1  
ATOM 7032   C CD2 . TYR C 3 608 ? -42.461  19.961  32.335  1.00 0.00 ? 611 TYR M CD2 1  
ATOM 7033   C CE1 . TYR C 3 608 ? -40.915  22.241  32.059  1.00 0.00 ? 611 TYR M CE1 1  
ATOM 7034   C CE2 . TYR C 3 608 ? -42.053  20.378  31.071  1.00 0.00 ? 611 TYR M CE2 1  
ATOM 7035   C CZ  . TYR C 3 608 ? -41.299  21.535  30.939  1.00 0.00 ? 611 TYR M CZ  1  
ATOM 7036   O OH  . TYR C 3 608 ? -40.979  21.977  29.689  1.00 0.00 ? 611 TYR M OH  1  
ATOM 7037   N N   . GLN C 3 609 ? -42.183  19.075  37.509  1.00 0.00 ? 612 GLN M N   1  
ATOM 7038   C CA  . GLN C 3 609 ? -42.729  18.321  38.622  1.00 0.00 ? 612 GLN M CA  1  
ATOM 7039   C C   . GLN C 3 609 ? -42.707  19.082  39.942  1.00 0.00 ? 612 GLN M C   1  
ATOM 7040   O O   . GLN C 3 609 ? -43.442  18.766  40.863  1.00 0.00 ? 612 GLN M O   1  
ATOM 7041   C CB  . GLN C 3 609 ? -42.024  16.972  38.772  1.00 0.00 ? 612 GLN M CB  1  
ATOM 7042   C CG  . GLN C 3 609 ? -42.945  15.789  38.481  1.00 0.00 ? 612 GLN M CG  1  
ATOM 7043   C CD  . GLN C 3 609 ? -42.151  14.575  38.109  1.00 0.00 ? 612 GLN M CD  1  
ATOM 7044   O OE1 . GLN C 3 609 ? -40.904  14.603  38.211  1.00 0.00 ? 612 GLN M OE1 1  
ATOM 7045   N NE2 . GLN C 3 609 ? -42.845  13.515  37.662  1.00 0.00 ? 612 GLN M NE2 1  
ATOM 7046   N N   . LYS C 3 610 ? -41.831  20.069  40.045  1.00 0.00 ? 613 LYS M N   1  
ATOM 7047   C CA  . LYS C 3 610 ? -41.731  20.875  41.248  1.00 0.00 ? 613 LYS M CA  1  
ATOM 7048   C C   . LYS C 3 610 ? -41.926  22.351  40.977  1.00 0.00 ? 613 LYS M C   1  
ATOM 7049   O O   . LYS C 3 610 ? -41.284  23.220  41.576  1.00 0.00 ? 613 LYS M O   1  
ATOM 7050   C CB  . LYS C 3 610 ? -40.418  20.713  42.028  1.00 0.00 ? 613 LYS M CB  1  
ATOM 7051   C CG  . LYS C 3 610 ? -39.540  19.524  41.696  1.00 0.00 ? 613 LYS M CG  1  
ATOM 7052   C CD  . LYS C 3 610 ? -38.083  19.906  41.889  1.00 0.00 ? 613 LYS M CD  1  
ATOM 7053   C CE  . LYS C 3 610 ? -37.165  18.772  42.325  1.00 0.00 ? 613 LYS M CE  1  
ATOM 7054   N NZ  . LYS C 3 610 ? -35.750  19.043  41.983  1.00 0.00 ? 613 LYS M NZ  1  
ATOM 7055   N N   . SER C 3 611 ? -42.822  22.645  40.044  1.00 0.00 ? 614 SER M N   1  
ATOM 7056   C CA  . SER C 3 611 ? -43.141  24.012  39.677  1.00 0.00 ? 614 SER M CA  1  
ATOM 7057   C C   . SER C 3 611 ? -43.958  24.740  40.725  1.00 0.00 ? 614 SER M C   1  
ATOM 7058   O O   . SER C 3 611 ? -44.649  24.173  41.555  1.00 0.00 ? 614 SER M O   1  
ATOM 7059   C CB  . SER C 3 611 ? -43.925  24.040  38.386  1.00 0.00 ? 614 SER M CB  1  
ATOM 7060   O OG  . SER C 3 611 ? -44.138  25.377  37.994  1.00 0.00 ? 614 SER M OG  1  
ATOM 7061   N N   . SER C 3 612 ? -43.961  26.041  40.603  1.00 0.00 ? 615 SER M N   1  
ATOM 7062   C CA  . SER C 3 612 ? -44.745  26.887  41.507  1.00 0.00 ? 615 SER M CA  1  
ATOM 7063   C C   . SER C 3 612 ? -46.153  27.006  40.951  1.00 0.00 ? 615 SER M C   1  
ATOM 7064   O O   . SER C 3 612 ? -47.073  27.496  41.571  1.00 0.00 ? 615 SER M O   1  
ATOM 7065   C CB  . SER C 3 612 ? -44.116  28.286  41.620  1.00 0.00 ? 615 SER M CB  1  
ATOM 7066   O OG  . SER C 3 612 ? -43.046  28.506  40.714  1.00 0.00 ? 615 SER M OG  1  
ATOM 7067   N N   . VAL C 3 613 ? -46.287  26.523  39.710  1.00 0.00 ? 616 VAL M N   1  
ATOM 7068   C CA  . VAL C 3 613 ? -47.515  26.528  38.969  1.00 0.00 ? 616 VAL M CA  1  
ATOM 7069   C C   . VAL C 3 613 ? -48.122  25.148  38.994  1.00 0.00 ? 616 VAL M C   1  
ATOM 7070   O O   . VAL C 3 613 ? -47.862  24.342  38.131  1.00 0.00 ? 616 VAL M O   1  
ATOM 7071   C CB  . VAL C 3 613 ? -47.282  27.047  37.581  1.00 0.00 ? 616 VAL M CB  1  
ATOM 7072   C CG1 . VAL C 3 613 ? -48.569  27.294  36.859  1.00 0.00 ? 616 VAL M CG1 1  
ATOM 7073   C CG2 . VAL C 3 613 ? -46.614  28.408  37.659  1.00 0.00 ? 616 VAL M CG2 1  
ATOM 7074   N N   . LYS C 3 614 ? -48.853  24.890  40.073  1.00 0.00 ? 617 LYS M N   1  
ATOM 7075   C CA  . LYS C 3 614 ? -49.474  23.648  40.476  1.00 0.00 ? 617 LYS M CA  1  
ATOM 7076   C C   . LYS C 3 614 ? -49.946  22.810  39.321  1.00 0.00 ? 617 LYS M C   1  
ATOM 7077   O O   . LYS C 3 614 ? -49.662  21.617  39.193  1.00 0.00 ? 617 LYS M O   1  
ATOM 7078   C CB  . LYS C 3 614 ? -50.628  23.932  41.391  1.00 0.00 ? 617 LYS M CB  1  
ATOM 7079   C CG  . LYS C 3 614 ? -50.180  24.190  42.822  1.00 0.00 ? 617 LYS M CG  1  
ATOM 7080   C CD  . LYS C 3 614 ? -51.323  24.458  43.797  1.00 0.00 ? 617 LYS M CD  1  
ATOM 7081   C CE  . LYS C 3 614 ? -51.634  23.247  44.676  1.00 0.00 ? 617 LYS M CE  1  
ATOM 7082   N NZ  . LYS C 3 614 ? -52.976  23.263  45.306  1.00 0.00 ? 617 LYS M NZ  1  
ATOM 7083   N N   . THR C 3 615 ? -50.733  23.453  38.507  1.00 0.00 ? 618 THR M N   1  
ATOM 7084   C CA  . THR C 3 615 ? -51.270  22.838  37.322  1.00 0.00 ? 618 THR M CA  1  
ATOM 7085   C C   . THR C 3 615 ? -50.183  22.195  36.482  1.00 0.00 ? 618 THR M C   1  
ATOM 7086   O O   . THR C 3 615 ? -50.217  21.019  36.121  1.00 0.00 ? 618 THR M O   1  
ATOM 7087   C CB  . THR C 3 615 ? -52.025  23.908  36.545  1.00 0.00 ? 618 THR M CB  1  
ATOM 7088   O OG1 . THR C 3 615 ? -53.117  24.303  37.363  1.00 0.00 ? 618 THR M OG1 1  
ATOM 7089   C CG2 . THR C 3 615 ? -52.449  23.338  35.250  1.00 0.00 ? 618 THR M CG2 1  
ATOM 7090   N N   . LEU C 3 616 ? -49.153  22.951  36.200  1.00 0.00 ? 619 LEU M N   1  
ATOM 7091   C CA  . LEU C 3 616 ? -48.031  22.423  35.438  1.00 0.00 ? 619 LEU M CA  1  
ATOM 7092   C C   . LEU C 3 616 ? -47.475  21.299  36.180  1.00 0.00 ? 619 LEU M C   1  
ATOM 7093   O O   . LEU C 3 616 ? -47.183  20.274  35.631  1.00 0.00 ? 619 LEU M O   1  
ATOM 7094   C CB  . LEU C 3 616 ? -46.890  23.419  35.271  1.00 0.00 ? 619 LEU M CB  1  
ATOM 7095   C CG  . LEU C 3 616 ? -45.731  22.767  34.616  1.00 0.00 ? 619 LEU M CG  1  
ATOM 7096   C CD1 . LEU C 3 616 ? -46.216  22.176  33.341  1.00 0.00 ? 619 LEU M CD1 1  
ATOM 7097   C CD2 . LEU C 3 616 ? -44.573  23.758  34.417  1.00 0.00 ? 619 LEU M CD2 1  
ATOM 7098   N N   . ALA C 3 617 ? -47.379  21.493  37.492  1.00 0.00 ? 620 ALA M N   1  
ATOM 7099   C CA  . ALA C 3 617 ? -46.877  20.422  38.308  1.00 0.00 ? 620 ALA M CA  1  
ATOM 7100   C C   . ALA C 3 617 ? -47.723  19.187  38.154  1.00 0.00 ? 620 ALA M C   1  
ATOM 7101   O O   . ALA C 3 617 ? -47.255  18.075  37.973  1.00 0.00 ? 620 ALA M O   1  
ATOM 7102   C CB  . ALA C 3 617 ? -46.867  20.828  39.723  1.00 0.00 ? 620 ALA M CB  1  
ATOM 7103   N N   . LEU C 3 618 ? -48.990  19.363  38.195  1.00 0.00 ? 621 LEU M N   1  
ATOM 7104   C CA  . LEU C 3 618 ? -49.879  18.237  38.075  1.00 0.00 ? 621 LEU M CA  1  
ATOM 7105   C C   . LEU C 3 618 ? -49.726  17.400  36.858  1.00 0.00 ? 621 LEU M C   1  
ATOM 7106   O O   . LEU C 3 618 ? -49.561  16.217  36.968  1.00 0.00 ? 621 LEU M O   1  
ATOM 7107   C CB  . LEU C 3 618 ? -51.321  18.616  38.212  1.00 0.00 ? 621 LEU M CB  1  
ATOM 7108   C CG  . LEU C 3 618 ? -51.740  17.938  39.441  1.00 0.00 ? 621 LEU M CG  1  
ATOM 7109   C CD1 . LEU C 3 618 ? -51.212  18.799  40.581  1.00 0.00 ? 621 LEU M CD1 1  
ATOM 7110   C CD2 . LEU C 3 618 ? -53.252  17.790  39.453  1.00 0.00 ? 621 LEU M CD2 1  
ATOM 7111   N N   . LEU C 3 619 ? -49.876  18.079  35.709  1.00 0.00 ? 622 LEU M N   1  
ATOM 7112   C CA  . LEU C 3 619 ? -49.811  17.460  34.394  1.00 0.00 ? 622 LEU M CA  1  
ATOM 7113   C C   . LEU C 3 619 ? -48.748  16.384  34.277  1.00 0.00 ? 622 LEU M C   1  
ATOM 7114   O O   . LEU C 3 619 ? -48.822  15.524  33.394  1.00 0.00 ? 622 LEU M O   1  
ATOM 7115   C CB  . LEU C 3 619 ? -49.387  18.466  33.341  1.00 0.00 ? 622 LEU M CB  1  
ATOM 7116   C CG  . LEU C 3 619 ? -50.462  19.293  32.719  1.00 0.00 ? 622 LEU M CG  1  
ATOM 7117   C CD1 . LEU C 3 619 ? -51.264  19.869  33.826  1.00 0.00 ? 622 LEU M CD1 1  
ATOM 7118   C CD2 . LEU C 3 619 ? -49.749  20.504  32.049  1.00 0.00 ? 622 LEU M CD2 1  
ATOM 7119   N N   . PHE C 3 620 ? -47.658  16.577  35.008  1.00 0.00 ? 623 PHE M N   1  
ATOM 7120   C CA  . PHE C 3 620 ? -46.513  15.653  34.896  1.00 0.00 ? 623 PHE M CA  1  
ATOM 7121   C C   . PHE C 3 620 ? -46.228  14.922  36.222  1.00 0.00 ? 623 PHE M C   1  
ATOM 7122   O O   . PHE C 3 620 ? -45.098  14.937  36.684  1.00 0.00 ? 623 PHE M O   1  
ATOM 7123   C CB  . PHE C 3 620 ? -45.227  16.384  34.426  1.00 0.00 ? 623 PHE M CB  1  
ATOM 7124   C CG  . PHE C 3 620 ? -45.078  16.845  32.973  1.00 0.00 ? 623 PHE M CG  1  
ATOM 7125   C CD1 . PHE C 3 620 ? -44.568  16.002  31.987  1.00 0.00 ? 623 PHE M CD1 1  
ATOM 7126   C CD2 . PHE C 3 620 ? -45.354  18.159  32.605  1.00 0.00 ? 623 PHE M CD2 1  
ATOM 7127   C CE1 . PHE C 3 620 ? -44.404  16.432  30.663  1.00 0.00 ? 623 PHE M CE1 1  
ATOM 7128   C CE2 . PHE C 3 620 ? -45.190  18.618  31.295  1.00 0.00 ? 623 PHE M CE2 1  
ATOM 7129   C CZ  . PHE C 3 620 ? -44.718  17.746  30.305  1.00 0.00 ? 623 PHE M CZ  1  
ATOM 7130   N N   . ALA C 3 621 ? -47.223  14.227  36.800  1.00 0.00 ? 624 ALA M N   1  
ATOM 7131   C CA  . ALA C 3 621 ? -47.044  13.451  38.050  1.00 0.00 ? 624 ALA M CA  1  
ATOM 7132   C C   . ALA C 3 621 ? -47.022  11.947  37.814  1.00 0.00 ? 624 ALA M C   1  
ATOM 7133   O O   . ALA C 3 621 ? -46.567  11.146  38.646  1.00 0.00 ? 624 ALA M O   1  
ATOM 7134   C CB  . ALA C 3 621 ? -48.093  13.772  39.074  1.00 0.00 ? 624 ALA M CB  1  
ATOM 7135   N N   . THR C 3 622 ? -47.546  11.610  36.664  1.00 0.00 ? 625 THR M N   1  
ATOM 7136   C CA  . THR C 3 622 ? -47.649  10.262  36.158  1.00 0.00 ? 625 THR M CA  1  
ATOM 7137   C C   . THR C 3 622 ? -46.336  9.819   35.472  1.00 0.00 ? 625 THR M C   1  
ATOM 7138   O O   . THR C 3 622 ? -46.190  8.726   34.893  1.00 0.00 ? 625 THR M O   1  
ATOM 7139   C CB  . THR C 3 622 ? -48.865  10.210  35.189  1.00 0.00 ? 625 THR M CB  1  
ATOM 7140   O OG1 . THR C 3 622 ? -48.706  9.197   34.189  1.00 0.00 ? 625 THR M OG1 1  
ATOM 7141   C CG2 . THR C 3 622 ? -49.057  11.577  34.536  1.00 0.00 ? 625 THR M CG2 1  
ATOM 7142   N N   . TYR C 3 623 ? -45.356  10.690  35.516  1.00 0.00 ? 626 TYR M N   1  
ATOM 7143   C CA  . TYR C 3 623 ? -44.115  10.401  34.885  1.00 0.00 ? 626 TYR M CA  1  
ATOM 7144   C C   . TYR C 3 623 ? -43.237  9.484   35.718  1.00 0.00 ? 626 TYR M C   1  
ATOM 7145   O O   . TYR C 3 623 ? -43.366  8.270   35.548  1.00 0.00 ? 626 TYR M O   1  
ATOM 7146   C CB  . TYR C 3 623 ? -43.437  11.650  34.319  1.00 0.00 ? 626 TYR M CB  1  
ATOM 7147   C CG  . TYR C 3 623 ? -42.988  11.423  32.907  1.00 0.00 ? 626 TYR M CG  1  
ATOM 7148   C CD1 . TYR C 3 623 ? -43.836  11.591  31.808  1.00 0.00 ? 626 TYR M CD1 1  
ATOM 7149   C CD2 . TYR C 3 623 ? -41.674  11.001  32.689  1.00 0.00 ? 626 TYR M CD2 1  
ATOM 7150   C CE1 . TYR C 3 623 ? -43.344  11.350  30.521  1.00 0.00 ? 626 TYR M CE1 1  
ATOM 7151   C CE2 . TYR C 3 623 ? -41.175  10.747  31.412  1.00 0.00 ? 626 TYR M CE2 1  
ATOM 7152   C CZ  . TYR C 3 623 ? -42.026  10.934  30.317  1.00 0.00 ? 626 TYR M CZ  1  
ATOM 7153   O OH  . TYR C 3 623 ? -41.577  10.699  29.046  1.00 0.00 ? 626 TYR M OH  1  
ATOM 7154   N N   . GLN C 3 644 ? -39.734  12.023  27.595  1.00 0.00 ? 647 GLN M N   1  
ATOM 7155   C CA  . GLN C 3 644 ? -41.071  11.627  27.144  1.00 0.00 ? 647 GLN M CA  1  
ATOM 7156   C C   . GLN C 3 644 ? -41.490  12.239  25.804  1.00 0.00 ? 647 GLN M C   1  
ATOM 7157   O O   . GLN C 3 644 ? -41.494  13.450  25.559  1.00 0.00 ? 647 GLN M O   1  
ATOM 7158   C CB  . GLN C 3 644 ? -42.144  11.856  28.190  1.00 0.00 ? 647 GLN M CB  1  
ATOM 7159   C CG  . GLN C 3 644 ? -43.546  12.028  27.576  1.00 0.00 ? 647 GLN M CG  1  
ATOM 7160   C CD  . GLN C 3 644 ? -44.689  11.596  28.527  1.00 0.00 ? 647 GLN M CD  1  
ATOM 7161   O OE1 . GLN C 3 644 ? -44.968  12.243  29.573  1.00 0.00 ? 647 GLN M OE1 1  
ATOM 7162   N NE2 . GLN C 3 644 ? -45.326  10.474  28.219  1.00 0.00 ? 647 GLN M NE2 1  
ATOM 7163   N N   . THR C 3 645 ? -41.903  11.315  24.927  1.00 0.00 ? 648 THR M N   1  
ATOM 7164   C CA  . THR C 3 645 ? -42.321  11.618  23.595  1.00 0.00 ? 648 THR M CA  1  
ATOM 7165   C C   . THR C 3 645 ? -43.826  11.910  23.457  1.00 0.00 ? 648 THR M C   1  
ATOM 7166   O O   . THR C 3 645 ? -44.612  11.787  24.372  1.00 0.00 ? 648 THR M O   1  
ATOM 7167   C CB  . THR C 3 645 ? -41.824  10.523  22.656  1.00 0.00 ? 648 THR M CB  1  
ATOM 7168   O OG1 . THR C 3 645 ? -42.075  10.869  21.298  1.00 0.00 ? 648 THR M OG1 1  
ATOM 7169   C CG2 . THR C 3 645 ? -42.478  9.230   23.001  1.00 0.00 ? 648 THR M CG2 1  
ATOM 7170   N N   . VAL C 3 646 ? -44.233  12.353  22.283  1.00 0.00 ? 649 VAL M N   1  
ATOM 7171   C CA  . VAL C 3 646 ? -45.586  12.703  21.965  1.00 0.00 ? 649 VAL M CA  1  
ATOM 7172   C C   . VAL C 3 646 ? -46.375  11.445  21.701  1.00 0.00 ? 649 VAL M C   1  
ATOM 7173   O O   . VAL C 3 646 ? -47.433  11.202  22.235  1.00 0.00 ? 649 VAL M O   1  
ATOM 7174   C CB  . VAL C 3 646 ? -45.631  13.553  20.702  1.00 0.00 ? 649 VAL M CB  1  
ATOM 7175   C CG1 . VAL C 3 646 ? -47.060  13.669  20.228  1.00 0.00 ? 649 VAL M CG1 1  
ATOM 7176   C CG2 . VAL C 3 646 ? -45.134  14.941  21.016  1.00 0.00 ? 649 VAL M CG2 1  
ATOM 7177   N N   . SER C 3 647 ? -45.789  10.623  20.864  1.00 0.00 ? 650 SER M N   1  
ATOM 7178   C CA  . SER C 3 647 ? -46.377  9.355   20.502  1.00 0.00 ? 650 SER M CA  1  
ATOM 7179   C C   . SER C 3 647 ? -46.459  8.478   21.712  1.00 0.00 ? 650 SER M C   1  
ATOM 7180   O O   . SER C 3 647 ? -47.309  7.619   21.770  1.00 0.00 ? 650 SER M O   1  
ATOM 7181   C CB  . SER C 3 647 ? -45.555  8.670   19.425  1.00 0.00 ? 650 SER M CB  1  
ATOM 7182   O OG  . SER C 3 647 ? -44.187  8.574   19.795  1.00 0.00 ? 650 SER M OG  1  
ATOM 7183   N N   . ALA C 3 648 ? -45.601  8.748   22.702  1.00 0.00 ? 651 ALA M N   1  
ATOM 7184   C CA  . ALA C 3 648 ? -45.583  8.018   23.963  1.00 0.00 ? 651 ALA M CA  1  
ATOM 7185   C C   . ALA C 3 648 ? -46.919  8.038   24.688  1.00 0.00 ? 651 ALA M C   1  
ATOM 7186   O O   . ALA C 3 648 ? -47.279  7.066   25.340  1.00 0.00 ? 651 ALA M O   1  
ATOM 7187   C CB  . ALA C 3 648 ? -44.568  8.582   24.937  1.00 0.00 ? 651 ALA M CB  1  
ATOM 7188   N N   . LEU C 3 649 ? -47.619  9.153   24.629  1.00 0.00 ? 652 LEU M N   1  
ATOM 7189   C CA  . LEU C 3 649 ? -48.937  9.275   25.288  1.00 0.00 ? 652 LEU M CA  1  
ATOM 7190   C C   . LEU C 3 649 ? -50.032  8.684   24.491  1.00 0.00 ? 652 LEU M C   1  
ATOM 7191   O O   . LEU C 3 649 ? -50.778  7.852   25.032  1.00 0.00 ? 652 LEU M O   1  
ATOM 7192   C CB  . LEU C 3 649 ? -49.360  10.735  25.390  1.00 0.00 ? 652 LEU M CB  1  
ATOM 7193   C CG  . LEU C 3 649 ? -48.581  11.484  26.440  1.00 0.00 ? 652 LEU M CG  1  
ATOM 7194   C CD1 . LEU C 3 649 ? -48.300  12.870  25.893  1.00 0.00 ? 652 LEU M CD1 1  
ATOM 7195   C CD2 . LEU C 3 649 ? -49.390  11.596  27.703  1.00 0.00 ? 652 LEU M CD2 1  
ATOM 7196   N N   . PHE C 3 650 ? -50.114  9.271   23.281  1.00 0.00 ? 653 PHE M N   1  
ATOM 7197   C CA  . PHE C 3 650 ? -51.070  8.927   22.262  1.00 0.00 ? 653 PHE M CA  1  
ATOM 7198   C C   . PHE C 3 650 ? -51.410  7.449   22.439  1.00 0.00 ? 653 PHE M C   1  
ATOM 7199   O O   . PHE C 3 650 ? -52.553  7.081   22.615  1.00 0.00 ? 653 PHE M O   1  
ATOM 7200   C CB  . PHE C 3 650 ? -50.425  9.164   20.946  1.00 0.00 ? 653 PHE M CB  1  
ATOM 7201   C CG  . PHE C 3 650 ? -51.419  8.674   19.980  1.00 0.00 ? 653 PHE M CG  1  
ATOM 7202   C CD1 . PHE C 3 650 ? -52.706  9.132   20.168  1.00 0.00 ? 653 PHE M CD1 1  
ATOM 7203   C CD2 . PHE C 3 650 ? -51.130  7.774   18.964  1.00 0.00 ? 653 PHE M CD2 1  
ATOM 7204   C CE1 . PHE C 3 650 ? -53.700  8.720   19.294  1.00 0.00 ? 653 PHE M CE1 1  
ATOM 7205   C CE2 . PHE C 3 650 ? -52.121  7.343   18.084  1.00 0.00 ? 653 PHE M CE2 1  
ATOM 7206   C CZ  . PHE C 3 650 ? -53.407  7.812   18.276  1.00 0.00 ? 653 PHE M CZ  1  
ATOM 7207   N N   . ARG C 3 651 ? -50.358  6.667   22.574  1.00 0.00 ? 654 ARG M N   1  
ATOM 7208   C CA  . ARG C 3 651 ? -50.448  5.273   22.789  1.00 0.00 ? 654 ARG M CA  1  
ATOM 7209   C C   . ARG C 3 651 ? -51.164  5.012   24.129  1.00 0.00 ? 654 ARG M C   1  
ATOM 7210   O O   . ARG C 3 651 ? -52.160  4.305   24.198  1.00 0.00 ? 654 ARG M O   1  
ATOM 7211   C CB  . ARG C 3 651 ? -49.092  4.614   22.671  1.00 0.00 ? 654 ARG M CB  1  
ATOM 7212   C CG  . ARG C 3 651 ? -48.580  4.409   21.246  1.00 0.00 ? 654 ARG M CG  1  
ATOM 7213   C CD  . ARG C 3 651 ? -47.055  4.551   21.063  1.00 0.00 ? 654 ARG M CD  1  
ATOM 7214   N NE  . ARG C 3 651 ? -46.265  3.317   21.209  1.00 0.00 ? 654 ARG M NE  1  
ATOM 7215   C CZ  . ARG C 3 651 ? -45.462  3.034   22.241  1.00 0.00 ? 654 ARG M CZ  1  
ATOM 7216   N NH1 . ARG C 3 651 ? -45.277  3.839   23.294  1.00 0.00 ? 654 ARG M NH1 1  
ATOM 7217   N NH2 . ARG C 3 651 ? -44.778  1.889   22.251  1.00 0.00 ? 654 ARG M NH2 1  
ATOM 7218   N N   . GLU C 3 652 ? -50.681  5.596   25.219  1.00 0.00 ? 655 GLU M N   1  
ATOM 7219   C CA  . GLU C 3 652 ? -51.185  5.472   26.599  1.00 0.00 ? 655 GLU M CA  1  
ATOM 7220   C C   . GLU C 3 652 ? -52.658  5.829   26.724  1.00 0.00 ? 655 GLU M C   1  
ATOM 7221   O O   . GLU C 3 652 ? -53.416  5.234   27.460  1.00 0.00 ? 655 GLU M O   1  
ATOM 7222   C CB  . GLU C 3 652 ? -50.448  6.467   27.502  1.00 0.00 ? 655 GLU M CB  1  
ATOM 7223   C CG  . GLU C 3 652 ? -50.102  5.980   28.922  1.00 0.00 ? 655 GLU M CG  1  
ATOM 7224   C CD  . GLU C 3 652 ? -48.740  6.468   29.407  1.00 0.00 ? 655 GLU M CD  1  
ATOM 7225   O OE1 . GLU C 3 652 ? -48.573  7.779   29.316  1.00 0.00 ? 655 GLU M OE1 1  
ATOM 7226   O OE2 . GLU C 3 652 ? -47.874  5.725   29.840  1.00 0.00 ? 655 GLU M OE2 1  
ATOM 7227   N N   . ASN C 3 653 ? -53.002  6.854   25.990  1.00 0.00 ? 656 ASN M N   1  
ATOM 7228   C CA  . ASN C 3 653 ? -54.343  7.361   25.941  1.00 0.00 ? 656 ASN M CA  1  
ATOM 7229   C C   . ASN C 3 653 ? -55.197  6.398   25.114  1.00 0.00 ? 656 ASN M C   1  
ATOM 7230   O O   . ASN C 3 653 ? -56.264  5.947   25.512  1.00 0.00 ? 656 ASN M O   1  
ATOM 7231   C CB  . ASN C 3 653 ? -54.374  8.808   25.429  1.00 0.00 ? 656 ASN M CB  1  
ATOM 7232   C CG  . ASN C 3 653 ? -53.885  9.839   26.443  1.00 0.00 ? 656 ASN M CG  1  
ATOM 7233   O OD1 . ASN C 3 653 ? -53.491  10.960  26.086  1.00 0.00 ? 656 ASN M OD1 1  
ATOM 7234   N ND2 . ASN C 3 653 ? -53.932  9.512   27.726  1.00 0.00 ? 656 ASN M ND2 1  
ATOM 7235   N N   . LEU C 3 654 ? -54.641  6.018   23.981  1.00 0.00 ? 657 LEU M N   1  
ATOM 7236   C CA  . LEU C 3 654 ? -55.279  5.068   23.071  1.00 0.00 ? 657 LEU M CA  1  
ATOM 7237   C C   . LEU C 3 654 ? -55.442  3.716   23.715  1.00 0.00 ? 657 LEU M C   1  
ATOM 7238   O O   . LEU C 3 654 ? -56.117  2.899   23.211  1.00 0.00 ? 657 LEU M O   1  
ATOM 7239   C CB  . LEU C 3 654 ? -54.398  4.822   21.859  1.00 0.00 ? 657 LEU M CB  1  
ATOM 7240   C CG  . LEU C 3 654 ? -54.902  3.827   20.889  1.00 0.00 ? 657 LEU M CG  1  
ATOM 7241   C CD1 . LEU C 3 654 ? -56.342  4.114   20.634  1.00 0.00 ? 657 LEU M CD1 1  
ATOM 7242   C CD2 . LEU C 3 654 ? -54.138  3.951   19.597  1.00 0.00 ? 657 LEU M CD2 1  
ATOM 7243   N N   . ASN C 3 655 ? -54.770  3.490   24.814  1.00 0.00 ? 658 ASN M N   1  
ATOM 7244   C CA  . ASN C 3 655 ? -54.868  2.197   25.478  1.00 0.00 ? 658 ASN M CA  1  
ATOM 7245   C C   . ASN C 3 655 ? -55.900  2.204   26.547  1.00 0.00 ? 658 ASN M C   1  
ATOM 7246   O O   . ASN C 3 655 ? -56.643  1.287   26.742  1.00 0.00 ? 658 ASN M O   1  
ATOM 7247   C CB  . ASN C 3 655 ? -53.513  1.758   26.067  1.00 0.00 ? 658 ASN M CB  1  
ATOM 7248   C CG  . ASN C 3 655 ? -52.632  1.212   24.968  1.00 0.00 ? 658 ASN M CG  1  
ATOM 7249   O OD1 . ASN C 3 655 ? -52.607  1.749   23.847  1.00 0.00 ? 658 ASN M OD1 1  
ATOM 7250   N ND2 . ASN C 3 655 ? -51.936  0.144   25.293  1.00 0.00 ? 658 ASN M ND2 1  
ATOM 7251   N N   . LYS C 3 656 ? -55.936  3.318   27.198  1.00 0.00 ? 659 LYS M N   1  
ATOM 7252   C CA  . LYS C 3 656 ? -56.823  3.606   28.268  1.00 0.00 ? 659 LYS M CA  1  
ATOM 7253   C C   . LYS C 3 656 ? -58.210  3.635   27.706  1.00 0.00 ? 659 LYS M C   1  
ATOM 7254   O O   . LYS C 3 656 ? -59.170  3.414   28.387  1.00 0.00 ? 659 LYS M O   1  
ATOM 7255   C CB  . LYS C 3 656 ? -56.347  4.960   28.845  1.00 0.00 ? 659 LYS M CB  1  
ATOM 7256   C CG  . LYS C 3 656 ? -57.303  5.633   29.804  1.00 0.00 ? 659 LYS M CG  1  
ATOM 7257   C CD  . LYS C 3 656 ? -56.707  6.907   30.370  1.00 0.00 ? 659 LYS M CD  1  
ATOM 7258   C CE  . LYS C 3 656 ? -57.639  7.644   31.314  1.00 0.00 ? 659 LYS M CE  1  
ATOM 7259   N NZ  . LYS C 3 656 ? -57.875  9.021   30.844  1.00 0.00 ? 659 LYS M NZ  1  
ATOM 7260   N N   . LEU C 3 657 ? -58.261  3.899   26.408  1.00 0.00 ? 660 LEU M N   1  
ATOM 7261   C CA  . LEU C 3 657 ? -59.483  4.065   25.630  1.00 0.00 ? 660 LEU M CA  1  
ATOM 7262   C C   . LEU C 3 657 ? -59.999  2.752   25.172  1.00 0.00 ? 660 LEU M C   1  
ATOM 7263   O O   . LEU C 3 657 ? -61.107  2.365   25.510  1.00 0.00 ? 660 LEU M O   1  
ATOM 7264   C CB  . LEU C 3 657 ? -59.127  4.849   24.401  1.00 0.00 ? 660 LEU M CB  1  
ATOM 7265   C CG  . LEU C 3 657 ? -60.231  4.935   23.357  1.00 0.00 ? 660 LEU M CG  1  
ATOM 7266   C CD1 . LEU C 3 657 ? -61.476  5.488   23.964  1.00 0.00 ? 660 LEU M CD1 1  
ATOM 7267   C CD2 . LEU C 3 657 ? -60.007  5.766   22.057  1.00 0.00 ? 660 LEU M CD2 1  
ATOM 7268   N N   . MET C 3 658 ? -59.171  2.065   24.402  1.00 0.00 ? 661 MET M N   1  
ATOM 7269   C CA  . MET C 3 658 ? -59.508  0.737   23.861  1.00 0.00 ? 661 MET M CA  1  
ATOM 7270   C C   . MET C 3 658 ? -59.828  -0.233  25.003  1.00 0.00 ? 661 MET M C   1  
ATOM 7271   O O   . MET C 3 658 ? -60.455  -1.230  24.801  1.00 0.00 ? 661 MET M O   1  
ATOM 7272   C CB  . MET C 3 658 ? -58.436  0.206   22.925  1.00 0.00 ? 661 MET M CB  1  
ATOM 7273   C CG  . MET C 3 658 ? -58.457  0.790   21.560  1.00 0.00 ? 661 MET M CG  1  
ATOM 7274   S SD  . MET C 3 658 ? -59.896  0.329   20.762  1.00 0.00 ? 661 MET M SD  1  
ATOM 7275   C CE  . MET C 3 658 ? -59.868  -1.440  21.149  1.00 0.00 ? 661 MET M CE  1  
ATOM 7276   N N   . ALA C 3 659 ? -59.447  0.131   26.230  1.00 0.00 ? 662 ALA M N   1  
ATOM 7277   C CA  . ALA C 3 659 ? -59.707  -0.700  27.400  1.00 0.00 ? 662 ALA M CA  1  
ATOM 7278   C C   . ALA C 3 659 ? -61.079  -0.392  27.911  1.00 0.00 ? 662 ALA M C   1  
ATOM 7279   O O   . ALA C 3 659 ? -61.794  -1.219  28.411  1.00 0.00 ? 662 ALA M O   1  
ATOM 7280   C CB  . ALA C 3 659 ? -58.746  -0.386  28.542  1.00 0.00 ? 662 ALA M CB  1  
ATOM 7281   N N   . ASN C 3 660 ? -61.414  0.861   27.803  1.00 0.00 ? 663 ASN M N   1  
ATOM 7282   C CA  . ASN C 3 660 ? -62.703  1.370   28.255  1.00 0.00 ? 663 ASN M CA  1  
ATOM 7283   C C   . ASN C 3 660 ? -63.738  0.858   27.238  1.00 0.00 ? 663 ASN M C   1  
ATOM 7284   O O   . ASN C 3 660 ? -64.861  0.571   27.515  1.00 0.00 ? 663 ASN M O   1  
ATOM 7285   C CB  . ASN C 3 660 ? -62.717  2.916   28.265  1.00 0.00 ? 663 ASN M CB  1  
ATOM 7286   C CG  . ASN C 3 660 ? -62.503  3.477   29.654  1.00 0.00 ? 663 ASN M CG  1  
ATOM 7287   O OD1 . ASN C 3 660 ? -62.887  2.856   30.637  1.00 0.00 ? 663 ASN M OD1 1  
ATOM 7288   N ND2 . ASN C 3 660 ? -61.929  4.678   29.754  1.00 0.00 ? 663 ASN M ND2 1  
ATOM 7289   N N   . LEU C 3 661 ? -63.273  0.712   26.014  1.00 0.00 ? 664 LEU M N   1  
ATOM 7290   C CA  . LEU C 3 661 ? -64.107  0.276   24.922  1.00 0.00 ? 664 LEU M CA  1  
ATOM 7291   C C   . LEU C 3 661 ? -64.501  -1.204  25.092  1.00 0.00 ? 664 LEU M C   1  
ATOM 7292   O O   . LEU C 3 661 ? -65.599  -1.597  24.724  1.00 0.00 ? 664 LEU M O   1  
ATOM 7293   C CB  . LEU C 3 661 ? -63.299  0.507   23.630  1.00 0.00 ? 664 LEU M CB  1  
ATOM 7294   C CG  . LEU C 3 661 ? -63.891  1.480   22.697  1.00 0.00 ? 664 LEU M CG  1  
ATOM 7295   C CD1 . LEU C 3 661 ? -64.569  2.485   23.574  1.00 0.00 ? 664 LEU M CD1 1  
ATOM 7296   C CD2 . LEU C 3 661 ? -62.872  2.068   21.834  1.00 0.00 ? 664 LEU M CD2 1  
ATOM 7297   N N   . ARG C 3 662 ? -63.627  -1.994  25.728  1.00 0.00 ? 665 ARG M N   1  
ATOM 7298   C CA  . ARG C 3 662 ? -63.815  -3.407  25.973  1.00 0.00 ? 665 ARG M CA  1  
ATOM 7299   C C   . ARG C 3 662 ? -64.867  -3.732  27.016  1.00 0.00 ? 665 ARG M C   1  
ATOM 7300   O O   . ARG C 3 662 ? -65.749  -4.555  26.755  1.00 0.00 ? 665 ARG M O   1  
ATOM 7301   C CB  . ARG C 3 662 ? -62.541  -4.121  26.259  1.00 0.00 ? 665 ARG M CB  1  
ATOM 7302   C CG  . ARG C 3 662 ? -61.575  -4.061  25.079  1.00 0.00 ? 665 ARG M CG  1  
ATOM 7303   C CD  . ARG C 3 662 ? -60.442  -5.092  25.174  1.00 0.00 ? 665 ARG M CD  1  
ATOM 7304   N NE  . ARG C 3 662 ? -59.602  -5.104  23.972  1.00 0.00 ? 665 ARG M NE  1  
ATOM 7305   C CZ  . ARG C 3 662 ? -58.415  -4.513  23.915  1.00 0.00 ? 665 ARG M CZ  1  
ATOM 7306   N NH1 . ARG C 3 662 ? -57.885  -3.859  24.982  1.00 0.00 ? 665 ARG M NH1 1  
ATOM 7307   N NH2 . ARG C 3 662 ? -57.750  -4.572  22.748  1.00 0.00 ? 665 ARG M NH2 1  
ATOM 7308   N N   . SER C 3 663 ? -64.797  -3.044  28.171  1.00 0.00 ? 666 SER M N   1  
ATOM 7309   C CA  . SER C 3 663 ? -65.780  -3.215  29.245  1.00 0.00 ? 666 SER M CA  1  
ATOM 7310   C C   . SER C 3 663 ? -67.074  -2.562  28.854  1.00 0.00 ? 666 SER M C   1  
ATOM 7311   O O   . SER C 3 663 ? -67.792  -2.022  29.704  1.00 0.00 ? 666 SER M O   1  
ATOM 7312   C CB  . SER C 3 663 ? -65.302  -2.570  30.555  1.00 0.00 ? 666 SER M CB  1  
ATOM 7313   O OG  . SER C 3 663 ? -64.083  -1.851  30.422  1.00 0.00 ? 666 SER M OG  1  
ATOM 7314   N N   . THR C 3 664 ? -67.304  -2.599  27.538  1.00 0.00 ? 667 THR M N   1  
ATOM 7315   C CA  . THR C 3 664 ? -68.411  -1.990  26.889  1.00 0.00 ? 667 THR M CA  1  
ATOM 7316   C C   . THR C 3 664 ? -69.040  -2.907  25.890  1.00 0.00 ? 667 THR M C   1  
ATOM 7317   O O   . THR C 3 664 ? -68.364  -3.751  25.291  1.00 0.00 ? 667 THR M O   1  
ATOM 7318   C CB  . THR C 3 664 ? -67.886  -0.760  26.154  1.00 0.00 ? 667 THR M CB  1  
ATOM 7319   O OG1 . THR C 3 664 ? -67.523  0.198   27.102  1.00 0.00 ? 667 THR M OG1 1  
ATOM 7320   C CG2 . THR C 3 664 ? -68.951  -0.230  25.279  1.00 0.00 ? 667 THR M CG2 1  
ATOM 7321   N N   . HIS C 3 665 ? -70.347  -2.714  25.698  1.00 0.00 ? 668 HIS M N   1  
ATOM 7322   C CA  . HIS C 3 665 ? -71.081  -3.367  24.635  1.00 0.00 ? 668 HIS M CA  1  
ATOM 7323   C C   . HIS C 3 665 ? -71.117  -2.447  23.412  1.00 0.00 ? 668 HIS M C   1  
ATOM 7324   O O   . HIS C 3 665 ? -71.854  -1.501  23.351  1.00 0.00 ? 668 HIS M O   1  
ATOM 7325   C CB  . HIS C 3 665 ? -72.508  -3.682  25.039  1.00 0.00 ? 668 HIS M CB  1  
ATOM 7326   C CG  . HIS C 3 665 ? -73.232  -4.367  23.929  1.00 0.00 ? 668 HIS M CG  1  
ATOM 7327   N ND1 . HIS C 3 665 ? -74.586  -4.595  23.988  1.00 0.00 ? 668 HIS M ND1 1  
ATOM 7328   C CD2 . HIS C 3 665 ? -72.743  -4.865  22.753  1.00 0.00 ? 668 HIS M CD2 1  
ATOM 7329   C CE1 . HIS C 3 665 ? -74.895  -5.225  22.842  1.00 0.00 ? 668 HIS M CE1 1  
ATOM 7330   N NE2 . HIS C 3 665 ? -73.831  -5.400  22.085  1.00 0.00 ? 668 HIS M NE2 1  
ATOM 7331   N N   . PRO C 3 666 ? -70.239  -2.666  22.482  1.00 0.00 ? 669 PRO M N   1  
ATOM 7332   C CA  . PRO C 3 666 ? -70.034  -1.822  21.351  1.00 0.00 ? 669 PRO M CA  1  
ATOM 7333   C C   . PRO C 3 666 ? -71.267  -1.690  20.497  1.00 0.00 ? 669 PRO M C   1  
ATOM 7334   O O   . PRO C 3 666 ? -71.927  -2.650  20.196  1.00 0.00 ? 669 PRO M O   1  
ATOM 7335   C CB  . PRO C 3 666 ? -68.873  -2.372  20.562  1.00 0.00 ? 669 PRO M CB  1  
ATOM 7336   C CG  . PRO C 3 666 ? -68.642  -3.718  21.119  1.00 0.00 ? 669 PRO M CG  1  
ATOM 7337   C CD  . PRO C 3 666 ? -69.407  -3.833  22.417  1.00 0.00 ? 669 PRO M CD  1  
ATOM 7338   N N   . HIS C 3 667 ? -71.559  -0.431  20.157  1.00 0.00 ? 670 HIS M N   1  
ATOM 7339   C CA  . HIS C 3 667 ? -72.627  -0.018  19.292  1.00 0.00 ? 670 HIS M CA  1  
ATOM 7340   C C   . HIS C 3 667 ? -71.997  0.891   18.254  1.00 0.00 ? 670 HIS M C   1  
ATOM 7341   O O   . HIS C 3 667 ? -71.362  1.848   18.614  1.00 0.00 ? 670 HIS M O   1  
ATOM 7342   C CB  . HIS C 3 667 ? -73.812  0.564   20.023  1.00 0.00 ? 670 HIS M CB  1  
ATOM 7343   C CG  . HIS C 3 667 ? -74.657  -0.471  20.769  1.00 0.00 ? 670 HIS M CG  1  
ATOM 7344   N ND1 . HIS C 3 667 ? -75.527  -1.381  20.122  1.00 0.00 ? 670 HIS M ND1 1  
ATOM 7345   C CD2 . HIS C 3 667 ? -74.748  -0.673  22.119  1.00 0.00 ? 670 HIS M CD2 1  
ATOM 7346   C CE1 . HIS C 3 667 ? -76.077  -2.077  21.082  1.00 0.00 ? 670 HIS M CE1 1  
ATOM 7347   N NE2 . HIS C 3 667 ? -75.607  -1.704  22.284  1.00 0.00 ? 670 HIS M NE2 1  
ATOM 7348   N N   . PHE C 3 668 ? -72.107  0.517   16.998  1.00 0.00 ? 671 PHE M N   1  
ATOM 7349   C CA  . PHE C 3 668 ? -71.500  1.165   15.854  1.00 0.00 ? 671 PHE M CA  1  
ATOM 7350   C C   . PHE C 3 668 ? -72.375  2.049   14.964  1.00 0.00 ? 671 PHE M C   1  
ATOM 7351   O O   . PHE C 3 668 ? -73.419  1.717   14.553  1.00 0.00 ? 671 PHE M O   1  
ATOM 7352   C CB  . PHE C 3 668 ? -70.847  0.081   14.955  1.00 0.00 ? 671 PHE M CB  1  
ATOM 7353   C CG  . PHE C 3 668 ? -69.758  -0.740  15.676  1.00 0.00 ? 671 PHE M CG  1  
ATOM 7354   C CD1 . PHE C 3 668 ? -68.460  -0.238  15.767  1.00 0.00 ? 671 PHE M CD1 1  
ATOM 7355   C CD2 . PHE C 3 668 ? -70.005  -2.003  16.216  1.00 0.00 ? 671 PHE M CD2 1  
ATOM 7356   C CE1 . PHE C 3 668 ? -67.448  -0.942  16.388  1.00 0.00 ? 671 PHE M CE1 1  
ATOM 7357   C CE2 . PHE C 3 668 ? -68.993  -2.734  16.841  1.00 0.00 ? 671 PHE M CE2 1  
ATOM 7358   C CZ  . PHE C 3 668 ? -67.715  -2.195  16.930  1.00 0.00 ? 671 PHE M CZ  1  
ATOM 7359   N N   . VAL C 3 669 ? -71.830  3.176   14.575  1.00 0.00 ? 672 VAL M N   1  
ATOM 7360   C CA  . VAL C 3 669 ? -72.434  4.175   13.717  1.00 0.00 ? 672 VAL M CA  1  
ATOM 7361   C C   . VAL C 3 669 ? -71.424  4.735   12.728  1.00 0.00 ? 672 VAL M C   1  
ATOM 7362   O O   . VAL C 3 669 ? -70.416  5.238   13.107  1.00 0.00 ? 672 VAL M O   1  
ATOM 7363   C CB  . VAL C 3 669 ? -72.998  5.305   14.519  1.00 0.00 ? 672 VAL M CB  1  
ATOM 7364   C CG1 . VAL C 3 669 ? -73.698  6.275   13.659  1.00 0.00 ? 672 VAL M CG1 1  
ATOM 7365   C CG2 . VAL C 3 669 ? -73.896  4.777   15.558  1.00 0.00 ? 672 VAL M CG2 1  
ATOM 7366   N N   . ARG C 3 670 ? -71.675  4.564   11.454  1.00 0.00 ? 673 ARG M N   1  
ATOM 7367   C CA  . ARG C 3 670 ? -70.832  4.980   10.355  1.00 0.00 ? 673 ARG M CA  1  
ATOM 7368   C C   . ARG C 3 670 ? -71.476  6.120   9.584   1.00 0.00 ? 673 ARG M C   1  
ATOM 7369   O O   . ARG C 3 670 ? -72.524  5.959   8.970   1.00 0.00 ? 673 ARG M O   1  
ATOM 7370   C CB  . ARG C 3 670 ? -70.437  3.862   9.401   1.00 0.00 ? 673 ARG M CB  1  
ATOM 7371   C CG  . ARG C 3 670 ? -69.507  2.839   10.008  1.00 0.00 ? 673 ARG M CG  1  
ATOM 7372   C CD  . ARG C 3 670 ? -68.849  3.260   11.314  1.00 0.00 ? 673 ARG M CD  1  
ATOM 7373   N NE  . ARG C 3 670 ? -67.577  2.547   11.570  1.00 0.00 ? 673 ARG M NE  1  
ATOM 7374   C CZ  . ARG C 3 670 ? -67.030  2.483   12.795  1.00 0.00 ? 673 ARG M CZ  1  
ATOM 7375   N NH1 . ARG C 3 670 ? -67.604  3.065   13.837  1.00 0.00 ? 673 ARG M NH1 1  
ATOM 7376   N NH2 . ARG C 3 670 ? -65.869  1.831   12.983  1.00 0.00 ? 673 ARG M NH2 1  
ATOM 7377   N N   . CYS C 3 671 ? -70.851  7.309   9.627   1.00 0.00 ? 674 CYS M N   1  
ATOM 7378   C CA  . CYS C 3 671 ? -71.363  8.496   8.976   1.00 0.00 ? 674 CYS M CA  1  
ATOM 7379   C C   . CYS C 3 671 ? -70.814  8.638   7.566   1.00 0.00 ? 674 CYS M C   1  
ATOM 7380   O O   . CYS C 3 671 ? -69.636  8.507   7.381   1.00 0.00 ? 674 CYS M O   1  
ATOM 7381   C CB  . CYS C 3 671 ? -71.065  9.732   9.808   1.00 0.00 ? 674 CYS M CB  1  
ATOM 7382   S SG  . CYS C 3 671 ? -71.787  9.727   11.419  1.00 0.00 ? 674 CYS M SG  1  
ATOM 7383   N N   . ILE C 3 672 ? -71.656  8.945   6.591   1.00 0.00 ? 675 ILE M N   1  
ATOM 7384   C CA  . ILE C 3 672 ? -71.250  9.049   5.205   1.00 0.00 ? 675 ILE M CA  1  
ATOM 7385   C C   . ILE C 3 672 ? -71.487  10.403  4.519   1.00 0.00 ? 675 ILE M C   1  
ATOM 7386   O O   . ILE C 3 672 ? -72.441  11.125  4.772   1.00 0.00 ? 675 ILE M O   1  
ATOM 7387   C CB  . ILE C 3 672 ? -71.883  7.954   4.355   1.00 0.00 ? 675 ILE M CB  1  
ATOM 7388   C CG1 . ILE C 3 672 ? -70.994  6.728   4.370   1.00 0.00 ? 675 ILE M CG1 1  
ATOM 7389   C CG2 . ILE C 3 672 ? -72.038  8.446   2.942   1.00 0.00 ? 675 ILE M CG2 1  
ATOM 7390   C CD1 . ILE C 3 672 ? -71.562  5.565   5.167   1.00 0.00 ? 675 ILE M CD1 1  
ATOM 7391   N N   . ILE C 3 673 ? -70.625  10.711  3.561   1.00 0.00 ? 676 ILE M N   1  
ATOM 7392   C CA  . ILE C 3 673 ? -70.626  11.955  2.821   1.00 0.00 ? 676 ILE M CA  1  
ATOM 7393   C C   . ILE C 3 673 ? -70.787  11.696  1.337   1.00 0.00 ? 676 ILE M C   1  
ATOM 7394   O O   . ILE C 3 673 ? -69.879  11.205  0.672   1.00 0.00 ? 676 ILE M O   1  
ATOM 7395   C CB  . ILE C 3 673 ? -69.416  12.853  3.084   1.00 0.00 ? 676 ILE M CB  1  
ATOM 7396   C CG1 . ILE C 3 673 ? -69.566  14.157  2.365   1.00 0.00 ? 676 ILE M CG1 1  
ATOM 7397   C CG2 . ILE C 3 673 ? -68.195  12.186  2.562   1.00 0.00 ? 676 ILE M CG2 1  
ATOM 7398   C CD1 . ILE C 3 673 ? -68.256  14.610  1.778   1.00 0.00 ? 676 ILE M CD1 1  
ATOM 7399   N N   . PRO C 3 674 ? -71.957  12.066  0.866   1.00 0.00 ? 677 PRO M N   1  
ATOM 7400   C CA  . PRO C 3 674 ? -72.486  11.875  -0.447  1.00 0.00 ? 677 PRO M CA  1  
ATOM 7401   C C   . PRO C 3 674 ? -71.688  12.422  -1.578  1.00 0.00 ? 677 PRO M C   1  
ATOM 7402   O O   . PRO C 3 674 ? -71.365  11.653  -2.524  1.00 0.00 ? 677 PRO M O   1  
ATOM 7403   C CB  . PRO C 3 674 ? -73.844  12.566  -0.424  1.00 0.00 ? 677 PRO M CB  1  
ATOM 7404   C CG  . PRO C 3 674 ? -74.065  13.204  0.948   1.00 0.00 ? 677 PRO M CG  1  
ATOM 7405   C CD  . PRO C 3 674 ? -72.859  12.846  1.777   1.00 0.00 ? 677 PRO M CD  1  
ATOM 7406   N N   . ASN C 3 675 ? -71.545  13.748  -1.621  1.00 0.00 ? 678 ASN M N   1  
ATOM 7407   C CA  . ASN C 3 675 ? -70.788  14.394  -2.700  1.00 0.00 ? 678 ASN M CA  1  
ATOM 7408   C C   . ASN C 3 675 ? -70.015  15.592  -2.225  1.00 0.00 ? 678 ASN M C   1  
ATOM 7409   O O   . ASN C 3 675 ? -70.512  16.445  -1.513  1.00 0.00 ? 678 ASN M O   1  
ATOM 7410   C CB  . ASN C 3 675 ? -71.746  14.876  -3.737  1.00 0.00 ? 678 ASN M CB  1  
ATOM 7411   C CG  . ASN C 3 675 ? -72.931  15.523  -3.052  1.00 0.00 ? 678 ASN M CG  1  
ATOM 7412   O OD1 . ASN C 3 675 ? -72.955  16.724  -2.779  1.00 0.00 ? 678 ASN M OD1 1  
ATOM 7413   N ND2 . ASN C 3 675 ? -73.884  14.702  -2.765  1.00 0.00 ? 678 ASN M ND2 1  
ATOM 7414   N N   . GLU C 3 676 ? -68.780  15.672  -2.692  1.00 0.00 ? 679 GLU M N   1  
ATOM 7415   C CA  . GLU C 3 676 ? -67.900  16.771  -2.333  1.00 0.00 ? 679 GLU M CA  1  
ATOM 7416   C C   . GLU C 3 676 ? -68.536  18.106  -2.608  1.00 0.00 ? 679 GLU M C   1  
ATOM 7417   O O   . GLU C 3 676 ? -68.258  19.091  -1.948  1.00 0.00 ? 679 GLU M O   1  
ATOM 7418   C CB  . GLU C 3 676 ? -66.551  16.657  -3.057  1.00 0.00 ? 679 GLU M CB  1  
ATOM 7419   C CG  . GLU C 3 676 ? -65.635  15.612  -2.361  1.00 0.00 ? 679 GLU M CG  1  
ATOM 7420   C CD  . GLU C 3 676 ? -64.216  15.724  -2.733  1.00 0.00 ? 679 GLU M CD  1  
ATOM 7421   O OE1 . GLU C 3 676 ? -63.834  15.805  -3.898  1.00 0.00 ? 679 GLU M OE1 1  
ATOM 7422   O OE2 . GLU C 3 676 ? -63.470  15.830  -1.665  1.00 0.00 ? 679 GLU M OE2 1  
ATOM 7423   N N   . THR C 3 677 ? -69.404  18.114  -3.595  1.00 0.00 ? 680 THR M N   1  
ATOM 7424   C CA  . THR C 3 677 ? -70.077  19.327  -4.015  1.00 0.00 ? 680 THR M CA  1  
ATOM 7425   C C   . THR C 3 677 ? -71.212  19.796  -3.134  1.00 0.00 ? 680 THR M C   1  
ATOM 7426   O O   . THR C 3 677 ? -71.876  20.740  -3.506  1.00 0.00 ? 680 THR M O   1  
ATOM 7427   C CB  . THR C 3 677 ? -70.702  19.238  -5.417  1.00 0.00 ? 680 THR M CB  1  
ATOM 7428   O OG1 . THR C 3 677 ? -71.736  18.271  -5.421  1.00 0.00 ? 680 THR M OG1 1  
ATOM 7429   C CG2 . THR C 3 677 ? -69.661  19.019  -6.522  1.00 0.00 ? 680 THR M CG2 1  
ATOM 7430   N N   . LYS C 3 678 ? -71.540  19.156  -2.024  1.00 0.00 ? 681 LYS M N   1  
ATOM 7431   C CA  . LYS C 3 678 ? -72.636  19.688  -1.193  1.00 0.00 ? 681 LYS M CA  1  
ATOM 7432   C C   . LYS C 3 678 ? -74.009  19.789  -1.857  1.00 0.00 ? 681 LYS M C   1  
ATOM 7433   O O   . LYS C 3 678 ? -74.571  20.860  -2.003  1.00 0.00 ? 681 LYS M O   1  
ATOM 7434   C CB  . LYS C 3 678 ? -72.290  21.098  -0.756  1.00 0.00 ? 681 LYS M CB  1  
ATOM 7435   C CG  . LYS C 3 678 ? -71.875  21.243  0.695   1.00 0.00 ? 681 LYS M CG  1  
ATOM 7436   C CD  . LYS C 3 678 ? -71.673  22.695  1.140   1.00 0.00 ? 681 LYS M CD  1  
ATOM 7437   C CE  . LYS C 3 678 ? -70.344  22.928  1.843   1.00 0.00 ? 681 LYS M CE  1  
ATOM 7438   N NZ  . LYS C 3 678 ? -70.466  23.800  3.026   1.00 0.00 ? 681 LYS M NZ  1  
ATOM 7439   N N   . THR C 3 679 ? -74.583  18.666  -2.211  1.00 0.00 ? 682 THR M N   1  
ATOM 7440   C CA  . THR C 3 679 ? -75.866  18.650  -2.879  1.00 0.00 ? 682 THR M CA  1  
ATOM 7441   C C   . THR C 3 679 ? -76.736  17.589  -2.278  1.00 0.00 ? 682 THR M C   1  
ATOM 7442   O O   . THR C 3 679 ? -76.362  16.451  -2.218  1.00 0.00 ? 682 THR M O   1  
ATOM 7443   C CB  . THR C 3 679 ? -75.572  18.200  -4.303  1.00 0.00 ? 682 THR M CB  1  
ATOM 7444   O OG1 . THR C 3 679 ? -74.509  19.012  -4.820  1.00 0.00 ? 682 THR M OG1 1  
ATOM 7445   C CG2 . THR C 3 679 ? -76.905  18.345  -5.015  1.00 0.00 ? 682 THR M CG2 1  
ATOM 7446   N N   . PRO C 3 680 ? -77.894  17.952  -1.817  1.00 0.00 ? 683 PRO M N   1  
ATOM 7447   C CA  . PRO C 3 680 ? -78.758  16.943  -1.241  1.00 0.00 ? 683 PRO M CA  1  
ATOM 7448   C C   . PRO C 3 680 ? -79.249  16.021  -2.342  1.00 0.00 ? 683 PRO M C   1  
ATOM 7449   O O   . PRO C 3 680 ? -79.194  16.393  -3.504  1.00 0.00 ? 683 PRO M O   1  
ATOM 7450   C CB  . PRO C 3 680 ? -79.927  17.680  -0.619  1.00 0.00 ? 683 PRO M CB  1  
ATOM 7451   C CG  . PRO C 3 680 ? -79.752  19.162  -1.014  1.00 0.00 ? 683 PRO M CG  1  
ATOM 7452   C CD  . PRO C 3 680 ? -78.514  19.284  -1.863  1.00 0.00 ? 683 PRO M CD  1  
ATOM 7453   N N   . GLY C 3 681 ? -79.665  14.817  -1.948  1.00 0.00 ? 684 GLY M N   1  
ATOM 7454   C CA  . GLY C 3 681 ? -80.151  13.776  -2.836  1.00 0.00 ? 684 GLY M CA  1  
ATOM 7455   C C   . GLY C 3 681 ? -79.158  13.278  -3.900  1.00 0.00 ? 684 GLY M C   1  
ATOM 7456   O O   . GLY C 3 681 ? -79.546  12.667  -4.910  1.00 0.00 ? 684 GLY M O   1  
ATOM 7457   N N   . ALA C 3 682 ? -77.875  13.506  -3.698  1.00 0.00 ? 685 ALA M N   1  
ATOM 7458   C CA  . ALA C 3 682 ? -76.885  13.067  -4.686  1.00 0.00 ? 685 ALA M CA  1  
ATOM 7459   C C   . ALA C 3 682 ? -75.725  12.259  -4.125  1.00 0.00 ? 685 ALA M C   1  
ATOM 7460   O O   . ALA C 3 682 ? -75.439  12.252  -2.938  1.00 0.00 ? 685 ALA M O   1  
ATOM 7461   C CB  . ALA C 3 682 ? -76.385  14.224  -5.475  1.00 0.00 ? 685 ALA M CB  1  
ATOM 7462   N N   . MET C 3 683 ? -75.017  11.559  -4.989  1.00 0.00 ? 686 MET M N   1  
ATOM 7463   C CA  . MET C 3 683 ? -73.966  10.747  -4.483  1.00 0.00 ? 686 MET M CA  1  
ATOM 7464   C C   . MET C 3 683 ? -72.819  10.451  -5.436  1.00 0.00 ? 686 MET M C   1  
ATOM 7465   O O   . MET C 3 683 ? -73.072  9.832   -6.450  1.00 0.00 ? 686 MET M O   1  
ATOM 7466   C CB  . MET C 3 683 ? -74.699  9.422   -4.284  1.00 0.00 ? 686 MET M CB  1  
ATOM 7467   C CG  . MET C 3 683 ? -73.937  8.328   -3.533  1.00 0.00 ? 686 MET M CG  1  
ATOM 7468   S SD  . MET C 3 683 ? -74.909  7.723   -2.177  1.00 0.00 ? 686 MET M SD  1  
ATOM 7469   C CE  . MET C 3 683 ? -74.956  6.107   -2.862  1.00 0.00 ? 686 MET M CE  1  
ATOM 7470   N N   . GLU C 3 684 ? -71.567  10.804  -5.150  1.00 0.00 ? 687 GLU M N   1  
ATOM 7471   C CA  . GLU C 3 684 ? -70.632  10.338  -6.176  1.00 0.00 ? 687 GLU M CA  1  
ATOM 7472   C C   . GLU C 3 684 ? -70.365  8.905   -5.819  1.00 0.00 ? 687 GLU M C   1  
ATOM 7473   O O   . GLU C 3 684 ? -70.327  8.581   -4.659  1.00 0.00 ? 687 GLU M O   1  
ATOM 7474   C CB  . GLU C 3 684 ? -69.310  11.078  -6.358  1.00 0.00 ? 687 GLU M CB  1  
ATOM 7475   C CG  . GLU C 3 684 ? -69.452  12.590  -6.249  1.00 0.00 ? 687 GLU M CG  1  
ATOM 7476   C CD  . GLU C 3 684 ? -68.132  13.265  -6.412  1.00 0.00 ? 687 GLU M CD  1  
ATOM 7477   O OE1 . GLU C 3 684 ? -67.176  12.422  -6.730  1.00 0.00 ? 687 GLU M OE1 1  
ATOM 7478   O OE2 . GLU C 3 684 ? -68.008  14.458  -6.257  1.00 0.00 ? 687 GLU M OE2 1  
ATOM 7479   N N   . HIS C 3 685 ? -70.231  8.084   -6.814  1.00 0.00 ? 688 HIS M N   1  
ATOM 7480   C CA  . HIS C 3 685 ? -70.003  6.695   -6.532  1.00 0.00 ? 688 HIS M CA  1  
ATOM 7481   C C   . HIS C 3 685 ? -68.736  6.381   -5.782  1.00 0.00 ? 688 HIS M C   1  
ATOM 7482   O O   . HIS C 3 685 ? -68.701  6.013   -4.614  1.00 0.00 ? 688 HIS M O   1  
ATOM 7483   C CB  . HIS C 3 685 ? -70.026  5.876   -7.819  1.00 0.00 ? 688 HIS M CB  1  
ATOM 7484   C CG  . HIS C 3 685 ? -71.423  5.831   -8.285  1.00 0.00 ? 688 HIS M CG  1  
ATOM 7485   N ND1 . HIS C 3 685 ? -71.766  5.249   -9.490  1.00 0.00 ? 688 HIS M ND1 1  
ATOM 7486   C CD2 . HIS C 3 685 ? -72.544  6.310   -7.682  1.00 0.00 ? 688 HIS M CD2 1  
ATOM 7487   C CE1 . HIS C 3 685 ? -73.090  5.373   -9.597  1.00 0.00 ? 688 HIS M CE1 1  
ATOM 7488   N NE2 . HIS C 3 685 ? -73.582  6.023   -8.539  1.00 0.00 ? 688 HIS M NE2 1  
ATOM 7489   N N   . GLU C 3 686 ? -67.662  6.453   -6.508  1.00 0.00 ? 689 GLU M N   1  
ATOM 7490   C CA  . GLU C 3 686 ? -66.384  6.098   -5.963  1.00 0.00 ? 689 GLU M CA  1  
ATOM 7491   C C   . GLU C 3 686 ? -66.041  6.778   -4.668  1.00 0.00 ? 689 GLU M C   1  
ATOM 7492   O O   . GLU C 3 686 ? -65.247  6.303   -3.879  1.00 0.00 ? 689 GLU M O   1  
ATOM 7493   C CB  . GLU C 3 686 ? -65.321  6.196   -7.039  1.00 0.00 ? 689 GLU M CB  1  
ATOM 7494   C CG  . GLU C 3 686 ? -63.883  6.210   -6.497  1.00 0.00 ? 689 GLU M CG  1  
ATOM 7495   C CD  . GLU C 3 686 ? -63.107  7.341   -7.121  1.00 0.00 ? 689 GLU M CD  1  
ATOM 7496   O OE1 . GLU C 3 686 ? -63.423  8.516   -6.931  1.00 0.00 ? 689 GLU M OE1 1  
ATOM 7497   O OE2 . GLU C 3 686 ? -62.074  6.938   -7.863  1.00 0.00 ? 689 GLU M OE2 1  
ATOM 7498   N N   . LEU C 3 687 ? -66.677  7.883   -4.444  1.00 0.00 ? 690 LEU M N   1  
ATOM 7499   C CA  . LEU C 3 687 ? -66.472  8.610   -3.215  1.00 0.00 ? 690 LEU M CA  1  
ATOM 7500   C C   . LEU C 3 687 ? -67.110  7.880   -2.046  1.00 0.00 ? 690 LEU M C   1  
ATOM 7501   O O   . LEU C 3 687 ? -66.486  7.723   -1.020  1.00 0.00 ? 690 LEU M O   1  
ATOM 7502   C CB  . LEU C 3 687 ? -66.896  10.077  -3.345  1.00 0.00 ? 690 LEU M CB  1  
ATOM 7503   C CG  . LEU C 3 687 ? -67.100  10.761  -2.013  1.00 0.00 ? 690 LEU M CG  1  
ATOM 7504   C CD1 . LEU C 3 687 ? -66.161  11.910  -1.888  1.00 0.00 ? 690 LEU M CD1 1  
ATOM 7505   C CD2 . LEU C 3 687 ? -68.476  11.375  -1.966  1.00 0.00 ? 690 LEU M CD2 1  
ATOM 7506   N N   . VAL C 3 688 ? -68.340  7.424   -2.232  1.00 0.00 ? 691 VAL M N   1  
ATOM 7507   C CA  . VAL C 3 688 ? -69.034  6.631   -1.223  1.00 0.00 ? 691 VAL M CA  1  
ATOM 7508   C C   . VAL C 3 688 ? -68.348  5.238   -1.111  1.00 0.00 ? 691 VAL M C   1  
ATOM 7509   O O   . VAL C 3 688 ? -68.147  4.645   -0.019  1.00 0.00 ? 691 VAL M O   1  
ATOM 7510   C CB  . VAL C 3 688 ? -70.484  6.502   -1.568  1.00 0.00 ? 691 VAL M CB  1  
ATOM 7511   C CG1 . VAL C 3 688 ? -71.248  5.881   -0.429  1.00 0.00 ? 691 VAL M CG1 1  
ATOM 7512   C CG2 . VAL C 3 688 ? -71.005  7.879   -1.840  1.00 0.00 ? 691 VAL M CG2 1  
ATOM 7513   N N   . LEU C 3 689 ? -67.943  4.714   -2.260  1.00 0.00 ? 692 LEU M N   1  
ATOM 7514   C CA  . LEU C 3 689 ? -67.296  3.423   -2.310  1.00 0.00 ? 692 LEU M CA  1  
ATOM 7515   C C   . LEU C 3 689 ? -66.100  3.383   -1.389  1.00 0.00 ? 692 LEU M C   1  
ATOM 7516   O O   . LEU C 3 689 ? -65.876  2.476   -0.594  1.00 0.00 ? 692 LEU M O   1  
ATOM 7517   C CB  . LEU C 3 689 ? -66.913  3.012   -3.752  1.00 0.00 ? 692 LEU M CB  1  
ATOM 7518   C CG  . LEU C 3 689 ? -68.078  2.340   -4.441  1.00 0.00 ? 692 LEU M CG  1  
ATOM 7519   C CD1 . LEU C 3 689 ? -67.661  2.063   -5.839  1.00 0.00 ? 692 LEU M CD1 1  
ATOM 7520   C CD2 . LEU C 3 689 ? -68.294  1.035   -3.731  1.00 0.00 ? 692 LEU M CD2 1  
ATOM 7521   N N   . HIS C 3 690 ? -65.330  4.431   -1.460  1.00 0.00 ? 693 HIS M N   1  
ATOM 7522   C CA  . HIS C 3 690 ? -64.168  4.574   -0.627  1.00 0.00 ? 693 HIS M CA  1  
ATOM 7523   C C   . HIS C 3 690 ? -64.476  4.371   0.827   1.00 0.00 ? 693 HIS M C   1  
ATOM 7524   O O   . HIS C 3 690 ? -63.956  3.493   1.492   1.00 0.00 ? 693 HIS M O   1  
ATOM 7525   C CB  . HIS C 3 690 ? -63.601  5.984   -0.724  1.00 0.00 ? 693 HIS M CB  1  
ATOM 7526   C CG  . HIS C 3 690 ? -62.344  5.814   -1.434  1.00 0.00 ? 693 HIS M CG  1  
ATOM 7527   N ND1 . HIS C 3 690 ? -62.327  5.687   -2.813  1.00 0.00 ? 693 HIS M ND1 1  
ATOM 7528   C CD2 . HIS C 3 690 ? -61.108  5.628   -0.932  1.00 0.00 ? 693 HIS M CD2 1  
ATOM 7529   C CE1 . HIS C 3 690 ? -61.064  5.483   -3.139  1.00 0.00 ? 693 HIS M CE1 1  
ATOM 7530   N NE2 . HIS C 3 690 ? -60.314  5.440   -2.027  1.00 0.00 ? 693 HIS M NE2 1  
ATOM 7531   N N   . GLN C 3 691 ? -65.350  5.243   1.280   1.00 0.00 ? 694 GLN M N   1  
ATOM 7532   C CA  . GLN C 3 691 ? -65.731  5.263   2.636   1.00 0.00 ? 694 GLN M CA  1  
ATOM 7533   C C   . GLN C 3 691 ? -66.126  3.906   3.104   1.00 0.00 ? 694 GLN M C   1  
ATOM 7534   O O   . GLN C 3 691 ? -65.774  3.378   4.142   1.00 0.00 ? 694 GLN M O   1  
ATOM 7535   C CB  . GLN C 3 691 ? -66.851  6.271   2.805   1.00 0.00 ? 694 GLN M CB  1  
ATOM 7536   C CG  . GLN C 3 691 ? -66.807  7.318   1.704   1.00 0.00 ? 694 GLN M CG  1  
ATOM 7537   C CD  . GLN C 3 691 ? -67.498  8.616   2.048   1.00 0.00 ? 694 GLN M CD  1  
ATOM 7538   O OE1 . GLN C 3 691 ? -67.604  8.954   3.251   1.00 0.00 ? 694 GLN M OE1 1  
ATOM 7539   N NE2 . GLN C 3 691 ? -67.925  9.334   0.969   1.00 0.00 ? 694 GLN M NE2 1  
ATOM 7540   N N   . LEU C 3 692 ? -66.867  3.256   2.242   1.00 0.00 ? 695 LEU M N   1  
ATOM 7541   C CA  . LEU C 3 692 ? -67.329  1.930   2.589   1.00 0.00 ? 695 LEU M CA  1  
ATOM 7542   C C   . LEU C 3 692 ? -66.251  0.927   2.947   1.00 0.00 ? 695 LEU M C   1  
ATOM 7543   O O   . LEU C 3 692 ? -66.474  0.005   3.739   1.00 0.00 ? 695 LEU M O   1  
ATOM 7544   C CB  . LEU C 3 692 ? -68.093  1.376   1.413   1.00 0.00 ? 695 LEU M CB  1  
ATOM 7545   C CG  . LEU C 3 692 ? -69.568  1.606   1.530   1.00 0.00 ? 695 LEU M CG  1  
ATOM 7546   C CD1 . LEU C 3 692 ? -69.818  3.050   1.663   1.00 0.00 ? 695 LEU M CD1 1  
ATOM 7547   C CD2 . LEU C 3 692 ? -70.248  1.231   0.257   1.00 0.00 ? 695 LEU M CD2 1  
ATOM 7548   N N   . ARG C 3 693 ? -65.090  1.072   2.294   1.00 0.00 ? 696 ARG M N   1  
ATOM 7549   C CA  . ARG C 3 693 ? -63.996  0.135   2.531   1.00 0.00 ? 696 ARG M CA  1  
ATOM 7550   C C   . ARG C 3 693 ? -63.266  0.413   3.815   1.00 0.00 ? 696 ARG M C   1  
ATOM 7551   O O   . ARG C 3 693 ? -62.923  -0.490  4.608   1.00 0.00 ? 696 ARG M O   1  
ATOM 7552   C CB  . ARG C 3 693 ? -63.054  0.227   1.382   1.00 0.00 ? 696 ARG M CB  1  
ATOM 7553   C CG  . ARG C 3 693 ? -63.815  0.348   0.048   1.00 0.00 ? 696 ARG M CG  1  
ATOM 7554   C CD  . ARG C 3 693 ? -62.925  0.024   -1.163  1.00 0.00 ? 696 ARG M CD  1  
ATOM 7555   N NE  . ARG C 3 693 ? -63.599  -0.539  -2.341  1.00 0.00 ? 696 ARG M NE  1  
ATOM 7556   C CZ  . ARG C 3 693 ? -63.640  0.067   -3.528  1.00 0.00 ? 696 ARG M CZ  1  
ATOM 7557   N NH1 . ARG C 3 693 ? -63.106  1.275   -3.706  1.00 0.00 ? 696 ARG M NH1 1  
ATOM 7558   N NH2 . ARG C 3 693 ? -64.216  -0.504  -4.612  1.00 0.00 ? 696 ARG M NH2 1  
ATOM 7559   N N   . CYS C 3 694 ? -63.052  1.703   3.994   1.00 0.00 ? 697 CYS M N   1  
ATOM 7560   C CA  . CYS C 3 694 ? -62.362  2.240   5.137   1.00 0.00 ? 697 CYS M CA  1  
