data_2W4T
# 
_entry.id   2W4T 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2W4T         
PDBE  EBI-37707    
WWPDB D_1290037707 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB  1SR6     unspecified            'STRUCTURE OF NUCLEOTIDE-FREE SCALLOP MYOSIN S1' 
PDB  1S5G     unspecified            'STRUCTURE OF SCALLOP MYOSIN S1 REVEALS A NOVEL NUCLEOTIDECONFORMATION' 
PDB  1QVI     unspecified            
'CRYSTAL STRUCTURE OF SCALLOP MYOSIN S1 IN THE PRE-POWERSTROKE STATE TO 2.6 ANGSTROM RESOLUTION: FLEXIBILITY ANDFUNCTION IN THE HEAD' 
PDB  2W4W     unspecified            
'ISOMETRICALLY CONTRACTING INSECT ASYNCHRONOUS FLIGHT MUSCLE QUICK FROZEN AFTER A QUICK STRETCH STEP' 
PDB  1KQM     unspecified            'SCALLOP MYOSIN S1-AMPPNP IN THE ACTIN- DETACHED CONFORMATION' 
PDB  1KWO     unspecified            'SCALLOP MYOSIN S1-ATPGAMMAS-P-PDM IN THE ACTIN-DETACHEDCONFORMATION' 
PDB  1SCM     unspecified            'MYOSIN (REGULATORY DOMAIN)' 
PDB  1DFL     unspecified            'SCALLOP MYOSIN S1 COMPLEXED WITH MGADP: VANADATE-TRANSITION STATE' 
PDB  1B7T     unspecified            'MYOSIN DIGESTED BY PAPAIN' 
PDB  2W4V     unspecified            
'ISOMETRICALLY CONTRACTING INSECT ASYNCHRONOUS FLIGHT MUSCLE QUICK FROZEN AFTER A QUICK RELEASE STEP' 
PDB  1KK7     unspecified            'SCALLOP MYOSIN IN THE NEAR RIGOR CONFORMATION' 
PDB  1WDC     unspecified            'SCALLOP MYOSIN REGULATORY DOMAIN' 
PDB  1L2O     unspecified            'SCALLOP MYOSIN S1-ADP-P-PDM IN THE ACTIN -DETACHEDCONFORMATION' 
PDB  1DFK     unspecified            'NUCLEOTIDE-FREE SCALLOP MYOSIN S1-NEAR RIGOR STATE' 
PDB  1KK8     unspecified            'SCALLOP MYOSIN (S1-ADP-BEFX) IN THE ACTIN -DETACHEDCONFORMATION' 
EMDB EMD-1561 'associated EM volume' 
'ELECTRON TOMOGRAPHY OF CRYOFIXED, ISOMETRICALLY CONTRACTING INSECT FLIGHT MUSCLE REVEALS NOVEL ACTIN-MYOSIN INTERACTIONS' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2W4T 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2008-12-02 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wu, S.'                 1  
'Liu, J.'                2  
'Reedy, M.C.'            3  
'Tregear, R.T.'          4  
'Winkler, H.'            5  
'Franzini-Armstrong, C.' 6  
'Sasaki, H.'             7  
'Lucaveche, C.'          8  
'Goldman, Y.E.'          9  
'Reedy, M.K.'            10 
'Taylor, K.A.'           11 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Electron Tomography of Cryofixed, Isometrically Contracting Insect Flight Muscle Reveals Novel Actin-Myosin Interactions' 
'Plos One'     5   12643 ?   2010 ?      US 1932-6203 ?    ? 20844746 10.1371/JOURNAL.PONE.0012643 
1       
'Methods for Identifying and Averaging Variable Molecular Conformations in Tomograms of Actively Contracting Insect Flight Muscle.' 
J.Struct.Biol. 168 485   502 2009 JSBIEM US 1047-8477 0803 ? 19698791 10.1016/j.jsb.2009.08.007    
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wu, S.'                 1  ? 
primary 'Liu, J.'                2  ? 
primary 'Reedy, M.C.'            3  ? 
primary 'Tregear, R.T.'          4  ? 
primary 'Winkler, H.'            5  ? 
primary 'Franzini-Armstrong, C.' 6  ? 
primary 'Sasaki, H.'             7  ? 
primary 'Lucaveche, C.'          8  ? 
primary 'Goldman, Y.E.'          9  ? 
primary 'Reedy, M.K.'            10 ? 
primary 'Taylor, K.A.'           11 ? 
1       'Wu, S.'                 12 ? 
1       'Liu, J.'                13 ? 
1       'Reedy, M.C.'            14 ? 
1       'Winkler, H.'            15 ? 
1       'Reedy, M.K.'            16 ? 
1       'Taylor, K.A.'           17 ? 
# 
_cell.entry_id           2W4T 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2W4T 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat 'MYOSIN HEAVY CHAIN, STRIATED MUSCLE'                     94843.883 1 ? ? 'RESIDUES 5-835'  'MYOSIN S1 HEAVY CHAIN' 
2 polymer nat 'MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE' 15575.700 1 ? ? 'RESIDUES 16-151' 
'MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE' 
3 polymer nat 'MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE'  17051.912 1 ? ? 'RESIDUES 5-155'  
'MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE'  
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'MYOSIN S1'       
2 'MYOSIN S1, R-LC' 
3 'MYOSIN S1, E-LC' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;FSDPDFQYLAVDRKKLMKEQTAAFDGKKNCWVPDEKEGFASAEIQSSKGDEITVKIVADSSTRTVKKDDIQSMNPPKFEK
LEDMANMTYLNEASVLYNLRSRYTSGLIYTYSGLFCIAVNPYRRLPIYTDSVIAKYRGKRKTEIPPHLFSVADNAYQNMV
TDRENQSCLITGESGAGKTENTKKVIMYLAKVACAVKKKDEEASDKKEGSLEDQIIQANPVLEAYGNAKTTRNNNSSRFG
KFIRIHFGPTGKIAGADIETYLLEKSRVTYQQSAERNYHIFYQICSNAIPELNDVMLVTPDSGLYSFINQGCLTVDNIDD
VEEFKLCDEAFDILGFTKEEKQSMFKCTASILHMGEMKFKQRPREEQAESDGTAEAEKVAFLCGINAGDLLKALLKPKVK
VGTEMVTKGQNMNQVVNSVGALAKSLYDRMFNWLVRRVNKTLDTKAKRNYYIGVLDIAGFEIFDFNSFEQLCINYTNERL
QQFFNHHMFILEQEEYKKEGIAWEFIDFGMDLQMCIDLIEKPMGILSILEEECMFPKADDKSFQDKLYQNHMGKNRMFTK
PGKPTRPNQGPAHFELHHYAGNVPYSITGWLEKNKDPINENVVALLGASKEPLVAELFKAPEEPAGGGKKKKGKSSAFQT
ISAVHRESLNKLMKNLYSTHPHFVRCIIPNELKQPGLVDAELVLHQLQCNGVLEGIRICRKGFPSRLIYSEFKQRYSILA
PNAIPQGFVDGKTVSEKILAGLQMDPAEYRLGTTKVFFKAGVLGNLEEMRDERLSKIISMFQAHIRGYLIRKAYKKLQDQ
RIGLSVIQRNIRKWLVLRNWQWWKLYSKVKP
;
;FSDPDFQYLAVDRKKLMKEQTAAFDGKKNCWVPDEKEGFASAEIQSSKGDEITVKIVADSSTRTVKKDDIQSMNPPKFEK
LEDMANMTYLNEASVLYNLRSRYTSGLIYTYSGLFCIAVNPYRRLPIYTDSVIAKYRGKRKTEIPPHLFSVADNAYQNMV
TDRENQSCLITGESGAGKTENTKKVIMYLAKVACAVKKKDEEASDKKEGSLEDQIIQANPVLEAYGNAKTTRNNNSSRFG
KFIRIHFGPTGKIAGADIETYLLEKSRVTYQQSAERNYHIFYQICSNAIPELNDVMLVTPDSGLYSFINQGCLTVDNIDD
VEEFKLCDEAFDILGFTKEEKQSMFKCTASILHMGEMKFKQRPREEQAESDGTAEAEKVAFLCGINAGDLLKALLKPKVK
VGTEMVTKGQNMNQVVNSVGALAKSLYDRMFNWLVRRVNKTLDTKAKRNYYIGVLDIAGFEIFDFNSFEQLCINYTNERL
QQFFNHHMFILEQEEYKKEGIAWEFIDFGMDLQMCIDLIEKPMGILSILEEECMFPKADDKSFQDKLYQNHMGKNRMFTK
PGKPTRPNQGPAHFELHHYAGNVPYSITGWLEKNKDPINENVVALLGASKEPLVAELFKAPEEPAGGGKKKKGKSSAFQT
ISAVHRESLNKLMKNLYSTHPHFVRCIIPNELKQPGLVDAELVLHQLQCNGVLEGIRICRKGFPSRLIYSEFKQRYSILA
PNAIPQGFVDGKTVSEKILAGLQMDPAEYRLGTTKVFFKAGVLGNLEEMRDERLSKIISMFQAHIRGYLIRKAYKKLQDQ
RIGLSVIQRNIRKWLVLRNWQWWKLYSKVKP
;
C ? 
2 'polypeptide(L)' no no 
;KQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFA
MFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKG
;
;KQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFA
MFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKG
;
Y ? 
3 'polypeptide(L)' no no 
;SQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTF
ADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYP
;
;SQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTF
ADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYP
;
Z ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PHE n 
1 2   SER n 
1 3   ASP n 
1 4   PRO n 
1 5   ASP n 
1 6   PHE n 
1 7   GLN n 
1 8   TYR n 
1 9   LEU n 
1 10  ALA n 
1 11  VAL n 
1 12  ASP n 
1 13  ARG n 
1 14  LYS n 
1 15  LYS n 
1 16  LEU n 
1 17  MET n 
1 18  LYS n 
1 19  GLU n 
1 20  GLN n 
1 21  THR n 
1 22  ALA n 
1 23  ALA n 
1 24  PHE n 
1 25  ASP n 
1 26  GLY n 
1 27  LYS n 
1 28  LYS n 
1 29  ASN n 
1 30  CYS n 
1 31  TRP n 
1 32  VAL n 
1 33  PRO n 
1 34  ASP n 
1 35  GLU n 
1 36  LYS n 
1 37  GLU n 
1 38  GLY n 
1 39  PHE n 
1 40  ALA n 
1 41  SER n 
1 42  ALA n 
1 43  GLU n 
1 44  ILE n 
1 45  GLN n 
1 46  SER n 
1 47  SER n 
1 48  LYS n 
1 49  GLY n 
1 50  ASP n 
1 51  GLU n 
1 52  ILE n 
1 53  THR n 
1 54  VAL n 
1 55  LYS n 
1 56  ILE n 
1 57  VAL n 
1 58  ALA n 
1 59  ASP n 
1 60  SER n 
1 61  SER n 
1 62  THR n 
1 63  ARG n 
1 64  THR n 
1 65  VAL n 
1 66  LYS n 
1 67  LYS n 
1 68  ASP n 
1 69  ASP n 
1 70  ILE n 
1 71  GLN n 
1 72  SER n 
1 73  MET n 
1 74  ASN n 
1 75  PRO n 
1 76  PRO n 
1 77  LYS n 
1 78  PHE n 
1 79  GLU n 
1 80  LYS n 
1 81  LEU n 
1 82  GLU n 
1 83  ASP n 
1 84  MET n 
1 85  ALA n 
1 86  ASN n 
1 87  MET n 
1 88  THR n 
1 89  TYR n 
1 90  LEU n 
1 91  ASN n 
1 92  GLU n 
1 93  ALA n 
1 94  SER n 
1 95  VAL n 
1 96  LEU n 
1 97  TYR n 
1 98  ASN n 
1 99  LEU n 
1 100 ARG n 
1 101 SER n 
1 102 ARG n 
1 103 TYR n 
1 104 THR n 
1 105 SER n 
1 106 GLY n 
1 107 LEU n 
1 108 ILE n 
1 109 TYR n 
1 110 THR n 
1 111 TYR n 
1 112 SER n 
1 113 GLY n 
1 114 LEU n 
1 115 PHE n 
1 116 CYS n 
1 117 ILE n 
1 118 ALA n 
1 119 VAL n 
1 120 ASN n 
1 121 PRO n 
1 122 TYR n 
1 123 ARG n 
1 124 ARG n 
1 125 LEU n 
1 126 PRO n 
1 127 ILE n 
1 128 TYR n 
1 129 THR n 
1 130 ASP n 
1 131 SER n 
1 132 VAL n 
1 133 ILE n 
1 134 ALA n 
1 135 LYS n 
1 136 TYR n 
1 137 ARG n 
1 138 GLY n 
1 139 LYS n 
1 140 ARG n 
1 141 LYS n 
1 142 THR n 
1 143 GLU n 
1 144 ILE n 
1 145 PRO n 
1 146 PRO n 
1 147 HIS n 
1 148 LEU n 
1 149 PHE n 
1 150 SER n 
1 151 VAL n 
1 152 ALA n 
1 153 ASP n 
1 154 ASN n 
1 155 ALA n 
1 156 TYR n 
1 157 GLN n 
1 158 ASN n 
1 159 MET n 
1 160 VAL n 
1 161 THR n 
1 162 ASP n 
1 163 ARG n 
1 164 GLU n 
1 165 ASN n 
1 166 GLN n 
1 167 SER n 
1 168 CYS n 
1 169 LEU n 
1 170 ILE n 
1 171 THR n 
1 172 GLY n 
1 173 GLU n 
1 174 SER n 
1 175 GLY n 
1 176 ALA n 
1 177 GLY n 
1 178 LYS n 
1 179 THR n 
1 180 GLU n 
1 181 ASN n 
1 182 THR n 
1 183 LYS n 
1 184 LYS n 
1 185 VAL n 
1 186 ILE n 
1 187 MET n 
1 188 TYR n 
1 189 LEU n 
1 190 ALA n 
1 191 LYS n 
1 192 VAL n 
1 193 ALA n 
1 194 CYS n 
1 195 ALA n 
1 196 VAL n 
1 197 LYS n 
1 198 LYS n 
1 199 LYS n 
1 200 ASP n 
1 201 GLU n 
1 202 GLU n 
1 203 ALA n 
1 204 SER n 
1 205 ASP n 
1 206 LYS n 
1 207 LYS n 
1 208 GLU n 
1 209 GLY n 
1 210 SER n 
1 211 LEU n 
1 212 GLU n 
1 213 ASP n 
1 214 GLN n 
1 215 ILE n 
1 216 ILE n 
1 217 GLN n 
1 218 ALA n 
1 219 ASN n 
1 220 PRO n 
1 221 VAL n 
1 222 LEU n 
1 223 GLU n 
1 224 ALA n 
1 225 TYR n 
1 226 GLY n 
1 227 ASN n 
1 228 ALA n 
1 229 LYS n 
1 230 THR n 
1 231 THR n 
1 232 ARG n 
1 233 ASN n 
1 234 ASN n 
1 235 ASN n 
1 236 SER n 
1 237 SER n 
1 238 ARG n 
1 239 PHE n 
1 240 GLY n 
1 241 LYS n 
1 242 PHE n 
1 243 ILE n 
1 244 ARG n 
1 245 ILE n 
1 246 HIS n 
1 247 PHE n 
1 248 GLY n 
1 249 PRO n 
1 250 THR n 
1 251 GLY n 
1 252 LYS n 
1 253 ILE n 
1 254 ALA n 
1 255 GLY n 
1 256 ALA n 
1 257 ASP n 
1 258 ILE n 
1 259 GLU n 
1 260 THR n 
1 261 TYR n 
1 262 LEU n 
1 263 LEU n 
1 264 GLU n 
1 265 LYS n 
1 266 SER n 
1 267 ARG n 
1 268 VAL n 
1 269 THR n 
1 270 TYR n 
1 271 GLN n 
1 272 GLN n 
1 273 SER n 
1 274 ALA n 
1 275 GLU n 
1 276 ARG n 
1 277 ASN n 
1 278 TYR n 
1 279 HIS n 
1 280 ILE n 
1 281 PHE n 
1 282 TYR n 
1 283 GLN n 
1 284 ILE n 
1 285 CYS n 
1 286 SER n 
1 287 ASN n 
1 288 ALA n 
1 289 ILE n 
1 290 PRO n 
1 291 GLU n 
1 292 LEU n 
1 293 ASN n 
1 294 ASP n 
1 295 VAL n 
1 296 MET n 
1 297 LEU n 
1 298 VAL n 
1 299 THR n 
1 300 PRO n 
1 301 ASP n 
1 302 SER n 
1 303 GLY n 
1 304 LEU n 
1 305 TYR n 
1 306 SER n 
1 307 PHE n 
1 308 ILE n 
1 309 ASN n 
1 310 GLN n 
1 311 GLY n 
1 312 CYS n 
1 313 LEU n 
1 314 THR n 
1 315 VAL n 
1 316 ASP n 
1 317 ASN n 
1 318 ILE n 
1 319 ASP n 
1 320 ASP n 
1 321 VAL n 
1 322 GLU n 
1 323 GLU n 
1 324 PHE n 
1 325 LYS n 
1 326 LEU n 
1 327 CYS n 
1 328 ASP n 
1 329 GLU n 
1 330 ALA n 
1 331 PHE n 
1 332 ASP n 
1 333 ILE n 
1 334 LEU n 
1 335 GLY n 
1 336 PHE n 
1 337 THR n 
1 338 LYS n 
1 339 GLU n 
1 340 GLU n 
1 341 LYS n 
1 342 GLN n 
1 343 SER n 
1 344 MET n 
1 345 PHE n 
1 346 LYS n 
1 347 CYS n 
1 348 THR n 
1 349 ALA n 
1 350 SER n 
1 351 ILE n 
1 352 LEU n 
1 353 HIS n 
1 354 MET n 
1 355 GLY n 
1 356 GLU n 
1 357 MET n 
1 358 LYS n 
1 359 PHE n 
1 360 LYS n 
1 361 GLN n 
1 362 ARG n 
1 363 PRO n 
1 364 ARG n 
1 365 GLU n 
1 366 GLU n 
1 367 GLN n 
1 368 ALA n 
1 369 GLU n 
1 370 SER n 
1 371 ASP n 
1 372 GLY n 
1 373 THR n 
1 374 ALA n 
1 375 GLU n 
1 376 ALA n 
1 377 GLU n 
1 378 LYS n 
1 379 VAL n 
1 380 ALA n 
1 381 PHE n 
1 382 LEU n 
1 383 CYS n 
1 384 GLY n 
1 385 ILE n 
1 386 ASN n 
1 387 ALA n 
1 388 GLY n 
1 389 ASP n 
1 390 LEU n 
1 391 LEU n 
1 392 LYS n 
1 393 ALA n 
1 394 LEU n 
1 395 LEU n 
1 396 LYS n 
1 397 PRO n 
1 398 LYS n 
1 399 VAL n 
1 400 LYS n 
1 401 VAL n 
1 402 GLY n 
1 403 THR n 
1 404 GLU n 
1 405 MET n 
1 406 VAL n 
1 407 THR n 
1 408 LYS n 
1 409 GLY n 
1 410 GLN n 
1 411 ASN n 
1 412 MET n 
1 413 ASN n 
1 414 GLN n 
1 415 VAL n 
1 416 VAL n 
1 417 ASN n 
1 418 SER n 
1 419 VAL n 
1 420 GLY n 
1 421 ALA n 
1 422 LEU n 
1 423 ALA n 
1 424 LYS n 
1 425 SER n 
1 426 LEU n 
1 427 TYR n 
1 428 ASP n 
1 429 ARG n 
1 430 MET n 
1 431 PHE n 
1 432 ASN n 
1 433 TRP n 
1 434 LEU n 
1 435 VAL n 
1 436 ARG n 
1 437 ARG n 
1 438 VAL n 
1 439 ASN n 
1 440 LYS n 
1 441 THR n 
1 442 LEU n 
1 443 ASP n 
1 444 THR n 
1 445 LYS n 
1 446 ALA n 
1 447 LYS n 
1 448 ARG n 
1 449 ASN n 
1 450 TYR n 
1 451 TYR n 
1 452 ILE n 
1 453 GLY n 
1 454 VAL n 
1 455 LEU n 
1 456 ASP n 
1 457 ILE n 
1 458 ALA n 
1 459 GLY n 
1 460 PHE n 
1 461 GLU n 
1 462 ILE n 
1 463 PHE n 
1 464 ASP n 
1 465 PHE n 
1 466 ASN n 
1 467 SER n 
1 468 PHE n 
1 469 GLU n 
1 470 GLN n 
1 471 LEU n 
1 472 CYS n 
1 473 ILE n 
1 474 ASN n 
1 475 TYR n 
1 476 THR n 
1 477 ASN n 
1 478 GLU n 
1 479 ARG n 
1 480 LEU n 
1 481 GLN n 
1 482 GLN n 
1 483 PHE n 
1 484 PHE n 
1 485 ASN n 
1 486 HIS n 
1 487 HIS n 
1 488 MET n 
1 489 PHE n 
1 490 ILE n 
1 491 LEU n 
1 492 GLU n 
1 493 GLN n 
1 494 GLU n 
1 495 GLU n 
1 496 TYR n 
1 497 LYS n 
1 498 LYS n 
1 499 GLU n 
1 500 GLY n 
1 501 ILE n 
1 502 ALA n 
1 503 TRP n 
1 504 GLU n 
1 505 PHE n 
1 506 ILE n 
1 507 ASP n 
1 508 PHE n 
1 509 GLY n 
1 510 MET n 
1 511 ASP n 
1 512 LEU n 
1 513 GLN n 
1 514 MET n 
1 515 CYS n 
1 516 ILE n 
1 517 ASP n 
1 518 LEU n 
1 519 ILE n 
1 520 GLU n 
1 521 LYS n 
1 522 PRO n 
1 523 MET n 
1 524 GLY n 
1 525 ILE n 
1 526 LEU n 
1 527 SER n 
1 528 ILE n 
1 529 LEU n 
1 530 GLU n 
1 531 GLU n 
1 532 GLU n 
1 533 CYS n 
1 534 MET n 
1 535 PHE n 
1 536 PRO n 
1 537 LYS n 
1 538 ALA n 
1 539 ASP n 
1 540 ASP n 
1 541 LYS n 
1 542 SER n 
1 543 PHE n 
1 544 GLN n 
1 545 ASP n 
1 546 LYS n 
1 547 LEU n 
1 548 TYR n 
1 549 GLN n 
1 550 ASN n 
1 551 HIS n 
1 552 MET n 
1 553 GLY n 
1 554 LYS n 
1 555 ASN n 
1 556 ARG n 
1 557 MET n 
1 558 PHE n 
1 559 THR n 
1 560 LYS n 
1 561 PRO n 
1 562 GLY n 
1 563 LYS n 
1 564 PRO n 
1 565 THR n 
1 566 ARG n 
1 567 PRO n 
1 568 ASN n 
1 569 GLN n 
1 570 GLY n 
1 571 PRO n 
1 572 ALA n 
1 573 HIS n 
1 574 PHE n 
1 575 GLU n 
1 576 LEU n 
1 577 HIS n 
1 578 HIS n 
1 579 TYR n 
1 580 ALA n 
1 581 GLY n 
1 582 ASN n 
1 583 VAL n 
1 584 PRO n 
1 585 TYR n 
1 586 SER n 
1 587 ILE n 
1 588 THR n 
1 589 GLY n 
1 590 TRP n 
1 591 LEU n 
1 592 GLU n 
1 593 LYS n 
1 594 ASN n 
1 595 LYS n 
1 596 ASP n 
1 597 PRO n 
1 598 ILE n 
1 599 ASN n 
1 600 GLU n 
1 601 ASN n 
1 602 VAL n 
1 603 VAL n 
1 604 ALA n 
1 605 LEU n 
1 606 LEU n 
1 607 GLY n 
1 608 ALA n 
1 609 SER n 
1 610 LYS n 
1 611 GLU n 
1 612 PRO n 
1 613 LEU n 
1 614 VAL n 
1 615 ALA n 
1 616 GLU n 
1 617 LEU n 
1 618 PHE n 
1 619 LYS n 
1 620 ALA n 
1 621 PRO n 
1 622 GLU n 
1 623 GLU n 
1 624 PRO n 
1 625 ALA n 
1 626 GLY n 
1 627 GLY n 
1 628 GLY n 
1 629 LYS n 
1 630 LYS n 
1 631 LYS n 
1 632 LYS n 
1 633 GLY n 
1 634 LYS n 
1 635 SER n 
1 636 SER n 
1 637 ALA n 
1 638 PHE n 
1 639 GLN n 
1 640 THR n 
1 641 ILE n 
1 642 SER n 
1 643 ALA n 
1 644 VAL n 
1 645 HIS n 
1 646 ARG n 
1 647 GLU n 
1 648 SER n 
1 649 LEU n 
1 650 ASN n 
1 651 LYS n 
1 652 LEU n 
1 653 MET n 
1 654 LYS n 
1 655 ASN n 
1 656 LEU n 
1 657 TYR n 
1 658 SER n 
1 659 THR n 
1 660 HIS n 
1 661 PRO n 
1 662 HIS n 
1 663 PHE n 
1 664 VAL n 
1 665 ARG n 
1 666 CYS n 
1 667 ILE n 
1 668 ILE n 
1 669 PRO n 
1 670 ASN n 
1 671 GLU n 
1 672 LEU n 
1 673 LYS n 
1 674 GLN n 
1 675 PRO n 
1 676 GLY n 
1 677 LEU n 
1 678 VAL n 
1 679 ASP n 
1 680 ALA n 
1 681 GLU n 
1 682 LEU n 
1 683 VAL n 
1 684 LEU n 
1 685 HIS n 
1 686 GLN n 
1 687 LEU n 
1 688 GLN n 
1 689 CYS n 
1 690 ASN n 
1 691 GLY n 
1 692 VAL n 
1 693 LEU n 
1 694 GLU n 
1 695 GLY n 
1 696 ILE n 
1 697 ARG n 
1 698 ILE n 
1 699 CYS n 
1 700 ARG n 
1 701 LYS n 
1 702 GLY n 
1 703 PHE n 
1 704 PRO n 
1 705 SER n 
1 706 ARG n 
1 707 LEU n 
1 708 ILE n 
1 709 TYR n 
1 710 SER n 
1 711 GLU n 
1 712 PHE n 
1 713 LYS n 
1 714 GLN n 
1 715 ARG n 
1 716 TYR n 
1 717 SER n 
1 718 ILE n 
1 719 LEU n 
1 720 ALA n 
1 721 PRO n 
1 722 ASN n 
1 723 ALA n 
1 724 ILE n 
1 725 PRO n 
1 726 GLN n 
1 727 GLY n 
1 728 PHE n 
1 729 VAL n 
1 730 ASP n 
1 731 GLY n 
1 732 LYS n 
1 733 THR n 
1 734 VAL n 
1 735 SER n 
1 736 GLU n 
1 737 LYS n 
1 738 ILE n 
1 739 LEU n 
1 740 ALA n 
1 741 GLY n 
1 742 LEU n 
1 743 GLN n 
1 744 MET n 
1 745 ASP n 
1 746 PRO n 
1 747 ALA n 
1 748 GLU n 
1 749 TYR n 
1 750 ARG n 
1 751 LEU n 
1 752 GLY n 
1 753 THR n 
1 754 THR n 
1 755 LYS n 
1 756 VAL n 
1 757 PHE n 
1 758 PHE n 
1 759 LYS n 
1 760 ALA n 
1 761 GLY n 
1 762 VAL n 
1 763 LEU n 
1 764 GLY n 
1 765 ASN n 
1 766 LEU n 
1 767 GLU n 
1 768 GLU n 
1 769 MET n 
1 770 ARG n 
1 771 ASP n 
1 772 GLU n 
1 773 ARG n 
1 774 LEU n 
1 775 SER n 
1 776 LYS n 
1 777 ILE n 
1 778 ILE n 
1 779 SER n 
1 780 MET n 
1 781 PHE n 
1 782 GLN n 
1 783 ALA n 
1 784 HIS n 
1 785 ILE n 
1 786 ARG n 
1 787 GLY n 
1 788 TYR n 
1 789 LEU n 
1 790 ILE n 
1 791 ARG n 
1 792 LYS n 
1 793 ALA n 
1 794 TYR n 
1 795 LYS n 
1 796 LYS n 
1 797 LEU n 
1 798 GLN n 
1 799 ASP n 
1 800 GLN n 
1 801 ARG n 
1 802 ILE n 
1 803 GLY n 
1 804 LEU n 
1 805 SER n 
1 806 VAL n 
1 807 ILE n 
1 808 GLN n 
1 809 ARG n 
1 810 ASN n 
1 811 ILE n 
1 812 ARG n 
1 813 LYS n 
1 814 TRP n 
1 815 LEU n 
1 816 VAL n 
1 817 LEU n 
1 818 ARG n 
1 819 ASN n 
1 820 TRP n 
1 821 GLN n 
1 822 TRP n 
1 823 TRP n 
1 824 LYS n 
1 825 LEU n 
1 826 TYR n 
1 827 SER n 
1 828 LYS n 
1 829 VAL n 
1 830 LYS n 
1 831 PRO n 
2 1   LYS n 
2 2   GLN n 
2 3   ILE n 
2 4   GLN n 
2 5   GLU n 
2 6   MET n 
2 7   LYS n 
2 8   GLU n 
2 9   ALA n 
2 10  PHE n 
2 11  SER n 
2 12  MET n 
2 13  ILE n 
2 14  ASP n 
2 15  VAL n 
2 16  ASP n 
2 17  ARG n 
2 18  ASP n 
2 19  GLY n 
2 20  PHE n 
2 21  VAL n 
2 22  SER n 
2 23  LYS n 
2 24  GLU n 
2 25  ASP n 
2 26  ILE n 
2 27  LYS n 
2 28  ALA n 
2 29  ILE n 
2 30  SER n 
2 31  GLU n 
2 32  GLN n 
2 33  LEU n 
2 34  GLY n 
2 35  ARG n 
2 36  ALA n 
2 37  PRO n 
2 38  ASP n 
2 39  ASP n 
2 40  LYS n 
2 41  GLU n 
2 42  LEU n 
2 43  THR n 
2 44  ALA n 
2 45  MET n 
2 46  LEU n 
2 47  LYS n 
2 48  GLU n 
2 49  ALA n 
2 50  PRO n 
2 51  GLY n 
2 52  PRO n 
2 53  LEU n 
2 54  ASN n 
2 55  PHE n 
2 56  THR n 
2 57  MET n 
2 58  PHE n 
2 59  LEU n 
2 60  SER n 
2 61  ILE n 
2 62  PHE n 
2 63  SER n 
2 64  ASP n 
2 65  LYS n 
2 66  LEU n 
2 67  SER n 
2 68  GLY n 
2 69  THR n 
2 70  ASP n 
2 71  SER n 
2 72  GLU n 
2 73  GLU n 
2 74  THR n 
2 75  ILE n 
2 76  ARG n 
2 77  ASN n 
2 78  ALA n 
2 79  PHE n 
2 80  ALA n 
2 81  MET n 
2 82  PHE n 
2 83  ASP n 
2 84  GLU n 
2 85  GLN n 
2 86  GLU n 
2 87  THR n 
2 88  LYS n 
2 89  LYS n 
2 90  LEU n 
2 91  ASN n 
2 92  ILE n 
2 93  GLU n 
2 94  TYR n 
2 95  ILE n 
2 96  LYS n 
2 97  ASP n 
2 98  LEU n 
2 99  LEU n 
2 100 GLU n 
2 101 ASN n 
2 102 MET n 
2 103 GLY n 
2 104 ASP n 
2 105 ASN n 
2 106 PHE n 
2 107 ASN n 
2 108 LYS n 
2 109 ASP n 
2 110 GLU n 
2 111 MET n 
2 112 ARG n 
2 113 MET n 
2 114 THR n 
2 115 PHE n 
2 116 LYS n 
2 117 GLU n 
2 118 ALA n 
2 119 PRO n 
2 120 VAL n 
2 121 GLU n 
2 122 GLY n 
2 123 GLY n 
2 124 LYS n 
2 125 PHE n 
2 126 ASP n 
2 127 TYR n 
2 128 VAL n 
2 129 LYS n 
2 130 PHE n 
2 131 THR n 
2 132 ALA n 
2 133 MET n 
2 134 ILE n 
2 135 LYS n 
2 136 GLY n 
3 1   SER n 
3 2   GLN n 
3 3   ASP n 
3 4   GLU n 
3 5   ILE n 
3 6   ASP n 
3 7   ASP n 
3 8   LEU n 
3 9   LYS n 
3 10  ASP n 
3 11  VAL n 
3 12  PHE n 
3 13  GLU n 
3 14  LEU n 
3 15  PHE n 
3 16  ASP n 
3 17  PHE n 
3 18  TRP n 
3 19  ASP n 
3 20  GLY n 
3 21  ARG n 
3 22  ASP n 
3 23  GLY n 
3 24  ALA n 
3 25  VAL n 
3 26  ASP n 
3 27  ALA n 
3 28  PHE n 
3 29  LYS n 
3 30  LEU n 
3 31  GLY n 
3 32  ASP n 
3 33  VAL n 
3 34  CYS n 
3 35  ARG n 
3 36  CYS n 
3 37  LEU n 
3 38  GLY n 
3 39  ILE n 
3 40  ASN n 
3 41  PRO n 
3 42  ARG n 
3 43  ASN n 
3 44  GLU n 
3 45  ASP n 
3 46  VAL n 
3 47  PHE n 
3 48  ALA n 
3 49  VAL n 
3 50  GLY n 
3 51  GLY n 
3 52  THR n 
3 53  HIS n 
3 54  LYS n 
3 55  MET n 
3 56  GLY n 
3 57  GLU n 
3 58  LYS n 
3 59  SER n 
3 60  LEU n 
3 61  PRO n 
3 62  PHE n 
3 63  GLU n 
3 64  GLU n 
3 65  PHE n 
3 66  LEU n 
3 67  PRO n 
3 68  ALA n 
3 69  TYR n 
3 70  GLU n 
3 71  GLY n 
3 72  LEU n 
3 73  MET n 
3 74  ASP n 
3 75  CYS n 
3 76  GLU n 
3 77  GLN n 
3 78  GLY n 
3 79  THR n 
3 80  PHE n 
3 81  ALA n 
3 82  ASP n 
3 83  TYR n 
3 84  MET n 
3 85  GLU n 
3 86  ALA n 
3 87  PHE n 
3 88  LYS n 
3 89  THR n 
3 90  PHE n 
3 91  ASP n 
3 92  ARG n 
3 93  GLU n 
3 94  GLY n 
3 95  GLN n 
3 96  GLY n 
3 97  PHE n 
3 98  ILE n 
3 99  SER n 
3 100 GLY n 
3 101 ALA n 
3 102 GLU n 
3 103 LEU n 
3 104 ARG n 
3 105 HIS n 
3 106 VAL n 
3 107 LEU n 
3 108 THR n 
3 109 ALA n 
3 110 LEU n 
3 111 GLY n 
3 112 GLU n 
3 113 ARG n 
3 114 LEU n 
3 115 SER n 
3 116 ASP n 
3 117 GLU n 
3 118 ASP n 
3 119 VAL n 
3 120 ASP n 
3 121 GLU n 
3 122 ILE n 
3 123 ILE n 
3 124 LYS n 
3 125 LEU n 
3 126 THR n 
3 127 ASP n 
3 128 LEU n 
3 129 GLN n 
3 130 GLU n 
3 131 ASP n 
3 132 LEU n 
3 133 GLU n 
3 134 GLY n 
3 135 ASN n 
3 136 VAL n 
3 137 LYS n 
3 138 TYR n 
3 139 GLU n 
3 140 ASP n 
3 141 PHE n 
3 142 VAL n 
3 143 LYS n 
3 144 LYS n 
3 145 VAL n 
3 146 MET n 
3 147 ALA n 
3 148 GLY n 
3 149 PRO n 
3 150 TYR n 
3 151 PRO n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? 'BAY SCALLOP' 'ARGOPECTEN IRRADIANS' 31199 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? 'BAY SCALLOP' 'ARGOPECTEN IRRADIANS' 31199 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? 'BAY SCALLOP' 'ARGOPECTEN IRRADIANS' 31199 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP MYS_AEQIR 1 ? ? P24733 ? 
2 UNP MLR_AEQIR 2 ? ? P13543 ? 
3 UNP MLE_AEQIR 3 ? ? P07291 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2W4T C 1 ? 831 ? P24733 5  ? 835 ? 5  835 
2 2 2W4T Y 1 ? 136 ? P13543 16 ? 151 ? 15 150 
3 3 2W4T Z 1 ? 151 ? P07291 5  ? 155 ? 4  154 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2W4T 
_exptl.method            'ELECTRON MICROSCOPY' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 2W4T 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            35.00 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8501 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               8501 
_refine_hist.d_res_high                       35.00 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  2W4T 
_struct.title                     'ISOMETRICALLY CONTRACTING INSECT ASYNCHRONOUS FLIGHT MUSCLE' 
_struct.pdbx_descriptor           
;MYOSIN HEAVY CHAIN, STRIATED MUSCLE, MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE, MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2W4T 
_struct_keywords.pdbx_keywords   'CONTRACTILE PROTEIN' 
_struct_keywords.text            
;CONTRACTILE PROTEIN, NUCLEOTIDE-BINDING, TROPOMYOSIN, LIGHT CHAINS, ACTIN- BINDING, FREEZE SUBSTITUTION, ISOMETRIC CONTRACTION, FREEZING, MICROTOMY, ATP-BINDING, THIN FILAMENT, MOTOR PROTEIN, THICK FILAMENT, MUSCLE PROTEIN, IMAGE PROCESSING, CALMODULIN-BINDING, ACTIN, INSECT, MYOSIN, MUSCLE, TROPONIN, MULTIVARIATE DATA ANALYSIS
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 3   ? GLN A 7   ? ASP C 7   GLN C 11  5 ? 5  
HELX_P HELX_P2  2  ASP A 68  ? ILE A 70  ? ASP C 72  ILE C 74  5 ? 3  
HELX_P HELX_P3  3  PRO A 75  ? GLU A 79  ? PRO C 79  GLU C 83  5 ? 5  
HELX_P HELX_P4  4  MET A 84  ? MET A 87  ? MET C 88  MET C 91  5 ? 4  
HELX_P HELX_P5  5  ASN A 91  ? THR A 104 ? ASN C 95  THR C 108 1 ? 14 
HELX_P HELX_P6  6  THR A 129 ? ARG A 137 ? THR C 133 ARG C 141 1 ? 9  
HELX_P HELX_P7  7  HIS A 147 ? ARG A 163 ? HIS C 151 ARG C 167 1 ? 17 
HELX_P HELX_P8  8  GLY A 177 ? VAL A 192 ? GLY C 181 VAL C 196 1 ? 16 
HELX_P HELX_P9  9  GLU A 212 ? GLN A 217 ? GLU C 216 GLN C 221 1 ? 6  
HELX_P HELX_P10 10 GLN A 217 ? GLY A 226 ? GLN C 221 GLY C 230 1 ? 10 
HELX_P HELX_P11 11 GLU A 264 ? THR A 269 ? GLU C 268 THR C 273 5 ? 6  
HELX_P HELX_P12 12 TYR A 278 ? ILE A 284 ? TYR C 282 ILE C 288 1 ? 7  
HELX_P HELX_P13 13 ILE A 289 ? GLU A 291 ? ILE C 293 GLU C 295 5 ? 3  
HELX_P HELX_P14 14 LEU A 292 ? LEU A 297 ? LEU C 296 LEU C 301 1 ? 6  
HELX_P HELX_P15 15 ASP A 301 ? TYR A 305 ? ASP C 305 TYR C 309 5 ? 5  
HELX_P HELX_P16 16 TYR A 305 ? ASN A 309 ? TYR C 309 ASN C 313 5 ? 5  
HELX_P HELX_P17 17 ASP A 319 ? LEU A 334 ? ASP C 323 LEU C 338 1 ? 16 
HELX_P HELX_P18 18 GLU A 339 ? GLY A 355 ? GLU C 343 GLY C 359 1 ? 17 
HELX_P HELX_P19 19 THR A 373 ? CYS A 383 ? THR C 377 CYS C 387 1 ? 11 
HELX_P HELX_P20 20 ASN A 386 ? LYS A 396 ? ASN C 390 LYS C 400 1 ? 11 
HELX_P HELX_P21 21 ASN A 411 ? ASP A 443 ? ASN C 415 ASP C 447 1 ? 33 
HELX_P HELX_P22 22 SER A 467 ? PHE A 489 ? SER C 471 PHE C 493 1 ? 23 
HELX_P HELX_P23 23 PHE A 489 ? GLU A 499 ? PHE C 493 GLU C 503 1 ? 11 
HELX_P HELX_P24 24 LEU A 512 ? LYS A 521 ? LEU C 516 LYS C 525 1 ? 10 
HELX_P HELX_P25 25 GLY A 524 ? MET A 534 ? GLY C 528 MET C 538 1 ? 11 
HELX_P HELX_P26 26 ASP A 539 ? MET A 552 ? ASP C 543 MET C 556 1 ? 14 
HELX_P HELX_P27 27 GLY A 589 ? LYS A 595 ? GLY C 593 LYS C 599 1 ? 7  
HELX_P HELX_P28 28 ASN A 601 ? LEU A 606 ? ASN C 605 LEU C 610 1 ? 6  
HELX_P HELX_P29 29 GLY A 607 ? SER A 609 ? GLY C 611 SER C 613 5 ? 3  
HELX_P HELX_P30 30 GLU A 611 ? GLU A 616 ? GLU C 615 GLU C 620 1 ? 6  
HELX_P HELX_P31 31 THR A 640 ? SER A 658 ? THR C 644 SER C 662 1 ? 19 
HELX_P HELX_P32 32 ASP A 679 ? ASN A 690 ? ASP C 683 ASN C 694 1 ? 12 
HELX_P HELX_P33 33 GLY A 691 ? GLY A 702 ? GLY C 695 GLY C 706 1 ? 12 
HELX_P HELX_P34 34 TYR A 709 ? SER A 717 ? TYR C 713 SER C 721 1 ? 9  
HELX_P HELX_P35 35 ASP A 730 ? LEU A 742 ? ASP C 734 LEU C 746 1 ? 13 
HELX_P HELX_P36 36 GLY A 761 ? ALA A 793 ? GLY C 765 ALA C 797 1 ? 33 
HELX_P HELX_P37 37 TYR A 794 ? LEU A 817 ? TYR C 798 LEU C 821 1 ? 24 
HELX_P HELX_P38 38 TRP A 820 ? LYS A 830 ? TRP C 824 LYS C 834 1 ? 11 
HELX_P HELX_P39 39 LYS B 1   ? ASP B 14  ? LYS Y 15  ASP Y 28  1 ? 14 
HELX_P HELX_P40 40 SER B 22  ? GLY B 34  ? SER Y 36  GLY Y 48  1 ? 13 
HELX_P HELX_P41 41 ASP B 38  ? LYS B 47  ? ASP Y 52  LYS Y 61  1 ? 10 
HELX_P HELX_P42 42 ASN B 54  ? ASP B 64  ? ASN Y 68  ASP Y 78  1 ? 11 
HELX_P HELX_P43 43 SER B 71  ? MET B 81  ? SER Y 85  MET Y 95  1 ? 11 
HELX_P HELX_P44 44 ILE B 92  ? MET B 102 ? ILE Y 106 MET Y 116 1 ? 11 
HELX_P HELX_P45 45 ASN B 107 ? LYS B 116 ? ASN Y 121 LYS Y 130 1 ? 10 
HELX_P HELX_P46 46 ASP B 126 ? LYS B 135 ? ASP Y 140 LYS Y 149 1 ? 10 
HELX_P HELX_P47 47 SER C 1   ? ASP C 19  ? SER Z 4   ASP Z 22  1 ? 19 
HELX_P HELX_P48 48 LYS C 29  ? LEU C 37  ? LYS Z 32  LEU Z 40  1 ? 9  
HELX_P HELX_P49 49 ARG C 42  ? GLY C 50  ? ARG Z 45  GLY Z 53  1 ? 9  
HELX_P HELX_P50 50 PRO C 61  ? LEU C 72  ? PRO Z 64  LEU Z 75  1 ? 12 
HELX_P HELX_P51 51 THR C 79  ? THR C 89  ? THR Z 82  THR Z 92  1 ? 11 
HELX_P HELX_P52 52 SER C 99  ? LEU C 110 ? SER Z 102 LEU Z 113 1 ? 12 
HELX_P HELX_P53 53 SER C 115 ? ASP C 127 ? SER Z 118 ASP Z 130 1 ? 13 
HELX_P HELX_P54 54 LYS C 137 ? GLY C 148 ? LYS Z 140 GLY Z 151 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           701 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            705 
_struct_mon_prot_cis.auth_asym_id           C 
_struct_mon_prot_cis.pdbx_label_comp_id_2   GLY 
_struct_mon_prot_cis.pdbx_label_seq_id_2    702 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    GLY 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     706 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    C 
_struct_mon_prot_cis.pdbx_PDB_model_num     8 
_struct_mon_prot_cis.pdbx_omega_angle       -23.71 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
CA ? 4 ? 
CB ? 7 ? 
CC ? 2 ? 
CD ? 2 ? 
CE ? 4 ? 
CF ? 3 ? 
YA ? 2 ? 