ATOM 7561   C C   . CYS C 3 694 ? -63.299  2.336   6.321   1.00 0.00 ? 697 CYS M C   1  
ATOM 7562   O O   . CYS C 3 694 ? -62.920  2.622   7.410   1.00 0.00 ? 697 CYS M O   1  
ATOM 7563   C CB  . CYS C 3 694 ? -61.881  3.635   4.753   1.00 0.00 ? 697 CYS M CB  1  
ATOM 7564   S SG  . CYS C 3 694 ? -60.708  3.805   3.262   1.00 0.00 ? 697 CYS M SG  1  
ATOM 7565   N N   . ASN C 3 695 ? -64.558  2.139   6.088   1.00 0.00 ? 698 ASN M N   1  
ATOM 7566   C CA  . ASN C 3 695 ? -65.559  2.274   7.135   1.00 0.00 ? 698 ASN M CA  1  
ATOM 7567   C C   . ASN C 3 695 ? -65.571  1.105   8.050   1.00 0.00 ? 698 ASN M C   1  
ATOM 7568   O O   . ASN C 3 695 ? -65.876  1.285   9.204   1.00 0.00 ? 698 ASN M O   1  
ATOM 7569   C CB  . ASN C 3 695 ? -66.943  2.046   6.470   1.00 0.00 ? 698 ASN M CB  1  
ATOM 7570   C CG  . ASN C 3 695 ? -67.671  3.284   6.189   1.00 0.00 ? 698 ASN M CG  1  
ATOM 7571   O OD1 . ASN C 3 695 ? -68.570  3.317   5.342   1.00 0.00 ? 698 ASN M OD1 1  
ATOM 7572   N ND2 . ASN C 3 695 ? -67.315  4.275   6.959   1.00 0.00 ? 698 ASN M ND2 1  
ATOM 7573   N N   . GLY C 3 696 ? -65.544  -0.056  7.396   1.00 0.00 ? 699 GLY M N   1  
ATOM 7574   C CA  . GLY C 3 696 ? -65.692  -1.350  7.950   1.00 0.00 ? 699 GLY M CA  1  
ATOM 7575   C C   . GLY C 3 696 ? -66.921  -2.039  7.367   1.00 0.00 ? 699 GLY M C   1  
ATOM 7576   O O   . GLY C 3 696 ? -67.135  -3.238  7.439   1.00 0.00 ? 699 GLY M O   1  
ATOM 7577   N N   . VAL C 3 697 ? -67.755  -1.259  6.714   1.00 0.00 ? 700 VAL M N   1  
ATOM 7578   C CA  . VAL C 3 697 ? -68.991  -1.713  6.129   1.00 0.00 ? 700 VAL M CA  1  
ATOM 7579   C C   . VAL C 3 697 ? -68.757  -2.830  5.140   1.00 0.00 ? 700 VAL M C   1  
ATOM 7580   O O   . VAL C 3 697 ? -69.400  -3.846  5.109   1.00 0.00 ? 700 VAL M O   1  
ATOM 7581   C CB  . VAL C 3 697 ? -69.737  -0.560  5.478   1.00 0.00 ? 700 VAL M CB  1  
ATOM 7582   C CG1 . VAL C 3 697 ? -70.542  -1.097  4.332   1.00 0.00 ? 700 VAL M CG1 1  
ATOM 7583   C CG2 . VAL C 3 697 ? -70.685  0.072   6.457   1.00 0.00 ? 700 VAL M CG2 1  
ATOM 7584   N N   . LEU C 3 698 ? -67.768  -2.621  4.287   1.00 0.00 ? 701 LEU M N   1  
ATOM 7585   C CA  . LEU C 3 698 ? -67.487  -3.633  3.303   1.00 0.00 ? 701 LEU M CA  1  
ATOM 7586   C C   . LEU C 3 698 ? -66.821  -4.828  3.896   1.00 0.00 ? 701 LEU M C   1  
ATOM 7587   O O   . LEU C 3 698 ? -66.789  -5.889  3.343   1.00 0.00 ? 701 LEU M O   1  
ATOM 7588   C CB  . LEU C 3 698 ? -66.683  -3.121  2.116   1.00 0.00 ? 701 LEU M CB  1  
ATOM 7589   C CG  . LEU C 3 698 ? -67.566  -3.037  0.844   1.00 0.00 ? 701 LEU M CG  1  
ATOM 7590   C CD1 . LEU C 3 698 ? -68.984  -2.741  1.252   1.00 0.00 ? 701 LEU M CD1 1  
ATOM 7591   C CD2 . LEU C 3 698 ? -67.141  -1.946  -0.137  1.00 0.00 ? 701 LEU M CD2 1  
ATOM 7592   N N   . GLU C 3 699 ? -66.273  -4.658  5.073   1.00 0.00 ? 702 GLU M N   1  
ATOM 7593   C CA  . GLU C 3 699 ? -65.601  -5.790  5.698   1.00 0.00 ? 702 GLU M CA  1  
ATOM 7594   C C   . GLU C 3 699 ? -66.602  -6.575  6.510   1.00 0.00 ? 702 GLU M C   1  
ATOM 7595   O O   . GLU C 3 699 ? -66.466  -7.764  6.766   1.00 0.00 ? 702 GLU M O   1  
ATOM 7596   C CB  . GLU C 3 699 ? -64.328  -5.419  6.485   1.00 0.00 ? 702 GLU M CB  1  
ATOM 7597   C CG  . GLU C 3 699 ? -63.015  -5.955  5.884   1.00 0.00 ? 702 GLU M CG  1  
ATOM 7598   C CD  . GLU C 3 699 ? -62.357  -7.040  6.715   1.00 0.00 ? 702 GLU M CD  1  
ATOM 7599   O OE1 . GLU C 3 699 ? -62.763  -8.203  6.781   1.00 0.00 ? 702 GLU M OE1 1  
ATOM 7600   O OE2 . GLU C 3 699 ? -61.296  -6.579  7.327   1.00 0.00 ? 702 GLU M OE2 1  
ATOM 7601   N N   . GLY C 3 700 ? -67.666  -5.904  6.883   1.00 0.00 ? 703 GLY M N   1  
ATOM 7602   C CA  . GLY C 3 700 ? -68.694  -6.575  7.664   1.00 0.00 ? 703 GLY M CA  1  
ATOM 7603   C C   . GLY C 3 700 ? -69.531  -7.423  6.743   1.00 0.00 ? 703 GLY M C   1  
ATOM 7604   O O   . GLY C 3 700 ? -70.066  -8.472  7.115   1.00 0.00 ? 703 GLY M O   1  
ATOM 7605   N N   . ILE C 3 701 ? -69.590  -7.008  5.477   1.00 0.00 ? 704 ILE M N   1  
ATOM 7606   C CA  . ILE C 3 701 ? -70.351  -7.700  4.503   1.00 0.00 ? 704 ILE M CA  1  
ATOM 7607   C C   . ILE C 3 701 ? -69.609  -8.957  4.141   1.00 0.00 ? 704 ILE M C   1  
ATOM 7608   O O   . ILE C 3 701 ? -70.183  -10.040 4.037   1.00 0.00 ? 704 ILE M O   1  
ATOM 7609   C CB  . ILE C 3 701 ? -70.631  -6.791  3.304   1.00 0.00 ? 704 ILE M CB  1  
ATOM 7610   C CG1 . ILE C 3 701 ? -72.035  -6.184  3.383   1.00 0.00 ? 704 ILE M CG1 1  
ATOM 7611   C CG2 . ILE C 3 701 ? -70.403  -7.526  2.045   1.00 0.00 ? 704 ILE M CG2 1  
ATOM 7612   C CD1 . ILE C 3 701 ? -72.292  -5.619  4.784   1.00 0.00 ? 704 ILE M CD1 1  
ATOM 7613   N N   . ARG C 3 702 ? -68.298  -8.812  4.020   1.00 0.00 ? 705 ARG M N   1  
ATOM 7614   C CA  . ARG C 3 702 ? -67.385  -9.925  3.716   1.00 0.00 ? 705 ARG M CA  1  
ATOM 7615   C C   . ARG C 3 702 ? -67.546  -11.085 4.684   1.00 0.00 ? 705 ARG M C   1  
ATOM 7616   O O   . ARG C 3 702 ? -67.844  -12.223 4.358   1.00 0.00 ? 705 ARG M O   1  
ATOM 7617   C CB  . ARG C 3 702 ? -65.947  -9.509  3.835   1.00 0.00 ? 705 ARG M CB  1  
ATOM 7618   C CG  . ARG C 3 702 ? -65.166  -9.507  2.549   1.00 0.00 ? 705 ARG M CG  1  
ATOM 7619   C CD  . ARG C 3 702 ? -64.844  -8.106  2.002   1.00 0.00 ? 705 ARG M CD  1  
ATOM 7620   N NE  . ARG C 3 702 ? -64.396  -8.145  0.607   1.00 0.00 ? 705 ARG M NE  1  
ATOM 7621   C CZ  . ARG C 3 702 ? -64.053  -7.064  -0.116  1.00 0.00 ? 705 ARG M CZ  1  
ATOM 7622   N NH1 . ARG C 3 702 ? -64.082  -5.818  0.394   1.00 0.00 ? 705 ARG M NH1 1  
ATOM 7623   N NH2 . ARG C 3 702 ? -63.682  -7.239  -1.403  1.00 0.00 ? 705 ARG M NH2 1  
ATOM 7624   N N   . ILE C 3 703 ? -67.296  -10.740 5.920   1.00 0.00 ? 706 ILE M N   1  
ATOM 7625   C CA  . ILE C 3 703 ? -67.401  -11.637 7.050   1.00 0.00 ? 706 ILE M CA  1  
ATOM 7626   C C   . ILE C 3 703 ? -68.776  -12.259 7.140   1.00 0.00 ? 706 ILE M C   1  
ATOM 7627   O O   . ILE C 3 703 ? -68.982  -13.333 7.705   1.00 0.00 ? 706 ILE M O   1  
ATOM 7628   C CB  . ILE C 3 703 ? -67.198  -10.798 8.307   1.00 0.00 ? 706 ILE M CB  1  
ATOM 7629   C CG1 . ILE C 3 703 ? -65.779  -10.285 8.374   1.00 0.00 ? 706 ILE M CG1 1  
ATOM 7630   C CG2 . ILE C 3 703 ? -67.678  -11.419 9.601   1.00 0.00 ? 706 ILE M CG2 1  
ATOM 7631   C CD1 . ILE C 3 703 ? -65.678  -9.348  9.560   1.00 0.00 ? 706 ILE M CD1 1  
ATOM 7632   N N   . CYS C 3 704 ? -69.745  -11.555 6.590   1.00 0.00 ? 707 CYS M N   1  
ATOM 7633   C CA  . CYS C 3 704 ? -71.093  -12.028 6.627   1.00 0.00 ? 707 CYS M CA  1  
ATOM 7634   C C   . CYS C 3 704 ? -71.244  -13.141 5.625   1.00 0.00 ? 707 CYS M C   1  
ATOM 7635   O O   . CYS C 3 704 ? -71.711  -14.253 5.934   1.00 0.00 ? 707 CYS M O   1  
ATOM 7636   C CB  . CYS C 3 704 ? -71.999  -10.857 6.313   1.00 0.00 ? 707 CYS M CB  1  
ATOM 7637   S SG  . CYS C 3 704 ? -72.670  -10.203 7.849   1.00 0.00 ? 707 CYS M SG  1  
ATOM 7638   N N   . ARG C 3 705 ? -70.771  -12.812 4.432   1.00 0.00 ? 708 ARG M N   1  
ATOM 7639   C CA  . ARG C 3 705 ? -70.811  -13.684 3.299   1.00 0.00 ? 708 ARG M CA  1  
ATOM 7640   C C   . ARG C 3 705 ? -69.922  -14.904 3.408   1.00 0.00 ? 708 ARG M C   1  
ATOM 7641   O O   . ARG C 3 705 ? -69.792  -15.678 2.472   1.00 0.00 ? 708 ARG M O   1  
ATOM 7642   C CB  . ARG C 3 705 ? -70.710  -12.933 1.957   1.00 0.00 ? 708 ARG M CB  1  
ATOM 7643   C CG  . ARG C 3 705 ? -69.475  -13.159 1.138   1.00 0.00 ? 708 ARG M CG  1  
ATOM 7644   C CD  . ARG C 3 705 ? -69.430  -12.264 -0.113  1.00 0.00 ? 708 ARG M CD  1  
ATOM 7645   N NE  . ARG C 3 705 ? -68.039  -11.950 -0.512  1.00 0.00 ? 708 ARG M NE  1  
ATOM 7646   C CZ  . ARG C 3 705 ? -67.679  -10.882 -1.223  1.00 0.00 ? 708 ARG M CZ  1  
ATOM 7647   N NH1 . ARG C 3 705 ? -68.582  -10.000 -1.665  1.00 0.00 ? 708 ARG M NH1 1  
ATOM 7648   N NH2 . ARG C 3 705 ? -66.384  -10.691 -1.501  1.00 0.00 ? 708 ARG M NH2 1  
ATOM 7649   N N   . LYS C 3 706 ? -69.347  -15.121 4.563   1.00 0.00 ? 709 LYS M N   1  
ATOM 7650   C CA  . LYS C 3 706 ? -68.472  -16.264 4.669   1.00 0.00 ? 709 LYS M CA  1  
ATOM 7651   C C   . LYS C 3 706 ? -69.208  -17.333 5.420   1.00 0.00 ? 709 LYS M C   1  
ATOM 7652   O O   . LYS C 3 706 ? -69.076  -18.519 5.165   1.00 0.00 ? 709 LYS M O   1  
ATOM 7653   C CB  . LYS C 3 706 ? -67.100  -15.945 5.248   1.00 0.00 ? 709 LYS M CB  1  
ATOM 7654   C CG  . LYS C 3 706 ? -66.036  -15.513 4.229   1.00 0.00 ? 709 LYS M CG  1  
ATOM 7655   C CD  . LYS C 3 706 ? -64.760  -15.031 4.893   1.00 0.00 ? 709 LYS M CD  1  
ATOM 7656   C CE  . LYS C 3 706 ? -63.420  -15.443 4.242   1.00 0.00 ? 709 LYS M CE  1  
ATOM 7657   N NZ  . LYS C 3 706 ? -62.215  -14.944 4.951   1.00 0.00 ? 709 LYS M NZ  1  
ATOM 7658   N N   . GLY C 3 707 ? -70.119  -16.887 6.249   1.00 0.00 ? 710 GLY M N   1  
ATOM 7659   C CA  . GLY C 3 707 ? -70.881  -17.853 7.036   1.00 0.00 ? 710 GLY M CA  1  
ATOM 7660   C C   . GLY C 3 707 ? -72.205  -18.090 6.324   1.00 0.00 ? 710 GLY M C   1  
ATOM 7661   O O   . GLY C 3 707 ? -72.285  -18.344 5.124   1.00 0.00 ? 710 GLY M O   1  
ATOM 7662   N N   . PHE C 3 708 ? -73.255  -17.983 7.096   1.00 0.00 ? 711 PHE M N   1  
ATOM 7663   C CA  . PHE C 3 708 ? -74.591  -18.098 6.607   1.00 0.00 ? 711 PHE M CA  1  
ATOM 7664   C C   . PHE C 3 708 ? -75.328  -16.783 6.891   1.00 0.00 ? 711 PHE M C   1  
ATOM 7665   O O   . PHE C 3 708 ? -75.918  -16.611 7.995   1.00 0.00 ? 711 PHE M O   1  
ATOM 7666   C CB  . PHE C 3 708 ? -75.278  -19.317 7.262   1.00 0.00 ? 711 PHE M CB  1  
ATOM 7667   C CG  . PHE C 3 708 ? -74.681  -20.611 6.743   1.00 0.00 ? 711 PHE M CG  1  
ATOM 7668   C CD1 . PHE C 3 708 ? -75.200  -21.198 5.595   1.00 0.00 ? 711 PHE M CD1 1  
ATOM 7669   C CD2 . PHE C 3 708 ? -73.597  -21.225 7.362   1.00 0.00 ? 711 PHE M CD2 1  
ATOM 7670   C CE1 . PHE C 3 708 ? -74.668  -22.373 5.054   1.00 0.00 ? 711 PHE M CE1 1  
ATOM 7671   C CE2 . PHE C 3 708 ? -73.058  -22.409 6.865   1.00 0.00 ? 711 PHE M CE2 1  
ATOM 7672   C CZ  . PHE C 3 708 ? -73.596  -22.985 5.707   1.00 0.00 ? 711 PHE M CZ  1  
ATOM 7673   N N   . PRO C 3 709 ? -75.213  -15.863 5.928   1.00 0.00 ? 712 PRO M N   1  
ATOM 7674   C CA  . PRO C 3 709 ? -75.788  -14.539 6.036   1.00 0.00 ? 712 PRO M CA  1  
ATOM 7675   C C   . PRO C 3 709 ? -77.259  -14.539 6.461   1.00 0.00 ? 712 PRO M C   1  
ATOM 7676   O O   . PRO C 3 709 ? -77.592  -14.555 7.639   1.00 0.00 ? 712 PRO M O   1  
ATOM 7677   C CB  . PRO C 3 709 ? -75.639  -13.923 4.655   1.00 0.00 ? 712 PRO M CB  1  
ATOM 7678   C CG  . PRO C 3 709 ? -74.678  -14.824 3.850   1.00 0.00 ? 712 PRO M CG  1  
ATOM 7679   C CD  . PRO C 3 709 ? -74.410  -16.063 4.676   1.00 0.00 ? 712 PRO M CD  1  
ATOM 7680   N N   . SER C 3 710 ? -78.124  -14.563 5.464   1.00 0.00 ? 713 SER M N   1  
ATOM 7681   C CA  . SER C 3 710 ? -79.564  -14.609 5.657   1.00 0.00 ? 713 SER M CA  1  
ATOM 7682   C C   . SER C 3 710 ? -80.008  -15.799 6.490   1.00 0.00 ? 713 SER M C   1  
ATOM 7683   O O   . SER C 3 710 ? -79.694  -16.994 6.237   1.00 0.00 ? 713 SER M O   1  
ATOM 7684   C CB  . SER C 3 710 ? -80.252  -14.624 4.313   1.00 0.00 ? 713 SER M CB  1  
ATOM 7685   O OG  . SER C 3 710 ? -79.354  -15.140 3.322   1.00 0.00 ? 713 SER M OG  1  
ATOM 7686   N N   . ARG C 3 711 ? -80.803  -15.475 7.504   1.00 0.00 ? 714 ARG M N   1  
ATOM 7687   C CA  . ARG C 3 711 ? -81.340  -16.477 8.414   1.00 0.00 ? 714 ARG M CA  1  
ATOM 7688   C C   . ARG C 3 711 ? -82.826  -16.259 8.621   1.00 0.00 ? 714 ARG M C   1  
ATOM 7689   O O   . ARG C 3 711 ? -83.243  -15.234 9.163   1.00 0.00 ? 714 ARG M O   1  
ATOM 7690   C CB  . ARG C 3 711 ? -80.623  -16.505 9.744   1.00 0.00 ? 714 ARG M CB  1  
ATOM 7691   C CG  . ARG C 3 711 ? -79.752  -15.273 9.935   1.00 0.00 ? 714 ARG M CG  1  
ATOM 7692   C CD  . ARG C 3 711 ? -78.567  -15.479 10.873  1.00 0.00 ? 714 ARG M CD  1  
ATOM 7693   N NE  . ARG C 3 711 ? -77.272  -15.569 10.153  1.00 0.00 ? 714 ARG M NE  1  
ATOM 7694   C CZ  . ARG C 3 711 ? -76.119  -15.212 10.712  1.00 0.00 ? 714 ARG M CZ  1  
ATOM 7695   N NH1 . ARG C 3 711 ? -76.071  -14.729 11.997  1.00 0.00 ? 714 ARG M NH1 1  
ATOM 7696   N NH2 . ARG C 3 711 ? -74.972  -15.342 9.979   1.00 0.00 ? 714 ARG M NH2 1  
ATOM 7697   N N   . VAL C 3 712 ? -83.605  -17.234 8.160   1.00 0.00 ? 715 VAL M N   1  
ATOM 7698   C CA  . VAL C 3 712 ? -85.033  -17.165 8.224   1.00 0.00 ? 715 VAL M CA  1  
ATOM 7699   C C   . VAL C 3 712 ? -85.620  -17.819 9.428   1.00 0.00 ? 715 VAL M C   1  
ATOM 7700   O O   . VAL C 3 712 ? -85.346  -18.962 9.754   1.00 0.00 ? 715 VAL M O   1  
ATOM 7701   C CB  . VAL C 3 712 ? -85.673  -17.842 7.034   1.00 0.00 ? 715 VAL M CB  1  
ATOM 7702   C CG1 . VAL C 3 712 ? -87.193  -17.751 7.109   1.00 0.00 ? 715 VAL M CG1 1  
ATOM 7703   C CG2 . VAL C 3 712 ? -85.166  -17.148 5.794   1.00 0.00 ? 715 VAL M CG2 1  
ATOM 7704   N N   . LEU C 3 713 ? -86.520  -17.079 10.023  1.00 0.00 ? 716 LEU M N   1  
ATOM 7705   C CA  . LEU C 3 713 ? -87.303  -17.581 11.127  1.00 0.00 ? 716 LEU M CA  1  
ATOM 7706   C C   . LEU C 3 713 ? -88.380  -18.445 10.466  1.00 0.00 ? 716 LEU M C   1  
ATOM 7707   O O   . LEU C 3 713 ? -88.985  -18.134 9.441   1.00 0.00 ? 716 LEU M O   1  
ATOM 7708   C CB  . LEU C 3 713 ? -87.903  -16.402 11.870  1.00 0.00 ? 716 LEU M CB  1  
ATOM 7709   C CG  . LEU C 3 713 ? -88.052  -16.715 13.333  1.00 0.00 ? 716 LEU M CG  1  
ATOM 7710   C CD1 . LEU C 3 713 ? -87.089  -15.867 14.101  1.00 0.00 ? 716 LEU M CD1 1  
ATOM 7711   C CD2 . LEU C 3 713 ? -89.460  -16.395 13.807  1.00 0.00 ? 716 LEU M CD2 1  
ATOM 7712   N N   . TYR C 3 714 ? -88.545  -19.569 11.079  1.00 0.00 ? 717 TYR M N   1  
ATOM 7713   C CA  . TYR C 3 714 ? -89.452  -20.635 10.645  1.00 0.00 ? 717 TYR M CA  1  
ATOM 7714   C C   . TYR C 3 714 ? -90.880  -20.318 10.156  1.00 0.00 ? 717 TYR M C   1  
ATOM 7715   O O   . TYR C 3 714 ? -91.251  -20.739 9.082   1.00 0.00 ? 717 TYR M O   1  
ATOM 7716   C CB  . TYR C 3 714 ? -89.428  -21.730 11.696  1.00 0.00 ? 717 TYR M CB  1  
ATOM 7717   C CG  . TYR C 3 714 ? -88.183  -22.611 11.573  1.00 0.00 ? 717 TYR M CG  1  
ATOM 7718   C CD1 . TYR C 3 714 ? -87.924  -23.246 10.356  1.00 0.00 ? 717 TYR M CD1 1  
ATOM 7719   C CD2 . TYR C 3 714 ? -87.336  -22.871 12.659  1.00 0.00 ? 717 TYR M CD2 1  
ATOM 7720   C CE1 . TYR C 3 714 ? -86.848  -24.114 10.207  1.00 0.00 ? 717 TYR M CE1 1  
ATOM 7721   C CE2 . TYR C 3 714 ? -86.251  -23.744 12.527  1.00 0.00 ? 717 TYR M CE2 1  
ATOM 7722   C CZ  . TYR C 3 714 ? -86.014  -24.372 11.299  1.00 0.00 ? 717 TYR M CZ  1  
ATOM 7723   O OH  . TYR C 3 714 ? -84.915  -25.189 11.081  1.00 0.00 ? 717 TYR M OH  1  
ATOM 7724   N N   . ALA C 3 715 ? -91.673  -19.586 10.919  1.00 0.00 ? 718 ALA M N   1  
ATOM 7725   C CA  . ALA C 3 715 ? -93.013  -19.209 10.464  1.00 0.00 ? 718 ALA M CA  1  
ATOM 7726   C C   . ALA C 3 715 ? -92.966  -18.274 9.289   1.00 0.00 ? 718 ALA M C   1  
ATOM 7727   O O   . ALA C 3 715 ? -93.686  -18.499 8.282   1.00 0.00 ? 718 ALA M O   1  
ATOM 7728   C CB  . ALA C 3 715 ? -93.702  -18.572 11.653  1.00 0.00 ? 718 ALA M CB  1  
ATOM 7729   N N   . ASP C 3 716 ? -92.010  -17.317 9.457   1.00 0.00 ? 719 ASP M N   1  
ATOM 7730   C CA  . ASP C 3 716 ? -91.668  -16.326 8.473   1.00 0.00 ? 719 ASP M CA  1  
ATOM 7731   C C   . ASP C 3 716 ? -91.208  -17.045 7.218   1.00 0.00 ? 719 ASP M C   1  
ATOM 7732   O O   . ASP C 3 716 ? -91.226  -16.482 6.101   1.00 0.00 ? 719 ASP M O   1  
ATOM 7733   C CB  . ASP C 3 716 ? -90.595  -15.427 9.076   1.00 0.00 ? 719 ASP M CB  1  
ATOM 7734   C CG  . ASP C 3 716 ? -91.134  -14.377 10.003  1.00 0.00 ? 719 ASP M CG  1  
ATOM 7735   O OD1 . ASP C 3 716 ? -91.680  -14.651 11.030  1.00 0.00 ? 719 ASP M OD1 1  
ATOM 7736   O OD2 . ASP C 3 716 ? -90.949  -13.135 9.610   1.00 0.00 ? 719 ASP M OD2 1  
ATOM 7737   N N   . PHE C 3 717 ? -90.874  -18.337 7.447   1.00 0.00 ? 720 PHE M N   1  
ATOM 7738   C CA  . PHE C 3 717 ? -90.409  -19.196 6.372   1.00 0.00 ? 720 PHE M CA  1  
ATOM 7739   C C   . PHE C 3 717 ? -91.527  -19.980 5.734   1.00 0.00 ? 720 PHE M C   1  
ATOM 7740   O O   . PHE C 3 717 ? -91.539  -20.267 4.520   1.00 0.00 ? 720 PHE M O   1  
ATOM 7741   C CB  . PHE C 3 717 ? -89.332  -20.185 6.846   1.00 0.00 ? 720 PHE M CB  1  
ATOM 7742   C CG  . PHE C 3 717 ? -88.753  -20.867 5.645   1.00 0.00 ? 720 PHE M CG  1  
ATOM 7743   C CD1 . PHE C 3 717 ? -87.835  -20.180 4.853   1.00 0.00 ? 720 PHE M CD1 1  
ATOM 7744   C CD2 . PHE C 3 717 ? -89.152  -22.159 5.268   1.00 0.00 ? 720 PHE M CD2 1  
ATOM 7745   C CE1 . PHE C 3 717 ? -87.281  -20.765 3.715   1.00 0.00 ? 720 PHE M CE1 1  
ATOM 7746   C CE2 . PHE C 3 717 ? -88.602  -22.766 4.133   1.00 0.00 ? 720 PHE M CE2 1  
ATOM 7747   C CZ  . PHE C 3 717 ? -87.668  -22.066 3.363   1.00 0.00 ? 720 PHE M CZ  1  
ATOM 7748   N N   . LYS C 3 718 ? -92.468  -20.346 6.581   1.00 0.00 ? 721 LYS M N   1  
ATOM 7749   C CA  . LYS C 3 718 ? -93.616  -21.125 6.135   1.00 0.00 ? 721 LYS M CA  1  
ATOM 7750   C C   . LYS C 3 718 ? -94.431  -20.305 5.159   1.00 0.00 ? 721 LYS M C   1  
ATOM 7751   O O   . LYS C 3 718 ? -94.387  -20.537 3.944   1.00 0.00 ? 721 LYS M O   1  
ATOM 7752   C CB  . LYS C 3 718 ? -94.484  -21.440 7.337   1.00 0.00 ? 721 LYS M CB  1  
ATOM 7753   C CG  . LYS C 3 718 ? -94.946  -22.876 7.377   1.00 0.00 ? 721 LYS M CG  1  
ATOM 7754   C CD  . LYS C 3 718 ? -95.258  -23.373 8.775   1.00 0.00 ? 721 LYS M CD  1  
ATOM 7755   C CE  . LYS C 3 718 ? -96.226  -24.536 8.830   1.00 0.00 ? 721 LYS M CE  1  
ATOM 7756   N NZ  . LYS C 3 718 ? -96.640  -24.806 10.232  1.00 0.00 ? 721 LYS M NZ  1  
ATOM 7757   N N   . GLN C 3 719 ? -95.146  -19.340 5.764   1.00 0.00 ? 722 GLN M N   1  
ATOM 7758   C CA  . GLN C 3 719 ? -95.979  -18.411 5.057   1.00 0.00 ? 722 GLN M CA  1  
ATOM 7759   C C   . GLN C 3 719 ? -95.531  -18.013 3.655   1.00 0.00 ? 722 GLN M C   1  
ATOM 7760   O O   . GLN C 3 719 ? -96.199  -18.288 2.658   1.00 0.00 ? 722 GLN M O   1  
ATOM 7761   C CB  . GLN C 3 719 ? -96.353  -17.207 5.899   1.00 0.00 ? 722 GLN M CB  1  
ATOM 7762   C CG  . GLN C 3 719 ? -96.532  -15.937 5.062   1.00 0.00 ? 722 GLN M CG  1  
ATOM 7763   C CD  . GLN C 3 719 ? -97.775  -15.166 5.493   1.00 0.00 ? 722 GLN M CD  1  
ATOM 7764   O OE1 . GLN C 3 719 ? -98.569  -14.702 4.661   1.00 0.00 ? 722 GLN M OE1 1  
ATOM 7765   N NE2 . GLN C 3 719 ? -97.966  -15.051 6.819   1.00 0.00 ? 722 GLN M NE2 1  
ATOM 7766   N N   . ARG C 3 720 ? -94.341  -17.421 3.602   1.00 0.00 ? 723 ARG M N   1  
ATOM 7767   C CA  . ARG C 3 720 ? -93.784  -16.926 2.349   1.00 0.00 ? 723 ARG M CA  1  
ATOM 7768   C C   . ARG C 3 720 ? -93.477  -17.952 1.267   1.00 0.00 ? 723 ARG M C   1  
ATOM 7769   O O   . ARG C 3 720 ? -93.430  -17.617 0.075   1.00 0.00 ? 723 ARG M O   1  
ATOM 7770   C CB  . ARG C 3 720 ? -92.518  -16.112 2.615   1.00 0.00 ? 723 ARG M CB  1  
ATOM 7771   C CG  . ARG C 3 720 ? -92.630  -14.639 2.210   1.00 0.00 ? 723 ARG M CG  1  
ATOM 7772   C CD  . ARG C 3 720 ? -91.562  -14.173 1.229   1.00 0.00 ? 723 ARG M CD  1  
ATOM 7773   N NE  . ARG C 3 720 ? -92.034  -13.169 0.245   1.00 0.00 ? 723 ARG M NE  1  
ATOM 7774   C CZ  . ARG C 3 720 ? -92.895  -12.175 0.545   1.00 0.00 ? 723 ARG M CZ  1  
ATOM 7775   N NH1 . ARG C 3 720 ? -93.402  -11.989 1.778   1.00 0.00 ? 723 ARG M NH1 1  
ATOM 7776   N NH2 . ARG C 3 720 ? -93.269  -11.333 -0.417  1.00 0.00 ? 723 ARG M NH2 1  
ATOM 7777   N N   . TYR C 3 721 ? -93.216  -19.197 1.705   1.00 0.00 ? 724 TYR M N   1  
ATOM 7778   C CA  . TYR C 3 721 ? -92.795  -20.193 0.726   1.00 0.00 ? 724 TYR M CA  1  
ATOM 7779   C C   . TYR C 3 721 ? -93.589  -21.481 0.618   1.00 0.00 ? 724 TYR M C   1  
ATOM 7780   O O   . TYR C 3 721 ? -93.237  -22.316 -0.253  1.00 0.00 ? 724 TYR M O   1  
ATOM 7781   C CB  . TYR C 3 721 ? -91.338  -20.564 0.947   1.00 0.00 ? 724 TYR M CB  1  
ATOM 7782   C CG  . TYR C 3 721 ? -90.385  -19.409 0.772   1.00 0.00 ? 724 TYR M CG  1  
ATOM 7783   C CD1 . TYR C 3 721 ? -89.849  -19.099 -0.481  1.00 0.00 ? 724 TYR M CD1 1  
ATOM 7784   C CD2 . TYR C 3 721 ? -90.024  -18.629 1.869   1.00 0.00 ? 724 TYR M CD2 1  
ATOM 7785   C CE1 . TYR C 3 721 ? -88.961  -18.039 -0.630  1.00 0.00 ? 724 TYR M CE1 1  
ATOM 7786   C CE2 . TYR C 3 721 ? -89.144  -17.561 1.731   1.00 0.00 ? 724 TYR M CE2 1  
ATOM 7787   C CZ  . TYR C 3 721 ? -88.616  -17.263 0.476   1.00 0.00 ? 724 TYR M CZ  1  
ATOM 7788   O OH  . TYR C 3 721 ? -87.781  -16.185 0.341   1.00 0.00 ? 724 TYR M OH  1  
ATOM 7789   N N   . ARG C 3 722 ? -94.580  -21.653 1.502   1.00 0.00 ? 725 ARG M N   1  
ATOM 7790   C CA  . ARG C 3 722 ? -95.442  -22.851 1.496   1.00 0.00 ? 725 ARG M CA  1  
ATOM 7791   C C   . ARG C 3 722 ? -95.798  -23.284 0.068   1.00 0.00 ? 725 ARG M C   1  
ATOM 7792   O O   . ARG C 3 722 ? -95.634  -24.418 -0.352  1.00 0.00 ? 725 ARG M O   1  
ATOM 7793   C CB  . ARG C 3 722 ? -96.726  -22.524 2.248   1.00 0.00 ? 725 ARG M CB  1  
ATOM 7794   C CG  . ARG C 3 722 ? -97.518  -23.774 2.636   1.00 0.00 ? 725 ARG M CG  1  
ATOM 7795   C CD  . ARG C 3 722 ? -98.981  -23.452 3.019   1.00 0.00 ? 725 ARG M CD  1  
ATOM 7796   N NE  . ARG C 3 722 ? -99.843  -24.655 3.080   1.00 0.00 ? 725 ARG M NE  1  
ATOM 7797   C CZ  . ARG C 3 722 ? -101.176 -24.623 3.159   1.00 0.00 ? 725 ARG M CZ  1  
ATOM 7798   N NH1 . ARG C 3 722 ? -101.852 -23.459 3.181   1.00 0.00 ? 725 ARG M NH1 1  
ATOM 7799   N NH2 . ARG C 3 722 ? -101.842 -25.785 3.226   1.00 0.00 ? 725 ARG M NH2 1  
ATOM 7800   N N   . VAL C 3 723 ? -96.232  -22.265 -0.677  1.00 0.00 ? 726 VAL M N   1  
ATOM 7801   C CA  . VAL C 3 723 ? -96.636  -22.297 -2.062  1.00 0.00 ? 726 VAL M CA  1  
ATOM 7802   C C   . VAL C 3 723 ? -95.704  -23.024 -3.022  1.00 0.00 ? 726 VAL M C   1  
ATOM 7803   O O   . VAL C 3 723 ? -96.040  -23.360 -4.155  1.00 0.00 ? 726 VAL M O   1  
ATOM 7804   C CB  . VAL C 3 723 ? -96.721  -20.845 -2.532  1.00 0.00 ? 726 VAL M CB  1  
ATOM 7805   C CG1 . VAL C 3 723 ? -97.167  -20.751 -3.975  1.00 0.00 ? 726 VAL M CG1 1  
ATOM 7806   C CG2 . VAL C 3 723 ? -97.646  -20.079 -1.636  1.00 0.00 ? 726 VAL M CG2 1  
ATOM 7807   N N   . LEU C 3 724 ? -94.483  -23.268 -2.611  1.00 0.00 ? 727 LEU M N   1  
ATOM 7808   C CA  . LEU C 3 724 ? -93.515  -23.856 -3.524  1.00 0.00 ? 727 LEU M CA  1  
ATOM 7809   C C   . LEU C 3 724 ? -93.716  -25.324 -3.821  1.00 0.00 ? 727 LEU M C   1  
ATOM 7810   O O   . LEU C 3 724 ? -93.312  -25.819 -4.863  1.00 0.00 ? 727 LEU M O   1  
ATOM 7811   C CB  . LEU C 3 724 ? -92.076  -23.569 -3.045  1.00 0.00 ? 727 LEU M CB  1  
ATOM 7812   C CG  . LEU C 3 724 ? -91.575  -22.159 -3.351  1.00 0.00 ? 727 LEU M CG  1  
ATOM 7813   C CD1 . LEU C 3 724 ? -90.934  -21.537 -2.116  1.00 0.00 ? 727 LEU M CD1 1  
ATOM 7814   C CD2 . LEU C 3 724 ? -90.553  -22.176 -4.495  1.00 0.00 ? 727 LEU M CD2 1  
ATOM 7815   N N   . ASN C 3 725 ? -94.273  -26.010 -2.847  1.00 0.00 ? 728 ASN M N   1  
ATOM 7816   C CA  . ASN C 3 725 ? -94.538  -27.449 -2.940  1.00 0.00 ? 728 ASN M CA  1  
ATOM 7817   C C   . ASN C 3 725 ? -95.560  -27.780 -1.881  1.00 0.00 ? 728 ASN M C   1  
ATOM 7818   O O   . ASN C 3 725 ? -95.619  -28.863 -1.331  1.00 0.00 ? 728 ASN M O   1  
ATOM 7819   C CB  . ASN C 3 725 ? -93.283  -28.293 -2.766  1.00 0.00 ? 728 ASN M CB  1  
ATOM 7820   C CG  . ASN C 3 725 ? -93.122  -29.391 -3.786  1.00 0.00 ? 728 ASN M CG  1  
ATOM 7821   O OD1 . ASN C 3 725 ? -92.948  -30.579 -3.442  1.00 0.00 ? 728 ASN M OD1 1  
ATOM 7822   N ND2 . ASN C 3 725 ? -93.167  -28.990 -5.039  1.00 0.00 ? 728 ASN M ND2 1  
ATOM 7823   N N   . ALA C 3 726 ? -96.405  -26.778 -1.658  1.00 0.00 ? 729 ALA M N   1  
ATOM 7824   C CA  . ALA C 3 726 ? -97.492  -26.767 -0.686  1.00 0.00 ? 729 ALA M CA  1  
ATOM 7825   C C   . ALA C 3 726 ? -98.118  -28.112 -0.351  1.00 0.00 ? 729 ALA M C   1  
ATOM 7826   O O   . ALA C 3 726 ? -98.774  -28.240 0.704   1.00 0.00 ? 729 ALA M O   1  
ATOM 7827   C CB  . ALA C 3 726 ? -98.568  -25.811 -1.140  1.00 0.00 ? 729 ALA M CB  1  
ATOM 7828   N N   . SER C 3 727 ? -97.921  -29.080 -1.219  1.00 0.00 ? 730 SER M N   1  
ATOM 7829   C CA  . SER C 3 727 ? -98.492  -30.392 -0.991  1.00 0.00 ? 730 SER M CA  1  
ATOM 7830   C C   . SER C 3 727 ? -97.679  -31.278 -0.051  1.00 0.00 ? 730 SER M C   1  
ATOM 7831   O O   . SER C 3 727 ? -98.181  -32.258 0.511   1.00 0.00 ? 730 SER M O   1  
ATOM 7832   C CB  . SER C 3 727 ? -98.877  -31.094 -2.303  1.00 0.00 ? 730 SER M CB  1  
ATOM 7833   O OG  . SER C 3 727 ? -97.721  -31.581 -2.981  1.00 0.00 ? 730 SER M OG  1  
ATOM 7834   N N   . ALA C 3 728 ? -96.415  -30.943 0.177   1.00 0.00 ? 731 ALA M N   1  
ATOM 7835   C CA  . ALA C 3 728 ? -95.590  -31.764 1.060   1.00 0.00 ? 731 ALA M CA  1  
ATOM 7836   C C   . ALA C 3 728 ? -96.221  -31.751 2.445   1.00 0.00 ? 731 ALA M C   1  
ATOM 7837   O O   . ALA C 3 728 ? -96.539  -32.800 3.008   1.00 0.00 ? 731 ALA M O   1  
ATOM 7838   C CB  . ALA C 3 728 ? -94.114  -31.377 1.128   1.00 0.00 ? 731 ALA M CB  1  
ATOM 7839   N N   . ILE C 3 729 ? -97.964  -32.106 1.739   1.00 0.00 ? 732 ILE M N   1  
ATOM 7840   C CA  . ILE C 3 729 ? -99.085  -31.621 2.508   1.00 0.00 ? 732 ILE M CA  1  
ATOM 7841   C C   . ILE C 3 729 ? -99.667  -32.321 3.723   1.00 0.00 ? 732 ILE M C   1  
ATOM 7842   O O   . ILE C 3 729 ? -99.593  -31.639 4.740   1.00 0.00 ? 732 ILE M O   1  
ATOM 7843   C CB  . ILE C 3 729 ? -100.171 -31.277 1.398   1.00 0.00 ? 732 ILE M CB  1  
ATOM 7844   C CD1 . ILE C 3 729 ? -100.812 -28.941 2.123   1.00 0.00 ? 732 ILE M CD1 1  
ATOM 7845   N N   . PRO C 3 730 ? -100.178 -33.564 3.833   1.00 0.00 ? 733 PRO M N   1  
ATOM 7846   C CA  . PRO C 3 730 ? -100.833 -33.959 5.096   1.00 0.00 ? 733 PRO M CA  1  
ATOM 7847   C C   . PRO C 3 730 ? -99.910  -33.866 6.325   1.00 0.00 ? 733 PRO M C   1  
ATOM 7848   O O   . PRO C 3 730 ? -100.184 -33.194 7.324   1.00 0.00 ? 733 PRO M O   1  
ATOM 7849   C CB  . PRO C 3 730 ? -101.347 -35.352 4.794   1.00 0.00 ? 733 PRO M CB  1  
ATOM 7850   C CG  . PRO C 3 730 ? -100.299 -35.957 3.896   1.00 0.00 ? 733 PRO M CG  1  
ATOM 7851   C CD  . PRO C 3 730 ? -99.840  -34.768 3.067   1.00 0.00 ? 733 PRO M CD  1  
ATOM 7852   N N   . GLU C 3 731 ? -98.697  -34.389 6.145   1.00 0.00 ? 734 GLU M N   1  
ATOM 7853   C CA  . GLU C 3 731 ? -97.631  -34.304 7.127   1.00 0.00 ? 734 GLU M CA  1  
ATOM 7854   C C   . GLU C 3 731 ? -96.914  -32.953 7.226   1.00 0.00 ? 734 GLU M C   1  
ATOM 7855   O O   . GLU C 3 731 ? -96.134  -32.721 8.156   1.00 0.00 ? 734 GLU M O   1  
ATOM 7856   C CB  . GLU C 3 731 ? -96.627  -35.374 6.810   1.00 0.00 ? 734 GLU M CB  1  
ATOM 7857   C CG  . GLU C 3 731 ? -96.519  -36.320 7.981   1.00 0.00 ? 734 GLU M CG  1  
ATOM 7858   C CD  . GLU C 3 731 ? -95.171  -37.005 8.030   1.00 0.00 ? 734 GLU M CD  1  
ATOM 7859   O OE1 . GLU C 3 731 ? -95.115  -38.221 7.906   1.00 0.00 ? 734 GLU M OE1 1  
ATOM 7860   O OE2 . GLU C 3 731 ? -94.183  -36.294 8.212   1.00 0.00 ? 734 GLU M OE2 1  
ATOM 7861   N N   . GLY C 3 732 ? -97.046  -32.082 6.218   1.00 0.00 ? 735 GLY M N   1  
ATOM 7862   C CA  . GLY C 3 732 ? -96.556  -30.700 6.265   1.00 0.00 ? 735 GLY M CA  1  
ATOM 7863   C C   . GLY C 3 732 ? -97.563  -29.684 6.844   1.00 0.00 ? 735 GLY M C   1  
ATOM 7864   O O   . GLY C 3 732 ? -97.196  -28.597 7.293   1.00 0.00 ? 735 GLY M O   1  
ATOM 7865   N N   . GLN C 3 733 ? -98.852  -30.037 6.872   1.00 0.00 ? 736 GLN M N   1  
ATOM 7866   C CA  . GLN C 3 733 ? -99.933  -29.243 7.469   1.00 0.00 ? 736 GLN M CA  1  
ATOM 7867   C C   . GLN C 3 733 ? -100.398 -29.564 8.891   1.00 0.00 ? 736 GLN M C   1  
ATOM 7868   O O   . GLN C 3 733 ? -100.733 -28.653 9.653   1.00 0.00 ? 736 GLN M O   1  
ATOM 7869   C CB  . GLN C 3 733 ? -101.160 -29.313 6.589   1.00 0.00 ? 736 GLN M CB  1  
ATOM 7870   C CG  . GLN C 3 733 ? -101.352 -28.044 5.785   1.00 0.00 ? 736 GLN M CG  1  
ATOM 7871   C CD  . GLN C 3 733 ? -102.628 -28.040 4.956   1.00 0.00 ? 736 GLN M CD  1  
ATOM 7872   O OE1 . GLN C 3 733 ? -103.330 -29.023 4.774   1.00 0.00 ? 736 GLN M OE1 1  
ATOM 7873   N NE2 . GLN C 3 733 ? -103.035 -26.949 4.370   1.00 0.00 ? 736 GLN M NE2 1  
ATOM 7874   N N   . PHE C 3 734 ? -100.503 -30.832 9.311   1.00 0.00 ? 737 PHE M N   1  
ATOM 7875   C CA  . PHE C 3 734 ? -100.812 -31.206 10.706  1.00 0.00 ? 737 PHE M CA  1  
ATOM 7876   C C   . PHE C 3 734 ? -99.571  -30.899 11.561  1.00 0.00 ? 737 PHE M C   1  
ATOM 7877   O O   . PHE C 3 734 ? -98.955  -31.771 12.177  1.00 0.00 ? 737 PHE M O   1  
ATOM 7878   C CB  . PHE C 3 734 ? -101.126 -32.702 10.735  1.00 0.00 ? 737 PHE M CB  1  
ATOM 7879   C CG  . PHE C 3 734 ? -102.530 -33.121 11.142  1.00 0.00 ? 737 PHE M CG  1  
ATOM 7880   C CD1 . PHE C 3 734 ? -102.848 -34.462 11.089  1.00 0.00 ? 737 PHE M CD1 1  
ATOM 7881   C CD2 . PHE C 3 734 ? -103.475 -32.201 11.565  1.00 0.00 ? 737 PHE M CD2 1  
ATOM 7882   C CE1 . PHE C 3 734 ? -104.109 -34.887 11.462  1.00 0.00 ? 737 PHE M CE1 1  
ATOM 7883   C CE2 . PHE C 3 734 ? -104.732 -32.635 11.932  1.00 0.00 ? 737 PHE M CE2 1  
ATOM 7884   C CZ  . PHE C 3 734 ? -105.047 -33.975 11.881  1.00 0.00 ? 737 PHE M CZ  1  
ATOM 7885   N N   . MET C 3 735 ? -99.362  -29.286 11.878  1.00 0.00 ? 738 MET M N   1  
ATOM 7886   C CA  . MET C 3 735 ? -97.906  -29.407 11.733  1.00 0.00 ? 738 MET M CA  1  
ATOM 7887   C C   . MET C 3 735 ? -97.213  -28.509 12.741  1.00 0.00 ? 738 MET M C   1  
ATOM 7888   O O   . MET C 3 735 ? -97.848  -27.858 13.570  1.00 0.00 ? 738 MET M O   1  
ATOM 7889   C CB  . MET C 3 735 ? -97.347  -29.141 10.297  1.00 0.00 ? 738 MET M CB  1  
ATOM 7890   C CG  . MET C 3 735 ? -96.126  -29.986 9.901   1.00 0.00 ? 738 MET M CG  1  
ATOM 7891   S SD  . MET C 3 735 ? -96.582  -31.717 9.501   1.00 0.00 ? 738 MET M SD  1  
ATOM 7892   C CE  . MET C 3 735 ? -95.266  -32.201 8.371   1.00 0.00 ? 738 MET M CE  1  
ATOM 7893   N N   . ASP C 3 736 ? -95.900  -28.498 12.605  1.00 0.00 ? 739 ASP M N   1  
ATOM 7894   C CA  . ASP C 3 736 ? -95.003  -27.753 13.443  1.00 0.00 ? 739 ASP M CA  1  
ATOM 7895   C C   . ASP C 3 736 ? -94.425  -26.558 12.700  1.00 0.00 ? 739 ASP M C   1  
ATOM 7896   O O   . ASP C 3 736 ? -94.115  -26.624 11.511  1.00 0.00 ? 739 ASP M O   1  
ATOM 7897   C CB  . ASP C 3 736 ? -93.899  -28.756 13.818  1.00 0.00 ? 739 ASP M CB  1  
ATOM 7898   C CG  . ASP C 3 736 ? -92.728  -28.208 14.594  1.00 0.00 ? 739 ASP M CG  1  
ATOM 7899   O OD1 . ASP C 3 736 ? -93.068  -27.210 15.382  1.00 0.00 ? 739 ASP M OD1 1  
ATOM 7900   O OD2 . ASP C 3 736 ? -91.612  -28.732 14.532  1.00 0.00 ? 739 ASP M OD2 1  
ATOM 7901   N N   . SER C 3 737 ? -94.202  -25.477 13.422  1.00 0.00 ? 740 SER M N   1  
ATOM 7902   C CA  . SER C 3 737 ? -93.624  -24.256 12.846  1.00 0.00 ? 740 SER M CA  1  
ATOM 7903   C C   . SER C 3 737 ? -92.185  -24.492 12.389  1.00 0.00 ? 740 SER M C   1  
ATOM 7904   O O   . SER C 3 737 ? -91.700  -23.814 11.475  1.00 0.00 ? 740 SER M O   1  
ATOM 7905   C CB  . SER C 3 737 ? -93.693  -23.127 13.857  1.00 0.00 ? 740 SER M CB  1  
ATOM 7906   O OG  . SER C 3 737 ? -93.261  -21.917 13.254  1.00 0.00 ? 740 SER M OG  1  
ATOM 7907   N N   . LYS C 3 738 ? -91.544  -25.497 12.987  1.00 0.00 ? 741 LYS M N   1  
ATOM 7908   C CA  . LYS C 3 738 ? -90.172  -25.841 12.644  1.00 0.00 ? 741 LYS M CA  1  
ATOM 7909   C C   . LYS C 3 738 ? -90.066  -27.019 11.677  1.00 0.00 ? 741 LYS M C   1  
ATOM 7910   O O   . LYS C 3 738 ? -89.603  -26.895 10.532  1.00 0.00 ? 741 LYS M O   1  
ATOM 7911   C CB  . LYS C 3 738 ? -89.216  -26.030 13.818  1.00 0.00 ? 741 LYS M CB  1  
ATOM 7912   C CG  . LYS C 3 738 ? -88.109  -27.049 13.490  1.00 0.00 ? 741 LYS M CG  1  
ATOM 7913   C CD  . LYS C 3 738 ? -86.908  -27.049 14.433  1.00 0.00 ? 741 LYS M CD  1  
ATOM 7914   C CE  . LYS C 3 738 ? -85.932  -28.200 14.168  1.00 0.00 ? 741 LYS M CE  1  
ATOM 7915   N NZ  . LYS C 3 738 ? -85.043  -28.470 15.309  1.00 0.00 ? 741 LYS M NZ  1  
ATOM 7916   N N   . LYS C 3 739 ? -90.451  -28.203 12.147  1.00 0.00 ? 742 LYS M N   1  
ATOM 7917   C CA  . LYS C 3 739 ? -90.388  -29.436 11.379  1.00 0.00 ? 742 LYS M CA  1  
ATOM 7918   C C   . LYS C 3 739 ? -90.903  -29.255 9.964   1.00 0.00 ? 742 LYS M C   1  
ATOM 7919   O O   . LYS C 3 739 ? -90.440  -29.915 9.021   1.00 0.00 ? 742 LYS M O   1  
ATOM 7920   C CB  . LYS C 3 739 ? -91.123  -30.550 12.099  1.00 0.00 ? 742 LYS M CB  1  
ATOM 7921   C CG  . LYS C 3 739 ? -90.921  -31.931 11.516  1.00 0.00 ? 742 LYS M CG  1  
ATOM 7922   C CD  . LYS C 3 739 ? -91.784  -33.010 12.213  1.00 0.00 ? 742 LYS M CD  1  
ATOM 7923   C CE  . LYS C 3 739 ? -91.520  -34.445 11.723  1.00 0.00 ? 742 LYS M CE  1  
ATOM 7924   N NZ  . LYS C 3 739 ? -92.456  -35.449 12.261  1.00 0.00 ? 742 LYS M NZ  1  
ATOM 7925   N N   . ALA C 3 740 ? -91.820  -28.292 9.845   1.00 0.00 ? 743 ALA M N   1  
ATOM 7926   C CA  . ALA C 3 740 ? -92.422  -27.951 8.579   1.00 0.00 ? 743 ALA M CA  1  
ATOM 7927   C C   . ALA C 3 740 ? -91.377  -27.509 7.565   1.00 0.00 ? 743 ALA M C   1  
ATOM 7928   O O   . ALA C 3 740 ? -91.138  -28.243 6.574   1.00 0.00 ? 743 ALA M O   1  
ATOM 7929   C CB  . ALA C 3 740 ? -93.436  -26.859 8.815   1.00 0.00 ? 743 ALA M CB  1  
ATOM 7930   N N   . SER C 3 741 ? -90.769  -26.339 7.842   1.00 0.00 ? 744 SER M N   1  
ATOM 7931   C CA  . SER C 3 741 ? -89.748  -25.760 6.983   1.00 0.00 ? 744 SER M CA  1  
ATOM 7932   C C   . SER C 3 741 ? -88.771  -26.827 6.595   1.00 0.00 ? 744 SER M C   1  
ATOM 7933   O O   . SER C 3 741 ? -88.331  -26.923 5.438   1.00 0.00 ? 744 SER M O   1  
ATOM 7934   C CB  . SER C 3 741 ? -89.073  -24.541 7.594   1.00 0.00 ? 744 SER M CB  1  
ATOM 7935   O OG  . SER C 3 741 ? -90.011  -23.785 8.377   1.00 0.00 ? 744 SER M OG  1  
ATOM 7936   N N   . GLU C 3 742 ? -88.581  -27.739 7.565   1.00 0.00 ? 745 GLU M N   1  
ATOM 7937   C CA  . GLU C 3 742 ? -87.688  -28.844 7.339   1.00 0.00 ? 745 GLU M CA  1  
ATOM 7938   C C   . GLU C 3 742 ? -88.226  -29.607 6.166   1.00 0.00 ? 745 GLU M C   1  
ATOM 7939   O O   . GLU C 3 742 ? -87.666  -29.629 5.025   1.00 0.00 ? 745 GLU M O   1  
ATOM 7940   C CB  . GLU C 3 742 ? -87.704  -29.722 8.604   1.00 0.00 ? 745 GLU M CB  1  
ATOM 7941   C CG  . GLU C 3 742 ? -86.394  -29.749 9.440   1.00 0.00 ? 745 GLU M CG  1  
ATOM 7942   C CD  . GLU C 3 742 ? -85.516  -30.961 9.232   1.00 0.00 ? 745 GLU M CD  1  
ATOM 7943   O OE1 . GLU C 3 742 ? -85.485  -31.620 8.169   1.00 0.00 ? 745 GLU M OE1 1  
ATOM 7944   O OE2 . GLU C 3 742 ? -84.836  -31.237 10.354  1.00 0.00 ? 745 GLU M OE2 1  
ATOM 7945   N N   . LYS C 3 743 ? -89.374  -30.195 6.478   1.00 0.00 ? 746 LYS M N   1  
ATOM 7946   C CA  . LYS C 3 743 ? -90.097  -30.984 5.517   1.00 0.00 ? 746 LYS M CA  1  
ATOM 7947   C C   . LYS C 3 743 ? -90.203  -30.276 4.188   1.00 0.00 ? 746 LYS M C   1  
ATOM 7948   O O   . LYS C 3 743 ? -89.930  -30.878 3.181   1.00 0.00 ? 746 LYS M O   1  
ATOM 7949   C CB  . LYS C 3 743 ? -91.445  -31.396 6.057   1.00 0.00 ? 746 LYS M CB  1  
ATOM 7950   C CG  . LYS C 3 743 ? -91.855  -32.823 5.660   1.00 0.00 ? 746 LYS M CG  1  
ATOM 7951   C CD  . LYS C 3 743 ? -91.422  -33.883 6.691   1.00 0.00 ? 746 LYS M CD  1  
ATOM 7952   C CE  . LYS C 3 743 ? -91.879  -35.319 6.337   1.00 0.00 ? 746 LYS M CE  1  
ATOM 7953   N NZ  . LYS C 3 743 ? -92.291  -36.187 7.478   1.00 0.00 ? 746 LYS M NZ  1  
ATOM 7954   N N   . LEU C 3 744 ? -90.517  -28.965 4.204   1.00 0.00 ? 747 LEU M N   1  
ATOM 7955   C CA  . LEU C 3 744 ? -90.677  -28.262 2.939   1.00 0.00 ? 747 LEU M CA  1  
ATOM 7956   C C   . LEU C 3 744 ? -89.524  -28.364 2.002   1.00 0.00 ? 747 LEU M C   1  
ATOM 7957   O O   . LEU C 3 744 ? -89.653  -28.705 0.828   1.00 0.00 ? 747 LEU M O   1  
ATOM 7958   C CB  . LEU C 3 744 ? -90.997  -26.768 2.962   1.00 0.00 ? 747 LEU M CB  1  
ATOM 7959   C CG  . LEU C 3 744 ? -91.744  -26.360 1.677   1.00 0.00 ? 747 LEU M CG  1  
ATOM 7960   C CD1 . LEU C 3 744 ? -92.691  -25.191 1.934   1.00 0.00 ? 747 LEU M CD1 1  
ATOM 7961   C CD2 . LEU C 3 744 ? -90.825  -26.059 0.478   1.00 0.00 ? 747 LEU M CD2 1  
ATOM 7962   N N   . LEU C 3 745 ? -88.363  -28.045 2.517   1.00 0.00 ? 748 LEU M N   1  
ATOM 7963   C CA  . LEU C 3 745 ? -87.202  -28.062 1.661   1.00 0.00 ? 748 LEU M CA  1  
ATOM 7964   C C   . LEU C 3 745 ? -86.977  -29.383 0.975   1.00 0.00 ? 748 LEU M C   1  
ATOM 7965   O O   . LEU C 3 745 ? -86.071  -29.493 0.153   1.00 0.00 ? 748 LEU M O   1  
ATOM 7966   C CB  . LEU C 3 745 ? -85.960  -27.490 2.300   1.00 0.00 ? 748 LEU M CB  1  
ATOM 7967   C CG  . LEU C 3 745 ? -85.955  -25.968 2.307   1.00 0.00 ? 748 LEU M CG  1  
ATOM 7968   C CD1 . LEU C 3 745 ? -86.256  -25.458 3.716   1.00 0.00 ? 748 LEU M CD1 1  
ATOM 7969   C CD2 . LEU C 3 745 ? -84.613  -25.453 1.813   1.00 0.00 ? 748 LEU M CD2 1  
ATOM 7970   N N   . GLY C 3 746 ? -87.813  -30.357 1.332   1.00 0.00 ? 749 GLY M N   1  
ATOM 7971   C CA  . GLY C 3 746 ? -87.814  -31.666 0.736   1.00 0.00 ? 749 GLY M CA  1  
ATOM 7972   C C   . GLY C 3 746 ? -87.802  -31.484 -0.769  1.00 0.00 ? 749 GLY M C   1  
ATOM 7973   O O   . GLY C 3 746 ? -86.961  -32.083 -1.450  1.00 0.00 ? 749 GLY M O   1  
ATOM 7974   N N   . SER C 3 747 ? -88.703  -30.629 -1.302  1.00 0.00 ? 750 SER M N   1  
ATOM 7975   C CA  . SER C 3 747 ? -88.735  -30.395 -2.739  1.00 0.00 ? 750 SER M CA  1  
ATOM 7976   C C   . SER C 3 747 ? -87.831  -29.247 -3.249  1.00 0.00 ? 750 SER M C   1  
ATOM 7977   O O   . SER C 3 747 ? -87.204  -28.495 -2.484  1.00 0.00 ? 750 SER M O   1  
ATOM 7978   N N   . ILE C 3 748 ? -87.734  -29.151 -4.575  1.00 0.00 ? 751 ILE M N   1  
ATOM 7979   C CA  . ILE C 3 748 ? -86.971  -28.131 -5.249  1.00 0.00 ? 751 ILE M CA  1  
ATOM 7980   C C   . ILE C 3 748 ? -85.675  -28.664 -5.836  1.00 0.00 ? 751 ILE M C   1  
ATOM 7981   O O   . ILE C 3 748 ? -85.070  -29.520 -5.241  1.00 0.00 ? 751 ILE M O   1  
ATOM 7982   N N   . ASP C 3 749 ? -85.264  -28.162 -6.994  1.00 0.00 ? 752 ASP M N   1  
ATOM 7983   C CA  . ASP C 3 749 ? -84.021  -28.626 -7.546  1.00 0.00 ? 752 ASP M CA  1  
ATOM 7984   C C   . ASP C 3 749 ? -82.838  -27.746 -7.025  1.00 0.00 ? 752 ASP M C   1  
ATOM 7985   O O   . ASP C 3 749 ? -81.929  -27.373 -7.770  1.00 0.00 ? 752 ASP M O   1  
ATOM 7986   C CB  . ASP C 3 749 ? -84.124  -29.046 -9.054  1.00 0.00 ? 752 ASP M CB  1  
ATOM 7987   C CG  . ASP C 3 749 ? -83.059  -28.630 -10.066 1.00 0.00 ? 752 ASP M CG  1  
ATOM 7988   O OD1 . ASP C 3 749 ? -81.890  -29.196 -9.875  1.00 0.00 ? 752 ASP M OD1 1  
ATOM 7989   O OD2 . ASP C 3 749 ? -83.273  -27.879 -11.005 1.00 0.00 ? 752 ASP M OD2 1  
ATOM 7990   N N   . VAL C 3 750 ? -82.917  -27.448 -5.694  1.00 0.00 ? 753 VAL M N   1  
ATOM 7991   C CA  . VAL C 3 750 ? -82.026  -26.606 -4.852  1.00 0.00 ? 753 VAL M CA  1  
ATOM 7992   C C   . VAL C 3 750 ? -80.869  -27.288 -4.094  1.00 0.00 ? 753 VAL M C   1  
ATOM 7993   O O   . VAL C 3 750 ? -81.000  -28.419 -3.638  1.00 0.00 ? 753 VAL M O   1  
ATOM 7994   C CB  . VAL C 3 750 ? -82.923  -26.029 -3.772  1.00 0.00 ? 753 VAL M CB  1  
ATOM 7995   C CG1 . VAL C 3 750 ? -83.281  -24.583 -4.097  1.00 0.00 ? 753 VAL M CG1 1  
ATOM 7996   C CG2 . VAL C 3 750 ? -84.183  -26.882 -3.746  1.00 0.00 ? 753 VAL M CG2 1  
ATOM 7997   N N   . ASP C 3 751 ? -79.734  -26.576 -3.880  1.00 0.00 ? 754 ASP M N   1  
ATOM 7998   C CA  . ASP C 3 751 ? -78.588  -27.114 -3.130  1.00 0.00 ? 754 ASP M CA  1  
ATOM 7999   C C   . ASP C 3 751 ? -78.912  -27.346 -1.661  1.00 0.00 ? 754 ASP M C   1  
ATOM 8000   O O   . ASP C 3 751 ? -79.057  -26.414 -0.875  1.00 0.00 ? 754 ASP M O   1  
ATOM 8001   C CB  . ASP C 3 751 ? -77.320  -26.253 -3.230  1.00 0.00 ? 754 ASP M CB  1  
ATOM 8002   C CG  . ASP C 3 751 ? -76.274  -26.940 -4.014  1.00 0.00 ? 754 ASP M CG  1  
ATOM 8003   O OD1 . ASP C 3 751 ? -75.551  -27.767 -3.521  1.00 0.00 ? 754 ASP M OD1 1  
ATOM 8004   O OD2 . ASP C 3 751 ? -76.276  -26.592 -5.294  1.00 0.00 ? 754 ASP M OD2 1  
ATOM 8005   N N   . HIS C 3 752 ? -79.050  -28.613 -1.302  1.00 0.00 ? 755 HIS M N   1  
ATOM 8006   C CA  . HIS C 3 752 ? -79.459  -28.983 0.043   1.00 0.00 ? 755 HIS M CA  1  
ATOM 8007   C C   . HIS C 3 752 ? -78.335  -28.812 1.088   1.00 0.00 ? 755 HIS M C   1  
ATOM 8008   O O   . HIS C 3 752 ? -78.456  -29.167 2.269   1.00 0.00 ? 755 HIS M O   1  
ATOM 8009   C CB  . HIS C 3 752 ? -80.266  -30.326 0.085   1.00 0.00 ? 755 HIS M CB  1  
ATOM 8010   C CG  . HIS C 3 752 ? -81.618  -30.441 -0.644  1.00 0.00 ? 755 HIS M CG  1  
ATOM 8011   N ND1 . HIS C 3 752 ? -81.796  -30.206 -2.015  1.00 0.00 ? 755 HIS M ND1 1  
ATOM 8012   C CD2 . HIS C 3 752 ? -82.833  -30.873 -0.184  1.00 0.00 ? 755 HIS M CD2 1  
ATOM 8013   C CE1 . HIS C 3 752 ? -83.088  -30.399 -2.280  1.00 0.00 ? 755 HIS M CE1 1  
ATOM 8014   N NE2 . HIS C 3 752 ? -83.758  -30.782 -1.220  1.00 0.00 ? 755 HIS M NE2 1  
ATOM 8015   N N   . THR C 3 753 ? -77.286  -28.172 0.624   1.00 0.00 ? 756 THR M N   1  
ATOM 8016   C CA  . THR C 3 753 ? -76.051  -27.826 1.285   1.00 0.00 ? 756 THR M CA  1  
ATOM 8017   C C   . THR C 3 753 ? -76.141  -26.432 1.907   1.00 0.00 ? 756 THR M C   1  
ATOM 8018   O O   . THR C 3 753 ? -76.130  -26.208 3.120   1.00 0.00 ? 756 THR M O   1  
ATOM 8019   C CB  . THR C 3 753 ? -75.185  -27.707 0.049   1.00 0.00 ? 756 THR M CB  1  
ATOM 8020   O OG1 . THR C 3 753 ? -75.349  -28.863 -0.713  1.00 0.00 ? 756 THR M OG1 1  
ATOM 8021   C CG2 . THR C 3 753 ? -73.780  -27.363 0.437   1.00 0.00 ? 756 THR M CG2 1  
ATOM 8022   N N   . GLN C 3 754 ? -76.234  -25.491 0.971   1.00 0.00 ? 757 GLN M N   1  
ATOM 8023   C CA  . GLN C 3 754 ? -76.371  -24.080 1.177   1.00 0.00 ? 757 GLN M CA  1  
ATOM 8024   C C   . GLN C 3 754 ? -77.202  -23.649 2.375   1.00 0.00 ? 757 GLN M C   1  
ATOM 8025   O O   . GLN C 3 754 ? -77.225  -22.480 2.709   1.00 0.00 ? 757 GLN M O   1  
ATOM 8026   C CB  . GLN C 3 754 ? -76.866  -23.341 -0.068  1.00 0.00 ? 757 GLN M CB  1  
ATOM 8027   C CG  . GLN C 3 754 ? -76.175  -23.752 -1.371  1.00 0.00 ? 757 GLN M CG  1  
ATOM 8028   C CD  . GLN C 3 754 ? -74.692  -23.481 -1.362  1.00 0.00 ? 757 GLN M CD  1  
ATOM 8029   O OE1 . GLN C 3 754 ? -74.238  -22.362 -1.678  1.00 0.00 ? 757 GLN M OE1 1  
ATOM 8030   N NE2 . GLN C 3 754 ? -73.960  -24.524 -0.975  1.00 0.00 ? 757 GLN M NE2 1  
ATOM 8031   N N   . TYR C 3 755 ? -77.912  -24.525 3.018   1.00 0.00 ? 758 TYR M N   1  
ATOM 8032   C CA  . TYR C 3 755 ? -78.694  -24.098 4.167   1.00 0.00 ? 758 TYR M CA  1  
ATOM 8033   C C   . TYR C 3 755 ? -78.343  -24.910 5.394   1.00 0.00 ? 758 TYR M C   1  
ATOM 8034   O O   . TYR C 3 755 ? -77.515  -25.829 5.352   1.00 0.00 ? 758 TYR M O   1  
ATOM 8035   C CB  . TYR C 3 755 ? -80.221  -24.095 3.949   1.00 0.00 ? 758 TYR M CB  1  
ATOM 8036   C CG  . TYR C 3 755 ? -80.777  -25.356 3.283   1.00 0.00 ? 758 TYR M CG  1  
ATOM 8037   C CD1 . TYR C 3 755 ? -80.570  -25.607 1.926   1.00 0.00 ? 758 TYR M CD1 1  
ATOM 8038   C CD2 . TYR C 3 755 ? -81.556  -26.247 4.019   1.00 0.00 ? 758 TYR M CD2 1  
ATOM 8039   C CE1 . TYR C 3 755 ? -81.088  -26.742 1.302   1.00 0.00 ? 758 TYR M CE1 1  
ATOM 8040   C CE2 . TYR C 3 755 ? -82.087  -27.395 3.430   1.00 0.00 ? 758 TYR M CE2 1  
ATOM 8041   C CZ  . TYR C 3 755 ? -81.847  -27.632 2.077   1.00 0.00 ? 758 TYR M CZ  1  
ATOM 8042   O OH  . TYR C 3 755 ? -82.382  -28.745 1.524   1.00 0.00 ? 758 TYR M OH  1  
ATOM 8043   N N   . ARG C 3 756 ? -78.961  -24.528 6.498   1.00 0.00 ? 759 ARG M N   1  
ATOM 8044   C CA  . ARG C 3 756 ? -78.690  -25.269 7.707   1.00 0.00 ? 759 ARG M CA  1  
ATOM 8045   C C   . ARG C 3 756 ? -79.697  -24.819 8.706   1.00 0.00 ? 759 ARG M C   1  
ATOM 8046   O O   . ARG C 3 756 ? -80.108  -23.657 8.789   1.00 0.00 ? 759 ARG M O   1  
ATOM 8047   C CB  . ARG C 3 756 ? -77.241  -25.186 8.191   1.00 0.00 ? 759 ARG M CB  1  
ATOM 8048   N N   . PHE C 3 757 ? -80.214  -25.822 9.382   1.00 0.00 ? 760 PHE M N   1  
ATOM 8049   C CA  . PHE C 3 757 ? -81.274  -25.566 10.322  1.00 0.00 ? 760 PHE M CA  1  
ATOM 8050   C C   . PHE C 3 757 ? -80.774  -25.570 11.710  1.00 0.00 ? 760 PHE M C   1  
ATOM 8051   O O   . PHE C 3 757 ? -79.758  -26.166 12.002  1.00 0.00 ? 760 PHE M O   1  
ATOM 8052   C CB  . PHE C 3 757 ? -82.275  -26.689 10.325  1.00 0.00 ? 760 PHE M CB  1  
ATOM 8053   C CG  . PHE C 3 757 ? -82.638  -27.217 8.971   1.00 0.00 ? 760 PHE M CG  1  
ATOM 8054   C CD1 . PHE C 3 757 ? -81.777  -27.968 8.157   1.00 0.00 ? 760 PHE M CD1 1  
ATOM 8055   C CD2 . PHE C 3 757 ? -83.938  -26.986 8.542   1.00 0.00 ? 760 PHE M CD2 1  
ATOM 8056   C CE1 . PHE C 3 757 ? -82.215  -28.451 6.916   1.00 0.00 ? 760 PHE M CE1 1  
ATOM 8057   C CE2 . PHE C 3 757 ? -84.375  -27.458 7.298   1.00 0.00 ? 760 PHE M CE2 1  
ATOM 8058   C CZ  . PHE C 3 757 ? -83.515  -28.206 6.485   1.00 0.00 ? 760 PHE M CZ  1  
ATOM 8059   N N   . GLY C 3 758 ? -81.601  -24.986 12.577  1.00 0.00 ? 761 GLY M N   1  
ATOM 8060   C CA  . GLY C 3 758 ? -81.299  -24.926 13.979  1.00 0.00 ? 761 GLY M CA  1  
ATOM 8061   C C   . GLY C 3 758 ? -82.508  -24.465 14.733  1.00 0.00 ? 761 GLY M C   1  
ATOM 8062   O O   . GLY C 3 758 ? -83.426  -23.887 14.157  1.00 0.00 ? 761 GLY M O   1  
ATOM 8063   N N   . HIS C 3 759 ? -82.475  -24.711 16.023  1.00 0.00 ? 762 HIS M N   1  
ATOM 8064   C CA  . HIS C 3 759 ? -83.531  -24.391 16.976  1.00 0.00 ? 762 HIS M CA  1  
ATOM 8065   C C   . HIS C 3 759 ? -84.477  -23.237 16.736  1.00 0.00 ? 762 HIS M C   1  
ATOM 8066   O O   . HIS C 3 759 ? -85.630  -23.331 17.134  1.00 0.00 ? 762 HIS M O   1  
ATOM 8067   C CB  . HIS C 3 759 ? -83.193  -24.630 18.468  1.00 0.00 ? 762 HIS M CB  1  
ATOM 8068   C CG  . HIS C 3 759 ? -81.979  -25.460 18.694  1.00 0.00 ? 762 HIS M CG  1  
ATOM 8069   N ND1 . HIS C 3 759 ? -81.204  -25.293 19.837  1.00 0.00 ? 762 HIS M ND1 1  
ATOM 8070   C CD2 . HIS C 3 759 ? -81.409  -26.435 17.933  1.00 0.00 ? 762 HIS M CD2 1  
ATOM 8071   C CE1 . HIS C 3 759 ? -80.210  -26.162 19.757  1.00 0.00 ? 762 HIS M CE1 1  
ATOM 8072   N NE2 . HIS C 3 759 ? -80.290  -26.860 18.622  1.00 0.00 ? 762 HIS M NE2 1  
ATOM 8073   N N   . THR C 3 760 ? -84.049  -22.151 16.108  1.00 0.00 ? 763 THR M N   1  
ATOM 8074   C CA  . THR C 3 760 ? -85.019  -21.090 15.914  1.00 0.00 ? 763 THR M CA  1  
ATOM 8075   C C   . THR C 3 760 ? -85.108  -20.655 14.475  1.00 0.00 ? 763 THR M C   1  
ATOM 8076   O O   . THR C 3 760 ? -86.015  -19.890 14.086  1.00 0.00 ? 763 THR M O   1  
ATOM 8077   C CB  . THR C 3 760 ? -84.760  -19.879 16.809  1.00 0.00 ? 763 THR M CB  1  
ATOM 8078   O OG1 . THR C 3 760 ? -84.357  -20.332 18.076  1.00 0.00 ? 763 THR M OG1 1  
ATOM 8079   C CG2 . THR C 3 760 ? -86.034  -19.018 16.880  1.00 0.00 ? 763 THR M CG2 1  
ATOM 8080   N N   . LYS C 3 761 ? -84.143  -21.125 13.682  1.00 0.00 ? 764 LYS M N   1  
ATOM 8081   C CA  . LYS C 3 761 ? -84.169  -20.709 12.318  1.00 0.00 ? 764 LYS M CA  1  
ATOM 8082   C C   . LYS C 3 761 ? -83.242  -21.425 11.400  1.00 0.00 ? 764 LYS M C   1  
ATOM 8083   O O   . LYS C 3 761 ? -82.401  -22.201 11.805  1.00 0.00 ? 764 LYS M O   1  
ATOM 8084   C CB  . LYS C 3 761 ? -84.011  -19.214 12.223  1.00 0.00 ? 764 LYS M CB  1  
ATOM 8085   C CG  . LYS C 3 761 ? -82.860  -18.650 13.030  1.00 0.00 ? 764 LYS M CG  1  
ATOM 8086   C CD  . LYS C 3 761 ? -83.071  -17.192 13.390  1.00 0.00 ? 764 LYS M CD  1  
ATOM 8087   C CE  . LYS C 3 761 ? -82.302  -16.764 14.614  1.00 0.00 ? 764 LYS M CE  1  
ATOM 8088   N NZ  . LYS C 3 761 ? -82.514  -15.337 14.922  1.00 0.00 ? 764 LYS M NZ  1  
ATOM 8089   N N   . VAL C 3 762 ? -83.415  -21.181 10.122  1.00 0.00 ? 765 VAL M N   1  
ATOM 8090   C CA  . VAL C 3 762 ? -82.603  -21.808 9.125   1.00 0.00 ? 765 VAL M CA  1  
ATOM 8091   C C   . VAL C 3 762 ? -81.546  -20.840 8.753   1.00 0.00 ? 765 VAL M C   1  
ATOM 8092   O O   . VAL C 3 762 ? -81.726  -19.628 8.784   1.00 0.00 ? 765 VAL M O   1  
ATOM 8093   C CB  . VAL C 3 762 ? -83.326  -22.139 7.813   1.00 0.00 ? 765 VAL M CB  1  
ATOM 8094   C CG1 . VAL C 3 762 ? -82.353  -22.662 6.762   1.00 0.00 ? 765 VAL M CG1 1  
ATOM 8095   C CG2 . VAL C 3 762 ? -84.372  -23.201 8.018   1.00 0.00 ? 765 VAL M CG2 1  
ATOM 8096   N N   . PHE C 3 763 ? -80.458  -21.405 8.340   1.00 0.00 ? 766 PHE M N   1  
ATOM 8097   C CA  . PHE C 3 763 ? -79.398  -20.614 7.901   1.00 0.00 ? 766 PHE M CA  1  
ATOM 8098   C C   . PHE C 3 763 ? -79.268  -20.876 6.452   1.00 0.00 ? 766 PHE M C   1  
ATOM 8099   O O   . PHE C 3 763 ? -79.482  -22.028 6.027   1.00 0.00 ? 766 PHE M O   1  
ATOM 8100   C CB  . PHE C 3 763 ? -78.133  -20.814 8.715   1.00 0.00 ? 766 PHE M CB  1  
ATOM 8101   C CG  . PHE C 3 763 ? -78.260  -20.155 10.088  1.00 0.00 ? 766 PHE M CG  1  
ATOM 8102   C CD1 . PHE C 3 763 ? -79.162  -20.597 11.055  1.00 0.00 ? 766 PHE M CD1 1  
ATOM 8103   C CD2 . PHE C 3 763 ? -77.442  -19.080 10.430  1.00 0.00 ? 766 PHE M CD2 1  
ATOM 8104   C CE1 . PHE C 3 763 ? -79.250  -20.003 12.318  1.00 0.00 ? 766 PHE M CE1 1  
ATOM 8105   C CE2 . PHE C 3 763 ? -77.506  -18.468 11.680  1.00 0.00 ? 766 PHE M CE2 1  
ATOM 8106   C CZ  . PHE C 3 763 ? -78.404  -18.933 12.633  1.00 0.00 ? 766 PHE M CZ  1  
ATOM 8107   N N   . PHE C 3 764 ? -78.953  -19.790 5.744   1.00 0.00 ? 767 PHE M N   1  
ATOM 8108   C CA  . PHE C 3 764 ? -78.870  -19.841 4.295   1.00 0.00 ? 767 PHE M CA  1  
ATOM 8109   C C   . PHE C 3 764 ? -77.694  -19.060 3.748   1.00 0.00 ? 767 PHE M C   1  
ATOM 8110   O O   . PHE C 3 764 ? -77.387  -18.010 4.257   1.00 0.00 ? 767 PHE M O   1  
ATOM 8111   C CB  . PHE C 3 764 ? -80.173  -19.101 3.819   1.00 0.00 ? 767 PHE M CB  1  
ATOM 8112   C CG  . PHE C 3 764 ? -81.472  -19.930 3.732   1.00 0.00 ? 767 PHE M CG  1  
ATOM 8113   C CD1 . PHE C 3 764 ? -81.578  -20.934 2.770   1.00 0.00 ? 767 PHE M CD1 1  
ATOM 8114   C CD2 . PHE C 3 764 ? -82.587  -19.708 4.530   1.00 0.00 ? 767 PHE M CD2 1  
ATOM 8115   C CE1 . PHE C 3 764 ? -82.726  -21.695 2.582   1.00 0.00 ? 767 PHE M CE1 1  
ATOM 8116   C CE2 . PHE C 3 764 ? -83.752  -20.484 4.409   1.00 0.00 ? 767 PHE M CE2 1  
ATOM 8117   C CZ  . PHE C 3 764 ? -83.815  -21.482 3.434   1.00 0.00 ? 767 PHE M CZ  1  
ATOM 8118   N N   . LYS C 3 765 ? -77.056  -19.507 2.683   1.00 0.00 ? 768 LYS M N   1  
ATOM 8119   C CA  . LYS C 3 765 ? -75.987  -18.787 2.046   1.00 0.00 ? 768 LYS M CA  1  
ATOM 8120   C C   . LYS C 3 765 ? -76.634  -17.698 1.205   1.00 0.00 ? 768 LYS M C   1  
ATOM 8121   O O   . LYS C 3 765 ? -77.841  -17.452 1.316   1.00 0.00 ? 768 LYS M O   1  
ATOM 8122   C CB  . LYS C 3 765 ? -75.200  -19.615 1.006   1.00 0.00 ? 768 LYS M CB  1  
ATOM 8123   C CG  . LYS C 3 765 ? -74.347  -20.741 1.559   1.00 0.00 ? 768 LYS M CG  1  
ATOM 8124   C CD  . LYS C 3 765 ? -72.881  -20.487 1.496   1.00 0.00 ? 768 LYS M CD  1  
ATOM 8125   C CE  . LYS C 3 765 ? -72.153  -20.756 2.813   1.00 0.00 ? 768 LYS M CE  1  
ATOM 8126   N NZ  . LYS C 3 765 ? -70.717  -20.415 2.730   1.00 0.00 ? 768 LYS M NZ  1  
ATOM 8127   N N   . ALA C 3 766 ? -75.823  -17.087 0.343   1.00 0.00 ? 769 ALA M N   1  
ATOM 8128   C CA  . ALA C 3 766 ? -76.272  -16.044 -0.537  1.00 0.00 ? 769 ALA M CA  1  
ATOM 8129   C C   . ALA C 3 766 ? -77.026  -16.554 -1.742  1.00 0.00 ? 769 ALA M C   1  
ATOM 8130   O O   . ALA C 3 766 ? -76.999  -17.741 -2.033  1.00 0.00 ? 769 ALA M O   1  
ATOM 8131   C CB  . ALA C 3 766 ? -75.073  -15.253 -1.053  1.00 0.00 ? 769 ALA M CB  1  
ATOM 8132   N N   . GLY C 3 767 ? -77.680  -15.584 -2.389  1.00 0.00 ? 770 GLY M N   1  
ATOM 8133   C CA  . GLY C 3 767 ? -78.446  -15.760 -3.618  1.00 0.00 ? 770 GLY M CA  1  
ATOM 8134   C C   . GLY C 3 767 ? -79.335  -16.962 -3.593  1.00 0.00 ? 770 GLY M C   1  
ATOM 8135   O O   . GLY C 3 767 ? -79.802  -17.420 -4.606  1.00 0.00 ? 770 GLY M O   1  
ATOM 8136   N N   . LEU C 3 768 ? -79.607  -17.454 -2.416  1.00 0.00 ? 771 LEU M N   1  
ATOM 8137   C CA  . LEU C 3 768 ? -80.427  -18.612 -2.314  1.00 0.00 ? 771 LEU M CA  1  
ATOM 8138   C C   . LEU C 3 768 ? -81.849  -18.219 -2.149  1.00 0.00 ? 771 LEU M C   1  
ATOM 8139   O O   . LEU C 3 768 ? -82.732  -18.549 -2.957  1.00 0.00 ? 771 LEU M O   1  
ATOM 8140   C CB  . LEU C 3 768 ? -80.034  -19.487 -1.133  1.00 0.00 ? 771 LEU M CB  1  
ATOM 8141   C CG  . LEU C 3 768 ? -80.692  -20.842 -1.358  1.00 0.00 ? 771 LEU M CG  1  
ATOM 8142   C CD1 . LEU C 3 768 ? -79.821  -21.717 -2.256  1.00 0.00 ? 771 LEU M CD1 1  
ATOM 8143   C CD2 . LEU C 3 768 ? -81.265  -21.580 -0.139  1.00 0.00 ? 771 LEU M CD2 1  
ATOM 8144   N N   . LEU C 3 769 ? -82.010  -17.461 -1.066  1.00 0.00 ? 772 LEU M N   1  
ATOM 8145   C CA  . LEU C 3 769 ? -83.266  -16.890 -0.744  1.00 0.00 ? 772 LEU M CA  1  
ATOM 8146   C C   . LEU C 3 769 ? -83.714  -16.177 -2.013  1.00 0.00 ? 772 LEU M C   1  
ATOM 8147   O O   . LEU C 3 769 ? -84.835  -16.236 -2.451  1.00 0.00 ? 772 LEU M O   1  
ATOM 8148   C CB  . LEU C 3 769 ? -83.103  -15.953 0.405   1.00 0.00 ? 772 LEU M CB  1  
ATOM 8149   C CG  . LEU C 3 769 ? -83.745  -16.521 1.686   1.00 0.00 ? 772 LEU M CG  1  
ATOM 8150   C CD1 . LEU C 3 769 ? -83.293  -17.941 1.841   1.00 0.00 ? 772 LEU M CD1 1  
ATOM 8151   C CD2 . LEU C 3 769 ? -83.334  -15.701 2.921   1.00 0.00 ? 772 LEU M CD2 1  
ATOM 8152   N N   . GLY C 3 770 ? -82.743  -15.688 -2.747  1.00 0.00 ? 773 GLY M N   1  
ATOM 8153   C CA  . GLY C 3 770 ? -83.007  -15.061 -3.999  1.00 0.00 ? 773 GLY M CA  1  
ATOM 8154   C C   . GLY C 3 770 ? -83.589  -16.087 -4.926  1.00 0.00 ? 773 GLY M C   1  
ATOM 8155   O O   . GLY C 3 770 ? -84.529  -15.876 -5.659  1.00 0.00 ? 773 GLY M O   1  
ATOM 8156   N N   . LEU C 3 771 ? -83.029  -17.265 -4.867  1.00 0.00 ? 774 LEU M N   1  
ATOM 8157   C CA  . LEU C 3 771 ? -83.528  -18.335 -5.725  1.00 0.00 ? 774 LEU M CA  1  
ATOM 8158   C C   . LEU C 3 771 ? -84.925  -18.701 -5.358  1.00 0.00 ? 774 LEU M C   1  
ATOM 8159   O O   . LEU C 3 771 ? -85.765  -18.842 -6.206  1.00 0.00 ? 774 LEU M O   1  
ATOM 8160   C CB  . LEU C 3 771 ? -82.761  -19.635 -5.580  1.00 0.00 ? 774 LEU M CB  1  
ATOM 8161   C CG  . LEU C 3 771 ? -82.462  -20.181 -6.922  1.00 0.00 ? 774 LEU M CG  1  
ATOM 8162   C CD1 . LEU C 3 771 ? -81.177  -19.561 -7.444  1.00 0.00 ? 774 LEU M CD1 1  
ATOM 8163   C CD2 . LEU C 3 771 ? -82.389  -21.697 -6.837  1.00 0.00 ? 774 LEU M CD2 1  
ATOM 8164   N N   . LEU C 3 772 ? -85.133  -18.870 -4.056  1.00 0.00 ? 775 LEU M N   1  
ATOM 8165   C CA  . LEU C 3 772 ? -86.450  -19.186 -3.550  1.00 0.00 ? 775 LEU M CA  1  
ATOM 8166   C C   . LEU C 3 772 ? -87.561  -18.319 -4.132  1.00 0.00 ? 775 LEU M C   1  
ATOM 8167   O O   . LEU C 3 772 ? -88.387  -18.776 -4.918  1.00 0.00 ? 775 LEU M O   1  
ATOM 8168   C CB  . LEU C 3 772 ? -86.566  -19.311 -2.028  1.00 0.00 ? 775 LEU M CB  1  
ATOM 8169   C CG  . LEU C 3 772 ? -86.308  -20.767 -1.641  1.00 0.00 ? 775 LEU M CG  1  
ATOM 8170   C CD1 . LEU C 3 772 ? -85.178  -21.284 -2.472  1.00 0.00 ? 775 LEU M CD1 1  
ATOM 8171   C CD2 . LEU C 3 772 ? -86.003  -20.970 -0.164  1.00 0.00 ? 775 LEU M CD2 1  
ATOM 8172   N N   . GLU C 3 773 ? -87.490  -17.059 -3.810  1.00 0.00 ? 776 GLU M N   1  
ATOM 8173   C CA  . GLU C 3 773 ? -88.382  -16.046 -4.277  1.00 0.00 ? 776 GLU M CA  1  
ATOM 8174   C C   . GLU C 3 773 ? -88.775  -16.192 -5.734  1.00 0.00 ? 776 GLU M C   1  
ATOM 8175   O O   . GLU C 3 773 ? -89.937  -16.141 -6.096  1.00 0.00 ? 776 GLU M O   1  
ATOM 8176   C CB  . GLU C 3 773 ? -87.613  -14.737 -4.147  1.00 0.00 ? 776 GLU M CB  1  
ATOM 8177   C CG  . GLU C 3 773 ? -87.725  -14.179 -2.727  1.00 0.00 ? 776 GLU M CG  1  
ATOM 8178   C CD  . GLU C 3 773 ? -89.148  -14.012 -2.289  1.00 0.00 ? 776 GLU M CD  1  
ATOM 8179   O OE1 . GLU C 3 773 ? -89.921  -13.179 -2.709  1.00 0.00 ? 776 GLU M OE1 1  
ATOM 8180   O OE2 . GLU C 3 773 ? -89.427  -14.727 -1.247  1.00 0.00 ? 776 GLU M OE2 1  
ATOM 8181   N N   . GLU C 3 774 ? -87.715  -16.389 -6.554  1.00 0.00 ? 777 GLU M N   1  
ATOM 8182   C CA  . GLU C 3 774 ? -87.927  -16.494 -7.975  1.00 0.00 ? 777 GLU M CA  1  
ATOM 8183   C C   . GLU C 3 774 ? -88.955  -17.551 -8.297  1.00 0.00 ? 777 GLU M C   1  
ATOM 8184   O O   . GLU C 3 774 ? -89.937  -17.318 -9.010  1.00 0.00 ? 777 GLU M O   1  
ATOM 8185   C CB  . GLU C 3 774 ? -86.612  -16.658 -8.712  1.00 0.00 ? 777 GLU M CB  1  
ATOM 8186   C CG  . GLU C 3 774 ? -86.748  -17.295 -10.091 1.00 0.00 ? 777 GLU M CG  1  
ATOM 8187   C CD  . GLU C 3 774 ? -85.393  -17.448 -10.753 1.00 0.00 ? 777 GLU M CD  1  
ATOM 8188   O OE1 . GLU C 3 774 ? -84.563  -18.288 -10.385 1.00 0.00 ? 777 GLU M OE1 1  
ATOM 8189   O OE2 . GLU C 3 774 ? -85.179  -16.584 -11.715 1.00 0.00 ? 777 GLU M OE2 1  
ATOM 8190   N N   . MET C 3 775 ? -88.743  -18.717 -7.723  1.00 0.00 ? 778 MET M N   1  
ATOM 8191   C CA  . MET C 3 775 ? -89.640  -19.824 -7.895  1.00 0.00 ? 778 MET M CA  1  
ATOM 8192   C C   . MET C 3 775 ? -91.004  -19.362 -7.453  1.00 0.00 ? 778 MET M C   1  
ATOM 8193   O O   . MET C 3 775 ? -92.031  -19.580 -8.070  1.00 0.00 ? 778 MET M O   1  
ATOM 8194   C CB  . MET C 3 775 ? -89.208  -20.969 -6.966  1.00 0.00 ? 778 MET M CB  1  
ATOM 8195   C CG  . MET C 3 775 ? -87.893  -21.574 -7.447  1.00 0.00 ? 778 MET M CG  1  
ATOM 8196   S SD  . MET C 3 775 ? -87.324  -22.889 -6.389  1.00 0.00 ? 778 MET M SD  1  
ATOM 8197   C CE  . MET C 3 775 ? -85.786  -23.252 -7.266  1.00 0.00 ? 778 MET M CE  1  
ATOM 8198   N N   . ARG C 3 776 ? -90.977  -18.688 -6.362  1.00 0.00 ? 779 ARG M N   1  
ATOM 8199   C CA  . ARG C 3 776 ? -92.164  -18.179 -5.791  1.00 0.00 ? 779 ARG M CA  1  
ATOM 8200   C C   . ARG C 3 776 ? -92.834  -17.267 -6.758  1.00 0.00 ? 779 ARG M C   1  
ATOM 8201   O O   . ARG C 3 776 ? -94.031  -17.429 -7.031  1.00 0.00 ? 779 ARG M O   1  
ATOM 8202   C CB  . ARG C 3 776 ? -91.857  -17.464 -4.490  1.00 0.00 ? 779 ARG M CB  1  
ATOM 8203   C CG  . ARG C 3 776 ? -93.110  -16.857 -3.955  1.00 0.00 ? 779 ARG M CG  1  
ATOM 8204   C CD  . ARG C 3 776 ? -92.836  -15.661 -3.103  1.00 0.00 ? 779 ARG M CD  1  
ATOM 8205   N NE  . ARG C 3 776 ? -93.787  -15.699 -2.004  1.00 0.00 ? 779 ARG M NE  1  
ATOM 8206   C CZ  . ARG C 3 776 ? -94.577  -14.658 -1.724  1.00 0.00 ? 779 ARG M CZ  1  
ATOM 8207   N NH1 . ARG C 3 776 ? -94.579  -13.544 -2.424  1.00 0.00 ? 779 ARG M NH1 1  
ATOM 8208   N NH2 . ARG C 3 776 ? -95.411  -14.750 -0.699  1.00 0.00 ? 779 ARG M NH2 1  
ATOM 8209   N N   . ASP C 3 777 ? -91.318  -15.038 -7.588  1.00 0.00 ? 780 ASP M N   1  
ATOM 8210   C CA  . ASP C 3 777 ? -92.536  -15.402 -8.280  1.00 0.00 ? 780 ASP M CA  1  
ATOM 8211   C C   . ASP C 3 777 ? -92.320  -16.653 -9.100  1.00 0.00 ? 780 ASP M C   1  
ATOM 8212   O O   . ASP C 3 777 ? -93.007  -17.631 -8.930  1.00 0.00 ? 780 ASP M O   1  
ATOM 8213   C CB  . ASP C 3 777 ? -93.166  -14.250 -9.119  1.00 0.00 ? 780 ASP M CB  1  
ATOM 8214   C CG  . ASP C 3 777 ? -94.182  -13.453 -8.336  1.00 0.00 ? 780 ASP M CG  1  
ATOM 8215   O OD1 . ASP C 3 777 ? -94.426  -13.951 -7.145  1.00 0.00 ? 780 ASP M OD1 1  
ATOM 8216   O OD2 . ASP C 3 777 ? -94.715  -12.447 -8.755  1.00 0.00 ? 780 ASP M OD2 1  
ATOM 8217   N N   . ASP C 3 778 ? -91.296  -16.636 -9.957  1.00 0.00 ? 781 ASP M N   1  
ATOM 8218   C CA  . ASP C 3 778 ? -91.013  -17.821 -10.732 1.00 0.00 ? 781 ASP M CA  1  
ATOM 8219   C C   . ASP C 3 778 ? -90.797  -19.010 -9.821  1.00 0.00 ? 781 ASP M C   1  
ATOM 8220   O O   . ASP C 3 778 ? -91.141  -20.134 -10.130 1.00 0.00 ? 781 ASP M O   1  
ATOM 8221   C CB  . ASP C 3 778 ? -89.747  -17.648 -11.572 1.00 0.00 ? 781 ASP M CB  1  
ATOM 8222   C CG  . ASP C 3 778 ? -89.796  -16.533 -12.620 1.00 0.00 ? 781 ASP M CG  1  
ATOM 8223   O OD1 . ASP C 3 778 ? -91.023  -16.104 -12.840 1.00 0.00 ? 781 ASP M OD1 1  
ATOM 8224   O OD2 . ASP C 3 778 ? -88.782  -16.062 -13.166 1.00 0.00 ? 781 ASP M OD2 1  
ATOM 8225   N N   . LYS C 3 779 ? -90.190  -18.769 -8.689  1.00 0.00 ? 782 LYS M N   1  
ATOM 8226   C CA  . LYS C 3 779 ? -89.851  -19.884 -7.877  1.00 0.00 ? 782 LYS M CA  1  
ATOM 8227   C C   . LYS C 3 779 ? -90.990  -20.579 -7.221  1.00 0.00 ? 782 LYS M C   1  
ATOM 8228   O O   . LYS C 3 779 ? -90.867  -21.671 -6.676  1.00 0.00 ? 782 LYS M O   1  
ATOM 8229   C CB  . LYS C 3 779 ? -88.525  -19.797 -7.122  1.00 0.00 ? 782 LYS M CB  1  
ATOM 8230   C CG  . LYS C 3 779 ? -87.358  -19.945 -8.108  1.00 0.00 ? 782 LYS M CG  1  
ATOM 8231   C CD  . LYS C 3 779 ? -86.027  -20.234 -7.443  1.00 0.00 ? 782 LYS M CD  1  
ATOM 8232   C CE  . LYS C 3 779 ? -85.259  -21.384 -8.084  1.00 0.00 ? 782 LYS M CE  1  
ATOM 8233   N NZ  . LYS C 3 779 ? -83.853  -21.064 -8.369  1.00 0.00 ? 782 LYS M NZ  1  
ATOM 8234   N N   . LEU C 3 780 ? -92.137  -19.970 -7.305  1.00 0.00 ? 783 LEU M N   1  
ATOM 8235   C CA  . LEU C 3 780 ? -93.259  -20.631 -6.680  1.00 0.00 ? 783 LEU M CA  1  
ATOM 8236   C C   . LEU C 3 780 ? -94.069  -21.393 -7.677  1.00 0.00 ? 783 LEU M C   1  
ATOM 8237   O O   . LEU C 3 780 ? -94.705  -22.370 -7.300  1.00 0.00 ? 783 LEU M O   1  
ATOM 8238   C CB  . LEU C 3 780 ? -94.061  -19.810 -5.689  1.00 0.00 ? 783 LEU M CB  1  
ATOM 8239   C CG  . LEU C 3 780 ? -93.250  -19.604 -4.419  1.00 0.00 ? 783 LEU M CG  1  
ATOM 8240   C CD1 . LEU C 3 780 ? -91.946  -18.889 -4.749  1.00 0.00 ? 783 LEU M CD1 1  
ATOM 8241   C CD2 . LEU C 3 780 ? -94.055  -18.825 -3.380  1.00 0.00 ? 783 LEU M CD2 1  
ATOM 8242   N N   . ALA C 3 781 ? -94.005  -20.919 -8.937  1.00 0.00 ? 784 ALA M N   1  
ATOM 8243   C CA  . ALA C 3 781 ? -94.694  -21.585 -10.006 1.00 0.00 ? 784 ALA M CA  1  
ATOM 8244   C C   . ALA C 3 781 ? -94.151  -22.995 -9.900  1.00 0.00 ? 784 ALA M C   1  
ATOM 8245   O O   . ALA C 3 781 ? -94.919  -23.924 -9.712  1.00 0.00 ? 784 ALA M O   1  
ATOM 8246   C CB  . ALA C 3 781 ? -94.414  -20.921 -11.317 1.00 0.00 ? 784 ALA M CB  1  
ATOM 8247   N N   . GLU C 3 782 ? -92.818  -23.058 -9.812  1.00 0.00 ? 785 GLU M N   1  
ATOM 8248   C CA  . GLU C 3 782 ? -92.074  -24.293 -9.626  1.00 0.00 ? 785 GLU M CA  1  
ATOM 8249   C C   . GLU C 3 782 ? -92.765  -24.981 -8.437  1.00 0.00 ? 785 GLU M C   1  
ATOM 8250   O O   . GLU C 3 782 ? -93.537  -25.890 -8.586  1.00 0.00 ? 785 GLU M O   1  
ATOM 8251   C CB  . GLU C 3 782 ? -90.570  -24.002 -9.276  1.00 0.00 ? 785 GLU M CB  1  
ATOM 8252   C CG  . GLU C 3 782 ? -89.497  -24.599 -10.235 1.00 0.00 ? 785 GLU M CG  1  
ATOM 8253   C CD  . GLU C 3 782 ? -89.676  -24.169 -11.675 1.00 0.00 ? 785 GLU M CD  1  
ATOM 8254   O OE1 . GLU C 3 782 ? -90.680  -23.609 -12.113 1.00 0.00 ? 785 GLU M OE1 1  
ATOM 8255   O OE2 . GLU C 3 782 ? -88.608  -24.425 -12.399 1.00 0.00 ? 785 GLU M OE2 1  
ATOM 8256   N N   . ILE C 3 783 ? -92.571  -24.439 -7.257  1.00 0.00 ? 786 ILE M N   1  
ATOM 8257   C CA  . ILE C 3 783 ? -93.123  -24.960 -6.028  1.00 0.00 ? 786 ILE M CA  1  
ATOM 8258   C C   . ILE C 3 783 ? -94.570  -25.309 -6.062  1.00 0.00 ? 786 ILE M C   1  
ATOM 8259   O O   . ILE C 3 783 ? -95.008  -26.292 -5.498  1.00 0.00 ? 786 ILE M O   1  
ATOM 8260   C CB  . ILE C 3 783 ? -93.013  -23.938 -4.960  1.00 0.00 ? 786 ILE M CB  1  
ATOM 8261   C CG1 . ILE C 3 783 ? -91.593  -23.921 -4.427  1.00 0.00 ? 786 ILE M CG1 1  
ATOM 8262   C CG2 . ILE C 3 783 ? -93.995  -24.337 -3.884  1.00 0.00 ? 786 ILE M CG2 1  
ATOM 8263   C CD1 . ILE C 3 783 ? -91.486  -23.176 -3.106  1.00 0.00 ? 786 ILE M CD1 1  
ATOM 8264   N N   . ILE C 3 784 ? -95.364  -24.456 -6.663  1.00 0.00 ? 787 ILE M N   1  
ATOM 8265   C CA  . ILE C 3 784 ? -96.778  -24.741 -6.656  1.00 0.00 ? 787 ILE M CA  1  
ATOM 8266   C C   . ILE C 3 784 ? -97.163  -25.806 -7.637  1.00 0.00 ? 787 ILE M C   1  
ATOM 8267   O O   . ILE C 3 784 ? -97.638  -26.868 -7.232  1.00 0.00 ? 787 ILE M O   1  
ATOM 8268   C CB  . ILE C 3 784 ? -97.595  -23.525 -6.909  1.00 0.00 ? 787 ILE M CB  1  
ATOM 8269   C CG1 . ILE C 3 784 ? -98.029  -22.947 -5.599  1.00 0.00 ? 787 ILE M CG1 1  
ATOM 8270   C CG2 . ILE C 3 784 ? -98.845  -23.905 -7.696  1.00 0.00 ? 787 ILE M CG2 1  
ATOM 8271   C CD1 . ILE C 3 784 ? -99.118  -21.964 -5.963  1.00 0.00 ? 787 ILE M CD1 1  
ATOM 8272   N N   . THR C 3 785 ? -96.934  -25.480 -8.920  1.00 0.00 ? 788 THR M N   1  
ATOM 8273   C CA  . THR C 3 785 ? -97.235  -26.340 -10.046 1.00 0.00 ? 788 THR M CA  1  
ATOM 8274   C C   . THR C 3 785 ? -96.937  -27.813 -9.722  1.00 0.00 ? 788 THR M C   1  
ATOM 8275   O O   . THR C 3 785 ? -97.757  -28.703 -9.902  1.00 0.00 ? 788 THR M O   1  
ATOM 8276   C CB  . THR C 3 785 ? -96.652  -25.779 -11.362 1.00 0.00 ? 788 THR M CB  1  
ATOM 8277   O OG1 . THR C 3 785 ? -97.306  -24.545 -11.692 1.00 0.00 ? 788 THR M OG1 1  
ATOM 8278   C CG2 . THR C 3 785 ? -96.794  -26.714 -12.509 1.00 0.00 ? 788 THR M CG2 1  
ATOM 8279   N N   . ARG C 3 786 ? -95.813  -28.035 -9.080  1.00 0.00 ? 789 ARG M N   1  
ATOM 8280   C CA  . ARG C 3 786 ? -95.413  -29.346 -8.647  1.00 0.00 ? 789 ARG M CA  1  
ATOM 8281   C C   . ARG C 3 786 ? -96.276  -29.819 -7.509  1.00 0.00 ? 789 ARG M C   1  
ATOM 8282   O O   . ARG C 3 786 ? -96.612  -30.975 -7.428  1.00 0.00 ? 789 ARG M O   1  
ATOM 8283   C CB  . ARG C 3 786 ? -93.939  -29.394 -8.256  1.00 0.00 ? 789 ARG M CB  1  
ATOM 8284   N N   . THR C 3 787 ? -96.634  -28.901 -6.623  1.00 0.00 ? 790 THR M N   1  
ATOM 8285   C CA  . THR C 3 787 ? -97.453  -29.339 -5.488  1.00 0.00 ? 790 THR M CA  1  
ATOM 8286   C C   . THR C 3 787 ? -98.892  -29.525 -5.917  1.00 0.00 ? 790 THR M C   1  
ATOM 8287   O O   . THR C 3 787 ? -99.733  -30.212 -5.365  1.00 0.00 ? 790 THR M O   1  
ATOM 8288   C CB  . THR C 3 787 ? -97.340  -28.399 -4.284  1.00 0.00 ? 790 THR M CB  1  
ATOM 8289   O OG1 . THR C 3 787 ? -96.068  -28.535 -3.686  1.00 0.00 ? 790 THR M OG1 1  
ATOM 8290   C CG2 . THR C 3 787 ? -98.390  -28.794 -3.276  1.00 0.00 ? 790 THR M CG2 1  
ATOM 8291   N N   . GLN C 3 788 ? -99.226  -28.918 -7.022  1.00 0.00 ? 791 GLN M N   1  
ATOM 8292   C CA  . GLN C 3 788 ? -100.577 -29.073 -7.468  1.00 0.00 ? 791 GLN M CA  1  
ATOM 8293   C C   . GLN C 3 788 ? -100.736 -30.490 -7.930  1.00 0.00 ? 791 GLN M C   1  
ATOM 8294   O O   . GLN C 3 788 ? -101.444 -31.275 -7.269  1.00 0.00 ? 791 GLN M O   1  
ATOM 8295   C CB  . GLN C 3 788 ? -100.921 -28.037 -8.577  1.00 0.00 ? 791 GLN M CB  1  
ATOM 8296   C CG  . GLN C 3 788 ? -100.995 -26.599 -8.013  1.00 0.00 ? 791 GLN M CG  1  
ATOM 8297   C CD  . GLN C 3 788 ? -101.714 -25.587 -8.881  1.00 0.00 ? 791 GLN M CD  1  
ATOM 8298   O OE1 . GLN C 3 788 ? -101.539 -25.508 -10.108 1.00 0.00 ? 791 GLN M OE1 1  
ATOM 8299   N NE2 . GLN C 3 788 ? -102.420 -24.658 -8.282  1.00 0.00 ? 791 GLN M NE2 1  
ATOM 8300   N N   . ALA C 3 789 ? -99.969  -30.798 -8.997  1.00 0.00 ? 792 ALA M N   1  
ATOM 8301   C CA  . ALA C 3 789 ? -99.903  -32.090 -9.625  1.00 0.00 ? 792 ALA M CA  1  
ATOM 8302   C C   . ALA C 3 789 ? -100.205 -33.300 -8.713  1.00 0.00 ? 792 ALA M C   1  
ATOM 8303   O O   . ALA C 3 789 ? -101.206 -33.980 -8.900  1.00 0.00 ? 792 ALA M O   1  
ATOM 8304   C CB  . ALA C 3 789 ? -98.580  -32.210 -10.368 1.00 0.00 ? 792 ALA M CB  1  
ATOM 8305   N N   . ARG C 3 790 ? -99.342  -33.531 -7.746  1.00 0.00 ? 793 ARG M N   1  
ATOM 8306   C CA  . ARG C 3 790 ? -99.423  -34.637 -6.799  1.00 0.00 ? 793 ARG M CA  1  
ATOM 8307   C C   . ARG C 3 790 ? -100.851 -34.703 -6.276  1.00 0.00 ? 793 ARG M C   1  
ATOM 8308   O O   . ARG C 3 790 ? -101.559 -35.728 -6.463  1.00 0.00 ? 793 ARG M O   1  
ATOM 8309   C CB  . ARG C 3 790 ? -98.425  -34.409 -5.676  1.00 0.00 ? 793 ARG M CB  1  
ATOM 8310   C CG  . ARG C 3 790 ? -98.600  -35.319 -4.490  1.00 0.00 ? 793 ARG M CG  1  
ATOM 8311   C CD  . ARG C 3 790 ? -98.451  -36.788 -4.858  1.00 0.00 ? 793 ARG M CD  1  
ATOM 8312   N NE  . ARG C 3 790 ? -97.334  -37.557 -4.259  1.00 0.00 ? 793 ARG M NE  1  
ATOM 8313   C CZ  . ARG C 3 790 ? -96.361  -38.099 -4.998  1.00 0.00 ? 793 ARG M CZ  1  
ATOM 8314   N NH1 . ARG C 3 790 ? -96.330  -37.999 -6.338  1.00 0.00 ? 793 ARG M NH1 1  
ATOM 8315   N NH2 . ARG C 3 790 ? -95.394  -38.770 -4.395  1.00 0.00 ? 793 ARG M NH2 1  
ATOM 8316   N N   . CYS C 3 791 ? -101.280 -33.540 -5.815  1.00 0.00 ? 794 CYS M N   1  
ATOM 8317   C CA  . CYS C 3 791 ? -102.632 -33.387 -5.349  1.00 0.00 ? 794 CYS M CA  1  
ATOM 8318   C C   . CYS C 3 791 ? -103.607 -33.948 -6.385  1.00 0.00 ? 794 CYS M C   1  
ATOM 8319   O O   . CYS C 3 791 ? -104.246 -34.981 -6.134  1.00 0.00 ? 794 CYS M O   1  
ATOM 8320   C CB  . CYS C 3 791 ? -102.941 -31.923 -5.010  1.00 0.00 ? 794 CYS M CB  1  
ATOM 8321   S SG  . CYS C 3 791 ? -101.787 -31.203 -3.840  1.00 0.00 ? 794 CYS M SG  1  
ATOM 8322   N N   . ARG C 3 792 ? -103.577 -33.329 -7.577  1.00 0.00 ? 795 ARG M N   1  
ATOM 8323   C CA  . ARG C 3 792 ? -104.411 -33.685 -8.709  1.00 0.00 ? 795 ARG M CA  1  
ATOM 8324   C C   . ARG C 3 792 ? -104.342 -35.186 -8.839  1.00 0.00 ? 795 ARG M C   1  
ATOM 8325   O O   . ARG C 3 792 ? -105.365 -35.847 -8.787  1.00 0.00 ? 795 ARG M O   1  
ATOM 8326   C CB  . ARG C 3 792 ? -103.897 -33.059 -10.003 1.00 0.00 ? 795 ARG M CB  1  
ATOM 8327   C CG  . ARG C 3 792 ? -104.172 -31.554 -10.121 1.00 0.00 ? 795 ARG M CG  1  
ATOM 8328   C CD  . ARG C 3 792 ? -104.594 -31.125 -11.535 1.00 0.00 ? 795 ARG M CD  1  
ATOM 8329   N NE  . ARG C 3 792 ? -104.493 -29.687 -11.742 1.00 0.00 ? 795 ARG M NE  1  
ATOM 8330   C CZ  . ARG C 3 792 ? -104.094 -29.118 -12.865 1.00 0.00 ? 795 ARG M CZ  1  
ATOM 8331   N NH1 . ARG C 3 792 ? -103.748 -29.875 -13.888 1.00 0.00 ? 795 ARG M NH1 1  
ATOM 8332   N NH2 . ARG C 3 792 ? -104.040 -27.785 -12.955 1.00 0.00 ? 795 ARG M NH2 1  
ATOM 8333   N N   . GLY C 3 793 ? -103.105 -35.647 -8.971  1.00 0.00 ? 796 GLY M N   1  
ATOM 8334   C CA  . GLY C 3 793 ? -102.794 -37.042 -9.115  1.00 0.00 ? 796 GLY M CA  1  
ATOM 8335   C C   . GLY C 3 793 ? -103.577 -37.718 -8.041  1.00 0.00 ? 796 GLY M C   1  
ATOM 8336   O O   . GLY C 3 793 ? -104.634 -38.297 -8.297  1.00 0.00 ? 796 GLY M O   1  
ATOM 8337   N N   . PHE C 3 794 ? -103.071 -37.543 -6.847  1.00 0.00 ? 797 PHE M N   1  
ATOM 8338   C CA  . PHE C 3 794 ? -103.667 -38.101 -5.656  1.00 0.00 ? 797 PHE M CA  1  
ATOM 8339   C C   . PHE C 3 794 ? -105.157 -37.978 -5.601  1.00 0.00 ? 797 PHE M C   1  
ATOM 8340   O O   . PHE C 3 794 ? -105.885 -38.805 -5.047  1.00 0.00 ? 797 PHE M O   1  
ATOM 8341   C CB  . PHE C 3 794 ? -103.193 -37.269 -4.510  1.00 0.00 ? 797 PHE M CB  1  
ATOM 8342   C CG  . PHE C 3 794 ? -103.955 -37.569 -3.224  1.00 0.00 ? 797 PHE M CG  1  
ATOM 8343   C CD1 . PHE C 3 794 ? -103.522 -38.601 -2.397  1.00 0.00 ? 797 PHE M CD1 1  
ATOM 8344   C CD2 . PHE C 3 794 ? -105.051 -36.808 -2.841  1.00 0.00 ? 797 PHE M CD2 1  
ATOM 8345   C CE1 . PHE C 3 794 ? -104.170 -38.871 -1.189  1.00 0.00 ? 797 PHE M CE1 1  
ATOM 8346   C CE2 . PHE C 3 794 ? -105.733 -37.083 -1.661  1.00 0.00 ? 797 PHE M CE2 1  
ATOM 8347   C CZ  . PHE C 3 794 ? -105.280 -38.114 -0.833  1.00 0.00 ? 797 PHE M CZ  1  
ATOM 8348   N N   . LEU C 3 795 ? -105.635 -36.895 -6.138  1.00 0.00 ? 798 LEU M N   1  
ATOM 8349   C CA  . LEU C 3 795 ? -107.058 -36.740 -6.051  1.00 0.00 ? 798 LEU M CA  1  
ATOM 8350   C C   . LEU C 3 795 ? -107.823 -37.809 -6.768  1.00 0.00 ? 798 LEU M C   1  
ATOM 8351   O O   . LEU C 3 795 ? -108.793 -38.379 -6.283  1.00 0.00 ? 798 LEU M O   1  
ATOM 8352   C CB  . LEU C 3 795 ? -107.575 -35.340 -6.357  1.00 0.00 ? 798 LEU M CB  1  
ATOM 8353   C CG  . LEU C 3 795 ? -108.353 -34.916 -5.128  1.00 0.00 ? 798 LEU M CG  1  
ATOM 8354   C CD1 . LEU C 3 795 ? -107.466 -35.237 -3.938  1.00 0.00 ? 798 LEU M CD1 1  
ATOM 8355   C CD2 . LEU C 3 795 ? -108.685 -33.446 -5.212  1.00 0.00 ? 798 LEU M CD2 1  
ATOM 8356   N N   . MET C 3 796 ? -107.350 -38.083 -7.948  1.00 0.00 ? 799 MET M N   1  
ATOM 8357   C CA  . MET C 3 796 ? -108.006 -39.099 -8.722  1.00 0.00 ? 799 MET M CA  1  
ATOM 8358   C C   . MET C 3 796 ? -107.674 -40.484 -8.207  1.00 0.00 ? 799 MET M C   1  
ATOM 8359   O O   . MET C 3 796 ? -108.452 -41.435 -8.355  1.00 0.00 ? 799 MET M O   1  
ATOM 8360   C CB  . MET C 3 796 ? -107.687 -38.954 -10.198 1.00 0.00 ? 799 MET M CB  1  
ATOM 8361   C CG  . MET C 3 796 ? -108.791 -38.235 -10.946 1.00 0.00 ? 799 MET M CG  1  
ATOM 8362   S SD  . MET C 3 796 ? -108.872 -38.782 -12.679 1.00 0.00 ? 799 MET M SD  1  
ATOM 8363   C CE  . MET C 3 796 ? -110.459 -39.644 -12.618 1.00 0.00 ? 799 MET M CE  1  
ATOM 8364   N N   . ARG C 3 797 ? -106.518 -40.601 -7.587  1.00 0.00 ? 800 ARG M N   1  
ATOM 8365   C CA  . ARG C 3 797 ? -106.092 -41.890 -7.057  1.00 0.00 ? 800 ARG M CA  1  
ATOM 8366   C C   . ARG C 3 797 ? -107.095 -42.403 -6.059  1.00 0.00 ? 800 ARG M C   1  
ATOM 8367   O O   . ARG C 3 797 ? -107.136 -43.594 -5.838  1.00 0.00 ? 800 ARG M O   1  
ATOM 8368   C CB  . ARG C 3 797 ? -104.697 -41.821 -6.487  1.00 0.00 ? 800 ARG M CB  1  
ATOM 8369   C CG  . ARG C 3 797 ? -103.700 -42.690 -7.205  1.00 0.00 ? 800 ARG M CG  1  
ATOM 8370   C CD  . ARG C 3 797 ? -102.264 -42.579 -6.635  1.00 0.00 ? 800 ARG M CD  1  
ATOM 8371   N NE  . ARG C 3 797 ? -101.491 -41.649 -7.422  1.00 0.00 ? 800 ARG M NE  1  
ATOM 8372   C CZ  . ARG C 3 797 ? -100.830 -40.663 -6.902  1.00 0.00 ? 800 ARG M CZ  1  
ATOM 8373   N NH1 . ARG C 3 797 ? -100.849 -40.395 -5.565  1.00 0.00 ? 800 ARG M NH1 1  
ATOM 8374   N NH2 . ARG C 3 797 ? -100.255 -39.931 -7.801  1.00 0.00 ? 800 ARG M NH2 1  
ATOM 8375   N N   . VAL C 3 798 ? -107.920 -41.515 -5.476  1.00 0.00 ? 801 VAL M N   1  
ATOM 8376   C CA  . VAL C 3 798 ? -108.882 -41.928 -4.437  1.00 0.00 ? 801 VAL M CA  1  
ATOM 8377   C C   . VAL C 3 798 ? -110.179 -42.262 -5.112  1.00 0.00 ? 801 VAL M C   1  
ATOM 8378   O O   . VAL C 3 798 ? -111.029 -42.953 -4.565  1.00 0.00 ? 801 VAL M O   1  
ATOM 8379   C CB  . VAL C 3 798 ? -109.156 -40.838 -3.418  1.00 0.00 ? 801 VAL M CB  1  
ATOM 8380   C CG1 . VAL C 3 798 ? -110.099 -41.361 -2.360  1.00 0.00 ? 801 VAL M CG1 1  
ATOM 8381   C CG2 . VAL C 3 798 ? -107.864 -40.378 -2.788  1.00 0.00 ? 801 VAL M CG2 1  
ATOM 8382   N N   . GLU C 3 799 ? -110.301 -41.707 -6.310  1.00 0.00 ? 802 GLU M N   1  
ATOM 8383   C CA  . GLU C 3 799 ? -111.481 -41.935 -7.099  1.00 0.00 ? 802 GLU M CA  1  
ATOM 8384   C C   . GLU C 3 799 ? -111.483 -43.345 -7.608  1.00 0.00 ? 802 GLU M C   1  
ATOM 8385   O O   . GLU C 3 799 ? -112.497 -44.019 -7.624  1.00 0.00 ? 802 GLU M O   1  
ATOM 8386   C CB  . GLU C 3 799 ? -111.718 -40.906 -8.199  1.00 0.00 ? 802 GLU M CB  1  
ATOM 8387   C CG  . GLU C 3 799 ? -112.888 -39.955 -7.872  1.00 0.00 ? 802 GLU M CG  1  
ATOM 8388   C CD  . GLU C 3 799 ? -113.889 -40.480 -6.894  1.00 0.00 ? 802 GLU M CD  1  
ATOM 8389   O OE1 . GLU C 3 799 ? -113.456 -40.593 -5.651  1.00 0.00 ? 802 GLU M OE1 1  
ATOM 8390   O OE2 . GLU C 3 799 ? -115.028 -40.700 -7.235  1.00 0.00 ? 802 GLU M OE2 1  
ATOM 8391   N N   . TYR C 3 800 ? -110.298 -43.816 -8.020  1.00 0.00 ? 803 TYR M N   1  
ATOM 8392   C CA  . TYR C 3 800 ? -110.244 -45.158 -8.431  1.00 0.00 ? 803 TYR M CA  1  
ATOM 8393   C C   . TYR C 3 800 ? -110.682 -46.103 -7.273  1.00 0.00 ? 803 TYR M C   1  
ATOM 8394   O O   . TYR C 3 800 ? -111.504 -46.980 -7.497  1.00 0.00 ? 803 TYR M O   1  
ATOM 8395   C CB  . TYR C 3 800 ? -108.942 -45.476 -9.156  1.00 0.00 ? 803 TYR M CB  1  
ATOM 8396   C CG  . TYR C 3 800 ? -108.756 -46.830 -9.846  1.00 0.00 ? 803 TYR M CG  1  
ATOM 8397   C CD1 . TYR C 3 800 ? -108.381 -47.938 -9.092  1.00 0.00 ? 803 TYR M CD1 1  
ATOM 8398   C CD2 . TYR C 3 800 ? -108.830 -46.968 -11.233 1.00 0.00 ? 803 TYR M CD2 1  
ATOM 8399   C CE1 . TYR C 3 800 ? -108.125 -49.174 -9.693  1.00 0.00 ? 803 TYR M CE1 1  
ATOM 8400   C CE2 . TYR C 3 800 ? -108.580 -48.197 -11.852 1.00 0.00 ? 803 TYR M CE2 1  
ATOM 8401   C CZ  . TYR C 3 800 ? -108.226 -49.298 -11.079 1.00 0.00 ? 803 TYR M CZ  1  
ATOM 8402   O OH  . TYR C 3 800 ? -107.992 -50.511 -11.699 1.00 0.00 ? 803 TYR M OH  1  
ATOM 8403   N N   . ARG C 3 801 ? -110.212 -45.887 -6.030  1.00 0.00 ? 804 ARG M N   1  
ATOM 8404   C CA  . ARG C 3 801 ? -110.532 -46.705 -4.810  1.00 0.00 ? 804 ARG M CA  1  
ATOM 8405   C C   . ARG C 3 801 ? -112.015 -46.748 -4.474  1.00 0.00 ? 804 ARG M C   1  
ATOM 8406   O O   . ARG C 3 801 ? -112.491 -47.618 -3.760  1.00 0.00 ? 804 ARG M O   1  
ATOM 8407   C CB  . ARG C 3 801 ? -109.855 -46.184 -3.548  1.00 0.00 ? 804 ARG M CB  1  
ATOM 8408   C CG  . ARG C 3 801 ? -109.251 -47.228 -2.609  1.00 0.00 ? 804 ARG M CG  1  
ATOM 8409   C CD  . ARG C 3 801 ? -107.919 -46.788 -1.963  1.00 0.00 ? 804 ARG M CD  1  
ATOM 8410   N NE  . ARG C 3 801 ? -106.716 -47.238 -2.695  1.00 0.00 ? 804 ARG M NE  1  
ATOM 8411   C CZ  . ARG C 3 801 ? -105.477 -47.063 -2.262  1.00 0.00 ? 804 ARG M CZ  1  
ATOM 8412   N NH1 . ARG C 3 801 ? -105.268 -46.495 -1.060  1.00 0.00 ? 804 ARG M NH1 1  
ATOM 8413   N NH2 . ARG C 3 801 ? -104.454 -47.529 -3.000  1.00 0.00 ? 804 ARG M NH2 1  
ATOM 8414   N N   . ARG C 3 802 ? -112.708 -45.754 -4.974  1.00 0.00 ? 805 ARG M N   1  
ATOM 8415   C CA  . ARG C 3 802 ? -114.126 -45.629 -4.765  1.00 0.00 ? 805 ARG M CA  1  
ATOM 8416   C C   . ARG C 3 802 ? -114.849 -46.329 -5.914  1.00 0.00 ? 805 ARG M C   1  
ATOM 8417   O O   . ARG C 3 802 ? -115.709 -47.173 -5.684  1.00 0.00 ? 805 ARG M O   1  
ATOM 8418   C CB  . ARG C 3 802 ? -114.473 -44.198 -4.563  1.00 0.00 ? 805 ARG M CB  1  
ATOM 8419   N N   . MET C 3 803 ? -114.464 -45.981 -7.135  1.00 0.00 ? 806 MET M N   1  
ATOM 8420   C CA  . MET C 3 803 ? -115.013 -46.571 -8.359  1.00 0.00 ? 806 MET M CA  1  
ATOM 8421   C C   . MET C 3 803 ? -115.074 -48.068 -8.234  1.00 0.00 ? 806 MET M C   1  
ATOM 8422   O O   . MET C 3 803 ? -116.109 -48.697 -8.441  1.00 0.00 ? 806 MET M O   1  
ATOM 8423   C CB  . MET C 3 803 ? -114.123 -46.285 -9.601  1.00 0.00 ? 806 MET M CB  1  
ATOM 8424   C CG  . MET C 3 803 ? -113.944 -44.799 -9.914  1.00 0.00 ? 806 MET M CG  1  
ATOM 8425   S SD  . MET C 3 803 ? -112.887 -44.530 -11.319 1.00 0.00 ? 806 MET M SD  1  
ATOM 8426   C CE  . MET C 3 803 ? -114.121 -44.962 -12.564 1.00 0.00 ? 806 MET M CE  1  
ATOM 8427   N N   . VAL C 3 804 ? -113.913 -48.596 -7.880  1.00 0.00 ? 807 VAL M N   1  
ATOM 8428   C CA  . VAL C 3 804 ? -113.657 -49.994 -7.670  1.00 0.00 ? 807 VAL M CA  1  
ATOM 8429   C C   . VAL C 3 804 ? -114.541 -50.637 -6.579  1.00 0.00 ? 807 VAL M C   1  
ATOM 8430   O O   . VAL C 3 804 ? -115.169 -51.679 -6.806  1.00 0.00 ? 807 VAL M O   1  
ATOM 8431   C CB  . VAL C 3 804 ? -112.152 -50.245 -7.537  1.00 0.00 ? 807 VAL M CB  1  
ATOM 8432   C CG1 . VAL C 3 804 ? -111.843 -51.606 -6.950  1.00 0.00 ? 807 VAL M CG1 1  
ATOM 8433   C CG2 . VAL C 3 804 ? -111.533 -50.206 -8.912  1.00 0.00 ? 807 VAL M CG2 1  
ATOM 8434   N N   . GLU C 3 805 ? -114.614 -50.014 -5.418  1.00 0.00 ? 808 GLU M N   1  
ATOM 8435   C CA  . GLU C 3 805 ? -115.440 -50.488 -4.309  1.00 0.00 ? 808 GLU M CA  1  
ATOM 8436   C C   . GLU C 3 805 ? -116.853 -50.722 -4.819  1.00 0.00 ? 808 GLU M C   1  
ATOM 8437   O O   . GLU C 3 805 ? -117.411 -51.815 -4.776  1.00 0.00 ? 808 GLU M O   1  
ATOM 8438   C CB  . GLU C 3 805 ? -115.470 -49.445 -3.161  1.00 0.00 ? 808 GLU M CB  1  
ATOM 8439   C CG  . GLU C 3 805 ? -114.393 -49.742 -2.099  1.00 0.00 ? 808 GLU M CG  1  
ATOM 8440   C CD  . GLU C 3 805 ? -114.048 -48.594 -1.192  1.00 0.00 ? 808 GLU M CD  1  
ATOM 8441   O OE1 . GLU C 3 805 ? -114.337 -47.423 -1.727  1.00 0.00 ? 808 GLU M OE1 1  
ATOM 8442   O OE2 . GLU C 3 805 ? -113.504 -48.733 -0.100  1.00 0.00 ? 808 GLU M OE2 1  
ATOM 8443   N N   . ARG C 3 806 ? -117.353 -49.648 -5.364  1.00 0.00 ? 809 ARG M N   1  
ATOM 8444   C CA  . ARG C 3 806 ? -118.639 -49.496 -5.983  1.00 0.00 ? 809 ARG M CA  1  
ATOM 8445   C C   . ARG C 3 806 ? -118.998 -50.590 -6.968  1.00 0.00 ? 809 ARG M C   1  
ATOM 8446   O O   . ARG C 3 806 ? -120.175 -50.892 -7.139  1.00 0.00 ? 809 ARG M O   1  
ATOM 8447   C CB  . ARG C 3 806 ? -118.524 -48.257 -6.857  1.00 0.00 ? 809 ARG M CB  1  
ATOM 8448   C CG  . ARG C 3 806 ? -118.693 -46.974 -6.057  1.00 0.00 ? 809 ARG M CG  1  
ATOM 8449   C CD  . ARG C 3 806 ? -118.452 -45.761 -6.929  1.00 0.00 ? 809 ARG M CD  1  
ATOM 8450   N NE  . ARG C 3 806 ? -118.797 -44.498 -6.264  1.00 0.00 ? 809 ARG M NE  1  
ATOM 8451   C CZ  . ARG C 3 806 ? -118.555 -43.301 -6.799  1.00 0.00 ? 809 ARG M CZ  1  
ATOM 8452   N NH1 . ARG C 3 806 ? -117.984 -43.151 -8.021  1.00 0.00 ? 809 ARG M NH1 1  
ATOM 8453   N NH2 . ARG C 3 806 ? -118.920 -42.221 -6.085  1.00 0.00 ? 809 ARG M NH2 1  
ATOM 8454   N N   . ARG C 3 807 ? -117.945 -51.088 -7.629  1.00 0.00 ? 810 ARG M N   1  
ATOM 8455   C CA  . ARG C 3 807 ? -118.001 -52.099 -8.670  1.00 0.00 ? 810 ARG M CA  1  
ATOM 8456   C C   . ARG C 3 807 ? -119.188 -53.011 -8.580  1.00 0.00 ? 810 ARG M C   1  
ATOM 8457   O O   . ARG C 3 807 ? -120.051 -53.006 -9.455  1.00 0.00 ? 810 ARG M O   1  
ATOM 8458   C CB  . ARG C 3 807 ? -116.732 -52.933 -8.810  1.00 0.00 ? 810 ARG M CB  1  
ATOM 8459   C CG  . ARG C 3 807 ? -116.337 -53.160 -10.266 1.00 0.00 ? 810 ARG M CG  1  
ATOM 8460   C CD  . ARG C 3 807 ? -116.385 -54.633 -10.725 1.00 0.00 ? 810 ARG M CD  1  
ATOM 8461   N NE  . ARG C 3 807 ? -115.943 -54.862 -12.120 1.00 0.00 ? 810 ARG M NE  1  
ATOM 8462   C CZ  . ARG C 3 807 ? -116.266 -54.076 -13.186 1.00 0.00 ? 810 ARG M CZ  1  
ATOM 8463   N NH1 . ARG C 3 807 ? -117.049 -52.993 -13.091 1.00 0.00 ? 810 ARG M NH1 1  
ATOM 8464   N NH2 . ARG C 3 807 ? -115.788 -54.388 -14.411 1.00 0.00 ? 810 ARG M NH2 1  
ATOM 8465   N N   . GLU C 3 808 ? -119.259 -53.711 -7.475  1.00 0.00 ? 811 GLU M N   1  
ATOM 8466   C CA  . GLU C 3 808 ? -120.345 -54.635 -7.347  1.00 0.00 ? 811 GLU M CA  1  
ATOM 8467   C C   . GLU C 3 808 ? -121.646 -54.087 -6.838  1.00 0.00 ? 811 GLU M C   1  
ATOM 8468   O O   . GLU C 3 808 ? -122.727 -54.488 -7.310  1.00 0.00 ? 811 GLU M O   1  
ATOM 8469   C CB  . GLU C 3 808 ? -119.942 -55.858 -6.517  1.00 0.00 ? 811 GLU M CB  1  
ATOM 8470   C CG  . GLU C 3 808 ? -119.691 -55.465 -5.064  1.00 0.00 ? 811 GLU M CG  1  
ATOM 8471   C CD  . GLU C 3 808 ? -118.695 -56.370 -4.405  1.00 0.00 ? 811 GLU M CD  1  
ATOM 8472   O OE1 . GLU C 3 808 ? -117.497 -56.300 -4.967  1.00 0.00 ? 811 GLU M OE1 1  
ATOM 8473   O OE2 . GLU C 3 808 ? -118.971 -57.110 -3.464  1.00 0.00 ? 811 GLU M OE2 1  
ATOM 8474   N N   . SER C 3 809 ? -121.583 -53.209 -5.845  1.00 0.00 ? 812 SER M N   1  
ATOM 8475   C CA  . SER C 3 809 ? -122.806 -52.670 -5.281  1.00 0.00 ? 812 SER M CA  1  
ATOM 8476   C C   . SER C 3 809 ? -123.725 -52.151 -6.336  1.00 0.00 ? 812 SER M C   1  
ATOM 8477   O O   . SER C 3 809 ? -124.938 -52.188 -6.171  1.00 0.00 ? 812 SER M O   1  
ATOM 8478   C CB  . SER C 3 809 ? -122.582 -51.693 -4.131  1.00 0.00 ? 812 SER M CB  1  
ATOM 8479   O OG  . SER C 3 809 ? -122.461 -52.383 -2.907  1.00 0.00 ? 812 SER M OG  1  
ATOM 8480   N N   . ILE C 3 810 ? -123.131 -51.785 -7.467  1.00 0.00 ? 813 ILE M N   1  
ATOM 8481   C CA  . ILE C 3 810 ? -123.920 -51.318 -8.577  1.00 0.00 ? 813 ILE M CA  1  
ATOM 8482   C C   . ILE C 3 810 ? -124.697 -52.484 -9.155  1.00 0.00 ? 813 ILE M C   1  
ATOM 8483   O O   . ILE C 3 810 ? -125.929 -52.503 -9.138  1.00 0.00 ? 813 ILE M O   1  
ATOM 8484   C CB  . ILE C 3 810 ? -123.048 -50.686 -9.659  1.00 0.00 ? 813 ILE M CB  1  
ATOM 8485   C CG1 . ILE C 3 810 ? -122.312 -49.490 -9.082  1.00 0.00 ? 813 ILE M CG1 1  
ATOM 8486   C CG2 . ILE C 3 810 ? -123.917 -50.269 -10.844 1.00 0.00 ? 813 ILE M CG2 1  
ATOM 8487   C CD1 . ILE C 3 810 ? -121.647 -48.610 -10.125 1.00 0.00 ? 813 ILE M CD1 1  
ATOM 8488   N N   . PHE C 3 811 ? -123.926 -53.454 -9.654  1.00 0.00 ? 814 PHE M N   1  
ATOM 8489   C CA  . PHE C 3 811 ? -124.388 -54.674 -10.257 1.00 0.00 ? 814 PHE M CA  1  
ATOM 8490   C C   . PHE C 3 811 ? -125.583 -55.175 -9.505  1.00 0.00 ? 814 PHE M C   1  
ATOM 8491   O O   . PHE C 3 811 ? -126.648 -55.335 -10.058 1.00 0.00 ? 814 PHE M O   1  
ATOM 8492   C CB  . PHE C 3 811 ? -123.328 -55.758 -10.128 1.00 0.00 ? 814 PHE M CB  1  
ATOM 8493   C CG  . PHE C 3 811 ? -122.286 -55.774 -11.205 1.00 0.00 ? 814 PHE M CG  1  
ATOM 8494   C CD1 . PHE C 3 811 ? -122.575 -55.428 -12.525 1.00 0.00 ? 814 PHE M CD1 1  
ATOM 8495   C CD2 . PHE C 3 811 ? -120.976 -56.105 -10.875 1.00 0.00 ? 814 PHE M CD2 1  
ATOM 8496   C CE1 . PHE C 3 811 ? -121.575 -55.390 -13.495 1.00 0.00 ? 814 PHE M CE1 1  
ATOM 8497   C CE2 . PHE C 3 811 ? -119.968 -56.121 -11.837 1.00 0.00 ? 814 PHE M CE2 1  
ATOM 8498   C CZ  . PHE C 3 811 ? -120.277 -55.756 -13.143 1.00 0.00 ? 814 PHE M CZ  1  
ATOM 8499   N N   . CYS C 3 812 ? -125.356 -55.273 -8.222  1.00 0.00 ? 815 CYS M N   1  
ATOM 8500   C CA  . CYS C 3 812 ? -126.388 -55.700 -7.314  1.00 0.00 ? 815 CYS M CA  1  
ATOM 8501   C C   . CYS C 3 812 ? -127.575 -54.859 -7.559  1.00 0.00 ? 815 CYS M C   1  
ATOM 8502   O O   . CYS C 3 812 ? -128.682 -55.333 -7.794  1.00 0.00 ? 815 CYS M O   1  
ATOM 8503   C CB  . CYS C 3 812 ? -125.974 -55.492 -5.869  1.00 0.00 ? 815 CYS M CB  1  
ATOM 8504   S SG  . CYS C 3 812 ? -127.429 -55.862 -4.969  1.00 0.00 ? 815 CYS M SG  1  
ATOM 8505   N N   . ILE C 3 813 ? -127.330 -53.587 -7.561  1.00 0.00 ? 816 ILE M N   1  
ATOM 8506   C CA  . ILE C 3 813 ? -128.430 -52.698 -7.825  1.00 0.00 ? 816 ILE M CA  1  
ATOM 8507   C C   . ILE C 3 813 ? -128.889 -52.931 -9.241  1.00 0.00 ? 816 ILE M C   1  
ATOM 8508   O O   . ILE C 3 813 ? -130.073 -53.101 -9.475  1.00 0.00 ? 816 ILE M O   1  
ATOM 8509   C CB  . ILE C 3 813 ? -128.140 -51.213 -7.597  1.00 0.00 ? 816 ILE M CB  1  
ATOM 8510   C CG1 . ILE C 3 813 ? -127.543 -50.979 -6.222  1.00 0.00 ? 816 ILE M CG1 1  
ATOM 8511   C CG2 . ILE C 3 813 ? -129.418 -50.370 -7.686  1.00 0.00 ? 816 ILE M CG2 1  
ATOM 8512   C CD1 . ILE C 3 813 ? -128.276 -49.853 -5.465  1.00 0.00 ? 816 ILE M CD1 1  
ATOM 8513   N N   . GLN C 3 814 ? -127.927 -52.990 -10.161 1.00 0.00 ? 817 GLN M N   1  
ATOM 8514   C CA  . GLN C 3 814 ? -128.225 -53.159 -11.592 1.00 0.00 ? 817 GLN M CA  1  
ATOM 8515   C C   . GLN C 3 814 ? -129.216 -54.268 -11.867 1.00 0.00 ? 817 GLN M C   1  
ATOM 8516   O O   . GLN C 3 814 ? -130.391 -54.056 -12.152 1.00 0.00 ? 817 GLN M O   1  
ATOM 8517   C CB  . GLN C 3 814 ? -126.983 -53.277 -12.530 1.00 0.00 ? 817 GLN M CB  1  
ATOM 8518   C CG  . GLN C 3 814 ? -126.609 -51.958 -13.265 1.00 0.00 ? 817 GLN M CG  1  
ATOM 8519   C CD  . GLN C 3 814 ? -125.276 -52.039 -13.961 1.00 0.00 ? 817 GLN M CD  1  
ATOM 8520   O OE1 . GLN C 3 814 ? -124.672 -53.105 -13.961 1.00 0.00 ? 817 GLN M OE1 1  
ATOM 8521   N NE2 . GLN C 3 814 ? -124.834 -50.934 -14.555 1.00 0.00 ? 817 GLN M NE2 1  
ATOM 8522   N N   . TYR C 3 815 ? -128.734 -55.483 -11.755 1.00 0.00 ? 818 TYR M N   1  
ATOM 8523   C CA  . TYR C 3 815 ? -129.543 -56.660 -11.992 1.00 0.00 ? 818 TYR M CA  1  
ATOM 8524   C C   . TYR C 3 815 ? -130.859 -56.640 -11.240 1.00 0.00 ? 818 TYR M C   1  
ATOM 8525   O O   . TYR C 3 815 ? -131.913 -56.884 -11.813 1.00 0.00 ? 818 TYR M O   1  
ATOM 8526   C CB  . TYR C 3 815 ? -128.718 -57.885 -11.627 1.00 0.00 ? 818 TYR M CB  1  
ATOM 8527   C CG  . TYR C 3 815 ? -127.549 -58.111 -12.559 1.00 0.00 ? 818 TYR M CG  1  
ATOM 8528   C CD1 . TYR C 3 815 ? -127.668 -57.954 -13.946 1.00 0.00 ? 818 TYR M CD1 1  
ATOM 8529   C CD2 . TYR C 3 815 ? -126.325 -58.538 -12.039 1.00 0.00 ? 818 TYR M CD2 1  
ATOM 8530   C CE1 . TYR C 3 815 ? -126.581 -58.139 -14.782 1.00 0.00 ? 818 TYR M CE1 1  
ATOM 8531   C CE2 . TYR C 3 815 ? -125.223 -58.736 -12.866 1.00 0.00 ? 818 TYR M CE2 1  
ATOM 8532   C CZ  . TYR C 3 815 ? -125.359 -58.552 -14.242 1.00 0.00 ? 818 TYR M CZ  1  
ATOM 8533   O OH  . TYR C 3 815 ? -124.281 -58.734 -15.074 1.00 0.00 ? 818 TYR M OH  1  
ATOM 8534   N N   . ASN C 3 816 ? -130.744 -56.388 -9.936  1.00 0.00 ? 819 ASN M N   1  
ATOM 8535   C CA  . ASN C 3 816 ? -131.864 -56.380 -9.006  1.00 0.00 ? 819 ASN M CA  1  
ATOM 8536   C C   . ASN C 3 816 ? -133.128 -55.710 -9.426  1.00 0.00 ? 819 ASN M C   1  
ATOM 8537   O O   . ASN C 3 816 ? -134.197 -56.184 -9.073  1.00 0.00 ? 819 ASN M O   1  
ATOM 8538   C CB  . ASN C 3 816 ? -131.477 -55.976 -7.593  1.00 0.00 ? 819 ASN M CB  1  
ATOM 8539   C CG  . ASN C 3 816 ? -131.561 -57.197 -6.708  1.00 0.00 ? 819 ASN M CG  1  
ATOM 8540   O OD1 . ASN C 3 816 ? -132.674 -57.634 -6.370  1.00 0.00 ? 819 ASN M OD1 1  
ATOM 8541   N ND2 . ASN C 3 816 ? -130.392 -57.809 -6.425  1.00 0.00 ? 819 ASN M ND2 1  
ATOM 8542   N N   . VAL C 3 817 ? -132.960 -54.589 -10.126 1.00 0.00 ? 820 VAL M N   1  
ATOM 8543   C CA  . VAL C 3 817 ? -134.062 -53.782 -10.636 1.00 0.00 ? 820 VAL M CA  1  
ATOM 8544   C C   . VAL C 3 817 ? -134.723 -54.478 -11.809 1.00 0.00 ? 820 VAL M C   1  
ATOM 8545   O O   . VAL C 3 817 ? -135.955 -54.666 -11.897 1.00 0.00 ? 820 VAL M O   1  
ATOM 8546   C CB  . VAL C 3 817 ? -133.529 -52.462 -11.146 1.00 0.00 ? 820 VAL M CB  1  
ATOM 8547   C CG1 . VAL C 3 817 ? -134.529 -51.853 -12.082 1.00 0.00 ? 820 VAL M CG1 1  
ATOM 8548   C CG2 . VAL C 3 817 ? -133.265 -51.536 -9.967  1.00 0.00 ? 820 VAL M CG2 1  
ATOM 8549   N N   . ARG C 3 818 ? -133.855 -54.824 -12.752 1.00 0.00 ? 821 ARG M N   1  
ATOM 8550   C CA  . ARG C 3 818 ? -134.243 -55.525 -13.948 1.00 0.00 ? 821 ARG M CA  1  
ATOM 8551   C C   . ARG C 3 818 ? -135.225 -56.654 -13.668 1.00 0.00 ? 821 ARG M C   1  
ATOM 8552   O O   . ARG C 3 818 ? -136.208 -56.743 -14.393 1.00 0.00 ? 821 ARG M O   1  
ATOM 8553   C CB  . ARG C 3 818 ? -133.026 -56.051 -14.672 1.00 0.00 ? 821 ARG M CB  1  
ATOM 8554   C CG  . ARG C 3 818 ? -132.437 -54.963 -15.569 1.00 0.00 ? 821 ARG M CG  1  
ATOM 8555   C CD  . ARG C 3 818 ? -131.450 -55.525 -16.580 1.00 0.00 ? 821 ARG M CD  1  
ATOM 8556   N NE  . ARG C 3 818 ? -130.447 -54.543 -16.979 1.00 0.00 ? 821 ARG M NE  1  
ATOM 8557   C CZ  . ARG C 3 818 ? -129.133 -54.768 -16.901 1.00 0.00 ? 821 ARG M CZ  1  
ATOM 8558   N NH1 . ARG C 3 818 ? -128.629 -55.914 -16.428 1.00 0.00 ? 821 ARG M NH1 1  
ATOM 8559   N NH2 . ARG C 3 818 ? -128.300 -53.830 -17.311 1.00 0.00 ? 821 ARG M NH2 1  
ATOM 8560   N N   . SER C 3 819 ? -134.923 -57.473 -12.622 1.00 0.00 ? 822 SER M N   1  
ATOM 8561   C CA  . SER C 3 819 ? -135.752 -58.565 -12.183 1.00 0.00 ? 822 SER M CA  1  
ATOM 8562   C C   . SER C 3 819 ? -137.170 -58.064 -12.184 1.00 0.00 ? 822 SER M C   1  
ATOM 8563   O O   . SER C 3 819 ? -137.989 -58.358 -13.058 1.00 0.00 ? 822 SER M O   1  
ATOM 8564   C CB  . SER C 3 819 ? -135.462 -58.913 -10.726 1.00 0.00 ? 822 SER M CB  1  
ATOM 8565   O OG  . SER C 3 819 ? -134.632 -60.048 -10.667 1.00 0.00 ? 822 SER M OG  1  
ATOM 8566   N N   . PHE C 3 820 ? -137.379 -57.243 -11.203 1.00 0.00 ? 823 PHE M N   1  
ATOM 8567   C CA  . PHE C 3 820 ? -138.608 -56.638 -10.904 1.00 0.00 ? 823 PHE M CA  1  
ATOM 8568   C C   . PHE C 3 820 ? -139.392 -56.150 -12.102 1.00 0.00 ? 823 PHE M C   1  
ATOM 8569   O O   . PHE C 3 820 ? -140.580 -56.387 -12.232 1.00 0.00 ? 823 PHE M O   1  
ATOM 8570   C CB  . PHE C 3 820 ? -138.325 -55.558 -9.919  1.00 0.00 ? 823 PHE M CB  1  
ATOM 8571   C CG  . PHE C 3 820 ? -139.518 -54.754 -9.668  1.00 0.00 ? 823 PHE M CG  1  
ATOM 8572   C CD1 . PHE C 3 820 ? -140.513 -55.196 -8.787  1.00 0.00 ? 823 PHE M CD1 1  
ATOM 8573   C CD2 . PHE C 3 820 ? -139.665 -53.555 -10.352 1.00 0.00 ? 823 PHE M CD2 1  
ATOM 8574   C CE1 . PHE C 3 820 ? -141.652 -54.417 -8.593  1.00 0.00 ? 823 PHE M CE1 1  
ATOM 8575   C CE2 . PHE C 3 820 ? -140.779 -52.758 -10.131 1.00 0.00 ? 823 PHE M CE2 1  
ATOM 8576   C CZ  . PHE C 3 820 ? -141.768 -53.199 -9.257  1.00 0.00 ? 823 PHE M CZ  1  
ATOM 8577   N N   . MET C 3 821 ? -138.730 -55.486 -12.999 1.00 0.00 ? 824 MET M N   1  
ATOM 8578   C CA  . MET C 3 821 ? -139.386 -55.003 -14.194 1.00 0.00 ? 824 MET M CA  1  
ATOM 8579   C C   . MET C 3 821 ? -140.005 -56.103 -15.034 1.00 0.00 ? 824 MET M C   1  
ATOM 8580   O O   . MET C 3 821 ? -140.873 -55.889 -15.857 1.00 0.00 ? 824 MET M O   1  
ATOM 8581   C CB  . MET C 3 821 ? -138.316 -54.388 -15.054 1.00 0.00 ? 824 MET M CB  1  
ATOM 8582   C CG  . MET C 3 821 ? -137.847 -53.116 -14.403 1.00 0.00 ? 824 MET M CG  1  
ATOM 8583   S SD  . MET C 3 821 ? -138.660 -51.720 -15.105 1.00 0.00 ? 824 MET M SD  1  
ATOM 8584   C CE  . MET C 3 821 ? -139.350 -51.109 -13.560 1.00 0.00 ? 824 MET M CE  1  
ATOM 8585   N N   . ASN C 3 822 ? -139.479 -57.266 -14.849 1.00 0.00 ? 825 ASN M N   1  
ATOM 8586   C CA  . ASN C 3 822 ? -139.900 -58.417 -15.599 1.00 0.00 ? 825 ASN M CA  1  
ATOM 8587   C C   . ASN C 3 822 ? -140.969 -59.189 -14.900 1.00 0.00 ? 825 ASN M C   1  
ATOM 8588   O O   . ASN C 3 822 ? -141.961 -59.659 -15.463 1.00 0.00 ? 825 ASN M O   1  
ATOM 8589   C CB  . ASN C 3 822 ? -138.685 -59.312 -15.642 1.00 0.00 ? 825 ASN M CB  1  
ATOM 8590   C CG  . ASN C 3 822 ? -137.859 -59.014 -16.848 1.00 0.00 ? 825 ASN M CG  1  
ATOM 8591   O OD1 . ASN C 3 822 ? -137.410 -57.860 -17.061 1.00 0.00 ? 825 ASN M OD1 1  
ATOM 8592   N ND2 . ASN C 3 822 ? -137.708 -60.030 -17.677 1.00 0.00 ? 825 ASN M ND2 1  
ATOM 8593   N N   . VAL C 3 823 ? -140.699 -59.300 -13.623 1.00 0.00 ? 826 VAL M N   1  
ATOM 8594   C CA  . VAL C 3 823 ? -141.503 -60.035 -12.738 1.00 0.00 ? 826 VAL M CA  1  
ATOM 8595   C C   . VAL C 3 823 ? -142.826 -59.419 -12.415 1.00 0.00 ? 826 VAL M C   1  
ATOM 8596   O O   . VAL C 3 823 ? -143.845 -60.074 -12.557 1.00 0.00 ? 826 VAL M O   1  
ATOM 8597   C CB  . VAL C 3 823 ? -140.726 -60.426 -11.502 1.00 0.00 ? 826 VAL M CB  1  
ATOM 8598   C CG1 . VAL C 3 823 ? -141.672 -61.135 -10.547 1.00 0.00 ? 826 VAL M CG1 1  
ATOM 8599   C CG2 . VAL C 3 823 ? -139.611 -61.374 -11.920 1.00 0.00 ? 826 VAL M CG2 1  
ATOM 8600   N N   . LYS C 3 824 ? -142.798 -58.183 -11.951 1.00 0.00 ? 827 LYS M N   1  
ATOM 8601   C CA  . LYS C 3 824 ? -143.973 -57.426 -11.559 1.00 0.00 ? 827 LYS M CA  1  
ATOM 8602   C C   . LYS C 3 824 ? -145.179 -57.629 -12.480 1.00 0.00 ? 827 LYS M C   1  
ATOM 8603   O O   . LYS C 3 824 ? -146.302 -57.368 -12.051 1.00 0.00 ? 827 LYS M O   1  
ATOM 8604   C CB  . LYS C 3 824 ? -143.653 -55.954 -11.431 1.00 0.00 ? 827 LYS M CB  1  
ATOM 8605   C CG  . LYS C 3 824 ? -143.732 -55.226 -12.778 1.00 0.00 ? 827 LYS M CG  1  
ATOM 8606   C CD  . LYS C 3 824 ? -143.844 -53.718 -12.583 1.00 0.00 ? 827 LYS M CD  1  
ATOM 8607   C CE  . LYS C 3 824 ? -143.521 -52.929 -13.845 1.00 0.00 ? 827 LYS M CE  1  
ATOM 8608   N NZ  . LYS C 3 824 ? -143.833 -51.491 -13.749 1.00 0.00 ? 827 LYS M NZ  1  
ATOM 8609   N N   . HIS C 3 825 ? -144.947 -58.121 -13.721 1.00 0.00 ? 828 HIS M N   1  
ATOM 8610   C CA  . HIS C 3 825 ? -146.069 -58.329 -14.640 1.00 0.00 ? 828 HIS M CA  1  
ATOM 8611   C C   . HIS C 3 825 ? -146.555 -59.796 -14.663 1.00 0.00 ? 828 HIS M C   1  
ATOM 8612   O O   . HIS C 3 825 ? -147.564 -60.097 -15.272 1.00 0.00 ? 828 HIS M O   1  
ATOM 8613   C CB  . HIS C 3 825 ? -145.822 -57.762 -16.077 1.00 0.00 ? 828 HIS M CB  1  
ATOM 8614   C CG  . HIS C 3 825 ? -146.176 -56.288 -16.358 1.00 0.00 ? 828 HIS M CG  1  
ATOM 8615   N ND1 . HIS C 3 825 ? -147.340 -55.661 -15.883 1.00 0.00 ? 828 HIS M ND1 1  
ATOM 8616   C CD2 . HIS C 3 825 ? -145.518 -55.351 -17.147 1.00 0.00 ? 828 HIS M CD2 1  
ATOM 8617   C CE1 . HIS C 3 825 ? -147.329 -54.386 -16.350 1.00 0.00 ? 828 HIS M CE1 1  