ZA ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? parallel      
CB 3 4 ? parallel      
CB 4 5 ? parallel      
CB 5 6 ? anti-parallel 
CB 6 7 ? anti-parallel 
CC 1 2 ? anti-parallel 
CD 1 2 ? anti-parallel 
CE 1 2 ? parallel      
CE 2 3 ? anti-parallel 
CE 3 4 ? anti-parallel 
CF 1 2 ? anti-parallel 
CF 2 3 ? anti-parallel 
YA 1 2 ? anti-parallel 
ZA 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
CA 1 ASN A 29  ? PRO A 33  ? ASN C 33  PRO C 37  
CA 2 PHE A 39  ? SER A 46  ? PHE C 43  SER C 50  
CA 3 GLU A 51  ? ILE A 56  ? GLU C 55  ILE C 60  
CA 4 THR A 62  ? LYS A 66  ? THR C 66  LYS C 70  
CB 1 TYR A 109 ? SER A 112 ? TYR C 113 SER C 116 
CB 2 PHE A 115 ? VAL A 119 ? PHE C 119 VAL C 123 
CB 3 HIS A 660 ? ILE A 667 ? HIS C 664 ILE C 671 
CB 4 GLN A 166 ? THR A 171 ? GLN C 170 THR C 175 
CB 5 TYR A 450 ? ASP A 456 ? TYR C 454 ASP C 460 
CB 6 GLY A 240 ? PHE A 247 ? GLY C 244 PHE C 251 
CB 7 ILE A 253 ? TYR A 261 ? ILE C 257 TYR C 265 
CC 1 ASN A 227 ? ALA A 228 ? ASN C 231 ALA C 232 
CC 2 SER A 236 ? SER A 237 ? SER C 240 SER C 241 
CD 1 PHE A 359 ? LYS A 360 ? PHE C 363 LYS C 364 
CD 2 GLU A 369 ? SER A 370 ? GLU C 373 SER C 374 
CE 1 GLY A 500 ? ILE A 501 ? GLY C 504 ILE C 505 
CE 2 TYR A 749 ? GLY A 752 ? TYR C 753 GLY C 756 
CE 3 LYS A 755 ? PHE A 758 ? LYS C 759 PHE C 762 
CE 4 LEU A 707 ? ILE A 708 ? LEU C 711 ILE C 712 
CF 1 PHE A 558 ? THR A 559 ? PHE C 562 THR C 563 
CF 2 PHE A 574 ? HIS A 578 ? PHE C 578 HIS C 582 
CF 3 GLY A 581 ? TYR A 585 ? GLY C 585 TYR C 589 
YA 1 LEU B 90  ? ASN B 91  ? LEU Y 104 ASN Y 105 
YA 2 LYS B 124 ? PHE B 125 ? LYS Y 138 PHE Y 139 
ZA 1 VAL C 25  ? ASP C 26  ? VAL Z 28  ASP Z 29  
ZA 2 SER C 59  ? LEU C 60  ? SER Z 62  LEU Z 63  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
CA 1 2 N VAL A 32  ? N VAL C 36  O ALA A 40  ? O ALA C 44  
CA 2 3 N GLN A 45  ? N GLN C 49  O THR A 53  ? O THR C 57  
CA 3 4 N VAL A 54  ? N VAL C 58  O ARG A 63  ? O ARG C 67  
CB 1 2 N SER A 112 ? N SER C 116 O PHE A 115 ? O PHE C 119 
CB 2 3 N CYS A 116 ? N CYS C 120 O PHE A 663 ? O PHE C 667 
CB 3 4 N HIS A 662 ? N HIS C 666 O SER A 167 ? O SER C 171 
CB 4 5 N GLN A 166 ? N GLN C 170 O TYR A 451 ? O TYR C 455 
CB 5 6 N ASP A 456 ? N ASP C 460 O LYS A 241 ? O LYS C 245 
CB 6 7 O HIS A 246 ? O HIS C 250 N ALA A 254 ? N ALA C 258 
CC 1 2 N ALA A 228 ? N ALA C 232 O SER A 236 ? O SER C 240 
CD 1 2 N LYS A 360 ? N LYS C 364 O GLU A 369 ? O GLU C 373 
CE 1 2 N GLY A 500 ? N GLY C 504 O LEU A 751 ? O LEU C 755 
CE 2 3 N ARG A 750 ? N ARG C 754 O PHE A 757 ? O PHE C 761 
CE 3 4 N VAL A 756 ? N VAL C 760 O LEU A 707 ? O LEU C 711 
CF 1 2 N THR A 559 ? N THR C 563 O GLU A 575 ? O GLU C 579 
CF 2 3 N HIS A 578 ? N HIS C 582 O GLY A 581 ? O GLY C 585 
YA 1 2 N LEU B 90  ? N LEU Y 104 O PHE B 125 ? O PHE Y 139 
ZA 1 2 N VAL C 25  ? N VAL Z 28  O LEU C 60  ? O LEU Z 63  
# 
_database_PDB_matrix.entry_id          2W4T 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2W4T 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      N N   . PHE A 1 1   ? -93.831  22.206  13.201  1.00 30.00  ? 5   PHE C N   1  
ATOM 2      C CA  . PHE A 1 1   ? -94.987  22.462  14.118  1.00 30.00  ? 5   PHE C CA  1  
ATOM 3      C C   . PHE A 1 1   ? -95.337  23.944  14.011  1.00 30.00  ? 5   PHE C C   1  
ATOM 4      O O   . PHE A 1 1   ? -96.234  24.438  14.710  1.00 30.00  ? 5   PHE C O   1  
ATOM 5      C CB  . PHE A 1 1   ? -94.600  22.110  15.550  1.00 99.99  ? 5   PHE C CB  1  
ATOM 6      C CG  . PHE A 1 1   ? -95.769  22.369  16.467  1.00 99.99  ? 5   PHE C CG  1  
ATOM 7      C CD1 . PHE A 1 1   ? -96.777  21.406  16.606  1.00 99.99  ? 5   PHE C CD1 1  
ATOM 8      C CD2 . PHE A 1 1   ? -95.847  23.572  17.181  1.00 99.99  ? 5   PHE C CD2 1  
ATOM 9      C CE1 . PHE A 1 1   ? -97.864  21.648  17.456  1.00 99.99  ? 5   PHE C CE1 1  
ATOM 10     C CE2 . PHE A 1 1   ? -96.933  23.810  18.030  1.00 99.99  ? 5   PHE C CE2 1  
ATOM 11     C CZ  . PHE A 1 1   ? -97.941  22.851  18.168  1.00 99.99  ? 5   PHE C CZ  1  
ATOM 12     N N   . SER A 1 2   ? -94.578  24.589  13.139  1.00 30.00  ? 6   SER C N   1  
ATOM 13     C CA  . SER A 1 2   ? -94.712  26.022  12.846  1.00 30.00  ? 6   SER C CA  1  
ATOM 14     C C   . SER A 1 2   ? -93.817  26.845  13.782  1.00 30.00  ? 6   SER C C   1  
ATOM 15     O O   . SER A 1 2   ? -93.821  28.083  13.743  1.00 30.00  ? 6   SER C O   1  
ATOM 16     C CB  . SER A 1 2   ? -96.159  26.459  13.039  1.00 99.99  ? 6   SER C CB  1  
ATOM 17     O OG  . SER A 1 2   ? -97.007  25.700  12.171  1.00 99.99  ? 6   SER C OG  1  
ATOM 18     N N   . ASP A 1 3   ? -93.069  26.127  14.597  1.00 30.00  ? 7   ASP C N   1  
ATOM 19     C CA  . ASP A 1 3   ? -92.171  26.733  15.599  1.00 30.00  ? 7   ASP C CA  1  
ATOM 20     C C   . ASP A 1 3   ? -90.906  27.295  14.946  1.00 30.00  ? 7   ASP C C   1  
ATOM 21     O O   . ASP A 1 3   ? -90.065  26.546  14.429  1.00 30.00  ? 7   ASP C O   1  
ATOM 22     C CB  . ASP A 1 3   ? -91.759  25.683  16.626  1.00 99.99  ? 7   ASP C CB  1  
ATOM 23     C CG  . ASP A 1 3   ? -91.301  24.417  15.906  1.00 99.99  ? 7   ASP C CG  1  
ATOM 24     O OD1 . ASP A 1 3   ? -92.115  23.888  15.099  1.00 99.99  ? 7   ASP C OD1 1  
ATOM 25     O OD2 . ASP A 1 3   ? -90.145  23.991  16.167  1.00 99.99  ? 7   ASP C OD2 1  
ATOM 26     N N   . PRO A 1 4   ? -90.818  28.606  15.005  1.00 30.00  ? 8   PRO C N   1  
ATOM 27     C CA  . PRO A 1 4   ? -89.684  29.354  14.459  1.00 30.00  ? 8   PRO C CA  1  
ATOM 28     C C   . PRO A 1 4   ? -88.360  28.713  14.908  1.00 30.00  ? 8   PRO C C   1  
ATOM 29     O O   . PRO A 1 4   ? -87.369  28.693  14.175  1.00 30.00  ? 8   PRO C O   1  
ATOM 30     C CB  . PRO A 1 4   ? -89.951  30.662  15.115  1.00 99.99  ? 8   PRO C CB  1  
ATOM 31     C CG  . PRO A 1 4   ? -91.231  30.484  15.898  1.00 99.99  ? 8   PRO C CG  1  
ATOM 32     C CD  . PRO A 1 4   ? -91.741  29.321  15.784  1.00 99.99  ? 8   PRO C CD  1  
ATOM 33     N N   . ASP A 1 5   ? -88.368  28.178  16.111  1.00 30.00  ? 9   ASP C N   1  
ATOM 34     C CA  . ASP A 1 5   ? -87.167  27.578  16.723  1.00 30.00  ? 9   ASP C CA  1  
ATOM 35     C C   . ASP A 1 5   ? -86.598  26.387  15.911  1.00 30.00  ? 9   ASP C C   1  
ATOM 36     O O   . ASP A 1 5   ? -85.580  25.790  16.282  1.00 30.00  ? 9   ASP C O   1  
ATOM 37     C CB  . ASP A 1 5   ? -87.501  27.058  18.118  1.00 99.99  ? 9   ASP C CB  1  
ATOM 38     C CG  . ASP A 1 5   ? -88.787  26.235  18.063  1.00 99.99  ? 9   ASP C CG  1  
ATOM 39     O OD1 . ASP A 1 5   ? -89.809  26.798  17.590  1.00 99.99  ? 9   ASP C OD1 1  
ATOM 40     O OD2 . ASP A 1 5   ? -88.730  25.053  18.490  1.00 99.99  ? 9   ASP C OD2 1  
ATOM 41     N N   . PHE A 1 6   ? -87.229  26.044  14.795  1.00 30.00  ? 10  PHE C N   1  
ATOM 42     C CA  . PHE A 1 6   ? -86.798  24.860  14.004  1.00 30.00  ? 10  PHE C CA  1  
ATOM 43     C C   . PHE A 1 6   ? -86.286  25.211  12.597  1.00 30.00  ? 10  PHE C C   1  
ATOM 44     O O   . PHE A 1 6   ? -86.261  24.367  11.693  1.00 30.00  ? 10  PHE C O   1  
ATOM 45     C CB  . PHE A 1 6   ? -87.970  23.900  13.826  1.00 99.99  ? 10  PHE C CB  1  
ATOM 46     C CG  . PHE A 1 6   ? -88.408  23.897  12.382  1.00 99.99  ? 10  PHE C CG  1  
ATOM 47     C CD1 . PHE A 1 6   ? -88.183  25.024  11.582  1.00 99.99  ? 10  PHE C CD1 1  
ATOM 48     C CD2 . PHE A 1 6   ? -89.037  22.769  11.843  1.00 99.99  ? 10  PHE C CD2 1  
ATOM 49     C CE1 . PHE A 1 6   ? -88.589  25.023  10.242  1.00 99.99  ? 10  PHE C CE1 1  
ATOM 50     C CE2 . PHE A 1 6   ? -89.444  22.768  10.502  1.00 99.99  ? 10  PHE C CE2 1  
ATOM 51     C CZ  . PHE A 1 6   ? -89.218  23.896  9.702   1.00 99.99  ? 10  PHE C CZ  1  
ATOM 52     N N   . GLN A 1 7   ? -85.857  26.435  12.418  1.00 30.00  ? 11  GLN C N   1  
ATOM 53     C CA  . GLN A 1 7   ? -85.382  26.909  11.109  1.00 30.00  ? 11  GLN C CA  1  
ATOM 54     C C   . GLN A 1 7   ? -84.249  26.047  10.550  1.00 30.00  ? 11  GLN C C   1  
ATOM 55     O O   . GLN A 1 7   ? -84.356  25.518  9.439   1.00 30.00  ? 11  GLN C O   1  
ATOM 56     C CB  . GLN A 1 7   ? -84.862  28.337  11.232  1.00 99.99  ? 11  GLN C CB  1  
ATOM 57     C CG  . GLN A 1 7   ? -84.932  29.025  9.872   1.00 99.99  ? 11  GLN C CG  1  
ATOM 58     C CD  . GLN A 1 7   ? -83.697  28.716  9.037   1.00 99.99  ? 11  GLN C CD  1  
ATOM 59     O OE1 . GLN A 1 7   ? -82.808  27.997  9.484   1.00 99.99  ? 11  GLN C OE1 1  
ATOM 60     N NE2 . GLN A 1 7   ? -83.648  29.265  7.820   1.00 99.99  ? 11  GLN C NE2 1  
ATOM 61     N N   . TYR A 1 8   ? -83.170  25.897  11.307  1.00 30.00  ? 12  TYR C N   1  
ATOM 62     C CA  . TYR A 1 8   ? -82.047  25.092  10.841  1.00 30.00  ? 12  TYR C CA  1  
ATOM 63     C C   . TYR A 1 8   ? -82.047  23.784  11.582  1.00 30.00  ? 12  TYR C C   1  
ATOM 64     O O   . TYR A 1 8   ? -80.982  23.242  11.892  1.00 30.00  ? 12  TYR C O   1  
ATOM 65     C CB  . TYR A 1 8   ? -80.738  25.829  11.103  1.00 99.99  ? 12  TYR C CB  1  
ATOM 66     C CG  . TYR A 1 8   ? -79.964  25.116  12.183  1.00 99.99  ? 12  TYR C CG  1  
ATOM 67     C CD1 . TYR A 1 8   ? -80.642  24.352  13.139  1.00 99.99  ? 12  TYR C CD1 1  
ATOM 68     C CD2 . TYR A 1 8   ? -78.569  25.219  12.230  1.00 99.99  ? 12  TYR C CD2 1  
ATOM 69     C CE1 . TYR A 1 8   ? -79.924  23.689  14.143  1.00 99.99  ? 12  TYR C CE1 1  
ATOM 70     C CE2 . TYR A 1 8   ? -77.851  24.558  13.234  1.00 99.99  ? 12  TYR C CE2 1  
ATOM 71     C CZ  . TYR A 1 8   ? -78.529  23.793  14.191  1.00 99.99  ? 12  TYR C CZ  1  
ATOM 72     O OH  . TYR A 1 8   ? -77.831  23.148  15.166  1.00 99.99  ? 12  TYR C OH  1  
ATOM 73     N N   . LEU A 1 9   ? -83.226  23.263  11.880  1.00 30.00  ? 13  LEU C N   1  
ATOM 74     C CA  . LEU A 1 9   ? -83.283  22.010  12.614  1.00 30.00  ? 13  LEU C CA  1  
ATOM 75     C C   . LEU A 1 9   ? -84.215  20.947  12.044  1.00 30.00  ? 13  LEU C C   1  
ATOM 76     O O   . LEU A 1 9   ? -83.959  19.758  12.216  1.00 30.00  ? 13  LEU C O   1  
ATOM 77     C CB  . LEU A 1 9   ? -83.759  22.266  14.041  1.00 99.99  ? 13  LEU C CB  1  
ATOM 78     C CG  . LEU A 1 9   ? -82.554  22.422  14.960  1.00 99.99  ? 13  LEU C CG  1  
ATOM 79     C CD1 . LEU A 1 9   ? -83.010  22.348  16.413  1.00 99.99  ? 13  LEU C CD1 1  
ATOM 80     C CD2 . LEU A 1 9   ? -81.553  21.307  14.680  1.00 99.99  ? 13  LEU C CD2 1  
ATOM 81     N N   . ALA A 1 10  ? -85.284  21.367  11.371  1.00 30.00  ? 14  ALA C N   1  
ATOM 82     C CA  . ALA A 1 10  ? -86.250  20.428  10.797  1.00 30.00  ? 14  ALA C CA  1  
ATOM 83     C C   . ALA A 1 10  ? -86.178  20.313  9.279   1.00 30.00  ? 14  ALA C C   1  
ATOM 84     O O   . ALA A 1 10  ? -86.106  21.330  8.583   1.00 30.00  ? 14  ALA C O   1  
ATOM 85     C CB  . ALA A 1 10  ? -87.651  20.831  11.199  1.00 30.00  ? 14  ALA C CB  1  
ATOM 86     N N   . VAL A 1 11  ? -86.203  19.074  8.780   1.00 30.00  ? 15  VAL C N   1  
ATOM 87     C CA  . VAL A 1 11  ? -86.144  18.813  7.336   1.00 30.00  ? 15  VAL C CA  1  
ATOM 88     C C   . VAL A 1 11  ? -87.327  19.478  6.650   1.00 30.00  ? 15  VAL C C   1  
ATOM 89     O O   . VAL A 1 11  ? -88.482  19.284  7.044   1.00 30.00  ? 15  VAL C O   1  
ATOM 90     C CB  . VAL A 1 11  ? -86.191  17.311  7.079   1.00 99.99  ? 15  VAL C CB  1  
ATOM 91     C CG1 . VAL A 1 11  ? -85.002  16.640  7.759   1.00 99.99  ? 15  VAL C CG1 1  
ATOM 92     C CG2 . VAL A 1 11  ? -87.489  16.737  7.640   1.00 99.99  ? 15  VAL C CG2 1  
ATOM 93     N N   . ASP A 1 12  ? -87.031  20.261  5.623   1.00 30.00  ? 16  ASP C N   1  
ATOM 94     C CA  . ASP A 1 12  ? -88.021  20.999  4.844   1.00 30.00  ? 16  ASP C CA  1  
ATOM 95     C C   . ASP A 1 12  ? -89.226  20.187  4.337   1.00 30.00  ? 16  ASP C C   1  
ATOM 96     O O   . ASP A 1 12  ? -89.195  18.941  4.411   1.00 30.00  ? 16  ASP C O   1  
ATOM 97     C CB  . ASP A 1 12  ? -87.366  21.592  3.599   1.00 99.99  ? 16  ASP C CB  1  
ATOM 98     C CG  . ASP A 1 12  ? -86.536  20.518  2.899   1.00 99.99  ? 16  ASP C CG  1  
ATOM 99     O OD1 . ASP A 1 12  ? -85.646  19.943  3.583   1.00 99.99  ? 16  ASP C OD1 1  
ATOM 100    O OD2 . ASP A 1 12  ? -86.797  20.285  1.691   1.00 99.99  ? 16  ASP C OD2 1  
ATOM 101    N N   . GLN A 1 20  ? -90.478  15.419  -2.728  1.00 30.00  ? 24  GLN C N   1  
ATOM 102    C CA  . GLN A 1 20  ? -89.527  14.288  -2.838  1.00 30.00  ? 24  GLN C CA  1  
ATOM 103    C C   . GLN A 1 20  ? -90.136  13.160  -3.711  1.00 30.00  ? 24  GLN C C   1  
ATOM 104    O O   . GLN A 1 20  ? -90.447  12.068  -3.224  1.00 30.00  ? 24  GLN C O   1  
ATOM 105    C CB  . GLN A 1 20  ? -89.221  13.731  -1.451  1.00 99.99  ? 24  GLN C CB  1  
ATOM 106    C CG  . GLN A 1 20  ? -89.400  12.218  -1.461  1.00 99.99  ? 24  GLN C CG  1  
ATOM 107    C CD  . GLN A 1 20  ? -90.868  11.837  -1.566  1.00 99.99  ? 24  GLN C CD  1  
ATOM 108    O OE1 . GLN A 1 20  ? -91.735  12.708  -1.633  1.00 99.99  ? 24  GLN C OE1 1  
ATOM 109    N NE2 . GLN A 1 20  ? -91.149  10.532  -1.585  1.00 99.99  ? 24  GLN C NE2 1  
ATOM 110    N N   . THR A 1 21  ? -90.303  13.402  -5.026  1.00 30.00  ? 25  THR C N   1  
ATOM 111    C CA  . THR A 1 21  ? -90.943  12.372  -5.896  1.00 30.00  ? 25  THR C CA  1  
ATOM 112    C C   . THR A 1 21  ? -90.592  12.450  -7.400  1.00 30.00  ? 25  THR C C   1  
ATOM 113    O O   . THR A 1 21  ? -90.038  13.452  -7.883  1.00 30.00  ? 25  THR C O   1  
ATOM 114    C CB  . THR A 1 21  ? -92.461  12.488  -5.807  1.00 99.99  ? 25  THR C CB  1  
ATOM 115    O OG1 . THR A 1 21  ? -92.887  12.200  -4.472  1.00 99.99  ? 25  THR C OG1 1  
ATOM 116    C CG2 . THR A 1 21  ? -93.105  11.498  -6.771  1.00 99.99  ? 25  THR C CG2 1  
ATOM 117    N N   . ALA A 1 22  ? -90.961  11.328  -8.044  1.00 30.00  ? 26  ALA C N   1  
ATOM 118    C CA  . ALA A 1 22  ? -90.857  11.084  -9.504  1.00 30.00  ? 26  ALA C CA  1  
ATOM 119    C C   . ALA A 1 22  ? -89.522  10.437  -9.925  1.00 30.00  ? 26  ALA C C   1  
ATOM 120    O O   . ALA A 1 22  ? -88.888  9.712   -9.139  1.00 30.00  ? 26  ALA C O   1  
ATOM 121    C CB  . ALA A 1 22  ? -90.988  12.392  -10.277 1.00 30.00  ? 26  ALA C CB  1  
ATOM 122    N N   . ALA A 1 23  ? -89.204  10.753  -11.175 1.00 30.00  ? 27  ALA C N   1  
ATOM 123    C CA  . ALA A 1 23  ? -88.001  10.313  -11.909 1.00 30.00  ? 27  ALA C CA  1  
ATOM 124    C C   . ALA A 1 23  ? -87.057  9.495   -11.029 1.00 30.00  ? 27  ALA C C   1  
ATOM 125    O O   . ALA A 1 23  ? -86.042  10.009  -10.535 1.00 30.00  ? 27  ALA C O   1  
ATOM 126    C CB  . ALA A 1 23  ? -87.226  11.528  -12.423 1.00 30.00  ? 27  ALA C CB  1  
ATOM 127    N N   . PHE A 1 24  ? -87.411  8.234   -10.872 1.00 30.00  ? 28  PHE C N   1  
ATOM 128    C CA  . PHE A 1 24  ? -86.622  7.294   -10.065 1.00 30.00  ? 28  PHE C CA  1  
ATOM 129    C C   . PHE A 1 24  ? -87.003  5.847   -10.380 1.00 30.00  ? 28  PHE C C   1  
ATOM 130    O O   . PHE A 1 24  ? -88.070  5.363   -9.969  1.00 30.00  ? 28  PHE C O   1  
ATOM 131    C CB  . PHE A 1 24  ? -86.869  7.549   -8.582  1.00 99.99  ? 28  PHE C CB  1  
ATOM 132    C CG  . PHE A 1 24  ? -86.053  6.581   -7.760  1.00 99.99  ? 28  PHE C CG  1  
ATOM 133    C CD1 . PHE A 1 24  ? -84.708  6.855   -7.484  1.00 99.99  ? 28  PHE C CD1 1  
ATOM 134    C CD2 . PHE A 1 24  ? -86.641  5.407   -7.274  1.00 99.99  ? 28  PHE C CD2 1  
ATOM 135    C CE1 . PHE A 1 24  ? -83.952  5.957   -6.722  1.00 99.99  ? 28  PHE C CE1 1  
ATOM 136    C CE2 . PHE A 1 24  ? -85.885  4.508   -6.512  1.00 99.99  ? 28  PHE C CE2 1  
ATOM 137    C CZ  . PHE A 1 24  ? -84.540  4.784   -6.236  1.00 99.99  ? 28  PHE C CZ  1  
ATOM 138    N N   . ASP A 1 25  ? -86.102  5.208   -11.106 1.00 30.00  ? 29  ASP C N   1  
ATOM 139    C CA  . ASP A 1 25  ? -86.218  3.791   -11.491 1.00 30.00  ? 29  ASP C CA  1  
ATOM 140    C C   . ASP A 1 25  ? -85.210  2.992   -10.664 1.00 30.00  ? 29  ASP C C   1  
ATOM 141    O O   . ASP A 1 25  ? -83.992  3.139   -10.822 1.00 30.00  ? 29  ASP C O   1  
ATOM 142    C CB  . ASP A 1 25  ? -85.920  3.631   -12.977 1.00 99.99  ? 29  ASP C CB  1  
ATOM 143    C CG  . ASP A 1 25  ? -86.279  2.218   -13.422 1.00 99.99  ? 29  ASP C CG  1  
ATOM 144    O OD1 . ASP A 1 25  ? -85.451  1.301   -13.164 1.00 99.99  ? 29  ASP C OD1 1  
ATOM 145    O OD2 . ASP A 1 25  ? -87.380  2.061   -14.014 1.00 99.99  ? 29  ASP C OD2 1  
ATOM 146    N N   . GLY A 1 26  ? -85.758  2.164   -9.795  1.00 30.00  ? 30  GLY C N   1  
ATOM 147    C CA  . GLY A 1 26  ? -84.972  1.358   -8.843  1.00 30.00  ? 30  GLY C CA  1  
ATOM 148    C C   . GLY A 1 26  ? -84.034  0.354   -9.534  1.00 30.00  ? 30  GLY C C   1  
ATOM 149    O O   . GLY A 1 26  ? -83.319  -0.412  -8.872  1.00 30.00  ? 30  GLY C O   1  
ATOM 150    N N   . LYS A 1 27  ? -84.019  0.355   -10.855 1.00 30.00  ? 31  LYS C N   1  
ATOM 151    C CA  . LYS A 1 27  ? -83.181  -0.602  -11.608 1.00 30.00  ? 31  LYS C CA  1  
ATOM 152    C C   . LYS A 1 27  ? -82.249  0.097   -12.601 1.00 30.00  ? 31  LYS C C   1  
ATOM 153    O O   . LYS A 1 27  ? -81.324  -0.516  -13.154 1.00 30.00  ? 31  LYS C O   1  
ATOM 154    C CB  . LYS A 1 27  ? -84.066  -1.564  -12.392 1.00 99.99  ? 31  LYS C CB  1  
ATOM 155    C CG  . LYS A 1 27  ? -83.196  -2.609  -13.084 1.00 99.99  ? 31  LYS C CG  1  
ATOM 156    C CD  . LYS A 1 27  ? -84.056  -3.802  -13.487 1.00 99.99  ? 31  LYS C CD  1  
ATOM 157    C CE  . LYS A 1 27  ? -83.295  -4.664  -14.488 1.00 99.99  ? 31  LYS C CE  1  
ATOM 158    N NZ  . LYS A 1 27  ? -82.589  -5.737  -13.773 1.00 99.99  ? 31  LYS C NZ  1  
ATOM 159    N N   . LYS A 1 28  ? -82.509  1.365   -12.820 1.00 30.00  ? 32  LYS C N   1  
ATOM 160    C CA  . LYS A 1 28  ? -81.713  2.170   -13.751 1.00 30.00  ? 32  LYS C CA  1  
ATOM 161    C C   . LYS A 1 28  ? -80.735  3.059   -12.983 1.00 30.00  ? 32  LYS C C   1  
ATOM 162    O O   . LYS A 1 28  ? -79.556  3.179   -13.355 1.00 30.00  ? 32  LYS C O   1  
ATOM 163    C CB  . LYS A 1 28  ? -82.631  3.054   -14.589 1.00 99.99  ? 32  LYS C CB  1  
ATOM 164    C CG  . LYS A 1 28  ? -81.805  3.813   -15.621 1.00 99.99  ? 32  LYS C CG  1  
ATOM 165    C CD  . LYS A 1 28  ? -82.721  4.334   -16.722 1.00 99.99  ? 32  LYS C CD  1  
ATOM 166    C CE  . LYS A 1 28  ? -81.983  5.389   -17.543 1.00 99.99  ? 32  LYS C CE  1  
ATOM 167    N NZ  . LYS A 1 28  ? -81.361  4.753   -18.712 1.00 99.99  ? 32  LYS C NZ  1  
ATOM 168    N N   . ASN A 1 29  ? -81.266  3.641   -11.926 1.00 30.00  ? 33  ASN C N   1  
ATOM 169    C CA  . ASN A 1 29  ? -80.534  4.592   -11.078 1.00 30.00  ? 33  ASN C CA  1  
ATOM 170    C C   . ASN A 1 29  ? -79.644  3.896   -10.039 1.00 30.00  ? 33  ASN C C   1  
ATOM 171    O O   . ASN A 1 29  ? -80.072  2.978   -9.338  1.00 30.00  ? 33  ASN C O   1  
ATOM 172    C CB  . ASN A 1 29  ? -81.520  5.475   -10.320 1.00 99.99  ? 33  ASN C CB  1  
ATOM 173    C CG  . ASN A 1 29  ? -80.891  6.814   -9.961  1.00 99.99  ? 33  ASN C CG  1  
ATOM 174    O OD1 . ASN A 1 29  ? -81.309  7.462   -9.003  1.00 99.99  ? 33  ASN C OD1 1  
ATOM 175    N ND2 . ASN A 1 29  ? -79.884  7.228   -10.732 1.00 99.99  ? 33  ASN C ND2 1  
ATOM 176    N N   . CYS A 1 30  ? -78.398  4.345   -9.932  1.00 30.00  ? 34  CYS C N   1  
ATOM 177    C CA  . CYS A 1 30  ? -77.468  3.742   -8.988  1.00 30.00  ? 34  CYS C CA  1  
ATOM 178    C C   . CYS A 1 30  ? -76.287  4.681   -8.661  1.00 30.00  ? 34  CYS C C   1  
ATOM 179    O O   . CYS A 1 30  ? -76.163  5.790   -9.205  1.00 30.00  ? 34  CYS C O   1  
ATOM 180    C CB  . CYS A 1 30  ? -76.900  2.453   -9.570  1.00 99.99  ? 34  CYS C CB  1  
ATOM 181    S SG  . CYS A 1 30  ? -75.808  1.502   -8.486  1.00 99.99  ? 34  CYS C SG  1  
ATOM 182    N N   . TRP A 1 31  ? -75.420  4.212   -7.768  1.00 30.00  ? 35  TRP C N   1  
ATOM 183    C CA  . TRP A 1 31  ? -74.257  4.973   -7.353  1.00 30.00  ? 35  TRP C CA  1  
ATOM 184    C C   . TRP A 1 31  ? -73.010  4.412   -8.010  1.00 30.00  ? 35  TRP C C   1  
ATOM 185    O O   . TRP A 1 31  ? -72.686  3.226   -7.829  1.00 30.00  ? 35  TRP C O   1  
ATOM 186    C CB  . TRP A 1 31  ? -74.100  4.894   -5.836  1.00 99.99  ? 35  TRP C CB  1  
ATOM 187    C CG  . TRP A 1 31  ? -75.159  5.621   -5.045  1.00 99.99  ? 35  TRP C CG  1  
ATOM 188    C CD1 . TRP A 1 31  ? -76.376  5.165   -4.719  1.00 99.99  ? 35  TRP C CD1 1  
ATOM 189    C CD2 . TRP A 1 31  ? -75.085  6.909   -4.499  1.00 99.99  ? 35  TRP C CD2 1  
ATOM 190    N NE1 . TRP A 1 31  ? -77.023  6.197   -3.971  1.00 99.99  ? 35  TRP C NE1 1  
ATOM 191    C CE2 . TRP A 1 31  ? -76.212  7.220   -3.864  1.00 99.99  ? 35  TRP C CE2 1  
ATOM 192    C CE3 . TRP A 1 31  ? -74.035  7.835   -4.542  1.00 99.99  ? 35  TRP C CE3 1  
ATOM 193    C CZ2 . TRP A 1 31  ? -76.441  8.437   -3.216  1.00 99.99  ? 35  TRP C CZ2 1  
ATOM 194    C CZ3 . TRP A 1 31  ? -74.245  9.070   -3.896  1.00 99.99  ? 35  TRP C CZ3 1  
ATOM 195    C CH2 . TRP A 1 31  ? -75.400  9.358   -3.259  1.00 99.99  ? 35  TRP C CH2 1  
ATOM 196    N N   . VAL A 1 32  ? -72.305  5.252   -8.767  1.00 30.00  ? 36  VAL C N   1  
ATOM 197    C CA  . VAL A 1 32  ? -71.066  4.825   -9.421  1.00 30.00  ? 36  VAL C CA  1  
ATOM 198    C C   . VAL A 1 32  ? -69.896  5.642   -8.890  1.00 30.00  ? 36  VAL C C   1  
ATOM 199    O O   . VAL A 1 32  ? -69.995  6.860   -8.751  1.00 30.00  ? 36  VAL C O   1  
ATOM 200    C CB  . VAL A 1 32  ? -71.178  5.027   -10.928 1.00 99.99  ? 36  VAL C CB  1  
ATOM 201    C CG1 . VAL A 1 32  ? -72.343  4.202   -11.467 1.00 99.99  ? 36  VAL C CG1 1  
ATOM 202    C CG2 . VAL A 1 32  ? -71.420  6.503   -11.227 1.00 99.99  ? 36  VAL C CG2 1  
ATOM 203    N N   . PRO A 1 33  ? -68.779  4.979   -8.563  1.00 30.00  ? 37  PRO C N   1  
ATOM 204    C CA  . PRO A 1 33  ? -67.590  5.674   -8.048  1.00 30.00  ? 37  PRO C CA  1  
ATOM 205    C C   . PRO A 1 33  ? -67.192  6.934   -8.817  1.00 30.00  ? 37  PRO C C   1  
ATOM 206    O O   . PRO A 1 33  ? -67.353  7.018   -10.044 1.00 30.00  ? 37  PRO C O   1  
ATOM 207    C CB  . PRO A 1 33  ? -66.603  4.579   -8.243  1.00 99.99  ? 37  PRO C CB  1  
ATOM 208    C CG  . PRO A 1 33  ? -67.379  3.405   -8.788  1.00 99.99  ? 37  PRO C CG  1  
ATOM 209    C CD  . PRO A 1 33  ? -68.627  3.632   -8.918  1.00 99.99  ? 37  PRO C CD  1  
ATOM 210    N N   . ASP A 1 34  ? -66.671  7.915   -8.085  1.00 30.00  ? 38  ASP C N   1  
ATOM 211    C CA  . ASP A 1 34  ? -66.229  9.170   -8.680  1.00 30.00  ? 38  ASP C CA  1  
ATOM 212    C C   . ASP A 1 34  ? -64.924  9.601   -8.010  1.00 30.00  ? 38  ASP C C   1  
ATOM 213    O O   . ASP A 1 34  ? -64.622  9.153   -6.904  1.00 30.00  ? 38  ASP C O   1  
ATOM 214    C CB  . ASP A 1 34  ? -67.294  10.244  -8.469  1.00 99.99  ? 38  ASP C CB  1  
ATOM 215    C CG  . ASP A 1 34  ? -66.946  11.475  -9.300  1.00 99.99  ? 38  ASP C CG  1  
ATOM 216    O OD1 . ASP A 1 34  ? -66.075  12.257  -8.836  1.00 99.99  ? 38  ASP C OD1 1  
ATOM 217    O OD2 . ASP A 1 34  ? -67.554  11.623  -10.396 1.00 99.99  ? 38  ASP C OD2 1  
ATOM 218    N N   . GLU A 1 35  ? -64.144  10.455  -8.677  1.00 30.00  ? 39  GLU C N   1  
ATOM 219    C CA  . GLU A 1 35  ? -62.868  10.929  -8.110  1.00 30.00  ? 39  GLU C CA  1  
ATOM 220    C C   . GLU A 1 35  ? -63.032  12.271  -7.371  1.00 30.00  ? 39  GLU C C   1  
ATOM 221    O O   . GLU A 1 35  ? -62.321  12.549  -6.405  1.00 30.00  ? 39  GLU C O   1  
ATOM 222    C CB  . GLU A 1 35  ? -61.847  11.123  -9.225  1.00 99.99  ? 39  GLU C CB  1  
ATOM 223    C CG  . GLU A 1 35  ? -62.392  12.088  -10.247 1.00 99.99  ? 39  GLU C CG  1  
ATOM 224    C CD  . GLU A 1 35  ? -63.396  11.364  -11.144 1.00 99.99  ? 39  GLU C CD  1  
ATOM 225    O OE1 . GLU A 1 35  ? -64.601  11.369  -10.779 1.00 99.99  ? 39  GLU C OE1 1  
ATOM 226    O OE2 . GLU A 1 35  ? -62.948  10.815  -12.186 1.00 99.99  ? 39  GLU C OE2 1  
ATOM 227    N N   . LYS A 1 36  ? -63.972  13.084  -7.843  1.00 30.00  ? 40  LYS C N   1  
ATOM 228    C CA  . LYS A 1 36  ? -64.259  14.390  -7.254  1.00 30.00  ? 40  LYS C CA  1  
ATOM 229    C C   . LYS A 1 36  ? -65.319  14.274  -6.156  1.00 30.00  ? 40  LYS C C   1  
ATOM 230    O O   . LYS A 1 36  ? -65.118  14.745  -5.040  1.00 30.00  ? 40  LYS C O   1  
ATOM 231    C CB  . LYS A 1 36  ? -64.774  15.342  -8.328  1.00 99.99  ? 40  LYS C CB  1  
ATOM 232    C CG  . LYS A 1 36  ? -64.977  16.728  -7.727  1.00 99.99  ? 40  LYS C CG  1  
ATOM 233    C CD  . LYS A 1 36  ? -65.053  17.763  -8.845  1.00 99.99  ? 40  LYS C CD  1  
ATOM 234    C CE  . LYS A 1 36  ? -65.619  19.067  -8.292  1.00 99.99  ? 40  LYS C CE  1  
ATOM 235    N NZ  . LYS A 1 36  ? -64.513  19.953  -7.896  1.00 99.99  ? 40  LYS C NZ  1  
ATOM 236    N N   . GLU A 1 37  ? -66.440  13.639  -6.492  1.00 30.00  ? 41  GLU C N   1  
ATOM 237    C CA  . GLU A 1 37  ? -67.559  13.464  -5.569  1.00 30.00  ? 41  GLU C CA  1  
ATOM 238    C C   . GLU A 1 37  ? -67.620  12.169  -4.775  1.00 30.00  ? 41  GLU C C   1  
ATOM 239    O O   . GLU A 1 37  ? -68.549  11.977  -3.985  1.00 30.00  ? 41  GLU C O   1  
ATOM 240    C CB  . GLU A 1 37  ? -68.876  13.525  -6.334  1.00 99.99  ? 41  GLU C CB  1  
ATOM 241    C CG  . GLU A 1 37  ? -69.930  14.183  -5.477  1.00 99.99  ? 41  GLU C CG  1  
ATOM 242    C CD  . GLU A 1 37  ? -70.211  13.306  -4.257  1.00 99.99  ? 41  GLU C CD  1  
ATOM 243    O OE1 . GLU A 1 37  ? -69.518  13.512  -3.227  1.00 99.99  ? 41  GLU C OE1 1  
ATOM 244    O OE2 . GLU A 1 37  ? -71.120  12.439  -4.371  1.00 99.99  ? 41  GLU C OE2 1  
ATOM 245    N N   . GLY A 1 38  ? -66.656  11.277  -4.974  1.00 30.00  ? 42  GLY C N   1  
ATOM 246    C CA  . GLY A 1 38  ? -66.678  10.015  -4.239  1.00 30.00  ? 42  GLY C CA  1  
ATOM 247    C C   . GLY A 1 38  ? -67.632  9.002   -4.869  1.00 30.00  ? 42  GLY C C   1  
ATOM 248    O O   . GLY A 1 38  ? -67.290  7.819   -5.015  1.00 30.00  ? 42  GLY C O   1  
ATOM 249    N N   . PHE A 1 39  ? -68.825  9.475   -5.235  1.00 30.00  ? 43  PHE C N   1  
ATOM 250    C CA  . PHE A 1 39  ? -69.857  8.653   -5.859  1.00 30.00  ? 43  PHE C CA  1  
ATOM 251    C C   . PHE A 1 39  ? -70.709  9.547   -6.744  1.00 30.00  ? 43  PHE C C   1  
ATOM 252    O O   . PHE A 1 39  ? -70.971  10.697  -6.398  1.00 30.00  ? 43  PHE C O   1  
ATOM 253    C CB  . PHE A 1 39  ? -70.723  8.006   -4.784  1.00 99.99  ? 43  PHE C CB  1  
ATOM 254    C CG  . PHE A 1 39  ? -69.882  7.068   -3.955  1.00 99.99  ? 43  PHE C CG  1  
ATOM 255    C CD1 . PHE A 1 39  ? -69.209  7.545   -2.825  1.00 99.99  ? 43  PHE C CD1 1  
ATOM 256    C CD2 . PHE A 1 39  ? -69.774  5.717   -4.315  1.00 99.99  ? 43  PHE C CD2 1  
ATOM 257    C CE1 . PHE A 1 39  ? -68.427  6.674   -2.052  1.00 99.99  ? 43  PHE C CE1 1  
ATOM 258    C CE2 . PHE A 1 39  ? -68.993  4.848   -3.545  1.00 99.99  ? 43  PHE C CE2 1  
ATOM 259    C CZ  . PHE A 1 39  ? -68.321  5.325   -2.415  1.00 99.99  ? 43  PHE C CZ  1  
ATOM 260    N N   . ALA A 1 40  ? -71.144  9.023   -7.885  1.00 30.00  ? 44  ALA C N   1  
ATOM 261    C CA  . ALA A 1 40  ? -71.959  9.811   -8.792  1.00 30.00  ? 44  ALA C CA  1  
ATOM 262    C C   . ALA A 1 40  ? -73.279  9.149   -9.082  1.00 30.00  ? 44  ALA C C   1  
ATOM 263    O O   . ALA A 1 40  ? -73.377  7.920   -9.116  1.00 30.00  ? 44  ALA C O   1  
ATOM 264    C CB  . ALA A 1 40  ? -71.214  10.032  -10.086 1.00 30.00  ? 44  ALA C CB  1  
ATOM 265    N N   . SER A 1 41  ? -74.297  9.981   -9.286  1.00 30.00  ? 45  SER C N   1  
ATOM 266    C CA  . SER A 1 41  ? -75.641  9.516   -9.586  1.00 30.00  ? 45  SER C CA  1  
ATOM 267    C C   . SER A 1 41  ? -75.617  9.044   -11.022 1.00 30.00  ? 45  SER C C   1  
ATOM 268    O O   . SER A 1 41  ? -75.419  9.839   -11.945 1.00 30.00  ? 45  SER C O   1  
ATOM 269    C CB  . SER A 1 41  ? -76.638  10.656  -9.405  1.00 99.99  ? 45  SER C CB  1  
ATOM 270    O OG  . SER A 1 41  ? -76.416  11.647  -10.412 1.00 99.99  ? 45  SER C OG  1  
ATOM 271    N N   . ALA A 1 42  ? -75.822  7.745   -11.209 1.00 30.00  ? 46  ALA C N   1  
ATOM 272    C CA  . ALA A 1 42  ? -75.807  7.190   -12.546 1.00 30.00  ? 46  ALA C CA  1  
ATOM 273    C C   . ALA A 1 42  ? -77.090  6.475   -12.907 1.00 30.00  ? 46  ALA C C   1  
ATOM 274    O O   . ALA A 1 42  ? -77.858  6.053   -12.035 1.00 30.00  ? 46  ALA C O   1  
ATOM 275    C CB  . ALA A 1 42  ? -74.640  6.239   -12.680 1.00 30.00  ? 46  ALA C CB  1  
ATOM 276    N N   . GLU A 1 43  ? -77.308  6.363   -14.212 1.00 30.00  ? 47  GLU C N   1  
ATOM 277    C CA  . GLU A 1 43  ? -78.466  5.688   -14.786 1.00 30.00  ? 47  GLU C CA  1  
ATOM 278    C C   . GLU A 1 43  ? -77.901  4.713   -15.813 1.00 30.00  ? 47  GLU C C   1  
ATOM 279    O O   . GLU A 1 43  ? -77.335  5.137   -16.828 1.00 30.00  ? 47  GLU C O   1  
ATOM 280    C CB  . GLU A 1 43  ? -79.392  6.709   -15.439 1.00 99.99  ? 47  GLU C CB  1  
ATOM 281    C CG  . GLU A 1 43  ? -79.729  6.262   -16.840 1.00 99.99  ? 47  GLU C CG  1  
ATOM 282    C CD  . GLU A 1 43  ? -78.499  6.404   -17.732 1.00 99.99  ? 47  GLU C CD  1  
ATOM 283    O OE1 . GLU A 1 43  ? -77.722  5.417   -17.807 1.00 99.99  ? 47  GLU C OE1 1  
ATOM 284    O OE2 . GLU A 1 43  ? -78.344  7.505   -18.328 1.00 99.99  ? 47  GLU C OE2 1  
ATOM 285    N N   . ILE A 1 44  ? -78.051  3.415   -15.544 1.00 30.00  ? 48  ILE C N   1  
ATOM 286    C CA  . ILE A 1 44  ? -77.545  2.372   -16.442 1.00 30.00  ? 48  ILE C CA  1  
ATOM 287    C C   . ILE A 1 44  ? -78.105  2.428   -17.858 1.00 30.00  ? 48  ILE C C   1  
ATOM 288    O O   . ILE A 1 44  ? -79.276  2.738   -18.081 1.00 30.00  ? 48  ILE C O   1  
ATOM 289    C CB  . ILE A 1 44  ? -77.895  0.996   -15.888 1.00 99.99  ? 48  ILE C CB  1  
ATOM 290    C CG1 . ILE A 1 44  ? -79.335  0.649   -16.256 1.00 99.99  ? 48  ILE C CG1 1  
ATOM 291    C CG2 . ILE A 1 44  ? -77.750  1.005   -14.370 1.00 99.99  ? 48  ILE C CG2 1  
ATOM 292    C CD1 . ILE A 1 44  ? -80.266  1.076   -15.127 1.00 99.99  ? 48  ILE C CD1 1  
ATOM 293    N N   . GLN A 1 45  ? -77.249  2.108   -18.815 1.00 30.00  ? 49  GLN C N   1  
ATOM 294    C CA  . GLN A 1 45  ? -77.633  2.121   -20.214 1.00 30.00  ? 49  GLN C CA  1  
ATOM 295    C C   . GLN A 1 45  ? -77.562  0.740   -20.841 1.00 30.00  ? 49  GLN C C   1  
ATOM 296    O O   . GLN A 1 45  ? -78.495  0.314   -21.529 1.00 30.00  ? 49  GLN C O   1  
ATOM 297    C CB  . GLN A 1 45  ? -76.700  3.041   -20.997 1.00 99.99  ? 49  GLN C CB  1  
ATOM 298    C CG  . GLN A 1 45  ? -76.884  4.477   -20.520 1.00 99.99  ? 49  GLN C CG  1  
ATOM 299    C CD  . GLN A 1 45  ? -78.215  5.046   -20.988 1.00 99.99  ? 49  GLN C CD  1  
ATOM 300    O OE1 . GLN A 1 45  ? -78.985  4.362   -21.661 1.00 99.99  ? 49  GLN C OE1 1  
ATOM 301    N NE2 . GLN A 1 45  ? -78.491  6.301   -20.631 1.00 99.99  ? 49  GLN C NE2 1  
ATOM 302    N N   . SER A 1 46  ? -76.457  0.041   -20.594 1.00 30.00  ? 50  SER C N   1  
ATOM 303    C CA  . SER A 1 46  ? -76.260  -1.277  -21.166 1.00 30.00  ? 50  SER C CA  1  
ATOM 304    C C   . SER A 1 46  ? -75.284  -2.173  -20.423 1.00 30.00  ? 50  SER C C   1  
ATOM 305    O O   . SER A 1 46  ? -74.179  -1.757  -20.093 1.00 30.00  ? 50  SER C O   1  
ATOM 306    C CB  . SER A 1 46  ? -75.722  -1.153  -22.587 1.00 99.99  ? 50  SER C CB  1  
ATOM 307    O OG  . SER A 1 46  ? -75.553  -2.454  -23.151 1.00 99.99  ? 50  SER C OG  1  
ATOM 308    N N   . SER A 1 47  ? -75.703  -3.410  -20.178 1.00 30.00  ? 51  SER C N   1  
ATOM 309    C CA  . SER A 1 47  ? -74.858  -4.382  -19.497 1.00 30.00  ? 51  SER C CA  1  