ATOM 8618   N NE2 . HIS C 3 825 ? -146.247 -54.160 -17.118 1.00 0.00 ? 828 HIS M NE2 1  
ATOM 8619   N N   . TRP C 3 826 ? -145.817 -60.707 -13.994 1.00 0.00 ? 829 TRP M N   1  
ATOM 8620   C CA  . TRP C 3 826 ? -146.030 -62.182 -13.864 1.00 0.00 ? 829 TRP M CA  1  
ATOM 8621   C C   . TRP C 3 826 ? -147.072 -62.648 -12.814 1.00 0.00 ? 829 TRP M C   1  
ATOM 8622   O O   . TRP C 3 826 ? -146.877 -62.488 -11.600 1.00 0.00 ? 829 TRP M O   1  
ATOM 8623   C CB  . TRP C 3 826 ? -144.673 -62.802 -13.421 1.00 0.00 ? 829 TRP M CB  1  
ATOM 8624   C CG  . TRP C 3 826 ? -144.516 -64.226 -13.725 1.00 0.00 ? 829 TRP M CG  1  
ATOM 8625   C CD1 . TRP C 3 826 ? -144.889 -64.819 -14.872 1.00 0.00 ? 829 TRP M CD1 1  
ATOM 8626   C CD2 . TRP C 3 826 ? -143.880 -65.238 -12.922 1.00 0.00 ? 829 TRP M CD2 1  
ATOM 8627   N NE1 . TRP C 3 826 ? -144.608 -66.154 -14.800 1.00 0.00 ? 829 TRP M NE1 1  
ATOM 8628   C CE2 . TRP C 3 826 ? -143.979 -66.436 -13.612 1.00 0.00 ? 829 TRP M CE2 1  
ATOM 8629   C CE3 . TRP C 3 826 ? -143.246 -65.265 -11.713 1.00 0.00 ? 829 TRP M CE3 1  
ATOM 8630   C CZ2 . TRP C 3 826 ? -143.539 -67.637 -13.075 1.00 0.00 ? 829 TRP M CZ2 1  
ATOM 8631   C CZ3 . TRP C 3 826 ? -142.756 -66.456 -11.192 1.00 0.00 ? 829 TRP M CZ3 1  
ATOM 8632   C CH2 . TRP C 3 826 ? -142.888 -67.611 -11.880 1.00 0.00 ? 829 TRP M CH2 1  
ATOM 8633   N N   . PRO C 3 827 ? -148.139 -63.290 -13.288 1.00 0.00 ? 830 PRO M N   1  
ATOM 8634   C CA  . PRO C 3 827 ? -149.234 -63.808 -12.485 1.00 0.00 ? 830 PRO M CA  1  
ATOM 8635   C C   . PRO C 3 827 ? -148.800 -64.320 -11.142 1.00 0.00 ? 830 PRO M C   1  
ATOM 8636   O O   . PRO C 3 827 ? -149.199 -63.804 -10.080 1.00 0.00 ? 830 PRO M O   1  
ATOM 8637   C CB  . PRO C 3 827 ? -149.805 -64.929 -13.308 1.00 0.00 ? 830 PRO M CB  1  
ATOM 8638   C CG  . PRO C 3 827 ? -149.342 -64.719 -14.739 1.00 0.00 ? 830 PRO M CG  1  
ATOM 8639   C CD  . PRO C 3 827 ? -148.335 -63.613 -14.705 1.00 0.00 ? 830 PRO M CD  1  
ATOM 8640   N N   . TRP C 3 828 ? -147.896 -65.260 -11.246 1.00 0.00 ? 831 TRP M N   1  
ATOM 8641   C CA  . TRP C 3 828 ? -147.338 -65.953 -10.107 1.00 0.00 ? 831 TRP M CA  1  
ATOM 8642   C C   . TRP C 3 828 ? -146.721 -64.997 -9.166  1.00 0.00 ? 831 TRP M C   1  
ATOM 8643   O O   . TRP C 3 828 ? -146.729 -65.199 -7.970  1.00 0.00 ? 831 TRP M O   1  
ATOM 8644   C CB  . TRP C 3 828 ? -146.295 -66.952 -10.587 1.00 0.00 ? 831 TRP M CB  1  
ATOM 8645   C CG  . TRP C 3 828 ? -146.958 -68.047 -11.330 1.00 0.00 ? 831 TRP M CG  1  
ATOM 8646   C CD1 . TRP C 3 828 ? -147.066 -68.188 -12.670 1.00 0.00 ? 831 TRP M CD1 1  
ATOM 8647   C CD2 . TRP C 3 828 ? -147.646 -69.126 -10.743 1.00 0.00 ? 831 TRP M CD2 1  
ATOM 8648   N NE1 . TRP C 3 828 ? -147.773 -69.327 -12.955 1.00 0.00 ? 831 TRP M NE1 1  
ATOM 8649   C CE2 . TRP C 3 828 ? -148.160 -69.910 -11.787 1.00 0.00 ? 831 TRP M CE2 1  
ATOM 8650   C CE3 . TRP C 3 828 ? -147.876 -69.504 -9.434  1.00 0.00 ? 831 TRP M CE3 1  
ATOM 8651   C CZ2 . TRP C 3 828 ? -148.875 -71.035 -11.527 1.00 0.00 ? 831 TRP M CZ2 1  
ATOM 8652   C CZ3 . TRP C 3 828 ? -148.589 -70.632 -9.170  1.00 0.00 ? 831 TRP M CZ3 1  
ATOM 8653   C CH2 . TRP C 3 828 ? -149.067 -71.390 -10.209 1.00 0.00 ? 831 TRP M CH2 1  
ATOM 8654   N N   . MET C 3 829 ? -146.123 -63.963 -9.728  1.00 0.00 ? 832 MET M N   1  
ATOM 8655   C CA  . MET C 3 829 ? -145.493 -63.046 -8.813  1.00 0.00 ? 832 MET M CA  1  
ATOM 8656   C C   . MET C 3 829 ? -146.503 -62.111 -8.162  1.00 0.00 ? 832 MET M C   1  
ATOM 8657   O O   . MET C 3 829 ? -146.392 -61.861 -6.985  1.00 0.00 ? 832 MET M O   1  
ATOM 8658   C CB  . MET C 3 829 ? -144.123 -62.494 -9.172  1.00 0.00 ? 832 MET M CB  1  
ATOM 8659   C CG  . MET C 3 829 ? -143.349 -62.023 -7.960  1.00 0.00 ? 832 MET M CG  1  
ATOM 8660   S SD  . MET C 3 829 ? -142.004 -63.033 -7.618  1.00 0.00 ? 832 MET M SD  1  
ATOM 8661   C CE  . MET C 3 829 ? -141.348 -62.155 -6.194  1.00 0.00 ? 832 MET M CE  1  
ATOM 8662   N N   . LYS C 3 830 ? -147.546 -61.707 -8.873  1.00 0.00 ? 833 LYS M N   1  
ATOM 8663   C CA  . LYS C 3 830 ? -148.546 -60.908 -8.271  1.00 0.00 ? 833 LYS M CA  1  
ATOM 8664   C C   . LYS C 3 830 ? -149.222 -61.673 -7.192  1.00 0.00 ? 833 LYS M C   1  
ATOM 8665   O O   . LYS C 3 830 ? -149.568 -61.156 -6.128  1.00 0.00 ? 833 LYS M O   1  
ATOM 8666   C CB  . LYS C 3 830 ? -149.614 -60.474 -9.231  1.00 0.00 ? 833 LYS M CB  1  
ATOM 8667   C CG  . LYS C 3 830 ? -149.133 -60.304 -10.615 1.00 0.00 ? 833 LYS M CG  1  
ATOM 8668   C CD  . LYS C 3 830 ? -149.611 -58.998 -11.241 1.00 0.00 ? 833 LYS M CD  1  
ATOM 8669   C CE  . LYS C 3 830 ? -150.097 -59.206 -12.686 1.00 0.00 ? 833 LYS M CE  1  
ATOM 8670   N NZ  . LYS C 3 830 ? -150.797 -58.029 -13.222 1.00 0.00 ? 833 LYS M NZ  1  
ATOM 8671   N N   . LEU C 3 831 ? -149.430 -62.924 -7.492  1.00 0.00 ? 834 LEU M N   1  
ATOM 8672   C CA  . LEU C 3 831 ? -150.070 -63.829 -6.534  1.00 0.00 ? 834 LEU M CA  1  
ATOM 8673   C C   . LEU C 3 831 ? -149.315 -63.838 -5.228  1.00 0.00 ? 834 LEU M C   1  
ATOM 8674   O O   . LEU C 3 831 ? -149.854 -63.521 -4.168  1.00 0.00 ? 834 LEU M O   1  
ATOM 8675   C CB  . LEU C 3 831 ? -150.176 -65.227 -7.076  1.00 0.00 ? 834 LEU M CB  1  
ATOM 8676   C CG  . LEU C 3 831 ? -151.223 -66.074 -6.335  1.00 0.00 ? 834 LEU M CG  1  
ATOM 8677   C CD1 . LEU C 3 831 ? -152.381 -66.498 -7.232  1.00 0.00 ? 834 LEU M CD1 1  
ATOM 8678   C CD2 . LEU C 3 831 ? -150.559 -67.334 -5.903  1.00 0.00 ? 834 LEU M CD2 1  
ATOM 8679   N N   . PHE C 3 832 ? -148.038 -64.178 -5.345  1.00 0.00 ? 835 PHE M N   1  
ATOM 8680   C CA  . PHE C 3 832 ? -147.130 -64.214 -4.182  1.00 0.00 ? 835 PHE M CA  1  
ATOM 8681   C C   . PHE C 3 832 ? -147.243 -62.931 -3.404  1.00 0.00 ? 835 PHE M C   1  
ATOM 8682   O O   . PHE C 3 832 ? -147.122 -62.881 -2.211  1.00 0.00 ? 835 PHE M O   1  
ATOM 8683   C CB  . PHE C 3 832 ? -145.709 -64.182 -4.715  1.00 0.00 ? 835 PHE M CB  1  
ATOM 8684   C CG  . PHE C 3 832 ? -144.645 -64.341 -3.680  1.00 0.00 ? 835 PHE M CG  1  
ATOM 8685   C CD1 . PHE C 3 832 ? -144.684 -65.401 -2.777  1.00 0.00 ? 835 PHE M CD1 1  
ATOM 8686   C CD2 . PHE C 3 832 ? -143.536 -63.500 -3.661  1.00 0.00 ? 835 PHE M CD2 1  
ATOM 8687   C CE1 . PHE C 3 832 ? -143.678 -65.613 -1.833  1.00 0.00 ? 835 PHE M CE1 1  
ATOM 8688   C CE2 . PHE C 3 832 ? -142.527 -63.689 -2.720  1.00 0.00 ? 835 PHE M CE2 1  
ATOM 8689   C CZ  . PHE C 3 832 ? -142.591 -64.746 -1.828  1.00 0.00 ? 835 PHE M CZ  1  
ATOM 8690   N N   . PHE C 3 833 ? -147.437 -61.882 -4.179  1.00 0.00 ? 836 PHE M N   1  
ATOM 8691   C CA  . PHE C 3 833 ? -147.543 -60.560 -3.641  1.00 0.00 ? 836 PHE M CA  1  
ATOM 8692   C C   . PHE C 3 833 ? -148.781 -60.393 -2.789  1.00 0.00 ? 836 PHE M C   1  
ATOM 8693   O O   . PHE C 3 833 ? -148.673 -60.059 -1.601  1.00 0.00 ? 836 PHE M O   1  
ATOM 8694   C CB  . PHE C 3 833 ? -147.376 -59.491 -4.711  1.00 0.00 ? 836 PHE M CB  1  
ATOM 8695   C CG  . PHE C 3 833 ? -145.919 -59.273 -5.064  1.00 0.00 ? 836 PHE M CG  1  
ATOM 8696   C CD1 . PHE C 3 833 ? -144.872 -59.597 -4.203  1.00 0.00 ? 836 PHE M CD1 1  
ATOM 8697   C CD2 . PHE C 3 833 ? -145.589 -58.693 -6.290  1.00 0.00 ? 836 PHE M CD2 1  
ATOM 8698   C CE1 . PHE C 3 833 ? -143.532 -59.346 -4.545  1.00 0.00 ? 836 PHE M CE1 1  
ATOM 8699   C CE2 . PHE C 3 833 ? -144.264 -58.474 -6.664  1.00 0.00 ? 836 PHE M CE2 1  
ATOM 8700   C CZ  . PHE C 3 833 ? -143.221 -58.812 -5.794  1.00 0.00 ? 836 PHE M CZ  1  
ATOM 8701   N N   . LYS C 3 834 ? -149.963 -60.636 -3.352  1.00 0.00 ? 837 LYS M N   1  
ATOM 8702   C CA  . LYS C 3 834 ? -151.129 -60.448 -2.516  1.00 0.00 ? 837 LYS M CA  1  
ATOM 8703   C C   . LYS C 3 834 ? -151.028 -61.386 -1.330  1.00 0.00 ? 837 LYS M C   1  
ATOM 8704   O O   . LYS C 3 834 ? -151.337 -61.071 -0.210  1.00 0.00 ? 837 LYS M O   1  
ATOM 8705   C CB  . LYS C 3 834 ? -152.413 -60.656 -3.307  1.00 0.00 ? 837 LYS M CB  1  
ATOM 8706   C CG  . LYS C 3 834 ? -152.299 -60.199 -4.742  1.00 0.00 ? 837 LYS M CG  1  
ATOM 8707   C CD  . LYS C 3 834 ? -153.491 -59.368 -5.233  1.00 0.00 ? 837 LYS M CD  1  
ATOM 8708   C CE  . LYS C 3 834 ? -153.779 -59.556 -6.708  1.00 0.00 ? 837 LYS M CE  1  
ATOM 8709   N NZ  . LYS C 3 834 ? -154.967 -58.807 -7.134  1.00 0.00 ? 837 LYS M NZ  1  
ATOM 8710   N N   . ILE C 3 835 ? -150.495 -62.540 -1.603  1.00 0.00 ? 838 ILE M N   1  
ATOM 8711   C CA  . ILE C 3 835 ? -150.388 -63.586 -0.595  1.00 0.00 ? 838 ILE M CA  1  
ATOM 8712   C C   . ILE C 3 835 ? -149.297 -63.424 0.456   1.00 0.00 ? 838 ILE M C   1  
ATOM 8713   O O   . ILE C 3 835 ? -149.519 -63.708 1.596   1.00 0.00 ? 838 ILE M O   1  
ATOM 8714   C CB  . ILE C 3 835 ? -150.567 -64.949 -1.247  1.00 0.00 ? 838 ILE M CB  1  
ATOM 8715   C CG1 . ILE C 3 835 ? -151.910 -65.458 -0.956  1.00 0.00 ? 838 ILE M CG1 1  
ATOM 8716   C CG2 . ILE C 3 835 ? -149.541 -66.011 -0.973  1.00 0.00 ? 838 ILE M CG2 1  
ATOM 8717   C CD1 . ILE C 3 835 ? -152.250 -66.518 -1.973  1.00 0.00 ? 838 ILE M CD1 1  
ATOM 8718   N N   . LYS C 3 836 ? -148.154 -62.888 0.055   1.00 0.00 ? 839 LYS M N   1  
ATOM 8719   C CA  . LYS C 3 836 ? -147.008 -62.656 0.926   1.00 0.00 ? 839 LYS M CA  1  
ATOM 8720   C C   . LYS C 3 836 ? -147.369 -62.114 2.284   1.00 0.00 ? 839 LYS M C   1  
ATOM 8721   O O   . LYS C 3 836 ? -146.606 -62.166 3.218   1.00 0.00 ? 839 LYS M O   1  
ATOM 8722   C CB  . LYS C 3 836 ? -146.065 -61.642 0.324   1.00 0.00 ? 839 LYS M CB  1  
ATOM 8723   C CG  . LYS C 3 836 ? -144.821 -61.360 1.186   1.00 0.00 ? 839 LYS M CG  1  
ATOM 8724   C CD  . LYS C 3 836 ? -143.603 -60.865 0.395   1.00 0.00 ? 839 LYS M CD  1  
ATOM 8725   C CE  . LYS C 3 836 ? -142.271 -61.367 0.952   1.00 0.00 ? 839 LYS M CE  1  
ATOM 8726   N NZ  . LYS C 3 836 ? -141.136 -60.612 0.407   1.00 0.00 ? 839 LYS M NZ  1  
ATOM 8727   N N   . PRO C 3 837 ? -148.508 -61.495 2.419   1.00 0.00 ? 840 PRO M N   1  
ATOM 8728   C CA  . PRO C 3 837 ? -148.813 -60.953 3.725   1.00 0.00 ? 840 PRO M CA  1  
ATOM 8729   C C   . PRO C 3 837 ? -149.411 -61.911 4.705   1.00 0.00 ? 840 PRO M C   1  
ATOM 8730   O O   . PRO C 3 837 ? -149.002 -61.949 5.863   1.00 0.00 ? 840 PRO M O   1  
ATOM 8731   C CB  . PRO C 3 837 ? -149.697 -59.721 3.500   1.00 0.00 ? 840 PRO M CB  1  
ATOM 8732   C CG  . PRO C 3 837 ? -149.837 -59.535 2.011   1.00 0.00 ? 840 PRO M CG  1  
ATOM 8733   C CD  . PRO C 3 837 ? -149.006 -60.607 1.331   1.00 0.00 ? 840 PRO M CD  1  
ATOM 8734   N N   . LEU C 3 838 ? -150.398 -62.699 4.246   1.00 0.00 ? 841 LEU M N   1  
ATOM 8735   C CA  . LEU C 3 838 ? -151.056 -63.675 5.120   1.00 0.00 ? 841 LEU M CA  1  
ATOM 8736   C C   . LEU C 3 838 ? -150.061 -64.574 5.873   1.00 0.00 ? 841 LEU M C   1  
ATOM 8737   O O   . LEU C 3 838 ? -150.415 -65.284 6.789   1.00 0.00 ? 841 LEU M O   1  
ATOM 8738   C CB  . LEU C 3 838 ? -151.993 -64.582 4.303   1.00 0.00 ? 841 LEU M CB  1  
ATOM 8739   C CG  . LEU C 3 838 ? -153.351 -64.035 4.063   1.00 0.00 ? 841 LEU M CG  1  
ATOM 8740   C CD1 . LEU C 3 838 ? -153.231 -62.773 3.217   1.00 0.00 ? 841 LEU M CD1 1  
ATOM 8741   C CD2 . LEU C 3 838 ? -154.263 -65.047 3.342   1.00 0.00 ? 841 LEU M CD2 1  
ATOM 8742   N N   . LEU C 3 839 ? -148.826 -64.547 5.408   1.00 0.00 ? 842 LEU M N   1  
ATOM 8743   C CA  . LEU C 3 839 ? -147.819 -65.377 5.969   1.00 0.00 ? 842 LEU M CA  1  
ATOM 8744   C C   . LEU C 3 839 ? -147.295 -64.828 7.244   1.00 0.00 ? 842 LEU M C   1  
ATOM 8745   O O   . LEU C 3 839 ? -147.561 -63.709 7.629   1.00 0.00 ? 842 LEU M O   1  
ATOM 8746   C CB  . LEU C 3 839 ? -146.602 -65.415 5.070   1.00 0.00 ? 842 LEU M CB  1  
ATOM 8747   C CG  . LEU C 3 839 ? -146.742 -66.417 3.948   1.00 0.00 ? 842 LEU M CG  1  
ATOM 8748   C CD1 . LEU C 3 839 ? -148.201 -66.625 3.599   1.00 0.00 ? 842 LEU M CD1 1  
ATOM 8749   C CD2 . LEU C 3 839 ? -146.034 -65.956 2.686   1.00 0.00 ? 842 LEU M CD2 1  
ATOM 8750   N N   . LYS C 3 840 ? -146.470 -65.666 7.835   1.00 0.00 ? 843 LYS M N   1  
ATOM 8751   C CA  . LYS C 3 840 ? -145.822 -65.316 9.081   1.00 0.00 ? 843 LYS M CA  1  
ATOM 8752   C C   . LYS C 3 840 ? -144.420 -65.922 9.108   1.00 0.00 ? 843 LYS M C   1  
ATOM 8753   O O   . LYS C 3 840 ? -144.266 -67.114 8.859   1.00 0.00 ? 843 LYS M O   1  
ATOM 8754   C CB  . LYS C 3 840 ? -146.634 -65.758 10.292  1.00 0.00 ? 843 LYS M CB  1  
ATOM 8755   C CG  . LYS C 3 840 ? -146.939 -67.264 10.305  1.00 0.00 ? 843 LYS M CG  1  
ATOM 8756   C CD  . LYS C 3 840 ? -148.140 -67.624 11.187  1.00 0.00 ? 843 LYS M CD  1  
ATOM 8757   C CE  . LYS C 3 840 ? -147.771 -68.017 12.615  1.00 0.00 ? 843 LYS M CE  1  
ATOM 8758   N NZ  . LYS C 3 840 ? -148.432 -69.251 13.067  1.00 0.00 ? 843 LYS M NZ  1  
ATOM 8759   N N   . ASN A 1 1   ? -154.580 -34.157 -19.398 1.00 0.00 ? 14  ASN B N   2  
ATOM 8760   C CA  . ASN A 1 1   ? -153.636 -33.201 -18.782 1.00 0.00 ? 14  ASN B CA  2  
ATOM 8761   C C   . ASN A 1 1   ? -154.351 -32.319 -17.740 1.00 0.00 ? 14  ASN B C   2  
ATOM 8762   O O   . ASN A 1 1   ? -153.898 -32.024 -16.630 1.00 0.00 ? 14  ASN B O   2  
ATOM 8763   C CB  . ASN A 1 1   ? -153.036 -32.314 -19.864 1.00 0.00 ? 14  ASN B CB  2  
ATOM 8764   C CG  . ASN A 1 1   ? -151.512 -32.333 -19.905 1.00 0.00 ? 14  ASN B CG  2  
ATOM 8765   O OD1 . ASN A 1 1   ? -150.836 -33.083 -19.218 1.00 0.00 ? 14  ASN B OD1 2  
ATOM 8766   N ND2 . ASN A 1 1   ? -150.843 -31.543 -20.705 1.00 0.00 ? 14  ASN B ND2 2  
ATOM 8767   N N   . VAL A 1 2   ? -155.583 -32.024 -18.149 1.00 0.00 ? 15  VAL B N   2  
ATOM 8768   C CA  . VAL A 1 2   ? -156.582 -31.259 -17.417 1.00 0.00 ? 15  VAL B CA  2  
ATOM 8769   C C   . VAL A 1 2   ? -157.210 -31.829 -16.140 1.00 0.00 ? 15  VAL B C   2  
ATOM 8770   O O   . VAL A 1 2   ? -157.892 -31.123 -15.396 1.00 0.00 ? 15  VAL B O   2  
ATOM 8771   C CB  . VAL A 1 2   ? -157.558 -30.923 -18.533 1.00 0.00 ? 15  VAL B CB  2  
ATOM 8772   C CG1 . VAL A 1 2   ? -159.004 -30.633 -18.177 1.00 0.00 ? 15  VAL B CG1 2  
ATOM 8773   C CG2 . VAL A 1 2   ? -156.785 -29.795 -19.176 1.00 0.00 ? 15  VAL B CG2 2  
ATOM 8774   N N   . PHE A 1 3   ? -157.043 -33.116 -15.865 1.00 0.00 ? 16  PHE B N   2  
ATOM 8775   C CA  . PHE A 1 3   ? -157.338 -33.585 -14.515 1.00 0.00 ? 16  PHE B CA  2  
ATOM 8776   C C   . PHE A 1 3   ? -156.065 -33.830 -13.674 1.00 0.00 ? 16  PHE B C   2  
ATOM 8777   O O   . PHE A 1 3   ? -156.135 -33.973 -12.459 1.00 0.00 ? 16  PHE B O   2  
ATOM 8778   C CB  . PHE A 1 3   ? -158.172 -34.867 -14.587 1.00 0.00 ? 16  PHE B CB  2  
ATOM 8779   C CG  . PHE A 1 3   ? -159.630 -34.680 -14.159 1.00 0.00 ? 16  PHE B CG  2  
ATOM 8780   C CD1 . PHE A 1 3   ? -160.563 -35.643 -14.494 1.00 0.00 ? 16  PHE B CD1 2  
ATOM 8781   C CD2 . PHE A 1 3   ? -160.040 -33.569 -13.434 1.00 0.00 ? 16  PHE B CD2 2  
ATOM 8782   C CE1 . PHE A 1 3   ? -161.882 -35.500 -14.106 1.00 0.00 ? 16  PHE B CE1 2  
ATOM 8783   C CE2 . PHE A 1 3   ? -161.354 -33.431 -13.050 1.00 0.00 ? 16  PHE B CE2 2  
ATOM 8784   C CZ  . PHE A 1 3   ? -162.281 -34.397 -13.384 1.00 0.00 ? 16  PHE B CZ  2  
ATOM 8785   N N   . SER A 1 4   ? -154.870 -33.858 -14.284 1.00 0.00 ? 17  SER B N   2  
ATOM 8786   C CA  . SER A 1 4   ? -153.598 -34.056 -13.561 1.00 0.00 ? 17  SER B CA  2  
ATOM 8787   C C   . SER A 1 4   ? -152.900 -33.002 -12.684 1.00 0.00 ? 17  SER B C   2  
ATOM 8788   O O   . SER A 1 4   ? -152.148 -33.383 -11.788 1.00 0.00 ? 17  SER B O   2  
ATOM 8789   C CB  . SER A 1 4   ? -152.506 -34.525 -14.513 1.00 0.00 ? 17  SER B CB  2  
ATOM 8790   O OG  . SER A 1 4   ? -152.684 -35.891 -14.874 1.00 0.00 ? 17  SER B OG  2  
ATOM 8791   N N   . MET A 1 5   ? -152.912 -31.690 -12.958 1.00 0.00 ? 18  MET B N   2  
ATOM 8792   C CA  . MET A 1 5   ? -152.494 -30.671 -11.953 1.00 0.00 ? 18  MET B CA  2  
ATOM 8793   C C   . MET A 1 5   ? -153.788 -30.597 -11.092 1.00 0.00 ? 18  MET B C   2  
ATOM 8794   O O   . MET A 1 5   ? -154.084 -31.545 -10.372 1.00 0.00 ? 18  MET B O   2  
ATOM 8795   C CB  . MET A 1 5   ? -152.200 -29.323 -12.648 1.00 0.00 ? 18  MET B CB  2  
ATOM 8796   C CG  . MET A 1 5   ? -151.327 -29.395 -13.902 1.00 0.00 ? 18  MET B CG  2  
ATOM 8797   S SD  . MET A 1 5   ? -151.591 -28.006 -15.033 1.00 0.00 ? 18  MET B SD  2  
ATOM 8798   C CE  . MET A 1 5   ? -149.918 -27.465 -15.229 1.00 0.00 ? 18  MET B CE  2  
ATOM 8799   N N   . PHE A 1 6   ? -154.600 -29.533 -11.117 1.00 0.00 ? 19  PHE B N   2  
ATOM 8800   C CA  . PHE A 1 6   ? -156.018 -29.575 -10.717 1.00 0.00 ? 19  PHE B CA  2  
ATOM 8801   C C   . PHE A 1 6   ? -156.530 -30.172 -9.399  1.00 0.00 ? 19  PHE B C   2  
ATOM 8802   O O   . PHE A 1 6   ? -157.340 -31.103 -9.315  1.00 0.00 ? 19  PHE B O   2  
ATOM 8803   C CB  . PHE A 1 6   ? -156.767 -30.203 -11.930 1.00 0.00 ? 19  PHE B CB  2  
ATOM 8804   C CG  . PHE A 1 6   ? -156.338 -29.552 -13.245 1.00 0.00 ? 19  PHE B CG  2  
ATOM 8805   C CD1 . PHE A 1 6   ? -155.326 -30.126 -13.989 1.00 0.00 ? 19  PHE B CD1 2  
ATOM 8806   C CD2 . PHE A 1 6   ? -156.889 -28.360 -13.667 1.00 0.00 ? 19  PHE B CD2 2  
ATOM 8807   C CE1 . PHE A 1 6   ? -154.856 -29.524 -15.128 1.00 0.00 ? 19  PHE B CE1 2  
ATOM 8808   C CE2 . PHE A 1 6   ? -156.412 -27.760 -14.820 1.00 0.00 ? 19  PHE B CE2 2  
ATOM 8809   C CZ  . PHE A 1 6   ? -155.398 -28.333 -15.551 1.00 0.00 ? 19  PHE B CZ  2  
ATOM 8810   N N   . ASP A 1 7   ? -156.098 -29.526 -8.327  1.00 0.00 ? 20  ASP B N   2  
ATOM 8811   C CA  . ASP A 1 7   ? -156.445 -29.904 -6.971  1.00 0.00 ? 20  ASP B CA  2  
ATOM 8812   C C   . ASP A 1 7   ? -157.899 -29.701 -6.514  1.00 0.00 ? 20  ASP B C   2  
ATOM 8813   O O   . ASP A 1 7   ? -158.668 -28.885 -7.040  1.00 0.00 ? 20  ASP B O   2  
ATOM 8814   C CB  . ASP A 1 7   ? -155.516 -29.149 -6.020  1.00 0.00 ? 20  ASP B CB  2  
ATOM 8815   C CG  . ASP A 1 7   ? -154.046 -29.549 -6.070  1.00 0.00 ? 20  ASP B CG  2  
ATOM 8816   O OD1 . ASP A 1 7   ? -153.489 -29.782 -7.141  1.00 0.00 ? 20  ASP B OD1 2  
ATOM 8817   O OD2 . ASP A 1 7   ? -153.451 -29.629 -5.000  1.00 0.00 ? 20  ASP B OD2 2  
ATOM 8818   N N   . GLN A 1 8   ? -158.326 -30.407 -5.458  1.00 0.00 ? 21  GLN B N   2  
ATOM 8819   C CA  . GLN A 1 8   ? -159.682 -30.298 -4.904  1.00 0.00 ? 21  GLN B CA  2  
ATOM 8820   C C   . GLN A 1 8   ? -160.190 -28.881 -4.649  1.00 0.00 ? 21  GLN B C   2  
ATOM 8821   O O   . GLN A 1 8   ? -161.266 -28.520 -5.105  1.00 0.00 ? 21  GLN B O   2  
ATOM 8822   C CB  . GLN A 1 8   ? -159.750 -31.091 -3.617  1.00 0.00 ? 21  GLN B CB  2  
ATOM 8823   C CG  . GLN A 1 8   ? -159.611 -32.572 -3.951  1.00 0.00 ? 21  GLN B CG  2  
ATOM 8824   C CD  . GLN A 1 8   ? -159.349 -33.530 -2.794  1.00 0.00 ? 21  GLN B CD  2  
ATOM 8825   O OE1 . GLN A 1 8   ? -159.037 -33.094 -1.687  1.00 0.00 ? 21  GLN B OE1 2  
ATOM 8826   N NE2 . GLN A 1 8   ? -159.435 -34.732 -3.028  1.00 0.00 ? 21  GLN B NE2 2  
ATOM 8827   N N   . THR A 1 9   ? -159.333 -28.019 -4.086  1.00 0.00 ? 22  THR B N   2  
ATOM 8828   C CA  . THR A 1 9   ? -159.633 -26.591 -3.885  1.00 0.00 ? 22  THR B CA  2  
ATOM 8829   C C   . THR A 1 9   ? -159.971 -25.883 -5.203  1.00 0.00 ? 22  THR B C   2  
ATOM 8830   O O   . THR A 1 9   ? -161.087 -25.407 -5.356  1.00 0.00 ? 22  THR B O   2  
ATOM 8831   C CB  . THR A 1 9   ? -158.449 -25.838 -3.262  1.00 0.00 ? 22  THR B CB  2  
ATOM 8832   O OG1 . THR A 1 9   ? -157.262 -26.270 -3.931  1.00 0.00 ? 22  THR B OG1 2  
ATOM 8833   C CG2 . THR A 1 9   ? -158.354 -26.083 -1.766  1.00 0.00 ? 22  THR B CG2 2  
ATOM 8834   N N   . GLN A 1 10  ? -159.077 -25.896 -6.206  1.00 0.00 ? 23  GLN B N   2  
ATOM 8835   C CA  . GLN A 1 10  ? -159.356 -25.371 -7.555  1.00 0.00 ? 23  GLN B CA  2  
ATOM 8836   C C   . GLN A 1 10  ? -160.713 -25.833 -8.107  1.00 0.00 ? 23  GLN B C   2  
ATOM 8837   O O   . GLN A 1 10  ? -161.578 -25.068 -8.541  1.00 0.00 ? 23  GLN B O   2  
ATOM 8838   C CB  . GLN A 1 10  ? -158.324 -25.843 -8.570  1.00 0.00 ? 23  GLN B CB  2  
ATOM 8839   C CG  . GLN A 1 10  ? -156.866 -25.451 -8.417  1.00 0.00 ? 23  GLN B CG  2  
ATOM 8840   C CD  . GLN A 1 10  ? -155.973 -26.165 -9.421  1.00 0.00 ? 23  GLN B CD  2  
ATOM 8841   O OE1 . GLN A 1 10  ? -156.255 -26.157 -10.616 1.00 0.00 ? 23  GLN B OE1 2  
ATOM 8842   N NE2 . GLN A 1 10  ? -154.985 -26.761 -9.007  1.00 0.00 ? 23  GLN B NE2 2  
ATOM 8843   N N   . ILE A 1 11  ? -160.945 -27.149 -8.034  1.00 0.00 ? 24  ILE B N   2  
ATOM 8844   C CA  . ILE A 1 11  ? -162.208 -27.747 -8.458  1.00 0.00 ? 24  ILE B CA  2  
ATOM 8845   C C   . ILE A 1 11  ? -163.408 -27.233 -7.642  1.00 0.00 ? 24  ILE B C   2  
ATOM 8846   O O   . ILE A 1 11  ? -164.495 -27.040 -8.193  1.00 0.00 ? 24  ILE B O   2  
ATOM 8847   C CB  . ILE A 1 11  ? -162.093 -29.292 -8.358  1.00 0.00 ? 24  ILE B CB  2  
ATOM 8848   C CG1 . ILE A 1 11  ? -160.955 -29.815 -9.232  1.00 0.00 ? 24  ILE B CG1 2  
ATOM 8849   C CG2 . ILE A 1 11  ? -163.372 -29.938 -8.886  1.00 0.00 ? 24  ILE B CG2 2  
ATOM 8850   C CD1 . ILE A 1 11  ? -160.656 -31.316 -9.035  1.00 0.00 ? 24  ILE B CD1 2  
ATOM 8851   N N   . GLN A 1 12  ? -163.313 -27.019 -6.329  1.00 0.00 ? 25  GLN B N   2  
ATOM 8852   C CA  . GLN A 1 12  ? -164.388 -26.418 -5.537  1.00 0.00 ? 25  GLN B CA  2  
ATOM 8853   C C   . GLN A 1 12  ? -164.652 -24.960 -5.896  1.00 0.00 ? 25  GLN B C   2  
ATOM 8854   O O   . GLN A 1 12  ? -165.813 -24.629 -6.150  1.00 0.00 ? 25  GLN B O   2  
ATOM 8855   C CB  . GLN A 1 12  ? -164.039 -26.565 -4.063  1.00 0.00 ? 25  GLN B CB  2  
ATOM 8856   C CG  . GLN A 1 12  ? -164.287 -28.041 -3.762  1.00 0.00 ? 25  GLN B CG  2  
ATOM 8857   C CD  . GLN A 1 12  ? -163.838 -28.603 -2.426  1.00 0.00 ? 25  GLN B CD  2  
ATOM 8858   O OE1 . GLN A 1 12  ? -163.170 -27.937 -1.635  1.00 0.00 ? 25  GLN B OE1 2  
ATOM 8859   N NE2 . GLN A 1 12  ? -164.173 -29.769 -2.214  1.00 0.00 ? 25  GLN B NE2 2  
ATOM 8860   N N   . ASP A 1 13  ? -163.615 -24.135 -6.085  1.00 0.00 ? 26  ASP B N   2  
ATOM 8861   C CA  . ASP A 1 13  ? -163.737 -22.765 -6.603  1.00 0.00 ? 26  ASP B CA  2  
ATOM 8862   C C   . ASP A 1 13  ? -164.562 -22.771 -7.902  1.00 0.00 ? 26  ASP B C   2  
ATOM 8863   O O   . ASP A 1 13  ? -165.563 -22.059 -8.076  1.00 0.00 ? 26  ASP B O   2  
ATOM 8864   C CB  . ASP A 1 13  ? -162.355 -22.173 -6.923  1.00 0.00 ? 26  ASP B CB  2  
ATOM 8865   C CG  . ASP A 1 13  ? -161.291 -22.133 -5.829  1.00 0.00 ? 26  ASP B CG  2  
ATOM 8866   O OD1 . ASP A 1 13  ? -161.559 -22.442 -4.672  1.00 0.00 ? 26  ASP B OD1 2  
ATOM 8867   O OD2 . ASP A 1 13  ? -160.161 -21.785 -6.156  1.00 0.00 ? 26  ASP B OD2 2  
ATOM 8868   N N   . PHE A 1 14  ? -164.203 -23.663 -8.836  1.00 0.00 ? 27  PHE B N   2  
ATOM 8869   C CA  . PHE A 1 14  ? -164.996 -23.892 -10.047 1.00 0.00 ? 27  PHE B CA  2  
ATOM 8870   C C   . PHE A 1 14  ? -166.432 -24.342 -9.749  1.00 0.00 ? 27  PHE B C   2  
ATOM 8871   O O   . PHE A 1 14  ? -167.371 -23.742 -10.268 1.00 0.00 ? 27  PHE B O   2  
ATOM 8872   C CB  . PHE A 1 14  ? -164.348 -24.960 -10.932 1.00 0.00 ? 27  PHE B CB  2  
ATOM 8873   C CG  . PHE A 1 14  ? -163.004 -24.599 -11.558 1.00 0.00 ? 27  PHE B CG  2  
ATOM 8874   C CD1 . PHE A 1 14  ? -161.975 -25.520 -11.496 1.00 0.00 ? 27  PHE B CD1 2  
ATOM 8875   C CD2 . PHE A 1 14  ? -162.801 -23.379 -12.170 1.00 0.00 ? 27  PHE B CD2 2  
ATOM 8876   C CE1 . PHE A 1 14  ? -160.748 -25.222 -12.046 1.00 0.00 ? 27  PHE B CE1 2  
ATOM 8877   C CE2 . PHE A 1 14  ? -161.568 -23.093 -12.723 1.00 0.00 ? 27  PHE B CE2 2  
ATOM 8878   C CZ  . PHE A 1 14  ? -160.543 -24.011 -12.659 1.00 0.00 ? 27  PHE B CZ  2  
ATOM 8879   N N   . LYS A 1 15  ? -166.700 -25.358 -8.917  1.00 0.00 ? 28  LYS B N   2  
ATOM 8880   C CA  . LYS A 1 15  ? -168.064 -25.770 -8.529  1.00 0.00 ? 28  LYS B CA  2  
ATOM 8881   C C   . LYS A 1 15  ? -168.943 -24.635 -7.979  1.00 0.00 ? 28  LYS B C   2  
ATOM 8882   O O   . LYS A 1 15  ? -170.090 -24.436 -8.401  1.00 0.00 ? 28  LYS B O   2  
ATOM 8883   C CB  . LYS A 1 15  ? -168.003 -26.873 -7.477  1.00 0.00 ? 28  LYS B CB  2  
ATOM 8884   C CG  . LYS A 1 15  ? -167.463 -28.206 -7.967  1.00 0.00 ? 28  LYS B CG  2  
ATOM 8885   C CD  . LYS A 1 15  ? -167.149 -29.071 -6.753  1.00 0.00 ? 28  LYS B CD  2  
ATOM 8886   C CE  . LYS A 1 15  ? -166.482 -30.367 -7.172  1.00 0.00 ? 28  LYS B CE  2  
ATOM 8887   N NZ  . LYS A 1 15  ? -165.944 -31.072 -6.024  1.00 0.00 ? 28  LYS B NZ  2  
ATOM 8888   N N   . GLU A 1 16  ? -168.424 -23.825 -7.058  1.00 0.00 ? 29  GLU B N   2  
ATOM 8889   C CA  . GLU A 1 16  ? -169.120 -22.642 -6.567  1.00 0.00 ? 29  GLU B CA  2  
ATOM 8890   C C   . GLU A 1 16  ? -169.361 -21.644 -7.705  1.00 0.00 ? 29  GLU B C   2  
ATOM 8891   O O   . GLU A 1 16  ? -170.480 -21.184 -7.918  1.00 0.00 ? 29  GLU B O   2  
ATOM 8892   C CB  . GLU A 1 16  ? -168.304 -21.970 -5.490  1.00 0.00 ? 29  GLU B CB  2  
ATOM 8893   C CG  . GLU A 1 16  ? -168.139 -22.830 -4.246  1.00 0.00 ? 29  GLU B CG  2  
ATOM 8894   C CD  . GLU A 1 16  ? -167.317 -22.213 -3.124  1.00 0.00 ? 29  GLU B CD  2  
ATOM 8895   O OE1 . GLU A 1 16  ? -166.801 -21.103 -3.270  1.00 0.00 ? 29  GLU B OE1 2  
ATOM 8896   O OE2 . GLU A 1 16  ? -167.210 -22.862 -2.086  1.00 0.00 ? 29  GLU B OE2 2  
ATOM 8897   N N   . ALA A 1 17  ? -168.356 -21.352 -8.545  1.00 0.00 ? 30  ALA B N   2  
ATOM 8898   C CA  . ALA A 1 17  ? -168.538 -20.503 -9.726  1.00 0.00 ? 30  ALA B CA  2  
ATOM 8899   C C   . ALA A 1 17  ? -169.646 -20.966 -10.672 1.00 0.00 ? 30  ALA B C   2  
ATOM 8900   O O   . ALA A 1 17  ? -170.483 -20.184 -11.114 1.00 0.00 ? 30  ALA B O   2  
ATOM 8901   C CB  . ALA A 1 17  ? -167.249 -20.439 -10.530 1.00 0.00 ? 30  ALA B CB  2  
ATOM 8902   N N   . PHE A 1 18  ? -169.703 -22.276 -10.940 1.00 0.00 ? 31  PHE B N   2  
ATOM 8903   C CA  . PHE A 1 18  ? -170.785 -22.878 -11.718 1.00 0.00 ? 31  PHE B CA  2  
ATOM 8904   C C   . PHE A 1 18  ? -172.109 -22.623 -11.008 1.00 0.00 ? 31  PHE B C   2  
ATOM 8905   O O   . PHE A 1 18  ? -172.922 -21.902 -11.558 1.00 0.00 ? 31  PHE B O   2  
ATOM 8906   C CB  . PHE A 1 18  ? -170.572 -24.392 -11.881 1.00 0.00 ? 31  PHE B CB  2  
ATOM 8907   C CG  . PHE A 1 18  ? -169.239 -24.773 -12.527 1.00 0.00 ? 31  PHE B CG  2  
ATOM 8908   C CD1 . PHE A 1 18  ? -168.676 -25.995 -12.224 1.00 0.00 ? 31  PHE B CD1 2  
ATOM 8909   C CD2 . PHE A 1 18  ? -168.582 -23.897 -13.373 1.00 0.00 ? 31  PHE B CD2 2  
ATOM 8910   C CE1 . PHE A 1 18  ? -167.452 -26.332 -12.762 1.00 0.00 ? 31  PHE B CE1 2  
ATOM 8911   C CE2 . PHE A 1 18  ? -167.358 -24.245 -13.905 1.00 0.00 ? 31  PHE B CE2 2  
ATOM 8912   C CZ  . PHE A 1 18  ? -166.792 -25.457 -13.600 1.00 0.00 ? 31  PHE B CZ  2  
ATOM 8913   N N   . THR A 1 19  ? -172.308 -23.005 -9.735  1.00 0.00 ? 32  THR B N   2  
ATOM 8914   C CA  . THR A 1 19  ? -173.575 -22.722 -9.032  1.00 0.00 ? 32  THR B CA  2  
ATOM 8915   C C   . THR A 1 19  ? -174.006 -21.247 -8.941  1.00 0.00 ? 32  THR B C   2  
ATOM 8916   O O   . THR A 1 19  ? -175.177 -20.943 -8.733  1.00 0.00 ? 32  THR B O   2  
ATOM 8917   C CB  . THR A 1 19  ? -173.586 -23.242 -7.575  1.00 0.00 ? 32  THR B CB  2  
ATOM 8918   O OG1 . THR A 1 19  ? -172.538 -22.619 -6.843  1.00 0.00 ? 32  THR B OG1 2  
ATOM 8919   C CG2 . THR A 1 19  ? -173.421 -24.754 -7.535  1.00 0.00 ? 32  THR B CG2 2  
ATOM 8920   N N   . VAL A 1 20  ? -173.075 -20.286 -9.032  1.00 0.00 ? 33  VAL B N   2  
ATOM 8921   C CA  . VAL A 1 20  ? -173.447 -18.871 -9.151  1.00 0.00 ? 33  VAL B CA  2  
ATOM 8922   C C   . VAL A 1 20  ? -173.934 -18.503 -10.565 1.00 0.00 ? 33  VAL B C   2  
ATOM 8923   O O   . VAL A 1 20  ? -174.819 -17.664 -10.728 1.00 0.00 ? 33  VAL B O   2  
ATOM 8924   C CB  . VAL A 1 20  ? -172.217 -18.030 -8.711  1.00 0.00 ? 33  VAL B CB  2  
ATOM 8925   C CG1 . VAL A 1 20  ? -172.209 -16.586 -9.213  1.00 0.00 ? 33  VAL B CG1 2  
ATOM 8926   C CG2 . VAL A 1 20  ? -172.285 -17.987 -7.199  1.00 0.00 ? 33  VAL B CG2 2  
ATOM 8927   N N   . ILE A 1 21  ? -173.355 -19.081 -11.623 1.00 0.00 ? 34  ILE B N   2  
ATOM 8928   C CA  . ILE A 1 21  ? -173.878 -18.842 -12.969 1.00 0.00 ? 34  ILE B CA  2  
ATOM 8929   C C   . ILE A 1 21  ? -175.159 -19.677 -13.238 1.00 0.00 ? 34  ILE B C   2  
ATOM 8930   O O   . ILE A 1 21  ? -176.062 -19.238 -13.950 1.00 0.00 ? 34  ILE B O   2  
ATOM 8931   C CB  . ILE A 1 21  ? -172.748 -19.143 -13.999 1.00 0.00 ? 34  ILE B CB  2  
ATOM 8932   C CG1 . ILE A 1 21  ? -171.462 -18.381 -13.685 1.00 0.00 ? 34  ILE B CG1 2  
ATOM 8933   C CG2 . ILE A 1 21  ? -173.216 -18.662 -15.376 1.00 0.00 ? 34  ILE B CG2 2  
ATOM 8934   C CD1 . ILE A 1 21  ? -170.236 -18.791 -14.531 1.00 0.00 ? 34  ILE B CD1 2  
ATOM 8935   N N   . ASP A 1 22  ? -175.279 -20.866 -12.634 1.00 0.00 ? 35  ASP B N   2  
ATOM 8936   C CA  . ASP A 1 22  ? -176.457 -21.745 -12.635 1.00 0.00 ? 35  ASP B CA  2  
ATOM 8937   C C   . ASP A 1 22  ? -177.731 -21.153 -11.984 1.00 0.00 ? 35  ASP B C   2  
ATOM 8938   O O   . ASP A 1 22  ? -178.261 -21.670 -10.992 1.00 0.00 ? 35  ASP B O   2  
ATOM 8939   C CB  . ASP A 1 22  ? -176.098 -23.068 -11.905 1.00 0.00 ? 35  ASP B CB  2  
ATOM 8940   C CG  . ASP A 1 22  ? -175.578 -24.256 -12.707 1.00 0.00 ? 35  ASP B CG  2  
ATOM 8941   O OD1 . ASP A 1 22  ? -174.368 -24.394 -12.862 1.00 0.00 ? 35  ASP B OD1 2  
ATOM 8942   O OD2 . ASP A 1 22  ? -176.393 -25.075 -13.135 1.00 0.00 ? 35  ASP B OD2 2  
ATOM 8943   N N   . GLN A 1 23  ? -178.332 -20.087 -12.519 1.00 0.00 ? 36  GLN B N   2  
ATOM 8944   C CA  . GLN A 1 23  ? -179.524 -19.438 -11.933 1.00 0.00 ? 36  GLN B CA  2  
ATOM 8945   C C   . GLN A 1 23  ? -180.673 -20.314 -11.447 1.00 0.00 ? 36  GLN B C   2  
ATOM 8946   O O   . GLN A 1 23  ? -181.225 -20.171 -10.355 1.00 0.00 ? 36  GLN B O   2  
ATOM 8947   C CB  . GLN A 1 23  ? -180.229 -18.522 -12.869 1.00 0.00 ? 36  GLN B CB  2  
ATOM 8948   C CG  . GLN A 1 23  ? -179.626 -17.234 -13.283 1.00 0.00 ? 36  GLN B CG  2  
ATOM 8949   C CD  . GLN A 1 23  ? -180.245 -16.868 -14.613 1.00 0.00 ? 36  GLN B CD  2  
ATOM 8950   O OE1 . GLN A 1 23  ? -181.261 -17.356 -15.082 1.00 0.00 ? 36  GLN B OE1 2  
ATOM 8951   N NE2 . GLN A 1 23  ? -179.572 -16.110 -15.423 1.00 0.00 ? 36  GLN B NE2 2  
ATOM 8952   N N   . ASN A 1 24  ? -181.034 -21.258 -12.306 1.00 0.00 ? 37  ASN B N   2  
ATOM 8953   C CA  . ASN A 1 24  ? -182.153 -22.146 -12.036 1.00 0.00 ? 37  ASN B CA  2  
ATOM 8954   C C   . ASN A 1 24  ? -181.923 -23.265 -11.018 1.00 0.00 ? 37  ASN B C   2  
ATOM 8955   O O   . ASN A 1 24  ? -182.872 -23.881 -10.538 1.00 0.00 ? 37  ASN B O   2  
ATOM 8956   C CB  . ASN A 1 24  ? -182.602 -22.736 -13.372 1.00 0.00 ? 37  ASN B CB  2  
ATOM 8957   C CG  . ASN A 1 24  ? -183.072 -21.664 -14.347 1.00 0.00 ? 37  ASN B CG  2  
ATOM 8958   O OD1 . ASN A 1 24  ? -184.126 -21.059 -14.193 1.00 0.00 ? 37  ASN B OD1 2  
ATOM 8959   N ND2 . ASN A 1 24  ? -182.348 -21.300 -15.378 1.00 0.00 ? 37  ASN B ND2 2  
ATOM 8960   N N   . ARG A 1 25  ? -180.673 -23.521 -10.600 1.00 0.00 ? 38  ARG B N   2  
ATOM 8961   C CA  . ARG A 1 25  ? -180.256 -24.642 -9.740  1.00 0.00 ? 38  ARG B CA  2  
ATOM 8962   C C   . ARG A 1 25  ? -180.392 -26.065 -10.310 1.00 0.00 ? 38  ARG B C   2  
ATOM 8963   O O   . ARG A 1 25  ? -179.901 -27.029 -9.720  1.00 0.00 ? 38  ARG B O   2  
ATOM 8964   C CB  . ARG A 1 25  ? -181.003 -24.632 -8.396  1.00 0.00 ? 38  ARG B CB  2  
ATOM 8965   N N   . ASP A 1 26  ? -181.031 -26.221 -11.472 1.00 0.00 ? 39  ASP B N   2  
ATOM 8966   C CA  . ASP A 1 26  ? -181.164 -27.469 -12.228 1.00 0.00 ? 39  ASP B CA  2  
ATOM 8967   C C   . ASP A 1 26  ? -179.937 -28.387 -12.379 1.00 0.00 ? 39  ASP B C   2  
ATOM 8968   O O   . ASP A 1 26  ? -180.024 -29.615 -12.297 1.00 0.00 ? 39  ASP B O   2  
ATOM 8969   C CB  . ASP A 1 26  ? -181.684 -27.127 -13.626 1.00 0.00 ? 39  ASP B CB  2  
ATOM 8970   C CG  . ASP A 1 26  ? -183.045 -26.444 -13.726 1.00 0.00 ? 39  ASP B CG  2  
ATOM 8971   O OD1 . ASP A 1 26  ? -183.548 -25.928 -12.729 1.00 0.00 ? 39  ASP B OD1 2  
ATOM 8972   O OD2 . ASP A 1 26  ? -183.596 -26.417 -14.819 1.00 0.00 ? 39  ASP B OD2 2  
ATOM 8973   N N   . GLY A 1 27  ? -178.760 -27.815 -12.635 1.00 0.00 ? 40  GLY B N   2  
ATOM 8974   C CA  . GLY A 1 27  ? -177.532 -28.586 -12.824 1.00 0.00 ? 40  GLY B CA  2  
ATOM 8975   C C   . GLY A 1 27  ? -176.818 -28.347 -14.165 1.00 0.00 ? 40  GLY B C   2  
ATOM 8976   O O   . GLY A 1 27  ? -175.694 -28.799 -14.423 1.00 0.00 ? 40  GLY B O   2  
ATOM 8977   N N   . ILE A 1 28  ? -177.533 -27.671 -15.061 1.00 0.00 ? 41  ILE B N   2  
ATOM 8978   C CA  . ILE A 1 28  ? -177.038 -27.316 -16.390 1.00 0.00 ? 41  ILE B CA  2  
ATOM 8979   C C   . ILE A 1 28  ? -177.117 -25.793 -16.590 1.00 0.00 ? 41  ILE B C   2  
ATOM 8980   O O   . ILE A 1 28  ? -178.185 -25.211 -16.408 1.00 0.00 ? 41  ILE B O   2  
ATOM 8981   C CB  . ILE A 1 28  ? -177.880 -27.972 -17.524 1.00 0.00 ? 41  ILE B CB  2  
ATOM 8982   C CG1 . ILE A 1 28  ? -178.206 -29.436 -17.256 1.00 0.00 ? 41  ILE B CG1 2  
ATOM 8983   C CG2 . ILE A 1 28  ? -177.065 -27.843 -18.812 1.00 0.00 ? 41  ILE B CG2 2  
ATOM 8984   C CD1 . ILE A 1 28  ? -179.043 -30.156 -18.334 1.00 0.00 ? 41  ILE B CD1 2  
ATOM 8985   N N   . ILE A 1 29  ? -176.015 -25.113 -16.896 1.00 0.00 ? 42  ILE B N   2  
ATOM 8986   C CA  . ILE A 1 29  ? -176.085 -23.700 -17.282 1.00 0.00 ? 42  ILE B CA  2  
ATOM 8987   C C   . ILE A 1 29  ? -176.511 -23.567 -18.738 1.00 0.00 ? 42  ILE B C   2  
ATOM 8988   O O   . ILE A 1 29  ? -175.969 -24.265 -19.598 1.00 0.00 ? 42  ILE B O   2  
ATOM 8989   C CB  . ILE A 1 29  ? -174.706 -23.003 -17.095 1.00 0.00 ? 42  ILE B CB  2  
ATOM 8990   C CG1 . ILE A 1 29  ? -174.621 -22.607 -15.652 1.00 0.00 ? 42  ILE B CG1 2  
ATOM 8991   C CG2 . ILE A 1 29  ? -174.514 -21.733 -17.935 1.00 0.00 ? 42  ILE B CG2 2  
ATOM 8992   C CD1 . ILE A 1 29  ? -173.199 -22.250 -15.194 1.00 0.00 ? 42  ILE B CD1 2  
ATOM 8993   N N   . ASP A 1 30  ? -177.429 -22.647 -19.019 1.00 0.00 ? 43  ASP B N   2  
ATOM 8994   C CA  . ASP A 1 30  ? -177.819 -22.343 -20.381 1.00 0.00 ? 43  ASP B CA  2  
ATOM 8995   C C   . ASP A 1 30  ? -177.769 -20.847 -20.733 1.00 0.00 ? 43  ASP B C   2  
ATOM 8996   O O   . ASP A 1 30  ? -177.217 -20.012 -20.005 1.00 0.00 ? 43  ASP B O   2  
ATOM 8997   C CB  . ASP A 1 30  ? -179.232 -22.884 -20.625 1.00 0.00 ? 43  ASP B CB  2  
ATOM 8998   C CG  . ASP A 1 30  ? -179.359 -24.383 -20.883 1.00 0.00 ? 43  ASP B CG  2  
ATOM 8999   O OD1 . ASP A 1 30  ? -178.384 -25.039 -21.242 1.00 0.00 ? 43  ASP B OD1 2  
ATOM 9000   O OD2 . ASP A 1 30  ? -180.464 -24.897 -20.761 1.00 0.00 ? 43  ASP B OD2 2  
ATOM 9001   N N   . LYS A 1 31  ? -178.341 -20.434 -21.869 1.00 0.00 ? 44  LYS B N   2  
ATOM 9002   C CA  . LYS A 1 31  ? -178.370 -19.022 -22.284 1.00 0.00 ? 44  LYS B CA  2  
ATOM 9003   C C   . LYS A 1 31  ? -179.025 -18.084 -21.277 1.00 0.00 ? 44  LYS B C   2  
ATOM 9004   O O   . LYS A 1 31  ? -178.526 -16.993 -21.013 1.00 0.00 ? 44  LYS B O   2  
ATOM 9005   C CB  . LYS A 1 31  ? -179.111 -18.843 -23.607 1.00 0.00 ? 44  LYS B CB  2  
ATOM 9006   C CG  . LYS A 1 31  ? -178.410 -19.533 -24.759 1.00 0.00 ? 44  LYS B CG  2  
ATOM 9007   C CD  . LYS A 1 31  ? -179.025 -19.255 -26.112 1.00 0.00 ? 44  LYS B CD  2  
ATOM 9008   C CE  . LYS A 1 31  ? -178.258 -20.087 -27.126 1.00 0.00 ? 44  LYS B CE  2  
ATOM 9009   N NZ  . LYS A 1 31  ? -178.599 -19.690 -28.473 1.00 0.00 ? 44  LYS B NZ  2  
ATOM 9010   N N   . ASP A 1 32  ? -180.129 -18.535 -20.693 1.00 0.00 ? 45  ASP B N   2  
ATOM 9011   C CA  . ASP A 1 32  ? -180.862 -17.797 -19.676 1.00 0.00 ? 45  ASP B CA  2  
ATOM 9012   C C   . ASP A 1 32  ? -180.007 -17.570 -18.427 1.00 0.00 ? 45  ASP B C   2  
ATOM 9013   O O   . ASP A 1 32  ? -179.768 -16.410 -18.055 1.00 0.00 ? 45  ASP B O   2  
ATOM 9014   C CB  . ASP A 1 32  ? -182.140 -18.608 -19.434 1.00 0.00 ? 45  ASP B CB  2  
ATOM 9015   C CG  . ASP A 1 32  ? -183.027 -18.776 -20.673 1.00 0.00 ? 45  ASP B CG  2  
ATOM 9016   O OD1 . ASP A 1 32  ? -182.685 -18.299 -21.770 1.00 0.00 ? 45  ASP B OD1 2  
ATOM 9017   O OD2 . ASP A 1 32  ? -184.072 -19.409 -20.555 1.00 0.00 ? 45  ASP B OD2 2  
ATOM 9018   N N   . ASP A 1 33  ? -179.402 -18.641 -17.894 1.00 0.00 ? 46  ASP B N   2  
ATOM 9019   C CA  . ASP A 1 33  ? -178.455 -18.577 -16.782 1.00 0.00 ? 46  ASP B CA  2  
ATOM 9020   C C   . ASP A 1 33  ? -177.311 -17.572 -17.001 1.00 0.00 ? 46  ASP B C   2  
ATOM 9021   O O   . ASP A 1 33  ? -177.075 -16.668 -16.186 1.00 0.00 ? 46  ASP B O   2  
ATOM 9022   C CB  . ASP A 1 33  ? -177.944 -19.998 -16.537 1.00 0.00 ? 46  ASP B CB  2  
ATOM 9023   C CG  . ASP A 1 33  ? -179.086 -20.920 -16.139 1.00 0.00 ? 46  ASP B CG  2  
ATOM 9024   O OD1 . ASP A 1 33  ? -179.753 -21.411 -17.039 1.00 0.00 ? 46  ASP B OD1 2  
ATOM 9025   O OD2 . ASP A 1 33  ? -179.362 -21.122 -14.959 1.00 0.00 ? 46  ASP B OD2 2  
ATOM 9026   N N   . LEU A 1 34  ? -176.680 -17.601 -18.172 1.00 0.00 ? 47  LEU B N   2  
ATOM 9027   C CA  . LEU A 1 34  ? -175.704 -16.571 -18.545 1.00 0.00 ? 47  LEU B CA  2  
ATOM 9028   C C   . LEU A 1 34  ? -176.299 -15.149 -18.580 1.00 0.00 ? 47  LEU B C   2  
ATOM 9029   O O   . LEU A 1 34  ? -175.783 -14.238 -17.923 1.00 0.00 ? 47  LEU B O   2  
ATOM 9030   C CB  . LEU A 1 34  ? -175.114 -16.908 -19.910 1.00 0.00 ? 47  LEU B CB  2  
ATOM 9031   C CG  . LEU A 1 34  ? -174.315 -18.193 -20.085 1.00 0.00 ? 47  LEU B CG  2  
ATOM 9032   C CD1 . LEU A 1 34  ? -174.000 -18.378 -21.558 1.00 0.00 ? 47  LEU B CD1 2  
ATOM 9033   C CD2 . LEU A 1 34  ? -173.037 -18.139 -19.268 1.00 0.00 ? 47  LEU B CD2 2  
ATOM 9034   N N   . ARG A 1 35  ? -177.409 -14.903 -19.294 1.00 0.00 ? 48  ARG B N   2  
ATOM 9035   C CA  . ARG A 1 35  ? -178.073 -13.585 -19.353 1.00 0.00 ? 48  ARG B CA  2  
ATOM 9036   C C   . ARG A 1 35  ? -178.299 -12.875 -18.018 1.00 0.00 ? 48  ARG B C   2  
ATOM 9037   O O   . ARG A 1 35  ? -177.785 -11.775 -17.798 1.00 0.00 ? 48  ARG B O   2  
ATOM 9038   C CB  . ARG A 1 35  ? -179.432 -13.712 -20.036 1.00 0.00 ? 48  ARG B CB  2  
ATOM 9039   C CG  . ARG A 1 35  ? -179.311 -14.008 -21.515 1.00 0.00 ? 48  ARG B CG  2  
ATOM 9040   C CD  . ARG A 1 35  ? -180.623 -14.477 -22.116 1.00 0.00 ? 48  ARG B CD  2  
ATOM 9041   N NE  . ARG A 1 35  ? -180.377 -14.965 -23.465 1.00 0.00 ? 48  ARG B NE  2  
ATOM 9042   C CZ  . ARG A 1 35  ? -181.326 -15.166 -24.347 1.00 0.00 ? 48  ARG B CZ  2  
ATOM 9043   N NH1 . ARG A 1 35  ? -182.586 -14.972 -24.063 1.00 0.00 ? 48  ARG B NH1 2  
ATOM 9044   N NH2 . ARG A 1 35  ? -181.001 -15.562 -25.542 1.00 0.00 ? 48  ARG B NH2 2  
ATOM 9045   N N   . GLU A 1 36  ? -178.998 -13.482 -17.053 1.00 0.00 ? 49  GLU B N   2  
ATOM 9046   C CA  . GLU A 1 36  ? -179.154 -12.789 -15.772 1.00 0.00 ? 49  GLU B CA  2  
ATOM 9047   C C   . GLU A 1 36  ? -177.893 -12.829 -14.918 1.00 0.00 ? 49  GLU B C   2  
ATOM 9048   O O   . GLU A 1 36  ? -177.765 -11.944 -14.072 1.00 0.00 ? 49  GLU B O   2  
ATOM 9049   C CB  . GLU A 1 36  ? -180.292 -13.350 -14.937 1.00 0.00 ? 49  GLU B CB  2  
ATOM 9050   C CG  . GLU A 1 36  ? -181.647 -13.372 -15.630 1.00 0.00 ? 49  GLU B CG  2  
ATOM 9051   C CD  . GLU A 1 36  ? -182.725 -14.180 -14.918 1.00 0.00 ? 49  GLU B CD  2  
ATOM 9052   O OE1 . GLU A 1 36  ? -182.605 -14.462 -13.722 1.00 0.00 ? 49  GLU B OE1 2  
ATOM 9053   O OE2 . GLU A 1 36  ? -183.708 -14.519 -15.579 1.00 0.00 ? 49  GLU B OE2 2  
ATOM 9054   N N   . THR A 1 37  ? -176.890 -13.722 -15.038 1.00 0.00 ? 50  THR B N   2  
ATOM 9055   C CA  . THR A 1 37  ? -175.641 -13.509 -14.279 1.00 0.00 ? 50  THR B CA  2  
ATOM 9056   C C   . THR A 1 37  ? -174.938 -12.250 -14.766 1.00 0.00 ? 50  THR B C   2  
ATOM 9057   O O   . THR A 1 37  ? -174.486 -11.421 -13.970 1.00 0.00 ? 50  THR B O   2  
ATOM 9058   C CB  . THR A 1 37  ? -174.610 -14.636 -14.397 1.00 0.00 ? 50  THR B CB  2  
ATOM 9059   O OG1 . THR A 1 37  ? -174.363 -15.012 -15.747 1.00 0.00 ? 50  THR B OG1 2  
ATOM 9060   C CG2 . THR A 1 37  ? -175.155 -15.791 -13.603 1.00 0.00 ? 50  THR B CG2 2  
ATOM 9061   N N   . PHE A 1 38  ? -174.906 -12.018 -16.086 1.00 0.00 ? 51  PHE B N   2  
ATOM 9062   C CA  . PHE A 1 38  ? -174.401 -10.759 -16.636 1.00 0.00 ? 51  PHE B CA  2  
ATOM 9063   C C   . PHE A 1 38  ? -175.185 -9.549  -16.112 1.00 0.00 ? 51  PHE B C   2  
ATOM 9064   O O   . PHE A 1 38  ? -174.599 -8.573  -15.636 1.00 0.00 ? 51  PHE B O   2  
ATOM 9065   C CB  . PHE A 1 38  ? -174.493 -10.741 -18.157 1.00 0.00 ? 51  PHE B CB  2  
ATOM 9066   C CG  . PHE A 1 38  ? -173.568 -11.717 -18.864 1.00 0.00 ? 51  PHE B CG  2  
ATOM 9067   C CD1 . PHE A 1 38  ? -174.091 -12.638 -19.747 1.00 0.00 ? 51  PHE B CD1 2  
ATOM 9068   C CD2 . PHE A 1 38  ? -172.208 -11.682 -18.632 1.00 0.00 ? 51  PHE B CD2 2  
ATOM 9069   C CE1 . PHE A 1 38  ? -173.260 -13.525 -20.399 1.00 0.00 ? 51  PHE B CE1 2  
ATOM 9070   C CE2 . PHE A 1 38  ? -171.394 -12.573 -19.290 1.00 0.00 ? 51  PHE B CE2 2  
ATOM 9071   C CZ  . PHE A 1 38  ? -171.908 -13.498 -20.167 1.00 0.00 ? 51  PHE B CZ  2  
ATOM 9072   N N   . ALA A 1 39  ? -176.520 -9.616  -16.159 1.00 0.00 ? 52  ALA B N   2  
ATOM 9073   C CA  . ALA A 1 39  ? -177.393 -8.588  -15.586 1.00 0.00 ? 52  ALA B CA  2  
ATOM 9074   C C   . ALA A 1 39  ? -177.157 -8.318  -14.089 1.00 0.00 ? 52  ALA B C   2  
ATOM 9075   O O   . ALA A 1 39  ? -177.023 -7.169  -13.674 1.00 0.00 ? 52  ALA B O   2  
ATOM 9076   C CB  . ALA A 1 39  ? -178.847 -8.984  -15.767 1.00 0.00 ? 52  ALA B CB  2  
ATOM 9077   N N   . ALA A 1 40  ? -177.045 -9.352  -13.249 1.00 0.00 ? 53  ALA B N   2  
ATOM 9078   C CA  . ALA A 1 40  ? -176.708 -9.224  -11.830 1.00 0.00 ? 53  ALA B CA  2  
ATOM 9079   C C   . ALA A 1 40  ? -175.348 -8.549  -11.578 1.00 0.00 ? 53  ALA B C   2  
ATOM 9080   O O   . ALA A 1 40  ? -175.160 -7.807  -10.613 1.00 0.00 ? 53  ALA B O   2  
ATOM 9081   C CB  . ALA A 1 40  ? -176.672 -10.596 -11.175 1.00 0.00 ? 53  ALA B CB  2  
ATOM 9082   N N   . MET A 1 41  ? -174.371 -8.814  -12.446 1.00 0.00 ? 54  MET B N   2  
ATOM 9083   C CA  . MET A 1 41  ? -173.087 -8.113  -12.405 1.00 0.00 ? 54  MET B CA  2  
ATOM 9084   C C   . MET A 1 41  ? -173.086 -6.693  -13.017 1.00 0.00 ? 54  MET B C   2  
ATOM 9085   O O   . MET A 1 41  ? -172.044 -6.038  -13.115 1.00 0.00 ? 54  MET B O   2  
ATOM 9086   C CB  . MET A 1 41  ? -172.021 -8.939  -13.125 1.00 0.00 ? 54  MET B CB  2  
ATOM 9087   C CG  . MET A 1 41  ? -171.781 -10.333 -12.549 1.00 0.00 ? 54  MET B CG  2  
ATOM 9088   S SD  . MET A 1 41  ? -171.479 -10.336 -10.767 1.00 0.00 ? 54  MET B SD  2  
ATOM 9089   C CE  . MET A 1 41  ? -169.769 -9.880  -10.748 1.00 0.00 ? 54  MET B CE  2  
ATOM 9090   N N   . GLY A 1 42  ? -174.232 -6.192  -13.484 1.00 0.00 ? 55  GLY B N   2  
ATOM 9091   C CA  . GLY A 1 42  ? -174.338 -4.855  -14.069 1.00 0.00 ? 55  GLY B CA  2  
ATOM 9092   C C   . GLY A 1 42  ? -174.379 -4.796  -15.600 1.00 0.00 ? 55  GLY B C   2  
ATOM 9093   O O   . GLY A 1 42  ? -174.723 -3.778  -16.212 1.00 0.00 ? 55  GLY B O   2  
ATOM 9094   N N   . ARG A 1 43  ? -174.082 -5.891  -16.301 1.00 0.00 ? 56  ARG B N   2  
ATOM 9095   C CA  . ARG A 1 43  ? -174.063 -5.889  -17.764 1.00 0.00 ? 56  ARG B CA  2  
ATOM 9096   C C   . ARG A 1 43  ? -175.418 -6.131  -18.428 1.00 0.00 ? 56  ARG B C   2  
ATOM 9097   O O   . ARG A 1 43  ? -175.890 -7.259  -18.587 1.00 0.00 ? 56  ARG B O   2  
ATOM 9098   C CB  . ARG A 1 43  ? -173.115 -6.945  -18.307 1.00 0.00 ? 56  ARG B CB  2  
ATOM 9099   C CG  . ARG A 1 43  ? -171.685 -6.907  -17.824 1.00 0.00 ? 56  ARG B CG  2  
ATOM 9100   C CD  . ARG A 1 43  ? -170.991 -8.002  -18.600 1.00 0.00 ? 56  ARG B CD  2  
ATOM 9101   N NE  . ARG A 1 43  ? -169.707 -8.331  -18.018 1.00 0.00 ? 56  ARG B NE  2  
ATOM 9102   C CZ  . ARG A 1 43  ? -168.925 -9.260  -18.535 1.00 0.00 ? 56  ARG B CZ  2  
ATOM 9103   N NH1 . ARG A 1 43  ? -169.213 -9.882  -19.642 1.00 0.00 ? 56  ARG B NH1 2  
ATOM 9104   N NH2 . ARG A 1 43  ? -167.828 -9.571  -17.896 1.00 0.00 ? 56  ARG B NH2 2  
ATOM 9105   N N   . LEU A 1 44  ? -176.070 -5.067  -18.876 1.00 0.00 ? 57  LEU B N   2  
ATOM 9106   C CA  . LEU A 1 44  ? -177.367 -5.191  -19.544 1.00 0.00 ? 57  LEU B CA  2  
ATOM 9107   C C   . LEU A 1 44  ? -177.346 -5.271  -21.079 1.00 0.00 ? 57  LEU B C   2  
ATOM 9108   O O   . LEU A 1 44  ? -178.244 -5.805  -21.724 1.00 0.00 ? 57  LEU B O   2  
ATOM 9109   C CB  . LEU A 1 44  ? -178.245 -4.021  -19.113 1.00 0.00 ? 57  LEU B CB  2  
ATOM 9110   C CG  . LEU A 1 44  ? -178.432 -3.760  -17.618 1.00 0.00 ? 57  LEU B CG  2  
ATOM 9111   C CD1 . LEU A 1 44  ? -179.266 -2.507  -17.443 1.00 0.00 ? 57  LEU B CD1 2  
ATOM 9112   C CD2 . LEU A 1 44  ? -179.103 -4.947  -16.943 1.00 0.00 ? 57  LEU B CD2 2  
ATOM 9113   N N   . ASN A 1 45  ? -176.257 -4.825  -21.698 1.00 0.00 ? 58  ASN B N   2  
ATOM 9114   C CA  . ASN A 1 45  ? -176.134 -4.735  -23.158 1.00 0.00 ? 58  ASN B CA  2  
ATOM 9115   C C   . ASN A 1 45  ? -175.785 -6.018  -23.941 1.00 0.00 ? 58  ASN B C   2  
ATOM 9116   O O   . ASN A 1 45  ? -175.329 -5.954  -25.088 1.00 0.00 ? 58  ASN B O   2  
ATOM 9117   C CB  . ASN A 1 45  ? -175.087 -3.661  -23.476 1.00 0.00 ? 58  ASN B CB  2  
ATOM 9118   C CG  . ASN A 1 45  ? -175.258 -2.385  -22.663 1.00 0.00 ? 58  ASN B CG  2  
ATOM 9119   O OD1 . ASN A 1 45  ? -176.305 -1.771  -22.589 1.00 0.00 ? 58  ASN B OD1 2  
ATOM 9120   N ND2 . ASN A 1 45  ? -174.283 -1.911  -21.922 1.00 0.00 ? 58  ASN B ND2 2  
ATOM 9121   N N   . VAL A 1 46  ? -176.041 -7.185  -23.355 1.00 0.00 ? 59  VAL B N   2  
ATOM 9122   C CA  . VAL A 1 46  ? -175.627 -8.470  -23.935 1.00 0.00 ? 59  VAL B CA  2  
ATOM 9123   C C   . VAL A 1 46  ? -176.418 -8.926  -25.170 1.00 0.00 ? 59  VAL B C   2  
ATOM 9124   O O   . VAL A 1 46  ? -177.638 -9.099  -25.158 1.00 0.00 ? 59  VAL B O   2  
ATOM 9125   C CB  . VAL A 1 46  ? -175.714 -9.556  -22.824 1.00 0.00 ? 59  VAL B CB  2  
ATOM 9126   C CG1 . VAL A 1 46  ? -175.163 -10.875 -23.345 1.00 0.00 ? 59  VAL B CG1 2  
ATOM 9127   C CG2 . VAL A 1 46  ? -174.895 -9.142  -21.608 1.00 0.00 ? 59  VAL B CG2 2  
ATOM 9128   N N   . LYS A 1 47  ? -175.729 -9.159  -26.275 1.00 0.00 ? 60  LYS B N   2  
ATOM 9129   C CA  . LYS A 1 47  ? -176.366 -9.607  -27.504 1.00 0.00 ? 60  LYS B CA  2  
ATOM 9130   C C   . LYS A 1 47  ? -176.323 -11.125 -27.671 1.00 0.00 ? 60  LYS B C   2  
ATOM 9131   O O   . LYS A 1 47  ? -175.333 -11.783 -27.343 1.00 0.00 ? 60  LYS B O   2  
ATOM 9132   C CB  . LYS A 1 47  ? -175.684 -8.933  -28.685 1.00 0.00 ? 60  LYS B CB  2  
ATOM 9133   C CG  . LYS A 1 47  ? -175.810 -7.428  -28.547 1.00 0.00 ? 60  LYS B CG  2  
ATOM 9134   C CD  . LYS A 1 47  ? -174.950 -6.708  -29.550 1.00 0.00 ? 60  LYS B CD  2  
ATOM 9135   C CE  . LYS A 1 47  ? -174.964 -5.250  -29.158 1.00 0.00 ? 60  LYS B CE  2  
ATOM 9136   N NZ  . LYS A 1 47  ? -174.166 -4.504  -30.099 1.00 0.00 ? 60  LYS B NZ  2  
ATOM 9137   N N   . ASN A 1 48  ? -177.393 -11.761 -28.170 1.00 0.00 ? 61  ASN B N   2  
ATOM 9138   C CA  . ASN A 1 48  ? -177.414 -13.221 -28.360 1.00 0.00 ? 61  ASN B CA  2  
ATOM 9139   C C   . ASN A 1 48  ? -176.162 -13.863 -28.962 1.00 0.00 ? 61  ASN B C   2  
ATOM 9140   O O   . ASN A 1 48  ? -175.651 -14.807 -28.382 1.00 0.00 ? 61  ASN B O   2  
ATOM 9141   C CB  . ASN A 1 48  ? -178.598 -13.635 -29.223 1.00 0.00 ? 61  ASN B CB  2  
ATOM 9142   C CG  . ASN A 1 48  ? -179.921 -13.385 -28.529 1.00 0.00 ? 61  ASN B CG  2  
ATOM 9143   O OD1 . ASN A 1 48  ? -180.307 -13.998 -27.537 1.00 0.00 ? 61  ASN B OD1 2  
ATOM 9144   N ND2 . ASN A 1 48  ? -180.722 -12.460 -29.007 1.00 0.00 ? 61  ASN B ND2 2  
ATOM 9145   N N   . GLU A 1 49  ? -175.558 -13.305 -30.015 1.00 0.00 ? 62  GLU B N   2  
ATOM 9146   C CA  . GLU A 1 49  ? -174.309 -13.814 -30.591 1.00 0.00 ? 62  GLU B CA  2  