ATOM 310    C C   . SER A 1 47  ? -74.012  -5.056  -20.579 1.00 30.00  ? 51  SER C C   1  
ATOM 311    O O   . SER A 1 47  ? -74.258  -4.881  -21.771 1.00 30.00  ? 51  SER C O   1  
ATOM 312    C CB  . SER A 1 47  ? -75.725  -5.405  -18.770 1.00 99.99  ? 51  SER C CB  1  
ATOM 313    O OG  . SER A 1 47  ? -76.416  -6.211  -19.727 1.00 99.99  ? 51  SER C OG  1  
ATOM 314    N N   . LYS A 1 48  ? -73.023  -5.829  -20.156 1.00 30.00  ? 52  LYS C N   1  
ATOM 315    C CA  . LYS A 1 48  ? -72.150  -6.518  -21.079 1.00 30.00  ? 52  LYS C CA  1  
ATOM 316    C C   . LYS A 1 48  ? -71.211  -7.379  -20.259 1.00 30.00  ? 52  LYS C C   1  
ATOM 317    O O   . LYS A 1 48  ? -70.008  -7.149  -20.229 1.00 30.00  ? 52  LYS C O   1  
ATOM 318    C CB  . LYS A 1 48  ? -71.362  -5.505  -21.902 1.00 99.99  ? 52  LYS C CB  1  
ATOM 319    C CG  . LYS A 1 48  ? -70.519  -6.237  -22.942 1.00 99.99  ? 52  LYS C CG  1  
ATOM 320    C CD  . LYS A 1 48  ? -70.090  -5.259  -24.030 1.00 99.99  ? 52  LYS C CD  1  
ATOM 321    C CE  . LYS A 1 48  ? -68.965  -5.876  -24.852 1.00 99.99  ? 52  LYS C CE  1  
ATOM 322    N NZ  . LYS A 1 48  ? -69.530  -6.547  -26.034 1.00 99.99  ? 52  LYS C NZ  1  
ATOM 323    N N   . GLY A 1 49  ? -71.778  -8.375  -19.591 1.00 30.00  ? 53  GLY C N   1  
ATOM 324    C CA  . GLY A 1 49  ? -70.991  -9.267  -18.766 1.00 30.00  ? 53  GLY C CA  1  
ATOM 325    C C   . GLY A 1 49  ? -70.752  -8.622  -17.414 1.00 30.00  ? 53  GLY C C   1  
ATOM 326    O O   . GLY A 1 49  ? -71.492  -8.846  -16.451 1.00 30.00  ? 53  GLY C O   1  
ATOM 327    N N   . ASP A 1 50  ? -69.702  -7.808  -17.356 1.00 30.00  ? 54  ASP C N   1  
ATOM 328    C CA  . ASP A 1 50  ? -69.316  -7.094  -16.150 1.00 30.00  ? 54  ASP C CA  1  
ATOM 329    C C   . ASP A 1 50  ? -69.209  -5.615  -16.476 1.00 30.00  ? 54  ASP C C   1  
ATOM 330    O O   . ASP A 1 50  ? -69.299  -4.764  -15.601 1.00 30.00  ? 54  ASP C O   1  
ATOM 331    C CB  . ASP A 1 50  ? -67.971  -7.610  -15.647 1.00 99.99  ? 54  ASP C CB  1  
ATOM 332    C CG  . ASP A 1 50  ? -67.693  -7.041  -14.262 1.00 99.99  ? 54  ASP C CG  1  
ATOM 333    O OD1 . ASP A 1 50  ? -67.252  -5.860  -14.200 1.00 99.99  ? 54  ASP C OD1 1  
ATOM 334    O OD2 . ASP A 1 50  ? -67.923  -7.788  -13.272 1.00 99.99  ? 54  ASP C OD2 1  
ATOM 335    N N   . GLU A 1 51  ? -69.022  -5.314  -17.747 1.00 30.00  ? 55  GLU C N   1  
ATOM 336    C CA  . GLU A 1 51  ? -68.886  -3.947  -18.179 1.00 30.00  ? 55  GLU C CA  1  
ATOM 337    C C   . GLU A 1 51  ? -70.207  -3.251  -18.348 1.00 30.00  ? 55  GLU C C   1  
ATOM 338    O O   . GLU A 1 51  ? -70.822  -3.335  -19.410 1.00 30.00  ? 55  GLU C O   1  
ATOM 339    C CB  . GLU A 1 51  ? -68.167  -3.897  -19.523 1.00 99.99  ? 55  GLU C CB  1  
ATOM 340    C CG  . GLU A 1 51  ? -67.299  -2.664  -19.583 1.00 99.99  ? 55  GLU C CG  1  
ATOM 341    C CD  . GLU A 1 51  ? -68.181  -1.419  -19.552 1.00 99.99  ? 55  GLU C CD  1  
ATOM 342    O OE1 . GLU A 1 51  ? -68.459  -0.934  -18.423 1.00 99.99  ? 55  GLU C OE1 1  
ATOM 343    O OE2 . GLU A 1 51  ? -68.572  -0.961  -20.661 1.00 99.99  ? 55  GLU C OE2 1  
ATOM 344    N N   . ILE A 1 52  ? -70.642  -2.558  -17.304 1.00 30.00  ? 56  ILE C N   1  
ATOM 345    C CA  . ILE A 1 52  ? -71.900  -1.833  -17.357 1.00 30.00  ? 56  ILE C CA  1  
ATOM 346    C C   . ILE A 1 52  ? -71.573  -0.465  -17.920 1.00 30.00  ? 56  ILE C C   1  
ATOM 347    O O   . ILE A 1 52  ? -70.496  0.059   -17.669 1.00 30.00  ? 56  ILE C O   1  
ATOM 348    C CB  . ILE A 1 52  ? -72.495  -1.722  -15.959 1.00 99.99  ? 56  ILE C CB  1  
ATOM 349    C CG1 . ILE A 1 52  ? -71.917  -0.499  -15.255 1.00 99.99  ? 56  ILE C CG1 1  
ATOM 350    C CG2 . ILE A 1 52  ? -72.153  -2.977  -15.160 1.00 99.99  ? 56  ILE C CG2 1  
ATOM 351    C CD1 . ILE A 1 52  ? -72.856  0.689   -15.452 1.00 99.99  ? 56  ILE C CD1 1  
ATOM 352    N N   . THR A 1 53  ? -72.494  0.102   -18.684 1.00 30.00  ? 57  THR C N   1  
ATOM 353    C CA  . THR A 1 53  ? -72.312  1.419   -19.283 1.00 30.00  ? 57  THR C CA  1  
ATOM 354    C C   . THR A 1 53  ? -73.447  2.280   -18.749 1.00 30.00  ? 57  THR C C   1  
ATOM 355    O O   . THR A 1 53  ? -74.622  2.050   -19.059 1.00 30.00  ? 57  THR C O   1  
ATOM 356    C CB  . THR A 1 53  ? -72.374  1.308   -20.803 1.00 99.99  ? 57  THR C CB  1  
ATOM 357    O OG1 . THR A 1 53  ? -73.704  0.965   -21.203 1.00 99.99  ? 57  THR C OG1 1  
ATOM 358    C CG2 . THR A 1 53  ? -71.408  0.229   -21.275 1.00 99.99  ? 57  THR C CG2 1  
ATOM 359    N N   . VAL A 1 54  ? -73.075  3.272   -17.942 1.00 30.00  ? 58  VAL C N   1  
ATOM 360    C CA  . VAL A 1 54  ? -74.027  4.187   -17.318 1.00 30.00  ? 58  VAL C CA  1  
ATOM 361    C C   . VAL A 1 54  ? -73.911  5.597   -17.849 1.00 30.00  ? 58  VAL C C   1  
ATOM 362    O O   . VAL A 1 54  ? -72.960  5.930   -18.558 1.00 30.00  ? 58  VAL C O   1  
ATOM 363    C CB  . VAL A 1 54  ? -73.790  4.236   -15.813 1.00 99.99  ? 58  VAL C CB  1  
ATOM 364    C CG1 . VAL A 1 54  ? -73.972  2.840   -15.224 1.00 99.99  ? 58  VAL C CG1 1  
ATOM 365    C CG2 . VAL A 1 54  ? -72.372  4.724   -15.535 1.00 99.99  ? 58  VAL C CG2 1  
ATOM 366    N N   . LYS A 1 55  ? -74.884  6.425   -17.505 1.00 30.00  ? 59  LYS C N   1  
ATOM 367    C CA  . LYS A 1 55  ? -74.877  7.810   -17.924 1.00 30.00  ? 59  LYS C CA  1  
ATOM 368    C C   . LYS A 1 55  ? -74.896  8.627   -16.640 1.00 30.00  ? 59  LYS C C   1  
ATOM 369    O O   . LYS A 1 55  ? -75.682  8.336   -15.728 1.00 30.00  ? 59  LYS C O   1  
ATOM 370    C CB  . LYS A 1 55  ? -76.106  8.100   -18.777 1.00 99.99  ? 59  LYS C CB  1  
ATOM 371    C CG  . LYS A 1 55  ? -76.042  9.533   -19.296 1.00 99.99  ? 59  LYS C CG  1  
ATOM 372    C CD  . LYS A 1 55  ? -76.994  9.691   -20.476 1.00 99.99  ? 59  LYS C CD  1  
ATOM 373    C CE  . LYS A 1 55  ? -77.214  11.175  -20.758 1.00 99.99  ? 59  LYS C CE  1  
ATOM 374    N NZ  . LYS A 1 55  ? -76.266  11.625  -21.788 1.00 99.99  ? 59  LYS C NZ  1  
ATOM 375    N N   . ILE A 1 56  ? -74.025  9.629   -16.562 1.00 30.00  ? 60  ILE C N   1  
ATOM 376    C CA  . ILE A 1 56  ? -73.951  10.490  -15.380 1.00 30.00  ? 60  ILE C CA  1  
ATOM 377    C C   . ILE A 1 56  ? -75.075  11.526  -15.500 1.00 30.00  ? 60  ILE C C   1  
ATOM 378    O O   . ILE A 1 56  ? -75.103  12.317  -16.453 1.00 30.00  ? 60  ILE C O   1  
ATOM 379    C CB  . ILE A 1 56  ? -72.593  11.180  -15.324 1.00 99.99  ? 60  ILE C CB  1  
ATOM 380    C CG1 . ILE A 1 56  ? -72.640  12.460  -16.150 1.00 99.99  ? 60  ILE C CG1 1  
ATOM 381    C CG2 . ILE A 1 56  ? -71.526  10.248  -15.891 1.00 99.99  ? 60  ILE C CG2 1  
ATOM 382    C CD1 . ILE A 1 56  ? -72.970  13.640  -15.241 1.00 99.99  ? 60  ILE C CD1 1  
ATOM 383    N N   . VAL A 1 57  ? -75.998  11.516  -14.541 1.00 30.00  ? 61  VAL C N   1  
ATOM 384    C CA  . VAL A 1 57  ? -77.131  12.448  -14.542 1.00 30.00  ? 61  VAL C CA  1  
ATOM 385    C C   . VAL A 1 57  ? -76.743  13.925  -14.558 1.00 30.00  ? 61  VAL C C   1  
ATOM 386    O O   . VAL A 1 57  ? -77.423  14.749  -15.180 1.00 30.00  ? 61  VAL C O   1  
ATOM 387    C CB  . VAL A 1 57  ? -77.981  12.234  -13.293 1.00 99.99  ? 61  VAL C CB  1  
ATOM 388    C CG1 . VAL A 1 57  ? -79.128  13.241  -13.280 1.00 99.99  ? 61  VAL C CG1 1  
ATOM 389    C CG2 . VAL A 1 57  ? -78.549  10.819  -13.299 1.00 99.99  ? 61  VAL C CG2 1  
ATOM 390    N N   . ALA A 1 58  ? -75.650  14.243  -13.873 1.00 30.00  ? 62  ALA C N   1  
ATOM 391    C CA  . ALA A 1 58  ? -75.138  15.604  -13.784 1.00 30.00  ? 62  ALA C CA  1  
ATOM 392    C C   . ALA A 1 58  ? -74.757  16.210  -15.140 1.00 30.00  ? 62  ALA C C   1  
ATOM 393    O O   . ALA A 1 58  ? -75.552  16.914  -15.766 1.00 30.00  ? 62  ALA C O   1  
ATOM 394    C CB  . ALA A 1 58  ? -73.929  15.629  -12.843 1.00 30.00  ? 62  ALA C CB  1  
ATOM 395    N N   . ASP A 1 59  ? -73.535  15.935  -15.589 1.00 30.00  ? 63  ASP C N   1  
ATOM 396    C CA  . ASP A 1 59  ? -73.040  16.457  -16.859 1.00 30.00  ? 63  ASP C CA  1  
ATOM 397    C C   . ASP A 1 59  ? -73.626  15.758  -18.081 1.00 30.00  ? 63  ASP C C   1  
ATOM 398    O O   . ASP A 1 59  ? -73.559  16.280  -19.197 1.00 30.00  ? 63  ASP C O   1  
ATOM 399    C CB  . ASP A 1 59  ? -71.526  16.297  -16.932 1.00 99.99  ? 63  ASP C CB  1  
ATOM 400    C CG  . ASP A 1 59  ? -70.989  17.063  -18.140 1.00 99.99  ? 63  ASP C CG  1  
ATOM 401    O OD1 . ASP A 1 59  ? -71.096  16.507  -19.268 1.00 99.99  ? 63  ASP C OD1 1  
ATOM 402    O OD2 . ASP A 1 59  ? -70.480  18.194  -17.926 1.00 99.99  ? 63  ASP C OD2 1  
ATOM 403    N N   . SER A 1 60  ? -74.196  14.575  -17.859 1.00 30.00  ? 64  SER C N   1  
ATOM 404    C CA  . SER A 1 60  ? -74.795  13.780  -18.923 1.00 30.00  ? 64  SER C CA  1  
ATOM 405    C C   . SER A 1 60  ? -73.728  13.087  -19.781 1.00 30.00  ? 64  SER C C   1  
ATOM 406    O O   . SER A 1 60  ? -73.954  12.774  -20.950 1.00 30.00  ? 64  SER C O   1  
ATOM 407    C CB  . SER A 1 60  ? -75.631  14.673  -19.833 1.00 99.99  ? 64  SER C CB  1  
ATOM 408    O OG  . SER A 1 60  ? -76.234  13.881  -20.858 1.00 99.99  ? 64  SER C OG  1  
ATOM 409    N N   . SER A 1 61  ? -72.562  12.854  -19.186 1.00 30.00  ? 65  SER C N   1  
ATOM 410    C CA  . SER A 1 61  ? -71.473  12.189  -19.879 1.00 30.00  ? 65  SER C CA  1  
ATOM 411    C C   . SER A 1 61  ? -71.738  10.682  -19.766 1.00 30.00  ? 65  SER C C   1  
ATOM 412    O O   . SER A 1 61  ? -72.732  10.274  -19.156 1.00 30.00  ? 65  SER C O   1  
ATOM 413    C CB  . SER A 1 61  ? -70.145  12.555  -19.230 1.00 99.99  ? 65  SER C CB  1  
ATOM 414    O OG  . SER A 1 61  ? -69.964  13.972  -19.281 1.00 99.99  ? 65  SER C OG  1  
ATOM 415    N N   . THR A 1 62  ? -70.864  9.859   -20.342 1.00 30.00  ? 66  THR C N   1  
ATOM 416    C CA  . THR A 1 62  ? -71.037  8.402   -20.295 1.00 30.00  ? 66  THR C CA  1  
ATOM 417    C C   . THR A 1 62  ? -69.763  7.669   -19.948 1.00 30.00  ? 66  THR C C   1  
ATOM 418    O O   . THR A 1 62  ? -68.666  8.147   -20.221 1.00 30.00  ? 66  THR C O   1  
ATOM 419    C CB  . THR A 1 62  ? -71.508  7.892   -21.652 1.00 99.99  ? 66  THR C CB  1  
ATOM 420    O OG1 . THR A 1 62  ? -71.696  6.476   -21.588 1.00 99.99  ? 66  THR C OG1 1  
ATOM 421    C CG2 . THR A 1 62  ? -70.457  8.217   -22.709 1.00 99.99  ? 66  THR C CG2 1  
ATOM 422    N N   . ARG A 1 63  ? -69.924  6.490   -19.353 1.00 30.00  ? 67  ARG C N   1  
ATOM 423    C CA  . ARG A 1 63  ? -68.777  5.676   -18.984 1.00 30.00  ? 67  ARG C CA  1  
ATOM 424    C C   . ARG A 1 63  ? -69.172  4.265   -18.580 1.00 30.00  ? 67  ARG C C   1  
ATOM 425    O O   . ARG A 1 63  ? -70.350  3.957   -18.411 1.00 30.00  ? 67  ARG C O   1  
ATOM 426    C CB  . ARG A 1 63  ? -68.048  6.313   -17.803 1.00 99.99  ? 67  ARG C CB  1  
ATOM 427    C CG  . ARG A 1 63  ? -68.926  6.233   -16.559 1.00 99.99  ? 67  ARG C CG  1  
ATOM 428    C CD  . ARG A 1 63  ? -68.106  6.614   -15.332 1.00 99.99  ? 67  ARG C CD  1  
ATOM 429    N NE  . ARG A 1 63  ? -68.957  6.664   -14.122 1.00 99.99  ? 67  ARG C NE  1  
ATOM 430    C CZ  . ARG A 1 63  ? -68.507  7.067   -12.935 1.00 99.99  ? 67  ARG C CZ  1  
ATOM 431    N NH1 . ARG A 1 63  ? -67.245  7.453   -12.756 1.00 99.99  ? 67  ARG C NH1 1  
ATOM 432    N NH2 . ARG A 1 63  ? -69.357  7.073   -11.914 1.00 99.99  ? 67  ARG C NH2 1  
ATOM 433    N N   . THR A 1 64  ? -68.161  3.423   -18.436 1.00 30.00  ? 68  THR C N   1  
ATOM 434    C CA  . THR A 1 64  ? -68.356  2.034   -18.066 1.00 30.00  ? 68  THR C CA  1  
ATOM 435    C C   . THR A 1 64  ? -67.904  1.852   -16.625 1.00 30.00  ? 68  THR C C   1  
ATOM 436    O O   . THR A 1 64  ? -67.139  2.665   -16.127 1.00 30.00  ? 68  THR C O   1  
ATOM 437    C CB  . THR A 1 64  ? -67.534  1.132   -18.981 1.00 99.99  ? 68  THR C CB  1  
ATOM 438    O OG1 . THR A 1 64  ? -66.141  1.333   -18.725 1.00 99.99  ? 68  THR C OG1 1  
ATOM 439    C CG2 . THR A 1 64  ? -67.836  1.478   -20.436 1.00 99.99  ? 68  THR C CG2 1  
ATOM 440    N N   . VAL A 1 65  ? -68.364  0.796   -15.960 1.00 30.00  ? 69  VAL C N   1  
ATOM 441    C CA  . VAL A 1 65  ? -67.995  0.554   -14.568 1.00 30.00  ? 69  VAL C CA  1  
ATOM 442    C C   . VAL A 1 65  ? -68.191  -0.899  -14.201 1.00 30.00  ? 69  VAL C C   1  
ATOM 443    O O   . VAL A 1 65  ? -69.234  -1.454  -14.504 1.00 30.00  ? 69  VAL C O   1  
ATOM 444    C CB  . VAL A 1 65  ? -68.858  1.407   -13.646 1.00 99.99  ? 69  VAL C CB  1  
ATOM 445    C CG1 . VAL A 1 65  ? -68.646  2.884   -13.974 1.00 99.99  ? 69  VAL C CG1 1  
ATOM 446    C CG2 . VAL A 1 65  ? -70.326  1.048   -13.846 1.00 99.99  ? 69  VAL C CG2 1  
ATOM 447    N N   . LYS A 1 66  ? -67.216  -1.524  -13.558 1.00 30.00  ? 70  LYS C N   1  
ATOM 448    C CA  . LYS A 1 66  ? -67.384  -2.924  -13.172 1.00 30.00  ? 70  LYS C CA  1  
ATOM 449    C C   . LYS A 1 66  ? -68.764  -3.055  -12.532 1.00 30.00  ? 70  LYS C C   1  
ATOM 450    O O   . LYS A 1 66  ? -69.239  -2.148  -11.857 1.00 30.00  ? 70  LYS C O   1  
ATOM 451    C CB  . LYS A 1 66  ? -66.298  -3.321  -12.179 1.00 99.99  ? 70  LYS C CB  1  
ATOM 452    C CG  . LYS A 1 66  ? -66.448  -4.793  -11.820 1.00 99.99  ? 70  LYS C CG  1  
ATOM 453    C CD  . LYS A 1 66  ? -65.438  -5.160  -10.737 1.00 99.99  ? 70  LYS C CD  1  
ATOM 454    C CE  . LYS A 1 66  ? -65.852  -6.472  -10.080 1.00 99.99  ? 70  LYS C CE  1  
ATOM 455    N NZ  . LYS A 1 66  ? -66.144  -7.469  -11.122 1.00 99.99  ? 70  LYS C NZ  1  
ATOM 456    N N   . LYS A 1 67  ? -69.415  -4.186  -12.754 1.00 30.00  ? 71  LYS C N   1  
ATOM 457    C CA  . LYS A 1 67  ? -70.742  -4.409  -12.212 1.00 30.00  ? 71  LYS C CA  1  
ATOM 458    C C   . LYS A 1 67  ? -70.721  -4.463  -10.700 1.00 30.00  ? 71  LYS C C   1  
ATOM 459    O O   . LYS A 1 67  ? -71.655  -4.013  -10.040 1.00 30.00  ? 71  LYS C O   1  
ATOM 460    C CB  . LYS A 1 67  ? -71.300  -5.730  -12.730 1.00 99.99  ? 71  LYS C CB  1  
ATOM 461    C CG  . LYS A 1 67  ? -72.731  -5.908  -12.236 1.00 99.99  ? 71  LYS C CG  1  
ATOM 462    C CD  . LYS A 1 67  ? -73.436  -6.962  -13.086 1.00 99.99  ? 71  LYS C CD  1  
ATOM 463    C CE  . LYS A 1 67  ? -74.712  -7.410  -12.383 1.00 99.99  ? 71  LYS C CE  1  
ATOM 464    N NZ  . LYS A 1 67  ? -75.849  -6.620  -12.877 1.00 99.99  ? 71  LYS C NZ  1  
ATOM 465    N N   . ASP A 1 68  ? -69.652  -5.014  -10.142 1.00 30.00  ? 72  ASP C N   1  
ATOM 466    C CA  . ASP A 1 68  ? -69.545  -5.125  -8.700  1.00 30.00  ? 72  ASP C CA  1  
ATOM 467    C C   . ASP A 1 68  ? -69.054  -3.854  -8.021  1.00 30.00  ? 72  ASP C C   1  
ATOM 468    O O   . ASP A 1 68  ? -68.643  -3.898  -6.869  1.00 30.00  ? 72  ASP C O   1  
ATOM 469    C CB  . ASP A 1 68  ? -68.560  -6.234  -8.337  1.00 99.99  ? 72  ASP C CB  1  
ATOM 470    C CG  . ASP A 1 68  ? -68.636  -6.513  -6.838  1.00 99.99  ? 72  ASP C CG  1  
ATOM 471    O OD1 . ASP A 1 68  ? -68.017  -5.725  -6.073  1.00 99.99  ? 72  ASP C OD1 1  
ATOM 472    O OD2 . ASP A 1 68  ? -69.313  -7.511  -6.470  1.00 99.99  ? 72  ASP C OD2 1  
ATOM 473    N N   . ASP A 1 69  ? -69.098  -2.727  -8.732  1.00 30.00  ? 73  ASP C N   1  
ATOM 474    C CA  . ASP A 1 69  ? -68.653  -1.433  -8.199  1.00 30.00  ? 73  ASP C CA  1  
ATOM 475    C C   . ASP A 1 69  ? -69.832  -0.467  -8.165  1.00 30.00  ? 73  ASP C C   1  
ATOM 476    O O   . ASP A 1 69  ? -69.698  0.698   -7.789  1.00 30.00  ? 73  ASP C O   1  
ATOM 477    C CB  . ASP A 1 69  ? -67.552  -0.858  -9.085  1.00 99.99  ? 73  ASP C CB  1  
ATOM 478    C CG  . ASP A 1 69  ? -66.297  -1.716  -8.960  1.00 99.99  ? 73  ASP C CG  1  
ATOM 479    O OD1 . ASP A 1 69  ? -65.653  -1.644  -7.880  1.00 99.99  ? 73  ASP C OD1 1  
ATOM 480    O OD2 . ASP A 1 69  ? -65.995  -2.442  -9.947  1.00 99.99  ? 73  ASP C OD2 1  
ATOM 481    N N   . ILE A 1 70  ? -70.987  -0.950  -8.585  1.00 30.00  ? 74  ILE C N   1  
ATOM 482    C CA  . ILE A 1 70  ? -72.182  -0.134  -8.585  1.00 30.00  ? 74  ILE C CA  1  
ATOM 483    C C   . ILE A 1 70  ? -72.700  -0.283  -7.158  1.00 30.00  ? 74  ILE C C   1  
ATOM 484    O O   . ILE A 1 70  ? -72.539  -1.344  -6.531  1.00 30.00  ? 74  ILE C O   1  
ATOM 485    C CB  . ILE A 1 70  ? -73.170  -0.660  -9.622  1.00 99.99  ? 74  ILE C CB  1  
ATOM 486    C CG1 . ILE A 1 70  ? -74.023  -1.760  -9.001  1.00 99.99  ? 74  ILE C CG1 1  
ATOM 487    C CG2 . ILE A 1 70  ? -72.403  -1.222  -10.814 1.00 99.99  ? 74  ILE C CG2 1  
ATOM 488    C CD1 . ILE A 1 70  ? -75.321  -1.158  -8.470  1.00 99.99  ? 74  ILE C CD1 1  
ATOM 489    N N   . GLN A 1 71  ? -73.306  0.780   -6.644  1.00 30.00  ? 75  GLN C N   1  
ATOM 490    C CA  . GLN A 1 71  ? -73.843  0.765   -5.292  1.00 30.00  ? 75  GLN C CA  1  
ATOM 491    C C   . GLN A 1 71  ? -75.329  1.017   -5.419  1.00 30.00  ? 75  GLN C C   1  
ATOM 492    O O   . GLN A 1 71  ? -75.753  1.844   -6.241  1.00 30.00  ? 75  GLN C O   1  
ATOM 493    C CB  . GLN A 1 71  ? -73.178  1.853   -4.457  1.00 99.99  ? 75  GLN C CB  1  
ATOM 494    C CG  . GLN A 1 71  ? -71.695  1.540   -4.299  1.00 99.99  ? 75  GLN C CG  1  
ATOM 495    C CD  . GLN A 1 71  ? -71.478  0.363   -3.359  1.00 99.99  ? 75  GLN C CD  1  
ATOM 496    O OE1 . GLN A 1 71  ? -72.436  -0.203  -2.837  1.00 99.99  ? 75  GLN C OE1 1  
ATOM 497    N NE2 . GLN A 1 71  ? -70.214  -0.005  -3.141  1.00 99.99  ? 75  GLN C NE2 1  
ATOM 498    N N   . SER A 1 72  ? -76.121  0.320   -4.616  1.00 30.00  ? 76  SER C N   1  
ATOM 499    C CA  . SER A 1 72  ? -77.568  0.502   -4.668  1.00 30.00  ? 76  SER C CA  1  
ATOM 500    C C   . SER A 1 72  ? -77.992  1.884   -4.143  1.00 30.00  ? 76  SER C C   1  
ATOM 501    O O   . SER A 1 72  ? -77.562  2.305   -3.069  1.00 30.00  ? 76  SER C O   1  
ATOM 502    C CB  . SER A 1 72  ? -78.255  -0.558  -3.815  1.00 99.99  ? 76  SER C CB  1  
ATOM 503    O OG  . SER A 1 72  ? -77.961  -0.327  -2.435  1.00 99.99  ? 76  SER C OG  1  
ATOM 504    N N   . MET A 1 73  ? -78.387  2.846   -4.715  1.00 30.00  ? 77  MET C N   1  
ATOM 505    C CA  . MET A 1 73  ? -78.992  4.146   -4.385  1.00 30.00  ? 77  MET C CA  1  
ATOM 506    C C   . MET A 1 73  ? -80.252  3.919   -3.549  1.00 30.00  ? 77  MET C C   1  
ATOM 507    O O   . MET A 1 73  ? -80.843  2.846   -3.601  1.00 30.00  ? 77  MET C O   1  
ATOM 508    C CB  . MET A 1 73  ? -79.360  4.885   -5.665  1.00 99.99  ? 77  MET C CB  1  
ATOM 509    C CG  . MET A 1 73  ? -79.918  6.264   -5.314  1.00 99.99  ? 77  MET C CG  1  
ATOM 510    S SD  . MET A 1 73  ? -80.055  7.275   -6.809  1.00 99.99  ? 77  MET C SD  1  
ATOM 511    C CE  . MET A 1 73  ? -80.796  8.740   -6.123  1.00 99.99  ? 77  MET C CE  1  
ATOM 512    N N   . ASN A 1 74  ? -80.664  4.921   -2.774  1.00 30.00  ? 78  ASN C N   1  
ATOM 513    C CA  . ASN A 1 74  ? -81.875  4.779   -1.962  1.00 30.00  ? 78  ASN C CA  1  
ATOM 514    C C   . ASN A 1 74  ? -82.967  5.579   -2.691  1.00 30.00  ? 78  ASN C C   1  
ATOM 515    O O   . ASN A 1 74  ? -82.669  6.552   -3.403  1.00 30.00  ? 78  ASN C O   1  
ATOM 516    C CB  . ASN A 1 74  ? -81.631  5.335   -0.564  1.00 99.99  ? 78  ASN C CB  1  
ATOM 517    C CG  . ASN A 1 74  ? -80.549  4.545   0.160   1.00 99.99  ? 78  ASN C CG  1  
ATOM 518    O OD1 . ASN A 1 74  ? -80.638  3.325   0.273   1.00 99.99  ? 78  ASN C OD1 1  
ATOM 519    N ND2 . ASN A 1 74  ? -79.525  5.245   0.649   1.00 99.99  ? 78  ASN C ND2 1  
ATOM 520    N N   . PRO A 1 75  ? -84.236  5.166   -2.542  1.00 30.00  ? 79  PRO C N   1  
ATOM 521    C CA  . PRO A 1 75  ? -85.372  5.849   -3.188  1.00 30.00  ? 79  PRO C CA  1  
ATOM 522    C C   . PRO A 1 75  ? -85.639  7.219   -2.559  1.00 30.00  ? 79  PRO C C   1  
ATOM 523    O O   . PRO A 1 75  ? -85.340  7.429   -1.379  1.00 30.00  ? 79  PRO C O   1  
ATOM 524    C CB  . PRO A 1 75  ? -86.431  4.853   -2.863  1.00 99.99  ? 79  PRO C CB  1  
ATOM 525    C CG  . PRO A 1 75  ? -85.738  3.727   -2.133  1.00 99.99  ? 79  PRO C CG  1  
ATOM 526    C CD  . PRO A 1 75  ? -84.479  3.899   -2.003  1.00 99.99  ? 79  PRO C CD  1  
ATOM 527    N N   . PRO A 1 76  ? -86.209  8.162   -3.327  1.00 30.00  ? 80  PRO C N   1  
ATOM 528    C CA  . PRO A 1 76  ? -86.487  9.492   -2.774  1.00 30.00  ? 80  PRO C CA  1  
ATOM 529    C C   . PRO A 1 76  ? -87.254  9.466   -1.439  1.00 30.00  ? 80  PRO C C   1  
ATOM 530    O O   . PRO A 1 76  ? -87.416  10.484  -0.773  1.00 30.00  ? 80  PRO C O   1  
ATOM 531    C CB  . PRO A 1 76  ? -87.327  10.016  -3.885  1.00 99.99  ? 80  PRO C CB  1  
ATOM 532    C CG  . PRO A 1 76  ? -87.358  8.927   -4.935  1.00 99.99  ? 80  PRO C CG  1  
ATOM 533    C CD  . PRO A 1 76  ? -86.675  7.896   -4.623  1.00 99.99  ? 80  PRO C CD  1  
ATOM 534    N N   . LYS A 1 77  ? -87.718  8.282   -1.064  1.00 30.00  ? 81  LYS C N   1  
ATOM 535    C CA  . LYS A 1 77  ? -88.455  8.064   0.182   1.00 30.00  ? 81  LYS C CA  1  
ATOM 536    C C   . LYS A 1 77  ? -87.583  8.498   1.375   1.00 30.00  ? 81  LYS C C   1  
ATOM 537    O O   . LYS A 1 77  ? -88.091  9.004   2.374   1.00 30.00  ? 81  LYS C O   1  
ATOM 538    C CB  . LYS A 1 77  ? -88.810  6.588   0.325   1.00 99.99  ? 81  LYS C CB  1  
ATOM 539    C CG  . LYS A 1 77  ? -89.661  6.388   1.574   1.00 99.99  ? 81  LYS C CG  1  
ATOM 540    C CD  . LYS A 1 77  ? -90.377  5.044   1.491   1.00 99.99  ? 81  LYS C CD  1  
ATOM 541    C CE  . LYS A 1 77  ? -90.923  4.671   2.866   1.00 99.99  ? 81  LYS C CE  1  
ATOM 542    N NZ  . LYS A 1 77  ? -92.318  5.121   2.979   1.00 99.99  ? 81  LYS C NZ  1  
ATOM 543    N N   . PHE A 1 78  ? -86.270  8.301   1.266   1.00 30.00  ? 82  PHE C N   1  
ATOM 544    C CA  . PHE A 1 78  ? -85.351  8.672   2.341   1.00 30.00  ? 82  PHE C CA  1  
ATOM 545    C C   . PHE A 1 78  ? -84.484  9.902   2.062   1.00 30.00  ? 82  PHE C C   1  
ATOM 546    O O   . PHE A 1 78  ? -83.280  9.870   2.265   1.00 30.00  ? 82  PHE C O   1  
ATOM 547    C CB  . PHE A 1 78  ? -84.390  7.522   2.622   1.00 99.99  ? 82  PHE C CB  1  
ATOM 548    C CG  . PHE A 1 78  ? -85.163  6.326   3.118   1.00 99.99  ? 82  PHE C CG  1  
ATOM 549    C CD1 . PHE A 1 78  ? -85.678  5.395   2.207   1.00 99.99  ? 82  PHE C CD1 1  
ATOM 550    C CD2 . PHE A 1 78  ? -85.367  6.147   4.493   1.00 99.99  ? 82  PHE C CD2 1  
ATOM 551    C CE1 . PHE A 1 78  ? -86.397  4.285   2.670   1.00 99.99  ? 82  PHE C CE1 1  
ATOM 552    C CE2 . PHE A 1 78  ? -86.087  5.038   4.955   1.00 99.99  ? 82  PHE C CE2 1  
ATOM 553    C CZ  . PHE A 1 78  ? -86.599  4.108   4.045   1.00 99.99  ? 82  PHE C CZ  1  
ATOM 554    N N   . GLU A 1 79  ? -85.099  10.982  1.594   1.00 30.00  ? 83  GLU C N   1  
ATOM 555    C CA  . GLU A 1 79  ? -84.366  12.210  1.319   1.00 30.00  ? 83  GLU C CA  1  
ATOM 556    C C   . GLU A 1 79  ? -84.060  12.876  2.663   1.00 30.00  ? 83  GLU C C   1  
ATOM 557    O O   . GLU A 1 79  ? -84.926  12.915  3.536   1.00 30.00  ? 83  GLU C O   1  
ATOM 558    C CB  . GLU A 1 79  ? -85.214  13.136  0.453   1.00 99.99  ? 83  GLU C CB  1  
ATOM 559    C CG  . GLU A 1 79  ? -84.313  14.079  -0.308  1.00 99.99  ? 83  GLU C CG  1  
ATOM 560    C CD  . GLU A 1 79  ? -83.985  15.286  0.567   1.00 99.99  ? 83  GLU C CD  1  
ATOM 561    O OE1 . GLU A 1 79  ? -82.963  15.209  1.298   1.00 99.99  ? 83  GLU C OE1 1  
ATOM 562    O OE2 . GLU A 1 79  ? -84.759  16.279  0.495   1.00 99.99  ? 83  GLU C OE2 1  
ATOM 563    N N   . LYS A 1 80  ? -82.842  13.389  2.835   1.00 30.00  ? 84  LYS C N   1  
ATOM 564    C CA  . LYS A 1 80  ? -82.450  14.045  4.089   1.00 30.00  ? 84  LYS C CA  1  
ATOM 565    C C   . LYS A 1 80  ? -82.957  13.320  5.344   1.00 30.00  ? 84  LYS C C   1  
ATOM 566    O O   . LYS A 1 80  ? -83.327  13.959  6.328   1.00 30.00  ? 84  LYS C O   1  
ATOM 567    C CB  . LYS A 1 80  ? -83.006  15.464  4.128   1.00 99.99  ? 84  LYS C CB  1  
ATOM 568    C CG  . LYS A 1 80  ? -82.210  16.353  3.181   1.00 99.99  ? 84  LYS C CG  1  
ATOM 569    C CD  . LYS A 1 80  ? -82.701  17.790  3.294   1.00 99.99  ? 84  LYS C CD  1  
ATOM 570    C CE  . LYS A 1 80  ? -83.740  18.060  2.212   1.00 99.99  ? 84  LYS C CE  1  
ATOM 571    N NZ  . LYS A 1 80  ? -83.968  19.506  2.099   1.00 99.99  ? 84  LYS C NZ  1  
ATOM 572    N N   . LEU A 1 81  ? -82.980  11.995  5.313   1.00 30.00  ? 85  LEU C N   1  
ATOM 573    C CA  . LEU A 1 81  ? -83.456  11.226  6.455   1.00 30.00  ? 85  LEU C CA  1  
ATOM 574    C C   . LEU A 1 81  ? -82.775  11.584  7.792   1.00 30.00  ? 85  LEU C C   1  
ATOM 575    O O   . LEU A 1 81  ? -81.555  11.759  7.850   1.00 30.00  ? 85  LEU C O   1  
ATOM 576    C CB  . LEU A 1 81  ? -83.208  9.740   6.219   1.00 99.99  ? 85  LEU C CB  1  
ATOM 577    C CG  . LEU A 1 81  ? -81.736  9.423   6.457   1.00 99.99  ? 85  LEU C CG  1  
ATOM 578    C CD1 . LEU A 1 81  ? -80.885  10.605  6.004   1.00 99.99  ? 85  LEU C CD1 1  
ATOM 579    C CD2 . LEU A 1 81  ? -81.505  9.168   7.942   1.00 99.99  ? 85  LEU C CD2 1  
ATOM 580    N N   . GLU A 1 82  ? -83.569  11.676  8.862   1.00 30.00  ? 86  GLU C N   1  
ATOM 581    C CA  . GLU A 1 82  ? -83.047  12.015  10.181  1.00 30.00  ? 86  GLU C CA  1  
ATOM 582    C C   . GLU A 1 82  ? -82.297  10.855  10.798  1.00 30.00  ? 86  GLU C C   1  
ATOM 583    O O   . GLU A 1 82  ? -81.296  11.068  11.490  1.00 30.00  ? 86  GLU C O   1  
ATOM 584    C CB  . GLU A 1 82  ? -84.196  12.390  11.111  1.00 99.99  ? 86  GLU C CB  1  
ATOM 585    C CG  . GLU A 1 82  ? -84.861  13.650  10.610  1.00 99.99  ? 86  GLU C CG  1  
ATOM 586    C CD  . GLU A 1 82  ? -83.942  14.843  10.855  1.00 99.99  ? 86  GLU C CD  1  
ATOM 587    O OE1 . GLU A 1 82  ? -83.125  15.141  9.943   1.00 99.99  ? 86  GLU C OE1 1  
ATOM 588    O OE2 . GLU A 1 82  ? -84.062  15.450  11.955  1.00 99.99  ? 86  GLU C OE2 1  
ATOM 589    N N   . ASP A 1 83  ? -82.756  9.625   10.572  1.00 30.00  ? 87  ASP C N   1  
ATOM 590    C CA  . ASP A 1 83  ? -82.032  8.452   11.100  1.00 30.00  ? 87  ASP C CA  1  
ATOM 591    C C   . ASP A 1 83  ? -81.677  7.523   9.932   1.00 30.00  ? 87  ASP C C   1  
ATOM 592    O O   . ASP A 1 83  ? -82.545  6.935   9.292   1.00 30.00  ? 87  ASP C O   1  
ATOM 593    C CB  . ASP A 1 83  ? -82.911  7.707   12.098  1.00 99.99  ? 87  ASP C CB  1  
ATOM 594    C CG  . ASP A 1 83  ? -82.080  6.650   12.822  1.00 99.99  ? 87  ASP C CG  1  
ATOM 595    O OD1 . ASP A 1 83  ? -81.867  5.569   12.214  1.00 99.99  ? 87  ASP C OD1 1  
ATOM 596    O OD2 . ASP A 1 83  ? -81.662  6.935   13.975  1.00 99.99  ? 87  ASP C OD2 1  
ATOM 597    N N   . MET A 1 84  ? -80.383  7.404   9.665   1.00 30.00  ? 88  MET C N   1  
ATOM 598    C CA  . MET A 1 84  ? -79.898  6.585   8.572   1.00 30.00  ? 88  MET C CA  1  
ATOM 599    C C   . MET A 1 84  ? -80.034  5.082   8.711   1.00 30.00  ? 88  MET C C   1  
ATOM 600    O O   . MET A 1 84  ? -79.969  4.366   7.722   1.00 30.00  ? 88  MET C O   1  
ATOM 601    C CB  . MET A 1 84  ? -78.410  6.832   8.360   1.00 99.99  ? 88  MET C CB  1  
ATOM 602    C CG  . MET A 1 84  ? -78.145  8.329   8.273   1.00 99.99  ? 88  MET C CG  1  
ATOM 603    S SD  . MET A 1 84  ? -78.556  8.937   6.618   1.00 99.99  ? 88  MET C SD  1  
ATOM 604    C CE  . MET A 1 84  ? -77.146  8.343   5.712   1.00 99.99  ? 88  MET C CE  1  
ATOM 605    N N   . ALA A 1 85  ? -80.218  4.596   9.929   1.00 30.00  ? 89  ALA C N   1  
ATOM 606    C CA  . ALA A 1 85  ? -80.366  3.171   10.134  1.00 30.00  ? 89  ALA C CA  1  
ATOM 607    C C   . ALA A 1 85  ? -81.681  2.725   9.468   1.00 30.00  ? 89  ALA C C   1  
ATOM 608    O O   . ALA A 1 85  ? -81.878  1.543   9.171   1.00 30.00  ? 89  ALA C O   1  
ATOM 609    C CB  . ALA A 1 85  ? -80.390  2.867   11.619  1.00 30.00  ? 89  ALA C CB  1  
ATOM 610    N N   . ASN A 1 86  ? -82.570  3.684   9.224   1.00 30.00  ? 90  ASN C N   1  
ATOM 611    C CA  . ASN A 1 86  ? -83.868  3.426   8.595   1.00 30.00  ? 90  ASN C CA  1  
ATOM 612    C C   . ASN A 1 86  ? -83.844  3.431   7.062   1.00 30.00  ? 90  ASN C C   1  
ATOM 613    O O   . ASN A 1 86  ? -84.882  3.287   6.420   1.00 30.00  ? 90  ASN C O   1  
ATOM 614    C CB  . ASN A 1 86  ? -84.873  4.489   9.023   1.00 99.99  ? 90  ASN C CB  1  
ATOM 615    C CG  . ASN A 1 86  ? -85.118  4.443   10.523  1.00 99.99  ? 90  ASN C CG  1  
ATOM 616    O OD1 . ASN A 1 86  ? -85.459  3.397   11.067  1.00 99.99  ? 90  ASN C OD1 1  
ATOM 617    N ND2 . ASN A 1 86  ? -84.944  5.585   11.192  1.00 99.99  ? 90  ASN C ND2 1  
ATOM 618    N N   . MET A 1 87  ? -82.665  3.613   6.482   1.00 30.00  ? 91  MET C N   1  
ATOM 619    C CA  . MET A 1 87  ? -82.514  3.633   5.029   1.00 30.00  ? 91  MET C CA  1  
ATOM 620    C C   . MET A 1 87  ? -82.398  2.204   4.524   1.00 30.00  ? 91  MET C C   1  
ATOM 621    O O   . MET A 1 87  ? -81.978  1.311   5.268   1.00 30.00  ? 91  MET C O   1  
ATOM 622    C CB  . MET A 1 87  ? -81.260  4.413   4.649   1.00 99.99  ? 91  MET C CB  1  
ATOM 623    C CG  . MET A 1 87  ? -81.260  5.758   5.364   1.00 99.99  ? 91  MET C CG  1  
ATOM 624    S SD  . MET A 1 87  ? -82.335  6.924   4.495   1.00 99.99  ? 91  MET C SD  1  
ATOM 625    C CE  . MET A 1 87  ? -81.294  7.331   3.109   1.00 99.99  ? 91  MET C CE  1  
ATOM 626    N N   . THR A 1 88  ? -82.767  1.998   3.258   1.00 30.00  ? 92  THR C N   1  
ATOM 627    C CA  . THR A 1 88  ? -82.679  0.658   2.668   1.00 30.00  ? 92  THR C CA  1  
ATOM 628    C C   . THR A 1 88  ? -81.198  0.330   2.539   1.00 30.00  ? 92  THR C C   1  
ATOM 629    O O   . THR A 1 88  ? -80.749  -0.730  2.990   1.00 30.00  ? 92  THR C O   1  
ATOM 630    C CB  . THR A 1 88  ? -83.355  0.649   1.301   1.00 99.99  ? 92  THR C CB  1  
ATOM 631    O OG1 . THR A 1 88  ? -82.592  1.443   0.388   1.00 99.99  ? 92  THR C OG1 1  
ATOM 632    C CG2 . THR A 1 88  ? -84.760  1.228   1.424   1.00 99.99  ? 92  THR C CG2 1  
ATOM 633    N N   . TYR A 1 89  ? -80.446  1.254   1.928   1.00 30.00  ? 93  TYR C N   1  
ATOM 634    C CA  . TYR A 1 89  ? -79.009  1.076   1.730   1.00 30.00  ? 93  TYR C CA  1  
ATOM 635    C C   . TYR A 1 89  ? -78.097  1.990   2.549   1.00 30.00  ? 93  TYR C C   1  
ATOM 636    O O   . TYR A 1 89  ? -78.176  3.223   2.491   1.00 30.00  ? 93  TYR C O   1  
ATOM 637    C CB  . TYR A 1 89  ? -78.651  1.332   0.269   1.00 99.99  ? 93  TYR C CB  1  
ATOM 638    C CG  . TYR A 1 89  ? -79.237  0.237   -0.592  1.00 99.99  ? 93  TYR C CG  1  
ATOM 639    C CD1 . TYR A 1 89  ? -78.563  -0.979  -0.734  1.00 99.99  ? 93  TYR C CD1 1  
ATOM 640    C CD2 . TYR A 1 89  ? -80.457  0.441   -1.248  1.00 99.99  ? 93  TYR C CD2 1  
ATOM 641    C CE1 . TYR A 1 89  ? -79.107  -1.994  -1.532  1.00 99.99  ? 93  TYR C CE1 1  
ATOM 642    C CE2 . TYR A 1 89  ? -81.001  -0.569  -2.047  1.00 99.99  ? 93  TYR C CE2 1  
ATOM 643    C CZ  . TYR A 1 89  ? -80.324  -1.788  -2.188  1.00 99.99  ? 93  TYR C CZ  1  
ATOM 644    O OH  . TYR A 1 89  ? -80.853  -2.774  -2.964  1.00 99.99  ? 93  TYR C OH  1  
ATOM 645    N N   . LEU A 1 90  ? -77.213  1.359   3.303   1.00 30.00  ? 94  LEU C N   1  
ATOM 646    C CA  . LEU A 1 90  ? -76.267  2.070   4.137   1.00 30.00  ? 94  LEU C CA  1  
ATOM 647    C C   . LEU A 1 90  ? -74.838  1.877   3.608   1.00 30.00  ? 94  LEU C C   1  
ATOM 648    O O   . LEU A 1 90  ? -73.988  1.269   4.269   1.00 30.00  ? 94  LEU C O   1  
ATOM 649    C CB  . LEU A 1 90  ? -76.337  1.545   5.566   1.00 99.99  ? 94  LEU C CB  1  
ATOM 650    C CG  . LEU A 1 90  ? -77.281  2.420   6.384   1.00 99.99  ? 94  LEU C CG  1  
ATOM 651    C CD1 . LEU A 1 90  ? -77.105  2.109   7.868   1.00 99.99  ? 94  LEU C CD1 1  
ATOM 652    C CD2 . LEU A 1 90  ? -76.962  3.889   6.130   1.00 99.99  ? 94  LEU C CD2 1  