ATOM 9147   C C   . GLU A 1 49  ? -173.151 -14.047 -29.613 1.00 0.00 ? 62  GLU B C   2  
ATOM 9148   O O   . GLU A 1 49  ? -172.404 -15.024 -29.733 1.00 0.00 ? 62  GLU B O   2  
ATOM 9149   C CB  . GLU A 1 49  ? -173.852 -12.854 -31.666 1.00 0.00 ? 62  GLU B CB  2  
ATOM 9150   C CG  . GLU A 1 49  ? -174.794 -12.877 -32.856 1.00 0.00 ? 62  GLU B CG  2  
ATOM 9151   C CD  . GLU A 1 49  ? -174.623 -11.702 -33.799 1.00 0.00 ? 62  GLU B CD  2  
ATOM 9152   O OE1 . GLU A 1 49  ? -173.524 -11.482 -34.294 1.00 0.00 ? 62  GLU B OE1 2  
ATOM 9153   O OE2 . GLU A 1 49  ? -175.614 -11.007 -34.019 1.00 0.00 ? 62  GLU B OE2 2  
ATOM 9154   N N   . GLU A 1 50  ? -173.043 -13.207 -28.586 1.00 0.00 ? 63  GLU B N   2  
ATOM 9155   C CA  . GLU A 1 50  ? -172.045 -13.336 -27.527 1.00 0.00 ? 63  GLU B CA  2  
ATOM 9156   C C   . GLU A 1 50  ? -172.399 -14.517 -26.606 1.00 0.00 ? 63  GLU B C   2  
ATOM 9157   O O   . GLU A 1 50  ? -171.580 -15.407 -26.354 1.00 0.00 ? 63  GLU B O   2  
ATOM 9158   C CB  . GLU A 1 50  ? -172.001 -12.008 -26.769 1.00 0.00 ? 63  GLU B CB  2  
ATOM 9159   C CG  . GLU A 1 50  ? -171.501 -10.862 -27.671 1.00 0.00 ? 63  GLU B CG  2  
ATOM 9160   C CD  . GLU A 1 50  ? -172.082 -9.464  -27.445 1.00 0.00 ? 63  GLU B CD  2  
ATOM 9161   O OE1 . GLU A 1 50  ? -172.825 -9.244  -26.492 1.00 0.00 ? 63  GLU B OE1 2  
ATOM 9162   O OE2 . GLU A 1 50  ? -171.823 -8.581  -28.262 1.00 0.00 ? 63  GLU B OE2 2  
ATOM 9163   N N   . LEU A 1 51  ? -173.662 -14.625 -26.178 1.00 0.00 ? 64  LEU B N   2  
ATOM 9164   C CA  . LEU A 1 51  ? -174.164 -15.753 -25.367 1.00 0.00 ? 64  LEU B CA  2  
ATOM 9165   C C   . LEU A 1 51  ? -174.007 -17.110 -26.070 1.00 0.00 ? 64  LEU B C   2  
ATOM 9166   O O   . LEU A 1 51  ? -173.503 -18.109 -25.543 1.00 0.00 ? 64  LEU B O   2  
ATOM 9167   C CB  . LEU A 1 51  ? -175.635 -15.543 -25.060 1.00 0.00 ? 64  LEU B CB  2  
ATOM 9168   C CG  . LEU A 1 51  ? -176.006 -14.315 -24.263 1.00 0.00 ? 64  LEU B CG  2  
ATOM 9169   C CD1 . LEU A 1 51  ? -177.397 -13.874 -24.643 1.00 0.00 ? 64  LEU B CD1 2  
ATOM 9170   C CD2 . LEU A 1 51  ? -175.857 -14.617 -22.785 1.00 0.00 ? 64  LEU B CD2 2  
ATOM 9171   N N   . ASP A 1 52  ? -174.432 -17.116 -27.330 1.00 0.00 ? 65  ASP B N   2  
ATOM 9172   C CA  . ASP A 1 52  ? -174.278 -18.233 -28.238 1.00 0.00 ? 65  ASP B CA  2  
ATOM 9173   C C   . ASP A 1 52  ? -172.808 -18.598 -28.449 1.00 0.00 ? 65  ASP B C   2  
ATOM 9174   O O   . ASP A 1 52  ? -172.456 -19.773 -28.380 1.00 0.00 ? 65  ASP B O   2  
ATOM 9175   C CB  . ASP A 1 52  ? -174.928 -17.856 -29.560 1.00 0.00 ? 65  ASP B CB  2  
ATOM 9176   C CG  . ASP A 1 52  ? -176.432 -18.012 -29.521 1.00 0.00 ? 65  ASP B CG  2  
ATOM 9177   O OD1 . ASP A 1 52  ? -177.130 -17.397 -28.717 1.00 0.00 ? 65  ASP B OD1 2  
ATOM 9178   O OD2 . ASP A 1 52  ? -176.949 -18.845 -30.259 1.00 0.00 ? 65  ASP B OD2 2  
ATOM 9179   N N   . ALA A 1 53  ? -171.905 -17.640 -28.707 1.00 0.00 ? 66  ALA B N   2  
ATOM 9180   C CA  . ALA A 1 53  ? -170.466 -17.902 -28.822 1.00 0.00 ? 66  ALA B CA  2  
ATOM 9181   C C   . ALA A 1 53  ? -169.896 -18.658 -27.618 1.00 0.00 ? 66  ALA B C   2  
ATOM 9182   O O   . ALA A 1 53  ? -169.222 -19.668 -27.790 1.00 0.00 ? 66  ALA B O   2  
ATOM 9183   C CB  . ALA A 1 53  ? -169.691 -16.600 -28.955 1.00 0.00 ? 66  ALA B CB  2  
ATOM 9184   N N   . MET A 1 54  ? -170.262 -18.210 -26.410 1.00 0.00 ? 67  MET B N   2  
ATOM 9185   C CA  . MET A 1 54  ? -169.934 -18.901 -25.162 1.00 0.00 ? 67  MET B CA  2  
ATOM 9186   C C   . MET A 1 54  ? -170.338 -20.381 -25.184 1.00 0.00 ? 67  MET B C   2  
ATOM 9187   O O   . MET A 1 54  ? -169.527 -21.295 -25.073 1.00 0.00 ? 67  MET B O   2  
ATOM 9188   C CB  . MET A 1 54  ? -170.664 -18.291 -23.963 1.00 0.00 ? 67  MET B CB  2  
ATOM 9189   C CG  . MET A 1 54  ? -170.566 -16.806 -23.723 1.00 0.00 ? 67  MET B CG  2  
ATOM 9190   S SD  . MET A 1 54  ? -168.888 -16.304 -23.308 1.00 0.00 ? 67  MET B SD  2  
ATOM 9191   C CE  . MET A 1 54  ? -168.873 -16.920 -21.652 1.00 0.00 ? 67  MET B CE  2  
ATOM 9192   N N   . ILE A 1 55  ? -171.641 -20.634 -25.370 1.00 0.00 ? 68  ILE B N   2  
ATOM 9193   C CA  . ILE A 1 55  ? -172.174 -21.998 -25.400 1.00 0.00 ? 68  ILE B CA  2  
ATOM 9194   C C   . ILE A 1 55  ? -171.592 -22.893 -26.507 1.00 0.00 ? 68  ILE B C   2  
ATOM 9195   O O   . ILE A 1 55  ? -171.203 -24.036 -26.252 1.00 0.00 ? 68  ILE B O   2  
ATOM 9196   C CB  . ILE A 1 55  ? -173.714 -21.856 -25.494 1.00 0.00 ? 68  ILE B CB  2  
ATOM 9197   C CG1 . ILE A 1 55  ? -174.148 -21.439 -24.094 1.00 0.00 ? 68  ILE B CG1 2  
ATOM 9198   C CG2 . ILE A 1 55  ? -174.431 -23.130 -25.945 1.00 0.00 ? 68  ILE B CG2 2  
ATOM 9199   C CD1 . ILE A 1 55  ? -175.656 -21.410 -23.814 1.00 0.00 ? 68  ILE B CD1 2  
ATOM 9200   N N   . LYS A 1 56  ? -171.426 -22.372 -27.724 1.00 0.00 ? 69  LYS B N   2  
ATOM 9201   C CA  . LYS A 1 56  ? -170.825 -23.095 -28.856 1.00 0.00 ? 69  LYS B CA  2  
ATOM 9202   C C   . LYS A 1 56  ? -169.489 -23.808 -28.624 1.00 0.00 ? 69  LYS B C   2  
ATOM 9203   O O   . LYS A 1 56  ? -169.129 -24.738 -29.349 1.00 0.00 ? 69  LYS B O   2  
ATOM 9204   C CB  . LYS A 1 56  ? -170.613 -22.154 -30.031 1.00 0.00 ? 69  LYS B CB  2  
ATOM 9205   C CG  . LYS A 1 56  ? -171.882 -21.700 -30.725 1.00 0.00 ? 69  LYS B CG  2  
ATOM 9206   C CD  . LYS A 1 56  ? -171.522 -20.572 -31.671 1.00 0.00 ? 69  LYS B CD  2  
ATOM 9207   C CE  . LYS A 1 56  ? -172.783 -19.875 -32.146 1.00 0.00 ? 69  LYS B CE  2  
ATOM 9208   N NZ  . LYS A 1 56  ? -172.444 -18.740 -32.974 1.00 0.00 ? 69  LYS B NZ  2  
ATOM 9209   N N   . GLU A 1 57  ? -168.722 -23.375 -27.621 1.00 0.00 ? 70  GLU B N   2  
ATOM 9210   C CA  . GLU A 1 57  ? -167.478 -24.043 -27.263 1.00 0.00 ? 70  GLU B CA  2  
ATOM 9211   C C   . GLU A 1 57  ? -167.649 -25.488 -26.780 1.00 0.00 ? 70  GLU B C   2  
ATOM 9212   O O   . GLU A 1 57  ? -166.726 -26.312 -26.844 1.00 0.00 ? 70  GLU B O   2  
ATOM 9213   C CB  . GLU A 1 57  ? -166.771 -23.275 -26.175 1.00 0.00 ? 70  GLU B CB  2  
ATOM 9214   C CG  . GLU A 1 57  ? -166.318 -21.848 -26.498 1.00 0.00 ? 70  GLU B CG  2  
ATOM 9215   C CD  . GLU A 1 57  ? -165.346 -21.306 -25.463 1.00 0.00 ? 70  GLU B CD  2  
ATOM 9216   O OE1 . GLU A 1 57  ? -165.305 -21.791 -24.336 1.00 0.00 ? 70  GLU B OE1 2  
ATOM 9217   O OE2 . GLU A 1 57  ? -164.496 -20.472 -25.753 1.00 0.00 ? 70  GLU B OE2 2  
ATOM 9218   N N   . ALA A 1 58  ? -168.826 -25.858 -26.273 1.00 0.00 ? 71  ALA B N   2  
ATOM 9219   C CA  . ALA A 1 58  ? -169.096 -27.223 -25.839 1.00 0.00 ? 71  ALA B CA  2  
ATOM 9220   C C   . ALA A 1 58  ? -169.985 -28.039 -26.784 1.00 0.00 ? 71  ALA B C   2  
ATOM 9221   O O   . ALA A 1 58  ? -170.883 -27.525 -27.441 1.00 0.00 ? 71  ALA B O   2  
ATOM 9222   C CB  . ALA A 1 58  ? -169.770 -27.195 -24.477 1.00 0.00 ? 71  ALA B CB  2  
ATOM 9223   N N   . SER A 1 59  ? -169.774 -29.354 -26.882 1.00 0.00 ? 72  SER B N   2  
ATOM 9224   C CA  . SER A 1 59  ? -170.591 -30.206 -27.755 1.00 0.00 ? 72  SER B CA  2  
ATOM 9225   C C   . SER A 1 59  ? -171.962 -30.619 -27.228 1.00 0.00 ? 72  SER B C   2  
ATOM 9226   O O   . SER A 1 59  ? -172.849 -31.027 -27.975 1.00 0.00 ? 72  SER B O   2  
ATOM 9227   C CB  . SER A 1 59  ? -169.868 -31.505 -28.085 1.00 0.00 ? 72  SER B CB  2  
ATOM 9228   O OG  . SER A 1 59  ? -169.545 -32.224 -26.902 1.00 0.00 ? 72  SER B OG  2  
ATOM 9229   N N   . GLY A 1 60  ? -172.147 -30.559 -25.912 1.00 0.00 ? 73  GLY B N   2  
ATOM 9230   C CA  . GLY A 1 60  ? -173.407 -30.953 -25.293 1.00 0.00 ? 73  GLY B CA  2  
ATOM 9231   C C   . GLY A 1 60  ? -173.996 -29.942 -24.307 1.00 0.00 ? 73  GLY B C   2  
ATOM 9232   O O   . GLY A 1 60  ? -173.593 -28.775 -24.287 1.00 0.00 ? 73  GLY B O   2  
ATOM 9233   N N   . PRO A 1 61  ? -174.947 -30.353 -23.454 1.00 0.00 ? 74  PRO B N   2  
ATOM 9234   C CA  . PRO A 1 61  ? -175.379 -29.522 -22.315 1.00 0.00 ? 74  PRO B CA  2  
ATOM 9235   C C   . PRO A 1 61  ? -174.212 -29.117 -21.413 1.00 0.00 ? 74  PRO B C   2  
ATOM 9236   O O   . PRO A 1 61  ? -173.394 -29.980 -21.077 1.00 0.00 ? 74  PRO B O   2  
ATOM 9237   C CB  . PRO A 1 61  ? -176.415 -30.373 -21.613 1.00 0.00 ? 74  PRO B CB  2  
ATOM 9238   C CG  . PRO A 1 61  ? -175.990 -31.784 -21.930 1.00 0.00 ? 74  PRO B CG  2  
ATOM 9239   C CD  . PRO A 1 61  ? -175.635 -31.638 -23.394 1.00 0.00 ? 74  PRO B CD  2  
ATOM 9240   N N   . ILE A 1 62  ? -174.110 -27.884 -20.925 1.00 0.00 ? 75  ILE B N   2  
ATOM 9241   C CA  . ILE A 1 62  ? -172.864 -27.499 -20.267 1.00 0.00 ? 75  ILE B CA  2  
ATOM 9242   C C   . ILE A 1 62  ? -172.534 -28.077 -18.873 1.00 0.00 ? 75  ILE B C   2  
ATOM 9243   O O   . ILE A 1 62  ? -171.492 -27.754 -18.321 1.00 0.00 ? 75  ILE B O   2  
ATOM 9244   C CB  . ILE A 1 62  ? -172.763 -25.934 -20.248 1.00 0.00 ? 75  ILE B CB  2  
ATOM 9245   C CG1 . ILE A 1 62  ? -173.566 -25.187 -21.322 1.00 0.00 ? 75  ILE B CG1 2  
ATOM 9246   C CG2 . ILE A 1 62  ? -171.305 -25.643 -20.594 1.00 0.00 ? 75  ILE B CG2 2  
ATOM 9247   C CD1 . ILE A 1 62  ? -173.426 -23.648 -21.270 1.00 0.00 ? 75  ILE B CD1 2  
ATOM 9248   N N   . ASN A 1 63  ? -173.362 -28.970 -18.298 1.00 0.00 ? 76  ASN B N   2  
ATOM 9249   C CA  . ASN A 1 63  ? -173.123 -29.745 -17.057 1.00 0.00 ? 76  ASN B CA  2  
ATOM 9250   C C   . ASN A 1 63  ? -171.780 -29.734 -16.314 1.00 0.00 ? 76  ASN B C   2  
ATOM 9251   O O   . ASN A 1 63  ? -170.769 -29.942 -16.972 1.00 0.00 ? 76  ASN B O   2  
ATOM 9252   C CB  . ASN A 1 63  ? -173.379 -31.227 -17.281 1.00 0.00 ? 76  ASN B CB  2  
ATOM 9253   C CG  . ASN A 1 63  ? -174.759 -31.594 -17.776 1.00 0.00 ? 76  ASN B CG  2  
ATOM 9254   O OD1 . ASN A 1 63  ? -175.767 -31.251 -17.204 1.00 0.00 ? 76  ASN B OD1 2  
ATOM 9255   N ND2 . ASN A 1 63  ? -174.938 -32.304 -18.863 1.00 0.00 ? 76  ASN B ND2 2  
ATOM 9256   N N   . PHE A 1 64  ? -171.698 -29.594 -14.985 1.00 0.00 ? 77  PHE B N   2  
ATOM 9257   C CA  . PHE A 1 64  ? -170.440 -29.582 -14.195 1.00 0.00 ? 77  PHE B CA  2  
ATOM 9258   C C   . PHE A 1 64  ? -169.143 -30.157 -14.792 1.00 0.00 ? 77  PHE B C   2  
ATOM 9259   O O   . PHE A 1 64  ? -168.127 -29.482 -14.918 1.00 0.00 ? 77  PHE B O   2  
ATOM 9260   C CB  . PHE A 1 64  ? -170.682 -30.290 -12.861 1.00 0.00 ? 77  PHE B CB  2  
ATOM 9261   C CG  . PHE A 1 64  ? -171.811 -29.669 -12.057 1.00 0.00 ? 77  PHE B CG  2  
ATOM 9262   C CD1 . PHE A 1 64  ? -173.048 -30.289 -12.047 1.00 0.00 ? 77  PHE B CD1 2  
ATOM 9263   C CD2 . PHE A 1 64  ? -171.614 -28.492 -11.365 1.00 0.00 ? 77  PHE B CD2 2  
ATOM 9264   C CE1 . PHE A 1 64  ? -174.086 -29.731 -11.339 1.00 0.00 ? 77  PHE B CE1 2  
ATOM 9265   C CE2 . PHE A 1 64  ? -172.663 -27.937 -10.659 1.00 0.00 ? 77  PHE B CE2 2  
ATOM 9266   C CZ  . PHE A 1 64  ? -173.894 -28.551 -10.648 1.00 0.00 ? 77  PHE B CZ  2  
ATOM 9267   N N   . THR A 1 65  ? -169.214 -31.401 -15.266 1.00 0.00 ? 78  THR B N   2  
ATOM 9268   C CA  . THR A 1 65  ? -168.110 -32.073 -15.970 1.00 0.00 ? 78  THR B CA  2  
ATOM 9269   C C   . THR A 1 65  ? -167.743 -31.436 -17.303 1.00 0.00 ? 78  THR B C   2  
ATOM 9270   O O   . THR A 1 65  ? -166.568 -31.158 -17.524 1.00 0.00 ? 78  THR B O   2  
ATOM 9271   C CB  . THR A 1 65  ? -168.416 -33.542 -16.289 1.00 0.00 ? 78  THR B CB  2  
ATOM 9272   O OG1 . THR A 1 65  ? -169.709 -33.564 -16.903 1.00 0.00 ? 78  THR B OG1 2  
ATOM 9273   C CG2 . THR A 1 65  ? -168.369 -34.422 -15.054 1.00 0.00 ? 78  THR B CG2 2  
ATOM 9274   N N   . VAL A 1 66  ? -168.707 -31.148 -18.190 1.00 0.00 ? 79  VAL B N   2  
ATOM 9275   C CA  . VAL A 1 66  ? -168.464 -30.486 -19.480 1.00 0.00 ? 79  VAL B CA  2  
ATOM 9276   C C   . VAL A 1 66  ? -167.816 -29.114 -19.222 1.00 0.00 ? 79  VAL B C   2  
ATOM 9277   O O   . VAL A 1 66  ? -166.844 -28.751 -19.873 1.00 0.00 ? 79  VAL B O   2  
ATOM 9278   C CB  . VAL A 1 66  ? -169.819 -30.350 -20.233 1.00 0.00 ? 79  VAL B CB  2  
ATOM 9279   C CG1 . VAL A 1 66  ? -169.661 -29.536 -21.514 1.00 0.00 ? 79  VAL B CG1 2  
ATOM 9280   C CG2 . VAL A 1 66  ? -170.330 -31.734 -20.587 1.00 0.00 ? 79  VAL B CG2 2  
ATOM 9281   N N   . PHE A 1 67  ? -168.307 -28.347 -18.243 1.00 0.00 ? 80  PHE B N   2  
ATOM 9282   C CA  . PHE A 1 67  ? -167.622 -27.125 -17.800 1.00 0.00 ? 80  PHE B CA  2  
ATOM 9283   C C   . PHE A 1 67  ? -166.165 -27.379 -17.390 1.00 0.00 ? 80  PHE B C   2  
ATOM 9284   O O   . PHE A 1 67  ? -165.220 -26.873 -18.004 1.00 0.00 ? 80  PHE B O   2  
ATOM 9285   C CB  . PHE A 1 67  ? -168.203 -26.488 -16.559 1.00 0.00 ? 80  PHE B CB  2  
ATOM 9286   C CG  . PHE A 1 67  ? -169.612 -25.963 -16.546 1.00 0.00 ? 80  PHE B CG  2  
ATOM 9287   C CD1 . PHE A 1 67  ? -170.494 -26.567 -15.684 1.00 0.00 ? 80  PHE B CD1 2  
ATOM 9288   C CD2 . PHE A 1 67  ? -169.998 -24.930 -17.358 1.00 0.00 ? 80  PHE B CD2 2  
ATOM 9289   C CE1 . PHE A 1 67  ? -171.796 -26.144 -15.621 1.00 0.00 ? 80  PHE B CE1 2  
ATOM 9290   C CE2 . PHE A 1 67  ? -171.304 -24.501 -17.291 1.00 0.00 ? 80  PHE B CE2 2  
ATOM 9291   C CZ  . PHE A 1 67  ? -172.189 -25.114 -16.427 1.00 0.00 ? 80  PHE B CZ  2  
ATOM 9292   N N   . LEU A 1 68  ? -165.943 -28.163 -16.327 1.00 0.00 ? 81  LEU B N   2  
ATOM 9293   C CA  . LEU A 1 68  ? -164.612 -28.490 -15.819 1.00 0.00 ? 81  LEU B CA  2  
ATOM 9294   C C   . LEU A 1 68  ? -163.629 -28.968 -16.888 1.00 0.00 ? 81  LEU B C   2  
ATOM 9295   O O   . LEU A 1 68  ? -162.496 -28.493 -16.944 1.00 0.00 ? 81  LEU B O   2  
ATOM 9296   C CB  . LEU A 1 68  ? -164.725 -29.566 -14.738 1.00 0.00 ? 81  LEU B CB  2  
ATOM 9297   C CG  . LEU A 1 68  ? -165.258 -29.155 -13.371 1.00 0.00 ? 81  LEU B CG  2  
ATOM 9298   C CD1 . LEU A 1 68  ? -165.655 -30.386 -12.581 1.00 0.00 ? 81  LEU B CD1 2  
ATOM 9299   C CD2 . LEU A 1 68  ? -164.196 -28.357 -12.635 1.00 0.00 ? 81  LEU B CD2 2  
ATOM 9300   N N   . THR A 1 69  ? -164.062 -29.831 -17.811 1.00 0.00 ? 82  THR B N   2  
ATOM 9301   C CA  . THR A 1 69  ? -163.228 -30.249 -18.934 1.00 0.00 ? 82  THR B CA  2  
ATOM 9302   C C   . THR A 1 69  ? -162.945 -29.063 -19.851 1.00 0.00 ? 82  THR B C   2  
ATOM 9303   O O   . THR A 1 69  ? -161.771 -28.761 -20.058 1.00 0.00 ? 82  THR B O   2  
ATOM 9304   C CB  . THR A 1 69  ? -163.868 -31.357 -19.794 1.00 0.00 ? 82  THR B CB  2  
ATOM 9305   O OG1 . THR A 1 69  ? -165.167 -30.934 -20.174 1.00 0.00 ? 82  THR B OG1 2  
ATOM 9306   C CG2 . THR A 1 69  ? -163.955 -32.668 -19.030 1.00 0.00 ? 82  THR B CG2 2  
ATOM 9307   N N   . MET A 1 70  ? -163.931 -28.285 -20.323 1.00 0.00 ? 83  MET B N   2  
ATOM 9308   C CA  . MET A 1 70  ? -163.679 -27.095 -21.149 1.00 0.00 ? 83  MET B CA  2  
ATOM 9309   C C   . MET A 1 70  ? -162.750 -26.025 -20.552 1.00 0.00 ? 83  MET B C   2  
ATOM 9310   O O   . MET A 1 70  ? -161.953 -25.375 -21.243 1.00 0.00 ? 83  MET B O   2  
ATOM 9311   C CB  . MET A 1 70  ? -164.969 -26.353 -21.512 1.00 0.00 ? 83  MET B CB  2  
ATOM 9312   C CG  . MET A 1 70  ? -166.029 -27.087 -22.324 1.00 0.00 ? 83  MET B CG  2  
ATOM 9313   S SD  . MET A 1 70  ? -165.392 -28.148 -23.646 1.00 0.00 ? 83  MET B SD  2  
ATOM 9314   C CE  . MET A 1 70  ? -164.562 -26.966 -24.664 1.00 0.00 ? 83  MET B CE  2  
ATOM 9315   N N   . PHE A 1 71  ? -162.852 -25.784 -19.247 1.00 0.00 ? 84  PHE B N   2  
ATOM 9316   C CA  . PHE A 1 71  ? -161.991 -24.804 -18.574 1.00 0.00 ? 84  PHE B CA  2  
ATOM 9317   C C   . PHE A 1 71  ? -160.616 -25.322 -18.227 1.00 0.00 ? 84  PHE B C   2  
ATOM 9318   O O   . PHE A 1 71  ? -159.620 -24.599 -18.297 1.00 0.00 ? 84  PHE B O   2  
ATOM 9319   C CB  . PHE A 1 71  ? -162.663 -24.289 -17.301 1.00 0.00 ? 84  PHE B CB  2  
ATOM 9320   C CG  . PHE A 1 71  ? -164.045 -23.769 -17.655 1.00 0.00 ? 84  PHE B CG  2  
ATOM 9321   C CD1 . PHE A 1 71  ? -165.115 -24.092 -16.854 1.00 0.00 ? 84  PHE B CD1 2  
ATOM 9322   C CD2 . PHE A 1 71  ? -164.239 -23.057 -18.825 1.00 0.00 ? 84  PHE B CD2 2  
ATOM 9323   C CE1 . PHE A 1 71  ? -166.376 -23.711 -17.241 1.00 0.00 ? 84  PHE B CE1 2  
ATOM 9324   C CE2 . PHE A 1 71  ? -165.503 -22.687 -19.196 1.00 0.00 ? 84  PHE B CE2 2  
ATOM 9325   C CZ  . PHE A 1 71  ? -166.575 -23.019 -18.406 1.00 0.00 ? 84  PHE B CZ  2  
ATOM 9326   N N   . GLY A 1 72  ? -160.546 -26.608 -17.902 1.00 0.00 ? 85  GLY B N   2  
ATOM 9327   C CA  . GLY A 1 72  ? -159.259 -27.247 -17.753 1.00 0.00 ? 85  GLY B CA  2  
ATOM 9328   C C   . GLY A 1 72  ? -158.521 -27.188 -19.091 1.00 0.00 ? 85  GLY B C   2  
ATOM 9329   O O   . GLY A 1 72  ? -157.403 -26.678 -19.172 1.00 0.00 ? 85  GLY B O   2  
ATOM 9330   N N   . GLU A 1 73  ? -159.122 -27.656 -20.192 1.00 0.00 ? 86  GLU B N   2  
ATOM 9331   C CA  . GLU A 1 73  ? -158.515 -27.636 -21.527 1.00 0.00 ? 86  GLU B CA  2  
ATOM 9332   C C   . GLU A 1 73  ? -157.835 -26.353 -22.012 1.00 0.00 ? 86  GLU B C   2  
ATOM 9333   O O   . GLU A 1 73  ? -156.889 -26.378 -22.805 1.00 0.00 ? 86  GLU B O   2  
ATOM 9334   C CB  . GLU A 1 73  ? -159.544 -28.019 -22.581 1.00 0.00 ? 86  GLU B CB  2  
ATOM 9335   C CG  . GLU A 1 73  ? -159.779 -29.524 -22.637 1.00 0.00 ? 86  GLU B CG  2  
ATOM 9336   C CD  . GLU A 1 73  ? -159.972 -30.050 -24.044 1.00 0.00 ? 86  GLU B CD  2  
ATOM 9337   O OE1 . GLU A 1 73  ? -159.009 -29.997 -24.815 1.00 0.00 ? 86  GLU B OE1 2  
ATOM 9338   O OE2 . GLU A 1 73  ? -161.045 -30.529 -24.369 1.00 0.00 ? 86  GLU B OE2 2  
ATOM 9339   N N   . LYS A 1 74  ? -158.293 -25.205 -21.535 1.00 0.00 ? 87  LYS B N   2  
ATOM 9340   C CA  . LYS A 1 74  ? -157.655 -23.928 -21.845 1.00 0.00 ? 87  LYS B CA  2  
ATOM 9341   C C   . LYS A 1 74  ? -156.474 -23.575 -20.932 1.00 0.00 ? 87  LYS B C   2  
ATOM 9342   O O   . LYS A 1 74  ? -155.539 -22.853 -21.294 1.00 0.00 ? 87  LYS B O   2  
ATOM 9343   C CB  . LYS A 1 74  ? -158.728 -22.856 -21.781 1.00 0.00 ? 87  LYS B CB  2  
ATOM 9344   C CG  . LYS A 1 74  ? -159.744 -23.185 -22.856 1.00 0.00 ? 87  LYS B CG  2  
ATOM 9345   C CD  . LYS A 1 74  ? -160.950 -22.302 -22.800 1.00 0.00 ? 87  LYS B CD  2  
ATOM 9346   C CE  . LYS A 1 74  ? -161.803 -22.780 -23.942 1.00 0.00 ? 87  LYS B CE  2  
ATOM 9347   N NZ  . LYS A 1 74  ? -162.804 -21.797 -24.221 1.00 0.00 ? 87  LYS B NZ  2  
ATOM 9348   N N   . LEU A 1 75  ? -156.490 -24.134 -19.728 1.00 0.00 ? 88  LEU B N   2  
ATOM 9349   C CA  . LEU A 1 75  ? -155.431 -23.968 -18.742 1.00 0.00 ? 88  LEU B CA  2  
ATOM 9350   C C   . LEU A 1 75  ? -154.483 -25.174 -18.629 1.00 0.00 ? 88  LEU B C   2  
ATOM 9351   O O   . LEU A 1 75  ? -153.818 -25.375 -17.613 1.00 0.00 ? 88  LEU B O   2  
ATOM 9352   C CB  . LEU A 1 75  ? -156.092 -23.690 -17.398 1.00 0.00 ? 88  LEU B CB  2  
ATOM 9353   C CG  . LEU A 1 75  ? -156.897 -22.411 -17.204 1.00 0.00 ? 88  LEU B CG  2  
ATOM 9354   C CD1 . LEU A 1 75  ? -157.795 -22.578 -15.999 1.00 0.00 ? 88  LEU B CD1 2  
ATOM 9355   C CD2 . LEU A 1 75  ? -155.969 -21.215 -17.036 1.00 0.00 ? 88  LEU B CD2 2  
ATOM 9356   N N   . LYS A 1 76  ? -154.302 -25.970 -19.693 1.00 0.00 ? 89  LYS B N   2  
ATOM 9357   C CA  . LYS A 1 76  ? -153.411 -27.146 -19.732 1.00 0.00 ? 89  LYS B CA  2  
ATOM 9358   C C   . LYS A 1 76  ? -151.976 -27.032 -19.191 1.00 0.00 ? 89  LYS B C   2  
ATOM 9359   O O   . LYS A 1 76  ? -151.267 -28.012 -18.970 1.00 0.00 ? 89  LYS B O   2  
ATOM 9360   C CB  . LYS A 1 76  ? -153.298 -27.664 -21.165 1.00 0.00 ? 89  LYS B CB  2  
ATOM 9361   C CG  . LYS A 1 76  ? -154.522 -28.398 -21.650 1.00 0.00 ? 89  LYS B CG  2  
ATOM 9362   C CD  . LYS A 1 76  ? -154.535 -28.622 -23.155 1.00 0.00 ? 89  LYS B CD  2  
ATOM 9363   C CE  . LYS A 1 76  ? -155.931 -29.161 -23.390 1.00 0.00 ? 89  LYS B CE  2  
ATOM 9364   N NZ  . LYS A 1 76  ? -156.405 -29.175 -24.754 1.00 0.00 ? 89  LYS B NZ  2  
ATOM 9365   N N   . GLY A 1 77  ? -151.520 -25.791 -19.060 1.00 0.00 ? 90  GLY B N   2  
ATOM 9366   C CA  . GLY A 1 77  ? -150.225 -25.466 -18.479 1.00 0.00 ? 90  GLY B CA  2  
ATOM 9367   C C   . GLY A 1 77  ? -150.354 -24.358 -17.433 1.00 0.00 ? 90  GLY B C   2  
ATOM 9368   O O   . GLY A 1 77  ? -149.643 -23.365 -17.488 1.00 0.00 ? 90  GLY B O   2  
ATOM 9369   N N   . ALA A 1 78  ? -151.333 -24.474 -16.539 1.00 0.00 ? 91  ALA B N   2  
ATOM 9370   C CA  . ALA A 1 78  ? -151.537 -23.510 -15.465 1.00 0.00 ? 91  ALA B CA  2  
ATOM 9371   C C   . ALA A 1 78  ? -151.665 -24.077 -14.047 1.00 0.00 ? 91  ALA B C   2  
ATOM 9372   O O   . ALA A 1 78  ? -152.540 -24.891 -13.744 1.00 0.00 ? 91  ALA B O   2  
ATOM 9373   C CB  . ALA A 1 78  ? -152.794 -22.698 -15.727 1.00 0.00 ? 91  ALA B CB  2  
ATOM 9374   N N   . ASP A 1 79  ? -150.763 -23.629 -13.188 1.00 0.00 ? 92  ASP B N   2  
ATOM 9375   C CA  . ASP A 1 79  ? -150.740 -24.029 -11.791 1.00 0.00 ? 92  ASP B CA  2  
ATOM 9376   C C   . ASP A 1 79  ? -151.549 -23.126 -10.838 1.00 0.00 ? 92  ASP B C   2  
ATOM 9377   O O   . ASP A 1 79  ? -151.955 -22.002 -11.178 1.00 0.00 ? 92  ASP B O   2  
ATOM 9378   C CB  . ASP A 1 79  ? -149.284 -24.071 -11.320 1.00 0.00 ? 92  ASP B CB  2  
ATOM 9379   C CG  . ASP A 1 79  ? -148.354 -25.013 -12.073 1.00 0.00 ? 92  ASP B CG  2  
ATOM 9380   O OD1 . ASP A 1 79  ? -148.727 -26.155 -12.331 1.00 0.00 ? 92  ASP B OD1 2  
ATOM 9381   O OD2 . ASP A 1 79  ? -147.239 -24.593 -12.373 1.00 0.00 ? 92  ASP B OD2 2  
ATOM 9382   N N   . PRO A 1 80  ? -151.798 -23.547 -9.590  1.00 0.00 ? 93  PRO B N   2  
ATOM 9383   C CA  . PRO A 1 80  ? -152.244 -22.609 -8.554  1.00 0.00 ? 93  PRO B CA  2  
ATOM 9384   C C   . PRO A 1 80  ? -151.183 -21.612 -8.073  1.00 0.00 ? 93  PRO B C   2  
ATOM 9385   O O   . PRO A 1 80  ? -149.994 -21.931 -8.011  1.00 0.00 ? 93  PRO B O   2  
ATOM 9386   C CB  . PRO A 1 80  ? -152.765 -23.503 -7.443  1.00 0.00 ? 93  PRO B CB  2  
ATOM 9387   C CG  . PRO A 1 80  ? -152.051 -24.807 -7.664  1.00 0.00 ? 93  PRO B CG  2  
ATOM 9388   C CD  . PRO A 1 80  ? -152.132 -24.906 -9.175  1.00 0.00 ? 93  PRO B CD  2  
ATOM 9389   N N   . GLU A 1 81  ? -151.549 -20.387 -7.679  1.00 0.00 ? 94  GLU B N   2  
ATOM 9390   C CA  . GLU A 1 81  ? -150.582 -19.349 -7.274  1.00 0.00 ? 94  GLU B CA  2  
ATOM 9391   C C   . GLU A 1 81  ? -149.379 -19.668 -6.399  1.00 0.00 ? 94  GLU B C   2  
ATOM 9392   O O   . GLU A 1 81  ? -148.252 -19.339 -6.788  1.00 0.00 ? 94  GLU B O   2  
ATOM 9393   C CB  . GLU A 1 81  ? -151.333 -18.194 -6.615  1.00 0.00 ? 94  GLU B CB  2  
ATOM 9394   C CG  . GLU A 1 81  ? -152.514 -18.490 -5.708  1.00 0.00 ? 94  GLU B CG  2  
ATOM 9395   C CD  . GLU A 1 81  ? -153.521 -17.357 -5.784  1.00 0.00 ? 94  GLU B CD  2  
ATOM 9396   O OE1 . GLU A 1 81  ? -153.160 -16.207 -5.547  1.00 0.00 ? 94  GLU B OE1 2  
ATOM 9397   O OE2 . GLU A 1 81  ? -154.671 -17.587 -6.164  1.00 0.00 ? 94  GLU B OE2 2  
ATOM 9398   N N   . ASP A 1 82  ? -149.516 -20.360 -5.267  1.00 0.00 ? 95  ASP B N   2  
ATOM 9399   C CA  . ASP A 1 82  ? -148.369 -20.784 -4.461  1.00 0.00 ? 95  ASP B CA  2  
ATOM 9400   C C   . ASP A 1 82  ? -147.277 -21.573 -5.194  1.00 0.00 ? 95  ASP B C   2  
ATOM 9401   O O   . ASP A 1 82  ? -146.067 -21.333 -5.036  1.00 0.00 ? 95  ASP B O   2  
ATOM 9402   C CB  . ASP A 1 82  ? -148.876 -21.619 -3.297  1.00 0.00 ? 95  ASP B CB  2  
ATOM 9403   C CG  . ASP A 1 82  ? -149.843 -20.863 -2.406  1.00 0.00 ? 95  ASP B CG  2  
ATOM 9404   O OD1 . ASP A 1 82  ? -149.487 -19.785 -1.932  1.00 0.00 ? 95  ASP B OD1 2  
ATOM 9405   O OD2 . ASP A 1 82  ? -150.946 -21.362 -2.217  1.00 0.00 ? 95  ASP B OD2 2  
ATOM 9406   N N   . VAL A 1 83  ? -147.700 -22.479 -6.085  1.00 0.00 ? 96  VAL B N   2  
ATOM 9407   C CA  . VAL A 1 83  ? -146.795 -23.300 -6.901  1.00 0.00 ? 96  VAL B CA  2  
ATOM 9408   C C   . VAL A 1 83  ? -145.985 -22.407 -7.858  1.00 0.00 ? 96  VAL B C   2  
ATOM 9409   O O   . VAL A 1 83  ? -144.750 -22.482 -7.954  1.00 0.00 ? 96  VAL B O   2  
ATOM 9410   C CB  . VAL A 1 83  ? -147.648 -24.340 -7.677  1.00 0.00 ? 96  VAL B CB  2  
ATOM 9411   C CG1 . VAL A 1 83  ? -146.788 -25.154 -8.638  1.00 0.00 ? 96  VAL B CG1 2  
ATOM 9412   C CG2 . VAL A 1 83  ? -148.304 -25.286 -6.679  1.00 0.00 ? 96  VAL B CG2 2  
ATOM 9413   N N   . ILE A 1 84  ? -146.669 -21.457 -8.495  1.00 0.00 ? 97  ILE B N   2  
ATOM 9414   C CA  . ILE A 1 84  ? -146.032 -20.476 -9.390  1.00 0.00 ? 97  ILE B CA  2  
ATOM 9415   C C   . ILE A 1 84  ? -145.014 -19.615 -8.616  1.00 0.00 ? 97  ILE B C   2  
ATOM 9416   O O   . ILE A 1 84  ? -143.857 -19.440 -9.012  1.00 0.00 ? 97  ILE B O   2  
ATOM 9417   C CB  . ILE A 1 84  ? -147.119 -19.581 -10.026 1.00 0.00 ? 97  ILE B CB  2  
ATOM 9418   C CG1 . ILE A 1 84  ? -148.198 -20.417 -10.705 1.00 0.00 ? 97  ILE B CG1 2  
ATOM 9419   C CG2 . ILE A 1 84  ? -146.468 -18.704 -11.089 1.00 0.00 ? 97  ILE B CG2 2  
ATOM 9420   C CD1 . ILE A 1 84  ? -149.431 -19.628 -11.180 1.00 0.00 ? 97  ILE B CD1 2  
ATOM 9421   N N   . MET A 1 85  ? -145.424 -19.116 -7.445  1.00 0.00 ? 98  MET B N   2  
ATOM 9422   C CA  . MET A 1 85  ? -144.537 -18.399 -6.531  1.00 0.00 ? 98  MET B CA  2  
ATOM 9423   C C   . MET A 1 85  ? -143.285 -19.201 -6.158  1.00 0.00 ? 98  MET B C   2  
ATOM 9424   O O   . MET A 1 85  ? -142.222 -18.626 -5.976  1.00 0.00 ? 98  MET B O   2  
ATOM 9425   C CB  . MET A 1 85  ? -145.259 -18.050 -5.239  1.00 0.00 ? 98  MET B CB  2  
ATOM 9426   C CG  . MET A 1 85  ? -146.354 -17.000 -5.338  1.00 0.00 ? 98  MET B CG  2  
ATOM 9427   S SD  . MET A 1 85  ? -145.736 -15.403 -5.915  1.00 0.00 ? 98  MET B SD  2  
ATOM 9428   C CE  . MET A 1 85  ? -144.777 -14.918 -4.510  1.00 0.00 ? 98  MET B CE  2  
ATOM 9429   N N   . GLY A 1 86  ? -143.366 -20.522 -5.964  1.00 0.00 ? 99  GLY B N   2  
ATOM 9430   C CA  . GLY A 1 86  ? -142.196 -21.376 -5.706  1.00 0.00 ? 99  GLY B CA  2  
ATOM 9431   C C   . GLY A 1 86  ? -141.104 -21.274 -6.777  1.00 0.00 ? 99  GLY B C   2  
ATOM 9432   O O   . GLY A 1 86  ? -139.924 -21.094 -6.479  1.00 0.00 ? 99  GLY B O   2  
ATOM 9433   N N   . ALA A 1 87  ? -141.501 -21.316 -8.047  1.00 0.00 ? 100 ALA B N   2  
ATOM 9434   C CA  . ALA A 1 87  ? -140.576 -21.131 -9.168  1.00 0.00 ? 100 ALA B CA  2  
ATOM 9435   C C   . ALA A 1 87  ? -139.803 -19.807 -9.097  1.00 0.00 ? 100 ALA B C   2  
ATOM 9436   O O   . ALA A 1 87  ? -138.575 -19.752 -9.214  1.00 0.00 ? 100 ALA B O   2  
ATOM 9437   C CB  . ALA A 1 87  ? -141.383 -21.197 -10.436 1.00 0.00 ? 100 ALA B CB  2  
ATOM 9438   N N   . PHE A 1 88  ? -140.521 -18.727 -8.804  1.00 0.00 ? 101 PHE B N   2  
ATOM 9439   C CA  . PHE A 1 88  ? -139.891 -17.431 -8.554  1.00 0.00 ? 101 PHE B CA  2  
ATOM 9440   C C   . PHE A 1 88  ? -139.019 -17.470 -7.297  1.00 0.00 ? 101 PHE B C   2  
ATOM 9441   O O   . PHE A 1 88  ? -137.846 -17.163 -7.398  1.00 0.00 ? 101 PHE B O   2  
ATOM 9442   C CB  . PHE A 1 88  ? -140.990 -16.386 -8.443  1.00 0.00 ? 101 PHE B CB  2  
ATOM 9443   C CG  . PHE A 1 88  ? -141.824 -16.320 -9.720  1.00 0.00 ? 101 PHE B CG  2  
ATOM 9444   C CD1 . PHE A 1 88  ? -143.202 -16.240 -9.632  1.00 0.00 ? 101 PHE B CD1 2  
ATOM 9445   C CD2 . PHE A 1 88  ? -141.219 -16.326 -10.963 1.00 0.00 ? 101 PHE B CD2 2  
ATOM 9446   C CE1 . PHE A 1 88  ? -143.958 -16.175 -10.781 1.00 0.00 ? 101 PHE B CE1 2  
ATOM 9447   C CE2 . PHE A 1 88  ? -141.986 -16.264 -12.102 1.00 0.00 ? 101 PHE B CE2 2  
ATOM 9448   C CZ  . PHE A 1 88  ? -143.354 -16.184 -12.018 1.00 0.00 ? 101 PHE B CZ  2  
ATOM 9449   N N   . LYS A 1 89  ? -139.467 -17.968 -6.142  1.00 0.00 ? 102 LYS B N   2  
ATOM 9450   C CA  . LYS A 1 89  ? -138.646 -18.135 -4.931  1.00 0.00 ? 102 LYS B CA  2  
ATOM 9451   C C   . LYS A 1 89  ? -137.329 -18.925 -5.122  1.00 0.00 ? 102 LYS B C   2  
ATOM 9452   O O   . LYS A 1 89  ? -136.347 -18.759 -4.398  1.00 0.00 ? 102 LYS B O   2  
ATOM 9453   C CB  . LYS A 1 89  ? -139.488 -18.826 -3.848  1.00 0.00 ? 102 LYS B CB  2  
ATOM 9454   C CG  . LYS A 1 89  ? -140.665 -18.000 -3.321  1.00 0.00 ? 102 LYS B CG  2  
ATOM 9455   C CD  . LYS A 1 89  ? -141.681 -18.883 -2.592  1.00 0.00 ? 102 LYS B CD  2  
ATOM 9456   C CE  . LYS A 1 89  ? -142.940 -18.086 -2.236  1.00 0.00 ? 102 LYS B CE  2  
ATOM 9457   N NZ  . LYS A 1 89  ? -144.009 -18.945 -1.736  1.00 0.00 ? 102 LYS B NZ  2  
ATOM 9458   N N   . VAL A 1 90  ? -137.304 -19.866 -6.078  1.00 0.00 ? 103 VAL B N   2  
ATOM 9459   C CA  . VAL A 1 90  ? -136.080 -20.571 -6.491  1.00 0.00 ? 103 VAL B CA  2  
ATOM 9460   C C   . VAL A 1 90  ? -135.149 -19.631 -7.274  1.00 0.00 ? 103 VAL B C   2  
ATOM 9461   O O   . VAL A 1 90  ? -133.923 -19.643 -7.140  1.00 0.00 ? 103 VAL B O   2  
ATOM 9462   C CB  . VAL A 1 90  ? -136.488 -21.807 -7.352  1.00 0.00 ? 103 VAL B CB  2  
ATOM 9463   C CG1 . VAL A 1 90  ? -135.296 -22.427 -8.078  1.00 0.00 ? 103 VAL B CG1 2  
ATOM 9464   C CG2 . VAL A 1 90  ? -137.080 -22.848 -6.426  1.00 0.00 ? 103 VAL B CG2 2  
ATOM 9465   N N   . LEU A 1 91  ? -135.723 -18.809 -8.158  1.00 0.00 ? 104 LEU B N   2  
ATOM 9466   C CA  . LEU A 1 91  ? -134.970 -17.786 -8.878  1.00 0.00 ? 104 LEU B CA  2  
ATOM 9467   C C   . LEU A 1 91  ? -134.512 -16.610 -8.007  1.00 0.00 ? 104 LEU B C   2  
ATOM 9468   O O   . LEU A 1 91  ? -133.531 -15.928 -8.318  1.00 0.00 ? 104 LEU B O   2  
ATOM 9469   C CB  . LEU A 1 91  ? -135.794 -17.229 -9.992  1.00 0.00 ? 104 LEU B CB  2  
ATOM 9470   C CG  . LEU A 1 91  ? -136.422 -18.025 -11.091 1.00 0.00 ? 104 LEU B CG  2  
ATOM 9471   C CD1 . LEU A 1 91  ? -137.377 -17.070 -11.771 1.00 0.00 ? 104 LEU B CD1 2  
ATOM 9472   C CD2 . LEU A 1 91  ? -135.402 -18.613 -12.053 1.00 0.00 ? 104 LEU B CD2 2  
ATOM 9473   N N   . ASP A 1 92  ? -135.258 -16.351 -6.934  1.00 0.00 ? 105 ASP B N   2  
ATOM 9474   C CA  . ASP A 1 92  ? -134.949 -15.378 -5.901  1.00 0.00 ? 105 ASP B CA  2  
ATOM 9475   C C   . ASP A 1 92  ? -133.810 -15.813 -4.965  1.00 0.00 ? 105 ASP B C   2  
ATOM 9476   O O   . ASP A 1 92  ? -133.485 -15.024 -4.085  1.00 0.00 ? 105 ASP B O   2  
ATOM 9477   C CB  . ASP A 1 92  ? -136.190 -15.103 -5.016  1.00 0.00 ? 105 ASP B CB  2  
ATOM 9478   C CG  . ASP A 1 92  ? -137.443 -14.434 -5.590  1.00 0.00 ? 105 ASP B CG  2  
ATOM 9479   O OD1 . ASP A 1 92  ? -137.397 -13.817 -6.653  1.00 0.00 ? 105 ASP B OD1 2  
ATOM 9480   O OD2 . ASP A 1 92  ? -138.485 -14.517 -4.948  1.00 0.00 ? 105 ASP B OD2 2  
ATOM 9481   N N   . PRO A 1 93  ? -133.141 -16.988 -5.068  1.00 0.00 ? 106 PRO B N   2  
ATOM 9482   C CA  . PRO A 1 93  ? -132.919 -17.898 -3.924  1.00 0.00 ? 106 PRO B CA  2  
ATOM 9483   C C   . PRO A 1 93  ? -132.512 -17.336 -2.555  1.00 0.00 ? 106 PRO B C   2  
ATOM 9484   O O   . PRO A 1 93  ? -132.802 -17.889 -1.494  1.00 0.00 ? 106 PRO B O   2  
ATOM 9485   C CB  . PRO A 1 93  ? -131.916 -18.891 -4.475  1.00 0.00 ? 106 PRO B CB  2  
ATOM 9486   C CG  . PRO A 1 93  ? -130.994 -18.028 -5.287  1.00 0.00 ? 106 PRO B CG  2  
ATOM 9487   C CD  . PRO A 1 93  ? -131.934 -17.002 -5.898  1.00 0.00 ? 106 PRO B CD  2  
ATOM 9488   N N   . ASP A 1 94  ? -131.821 -16.203 -2.615  1.00 0.00 ? 107 ASP B N   2  
ATOM 9489   C CA  . ASP A 1 94  ? -131.431 -15.333 -1.512  1.00 0.00 ? 107 ASP B CA  2  
ATOM 9490   C C   . ASP A 1 94  ? -132.633 -14.823 -0.682  1.00 0.00 ? 107 ASP B C   2  
ATOM 9491   O O   . ASP A 1 94  ? -132.545 -14.560 0.524   1.00 0.00 ? 107 ASP B O   2  
ATOM 9492   C CB  . ASP A 1 94  ? -130.647 -14.154 -2.129  1.00 0.00 ? 107 ASP B CB  2  
ATOM 9493   C CG  . ASP A 1 94  ? -129.536 -14.452 -3.145  1.00 0.00 ? 107 ASP B CG  2  
ATOM 9494   O OD1 . ASP A 1 94  ? -129.364 -15.591 -3.579  1.00 0.00 ? 107 ASP B OD1 2  
ATOM 9495   O OD2 . ASP A 1 94  ? -128.842 -13.518 -3.530  1.00 0.00 ? 107 ASP B OD2 2  
ATOM 9496   N N   . GLY A 1 95  ? -133.803 -14.649 -1.299  1.00 0.00 ? 108 GLY B N   2  
ATOM 9497   C CA  . GLY A 1 95  ? -135.039 -14.270 -0.608  1.00 0.00 ? 108 GLY B CA  2  
ATOM 9498   C C   . GLY A 1 95  ? -135.664 -12.887 -0.873  1.00 0.00 ? 108 GLY B C   2  
ATOM 9499   O O   . GLY A 1 95  ? -135.135 -11.988 -1.521  1.00 0.00 ? 108 GLY B O   2  
ATOM 9500   N N   . LYS A 1 96  ? -136.832 -12.698 -0.259  1.00 0.00 ? 109 LYS B N   2  
ATOM 9501   C CA  . LYS A 1 96  ? -137.686 -11.496 -0.296  1.00 0.00 ? 109 LYS B CA  2  
ATOM 9502   C C   . LYS A 1 96  ? -137.881 -10.454 -1.413  1.00 0.00 ? 109 LYS B C   2  
ATOM 9503   O O   . LYS A 1 96  ? -139.047 -10.100 -1.674  1.00 0.00 ? 109 LYS B O   2  
ATOM 9504   C CB  . LYS A 1 96  ? -137.398 -10.682 0.963   1.00 0.00 ? 109 LYS B CB  2  
ATOM 9505   C CG  . LYS A 1 96  ? -137.856 -11.385 2.234   1.00 0.00 ? 109 LYS B CG  2  
ATOM 9506   C CD  . LYS A 1 96  ? -137.667 -10.488 3.445   1.00 0.00 ? 109 LYS B CD  2  
ATOM 9507   C CE  . LYS A 1 96  ? -137.976 -11.285 4.704   1.00 0.00 ? 109 LYS B CE  2  
ATOM 9508   N NZ  . LYS A 1 96  ? -137.868 -10.450 5.882   1.00 0.00 ? 109 LYS B NZ  2  
ATOM 9509   N N   . GLY A 1 97  ? -136.845 -9.882  -2.023  1.00 0.00 ? 110 GLY B N   2  
ATOM 9510   C CA  . GLY A 1 97  ? -136.989 -8.859  -3.065  1.00 0.00 ? 110 GLY B CA  2  
ATOM 9511   C C   . GLY A 1 97  ? -136.879 -9.473  -4.450  1.00 0.00 ? 110 GLY B C   2  
ATOM 9512   O O   . GLY A 1 97  ? -135.818 -10.010 -4.781  1.00 0.00 ? 110 GLY B O   2  
ATOM 9513   N N   . SER A 1 98  ? -137.891 -9.355  -5.308  1.00 0.00 ? 111 SER B N   2  
ATOM 9514   C CA  . SER A 1 98  ? -137.817 -10.119 -6.543  1.00 0.00 ? 111 SER B CA  2  
ATOM 9515   C C   . SER A 1 98  ? -136.941 -9.604  -7.700  1.00 0.00 ? 111 SER B C   2  
ATOM 9516   O O   . SER A 1 98  ? -136.434 -8.483  -7.734  1.00 0.00 ? 111 SER B O   2  
ATOM 9517   C CB  . SER A 1 98  ? -139.255 -10.397 -7.024  1.00 0.00 ? 111 SER B CB  2  
ATOM 9518   O OG  . SER A 1 98  ? -140.247 -9.391  -7.179  1.00 0.00 ? 111 SER B OG  2  
ATOM 9519   N N   . ILE A 1 99  ? -136.698 -10.500 -8.651  1.00 0.00 ? 112 ILE B N   2  
ATOM 9520   C CA  . ILE A 1 99  ? -135.680 -10.365 -9.706  1.00 0.00 ? 112 ILE B CA  2  
ATOM 9521   C C   . ILE A 1 99  ? -135.662 -9.231  -10.744 1.00 0.00 ? 112 ILE B C   2  
ATOM 9522   O O   . ILE A 1 99  ? -136.585 -8.454  -10.920 1.00 0.00 ? 112 ILE B O   2  
ATOM 9523   C CB  . ILE A 1 99  ? -135.653 -11.783 -10.392 1.00 0.00 ? 112 ILE B CB  2  
ATOM 9524   C CG1 . ILE A 1 99  ? -135.327 -12.775 -9.315  1.00 0.00 ? 112 ILE B CG1 2  
ATOM 9525   C CG2 . ILE A 1 99  ? -134.574 -12.015 -11.439 1.00 0.00 ? 112 ILE B CG2 2  
ATOM 9526   C CD1 . ILE A 1 99  ? -136.203 -13.982 -9.588  1.00 0.00 ? 112 ILE B CD1 2  
ATOM 9527   N N   . LYS A 1 100 ? -134.548 -9.097  -11.462 1.00 0.00 ? 113 LYS B N   2  
ATOM 9528   C CA  . LYS A 1 100 ? -134.371 -8.075  -12.493 1.00 0.00 ? 113 LYS B CA  2  
ATOM 9529   C C   . LYS A 1 100 ? -134.569 -8.453  -13.967 1.00 0.00 ? 113 LYS B C   2  
ATOM 9530   O O   . LYS A 1 100 ? -134.247 -9.556  -14.440 1.00 0.00 ? 113 LYS B O   2  
ATOM 9531   C CB  . LYS A 1 100 ? -132.974 -7.485  -12.351 1.00 0.00 ? 113 LYS B CB  2  
ATOM 9532   C CG  . LYS A 1 100 ? -132.567 -7.115  -10.929 1.00 0.00 ? 113 LYS B CG  2  
ATOM 9533   C CD  . LYS A 1 100 ? -131.072 -6.878  -10.917 1.00 0.00 ? 113 LYS B CD  2  
ATOM 9534   C CE  . LYS A 1 100 ? -130.514 -6.878  -9.504  1.00 0.00 ? 113 LYS B CE  2  
ATOM 9535   N NZ  . LYS A 1 100 ? -129.069 -6.843  -9.558  1.00 0.00 ? 113 LYS B NZ  2  
ATOM 9536   N N   . LYS A 1 101 ? -135.125 -7.514  -14.727 1.00 0.00 ? 114 LYS B N   2  
ATOM 9537   C CA  . LYS A 1 101 ? -135.215 -7.643  -16.178 1.00 0.00 ? 114 LYS B CA  2  
ATOM 9538   C C   . LYS A 1 101 ? -133.850 -7.458  -16.872 1.00 0.00 ? 114 LYS B C   2  
ATOM 9539   O O   . LYS A 1 101 ? -133.127 -6.471  -16.745 1.00 0.00 ? 114 LYS B O   2  
ATOM 9540   C CB  . LYS A 1 101 ? -136.210 -6.637  -16.764 1.00 0.00 ? 114 LYS B CB  2  
ATOM 9541   C CG  . LYS A 1 101 ? -136.351 -5.249  -16.151 1.00 0.00 ? 114 LYS B CG  2  
ATOM 9542   C CD  . LYS A 1 101 ? -137.144 -4.282  -17.044 1.00 0.00 ? 114 LYS B CD  2  
ATOM 9543   C CE  . LYS A 1 101 ? -138.288 -4.932  -17.825 1.00 0.00 ? 114 LYS B CE  2  
ATOM 9544   N NZ  . LYS A 1 101 ? -139.546 -4.234  -17.641 1.00 0.00 ? 114 LYS B NZ  2  
ATOM 9545   N N   . SER A 1 102 ? -133.452 -8.655  -17.293 1.00 0.00 ? 115 SER B N   2  
ATOM 9546   C CA  . SER A 1 102 ? -132.234 -9.059  -18.018 1.00 0.00 ? 115 SER B CA  2  
ATOM 9547   C C   . SER A 1 102 ? -131.990 -10.492 -17.576 1.00 0.00 ? 115 SER B C   2  
ATOM 9548   O O   . SER A 1 102 ? -132.141 -11.435 -18.350 1.00 0.00 ? 115 SER B O   2  
ATOM 9549   C CB  . SER A 1 102 ? -130.940 -8.293  -17.689 1.00 0.00 ? 115 SER B CB  2  
ATOM 9550   O OG  . SER A 1 102 ? -130.699 -8.191  -16.292 1.00 0.00 ? 115 SER B OG  2  
ATOM 9551   N N   . PHE A 1 103 ? -131.895 -10.681 -16.255 1.00 0.00 ? 116 PHE B N   2  
ATOM 9552   C CA  . PHE A 1 103 ? -131.696 -11.980 -15.601 1.00 0.00 ? 116 PHE B CA  2  
ATOM 9553   C C   . PHE A 1 103 ? -132.732 -13.016 -16.057 1.00 0.00 ? 116 PHE B C   2  
ATOM 9554   O O   . PHE A 1 103 ? -132.407 -14.103 -16.539 1.00 0.00 ? 116 PHE B O   2  
ATOM 9555   C CB  . PHE A 1 103 ? -131.774 -11.803 -14.072 1.00 0.00 ? 116 PHE B CB  2  
ATOM 9556   C CG  . PHE A 1 103 ? -130.638 -10.986 -13.451 1.00 0.00 ? 116 PHE B CG  2  
ATOM 9557   C CD1 . PHE A 1 103 ? -130.456 -9.662  -13.798 1.00 0.00 ? 116 PHE B CD1 2  
ATOM 9558   C CD2 . PHE A 1 103 ? -129.782 -11.566 -12.543 1.00 0.00 ? 116 PHE B CD2 2  
ATOM 9559   C CE1 . PHE A 1 103 ? -129.422 -8.924  -13.255 1.00 0.00 ? 116 PHE B CE1 2  
ATOM 9560   C CE2 . PHE A 1 103 ? -128.745 -10.824 -11.997 1.00 0.00 ? 116 PHE B CE2 2  
ATOM 9561   C CZ  . PHE A 1 103 ? -128.567 -9.507  -12.350 1.00 0.00 ? 116 PHE B CZ  2  
ATOM 9562   N N   . LEU A 1 104 ? -134.024 -12.682 -15.988 1.00 0.00 ? 117 LEU B N   2  
ATOM 9563   C CA  . LEU A 1 104 ? -135.019 -13.586 -16.559 1.00 0.00 ? 117 LEU B CA  2  
ATOM 9564   C C   . LEU A 1 104 ? -135.207 -13.522 -18.073 1.00 0.00 ? 117 LEU B C   2  
ATOM 9565   O O   . LEU A 1 104 ? -135.538 -14.547 -18.666 1.00 0.00 ? 117 LEU B O   2  
ATOM 9566   C CB  . LEU A 1 104 ? -136.379 -13.377 -15.912 1.00 0.00 ? 117 LEU B CB  2  
ATOM 9567   C CG  . LEU A 1 104 ? -136.650 -14.033 -14.556 1.00 0.00 ? 117 LEU B CG  2  
ATOM 9568   C CD1 . LEU A 1 104 ? -138.002 -14.717 -14.675 1.00 0.00 ? 117 LEU B CD1 2  
ATOM 9569   C CD2 . LEU A 1 104 ? -135.613 -15.075 -14.166 1.00 0.00 ? 117 LEU B CD2 2  
ATOM 9570   N N   . GLU A 1 105 ? -134.935 -12.394 -18.751 1.00 0.00 ? 118 GLU B N   2  
ATOM 9571   C CA  . GLU A 1 105 ? -135.014 -12.290 -20.227 1.00 0.00 ? 118 GLU B CA  2  
ATOM 9572   C C   . GLU A 1 105 ? -134.145 -13.381 -20.851 1.00 0.00 ? 118 GLU B C   2  
ATOM 9573   O O   . GLU A 1 105 ? -134.601 -14.283 -21.559 1.00 0.00 ? 118 GLU B O   2  
ATOM 9574   C CB  . GLU A 1 105 ? -134.480 -10.962 -20.772 1.00 0.00 ? 118 GLU B CB  2  
ATOM 9575   C CG  . GLU A 1 105 ? -134.887 -9.760  -19.954 1.00 0.00 ? 118 GLU B CG  2  
ATOM 9576   C CD  . GLU A 1 105 ? -134.646 -8.362  -20.500 1.00 0.00 ? 118 GLU B CD  2  
ATOM 9577   O OE1 . GLU A 1 105 ? -133.830 -8.184  -21.402 1.00 0.00 ? 118 GLU B OE1 2  
ATOM 9578   O OE2 . GLU A 1 105 ? -135.277 -7.443  -19.978 1.00 0.00 ? 118 GLU B OE2 2  
ATOM 9579   N N   . GLU A 1 106 ? -132.892 -13.387 -20.388 1.00 0.00 ? 119 GLU B N   2  
ATOM 9580   C CA  . GLU A 1 106 ? -131.929 -14.417 -20.734 1.00 0.00 ? 119 GLU B CA  2  
ATOM 9581   C C   . GLU A 1 106 ? -132.406 -15.804 -20.308 1.00 0.00 ? 119 GLU B C   2  
ATOM 9582   O O   . GLU A 1 106 ? -132.519 -16.686 -21.151 1.00 0.00 ? 119 GLU B O   2  
ATOM 9583   C CB  . GLU A 1 106 ? -130.599 -14.175 -20.061 1.00 0.00 ? 119 GLU B CB  2  
ATOM 9584   C CG  . GLU A 1 106 ? -129.782 -13.014 -20.584 1.00 0.00 ? 119 GLU B CG  2  
ATOM 9585   C CD  . GLU A 1 106 ? -128.456 -12.858 -19.853 1.00 0.00 ? 119 GLU B CD  2  
ATOM 9586   O OE1 . GLU A 1 106 ? -127.749 -13.858 -19.674 1.00 0.00 ? 119 GLU B OE1 2  
ATOM 9587   O OE2 . GLU A 1 106 ? -128.137 -11.736 -19.468 1.00 0.00 ? 119 GLU B OE2 2  
ATOM 9588   N N   . LEU A 1 107 ? -132.732 -16.090 -19.044 1.00 0.00 ? 120 LEU B N   2  
ATOM 9589   C CA  . LEU A 1 107 ? -133.200 -17.427 -18.663 1.00 0.00 ? 120 LEU B CA  2  
ATOM 9590   C C   . LEU A 1 107 ? -134.465 -17.995 -19.331 1.00 0.00 ? 120 LEU B C   2  
ATOM 9591   O O   . LEU A 1 107 ? -134.654 -19.210 -19.367 1.00 0.00 ? 120 LEU B O   2  
ATOM 9592   C CB  . LEU A 1 107 ? -133.382 -17.467 -17.148 1.00 0.00 ? 120 LEU B CB  2  
ATOM 9593   C CG  . LEU A 1 107 ? -132.130 -17.274 -16.287 1.00 0.00 ? 120 LEU B CG  2  
ATOM 9594   C CD1 . LEU A 1 107 ? -132.524 -17.356 -14.827 1.00 0.00 ? 120 LEU B CD1 2  
ATOM 9595   C CD2 . LEU A 1 107 ? -131.085 -18.336 -16.610 1.00 0.00 ? 120 LEU B CD2 2  
ATOM 9596   N N   . LEU A 1 108 ? -135.377 -17.175 -19.847 1.00 0.00 ? 121 LEU B N   2  
ATOM 9597   C CA  . LEU A 1 108 ? -136.492 -17.666 -20.654 1.00 0.00 ? 121 LEU B CA  2  
ATOM 9598   C C   . LEU A 1 108 ? -136.072 -17.971 -22.101 1.00 0.00 ? 121 LEU B C   2  
ATOM 9599   O O   . LEU A 1 108 ? -136.610 -18.862 -22.765 1.00 0.00 ? 121 LEU B O   2  
ATOM 9600   C CB  . LEU A 1 108 ? -137.616 -16.631 -20.671 1.00 0.00 ? 121 LEU B CB  2  
ATOM 9601   C CG  . LEU A 1 108 ? -138.266 -16.183 -19.360 1.00 0.00 ? 121 LEU B CG  2  
ATOM 9602   C CD1 . LEU A 1 108 ? -139.265 -15.081 -19.671 1.00 0.00 ? 121 LEU B CD1 2  
ATOM 9603   C CD2 . LEU A 1 108 ? -138.953 -17.349 -18.670 1.00 0.00 ? 121 LEU B CD2 2  
ATOM 9604   N N   . THR A 1 109 ? -135.139 -17.196 -22.663 1.00 0.00 ? 122 THR B N   2  
ATOM 9605   C CA  . THR A 1 109 ? -134.603 -17.494 -23.997 1.00 0.00 ? 122 THR B CA  2  
ATOM 9606   C C   . THR A 1 109 ? -133.517 -18.555 -24.087 1.00 0.00 ? 122 THR B C   2  
ATOM 9607   O O   . THR A 1 109 ? -133.386 -19.234 -25.099 1.00 0.00 ? 122 THR B O   2  
ATOM 9608   C CB  . THR A 1 109 ? -133.937 -16.302 -24.718 1.00 0.00 ? 122 THR B CB  2  
ATOM 9609   O OG1 . THR A 1 109 ? -133.085 -15.641 -23.787 1.00 0.00 ? 122 THR B OG1 2  
ATOM 9610   C CG2 . THR A 1 109 ? -134.962 -15.353 -25.295 1.00 0.00 ? 122 THR B CG2 2  
ATOM 9611   N N   . THR A 1 110 ? -132.682 -18.679 -23.052 1.00 0.00 ? 123 THR B N   2  
ATOM 9612   C CA  . THR A 1 110 ? -131.501 -19.536 -23.133 1.00 0.00 ? 123 THR B CA  2  
ATOM 9613   C C   . THR A 1 110 ? -131.651 -21.059 -23.100 1.00 0.00 ? 123 THR B C   2  
ATOM 9614   O O   . THR A 1 110 ? -131.808 -21.651 -24.165 1.00 0.00 ? 123 THR B O   2  
ATOM 9615   C CB  . THR A 1 110 ? -130.444 -19.164 -22.036 1.00 0.00 ? 123 THR B CB  2  
ATOM 9616   O OG1 . THR A 1 110 ? -130.976 -19.344 -20.724 1.00 0.00 ? 123 THR B OG1 2  
ATOM 9617   C CG2 . THR A 1 110 ? -129.940 -17.750 -22.293 1.00 0.00 ? 123 THR B CG2 2  
ATOM 9618   N N   . GLN A 1 111 ? -131.511 -21.811 -22.004 1.00 0.00 ? 124 GLN B N   2  
ATOM 9619   C CA  . GLN A 1 111 ? -131.704 -23.265 -21.991 1.00 0.00 ? 124 GLN B CA  2  
ATOM 9620   C C   . GLN A 1 111 ? -133.064 -23.664 -22.601 1.00 0.00 ? 124 GLN B C   2  
ATOM 9621   O O   . GLN A 1 111 ? -134.055 -22.980 -22.350 1.00 0.00 ? 124 GLN B O   2  
ATOM 9622   C CB  . GLN A 1 111 ? -131.568 -23.698 -20.538 1.00 0.00 ? 124 GLN B CB  2  
ATOM 9623   C CG  . GLN A 1 111 ? -131.483 -25.184 -20.245 1.00 0.00 ? 124 GLN B CG  2  
ATOM 9624   C CD  . GLN A 1 111 ? -131.253 -25.440 -18.761 1.00 0.00 ? 124 GLN B CD  2  
ATOM 9625   O OE1 . GLN A 1 111 ? -132.038 -25.077 -17.902 1.00 0.00 ? 124 GLN B OE1 2  
ATOM 9626   N NE2 . GLN A 1 111 ? -130.186 -26.043 -18.298 1.00 0.00 ? 124 GLN B NE2 2  
ATOM 9627   N N   . CYS A 1 112 ? -133.123 -24.761 -23.374 1.00 0.00 ? 125 CYS B N   2  
ATOM 9628   C CA  . CYS A 1 112 ? -134.240 -25.187 -24.245 1.00 0.00 ? 125 CYS B CA  2  
ATOM 9629   C C   . CYS A 1 112 ? -134.179 -24.510 -25.620 1.00 0.00 ? 125 CYS B C   2  
ATOM 9630   O O   . CYS A 1 112 ? -133.121 -24.005 -25.998 1.00 0.00 ? 125 CYS B O   2  
ATOM 9631   C CB  . CYS A 1 112 ? -135.656 -24.882 -23.696 1.00 0.00 ? 125 CYS B CB  2  
ATOM 9632   S SG  . CYS A 1 112 ? -136.272 -26.198 -22.625 1.00 0.00 ? 125 CYS B SG  2  
ATOM 9633   N N   . ASP A 1 113 ? -135.239 -24.516 -26.423 1.00 0.00 ? 126 ASP B N   2  
ATOM 9634   C CA  . ASP A 1 113 ? -135.260 -23.891 -27.734 1.00 0.00 ? 126 ASP B CA  2  
ATOM 9635   C C   . ASP A 1 113 ? -135.655 -22.418 -27.771 1.00 0.00 ? 126 ASP B C   2  
ATOM 9636   O O   . ASP A 1 113 ? -135.035 -21.571 -28.415 1.00 0.00 ? 126 ASP B O   2  
ATOM 9637   C CB  . ASP A 1 113 ? -136.206 -24.736 -28.612 1.00 0.00 ? 126 ASP B CB  2  
ATOM 9638   C CG  . ASP A 1 113 ? -137.652 -24.892 -28.136 1.00 0.00 ? 126 ASP B CG  2  
ATOM 9639   O OD1 . ASP A 1 113 ? -138.488 -25.271 -28.943 1.00 0.00 ? 126 ASP B OD1 2  
ATOM 9640   O OD2 . ASP A 1 113 ? -137.953 -24.638 -26.966 1.00 0.00 ? 126 ASP B OD2 2  
ATOM 9641   N N   . ARG A 1 114 ? -136.706 -22.091 -27.007 1.00 0.00 ? 127 ARG B N   2  
ATOM 9642   C CA  . ARG A 1 114 ? -137.288 -20.761 -27.031 1.00 0.00 ? 127 ARG B CA  2  
ATOM 9643   C C   . ARG A 1 114 ? -138.490 -20.386 -26.167 1.00 0.00 ? 127 ARG B C   2  
ATOM 9644   O O   . ARG A 1 114 ? -139.546 -21.027 -26.160 1.00 0.00 ? 127 ARG B O   2  
ATOM 9645   C CB  . ARG A 1 114 ? -137.741 -20.382 -28.451 1.00 0.00 ? 127 ARG B CB  2  
ATOM 9646   C CG  . ARG A 1 114 ? -137.181 -19.143 -29.134 1.00 0.00 ? 127 ARG B CG  2  
ATOM 9647   C CD  . ARG A 1 114 ? -137.792 -19.134 -30.533 1.00 0.00 ? 127 ARG B CD  2  
ATOM 9648   N NE  . ARG A 1 114 ? -137.459 -17.938 -31.292 1.00 0.00 ? 127 ARG B NE  2  
ATOM 9649   C CZ  . ARG A 1 114 ? -138.223 -17.463 -32.261 1.00 0.00 ? 127 ARG B CZ  2  
ATOM 9650   N NH1 . ARG A 1 114 ? -137.827 -16.406 -32.924 1.00 0.00 ? 127 ARG B NH1 2  
ATOM 9651   N NH2 . ARG A 1 114 ? -139.365 -18.002 -32.594 1.00 0.00 ? 127 ARG B NH2 2  
ATOM 9652   N N   . PHE A 1 115 ? -138.319 -19.357 -25.355 1.00 0.00 ? 128 PHE B N   2  
ATOM 9653   C CA  . PHE A 1 115 ? -139.493 -18.563 -25.053 1.00 0.00 ? 128 PHE B CA  2  
ATOM 9654   C C   . PHE A 1 115 ? -139.178 -17.335 -25.897 1.00 0.00 ? 128 PHE B C   2  
ATOM 9655   O O   . PHE A 1 115 ? -138.267 -16.541 -25.664 1.00 0.00 ? 128 PHE B O   2  
ATOM 9656   C CB  . PHE A 1 115 ? -139.596 -18.265 -23.563 1.00 0.00 ? 128 PHE B CB  2  
ATOM 9657   C CG  . PHE A 1 115 ? -140.560 -19.314 -23.044 1.00 0.00 ? 128 PHE B CG  2  
ATOM 9658   C CD1 . PHE A 1 115 ? -140.169 -20.640 -23.004 1.00 0.00 ? 128 PHE B CD1 2  
ATOM 9659   C CD2 . PHE A 1 115 ? -141.843 -18.948 -22.706 1.00 0.00 ? 128 PHE B CD2 2  
ATOM 9660   C CE1 . PHE A 1 115 ? -141.075 -21.610 -22.635 1.00 0.00 ? 128 PHE B CE1 2  
ATOM 9661   C CE2 . PHE A 1 115 ? -142.738 -19.920 -22.337 1.00 0.00 ? 128 PHE B CE2 2  
ATOM 9662   C CZ  . PHE A 1 115 ? -142.355 -21.247 -22.305 1.00 0.00 ? 128 PHE B CZ  2  
ATOM 9663   N N   . THR A 1 116 ? -139.887 -17.278 -27.024 1.00 0.00 ? 129 THR B N   2  
ATOM 9664   C CA  . THR A 1 116 ? -139.536 -16.344 -28.101 1.00 0.00 ? 129 THR B CA  2  
ATOM 9665   C C   . THR A 1 116 ? -139.454 -14.854 -27.763 1.00 0.00 ? 129 THR B C   2  
ATOM 9666   O O   . THR A 1 116 ? -140.248 -14.325 -26.984 1.00 0.00 ? 129 THR B O   2  
ATOM 9667   C CB  . THR A 1 116 ? -140.503 -16.481 -29.350 1.00 0.00 ? 129 THR B CB  2  
ATOM 9668   O OG1 . THR A 1 116 ? -141.486 -15.466 -29.246 1.00 0.00 ? 129 THR B OG1 2  
ATOM 9669   C CG2 . THR A 1 116 ? -141.125 -17.864 -29.482 1.00 0.00 ? 129 THR B CG2 2  
ATOM 9670   N N   . PRO A 1 117 ? -138.537 -14.106 -28.390 1.00 0.00 ? 130 PRO B N   2  
ATOM 9671   C CA  . PRO A 1 117 ? -138.542 -12.645 -28.266 1.00 0.00 ? 130 PRO B CA  2  
ATOM 9672   C C   . PRO A 1 117 ? -139.763 -11.836 -28.722 1.00 0.00 ? 130 PRO B C   2  
ATOM 9673   O O   . PRO A 1 117 ? -139.782 -10.599 -28.629 1.00 0.00 ? 130 PRO B O   2  
ATOM 9674   C CB  . PRO A 1 117 ? -137.257 -12.229 -28.970 1.00 0.00 ? 130 PRO B CB  2  
ATOM 9675   C CG  . PRO A 1 117 ? -136.737 -13.488 -29.618 1.00 0.00 ? 130 PRO B CG  2  
ATOM 9676   C CD  . PRO A 1 117 ? -137.147 -14.496 -28.574 1.00 0.00 ? 130 PRO B CD  2  
ATOM 9677   N N   . GLU A 1 118 ? -140.807 -12.503 -29.222 1.00 0.00 ? 131 GLU B N   2  
ATOM 9678   C CA  . GLU A 1 118 ? -142.102 -11.880 -29.470 1.00 0.00 ? 131 GLU B CA  2  
ATOM 9679   C C   . GLU A 1 118 ? -142.863 -12.061 -28.144 1.00 0.00 ? 131 GLU B C   2  
ATOM 9680   O O   . GLU A 1 118 ? -143.236 -11.097 -27.471 1.00 0.00 ? 131 GLU B O   2  
ATOM 9681   C CB  . GLU A 1 118 ? -142.824 -12.607 -30.598 1.00 0.00 ? 131 GLU B CB  2  
ATOM 9682   C CG  . GLU A 1 118 ? -142.119 -12.426 -31.942 1.00 0.00 ? 131 GLU B CG  2  
ATOM 9683   C CD  . GLU A 1 118 ? -142.610 -13.331 -33.061 1.00 0.00 ? 131 GLU B CD  2  
ATOM 9684   O OE1 . GLU A 1 118 ? -143.811 -13.553 -33.191 1.00 0.00 ? 131 GLU B OE1 2  
ATOM 9685   O OE2 . GLU A 1 118 ? -141.759 -13.838 -33.798 1.00 0.00 ? 131 GLU B OE2 2  
ATOM 9686   N N   . GLU A 1 119 ? -142.978 -13.314 -27.668 1.00 0.00 ? 132 GLU B N   2  
ATOM 9687   C CA  . GLU A 1 119 ? -143.569 -13.664 -26.360 1.00 0.00 ? 132 GLU B CA  2  
ATOM 9688   C C   . GLU A 1 119 ? -143.021 -12.820 -25.203 1.00 0.00 ? 132 GLU B C   2  
ATOM 9689   O O   . GLU A 1 119 ? -143.776 -12.172 -24.480 1.00 0.00 ? 132 GLU B O   2  
ATOM 9690   C CB  . GLU A 1 119 ? -143.317 -15.146 -26.005 1.00 0.00 ? 132 GLU B CB  2  
ATOM 9691   C CG  . GLU A 1 119 ? -143.936 -16.217 -26.915 1.00 0.00 ? 132 GLU B CG  2  
ATOM 9692   C CD  . GLU A 1 119 ? -143.713 -17.673 -26.488 1.00 0.00 ? 132 GLU B CD  2  
ATOM 9693   O OE1 . GLU A 1 119 ? -142.587 -18.143 -26.397 1.00 0.00 ? 132 GLU B OE1 2  
ATOM 9694   O OE2 . GLU A 1 119 ? -144.680 -18.385 -26.252 1.00 0.00 ? 132 GLU B OE2 2  
ATOM 9695   N N   . ILE A 1 120 ? -141.699 -12.694 -25.062 1.00 0.00 ? 133 ILE B N   2  
ATOM 9696   C CA  . ILE A 1 120 ? -141.071 -11.875 -24.012 1.00 0.00 ? 133 ILE B CA  2  
ATOM 9697   C C   . ILE A 1 120 ? -141.410 -10.372 -24.051 1.00 0.00 ? 133 ILE B C   2  
ATOM 9698   O O   . ILE A 1 120 ? -141.691 -9.782  -23.005 1.00 0.00 ? 133 ILE B O   2  
ATOM 9699   C CB  . ILE A 1 120 ? -139.542 -12.145 -24.120 1.00 0.00 ? 133 ILE B CB  2  
ATOM 9700   C CG1 . ILE A 1 120 ? -139.297 -13.562 -23.621 1.00 0.00 ? 133 ILE B CG1 2  
ATOM 9701   C CG2 . ILE A 1 120 ? -138.719 -11.190 -23.263 1.00 0.00 ? 133 ILE B CG2 2  
ATOM 9702   C CD1 . ILE A 1 120 ? -137.827 -14.014 -23.665 1.00 0.00 ? 133 ILE B CD1 2  
ATOM 9703   N N   . LYS A 1 121 ? -141.464 -9.682  -25.199 1.00 0.00 ? 134 LYS B N   2  
ATOM 9704   C CA  . LYS A 1 121 ? -141.894 -8.277  -25.230 1.00 0.00 ? 134 LYS B CA  2  
ATOM 9705   C C   . LYS A 1 121 ? -143.362 -8.115  -24.805 1.00 0.00 ? 134 LYS B C   2  
ATOM 9706   O O   . LYS A 1 121 ? -143.714 -7.231  -24.019 1.00 0.00 ? 134 LYS B O   2  
ATOM 9707   C CB  . LYS A 1 121 ? -141.712 -7.716  -26.631 1.00 0.00 ? 134 LYS B CB  2  
ATOM 9708   C CG  . LYS A 1 121 ? -140.238 -7.645  -26.994 1.00 0.00 ? 134 LYS B CG  2  
ATOM 9709   C CD  . LYS A 1 121 ? -140.059 -7.139  -28.409 1.00 0.00 ? 134 LYS B CD  2  
ATOM 9710   C CE  . LYS A 1 121 ? -138.589 -7.233  -28.774 1.00 0.00 ? 134 LYS B CE  2  
ATOM 9711   N NZ  . LYS A 1 121 ? -138.384 -6.770  -30.129 1.00 0.00 ? 134 LYS B NZ  2  
ATOM 9712   N N   . ASN A 1 122 ? -144.222 -9.037  -25.251 1.00 0.00 ? 135 ASN B N   2  
ATOM 9713   C CA  . ASN A 1 122 ? -145.616 -9.101  -24.790 1.00 0.00 ? 135 ASN B CA  2  
ATOM 9714   C C   . ASN A 1 122 ? -145.669 -9.275  -23.269 1.00 0.00 ? 135 ASN B C   2  
ATOM 9715   O O   . ASN A 1 122 ? -146.446 -8.626  -22.579 1.00 0.00 ? 135 ASN B O   2  
ATOM 9716   C CB  . ASN A 1 122 ? -146.356 -10.281 -25.408 1.00 0.00 ? 135 ASN B CB  2  
ATOM 9717   C CG  . ASN A 1 122 ? -146.429 -10.243 -26.920 1.00 0.00 ? 135 ASN B CG  2  
ATOM 9718   O OD1 . ASN A 1 122 ? -146.847 -9.290  -27.548 1.00 0.00 ? 135 ASN B OD1 2  
ATOM 9719   N ND2 . ASN A 1 122 ? -146.035 -11.274 -27.621 1.00 0.00 ? 135 ASN B ND2 2  
ATOM 9720   N N   . MET A 1 123 ? -144.818 -10.151 -22.728 1.00 0.00 ? 136 MET B N   2  
ATOM 9721   C CA  . MET A 1 123 ? -144.617 -10.286 -21.289 1.00 0.00 ? 136 MET B CA  2  
ATOM 9722   C C   . MET A 1 123 ? -144.282 -8.951  -20.628 1.00 0.00 ? 136 MET B C   2  
ATOM 9723   O O   . MET A 1 123 ? -145.085 -8.523  -19.820 1.00 0.00 ? 136 MET B O   2  
ATOM 9724   C CB  . MET A 1 123 ? -143.499 -11.271 -21.003 1.00 0.00 ? 136 MET B CB  2  
ATOM 9725   C CG  . MET A 1 123 ? -143.873 -12.720 -21.220 1.00 0.00 ? 136 MET B CG  2  
ATOM 9726   S SD  . MET A 1 123 ? -145.079 -13.239 -19.979 1.00 0.00 ? 136 MET B SD  2  
ATOM 9727   C CE  . MET A 1 123 ? -144.035 -13.065 -18.557 1.00 0.00 ? 136 MET B CE  2  
ATOM 9728   N N   . TRP A 1 124 ? -143.237 -8.199  -20.976 1.00 0.00 ? 137 TRP B N   2  
ATOM 9729   C CA  . TRP A 1 124 ? -142.961 -6.885  -20.367 1.00 0.00 ? 137 TRP B CA  2  
ATOM 9730   C C   . TRP A 1 124 ? -144.084 -5.831  -20.441 1.00 0.00 ? 137 TRP B C   2  
ATOM 9731   O O   . TRP A 1 124 ? -144.162 -4.899  -19.632 1.00 0.00 ? 137 TRP B O   2  
ATOM 9732   C CB  . TRP A 1 124 ? -141.724 -6.224  -20.983 1.00 0.00 ? 137 TRP B CB  2  
ATOM 9733   C CG  . TRP A 1 124 ? -140.506 -7.125  -21.113 1.00 0.00 ? 137 TRP B CG  2  
ATOM 9734   C CD1 . TRP A 1 124 ? -139.945 -7.315  -22.344 1.00 0.00 ? 137 TRP B CD1 2  
ATOM 9735   C CD2 . TRP A 1 124 ? -139.881 -7.847  -20.125 1.00 0.00 ? 137 TRP B CD2 2  
ATOM 9736   N NE1 . TRP A 1 124 ? -138.979 -8.163  -22.136 1.00 0.00 ? 137 TRP B NE1 2  
ATOM 9737   C CE2 . TRP A 1 124 ? -138.916 -8.497  -20.845 1.00 0.00 ? 137 TRP B CE2 2  
ATOM 9738   C CE3 . TRP A 1 124 ? -139.951 -8.079  -18.777 1.00 0.00 ? 137 TRP B CE3 2  
ATOM 9739   C CZ2 . TRP A 1 124 ? -138.045 -9.359  -20.232 1.00 0.00 ? 137 TRP B CZ2 2  
ATOM 9740   C CZ3 . TRP A 1 124 ? -139.083 -8.933  -18.143 1.00 0.00 ? 137 TRP B CZ3 2  
ATOM 9741   C CH2 . TRP A 1 124 ? -138.122 -9.580  -18.877 1.00 0.00 ? 137 TRP B CH2 2  
ATOM 9742   N N   . ALA A 1 125 ? -144.898 -5.911  -21.493 1.00 0.00 ? 138 ALA B N   2  
ATOM 9743   C CA  . ALA A 1 125 ? -146.097 -5.080  -21.626 1.00 0.00 ? 138 ALA B CA  2  
ATOM 9744   C C   . ALA A 1 125 ? -147.345 -5.526  -20.838 1.00 0.00 ? 138 ALA B C   2  
ATOM 9745   O O   . ALA A 1 125 ? -148.105 -4.710  -20.325 1.00 0.00 ? 138 ALA B O   2  
ATOM 9746   C CB  . ALA A 1 125 ? -146.476 -4.991  -23.094 1.00 0.00 ? 138 ALA B CB  2  
ATOM 9747   N N   . ALA A 1 126 ? -147.609 -6.836  -20.755 1.00 0.00 ? 139 ALA B N   2  
ATOM 9748   C CA  . ALA A 1 126 ? -148.751 -7.427  -20.032 1.00 0.00 ? 139 ALA B CA  2  
ATOM 9749   C C   . ALA A 1 126 ? -148.539 -7.839  -18.568 1.00 0.00 ? 139 ALA B C   2  
ATOM 9750   O O   . ALA A 1 126 ? -149.437 -8.216  -17.814 1.00 0.00 ? 139 ALA B O   2  
ATOM 9751   C CB  . ALA A 1 126 ? -149.237 -8.655  -20.774 1.00 0.00 ? 139 ALA B CB  2  
ATOM 9752   N N   . PHE A 1 127 ? -147.249 -7.892  -18.292 1.00 0.00 ? 140 PHE B N   2  
ATOM 9753   C CA  . PHE A 1 127 ? -146.619 -7.940  -16.980 1.00 0.00 ? 140 PHE B CA  2  
ATOM 9754   C C   . PHE A 1 127 ? -145.641 -6.763  -17.116 1.00 0.00 ? 140 PHE B C   2  
ATOM 9755   O O   . PHE A 1 127 ? -144.476 -6.915  -17.432 1.00 0.00 ? 140 PHE B O   2  
ATOM 9756   C CB  . PHE A 1 127 ? -145.889 -9.274  -16.772 1.00 0.00 ? 140 PHE B CB  2  
ATOM 9757   C CG  . PHE A 1 127 ? -146.930 -10.370 -16.697 1.00 0.00 ? 140 PHE B CG  2  
ATOM 9758   C CD1 . PHE A 1 127 ? -147.323 -11.011 -17.858 1.00 0.00 ? 140 PHE B CD1 2  
ATOM 9759   C CD2 . PHE A 1 127 ? -147.539 -10.647 -15.494 1.00 0.00 ? 140 PHE B CD2 2  
ATOM 9760   C CE1 . PHE A 1 127 ? -148.342 -11.931 -17.807 1.00 0.00 ? 140 PHE B CE1 2  
ATOM 9761   C CE2 . PHE A 1 127 ? -148.556 -11.570 -15.452 1.00 0.00 ? 140 PHE B CE2 2  
ATOM 9762   C CZ  . PHE A 1 127 ? -148.956 -12.206 -16.608 1.00 0.00 ? 140 PHE B CZ  2  
ATOM 9763   N N   . PRO A 1 128 ? -146.192 -5.539  -17.194 1.00 0.00 ? 141 PRO B N   2  
ATOM 9764   C CA  . PRO A 1 128 ? -145.685 -4.348  -16.556 1.00 0.00 ? 141 PRO B CA  2  
ATOM 9765   C C   . PRO A 1 128 ? -144.420 -3.519  -16.263 1.00 0.00 ? 141 PRO B C   2  
ATOM 9766   O O   . PRO A 1 128 ? -143.230 -3.840  -16.315 1.00 0.00 ? 141 PRO B O   2  
ATOM 9767   C CB  . PRO A 1 128 ? -146.522 -4.548  -15.309 1.00 0.00 ? 141 PRO B CB  2  
ATOM 9768   C CG  . PRO A 1 128 ? -147.908 -4.785  -15.789 1.00 0.00 ? 141 PRO B CG  2  
ATOM 9769   C CD  . PRO A 1 128 ? -147.577 -5.082  -17.231 1.00 0.00 ? 141 PRO B CD  2  
ATOM 9770   N N   . PRO A 1 129 ? -144.785 -2.295  -15.851 1.00 0.00 ? 142 PRO B N   2  
ATOM 9771   C CA  . PRO A 1 129 ? -144.531 -1.821  -14.485 1.00 0.00 ? 142 PRO B CA  2  
ATOM 9772   C C   . PRO A 1 129 ? -144.021 -2.846  -13.464 1.00 0.00 ? 142 PRO B C   2  
ATOM 9773   O O   . PRO A 1 129 ? -142.855 -2.713  -13.105 1.00 0.00 ? 142 PRO B O   2  
ATOM 9774   C CB  . PRO A 1 129 ? -145.850 -1.170  -14.104 1.00 0.00 ? 142 PRO B CB  2  
ATOM 9775   C CG  . PRO A 1 129 ? -146.600 -0.933  -15.412 1.00 0.00 ? 142 PRO B CG  2  
ATOM 9776   C CD  . PRO A 1 129 ? -145.566 -1.245  -16.489 1.00 0.00 ? 142 PRO B CD  2  
ATOM 9777   N N   . ASP A 1 130 ? -144.770 -3.867  -13.003 1.00 0.00 ? 143 ASP B N   2  
ATOM 9778   C CA  . ASP A 1 130 ? -144.247 -4.938  -12.153 1.00 0.00 ? 143 ASP B CA  2  
ATOM 9779   C C   . ASP A 1 130 ? -142.885 -5.468  -12.623 1.00 0.00 ? 143 ASP B C   2  
ATOM 9780   O O   . ASP A 1 130 ? -141.845 -5.261  -11.993 1.00 0.00 ? 143 ASP B O   2  
ATOM 9781   C CB  . ASP A 1 130 ? -145.324 -6.083  -12.066 1.00 0.00 ? 143 ASP B CB  2  
ATOM 9782   C CG  . ASP A 1 130 ? -145.618 -7.103  -13.169 1.00 0.00 ? 143 ASP B CG  2  
ATOM 9783   O OD1 . ASP A 1 130 ? -146.773 -7.279  -13.522 1.00 0.00 ? 143 ASP B OD1 2  
ATOM 9784   O OD2 . ASP A 1 130 ? -144.718 -7.746  -13.685 1.00 0.00 ? 143 ASP B OD2 2  
ATOM 9785   N N   . VAL A 1 131 ? -142.806 -5.965  -13.848 1.00 0.00 ? 144 VAL B N   2  
ATOM 9786   C CA  . VAL A 1 131 ? -141.594 -6.453  -14.476 1.00 0.00 ? 144 VAL B CA  2  
ATOM 9787   C C   . VAL A 1 131 ? -140.490 -5.393  -14.628 1.00 0.00 ? 144 VAL B C   2  
ATOM 9788   O O   . VAL A 1 131 ? -139.342 -5.672  -14.974 1.00 0.00 ? 144 VAL B O   2  
ATOM 9789   C CB  . VAL A 1 131 ? -142.152 -7.059  -15.770 1.00 0.00 ? 144 VAL B CB  2  
ATOM 9790   C CG1 . VAL A 1 131 ? -141.697 -6.267  -16.957 1.00 0.00 ? 144 VAL B CG1 2  
ATOM 9791   C CG2 . VAL A 1 131 ? -141.766 -8.510  -15.864 1.00 0.00 ? 144 VAL B CG2 2  
ATOM 9792   N N   . ALA A 1 132 ? -140.814 -4.105  -14.577 1.00 0.00 ? 145 ALA B N   2  
ATOM 9793   C CA  . ALA A 1 132 ? -139.803 -3.054  -14.556 1.00 0.00 ? 145 ALA B CA  2  
ATOM 9794   C C   . ALA A 1 132 ? -139.243 -2.717  -13.176 1.00 0.00 ? 145 ALA B C   2  
ATOM 9795   O O   . ALA A 1 132 ? -138.037 -2.597  -13.005 1.00 0.00 ? 145 ALA B O   2  
ATOM 9796   C CB  . ALA A 1 132 ? -140.375 -1.784  -15.160 1.00 0.00 ? 145 ALA B CB  2  
ATOM 9797   N N   . GLY A 1 133 ? -140.133 -2.604  -12.190 1.00 0.00 ? 146 GLY B N   2  
ATOM 9798   C CA  . GLY A 1 133 ? -139.778 -2.233  -10.823 1.00 0.00 ? 146 GLY B CA  2  
ATOM 9799   C C   . GLY A 1 133 ? -139.037 -3.270  -9.988  1.00 0.00 ? 146 GLY B C   2  
ATOM 9800   O O   . GLY A 1 133 ? -137.864 -3.126  -9.644  1.00 0.00 ? 146 GLY B O   2  
ATOM 9801   N N   . ASN A 1 134 ? -139.728 -4.330  -9.612  1.00 0.00 ? 147 ASN B N   2  
ATOM 9802   C CA  . ASN A 1 134 ? -139.158 -5.402  -8.800  1.00 0.00 ? 147 ASN B CA  2  
ATOM 9803   C C   . ASN A 1 134 ? -139.266 -6.716  -9.590  1.00 0.00 ? 147 ASN B C   2  
ATOM 9804   O O   . ASN A 1 134 ? -139.042 -7.789  -9.046  1.00 0.00 ? 147 ASN B O   2  
ATOM 9805   C CB  . ASN A 1 134 ? -139.984 -5.285  -7.478  1.00 0.00 ? 147 ASN B CB  2  
ATOM 9806   C CG  . ASN A 1 134 ? -140.346 -6.460  -6.572  1.00 0.00 ? 147 ASN B CG  2  
ATOM 9807   O OD1 . ASN A 1 134 ? -139.532 -7.041  -5.871  1.00 0.00 ? 147 ASN B OD1 2  
ATOM 9808   N ND2 . ASN A 1 134 ? -141.575 -6.898  -6.390  1.00 0.00 ? 147 ASN B ND2 2  
ATOM 9809   N N   . VAL A 1 135 ? -139.524 -6.633  -10.916 1.00 0.00 ? 148 VAL B N   2  
ATOM 9810   C CA  . VAL A 1 135 ? -140.148 -7.685  -11.746 1.00 0.00 ? 148 VAL B CA  2  
ATOM 9811   C C   . VAL A 1 135 ? -141.101 -8.429  -10.809 1.00 0.00 ? 148 VAL B C   2  
ATOM 9812   O O   . VAL A 1 135 ? -140.964 -9.604  -10.474 1.00 0.00 ? 148 VAL B O   2  
ATOM 9813   C CB  . VAL A 1 135 ? -139.175 -8.717  -12.400 1.00 0.00 ? 148 VAL B CB  2  
ATOM 9814   C CG1 . VAL A 1 135 ? -139.982 -9.654  -13.275 1.00 0.00 ? 148 VAL B CG1 2  
ATOM 9815   C CG2 . VAL A 1 135 ? -138.239 -8.090  -13.406 1.00 0.00 ? 148 VAL B CG2 2  
ATOM 9816   N N   . ASP A 1 136 ? -141.978 -7.594  -10.234 1.00 0.00 ? 149 ASP B N   2  
ATOM 9817   C CA  . ASP A 1 136 ? -142.879 -7.955  -9.157  1.00 0.00 ? 149 ASP B CA  2  
ATOM 9818   C C   . ASP A 1 136 ? -143.553 -9.326  -9.229  1.00 0.00 ? 149 ASP B C   2  
ATOM 9819   O O   . ASP A 1 136 ? -144.752 -9.485  -9.418  1.00 0.00 ? 149 ASP B O   2  
ATOM 9820   C CB  . ASP A 1 136 ? -143.909 -6.839  -9.058  1.00 0.00 ? 149 ASP B CB  2  
ATOM 9821   C CG  . ASP A 1 136 ? -143.401 -5.491  -8.587  1.00 0.00 ? 149 ASP B CG  2  
ATOM 9822   O OD1 . ASP A 1 136 ? -142.655 -4.828  -9.297  1.00 0.00 ? 149 ASP B OD1 2  
ATOM 9823   O OD2 . ASP A 1 136 ? -143.721 -5.124  -7.463  1.00 0.00 ? 149 ASP B OD2 2  
ATOM 9824   N N   . TYR A 1 137 ? -142.795 -10.393 -8.964  1.00 0.00 ? 150 TYR B N   2  
ATOM 9825   C CA  . TYR A 1 137 ? -143.284 -11.763 -9.140  1.00 0.00 ? 150 TYR B CA  2  
ATOM 9826   C C   . TYR A 1 137 ? -144.493 -12.145 -8.314  1.00 0.00 ? 150 TYR B C   2  
ATOM 9827   O O   . TYR A 1 137 ? -145.383 -12.865 -8.753  1.00 0.00 ? 150 TYR B O   2  
ATOM 9828   C CB  . TYR A 1 137 ? -142.207 -12.771 -8.843  1.00 0.00 ? 150 TYR B CB  2  
ATOM 9829   C CG  . TYR A 1 137 ? -141.137 -12.713 -9.910  1.00 0.00 ? 150 TYR B CG  2  
ATOM 9830   C CD1 . TYR A 1 137 ? -139.896 -12.300 -9.523  1.00 0.00 ? 150 TYR B CD1 2  
ATOM 9831   C CD2 . TYR A 1 137 ? -141.399 -13.002 -11.232 1.00 0.00 ? 150 TYR B CD2 2  
ATOM 9832   C CE1 . TYR A 1 137 ? -138.917 -12.168 -10.456 1.00 0.00 ? 150 TYR B CE1 2  
ATOM 9833   C CE2 . TYR A 1 137 ? -140.405 -12.880 -12.174 1.00 0.00 ? 150 TYR B CE2 2  
ATOM 9834   C CZ  . TYR A 1 137 ? -139.162 -12.452 -11.765 1.00 0.00 ? 150 TYR B CZ  2  
ATOM 9835   O OH  . TYR A 1 137 ? -138.143 -12.242 -12.668 1.00 0.00 ? 150 TYR B OH  2  
ATOM 9836   N N   . LYS A 1 138 ? -144.540 -11.541 -7.126  1.00 0.00 ? 151 LYS B N   2  
ATOM 9837   C CA  . LYS A 1 138 ? -145.705 -11.640 -6.254  1.00 0.00 ? 151 LYS B CA  2  
ATOM 9838   C C   . LYS A 1 138 ? -146.943 -11.140 -7.021  1.00 0.00 ? 151 LYS B C   2  
ATOM 9839   O O   . LYS A 1 138 ? -147.900 -11.873 -7.261  1.00 0.00 ? 151 LYS B O   2  
ATOM 9840   C CB  . LYS A 1 138 ? -145.481 -10.780 -5.006  1.00 0.00 ? 151 LYS B CB  2  
ATOM 9841   C CG  . LYS A 1 138 ? -144.259 -11.198 -4.199  1.00 0.00 ? 151 LYS B CG  2  
ATOM 9842   C CD  . LYS A 1 138 ? -144.132 -10.373 -2.931  1.00 0.00 ? 151 LYS B CD  2  
ATOM 9843   C CE  . LYS A 1 138 ? -142.908 -10.820 -2.151  1.00 0.00 ? 151 LYS B CE  2  
ATOM 9844   N NZ  . LYS A 1 138 ? -142.799 -10.072 -0.913  1.00 0.00 ? 151 LYS B NZ  2  
ATOM 9845   N N   . ASN A 1 139 ? -146.845 -9.918  -7.552  1.00 0.00 ? 152 ASN B N   2  
ATOM 9846   C CA  . ASN A 1 139 ? -147.885 -9.308  -8.379  1.00 0.00 ? 152 ASN B CA  2  
ATOM 9847   C C   . ASN A 1 139 ? -148.198 -10.139 -9.638  1.00 0.00 ? 152 ASN B C   2  
ATOM 9848   O O   . ASN A 1 139 ? -149.332 -10.583 -9.827  1.00 0.00 ? 152 ASN B O   2  
ATOM 9849   C CB  . ASN A 1 139 ? -147.402 -7.901  -8.710  1.00 0.00 ? 152 ASN B CB  2  
ATOM 9850   C CG  . ASN A 1 139 ? -147.272 -6.991  -7.490  1.00 0.00 ? 152 ASN B CG  2  
ATOM 9851   O OD1 . ASN A 1 139 ? -147.764 -7.244  -6.400  1.00 0.00 ? 152 ASN B OD1 2  
ATOM 9852   N ND2 . ASN A 1 139 ? -146.540 -5.904  -7.520  1.00 0.00 ? 152 ASN B ND2 2  
ATOM 9853   N N   . ILE A 1 140 ? -147.170 -10.535 -10.413 1.00 0.00 ? 153 ILE B N   2  
ATOM 9854   C CA  . ILE A 1 140 ? -147.272 -11.443 -11.573 1.00 0.00 ? 153 ILE B CA  2  
ATOM 9855   C C   . ILE A 1 140 ? -148.156 -12.666 -11.273 1.00 0.00 ? 153 ILE B C   2  
ATOM 9856   O O   . ILE A 1 140 ? -149.146 -12.941 -11.962 1.00 0.00 ? 153 ILE B O   2  
ATOM 9857   C CB  . ILE A 1 140 ? -145.837 -11.923 -11.996 1.00 0.00 ? 153 ILE B CB  2  
ATOM 9858   C CG1 . ILE A 1 140 ? -145.127 -10.770 -12.674 1.00 0.00 ? 153 ILE B CG1 2  
ATOM 9859   C CG2 . ILE A 1 140 ? -145.886 -13.114 -12.960 1.00 0.00 ? 153 ILE B CG2 2  
ATOM 9860   C CD1 . ILE A 1 140 ? -143.699 -11.050 -13.189 1.00 0.00 ? 153 ILE B CD1 2  
ATOM 9861   N N   . CYS A 1 141 ? -147.851 -13.398 -10.195 1.00 0.00 ? 154 CYS B N   2  
ATOM 9862   C CA  . CYS A 1 141 ? -148.660 -14.527 -9.741  1.00 0.00 ? 154 CYS B CA  2  
ATOM 9863   C C   . CYS A 1 141 ? -150.115 -14.165 -9.422  1.00 0.00 ? 154 CYS B C   2  
ATOM 9864   O O   . CYS A 1 141 ? -151.046 -14.806 -9.909  1.00 0.00 ? 154 CYS B O   2  
ATOM 9865   C CB  . CYS A 1 141 ? -148.083 -15.158 -8.491  1.00 0.00 ? 154 CYS B CB  2  
ATOM 9866   S SG  . CYS A 1 141 ? -146.495 -15.951 -8.815  1.00 0.00 ? 154 CYS B SG  2  
ATOM 9867   N N   . TYR A 1 142 ? -150.362 -13.102 -8.656  1.00 0.00 ? 155 TYR B N   2  
ATOM 9868   C CA  . TYR A 1 142 ? -151.733 -12.672 -8.385  1.00 0.00 ? 155 TYR B CA  2  
ATOM 9869   C C   . TYR A 1 142 ? -152.532 -12.254 -9.625  1.00 0.00 ? 155 TYR B C   2  
ATOM 9870   O O   . TYR A 1 142 ? -153.726 -12.549 -9.688  1.00 0.00 ? 155 TYR B O   2  
ATOM 9871   C CB  . TYR A 1 142 ? -151.744 -11.508 -7.392  1.00 0.00 ? 155 TYR B CB  2  
ATOM 9872   C CG  . TYR A 1 142 ? -151.086 -11.835 -6.052  1.00 0.00 ? 155 TYR B CG  2  
ATOM 9873   C CD1 . TYR A 1 142 ? -150.154 -10.958 -5.537  1.00 0.00 ? 155 TYR B CD1 2  
ATOM 9874   C CD2 . TYR A 1 142 ? -151.387 -13.004 -5.378  1.00 0.00 ? 155 TYR B CD2 2  
ATOM 9875   C CE1 . TYR A 1 142 ? -149.510 -11.249 -4.355  1.00 0.00 ? 155 TYR B CE1 2  
ATOM 9876   C CE2 . TYR A 1 142 ? -150.746 -13.296 -4.189  1.00 0.00 ? 155 TYR B CE2 2  
ATOM 9877   C CZ  . TYR A 1 142 ? -149.812 -12.422 -3.688  1.00 0.00 ? 155 TYR B CZ  2  
ATOM 9878   O OH  . TYR A 1 142 ? -149.159 -12.714 -2.507  1.00 0.00 ? 155 TYR B OH  2  
ATOM 9879   N N   . VAL A 1 143 ? -151.934 -11.626 -10.634 1.00 0.00 ? 156 VAL B N   2  
ATOM 9880   C CA  . VAL A 1 143 ? -152.626 -11.294 -11.885 1.00 0.00 ? 156 VAL B CA  2  
ATOM 9881   C C   . VAL A 1 143 ? -152.949 -12.506 -12.761 1.00 0.00 ? 156 VAL B C   2  
ATOM 9882   O O   . VAL A 1 143 ? -153.982 -12.581 -13.446 1.00 0.00 ? 156 VAL B O   2  
ATOM 9883   C CB  . VAL A 1 143 ? -151.748 -10.258 -12.643 1.00 0.00 ? 156 VAL B CB  2  
ATOM 9884   C CG1 . VAL A 1 143 ? -152.004 -10.149 -14.147 1.00 0.00 ? 156 VAL B CG1 2  
ATOM 9885   C CG2 . VAL A 1 143 ? -152.103 -8.922  -12.036 1.00 0.00 ? 156 VAL B CG2 2  
ATOM 9886   N N   . ILE A 1 144 ? -152.062 -13.501 -12.804 1.00 0.00 ? 157 ILE B N   2  
ATOM 9887   C CA  . ILE A 1 144 ? -152.384 -14.704 -13.567 1.00 0.00 ? 157 ILE B CA  2  
ATOM 9888   C C   . ILE A 1 144 ? -153.452 -15.574 -12.898 1.00 0.00 ? 157 ILE B C   2  
ATOM 9889   O O   . ILE A 1 144 ? -154.395 -16.043 -13.545 1.00 0.00 ? 157 ILE B O   2  
ATOM 9890   C CB  . ILE A 1 144 ? -151.078 -15.504 -13.836 1.00 0.00 ? 157 ILE B CB  2  
ATOM 9891   C CG1 . ILE A 1 144 ? -150.183 -15.836 -12.662 1.00 0.00 ? 157 ILE B CG1 2  
ATOM 9892   C CG2 . ILE A 1 144 ? -150.352 -14.609 -14.811 1.00 0.00 ? 157 ILE B CG2 2  
ATOM 9893   C CD1 . ILE A 1 144 ? -148.812 -16.443 -13.055 1.00 0.00 ? 157 ILE B CD1 2  
ATOM 9894   N N   . THR A 1 145 ? -153.417 -15.757 -11.582 1.00 0.00 ? 158 THR B N   2  
ATOM 9895   C CA  . THR A 1 145 ? -154.481 -16.512 -10.902 1.00 0.00 ? 158 THR B CA  2  
ATOM 9896   C C   . THR A 1 145 ? -155.758 -15.709 -10.655 1.00 0.00 ? 158 THR B C   2  
ATOM 9897   O O   . THR A 1 145 ? -156.890 -16.215 -10.761 1.00 0.00 ? 158 THR B O   2  
ATOM 9898   C CB  . THR A 1 145 ? -154.018 -17.030 -9.550  1.00 0.00 ? 158 THR B CB  2  
ATOM 9899   O OG1 . THR A 1 145 ? -153.668 -15.915 -8.727  1.00 0.00 ? 158 THR B OG1 2  
ATOM 9900   C CG2 . THR A 1 145 ? -152.876 -18.007 -9.749  1.00 0.00 ? 158 THR B CG2 2  
ATOM 9901   N N   . HIS A 1 146 ? -155.642 -14.417 -10.349 1.00 0.00 ? 159 HIS B N   2  
ATOM 9902   C CA  . HIS A 1 146 ? -156.787 -13.555 -10.049 1.00 0.00 ? 159 HIS B CA  2  
ATOM 9903   C C   . HIS A 1 146 ? -157.221 -12.445 -11.025 1.00 0.00 ? 159 HIS B C   2  
ATOM 9904   O O   . HIS A 1 146 ? -157.926 -11.518 -10.606 1.00 0.00 ? 159 HIS B O   2  
ATOM 9905   C CB  . HIS A 1 146 ? -156.564 -12.904 -8.681  1.00 0.00 ? 159 HIS B CB  2  
ATOM 9906   C CG  . HIS A 1 146 ? -156.387 -13.848 -7.502  1.00 0.00 ? 159 HIS B CG  2  
ATOM 9907   N ND1 . HIS A 1 146 ? -155.395 -13.823 -6.615  1.00 0.00 ? 159 HIS B ND1 2  
ATOM 9908   C CD2 . HIS A 1 146 ? -157.253 -14.849 -7.137  1.00 0.00 ? 159 HIS B CD2 2  
ATOM 9909   C CE1 . HIS A 1 146 ? -155.652 -14.749 -5.734  1.00 0.00 ? 159 HIS B CE1 2  
ATOM 9910   N NE2 . HIS A 1 146 ? -156.756 -15.369 -6.049  1.00 0.00 ? 159 HIS B NE2 2  
ATOM 9911   N N   . GLY A 1 147 ? -156.894 -12.486 -12.316 1.00 0.00 ? 160 GLY B N   2  
ATOM 9912   C CA  . GLY A 1 147 ? -157.358 -11.455 -13.257 1.00 0.00 ? 160 GLY B CA  2  
ATOM 9913   C C   . GLY A 1 147 ? -156.382 -10.312 -13.540 1.00 0.00 ? 160 GLY B C   2  
ATOM 9914   O O   . GLY A 1 147 ? -155.474 -10.035 -12.763 1.00 0.00 ? 160 GLY B O   2  
ATOM 9915   N N   . GLU A 1 148 ? -156.576 -9.576  -14.633 1.00 0.00 ? 161 GLU B N   2  
ATOM 9916   C CA  . GLU A 1 148 ? -155.635 -8.539  -15.070 1.00 0.00 ? 161 GLU B CA  2  
ATOM 9917   C C   . GLU A 1 148 ? -155.609 -7.162  -14.392 1.00 0.00 ? 161 GLU B C   2  
ATOM 9918   O O   . GLU A 1 148 ? -154.567 -6.524  -14.287 1.00 0.00 ? 161 GLU B O   2  
ATOM 9919   C CB  . GLU A 1 148 ? -155.822 -8.306  -16.565 1.00 0.00 ? 161 GLU B CB  2  
ATOM 9920   C CG  . GLU A 1 148 ? -155.787 -9.602  -17.358 1.00 0.00 ? 161 GLU B CG  2  
ATOM 9921   C CD  . GLU A 1 148 ? -155.473 -9.439  -18.826 1.00 0.00 ? 161 GLU B CD  2  
ATOM 9922   O OE1 . GLU A 1 148 ? -154.278 -9.316  -19.136 1.00 0.00 ? 161 GLU B OE1 2  
ATOM 9923   O OE2 . GLU A 1 148 ? -156.376 -9.524  -19.654 1.00 0.00 ? 161 GLU B OE2 2  
ATOM 9924   N N   . ASP A 1 149 ? -156.769 -6.668  -13.976 1.00 0.00 ? 162 ASP B N   2  
ATOM 9925   C CA  . ASP A 1 149 ? -156.922 -5.363  -13.320 1.00 0.00 ? 162 ASP B CA  2  
ATOM 9926   C C   . ASP A 1 149 ? -156.383 -5.299  -11.882 1.00 0.00 ? 162 ASP B C   2  
ATOM 9927   O O   . ASP A 1 149 ? -155.824 -4.311  -11.396 1.00 0.00 ? 162 ASP B O   2  
ATOM 9928   C CB  . ASP A 1 149 ? -158.419 -4.963  -13.272 1.00 0.00 ? 162 ASP B CB  2  
ATOM 9929   C CG  . ASP A 1 149 ? -159.410 -5.539  -14.290 1.00 0.00 ? 162 ASP B CG  2  
ATOM 9930   O OD1 . ASP A 1 149 ? -159.022 -6.069  -15.326 1.00 0.00 ? 162 ASP B OD1 2  
ATOM 9931   O OD2 . ASP A 1 149 ? -160.614 -5.492  -14.023 1.00 0.00 ? 162 ASP B OD2 2  
ATOM 9932   N N   . LYS A 1 150 ? -156.668 -6.381  -11.158 1.00 0.00 ? 163 LYS B N   2  
ATOM 9933   C CA  . LYS A 1 150 ? -156.251 -6.590  -9.768  1.00 0.00 ? 163 LYS B CA  2  
ATOM 9934   C C   . LYS A 1 150 ? -154.765 -6.592  -9.424  1.00 0.00 ? 163 LYS B C   2  
ATOM 9935   O O   . LYS A 1 150 ? -153.953 -7.039  -10.218 1.00 0.00 ? 163 LYS B O   2  
ATOM 9936   N N   . ASP B 2 1   ? -115.016 -41.446 -29.291 1.00 0.00 ? 5   ASP C N   2  
ATOM 9937   C CA  . ASP B 2 1   ? -115.394 -41.247 -27.883 1.00 0.00 ? 5   ASP C CA  2  
ATOM 9938   C C   . ASP B 2 1   ? -116.550 -42.066 -27.231 1.00 0.00 ? 5   ASP C C   2  
ATOM 9939   O O   . ASP B 2 1   ? -117.262 -42.755 -27.965 1.00 0.00 ? 5   ASP C O   2  
ATOM 9940   C CB  . ASP B 2 1   ? -115.622 -39.723 -27.832 1.00 0.00 ? 5   ASP C CB  2  
ATOM 9941   C CG  . ASP B 2 1   ? -116.651 -39.226 -26.834 1.00 0.00 ? 5   ASP C CG  2  
ATOM 9942   O OD1 . ASP B 2 1   ? -116.265 -38.701 -25.799 1.00 0.00 ? 5   ASP C OD1 2  
ATOM 9943   O OD2 . ASP B 2 1   ? -117.845 -39.397 -27.083 1.00 0.00 ? 5   ASP C OD2 2  
ATOM 9944   N N   . GLU B 2 2   ? -116.776 -42.016 -25.883 1.00 0.00 ? 6   GLU C N   2  
ATOM 9945   C CA  . GLU B 2 2   ? -117.959 -42.576 -25.171 1.00 0.00 ? 6   GLU C CA  2  
ATOM 9946   C C   . GLU B 2 2   ? -118.300 -42.451 -23.651 1.00 0.00 ? 6   GLU C C   2  
ATOM 9947   O O   . GLU B 2 2   ? -117.432 -42.429 -22.784 1.00 0.00 ? 6   GLU C O   2  
ATOM 9948   C CB  . GLU B 2 2   ? -118.081 -44.074 -25.462 1.00 0.00 ? 6   GLU C CB  2  
ATOM 9949   C CG  . GLU B 2 2   ? -119.433 -44.233 -26.160 1.00 0.00 ? 6   GLU C CG  2  
ATOM 9950   C CD  . GLU B 2 2   ? -119.572 -45.419 -27.095 1.00 0.00 ? 6   GLU C CD  2  
ATOM 9951   O OE1 . GLU B 2 2   ? -118.893 -46.428 -27.027 1.00 0.00 ? 6   GLU C OE1 2  
ATOM 9952   O OE2 . GLU B 2 2   ? -120.489 -45.393 -28.033 1.00 0.00 ? 6   GLU C OE2 2  
ATOM 9953   N N   . ILE B 2 3   ? -119.635 -42.438 -23.389 1.00 0.00 ? 7   ILE C N   2  
ATOM 9954   C CA  . ILE B 2 3   ? -120.470 -42.360 -22.147 1.00 0.00 ? 7   ILE C CA  2  
ATOM 9955   C C   . ILE B 2 3   ? -121.840 -41.723 -22.565 1.00 0.00 ? 7   ILE C C   2  
ATOM 9956   O O   . ILE B 2 3   ? -121.912 -41.218 -23.693 1.00 0.00 ? 7   ILE C O   2  
ATOM 9957   C CB  . ILE B 2 3   ? -119.781 -41.483 -21.002 1.00 0.00 ? 7   ILE C CB  2  
ATOM 9958   C CG1 . ILE B 2 3   ? -118.963 -42.428 -20.110 1.00 0.00 ? 7   ILE C CG1 2  
ATOM 9959   C CG2 . ILE B 2 3   ? -120.773 -40.793 -20.055 1.00 0.00 ? 7   ILE C CG2 2  
ATOM 9960   C CD1 . ILE B 2 3   ? -118.145 -41.748 -18.984 1.00 0.00 ? 7   ILE C CD1 2  
ATOM 9961   N N   . ASN B 2 4   ? -122.970 -41.694 -21.827 1.00 0.00 ? 8   ASN C N   2  
ATOM 9962   C CA  . ASN B 2 4   ? -124.194 -41.014 -22.281 1.00 0.00 ? 8   ASN C CA  2  
ATOM 9963   C C   . ASN B 2 4   ? -124.519 -39.638 -21.671 1.00 0.00 ? 8   ASN C C   2  
ATOM 9964   O O   . ASN B 2 4   ? -124.460 -38.641 -22.398 1.00 0.00 ? 8   ASN C O   2  
ATOM 9965   C CB  . ASN B 2 4   ? -125.358 -41.989 -22.084 1.00 0.00 ? 8   ASN C CB  2  
ATOM 9966   C CG  . ASN B 2 4   ? -125.525 -42.992 -23.226 1.00 0.00 ? 8   ASN C CG  2  
ATOM 9967   O OD1 . ASN B 2 4   ? -124.875 -42.859 -24.277 1.00 0.00 ? 8   ASN C OD1 2  
ATOM 9968   N ND2 . ASN B 2 4   ? -126.331 -43.909 -23.076 1.00 0.00 ? 8   ASN C ND2 2  
ATOM 9969   N N   . ASP B 2 5   ? -124.770 -39.490 -20.366 1.00 0.00 ? 9   ASP C N   2  
ATOM 9970   C CA  . ASP B 2 5   ? -125.005 -38.233 -19.618 1.00 0.00 ? 9   ASP C CA  2  
ATOM 9971   C C   . ASP B 2 5   ? -124.442 -36.905 -20.159 1.00 0.00 ? 9   ASP C C   2  
ATOM 9972   O O   . ASP B 2 5   ? -125.095 -35.859 -20.224 1.00 0.00 ? 9   ASP C O   2  
ATOM 9973   C CB  . ASP B 2 5   ? -124.457 -38.370 -18.194 1.00 0.00 ? 9   ASP C CB  2  
ATOM 9974   C CG  . ASP B 2 5   ? -124.838 -39.582 -17.354 1.00 0.00 ? 9   ASP C CG  2  
ATOM 9975   O OD1 . ASP B 2 5   ? -124.973 -40.685 -17.890 1.00 0.00 ? 9   ASP C OD1 2  
ATOM 9976   O OD2 . ASP B 2 5   ? -124.937 -39.434 -16.142 1.00 0.00 ? 9   ASP C OD2 2  
ATOM 9977   N N   . PHE B 2 6   ? -123.178 -36.895 -20.595 1.00 0.00 ? 10  PHE C N   2  
ATOM 9978   C CA  . PHE B 2 6   ? -122.542 -35.702 -21.165 1.00 0.00 ? 10  PHE C CA  2  
ATOM 9979   C C   . PHE B 2 6   ? -123.290 -35.112 -22.369 1.00 0.00 ? 10  PHE C C   2  
ATOM 9980   O O   . PHE B 2 6   ? -123.431 -33.898 -22.512 1.00 0.00 ? 10  PHE C O   2  
ATOM 9981   C CB  . PHE B 2 6   ? -121.101 -36.034 -21.559 1.00 0.00 ? 10  PHE C CB  2  
ATOM 9982   C CG  . PHE B 2 6   ? -120.240 -36.396 -20.351 1.00 0.00 ? 10  PHE C CG  2  
ATOM 9983   C CD1 . PHE B 2 6   ? -119.457 -37.531 -20.381 1.00 0.00 ? 10  PHE C CD1 2  
ATOM 9984   C CD2 . PHE B 2 6   ? -120.247 -35.599 -19.220 1.00 0.00 ? 10  PHE C CD2 2  
ATOM 9985   C CE1 . PHE B 2 6   ? -118.689 -37.863 -19.281 1.00 0.00 ? 10  PHE C CE1 2  
ATOM 9986   C CE2 . PHE B 2 6   ? -119.477 -35.938 -18.127 1.00 0.00 ? 10  PHE C CE2 2  
ATOM 9987   C CZ  . PHE B 2 6   ? -118.697 -37.068 -18.156 1.00 0.00 ? 10  PHE C CZ  2  
ATOM 9988   N N   . LYS B 2 7   ? -123.913 -35.967 -23.178 1.00 0.00 ? 11  LYS C N   2  
ATOM 9989   C CA  . LYS B 2 7   ? -124.752 -35.540 -24.292 1.00 0.00 ? 11  LYS C CA  2  
ATOM 9990   C C   . LYS B 2 7   ? -126.019 -34.835 -23.793 1.00 0.00 ? 11  LYS C C   2  
ATOM 9991   O O   . LYS B 2 7   ? -126.423 -33.784 -24.296 1.00 0.00 ? 11  LYS C O   2  
ATOM 9992   C CB  . LYS B 2 7   ? -125.128 -36.758 -25.127 1.00 0.00 ? 11  LYS C CB  2  
ATOM 9993   C CG  . LYS B 2 7   ? -123.907 -37.416 -25.746 1.00 0.00 ? 11  LYS C CG  2  
ATOM 9994   C CD  . LYS B 2 7   ? -124.334 -38.668 -26.479 1.00 0.00 ? 11  LYS C CD  2  
ATOM 9995   C CE  . LYS B 2 7   ? -123.109 -39.410 -26.966 1.00 0.00 ? 11  LYS C CE  2  
ATOM 9996   N NZ  . LYS B 2 7   ? -123.522 -40.649 -27.592 1.00 0.00 ? 11  LYS C NZ  2  
ATOM 9997   N N   . GLU B 2 8   ? -126.619 -35.360 -22.720 1.00 0.00 ? 12  GLU C N   2  
ATOM 9998   C CA  . GLU B 2 8   ? -127.771 -34.728 -22.068 1.00 0.00 ? 12  GLU C CA  2  
ATOM 9999   C C   . GLU B 2 8   ? -127.399 -33.338 -21.523 1.00 0.00 ? 12  GLU C C   2  
ATOM 10000  O O   . GLU B 2 8   ? -128.074 -32.320 -21.740 1.00 0.00 ? 12  GLU C O   2  
ATOM 10001  C CB  . GLU B 2 8   ? -128.276 -35.566 -20.907 1.00 0.00 ? 12  GLU C CB  2  
ATOM 10002  C CG  . GLU B 2 8   ? -128.675 -36.997 -21.263 1.00 0.00 ? 12  GLU C CG  2  
ATOM 10003  C CD  . GLU B 2 8   ? -129.397 -37.785 -20.175 1.00 0.00 ? 12  GLU C CD  2  
ATOM 10004  O OE1 . GLU B 2 8   ? -129.606 -37.279 -19.068 1.00 0.00 ? 12  GLU C OE1 2  
ATOM 10005  O OE2 . GLU B 2 8   ? -129.776 -38.919 -20.458 1.00 0.00 ? 12  GLU C OE2 2  
ATOM 10006  N N   . ALA B 2 9   ? -126.247 -33.260 -20.858 1.00 0.00 ? 13  ALA C N   2  
ATOM 10007  C CA  . ALA B 2 9   ? -125.690 -31.993 -20.375 1.00 0.00 ? 13  ALA C CA  2  
ATOM 10008  C C   . ALA B 2 9   ? -125.375 -30.955 -21.454 1.00 0.00 ? 13  ALA C C   2  
ATOM 10009  O O   . ALA B 2 9   ? -125.538 -29.761 -21.208 1.00 0.00 ? 13  ALA C O   2  
ATOM 10010  C CB  . ALA B 2 9   ? -124.407 -32.261 -19.607 1.00 0.00 ? 13  ALA C CB  2  
ATOM 10011  N N   . PHE B 2 10  ? -124.931 -31.351 -22.658 1.00 0.00 ? 14  PHE C N   2  
ATOM 10012  C CA  . PHE B 2 10  ? -124.717 -30.397 -23.757 1.00 0.00 ? 14  PHE C CA  2  
ATOM 10013  C C   . PHE B 2 10  ? -125.954 -29.548 -24.077 1.00 0.00 ? 14  PHE C C   2  
ATOM 10014  O O   . PHE B 2 10  ? -125.901 -28.324 -23.960 1.00 0.00 ? 14  PHE C O   2  
ATOM 10015  C CB  . PHE B 2 10  ? -124.260 -31.148 -25.017 1.00 0.00 ? 14  PHE C CB  2  
ATOM 10016  C CG  . PHE B 2 10  ? -122.882 -31.793 -24.873 1.00 0.00 ? 14  PHE C CG  2  
ATOM 10017  C CD1 . PHE B 2 10  ? -122.633 -33.006 -25.485 1.00 0.00 ? 14  PHE C CD1 2  
ATOM 10018  C CD2 . PHE B 2 10  ? -121.887 -31.191 -24.124 1.00 0.00 ? 14  PHE C CD2 2  
ATOM 10019  C CE1 . PHE B 2 10  ? -121.407 -33.614 -25.342 1.00 0.00 ? 14  PHE C CE1 2  
ATOM 10020  C CE2 . PHE B 2 10  ? -120.662 -31.805 -23.987 1.00 0.00 ? 14  PHE C CE2 2  
ATOM 10021  C CZ  . PHE B 2 10  ? -120.423 -33.015 -24.595 1.00 0.00 ? 14  PHE C CZ  2  
ATOM 10022  N N   . LEU B 2 11  ? -127.128 -30.163 -24.266 1.00 0.00 ? 15  LEU C N   2  
ATOM 10023  C CA  . LEU B 2 11  ? -128.385 -29.437 -24.496 1.00 0.00 ? 15  LEU C CA  2  
ATOM 10024  C C   . LEU B 2 11  ? -128.782 -28.425 -23.409 1.00 0.00 ? 15  LEU C C   2  
ATOM 10025  O O   . LEU B 2 11  ? -129.465 -27.413 -23.601 1.00 0.00 ? 15  LEU C O   2  
ATOM 10026  C CB  . LEU B 2 11  ? -129.537 -30.413 -24.646 1.00 0.00 ? 15  LEU C CB  2  
ATOM 10027  C CG  . LEU B 2 11  ? -129.482 -31.520 -25.688 1.00 0.00 ? 15  LEU C CG  2  
ATOM 10028  C CD1 . LEU B 2 11  ? -130.725 -32.374 -25.546 1.00 0.00 ? 15  LEU C CD1 2  
ATOM 10029  C CD2 . LEU B 2 11  ? -129.407 -30.943 -27.088 1.00 0.00 ? 15  LEU C CD2 2  
ATOM 10030  N N   . LEU B 2 12  ? -128.338 -28.685 -22.179 1.00 0.00 ? 16  LEU C N   2  
ATOM 10031  C CA  . LEU B 2 12  ? -128.590 -27.777 -21.063 1.00 0.00 ? 16  LEU C CA  2  
ATOM 10032  C C   . LEU B 2 12  ? -127.835 -26.445 -21.167 1.00 0.00 ? 16  LEU C C   2  
ATOM 10033  O O   . LEU B 2 12  ? -128.154 -25.466 -20.487 1.00 0.00 ? 16  LEU C O   2  
ATOM 10034  C CB  . LEU B 2 12  ? -128.217 -28.480 -19.759 1.00 0.00 ? 16  LEU C CB  2  
ATOM 10035  C CG  . LEU B 2 12  ? -128.915 -29.791 -19.402 1.00 0.00 ? 16  LEU C CG  2  
ATOM 10036  C CD1 . LEU B 2 12  ? -128.385 -30.278 -18.068 1.00 0.00 ? 16  LEU C CD1 2  
ATOM 10037  C CD2 . LEU B 2 12  ? -130.423 -29.592 -19.318 1.00 0.00 ? 16  LEU C CD2 2  
ATOM 10038  N N   . PHE B 2 13  ? -126.823 -26.392 -22.035 1.00 0.00 ? 17  PHE C N   2  
ATOM 10039  C CA  . PHE B 2 13  ? -126.030 -25.195 -22.274 1.00 0.00 ? 17  PHE C CA  2  
ATOM 10040  C C   . PHE B 2 13  ? -126.057 -24.677 -23.720 1.00 0.00 ? 17  PHE C C   2  
ATOM 10041  O O   . PHE B 2 13  ? -125.273 -23.802 -24.100 1.00 0.00 ? 17  PHE C O   2  
ATOM 10042  C CB  . PHE B 2 13  ? -124.598 -25.503 -21.790 1.00 0.00 ? 17  PHE C CB  2  
ATOM 10043  C CG  . PHE B 2 13  ? -124.593 -25.587 -20.268 1.00 0.00 ? 17  PHE C CG  2  
ATOM 10044  C CD1 . PHE B 2 13  ? -124.883 -26.783 -19.630 1.00 0.00 ? 17  PHE C CD1 2  
ATOM 10045  C CD2 . PHE B 2 13  ? -124.392 -24.447 -19.521 1.00 0.00 ? 17  PHE C CD2 2  
ATOM 10046  C CE1 . PHE B 2 13  ? -124.988 -26.826 -18.260 1.00 0.00 ? 17  PHE C CE1 2  
ATOM 10047  C CE2 . PHE B 2 13  ? -124.493 -24.497 -18.145 1.00 0.00 ? 17  PHE C CE2 2  
ATOM 10048  C CZ  . PHE B 2 13  ? -124.798 -25.684 -17.516 1.00 0.00 ? 17  PHE C CZ  2  
ATOM 10049  N N   . ASP B 2 14  ? -127.052 -25.141 -24.488 1.00 0.00 ? 18  ASP C N   2  
ATOM 10050  C CA  . ASP B 2 14  ? -127.308 -24.711 -25.863 1.00 0.00 ? 18  ASP C CA  2  
ATOM 10051  C C   . ASP B 2 14  ? -127.633 -23.230 -26.062 1.00 0.00 ? 18  ASP C C   2  
ATOM 10052  O O   . ASP B 2 14  ? -127.120 -22.525 -26.930 1.00 0.00 ? 18  ASP C O   2  
ATOM 10053  C CB  . ASP B 2 14  ? -128.468 -25.497 -26.452 1.00 0.00 ? 18  ASP C CB  2  
ATOM 10054  C CG  . ASP B 2 14  ? -128.169 -26.894 -26.942 1.00 0.00 ? 18  ASP C CG  2  
ATOM 10055  O OD1 . ASP B 2 14  ? -127.017 -27.324 -26.980 1.00 0.00 ? 18  ASP C OD1 2  
ATOM 10056  O OD2 . ASP B 2 14  ? -129.127 -27.555 -27.322 1.00 0.00 ? 18  ASP C OD2 2  
ATOM 10057  N N   . ARG B 2 15  ? -128.599 -22.786 -25.257 1.00 0.00 ? 19  ARG C N   2  
ATOM 10058  C CA  . ARG B 2 15  ? -129.049 -21.398 -25.190 1.00 0.00 ? 19  ARG C CA  2  
ATOM 10059  C C   . ARG B 2 15  ? -129.457 -20.650 -26.473 1.00 0.00 ? 19  ARG C C   2  
ATOM 10060  O O   . ARG B 2 15  ? -129.250 -19.447 -26.668 1.00 0.00 ? 19  ARG C O   2  
ATOM 10061  C CB  . ARG B 2 15  ? -127.952 -20.637 -24.411 1.00 0.00 ? 19  ARG C CB  2  
ATOM 10062  C CG  . ARG B 2 15  ? -127.812 -21.175 -22.977 1.00 0.00 ? 19  ARG C CG  2  
ATOM 10063  C CD  . ARG B 2 15  ? -127.067 -20.212 -22.065 1.00 0.00 ? 19  ARG C CD  2  
ATOM 10064  N NE  . ARG B 2 15  ? -127.393 -20.458 -20.661 1.00 0.00 ? 19  ARG C NE  2  
ATOM 10065  C CZ  . ARG B 2 15  ? -127.371 -19.508 -19.738 1.00 0.00 ? 19  ARG C CZ  2  
ATOM 10066  N NH1 . ARG B 2 15  ? -127.143 -18.246 -20.027 1.00 0.00 ? 19  ARG C NH1 2  
ATOM 10067  N NH2 . ARG B 2 15  ? -127.582 -19.841 -18.497 1.00 0.00 ? 19  ARG C NH2 2  
ATOM 10068  N N   . THR B 2 16  ? -130.195 -21.425 -27.266 1.00 0.00 ? 20  THR C N   2  
ATOM 10069  C CA  . THR B 2 16  ? -130.682 -21.103 -28.625 1.00 0.00 ? 20  THR C CA  2  
ATOM 10070  C C   . THR B 2 16  ? -131.678 -22.188 -29.056 1.00 0.00 ? 20  THR C C   2  
ATOM 10071  O O   . THR B 2 16  ? -132.640 -21.971 -29.780 1.00 0.00 ? 20  THR C O   2  
ATOM 10072  C CB  . THR B 2 16  ? -129.636 -21.143 -29.769 1.00 0.00 ? 20  THR C CB  2  
ATOM 10073  O OG1 . THR B 2 16  ? -128.993 -22.408 -29.622 1.00 0.00 ? 20  THR C OG1 2  
ATOM 10074  C CG2 . THR B 2 16  ? -128.656 -19.978 -29.785 1.00 0.00 ? 20  THR C CG2 2  
ATOM 10075  N N   . GLY B 2 17  ? -131.340 -23.424 -28.664 1.00 0.00 ? 21  GLY C N   2  
ATOM 10076  C CA  . GLY B 2 17  ? -132.137 -24.622 -28.949 1.00 0.00 ? 21  GLY C CA  2  
ATOM 10077  C C   . GLY B 2 17  ? -131.661 -25.503 -30.110 1.00 0.00 ? 21  GLY C C   2  
ATOM 10078  O O   . GLY B 2 17  ? -132.184 -26.582 -30.386 1.00 0.00 ? 21  GLY C O   2  
ATOM 10079  N N   . ASP B 2 18  ? -130.591 -25.062 -30.752 1.00 0.00 ? 22  ASP C N   2  
ATOM 10080  C CA  . ASP B 2 18  ? -129.998 -25.694 -31.926 1.00 0.00 ? 22  ASP C CA  2  
ATOM 10081  C C   . ASP B 2 18  ? -129.106 -26.934 -31.732 1.00 0.00 ? 22  ASP C C   2  
ATOM 10082  O O   . ASP B 2 18  ? -128.693 -27.575 -32.710 1.00 0.00 ? 22  ASP C O   2  
ATOM 10083  C CB  . ASP B 2 18  ? -129.159 -24.653 -32.675 1.00 0.00 ? 22  ASP C CB  2  
ATOM 10084  C CG  . ASP B 2 18  ? -129.818 -23.333 -33.045 1.00 0.00 ? 22  ASP C CG  2  
ATOM 10085  O OD1 . ASP B 2 18  ? -130.700 -22.866 -32.324 1.00 0.00 ? 22  ASP C OD1 2  
ATOM 10086  O OD2 . ASP B 2 18  ? -129.406 -22.747 -34.035 1.00 0.00 ? 22  ASP C OD2 2  
ATOM 10087  N N   . ALA B 2 19  ? -128.737 -27.262 -30.486 1.00 0.00 ? 23  ALA C N   2  
ATOM 10088  C CA  . ALA B 2 19  ? -127.771 -28.317 -30.136 1.00 0.00 ? 23  ALA C CA  2  
ATOM 10089  C C   . ALA B 2 19  ? -126.340 -28.140 -30.677 1.00 0.00 ? 23  ALA C C   2  
ATOM 10090  O O   . ALA B 2 19  ? -125.524 -29.058 -30.816 1.00 0.00 ? 23  ALA C O   2  
ATOM 10091  C CB  . ALA B 2 19  ? -128.295 -29.684 -30.605 1.00 0.00 ? 23  ALA C CB  2  
ATOM 10092  N N   . LYS B 2 20  ? -126.042 -26.886 -31.030 1.00 0.00 ? 24  LYS C N   2  
ATOM 10093  C CA  . LYS B 2 20  ? -124.738 -26.466 -31.536 1.00 0.00 ? 24  LYS C CA  2  
ATOM 10094  C C   . LYS B 2 20  ? -124.095 -25.364 -30.689 1.00 0.00 ? 24  LYS C C   2  
ATOM 10095  O O   . LYS B 2 20  ? -124.290 -24.160 -30.897 1.00 0.00 ? 24  LYS C O   2  
ATOM 10096  C CB  . LYS B 2 20  ? -124.866 -25.966 -32.971 1.00 0.00 ? 24  LYS C CB  2  
ATOM 10097  C CG  . LYS B 2 20  ? -125.319 -27.013 -33.971 1.00 0.00 ? 24  LYS C CG  2  
ATOM 10098  C CD  . LYS B 2 20  ? -125.324 -26.383 -35.348 1.00 0.00 ? 24  LYS C CD  2  
ATOM 10099  C CE  . LYS B 2 20  ? -125.861 -27.386 -36.353 1.00 0.00 ? 24  LYS C CE  2  
ATOM 10100  N NZ  . LYS B 2 20  ? -125.804 -26.810 -37.678 1.00 0.00 ? 24  LYS C NZ  2  
ATOM 10101  N N   . ILE B 2 21  ? -123.240 -25.750 -29.753 1.00 0.00 ? 25  ILE C N   2  
ATOM 10102  C CA  . ILE B 2 21  ? -122.660 -24.785 -28.806 1.00 0.00 ? 25  ILE C CA  2  
ATOM 10103  C C   . ILE B 2 21  ? -121.431 -24.058 -29.375 1.00 0.00 ? 25  ILE C C   2  
ATOM 10104  O O   . ILE B 2 21  ? -120.744 -24.558 -30.264 1.00 0.00 ? 25  ILE C O   2  
ATOM 10105  C CB  . ILE B 2 21  ? -122.362 -25.592 -27.512 1.00 0.00 ? 25  ILE C CB  2  
ATOM 10106  C CG1 . ILE B 2 21  ? -123.675 -25.977 -26.867 1.00 0.00 ? 25  ILE C CG1 2  
ATOM 10107  C CG2 . ILE B 2 21  ? -121.513 -24.805 -26.538 1.00 0.00 ? 25  ILE C CG2 2  
ATOM 10108  C CD1 . ILE B 2 21  ? -123.525 -27.227 -25.981 1.00 0.00 ? 25  ILE C CD1 2  
ATOM 10109  N N   . THR B 2 22  ? -121.086 -22.852 -28.938 1.00 0.00 ? 26  THR C N   2  
ATOM 10110  C CA  . THR B 2 22  ? -119.948 -22.098 -29.485 1.00 0.00 ? 26  THR C CA  2  
ATOM 10111  C C   . THR B 2 22  ? -118.527 -22.441 -29.012 1.00 0.00 ? 26  THR C C   2  
ATOM 10112  O O   . THR B 2 22  ? -118.294 -22.795 -27.857 1.00 0.00 ? 26  THR C O   2  
ATOM 10113  C CB  . THR B 2 22  ? -120.094 -20.572 -29.246 1.00 0.00 ? 26  THR C CB  2  
ATOM 10114  O OG1 . THR B 2 22  ? -119.761 -20.338 -27.891 1.00 0.00 ? 26  THR C OG1 2  
ATOM 10115  C CG2 . THR B 2 22  ? -121.491 -20.042 -29.546 1.00 0.00 ? 26  THR C CG2 2  
ATOM 10116  N N   . LEU B 2 23  ? -117.531 -22.227 -29.879 1.00 0.00 ? 27  LEU C N   2  
ATOM 10117  C CA  . LEU B 2 23  ? -116.102 -22.415 -29.573 1.00 0.00 ? 27  LEU C CA  2  
ATOM 10118  C C   . LEU B 2 23  ? -115.569 -21.707 -28.315 1.00 0.00 ? 27  LEU C C   2  
ATOM 10119  O O   . LEU B 2 23  ? -114.630 -22.109 -27.638 1.00 0.00 ? 27  LEU C O   2  
ATOM 10120  C CB  . LEU B 2 23  ? -115.280 -21.949 -30.764 1.00 0.00 ? 27  LEU C CB  2  
ATOM 10121  N N   . SER B 2 24  ? -116.227 -20.628 -27.899 1.00 0.00 ? 28  SER C N   2  
ATOM 10122  C CA  . SER B 2 24  ? -115.897 -19.970 -26.636 1.00 0.00 ? 28  SER C CA  2  
ATOM 10123  C C   . SER B 2 24  ? -116.508 -20.735 -25.455 1.00 0.00 ? 28  SER C C   2  
ATOM 10124  O O   . SER B 2 24  ? -115.795 -21.121 -24.528 1.00 0.00 ? 28  SER C O   2  
ATOM 10125  C CB  . SER B 2 24  ? -116.425 -18.549 -26.622 1.00 0.00 ? 28  SER C CB  2  
ATOM 10126  O OG  . SER B 2 24  ? -117.626 -18.447 -27.381 1.00 0.00 ? 28  SER C OG  2  
ATOM 10127  N N   . GLN B 2 25  ? -117.801 -21.099 -25.504 1.00 0.00 ? 29  GLN C N   2  
ATOM 10128  C CA  . GLN B 2 25  ? -118.443 -21.908 -24.447 1.00 0.00 ? 29  GLN C CA  2  
ATOM 10129  C C   . GLN B 2 25  ? -117.797 -23.281 -24.213 1.00 0.00 ? 29  GLN C C   2  
ATOM 10130  O O   . GLN B 2 25  ? -117.950 -23.968 -23.194 1.00 0.00 ? 29  GLN C O   2  
ATOM 10131  C CB  . GLN B 2 25  ? -119.912 -22.120 -24.785 1.00 0.00 ? 29  GLN C CB  2  
ATOM 10132  C CG  . GLN B 2 25  ? -120.811 -20.895 -24.642 1.00 0.00 ? 29  GLN C CG  2  
ATOM 10133  C CD  . GLN B 2 25  ? -122.013 -20.907 -25.582 1.00 0.00 ? 29  GLN C CD  2  
ATOM 10134  O OE1 . GLN B 2 25  ? -122.024 -21.611 -26.582 1.00 0.00 ? 29  GLN C OE1 2  
ATOM 10135  N NE2 . GLN B 2 25  ? -123.034 -20.098 -25.502 1.00 0.00 ? 29  GLN C NE2 2  
ATOM 10136  N N   . VAL B 2 26  ? -117.105 -23.744 -25.247 1.00 0.00 ? 30  VAL C N   2  
ATOM 10137  C CA  . VAL B 2 26  ? -116.214 -24.905 -25.241 1.00 0.00 ? 30  VAL C CA  2  
ATOM 10138  C C   . VAL B 2 26  ? -115.322 -25.046 -23.995 1.00 0.00 ? 30  VAL C C   2  
ATOM 10139  O O   . VAL B 2 26  ? -115.338 -26.071 -23.293 1.00 0.00 ? 30  VAL C O   2  
ATOM 10140  C CB  . VAL B 2 26  ? -115.419 -24.754 -26.545 1.00 0.00 ? 30  VAL C CB  2  
ATOM 10141  C CG1 . VAL B 2 26  ? -114.033 -25.394 -26.554 1.00 0.00 ? 30  VAL C CG1 2  
ATOM 10142  C CG2 . VAL B 2 26  ? -116.375 -25.280 -27.589 1.00 0.00 ? 30  VAL C CG2 2  
ATOM 10143  N N   . GLY B 2 27  ? -114.589 -23.964 -23.711 1.00 0.00 ? 31  GLY C N   2  
ATOM 10144  C CA  . GLY B 2 27  ? -113.674 -23.879 -22.576 1.00 0.00 ? 31  GLY C CA  2  
ATOM 10145  C C   . GLY B 2 27  ? -114.347 -23.970 -21.208 1.00 0.00 ? 31  GLY C C   2  
ATOM 10146  O O   . GLY B 2 27  ? -113.755 -24.434 -20.230 1.00 0.00 ? 31  GLY C O   2  
ATOM 10147  N N   . ASP B 2 28  ? -115.597 -23.521 -21.127 1.00 0.00 ? 32  ASP C N   2  
ATOM 10148  C CA  . ASP B 2 28  ? -116.376 -23.601 -19.900 1.00 0.00 ? 32  ASP C CA  2  
ATOM 10149  C C   . ASP B 2 28  ? -117.085 -24.948 -19.692 1.00 0.00 ? 32  ASP C C   2  
ATOM 10150  O O   . ASP B 2 28  ? -116.951 -25.565 -18.631 1.00 0.00 ? 32  ASP C O   2  
ATOM 10151  C CB  . ASP B 2 28  ? -117.368 -22.446 -19.924 1.00 0.00 ? 32  ASP C CB  2  
ATOM 10152  C CG  . ASP B 2 28  ? -116.715 -21.081 -20.102 1.00 0.00 ? 32  ASP C CG  2  
ATOM 10153  O OD1 . ASP B 2 28  ? -115.750 -20.752 -19.405 1.00 0.00 ? 32  ASP C OD1 2  
ATOM 10154  O OD2 . ASP B 2 28  ? -117.160 -20.339 -20.967 1.00 0.00 ? 32  ASP C OD2 2  
ATOM 10155  N N   . ILE B 2 29  ? -117.758 -25.518 -20.700 1.00 0.00 ? 33  ILE C N   2  
ATOM 10156  C CA  . ILE B 2 29  ? -118.413 -26.830 -20.572 1.00 0.00 ? 33  ILE C CA  2  
ATOM 10157  C C   . ILE B 2 29  ? -117.444 -27.945 -20.145 1.00 0.00 ? 33  ILE C C   2  
ATOM 10158  O O   . ILE B 2 29  ? -117.746 -28.778 -19.283 1.00 0.00 ? 33  ILE C O   2  
ATOM 10159  C CB  . ILE B 2 29  ? -119.110 -27.133 -21.921 1.00 0.00 ? 33  ILE C CB  2  
ATOM 10160  C CG1 . ILE B 2 29  ? -120.326 -26.212 -21.996 1.00 0.00 ? 33  ILE C CG1 2  
ATOM 10161  C CG2 . ILE B 2 29  ? -119.586 -28.583 -22.039 1.00 0.00 ? 33  ILE C CG2 2  
ATOM 10162  C CD1 . ILE B 2 29  ? -121.097 -26.265 -23.320 1.00 0.00 ? 33  ILE C CD1 2  
ATOM 10163  N N   . VAL B 2 30  ? -116.221 -27.920 -20.683 1.00 0.00 ? 34  VAL C N   2  
ATOM 10164  C CA  . VAL B 2 30  ? -115.161 -28.836 -20.265 1.00 0.00 ? 34  VAL C CA  2  
ATOM 10165  C C   . VAL B 2 30  ? -114.811 -28.842 -18.768 1.00 0.00 ? 34  VAL C C   2  
ATOM 10166  O O   . VAL B 2 30  ? -114.420 -29.868 -18.198 1.00 0.00 ? 34  VAL C O   2  
ATOM 10167  C CB  . VAL B 2 30  ? -113.883 -28.506 -21.029 1.00 0.00 ? 34  VAL C CB  2  
ATOM 10168  N N   . ARG B 2 31  ? -114.998 -27.699 -18.106 1.00 0.00 ? 35  ARG C N   2  
ATOM 10169  C CA  . ARG B 2 31  ? -114.705 -27.519 -16.683 1.00 0.00 ? 35  ARG C CA  2  
ATOM 10170  C C   . ARG B 2 31  ? -115.613 -28.238 -15.689 1.00 0.00 ? 35  ARG C C   2  
ATOM 10171  O O   . ARG B 2 31  ? -115.179 -28.655 -14.608 1.00 0.00 ? 35  ARG C O   2  
ATOM 10172  C CB  . ARG B 2 31  ? -114.714 -26.032 -16.346 1.00 0.00 ? 35  ARG C CB  2  
ATOM 10173  C CG  . ARG B 2 31  ? -113.672 -25.232 -17.104 1.00 0.00 ? 35  ARG C CG  2  
ATOM 10174  C CD  . ARG B 2 31  ? -113.806 -23.753 -16.796 1.00 0.00 ? 35  ARG C CD  2  
ATOM 10175  N NE  . ARG B 2 31  ? -113.028 -22.946 -17.721 1.00 0.00 ? 35  ARG C NE  2  
ATOM 10176  C CZ  . ARG B 2 31  ? -113.256 -21.665 -17.918 1.00 0.00 ? 35  ARG C CZ  2  
ATOM 10177  N NH1 . ARG B 2 31  ? -114.152 -21.002 -17.228 1.00 0.00 ? 35  ARG C NH1 2  
ATOM 10178  N NH2 . ARG B 2 31  ? -112.577 -21.019 -18.823 1.00 0.00 ? 35  ARG C NH2 2  
ATOM 10179  N N   . ALA B 2 32  ? -116.909 -28.330 -15.998 1.00 0.00 ? 36  ALA C N   2  
ATOM 10180  C CA  . ALA B 2 32  ? -117.806 -29.105 -15.145 1.00 0.00 ? 36  ALA C CA  2  
ATOM 10181  C C   . ALA B 2 32  ? -117.908 -30.581 -15.474 1.00 0.00 ? 36  ALA C C   2  
ATOM 10182  O O   . ALA B 2 32  ? -118.305 -31.396 -14.640 1.00 0.00 ? 36  ALA C O   2  
ATOM 10183  C CB  . ALA B 2 32  ? -119.192 -28.566 -15.198 1.00 0.00 ? 36  ALA C CB  2  
ATOM 10184  N N   . LEU B 2 33  ? -117.593 -30.979 -16.711 1.00 0.00 ? 37  LEU C N   2  
ATOM 10185  C CA  . LEU B 2 33  ? -117.574 -32.393 -17.058 1.00 0.00 ? 37  LEU C CA  2  
ATOM 10186  C C   . LEU B 2 33  ? -116.342 -33.149 -16.524 1.00 0.00 ? 37  LEU C C   2  
ATOM 10187  O O   . LEU B 2 33  ? -115.316 -33.465 -17.144 1.00 0.00 ? 37  LEU C O   2  
ATOM 10188  C CB  . LEU B 2 33  ? -117.701 -32.492 -18.586 1.00 0.00 ? 37  LEU C CB  2  
ATOM 10189  C CG  . LEU B 2 33  ? -118.899 -31.768 -19.227 1.00 0.00 ? 37  LEU C CG  2  
ATOM 10190  C CD1 . LEU B 2 33  ? -118.999 -32.204 -20.668 1.00 0.00 ? 37  LEU C CD1 2  
ATOM 10191  C CD2 . LEU B 2 33  ? -120.209 -32.101 -18.529 1.00 0.00 ? 37  LEU C CD2 2  
ATOM 10192  N N   . GLY B 2 34  ? -116.471 -33.357 -15.216 1.00 0.00 ? 38  GLY C N   2  
ATOM 10193  C CA  . GLY B 2 34  ? -115.510 -34.051 -14.385 1.00 0.00 ? 38  GLY C CA  2  
ATOM 10194  C C   . GLY B 2 34  ? -114.277 -33.281 -13.918 1.00 0.00 ? 38  GLY C C   2  
ATOM 10195  O O   . GLY B 2 34  ? -114.098 -32.977 -12.733 1.00 0.00 ? 38  GLY C O   2  
ATOM 10196  N N   . GLN B 2 35  ? -113.384 -32.913 -14.833 1.00 0.00 ? 39  GLN C N   2  
ATOM 10197  C CA  . GLN B 2 35  ? -112.075 -32.438 -14.386 1.00 0.00 ? 39  GLN C CA  2  
ATOM 10198  C C   . GLN B 2 35  ? -111.488 -31.191 -15.070 1.00 0.00 ? 39  GLN C C   2  
ATOM 10199  O O   . GLN B 2 35  ? -111.687 -30.970 -16.260 1.00 0.00 ? 39  GLN C O   2  
ATOM 10200  C CB  . GLN B 2 35  ? -111.080 -33.613 -14.507 1.00 0.00 ? 39  GLN C CB  2  
ATOM 10201  C CG  . GLN B 2 35  ? -111.588 -35.078 -14.419 1.00 0.00 ? 39  GLN C CG  2  
ATOM 10202  C CD  . GLN B 2 35  ? -110.621 -36.135 -14.940 1.00 0.00 ? 39  GLN C CD  2  
ATOM 10203  O OE1 . GLN B 2 35  ? -109.578 -36.373 -14.379 1.00 0.00 ? 39  GLN C OE1 2  
ATOM 10204  N NE2 . GLN B 2 35  ? -110.809 -36.852 -16.030 1.00 0.00 ? 39  GLN C NE2 2  