ATOM 653    N N   . ASN A 1 91  ? -74.568  2.386   2.414   1.00 30.00  ? 95  ASN C N   1  
ATOM 654    C CA  . ASN A 1 91  ? -73.233  2.229   1.854   1.00 30.00  ? 95  ASN C CA  1  
ATOM 655    C C   . ASN A 1 91  ? -72.571  3.594   1.740   1.00 30.00  ? 95  ASN C C   1  
ATOM 656    O O   . ASN A 1 91  ? -73.256  4.617   1.644   1.00 30.00  ? 95  ASN C O   1  
ATOM 657    C CB  . ASN A 1 91  ? -73.324  1.595   0.470   1.00 99.99  ? 95  ASN C CB  1  
ATOM 658    C CG  . ASN A 1 91  ? -74.166  2.444   -0.471  1.00 99.99  ? 95  ASN C CG  1  
ATOM 659    O OD1 . ASN A 1 91  ? -73.635  3.093   -1.368  1.00 99.99  ? 95  ASN C OD1 1  
ATOM 660    N ND2 . ASN A 1 91  ? -75.483  2.440   -0.259  1.00 99.99  ? 95  ASN C ND2 1  
ATOM 661    N N   . GLU A 1 92  ? -71.237  3.598   1.753   1.00 30.00  ? 96  GLU C N   1  
ATOM 662    C CA  . GLU A 1 92  ? -70.489  4.841   1.673   1.00 30.00  ? 96  GLU C CA  1  
ATOM 663    C C   . GLU A 1 92  ? -71.057  5.891   0.744   1.00 30.00  ? 96  GLU C C   1  
ATOM 664    O O   . GLU A 1 92  ? -70.753  7.068   0.884   1.00 30.00  ? 96  GLU C O   1  
ATOM 665    C CB  . GLU A 1 92  ? -69.072  4.563   1.179   1.00 99.99  ? 96  GLU C CB  1  
ATOM 666    C CG  . GLU A 1 92  ? -68.306  3.817   2.243   1.00 99.99  ? 96  GLU C CG  1  
ATOM 667    C CD  . GLU A 1 92  ? -67.981  4.764   3.396   1.00 99.99  ? 96  GLU C CD  1  
ATOM 668    O OE1 . GLU A 1 92  ? -68.820  4.844   4.330   1.00 99.99  ? 96  GLU C OE1 1  
ATOM 669    O OE2 . GLU A 1 92  ? -66.892  5.397   3.330   1.00 99.99  ? 96  GLU C OE2 1  
ATOM 670    N N   . ALA A 1 93  ? -71.894  5.499   -0.201  1.00 30.00  ? 97  ALA C N   1  
ATOM 671    C CA  . ALA A 1 93  ? -72.432  6.502   -1.107  1.00 30.00  ? 97  ALA C CA  1  
ATOM 672    C C   . ALA A 1 93  ? -73.819  6.982   -0.714  1.00 30.00  ? 97  ALA C C   1  
ATOM 673    O O   . ALA A 1 93  ? -74.219  8.079   -1.089  1.00 30.00  ? 97  ALA C O   1  
ATOM 674    C CB  . ALA A 1 93  ? -72.460  5.943   -2.531  1.00 30.00  ? 97  ALA C CB  1  
ATOM 675    N N   . SER A 1 94  ? -74.555  6.156   0.031   1.00 30.00  ? 98  SER C N   1  
ATOM 676    C CA  . SER A 1 94  ? -75.906  6.516   0.474   1.00 30.00  ? 98  SER C CA  1  
ATOM 677    C C   . SER A 1 94  ? -75.767  7.425   1.676   1.00 30.00  ? 98  SER C C   1  
ATOM 678    O O   . SER A 1 94  ? -76.506  8.395   1.824   1.00 30.00  ? 98  SER C O   1  
ATOM 679    C CB  . SER A 1 94  ? -76.678  5.257   0.852   1.00 99.99  ? 98  SER C CB  1  
ATOM 680    O OG  . SER A 1 94  ? -76.106  4.679   2.028   1.00 99.99  ? 98  SER C OG  1  
ATOM 681    N N   . VAL A 1 95  ? -74.812  7.082   2.534   1.00 30.00  ? 99  VAL C N   1  
ATOM 682    C CA  . VAL A 1 95  ? -74.529  7.848   3.733   1.00 30.00  ? 99  VAL C CA  1  
ATOM 683    C C   . VAL A 1 95  ? -74.009  9.240   3.323   1.00 30.00  ? 99  VAL C C   1  
ATOM 684    O O   . VAL A 1 95  ? -74.611  10.261  3.652   1.00 30.00  ? 99  VAL C O   1  
ATOM 685    C CB  . VAL A 1 95  ? -73.472  7.131   4.568   1.00 99.99  ? 99  VAL C CB  1  
ATOM 686    C CG1 . VAL A 1 95  ? -73.985  5.750   4.963   1.00 99.99  ? 99  VAL C CG1 1  
ATOM 687    C CG2 . VAL A 1 95  ? -72.194  6.984   3.752   1.00 99.99  ? 99  VAL C CG2 1  
ATOM 688    N N   . LEU A 1 96  ? -72.899  9.282   2.596   1.00 30.00  ? 100 LEU C N   1  
ATOM 689    C CA  . LEU A 1 96  ? -72.352  10.555  2.149   1.00 30.00  ? 100 LEU C CA  1  
ATOM 690    C C   . LEU A 1 96  ? -73.420  11.408  1.453   1.00 30.00  ? 100 LEU C C   1  
ATOM 691    O O   . LEU A 1 96  ? -73.423  12.626  1.560   1.00 30.00  ? 100 LEU C O   1  
ATOM 692    C CB  . LEU A 1 96  ? -71.212  10.312  1.164   1.00 99.99  ? 100 LEU C CB  1  
ATOM 693    C CG  . LEU A 1 96  ? -69.882  10.323  1.910   1.00 99.99  ? 100 LEU C CG  1  
ATOM 694    C CD1 . LEU A 1 96  ? -68.738  10.413  0.906   1.00 99.99  ? 100 LEU C CD1 1  
ATOM 695    C CD2 . LEU A 1 96  ? -69.836  11.527  2.845   1.00 99.99  ? 100 LEU C CD2 1  
ATOM 696    N N   . TYR A 1 97  ? -74.332  10.784  0.727   1.00 30.00  ? 101 TYR C N   1  
ATOM 697    C CA  . TYR A 1 97  ? -75.352  11.564  0.043   1.00 30.00  ? 101 TYR C CA  1  
ATOM 698    C C   . TYR A 1 97  ? -76.348  12.177  1.009   1.00 30.00  ? 101 TYR C C   1  
ATOM 699    O O   . TYR A 1 97  ? -76.718  13.343  0.866   1.00 30.00  ? 101 TYR C O   1  
ATOM 700    C CB  . TYR A 1 97  ? -76.125  10.671  -0.925  1.00 99.99  ? 101 TYR C CB  1  
ATOM 701    C CG  . TYR A 1 97  ? -77.177  11.490  -1.631  1.00 99.99  ? 101 TYR C CG  1  
ATOM 702    C CD1 . TYR A 1 97  ? -76.837  12.253  -2.755  1.00 99.99  ? 101 TYR C CD1 1  
ATOM 703    C CD2 . TYR A 1 97  ? -78.497  11.488  -1.162  1.00 99.99  ? 101 TYR C CD2 1  
ATOM 704    C CE1 . TYR A 1 97  ? -77.813  13.010  -3.410  1.00 99.99  ? 101 TYR C CE1 1  
ATOM 705    C CE2 . TYR A 1 97  ? -79.475  12.245  -1.817  1.00 99.99  ? 101 TYR C CE2 1  
ATOM 706    C CZ  . TYR A 1 97  ? -79.132  13.007  -2.941  1.00 99.99  ? 101 TYR C CZ  1  
ATOM 707    O OH  . TYR A 1 97  ? -80.083  13.743  -3.578  1.00 99.99  ? 101 TYR C OH  1  
ATOM 708    N N   . ASN A 1 98  ? -76.790  11.387  1.986   1.00 30.00  ? 102 ASN C N   1  
ATOM 709    C CA  . ASN A 1 98  ? -77.753  11.848  2.974   1.00 30.00  ? 102 ASN C CA  1  
ATOM 710    C C   . ASN A 1 98  ? -77.213  13.030  3.776   1.00 30.00  ? 102 ASN C C   1  
ATOM 711    O O   . ASN A 1 98  ? -77.866  14.069  3.901   1.00 30.00  ? 102 ASN C O   1  
ATOM 712    C CB  . ASN A 1 98  ? -78.080  10.720  3.948   1.00 99.99  ? 102 ASN C CB  1  
ATOM 713    C CG  . ASN A 1 98  ? -78.993  9.687   3.307   1.00 99.99  ? 102 ASN C CG  1  
ATOM 714    O OD1 . ASN A 1 98  ? -78.822  8.489   3.510   1.00 99.99  ? 102 ASN C OD1 1  
ATOM 715    N ND2 . ASN A 1 98  ? -79.970  10.157  2.528   1.00 99.99  ? 102 ASN C ND2 1  
ATOM 716    N N   . LEU A 1 99  ? -76.012  12.864  4.320   1.00 30.00  ? 103 LEU C N   1  
ATOM 717    C CA  . LEU A 1 99  ? -75.364  13.912  5.096   1.00 30.00  ? 103 LEU C CA  1  
ATOM 718    C C   . LEU A 1 99  ? -75.310  15.162  4.235   1.00 30.00  ? 103 LEU C C   1  
ATOM 719    O O   . LEU A 1 99  ? -76.052  16.115  4.462   1.00 30.00  ? 103 LEU C O   1  
ATOM 720    C CB  . LEU A 1 99  ? -73.953  13.476  5.476   1.00 99.99  ? 103 LEU C CB  1  
ATOM 721    C CG  . LEU A 1 99  ? -73.972  12.850  6.867   1.00 99.99  ? 103 LEU C CG  1  
ATOM 722    C CD1 . LEU A 1 99  ? -72.541  12.719  7.384   1.00 99.99  ? 103 LEU C CD1 1  
ATOM 723    C CD2 . LEU A 1 99  ? -74.774  13.737  7.813   1.00 99.99  ? 103 LEU C CD2 1  
ATOM 724    N N   . ARG A 1 100 ? -74.433  15.145  3.244   1.00 30.00  ? 104 ARG C N   1  
ATOM 725    C CA  . ARG A 1 100 ? -74.256  16.247  2.308   1.00 30.00  ? 104 ARG C CA  1  
ATOM 726    C C   . ARG A 1 100 ? -75.595  16.875  1.864   1.00 30.00  ? 104 ARG C C   1  
ATOM 727    O O   . ARG A 1 100 ? -75.661  18.057  1.552   1.00 30.00  ? 104 ARG C O   1  
ATOM 728    C CB  . ARG A 1 100 ? -73.539  15.757  1.055   1.00 99.99  ? 104 ARG C CB  1  
ATOM 729    C CG  . ARG A 1 100 ? -72.740  16.901  0.445   1.00 99.99  ? 104 ARG C CG  1  
ATOM 730    C CD  . ARG A 1 100 ? -71.796  16.351  -0.620  1.00 99.99  ? 104 ARG C CD  1  
ATOM 731    N NE  . ARG A 1 100 ? -70.736  17.330  -0.945  1.00 99.99  ? 104 ARG C NE  1  
ATOM 732    C CZ  . ARG A 1 100 ? -69.698  17.041  -1.725  1.00 99.99  ? 104 ARG C CZ  1  
ATOM 733    N NH1 . ARG A 1 100 ? -69.540  15.840  -2.273  1.00 99.99  ? 104 ARG C NH1 1  
ATOM 734    N NH2 . ARG A 1 100 ? -68.801  17.997  -1.952  1.00 99.99  ? 104 ARG C NH2 1  
ATOM 735    N N   . SER A 1 101 ? -76.660  16.081  1.832   1.00 30.00  ? 105 SER C N   1  
ATOM 736    C CA  . SER A 1 101 ? -77.967  16.602  1.425   1.00 30.00  ? 105 SER C CA  1  
ATOM 737    C C   . SER A 1 101 ? -78.447  17.542  2.514   1.00 30.00  ? 105 SER C C   1  
ATOM 738    O O   . SER A 1 101 ? -78.773  18.697  2.249   1.00 30.00  ? 105 SER C O   1  
ATOM 739    C CB  . SER A 1 101 ? -78.952  15.451  1.250   1.00 99.99  ? 105 SER C CB  1  
ATOM 740    O OG  . SER A 1 101 ? -78.458  14.545  0.262   1.00 99.99  ? 105 SER C OG  1  
ATOM 741    N N   . ARG A 1 102 ? -78.485  17.022  3.737   1.00 30.00  ? 106 ARG C N   1  
ATOM 742    C CA  . ARG A 1 102 ? -78.906  17.761  4.914   1.00 30.00  ? 106 ARG C CA  1  
ATOM 743    C C   . ARG A 1 102 ? -78.002  18.986  5.095   1.00 30.00  ? 106 ARG C C   1  
ATOM 744    O O   . ARG A 1 102 ? -78.475  20.126  5.044   1.00 30.00  ? 106 ARG C O   1  
ATOM 745    C CB  . ARG A 1 102 ? -78.806  16.874  6.148   1.00 99.99  ? 106 ARG C CB  1  
ATOM 746    C CG  . ARG A 1 102 ? -79.667  15.629  5.952   1.00 99.99  ? 106 ARG C CG  1  
ATOM 747    C CD  . ARG A 1 102 ? -79.308  14.590  7.009   1.00 99.99  ? 106 ARG C CD  1  
ATOM 748    N NE  . ARG A 1 102 ? -79.583  15.101  8.372   1.00 99.99  ? 106 ARG C NE  1  
ATOM 749    C CZ  . ARG A 1 102 ? -80.751  14.936  8.983   1.00 99.99  ? 106 ARG C CZ  1  
ATOM 750    N NH1 . ARG A 1 102 ? -81.766  14.299  8.406   1.00 99.99  ? 106 ARG C NH1 1  
ATOM 751    N NH2 . ARG A 1 102 ? -80.892  15.435  10.209  1.00 99.99  ? 106 ARG C NH2 1  
ATOM 752    N N   . TYR A 1 103 ? -76.706  18.739  5.293   1.00 30.00  ? 107 TYR C N   1  
ATOM 753    C CA  . TYR A 1 103 ? -75.726  19.810  5.470   1.00 30.00  ? 107 TYR C CA  1  
ATOM 754    C C   . TYR A 1 103 ? -75.956  21.060  4.604   1.00 30.00  ? 107 TYR C C   1  
ATOM 755    O O   . TYR A 1 103 ? -76.071  22.164  5.139   1.00 30.00  ? 107 TYR C O   1  
ATOM 756    C CB  . TYR A 1 103 ? -74.331  19.300  5.124   1.00 99.99  ? 107 TYR C CB  1  
ATOM 757    C CG  . TYR A 1 103 ? -73.327  20.408  5.311   1.00 99.99  ? 107 TYR C CG  1  
ATOM 758    C CD1 . TYR A 1 103 ? -72.807  20.676  6.583   1.00 99.99  ? 107 TYR C CD1 1  
ATOM 759    C CD2 . TYR A 1 103 ? -72.913  21.173  4.210   1.00 99.99  ? 107 TYR C CD2 1  
ATOM 760    C CE1 . TYR A 1 103 ? -71.875  21.707  6.754   1.00 99.99  ? 107 TYR C CE1 1  
ATOM 761    C CE2 . TYR A 1 103 ? -71.981  22.202  4.384   1.00 99.99  ? 107 TYR C CE2 1  
ATOM 762    C CZ  . TYR A 1 103 ? -71.462  22.468  5.657   1.00 99.99  ? 107 TYR C CZ  1  
ATOM 763    O OH  . TYR A 1 103 ? -70.557  23.472  5.825   1.00 99.99  ? 107 TYR C OH  1  
ATOM 764    N N   . THR A 1 104 ? -76.025  20.903  3.284   1.00 30.00  ? 108 THR C N   1  
ATOM 765    C CA  . THR A 1 104 ? -76.236  22.056  2.404   1.00 30.00  ? 108 THR C CA  1  
ATOM 766    C C   . THR A 1 104 ? -77.608  22.688  2.597   1.00 30.00  ? 108 THR C C   1  
ATOM 767    O O   . THR A 1 104 ? -78.060  23.487  1.781   1.00 30.00  ? 108 THR C O   1  
ATOM 768    C CB  . THR A 1 104 ? -76.124  21.623  0.946   1.00 99.99  ? 108 THR C CB  1  
ATOM 769    O OG1 . THR A 1 104 ? -77.226  20.770  0.616   1.00 99.99  ? 108 THR C OG1 1  
ATOM 770    C CG2 . THR A 1 104 ? -74.816  20.867  0.741   1.00 99.99  ? 108 THR C CG2 1  
ATOM 771    N N   . SER A 1 105 ? -78.273  22.334  3.681   1.00 30.00  ? 109 SER C N   1  
ATOM 772    C CA  . SER A 1 105 ? -79.584  22.883  3.955   1.00 30.00  ? 109 SER C CA  1  
ATOM 773    C C   . SER A 1 105 ? -79.670  23.391  5.389   1.00 30.00  ? 109 SER C C   1  
ATOM 774    O O   . SER A 1 105 ? -80.744  23.754  5.867   1.00 30.00  ? 109 SER C O   1  
ATOM 775    C CB  . SER A 1 105 ? -80.648  21.813  3.750   1.00 99.99  ? 109 SER C CB  1  
ATOM 776    O OG  . SER A 1 105 ? -80.590  21.333  2.405   1.00 99.99  ? 109 SER C OG  1  
ATOM 777    N N   . GLY A 1 106 ? -78.531  23.405  6.079   1.00 30.00  ? 110 GLY C N   1  
ATOM 778    C CA  . GLY A 1 106 ? -78.497  23.882  7.449   1.00 30.00  ? 110 GLY C CA  1  
ATOM 779    C C   . GLY A 1 106 ? -78.490  22.799  8.509   1.00 30.00  ? 110 GLY C C   1  
ATOM 780    O O   . GLY A 1 106 ? -77.982  23.011  9.617   1.00 30.00  ? 110 GLY C O   1  
ATOM 781    N N   . LEU A 1 107 ? -79.051  21.640  8.175   1.00 30.00  ? 111 LEU C N   1  
ATOM 782    C CA  . LEU A 1 107 ? -79.103  20.525  9.107   1.00 30.00  ? 111 LEU C CA  1  
ATOM 783    C C   . LEU A 1 107 ? -77.725  19.877  9.202   1.00 30.00  ? 111 LEU C C   1  
ATOM 784    O O   . LEU A 1 107 ? -77.229  19.305  8.229   1.00 30.00  ? 111 LEU C O   1  
ATOM 785    C CB  . LEU A 1 107 ? -80.114  19.492  8.622   1.00 99.99  ? 111 LEU C CB  1  
ATOM 786    C CG  . LEU A 1 107 ? -81.461  19.741  9.291   1.00 99.99  ? 111 LEU C CG  1  
ATOM 787    C CD1 . LEU A 1 107 ? -82.369  18.537  9.074   1.00 99.99  ? 111 LEU C CD1 1  
ATOM 788    C CD2 . LEU A 1 107 ? -81.253  19.961  10.786  1.00 99.99  ? 111 LEU C CD2 1  
ATOM 789    N N   . ILE A 1 108 ? -77.120  19.972  10.383  1.00 30.00  ? 112 ILE C N   1  
ATOM 790    C CA  . ILE A 1 108 ? -75.790  19.427  10.617  1.00 30.00  ? 112 ILE C CA  1  
ATOM 791    C C   . ILE A 1 108 ? -75.777  18.243  11.571  1.00 30.00  ? 112 ILE C C   1  
ATOM 792    O O   . ILE A 1 108 ? -74.710  17.671  11.850  1.00 30.00  ? 112 ILE C O   1  
ATOM 793    C CB  . ILE A 1 108 ? -74.887  20.499  11.216  1.00 99.99  ? 112 ILE C CB  1  
ATOM 794    C CG1 . ILE A 1 108 ? -75.138  20.595  12.716  1.00 99.99  ? 112 ILE C CG1 1  
ATOM 795    C CG2 . ILE A 1 108 ? -75.195  21.844  10.563  1.00 99.99  ? 112 ILE C CG2 1  
ATOM 796    C CD1 . ILE A 1 108 ? -76.189  21.666  12.992  1.00 99.99  ? 112 ILE C CD1 1  
ATOM 797    N N   . TYR A 1 109 ? -76.946  17.872  12.084  1.00 30.00  ? 113 TYR C N   1  
ATOM 798    C CA  . TYR A 1 109 ? -77.043  16.742  13.011  1.00 30.00  ? 113 TYR C CA  1  
ATOM 799    C C   . TYR A 1 109 ? -77.857  15.602  12.376  1.00 30.00  ? 113 TYR C C   1  
ATOM 800    O O   . TYR A 1 109 ? -78.921  15.842  11.783  1.00 30.00  ? 113 TYR C O   1  
ATOM 801    C CB  . TYR A 1 109 ? -77.731  17.184  14.298  1.00 99.99  ? 113 TYR C CB  1  
ATOM 802    C CG  . TYR A 1 109 ? -77.822  16.016  15.248  1.00 99.99  ? 113 TYR C CG  1  
ATOM 803    C CD1 . TYR A 1 109 ? -76.731  15.681  16.059  1.00 99.99  ? 113 TYR C CD1 1  
ATOM 804    C CD2 . TYR A 1 109 ? -79.001  15.262  15.319  1.00 99.99  ? 113 TYR C CD2 1  
ATOM 805    C CE1 . TYR A 1 109 ? -76.817  14.597  16.938  1.00 99.99  ? 113 TYR C CE1 1  
ATOM 806    C CE2 . TYR A 1 109 ? -79.088  14.178  16.200  1.00 99.99  ? 113 TYR C CE2 1  
ATOM 807    C CZ  . TYR A 1 109 ? -77.996  13.844  17.008  1.00 99.99  ? 113 TYR C CZ  1  
ATOM 808    O OH  . TYR A 1 109 ? -78.080  12.790  17.864  1.00 99.99  ? 113 TYR C OH  1  
ATOM 809    N N   . THR A 1 110 ? -77.363  14.368  12.487  1.00 30.00  ? 114 THR C N   1  
ATOM 810    C CA  . THR A 1 110 ? -78.057  13.205  11.907  1.00 30.00  ? 114 THR C CA  1  
ATOM 811    C C   . THR A 1 110 ? -77.734  11.938  12.677  1.00 30.00  ? 114 THR C C   1  
ATOM 812    O O   . THR A 1 110 ? -76.574  11.694  13.026  1.00 30.00  ? 114 THR C O   1  
ATOM 813    C CB  . THR A 1 110 ? -77.626  13.014  10.457  1.00 99.99  ? 114 THR C CB  1  
ATOM 814    O OG1 . THR A 1 110 ? -77.935  14.194  9.710   1.00 99.99  ? 114 THR C OG1 1  
ATOM 815    C CG2 . THR A 1 110 ? -78.370  11.824  9.859   1.00 99.99  ? 114 THR C CG2 1  
ATOM 816    N N   . TYR A 1 111 ? -78.744  11.119  12.947  1.00 30.00  ? 115 TYR C N   1  
ATOM 817    C CA  . TYR A 1 111 ? -78.476  9.883   13.672  1.00 30.00  ? 115 TYR C CA  1  
ATOM 818    C C   . TYR A 1 111 ? -78.238  8.760   12.658  1.00 30.00  ? 115 TYR C C   1  
ATOM 819    O O   . TYR A 1 111 ? -78.549  8.886   11.462  1.00 30.00  ? 115 TYR C O   1  
ATOM 820    C CB  . TYR A 1 111 ? -79.667  9.532   14.556  1.00 99.99  ? 115 TYR C CB  1  
ATOM 821    C CG  . TYR A 1 111 ? -79.851  10.602  15.603  1.00 99.99  ? 115 TYR C CG  1  
ATOM 822    C CD1 . TYR A 1 111 ? -80.652  11.717  15.333  1.00 99.99  ? 115 TYR C CD1 1  
ATOM 823    C CD2 . TYR A 1 111 ? -79.222  10.479  16.848  1.00 99.99  ? 115 TYR C CD2 1  
ATOM 824    C CE1 . TYR A 1 111 ? -80.823  12.711  16.303  1.00 99.99  ? 115 TYR C CE1 1  
ATOM 825    C CE2 . TYR A 1 111 ? -79.391  11.473  17.819  1.00 99.99  ? 115 TYR C CE2 1  
ATOM 826    C CZ  . TYR A 1 111 ? -80.192  12.589  17.548  1.00 99.99  ? 115 TYR C CZ  1  
ATOM 827    O OH  . TYR A 1 111 ? -80.358  13.553  18.494  1.00 99.99  ? 115 TYR C OH  1  
ATOM 828    N N   . SER A 1 112 ? -77.203  8.064   13.377  1.00 30.00  ? 116 SER C N   1  
ATOM 829    C CA  . SER A 1 112 ? -76.667  6.988   12.593  1.00 30.00  ? 116 SER C CA  1  
ATOM 830    C C   . SER A 1 112 ? -76.968  5.820   13.440  1.00 30.00  ? 116 SER C C   1  
ATOM 831    O O   . SER A 1 112 ? -76.115  5.204   14.035  1.00 30.00  ? 116 SER C O   1  
ATOM 832    C CB  . SER A 1 112 ? -75.173  7.199   12.373  1.00 99.99  ? 116 SER C CB  1  
ATOM 833    O OG  . SER A 1 112 ? -74.482  7.051   13.616  1.00 99.99  ? 116 SER C OG  1  
ATOM 834    N N   . GLY A 1 113 ? -78.223  5.560   13.554  1.00 30.00  ? 117 GLY C N   1  
ATOM 835    C CA  . GLY A 1 113 ? -78.458  4.462   14.411  1.00 30.00  ? 117 GLY C CA  1  
ATOM 836    C C   . GLY A 1 113 ? -78.389  5.021   15.803  1.00 30.00  ? 117 GLY C C   1  
ATOM 837    O O   . GLY A 1 113 ? -78.988  6.058   16.081  1.00 30.00  ? 117 GLY C O   1  
ATOM 838    N N   . LEU A 1 114 ? -77.663  4.313   16.673  1.00 30.00  ? 118 LEU C N   1  
ATOM 839    C CA  . LEU A 1 114 ? -77.555  4.704   18.074  1.00 30.00  ? 118 LEU C CA  1  
ATOM 840    C C   . LEU A 1 114 ? -76.696  5.911   18.481  1.00 30.00  ? 118 LEU C C   1  
ATOM 841    O O   . LEU A 1 114 ? -76.803  6.423   19.591  1.00 30.00  ? 118 LEU C O   1  
ATOM 842    C CB  . LEU A 1 114 ? -76.965  3.556   18.887  1.00 99.99  ? 118 LEU C CB  1  
ATOM 843    C CG  . LEU A 1 114 ? -78.094  2.733   19.498  1.00 99.99  ? 118 LEU C CG  1  
ATOM 844    C CD1 . LEU A 1 114 ? -77.523  1.803   20.565  1.00 99.99  ? 118 LEU C CD1 1  
ATOM 845    C CD2 . LEU A 1 114 ? -79.118  3.667   20.134  1.00 99.99  ? 118 LEU C CD2 1  
ATOM 846    N N   . PHE A 1 115 ? -75.848  6.393   17.589  1.00 30.00  ? 119 PHE C N   1  
ATOM 847    C CA  . PHE A 1 115 ? -74.990  7.530   17.877  1.00 30.00  ? 119 PHE C CA  1  
ATOM 848    C C   . PHE A 1 115 ? -75.279  8.689   16.947  1.00 30.00  ? 119 PHE C C   1  
ATOM 849    O O   . PHE A 1 115 ? -75.917  8.525   15.906  1.00 30.00  ? 119 PHE C O   1  
ATOM 850    C CB  . PHE A 1 115 ? -73.528  7.129   17.706  1.00 99.99  ? 119 PHE C CB  1  
ATOM 851    C CG  . PHE A 1 115 ? -73.173  6.066   18.716  1.00 99.99  ? 119 PHE C CG  1  
ATOM 852    C CD1 . PHE A 1 115 ? -73.360  4.714   18.402  1.00 99.99  ? 119 PHE C CD1 1  
ATOM 853    C CD2 . PHE A 1 115 ? -72.657  6.430   19.966  1.00 99.99  ? 119 PHE C CD2 1  
ATOM 854    C CE1 . PHE A 1 115 ? -73.029  3.725   19.337  1.00 99.99  ? 119 PHE C CE1 1  
ATOM 855    C CE2 . PHE A 1 115 ? -72.330  5.443   20.902  1.00 99.99  ? 119 PHE C CE2 1  
ATOM 856    C CZ  . PHE A 1 115 ? -72.515  4.091   20.589  1.00 99.99  ? 119 PHE C CZ  1  
ATOM 857    N N   . CYS A 1 116 ? -74.772  9.838   17.346  1.00 30.00  ? 120 CYS C N   1  
ATOM 858    C CA  . CYS A 1 116 ? -74.974  11.029  16.572  1.00 30.00  ? 120 CYS C CA  1  
ATOM 859    C C   . CYS A 1 116 ? -73.805  11.390  15.695  1.00 30.00  ? 120 CYS C C   1  
ATOM 860    O O   . CYS A 1 116 ? -72.668  11.189  16.072  1.00 30.00  ? 120 CYS C O   1  
ATOM 861    C CB  . CYS A 1 116 ? -75.217  12.215  17.502  1.00 99.99  ? 120 CYS C CB  1  
ATOM 862    S SG  . CYS A 1 116 ? -73.822  12.705  18.546  1.00 99.99  ? 120 CYS C SG  1  
ATOM 863    N N   . ILE A 1 117 ? -74.250  12.223  14.407  1.00 30.00  ? 121 ILE C N   1  
ATOM 864    C CA  . ILE A 1 117 ? -73.247  12.793  13.500  1.00 30.00  ? 121 ILE C CA  1  
ATOM 865    C C   . ILE A 1 117 ? -73.356  14.296  13.369  1.00 30.00  ? 121 ILE C C   1  
ATOM 866    O O   . ILE A 1 117 ? -74.408  14.832  12.987  1.00 30.00  ? 121 ILE C O   1  
ATOM 867    C CB  . ILE A 1 117 ? -73.411  12.198  12.105  1.00 99.99  ? 121 ILE C CB  1  
ATOM 868    C CG1 . ILE A 1 117 ? -74.450  13.001  11.328  1.00 99.99  ? 121 ILE C CG1 1  
ATOM 869    C CG2 . ILE A 1 117 ? -73.873  10.749  12.223  1.00 99.99  ? 121 ILE C CG2 1  
ATOM 870    C CD1 . ILE A 1 117 ? -73.746  14.065  10.493  1.00 99.99  ? 121 ILE C CD1 1  
ATOM 871    N N   . ALA A 1 118 ? -72.255  14.971  13.675  1.00 30.00  ? 122 ALA C N   1  
ATOM 872    C CA  . ALA A 1 118 ? -72.210  16.411  13.602  1.00 30.00  ? 122 ALA C CA  1  
ATOM 873    C C   . ALA A 1 118 ? -71.245  16.846  12.518  1.00 30.00  ? 122 ALA C C   1  
ATOM 874    O O   . ALA A 1 118 ? -70.065  16.480  12.542  1.00 30.00  ? 122 ALA C O   1  
ATOM 875    C CB  . ALA A 1 118 ? -71.760  16.966  14.946  1.00 30.00  ? 122 ALA C CB  1  
ATOM 876    N N   . VAL A 1 119 ? -71.738  17.618  11.562  1.00 30.00  ? 123 VAL C N   1  
ATOM 877    C CA  . VAL A 1 119 ? -70.880  18.101  10.487  1.00 30.00  ? 123 VAL C CA  1  
ATOM 878    C C   . VAL A 1 119 ? -70.604  19.587  10.737  1.00 30.00  ? 123 VAL C C   1  
ATOM 879    O O   . VAL A 1 119 ? -71.521  20.406  10.723  1.00 30.00  ? 123 VAL C O   1  
ATOM 880    C CB  . VAL A 1 119 ? -71.580  17.918  9.145   1.00 99.99  ? 123 VAL C CB  1  
ATOM 881    C CG1 . VAL A 1 119 ? -71.876  16.437  8.925   1.00 99.99  ? 123 VAL C CG1 1  
ATOM 882    C CG2 . VAL A 1 119 ? -72.885  18.705  9.136   1.00 99.99  ? 123 VAL C CG2 1  
ATOM 883    N N   . ASN A 1 120 ? -69.351  20.025  11.034  1.00 30.00  ? 124 ASN C N   1  
ATOM 884    C CA  . ASN A 1 120 ? -68.970  21.408  11.301  1.00 30.00  ? 124 ASN C CA  1  
ATOM 885    C C   . ASN A 1 120 ? -69.611  22.460  10.372  1.00 30.00  ? 124 ASN C C   1  
ATOM 886    O O   . ASN A 1 120 ? -69.401  22.452  9.155   1.00 30.00  ? 124 ASN C O   1  
ATOM 887    C CB  . ASN A 1 120 ? -67.461  21.567  11.151  1.00 99.99  ? 124 ASN C CB  1  
ATOM 888    C CG  . ASN A 1 120 ? -67.013  21.253  9.731   1.00 99.99  ? 124 ASN C CG  1  
ATOM 889    O OD1 . ASN A 1 120 ? -65.883  21.553  9.352   1.00 99.99  ? 124 ASN C OD1 1  
ATOM 890    N ND2 . ASN A 1 120 ? -67.906  20.650  8.945   1.00 99.99  ? 124 ASN C ND2 1  
ATOM 891    N N   . PRO A 1 121 ? -70.381  23.409  10.946  1.00 30.00  ? 125 PRO C N   1  
ATOM 892    C CA  . PRO A 1 121 ? -71.064  24.470  10.188  1.00 30.00  ? 125 PRO C CA  1  
ATOM 893    C C   . PRO A 1 121 ? -70.232  25.641  9.705   1.00 30.00  ? 125 PRO C C   1  
ATOM 894    O O   . PRO A 1 121 ? -70.581  26.270  8.691   1.00 30.00  ? 125 PRO C O   1  
ATOM 895    C CB  . PRO A 1 121 ? -72.016  24.907  11.243  1.00 99.99  ? 125 PRO C CB  1  
ATOM 896    C CG  . PRO A 1 121 ? -71.780  24.000  12.426  1.00 99.99  ? 125 PRO C CG  1  
ATOM 897    C CD  . PRO A 1 121 ? -70.879  23.118  12.224  1.00 99.99  ? 125 PRO C CD  1  
ATOM 898    N N   . TYR A 1 122 ? -69.144  25.919  10.426  1.00 30.00  ? 126 TYR C N   1  
ATOM 899    C CA  . TYR A 1 122 ? -68.246  27.037  10.117  1.00 30.00  ? 126 TYR C CA  1  
ATOM 900    C C   . TYR A 1 122 ? -69.072  28.326  10.009  1.00 30.00  ? 126 TYR C C   1  
ATOM 901    O O   . TYR A 1 122 ? -68.865  29.155  9.125   1.00 30.00  ? 126 TYR C O   1  
ATOM 902    C CB  . TYR A 1 122 ? -67.529  26.777  8.796   1.00 99.99  ? 126 TYR C CB  1  
ATOM 903    C CG  . TYR A 1 122 ? -66.607  27.930  8.487   1.00 99.99  ? 126 TYR C CG  1  
ATOM 904    C CD1 . TYR A 1 122 ? -65.385  28.051  9.161   1.00 99.99  ? 126 TYR C CD1 1  
ATOM 905    C CD2 . TYR A 1 122 ? -66.970  28.882  7.527   1.00 99.99  ? 126 TYR C CD2 1  
ATOM 906    C CE1 . TYR A 1 122 ? -64.527  29.119  8.874   1.00 99.99  ? 126 TYR C CE1 1  
ATOM 907    C CE2 . TYR A 1 122 ? -66.115  29.953  7.241   1.00 99.99  ? 126 TYR C CE2 1  
ATOM 908    C CZ  . TYR A 1 122 ? -64.893  30.069  7.916   1.00 99.99  ? 126 TYR C CZ  1  
ATOM 909    O OH  . TYR A 1 122 ? -64.062  31.111  7.635   1.00 99.99  ? 126 TYR C OH  1  
ATOM 910    N N   . ARG A 1 123 ? -70.017  28.478  10.933  1.00 30.00  ? 127 ARG C N   1  
ATOM 911    C CA  . ARG A 1 123 ? -70.890  29.636  10.976  1.00 30.00  ? 127 ARG C CA  1  
ATOM 912    C C   . ARG A 1 123 ? -71.809  29.477  12.195  1.00 30.00  ? 127 ARG C C   1  
ATOM 913    O O   . ARG A 1 123 ? -72.087  28.364  12.637  1.00 30.00  ? 127 ARG C O   1  
ATOM 914    C CB  . ARG A 1 123 ? -71.718  29.709  9.698   1.00 99.99  ? 127 ARG C CB  1  
ATOM 915    C CG  . ARG A 1 123 ? -72.596  30.954  9.730   1.00 99.99  ? 127 ARG C CG  1  
ATOM 916    C CD  . ARG A 1 123 ? -73.459  31.002  8.475   1.00 99.99  ? 127 ARG C CD  1  
ATOM 917    N NE  . ARG A 1 123 ? -74.131  29.705  8.245   1.00 99.99  ? 127 ARG C NE  1  
ATOM 918    C CZ  . ARG A 1 123 ? -75.234  29.335  8.893   1.00 99.99  ? 127 ARG C CZ  1  
ATOM 919    N NH1 . ARG A 1 123 ? -75.812  30.115  9.802   1.00 99.99  ? 127 ARG C NH1 1  
ATOM 920    N NH2 . ARG A 1 123 ? -75.758  28.146  8.608   1.00 99.99  ? 127 ARG C NH2 1  
ATOM 921    N N   . ARG A 1 124 ? -72.273  30.587  12.752  1.00 30.00  ? 128 ARG C N   1  
ATOM 922    C CA  . ARG A 1 124 ? -73.130  30.506  13.923  1.00 30.00  ? 128 ARG C CA  1  
ATOM 923    C C   . ARG A 1 124 ? -74.568  30.180  13.557  1.00 30.00  ? 128 ARG C C   1  
ATOM 924    O O   . ARG A 1 124 ? -75.124  30.748  12.615  1.00 30.00  ? 128 ARG C O   1  
ATOM 925    C CB  . ARG A 1 124 ? -73.124  31.841  14.665  1.00 99.99  ? 128 ARG C CB  1  
ATOM 926    C CG  . ARG A 1 124 ? -73.984  31.732  15.919  1.00 99.99  ? 128 ARG C CG  1  
ATOM 927    C CD  . ARG A 1 124 ? -74.015  33.080  16.631  1.00 99.99  ? 128 ARG C CD  1  
ATOM 928    N NE  . ARG A 1 124 ? -74.333  34.171  15.684  1.00 99.99  ? 128 ARG C NE  1  
ATOM 929    C CZ  . ARG A 1 124 ? -75.570  34.446  15.281  1.00 99.99  ? 128 ARG C CZ  1  
ATOM 930    N NH1 . ARG A 1 124 ? -76.619  33.747  15.703  1.00 99.99  ? 128 ARG C NH1 1  
ATOM 931    N NH2 . ARG A 1 124 ? -75.740  35.452  14.428  1.00 99.99  ? 128 ARG C NH2 1  
ATOM 932    N N   . LEU A 1 125 ? -75.159  29.260  14.313  1.00 30.00  ? 129 LEU C N   1  
ATOM 933    C CA  . LEU A 1 125 ? -76.533  28.829  14.082  1.00 30.00  ? 129 LEU C CA  1  
ATOM 934    C C   . LEU A 1 125 ? -77.432  29.044  15.285  1.00 30.00  ? 129 LEU C C   1  
ATOM 935    O O   . LEU A 1 125 ? -77.060  28.728  16.408  1.00 30.00  ? 129 LEU C O   1  
ATOM 936    C CB  . LEU A 1 125 ? -76.559  27.342  13.748  1.00 99.99  ? 129 LEU C CB  1  
ATOM 937    C CG  . LEU A 1 125 ? -76.384  26.529  15.026  1.00 99.99  ? 129 LEU C CG  1  
ATOM 938    C CD1 . LEU A 1 125 ? -75.441  27.268  15.972  1.00 99.99  ? 129 LEU C CD1 1  
ATOM 939    C CD2 . LEU A 1 125 ? -77.739  26.344  15.700  1.00 99.99  ? 129 LEU C CD2 1  
ATOM 940    N N   . PRO A 1 126 ? -78.643  29.575  15.055  1.00 30.00  ? 130 PRO C N   1  
ATOM 941    C CA  . PRO A 1 126 ? -79.632  29.848  16.111  1.00 30.00  ? 130 PRO C CA  1  
ATOM 942    C C   . PRO A 1 126 ? -80.340  28.603  16.622  1.00 30.00  ? 130 PRO C C   1  
ATOM 943    O O   . PRO A 1 126 ? -81.531  28.640  16.924  1.00 30.00  ? 130 PRO C O   1  
ATOM 944    C CB  . PRO A 1 126 ? -80.544  30.724  15.328  1.00 99.99  ? 130 PRO C CB  1  
ATOM 945    C CG  . PRO A 1 126 ? -79.918  30.870  13.964  1.00 99.99  ? 130 PRO C CG  1  
ATOM 946    C CD  . PRO A 1 126 ? -78.810  30.249  13.839  1.00 99.99  ? 130 PRO C CD  1  
ATOM 947    N N   . ILE A 1 127 ? -79.605  27.507  16.733  1.00 30.00  ? 131 ILE C N   1  
ATOM 948    C CA  . ILE A 1 127 ? -80.177  26.242  17.181  1.00 30.00  ? 131 ILE C CA  1  
ATOM 949    C C   . ILE A 1 127 ? -79.849  25.867  18.622  1.00 30.00  ? 131 ILE C C   1  
ATOM 950    O O   . ILE A 1 127 ? -80.341  24.861  19.132  1.00 30.00  ? 131 ILE C O   1  
ATOM 951    C CB  . ILE A 1 127 ? -79.665  25.102  16.309  1.00 99.99  ? 131 ILE C CB  1  
ATOM 952    C CG1 . ILE A 1 127 ? -80.085  23.767  16.917  1.00 99.99  ? 131 ILE C CG1 1  
ATOM 953    C CG2 . ILE A 1 127 ? -78.143  25.167  16.228  1.00 99.99  ? 131 ILE C CG2 1  
ATOM 954    C CD1 . ILE A 1 127 ? -81.532  23.855  17.387  1.00 99.99  ? 131 ILE C CD1 1  
ATOM 955    N N   . TYR A 1 128 ? -79.026  26.681  19.276  1.00 30.00  ? 132 TYR C N   1  
ATOM 956    C CA  . TYR A 1 128 ? -78.623  26.428  20.659  1.00 30.00  ? 132 TYR C CA  1  
ATOM 957    C C   . TYR A 1 128 ? -79.284  27.331  21.707  1.00 30.00  ? 132 TYR C C   1  
ATOM 958    O O   . TYR A 1 128 ? -79.017  27.203  22.906  1.00 30.00  ? 132 TYR C O   1  
ATOM 959    C CB  . TYR A 1 128 ? -77.119  26.628  20.807  1.00 99.99  ? 132 TYR C CB  1  
ATOM 960    C CG  . TYR A 1 128 ? -76.788  28.093  20.650  1.00 99.99  ? 132 TYR C CG  1  
ATOM 961    C CD1 . TYR A 1 128 ? -76.495  28.610  19.383  1.00 99.99  ? 132 TYR C CD1 1  
ATOM 962    C CD2 . TYR A 1 128 ? -76.771  28.931  21.770  1.00 99.99  ? 132 TYR C CD2 1  
ATOM 963    C CE1 . TYR A 1 128 ? -76.187  29.970  19.236  1.00 99.99  ? 132 TYR C CE1 1  
ATOM 964    C CE2 . TYR A 1 128 ? -76.463  30.287  21.624  1.00 99.99  ? 132 TYR C CE2 1  
ATOM 965    C CZ  . TYR A 1 128 ? -76.171  30.807  20.356  1.00 99.99  ? 132 TYR C CZ  1  
ATOM 966    O OH  . TYR A 1 128 ? -75.871  32.127  20.214  1.00 99.99  ? 132 TYR C OH  1  
ATOM 967    N N   . THR A 1 129 ? -80.147  28.237  21.251  1.00 30.00  ? 133 THR C N   1  
ATOM 968    C CA  . THR A 1 129 ? -80.842  29.158  22.133  1.00 30.00  ? 133 THR C CA  1  
ATOM 969    C C   . THR A 1 129 ? -81.585  28.467  23.277  1.00 30.00  ? 133 THR C C   1  
ATOM 970    O O   . THR A 1 129 ? -81.722  27.241  23.317  1.00 30.00  ? 133 THR C O   1  
ATOM 971    C CB  . THR A 1 129 ? -81.878  29.951  21.342  1.00 99.99  ? 133 THR C CB  1  
ATOM 972    O OG1 . THR A 1 129 ? -82.922  29.077  20.911  1.00 99.99  ? 133 THR C OG1 1  
ATOM 973    C CG2 . THR A 1 129 ? -81.209  30.583  20.126  1.00 99.99  ? 133 THR C CG2 1  
ATOM 974    N N   . ASP A 1 130 ? -82.050  29.282  24.209  1.00 30.00  ? 134 ASP C N   1  
ATOM 975    C CA  . ASP A 1 130 ? -82.786  28.791  25.363  1.00 30.00  ? 134 ASP C CA  1  
ATOM 976    C C   . ASP A 1 130 ? -84.191  28.437  24.890  1.00 30.00  ? 134 ASP C C   1  
ATOM 977    O O   . ASP A 1 130 ? -84.902  27.636  25.501  1.00 30.00  ? 134 ASP C O   1  
ATOM 978    C CB  . ASP A 1 130 ? -82.842  29.867  26.441  1.00 99.99  ? 134 ASP C CB  1  
ATOM 979    C CG  . ASP A 1 130 ? -83.268  31.194  25.813  1.00 99.99  ? 134 ASP C CG  1  
ATOM 980    O OD1 . ASP A 1 130 ? -82.572  31.625  24.853  1.00 99.99  ? 134 ASP C OD1 1  
ATOM 981    O OD2 . ASP A 1 130 ? -84.279  31.763  26.298  1.00 99.99  ? 134 ASP C OD2 1  
ATOM 982    N N   . SER A 1 131 ? -84.591  29.062  23.790  1.00 30.00  ? 135 SER C N   1  
ATOM 983    C CA  . SER A 1 131 ? -85.899  28.811  23.214  1.00 30.00  ? 135 SER C CA  1  
ATOM 984    C C   . SER A 1 131 ? -85.896  27.336  22.813  1.00 30.00  ? 135 SER C C   1  
ATOM 985    O O   . SER A 1 131 ? -86.767  26.552  23.200  1.00 30.00  ? 135 SER C O   1  
ATOM 986    C CB  . SER A 1 131 ? -86.113  29.714  22.004  1.00 99.99  ? 135 SER C CB  1  
ATOM 987    O OG  . SER A 1 131 ? -85.230  29.323  20.953  1.00 99.99  ? 135 SER C OG  1  
ATOM 988    N N   . VAL A 1 132 ? -84.883  26.968  22.039  1.00 30.00  ? 136 VAL C N   1  
ATOM 989    C CA  . VAL A 1 132 ? -84.715  25.611  21.555  1.00 30.00  ? 136 VAL C CA  1  
ATOM 990    C C   . VAL A 1 132 ? -84.481  24.587  22.653  1.00 30.00  ? 136 VAL C C   1  
ATOM 991    O O   . VAL A 1 132 ? -84.970  23.460  22.557  1.00 30.00  ? 136 VAL C O   1  
ATOM 992    C CB  . VAL A 1 132 ? -83.517  25.539  20.614  1.00 99.99  ? 136 VAL C CB  1  
ATOM 993    C CG1 . VAL A 1 132 ? -83.742  26.473  19.427  1.00 99.99  ? 136 VAL C CG1 1  
ATOM 994    C CG2 . VAL A 1 132 ? -82.257  25.964  21.361  1.00 99.99  ? 136 VAL C CG2 1  