ATOM 10205  N N   . ASN B 2 36  ? -110.705 -30.430 -14.305 1.00 0.00 ? 40  ASN C N   2  
ATOM 10206  C CA  . ASN B 2 36  ? -110.089 -29.147 -14.701 1.00 0.00 ? 40  ASN C CA  2  
ATOM 10207  C C   . ASN B 2 36  ? -109.301 -29.064 -16.026 1.00 0.00 ? 40  ASN C C   2  
ATOM 10208  O O   . ASN B 2 36  ? -108.593 -30.007 -16.389 1.00 0.00 ? 40  ASN C O   2  
ATOM 10209  C CB  . ASN B 2 36  ? -109.141 -28.667 -13.594 1.00 0.00 ? 40  ASN C CB  2  
ATOM 10210  C CG  . ASN B 2 36  ? -109.633 -28.899 -12.171 1.00 0.00 ? 40  ASN C CG  2  
ATOM 10211  O OD1 . ASN B 2 36  ? -110.736 -28.571 -11.764 1.00 0.00 ? 40  ASN C OD1 2  
ATOM 10212  N ND2 . ASN B 2 36  ? -108.921 -29.601 -11.318 1.00 0.00 ? 40  ASN C ND2 2  
ATOM 10213  N N   . PRO B 2 37  ? -109.416 -27.955 -16.772 1.00 0.00 ? 41  PRO C N   2  
ATOM 10214  C CA  . PRO B 2 37  ? -108.411 -27.588 -17.785 1.00 0.00 ? 41  PRO C CA  2  
ATOM 10215  C C   . PRO B 2 37  ? -107.923 -26.133 -17.727 1.00 0.00 ? 41  PRO C C   2  
ATOM 10216  O O   . PRO B 2 37  ? -108.741 -25.235 -17.482 1.00 0.00 ? 41  PRO C O   2  
ATOM 10217  C CB  . PRO B 2 37  ? -109.089 -27.939 -19.098 1.00 0.00 ? 41  PRO C CB  2  
ATOM 10218  C CG  . PRO B 2 37  ? -110.525 -27.575 -18.837 1.00 0.00 ? 41  PRO C CG  2  
ATOM 10219  C CD  . PRO B 2 37  ? -110.720 -28.090 -17.425 1.00 0.00 ? 41  PRO C CD  2  
ATOM 10220  N N   . THR B 2 38  ? -106.644 -25.783 -17.917 1.00 0.00 ? 42  THR C N   2  
ATOM 10221  C CA  . THR B 2 38  ? -106.249 -24.368 -17.857 1.00 0.00 ? 42  THR C CA  2  
ATOM 10222  C C   . THR B 2 38  ? -106.506 -23.571 -19.144 1.00 0.00 ? 42  THR C C   2  
ATOM 10223  O O   . THR B 2 38  ? -106.539 -24.091 -20.275 1.00 0.00 ? 42  THR C O   2  
ATOM 10224  C CB  . THR B 2 38  ? -104.733 -24.108 -17.565 1.00 0.00 ? 42  THR C CB  2  
ATOM 10225  O OG1 . THR B 2 38  ? -104.006 -24.410 -18.751 1.00 0.00 ? 42  THR C OG1 2  
ATOM 10226  C CG2 . THR B 2 38  ? -104.205 -24.946 -16.409 1.00 0.00 ? 42  THR C CG2 2  
ATOM 10227  N N   . ASN B 2 39  ? -106.671 -22.255 -19.036 1.00 0.00 ? 43  ASN C N   2  
ATOM 10228  C CA  . ASN B 2 39  ? -106.794 -21.426 -20.226 1.00 0.00 ? 43  ASN C CA  2  
ATOM 10229  C C   . ASN B 2 39  ? -105.383 -20.955 -20.597 1.00 0.00 ? 43  ASN C C   2  
ATOM 10230  O O   . ASN B 2 39  ? -104.762 -20.070 -20.025 1.00 0.00 ? 43  ASN C O   2  
ATOM 10231  C CB  . ASN B 2 39  ? -107.657 -20.196 -20.006 1.00 0.00 ? 43  ASN C CB  2  
ATOM 10232  C CG  . ASN B 2 39  ? -109.015 -20.452 -19.381 1.00 0.00 ? 43  ASN C CG  2  
ATOM 10233  O OD1 . ASN B 2 39  ? -109.923 -21.140 -19.838 1.00 0.00 ? 43  ASN C OD1 2  
ATOM 10234  N ND2 . ASN B 2 39  ? -109.269 -19.838 -18.257 1.00 0.00 ? 43  ASN C ND2 2  
ATOM 10235  N N   . ALA B 2 40  ? -104.998 -21.544 -21.716 1.00 0.00 ? 44  ALA C N   2  
ATOM 10236  C CA  . ALA B 2 40  ? -103.664 -21.554 -22.311 1.00 0.00 ? 44  ALA C CA  2  
ATOM 10237  C C   . ALA B 2 40  ? -103.664 -22.960 -22.885 1.00 0.00 ? 44  ALA C C   2  
ATOM 10238  O O   . ALA B 2 40  ? -103.472 -23.124 -24.084 1.00 0.00 ? 44  ALA C O   2  
ATOM 10239  C CB  . ALA B 2 40  ? -102.489 -21.519 -21.335 1.00 0.00 ? 44  ALA C CB  2  
ATOM 10240  N N   . GLU B 2 41  ? -103.959 -24.017 -22.114 1.00 0.00 ? 45  GLU C N   2  
ATOM 10241  C CA  . GLU B 2 41  ? -104.105 -25.360 -22.681 1.00 0.00 ? 45  GLU C CA  2  
ATOM 10242  C C   . GLU B 2 41  ? -105.272 -25.512 -23.646 1.00 0.00 ? 45  GLU C C   2  
ATOM 10243  O O   . GLU B 2 41  ? -105.092 -25.998 -24.763 1.00 0.00 ? 45  GLU C O   2  
ATOM 10244  C CB  . GLU B 2 41  ? -104.270 -26.377 -21.585 1.00 0.00 ? 45  GLU C CB  2  
ATOM 10245  C CG  . GLU B 2 41  ? -102.950 -26.523 -20.862 1.00 0.00 ? 45  GLU C CG  2  
ATOM 10246  C CD  . GLU B 2 41  ? -102.994 -27.370 -19.612 1.00 0.00 ? 45  GLU C CD  2  
ATOM 10247  O OE1 . GLU B 2 41  ? -104.011 -27.364 -18.913 1.00 0.00 ? 45  GLU C OE1 2  
ATOM 10248  O OE2 . GLU B 2 41  ? -101.975 -27.991 -19.344 1.00 0.00 ? 45  GLU C OE2 2  
ATOM 10249  N N   . ILE B 2 42  ? -106.457 -25.023 -23.255 1.00 0.00 ? 46  ILE C N   2  
ATOM 10250  C CA  . ILE B 2 42  ? -107.622 -24.987 -24.150 1.00 0.00 ? 46  ILE C CA  2  
ATOM 10251  C C   . ILE B 2 42  ? -107.280 -24.122 -25.384 1.00 0.00 ? 46  ILE C C   2  
ATOM 10252  O O   . ILE B 2 42  ? -107.420 -24.528 -26.538 1.00 0.00 ? 46  ILE C O   2  
ATOM 10253  C CB  . ILE B 2 42  ? -108.839 -24.389 -23.394 1.00 0.00 ? 46  ILE C CB  2  
ATOM 10254  C CG1 . ILE B 2 42  ? -109.198 -25.258 -22.193 1.00 0.00 ? 46  ILE C CG1 2  
ATOM 10255  C CG2 . ILE B 2 42  ? -110.046 -24.329 -24.333 1.00 0.00 ? 46  ILE C CG2 2  
ATOM 10256  C CD1 . ILE B 2 42  ? -110.162 -24.574 -21.202 1.00 0.00 ? 46  ILE C CD1 2  
ATOM 10257  N N   . ASN B 2 43  ? -106.726 -22.929 -25.125 1.00 0.00 ? 47  ASN C N   2  
ATOM 10258  C CA  . ASN B 2 43  ? -106.240 -22.031 -26.175 1.00 0.00 ? 47  ASN C CA  2  
ATOM 10259  C C   . ASN B 2 43  ? -105.196 -22.677 -27.107 1.00 0.00 ? 47  ASN C C   2  
ATOM 10260  O O   . ASN B 2 43  ? -105.145 -22.366 -28.286 1.00 0.00 ? 47  ASN C O   2  
ATOM 10261  C CB  . ASN B 2 43  ? -105.609 -20.771 -25.560 1.00 0.00 ? 47  ASN C CB  2  
ATOM 10262  C CG  . ASN B 2 43  ? -106.457 -20.051 -24.517 1.00 0.00 ? 47  ASN C CG  2  
ATOM 10263  O OD1 . ASN B 2 43  ? -107.653 -20.246 -24.380 1.00 0.00 ? 47  ASN C OD1 2  
ATOM 10264  N ND2 . ASN B 2 43  ? -105.936 -19.255 -23.610 1.00 0.00 ? 47  ASN C ND2 2  
ATOM 10265  N N   . LYS B 2 44  ? -104.351 -23.609 -26.644 1.00 0.00 ? 48  LYS C N   2  
ATOM 10266  C CA  . LYS B 2 44  ? -103.363 -24.297 -27.484 1.00 0.00 ? 48  LYS C CA  2  
ATOM 10267  C C   . LYS B 2 44  ? -103.924 -25.164 -28.613 1.00 0.00 ? 48  LYS C C   2  
ATOM 10268  O O   . LYS B 2 44  ? -103.819 -24.834 -29.800 1.00 0.00 ? 48  LYS C O   2  
ATOM 10269  C CB  . LYS B 2 44  ? -102.459 -25.235 -26.670 1.00 0.00 ? 48  LYS C CB  2  
ATOM 10270  C CG  . LYS B 2 44  ? -101.436 -24.689 -25.694 1.00 0.00 ? 48  LYS C CG  2  
ATOM 10271  C CD  . LYS B 2 44  ? -101.049 -25.847 -24.785 1.00 0.00 ? 48  LYS C CD  2  
ATOM 10272  C CE  . LYS B 2 44  ? -100.342 -25.361 -23.519 1.00 0.00 ? 48  LYS C CE  2  
ATOM 10273  N NZ  . LYS B 2 44  ? -100.203 -26.434 -22.547 1.00 0.00 ? 48  LYS C NZ  2  
ATOM 10274  N N   . ILE B 2 45  ? -104.543 -26.292 -28.274 1.00 0.00 ? 49  ILE C N   2  
ATOM 10275  C CA  . ILE B 2 45  ? -105.006 -27.170 -29.329 1.00 0.00 ? 49  ILE C CA  2  
ATOM 10276  C C   . ILE B 2 45  ? -106.497 -27.248 -29.558 1.00 0.00 ? 49  ILE C C   2  
ATOM 10277  O O   . ILE B 2 45  ? -107.362 -27.407 -28.709 1.00 0.00 ? 49  ILE C O   2  
ATOM 10278  C CB  . ILE B 2 45  ? -104.352 -28.565 -29.084 1.00 0.00 ? 49  ILE C CB  2  
ATOM 10279  C CG1 . ILE B 2 45  ? -103.151 -28.501 -30.031 1.00 0.00 ? 49  ILE C CG1 2  
ATOM 10280  C CG2 . ILE B 2 45  ? -105.204 -29.807 -29.362 1.00 0.00 ? 49  ILE C CG2 2  
ATOM 10281  C CD1 . ILE B 2 45  ? -102.259 -29.747 -30.170 1.00 0.00 ? 49  ILE C CD1 2  
ATOM 10282  N N   . LEU B 2 46  ? -106.650 -27.017 -30.865 1.00 0.00 ? 50  LEU C N   2  
ATOM 10283  C CA  . LEU B 2 46  ? -107.900 -26.793 -31.579 1.00 0.00 ? 50  LEU C CA  2  
ATOM 10284  C C   . LEU B 2 46  ? -108.471 -25.419 -31.223 1.00 0.00 ? 50  LEU C C   2  
ATOM 10285  O O   . LEU B 2 46  ? -108.856 -24.728 -32.156 1.00 0.00 ? 50  LEU C O   2  
ATOM 10286  C CB  . LEU B 2 46  ? -108.849 -27.960 -31.293 1.00 0.00 ? 50  LEU C CB  2  
ATOM 10287  C CG  . LEU B 2 46  ? -108.265 -29.213 -31.968 1.00 0.00 ? 50  LEU C CG  2  
ATOM 10288  C CD1 . LEU B 2 46  ? -108.477 -30.408 -31.075 1.00 0.00 ? 50  LEU C CD1 2  
ATOM 10289  C CD2 . LEU B 2 46  ? -108.860 -29.367 -33.351 1.00 0.00 ? 50  LEU C CD2 2  
ATOM 10290  N N   . GLY B 2 47  ? -108.381 -24.938 -29.977 1.00 0.00 ? 51  GLY C N   2  
ATOM 10291  C CA  . GLY B 2 47  ? -108.694 -23.545 -29.628 1.00 0.00 ? 51  GLY C CA  2  
ATOM 10292  C C   . GLY B 2 47  ? -107.987 -22.466 -30.474 1.00 0.00 ? 51  GLY C C   2  
ATOM 10293  O O   . GLY B 2 47  ? -108.609 -21.590 -31.080 1.00 0.00 ? 51  GLY C O   2  
ATOM 10294  N N   . ASN B 2 48  ? -106.648 -22.475 -30.555 1.00 0.00 ? 52  ASN C N   2  
ATOM 10295  C CA  . ASN B 2 48  ? -105.905 -21.536 -31.409 1.00 0.00 ? 52  ASN C CA  2  
ATOM 10296  C C   . ASN B 2 48  ? -106.296 -21.440 -32.897 1.00 0.00 ? 52  ASN C C   2  
ATOM 10297  O O   . ASN B 2 48  ? -106.181 -20.362 -33.496 1.00 0.00 ? 52  ASN C O   2  
ATOM 10298  C CB  . ASN B 2 48  ? -104.406 -21.833 -31.364 1.00 0.00 ? 52  ASN C CB  2  
ATOM 10299  C CG  . ASN B 2 48  ? -103.573 -20.964 -30.437 1.00 0.00 ? 52  ASN C CG  2  
ATOM 10300  O OD1 . ASN B 2 48  ? -103.907 -19.864 -30.033 1.00 0.00 ? 52  ASN C OD1 2  
ATOM 10301  N ND2 . ASN B 2 48  ? -102.386 -21.373 -30.060 1.00 0.00 ? 52  ASN C ND2 2  
ATOM 10302  N N   . PRO B 2 49  ? -106.735 -22.508 -33.586 1.00 0.00 ? 53  PRO C N   2  
ATOM 10303  C CA  . PRO B 2 49  ? -107.340 -22.283 -34.900 1.00 0.00 ? 53  PRO C CA  2  
ATOM 10304  C C   . PRO B 2 49  ? -108.815 -21.899 -34.978 1.00 0.00 ? 53  PRO C C   2  
ATOM 10305  O O   . PRO B 2 49  ? -109.675 -22.770 -35.083 1.00 0.00 ? 53  PRO C O   2  
ATOM 10306  C CB  . PRO B 2 49  ? -107.027 -23.552 -35.679 1.00 0.00 ? 53  PRO C CB  2  
ATOM 10307  C CG  . PRO B 2 49  ? -106.891 -24.608 -34.623 1.00 0.00 ? 53  PRO C CG  2  
ATOM 10308  C CD  . PRO B 2 49  ? -106.091 -23.822 -33.612 1.00 0.00 ? 53  PRO C CD  2  
ATOM 10309  N N   . SER B 2 50  ? -109.185 -20.613 -35.022 1.00 0.00 ? 54  SER C N   2  
ATOM 10310  C CA  . SER B 2 50  ? -110.598 -20.175 -35.077 1.00 0.00 ? 54  SER C CA  2  
ATOM 10311  C C   . SER B 2 50  ? -111.525 -20.898 -36.050 1.00 0.00 ? 54  SER C C   2  
ATOM 10312  O O   . SER B 2 50  ? -112.498 -21.502 -35.622 1.00 0.00 ? 54  SER C O   2  
ATOM 10313  C CB  . SER B 2 50  ? -110.730 -18.700 -35.426 1.00 0.00 ? 54  SER C CB  2  
ATOM 10314  O OG  . SER B 2 50  ? -110.026 -17.861 -34.530 1.00 0.00 ? 54  SER C OG  2  
ATOM 10315  N N   . LYS B 2 51  ? -111.268 -20.917 -37.367 1.00 0.00 ? 55  LYS C N   2  
ATOM 10316  C CA  . LYS B 2 51  ? -112.089 -21.683 -38.312 1.00 0.00 ? 55  LYS C CA  2  
ATOM 10317  C C   . LYS B 2 51  ? -112.123 -23.182 -38.007 1.00 0.00 ? 55  LYS C C   2  
ATOM 10318  O O   . LYS B 2 51  ? -113.203 -23.757 -37.959 1.00 0.00 ? 55  LYS C O   2  
ATOM 10319  C CB  . LYS B 2 51  ? -111.591 -21.528 -39.735 1.00 0.00 ? 55  LYS C CB  2  
ATOM 10320  C CG  . LYS B 2 51  ? -112.612 -20.942 -40.700 1.00 0.00 ? 55  LYS C CG  2  
ATOM 10321  C CD  . LYS B 2 51  ? -112.258 -21.413 -42.105 1.00 0.00 ? 55  LYS C CD  2  
ATOM 10322  C CE  . LYS B 2 51  ? -112.851 -20.561 -43.220 1.00 0.00 ? 55  LYS C CE  2  
ATOM 10323  N NZ  . LYS B 2 51  ? -114.292 -20.428 -43.140 1.00 0.00 ? 55  LYS C NZ  2  
ATOM 10324  N N   . GLU B 2 52  ? -110.979 -23.837 -37.779 1.00 0.00 ? 56  GLU C N   2  
ATOM 10325  C CA  . GLU B 2 52  ? -110.983 -25.247 -37.402 1.00 0.00 ? 56  GLU C CA  2  
ATOM 10326  C C   . GLU B 2 52  ? -111.737 -25.486 -36.098 1.00 0.00 ? 56  GLU C C   2  
ATOM 10327  O O   . GLU B 2 52  ? -112.703 -26.220 -36.165 1.00 0.00 ? 56  GLU C O   2  
ATOM 10328  C CB  . GLU B 2 52  ? -109.581 -25.799 -37.219 1.00 0.00 ? 56  GLU C CB  2  
ATOM 10329  C CG  . GLU B 2 52  ? -108.821 -26.033 -38.520 1.00 0.00 ? 56  GLU C CG  2  
ATOM 10330  C CD  . GLU B 2 52  ? -107.597 -26.930 -38.361 1.00 0.00 ? 56  GLU C CD  2  
ATOM 10331  O OE1 . GLU B 2 52  ? -107.422 -27.819 -39.194 1.00 0.00 ? 56  GLU C OE1 2  
ATOM 10332  O OE2 . GLU B 2 52  ? -106.824 -26.760 -37.419 1.00 0.00 ? 56  GLU C OE2 2  
ATOM 10333  N N   . GLU B 2 53  ? -111.503 -24.877 -34.933 1.00 0.00 ? 57  GLU C N   2  
ATOM 10334  C CA  . GLU B 2 53  ? -112.320 -25.100 -33.728 1.00 0.00 ? 57  GLU C CA  2  
ATOM 10335  C C   . GLU B 2 53  ? -113.797 -24.739 -33.939 1.00 0.00 ? 57  GLU C C   2  
ATOM 10336  O O   . GLU B 2 53  ? -114.725 -25.410 -33.463 1.00 0.00 ? 57  GLU C O   2  
ATOM 10337  C CB  . GLU B 2 53  ? -111.822 -24.274 -32.561 1.00 0.00 ? 57  GLU C CB  2  
ATOM 10338  C CG  . GLU B 2 53  ? -112.422 -24.798 -31.260 1.00 0.00 ? 57  GLU C CG  2  
ATOM 10339  C CD  . GLU B 2 53  ? -112.058 -24.027 -30.005 1.00 0.00 ? 57  GLU C CD  2  
ATOM 10340  O OE1 . GLU B 2 53  ? -111.738 -24.673 -29.008 1.00 0.00 ? 57  GLU C OE1 2  
ATOM 10341  O OE2 . GLU B 2 53  ? -112.104 -22.794 -30.024 1.00 0.00 ? 57  GLU C OE2 2  
ATOM 10342  N N   . MET B 2 54  ? -114.113 -23.698 -34.709 1.00 0.00 ? 58  MET C N   2  
ATOM 10343  C CA  . MET B 2 54  ? -115.502 -23.447 -35.082 1.00 0.00 ? 58  MET C CA  2  
ATOM 10344  C C   . MET B 2 54  ? -116.136 -24.558 -35.926 1.00 0.00 ? 58  MET C C   2  
ATOM 10345  O O   . MET B 2 54  ? -117.336 -24.788 -35.851 1.00 0.00 ? 58  MET C O   2  
ATOM 10346  C CB  . MET B 2 54  ? -115.643 -22.137 -35.847 1.00 0.00 ? 58  MET C CB  2  
ATOM 10347  C CG  . MET B 2 54  ? -115.574 -20.935 -34.917 1.00 0.00 ? 58  MET C CG  2  
ATOM 10348  S SD  . MET B 2 54  ? -116.583 -19.557 -35.523 1.00 0.00 ? 58  MET C SD  2  
ATOM 10349  C CE  . MET B 2 54  ? -116.784 -18.642 -34.025 1.00 0.00 ? 58  MET C CE  2  
ATOM 10350  N N   . ASN B 2 55  ? -115.317 -25.250 -36.707 1.00 0.00 ? 59  ASN C N   2  
ATOM 10351  C CA  . ASN B 2 55  ? -115.686 -26.463 -37.432 1.00 0.00 ? 59  ASN C CA  2  
ATOM 10352  C C   . ASN B 2 55  ? -115.177 -27.761 -36.765 1.00 0.00 ? 59  ASN C C   2  
ATOM 10353  O O   . ASN B 2 55  ? -115.071 -28.792 -37.422 1.00 0.00 ? 59  ASN C O   2  
ATOM 10354  C CB  . ASN B 2 55  ? -115.141 -26.340 -38.846 1.00 0.00 ? 59  ASN C CB  2  
ATOM 10355  C CG  . ASN B 2 55  ? -116.167 -26.513 -39.946 1.00 0.00 ? 59  ASN C CG  2  
ATOM 10356  O OD1 . ASN B 2 55  ? -117.316 -26.106 -39.899 1.00 0.00 ? 59  ASN C OD1 2  
ATOM 10357  N ND2 . ASN B 2 55  ? -115.823 -27.066 -41.085 1.00 0.00 ? 59  ASN C ND2 2  
ATOM 10358  N N   . ALA B 2 56  ? -114.720 -27.634 -35.507 1.00 0.00 ? 60  ALA C N   2  
ATOM 10359  C CA  . ALA B 2 56  ? -114.256 -28.725 -34.635 1.00 0.00 ? 60  ALA C CA  2  
ATOM 10360  C C   . ALA B 2 56  ? -114.646 -28.649 -33.142 1.00 0.00 ? 60  ALA C C   2  
ATOM 10361  O O   . ALA B 2 56  ? -114.024 -29.237 -32.258 1.00 0.00 ? 60  ALA C O   2  
ATOM 10362  C CB  . ALA B 2 56  ? -112.733 -28.843 -34.693 1.00 0.00 ? 60  ALA C CB  2  
ATOM 10363  N N   . LYS B 2 57  ? -115.675 -27.856 -32.810 1.00 0.00 ? 61  LYS C N   2  
ATOM 10364  C CA  . LYS B 2 57  ? -116.356 -27.799 -31.502 1.00 0.00 ? 61  LYS C CA  2  
ATOM 10365  C C   . LYS B 2 57  ? -117.430 -26.708 -31.411 1.00 0.00 ? 61  LYS C C   2  
ATOM 10366  O O   . LYS B 2 57  ? -118.322 -26.801 -30.566 1.00 0.00 ? 61  LYS C O   2  
ATOM 10367  C CB  . LYS B 2 57  ? -115.407 -27.585 -30.307 1.00 0.00 ? 61  LYS C CB  2  
ATOM 10368  C CG  . LYS B 2 57  ? -115.966 -28.373 -29.102 1.00 0.00 ? 61  LYS C CG  2  
ATOM 10369  C CD  . LYS B 2 57  ? -115.000 -28.421 -27.928 1.00 0.00 ? 61  LYS C CD  2  
ATOM 10370  C CE  . LYS B 2 57  ? -115.482 -28.540 -26.472 1.00 0.00 ? 61  LYS C CE  2  
ATOM 10371  N NZ  . LYS B 2 57  ? -116.107 -29.782 -26.073 1.00 0.00 ? 61  LYS C NZ  2  
ATOM 10372  N N   . LYS B 2 58  ? -117.429 -25.649 -32.235 1.00 0.00 ? 62  LYS C N   2  
ATOM 10373  C CA  . LYS B 2 58  ? -118.574 -24.717 -32.338 1.00 0.00 ? 62  LYS C CA  2  
ATOM 10374  C C   . LYS B 2 58  ? -119.630 -25.377 -33.237 1.00 0.00 ? 62  LYS C C   2  
ATOM 10375  O O   . LYS B 2 58  ? -120.088 -24.944 -34.299 1.00 0.00 ? 62  LYS C O   2  
ATOM 10376  C CB  . LYS B 2 58  ? -118.129 -23.407 -32.942 1.00 0.00 ? 62  LYS C CB  2  
ATOM 10377  C CG  . LYS B 2 58  ? -119.228 -22.375 -33.075 1.00 0.00 ? 62  LYS C CG  2  
ATOM 10378  C CD  . LYS B 2 58  ? -119.184 -21.783 -34.473 1.00 0.00 ? 62  LYS C CD  2  
ATOM 10379  C CE  . LYS B 2 58  ? -120.272 -20.751 -34.681 1.00 0.00 ? 62  LYS C CE  2  
ATOM 10380  N NZ  . LYS B 2 58  ? -120.305 -19.857 -33.542 1.00 0.00 ? 62  LYS C NZ  2  
ATOM 10381  N N   . ILE B 2 59  ? -120.113 -26.421 -32.607 1.00 0.00 ? 63  ILE C N   2  
ATOM 10382  C CA  . ILE B 2 59  ? -120.722 -27.500 -33.334 1.00 0.00 ? 63  ILE C CA  2  
ATOM 10383  C C   . ILE B 2 59  ? -121.651 -28.376 -32.509 1.00 0.00 ? 63  ILE C C   2  
ATOM 10384  O O   . ILE B 2 59  ? -122.138 -28.039 -31.434 1.00 0.00 ? 63  ILE C O   2  
ATOM 10385  C CB  . ILE B 2 59  ? -119.444 -28.190 -33.942 1.00 0.00 ? 63  ILE C CB  2  
ATOM 10386  C CG1 . ILE B 2 59  ? -119.719 -28.330 -35.392 1.00 0.00 ? 63  ILE C CG1 2  
ATOM 10387  C CG2 . ILE B 2 59  ? -119.023 -29.481 -33.273 1.00 0.00 ? 63  ILE C CG2 2  
ATOM 10388  C CD1 . ILE B 2 59  ? -118.494 -27.719 -36.036 1.00 0.00 ? 63  ILE C CD1 2  
ATOM 10389  N N   . THR B 2 60  ? -121.941 -29.504 -33.126 1.00 0.00 ? 64  THR C N   2  
ATOM 10390  C CA  . THR B 2 60  ? -122.654 -30.614 -32.540 1.00 0.00 ? 64  THR C CA  2  
ATOM 10391  C C   . THR B 2 60  ? -121.756 -31.432 -31.613 1.00 0.00 ? 64  THR C C   2  
ATOM 10392  O O   . THR B 2 60  ? -120.543 -31.254 -31.451 1.00 0.00 ? 64  THR C O   2  
ATOM 10393  C CB  . THR B 2 60  ? -123.175 -31.511 -33.664 1.00 0.00 ? 64  THR C CB  2  
ATOM 10394  O OG1 . THR B 2 60  ? -122.102 -31.639 -34.596 1.00 0.00 ? 64  THR C OG1 2  
ATOM 10395  C CG2 . THR B 2 60  ? -124.406 -30.946 -34.353 1.00 0.00 ? 64  THR C CG2 2  
ATOM 10396  N N   . PHE B 2 61  ? -122.308 -32.481 -31.043 1.00 0.00 ? 65  PHE C N   2  
ATOM 10397  C CA  . PHE B 2 61  ? -121.638 -33.314 -30.050 1.00 0.00 ? 65  PHE C CA  2  
ATOM 10398  C C   . PHE B 2 61  ? -120.355 -34.007 -30.539 1.00 0.00 ? 65  PHE C C   2  
ATOM 10399  O O   . PHE B 2 61  ? -119.385 -34.178 -29.799 1.00 0.00 ? 65  PHE C O   2  
ATOM 10400  C CB  . PHE B 2 61  ? -122.688 -34.321 -29.554 1.00 0.00 ? 65  PHE C CB  2  
ATOM 10401  C CG  . PHE B 2 61  ? -123.975 -33.722 -28.945 1.00 0.00 ? 65  PHE C CG  2  
ATOM 10402  C CD1 . PHE B 2 61  ? -124.520 -32.508 -29.345 1.00 0.00 ? 65  PHE C CD1 2  
ATOM 10403  C CD2 . PHE B 2 61  ? -124.630 -34.433 -27.965 1.00 0.00 ? 65  PHE C CD2 2  
ATOM 10404  C CE1 . PHE B 2 61  ? -125.678 -32.018 -28.791 1.00 0.00 ? 65  PHE C CE1 2  
ATOM 10405  C CE2 . PHE B 2 61  ? -125.791 -33.936 -27.410 1.00 0.00 ? 65  PHE C CE2 2  
ATOM 10406  C CZ  . PHE B 2 61  ? -126.321 -32.738 -27.815 1.00 0.00 ? 65  PHE C CZ  2  
ATOM 10407  N N   . GLU B 2 62  ? -120.295 -34.157 -31.865 1.00 0.00 ? 66  GLU C N   2  
ATOM 10408  C CA  . GLU B 2 62  ? -119.232 -34.827 -32.616 1.00 0.00 ? 66  GLU C CA  2  
ATOM 10409  C C   . GLU B 2 62  ? -117.793 -34.406 -32.393 1.00 0.00 ? 66  GLU C C   2  
ATOM 10410  O O   . GLU B 2 62  ? -116.859 -35.199 -32.485 1.00 0.00 ? 66  GLU C O   2  
ATOM 10411  C CB  . GLU B 2 62  ? -119.559 -34.699 -34.087 1.00 0.00 ? 66  GLU C CB  2  
ATOM 10412  C CG  . GLU B 2 62  ? -120.750 -35.582 -34.409 1.00 0.00 ? 66  GLU C CG  2  
ATOM 10413  C CD  . GLU B 2 62  ? -121.479 -35.234 -35.692 1.00 0.00 ? 66  GLU C CD  2  
ATOM 10414  O OE1 . GLU B 2 62  ? -120.855 -35.122 -36.745 1.00 0.00 ? 66  GLU C OE1 2  
ATOM 10415  O OE2 . GLU B 2 62  ? -122.691 -35.054 -35.618 1.00 0.00 ? 66  GLU C OE2 2  
ATOM 10416  N N   . GLU B 2 63  ? -117.633 -33.134 -32.050 1.00 0.00 ? 67  GLU C N   2  
ATOM 10417  C CA  . GLU B 2 63  ? -116.322 -32.588 -31.762 1.00 0.00 ? 67  GLU C CA  2  
ATOM 10418  C C   . GLU B 2 63  ? -116.194 -32.130 -30.314 1.00 0.00 ? 67  GLU C C   2  
ATOM 10419  O O   . GLU B 2 63  ? -115.108 -32.082 -29.718 1.00 0.00 ? 67  GLU C O   2  
ATOM 10420  C CB  . GLU B 2 63  ? -116.140 -31.516 -32.790 1.00 0.00 ? 67  GLU C CB  2  
ATOM 10421  C CG  . GLU B 2 63  ? -115.882 -32.241 -34.110 1.00 0.00 ? 67  GLU C CG  2  
ATOM 10422  C CD  . GLU B 2 63  ? -116.074 -31.457 -35.388 1.00 0.00 ? 67  GLU C CD  2  
ATOM 10423  O OE1 . GLU B 2 63  ? -117.012 -30.666 -35.464 1.00 0.00 ? 67  GLU C OE1 2  
ATOM 10424  O OE2 . GLU B 2 63  ? -115.279 -31.656 -36.301 1.00 0.00 ? 67  GLU C OE2 2  
ATOM 10425  N N   . PHE B 2 64  ? -117.338 -31.885 -29.650 1.00 0.00 ? 68  PHE C N   2  
ATOM 10426  C CA  . PHE B 2 64  ? -117.338 -31.681 -28.205 1.00 0.00 ? 68  PHE C CA  2  
ATOM 10427  C C   . PHE B 2 64  ? -116.673 -32.801 -27.439 1.00 0.00 ? 68  PHE C C   2  
ATOM 10428  O O   . PHE B 2 64  ? -115.698 -32.548 -26.727 1.00 0.00 ? 68  PHE C O   2  
ATOM 10429  C CB  . PHE B 2 64  ? -118.721 -31.590 -27.567 1.00 0.00 ? 68  PHE C CB  2  
ATOM 10430  C CG  . PHE B 2 64  ? -119.436 -30.308 -27.878 1.00 0.00 ? 68  PHE C CG  2  
ATOM 10431  C CD1 . PHE B 2 64  ? -120.642 -30.378 -28.516 1.00 0.00 ? 68  PHE C CD1 2  
ATOM 10432  C CD2 . PHE B 2 64  ? -118.860 -29.099 -27.569 1.00 0.00 ? 68  PHE C CD2 2  
ATOM 10433  C CE1 . PHE B 2 64  ? -121.273 -29.217 -28.871 1.00 0.00 ? 68  PHE C CE1 2  
ATOM 10434  C CE2 . PHE B 2 64  ? -119.493 -27.940 -27.923 1.00 0.00 ? 68  PHE C CE2 2  
ATOM 10435  C CZ  . PHE B 2 64  ? -120.694 -28.016 -28.575 1.00 0.00 ? 68  PHE C CZ  2  
ATOM 10436  N N   . LEU B 2 65  ? -117.202 -33.993 -27.674 1.00 0.00 ? 69  LEU C N   2  
ATOM 10437  C CA  . LEU B 2 65  ? -116.776 -35.223 -27.037 1.00 0.00 ? 69  LEU C CA  2  
ATOM 10438  C C   . LEU B 2 65  ? -115.300 -35.592 -27.279 1.00 0.00 ? 69  LEU C C   2  
ATOM 10439  O O   . LEU B 2 65  ? -114.542 -35.610 -26.295 1.00 0.00 ? 69  LEU C O   2  
ATOM 10440  C CB  . LEU B 2 65  ? -117.796 -36.240 -27.538 1.00 0.00 ? 69  LEU C CB  2  
ATOM 10441  C CG  . LEU B 2 65  ? -119.235 -36.177 -27.022 1.00 0.00 ? 69  LEU C CG  2  
ATOM 10442  C CD1 . LEU B 2 65  ? -120.121 -37.039 -27.907 1.00 0.00 ? 69  LEU C CD1 2  
ATOM 10443  C CD2 . LEU B 2 65  ? -119.288 -36.645 -25.576 1.00 0.00 ? 69  LEU C CD2 2  
ATOM 10444  N N   . PRO B 2 66  ? -114.760 -35.703 -28.517 1.00 0.00 ? 70  PRO C N   2  
ATOM 10445  C CA  . PRO B 2 66  ? -113.300 -35.732 -28.683 1.00 0.00 ? 70  PRO C CA  2  
ATOM 10446  C C   . PRO B 2 66  ? -112.460 -34.626 -28.039 1.00 0.00 ? 70  PRO C C   2  
ATOM 10447  O O   . PRO B 2 66  ? -111.444 -34.942 -27.422 1.00 0.00 ? 70  PRO C O   2  
ATOM 10448  C CB  . PRO B 2 66  ? -113.057 -35.801 -30.168 1.00 0.00 ? 70  PRO C CB  2  
ATOM 10449  C CG  . PRO B 2 66  ? -114.359 -35.420 -30.776 1.00 0.00 ? 70  PRO C CG  2  
ATOM 10450  C CD  . PRO B 2 66  ? -115.303 -36.094 -29.814 1.00 0.00 ? 70  PRO C CD  2  
ATOM 10451  N N   . MET B 2 67  ? -112.789 -33.315 -28.093 1.00 0.00 ? 71  MET C N   2  
ATOM 10452  C CA  . MET B 2 67  ? -112.019 -32.303 -27.342 1.00 0.00 ? 71  MET C CA  2  
ATOM 10453  C C   . MET B 2 67  ? -111.968 -32.564 -25.831 1.00 0.00 ? 71  MET C C   2  
ATOM 10454  O O   . MET B 2 67  ? -110.939 -32.485 -25.158 1.00 0.00 ? 71  MET C O   2  
ATOM 10455  C CB  . MET B 2 67  ? -112.604 -30.916 -27.463 1.00 0.00 ? 71  MET C CB  2  
ATOM 10456  C CG  . MET B 2 67  ? -112.316 -30.126 -28.720 1.00 0.00 ? 71  MET C CG  2  
ATOM 10457  S SD  . MET B 2 67  ? -110.565 -29.823 -28.974 1.00 0.00 ? 71  MET C SD  2  
ATOM 10458  C CE  . MET B 2 67  ? -110.284 -28.561 -27.769 1.00 0.00 ? 71  MET C CE  2  
ATOM 10459  N N   . LEU B 2 68  ? -113.140 -32.891 -25.276 1.00 0.00 ? 72  LEU C N   2  
ATOM 10460  C CA  . LEU B 2 68  ? -113.264 -33.210 -23.856 1.00 0.00 ? 72  LEU C CA  2  
ATOM 10461  C C   . LEU B 2 68  ? -112.406 -34.401 -23.423 1.00 0.00 ? 72  LEU C C   2  
ATOM 10462  O O   . LEU B 2 68  ? -111.732 -34.388 -22.382 1.00 0.00 ? 72  LEU C O   2  
ATOM 10463  C CB  . LEU B 2 68  ? -114.705 -33.525 -23.503 1.00 0.00 ? 72  LEU C CB  2  
ATOM 10464  C CG  . LEU B 2 68  ? -115.769 -32.480 -23.758 1.00 0.00 ? 72  LEU C CG  2  
ATOM 10465  C CD1 . LEU B 2 68  ? -117.101 -33.129 -23.510 1.00 0.00 ? 72  LEU C CD1 2  
ATOM 10466  C CD2 . LEU B 2 68  ? -115.567 -31.249 -22.902 1.00 0.00 ? 72  LEU C CD2 2  
ATOM 10467  N N   . GLN B 2 69  ? -112.391 -35.461 -24.234 1.00 0.00 ? 73  GLN C N   2  
ATOM 10468  C CA  . GLN B 2 69  ? -111.490 -36.588 -24.005 1.00 0.00 ? 73  GLN C CA  2  
ATOM 10469  C C   . GLN B 2 69  ? -110.010 -36.196 -24.067 1.00 0.00 ? 73  GLN C C   2  
ATOM 10470  O O   . GLN B 2 69  ? -109.217 -36.567 -23.196 1.00 0.00 ? 73  GLN C O   2  
ATOM 10471  C CB  . GLN B 2 69  ? -111.712 -37.674 -25.027 1.00 0.00 ? 73  GLN C CB  2  
ATOM 10472  C CG  . GLN B 2 69  ? -113.040 -38.334 -24.780 1.00 0.00 ? 73  GLN C CG  2  
ATOM 10473  C CD  . GLN B 2 69  ? -113.085 -39.781 -25.223 1.00 0.00 ? 73  GLN C CD  2  
ATOM 10474  O OE1 . GLN B 2 69  ? -112.137 -40.393 -25.696 1.00 0.00 ? 73  GLN C OE1 2  
ATOM 10475  N NE2 . GLN B 2 69  ? -114.194 -40.448 -25.082 1.00 0.00 ? 73  GLN C NE2 2  
ATOM 10476  N N   . ALA B 2 70  ? -109.611 -35.388 -25.051 1.00 0.00 ? 74  ALA C N   2  
ATOM 10477  C CA  . ALA B 2 70  ? -108.250 -34.848 -25.114 1.00 0.00 ? 74  ALA C CA  2  
ATOM 10478  C C   . ALA B 2 70  ? -107.801 -34.182 -23.807 1.00 0.00 ? 74  ALA C C   2  
ATOM 10479  O O   . ALA B 2 70  ? -106.722 -34.460 -23.282 1.00 0.00 ? 74  ALA C O   2  
ATOM 10480  C CB  . ALA B 2 70  ? -108.143 -33.826 -26.231 1.00 0.00 ? 74  ALA C CB  2  
ATOM 10481  N N   . ALA B 2 71  ? -108.669 -33.345 -23.229 1.00 0.00 ? 75  ALA C N   2  
ATOM 10482  C CA  . ALA B 2 71  ? -108.429 -32.799 -21.895 1.00 0.00 ? 75  ALA C CA  2  
ATOM 10483  C C   . ALA B 2 71  ? -108.365 -33.906 -20.837 1.00 0.00 ? 75  ALA C C   2  
ATOM 10484  O O   . ALA B 2 71  ? -107.462 -33.913 -20.000 1.00 0.00 ? 75  ALA C O   2  
ATOM 10485  C CB  . ALA B 2 71  ? -109.548 -31.833 -21.523 1.00 0.00 ? 75  ALA C CB  2  
ATOM 10486  N N   . ALA B 2 72  ? -109.295 -34.884 -20.838 1.00 0.00 ? 76  ALA C N   2  
ATOM 10487  C CA  . ALA B 2 72  ? -109.283 -36.027 -19.908 1.00 0.00 ? 76  ALA C CA  2  
ATOM 10488  C C   . ALA B 2 72  ? -107.951 -36.748 -19.686 1.00 0.00 ? 76  ALA C C   2  
ATOM 10489  O O   . ALA B 2 72  ? -107.645 -37.128 -18.564 1.00 0.00 ? 76  ALA C O   2  
ATOM 10490  C CB  . ALA B 2 72  ? -110.297 -37.075 -20.340 1.00 0.00 ? 76  ALA C CB  2  
ATOM 10491  N N   . ASN B 2 73  ? -107.142 -36.840 -20.740 1.00 0.00 ? 77  ASN C N   2  
ATOM 10492  C CA  . ASN B 2 73  ? -105.789 -37.395 -20.663 1.00 0.00 ? 77  ASN C CA  2  
ATOM 10493  C C   . ASN B 2 73  ? -104.771 -36.654 -19.775 1.00 0.00 ? 77  ASN C C   2  
ATOM 10494  O O   . ASN B 2 73  ? -103.973 -37.272 -19.084 1.00 0.00 ? 77  ASN C O   2  
ATOM 10495  C CB  . ASN B 2 73  ? -105.170 -37.478 -22.048 1.00 0.00 ? 77  ASN C CB  2  
ATOM 10496  C CG  . ASN B 2 73  ? -106.041 -38.187 -23.070 1.00 0.00 ? 77  ASN C CG  2  
ATOM 10497  O OD1 . ASN B 2 73  ? -106.317 -39.374 -23.017 1.00 0.00 ? 77  ASN C OD1 2  
ATOM 10498  N ND2 . ASN B 2 73  ? -106.552 -37.504 -24.062 1.00 0.00 ? 77  ASN C ND2 2  
ATOM 10499  N N   . ASN B 2 74  ? -104.733 -35.317 -19.761 1.00 0.00 ? 78  ASN C N   2  
ATOM 10500  C CA  . ASN B 2 74  ? -103.760 -34.578 -18.940 1.00 0.00 ? 78  ASN C CA  2  
ATOM 10501  C C   . ASN B 2 74  ? -104.148 -34.355 -17.476 1.00 0.00 ? 78  ASN C C   2  
ATOM 10502  O O   . ASN B 2 74  ? -103.362 -33.921 -16.625 1.00 0.00 ? 78  ASN C O   2  
ATOM 10503  C CB  . ASN B 2 74  ? -103.496 -33.197 -19.531 1.00 0.00 ? 78  ASN C CB  2  
ATOM 10504  C CG  . ASN B 2 74  ? -103.055 -33.218 -20.981 1.00 0.00 ? 78  ASN C CG  2  
ATOM 10505  O OD1 . ASN B 2 74  ? -102.045 -33.781 -21.369 1.00 0.00 ? 78  ASN C OD1 2  
ATOM 10506  N ND2 . ASN B 2 74  ? -103.777 -32.620 -21.896 1.00 0.00 ? 78  ASN C ND2 2  
ATOM 10507  N N   . LYS B 2 75  ? -105.394 -34.675 -17.149 1.00 0.00 ? 79  LYS C N   2  
ATOM 10508  C CA  . LYS B 2 75  ? -105.953 -34.371 -15.842 1.00 0.00 ? 79  LYS C CA  2  
ATOM 10509  C C   . LYS B 2 75  ? -105.396 -35.027 -14.569 1.00 0.00 ? 79  LYS C C   2  
ATOM 10510  O O   . LYS B 2 75  ? -105.773 -34.632 -13.457 1.00 0.00 ? 79  LYS C O   2  
ATOM 10511  C CB  . LYS B 2 75  ? -107.448 -34.592 -15.989 1.00 0.00 ? 79  LYS C CB  2  
ATOM 10512  C CG  . LYS B 2 75  ? -108.079 -33.468 -16.826 1.00 0.00 ? 79  LYS C CG  2  
ATOM 10513  C CD  . LYS B 2 75  ? -109.415 -33.965 -17.334 1.00 0.00 ? 79  LYS C CD  2  
ATOM 10514  C CE  . LYS B 2 75  ? -110.332 -32.985 -18.054 1.00 0.00 ? 79  LYS C CE  2  
ATOM 10515  N NZ  . LYS B 2 75  ? -111.587 -33.654 -18.364 1.00 0.00 ? 79  LYS C NZ  2  
ATOM 10516  N N   . ASP B 2 76  ? -104.409 -35.928 -14.667 1.00 0.00 ? 80  ASP C N   2  
ATOM 10517  C CA  . ASP B 2 76  ? -103.642 -36.467 -13.530 1.00 0.00 ? 80  ASP C CA  2  
ATOM 10518  C C   . ASP B 2 76  ? -103.123 -35.384 -12.563 1.00 0.00 ? 80  ASP C C   2  
ATOM 10519  O O   . ASP B 2 76  ? -103.058 -35.514 -11.338 1.00 0.00 ? 80  ASP C O   2  
ATOM 10520  C CB  . ASP B 2 76  ? -102.463 -37.266 -14.082 1.00 0.00 ? 80  ASP C CB  2  
ATOM 10521  C CG  . ASP B 2 76  ? -102.811 -38.501 -14.905 1.00 0.00 ? 80  ASP C CG  2  
ATOM 10522  O OD1 . ASP B 2 76  ? -103.886 -38.555 -15.505 1.00 0.00 ? 80  ASP C OD1 2  
ATOM 10523  O OD2 . ASP B 2 76  ? -101.989 -39.410 -14.947 1.00 0.00 ? 80  ASP C OD2 2  
ATOM 10524  N N   . GLN B 2 77  ? -102.857 -34.186 -13.119 1.00 0.00 ? 81  GLN C N   2  
ATOM 10525  C CA  . GLN B 2 77  ? -102.499 -32.985 -12.350 1.00 0.00 ? 81  GLN C CA  2  
ATOM 10526  C C   . GLN B 2 77  ? -103.530 -32.545 -11.284 1.00 0.00 ? 81  GLN C C   2  
ATOM 10527  O O   . GLN B 2 77  ? -103.386 -31.546 -10.563 1.00 0.00 ? 81  GLN C O   2  
ATOM 10528  C CB  . GLN B 2 77  ? -102.293 -31.816 -13.298 1.00 0.00 ? 81  GLN C CB  2  
ATOM 10529  C CG  . GLN B 2 77  ? -101.184 -31.923 -14.338 1.00 0.00 ? 81  GLN C CG  2  
ATOM 10530  C CD  . GLN B 2 77  ? -101.099 -30.657 -15.184 1.00 0.00 ? 81  GLN C CD  2  
ATOM 10531  O OE1 . GLN B 2 77  ? -101.335 -29.554 -14.716 1.00 0.00 ? 81  GLN C OE1 2  
ATOM 10532  N NE2 . GLN B 2 77  ? -100.744 -30.675 -16.447 1.00 0.00 ? 81  GLN C NE2 2  
ATOM 10533  N N   . GLY B 2 78  ? -104.671 -33.236 -11.196 1.00 0.00 ? 82  GLY C N   2  
ATOM 10534  C CA  . GLY B 2 78  ? -105.661 -33.063 -10.134 1.00 0.00 ? 82  GLY C CA  2  
ATOM 10535  C C   . GLY B 2 78  ? -105.108 -33.376 -8.738  1.00 0.00 ? 82  GLY C C   2  
ATOM 10536  O O   . GLY B 2 78  ? -105.725 -33.022 -7.729  1.00 0.00 ? 82  GLY C O   2  
ATOM 10537  N N   . THR B 2 79  ? -103.927 -33.997 -8.646  1.00 0.00 ? 83  THR C N   2  
ATOM 10538  C CA  . THR B 2 79  ? -103.195 -34.266 -7.396  1.00 0.00 ? 83  THR C CA  2  
ATOM 10539  C C   . THR B 2 79  ? -103.176 -33.092 -6.417  1.00 0.00 ? 83  THR C C   2  
ATOM 10540  O O   . THR B 2 79  ? -102.755 -31.975 -6.720  1.00 0.00 ? 83  THR C O   2  
ATOM 10541  C CB  . THR B 2 79  ? -101.727 -34.628 -7.680  1.00 0.00 ? 83  THR C CB  2  
ATOM 10542  O OG1 . THR B 2 79  ? -101.254 -33.662 -8.616  1.00 0.00 ? 83  THR C OG1 2  
ATOM 10543  C CG2 . THR B 2 79  ? -101.562 -36.043 -8.211  1.00 0.00 ? 83  THR C CG2 2  
ATOM 10544  N N   . PHE B 2 80  ? -103.722 -33.254 -5.219  1.00 0.00 ? 84  PHE C N   2  
ATOM 10545  C CA  . PHE B 2 80  ? -103.819 -32.150 -4.265  1.00 0.00 ? 84  PHE C CA  2  
ATOM 10546  C C   . PHE B 2 80  ? -102.533 -31.804 -3.527  1.00 0.00 ? 84  PHE C C   2  
ATOM 10547  O O   . PHE B 2 80  ? -102.409 -30.669 -3.075  1.00 0.00 ? 84  PHE C O   2  
ATOM 10548  C CB  . PHE B 2 80  ? -104.836 -32.408 -3.156  1.00 0.00 ? 84  PHE C CB  2  
ATOM 10549  C CG  . PHE B 2 80  ? -106.269 -32.785 -3.510  1.00 0.00 ? 84  PHE C CG  2  
ATOM 10550  C CD1 . PHE B 2 80  ? -106.583 -33.581 -4.599  1.00 0.00 ? 84  PHE C CD1 2  
ATOM 10551  C CD2 . PHE B 2 80  ? -107.274 -32.354 -2.663  1.00 0.00 ? 84  PHE C CD2 2  
ATOM 10552  C CE1 . PHE B 2 80  ? -107.888 -33.950 -4.830  1.00 0.00 ? 84  PHE C CE1 2  
ATOM 10553  C CE2 . PHE B 2 80  ? -108.575 -32.733 -2.903  1.00 0.00 ? 84  PHE C CE2 2  
ATOM 10554  C CZ  . PHE B 2 80  ? -108.886 -33.528 -3.984  1.00 0.00 ? 84  PHE C CZ  2  
ATOM 10555  N N   . GLU B 2 81  ? -101.587 -32.743 -3.453  1.00 0.00 ? 85  GLU C N   2  
ATOM 10556  C CA  . GLU B 2 81  ? -100.325 -32.611 -2.706  1.00 0.00 ? 85  GLU C CA  2  
ATOM 10557  C C   . GLU B 2 81  ? -99.670  -31.223 -2.755  1.00 0.00 ? 85  GLU C C   2  
ATOM 10558  O O   . GLU B 2 81  ? -99.816  -30.419 -1.825  1.00 0.00 ? 85  GLU C O   2  
ATOM 10559  C CB  . GLU B 2 81  ? -99.421  -33.724 -3.241  1.00 0.00 ? 85  GLU C CB  2  
ATOM 10560  C CG  . GLU B 2 81  ? -99.975  -35.075 -2.773  1.00 0.00 ? 85  GLU C CG  2  
ATOM 10561  C CD  . GLU B 2 81  ? -99.843  -36.221 -3.763  1.00 0.00 ? 85  GLU C CD  2  
ATOM 10562  O OE1 . GLU B 2 81  ? -98.727  -36.663 -4.020  1.00 0.00 ? 85  GLU C OE1 2  
ATOM 10563  O OE2 . GLU B 2 81  ? -100.876 -36.655 -4.268  1.00 0.00 ? 85  GLU C OE2 2  
ATOM 10564  N N   . ASP B 2 82  ? -99.211  -30.804 -3.930  1.00 0.00 ? 86  ASP C N   2  
ATOM 10565  C CA  . ASP B 2 82  ? -98.630  -29.479 -4.144  1.00 0.00 ? 86  ASP C CA  2  
ATOM 10566  C C   . ASP B 2 82  ? -99.550  -28.277 -3.826  1.00 0.00 ? 86  ASP C C   2  
ATOM 10567  O O   . ASP B 2 82  ? -99.143  -27.179 -3.432  1.00 0.00 ? 86  ASP C O   2  
ATOM 10568  C CB  . ASP B 2 82  ? -98.192  -29.364 -5.609  1.00 0.00 ? 86  ASP C CB  2  
ATOM 10569  C CG  . ASP B 2 82  ? -97.353  -30.506 -6.166  1.00 0.00 ? 86  ASP C CG  2  
ATOM 10570  O OD1 . ASP B 2 82  ? -97.848  -31.632 -6.209  1.00 0.00 ? 86  ASP C OD1 2  
ATOM 10571  O OD2 . ASP B 2 82  ? -96.230  -30.261 -6.594  1.00 0.00 ? 86  ASP C OD2 2  
ATOM 10572  N N   . PHE B 2 83  ? -100.869 -28.472 -3.863  1.00 0.00 ? 87  PHE C N   2  
ATOM 10573  C CA  . PHE B 2 83  ? -101.819 -27.361 -3.802  1.00 0.00 ? 87  PHE C CA  2  
ATOM 10574  C C   . PHE B 2 83  ? -102.445 -26.885 -2.500  1.00 0.00 ? 87  PHE C C   2  
ATOM 10575  O O   . PHE B 2 83  ? -103.371 -26.080 -2.472  1.00 0.00 ? 87  PHE C O   2  
ATOM 10576  C CB  . PHE B 2 83  ? -102.876 -27.689 -4.862  1.00 0.00 ? 87  PHE C CB  2  
ATOM 10577  C CG  . PHE B 2 83  ? -102.149 -27.686 -6.201  1.00 0.00 ? 87  PHE C CG  2  
ATOM 10578  C CD1 . PHE B 2 83  ? -101.799 -28.874 -6.806  1.00 0.00 ? 87  PHE C CD1 2  
ATOM 10579  C CD2 . PHE B 2 83  ? -101.763 -26.482 -6.761  1.00 0.00 ? 87  PHE C CD2 2  
ATOM 10580  C CE1 . PHE B 2 83  ? -101.064 -28.866 -7.970  1.00 0.00 ? 87  PHE C CE1 2  
ATOM 10581  C CE2 . PHE B 2 83  ? -101.024 -26.490 -7.922  1.00 0.00 ? 87  PHE C CE2 2  
ATOM 10582  C CZ  . PHE B 2 83  ? -100.671 -27.674 -8.525  1.00 0.00 ? 87  PHE C CZ  2  
ATOM 10583  N N   . VAL B 2 84  ? -101.923 -27.401 -1.389  1.00 0.00 ? 88  VAL C N   2  
ATOM 10584  C CA  . VAL B 2 84  ? -102.182 -26.846 -0.059  1.00 0.00 ? 88  VAL C CA  2  
ATOM 10585  C C   . VAL B 2 84  ? -100.837 -26.193 0.315   1.00 0.00 ? 88  VAL C C   2  
ATOM 10586  O O   . VAL B 2 84  ? -100.724 -25.075 0.834   1.00 0.00 ? 88  VAL C O   2  
ATOM 10587  C CB  . VAL B 2 84  ? -102.521 -27.936 0.994   1.00 0.00 ? 88  VAL C CB  2  
ATOM 10588  C CG1 . VAL B 2 84  ? -102.760 -27.269 2.350   1.00 0.00 ? 88  VAL C CG1 2  
ATOM 10589  C CG2 . VAL B 2 84  ? -103.752 -28.717 0.587   1.00 0.00 ? 88  VAL C CG2 2  
ATOM 10590  N N   . GLU B 2 85  ? -99.758  -26.913 -0.004  1.00 0.00 ? 89  GLU C N   2  
ATOM 10591  C CA  . GLU B 2 85  ? -98.379  -26.468 0.195   1.00 0.00 ? 89  GLU C CA  2  
ATOM 10592  C C   . GLU B 2 85  ? -97.993  -25.149 -0.481  1.00 0.00 ? 89  GLU C C   2  
ATOM 10593  O O   . GLU B 2 85  ? -97.448  -24.237 0.161   1.00 0.00 ? 89  GLU C O   2  
ATOM 10594  C CB  . GLU B 2 85  ? -97.434  -27.547 -0.296  1.00 0.00 ? 89  GLU C CB  2  
ATOM 10595  C CG  . GLU B 2 85  ? -97.551  -28.831 0.511   1.00 0.00 ? 89  GLU C CG  2  
ATOM 10596  C CD  . GLU B 2 85  ? -96.587  -29.953 0.135   1.00 0.00 ? 89  GLU C CD  2  
ATOM 10597  O OE1 . GLU B 2 85  ? -95.582  -29.706 -0.531  1.00 0.00 ? 89  GLU C OE1 2  
ATOM 10598  O OE2 . GLU B 2 85  ? -96.839  -31.079 0.550   1.00 0.00 ? 89  GLU C OE2 2  
ATOM 10599  N N   . GLY B 2 86  ? -98.312  -25.003 -1.771  1.00 0.00 ? 90  GLY C N   2  
ATOM 10600  C CA  . GLY B 2 86  ? -98.087  -23.772 -2.531  1.00 0.00 ? 90  GLY C CA  2  
ATOM 10601  C C   . GLY B 2 86  ? -98.727  -22.553 -1.895  1.00 0.00 ? 90  GLY C C   2  
ATOM 10602  O O   . GLY B 2 86  ? -98.143  -21.473 -1.812  1.00 0.00 ? 90  GLY C O   2  
ATOM 10603  N N   . LEU B 2 87  ? -99.930  -22.777 -1.367  1.00 0.00 ? 91  LEU C N   2  
ATOM 10604  C CA  . LEU B 2 87  ? -100.629 -21.758 -0.617  1.00 0.00 ? 91  LEU C CA  2  
ATOM 10605  C C   . LEU B 2 87  ? -99.846  -21.416 0.645   1.00 0.00 ? 91  LEU C C   2  
ATOM 10606  O O   . LEU B 2 87  ? -99.395  -20.289 0.727   1.00 0.00 ? 91  LEU C O   2  
ATOM 10607  C CB  . LEU B 2 87  ? -102.025 -22.290 -0.347  1.00 0.00 ? 91  LEU C CB  2  
ATOM 10608  C CG  . LEU B 2 87  ? -103.005 -22.278 -1.517  1.00 0.00 ? 91  LEU C CG  2  
ATOM 10609  C CD1 . LEU B 2 87  ? -104.399 -22.532 -0.983  1.00 0.00 ? 91  LEU C CD1 2  
ATOM 10610  C CD2 . LEU B 2 87  ? -103.020 -20.920 -2.210  1.00 0.00 ? 91  LEU C CD2 2  
ATOM 10611  N N   . ARG B 2 88  ? -99.528  -22.314 1.590   1.00 0.00 ? 92  ARG C N   2  
ATOM 10612  C CA  . ARG B 2 88  ? -98.684  -21.985 2.760   1.00 0.00 ? 92  ARG C CA  2  
ATOM 10613  C C   . ARG B 2 88  ? -97.419  -21.149 2.473   1.00 0.00 ? 92  ARG C C   2  
ATOM 10614  O O   . ARG B 2 88  ? -96.865  -20.483 3.341   1.00 0.00 ? 92  ARG C O   2  
ATOM 10615  C CB  . ARG B 2 88  ? -98.255  -23.271 3.460   1.00 0.00 ? 92  ARG C CB  2  
ATOM 10616  C CG  . ARG B 2 88  ? -99.356  -24.102 4.113   1.00 0.00 ? 92  ARG C CG  2  
ATOM 10617  C CD  . ARG B 2 88  ? -98.733  -25.386 4.659   1.00 0.00 ? 92  ARG C CD  2  
ATOM 10618  N NE  . ARG B 2 88  ? -99.686  -26.240 5.351   1.00 0.00 ? 92  ARG C NE  2  
ATOM 10619  C CZ  . ARG B 2 88  ? -99.380  -27.448 5.795   1.00 0.00 ? 92  ARG C CZ  2  
ATOM 10620  N NH1 . ARG B 2 88  ? -98.203  -27.988 5.612   1.00 0.00 ? 92  ARG C NH1 2  
ATOM 10621  N NH2 . ARG B 2 88  ? -100.272 -28.135 6.435   1.00 0.00 ? 92  ARG C NH2 2  
ATOM 10622  N N   . VAL B 2 89  ? -96.855  -21.206 1.265   1.00 0.00 ? 93  VAL C N   2  
ATOM 10623  C CA  . VAL B 2 89  ? -95.709  -20.380 0.877   1.00 0.00 ? 93  VAL C CA  2  
ATOM 10624  C C   . VAL B 2 89  ? -95.978  -18.871 0.830   1.00 0.00 ? 93  VAL C C   2  
ATOM 10625  O O   . VAL B 2 89  ? -95.062  -18.089 1.092   1.00 0.00 ? 93  VAL C O   2  
ATOM 10626  C CB  . VAL B 2 89  ? -95.209  -20.930 -0.484  1.00 0.00 ? 93  VAL C CB  2  
ATOM 10627  C CG1 . VAL B 2 89  ? -94.142  -20.062 -1.143  1.00 0.00 ? 93  VAL C CG1 2  
ATOM 10628  C CG2 . VAL B 2 89  ? -94.640  -22.309 -0.203  1.00 0.00 ? 93  VAL C CG2 2  
ATOM 10629  N N   . PHE B 2 90  ? -97.209  -18.427 0.569   1.00 0.00 ? 94  PHE C N   2  
ATOM 10630  C CA  . PHE B 2 90  ? -97.511  -17.004 0.551   1.00 0.00 ? 94  PHE C CA  2  
ATOM 10631  C C   . PHE B 2 90  ? -97.551  -16.422 1.984   1.00 0.00 ? 94  PHE C C   2  
ATOM 10632  O O   . PHE B 2 90  ? -96.705  -15.589 2.310   1.00 0.00 ? 94  PHE C O   2  
ATOM 10633  C CB  . PHE B 2 90  ? -98.846  -16.798 -0.183  1.00 0.00 ? 94  PHE C CB  2  
ATOM 10634  C CG  . PHE B 2 90  ? -98.837  -17.257 -1.639  1.00 0.00 ? 94  PHE C CG  2  
ATOM 10635  C CD1 . PHE B 2 90  ? -99.425  -18.455 -2.001  1.00 0.00 ? 94  PHE C CD1 2  
ATOM 10636  C CD2 . PHE B 2 90  ? -98.228  -16.473 -2.603  1.00 0.00 ? 94  PHE C CD2 2  
ATOM 10637  C CE1 . PHE B 2 90  ? -99.402  -18.865 -3.318  1.00 0.00 ? 94  PHE C CE1 2  
ATOM 10638  C CE2 . PHE B 2 90  ? -98.214  -16.892 -3.917  1.00 0.00 ? 94  PHE C CE2 2  
ATOM 10639  C CZ  . PHE B 2 90  ? -98.799  -18.086 -4.277  1.00 0.00 ? 94  PHE C CZ  2  
ATOM 10640  N N   . ASP B 2 91  ? -98.399  -16.907 2.900   1.00 0.00 ? 95  ASP C N   2  
ATOM 10641  C CA  . ASP B 2 91  ? -98.452  -16.351 4.261   1.00 0.00 ? 95  ASP C CA  2  
ATOM 10642  C C   . ASP B 2 91  ? -98.080  -17.237 5.492   1.00 0.00 ? 95  ASP C C   2  
ATOM 10643  O O   . ASP B 2 91  ? -98.761  -17.307 6.526   1.00 0.00 ? 95  ASP C O   2  
ATOM 10644  C CB  . ASP B 2 91  ? -99.857  -15.773 4.436   1.00 0.00 ? 95  ASP C CB  2  
ATOM 10645  C CG  . ASP B 2 91  ? -100.500 -14.964 3.317   1.00 0.00 ? 95  ASP C CG  2  
ATOM 10646  O OD1 . ASP B 2 91  ? -100.663 -15.446 2.199   1.00 0.00 ? 95  ASP C OD1 2  
ATOM 10647  O OD2 . ASP B 2 91  ? -100.976 -13.877 3.600   1.00 0.00 ? 95  ASP C OD2 2  
ATOM 10648  N N   . LYS B 2 92  ? -96.982  -18.004 5.467   1.00 0.00 ? 96  LYS C N   2  
ATOM 10649  C CA  . LYS B 2 92  ? -96.520  -18.860 6.583   1.00 0.00 ? 96  LYS C CA  2  
ATOM 10650  C C   . LYS B 2 92  ? -96.094  -18.314 7.970   1.00 0.00 ? 96  LYS C C   2  
ATOM 10651  O O   . LYS B 2 92  ? -94.898  -18.130 8.238   1.00 0.00 ? 96  LYS C O   2  
ATOM 10652  C CB  . LYS B 2 92  ? -95.354  -19.704 6.068   1.00 0.00 ? 96  LYS C CB  2  
ATOM 10653  C CG  . LYS B 2 92  ? -95.506  -21.208 5.929   1.00 0.00 ? 96  LYS C CG  2  
ATOM 10654  C CD  . LYS B 2 92  ? -94.299  -21.614 5.093   1.00 0.00 ? 96  LYS C CD  2  
ATOM 10655  C CE  . LYS B 2 92  ? -94.639  -22.727 4.119   1.00 0.00 ? 96  LYS C CE  2  
ATOM 10656  N NZ  . LYS B 2 92  ? -93.715  -22.733 3.004   1.00 0.00 ? 96  LYS C NZ  2  
ATOM 10657  N N   . GLU B 2 93  ? -97.013  -18.144 8.924   1.00 0.00 ? 97  GLU C N   2  
ATOM 10658  C CA  . GLU B 2 93  ? -96.690  -17.650 10.275  1.00 0.00 ? 97  GLU C CA  2  
ATOM 10659  C C   . GLU B 2 93  ? -97.355  -18.475 11.400  1.00 0.00 ? 97  GLU C C   2  
ATOM 10660  O O   . GLU B 2 93  ? -98.037  -18.004 12.312  1.00 0.00 ? 97  GLU C O   2  
ATOM 10661  C CB  . GLU B 2 93  ? -97.116  -16.181 10.369  1.00 0.00 ? 97  GLU C CB  2  
ATOM 10662  C CG  . GLU B 2 93  ? -96.257  -15.213 9.541   1.00 0.00 ? 97  GLU C CG  2  
ATOM 10663  C CD  . GLU B 2 93  ? -96.811  -13.804 9.314   1.00 0.00 ? 97  GLU C CD  2  
ATOM 10664  O OE1 . GLU B 2 93  ? -97.899  -13.476 9.782   1.00 0.00 ? 97  GLU C OE1 2  
ATOM 10665  O OE2 . GLU B 2 93  ? -96.130  -13.022 8.654   1.00 0.00 ? 97  GLU C OE2 2  
ATOM 10666  N N   . GLY B 2 94  ? -97.146  -19.789 11.368  1.00 0.00 ? 98  GLY C N   2  
ATOM 10667  C CA  . GLY B 2 94  ? -97.752  -20.707 12.331  1.00 0.00 ? 98  GLY C CA  2  
ATOM 10668  C C   . GLY B 2 94  ? -98.676  -21.721 11.657  1.00 0.00 ? 98  GLY C C   2  
ATOM 10669  O O   . GLY B 2 94  ? -98.211  -22.652 11.004  1.00 0.00 ? 98  GLY C O   2  
ATOM 10670  N N   . ASN B 2 95  ? -99.997  -21.570 11.781  1.00 0.00 ? 99  ASN C N   2  
ATOM 10671  C CA  . ASN B 2 95  ? -100.942 -22.463 11.096  1.00 0.00 ? 99  ASN C CA  2  
ATOM 10672  C C   . ASN B 2 95  ? -101.099 -22.167 9.597   1.00 0.00 ? 99  ASN C C   2  
ATOM 10673  O O   . ASN B 2 95  ? -100.317 -21.384 9.062   1.00 0.00 ? 99  ASN C O   2  
ATOM 10674  C CB  . ASN B 2 95  ? -102.298 -22.358 11.789  1.00 0.00 ? 99  ASN C CB  2  
ATOM 10675  C CG  . ASN B 2 95  ? -102.266 -22.997 13.165  1.00 0.00 ? 99  ASN C CG  2  
ATOM 10676  O OD1 . ASN B 2 95  ? -102.010 -24.173 13.320  1.00 0.00 ? 99  ASN C OD1 2  
ATOM 10677  N ND2 . ASN B 2 95  ? -102.494 -22.353 14.285  1.00 0.00 ? 99  ASN C ND2 2  
ATOM 10678  N N   . GLY B 2 96  ? -102.032 -22.743 8.830   1.00 0.00 ? 100 GLY C N   2  
ATOM 10679  C CA  . GLY B 2 96  ? -102.233 -22.326 7.431   1.00 0.00 ? 100 GLY C CA  2  
ATOM 10680  C C   . GLY B 2 96  ? -102.840 -20.923 7.287   1.00 0.00 ? 100 GLY C C   2  
ATOM 10681  O O   . GLY B 2 96  ? -103.931 -20.739 6.747   1.00 0.00 ? 100 GLY C O   2  
ATOM 10682  N N   . THR B 2 97  ? -102.104 -19.913 7.727   1.00 0.00 ? 101 THR C N   2  
ATOM 10683  C CA  . THR B 2 97  ? -102.515 -18.511 7.754   1.00 0.00 ? 101 THR C CA  2  
ATOM 10684  C C   . THR B 2 97  ? -102.386 -17.802 6.424   1.00 0.00 ? 101 THR C C   2  
ATOM 10685  O O   . THR B 2 97  ? -101.384 -17.971 5.746   1.00 0.00 ? 101 THR C O   2  
ATOM 10686  C CB  . THR B 2 97  ? -101.672 -17.729 8.789   1.00 0.00 ? 101 THR C CB  2  
ATOM 10687  O OG1 . THR B 2 97  ? -100.325 -18.202 8.723   1.00 0.00 ? 101 THR C OG1 2  
ATOM 10688  C CG2 . THR B 2 97  ? -102.220 -17.915 10.196  1.00 0.00 ? 101 THR C CG2 2  
ATOM 10689  N N   . VAL B 2 98  ? -103.423 -17.113 5.968   1.00 0.00 ? 102 VAL C N   2  
ATOM 10690  C CA  . VAL B 2 98  ? -103.388 -16.275 4.755   1.00 0.00 ? 102 VAL C CA  2  
ATOM 10691  C C   . VAL B 2 98  ? -103.873 -14.860 5.065   1.00 0.00 ? 102 VAL C C   2  
ATOM 10692  O O   . VAL B 2 98  ? -104.541 -14.664 6.074   1.00 0.00 ? 102 VAL C O   2  
ATOM 10693  C CB  . VAL B 2 98  ? -104.353 -16.666 3.616   1.00 0.00 ? 102 VAL C CB  2  
ATOM 10694  C CG1 . VAL B 2 98  ? -103.696 -16.326 2.312   1.00 0.00 ? 102 VAL C CG1 2  
ATOM 10695  C CG2 . VAL B 2 98  ? -104.811 -18.088 3.726   1.00 0.00 ? 102 VAL C CG2 2  
ATOM 10696  N N   . MET B 2 99  ? -103.661 -13.855 4.235   1.00 0.00 ? 103 MET C N   2  
ATOM 10697  C CA  . MET B 2 99  ? -104.363 -12.593 4.368   1.00 0.00 ? 103 MET C CA  2  
ATOM 10698  C C   . MET B 2 99  ? -105.243 -12.389 3.144   1.00 0.00 ? 103 MET C C   2  
ATOM 10699  O O   . MET B 2 99  ? -104.855 -12.670 2.001   1.00 0.00 ? 103 MET C O   2  
ATOM 10700  C CB  . MET B 2 99  ? -103.395 -11.427 4.478   1.00 0.00 ? 103 MET C CB  2  
ATOM 10701  C CG  . MET B 2 99  ? -102.691 -11.395 5.825   1.00 0.00 ? 103 MET C CG  2  
ATOM 10702  S SD  . MET B 2 99  ? -103.863 -11.371 7.200   1.00 0.00 ? 103 MET C SD  2  
ATOM 10703  C CE  . MET B 2 99  ? -104.191 -9.635  7.313   1.00 0.00 ? 103 MET C CE  2  
ATOM 10704  N N   . GLY B 2 100 ? -106.490 -11.944 3.348   1.00 0.00 ? 104 GLY C N   2  
ATOM 10705  C CA  . GLY B 2 100 ? -107.440 -11.702 2.258   1.00 0.00 ? 104 GLY C CA  2  
ATOM 10706  C C   . GLY B 2 100 ? -106.839 -10.991 1.042   1.00 0.00 ? 104 GLY C C   2  
ATOM 10707  O O   . GLY B 2 100 ? -106.804 -11.483 -0.083  1.00 0.00 ? 104 GLY C O   2  
ATOM 10708  N N   . ALA B 2 101 ? -106.246 -9.829  1.307   1.00 0.00 ? 105 ALA C N   2  
ATOM 10709  C CA  . ALA B 2 101 ? -105.576 -9.023  0.291   1.00 0.00 ? 105 ALA C CA  2  
ATOM 10710  C C   . ALA B 2 101 ? -104.562 -9.716  -0.617  1.00 0.00 ? 105 ALA C C   2  
ATOM 10711  O O   . ALA B 2 101 ? -104.582 -9.487  -1.833  1.00 0.00 ? 105 ALA C O   2  
ATOM 10712  C CB  . ALA B 2 101 ? -104.859 -7.883  0.968   1.00 0.00 ? 105 ALA C CB  2  
ATOM 10713  N N   . GLU B 2 102 ? -103.717 -10.568 -0.048  1.00 0.00 ? 106 GLU C N   2  
ATOM 10714  C CA  . GLU B 2 102 ? -102.716 -11.301 -0.804  1.00 0.00 ? 106 GLU C CA  2  
ATOM 10715  C C   . GLU B 2 102 ? -103.353 -12.314 -1.746  1.00 0.00 ? 106 GLU C C   2  
ATOM 10716  O O   . GLU B 2 102 ? -103.196 -12.132 -2.956  1.00 0.00 ? 106 GLU C O   2  
ATOM 10717  C CB  . GLU B 2 102 ? -101.770 -11.924 0.219   1.00 0.00 ? 106 GLU C CB  2  
ATOM 10718  C CG  . GLU B 2 102 ? -100.989 -10.691 0.680   1.00 0.00 ? 106 GLU C CG  2  
ATOM 10719  C CD  . GLU B 2 102 ? -100.137 -10.773 1.933   1.00 0.00 ? 106 GLU C CD  2  
ATOM 10720  O OE1 . GLU B 2 102 ? -99.005  -11.242 1.839   1.00 0.00 ? 106 GLU C OE1 2  
ATOM 10721  O OE2 . GLU B 2 102 ? -100.584 -10.275 2.962   1.00 0.00 ? 106 GLU C OE2 2  
ATOM 10722  N N   . LEU B 2 103 ? -104.200 -13.260 -1.312  1.00 0.00 ? 107 LEU C N   2  
ATOM 10723  C CA  . LEU B 2 103 ? -104.882 -14.145 -2.270  1.00 0.00 ? 107 LEU C CA  2  
ATOM 10724  C C   . LEU B 2 103 ? -105.748 -13.392 -3.290  1.00 0.00 ? 107 LEU C C   2  
ATOM 10725  O O   . LEU B 2 103 ? -105.618 -13.632 -4.487  1.00 0.00 ? 107 LEU C O   2  
ATOM 10726  C CB  . LEU B 2 103 ? -105.794 -15.160 -1.579  1.00 0.00 ? 107 LEU C CB  2  
ATOM 10727  C CG  . LEU B 2 103 ? -105.185 -16.347 -0.845  1.00 0.00 ? 107 LEU C CG  2  
ATOM 10728  C CD1 . LEU B 2 103 ? -106.287 -17.345 -0.553  1.00 0.00 ? 107 LEU C CD1 2  
ATOM 10729  C CD2 . LEU B 2 103 ? -104.124 -17.037 -1.695  1.00 0.00 ? 107 LEU C CD2 2  
ATOM 10730  N N   . ARG B 2 104 ? -106.550 -12.399 -2.872  1.00 0.00 ? 108 ARG C N   2  
ATOM 10731  C CA  . ARG B 2 104 ? -107.359 -11.577 -3.784  1.00 0.00 ? 108 ARG C CA  2  
ATOM 10732  C C   . ARG B 2 104 ? -106.591 -10.940 -4.939  1.00 0.00 ? 108 ARG C C   2  