ATOM 995    N N   . ILE A 1 133 ? -83.740  24.960  23.690  1.00 30.00  ? 137 ILE C N   1  
ATOM 996    C CA  . ILE A 1 133 ? -83.475  24.017  24.774  1.00 30.00  ? 137 ILE C CA  1  
ATOM 997    C C   . ILE A 1 133 ? -84.751  23.592  25.475  1.00 30.00  ? 137 ILE C C   1  
ATOM 998    O O   . ILE A 1 133 ? -84.878  22.450  25.933  1.00 30.00  ? 137 ILE C O   1  
ATOM 999    C CB  . ILE A 1 133 ? -82.555  24.659  25.807  1.00 99.99  ? 137 ILE C CB  1  
ATOM 1000   C CG1 . ILE A 1 133 ? -83.390  25.447  26.810  1.00 99.99  ? 137 ILE C CG1 1  
ATOM 1001   C CG2 . ILE A 1 133 ? -81.581  25.603  25.105  1.00 99.99  ? 137 ILE C CG2 1  
ATOM 1002   C CD1 . ILE A 1 133 ? -83.688  24.570  28.024  1.00 99.99  ? 137 ILE C CD1 1  
ATOM 1003   N N   . ALA A 1 134 ? -85.698  24.526  25.554  1.00 30.00  ? 138 ALA C N   1  
ATOM 1004   C CA  . ALA A 1 134 ? -86.992  24.295  26.194  1.00 30.00  ? 138 ALA C CA  1  
ATOM 1005   C C   . ALA A 1 134 ? -87.732  23.137  25.528  1.00 30.00  ? 138 ALA C C   1  
ATOM 1006   O O   . ALA A 1 134 ? -88.299  22.270  26.197  1.00 30.00  ? 138 ALA C O   1  
ATOM 1007   C CB  . ALA A 1 134 ? -87.839  25.561  26.108  1.00 30.00  ? 138 ALA C CB  1  
ATOM 1008   N N   . LYS A 1 135 ? -87.711  23.141  24.202  1.00 30.00  ? 139 LYS C N   1  
ATOM 1009   C CA  . LYS A 1 135 ? -88.363  22.124  23.396  1.00 30.00  ? 139 LYS C CA  1  
ATOM 1010   C C   . LYS A 1 135 ? -87.714  20.739  23.417  1.00 30.00  ? 139 LYS C C   1  
ATOM 1011   O O   . LYS A 1 135 ? -88.398  19.742  23.231  1.00 30.00  ? 139 LYS C O   1  
ATOM 1012   C CB  . LYS A 1 135 ? -88.384  22.557  21.933  1.00 99.99  ? 139 LYS C CB  1  
ATOM 1013   C CG  . LYS A 1 135 ? -89.320  21.646  21.146  1.00 99.99  ? 139 LYS C CG  1  
ATOM 1014   C CD  . LYS A 1 135 ? -89.418  22.140  19.706  1.00 99.99  ? 139 LYS C CD  1  
ATOM 1015   C CE  . LYS A 1 135 ? -90.334  21.213  18.914  1.00 99.99  ? 139 LYS C CE  1  
ATOM 1016   N NZ  . LYS A 1 135 ? -90.410  21.676  17.521  1.00 99.99  ? 139 LYS C NZ  1  
ATOM 1017   N N   . TYR A 1 136 ? -86.407  20.665  23.647  1.00 30.00  ? 140 TYR C N   1  
ATOM 1018   C CA  . TYR A 1 136 ? -85.736  19.372  23.670  1.00 30.00  ? 140 TYR C CA  1  
ATOM 1019   C C   . TYR A 1 136 ? -85.792  18.678  25.006  1.00 30.00  ? 140 TYR C C   1  
ATOM 1020   O O   . TYR A 1 136 ? -85.514  17.478  25.101  1.00 30.00  ? 140 TYR C O   1  
ATOM 1021   C CB  . TYR A 1 136 ? -84.265  19.546  23.317  1.00 99.99  ? 140 TYR C CB  1  
ATOM 1022   C CG  . TYR A 1 136 ? -83.419  19.278  24.539  1.00 99.99  ? 140 TYR C CG  1  
ATOM 1023   C CD1 . TYR A 1 136 ? -83.952  19.482  25.816  1.00 99.99  ? 140 TYR C CD1 1  
ATOM 1024   C CD2 . TYR A 1 136 ? -82.100  18.830  24.394  1.00 99.99  ? 140 TYR C CD2 1  
ATOM 1025   C CE1 . TYR A 1 136 ? -83.168  19.234  26.950  1.00 99.99  ? 140 TYR C CE1 1  
ATOM 1026   C CE2 . TYR A 1 136 ? -81.316  18.583  25.527  1.00 99.99  ? 140 TYR C CE2 1  
ATOM 1027   C CZ  . TYR A 1 136 ? -81.851  18.785  26.805  1.00 99.99  ? 140 TYR C CZ  1  
ATOM 1028   O OH  . TYR A 1 136 ? -81.087  18.545  27.907  1.00 99.99  ? 140 TYR C OH  1  
ATOM 1029   N N   . ARG A 1 137 ? -86.153  19.423  26.043  1.00 30.00  ? 141 ARG C N   1  
ATOM 1030   C CA  . ARG A 1 137 ? -86.228  18.859  27.382  1.00 30.00  ? 141 ARG C CA  1  
ATOM 1031   C C   . ARG A 1 137 ? -87.181  17.652  27.467  1.00 30.00  ? 141 ARG C C   1  
ATOM 1032   O O   . ARG A 1 137 ? -88.359  17.741  27.095  1.00 30.00  ? 141 ARG C O   1  
ATOM 1033   C CB  . ARG A 1 137 ? -86.732  19.917  28.360  1.00 99.99  ? 141 ARG C CB  1  
ATOM 1034   C CG  . ARG A 1 137 ? -86.165  19.636  29.748  1.00 99.99  ? 141 ARG C CG  1  
ATOM 1035   C CD  . ARG A 1 137 ? -86.419  20.839  30.651  1.00 99.99  ? 141 ARG C CD  1  
ATOM 1036   N NE  . ARG A 1 137 ? -85.552  20.792  31.850  1.00 99.99  ? 141 ARG C NE  1  
ATOM 1037   C CZ  . ARG A 1 137 ? -85.462  21.794  32.720  1.00 99.99  ? 141 ARG C CZ  1  
ATOM 1038   N NH1 . ARG A 1 137 ? -86.152  22.923  32.568  1.00 99.99  ? 141 ARG C NH1 1  
ATOM 1039   N NH2 . ARG A 1 137 ? -84.653  21.647  33.764  1.00 99.99  ? 141 ARG C NH2 1  
ATOM 1040   N N   . GLY A 1 138 ? -86.596  16.570  27.965  1.00 30.00  ? 142 GLY C N   1  
ATOM 1041   C CA  . GLY A 1 138 ? -87.282  15.288  28.248  1.00 30.00  ? 142 GLY C CA  1  
ATOM 1042   C C   . GLY A 1 138 ? -87.855  14.610  26.990  1.00 30.00  ? 142 GLY C C   1  
ATOM 1043   O O   . GLY A 1 138 ? -88.671  13.684  27.077  1.00 30.00  ? 142 GLY C O   1  
ATOM 1044   N N   . LYS A 1 139 ? -87.420  15.058  25.832  1.00 30.00  ? 143 LYS C N   1  
ATOM 1045   C CA  . LYS A 1 139 ? -87.904  14.483  24.563  1.00 30.00  ? 143 LYS C CA  1  
ATOM 1046   C C   . LYS A 1 139 ? -87.092  13.238  24.191  1.00 30.00  ? 143 LYS C C   1  
ATOM 1047   O O   . LYS A 1 139 ? -85.864  13.204  24.361  1.00 30.00  ? 143 LYS C O   1  
ATOM 1048   C CB  . LYS A 1 139 ? -87.769  15.510  23.444  1.00 99.99  ? 143 LYS C CB  1  
ATOM 1049   C CG  . LYS A 1 139 ? -89.072  16.287  23.304  1.00 99.99  ? 143 LYS C CG  1  
ATOM 1050   C CD  . LYS A 1 139 ? -89.181  17.303  24.437  1.00 99.99  ? 143 LYS C CD  1  
ATOM 1051   C CE  . LYS A 1 139 ? -90.566  17.941  24.417  1.00 99.99  ? 143 LYS C CE  1  
ATOM 1052   N NZ  . LYS A 1 139 ? -90.714  18.829  25.578  1.00 99.99  ? 143 LYS C NZ  1  
ATOM 1053   N N   . ARG A 1 140 ? -87.827  12.261  23.700  1.00 30.00  ? 144 ARG C N   1  
ATOM 1054   C CA  . ARG A 1 140 ? -87.285  10.974  23.238  1.00 30.00  ? 144 ARG C CA  1  
ATOM 1055   C C   . ARG A 1 140 ? -86.844  11.151  21.763  1.00 30.00  ? 144 ARG C C   1  
ATOM 1056   O O   . ARG A 1 140 ? -87.627  11.597  20.919  1.00 30.00  ? 144 ARG C O   1  
ATOM 1057   C CB  . ARG A 1 140 ? -88.355  9.894   23.342  1.00 99.99  ? 144 ARG C CB  1  
ATOM 1058   C CG  . ARG A 1 140 ? -89.460  10.171  22.327  1.00 99.99  ? 144 ARG C CG  1  
ATOM 1059   C CD  . ARG A 1 140 ? -90.386  8.963   22.237  1.00 99.99  ? 144 ARG C CD  1  
ATOM 1060   N NE  . ARG A 1 140 ? -91.537  9.242   21.351  1.00 99.99  ? 144 ARG C NE  1  
ATOM 1061   C CZ  . ARG A 1 140 ? -92.541  8.387   21.180  1.00 99.99  ? 144 ARG C CZ  1  
ATOM 1062   N NH1 . ARG A 1 140 ? -92.579  7.208   21.797  1.00 99.99  ? 144 ARG C NH1 1  
ATOM 1063   N NH2 . ARG A 1 140 ? -93.529  8.740   20.361  1.00 99.99  ? 144 ARG C NH2 1  
ATOM 1064   N N   . LYS A 1 141 ? -85.590  10.790  21.521  1.00 30.00  ? 145 LYS C N   1  
ATOM 1065   C CA  . LYS A 1 141 ? -84.868  10.956  20.217  1.00 30.00  ? 145 LYS C CA  1  
ATOM 1066   C C   . LYS A 1 141 ? -85.758  10.935  18.937  1.00 30.00  ? 145 LYS C C   1  
ATOM 1067   O O   . LYS A 1 141 ? -85.516  11.681  17.975  1.00 30.00  ? 145 LYS C O   1  
ATOM 1068   C CB  . LYS A 1 141 ? -83.853  9.831   20.039  1.00 99.99  ? 145 LYS C CB  1  
ATOM 1069   C CG  . LYS A 1 141 ? -82.858  9.856   21.193  1.00 99.99  ? 145 LYS C CG  1  
ATOM 1070   C CD  . LYS A 1 141 ? -81.786  8.796   20.964  1.00 99.99  ? 145 LYS C CD  1  
ATOM 1071   C CE  . LYS A 1 141 ? -80.776  8.841   22.107  1.00 99.99  ? 145 LYS C CE  1  
ATOM 1072   N NZ  . LYS A 1 141 ? -79.526  8.194   21.679  1.00 99.99  ? 145 LYS C NZ  1  
ATOM 1073   N N   . THR A 1 142 ? -86.777  10.091  18.896  1.00 30.00  ? 146 THR C N   1  
ATOM 1074   C CA  . THR A 1 142 ? -87.642  9.971   17.685  1.00 30.00  ? 146 THR C CA  1  
ATOM 1075   C C   . THR A 1 142 ? -88.726  11.057  17.642  1.00 30.00  ? 146 THR C C   1  
ATOM 1076   O O   . THR A 1 142 ? -89.276  11.371  16.573  1.00 30.00  ? 146 THR C O   1  
ATOM 1077   C CB  . THR A 1 142 ? -88.335  8.613   17.675  1.00 99.99  ? 146 THR C CB  1  
ATOM 1078   O OG1 . THR A 1 142 ? -89.283  8.553   18.744  1.00 99.99  ? 146 THR C OG1 1  
ATOM 1079   C CG2 . THR A 1 142 ? -87.297  7.510   17.856  1.00 99.99  ? 146 THR C CG2 1  
ATOM 1080   N N   . GLU A 1 143 ? -88.987  11.595  18.807  1.00 30.00  ? 147 GLU C N   1  
ATOM 1081   C CA  . GLU A 1 143 ? -90.038  12.601  19.025  1.00 30.00  ? 147 GLU C CA  1  
ATOM 1082   C C   . GLU A 1 143 ? -89.704  13.956  18.395  1.00 30.00  ? 147 GLU C C   1  
ATOM 1083   O O   . GLU A 1 143 ? -90.594  14.683  17.933  1.00 30.00  ? 147 GLU C O   1  
ATOM 1084   C CB  . GLU A 1 143 ? -90.240  12.822  20.519  1.00 99.99  ? 147 GLU C CB  1  
ATOM 1085   C CG  . GLU A 1 143 ? -90.763  11.555  21.153  1.00 99.99  ? 147 GLU C CG  1  
ATOM 1086   C CD  . GLU A 1 143 ? -92.216  11.337  20.733  1.00 99.99  ? 147 GLU C CD  1  
ATOM 1087   O OE1 . GLU A 1 143 ? -92.420  10.671  19.685  1.00 99.99  ? 147 GLU C OE1 1  
ATOM 1088   O OE2 . GLU A 1 143 ? -93.110  11.842  21.466  1.00 99.99  ? 147 GLU C OE2 1  
ATOM 1089   N N   . ILE A 1 144 ? -88.429  14.298  18.381  1.00 30.00  ? 148 ILE C N   1  
ATOM 1090   C CA  . ILE A 1 144 ? -88.015  15.617  17.884  1.00 30.00  ? 148 ILE C CA  1  
ATOM 1091   C C   . ILE A 1 144 ? -86.765  15.540  16.979  1.00 30.00  ? 148 ILE C C   1  
ATOM 1092   O O   . ILE A 1 144 ? -85.946  14.628  17.134  1.00 30.00  ? 148 ILE C O   1  
ATOM 1093   C CB  . ILE A 1 144 ? -87.685  16.530  19.059  1.00 99.99  ? 148 ILE C CB  1  
ATOM 1094   C CG1 . ILE A 1 144 ? -86.268  16.241  19.547  1.00 99.99  ? 148 ILE C CG1 1  
ATOM 1095   C CG2 . ILE A 1 144 ? -88.674  16.276  20.194  1.00 99.99  ? 148 ILE C CG2 1  
ATOM 1096   C CD1 . ILE A 1 144 ? -86.315  15.214  20.671  1.00 99.99  ? 148 ILE C CD1 1  
ATOM 1097   N N   . PRO A 1 145 ? -86.620  16.485  16.017  1.00 30.00  ? 149 PRO C N   1  
ATOM 1098   C CA  . PRO A 1 145 ? -85.473  16.513  15.105  1.00 30.00  ? 149 PRO C CA  1  
ATOM 1099   C C   . PRO A 1 145 ? -84.151  16.106  15.717  1.00 30.00  ? 149 PRO C C   1  
ATOM 1100   O O   . PRO A 1 145 ? -83.977  16.127  16.938  1.00 30.00  ? 149 PRO C O   1  
ATOM 1101   C CB  . PRO A 1 145 ? -85.495  17.963  14.776  1.00 99.99  ? 149 PRO C CB  1  
ATOM 1102   C CG  . PRO A 1 145 ? -86.687  18.541  15.507  1.00 99.99  ? 149 PRO C CG  1  
ATOM 1103   C CD  . PRO A 1 145 ? -87.346  17.674  16.170  1.00 99.99  ? 149 PRO C CD  1  
ATOM 1104   N N   . PRO A 1 146 ? -83.184  15.719  14.873  1.00 30.00  ? 150 PRO C N   1  
ATOM 1105   C CA  . PRO A 1 146 ? -81.908  15.322  15.457  1.00 30.00  ? 150 PRO C CA  1  
ATOM 1106   C C   . PRO A 1 146 ? -81.155  16.542  16.008  1.00 30.00  ? 150 PRO C C   1  
ATOM 1107   O O   . PRO A 1 146 ? -81.081  17.607  15.373  1.00 30.00  ? 150 PRO C O   1  
ATOM 1108   C CB  . PRO A 1 146 ? -81.279  14.759  14.230  1.00 99.99  ? 150 PRO C CB  1  
ATOM 1109   C CG  . PRO A 1 146 ? -82.420  14.358  13.322  1.00 99.99  ? 150 PRO C CG  1  
ATOM 1110   C CD  . PRO A 1 146 ? -83.457  15.088  13.455  1.00 99.99  ? 150 PRO C CD  1  
ATOM 1111   N N   . HIS A 1 147 ? -80.605  16.378  17.198  1.00 30.00  ? 151 HIS C N   1  
ATOM 1112   C CA  . HIS A 1 147 ? -79.869  17.453  17.821  1.00 30.00  ? 151 HIS C CA  1  
ATOM 1113   C C   . HIS A 1 147 ? -78.989  16.889  18.902  1.00 30.00  ? 151 HIS C C   1  
ATOM 1114   O O   . HIS A 1 147 ? -79.252  15.809  19.451  1.00 30.00  ? 151 HIS C O   1  
ATOM 1115   C CB  . HIS A 1 147 ? -80.839  18.459  18.429  1.00 99.99  ? 151 HIS C CB  1  
ATOM 1116   C CG  . HIS A 1 147 ? -80.230  19.784  18.818  1.00 99.99  ? 151 HIS C CG  1  
ATOM 1117   N ND1 . HIS A 1 147 ? -79.698  20.006  20.081  1.00 99.99  ? 151 HIS C ND1 1  
ATOM 1118   C CD2 . HIS A 1 147 ? -80.068  20.937  18.117  1.00 99.99  ? 151 HIS C CD2 1  
ATOM 1119   C CE1 . HIS A 1 147 ? -79.243  21.245  20.120  1.00 99.99  ? 151 HIS C CE1 1  
ATOM 1120   N NE2 . HIS A 1 147 ? -79.455  21.815  18.959  1.00 99.99  ? 151 HIS C NE2 1  
ATOM 1121   N N   . LEU A 1 148 ? -77.939  17.644  19.201  1.00 30.00  ? 152 LEU C N   1  
ATOM 1122   C CA  . LEU A 1 148 ? -76.984  17.274  20.223  1.00 30.00  ? 152 LEU C CA  1  
ATOM 1123   C C   . LEU A 1 148 ? -77.687  17.334  21.591  1.00 30.00  ? 152 LEU C C   1  
ATOM 1124   O O   . LEU A 1 148 ? -77.365  16.564  22.505  1.00 30.00  ? 152 LEU C O   1  
ATOM 1125   C CB  . LEU A 1 148 ? -75.804  18.241  20.205  1.00 99.99  ? 152 LEU C CB  1  
ATOM 1126   C CG  . LEU A 1 148 ? -74.686  17.661  19.349  1.00 99.99  ? 152 LEU C CG  1  
ATOM 1127   C CD1 . LEU A 1 148 ? -73.401  18.447  19.590  1.00 99.99  ? 152 LEU C CD1 1  
ATOM 1128   C CD2 . LEU A 1 148 ? -74.464  16.199  19.722  1.00 99.99  ? 152 LEU C CD2 1  
ATOM 1129   N N   . PHE A 1 149 ? -78.666  18.237  21.727  1.00 30.00  ? 153 PHE C N   1  
ATOM 1130   C CA  . PHE A 1 149 ? -79.380  18.354  23.001  1.00 30.00  ? 153 PHE C CA  1  
ATOM 1131   C C   . PHE A 1 149 ? -80.030  17.030  23.308  1.00 30.00  ? 153 PHE C C   1  
ATOM 1132   O O   . PHE A 1 149 ? -79.975  16.553  24.443  1.00 30.00  ? 153 PHE C O   1  
ATOM 1133   C CB  . PHE A 1 149 ? -80.445  19.441  22.900  1.00 99.99  ? 153 PHE C CB  1  
ATOM 1134   C CG  . PHE A 1 149 ? -79.783  20.798  22.905  1.00 99.99  ? 153 PHE C CG  1  
ATOM 1135   C CD1 . PHE A 1 149 ? -79.322  21.345  24.109  1.00 99.99  ? 153 PHE C CD1 1  
ATOM 1136   C CD2 . PHE A 1 149 ? -79.630  21.507  21.707  1.00 99.99  ? 153 PHE C CD2 1  
ATOM 1137   C CE1 . PHE A 1 149 ? -78.707  22.604  24.112  1.00 99.99  ? 153 PHE C CE1 1  
ATOM 1138   C CE2 . PHE A 1 149 ? -79.017  22.766  21.715  1.00 99.99  ? 153 PHE C CE2 1  
ATOM 1139   C CZ  . PHE A 1 149 ? -78.556  23.312  22.918  1.00 99.99  ? 153 PHE C CZ  1  
ATOM 1140   N N   . SER A 1 150 ? -80.638  16.438  22.281  1.00 30.00  ? 154 SER C N   1  
ATOM 1141   C CA  . SER A 1 150 ? -81.314  15.148  22.386  1.00 30.00  ? 154 SER C CA  1  
ATOM 1142   C C   . SER A 1 150 ? -80.381  14.072  22.921  1.00 30.00  ? 154 SER C C   1  
ATOM 1143   O O   . SER A 1 150 ? -80.759  13.265  23.774  1.00 30.00  ? 154 SER C O   1  
ATOM 1144   C CB  . SER A 1 150 ? -81.815  14.713  21.014  1.00 99.99  ? 154 SER C CB  1  
ATOM 1145   O OG  . SER A 1 150 ? -82.711  15.697  20.497  1.00 99.99  ? 154 SER C OG  1  
ATOM 1146   N N   . VAL A 1 151 ? -79.152  14.057  22.417  1.00 30.00  ? 155 VAL C N   1  
ATOM 1147   C CA  . VAL A 1 151 ? -78.177  13.072  22.868  1.00 30.00  ? 155 VAL C CA  1  
ATOM 1148   C C   . VAL A 1 151 ? -77.919  13.275  24.361  1.00 30.00  ? 155 VAL C C   1  
ATOM 1149   O O   . VAL A 1 151 ? -77.890  12.309  25.131  1.00 30.00  ? 155 VAL C O   1  
ATOM 1150   C CB  . VAL A 1 151 ? -76.870  13.243  22.098  1.00 99.99  ? 155 VAL C CB  1  
ATOM 1151   C CG1 . VAL A 1 151 ? -75.840  12.242  22.612  1.00 99.99  ? 155 VAL C CG1 1  
ATOM 1152   C CG2 . VAL A 1 151 ? -77.119  12.999  20.615  1.00 99.99  ? 155 VAL C CG2 1  
ATOM 1153   N N   . ALA A 1 152 ? -77.728  14.549  24.746  1.00 30.00  ? 156 ALA C N   1  
ATOM 1154   C CA  . ALA A 1 152 ? -77.469  14.948  26.145  1.00 30.00  ? 156 ALA C CA  1  
ATOM 1155   C C   . ALA A 1 152 ? -78.715  14.685  26.992  1.00 30.00  ? 156 ALA C C   1  
ATOM 1156   O O   . ALA A 1 152 ? -78.653  14.013  28.037  1.00 30.00  ? 156 ALA C O   1  
ATOM 1157   C CB  . ALA A 1 152 ? -77.113  16.415  26.195  1.00 30.00  ? 156 ALA C CB  1  
ATOM 1158   N N   . ASP A 1 153 ? -79.844  15.219  26.534  1.00 30.00  ? 157 ASP C N   1  
ATOM 1159   C CA  . ASP A 1 153 ? -81.088  15.007  27.249  1.00 30.00  ? 157 ASP C CA  1  
ATOM 1160   C C   . ASP A 1 153 ? -81.325  13.511  27.484  1.00 30.00  ? 157 ASP C C   1  
ATOM 1161   O O   . ASP A 1 153 ? -81.752  13.101  28.564  1.00 30.00  ? 157 ASP C O   1  
ATOM 1162   C CB  . ASP A 1 153 ? -82.253  15.568  26.441  1.00 99.99  ? 157 ASP C CB  1  
ATOM 1163   C CG  . ASP A 1 153 ? -83.516  15.567  27.297  1.00 99.99  ? 157 ASP C CG  1  
ATOM 1164   O OD1 . ASP A 1 153 ? -84.133  14.475  27.414  1.00 99.99  ? 157 ASP C OD1 1  
ATOM 1165   O OD2 . ASP A 1 153 ? -83.853  16.658  27.831  1.00 99.99  ? 157 ASP C OD2 1  
ATOM 1166   N N   . ASN A 1 154 ? -81.052  12.678  26.487  1.00 30.00  ? 158 ASN C N   1  
ATOM 1167   C CA  . ASN A 1 154 ? -81.279  11.260  26.685  1.00 30.00  ? 158 ASN C CA  1  
ATOM 1168   C C   . ASN A 1 154 ? -80.324  10.630  27.681  1.00 30.00  ? 158 ASN C C   1  
ATOM 1169   O O   . ASN A 1 154 ? -80.747  9.827   28.498  1.00 30.00  ? 158 ASN C O   1  
ATOM 1170   C CB  . ASN A 1 154 ? -81.111  10.519  25.364  1.00 99.99  ? 158 ASN C CB  1  
ATOM 1171   C CG  . ASN A 1 154 ? -82.366  10.623  24.511  1.00 99.99  ? 158 ASN C CG  1  
ATOM 1172   O OD1 . ASN A 1 154 ? -83.435  10.175  24.920  1.00 99.99  ? 158 ASN C OD1 1  
ATOM 1173   N ND2 . ASN A 1 154 ? -82.234  11.219  23.323  1.00 99.99  ? 158 ASN C ND2 1  
ATOM 1174   N N   . ALA A 1 155 ? -79.046  10.975  27.627  1.00 30.00  ? 159 ALA C N   1  
ATOM 1175   C CA  . ALA A 1 155 ? -78.111  10.391  28.576  1.00 30.00  ? 159 ALA C CA  1  
ATOM 1176   C C   . ALA A 1 155 ? -78.590  10.724  29.991  1.00 30.00  ? 159 ALA C C   1  
ATOM 1177   O O   . ALA A 1 155 ? -78.425  9.931   30.916  1.00 30.00  ? 159 ALA C O   1  
ATOM 1178   C CB  . ALA A 1 155 ? -76.710  10.944  28.349  1.00 30.00  ? 159 ALA C CB  1  
ATOM 1179   N N   . TYR A 1 156 ? -79.192  11.898  30.161  1.00 30.00  ? 160 TYR C N   1  
ATOM 1180   C CA  . TYR A 1 156 ? -79.682  12.297  31.475  1.00 30.00  ? 160 TYR C CA  1  
ATOM 1181   C C   . TYR A 1 156 ? -80.769  11.336  31.940  1.00 30.00  ? 160 TYR C C   1  
ATOM 1182   O O   . TYR A 1 156 ? -80.664  10.742  33.020  1.00 30.00  ? 160 TYR C O   1  
ATOM 1183   C CB  . TYR A 1 156 ? -80.260  13.707  31.409  1.00 99.99  ? 160 TYR C CB  1  
ATOM 1184   C CG  . TYR A 1 156 ? -80.763  14.112  32.772  1.00 99.99  ? 160 TYR C CG  1  
ATOM 1185   C CD1 . TYR A 1 156 ? -79.873  14.623  33.724  1.00 99.99  ? 160 TYR C CD1 1  
ATOM 1186   C CD2 . TYR A 1 156 ? -82.122  13.973  33.087  1.00 99.99  ? 160 TYR C CD2 1  
ATOM 1187   C CE1 . TYR A 1 156 ? -80.341  15.001  34.989  1.00 99.99  ? 160 TYR C CE1 1  
ATOM 1188   C CE2 . TYR A 1 156 ? -82.587  14.349  34.353  1.00 99.99  ? 160 TYR C CE2 1  
ATOM 1189   C CZ  . TYR A 1 156 ? -81.698  14.861  35.304  1.00 99.99  ? 160 TYR C CZ  1  
ATOM 1190   O OH  . TYR A 1 156 ? -82.152  15.226  36.533  1.00 99.99  ? 160 TYR C OH  1  
ATOM 1191   N N   . GLN A 1 157 ? -81.808  11.188  31.114  1.00 30.00  ? 161 GLN C N   1  
ATOM 1192   C CA  . GLN A 1 157 ? -82.924  10.299  31.425  1.00 30.00  ? 161 GLN C CA  1  
ATOM 1193   C C   . GLN A 1 157 ? -82.442  8.890   31.805  1.00 30.00  ? 161 GLN C C   1  
ATOM 1194   O O   . GLN A 1 157 ? -82.943  8.298   32.767  1.00 30.00  ? 161 GLN C O   1  
ATOM 1195   C CB  . GLN A 1 157 ? -83.843  10.177  30.215  1.00 99.99  ? 161 GLN C CB  1  
ATOM 1196   C CG  . GLN A 1 157 ? -85.243  9.782   30.677  1.00 99.99  ? 161 GLN C CG  1  
ATOM 1197   C CD  . GLN A 1 157 ? -85.362  8.274   30.837  1.00 99.99  ? 161 GLN C CD  1  
ATOM 1198   O OE1 . GLN A 1 157 ? -84.401  7.543   30.602  1.00 99.99  ? 161 GLN C OE1 1  
ATOM 1199   N NE2 . GLN A 1 157 ? -86.547  7.805   31.239  1.00 99.99  ? 161 GLN C NE2 1  
ATOM 1200   N N   . ASN A 1 158 ? -81.471  8.361   31.055  1.00 30.00  ? 162 ASN C N   1  
ATOM 1201   C CA  . ASN A 1 158 ? -80.927  7.019   31.318  1.00 30.00  ? 162 ASN C CA  1  
ATOM 1202   C C   . ASN A 1 158 ? -80.257  6.930   32.676  1.00 30.00  ? 162 ASN C C   1  
ATOM 1203   O O   . ASN A 1 158 ? -80.505  6.006   33.441  1.00 30.00  ? 162 ASN C O   1  
ATOM 1204   C CB  . ASN A 1 158 ? -79.890  6.661   30.258  1.00 99.99  ? 162 ASN C CB  1  
ATOM 1205   C CG  . ASN A 1 158 ? -80.520  6.595   28.873  1.00 99.99  ? 162 ASN C CG  1  
ATOM 1206   O OD1 . ASN A 1 158 ? -81.499  5.880   28.668  1.00 99.99  ? 162 ASN C OD1 1  
ATOM 1207   N ND2 . ASN A 1 158 ? -79.957  7.341   27.923  1.00 99.99  ? 162 ASN C ND2 1  
ATOM 1208   N N   . MET A 1 159 ? -79.390  7.893   32.970  1.00 30.00  ? 163 MET C N   1  
ATOM 1209   C CA  . MET A 1 159 ? -78.699  7.889   34.245  1.00 30.00  ? 163 MET C CA  1  
ATOM 1210   C C   . MET A 1 159 ? -79.728  7.887   35.361  1.00 30.00  ? 163 MET C C   1  
ATOM 1211   O O   . MET A 1 159 ? -79.593  7.157   36.354  1.00 30.00  ? 163 MET C O   1  
ATOM 1212   C CB  . MET A 1 159 ? -77.818  9.128   34.362  1.00 99.99  ? 163 MET C CB  1  
ATOM 1213   C CG  . MET A 1 159 ? -76.793  9.133   33.235  1.00 99.99  ? 163 MET C CG  1  
ATOM 1214   S SD  . MET A 1 159 ? -75.354  10.122  33.710  1.00 99.99  ? 163 MET C SD  1  
ATOM 1215   C CE  . MET A 1 159 ? -76.124  11.712  33.915  1.00 99.99  ? 163 MET C CE  1  
ATOM 1216   N N   . VAL A 1 160 ? -80.757  8.714   35.180  1.00 30.00  ? 164 VAL C N   1  
ATOM 1217   C CA  . VAL A 1 160 ? -81.847  8.848   36.145  1.00 30.00  ? 164 VAL C CA  1  
ATOM 1218   C C   . VAL A 1 160 ? -82.634  7.537   36.288  1.00 30.00  ? 164 VAL C C   1  
ATOM 1219   O O   . VAL A 1 160 ? -82.516  6.835   37.303  1.00 30.00  ? 164 VAL C O   1  
ATOM 1220   C CB  . VAL A 1 160 ? -82.808  9.941   35.694  1.00 99.99  ? 164 VAL C CB  1  
ATOM 1221   C CG1 . VAL A 1 160 ? -83.967  10.036  36.683  1.00 99.99  ? 164 VAL C CG1 1  
ATOM 1222   C CG2 . VAL A 1 160 ? -82.075  11.276  35.641  1.00 99.99  ? 164 VAL C CG2 1  
ATOM 1223   N N   . THR A 1 161 ? -83.422  7.195   35.265  1.00 30.00  ? 165 THR C N   1  
ATOM 1224   C CA  . THR A 1 161 ? -84.218  5.976   35.303  1.00 30.00  ? 165 THR C CA  1  
ATOM 1225   C C   . THR A 1 161 ? -83.391  4.696   35.467  1.00 30.00  ? 165 THR C C   1  
ATOM 1226   O O   . THR A 1 161 ? -83.720  3.866   36.312  1.00 30.00  ? 165 THR C O   1  
ATOM 1227   C CB  . THR A 1 161 ? -85.011  5.834   34.008  1.00 99.99  ? 165 THR C CB  1  
ATOM 1228   O OG1 . THR A 1 161 ? -84.110  5.587   32.925  1.00 99.99  ? 165 THR C OG1 1  
ATOM 1229   C CG2 . THR A 1 161 ? -85.783  7.119   33.742  1.00 99.99  ? 165 THR C CG2 1  
ATOM 1230   N N   . ASP A 1 162 ? -82.324  4.541   34.684  1.00 30.00  ? 166 ASP C N   1  
ATOM 1231   C CA  . ASP A 1 162 ? -81.472  3.338   34.763  1.00 30.00  ? 166 ASP C CA  1  
ATOM 1232   C C   . ASP A 1 162 ? -80.545  3.324   35.972  1.00 30.00  ? 166 ASP C C   1  
ATOM 1233   O O   . ASP A 1 162 ? -79.986  2.281   36.313  1.00 30.00  ? 166 ASP C O   1  
ATOM 1234   C CB  . ASP A 1 162 ? -80.597  3.241   33.520  1.00 99.99  ? 166 ASP C CB  1  
ATOM 1235   C CG  . ASP A 1 162 ? -81.466  2.952   32.301  1.00 99.99  ? 166 ASP C CG  1  
ATOM 1236   O OD1 . ASP A 1 162 ? -81.964  1.797   32.207  1.00 99.99  ? 166 ASP C OD1 1  
ATOM 1237   O OD2 . ASP A 1 162 ? -81.632  3.890   31.473  1.00 99.99  ? 166 ASP C OD2 1  
ATOM 1238   N N   . ARG A 1 163 ? -80.371  4.473   36.614  1.00 30.00  ? 167 ARG C N   1  
ATOM 1239   C CA  . ARG A 1 163 ? -79.498  4.602   37.790  1.00 30.00  ? 167 ARG C CA  1  
ATOM 1240   C C   . ARG A 1 163 ? -78.112  4.032   37.481  1.00 30.00  ? 167 ARG C C   1  
ATOM 1241   O O   . ARG A 1 163 ? -77.735  2.970   37.987  1.00 30.00  ? 167 ARG C O   1  
ATOM 1242   C CB  . ARG A 1 163 ? -80.098  3.838   38.967  1.00 99.99  ? 167 ARG C CB  1  
ATOM 1243   C CG  . ARG A 1 163 ? -81.404  4.502   39.391  1.00 99.99  ? 167 ARG C CG  1  
ATOM 1244   C CD  . ARG A 1 163 ? -82.186  3.555   40.295  1.00 99.99  ? 167 ARG C CD  1  
ATOM 1245   N NE  . ARG A 1 163 ? -83.514  4.118   40.630  1.00 99.99  ? 167 ARG C NE  1  
ATOM 1246   C CZ  . ARG A 1 163 ? -84.543  4.094   39.789  1.00 99.99  ? 167 ARG C CZ  1  
ATOM 1247   N NH1 . ARG A 1 163 ? -84.449  3.560   38.572  1.00 99.99  ? 167 ARG C NH1 1  
ATOM 1248   N NH2 . ARG A 1 163 ? -85.692  4.628   40.191  1.00 99.99  ? 167 ARG C NH2 1  
ATOM 1249   N N   . GLU A 1 164 ? -77.335  4.754   36.663  1.00 30.00  ? 168 GLU C N   1  
ATOM 1250   C CA  . GLU A 1 164 ? -75.970  4.374   36.264  1.00 30.00  ? 168 GLU C CA  1  
ATOM 1251   C C   . GLU A 1 164 ? -75.264  5.604   35.652  1.00 30.00  ? 168 GLU C C   1  
ATOM 1252   O O   . GLU A 1 164 ? -75.931  6.568   35.263  1.00 30.00  ? 168 GLU C O   1  
ATOM 1253   C CB  . GLU A 1 164 ? -76.024  3.252   35.233  1.00 99.99  ? 168 GLU C CB  1  
ATOM 1254   C CG  . GLU A 1 164 ? -75.164  3.613   34.047  1.00 99.99  ? 168 GLU C CG  1  
ATOM 1255   C CD  . GLU A 1 164 ? -75.831  4.735   33.256  1.00 99.99  ? 168 GLU C CD  1  
ATOM 1256   O OE1 . GLU A 1 164 ? -75.549  5.917   33.580  1.00 99.99  ? 168 GLU C OE1 1  
ATOM 1257   O OE2 . GLU A 1 164 ? -76.622  4.395   32.334  1.00 99.99  ? 168 GLU C OE2 1  
ATOM 1258   N N   . ASN A 1 165 ? -73.933  5.572   35.567  1.00 30.00  ? 169 ASN C N   1  
ATOM 1259   C CA  . ASN A 1 165 ? -73.193  6.699   34.987  1.00 30.00  ? 169 ASN C CA  1  
ATOM 1260   C C   . ASN A 1 165 ? -73.284  6.703   33.463  1.00 30.00  ? 169 ASN C C   1  
ATOM 1261   O O   . ASN A 1 165 ? -73.263  5.641   32.824  1.00 30.00  ? 169 ASN C O   1  
ATOM 1262   C CB  . ASN A 1 165 ? -71.722  6.609   35.379  1.00 99.99  ? 169 ASN C CB  1  
ATOM 1263   C CG  . ASN A 1 165 ? -71.545  6.723   36.885  1.00 99.99  ? 169 ASN C CG  1  
ATOM 1264   O OD1 . ASN A 1 165 ? -72.019  7.680   37.498  1.00 99.99  ? 169 ASN C OD1 1  
ATOM 1265   N ND2 . ASN A 1 165 ? -70.862  5.745   37.483  1.00 99.99  ? 169 ASN C ND2 1  
ATOM 1266   N N   . GLN A 1 166 ? -73.390  7.895   32.888  1.00 30.00  ? 170 GLN C N   1  
ATOM 1267   C CA  . GLN A 1 166 ? -73.467  8.033   31.439  1.00 30.00  ? 170 GLN C CA  1  
ATOM 1268   C C   . GLN A 1 166 ? -72.139  8.585   30.955  1.00 30.00  ? 170 GLN C C   1  
ATOM 1269   O O   . GLN A 1 166 ? -71.237  8.851   31.758  1.00 30.00  ? 170 GLN C O   1  
ATOM 1270   C CB  . GLN A 1 166 ? -74.599  8.980   31.067  1.00 99.99  ? 170 GLN C CB  1  
ATOM 1271   C CG  . GLN A 1 166 ? -75.933  8.371   31.480  1.00 99.99  ? 170 GLN C CG  1  
ATOM 1272   C CD  . GLN A 1 166 ? -76.305  7.203   30.576  1.00 99.99  ? 170 GLN C CD  1  
ATOM 1273   O OE1 . GLN A 1 166 ? -75.565  6.867   29.655  1.00 99.99  ? 170 GLN C OE1 1  
ATOM 1274   N NE2 . GLN A 1 166 ? -77.458  6.586   30.841  1.00 99.99  ? 170 GLN C NE2 1  
ATOM 1275   N N   . SER A 1 167 ? -72.006  8.752   29.646  1.00 30.00  ? 171 SER C N   1  
ATOM 1276   C CA  . SER A 1 167 ? -70.765  9.274   29.089  1.00 30.00  ? 171 SER C CA  1  
ATOM 1277   C C   . SER A 1 167 ? -70.838  9.465   27.577  1.00 30.00  ? 171 SER C C   1  
ATOM 1278   O O   . SER A 1 167 ? -71.390  8.627   26.859  1.00 30.00  ? 171 SER C O   1  
ATOM 1279   C CB  . SER A 1 167 ? -69.620  8.309   29.379  1.00 99.99  ? 171 SER C CB  1  
ATOM 1280   O OG  . SER A 1 167 ? -69.290  8.367   30.769  1.00 99.99  ? 171 SER C OG  1  
ATOM 1281   N N   . CYS A 1 168 ? -70.290  10.587  27.108  1.00 30.00  ? 172 CYS C N   1  
ATOM 1282   C CA  . CYS A 1 168 ? -70.266  10.925  25.694  1.00 30.00  ? 172 CYS C CA  1  
ATOM 1283   C C   . CYS A 1 168 ? -68.866  11.066  25.215  1.00 30.00  ? 172 CYS C C   1  
ATOM 1284   O O   . CYS A 1 168 ? -68.091  11.871  25.735  1.00 30.00  ? 172 CYS C O   1  
ATOM 1285   C CB  . CYS A 1 168 ? -70.997  12.242  25.465  1.00 99.99  ? 172 CYS C CB  1  
ATOM 1286   S SG  . CYS A 1 168 ? -70.234  13.714  26.192  1.00 99.99  ? 172 CYS C SG  1  
ATOM 1287   N N   . LEU A 1 169 ? -68.540  10.273  24.208  1.00 30.00  ? 173 LEU C N   1  
ATOM 1288   C CA  . LEU A 1 169 ? -67.226  10.341  23.641  1.00 30.00  ? 173 LEU C CA  1  
ATOM 1289   C C   . LEU A 1 169 ? -67.540  11.097  22.345  1.00 30.00  ? 173 LEU C C   1  
ATOM 1290   O O   . LEU A 1 169 ? -68.231  10.580  21.448  1.00 30.00  ? 173 LEU C O   1  
ATOM 1291   C CB  . LEU A 1 169 ? -66.684  8.934   23.419  1.00 99.99  ? 173 LEU C CB  1  
ATOM 1292   C CG  . LEU A 1 169 ? -65.837  8.519   24.618  1.00 99.99  ? 173 LEU C CG  1  
ATOM 1293   C CD1 . LEU A 1 169 ? -65.032  7.272   24.264  1.00 99.99  ? 173 LEU C CD1 1  
ATOM 1294   C CD2 . LEU A 1 169 ? -64.883  9.652   24.981  1.00 99.99  ? 173 LEU C CD2 1  
ATOM 1295   N N   . ILE A 1 170 ? -67.065  12.345  22.264  1.00 30.00  ? 174 ILE C N   1  
ATOM 1296   C CA  . ILE A 1 170 ? -67.288  13.165  21.086  1.00 30.00  ? 174 ILE C CA  1  
ATOM 1297   C C   . ILE A 1 170 ? -66.003  13.067  20.304  1.00 30.00  ? 174 ILE C C   1  
ATOM 1298   O O   . ILE A 1 170 ? -64.983  13.637  20.703  1.00 30.00  ? 174 ILE C O   1  
ATOM 1299   C CB  . ILE A 1 170 ? -67.588  14.600  21.501  1.00 99.99  ? 174 ILE C CB  1  
ATOM 1300   C CG1 . ILE A 1 170 ? -66.281  15.362  21.681  1.00 99.99  ? 174 ILE C CG1 1  
ATOM 1301   C CG2 . ILE A 1 170 ? -68.359  14.596  22.818  1.00 99.99  ? 174 ILE C CG2 1  
ATOM 1302   C CD1 . ILE A 1 170 ? -65.940  16.097  20.387  1.00 99.99  ? 174 ILE C CD1 1  
ATOM 1303   N N   . THR A 1 171 ? -66.044  12.340  19.188  1.00 30.00  ? 175 THR C N   1  
ATOM 1304   C CA  . THR A 1 171 ? -64.853  12.175  18.368  1.00 30.00  ? 175 THR C CA  1  
ATOM 1305   C C   . THR A 1 171 ? -64.937  12.832  17.002  1.00 30.00  ? 175 THR C C   1  
ATOM 1306   O O   . THR A 1 171 ? -65.997  13.281  16.556  1.00 30.00  ? 175 THR C O   1  
ATOM 1307   C CB  . THR A 1 171 ? -64.588  10.693  18.129  1.00 99.99  ? 175 THR C CB  1  
ATOM 1308   O OG1 . THR A 1 171 ? -65.619  10.154  17.298  1.00 99.99  ? 175 THR C OG1 1  
ATOM 1309   C CG2 . THR A 1 171 ? -64.578  9.957   19.464  1.00 99.99  ? 175 THR C CG2 1  
ATOM 1310   N N   . GLY A 1 172 ? -63.787  12.875  16.342  1.00 30.00  ? 176 GLY C N   1  
ATOM 1311   C CA  . GLY A 1 172 ? -63.714  13.490  15.040  1.00 30.00  ? 176 GLY C CA  1  
ATOM 1312   C C   . GLY A 1 172 ? -62.293  13.943  14.820  1.00 30.00  ? 176 GLY C C   1  
ATOM 1313   O O   . GLY A 1 172 ? -61.439  13.795  15.702  1.00 30.00  ? 176 GLY C O   1  
ATOM 1314   N N   . GLU A 1 173 ? -62.039  14.495  13.634  1.00 30.00  ? 177 GLU C N   1  
ATOM 1315   C CA  . GLU A 1 173 ? -60.713  14.980  13.260  1.00 30.00  ? 177 GLU C CA  1  
ATOM 1316   C C   . GLU A 1 173 ? -60.497  16.345  13.886  1.00 30.00  ? 177 GLU C C   1  
ATOM 1317   O O   . GLU A 1 173 ? -61.389  16.887  14.527  1.00 30.00  ? 177 GLU C O   1  
ATOM 1318   C CB  . GLU A 1 173 ? -60.609  15.091  11.744  1.00 99.99  ? 177 GLU C CB  1  
ATOM 1319   C CG  . GLU A 1 173 ? -61.701  15.996  11.228  1.00 99.99  ? 177 GLU C CG  1  
ATOM 1320   C CD  . GLU A 1 173 ? -63.025  15.233  11.194  1.00 99.99  ? 177 GLU C CD  1  
ATOM 1321   O OE1 . GLU A 1 173 ? -63.741  15.277  12.226  1.00 99.99  ? 177 GLU C OE1 1  
ATOM 1322   O OE2 . GLU A 1 173 ? -63.303  14.614  10.131  1.00 99.99  ? 177 GLU C OE2 1  
ATOM 1323   N N   . SER A 1 174 ? -59.311  16.900  13.688  1.00 30.00  ? 178 SER C N   1  
ATOM 1324   C CA  . SER A 1 174 ? -59.009  18.193  14.256  1.00 30.00  ? 178 SER C CA  1  
ATOM 1325   C C   . SER A 1 174 ? -59.639  19.321  13.460  1.00 30.00  ? 178 SER C C   1  
ATOM 1326   O O   . SER A 1 174 ? -59.354  19.490  12.284  1.00 30.00  ? 178 SER C O   1  
ATOM 1327   C CB  . SER A 1 174 ? -57.499  18.414  14.272  1.00 99.99  ? 178 SER C CB  1  
ATOM 1328   O OG  . SER A 1 174 ? -56.877  17.381  15.041  1.00 99.99  ? 178 SER C OG  1  
ATOM 1329   N N   . GLY A 1 175 ? -60.499  20.086  14.128  1.00 30.00  ? 179 GLY C N   1  
ATOM 1330   C CA  . GLY A 1 175 ? -61.166  21.201  13.478  1.00 30.00  ? 179 GLY C CA  1  
ATOM 1331   C C   . GLY A 1 175 ? -62.573  20.803  13.125  1.00 30.00  ? 179 GLY C C   1  
ATOM 1332   O O   . GLY A 1 175 ? -63.270  21.558  12.441  1.00 30.00  ? 179 GLY C O   1  
ATOM 1333   N N   . ALA A 1 176 ? -62.989  19.624  13.604  1.00 30.00  ? 180 ALA C N   1  
ATOM 1334   C CA  . ALA A 1 176 ? -64.329  19.073  13.328  1.00 30.00  ? 180 ALA C CA  1  
ATOM 1335   C C   . ALA A 1 176 ? -65.479  19.675  14.110  1.00 30.00  ? 180 ALA C C   1  
ATOM 1336   O O   . ALA A 1 176 ? -66.470  20.122  13.510  1.00 30.00  ? 180 ALA C O   1  
ATOM 1337   C CB  . ALA A 1 176 ? -64.326  17.582  13.557  1.00 30.00  ? 180 ALA C CB  1  
ATOM 1338   N N   . GLY A 1 177 ? -65.351  19.668  15.441  1.00 30.00  ? 181 GLY C N   1  
ATOM 1339   C CA  . GLY A 1 177 ? -66.395  20.211  16.285  1.00 30.00  ? 181 GLY C CA  1  
ATOM 1340   C C   . GLY A 1 177 ? -66.363  19.557  17.656  1.00 30.00  ? 181 GLY C C   1  
ATOM 1341   O O   . GLY A 1 177 ? -67.263  19.778  18.478  1.00 30.00  ? 181 GLY C O   1  
ATOM 1342   N N   . LYS A 1 178 ? -65.336  18.755  17.921  1.00 30.00  ? 182 LYS C N   1  
ATOM 1343   C CA  . LYS A 1 178 ? -65.249  18.087  19.227  1.00 30.00  ? 182 LYS C CA  1  
ATOM 1344   C C   . LYS A 1 178 ? -65.488  19.044  20.409  1.00 30.00  ? 182 LYS C C   1  
ATOM 1345   O O   . LYS A 1 178 ? -66.373  18.814  21.228  1.00 30.00  ? 182 LYS C O   1  
ATOM 1346   C CB  . LYS A 1 178 ? -63.864  17.474  19.404  1.00 99.99  ? 182 LYS C CB  1  
ATOM 1347   C CG  . LYS A 1 178 ? -63.846  16.073  18.800  1.00 99.99  ? 182 LYS C CG  1  
ATOM 1348   C CD  . LYS A 1 178 ? -62.640  15.306  19.332  1.00 99.99  ? 182 LYS C CD  1  
ATOM 1349   C CE  . LYS A 1 178 ? -61.369  15.831  18.669  1.00 99.99  ? 182 LYS C CE  1  
ATOM 1350   N NZ  . LYS A 1 178 ? -60.265  14.893  18.913  1.00 99.99  ? 182 LYS C NZ  1  
ATOM 1351   N N   . THR A 1 179 ? -64.687  20.113  20.485  1.00 30.00  ? 183 THR C N   1  
ATOM 1352   C CA  . THR A 1 179 ? -64.773  21.107  21.558  1.00 30.00  ? 183 THR C CA  1  
ATOM 1353   C C   . THR A 1 179 ? -66.086  21.884  21.587  1.00 30.00  ? 183 THR C C   1  
ATOM 1354   O O   . THR A 1 179 ? -66.770  21.902  22.615  1.00 30.00  ? 183 THR C O   1  
ATOM 1355   C CB  . THR A 1 179 ? -63.653  22.129  21.405  1.00 99.99  ? 183 THR C CB  1  
ATOM 1356   O OG1 . THR A 1 179 ? -63.883  22.916  20.233  1.00 99.99  ? 183 THR C OG1 1  
ATOM 1357   C CG2 . THR A 1 179 ? -62.318  21.408  21.277  1.00 99.99  ? 183 THR C CG2 1  
ATOM 1358   N N   . GLU A 1 180 ? -66.438  22.520  20.478  1.00 30.00  ? 184 GLU C N   1  
ATOM 1359   C CA  . GLU A 1 180 ? -67.687  23.266  20.405  1.00 30.00  ? 184 GLU C CA  1  
ATOM 1360   C C   . GLU A 1 180 ? -68.883  22.465  20.916  1.00 30.00  ? 184 GLU C C   1  
ATOM 1361   O O   . GLU A 1 180 ? -69.726  22.971  21.662  1.00 30.00  ? 184 GLU C O   1  
ATOM 1362   C CB  . GLU A 1 180 ? -67.974  23.657  18.960  1.00 99.99  ? 184 GLU C CB  1  
ATOM 1363   C CG  . GLU A 1 180 ? -66.911  24.612  18.474  1.00 99.99  ? 184 GLU C CG  1  
ATOM 1364   C CD  . GLU A 1 180 ? -67.106  25.970  19.141  1.00 99.99  ? 184 GLU C CD  1  
ATOM 1365   O OE1 . GLU A 1 180 ? -66.509  26.167  20.233  1.00 99.99  ? 184 GLU C OE1 1  
ATOM 1366   O OE2 . GLU A 1 180 ? -67.848  26.803  18.552  1.00 99.99  ? 184 GLU C OE2 1  
ATOM 1367   N N   . ASN A 1 181 ? -68.948  21.206  20.503  1.00 30.00  ? 185 ASN C N   1  
ATOM 1368   C CA  . ASN A 1 181 ? -70.028  20.322  20.897  1.00 30.00  ? 185 ASN C CA  1  
ATOM 1369   C C   . ASN A 1 181 ? -69.916  19.872  22.349  1.00 30.00  ? 185 ASN C C   1  
ATOM 1370   O O   . ASN A 1 181 ? -70.932  19.634  23.005  1.00 30.00  ? 185 ASN C O   1  
ATOM 1371   C CB  . ASN A 1 181 ? -70.022  19.072  20.024  1.00 99.99  ? 185 ASN C CB  1  
ATOM 1372   C CG  . ASN A 1 181 ? -70.276  19.420  18.564  1.00 99.99  ? 185 ASN C CG  1  
ATOM 1373   O OD1 . ASN A 1 181 ? -71.267  20.073  18.244  1.00 99.99  ? 185 ASN C OD1 1  
ATOM 1374   N ND2 . ASN A 1 181 ? -69.377  18.982  17.681  1.00 99.99  ? 185 ASN C ND2 1  
ATOM 1375   N N   . THR A 1 182 ? -68.698  19.744  22.856  1.00 30.00  ? 186 THR C N   1  
ATOM 1376   C CA  . THR A 1 182 ? -68.546  19.336  24.237  1.00 30.00  ? 186 THR C CA  1  
ATOM 1377   C C   . THR A 1 182 ? -69.100  20.467  25.096  1.00 30.00  ? 186 THR C C   1  
ATOM 1378   O O   . THR A 1 182 ? -69.827  20.249  26.064  1.00 30.00  ? 186 THR C O   1  
ATOM 1379   C CB  . THR A 1 182 ? -67.072  19.097  24.547  1.00 99.99  ? 186 THR C CB  1  
ATOM 1380   O OG1 . THR A 1 182 ? -66.370  20.342  24.509  1.00 99.99  ? 186 THR C OG1 1  
ATOM 1381   C CG2 . THR A 1 182 ? -66.483  18.150  23.508  1.00 99.99  ? 186 THR C CG2 1  
ATOM 1382   N N   . LYS A 1 183 ? -68.754  21.690  24.728  1.00 30.00  ? 187 LYS C N   1  
ATOM 1383   C CA  . LYS A 1 183 ? -69.221  22.821  25.487  1.00 30.00  ? 187 LYS C CA  1  
ATOM 1384   C C   . LYS A 1 183 ? -70.751  22.928  25.424  1.00 30.00  ? 187 LYS C C   1  
ATOM 1385   O O   . LYS A 1 183 ? -71.402  23.111  26.453  1.00 30.00  ? 187 LYS C O   1  
ATOM 1386   C CB  . LYS A 1 183 ? -68.621  24.105  24.926  1.00 99.99  ? 187 LYS C CB  1  
ATOM 1387   C CG  . LYS A 1 183 ? -69.041  25.286  25.792  1.00 99.99  ? 187 LYS C CG  1  
ATOM 1388   C CD  . LYS A 1 183 ? -68.118  26.470  25.526  1.00 99.99  ? 187 LYS C CD  1  
ATOM 1389   C CE  . LYS A 1 183 ? -68.744  27.741  26.093  1.00 99.99  ? 187 LYS C CE  1  
ATOM 1390   N NZ  . LYS A 1 183 ? -68.232  27.975  27.450  1.00 99.99  ? 187 LYS C NZ  1  
ATOM 1391   N N   . LYS A 1 184 ? -71.339  22.796  24.245  1.00 30.00  ? 188 LYS C N   1  
ATOM 1392   C CA  . LYS A 1 184 ? -72.794  22.891  24.144  1.00 30.00  ? 188 LYS C CA  1  
ATOM 1393   C C   . LYS A 1 184 ? -73.515  21.842  24.987  1.00 30.00  ? 188 LYS C C   1  
ATOM 1394   O O   . LYS A 1 184 ? -74.647  22.054  25.414  1.00 30.00  ? 188 LYS C O   1  
ATOM 1395   C CB  . LYS A 1 184 ? -73.228  22.697  22.695  1.00 99.99  ? 188 LYS C CB  1  
ATOM 1396   C CG  . LYS A 1 184 ? -74.694  23.088  22.545  1.00 99.99  ? 188 LYS C CG  1  
ATOM 1397   C CD  . LYS A 1 184 ? -75.099  22.989  21.079  1.00 99.99  ? 188 LYS C CD  1  
ATOM 1398   C CE  . LYS A 1 184 ? -76.572  23.354  20.932  1.00 99.99  ? 188 LYS C CE  1  
ATOM 1399   N NZ  . LYS A 1 184 ? -76.969  23.236  19.521  1.00 99.99  ? 188 LYS C NZ  1  
ATOM 1400   N N   . VAL A 1 185 ? -72.872  20.704  25.226  1.00 30.00  ? 189 VAL C N   1  
ATOM 1401   C CA  . VAL A 1 185 ? -73.484  19.630  26.012  1.00 30.00  ? 189 VAL C CA  1  
ATOM 1402   C C   . VAL A 1 185 ? -73.548  20.045  27.458  1.00 30.00  ? 189 VAL C C   1  
ATOM 1403   O O   . VAL A 1 185 ? -74.570  19.878  28.107  1.00 30.00  ? 189 VAL C O   1  
ATOM 1404   C CB  . VAL A 1 185 ? -72.654  18.357  25.885  1.00 99.99  ? 189 VAL C CB  1  
ATOM 1405   C CG1 . VAL A 1 185 ? -73.270  17.259  26.743  1.00 99.99  ? 189 VAL C CG1 1  
ATOM 1406   C CG2 . VAL A 1 185 ? -72.627  17.908  24.430  1.00 99.99  ? 189 VAL C CG2 1  
ATOM 1407   N N   . ILE A 1 186 ? -72.435  20.573  27.956  1.00 30.00  ? 190 ILE C N   1  
ATOM 1408   C CA  . ILE A 1 186 ? -72.339  21.047  29.325  1.00 30.00  ? 190 ILE C CA  1  
ATOM 1409   C C   . ILE A 1 186 ? -73.301  22.247  29.459  1.00 30.00  ? 190 ILE C C   1  
ATOM 1410   O O   . ILE A 1 186 ? -74.119  22.321  30.367  1.00 30.00  ? 190 ILE C O   1  
ATOM 1411   C CB  . ILE A 1 186 ? -70.908  21.471  29.629  1.00 99.99  ? 190 ILE C CB  1  
ATOM 1412   C CG1 . ILE A 1 186 ? -70.703  22.922  29.203  1.00 99.99  ? 190 ILE C CG1 1  
ATOM 1413   C CG2 . ILE A 1 186 ? -69.939  20.578  28.861  1.00 99.99  ? 190 ILE C CG2 1  
ATOM 1414   C CD1 . ILE A 1 186 ? -70.940  23.841  30.397  1.00 99.99  ? 190 ILE C CD1 1  
ATOM 1415   N N   . MET A 1 187 ? -73.199  23.196  28.539  1.00 30.00  ? 191 MET C N   1  
ATOM 1416   C CA  . MET A 1 187 ? -74.069  24.349  28.592  1.00 30.00  ? 191 MET C CA  1  
ATOM 1417   C C   . MET A 1 187 ? -75.508  23.879  28.664  1.00 30.00  ? 191 MET C C   1  
ATOM 1418   O O   . MET A 1 187 ? -76.327  24.493  29.339  1.00 30.00  ? 191 MET C O   1  
ATOM 1419   C CB  . MET A 1 187 ? -73.872  25.207  27.345  1.00 99.99  ? 191 MET C CB  1  
ATOM 1420   C CG  . MET A 1 187 ? -72.387  25.467  27.135  1.00 99.99  ? 191 MET C CG  1  
ATOM 1421   S SD  . MET A 1 187 ? -71.829  26.799  28.224  1.00 99.99  ? 191 MET C SD  1  
ATOM 1422   C CE  . MET A 1 187 ? -72.497  28.205  27.360  1.00 99.99  ? 191 MET C CE  1  
ATOM 1423   N N   . TYR A 1 188 ? -75.812  22.782  27.967  1.00 30.00  ? 192 TYR C N   1  
ATOM 1424   C CA  . TYR A 1 188 ? -77.171  22.224  27.948  1.00 30.00  ? 192 TYR C CA  1  
ATOM 1425   C C   . TYR A 1 188 ? -77.532  21.642  29.310  1.00 30.00  ? 192 TYR C C   1  
ATOM 1426   O O   . TYR A 1 188 ? -78.484  22.075  29.947  1.00 30.00  ? 192 TYR C O   1  
ATOM 1427   C CB  . TYR A 1 188 ? -77.261  21.114  26.905  1.00 99.99  ? 192 TYR C CB  1  
ATOM 1428   C CG  . TYR A 1 188 ? -77.422  19.782  27.597  1.00 99.99  ? 192 TYR C CG  1  
ATOM 1429   C CD1 . TYR A 1 188 ? -76.929  19.605  28.894  1.00 99.99  ? 192 TYR C CD1 1  
ATOM 1430   C CD2 . TYR A 1 188 ? -78.063  18.726  26.940  1.00 99.99  ? 192 TYR C CD2 1  
ATOM 1431   C CE1 . TYR A 1 188 ? -77.078  18.370  29.535  1.00 99.99  ? 192 TYR C CE1 1  
ATOM 1432   C CE2 . TYR A 1 188 ? -78.210  17.491  27.579  1.00 99.99  ? 192 TYR C CE2 1  
ATOM 1433   C CZ  . TYR A 1 188 ? -77.718  17.311  28.879  1.00 99.99  ? 192 TYR C CZ  1  
ATOM 1434   O OH  . TYR A 1 188 ? -77.863  16.111  29.502  1.00 99.99  ? 192 TYR C OH  1  
ATOM 1435   N N   . LEU A 1 189 ? -76.764  20.655  29.738  1.00 30.00  ? 193 LEU C N   1  
ATOM 1436   C CA  . LEU A 1 189 ? -76.966  20.009  31.029  1.00 30.00  ? 193 LEU C CA  1  
ATOM 1437   C C   . LEU A 1 189 ? -76.973  21.026  32.175  1.00 30.00  ? 193 LEU C C   1  
ATOM 1438   O O   . LEU A 1 189 ? -77.581  20.809  33.212  1.00 30.00  ? 193 LEU C O   1  
ATOM 1439   C CB  . LEU A 1 189 ? -75.846  19.005  31.289  1.00 99.99  ? 193 LEU C CB  1  
ATOM 1440   C CG  . LEU A 1 189 ? -75.998  18.423  32.689  1.00 99.99  ? 193 LEU C CG  1  
ATOM 1441   C CD1 . LEU A 1 189 ? -74.837  17.477  32.975  1.00 99.99  ? 193 LEU C CD1 1  
ATOM 1442   C CD2 . LEU A 1 189 ? -75.996  19.553  33.713  1.00 99.99  ? 193 LEU C CD2 1  
ATOM 1443   N N   . ALA A 1 190 ? -76.274  22.137  31.992  1.00 30.00  ? 194 ALA C N   1  
ATOM 1444   C CA  . ALA A 1 190 ? -76.213  23.167  33.020  1.00 30.00  ? 194 ALA C CA  1  
ATOM 1445   C C   . ALA A 1 190 ? -77.531  23.933  33.054  1.00 30.00  ? 194 ALA C C   1  
ATOM 1446   O O   . ALA A 1 190 ? -78.002  24.325  34.120  1.00 30.00  ? 194 ALA C O   1  
ATOM 1447   C CB  . ALA A 1 190 ? -75.059  24.129  32.729  1.00 30.00  ? 194 ALA C CB  1  
ATOM 1448   N N   . LYS A 1 191 ? -78.117  24.137  31.881  1.00 30.00  ? 195 LYS C N   1  
ATOM 1449   C CA  . LYS A 1 191 ? -79.374  24.863  31.769  1.00 30.00  ? 195 LYS C CA  1  
ATOM 1450   C C   . LYS A 1 191 ? -80.652  24.084  32.158  1.00 30.00  ? 195 LYS C C   1  
ATOM 1451   O O   . LYS A 1 191 ? -81.726  24.674  32.266  1.00 30.00  ? 195 LYS C O   1  
ATOM 1452   C CB  . LYS A 1 191 ? -79.586  25.311  30.324  1.00 99.99  ? 195 LYS C CB  1  
ATOM 1453   C CG  . LYS A 1 191 ? -80.853  26.152  30.232  1.00 99.99  ? 195 LYS C CG  1  
ATOM 1454   C CD  . LYS A 1 191 ? -80.837  26.956  28.939  1.00 99.99  ? 195 LYS C CD  1  
ATOM 1455   C CE  . LYS A 1 191 ? -82.235  27.502  28.661  1.00 99.99  ? 195 LYS C CE  1  
ATOM 1456   N NZ  . LYS A 1 191 ? -82.348  28.863  29.205  1.00 99.99  ? 195 LYS C NZ  1  
ATOM 1457   N N   . VAL A 1 192 ? -80.557  22.776  32.390  1.00 30.00  ? 196 VAL C N   1  
ATOM 1458   C CA  . VAL A 1 192 ? -81.751  22.004  32.735  1.00 30.00  ? 196 VAL C CA  1  
ATOM 1459   C C   . VAL A 1 192 ? -81.664  21.147  34.004  1.00 30.00  ? 196 VAL C C   1  
ATOM 1460   O O   . VAL A 1 192 ? -82.658  20.578  34.451  1.00 30.00  ? 196 VAL C O   1  
ATOM 1461   C CB  . VAL A 1 192 ? -82.087  21.035  31.605  1.00 99.99  ? 196 VAL C CB  1  
ATOM 1462   C CG1 . VAL A 1 192 ? -82.349  21.823  30.323  1.00 99.99  ? 196 VAL C CG1 1  
ATOM 1463   C CG2 . VAL A 1 192 ? -80.918  20.083  31.384  1.00 99.99  ? 196 VAL C CG2 1  
ATOM 1464   N N   . GLU A 1 212 ? -73.286  26.655  38.354  1.00 30.00  ? 216 GLU C N   1  
ATOM 1465   C CA  . GLU A 1 212 ? -73.538  26.569  36.929  1.00 30.00  ? 216 GLU C CA  1  
ATOM 1466   C C   . GLU A 1 212 ? -72.708  27.613  36.202  1.00 30.00  ? 216 GLU C C   1  
ATOM 1467   O O   . GLU A 1 212 ? -72.025  27.322  35.230  1.00 30.00  ? 216 GLU C O   1  
ATOM 1468   C CB  . GLU A 1 212 ? -75.015  26.816  36.646  1.00 99.99  ? 216 GLU C CB  1  
ATOM 1469   C CG  . GLU A 1 212 ? -75.417  28.159  37.203  1.00 99.99  ? 216 GLU C CG  1  
ATOM 1470   C CD  . GLU A 1 212 ? -75.613  28.045  38.715  1.00 99.99  ? 216 GLU C CD  1  
ATOM 1471   O OE1 . GLU A 1 212 ? -74.606  28.263  39.442  1.00 99.99  ? 216 GLU C OE1 1  
ATOM 1472   O OE2 . GLU A 1 212 ? -76.766  27.747  39.127  1.00 99.99  ? 216 GLU C OE2 1  
ATOM 1473   N N   . ASP A 1 213 ? -72.771  28.839  36.693  1.00 30.00  ? 217 ASP C N   1  
ATOM 1474   C CA  . ASP A 1 213 ? -72.038  29.954  36.108  1.00 30.00  ? 217 ASP C CA  1  
ATOM 1475   C C   . ASP A 1 213 ? -70.514  29.795  36.073  1.00 30.00  ? 217 ASP C C   1  
ATOM 1476   O O   . ASP A 1 213 ? -69.864  30.231  35.117  1.00 30.00  ? 217 ASP C O   1  
ATOM 1477   C CB  . ASP A 1 213 ? -72.314  31.228  36.899  1.00 99.99  ? 217 ASP C CB  1  
ATOM 1478   C CG  . ASP A 1 213 ? -72.151  30.948  38.391  1.00 99.99  ? 217 ASP C CG  1  
ATOM 1479   O OD1 . ASP A 1 213 ? -72.846  30.016  38.880  1.00 99.99  ? 217 ASP C OD1 1  
ATOM 1480   O OD2 . ASP A 1 213 ? -71.336  31.667  39.027  1.00 99.99  ? 217 ASP C OD2 1  
ATOM 1481   N N   . GLN A 1 214 ? -69.946  29.188  37.112  1.00 30.00  ? 218 GLN C N   1  
ATOM 1482   C CA  . GLN A 1 214 ? -68.503  28.984  37.202  1.00 30.00  ? 218 GLN C CA  1  
ATOM 1483   C C   . GLN A 1 214 ? -68.043  27.919  36.232  1.00 30.00  ? 218 GLN C C   1  
ATOM 1484   O O   . GLN A 1 214 ? -66.987  28.046  35.596  1.00 30.00  ? 218 GLN C O   1  
ATOM 1485   C CB  . GLN A 1 214 ? -68.131  28.544  38.615  1.00 99.99  ? 218 GLN C CB  1  
ATOM 1486   C CG  . GLN A 1 214 ? -68.902  27.282  38.977  1.00 99.99  ? 218 GLN C CG  1  
ATOM 1487   C CD  . GLN A 1 214 ? -70.341  27.607  39.355  1.00 99.99  ? 218 GLN C CD  1  
ATOM 1488   O OE1 . GLN A 1 214 ? -70.740  28.769  39.343  1.00 99.99  ? 218 GLN C OE1 1  
ATOM 1489   N NE2 . GLN A 1 214 ? -71.118  26.575  39.694  1.00 99.99  ? 218 GLN C NE2 1  
ATOM 1490   N N   . ILE A 1 215 ? -68.849  26.861  36.144  1.00 30.00  ? 219 ILE C N   1  
ATOM 1491   C CA  . ILE A 1 215 ? -68.596  25.737  35.268  1.00 30.00  ? 219 ILE C CA  1  
ATOM 1492   C C   . ILE A 1 215 ? -68.376  26.306  33.869  1.00 30.00  ? 219 ILE C C   1  
ATOM 1493   O O   . ILE A 1 215 ? -67.280  26.242  33.297  1.00 30.00  ? 219 ILE C O   1  
ATOM 1494   C CB  . ILE A 1 215 ? -69.793  24.792  35.276  1.00 99.99  ? 219 ILE C CB  1  
ATOM 1495   C CG1 . ILE A 1 215 ? -70.818  25.257  34.248  1.00 99.99  ? 219 ILE C CG1 1  
ATOM 1496   C CG2 . ILE A 1 215 ? -70.428  24.792  36.664  1.00 99.99  ? 219 ILE C CG2 1  
ATOM 1497   C CD1 . ILE A 1 215 ? -70.593  24.518  32.935  1.00 99.99  ? 219 ILE C CD1 1  
ATOM 1498   N N   . ILE A 1 216 ? -69.425  26.885  33.318  1.00 30.00  ? 220 ILE C N   1  
ATOM 1499   C CA  . ILE A 1 216 ? -69.339  27.478  32.005  1.00 30.00  ? 220 ILE C CA  1  
ATOM 1500   C C   . ILE A 1 216 ? -68.116  28.377  31.891  1.00 30.00  ? 220 ILE C C   1  
ATOM 1501   O O   . ILE A 1 216 ? -67.475  28.467  30.851  1.00 30.00  ? 220 ILE C O   1  
ATOM 1502   C CB  . ILE A 1 216 ? -70.583  28.316  31.734  1.00 99.99  ? 220 ILE C CB  1  
ATOM 1503   C CG1 . ILE A 1 216 ? -70.382  29.721  32.291  1.00 99.99  ? 220 ILE C CG1 1  
ATOM 1504   C CG2 . ILE A 1 216 ? -71.788  27.668  32.409  1.00 99.99  ? 220 ILE C CG2 1  
ATOM 1505   C CD1 . ILE A 1 216 ? -69.859  30.634  31.187  1.00 99.99  ? 220 ILE C CD1 1  
ATOM 1506   N N   . GLN A 1 217 ? -67.802  29.051  32.985  1.00 30.00  ? 221 GLN C N   1  
ATOM 1507   C CA  . GLN A 1 217 ? -66.686  29.979  33.031  1.00 30.00  ? 221 GLN C CA  1  
ATOM 1508   C C   . GLN A 1 217 ? -65.295  29.409  33.153  1.00 30.00  ? 221 GLN C C   1  
ATOM 1509   O O   . GLN A 1 217 ? -64.319  30.149  33.102  1.00 30.00  ? 221 GLN C O   1  
ATOM 1510   C CB  . GLN A 1 217 ? -66.832  30.910  34.229  1.00 99.99  ? 221 GLN C CB  1  
ATOM 1511   C CG  . GLN A 1 217 ? -68.068  31.784  34.045  1.00 99.99  ? 221 GLN C CG  1  
ATOM 1512   C CD  . GLN A 1 217 ? -67.842  32.832  32.966  1.00 99.99  ? 221 GLN C CD  1  
ATOM 1513   O OE1 . GLN A 1 217 ? -66.770  32.892  32.369  1.00 99.99  ? 221 GLN C OE1 1  
ATOM 1514   N NE2 . GLN A 1 217 ? -68.859  33.659  32.714  1.00 99.99  ? 221 GLN C NE2 1  
ATOM 1515   N N   . ALA A 1 218 ? -65.201  28.098  33.318  1.00 30.00  ? 222 ALA C N   1  
ATOM 1516   C CA  . ALA A 1 218 ? -63.893  27.475  33.434  1.00 30.00  ? 222 ALA C CA  1  
ATOM 1517   C C   . ALA A 1 218 ? -63.269  27.280  32.060  1.00 30.00  ? 222 ALA C C   1  
ATOM 1518   O O   . ALA A 1 218 ? -62.063  27.138  31.938  1.00 30.00  ? 222 ALA C O   1  
ATOM 1519   C CB  . ALA A 1 218 ? -64.021  26.132  34.131  1.00 30.00  ? 222 ALA C CB  1  
ATOM 1520   N N   . ASN A 1 219 ? -64.094  27.285  31.021  1.00 30.00  ? 223 ASN C N   1  
ATOM 1521   C CA  . ASN A 1 219 ? -63.586  27.092  29.669  1.00 30.00  ? 223 ASN C CA  1  
ATOM 1522   C C   . ASN A 1 219 ? -62.750  28.258  29.202  1.00 30.00  ? 223 ASN C C   1  
ATOM 1523   O O   . ASN A 1 219 ? -61.635  28.060  28.706  1.00 30.00  ? 223 ASN C O   1  
ATOM 1524   C CB  . ASN A 1 219 ? -64.751  26.930  28.697  1.00 99.99  ? 223 ASN C CB  1  
ATOM 1525   C CG  . ASN A 1 219 ? -65.567  25.687  29.020  1.00 99.99  ? 223 ASN C CG  1  
ATOM 1526   O OD1 . ASN A 1 219 ? -65.024  24.589  29.107  1.00 99.99  ? 223 ASN C OD1 1  
ATOM 1527   N ND2 . ASN A 1 219 ? -66.878  25.865  29.198  1.00 99.99  ? 223 ASN C ND2 1  
ATOM 1528   N N   . PRO A 1 220 ? -63.266  29.487  29.367  1.00 30.00  ? 224 PRO C N   1  
ATOM 1529   C CA  . PRO A 1 220 ? -62.504  30.659  28.929  1.00 30.00  ? 224 PRO C CA  1  
ATOM 1530   C C   . PRO A 1 220 ? -61.095  30.733  29.485  1.00 30.00  ? 224 PRO C C   1  
ATOM 1531   O O   . PRO A 1 220 ? -60.181  31.172  28.788  1.00 30.00  ? 224 PRO C O   1  
ATOM 1532   C CB  . PRO A 1 220 ? -63.381  31.712  29.513  1.00 99.99  ? 224 PRO C CB  1  
ATOM 1533   C CG  . PRO A 1 220 ? -64.542  30.985  30.148  1.00 99.99  ? 224 PRO C CG  1  
ATOM 1534   C CD  . PRO A 1 220 ? -64.490  29.719  30.012  1.00 99.99  ? 224 PRO C CD  1  
ATOM 1535   N N   . VAL A 1 221 ? -60.894  30.304  30.730  1.00 30.00  ? 225 VAL C N   1  
ATOM 1536   C CA  . VAL A 1 221 ? -59.539  30.373  31.266  1.00 30.00  ? 225 VAL C CA  1  
ATOM 1537   C C   . VAL A 1 221 ? -58.693  29.191  30.810  1.00 30.00  ? 225 VAL C C   1  
ATOM 1538   O O   . VAL A 1 221 ? -57.527  29.371  30.450  1.00 30.00  ? 225 VAL C O   1  
ATOM 1539   C CB  . VAL A 1 221 ? -59.581  30.365  32.791  1.00 99.99  ? 225 VAL C CB  1  
ATOM 1540   C CG1 . VAL A 1 221 ? -60.379  31.572  33.282  1.00 99.99  ? 225 VAL C CG1 1  
ATOM 1541   C CG2 . VAL A 1 221 ? -60.250  29.085  33.276  1.00 99.99  ? 225 VAL C CG2 1  
ATOM 1542   N N   . LEU A 1 222 ? -59.261  27.988  30.807  1.00 30.00  ? 226 LEU C N   1  
ATOM 1543   C CA  . LEU A 1 222 ? -58.501  26.811  30.376  1.00 30.00  ? 226 LEU C CA  1  
ATOM 1544   C C   . LEU A 1 222 ? -58.155  26.888  28.889  1.00 30.00  ? 226 LEU C C   1  
ATOM 1545   O O   . LEU A 1 222 ? -57.095  26.427  28.464  1.00 30.00  ? 226 LEU C O   1  
ATOM 1546   C CB  . LEU A 1 222 ? -59.323  25.549  30.615  1.00 99.99  ? 226 LEU C CB  1  
ATOM 1547   C CG  . LEU A 1 222 ? -58.949  24.945  31.964  1.00 99.99  ? 226 LEU C CG  1  
ATOM 1548   C CD1 . LEU A 1 222 ? -59.509  23.531  32.062  1.00 99.99  ? 226 LEU C CD1 1  
ATOM 1549   C CD2 . LEU A 1 222 ? -57.430  24.902  32.100  1.00 99.99  ? 226 LEU C CD2 1  
ATOM 1550   N N   . GLU A 1 223 ? -59.044  27.482  28.101  1.00 30.00  ? 227 GLU C N   1  
ATOM 1551   C CA  . GLU A 1 223 ? -58.798  27.607  26.677  1.00 30.00  ? 227 GLU C CA  1  
ATOM 1552   C C   . GLU A 1 223 ? -57.734  28.657  26.388  1.00 30.00  ? 227 GLU C C   1  
ATOM 1553   O O   . GLU A 1 223 ? -57.014  28.571  25.397  1.00 30.00  ? 227 GLU C O   1  
ATOM 1554   C CB  . GLU A 1 223 ? -60.082  28.014  25.962  1.00 99.99  ? 227 GLU C CB  1  
ATOM 1555   C CG  . GLU A 1 223 ? -61.103  26.911  26.093  1.00 99.99  ? 227 GLU C CG  1  
ATOM 1556   C CD  . GLU A 1 223 ? -60.694  25.730  25.216  1.00 99.99  ? 227 GLU C CD  1  
ATOM 1557   O OE1 . GLU A 1 223 ? -59.960  24.852  25.739  1.00 99.99  ? 227 GLU C OE1 1  
ATOM 1558   O OE2 . GLU A 1 223 ? -61.121  25.720  24.030  1.00 99.99  ? 227 GLU C OE2 1  
ATOM 1559   N N   . ALA A 1 224 ? -57.639  29.661  27.249  1.00 30.00  ? 228 ALA C N   1  
ATOM 1560   C CA  . ALA A 1 224 ? -56.661  30.716  27.049  1.00 30.00  ? 228 ALA C CA  1  
ATOM 1561   C C   . ALA A 1 224 ? -55.267  30.149  27.270  1.00 30.00  ? 228 ALA C C   1  
ATOM 1562   O O   . ALA A 1 224 ? -54.324  30.463  26.544  1.00 30.00  ? 228 ALA C O   1  
ATOM 1563   C CB  . ALA A 1 224 ? -56.935  31.852  28.019  1.00 30.00  ? 228 ALA C CB  1  
ATOM 1564   N N   . TYR A 1 225 ? -55.154  29.292  28.274  1.00 30.00  ? 229 TYR C N   1  
ATOM 1565   C CA  . TYR A 1 225 ? -53.897  28.665  28.620  1.00 30.00  ? 229 TYR C CA  1  
ATOM 1566   C C   . TYR A 1 225 ? -53.572  27.341  27.905  1.00 30.00  ? 229 TYR C C   1  
ATOM 1567   O O   . TYR A 1 225 ? -52.419  26.921  27.875  1.00 30.00  ? 229 TYR C O   1  
ATOM 1568   C CB  . TYR A 1 225 ? -53.871  28.346  30.111  1.00 99.99  ? 229 TYR C CB  1  
ATOM 1569   C CG  . TYR A 1 225 ? -53.934  29.630  30.903  1.00 99.99  ? 229 TYR C CG  1  
ATOM 1570   C CD1 . TYR A 1 225 ? -55.175  30.172  31.256  1.00 99.99  ? 229 TYR C CD1 1  
ATOM 1571   C CD2 . TYR A 1 225 ? -52.751  30.276  31.283  1.00 99.99  ? 229 TYR C CD2 1  
ATOM 1572   C CE1 . TYR A 1 225 ? -55.234  31.362  31.991  1.00 99.99  ? 229 TYR C CE1 1  
ATOM 1573   C CE2 . TYR A 1 225 ? -52.811  31.465  32.017  1.00 99.99  ? 229 TYR C CE2 1  
ATOM 1574   C CZ  . TYR A 1 225 ? -54.052  32.010  32.371  1.00 99.99  ? 229 TYR C CZ  1  
ATOM 1575   O OH  . TYR A 1 225 ? -54.109  33.167  33.085  1.00 99.99  ? 229 TYR C OH  1  
ATOM 1576   N N   . GLY A 1 226 ? -54.583  26.687  27.334  1.00 30.00  ? 230 GLY C N   1  
ATOM 1577   C CA  . GLY A 1 226 ? -54.353  25.425  26.654  1.00 30.00  ? 230 GLY C CA  1  
ATOM 1578   C C   . GLY A 1 226 ? -54.914  25.286  25.248  1.00 30.00  ? 230 GLY C C   1  
ATOM 1579   O O   . GLY A 1 226 ? -55.286  24.205  24.847  1.00 30.00  ? 230 GLY C O   1  
ATOM 1580   N N   . ASN A 1 227 ? -54.810  26.464  24.456  1.00 30.00  ? 231 ASN C N   1  
ATOM 1581   C CA  . ASN A 1 227 ? -55.312  26.448  23.092  1.00 30.00  ? 231 ASN C CA  1  
ATOM 1582   C C   . ASN A 1 227 ? -54.370  27.349  22.315  1.00 30.00  ? 231 ASN C C   1  
ATOM 1583   O O   . ASN A 1 227 ? -53.632  28.124  22.897  1.00 30.00  ? 231 ASN C O   1  
ATOM 1584   C CB  . ASN A 1 227 ? -56.743  26.973  23.057  1.00 99.99  ? 231 ASN C CB  1  
ATOM 1585   C CG  . ASN A 1 227 ? -57.719  25.938  23.597  1.00 99.99  ? 231 ASN C CG  1  
ATOM 1586   O OD1 . ASN A 1 227 ? -58.657  26.280  24.314  1.00 99.99  ? 231 ASN C OD1 1  
ATOM 1587   N ND2 . ASN A 1 227 ? -57.498  24.670  23.249  1.00 99.99  ? 231 ASN C ND2 1  
ATOM 1588   N N   . ALA A 1 228 ? -54.392  27.248  20.999  1.00 30.00  ? 232 ALA C N   1  
ATOM 1589   C CA  . ALA A 1 228 ? -53.509  28.057  20.198  1.00 30.00  ? 232 ALA C CA  1  
ATOM 1590   C C   . ALA A 1 228 ? -53.893  27.927  18.745  1.00 30.00  ? 232 ALA C C   1  
ATOM 1591   O O   . ALA A 1 228 ? -54.508  26.949  18.339  1.00 30.00  ? 232 ALA C O   1  
ATOM 1592   C CB  . ALA A 1 228 ? -52.084  27.586  20.398  1.00 30.00  ? 232 ALA C CB  1  
ATOM 1593   N N   . LYS A 1 229 ? -53.529  28.923  17.960  1.00 30.00  ? 233 LYS C N   1  
ATOM 1594   C CA  . LYS A 1 229 ? -53.824  28.884  16.554  1.00 30.00  ? 233 LYS C CA  1  
ATOM 1595   C C   . LYS A 1 229 ? -52.919  27.835  15.947  1.00 30.00  ? 233 LYS C C   1  
ATOM 1596   O O   . LYS A 1 229 ? -51.740  27.718  16.301  1.00 30.00  ? 233 LYS C O   1  
ATOM 1597   C CB  . LYS A 1 229 ? -53.558  30.252  15.931  1.00 99.99  ? 233 LYS C CB  1  
ATOM 1598   C CG  . LYS A 1 229 ? -53.969  30.232  14.462  1.00 99.99  ? 233 LYS C CG  1  
ATOM 1599   C CD  . LYS A 1 229 ? -54.129  31.663  13.960  1.00 99.99  ? 233 LYS C CD  1  
ATOM 1600   C CE  . LYS A 1 229 ? -54.170  31.662  12.434  1.00 99.99  ? 233 LYS C CE  1  
ATOM 1601   N NZ  . LYS A 1 229 ? -55.568  31.617  11.983  1.00 99.99  ? 233 LYS C NZ  1  
ATOM 1602   N N   . THR A 1 230 ? -53.261  27.213  15.122  1.00 30.00  ? 234 THR C N   1  
ATOM 1603   C CA  . THR A 1 230 ? -52.608  26.138  14.390  1.00 30.00  ? 234 THR C CA  1  
ATOM 1604   C C   . THR A 1 230 ? -53.114  26.302  12.945  1.00 30.00  ? 234 THR C C   1  
ATOM 1605   O O   . THR A 1 230 ? -54.073  27.062  12.686  1.00 30.00  ? 234 THR C O   1  
ATOM 1606   C CB  . THR A 1 230 ? -53.007  24.790  14.982  1.00 99.99  ? 234 THR C CB  1  
ATOM 1607   O OG1 . THR A 1 230 ? -54.393  24.548  14.725  1.00 99.99  ? 234 THR C OG1 1  
ATOM 1608   C CG2 . THR A 1 230 ? -52.765  24.805  16.487  1.00 99.99  ? 234 THR C CG2 1  
ATOM 1609   N N   . THR A 1 231 ? -52.481  25.629  11.998  1.00 30.00  ? 235 THR C N   1  
ATOM 1610   C CA  . THR A 1 231 ? -52.910  25.743  10.602  1.00 30.00  ? 235 THR C CA  1  
ATOM 1611   C C   . THR A 1 231 ? -54.315  25.175  10.501  1.00 30.00  ? 235 THR C C   1  
ATOM 1612   O O   . THR A 1 231 ? -55.190  25.746  9.844   1.00 30.00  ? 235 THR C O   1  
ATOM 1613   C CB  . THR A 1 231 ? -51.960  24.960  9.700   1.00 99.99  ? 235 THR C CB  1  
ATOM 1614   O OG1 . THR A 1 231 ? -52.105  23.562  9.958   1.00 99.99  ? 235 THR C OG1 1  
ATOM 1615   C CG2 . THR A 1 231 ? -50.524  25.383  9.988   1.00 99.99  ? 235 THR C CG2 1  
ATOM 1616   N N   . ARG A 1 232 ? -54.544  24.168  11.046  1.00 30.00  ? 236 ARG C N   1  
ATOM 1617   C CA  . ARG A 1 232 ? -55.804  23.448  11.061  1.00 30.00  ? 236 ARG C CA  1  
ATOM 1618   C C   . ARG A 1 232 ? -56.884  24.198  11.854  1.00 30.00  ? 236 ARG C C   1  
ATOM 1619   O O   . ARG A 1 232 ? -57.975  24.476  11.340  1.00 30.00  ? 236 ARG C O   1  
ATOM 1620   C CB  . ARG A 1 232 ? -55.613  22.077  11.699  1.00 99.99  ? 236 ARG C CB  1  
ATOM 1621   C CG  . ARG A 1 232 ? -56.617  21.093  11.110  1.00 99.99  ? 236 ARG C CG  1  
ATOM 1622   C CD  . ARG A 1 232 ? -56.238  19.672  11.518  1.00 99.99  ? 236 ARG C CD  1  
ATOM 1623   N NE  . ARG A 1 232 ? -56.918  18.675  10.663  1.00 99.99  ? 236 ARG C NE  1  
ATOM 1624   C CZ  . ARG A 1 232 ? -56.643  17.377  10.705  1.00 99.99  ? 236 ARG C CZ  1  
ATOM 1625   N NH1 . ARG A 1 232 ? -55.726  16.877  11.531  1.00 99.99  ? 236 ARG C NH1 1  
ATOM 1626   N NH2 . ARG A 1 232 ? -57.314  16.567  9.891   1.00 99.99  ? 236 ARG C NH2 1  
ATOM 1627   N N   . ASN A 1 233 ? -56.573  24.526  13.109  1.00 30.00  ? 237 ASN C N   1  
ATOM 1628   C CA  . ASN A 1 233 ? -57.520  25.235  13.979  1.00 30.00  ? 237 ASN C CA  1  
ATOM 1629   C C   . ASN A 1 233 ? -57.025  26.557  14.566  1.00 30.00  ? 237 ASN C C   1  
ATOM 1630   O O   . ASN A 1 233 ? -55.965  26.604  15.197  1.00 30.00  ? 237 ASN C O   1  
ATOM 1631   C CB  . ASN A 1 233 ? -57.884  24.356  15.171  1.00 99.99  ? 237 ASN C CB  1  
ATOM 1632   C CG  . ASN A 1 233 ? -58.844  23.248  14.762  1.00 99.99  ? 237 ASN C CG  1  
ATOM 1633   O OD1 . ASN A 1 233 ? -58.719  22.113  15.218  1.00 99.99  ? 237 ASN C OD1 1  
ATOM 1634   N ND2 . ASN A 1 233 ? -59.804  23.580  13.896  1.00 99.99  ? 237 ASN C ND2 1  
ATOM 1635   N N   . ASN A 1 234 ? -57.788  27.632  14.374  1.00 30.00  ? 238 ASN C N   1  
ATOM 1636   C CA  . ASN A 1 234 ? -57.375  28.917  14.937  1.00 30.00  ? 238 ASN C CA  1  
ATOM 1637   C C   . ASN A 1 234 ? -57.435  28.854  16.471  1.00 30.00  ? 238 ASN C C   1  
ATOM 1638   O O   . ASN A 1 234 ? -56.782  29.644  17.160  1.00 30.00  ? 238 ASN C O   1  
ATOM 1639   C CB  . ASN A 1 234 ? -58.303  30.022  14.444  1.00 99.99  ? 238 ASN C CB  1  
ATOM 1640   C CG  . ASN A 1 234 ? -57.869  31.382  14.973  1.00 99.99  ? 238 ASN C CG  1  
ATOM 1641   O OD1 . ASN A 1 234 ? -56.676  31.641  15.120  1.00 99.99  ? 238 ASN C OD1 1  
ATOM 1642   N ND2 . ASN A 1 234 ? -58.841  32.249  15.260  1.00 99.99  ? 238 ASN C ND2 1  
ATOM 1643   N N   . ASN A 1 235 ? -58.208  27.895  17.000  1.00 30.00  ? 239 ASN C N   1  
ATOM 1644   C CA  . ASN A 1 235 ? -58.344  27.695  18.436  1.00 30.00  ? 239 ASN C CA  1  
ATOM 1645   C C   . ASN A 1 235 ? -58.141  26.205  18.791  1.00 30.00  ? 239 ASN C C   1  
ATOM 1646   O O   . ASN A 1 235 ? -58.991  25.528  19.417  1.00 30.00  ? 239 ASN C O   1  
ATOM 1647   C CB  . ASN A 1 235 ? -59.733  28.130  18.890  1.00 99.99  ? 239 ASN C CB  1  
ATOM 1648   C CG  . ASN A 1 235 ? -59.852  29.646  18.928  1.00 99.99  ? 239 ASN C CG  1  
ATOM 1649   O OD1 . ASN A 1 235 ? -60.880  30.201  18.547  1.00 99.99  ? 239 ASN C OD1 1  
ATOM 1650   N ND2 . ASN A 1 235 ? -58.794  30.314  19.389  1.00 99.99  ? 239 ASN C ND2 1  
ATOM 1651   N N   . SER A 1 236 ? -56.983  25.694  18.396  1.00 30.00  ? 240 SER C N   1  
ATOM 1652   C CA  . SER A 1 236 ? -56.656  24.304  18.647  1.00 30.00  ? 240 SER C CA  1  
ATOM 1653   C C   . SER A 1 236 ? -56.429  23.950  20.122  1.00 30.00  ? 240 SER C C   1  
ATOM 1654   O O   . SER A 1 236 ? -55.614  24.550  20.789  1.00 30.00  ? 240 SER C O   1  
ATOM 1655   C CB  . SER A 1 236 ? -55.377  23.929  17.909  1.00 99.99  ? 240 SER C CB  1  
ATOM 1656   O OG  . SER A 1 236 ? -55.590  24.034  16.498  1.00 99.99  ? 240 SER C OG  1  
ATOM 1657   N N   . SER A 1 237 ? -57.152  22.957  20.621  1.00 30.00  ? 241 SER C N   1  
ATOM 1658   C CA  . SER A 1 237 ? -56.987  22.519  21.999  1.00 30.00  ? 241 SER C CA  1  
ATOM 1659   C C   . SER A 1 237 ? -55.692  21.714  22.061  1.00 30.00  ? 241 SER C C   1  
ATOM 1660   O O   . SER A 1 237 ? -55.544  20.733  21.337  1.00 30.00  ? 241 SER C O   1  
ATOM 1661   C CB  . SER A 1 237 ? -58.175  21.657  22.414  1.00 99.99  ? 241 SER C CB  1  
ATOM 1662   O OG  . SER A 1 237 ? -58.016  21.253  23.775  1.00 99.99  ? 241 SER C OG  1  
ATOM 1663   N N   . ARG A 1 238 ? -54.887  22.018  22.988  1.00 30.00  ? 242 ARG C N   1  
ATOM 1664   C CA  . ARG A 1 238 ? -53.596  21.336  23.111  1.00 30.00  ? 242 ARG C CA  1  
ATOM 1665   C C   . ARG A 1 238 ? -53.420  20.512  24.344  1.00 30.00  ? 242 ARG C C   1  
ATOM 1666   O O   . ARG A 1 238 ? -52.284  20.332  24.849  1.00 30.00  ? 242 ARG C O   1  
ATOM 1667   C CB  . ARG A 1 238 ? -52.469  22.364  23.122  1.00 99.99  ? 242 ARG C CB  1  
ATOM 1668   C CG  . ARG A 1 238 ? -52.476  23.145  21.812  1.00 99.99  ? 242 ARG C CG  1  
ATOM 1669   C CD  . ARG A 1 238 ? -51.429  24.250  21.873  1.00 99.99  ? 242 ARG C CD  1  
ATOM 1670   N NE  . ARG A 1 238 ? -51.888  25.368  22.729  1.00 99.99  ? 242 ARG C NE  1  
ATOM 1671   C CZ  . ARG A 1 238 ? -51.127  26.423  23.010  1.00 99.99  ? 242 ARG C CZ  1  
ATOM 1672   N NH1 . ARG A 1 238 ? -49.892  26.549  22.535  1.00 99.99  ? 242 ARG C NH1 1  
ATOM 1673   N NH2 . ARG A 1 238 ? -51.639  27.371  23.792  1.00 99.99  ? 242 ARG C NH2 1  
ATOM 1674   N N   . PHE A 1 239 ? -54.543  20.004  24.835  1.00 30.00  ? 243 PHE C N   1  
ATOM 1675   C CA  . PHE A 1 239 ? -54.525  19.142  26.033  1.00 30.00  ? 243 PHE C CA  1  
ATOM 1676   C C   . PHE A 1 239 ? -55.807  18.294  25.953  1.00 30.00  ? 243 PHE C C   1  
ATOM 1677   O O   . PHE A 1 239 ? -56.784  18.669  25.283  1.00 30.00  ? 243 PHE C O   1  
ATOM 1678   C CB  . PHE A 1 239 ? -54.510  20.003  27.290  1.00 99.99  ? 243 PHE C CB  1  