ATOM 10733  O O   . ARG B 2 104 ? -106.962 -11.075 -6.099  1.00 0.00 ? 108 ARG C O   2  
ATOM 10734  C CB  . ARG B 2 104 ? -108.042 -10.436 -3.032  1.00 0.00 ? 108 ARG C CB  2  
ATOM 10735  C CG  . ARG B 2 104 ? -109.057 -10.913 -2.019  1.00 0.00 ? 108 ARG C CG  2  
ATOM 10736  C CD  . ARG B 2 104 ? -109.495 -9.813  -1.066  1.00 0.00 ? 108 ARG C CD  2  
ATOM 10737  N NE  . ARG B 2 104 ? -110.037 -10.387 0.164   1.00 0.00 ? 108 ARG C NE  2  
ATOM 10738  C CZ  . ARG B 2 104 ? -110.549 -9.689  1.150   1.00 0.00 ? 108 ARG C CZ  2  
ATOM 10739  N NH1 . ARG B 2 104 ? -110.636 -8.388  1.098   1.00 0.00 ? 108 ARG C NH1 2  
ATOM 10740  N NH2 . ARG B 2 104 ? -110.983 -10.304 2.203   1.00 0.00 ? 108 ARG C NH2 2  
ATOM 10741  N N   . HIS B 2 105 ? -105.492 -10.223 -4.672  1.00 0.00 ? 109 HIS C N   2  
ATOM 10742  C CA  . HIS B 2 105 ? -104.715 -9.657  -5.773  1.00 0.00 ? 109 HIS C CA  2  
ATOM 10743  C C   . HIS B 2 105 ? -103.918 -10.706 -6.537  1.00 0.00 ? 109 HIS C C   2  
ATOM 10744  O O   . HIS B 2 105 ? -104.038 -10.757 -7.754  1.00 0.00 ? 109 HIS C O   2  
ATOM 10745  C CB  . HIS B 2 105 ? -103.746 -8.597  -5.282  1.00 0.00 ? 109 HIS C CB  2  
ATOM 10746  C CG  . HIS B 2 105 ? -104.519 -7.420  -4.711  1.00 0.00 ? 109 HIS C CG  2  
ATOM 10747  N ND1 . HIS B 2 105 ? -104.834 -7.252  -3.440  1.00 0.00 ? 109 HIS C ND1 2  
ATOM 10748  C CD2 . HIS B 2 105 ? -105.031 -6.361  -5.423  1.00 0.00 ? 109 HIS C CD2 2  
ATOM 10749  C CE1 . HIS B 2 105 ? -105.508 -6.145  -3.342  1.00 0.00 ? 109 HIS C CE1 2  
ATOM 10750  N NE2 . HIS B 2 105 ? -105.623 -5.608  -4.529  1.00 0.00 ? 109 HIS C NE2 2  
ATOM 10751  N N   . VAL B 2 106 ? -103.203 -11.625 -5.877  1.00 0.00 ? 110 VAL C N   2  
ATOM 10752  C CA  . VAL B 2 106 ? -102.432 -12.667 -6.554  1.00 0.00 ? 110 VAL C CA  2  
ATOM 10753  C C   . VAL B 2 106 ? -103.269 -13.505 -7.540  1.00 0.00 ? 110 VAL C C   2  
ATOM 10754  O O   . VAL B 2 106 ? -102.847 -13.824 -8.652  1.00 0.00 ? 110 VAL C O   2  
ATOM 10755  C CB  . VAL B 2 106 ? -101.783 -13.516 -5.422  1.00 0.00 ? 110 VAL C CB  2  
ATOM 10756  C CG1 . VAL B 2 106 ? -101.336 -14.899 -5.858  1.00 0.00 ? 110 VAL C CG1 2  
ATOM 10757  C CG2 . VAL B 2 106 ? -100.567 -12.738 -4.937  1.00 0.00 ? 110 VAL C CG2 2  
ATOM 10758  N N   . LEU B 2 107 ? -104.523 -13.802 -7.184  1.00 0.00 ? 111 LEU C N   2  
ATOM 10759  C CA  . LEU B 2 107 ? -105.417 -14.518 -8.082  1.00 0.00 ? 111 LEU C CA  2  
ATOM 10760  C C   . LEU B 2 107 ? -106.314 -13.657 -8.981  1.00 0.00 ? 111 LEU C C   2  
ATOM 10761  O O   . LEU B 2 107 ? -107.317 -14.118 -9.510  1.00 0.00 ? 111 LEU C O   2  
ATOM 10762  C CB  . LEU B 2 107 ? -106.264 -15.478 -7.237  1.00 0.00 ? 111 LEU C CB  2  
ATOM 10763  C CG  . LEU B 2 107 ? -105.518 -16.507 -6.376  1.00 0.00 ? 111 LEU C CG  2  
ATOM 10764  C CD1 . LEU B 2 107 ? -106.538 -17.364 -5.655  1.00 0.00 ? 111 LEU C CD1 2  
ATOM 10765  C CD2 . LEU B 2 107 ? -104.609 -17.378 -7.230  1.00 0.00 ? 111 LEU C CD2 2  
ATOM 10766  N N   . ALA B 2 108 ? -105.957 -12.391 -9.190  1.00 0.00 ? 112 ALA C N   2  
ATOM 10767  C CA  . ALA B 2 108 ? -106.647 -11.492 -10.118 1.00 0.00 ? 112 ALA C CA  2  
ATOM 10768  C C   . ALA B 2 108 ? -105.649 -10.876 -11.109 1.00 0.00 ? 112 ALA C C   2  
ATOM 10769  O O   . ALA B 2 108 ? -105.888 -10.760 -12.313 1.00 0.00 ? 112 ALA C O   2  
ATOM 10770  C CB  . ALA B 2 108 ? -107.322 -10.358 -9.359  1.00 0.00 ? 112 ALA C CB  2  
ATOM 10771  N N   . THR B 2 109 ? -104.464 -10.528 -10.600 1.00 0.00 ? 113 THR C N   2  
ATOM 10772  C CA  . THR B 2 109 ? -103.372 -9.927  -11.370 1.00 0.00 ? 113 THR C CA  2  
ATOM 10773  C C   . THR B 2 109 ? -102.332 -10.868 -11.980 1.00 0.00 ? 113 THR C C   2  
ATOM 10774  O O   . THR B 2 109 ? -101.654 -10.512 -12.946 1.00 0.00 ? 113 THR C O   2  
ATOM 10775  C CB  . THR B 2 109 ? -102.561 -8.928  -10.524 1.00 0.00 ? 113 THR C CB  2  
ATOM 10776  O OG1 . THR B 2 109 ? -102.100 -9.645  -9.379  1.00 0.00 ? 113 THR C OG1 2  
ATOM 10777  C CG2 . THR B 2 109 ? -103.377 -7.723  -10.080 1.00 0.00 ? 113 THR C CG2 2  
ATOM 10778  N N   . LEU B 2 110 ? -102.119 -12.070 -11.442 1.00 0.00 ? 114 LEU C N   2  
ATOM 10779  C CA  . LEU B 2 110 ? -101.045 -12.933 -11.934 1.00 0.00 ? 114 LEU C CA  2  
ATOM 10780  C C   . LEU B 2 110 ? -101.353 -14.148 -12.817 1.00 0.00 ? 114 LEU C C   2  
ATOM 10781  O O   . LEU B 2 110 ? -102.444 -14.719 -12.788 1.00 0.00 ? 114 LEU C O   2  
ATOM 10782  C CB  . LEU B 2 110 ? -100.243 -13.393 -10.717 1.00 0.00 ? 114 LEU C CB  2  
ATOM 10783  C CG  . LEU B 2 110 ? -99.544  -12.295 -9.910  1.00 0.00 ? 114 LEU C CG  2  
ATOM 10784  C CD1 . LEU B 2 110 ? -98.991  -12.854 -8.621  1.00 0.00 ? 114 LEU C CD1 2  
ATOM 10785  C CD2 . LEU B 2 110 ? -98.425  -11.699 -10.743 1.00 0.00 ? 114 LEU C CD2 2  
ATOM 10786  N N   . GLY B 2 111 ? -100.381 -14.567 -13.632 1.00 0.00 ? 115 GLY C N   2  
ATOM 10787  C CA  . GLY B 2 111 ? -100.512 -15.721 -14.530 1.00 0.00 ? 115 GLY C CA  2  
ATOM 10788  C C   . GLY B 2 111 ? -101.706 -15.705 -15.491 1.00 0.00 ? 115 GLY C C   2  
ATOM 10789  O O   . GLY B 2 111 ? -101.726 -15.004 -16.501 1.00 0.00 ? 115 GLY C O   2  
ATOM 10790  N N   . GLU B 2 112 ? -102.749 -16.444 -15.127 1.00 0.00 ? 116 GLU C N   2  
ATOM 10791  C CA  . GLU B 2 112 ? -103.958 -16.530 -15.933 1.00 0.00 ? 116 GLU C CA  2  
ATOM 10792  C C   . GLU B 2 112 ? -105.047 -15.504 -15.601 1.00 0.00 ? 116 GLU C C   2  
ATOM 10793  O O   . GLU B 2 112 ? -106.131 -15.535 -16.210 1.00 0.00 ? 116 GLU C O   2  
ATOM 10794  C CB  . GLU B 2 112 ? -104.565 -17.924 -15.803 1.00 0.00 ? 116 GLU C CB  2  
ATOM 10795  C CG  . GLU B 2 112 ? -103.966 -19.159 -16.458 1.00 0.00 ? 116 GLU C CG  2  
ATOM 10796  C CD  . GLU B 2 112 ? -104.761 -20.422 -16.146 1.00 0.00 ? 116 GLU C CD  2  
ATOM 10797  O OE1 . GLU B 2 112 ? -105.799 -20.667 -16.760 1.00 0.00 ? 116 GLU C OE1 2  
ATOM 10798  O OE2 . GLU B 2 112 ? -104.372 -21.172 -15.261 1.00 0.00 ? 116 GLU C OE2 2  
ATOM 10799  N N   . LYS B 2 113 ? -104.841 -14.612 -14.614 1.00 0.00 ? 117 LYS C N   2  
ATOM 10800  C CA  . LYS B 2 113 ? -105.816 -13.618 -14.114 1.00 0.00 ? 117 LYS C CA  2  
ATOM 10801  C C   . LYS B 2 113 ? -107.034 -14.286 -13.454 1.00 0.00 ? 117 LYS C C   2  
ATOM 10802  O O   . LYS B 2 113 ? -107.026 -15.479 -13.190 1.00 0.00 ? 117 LYS C O   2  
ATOM 10803  C CB  . LYS B 2 113 ? -106.355 -12.709 -15.240 1.00 0.00 ? 117 LYS C CB  2  
ATOM 10804  C CG  . LYS B 2 113 ? -105.339 -11.970 -16.091 1.00 0.00 ? 117 LYS C CG  2  
ATOM 10805  C CD  . LYS B 2 113 ? -106.034 -11.521 -17.369 1.00 0.00 ? 117 LYS C CD  2  
ATOM 10806  C CE  . LYS B 2 113 ? -105.004 -10.983 -18.348 1.00 0.00 ? 117 LYS C CE  2  
ATOM 10807  N NZ  . LYS B 2 113 ? -105.632 -10.663 -19.615 1.00 0.00 ? 117 LYS C NZ  2  
ATOM 10808  N N   . MET B 2 114 ? -108.068 -13.565 -13.072 1.00 0.00 ? 118 MET C N   2  
ATOM 10809  C CA  . MET B 2 114 ? -109.401 -14.051 -12.678 1.00 0.00 ? 118 MET C CA  2  
ATOM 10810  C C   . MET B 2 114 ? -110.172 -12.762 -12.462 1.00 0.00 ? 118 MET C C   2  
ATOM 10811  O O   . MET B 2 114 ? -109.586 -11.795 -11.953 1.00 0.00 ? 118 MET C O   2  
ATOM 10812  C CB  . MET B 2 114 ? -109.521 -14.802 -11.343 1.00 0.00 ? 118 MET C CB  2  
ATOM 10813  C CG  . MET B 2 114 ? -109.153 -16.279 -11.287 1.00 0.00 ? 118 MET C CG  2  
ATOM 10814  S SD  . MET B 2 114 ? -109.953 -17.201 -12.612 1.00 0.00 ? 118 MET C SD  2  
ATOM 10815  C CE  . MET B 2 114 ? -111.533 -17.402 -11.853 1.00 0.00 ? 118 MET C CE  2  
ATOM 10816  N N   . THR B 2 115 ? -111.430 -12.599 -12.845 1.00 0.00 ? 119 THR C N   2  
ATOM 10817  C CA  . THR B 2 115 ? -112.085 -11.309 -12.616 1.00 0.00 ? 119 THR C CA  2  
ATOM 10818  C C   . THR B 2 115 ? -112.316 -11.070 -11.130 1.00 0.00 ? 119 THR C C   2  
ATOM 10819  O O   . THR B 2 115 ? -112.504 -12.007 -10.347 1.00 0.00 ? 119 THR C O   2  
ATOM 10820  C CB  . THR B 2 115 ? -113.478 -11.156 -13.318 1.00 0.00 ? 119 THR C CB  2  
ATOM 10821  O OG1 . THR B 2 115 ? -114.464 -11.815 -12.532 1.00 0.00 ? 119 THR C OG1 2  
ATOM 10822  C CG2 . THR B 2 115 ? -113.445 -11.686 -14.746 1.00 0.00 ? 119 THR C CG2 2  
ATOM 10823  N N   . GLU B 2 116 ? -112.257 -9.815  -10.692 1.00 0.00 ? 120 GLU C N   2  
ATOM 10824  C CA  . GLU B 2 116 ? -112.507 -9.470  -9.290  1.00 0.00 ? 120 GLU C CA  2  
ATOM 10825  C C   . GLU B 2 116 ? -113.810 -10.083 -8.778  1.00 0.00 ? 120 GLU C C   2  
ATOM 10826  O O   . GLU B 2 116 ? -113.807 -10.806 -7.792  1.00 0.00 ? 120 GLU C O   2  
ATOM 10827  C CB  . GLU B 2 116 ? -112.487 -7.949  -9.187  1.00 0.00 ? 120 GLU C CB  2  
ATOM 10828  C CG  . GLU B 2 116 ? -111.069 -7.475  -9.543  1.00 0.00 ? 120 GLU C CG  2  
ATOM 10829  C CD  . GLU B 2 116 ? -110.819 -5.976  -9.645  1.00 0.00 ? 120 GLU C CD  2  
ATOM 10830  O OE1 . GLU B 2 116 ? -111.743 -5.218  -9.926  1.00 0.00 ? 120 GLU C OE1 2  
ATOM 10831  O OE2 . GLU B 2 116 ? -109.668 -5.575  -9.470  1.00 0.00 ? 120 GLU C OE2 2  
ATOM 10832  N N   . GLU B 2 117 ? -114.866 -10.005 -9.603  1.00 0.00 ? 121 GLU C N   2  
ATOM 10833  C CA  . GLU B 2 117 ? -116.153 -10.683 -9.378  1.00 0.00 ? 121 GLU C CA  2  
ATOM 10834  C C   . GLU B 2 117 ? -115.990 -12.179 -9.052  1.00 0.00 ? 121 GLU C C   2  
ATOM 10835  O O   . GLU B 2 117 ? -116.355 -12.655 -7.972  1.00 0.00 ? 121 GLU C O   2  
ATOM 10836  C CB  . GLU B 2 117 ? -117.021 -10.554 -10.626 1.00 0.00 ? 121 GLU C CB  2  
ATOM 10837  C CG  . GLU B 2 117 ? -117.203 -9.129  -11.143 1.00 0.00 ? 121 GLU C CG  2  
ATOM 10838  C CD  . GLU B 2 117 ? -117.692 -8.985  -12.578 1.00 0.00 ? 121 GLU C CD  2  
ATOM 10839  O OE1 . GLU B 2 117 ? -117.922 -9.983  -13.266 1.00 0.00 ? 121 GLU C OE1 2  
ATOM 10840  O OE2 . GLU B 2 117 ? -117.822 -7.851  -13.023 1.00 0.00 ? 121 GLU C OE2 2  
ATOM 10841  N N   . GLU B 2 118 ? -115.339 -12.963 -9.923  1.00 0.00 ? 122 GLU C N   2  
ATOM 10842  C CA  . GLU B 2 118 ? -115.059 -14.384 -9.678  1.00 0.00 ? 122 GLU C CA  2  
ATOM 10843  C C   . GLU B 2 118 ? -114.232 -14.644 -8.410  1.00 0.00 ? 122 GLU C C   2  
ATOM 10844  O O   . GLU B 2 118 ? -114.510 -15.554 -7.621  1.00 0.00 ? 122 GLU C O   2  
ATOM 10845  C CB  . GLU B 2 118 ? -114.312 -14.982 -10.866 1.00 0.00 ? 122 GLU C CB  2  
ATOM 10846  C CG  . GLU B 2 118 ? -115.063 -14.990 -12.203 1.00 0.00 ? 122 GLU C CG  2  
ATOM 10847  C CD  . GLU B 2 118 ? -114.206 -15.375 -13.409 1.00 0.00 ? 122 GLU C CD  2  
ATOM 10848  O OE1 . GLU B 2 118 ? -113.098 -14.865 -13.549 1.00 0.00 ? 122 GLU C OE1 2  
ATOM 10849  O OE2 . GLU B 2 118 ? -114.648 -16.174 -14.227 1.00 0.00 ? 122 GLU C OE2 2  
ATOM 10850  N N   . VAL B 2 119 ? -113.196 -13.842 -8.127  1.00 0.00 ? 123 VAL C N   2  
ATOM 10851  C CA  . VAL B 2 119 ? -112.416 -13.978 -6.886  1.00 0.00 ? 123 VAL C CA  2  
ATOM 10852  C C   . VAL B 2 119 ? -113.279 -13.680 -5.646  1.00 0.00 ? 123 VAL C C   2  
ATOM 10853  O O   . VAL B 2 119 ? -113.301 -14.482 -4.708  1.00 0.00 ? 123 VAL C O   2  
ATOM 10854  C CB  . VAL B 2 119 ? -111.193 -13.022 -6.927  1.00 0.00 ? 123 VAL C CB  2  
ATOM 10855  C CG1 . VAL B 2 119 ? -110.399 -13.095 -5.631  1.00 0.00 ? 123 VAL C CG1 2  
ATOM 10856  C CG2 . VAL B 2 119 ? -110.283 -13.430 -8.064  1.00 0.00 ? 123 VAL C CG2 2  
ATOM 10857  N N   . GLU B 2 120 ? -114.052 -12.590 -5.605  1.00 0.00 ? 124 GLU C N   2  
ATOM 10858  C CA  . GLU B 2 120 ? -115.008 -12.279 -4.536  1.00 0.00 ? 124 GLU C CA  2  
ATOM 10859  C C   . GLU B 2 120 ? -115.965 -13.461 -4.292  1.00 0.00 ? 124 GLU C C   2  
ATOM 10860  O O   . GLU B 2 120 ? -116.250 -13.886 -3.165  1.00 0.00 ? 124 GLU C O   2  
ATOM 10861  C CB  . GLU B 2 120 ? -115.823 -11.051 -4.915  1.00 0.00 ? 124 GLU C CB  2  
ATOM 10862  C CG  . GLU B 2 120 ? -115.034 -9.742  -4.940  1.00 0.00 ? 124 GLU C CG  2  
ATOM 10863  C CD  . GLU B 2 120 ? -115.675 -8.628  -5.759  1.00 0.00 ? 124 GLU C CD  2  
ATOM 10864  O OE1 . GLU B 2 120 ? -116.886 -8.428  -5.685  1.00 0.00 ? 124 GLU C OE1 2  
ATOM 10865  O OE2 . GLU B 2 120 ? -114.950 -7.952  -6.485  1.00 0.00 ? 124 GLU C OE2 2  
ATOM 10866  N N   . GLU B 2 121 ? -116.420 -14.061 -5.391  1.00 0.00 ? 125 GLU C N   2  
ATOM 10867  C CA  . GLU B 2 121 ? -117.176 -15.308 -5.368  1.00 0.00 ? 125 GLU C CA  2  
ATOM 10868  C C   . GLU B 2 121 ? -116.466 -16.586 -4.922  1.00 0.00 ? 125 GLU C C   2  
ATOM 10869  O O   . GLU B 2 121 ? -117.110 -17.604 -4.629  1.00 0.00 ? 125 GLU C O   2  
ATOM 10870  C CB  . GLU B 2 121 ? -117.733 -15.601 -6.737  1.00 0.00 ? 125 GLU C CB  2  
ATOM 10871  C CG  . GLU B 2 121 ? -119.097 -15.005 -6.978  1.00 0.00 ? 125 GLU C CG  2  
ATOM 10872  C CD  . GLU B 2 121 ? -119.852 -15.806 -8.023  1.00 0.00 ? 125 GLU C CD  2  
ATOM 10873  O OE1 . GLU B 2 121 ? -120.137 -16.973 -7.754  1.00 0.00 ? 125 GLU C OE1 2  
ATOM 10874  O OE2 . GLU B 2 121 ? -120.144 -15.280 -9.082  1.00 0.00 ? 125 GLU C OE2 2  
ATOM 10875  N N   . LEU B 2 122 ? -115.142 -16.669 -5.006  1.00 0.00 ? 126 LEU C N   2  
ATOM 10876  C CA  . LEU B 2 122 ? -114.396 -17.769 -4.391  1.00 0.00 ? 126 LEU C CA  2  
ATOM 10877  C C   . LEU B 2 122 ? -114.295 -17.564 -2.878  1.00 0.00 ? 126 LEU C C   2  
ATOM 10878  O O   . LEU B 2 122 ? -114.457 -18.479 -2.063  1.00 0.00 ? 126 LEU C O   2  
ATOM 10879  C CB  . LEU B 2 122 ? -113.015 -17.841 -5.028  1.00 0.00 ? 126 LEU C CB  2  
ATOM 10880  C CG  . LEU B 2 122 ? -113.023 -18.310 -6.478  1.00 0.00 ? 126 LEU C CG  2  
ATOM 10881  C CD1 . LEU B 2 122 ? -111.712 -17.940 -7.142  1.00 0.00 ? 126 LEU C CD1 2  
ATOM 10882  C CD2 . LEU B 2 122 ? -113.306 -19.804 -6.517  1.00 0.00 ? 126 LEU C CD2 2  
ATOM 10883  N N   . MET B 2 123 ? -114.165 -16.307 -2.478  1.00 0.00 ? 127 MET C N   2  
ATOM 10884  C CA  . MET B 2 123 ? -114.165 -15.904 -1.069  1.00 0.00 ? 127 MET C CA  2  
ATOM 10885  C C   . MET B 2 123 ? -115.560 -15.869 -0.403  1.00 0.00 ? 127 MET C C   2  
ATOM 10886  O O   . MET B 2 123 ? -115.833 -15.127 0.545   1.00 0.00 ? 127 MET C O   2  
ATOM 10887  C CB  . MET B 2 123 ? -113.524 -14.539 -0.970  1.00 0.00 ? 127 MET C CB  2  
ATOM 10888  C CG  . MET B 2 123 ? -112.179 -14.408 -1.666  1.00 0.00 ? 127 MET C CG  2  
ATOM 10889  S SD  . MET B 2 123 ? -111.398 -12.809 -1.358  1.00 0.00 ? 127 MET C SD  2  
ATOM 10890  C CE  . MET B 2 123 ? -112.790 -11.722 -1.199  1.00 0.00 ? 127 MET C CE  2  
ATOM 10891  N N   . LYS B 2 124 ? -116.476 -16.761 -0.802  1.00 0.00 ? 128 LYS C N   2  
ATOM 10892  C CA  . LYS B 2 124 ? -117.852 -16.827 -0.298  1.00 0.00 ? 128 LYS C CA  2  
ATOM 10893  C C   . LYS B 2 124 ? -118.040 -17.127 1.195   1.00 0.00 ? 128 LYS C C   2  
ATOM 10894  O O   . LYS B 2 124 ? -118.357 -18.251 1.591   1.00 0.00 ? 128 LYS C O   2  
ATOM 10895  C CB  . LYS B 2 124 ? -118.623 -17.886 -1.113  1.00 0.00 ? 128 LYS C CB  2  
ATOM 10896  C CG  . LYS B 2 124 ? -119.270 -17.393 -2.397  1.00 0.00 ? 128 LYS C CG  2  
ATOM 10897  C CD  . LYS B 2 124 ? -119.755 -18.572 -3.249  1.00 0.00 ? 128 LYS C CD  2  
ATOM 10898  C CE  . LYS B 2 124 ? -120.252 -18.042 -4.592  1.00 0.00 ? 128 LYS C CE  2  
ATOM 10899  N NZ  . LYS B 2 124 ? -119.596 -18.694 -5.710  1.00 0.00 ? 128 LYS C NZ  2  
ATOM 10900  N N   . GLY B 2 125 ? -117.785 -16.154 2.076   1.00 0.00 ? 129 GLY C N   2  
ATOM 10901  C CA  . GLY B 2 125 ? -117.924 -16.345 3.524   1.00 0.00 ? 129 GLY C CA  2  
ATOM 10902  C C   . GLY B 2 125 ? -116.984 -17.400 4.123   1.00 0.00 ? 129 GLY C C   2  
ATOM 10903  O O   . GLY B 2 125 ? -117.351 -18.262 4.906   1.00 0.00 ? 129 GLY C O   2  
ATOM 10904  N N   . GLN B 2 126 ? -115.754 -17.414 3.609   1.00 0.00 ? 130 GLN C N   2  
ATOM 10905  C CA  . GLN B 2 126 ? -114.702 -18.292 4.124   1.00 0.00 ? 130 GLN C CA  2  
ATOM 10906  C C   . GLN B 2 126 ? -113.541 -17.504 4.763   1.00 0.00 ? 130 GLN C C   2  
ATOM 10907  O O   . GLN B 2 126 ? -112.602 -18.041 5.361   1.00 0.00 ? 130 GLN C O   2  
ATOM 10908  C CB  . GLN B 2 126 ? -114.203 -19.178 2.977   1.00 0.00 ? 130 GLN C CB  2  
ATOM 10909  C CG  . GLN B 2 126 ? -115.259 -20.187 2.516   1.00 0.00 ? 130 GLN C CG  2  
ATOM 10910  C CD  . GLN B 2 126 ? -114.785 -21.254 1.538   1.00 0.00 ? 130 GLN C CD  2  
ATOM 10911  O OE1 . GLN B 2 126 ? -113.837 -21.997 1.766   1.00 0.00 ? 130 GLN C OE1 2  
ATOM 10912  N NE2 . GLN B 2 126 ? -115.452 -21.496 0.432   1.00 0.00 ? 130 GLN C NE2 2  
ATOM 10913  N N   . GLU B 2 127 ? -113.656 -16.183 4.621   1.00 0.00 ? 131 GLU C N   2  
ATOM 10914  C CA  . GLU B 2 127 ? -112.740 -15.187 5.161   1.00 0.00 ? 131 GLU C CA  2  
ATOM 10915  C C   . GLU B 2 127 ? -113.449 -14.133 6.016   1.00 0.00 ? 131 GLU C C   2  
ATOM 10916  O O   . GLU B 2 127 ? -113.605 -12.956 5.669   1.00 0.00 ? 131 GLU C O   2  
ATOM 10917  C CB  . GLU B 2 127 ? -111.993 -14.404 4.072   1.00 0.00 ? 131 GLU C CB  2  
ATOM 10918  C CG  . GLU B 2 127 ? -112.262 -14.634 2.598   1.00 0.00 ? 131 GLU C CG  2  
ATOM 10919  C CD  . GLU B 2 127 ? -111.086 -14.163 1.754   1.00 0.00 ? 131 GLU C CD  2  
ATOM 10920  O OE1 . GLU B 2 127 ? -110.795 -12.968 1.717   1.00 0.00 ? 131 GLU C OE1 2  
ATOM 10921  O OE2 . GLU B 2 127 ? -110.448 -14.997 1.127   1.00 0.00 ? 131 GLU C OE2 2  
ATOM 10922  N N   . ASP B 2 128 ? -113.965 -14.583 7.147   1.00 0.00 ? 132 ASP C N   2  
ATOM 10923  C CA  . ASP B 2 128 ? -114.617 -13.681 8.079   1.00 0.00 ? 132 ASP C CA  2  
ATOM 10924  C C   . ASP B 2 128 ? -113.763 -12.547 8.653   1.00 0.00 ? 132 ASP C C   2  
ATOM 10925  O O   . ASP B 2 128 ? -112.542 -12.470 8.479   1.00 0.00 ? 132 ASP C O   2  
ATOM 10926  C CB  . ASP B 2 128 ? -115.194 -14.540 9.199   1.00 0.00 ? 132 ASP C CB  2  
ATOM 10927  C CG  . ASP B 2 128 ? -116.355 -15.431 8.774   1.00 0.00 ? 132 ASP C CG  2  
ATOM 10928  O OD1 . ASP B 2 128 ? -116.478 -15.758 7.592   1.00 0.00 ? 132 ASP C OD1 2  
ATOM 10929  O OD2 . ASP B 2 128 ? -117.127 -15.789 9.652   1.00 0.00 ? 132 ASP C OD2 2  
ATOM 10930  N N   . SER B 2 129 ? -114.387 -11.638 9.402   1.00 0.00 ? 133 SER C N   2  
ATOM 10931  C CA  . SER B 2 129 ? -113.755 -10.457 10.026  1.00 0.00 ? 133 SER C CA  2  
ATOM 10932  C C   . SER B 2 129 ? -112.289 -10.420 10.487  1.00 0.00 ? 133 SER C C   2  
ATOM 10933  O O   . SER B 2 129 ? -111.671 -9.362  10.558  1.00 0.00 ? 133 SER C O   2  
ATOM 10934  C CB  . SER B 2 129 ? -114.566 -10.033 11.237  1.00 0.00 ? 133 SER C CB  2  
ATOM 10935  O OG  . SER B 2 129 ? -114.628 -11.080 12.199  1.00 0.00 ? 133 SER C OG  2  
ATOM 10936  N N   . ASN B 2 130 ? -111.686 -11.579 10.738  1.00 0.00 ? 134 ASN C N   2  
ATOM 10937  C CA  . ASN B 2 130 ? -110.307 -11.716 11.206  1.00 0.00 ? 134 ASN C CA  2  
ATOM 10938  C C   . ASN B 2 130 ? -109.191 -11.274 10.246  1.00 0.00 ? 134 ASN C C   2  
ATOM 10939  O O   . ASN B 2 130 ? -108.018 -11.231 10.626  1.00 0.00 ? 134 ASN C O   2  
ATOM 10940  C CB  . ASN B 2 130 ? -110.069 -13.178 11.596  1.00 0.00 ? 134 ASN C CB  2  
ATOM 10941  C CG  . ASN B 2 130 ? -111.138 -13.732 12.532  1.00 0.00 ? 134 ASN C CG  2  
ATOM 10942  O OD1 . ASN B 2 130 ? -111.358 -13.279 13.644  1.00 0.00 ? 134 ASN C OD1 2  
ATOM 10943  N ND2 . ASN B 2 130 ? -111.917 -14.726 12.172  1.00 0.00 ? 134 ASN C ND2 2  
ATOM 10944  N N   . GLY B 2 131 ? -109.455 -11.017 8.959   1.00 0.00 ? 135 GLY C N   2  
ATOM 10945  C CA  . GLY B 2 131 ? -108.424 -10.582 8.005   1.00 0.00 ? 135 GLY C CA  2  
ATOM 10946  C C   . GLY B 2 131 ? -107.620 -11.738 7.405   1.00 0.00 ? 135 GLY C C   2  
ATOM 10947  O O   . GLY B 2 131 ? -107.316 -11.807 6.208   1.00 0.00 ? 135 GLY C O   2  
ATOM 10948  N N   . CYS B 2 132 ? -107.226 -12.633 8.312   1.00 0.00 ? 136 CYS C N   2  
ATOM 10949  C CA  . CYS B 2 132 ? -106.580 -13.887 7.988   1.00 0.00 ? 136 CYS C CA  2  
ATOM 10950  C C   . CYS B 2 132 ? -107.531 -14.995 7.566   1.00 0.00 ? 136 CYS C C   2  
ATOM 10951  O O   . CYS B 2 132 ? -108.567 -15.274 8.171   1.00 0.00 ? 136 CYS C O   2  
ATOM 10952  C CB  . CYS B 2 132 ? -105.785 -14.441 9.158   1.00 0.00 ? 136 CYS C CB  2  
ATOM 10953  S SG  . CYS B 2 132 ? -104.415 -13.379 9.680   1.00 0.00 ? 136 CYS C SG  2  
ATOM 10954  N N   . ILE B 2 133 ? -107.126 -15.661 6.506   1.00 0.00 ? 137 ILE C N   2  
ATOM 10955  C CA  . ILE B 2 133 ? -107.874 -16.777 5.959   1.00 0.00 ? 137 ILE C CA  2  
ATOM 10956  C C   . ILE B 2 133 ? -107.218 -18.124 6.306   1.00 0.00 ? 137 ILE C C   2  
ATOM 10957  O O   . ILE B 2 133 ? -106.005 -18.166 6.483   1.00 0.00 ? 137 ILE C O   2  
ATOM 10958  C CB  . ILE B 2 133 ? -108.001 -16.545 4.426   1.00 0.00 ? 137 ILE C CB  2  
ATOM 10959  C CG1 . ILE B 2 133 ? -107.442 -15.267 3.815   1.00 0.00 ? 137 ILE C CG1 2  
ATOM 10960  C CG2 . ILE B 2 133 ? -109.467 -16.425 4.266   1.00 0.00 ? 137 ILE C CG2 2  
ATOM 10961  C CD1 . ILE B 2 133 ? -107.433 -15.291 2.271   1.00 0.00 ? 137 ILE C CD1 2  
ATOM 10962  N N   . ASN B 2 134 ? -107.915 -19.258 6.469   1.00 0.00 ? 138 ASN C N   2  
ATOM 10963  C CA  . ASN B 2 134 ? -107.252 -20.537 6.794   1.00 0.00 ? 138 ASN C CA  2  
ATOM 10964  C C   . ASN B 2 134 ? -107.014 -21.530 5.638   1.00 0.00 ? 138 ASN C C   2  
ATOM 10965  O O   . ASN B 2 134 ? -107.811 -22.435 5.370   1.00 0.00 ? 138 ASN C O   2  
ATOM 10966  C CB  . ASN B 2 134 ? -108.052 -21.254 7.883   1.00 0.00 ? 138 ASN C CB  2  
ATOM 10967  C CG  . ASN B 2 134 ? -108.093 -20.500 9.200   1.00 0.00 ? 138 ASN C CG  2  
ATOM 10968  O OD1 . ASN B 2 134 ? -107.097 -20.247 9.852   1.00 0.00 ? 138 ASN C OD1 2  
ATOM 10969  N ND2 . ASN B 2 134 ? -109.239 -20.089 9.683   1.00 0.00 ? 138 ASN C ND2 2  
ATOM 10970  N N   . TYR B 2 135 ? -105.883 -21.409 4.930   1.00 0.00 ? 139 TYR C N   2  
ATOM 10971  C CA  . TYR B 2 135 ? -105.502 -22.214 3.750   1.00 0.00 ? 139 TYR C CA  2  
ATOM 10972  C C   . TYR B 2 135 ? -106.039 -23.631 3.529   1.00 0.00 ? 139 TYR C C   2  
ATOM 10973  O O   . TYR B 2 135 ? -106.719 -23.962 2.546   1.00 0.00 ? 139 TYR C O   2  
ATOM 10974  C CB  . TYR B 2 135 ? -103.994 -22.363 3.669   1.00 0.00 ? 139 TYR C CB  2  
ATOM 10975  C CG  . TYR B 2 135 ? -103.200 -21.178 3.166   1.00 0.00 ? 139 TYR C CG  2  
ATOM 10976  C CD1 . TYR B 2 135 ? -102.093 -20.783 3.879   1.00 0.00 ? 139 TYR C CD1 2  
ATOM 10977  C CD2 . TYR B 2 135 ? -103.545 -20.544 1.990   1.00 0.00 ? 139 TYR C CD2 2  
ATOM 10978  C CE1 . TYR B 2 135 ? -101.315 -19.749 3.414   1.00 0.00 ? 139 TYR C CE1 2  
ATOM 10979  C CE2 . TYR B 2 135 ? -102.764 -19.504 1.518   1.00 0.00 ? 139 TYR C CE2 2  
ATOM 10980  C CZ  . TYR B 2 135 ? -101.653 -19.131 2.238   1.00 0.00 ? 139 TYR C CZ  2  
ATOM 10981  O OH  . TYR B 2 135 ? -100.813 -18.160 1.752   1.00 0.00 ? 139 TYR C OH  2  
ATOM 10982  N N   . GLU B 2 136 ? -105.781 -24.464 4.529   1.00 0.00 ? 140 GLU C N   2  
ATOM 10983  C CA  . GLU B 2 136 ? -106.137 -25.884 4.538   1.00 0.00 ? 140 GLU C CA  2  
ATOM 10984  C C   . GLU B 2 136 ? -107.615 -26.165 4.299   1.00 0.00 ? 140 GLU C C   2  
ATOM 10985  O O   . GLU B 2 136 ? -108.021 -27.132 3.643   1.00 0.00 ? 140 GLU C O   2  
ATOM 10986  C CB  . GLU B 2 136 ? -105.766 -26.509 5.860   1.00 0.00 ? 140 GLU C CB  2  
ATOM 10987  C CG  . GLU B 2 136 ? -104.340 -26.182 6.257   1.00 0.00 ? 140 GLU C CG  2  
ATOM 10988  C CD  . GLU B 2 136 ? -103.728 -27.062 7.328   1.00 0.00 ? 140 GLU C CD  2  
ATOM 10989  O OE1 . GLU B 2 136 ? -104.426 -27.823 7.995   1.00 0.00 ? 140 GLU C OE1 2  
ATOM 10990  O OE2 . GLU B 2 136 ? -102.513 -26.995 7.443   1.00 0.00 ? 140 GLU C OE2 2  
ATOM 10991  N N   . ALA B 2 137 ? -108.467 -25.283 4.810   1.00 0.00 ? 141 ALA C N   2  
ATOM 10992  C CA  . ALA B 2 137 ? -109.902 -25.402 4.601   1.00 0.00 ? 141 ALA C CA  2  
ATOM 10993  C C   . ALA B 2 137 ? -110.313 -24.961 3.200   1.00 0.00 ? 141 ALA C C   2  
ATOM 10994  O O   . ALA B 2 137 ? -111.249 -25.515 2.618   1.00 0.00 ? 141 ALA C O   2  
ATOM 10995  C CB  . ALA B 2 137 ? -110.642 -24.549 5.609   1.00 0.00 ? 141 ALA C CB  2  
ATOM 10996  N N   . PHE B 2 138 ? -109.636 -23.980 2.595   1.00 0.00 ? 142 PHE C N   2  
ATOM 10997  C CA  . PHE B 2 138 ? -109.997 -23.535 1.246   1.00 0.00 ? 142 PHE C CA  2  
ATOM 10998  C C   . PHE B 2 138 ? -109.726 -24.566 0.201   1.00 0.00 ? 142 PHE C C   2  
ATOM 10999  O O   . PHE B 2 138 ? -110.652 -24.882 -0.525  1.00 0.00 ? 142 PHE C O   2  
ATOM 11000  C CB  . PHE B 2 138 ? -109.255 -22.289 0.796   1.00 0.00 ? 142 PHE C CB  2  
ATOM 11001  C CG  . PHE B 2 138 ? -109.468 -21.242 1.843   1.00 0.00 ? 142 PHE C CG  2  
ATOM 11002  C CD1 . PHE B 2 138 ? -108.371 -20.569 2.320   1.00 0.00 ? 142 PHE C CD1 2  
ATOM 11003  C CD2 . PHE B 2 138 ? -110.731 -21.058 2.377   1.00 0.00 ? 142 PHE C CD2 2  
ATOM 11004  C CE1 . PHE B 2 138 ? -108.561 -19.712 3.363   1.00 0.00 ? 142 PHE C CE1 2  
ATOM 11005  C CE2 . PHE B 2 138 ? -110.903 -20.199 3.419   1.00 0.00 ? 142 PHE C CE2 2  
ATOM 11006  C CZ  . PHE B 2 138 ? -109.817 -19.541 3.906   1.00 0.00 ? 142 PHE C CZ  2  
ATOM 11007  N N   . VAL B 2 139 ? -108.547 -25.183 0.170   1.00 0.00 ? 143 VAL C N   2  
ATOM 11008  C CA  . VAL B 2 139 ? -108.277 -26.246 -0.800  1.00 0.00 ? 143 VAL C CA  2  
ATOM 11009  C C   . VAL B 2 139 ? -109.347 -27.341 -0.685  1.00 0.00 ? 143 VAL C C   2  
ATOM 11010  O O   . VAL B 2 139 ? -109.904 -27.746 -1.698  1.00 0.00 ? 143 VAL C O   2  
ATOM 11011  C CB  . VAL B 2 139 ? -106.884 -26.853 -0.557  1.00 0.00 ? 143 VAL C CB  2  
ATOM 11012  C CG1 . VAL B 2 139 ? -106.555 -27.876 -1.639  1.00 0.00 ? 143 VAL C CG1 2  
ATOM 11013  C CG2 . VAL B 2 139 ? -105.854 -25.747 -0.566  1.00 0.00 ? 143 VAL C CG2 2  
ATOM 11014  N N   . LYS B 2 140 ? -109.753 -27.745 0.525   1.00 0.00 ? 144 LYS C N   2  
ATOM 11015  C CA  . LYS B 2 140 ? -110.881 -28.663 0.693   1.00 0.00 ? 144 LYS C CA  2  
ATOM 11016  C C   . LYS B 2 140 ? -112.208 -28.119 0.120   1.00 0.00 ? 144 LYS C C   2  
ATOM 11017  O O   . LYS B 2 140 ? -112.843 -28.790 -0.686  1.00 0.00 ? 144 LYS C O   2  
ATOM 11018  C CB  . LYS B 2 140 ? -111.039 -28.978 2.187   1.00 0.00 ? 144 LYS C CB  2  
ATOM 11019  C CG  . LYS B 2 140 ? -109.814 -29.697 2.746   1.00 0.00 ? 144 LYS C CG  2  
ATOM 11020  C CD  . LYS B 2 140 ? -109.830 -29.789 4.267   1.00 0.00 ? 144 LYS C CD  2  
ATOM 11021  C CE  . LYS B 2 140 ? -108.450 -30.241 4.745   1.00 0.00 ? 144 LYS C CE  2  
ATOM 11022  N NZ  . LYS B 2 140 ? -108.356 -30.229 6.195   1.00 0.00 ? 144 LYS C NZ  2  
ATOM 11023  N N   . HIS B 2 141 ? -112.662 -26.900 0.440   1.00 0.00 ? 145 HIS C N   2  
ATOM 11024  C CA  . HIS B 2 141 ? -113.895 -26.319 -0.138  1.00 0.00 ? 145 HIS C CA  2  
ATOM 11025  C C   . HIS B 2 141 ? -113.884 -25.974 -1.634  1.00 0.00 ? 145 HIS C C   2  
ATOM 11026  O O   . HIS B 2 141 ? -114.908 -25.766 -2.279  1.00 0.00 ? 145 HIS C O   2  
ATOM 11027  C CB  . HIS B 2 141 ? -114.304 -25.022 0.536   1.00 0.00 ? 145 HIS C CB  2  
ATOM 11028  C CG  . HIS B 2 141 ? -114.443 -25.065 2.047   1.00 0.00 ? 145 HIS C CG  2  
ATOM 11029  N ND1 . HIS B 2 141 ? -113.650 -24.459 2.918   1.00 0.00 ? 145 HIS C ND1 2  
ATOM 11030  C CD2 . HIS B 2 141 ? -115.426 -25.698 2.762   1.00 0.00 ? 145 HIS C CD2 2  
ATOM 11031  C CE1 . HIS B 2 141 ? -114.094 -24.686 4.120   1.00 0.00 ? 145 HIS C CE1 2  
ATOM 11032  N NE2 . HIS B 2 141 ? -115.163 -25.431 4.013   1.00 0.00 ? 145 HIS C NE2 2  
ATOM 11033  N N   . ILE B 2 142 ? -112.681 -25.745 -2.150  1.00 0.00 ? 146 ILE C N   2  
ATOM 11034  C CA  . ILE B 2 142 ? -112.420 -25.507 -3.561  1.00 0.00 ? 146 ILE C CA  2  
ATOM 11035  C C   . ILE B 2 142 ? -112.518 -26.883 -4.228  1.00 0.00 ? 146 ILE C C   2  
ATOM 11036  O O   . ILE B 2 142 ? -113.413 -27.127 -5.028  1.00 0.00 ? 146 ILE C O   2  
ATOM 11037  C CB  . ILE B 2 142 ? -111.016 -24.818 -3.604  1.00 0.00 ? 146 ILE C CB  2  
ATOM 11038  C CG1 . ILE B 2 142 ? -111.269 -23.331 -3.387  1.00 0.00 ? 146 ILE C CG1 2  
ATOM 11039  C CG2 . ILE B 2 142 ? -110.246 -25.033 -4.892  1.00 0.00 ? 146 ILE C CG2 2  
ATOM 11040  C CD1 . ILE B 2 142 ? -109.996 -22.480 -3.195  1.00 0.00 ? 146 ILE C CD1 2  
ATOM 11041  N N   . MET B 2 143 ? -111.708 -27.867 -3.846  1.00 0.00 ? 147 MET C N   2  
ATOM 11042  C CA  . MET B 2 143 ? -111.777 -29.207 -4.416  1.00 0.00 ? 147 MET C CA  2  
ATOM 11043  C C   . MET B 2 143 ? -113.078 -29.990 -4.170  1.00 0.00 ? 147 MET C C   2  
ATOM 11044  O O   . MET B 2 143 ? -113.351 -30.971 -4.856  1.00 0.00 ? 147 MET C O   2  
ATOM 11045  C CB  . MET B 2 143 ? -110.592 -30.024 -3.909  1.00 0.00 ? 147 MET C CB  2  
ATOM 11046  C CG  . MET B 2 143 ? -109.194 -29.446 -4.191  1.00 0.00 ? 147 MET C CG  2  
ATOM 11047  S SD  . MET B 2 143 ? -108.767 -29.097 -5.914  1.00 0.00 ? 147 MET C SD  2  
ATOM 11048  C CE  . MET B 2 143 ? -108.512 -30.735 -6.535  1.00 0.00 ? 147 MET C CE  2  
ATOM 11049  N N   . SER B 2 144 ? -113.909 -29.539 -3.224  1.00 0.00 ? 148 SER C N   2  
ATOM 11050  C CA  . SER B 2 144 ? -115.205 -30.145 -2.876  1.00 0.00 ? 148 SER C CA  2  
ATOM 11051  C C   . SER B 2 144 ? -116.406 -30.097 -3.834  1.00 0.00 ? 148 SER C C   2  
ATOM 11052  O O   . SER B 2 144 ? -117.572 -30.198 -3.399  1.00 0.00 ? 148 SER C O   2  
ATOM 11053  C CB  . SER B 2 144 ? -115.728 -29.577 -1.547  1.00 0.00 ? 148 SER C CB  2  
ATOM 11054  O OG  . SER B 2 144 ? -116.324 -28.285 -1.644  1.00 0.00 ? 148 SER C OG  2  
ATOM 11055  N N   . VAL B 2 145 ? -116.239 -29.810 -5.121  1.00 0.00 ? 149 VAL C N   2  
ATOM 11056  C CA  . VAL B 2 145 ? -117.386 -29.886 -6.008  1.00 0.00 ? 149 VAL C CA  2  
ATOM 11057  C C   . VAL B 2 145 ? -117.514 -31.285 -6.621  1.00 0.00 ? 149 VAL C C   2  
ATOM 11058  O O   . VAL B 2 145 ? -116.802 -31.605 -7.578  1.00 0.00 ? 149 VAL C O   2  
ATOM 11059  C CB  . VAL B 2 145 ? -117.297 -28.835 -7.133  1.00 0.00 ? 149 VAL C CB  2  
ATOM 11060  C CG1 . VAL B 2 145 ? -118.604 -28.889 -7.902  1.00 0.00 ? 149 VAL C CG1 2  
ATOM 11061  C CG2 . VAL B 2 145 ? -117.122 -27.420 -6.611  1.00 0.00 ? 149 VAL C CG2 2  
ATOM 11062  N N   . ASP C 3 1   ? -97.933  2.025   7.884   1.00 0.00 ? 4   ASP M N   2  
ATOM 11063  C CA  . ASP C 3 1   ? -98.946  3.055   7.701   1.00 0.00 ? 4   ASP M CA  2  
ATOM 11064  C C   . ASP C 3 1   ? -99.740  3.228   8.958   1.00 0.00 ? 4   ASP M C   2  
ATOM 11065  O O   . ASP C 3 1   ? -99.753  4.315   9.527   1.00 0.00 ? 4   ASP M O   2  
ATOM 11066  C CB  . ASP C 3 1   ? -99.844  2.752   6.507   1.00 0.00 ? 4   ASP M CB  2  
ATOM 11067  C CG  . ASP C 3 1   ? -99.085  2.899   5.215   1.00 0.00 ? 4   ASP M CG  2  
ATOM 11068  O OD1 . ASP C 3 1   ? -97.920  2.255   5.203   1.00 0.00 ? 4   ASP M OD1 2  
ATOM 11069  O OD2 . ASP C 3 1   ? -99.462  3.603   4.283   1.00 0.00 ? 4   ASP M OD2 2  
ATOM 11070  N N   . ALA C 3 2   ? -100.400 2.122   9.340   1.00 0.00 ? 5   ALA M N   2  
ATOM 11071  C CA  . ALA C 3 2   ? -101.184 2.099   10.552  1.00 0.00 ? 5   ALA M CA  2  
ATOM 11072  C C   . ALA C 3 2   ? -100.259 2.439   11.705  1.00 0.00 ? 5   ALA M C   2  
ATOM 11073  O O   . ALA C 3 2   ? -100.483 3.341   12.512  1.00 0.00 ? 5   ALA M O   2  
ATOM 11074  C CB  . ALA C 3 2   ? -101.790 0.704   10.727  1.00 0.00 ? 5   ALA M CB  2  
ATOM 11075  N N   . GLU C 3 3   ? -99.145  1.708   11.734  1.00 0.00 ? 6   GLU M N   2  
ATOM 11076  C CA  . GLU C 3 3   ? -98.113  1.882   12.739  1.00 0.00 ? 6   GLU M CA  2  
ATOM 11077  C C   . GLU C 3 3   ? -97.653  3.314   12.819  1.00 0.00 ? 6   GLU M C   2  
ATOM 11078  O O   . GLU C 3 3   ? -97.800  3.999   13.839  1.00 0.00 ? 6   GLU M O   2  
ATOM 11079  C CB  . GLU C 3 3   ? -96.902  1.010   12.408  1.00 0.00 ? 6   GLU M CB  2  
ATOM 11080  C CG  . GLU C 3 3   ? -97.087  -0.450  12.853  1.00 0.00 ? 6   GLU M CG  2  
ATOM 11081  C CD  . GLU C 3 3   ? -95.809  -1.259  12.762  1.00 0.00 ? 6   GLU M CD  2  
ATOM 11082  O OE1 . GLU C 3 3   ? -94.861  -0.636  12.087  1.00 0.00 ? 6   GLU M OE1 2  
ATOM 11083  O OE2 . GLU C 3 3   ? -95.663  -2.380  13.262  1.00 0.00 ? 6   GLU M OE2 2  
ATOM 11084  N N   . MET C 3 4   ? -97.049  3.760   11.722  1.00 0.00 ? 7   MET M N   2  
ATOM 11085  C CA  . MET C 3 4   ? -96.559  5.104   11.614  1.00 0.00 ? 7   MET M CA  2  
ATOM 11086  C C   . MET C 3 4   ? -97.649  6.117   11.861  1.00 0.00 ? 7   MET M C   2  
ATOM 11087  O O   . MET C 3 4   ? -98.648  6.179   11.170  1.00 0.00 ? 7   MET M O   2  
ATOM 11088  C CB  . MET C 3 4   ? -95.832  5.406   10.297  1.00 0.00 ? 7   MET M CB  2  
ATOM 11089  C CG  . MET C 3 4   ? -95.033  4.208   9.783   1.00 0.00 ? 7   MET M CG  2  
ATOM 11090  S SD  . MET C 3 4   ? -93.217  4.422   9.783   1.00 0.00 ? 7   MET M SD  2  
ATOM 11091  C CE  . MET C 3 4   ? -93.016  5.703   8.522   1.00 0.00 ? 7   MET M CE  2  
ATOM 11092  N N   . ALA C 3 5   ? -97.392  6.892   12.875  1.00 0.00 ? 8   ALA M N   2  
ATOM 11093  C CA  . ALA C 3 5   ? -98.252  7.934   13.304  1.00 0.00 ? 8   ALA M CA  2  
ATOM 11094  C C   . ALA C 3 5   ? -97.382  8.810   14.151  1.00 0.00 ? 8   ALA M C   2  
ATOM 11095  O O   . ALA C 3 5   ? -97.315  10.026  13.923  1.00 0.00 ? 8   ALA M O   2  
ATOM 11096  C CB  . ALA C 3 5   ? -99.356  7.330   14.145  1.00 0.00 ? 8   ALA M CB  2  
ATOM 11097  N N   . ALA C 3 6   ? -96.703  8.102   15.086  1.00 0.00 ? 9   ALA M N   2  
ATOM 11098  C CA  . ALA C 3 6   ? -95.772  8.690   16.025  1.00 0.00 ? 9   ALA M CA  2  
ATOM 11099  C C   . ALA C 3 6   ? -94.907  9.709   15.291  1.00 0.00 ? 9   ALA M C   2  
ATOM 11100  O O   . ALA C 3 6   ? -94.815  10.877  15.673  1.00 0.00 ? 9   ALA M O   2  
ATOM 11101  C CB  . ALA C 3 6   ? -94.932  7.584   16.642  1.00 0.00 ? 9   ALA M CB  2  
ATOM 11102  N N   . PHE C 3 7   ? -94.340  9.220   14.172  1.00 0.00 ? 10  PHE M N   2  
ATOM 11103  C CA  . PHE C 3 7   ? -93.506  10.041  13.326  1.00 0.00 ? 10  PHE M CA  2  
ATOM 11104  C C   . PHE C 3 7   ? -94.392  10.910  12.489  1.00 0.00 ? 10  PHE M C   2  
ATOM 11105  O O   . PHE C 3 7   ? -94.321  12.133  12.453  1.00 0.00 ? 10  PHE M O   2  
ATOM 11106  C CB  . PHE C 3 7   ? -92.758  9.131   12.343  1.00 0.00 ? 10  PHE M CB  2  
ATOM 11107  C CG  . PHE C 3 7   ? -92.288  7.849   12.976  1.00 0.00 ? 10  PHE M CG  2  
ATOM 11108  C CD1 . PHE C 3 7   ? -93.126  6.736   12.983  1.00 0.00 ? 10  PHE M CD1 2  
ATOM 11109  C CD2 . PHE C 3 7   ? -91.019  7.731   13.544  1.00 0.00 ? 10  PHE M CD2 2  
ATOM 11110  C CE1 . PHE C 3 7   ? -92.708  5.535   13.553  1.00 0.00 ? 10  PHE M CE1 2  
ATOM 11111  C CE2 . PHE C 3 7   ? -90.592  6.538   14.116  1.00 0.00 ? 10  PHE M CE2 2  
ATOM 11112  C CZ  . PHE C 3 7   ? -91.452  5.441   14.137  1.00 0.00 ? 10  PHE M CZ  2  
ATOM 11113  N N   . GLY C 3 8   ? -95.263  10.193  11.791  1.00 0.00 ? 11  GLY M N   2  
ATOM 11114  C CA  . GLY C 3 8   ? -96.193  10.803  10.913  1.00 0.00 ? 11  GLY M CA  2  
ATOM 11115  C C   . GLY C 3 8   ? -95.446  11.682  9.929   1.00 0.00 ? 11  GLY M C   2  
ATOM 11116  O O   . GLY C 3 8   ? -95.056  11.232  8.851   1.00 0.00 ? 11  GLY M O   2  
ATOM 11117  N N   . GLU C 3 9   ? -95.190  12.918  10.350  1.00 0.00 ? 12  GLU M N   2  
ATOM 11118  C CA  . GLU C 3 9   ? -94.514  13.866  9.497   1.00 0.00 ? 12  GLU M CA  2  
ATOM 11119  C C   . GLU C 3 9   ? -93.134  13.422  9.048   1.00 0.00 ? 12  GLU M C   2  
ATOM 11120  O O   . GLU C 3 9   ? -92.768  13.692  7.884   1.00 0.00 ? 12  GLU M O   2  
ATOM 11121  C CB  . GLU C 3 9   ? -94.593  15.302  10.046  1.00 0.00 ? 12  GLU M CB  2  
ATOM 11122  C CG  . GLU C 3 9   ? -95.393  16.271  9.134   1.00 0.00 ? 12  GLU M CG  2  
ATOM 11123  C CD  . GLU C 3 9   ? -96.796  16.593  9.612   1.00 0.00 ? 12  GLU M CD  2  
ATOM 11124  O OE1 . GLU C 3 9   ? -97.637  15.757  9.911   1.00 0.00 ? 12  GLU M OE1 2  
ATOM 11125  O OE2 . GLU C 3 9   ? -97.013  17.882  9.676   1.00 0.00 ? 12  GLU M OE2 2  
ATOM 11126  N N   . ALA C 3 10  ? -92.447  12.653  9.889   1.00 0.00 ? 13  ALA M N   2  
ATOM 11127  C CA  . ALA C 3 10  ? -91.108  12.192  9.576   1.00 0.00 ? 13  ALA M CA  2  
ATOM 11128  C C   . ALA C 3 10  ? -91.109  10.956  8.693   1.00 0.00 ? 13  ALA M C   2  
ATOM 11129  O O   . ALA C 3 10  ? -90.203  10.753  7.844   1.00 0.00 ? 13  ALA M O   2  
ATOM 11130  C CB  . ALA C 3 10  ? -90.372  12.008  10.888  1.00 0.00 ? 13  ALA M CB  2  
ATOM 11131  N N   . ALA C 3 11  ? -92.192  10.195  8.876   1.00 0.00 ? 14  ALA M N   2  
ATOM 11132  C CA  . ALA C 3 11  ? -92.458  8.933   8.214   1.00 0.00 ? 14  ALA M CA  2  
ATOM 11133  C C   . ALA C 3 11  ? -91.869  8.787   6.834   1.00 0.00 ? 14  ALA M C   2  
ATOM 11134  O O   . ALA C 3 11  ? -91.157  7.839   6.541   1.00 0.00 ? 14  ALA M O   2  
ATOM 11135  C CB  . ALA C 3 11  ? -93.921  8.747   8.212   1.00 0.00 ? 14  ALA M CB  2  
ATOM 11136  N N   . PRO C 3 12  ? -92.204  9.716   5.975   1.00 0.00 ? 15  PRO M N   2  
ATOM 11137  C CA  . PRO C 3 12  ? -91.733  9.656   4.605   1.00 0.00 ? 15  PRO M CA  2  
ATOM 11138  C C   . PRO C 3 12  ? -90.227  9.544   4.461   1.00 0.00 ? 15  PRO M C   2  
ATOM 11139  O O   . PRO C 3 12  ? -89.755  9.064   3.403   1.00 0.00 ? 15  PRO M O   2  
ATOM 11140  C CB  . PRO C 3 12  ? -92.327  10.899  3.883   1.00 0.00 ? 15  PRO M CB  2  
ATOM 11141  C CG  . PRO C 3 12  ? -93.083  11.703  4.965   1.00 0.00 ? 15  PRO M CG  2  
ATOM 11142  C CD  . PRO C 3 12  ? -92.994  10.934  6.282   1.00 0.00 ? 15  PRO M CD  2  
ATOM 11143  N N   . TYR C 3 13  ? -89.496  9.983   5.498   1.00 0.00 ? 16  TYR M N   2  
ATOM 11144  C CA  . TYR C 3 13  ? -88.031  9.990   5.496   1.00 0.00 ? 16  TYR M CA  2  
ATOM 11145  C C   . TYR C 3 13  ? -87.424  8.823   6.233   1.00 0.00 ? 16  TYR M C   2  
ATOM 11146  O O   . TYR C 3 13  ? -86.201  8.618   6.195   1.00 0.00 ? 16  TYR M O   2  
ATOM 11147  C CB  . TYR C 3 13  ? -87.492  11.309  6.067   1.00 0.00 ? 16  TYR M CB  2  
ATOM 11148  C CG  . TYR C 3 13  ? -88.089  12.523  5.373   1.00 0.00 ? 16  TYR M CG  2  
ATOM 11149  C CD1 . TYR C 3 13  ? -87.759  12.839  4.054   1.00 0.00 ? 16  TYR M CD1 2  
ATOM 11150  C CD2 . TYR C 3 13  ? -88.991  13.342  6.046   1.00 0.00 ? 16  TYR M CD2 2  
ATOM 11151  C CE1 . TYR C 3 13  ? -88.305  13.954  3.422   1.00 0.00 ? 16  TYR M CE1 2  
ATOM 11152  C CE2 . TYR C 3 13  ? -89.543  14.478  5.435   1.00 0.00 ? 16  TYR M CE2 2  
ATOM 11153  C CZ  . TYR C 3 13  ? -89.201  14.769  4.114   1.00 0.00 ? 16  TYR M CZ  2  
ATOM 11154  O OH  . TYR C 3 13  ? -89.763  15.869  3.509   1.00 0.00 ? 16  TYR M OH  2  
ATOM 11155  N N   . LEU C 3 14  ? -88.314  8.066   6.875   1.00 0.00 ? 17  LEU M N   2  
ATOM 11156  C CA  . LEU C 3 14  ? -87.999  6.872   7.644   1.00 0.00 ? 17  LEU M CA  2  
ATOM 11157  C C   . LEU C 3 14  ? -88.405  5.603   6.935   1.00 0.00 ? 17  LEU M C   2  
ATOM 11158  O O   . LEU C 3 14  ? -87.606  4.683   6.762   1.00 0.00 ? 17  LEU M O   2  
ATOM 11159  C CB  . LEU C 3 14  ? -88.833  6.905   8.941   1.00 0.00 ? 17  LEU M CB  2  
ATOM 11160  C CG  . LEU C 3 14  ? -88.063  7.510   10.098  1.00 0.00 ? 17  LEU M CG  2  
ATOM 11161  C CD1 . LEU C 3 14  ? -87.046  8.435   9.518   1.00 0.00 ? 17  LEU M CD1 2  
ATOM 11162  C CD2 . LEU C 3 14  ? -88.927  8.261   11.130  1.00 0.00 ? 17  LEU M CD2 2  
ATOM 11163  N N   . ARG C 3 15  ? -89.670  5.626   6.507   1.00 0.00 ? 18  ARG M N   2  
ATOM 11164  C CA  . ARG C 3 15  ? -90.295  4.551   5.778   1.00 0.00 ? 18  ARG M CA  2  
ATOM 11165  C C   . ARG C 3 15  ? -91.138  5.039   4.650   1.00 0.00 ? 18  ARG M C   2  
ATOM 11166  O O   . ARG C 3 15  ? -91.469  6.213   4.635   1.00 0.00 ? 18  ARG M O   2  
ATOM 11167  C CB  . ARG C 3 15  ? -91.115  3.690   6.717   1.00 0.00 ? 18  ARG M CB  2  
ATOM 11168  C CG  . ARG C 3 15  ? -90.646  2.222   6.733   1.00 0.00 ? 18  ARG M CG  2  
ATOM 11169  C CD  . ARG C 3 15  ? -91.309  1.347   7.816   1.00 0.00 ? 18  ARG M CD  2  
ATOM 11170  N NE  . ARG C 3 15  ? -90.520  0.174   8.200   1.00 0.00 ? 18  ARG M NE  2  
ATOM 11171  C CZ  . ARG C 3 15  ? -90.783  -0.590  9.250   1.00 0.00 ? 18  ARG M CZ  2  
ATOM 11172  N NH1 . ARG C 3 15  ? -91.820  -0.355  10.068  1.00 0.00 ? 18  ARG M NH1 2  
ATOM 11173  N NH2 . ARG C 3 15  ? -90.021  -1.637  9.497   1.00 0.00 ? 18  ARG M NH2 2  
ATOM 11174  N N   . LYS C 3 16  ? -91.477  4.134   3.722   1.00 0.00 ? 19  LYS M N   2  
ATOM 11175  C CA  . LYS C 3 16  ? -92.300  4.478   2.570   1.00 0.00 ? 19  LYS M CA  2  
ATOM 11176  C C   . LYS C 3 16  ? -93.718  3.932   2.658   1.00 0.00 ? 19  LYS M C   2  
ATOM 11177  O O   . LYS C 3 16  ? -94.005  2.990   3.388   1.00 0.00 ? 19  LYS M O   2  
ATOM 11178  C CB  . LYS C 3 16  ? -91.648  4.132   1.282   1.00 0.00 ? 19  LYS M CB  2  
ATOM 11179  C CG  . LYS C 3 16  ? -90.701  5.202   0.748   1.00 0.00 ? 19  LYS M CG  2  
ATOM 11180  C CD  . LYS C 3 16  ? -91.303  6.598   0.716   1.00 0.00 ? 19  LYS M CD  2  
ATOM 11181  C CE  . LYS C 3 16  ? -90.746  7.438   -0.433  1.00 0.00 ? 19  LYS M CE  2  
ATOM 11182  N NZ  . LYS C 3 16  ? -90.945  8.887   -0.274  1.00 0.00 ? 19  LYS M NZ  2  
ATOM 11183  N N   . SER C 3 17  ? -94.651  4.567   1.936   1.00 0.00 ? 20  SER M N   2  
ATOM 11184  C CA  . SER C 3 17  ? -96.030  4.114   2.003   1.00 0.00 ? 20  SER M CA  2  
ATOM 11185  C C   . SER C 3 17  ? -96.126  2.665   1.617   1.00 0.00 ? 20  SER M C   2  
ATOM 11186  O O   . SER C 3 17  ? -95.448  2.183   0.697   1.00 0.00 ? 20  SER M O   2  
ATOM 11187  C CB  . SER C 3 17  ? -96.955  4.958   1.158   1.00 0.00 ? 20  SER M CB  2  
ATOM 11188  O OG  . SER C 3 17  ? -97.360  4.204   0.032   1.00 0.00 ? 20  SER M OG  2  
ATOM 11189  N N   . GLU C 3 18  ? -96.992  1.974   2.310   1.00 0.00 ? 21  GLU M N   2  
ATOM 11190  C CA  . GLU C 3 18  ? -97.227  0.545   2.098   1.00 0.00 ? 21  GLU M CA  2  
ATOM 11191  C C   . GLU C 3 18  ? -97.558  0.109   0.702   1.00 0.00 ? 21  GLU M C   2  
ATOM 11192  O O   . GLU C 3 18  ? -97.841  -1.036  0.514   1.00 0.00 ? 21  GLU M O   2  
ATOM 11193  C CB  . GLU C 3 18  ? -98.284  0.000   3.058   1.00 0.00 ? 21  GLU M CB  2  
ATOM 11194  C CG  . GLU C 3 18  ? -98.122  -1.495  3.320   1.00 0.00 ? 21  GLU M CG  2  
ATOM 11195  C CD  . GLU C 3 18  ? -98.993  -1.914  4.486   1.00 0.00 ? 21  GLU M CD  2  
ATOM 11196  O OE1 . GLU C 3 18  ? -99.534  -1.138  5.262   1.00 0.00 ? 21  GLU M OE1 2  
ATOM 11197  O OE2 . GLU C 3 18  ? -99.160  -3.212  4.571   1.00 0.00 ? 21  GLU M OE2 2  
ATOM 11198  N N   . LYS C 3 19  ? -97.529  0.981   -0.276  1.00 0.00 ? 22  LYS M N   2  
ATOM 11199  C CA  . LYS C 3 19  ? -97.808  0.485   -1.589  1.00 0.00 ? 22  LYS M CA  2  
ATOM 11200  C C   . LYS C 3 19  ? -96.627  0.854   -2.443  1.00 0.00 ? 22  LYS M C   2  
ATOM 11201  O O   . LYS C 3 19  ? -96.280  0.169   -3.404  1.00 0.00 ? 22  LYS M O   2  
ATOM 11202  C CB  . LYS C 3 19  ? -99.204  0.747   -2.125  1.00 0.00 ? 22  LYS M CB  2  
ATOM 11203  C CG  . LYS C 3 19  ? -99.721  2.168   -1.932  1.00 0.00 ? 22  LYS M CG  2  
ATOM 11204  C CD  . LYS C 3 19  ? -100.181 2.793   -3.251  1.00 0.00 ? 22  LYS M CD  2  
ATOM 11205  C CE  . LYS C 3 19  ? -99.927  4.305   -3.301  1.00 0.00 ? 22  LYS M CE  2  
ATOM 11206  N NZ  . LYS C 3 19  ? -99.789  4.818   -4.664  1.00 0.00 ? 22  LYS M NZ  2  
ATOM 11207  N N   . GLU C 3 20  ? -95.966  1.935   -1.948  1.00 0.00 ? 23  GLU M N   2  
ATOM 11208  C CA  . GLU C 3 20  ? -94.769  2.409   -2.596  1.00 0.00 ? 23  GLU M CA  2  
ATOM 11209  C C   . GLU C 3 20  ? -93.801  1.257   -2.511  1.00 0.00 ? 23  GLU M C   2  
ATOM 11210  O O   . GLU C 3 20  ? -92.983  0.935   -3.421  1.00 0.00 ? 23  GLU M O   2  
ATOM 11211  C CB  . GLU C 3 20  ? -94.232  3.639   -1.862  1.00 0.00 ? 23  GLU M CB  2  
ATOM 11212  C CG  . GLU C 3 20  ? -94.485  4.905   -2.696  1.00 0.00 ? 23  GLU M CG  2  
ATOM 11213  C CD  . GLU C 3 20  ? -94.587  6.118   -1.805  1.00 0.00 ? 23  GLU M CD  2  
ATOM 11214  O OE1 . GLU C 3 20  ? -94.931  5.826   -0.555  1.00 0.00 ? 23  GLU M OE1 2  
ATOM 11215  O OE2 . GLU C 3 20  ? -94.306  7.241   -2.198  1.00 0.00 ? 23  GLU M OE2 2  
ATOM 11216  N N   . ARG C 3 21  ? -93.977  0.585   -1.383  1.00 0.00 ? 24  ARG M N   2  
ATOM 11217  C CA  . ARG C 3 21  ? -93.198  -0.582  -1.080  1.00 0.00 ? 24  ARG M CA  2  
ATOM 11218  C C   . ARG C 3 21  ? -93.647  -1.639  -2.061  1.00 0.00 ? 24  ARG M C   2  
ATOM 11219  O O   . ARG C 3 21  ? -92.912  -2.084  -2.971  1.00 0.00 ? 24  ARG M O   2  
ATOM 11220  C CB  . ARG C 3 21  ? -93.557  -1.042  0.329   1.00 0.00 ? 24  ARG M CB  2  
ATOM 11221  C CG  . ARG C 3 21  ? -92.908  -0.256  1.452   1.00 0.00 ? 24  ARG M CG  2  
ATOM 11222  C CD  . ARG C 3 21  ? -92.961  -0.956  2.824   1.00 0.00 ? 24  ARG M CD  2  
ATOM 11223  N NE  . ARG C 3 21  ? -93.737  -0.197  3.810   1.00 0.00 ? 24  ARG M NE  2  
ATOM 11224  C CZ  . ARG C 3 21  ? -94.516  -0.754  4.739   1.00 0.00 ? 24  ARG M CZ  2  
ATOM 11225  N NH1 . ARG C 3 21  ? -94.607  -2.067  4.882   1.00 0.00 ? 24  ARG M NH1 2  
ATOM 11226  N NH2 . ARG C 3 21  ? -95.187  0.035   5.584   1.00 0.00 ? 24  ARG M NH2 2  
ATOM 11227  N N   . ILE C 3 22  ? -94.911  -2.007  -1.848  1.00 0.00 ? 25  ILE M N   2  
ATOM 11228  C CA  . ILE C 3 22  ? -95.610  -2.998  -2.627  1.00 0.00 ? 25  ILE M CA  2  
ATOM 11229  C C   . ILE C 3 22  ? -95.458  -2.858  -4.128  1.00 0.00 ? 25  ILE M C   2  
ATOM 11230  O O   . ILE C 3 22  ? -95.334  -3.822  -4.840  1.00 0.00 ? 25  ILE M O   2  
ATOM 11231  C CB  . ILE C 3 22  ? -97.061  -2.992  -2.274  1.00 0.00 ? 25  ILE M CB  2  
ATOM 11232  C CG1 . ILE C 3 22  ? -97.236  -3.405  -0.815  1.00 0.00 ? 25  ILE M CG1 2  
ATOM 11233  C CG2 . ILE C 3 22  ? -97.686  -4.009  -3.148  1.00 0.00 ? 25  ILE M CG2 2  
ATOM 11234  C CD1 . ILE C 3 22  ? -98.580  -4.081  -0.568  1.00 0.00 ? 25  ILE M CD1 2  
ATOM 11235  N N   . GLU C 3 23  ? -95.502  -1.634  -4.596  1.00 0.00 ? 26  GLU M N   2  
ATOM 11236  C CA  . GLU C 3 23  ? -95.341  -1.349  -5.986  1.00 0.00 ? 26  GLU M CA  2  
ATOM 11237  C C   . GLU C 3 23  ? -93.916  -1.554  -6.443  1.00 0.00 ? 26  GLU M C   2  
ATOM 11238  O O   . GLU C 3 23  ? -93.584  -1.552  -7.646  1.00 0.00 ? 26  GLU M O   2  
ATOM 11239  C CB  . GLU C 3 23  ? -95.691  0.108   -6.269  1.00 0.00 ? 26  GLU M CB  2  
ATOM 11240  C CG  . GLU C 3 23  ? -97.173  0.420   -6.066  1.00 0.00 ? 26  GLU M CG  2  
ATOM 11241  C CD  . GLU C 3 23  ? -97.515  1.819   -6.486  1.00 0.00 ? 26  GLU M CD  2  
ATOM 11242  O OE1 . GLU C 3 23  ? -96.876  2.173   -7.596  1.00 0.00 ? 26  GLU M OE1 2  
ATOM 11243  O OE2 . GLU C 3 23  ? -98.190  2.578   -5.814  1.00 0.00 ? 26  GLU M OE2 2  
ATOM 11244  N N   . ALA C 3 24  ? -93.029  -1.649  -5.466  1.00 0.00 ? 27  ALA M N   2  
ATOM 11245  C CA  . ALA C 3 24  ? -91.628  -1.806  -5.748  1.00 0.00 ? 27  ALA M CA  2  
ATOM 11246  C C   . ALA C 3 24  ? -91.108  -3.225  -5.643  1.00 0.00 ? 27  ALA M C   2  
ATOM 11247  O O   . ALA C 3 24  ? -90.274  -3.650  -6.439  1.00 0.00 ? 27  ALA M O   2  
ATOM 11248  C CB  . ALA C 3 24  ? -90.835  -0.885  -4.845  1.00 0.00 ? 27  ALA M CB  2  
ATOM 11249  N N   . GLN C 3 25  ? -91.594  -3.935  -4.626  1.00 0.00 ? 28  GLN M N   2  
ATOM 11250  C CA  . GLN C 3 25  ? -91.171  -5.304  -4.412  1.00 0.00 ? 28  GLN M CA  2  
ATOM 11251  C C   . GLN C 3 25  ? -91.857  -6.267  -5.379  1.00 0.00 ? 28  GLN M C   2  
ATOM 11252  O O   . GLN C 3 25  ? -91.307  -7.300  -5.740  1.00 0.00 ? 28  GLN M O   2  
ATOM 11253  C CB  . GLN C 3 25  ? -91.437  -5.727  -2.966  1.00 0.00 ? 28  GLN M CB  2  
ATOM 11254  C CG  . GLN C 3 25  ? -91.123  -4.659  -1.940  1.00 0.00 ? 28  GLN M CG  2  
ATOM 11255  C CD  . GLN C 3 25  ? -91.123  -5.235  -0.538  1.00 0.00 ? 28  GLN M CD  2  
ATOM 11256  O OE1 . GLN C 3 25  ? -91.700  -6.314  -0.314  1.00 0.00 ? 28  GLN M OE1 2  
ATOM 11257  N NE2 . GLN C 3 25  ? -90.514  -4.485  0.389   1.00 0.00 ? 28  GLN M NE2 2  
ATOM 11258  N N   . ASN C 3 26  ? -93.090  -5.920  -5.734  1.00 0.00 ? 29  ASN M N   2  
ATOM 11259  C CA  . ASN C 3 26  ? -93.907  -6.732  -6.599  1.00 0.00 ? 29  ASN M CA  2  
ATOM 11260  C C   . ASN C 3 26  ? -93.915  -6.136  -7.987  1.00 0.00 ? 29  ASN M C   2  
ATOM 11261  O O   . ASN C 3 26  ? -94.789  -5.412  -8.399  1.00 0.00 ? 29  ASN M O   2  
ATOM 11262  C CB  .