ATOM 1679   C CG  . PHE A 1 239 ? -55.836  20.709  27.435  1.00 99.99  ? 243 PHE C CG  1  
ATOM 1680   C CD1 . PHE A 1 239 ? -56.024  21.970  26.855  1.00 99.99  ? 243 PHE C CD1 1  
ATOM 1681   C CD2 . PHE A 1 239 ? -56.877  20.104  28.145  1.00 99.99  ? 243 PHE C CD2 1  
ATOM 1682   C CE1 . PHE A 1 239 ? -57.253  22.626  26.990  1.00 99.99  ? 243 PHE C CE1 1  
ATOM 1683   C CE2 . PHE A 1 239 ? -58.108  20.760  28.280  1.00 99.99  ? 243 PHE C CE2 1  
ATOM 1684   C CZ  . PHE A 1 239 ? -58.294  22.021  27.702  1.00 99.99  ? 243 PHE C CZ  1  
ATOM 1685   N N   . GLY A 1 240 ? -55.811  17.154  26.629  1.00 30.00  ? 244 GLY C N   1  
ATOM 1686   C CA  . GLY A 1 240 ? -56.983  16.308  26.590  1.00 30.00  ? 244 GLY C CA  1  
ATOM 1687   C C   . GLY A 1 240 ? -57.889  16.685  27.729  1.00 30.00  ? 244 GLY C C   1  
ATOM 1688   O O   . GLY A 1 240 ? -57.406  16.939  28.825  1.00 30.00  ? 244 GLY C O   1  
ATOM 1689   N N   . LYS A 1 241 ? -59.190  16.697  27.485  1.00 30.00  ? 245 LYS C N   1  
ATOM 1690   C CA  . LYS A 1 241 ? -60.142  17.076  28.515  1.00 30.00  ? 245 LYS C CA  1  
ATOM 1691   C C   . LYS A 1 241 ? -61.264  16.105  28.834  1.00 30.00  ? 245 LYS C C   1  
ATOM 1692   O O   . LYS A 1 241 ? -62.059  15.749  27.970  1.00 30.00  ? 245 LYS C O   1  
ATOM 1693   C CB  . LYS A 1 241 ? -60.839  18.374  28.125  1.00 99.99  ? 245 LYS C CB  1  
ATOM 1694   C CG  . LYS A 1 241 ? -60.011  19.562  28.597  1.00 99.99  ? 245 LYS C CG  1  
ATOM 1695   C CD  . LYS A 1 241 ? -60.875  20.820  28.595  1.00 99.99  ? 245 LYS C CD  1  
ATOM 1696   C CE  . LYS A 1 241 ? -61.095  21.282  27.160  1.00 99.99  ? 245 LYS C CE  1  
ATOM 1697   N NZ  . LYS A 1 241 ? -61.629  22.653  27.164  1.00 99.99  ? 245 LYS C NZ  1  
ATOM 1698   N N   . PHE A 1 242 ? -61.338  15.677  30.084  1.00 30.00  ? 246 PHE C N   1  
ATOM 1699   C CA  . PHE A 1 242 ? -62.401  14.785  30.499  1.00 30.00  ? 246 PHE C CA  1  
ATOM 1700   C C   . PHE A 1 242 ? -63.086  15.509  31.652  1.00 30.00  ? 246 PHE C C   1  
ATOM 1701   O O   . PHE A 1 242 ? -62.492  15.674  32.716  1.00 30.00  ? 246 PHE C O   1  
ATOM 1702   C CB  . PHE A 1 242 ? -61.814  13.447  30.939  1.00 99.99  ? 246 PHE C CB  1  
ATOM 1703   C CG  . PHE A 1 242 ? -62.927  12.524  31.366  1.00 99.99  ? 246 PHE C CG  1  
ATOM 1704   C CD1 . PHE A 1 242 ? -63.633  11.787  30.407  1.00 99.99  ? 246 PHE C CD1 1  
ATOM 1705   C CD2 . PHE A 1 242 ? -63.255  12.403  32.722  1.00 99.99  ? 246 PHE C CD2 1  
ATOM 1706   C CE1 . PHE A 1 242 ? -64.666  10.930  30.804  1.00 99.99  ? 246 PHE C CE1 1  
ATOM 1707   C CE2 . PHE A 1 242 ? -64.290  11.546  33.118  1.00 99.99  ? 246 PHE C CE2 1  
ATOM 1708   C CZ  . PHE A 1 242 ? -64.996  10.810  32.158  1.00 99.99  ? 246 PHE C CZ  1  
ATOM 1709   N N   . ILE A 1 243 ? -64.331  15.937  31.460  1.00 30.00  ? 247 ILE C N   1  
ATOM 1710   C CA  . ILE A 1 243 ? -65.044  16.632  32.521  1.00 30.00  ? 247 ILE C CA  1  
ATOM 1711   C C   . ILE A 1 243 ? -66.288  15.870  32.967  1.00 30.00  ? 247 ILE C C   1  
ATOM 1712   O O   . ILE A 1 243 ? -67.167  15.610  32.164  1.00 30.00  ? 247 ILE C O   1  
ATOM 1713   C CB  . ILE A 1 243 ? -65.484  18.009  32.036  1.00 99.99  ? 247 ILE C CB  1  
ATOM 1714   C CG1 . ILE A 1 243 ? -66.769  17.878  31.226  1.00 99.99  ? 247 ILE C CG1 1  
ATOM 1715   C CG2 . ILE A 1 243 ? -64.390  18.612  31.161  1.00 99.99  ? 247 ILE C CG2 1  
ATOM 1716   C CD1 . ILE A 1 243 ? -66.424  17.732  29.746  1.00 99.99  ? 247 ILE C CD1 1  
ATOM 1717   N N   . ARG A 1 244 ? -66.350  15.517  34.253  1.00 30.00  ? 248 ARG C N   1  
ATOM 1718   C CA  . ARG A 1 244 ? -67.496  14.803  34.816  1.00 30.00  ? 248 ARG C CA  1  
ATOM 1719   C C   . ARG A 1 244 ? -68.434  15.796  35.476  1.00 30.00  ? 248 ARG C C   1  
ATOM 1720   O O   . ARG A 1 244 ? -67.995  16.705  36.164  1.00 30.00  ? 248 ARG C O   1  
ATOM 1721   C CB  . ARG A 1 244 ? -67.017  13.793  35.855  1.00 99.99  ? 248 ARG C CB  1  
ATOM 1722   C CG  . ARG A 1 244 ? -65.982  12.867  35.227  1.00 99.99  ? 248 ARG C CG  1  
ATOM 1723   C CD  . ARG A 1 244 ? -66.649  12.001  34.166  1.00 99.99  ? 248 ARG C CD  1  
ATOM 1724   N NE  . ARG A 1 244 ? -67.745  11.193  34.753  1.00 99.99  ? 248 ARG C NE  1  
ATOM 1725   C CZ  . ARG A 1 244 ? -68.280  10.143  34.137  1.00 99.99  ? 248 ARG C CZ  1  
ATOM 1726   N NH1 . ARG A 1 244 ? -67.865  9.743   32.937  1.00 99.99  ? 248 ARG C NH1 1  
ATOM 1727   N NH2 . ARG A 1 244 ? -69.258  9.488   34.754  1.00 99.99  ? 248 ARG C NH2 1  
ATOM 1728   N N   . ILE A 1 245 ? -69.732  15.618  35.266  1.00 30.00  ? 249 ILE C N   1  
ATOM 1729   C CA  . ILE A 1 245 ? -70.738  16.498  35.848  1.00 30.00  ? 249 ILE C CA  1  
ATOM 1730   C C   . ILE A 1 245 ? -71.648  15.701  36.775  1.00 30.00  ? 249 ILE C C   1  
ATOM 1731   O O   . ILE A 1 245 ? -72.507  14.961  36.316  1.00 30.00  ? 249 ILE C O   1  
ATOM 1732   C CB  . ILE A 1 245 ? -71.576  17.129  34.744  1.00 99.99  ? 249 ILE C CB  1  
ATOM 1733   C CG1 . ILE A 1 245 ? -72.727  16.197  34.380  1.00 99.99  ? 249 ILE C CG1 1  
ATOM 1734   C CG2 . ILE A 1 245 ? -70.704  17.365  33.513  1.00 99.99  ? 249 ILE C CG2 1  
ATOM 1735   C CD1 . ILE A 1 245 ? -73.968  16.588  35.172  1.00 99.99  ? 249 ILE C CD1 1  
ATOM 1736   N N   . HIS A 1 246 ? -71.453  15.862  38.081  1.00 30.00  ? 250 HIS C N   1  
ATOM 1737   C CA  . HIS A 1 246 ? -72.240  15.160  39.088  1.00 30.00  ? 250 HIS C CA  1  
ATOM 1738   C C   . HIS A 1 246 ? -73.676  15.653  39.305  1.00 30.00  ? 250 HIS C C   1  
ATOM 1739   O O   . HIS A 1 246 ? -73.985  16.840  39.130  1.00 30.00  ? 250 HIS C O   1  
ATOM 1740   C CB  . HIS A 1 246 ? -71.559  15.270  40.448  1.00 99.99  ? 250 HIS C CB  1  
ATOM 1741   C CG  . HIS A 1 246 ? -70.133  14.778  40.490  1.00 99.99  ? 250 HIS C CG  1  
ATOM 1742   N ND1 . HIS A 1 246 ? -69.818  13.458  40.790  1.00 99.99  ? 250 HIS C ND1 1  
ATOM 1743   C CD2 . HIS A 1 246 ? -68.952  15.419  40.273  1.00 99.99  ? 250 HIS C CD2 1  
ATOM 1744   C CE1 . HIS A 1 246 ? -68.505  13.334  40.750  1.00 99.99  ? 250 HIS C CE1 1  
ATOM 1745   N NE2 . HIS A 1 246 ? -67.972  14.488  40.443  1.00 99.99  ? 250 HIS C NE2 1  
ATOM 1746   N N   . PHE A 1 247 ? -74.549  14.720  39.684  1.00 30.00  ? 251 PHE C N   1  
ATOM 1747   C CA  . PHE A 1 247 ? -75.962  15.013  39.917  1.00 30.00  ? 251 PHE C CA  1  
ATOM 1748   C C   . PHE A 1 247 ? -76.463  14.524  41.277  1.00 30.00  ? 251 PHE C C   1  
ATOM 1749   O O   . PHE A 1 247 ? -76.053  13.460  41.753  1.00 30.00  ? 251 PHE C O   1  
ATOM 1750   C CB  . PHE A 1 247 ? -76.816  14.340  38.847  1.00 99.99  ? 251 PHE C CB  1  
ATOM 1751   C CG  . PHE A 1 247 ? -76.662  15.080  37.540  1.00 99.99  ? 251 PHE C CG  1  
ATOM 1752   C CD1 . PHE A 1 247 ? -77.338  16.287  37.335  1.00 99.99  ? 251 PHE C CD1 1  
ATOM 1753   C CD2 . PHE A 1 247 ? -75.842  14.556  36.532  1.00 99.99  ? 251 PHE C CD2 1  
ATOM 1754   C CE1 . PHE A 1 247 ? -77.196  16.971  36.122  1.00 99.99  ? 251 PHE C CE1 1  
ATOM 1755   C CE2 . PHE A 1 247 ? -75.699  15.242  35.319  1.00 99.99  ? 251 PHE C CE2 1  
ATOM 1756   C CZ  . PHE A 1 247 ? -76.377  16.448  35.116  1.00 99.99  ? 251 PHE C CZ  1  
ATOM 1757   N N   . GLY A 1 248 ? -77.362  15.310  41.885  1.00 30.00  ? 252 GLY C N   1  
ATOM 1758   C CA  . GLY A 1 248 ? -77.916  14.958  43.184  1.00 30.00  ? 252 GLY C CA  1  
ATOM 1759   C C   . GLY A 1 248 ? -79.223  14.170  43.176  1.00 30.00  ? 252 GLY C C   1  
ATOM 1760   O O   . GLY A 1 248 ? -79.749  13.857  42.104  1.00 30.00  ? 252 GLY C O   1  
ATOM 1761   N N   . PRO A 1 249 ? -79.770  13.831  44.370  1.00 30.00  ? 253 PRO C N   1  
ATOM 1762   C CA  . PRO A 1 249 ? -81.013  13.081  44.606  1.00 30.00  ? 253 PRO C CA  1  
ATOM 1763   C C   . PRO A 1 249 ? -82.313  13.644  44.032  1.00 30.00  ? 253 PRO C C   1  
ATOM 1764   O O   . PRO A 1 249 ? -83.368  13.025  44.146  1.00 30.00  ? 253 PRO C O   1  
ATOM 1765   C CB  . PRO A 1 249 ? -81.028  13.154  46.093  1.00 99.99  ? 253 PRO C CB  1  
ATOM 1766   C CG  . PRO A 1 249 ? -79.768  13.884  46.489  1.00 99.99  ? 253 PRO C CG  1  
ATOM 1767   C CD  . PRO A 1 249 ? -79.037  14.221  45.498  1.00 99.99  ? 253 PRO C CD  1  
ATOM 1768   N N   . THR A 1 250 ? -82.242  14.816  43.417  1.00 30.00  ? 254 THR C N   1  
ATOM 1769   C CA  . THR A 1 250 ? -83.423  15.425  42.811  1.00 30.00  ? 254 THR C CA  1  
ATOM 1770   C C   . THR A 1 250 ? -83.105  15.575  41.325  1.00 30.00  ? 254 THR C C   1  
ATOM 1771   O O   . THR A 1 250 ? -83.835  16.249  40.589  1.00 30.00  ? 254 THR C O   1  
ATOM 1772   C CB  . THR A 1 250 ? -83.692  16.782  43.453  1.00 99.99  ? 254 THR C CB  1  
ATOM 1773   O OG1 . THR A 1 250 ? -82.650  17.693  43.096  1.00 99.99  ? 254 THR C OG1 1  
ATOM 1774   C CG2 . THR A 1 250 ? -83.734  16.628  44.968  1.00 99.99  ? 254 THR C CG2 1  
ATOM 1775   N N   . GLY A 1 251 ? -82.002  14.944  40.903  1.00 30.00  ? 255 GLY C N   1  
ATOM 1776   C CA  . GLY A 1 251 ? -81.556  14.986  39.514  1.00 30.00  ? 255 GLY C CA  1  
ATOM 1777   C C   . GLY A 1 251 ? -81.039  16.342  39.045  1.00 30.00  ? 255 GLY C C   1  
ATOM 1778   O O   . GLY A 1 251 ? -81.215  16.705  37.874  1.00 30.00  ? 255 GLY C O   1  
ATOM 1779   N N   . LYS A 1 252 ? -80.401  17.092  39.942  1.00 30.00  ? 256 LYS C N   1  
ATOM 1780   C CA  . LYS A 1 252 ? -79.873  18.411  39.595  1.00 30.00  ? 256 LYS C CA  1  
ATOM 1781   C C   . LYS A 1 252 ? -78.357  18.463  39.767  1.00 30.00  ? 256 LYS C C   1  
ATOM 1782   O O   . LYS A 1 252 ? -77.791  17.682  40.543  1.00 30.00  ? 256 LYS C O   1  
ATOM 1783   C CB  . LYS A 1 252 ? -80.500  19.472  40.492  1.00 99.99  ? 256 LYS C CB  1  
ATOM 1784   C CG  . LYS A 1 252 ? -80.021  20.852  40.057  1.00 99.99  ? 256 LYS C CG  1  
ATOM 1785   C CD  . LYS A 1 252 ? -80.953  21.917  40.626  1.00 99.99  ? 256 LYS C CD  1  
ATOM 1786   C CE  . LYS A 1 252 ? -80.286  23.286  40.518  1.00 99.99  ? 256 LYS C CE  1  
ATOM 1787   N NZ  . LYS A 1 252 ? -80.715  23.941  39.272  1.00 99.99  ? 256 LYS C NZ  1  
ATOM 1788   N N   . ILE A 1 253 ? -77.698  19.375  39.052  1.00 30.00  ? 257 ILE C N   1  
ATOM 1789   C CA  . ILE A 1 253 ? -76.244  19.480  39.139  1.00 30.00  ? 257 ILE C CA  1  
ATOM 1790   C C   . ILE A 1 253 ? -75.779  19.808  40.557  1.00 30.00  ? 257 ILE C C   1  
ATOM 1791   O O   . ILE A 1 253 ? -76.133  20.833  41.128  1.00 30.00  ? 257 ILE C O   1  
ATOM 1792   C CB  . ILE A 1 253 ? -75.750  20.586  38.212  1.00 99.99  ? 257 ILE C CB  1  
ATOM 1793   C CG1 . ILE A 1 253 ? -75.911  21.936  38.899  1.00 99.99  ? 257 ILE C CG1 1  
ATOM 1794   C CG2 . ILE A 1 253 ? -76.563  20.570  36.923  1.00 99.99  ? 257 ILE C CG2 1  
ATOM 1795   C CD1 . ILE A 1 253 ? -77.255  22.545  38.512  1.00 99.99  ? 257 ILE C CD1 1  
ATOM 1796   N N   . ALA A 1 254 ? -74.975  18.903  41.106  1.00 30.00  ? 258 ALA C N   1  
ATOM 1797   C CA  . ALA A 1 254 ? -74.438  19.017  42.457  1.00 30.00  ? 258 ALA C CA  1  
ATOM 1798   C C   . ALA A 1 254 ? -72.909  18.954  42.544  1.00 30.00  ? 258 ALA C C   1  
ATOM 1799   O O   . ALA A 1 254 ? -72.370  18.439  43.536  1.00 30.00  ? 258 ALA C O   1  
ATOM 1800   C CB  . ALA A 1 254 ? -75.023  17.901  43.301  1.00 30.00  ? 258 ALA C CB  1  
ATOM 1801   N N   . GLY A 1 255 ? -72.219  19.467  41.527  1.00 30.00  ? 259 GLY C N   1  
ATOM 1802   C CA  . GLY A 1 255 ? -70.760  19.435  41.532  1.00 30.00  ? 259 GLY C CA  1  
ATOM 1803   C C   . GLY A 1 255 ? -70.181  19.110  40.167  1.00 30.00  ? 259 GLY C C   1  
ATOM 1804   O O   . GLY A 1 255 ? -70.936  18.882  39.219  1.00 30.00  ? 259 GLY C O   1  
ATOM 1805   N N   . ALA A 1 256 ? -68.849  19.075  40.061  1.00 30.00  ? 260 ALA C N   1  
ATOM 1806   C CA  . ALA A 1 256 ? -68.180  18.784  38.789  1.00 30.00  ? 260 ALA C CA  1  
ATOM 1807   C C   . ALA A 1 256 ? -66.656  18.850  38.870  1.00 30.00  ? 260 ALA C C   1  
ATOM 1808   O O   . ALA A 1 256 ? -66.106  19.667  39.594  1.00 30.00  ? 260 ALA C O   1  
ATOM 1809   C CB  . ALA A 1 256 ? -68.657  19.758  37.729  1.00 30.00  ? 260 ALA C CB  1  
ATOM 1810   N N   . ASP A 1 257 ? -65.970  17.991  38.126  1.00 30.00  ? 261 ASP C N   1  
ATOM 1811   C CA  . ASP A 1 257 ? -64.508  17.997  38.128  1.00 30.00  ? 261 ASP C CA  1  
ATOM 1812   C C   . ASP A 1 257 ? -63.940  17.888  36.721  1.00 30.00  ? 261 ASP C C   1  
ATOM 1813   O O   . ASP A 1 257 ? -64.598  17.409  35.789  1.00 30.00  ? 261 ASP C O   1  
ATOM 1814   C CB  . ASP A 1 257 ? -63.985  16.820  38.944  1.00 99.99  ? 261 ASP C CB  1  
ATOM 1815   C CG  . ASP A 1 257 ? -62.480  16.969  39.151  1.00 99.99  ? 261 ASP C CG  1  
ATOM 1816   O OD1 . ASP A 1 257 ? -61.729  16.631  38.195  1.00 99.99  ? 261 ASP C OD1 1  
ATOM 1817   O OD2 . ASP A 1 257 ? -62.092  17.424  40.262  1.00 99.99  ? 261 ASP C OD2 1  
ATOM 1818   N N   . ILE A 1 258 ? -62.702  18.330  36.580  1.00 30.00  ? 262 ILE C N   1  
ATOM 1819   C CA  . ILE A 1 258 ? -62.025  18.322  35.302  1.00 30.00  ? 262 ILE C CA  1  
ATOM 1820   C C   . ILE A 1 258 ? -60.704  17.592  35.370  1.00 30.00  ? 262 ILE C C   1  
ATOM 1821   O O   . ILE A 1 258 ? -59.999  17.654  36.375  1.00 30.00  ? 262 ILE C O   1  
ATOM 1822   C CB  . ILE A 1 258 ? -61.755  19.750  34.850  1.00 99.99  ? 262 ILE C CB  1  
ATOM 1823   C CG1 . ILE A 1 258 ? -60.497  20.274  35.535  1.00 99.99  ? 262 ILE C CG1 1  
ATOM 1824   C CG2 . ILE A 1 258 ? -62.941  20.636  35.220  1.00 99.99  ? 262 ILE C CG2 1  
ATOM 1825   C CD1 . ILE A 1 258 ? -60.885  21.009  36.815  1.00 99.99  ? 262 ILE C CD1 1  
ATOM 1826   N N   . GLU A 1 259 ? -60.386  16.890  34.288  1.00 30.00  ? 263 GLU C N   1  
ATOM 1827   C CA  . GLU A 1 259 ? -59.140  16.141  34.164  1.00 30.00  ? 263 GLU C CA  1  
ATOM 1828   C C   . GLU A 1 259 ? -58.594  16.582  32.818  1.00 30.00  ? 263 GLU C C   1  
ATOM 1829   O O   . GLU A 1 259 ? -59.357  16.791  31.863  1.00 30.00  ? 263 GLU C O   1  
ATOM 1830   C CB  . GLU A 1 259 ? -59.427  14.643  34.207  1.00 99.99  ? 263 GLU C CB  1  
ATOM 1831   C CG  . GLU A 1 259 ? -60.021  14.281  35.545  1.00 99.99  ? 263 GLU C CG  1  
ATOM 1832   C CD  . GLU A 1 259 ? -58.943  14.375  36.624  1.00 99.99  ? 263 GLU C CD  1  
ATOM 1833   O OE1 . GLU A 1 259 ? -58.804  15.487  37.200  1.00 99.99  ? 263 GLU C OE1 1  
ATOM 1834   O OE2 . GLU A 1 259 ? -58.271  13.337  36.859  1.00 99.99  ? 263 GLU C OE2 1  
ATOM 1835   N N   . THR A 1 260 ? -57.282  16.755  32.752  1.00 30.00  ? 264 THR C N   1  
ATOM 1836   C CA  . THR A 1 260 ? -56.648  17.179  31.521  1.00 30.00  ? 264 THR C CA  1  
ATOM 1837   C C   . THR A 1 260 ? -55.519  16.219  31.217  1.00 30.00  ? 264 THR C C   1  
ATOM 1838   O O   . THR A 1 260 ? -54.964  15.574  32.115  1.00 30.00  ? 264 THR C O   1  
ATOM 1839   C CB  . THR A 1 260 ? -56.101  18.593  31.680  1.00 99.99  ? 264 THR C CB  1  
ATOM 1840   O OG1 . THR A 1 260 ? -55.010  18.581  32.607  1.00 99.99  ? 264 THR C OG1 1  
ATOM 1841   C CG2 . THR A 1 260 ? -57.201  19.506  32.207  1.00 99.99  ? 264 THR C CG2 1  
ATOM 1842   N N   . TYR A 1 261 ? -55.175  16.131  29.933  1.00 30.00  ? 265 TYR C N   1  
ATOM 1843   C CA  . TYR A 1 261 ? -54.130  15.234  29.501  1.00 30.00  ? 265 TYR C CA  1  
ATOM 1844   C C   . TYR A 1 261 ? -53.181  15.793  28.447  1.00 30.00  ? 265 TYR C C   1  
ATOM 1845   O O   . TYR A 1 261 ? -53.607  16.461  27.495  1.00 30.00  ? 265 TYR C O   1  
ATOM 1846   C CB  . TYR A 1 261 ? -54.744  13.976  28.895  1.00 99.99  ? 265 TYR C CB  1  
ATOM 1847   C CG  . TYR A 1 261 ? -53.646  13.043  28.447  1.00 99.99  ? 265 TYR C CG  1  
ATOM 1848   C CD1 . TYR A 1 261 ? -53.036  12.185  29.371  1.00 99.99  ? 265 TYR C CD1 1  
ATOM 1849   C CD2 . TYR A 1 261 ? -53.235  13.035  27.108  1.00 99.99  ? 265 TYR C CD2 1  
ATOM 1850   C CE1 . TYR A 1 261 ? -52.017  11.320  28.954  1.00 99.99  ? 265 TYR C CE1 1  
ATOM 1851   C CE2 . TYR A 1 261 ? -52.216  12.172  26.694  1.00 99.99  ? 265 TYR C CE2 1  
ATOM 1852   C CZ  . TYR A 1 261 ? -51.608  11.313  27.617  1.00 99.99  ? 265 TYR C CZ  1  
ATOM 1853   O OH  . TYR A 1 261 ? -50.615  10.472  27.213  1.00 99.99  ? 265 TYR C OH  1  
ATOM 1854   N N   . LEU A 1 262 ? -51.895  15.504  28.641  1.00 30.00  ? 266 LEU C N   1  
ATOM 1855   C CA  . LEU A 1 262 ? -50.823  15.897  27.731  1.00 30.00  ? 266 LEU C CA  1  
ATOM 1856   C C   . LEU A 1 262 ? -50.875  17.268  27.085  1.00 30.00  ? 266 LEU C C   1  
ATOM 1857   O O   . LEU A 1 262 ? -51.211  17.392  25.895  1.00 30.00  ? 266 LEU C O   1  
ATOM 1858   C CB  . LEU A 1 262 ? -50.760  14.929  26.553  1.00 99.99  ? 266 LEU C CB  1  
ATOM 1859   C CG  . LEU A 1 262 ? -49.730  13.843  26.841  1.00 99.99  ? 266 LEU C CG  1  
ATOM 1860   C CD1 . LEU A 1 262 ? -49.426  13.076  25.558  1.00 99.99  ? 266 LEU C CD1 1  
ATOM 1861   C CD2 . LEU A 1 262 ? -48.450  14.484  27.369  1.00 99.99  ? 266 LEU C CD2 1  
ATOM 1862   N N   . LEU A 1 263 ? -50.538  18.296  27.850  1.00 30.00  ? 267 LEU C N   1  
ATOM 1863   C CA  . LEU A 1 263 ? -50.544  19.652  27.316  1.00 30.00  ? 267 LEU C CA  1  
ATOM 1864   C C   . LEU A 1 263 ? -49.255  19.835  26.506  1.00 30.00  ? 267 LEU C C   1  
ATOM 1865   O O   . LEU A 1 263 ? -48.178  19.391  26.923  1.00 30.00  ? 267 LEU C O   1  
ATOM 1866   C CB  . LEU A 1 263 ? -50.599  20.660  28.458  1.00 99.99  ? 267 LEU C CB  1  
ATOM 1867   C CG  . LEU A 1 263 ? -52.047  21.058  28.719  1.00 99.99  ? 267 LEU C CG  1  
ATOM 1868   C CD1 . LEU A 1 263 ? -52.083  22.290  29.617  1.00 99.99  ? 267 LEU C CD1 1  
ATOM 1869   C CD2 . LEU A 1 263 ? -52.734  21.375  27.395  1.00 99.99  ? 267 LEU C CD2 1  
ATOM 1870   N N   . GLU A 1 264 ? -49.362  20.488  25.356  1.00 30.00  ? 268 GLU C N   1  
ATOM 1871   C CA  . GLU A 1 264 ? -48.193  20.697  24.519  1.00 30.00  ? 268 GLU C CA  1  
ATOM 1872   C C   . GLU A 1 264 ? -47.113  21.637  25.080  1.00 30.00  ? 268 GLU C C   1  
ATOM 1873   O O   . GLU A 1 264 ? -47.025  22.807  24.684  1.00 30.00  ? 268 GLU C O   1  
ATOM 1874   C CB  . GLU A 1 264 ? -48.614  21.300  23.183  1.00 99.99  ? 268 GLU C CB  1  
ATOM 1875   C CG  . GLU A 1 264 ? -47.767  22.513  22.887  1.00 99.99  ? 268 GLU C CG  1  
ATOM 1876   C CD  . GLU A 1 264 ? -48.163  23.651  23.829  1.00 99.99  ? 268 GLU C CD  1  
ATOM 1877   O OE1 . GLU A 1 264 ? -47.549  23.728  24.926  1.00 99.99  ? 268 GLU C OE1 1  
ATOM 1878   O OE2 . GLU A 1 264 ? -49.074  24.430  23.438  1.00 99.99  ? 268 GLU C OE2 1  
ATOM 1879   N N   . LYS A 1 265 ? -46.428  20.904  26.001  1.00 30.00  ? 269 LYS C N   1  
ATOM 1880   C CA  . LYS A 1 265 ? -45.325  21.675  26.581  1.00 30.00  ? 269 LYS C CA  1  
ATOM 1881   C C   . LYS A 1 265 ? -44.499  22.408  25.528  1.00 30.00  ? 269 LYS C C   1  
ATOM 1882   O O   . LYS A 1 265 ? -44.043  23.523  25.745  1.00 30.00  ? 269 LYS C O   1  
ATOM 1883   C CB  . LYS A 1 265 ? -44.386  20.740  27.336  1.00 99.99  ? 269 LYS C CB  1  
ATOM 1884   C CG  . LYS A 1 265 ? -45.157  20.022  28.438  1.00 99.99  ? 269 LYS C CG  1  
ATOM 1885   C CD  . LYS A 1 265 ? -44.197  19.164  29.255  1.00 99.99  ? 269 LYS C CD  1  
ATOM 1886   C CE  . LYS A 1 265 ? -44.966  18.466  30.372  1.00 99.99  ? 269 LYS C CE  1  
ATOM 1887   N NZ  . LYS A 1 265 ? -44.028  18.043  31.423  1.00 99.99  ? 269 LYS C NZ  1  
ATOM 1888   N N   . SER A 1 266 ? -44.305  21.784  24.379  1.00 30.00  ? 270 SER C N   1  
ATOM 1889   C CA  . SER A 1 266 ? -43.501  22.379  23.310  1.00 30.00  ? 270 SER C CA  1  
ATOM 1890   C C   . SER A 1 266 ? -43.921  23.685  22.656  1.00 30.00  ? 270 SER C C   1  
ATOM 1891   O O   . SER A 1 266 ? -43.063  24.423  22.167  1.00 30.00  ? 270 SER C O   1  
ATOM 1892   C CB  . SER A 1 266 ? -43.403  21.414  22.136  1.00 99.99  ? 270 SER C CB  1  
ATOM 1893   O OG  . SER A 1 266 ? -44.685  21.276  21.520  1.00 99.99  ? 270 SER C OG  1  
ATOM 1894   N N   . ARG A 1 267 ? -45.216  23.980  22.620  1.00 30.00  ? 271 ARG C N   1  
ATOM 1895   C CA  . ARG A 1 267 ? -45.666  25.217  21.970  1.00 30.00  ? 271 ARG C CA  1  
ATOM 1896   C C   . ARG A 1 267 ? -45.189  26.483  22.670  1.00 30.00  ? 271 ARG C C   1  
ATOM 1897   O O   . ARG A 1 267 ? -45.054  27.538  22.043  1.00 30.00  ? 271 ARG C O   1  
ATOM 1898   C CB  . ARG A 1 267 ? -47.189  25.264  21.941  1.00 99.99  ? 271 ARG C CB  1  
ATOM 1899   C CG  . ARG A 1 267 ? -47.654  26.068  20.733  1.00 99.99  ? 271 ARG C CG  1  
ATOM 1900   C CD  . ARG A 1 267 ? -48.886  25.407  20.125  1.00 99.99  ? 271 ARG C CD  1  
ATOM 1901   N NE  . ARG A 1 267 ? -49.096  25.860  18.732  1.00 99.99  ? 271 ARG C NE  1  
ATOM 1902   C CZ  . ARG A 1 267 ? -49.954  25.274  17.902  1.00 99.99  ? 271 ARG C CZ  1  
ATOM 1903   N NH1 . ARG A 1 267 ? -50.689  24.227  18.269  1.00 99.99  ? 271 ARG C NH1 1  
ATOM 1904   N NH2 . ARG A 1 267 ? -50.066  25.762  16.670  1.00 99.99  ? 271 ARG C NH2 1  
ATOM 1905   N N   . VAL A 1 268 ? -44.947  26.368  23.972  1.00 30.00  ? 272 VAL C N   1  
ATOM 1906   C CA  . VAL A 1 268 ? -44.490  27.470  24.809  1.00 30.00  ? 272 VAL C CA  1  
ATOM 1907   C C   . VAL A 1 268 ? -43.326  28.272  24.211  1.00 30.00  ? 272 VAL C C   1  
ATOM 1908   O O   . VAL A 1 268 ? -43.405  29.496  24.069  1.00 30.00  ? 272 VAL C O   1  
ATOM 1909   C CB  . VAL A 1 268 ? -44.015  26.937  26.154  1.00 99.99  ? 272 VAL C CB  1  
ATOM 1910   C CG1 . VAL A 1 268 ? -45.167  26.220  26.854  1.00 99.99  ? 272 VAL C CG1 1  
ATOM 1911   C CG2 . VAL A 1 268 ? -42.864  25.961  25.941  1.00 99.99  ? 272 VAL C CG2 1  
ATOM 1912   N N   . THR A 1 269 ? -42.252  27.567  23.854  1.00 30.00  ? 273 THR C N   1  
ATOM 1913   C CA  . THR A 1 269 ? -41.059  28.192  23.271  1.00 30.00  ? 273 THR C CA  1  
ATOM 1914   C C   . THR A 1 269 ? -40.951  28.088  21.746  1.00 30.00  ? 273 THR C C   1  
ATOM 1915   O O   . THR A 1 269 ? -40.230  28.862  21.120  1.00 30.00  ? 273 THR C O   1  
ATOM 1916   C CB  . THR A 1 269 ? -39.802  27.543  23.842  1.00 99.99  ? 273 THR C CB  1  
ATOM 1917   O OG1 . THR A 1 269 ? -39.709  26.196  23.372  1.00 99.99  ? 273 THR C OG1 1  
ATOM 1918   C CG2 . THR A 1 269 ? -39.874  27.546  25.363  1.00 99.99  ? 273 THR C CG2 1  
ATOM 1919   N N   . TYR A 1 270 ? -41.664  27.133  21.153  1.00 30.00  ? 274 TYR C N   1  
ATOM 1920   C CA  . TYR A 1 270 ? -41.619  26.944  19.701  1.00 30.00  ? 274 TYR C CA  1  
ATOM 1921   C C   . TYR A 1 270 ? -42.976  26.900  19.027  1.00 30.00  ? 274 TYR C C   1  
ATOM 1922   O O   . TYR A 1 270 ? -43.944  26.393  19.598  1.00 30.00  ? 274 TYR C O   1  
ATOM 1923   C CB  . TYR A 1 270 ? -40.925  25.627  19.370  1.00 99.99  ? 274 TYR C CB  1  
ATOM 1924   C CG  . TYR A 1 270 ? -40.882  25.440  17.873  1.00 99.99  ? 274 TYR C CG  1  
ATOM 1925   C CD1 . TYR A 1 270 ? -39.872  26.053  17.121  1.00 99.99  ? 274 TYR C CD1 1  
ATOM 1926   C CD2 . TYR A 1 270 ? -41.853  24.658  17.236  1.00 99.99  ? 274 TYR C CD2 1  
ATOM 1927   C CE1 . TYR A 1 270 ? -39.831  25.881  15.732  1.00 99.99  ? 274 TYR C CE1 1  
ATOM 1928   C CE2 . TYR A 1 270 ? -41.812  24.486  15.847  1.00 99.99  ? 274 TYR C CE2 1  
ATOM 1929   C CZ  . TYR A 1 270 ? -40.802  25.097  15.095  1.00 99.99  ? 274 TYR C CZ  1  
ATOM 1930   O OH  . TYR A 1 270 ? -40.765  24.929  13.746  1.00 99.99  ? 274 TYR C OH  1  
ATOM 1931   N N   . GLN A 1 271 ? -43.037  27.428  17.807  1.00 30.00  ? 275 GLN C N   1  
ATOM 1932   C CA  . GLN A 1 271 ? -44.281  27.420  17.053  1.00 30.00  ? 275 GLN C CA  1  
ATOM 1933   C C   . GLN A 1 271 ? -44.043  27.438  15.551  1.00 30.00  ? 275 GLN C C   1  
ATOM 1934   O O   . GLN A 1 271 ? -43.617  28.452  15.005  1.00 30.00  ? 275 GLN C O   1  
ATOM 1935   C CB  . GLN A 1 271 ? -45.116  28.645  17.410  1.00 99.99  ? 275 GLN C CB  1  
ATOM 1936   C CG  . GLN A 1 271 ? -45.536  28.565  18.875  1.00 99.99  ? 275 GLN C CG  1  
ATOM 1937   C CD  . GLN A 1 271 ? -46.597  27.495  19.083  1.00 99.99  ? 275 GLN C CD  1  
ATOM 1938   O OE1 . GLN A 1 271 ? -47.005  26.830  18.133  1.00 99.99  ? 275 GLN C OE1 1  
ATOM 1939   N NE2 . GLN A 1 271 ? -47.046  27.333  20.330  1.00 99.99  ? 275 GLN C NE2 1  
ATOM 1940   N N   . GLN A 1 272 ? -44.324  26.311  14.895  1.00 30.00  ? 276 GLN C N   1  
ATOM 1941   C CA  . GLN A 1 272 ? -44.161  26.169  13.443  1.00 30.00  ? 276 GLN C CA  1  
ATOM 1942   C C   . GLN A 1 272 ? -44.808  27.351  12.728  1.00 30.00  ? 276 GLN C C   1  
ATOM 1943   O O   . GLN A 1 272 ? -45.713  27.983  13.263  1.00 30.00  ? 276 GLN C O   1  
ATOM 1944   C CB  . GLN A 1 272 ? -44.822  24.879  12.971  1.00 99.99  ? 276 GLN C CB  1  
ATOM 1945   C CG  . GLN A 1 272 ? -46.293  24.882  13.373  1.00 99.99  ? 276 GLN C CG  1  
ATOM 1946   C CD  . GLN A 1 272 ? -46.459  24.538  14.848  1.00 99.99  ? 276 GLN C CD  1  
ATOM 1947   O OE1 . GLN A 1 272 ? -45.475  24.305  15.546  1.00 99.99  ? 276 GLN C OE1 1  
ATOM 1948   N NE2 . GLN A 1 272 ? -47.706  24.510  15.318  1.00 99.99  ? 276 GLN C NE2 1  
ATOM 1949   N N   . SER A 1 273 ? -44.354  27.657  11.520  1.00 30.00  ? 277 SER C N   1  
ATOM 1950   C CA  . SER A 1 273 ? -44.923  28.786  10.800  1.00 30.00  ? 277 SER C CA  1  
ATOM 1951   C C   . SER A 1 273 ? -46.437  28.700  10.731  1.00 30.00  ? 277 SER C C   1  
ATOM 1952   O O   . SER A 1 273 ? -47.008  27.611  10.845  1.00 30.00  ? 277 SER C O   1  
ATOM 1953   C CB  . SER A 1 273 ? -44.380  28.818  9.377   1.00 99.99  ? 277 SER C CB  1  
ATOM 1954   O OG  . SER A 1 273 ? -44.885  27.697  8.647   1.00 99.99  ? 277 SER C OG  1  
ATOM 1955   N N   . ALA A 1 274 ? -47.083  29.857  10.548  1.00 30.00  ? 278 ALA C N   1  
ATOM 1956   C CA  . ALA A 1 274 ? -48.548  29.943  10.452  1.00 30.00  ? 278 ALA C CA  1  
ATOM 1957   C C   . ALA A 1 274 ? -49.298  29.463  11.707  1.00 30.00  ? 278 ALA C C   1  
ATOM 1958   O O   . ALA A 1 274 ? -50.511  29.218  11.671  1.00 30.00  ? 278 ALA C O   1  
ATOM 1959   C CB  . ALA A 1 274 ? -49.022  29.147  9.246   1.00 30.00  ? 278 ALA C CB  1  
ATOM 1960   N N   . GLU A 1 275 ? -48.571  29.331  12.811  1.00 30.00  ? 279 GLU C N   1  
ATOM 1961   C CA  . GLU A 1 275 ? -49.150  28.889  14.075  1.00 30.00  ? 279 GLU C CA  1  
ATOM 1962   C C   . GLU A 1 275 ? -48.784  29.869  15.181  1.00 30.00  ? 279 GLU C C   1  
ATOM 1963   O O   . GLU A 1 275 ? -47.773  30.568  15.096  1.00 30.00  ? 279 GLU C O   1  
ATOM 1964   C CB  . GLU A 1 275 ? -48.618  27.505  14.433  1.00 99.99  ? 279 GLU C CB  1  
ATOM 1965   C CG  . GLU A 1 275 ? -48.111  27.515  15.855  1.00 99.99  ? 279 GLU C CG  1  
ATOM 1966   C CD  . GLU A 1 275 ? -46.816  28.327  15.928  1.00 99.99  ? 279 GLU C CD  1  
ATOM 1967   O OE1 . GLU A 1 275 ? -46.922  29.558  16.160  1.00 99.99  ? 279 GLU C OE1 1  
ATOM 1968   O OE2 . GLU A 1 275 ? -45.736  27.703  15.749  1.00 99.99  ? 279 GLU C OE2 1  
ATOM 1969   N N   . ARG A 1 276 ? -49.605  29.909  16.221  1.00 30.00  ? 280 ARG C N   1  
ATOM 1970   C CA  . ARG A 1 276 ? -49.359  30.794  17.342  1.00 30.00  ? 280 ARG C CA  1  
ATOM 1971   C C   . ARG A 1 276 ? -49.081  30.003  18.599  1.00 30.00  ? 280 ARG C C   1  
ATOM 1972   O O   . ARG A 1 276 ? -49.252  28.777  18.637  1.00 30.00  ? 280 ARG C O   1  
ATOM 1973   C CB  . ARG A 1 276 ? -50.580  31.677  17.582  1.00 99.99  ? 280 ARG C CB  1  
ATOM 1974   C CG  . ARG A 1 276 ? -50.270  32.686  18.681  1.00 99.99  ? 280 ARG C CG  1  
ATOM 1975   C CD  . ARG A 1 276 ? -51.526  33.485  19.007  1.00 99.99  ? 280 ARG C CD  1  
ATOM 1976   N NE  . ARG A 1 276 ? -52.519  32.648  19.715  1.00 99.99  ? 280 ARG C NE  1  
ATOM 1977   C CZ  . ARG A 1 276 ? -53.670  33.126  20.181  1.00 99.99  ? 280 ARG C CZ  1  
ATOM 1978   N NH1 . ARG A 1 276 ? -54.012  34.404  20.041  1.00 99.99  ? 280 ARG C NH1 1  
ATOM 1979   N NH2 . ARG A 1 276 ? -54.490  32.283  20.802  1.00 99.99  ? 280 ARG C NH2 1  
ATOM 1980   N N   . ASN A 1 277 ? -48.643  30.716  19.635  1.00 30.00  ? 281 ASN C N   1  
ATOM 1981   C CA  . ASN A 1 277 ? -48.363  30.096  20.925  1.00 30.00  ? 281 ASN C CA  1  
ATOM 1982   C C   . ASN A 1 277 ? -49.738  30.134  21.578  1.00 30.00  ? 281 ASN C C   1  
ATOM 1983   O O   . ASN A 1 277 ? -50.728  30.560  20.942  1.00 30.00  ? 281 ASN C O   1  
ATOM 1984   C CB  . ASN A 1 277 ? -47.315  30.913  21.675  1.00 99.99  ? 281 ASN C CB  1  
ATOM 1985   C CG  . ASN A 1 277 ? -47.815  32.318  21.965  1.00 99.99  ? 281 ASN C CG  1  
ATOM 1986   O OD1 . ASN A 1 277 ? -47.220  33.042  22.758  1.00 99.99  ? 281 ASN C OD1 1  
ATOM 1987   N ND2 . ASN A 1 277 ? -48.918  32.703  21.316  1.00 99.99  ? 281 ASN C ND2 1  
ATOM 1988   N N   . TYR A 1 278 ? -49.820  29.690  22.825  1.00 30.00  ? 282 TYR C N   1  
ATOM 1989   C CA  . TYR A 1 278 ? -51.094  29.711  23.516  1.00 30.00  ? 282 TYR C CA  1  
ATOM 1990   C C   . TYR A 1 278 ? -51.782  31.075  23.443  1.00 30.00  ? 282 TYR C C   1  
ATOM 1991   O O   . TYR A 1 278 ? -51.128  32.101  23.305  1.00 30.00  ? 282 TYR C O   1  
ATOM 1992   C CB  . TYR A 1 278 ? -50.893  29.372  24.990  1.00 99.99  ? 282 TYR C CB  1  
ATOM 1993   C CG  . TYR A 1 278 ? -50.151  30.497  25.670  1.00 99.99  ? 282 TYR C CG  1  
ATOM 1994   C CD1 . TYR A 1 278 ? -48.752  30.485  25.714  1.00 99.99  ? 282 TYR C CD1 1  
ATOM 1995   C CD2 . TYR A 1 278 ? -50.861  31.550  26.253  1.00 99.99  ? 282 TYR C CD2 1  
ATOM 1996   C CE1 . TYR A 1 278 ? -48.064  31.531  26.346  1.00 99.99  ? 282 TYR C CE1 1  
ATOM 1997   C CE2 . TYR A 1 278 ? -50.176  32.594  26.885  1.00 99.99  ? 282 TYR C CE2 1  
ATOM 1998   C CZ  . TYR A 1 278 ? -48.777  32.584  26.930  1.00 99.99  ? 282 TYR C CZ  1  
ATOM 1999   O OH  . TYR A 1 278 ? -48.106  33.599  27.542  1.00 99.99  ? 282 TYR C OH  1  
ATOM 2000   N N   . HIS A 1 279 ? -53.108  31.076  23.514  1.00 30.00  ? 283 HIS C N   1  
ATOM 2001   C CA  . HIS A 1 279 ? -53.874  32.320  23.423  1.00 30.00  ? 283 HIS C CA  1  
ATOM 2002   C C   . HIS A 1 279 ? -53.506  33.447  24.401  1.00 30.00  ? 283 HIS C C   1  
ATOM 2003   O O   . HIS A 1 279 ? -53.423  34.606  23.970  1.00 30.00  ? 283 HIS C O   1  
ATOM 2004   C CB  . HIS A 1 279 ? -55.351  32.037  23.671  1.00 99.99  ? 283 HIS C CB  1  
ATOM 2005   C CG  . HIS A 1 279 ? -55.964  31.001  22.762  1.00 99.99  ? 283 HIS C CG  1  
ATOM 2006   N ND1 . HIS A 1 279 ? -56.556  31.340  21.551  1.00 99.99  ? 283 HIS C ND1 1  
ATOM 2007   C CD2 . HIS A 1 279 ? -56.080  29.651  22.885  1.00 99.99  ? 283 HIS C CD2 1  
ATOM 2008   C CE1 . HIS A 1 279 ? -56.999  30.232  20.987  1.00 99.99  ? 283 HIS C CE1 1  
ATOM 2009   N NE2 . HIS A 1 279 ? -56.723  29.216  21.767  1.00 99.99  ? 283 HIS C NE2 1  
ATOM 2010   N N   . ILE A 1 280 ? -53.297  33.123  25.689  1.00 30.00  ? 284 ILE C N   1  
ATOM 2011   C CA  . ILE A 1 280 ? -52.951  34.130  26.697  1.00 30.00  ? 284 ILE C CA  1  
ATOM 2012   C C   . ILE A 1 280 ? -51.893  35.122  26.242  1.00 30.00  ? 284 ILE C C   1  
ATOM 2013   O O   . ILE A 1 280 ? -52.157  36.328  26.113  1.00 30.00  ? 284 ILE C O   1  
ATOM 2014   C CB  . ILE A 1 280 ? -52.412  33.446  27.949  1.00 99.99  ? 284 ILE C CB  1  
ATOM 2015   C CG1 . ILE A 1 280 ? -53.577  32.980  28.813  1.00 99.99  ? 284 ILE C CG1 1  
ATOM 2016   C CG2 . ILE A 1 280 ? -51.559  34.432  28.739  1.00 99.99  ? 284 ILE C CG2 1  
ATOM 2017   C CD1 . ILE A 1 280 ? -53.841  31.499  28.555  1.00 99.99  ? 284 ILE C CD1 1  
ATOM 2018   N N   . PHE A 1 281 ? -50.689  34.608  26.014  1.00 30.00  ? 285 PHE C N   1  
ATOM 2019   C CA  . PHE A 1 281 ? -49.568  35.432  25.582  1.00 30.00  ? 285 PHE C CA  1  
ATOM 2020   C C   . PHE A 1 281 ? -49.975  36.579  24.657  1.00 30.00  ? 285 PHE C C   1  
ATOM 2021   O O   . PHE A 1 281 ? -49.452  37.681  24.762  1.00 30.00  ? 285 PHE C O   1  
ATOM 2022   C CB  . PHE A 1 281 ? -48.558  34.577  24.824  1.00 99.99  ? 285 PHE C CB  1  
ATOM 2023   C CG  . PHE A 1 281 ? -47.399  35.439  24.383  1.00 99.99  ? 285 PHE C CG  1  
ATOM 2024   C CD1 . PHE A 1 281 ? -46.353  35.716  25.271  1.00 99.99  ? 285 PHE C CD1 1  
ATOM 2025   C CD2 . PHE A 1 281 ? -47.371  35.958  23.082  1.00 99.99  ? 285 PHE C CD2 1  
ATOM 2026   C CE1 . PHE A 1 281 ? -45.279  36.513  24.859  1.00 99.99  ? 285 PHE C CE1 1  
ATOM 2027   C CE2 . PHE A 1 281 ? -46.296  36.758  22.673  1.00 99.99  ? 285 PHE C CE2 1  
ATOM 2028   C CZ  . PHE A 1 281 ? -45.251  37.034  23.561  1.00 99.99  ? 285 PHE C CZ  1  
ATOM 2029   N N   . TYR A 1 282 ? -50.915  36.343  23.757  1.00 30.00  ? 286 TYR C N   1  
ATOM 2030   C CA  . TYR A 1 282 ? -51.319  37.398  22.841  1.00 30.00  ? 286 TYR C CA  1  
ATOM 2031   C C   . TYR A 1 282 ? -52.342  38.307  23.468  1.00 30.00  ? 286 TYR C C   1  
ATOM 2032   O O   . TYR A 1 282 ? -52.452  39.477  23.097  1.00 30.00  ? 286 TYR C O   1  
ATOM 2033   C CB  . TYR A 1 282 ? -51.925  36.787  21.581  1.00 99.99  ? 286 TYR C CB  1  
ATOM 2034   C CG  . TYR A 1 282 ? -50.877  35.978  20.859  1.00 99.99  ? 286 TYR C CG  1  
ATOM 2035   C CD1 . TYR A 1 282 ? -50.698  34.625  21.171  1.00 99.99  ? 286 TYR C CD1 1  
ATOM 2036   C CD2 . TYR A 1 282 ? -50.086  36.578  19.873  1.00 99.99  ? 286 TYR C CD2 1  
ATOM 2037   C CE1 . TYR A 1 282 ? -49.727  33.874  20.502  1.00 99.99  ? 286 TYR C CE1 1  
ATOM 2038   C CE2 . TYR A 1 282 ? -49.112  35.827  19.203  1.00 99.99  ? 286 TYR C CE2 1  
ATOM 2039   C CZ  . TYR A 1 282 ? -48.933  34.476  19.515  1.00 99.99  ? 286 TYR C CZ  1  
ATOM 2040   O OH  . TYR A 1 282 ? -47.988  33.747  18.862  1.00 99.99  ? 286 TYR C OH  1  
ATOM 2041   N N   . GLN A 1 283 ? -53.095  37.770  24.421  1.00 30.00  ? 287 GLN C N   1  
ATOM 2042   C CA  . GLN A 1 283 ? -54.115  38.537  25.123  1.00 30.00  ? 287 GLN C CA  1  
ATOM 2043   C C   . GLN A 1 283 ? -53.339  39.584  25.947  1.00 30.00  ? 287 GLN C C   1  
ATOM 2044   O O   . GLN A 1 283 ? -53.594  40.797  25.878  1.00 30.00  ? 287 GLN C O   1  
ATOM 2045   C CB  . GLN A 1 283 ? -54.931  37.616  26.024  1.00 99.99  ? 287 GLN C CB  1  
ATOM 2046   C CG  . GLN A 1 283 ? -55.705  36.621  25.166  1.00 99.99  ? 287 GLN C CG  1  
ATOM 2047   C CD  . GLN A 1 283 ? -56.851  37.304  24.434  1.00 99.99  ? 287 GLN C CD  1  
ATOM 2048   O OE1 . GLN A 1 283 ? -57.054  38.507  24.576  1.00 99.99  ? 287 GLN C OE1 1  
ATOM 2049   N NE2 . GLN A 1 283 ? -57.604  36.528  23.649  1.00 99.99  ? 287 GLN C NE2 1  
ATOM 2050   N N   . ILE A 1 284 ? -52.378  39.078  26.713  1.00 30.00  ? 288 ILE C N   1  
ATOM 2051   C CA  . ILE A 1 284 ? -51.502  39.871  27.567  1.00 30.00  ? 288 ILE C CA  1  
ATOM 2052   C C   . ILE A 1 284 ? -50.795  41.089  26.906  1.00 30.00  ? 288 ILE C C   1  
ATOM 2053   O O   . ILE A 1 284 ? -50.417  42.031  27.598  1.00 30.00  ? 288 ILE C O   1  
ATOM 2054   C CB  . ILE A 1 284 ? -50.382  39.000  28.117  1.00 99.99  ? 288 ILE C CB  1  
ATOM 2055   C CG1 . ILE A 1 284 ? -49.230  38.957  27.117  1.00 99.99  ? 288 ILE C CG1 1  
ATOM 2056   C CG2 . ILE A 1 284 ? -50.905  37.585  28.346  1.00 99.99  ? 288 ILE C CG2 1  
ATOM 2057   C CD1 . ILE A 1 284 ? -48.205  40.027  27.478  1.00 99.99  ? 288 ILE C CD1 1  
ATOM 2058   N N   . CYS A 1 285 ? -50.609  41.081  25.593  1.00 30.00  ? 289 CYS C N   1  
ATOM 2059   C CA  . CYS A 1 285 ? -49.938  42.192  24.918  1.00 30.00  ? 289 CYS C CA  1  
ATOM 2060   C C   . CYS A 1 285 ? -50.862  42.984  24.027  1.00 30.00  ? 289 CYS C C   1  
ATOM 2061   O O   . CYS A 1 285 ? -50.421  43.501  22.991  1.00 30.00  ? 289 CYS C O   1  
ATOM 2062   C CB  . CYS A 1 285 ? -48.804  41.660  24.049  1.00 99.99  ? 289 CYS C CB  1  
ATOM 2063   S SG  . CYS A 1 285 ? -49.296  40.638  22.638  1.00 99.99  ? 289 CYS C SG  1  
ATOM 2064   N N   . SER A 1 286 ? -52.135  43.103  24.404  1.00 30.00  ? 290 SER C N   1  
ATOM 2065   C CA  . SER A 1 286 ? -53.088  43.845  23.570  1.00 30.00  ? 290 SER C CA  1  
ATOM 2066   C C   . SER A 1 286 ? -53.552  45.194  24.087  1.00 30.00  ? 290 SER C C   1  
ATOM 2067   O O   . SER A 1 286 ? -53.913  46.057  23.291  1.00 30.00  ? 290 SER C O   1  
ATOM 2068   C CB  . SER A 1 286 ? -54.359  43.026  23.381  1.00 99.99  ? 290 SER C CB  1  
ATOM 2069   O OG  . SER A 1 286 ? -55.051  42.923  24.628  1.00 99.99  ? 290 SER C OG  1  
ATOM 2070   N N   . ASN A 1 287 ? -53.555  45.344  25.413  1.00 30.00  ? 291 ASN C N   1  
ATOM 2071   C CA  . ASN A 1 287 ? -53.968  46.565  26.109  1.00 30.00  ? 291 ASN C CA  1  
ATOM 2072   C C   . ASN A 1 287 ? -55.449  46.567  26.458  1.00 30.00  ? 291 ASN C C   1  
ATOM 2073   O O   . ASN A 1 287 ? -56.107  47.616  26.447  1.00 30.00  ? 291 ASN C O   1  
ATOM 2074   C CB  . ASN A 1 287 ? -53.698  47.781  25.230  1.00 99.99  ? 291 ASN C CB  1  
ATOM 2075   C CG  . ASN A 1 287 ? -53.496  49.034  26.069  1.00 99.99  ? 291 ASN C CG  1  
ATOM 2076   O OD1 . ASN A 1 287 ? -53.718  50.146  25.597  1.00 99.99  ? 291 ASN C OD1 1  
ATOM 2077   N ND2 . ASN A 1 287 ? -53.072  48.851  27.323  1.00 99.99  ? 291 ASN C ND2 1  
ATOM 2078   N N   . ALA A 1 288 ? -55.965  45.384  26.766  1.00 30.00  ? 292 ALA C N   1  
ATOM 2079   C CA  . ALA A 1 288 ? -57.362  45.239  27.132  1.00 30.00  ? 292 ALA C CA  1  
ATOM 2080   C C   . ALA A 1 288 ? -57.499  45.854  28.520  1.00 30.00  ? 292 ALA C C   1  
ATOM 2081   O O   . ALA A 1 288 ? -58.539  46.381  28.895  1.00 30.00  ? 292 ALA C O   1  
ATOM 2082   C CB  . ALA A 1 288 ? -57.736  43.766  27.167  1.00 30.00  ? 292 ALA C CB  1  
ATOM 2083   N N   . ILE A 1 289 ? -56.418  45.775  29.279  1.00 30.00  ? 293 ILE C N   1  
ATOM 2084   C CA  . ILE A 1 289 ? -56.384  46.317  30.623  1.00 30.00  ? 293 ILE C CA  1  
ATOM 2085   C C   . ILE A 1 289 ? -55.022  46.967  30.790  1.00 30.00  ? 293 ILE C C   1  
ATOM 2086   O O   . ILE A 1 289 ? -54.085  46.344  31.306  1.00 30.00  ? 293 ILE C O   1  
ATOM 2087   C CB  . ILE A 1 289 ? -56.580  45.197  31.639  1.00 99.99  ? 293 ILE C CB  1  
ATOM 2088   C CG1 . ILE A 1 289 ? -55.254  44.481  31.869  1.00 99.99  ? 293 ILE C CG1 1  
ATOM 2089   C CG2 . ILE A 1 289 ? -57.608  44.202  31.108  1.00 99.99  ? 293 ILE C CG2 1  
ATOM 2090   C CD1 . ILE A 1 289 ? -55.151  43.283  30.929  1.00 99.99  ? 293 ILE C CD1 1  
ATOM 2091   N N   . PRO A 1 290 ? -54.893  48.222  30.339  1.00 30.00  ? 294 PRO C N   1  
ATOM 2092   C CA  . PRO A 1 290 ? -53.645  48.991  30.425  1.00 30.00  ? 294 PRO C CA  1  
ATOM 2093   C C   . PRO A 1 290 ? -53.085  48.979  31.840  1.00 30.00  ? 294 PRO C C   1  
ATOM 2094   O O   . PRO A 1 290 ? -51.878  48.891  32.039  1.00 30.00  ? 294 PRO C O   1  
ATOM 2095   C CB  . PRO A 1 290 ? -54.187  50.321  30.034  1.00 99.99  ? 294 PRO C CB  1  
ATOM 2096   C CG  . PRO A 1 290 ? -55.652  50.103  29.729  1.00 99.99  ? 294 PRO C CG  1  
ATOM 2097   C CD  . PRO A 1 290 ? -56.026  48.891  29.860  1.00 99.99  ? 294 PRO C CD  1  
ATOM 2098   N N   . GLU A 1 291 ? -53.970  49.061  32.828  1.00 30.00  ? 295 GLU C N   1  
ATOM 2099   C CA  . GLU A 1 291 ? -53.570  49.051  34.224  1.00 30.00  ? 295 GLU C CA  1  
ATOM 2100   C C   . GLU A 1 291 ? -52.569  47.927  34.518  1.00 30.00  ? 295 GLU C C   1  
ATOM 2101   O O   . GLU A 1 291 ? -51.631  48.099  35.294  1.00 30.00  ? 295 GLU C O   1  
ATOM 2102   C CB  . GLU A 1 291 ? -54.793  48.840  35.111  1.00 99.99  ? 295 GLU C CB  1  
ATOM 2103   C CG  . GLU A 1 291 ? -55.725  50.021  34.973  1.00 99.99  ? 295 GLU C CG  1  
ATOM 2104   C CD  . GLU A 1 291 ? -55.116  51.235  35.672  1.00 99.99  ? 295 GLU C CD  1  
ATOM 2105   O OE1 . GLU A 1 291 ? -54.374  51.984  34.983  1.00 99.99  ? 295 GLU C OE1 1  
ATOM 2106   O OE2 . GLU A 1 291 ? -55.399  51.401  36.888  1.00 99.99  ? 295 GLU C OE2 1  
ATOM 2107   N N   . LEU A 1 292 ? -52.766  46.779  33.884  1.00 30.00  ? 296 LEU C N   1  
ATOM 2108   C CA  . LEU A 1 292 ? -51.895  45.612  34.076  1.00 30.00  ? 296 LEU C CA  1  
ATOM 2109   C C   . LEU A 1 292 ? -50.512  45.648  33.417  1.00 30.00  ? 296 LEU C C   1  
ATOM 2110   O O   . LEU A 1 292 ? -49.598  44.919  33.833  1.00 30.00  ? 296 LEU C O   1  
ATOM 2111   C CB  . LEU A 1 292 ? -52.570  44.362  33.519  1.00 99.99  ? 296 LEU C CB  1  
ATOM 2112   C CG  . LEU A 1 292 ? -53.309  43.640  34.640  1.00 99.99  ? 296 LEU C CG  1  
ATOM 2113   C CD1 . LEU A 1 292 ? -53.700  42.243  34.171  1.00 99.99  ? 296 LEU C CD1 1  
ATOM 2114   C CD2 . LEU A 1 292 ? -52.402  43.534  35.861  1.00 99.99  ? 296 LEU C CD2 1  
ATOM 2115   N N   . ASN A 1 293 ? -50.355  46.480  32.392  1.00 30.00  ? 297 ASN C N   1  
ATOM 2116   C CA  . ASN A 1 293 ? -49.079  46.578  31.699  1.00 30.00  ? 297 ASN C CA  1  
ATOM 2117   C C   . ASN A 1 293 ? -47.892  46.693  32.647  1.00 30.00  ? 297 ASN C C   1  
ATOM 2118   O O   . ASN A 1 293 ? -46.885  45.993  32.485  1.00 30.00  ? 297 ASN C O   1  
ATOM 2119   C CB  . ASN A 1 293 ? -49.069  47.812  30.803  1.00 99.99  ? 297 ASN C CB  1  
ATOM 2120   C CG  . ASN A 1 293 ? -49.226  49.086  31.619  1.00 99.99  ? 297 ASN C CG  1  
ATOM 2121   O OD1 . ASN A 1 293 ? -49.004  50.184  31.112  1.00 99.99  ? 297 ASN C OD1 1  
ATOM 2122   N ND2 . ASN A 1 293 ? -49.608  48.937  32.889  1.00 99.99  ? 297 ASN C ND2 1  
ATOM 2123   N N   . ASP A 1 294 ? -48.001  47.562  33.646  1.00 30.00  ? 298 ASP C N   1  
ATOM 2124   C CA  . ASP A 1 294 ? -46.915  47.742  34.598  1.00 30.00  ? 298 ASP C CA  1  
ATOM 2125   C C   . ASP A 1 294 ? -46.810  46.625  35.633  1.00 30.00  ? 298 ASP C C   1  
ATOM 2126   O O   . ASP A 1 294 ? -45.764  46.444  36.254  1.00 30.00  ? 298 ASP C O   1  
ATOM 2127   C CB  . ASP A 1 294 ? -47.106  49.045  35.364  1.00 99.99  ? 298 ASP C CB  1  
ATOM 2128   C CG  . ASP A 1 294 ? -48.396  48.975  36.177  1.00 99.99  ? 298 ASP C CG  1  
ATOM 2129   O OD1 . ASP A 1 294 ? -49.474  49.206  35.566  1.00 99.99  ? 298 ASP C OD1 1  
ATOM 2130   O OD2 . ASP A 1 294 ? -48.297  48.689  37.400  1.00 99.99  ? 298 ASP C OD2 1  
ATOM 2131   N N   . VAL A 1 295 ? -47.892  45.873  35.813  1.00 30.00  ? 299 VAL C N   1  
ATOM 2132   C CA  . VAL A 1 295 ? -47.889  44.769  36.770  1.00 30.00  ? 299 VAL C CA  1  
ATOM 2133   C C   . VAL A 1 295 ? -47.109  43.594  36.208  1.00 30.00  ? 299 VAL C C   1  
ATOM 2134   O O   . VAL A 1 295 ? -46.453  42.848  36.941  1.00 30.00  ? 299 VAL C O   1  
ATOM 2135   C CB  . VAL A 1 295 ? -49.321  44.324  37.052  1.00 99.99  ? 299 VAL C CB  1  
ATOM 2136   C CG1 . VAL A 1 295 ? -50.111  45.492  37.632  1.00 99.99  ? 299 VAL C CG1 1  
ATOM 2137   C CG2 . VAL A 1 295 ? -49.976  43.863  35.753  1.00 99.99  ? 299 VAL C CG2 1  
ATOM 2138   N N   . MET A 1 296 ? -47.184  43.443  34.893  1.00 30.00  ? 300 MET C N   1  
ATOM 2139   C CA  . MET A 1 296 ? -46.497  42.365  34.207  1.00 30.00  ? 300 MET C CA  1  
ATOM 2140   C C   . MET A 1 296 ? -45.166  42.833  33.614  1.00 30.00  ? 300 MET C C   1  
ATOM 2141   O O   . MET A 1 296 ? -44.285  42.016  33.315  1.00 30.00  ? 300 MET C O   1  
ATOM 2142   C CB  . MET A 1 296 ? -47.365  41.836  33.070  1.00 99.99  ? 300 MET C CB  1  
ATOM 2143   C CG  . MET A 1 296 ? -48.682  41.314  33.634  1.00 99.99  ? 300 MET C CG  1  
ATOM 2144   S SD  . MET A 1 296 ? -49.398  40.090  32.508  1.00 99.99  ? 300 MET C SD  1  
ATOM 2145   C CE  . MET A 1 296 ? -49.648  41.108  31.068  1.00 99.99  ? 300 MET C CE  1  
ATOM 2146   N N   . LEU A 1 297 ? -45.024  44.147  33.451  1.00 30.00  ? 301 LEU C N   1  
ATOM 2147   C CA  . LEU A 1 297 ? -43.808  44.737  32.897  1.00 30.00  ? 301 LEU C CA  1  
ATOM 2148   C C   . LEU A 1 297 ? -43.728  44.445  31.409  1.00 30.00  ? 301 LEU C C   1  
ATOM 2149   O O   . LEU A 1 297 ? -42.650  44.212  30.862  1.00 30.00  ? 301 LEU C O   1  
ATOM 2150   C CB  . LEU A 1 297 ? -42.585  44.149  33.592  1.00 99.99  ? 301 LEU C CB  1  
ATOM 2151   C CG  . LEU A 1 297 ? -42.165  45.059  34.740  1.00 99.99  ? 301 LEU C CG  1  
ATOM 2152   C CD1 . LEU A 1 297 ? -40.772  44.659  35.220  1.00 99.99  ? 301 LEU C CD1 1  
ATOM 2153   C CD2 . LEU A 1 297 ? -42.145  46.506  34.263  1.00 99.99  ? 301 LEU C CD2 1  
ATOM 2154   N N   . VAL A 1 298 ? -44.876  44.473  30.744  1.00 30.00  ? 302 VAL C N   1  
ATOM 2155   C CA  . VAL A 1 298 ? -44.897  44.196  29.323  1.00 30.00  ? 302 VAL C CA  1  
ATOM 2156   C C   . VAL A 1 298 ? -45.238  45.384  28.462  1.00 30.00  ? 302 VAL C C   1  
ATOM 2157   O O   . VAL A 1 298 ? -46.028  46.242  28.843  1.00 30.00  ? 302 VAL C O   1  
ATOM 2158   C CB  . VAL A 1 298 ? -45.933  43.120  29.018  1.00 99.99  ? 302 VAL C CB  1  
ATOM 2159   C CG1 . VAL A 1 298 ? -45.579  41.844  29.775  1.00 99.99  ? 302 VAL C CG1 1  
ATOM 2160   C CG2 . VAL A 1 298 ? -47.312  43.604  29.457  1.00 99.99  ? 302 VAL C CG2 1  
ATOM 2161   N N   . THR A 1 299 ? -44.619  45.424  27.292  1.00 30.00  ? 303 THR C N   1  
ATOM 2162   C CA  . THR A 1 299 ? -44.861  46.477  26.324  1.00 30.00  ? 303 THR C CA  1  
ATOM 2163   C C   . THR A 1 299 ? -45.912  45.803  25.446  1.00 30.00  ? 303 THR C C   1  
ATOM 2164   O O   . THR A 1 299 ? -45.684  44.716  24.918  1.00 30.00  ? 303 THR C O   1  
ATOM 2165   C CB  . THR A 1 299 ? -43.568  46.812  25.589  1.00 99.99  ? 303 THR C CB  1  
ATOM 2166   O OG1 . THR A 1 299 ? -43.191  45.706  24.762  1.00 99.99  ? 303 THR C OG1 1  
ATOM 2167   C CG2 . THR A 1 299 ? -42.462  47.086  26.602  1.00 99.99  ? 303 THR C CG2 1  
ATOM 2168   N N   . PRO A 1 300 ? -47.088  46.431  25.295  1.00 30.00  ? 304 PRO C N   1  
ATOM 2169   C CA  . PRO A 1 300 ? -48.158  45.846  24.471  1.00 30.00  ? 304 PRO C CA  1  
ATOM 2170   C C   . PRO A 1 300 ? -47.855  45.560  22.999  1.00 30.00  ? 304 PRO C C   1  
ATOM 2171   O O   . PRO A 1 300 ? -48.554  46.054  22.111  1.00 30.00  ? 304 PRO C O   1  
ATOM 2172   C CB  . PRO A 1 300 ? -49.150  46.947  24.594  1.00 99.99  ? 304 PRO C CB  1  
ATOM 2173   C CG  . PRO A 1 300 ? -48.528  47.972  25.511  1.00 99.99  ? 304 PRO C CG  1  
ATOM 2174   C CD  . PRO A 1 300 ? -47.371  47.641  25.942  1.00 99.99  ? 304 PRO C CD  1  
ATOM 2175   N N   . ASP A 1 301 ? -46.822  44.753  22.758  1.00 30.00  ? 305 ASP C N   1  
ATOM 2176   C CA  . ASP A 1 301 ? -46.400  44.356  21.408  1.00 30.00  ? 305 ASP C CA  1  
ATOM 2177   C C   . ASP A 1 301 ? -46.021  42.879  21.488  1.00 30.00  ? 305 ASP C C   1  
ATOM 2178   O O   . ASP A 1 301 ? -45.059  42.526  22.173  1.00 30.00  ? 305 ASP C O   1  
ATOM 2179   C CB  . ASP A 1 301 ? -45.208  45.197  20.967  1.00 99.99  ? 305 ASP C CB  1  
ATOM 2180   C CG  . ASP A 1 301 ? -44.933  44.960  19.485  1.00 99.99  ? 305 ASP C CG  1  
ATOM 2181   O OD1 . ASP A 1 301 ? -44.299  43.913  19.178  1.00 99.99  ? 305 ASP C OD1 1  
ATOM 2182   O OD2 . ASP A 1 301 ? -45.362  45.821  18.672  1.00 99.99  ? 305 ASP C OD2 1  
ATOM 2183   N N   . SER A 1 302 ? -46.773  42.016  20.808  1.00 30.00  ? 306 SER C N   1  
ATOM 2184   C CA  . SER A 1 302 ? -46.451  40.594  20.852  1.00 30.00  ? 306 SER C CA  1  
ATOM 2185   C C   . SER A 1 302 ? -45.243  40.275  19.958  1.00 30.00  ? 306 SER C C   1  
ATOM 2186   O O   . SER A 1 302 ? -44.379  39.470  20.331  1.00 30.00  ? 306 SER C O   1  
ATOM 2187   C CB  . SER A 1 302 ? -47.645  39.778  20.366  1.00 99.99  ? 306 SER C CB  1  
ATOM 2188   O OG  . SER A 1 302 ? -47.846  40.012  18.971  1.00 99.99  ? 306 SER C OG  1  
ATOM 2189   N N   . GLY A 1 303 ? -45.185  40.933  18.794  1.00 30.00  ? 307 GLY C N   1  
ATOM 2190   C CA  . GLY A 1 303 ? -44.096  40.721  17.850  1.00 30.00  ? 307 GLY C CA  1  
ATOM 2191   C C   . GLY A 1 303 ? -42.753  41.199  18.360  1.00 30.00  ? 307 GLY C C   1  
ATOM 2192   O O   . GLY A 1 303 ? -41.786  41.353  17.613  1.00 30.00  ? 307 GLY C O   1  
ATOM 2193   N N   . LEU A 1 304 ? -42.716  41.415  19.664  1.00 30.00  ? 308 LEU C N   1  
ATOM 2194   C CA  . LEU A 1 304 ? -41.543  41.888  20.368  1.00 30.00  ? 308 LEU C CA  1  
ATOM 2195   C C   . LEU A 1 304 ? -40.872  40.750  21.113  1.00 30.00  ? 308 LEU C C   1  
ATOM 2196   O O   . LEU A 1 304 ? -39.666  40.780  21.352  1.00 30.00  ? 308 LEU C O   1  
ATOM 2197   C CB  . LEU A 1 304 ? -41.939  42.964  21.372  1.00 99.99  ? 308 LEU C CB  1  
ATOM 2198   C CG  . LEU A 1 304 ? -41.765  44.339  20.738  1.00 99.99  ? 308 LEU C CG  1  
ATOM 2199   C CD1 . LEU A 1 304 ? -41.839  45.411  21.824  1.00 99.99  ? 308 LEU C CD1 1  
ATOM 2200   C CD2 . LEU A 1 304 ? -40.411  44.410  20.043  1.00 99.99  ? 308 LEU C CD2 1  
ATOM 2201   N N   . TYR A 1 305 ? -41.662  39.746  21.478  1.00 30.00  ? 309 TYR C N   1  
ATOM 2202   C CA  . TYR A 1 305 ? -41.141  38.610  22.217  1.00 30.00  ? 309 TYR C CA  1  
ATOM 2203   C C   . TYR A 1 305 ? -40.934  37.393  21.354  1.00 30.00  ? 309 TYR C C   1  
ATOM 2204   O O   . TYR A 1 305 ? -41.874  36.862  20.772  1.00 30.00  ? 309 TYR C O   1  
ATOM 2205   C CB  . TYR A 1 305 ? -42.111  38.224  23.329  1.00 99.99  ? 309 TYR C CB  1  
ATOM 2206   C CG  . TYR A 1 305 ? -42.220  39.359  24.319  1.00 99.99  ? 309 TYR C CG  1  
ATOM 2207   C CD1 . TYR A 1 305 ? -43.171  40.368  24.127  1.00 99.99  ? 309 TYR C CD1 1  
ATOM 2208   C CD2 . TYR A 1 305 ? -41.368  39.400  25.430  1.00 99.99  ? 309 TYR C CD2 1  
ATOM 2209   C CE1 . TYR A 1 305 ? -43.270  41.420  25.045  1.00 99.99  ? 309 TYR C CE1 1  
ATOM 2210   C CE2 . TYR A 1 305 ? -41.468  40.452  26.348  1.00 99.99  ? 309 TYR C CE2 1  
ATOM 2211   C CZ  . TYR A 1 305 ? -42.420  41.461  26.158  1.00 99.99  ? 309 TYR C CZ  1  
ATOM 2212   O OH  . TYR A 1 305 ? -42.516  42.484  27.050  1.00 99.99  ? 309 TYR C OH  1  
ATOM 2213   N N   . SER A 1 306 ? -39.677  36.961  21.281  1.00 30.00  ? 310 SER C N   1  
ATOM 2214   C CA  . SER A 1 306 ? -39.288  35.803  20.485  1.00 30.00  ? 310 SER C CA  1  
ATOM 2215   C C   . SER A 1 306 ? -40.182  34.600  20.756  1.00 30.00  ? 310 SER C C   1  
ATOM 2216   O O   . SER A 1 306 ? -40.794  34.071  19.832  1.00 30.00  ? 310 SER C O   1  
ATOM 2217   C CB  . SER A 1 306 ? -37.853  35.409  20.814  1.00 99.99  ? 310 SER C CB  1  
ATOM 2218   O OG  . SER A 1 306 ? -37.789  34.905  22.150  1.00 99.99  ? 310 SER C OG  1  
ATOM 2219   N N   . PHE A 1 307 ? -40.259  34.177  22.014  1.00 30.00  ? 311 PHE C N   1  
ATOM 2220   C CA  . PHE A 1 307 ? -41.093  33.033  22.396  1.00 30.00  ? 311 PHE C CA  1  
ATOM 2221   C C   . PHE A 1 307 ? -42.530  33.013  21.873  1.00 30.00  ? 311 PHE C C   1  
ATOM 2222   O O   . PHE A 1 307 ? -43.195  31.988  22.015  1.00 30.00  ? 311 PHE C O   1  
ATOM 2223   C CB  . PHE A 1 307 ? -41.214  32.964  23.915  1.00 99.99  ? 311 PHE C CB  1  
ATOM 2224   C CG  . PHE A 1 307 ? -42.628  33.303  24.323  1.00 99.99  ? 311 PHE C CG  1  
ATOM 2225   C CD1 . PHE A 1 307 ? -43.415  34.121  23.504  1.00 99.99  ? 311 PHE C CD1 1  
ATOM 2226   C CD2 . PHE A 1 307 ? -43.150  32.800  25.519  1.00 99.99  ? 311 PHE C CD2 1  
ATOM 2227   C CE1 . PHE A 1 307 ? -44.725  34.437  23.881  1.00 99.99  ? 311 PHE C CE1 1  
ATOM 2228   C CE2 . PHE A 1 307 ? -44.459  33.114  25.898  1.00 99.99  ? 311 PHE C CE2 1  
ATOM 2229   C CZ  . PHE A 1 307 ? -45.247  33.933  25.079  1.00 99.99  ? 311 PHE C CZ  1  
ATOM 2230   N N   . ILE A 1 308 ? -43.020  34.105  21.288  1.00 30.00  ? 312 ILE C N   1  
ATOM 2231   C CA  . ILE A 1 308 ? -44.389  34.130  20.782  1.00 30.00  ? 312 ILE C CA  1  
ATOM 2232   C C   . ILE A 1 308 ? -44.594  34.823  19.438  1.00 30.00  ? 312 ILE C C   1  
ATOM 2233   O O   . ILE A 1 308 ? -45.730  35.123  19.047  1.00 30.00  ? 312 ILE C O   1  
ATOM 2234   C CB  . ILE A 1 308 ? -45.292  34.860  21.771  1.00 99.99  ? 312 ILE C CB  1  
ATOM 2235   C CG1 . ILE A 1 308 ? -46.663  35.079  21.140  1.00 99.99  ? 312 ILE C CG1 1  
ATOM 2236   C CG2 . ILE A 1 308 ? -44.673  36.209  22.125  1.00 99.99  ? 312 ILE C CG2 1  
ATOM 2237   C CD1 . ILE A 1 308 ? -47.097  33.812  20.410  1.00 99.99  ? 312 ILE C CD1 1  
ATOM 2238   N N   . ASN A 1 309 ? -43.512  35.104  18.715  1.00 30.00  ? 313 ASN C N   1  
ATOM 2239   C CA  . ASN A 1 309 ? -43.685  35.746  17.416  1.00 30.00  ? 313 ASN C CA  1  
ATOM 2240   C C   . ASN A 1 309 ? -43.040  34.923  16.304  1.00 30.00  ? 313 ASN C C   1  
ATOM 2241   O O   . ASN A 1 309 ? -42.906  35.404  15.177  1.00 30.00  ? 313 ASN C O   1  
ATOM 2242   C CB  . ASN A 1 309 ? -43.037  37.127  17.431  1.00 99.99  ? 313 ASN C CB  1  
ATOM 2243   C CG  . ASN A 1 309 ? -41.541  37.030  17.681  1.00 99.99  ? 313 ASN C CG  1  
ATOM 2244   O OD1 . ASN A 1 309 ? -40.813  38.003  17.491  1.00 99.99  ? 313 ASN C OD1 1  
ATOM 2245   N ND2 . ASN A 1 309 ? -41.082  35.851  18.103  1.00 99.99  ? 313 ASN C ND2 1  
ATOM 2246   N N   . GLN A 1 310 ? -42.658  33.680  16.629  1.00 30.00  ? 314 GLN C N   1  
ATOM 2247   C CA  . GLN A 1 310 ? -42.040  32.743  15.679  1.00 30.00  ? 314 GLN C CA  1  
ATOM 2248   C C   . GLN A 1 310 ? -42.974  32.544  14.485  1.00 30.00  ? 314 GLN C C   1  
ATOM 2249   O O   . GLN A 1 310 ? -42.649  32.862  13.338  1.00 30.00  ? 314 GLN C O   1  
ATOM 2250   C CB  . GLN A 1 310 ? -41.792  31.402  16.358  1.00 99.99  ? 314 GLN C CB  1  
ATOM 2251   C CG  . GLN A 1 310 ? -43.106  30.857  16.907  1.00 99.99  ? 314 GLN C CG  1  
ATOM 2252   C CD  . GLN A 1 310 ? -43.486  31.555  18.208  1.00 99.99  ? 314 GLN C CD  1  
ATOM 2253   O OE1 . GLN A 1 310 ? -42.766  32.431  18.678  1.00 99.99  ? 314 GLN C OE1 1  
ATOM 2254   N NE2 . GLN A 1 310 ? -44.624  31.162  18.785  1.00 99.99  ? 314 GLN C NE2 1  
ATOM 2255   N N   . GLY A 1 311 ? -44.149  32.006  14.765  1.00 30.00  ? 315 GLY C N   1  
ATOM 2256   C CA  . GLY A 1 311 ? -45.105  31.780  13.707  1.00 30.00  ? 315 GLY C CA  1  
ATOM 2257   C C   . GLY A 1 311 ? -45.986  32.993  13.483  1.00 30.00  ? 315 GLY C C   1  
ATOM 2258   O O   . GLY A 1 311 ? -45.548  34.015  12.999  1.00 30.00  ? 315 GLY C O   1  
ATOM 2259   N N   . CYS A 1 312 ? -47.250  32.856  13.854  1.00 30.00  ? 316 CYS C N   1  
ATOM 2260   C CA  . CYS A 1 312 ? -48.243  33.910  13.703  1.00 30.00  ? 316 CYS C CA  1  
ATOM 2261   C C   . CYS A 1 312 ? -48.363  34.881  14.896  1.00 30.00  ? 316 CYS C C   1  
ATOM 2262   O O   . CYS A 1 312 ? -47.879  34.615  16.006  1.00 30.00  ? 316 CYS C O   1  
ATOM 2263   C CB  . CYS A 1 312 ? -49.627  33.297  13.513  1.00 99.99  ? 316 CYS C CB  1  
ATOM 2264   S SG  . CYS A 1 312 ? -50.976  34.460  13.197  1.00 99.99  ? 316 CYS C SG  1  
ATOM 2265   N N   . LEU A 1 313 ? -49.025  36.002  14.647  1.00 30.00  ? 317 LEU C N   1  
ATOM 2266   C CA  . LEU A 1 313 ? -49.222  37.019  15.662  1.00 30.00  ? 317 LEU C CA  1  
ATOM 2267   C C   . LEU A 1 313 ? -50.705  37.260  15.910  1.00 30.00  ? 317 LEU C C   1  
ATOM 2268   O O   . LEU A 1 313 ? -51.178  37.124  17.037  1.00 30.00  ? 317 LEU C O   1  
ATOM 2269   C CB  . LEU A 1 313 ? -48.586  38.329  15.212  1.00 99.99  ? 317 LEU C CB  1  
ATOM 2270   C CG  . LEU A 1 313 ? -47.176  38.435  15.784  1.00 99.99  ? 317 LEU C CG  1  
ATOM 2271   C CD1 . LEU A 1 313 ? -46.665  39.863  15.618  1.00 99.99  ? 317 LEU C CD1 1  
ATOM 2272   C CD2 . LEU A 1 313 ? -47.198  38.067  17.265  1.00 99.99  ? 317 LEU C CD2 1  
ATOM 2273   N N   . THR A 1 314 ? -51.423  37.618  14.854  1.00 30.00  ? 318 THR C N   1  
ATOM 2274   C CA  . THR A 1 314 ? -52.864  37.871  14.946  1.00 30.00  ? 318 THR C CA  1  
ATOM 2275   C C   . THR A 1 314 ? -53.655  36.599  14.561  1.00 30.00  ? 318 THR C C   1  
ATOM 2276   O O   . THR A 1 314 ? -53.062  35.585  14.199  1.00 30.00  ? 318 THR C O   1  
ATOM 2277   C CB  . THR A 1 314 ? -53.254  39.001  13.996  1.00 99.99  ? 318 THR C CB  1  
ATOM 2278   O OG1 . THR A 1 314 ? -53.095  38.564  12.645  1.00 99.99  ? 318 THR C OG1 1  
ATOM 2279   C CG2 . THR A 1 314 ? -52.353  40.205  14.248  1.00 99.99  ? 318 THR C CG2 1  
ATOM 2280   N N   . VAL A 1 315 ? -54.982  36.639  14.644  1.00 30.00  ? 319 VAL C N   1  
ATOM 2281   C CA  . VAL A 1 315 ? -55.785  35.461  14.293  1.00 30.00  ? 319 VAL C CA  1  
ATOM 2282   C C   . VAL A 1 315 ? -57.177  35.776  13.757  1.00 30.00  ? 319 VAL C C   1  
ATOM 2283   O O   . VAL A 1 315 ? -58.110  35.985  14.521  1.00 30.00  ? 319 VAL C O   1  
ATOM 2284   C CB  . VAL A 1 315 ? -55.979  34.579  15.523  1.00 99.99  ? 319 VAL C CB  1  
ATOM 2285   C CG1 . VAL A 1 315 ? -54.620  34.123  16.042  1.00 99.99  ? 319 VAL C CG1 1  
ATOM 2286   C CG2 . VAL A 1 315 ? -56.699  35.371  16.607  1.00 99.99  ? 319 VAL C CG2 1  
ATOM 2287   N N   . ASP A 1 316 ? -57.317  35.798  12.438  1.00 30.00  ? 320 ASP C N   1  
ATOM 2288   C CA  . ASP A 1 316 ? -58.603  36.083  11.819  1.00 30.00  ? 320 ASP C CA  1  
ATOM 2289   C C   . ASP A 1 316 ? -59.735  35.560  12.707  1.00 30.00  ? 320 ASP C C   1  
ATOM 2290   O O   . ASP A 1 316 ? -59.854  34.360  12.935  1.00 30.00  ? 320 ASP C O   1  
ATOM 2291   C CB  . ASP A 1 316 ? -58.685  35.402  10.458  1.00 99.99  ? 320 ASP C CB  1  
ATOM 2292   C CG  . ASP A 1 316 ? -58.240  33.949  10.585  1.00 99.99  ? 320 ASP C CG  1  
ATOM 2293   O OD1 . ASP A 1 316 ? -57.095  33.738  11.068  1.00 99.99  ? 320 ASP C OD1 1  
ATOM 2294   O OD2 . ASP A 1 316 ? -59.046  33.061  10.199  1.00 99.99  ? 320 ASP C OD2 1  
ATOM 2295   N N   . ASN A 1 317 ? -60.537  36.480  13.227  1.00 30.00  ? 321 ASN C N   1  
ATOM 2296   C CA  . ASN A 1 317 ? -61.673  36.146  14.083  1.00 30.00  ? 321 ASN C CA  1  
ATOM 2297   C C   . ASN A 1 317 ? -61.456  35.822  15.559  1.00 30.00  ? 321 ASN C C   1  
ATOM 2298   O O   . ASN A 1 317 ? -62.213  35.060  16.154  1.00 30.00  ? 321 ASN C O   1  
ATOM 2299   C CB  . ASN A 1 317 ? -62.381  34.907  13.545  1.00 99.99  ? 321 ASN C CB  1  
ATOM 2300   C CG  . ASN A 1 317 ? -63.844  34.886  13.961  1.00 99.99  ? 321 ASN C CG  1  
ATOM 2301   O OD1 . ASN A 1 317 ? -64.457  33.823  14.038  1.00 99.99  ? 321 ASN C OD1 1  
ATOM 2302   N ND2 . ASN A 1 317 ? -64.406  36.066  14.231  1.00 99.99  ? 321 ASN C ND2 1  
ATOM 2303   N N   . ILE A 1 318 ? -60.422  36.410  16.138  1.00 30.00  ? 322 ILE C N   1  
ATOM 2304   C CA  . ILE A 1 318 ? -60.106  36.232  17.547  1.00 30.00  ? 322 ILE C CA  1  
ATOM 2305   C C   . ILE A 1 318 ? -59.626  37.608  17.958  1.00 30.00  ? 322 ILE C C   1  
ATOM 2306   O O   . ILE A 1 318 ? -58.578  38.057  17.500  1.00 30.00  ? 322 ILE C O   1  
ATOM 2307   C CB  . ILE A 1 318 ? -59.027  35.165  17.704  1.00 99.99  ? 322 ILE C CB  1  
ATOM 2308   C CG1 . ILE A 1 318 ? -59.407  33.934  16.890  1.00 99.99  ? 322 ILE C CG1 1  
ATOM 2309   C CG2 . ILE A 1 318 ? -58.902  34.785  19.176  1.00 99.99  ? 322 ILE C CG2 1  
ATOM 2310   C CD1 . ILE A 1 318 ? -60.578  33.222  17.560  1.00 99.99  ? 322 ILE C CD1 1  
ATOM 2311   N N   . ASP A 1 319 ? -60.407  38.279  18.799  1.00 30.00  ? 323 ASP C N   1  
ATOM 2312   C CA  . ASP A 1 319 ? -60.050  39.609  19.274  1.00 30.00  ? 323 ASP C CA  1  
ATOM 2313   C C   . ASP A 1 319 ? -59.339  39.411  20.611  1.00 30.00  ? 323 ASP C C   1  
ATOM 2314   O O   . ASP A 1 319 ? -59.992  39.203  21.633  1.00 30.00  ? 323 ASP C O   1  
ATOM 2315   C CB  . ASP A 1 319 ? -61.311  40.452  19.450  1.00 99.99  ? 323 ASP C CB  1  
ATOM 2316   C CG  . ASP A 1 319 ? -60.923  41.904  19.705  1.00 99.99  ? 323 ASP C CG  1  
ATOM 2317   O OD1 . ASP A 1 319 ? -60.566  42.208  20.876  1.00 99.99  ? 323 ASP C OD1 1  
ATOM 2318   O OD2 . ASP A 1 319 ? -60.983  42.699  18.728  1.00 99.99  ? 323 ASP C OD2 1  
ATOM 2319   N N   . ASP A 1 320 ? -58.009  39.473  20.598  1.00 30.00  ? 324 ASP C N   1  
ATOM 2320   C CA  . ASP A 1 320 ? -57.225  39.288  21.813  1.00 30.00  ? 324 ASP C CA  1  
ATOM 2321   C C   . ASP A 1 320 ? -57.542  40.298  22.928  1.00 30.00  ? 324 ASP C C   1  
ATOM 2322   O O   . ASP A 1 320 ? -57.375  40.005  24.122  1.00 30.00  ? 324 ASP C O   1  
ATOM 2323   C CB  . ASP A 1 320 ? -55.739  39.431  21.496  1.00 99.99  ? 324 ASP C CB  1  
ATOM 2324   C CG  . ASP A 1 320 ? -55.286  38.261  20.628  1.00 99.99  ? 324 ASP C CG  1  
ATOM 2325   O OD1 . ASP A 1 320 ? -55.199  37.132  21.182  1.00 99.99  ? 324 ASP C OD1 1  
ATOM 2326   O OD2 . ASP A 1 320 ? -55.035  38.503  19.417  1.00 99.99  ? 324 ASP C OD2 1  
ATOM 2327   N N   . VAL A 1 321 ? -58.001  41.484  22.527  1.00 30.00  ? 325 VAL C N   1  
ATOM 2328   C CA  . VAL A 1 321 ? -58.369  42.560  23.442  1.00 30.00  ? 325 VAL C CA  1  
ATOM 2329   C C   . VAL A 1 321 ? -59.537  42.066  24.306  1.00 30.00  ? 325 VAL C C   1  
ATOM 2330   O O   . VAL A 1 321 ? -59.431  41.915  25.533  1.00 30.00  ? 325 VAL C O   1  
ATOM 2331   C CB  . VAL A 1 321 ? -58.788  43.794  22.651  1.00 99.99  ? 325 VAL C CB  1  
ATOM 2332   C CG1 . VAL A 1 321 ? -59.219  44.896  23.615  1.00 99.99  ? 325 VAL C CG1 1  
ATOM 2333   C CG2 . VAL A 1 321 ? -57.613  44.284  21.811  1.00 99.99  ? 325 VAL C CG2 1  
ATOM 2334   N N   . GLU A 1 322 ? -60.657  41.812  23.634  1.00 30.00  ? 326 GLU C N   1  
ATOM 2335   C CA  . GLU A 1 322 ? -61.871  41.329  24.278  1.00 30.00  ? 326 GLU C CA  1  
ATOM 2336   C C   . GLU A 1 322 ? -61.734  39.960  24.932  1.00 30.00  ? 326 GLU C C   1  
ATOM 2337   O O   . GLU A 1 322 ? -62.381  39.671  25.937  1.00 30.00  ? 326 GLU C O   1  
ATOM 2338   C CB  . GLU A 1 322 ? -62.995  41.218  23.252  1.00 99.99  ? 326 GLU C CB  1  
ATOM 2339   C CG  . GLU A 1 322 ? -63.338  42.591  22.730  1.00 99.99  ? 326 GLU C CG  1  
ATOM 2340   C CD  . GLU A 1 322 ? -64.070  43.378  23.816  1.00 99.99  ? 326 GLU C CD  1  
ATOM 2341   O OE1 . GLU A 1 322 ? -63.366  44.066  24.604  1.00 99.99  ? 326 GLU C OE1 1  
ATOM 2342   O OE2 . GLU A 1 322 ? -65.326  43.288  23.848  1.00 99.99  ? 326 GLU C OE2 1  
ATOM 2343   N N   . GLU A 1 323 ? -60.909  39.100  24.365  1.00 30.00  ? 327 GLU C N   1  
ATOM 2344   C CA  . GLU A 1 323 ? -60.762  37.790  24.961  1.00 30.00  ? 327 GLU C CA  1  
ATOM 2345   C C   . GLU A 1 323 ? -60.025  37.974  26.275  1.00 30.00  ? 327 GLU C C   1  
ATOM 2346   O O   . GLU A 1 323 ? -60.315  37.280  27.253  1.00 30.00  ? 327 GLU C O   1  
ATOM 2347   C CB  . GLU A 1 323 ? -59.969  36.882  24.026  1.00 99.99  ? 327 GLU C CB  1  
ATOM 2348   C CG  . GLU A 1 323 ? -60.307  35.439  24.318  1.00 99.99  ? 327 GLU C CG  1  
ATOM 2349   C CD  . GLU A 1 323 ? -59.435  34.933  25.463  1.00 99.99  ? 327 GLU C CD  1  
ATOM 2350   O OE1 . GLU A 1 323 ? -59.881  35.073  26.631  1.00 99.99  ? 327 GLU C OE1 1  
ATOM 2351   O OE2 . GLU A 1 323 ? -58.326  34.410  25.158  1.00 99.99  ? 327 GLU C OE2 1  
ATOM 2352   N N   . PHE A 1 324 ? -59.076  38.912  26.307  1.00 30.00  ? 328 PHE C N   1  
ATOM 2353   C CA  . PHE A 1 324 ? -58.324  39.156  27.542  1.00 30.00  ? 328 PHE C CA  1  
ATOM 2354   C C   . PHE A 1 324 ? -59.295  39.620  28.631  1.00 30.00  ? 328 PHE C C   1  
ATOM 2355   O O   . PHE A 1 324 ? -59.289  39.085  29.756  1.00 30.00  ? 328 PHE C O   1  
ATOM 2356   C CB  . PHE A 1 324 ? -57.270  40.229  27.303  1.00 99.99  ? 328 PHE C CB  1  
ATOM 2357   C CG  . PHE A 1 324 ? -56.501  40.473  28.577  1.00 99.99  ? 328 PHE C CG  1  
ATOM 2358   C CD1 . PHE A 1 324 ? -55.430  39.636  28.920  1.00 99.99  ? 328 PHE C CD1 1  
ATOM 2359   C CD2 . PHE A 1 324 ? -56.854  41.534  29.418  1.00 99.99  ? 328 PHE C CD2 1  
ATOM 2360   C CE1 . PHE A 1 324 ? -54.716  39.861  30.103  1.00 99.99  ? 328 PHE C CE1 1  
ATOM 2361   C CE2 . PHE A 1 324 ? -56.140  41.760  30.601  1.00 99.99  ? 328 PHE C CE2 1  
ATOM 2362   C CZ  . PHE A 1 324 ? -55.071  40.922  30.943  1.00 99.99  ? 328 PHE C CZ  1  
ATOM 2363   N N   . LYS A 1 325 ? -60.126  40.605  28.287  1.00 30.00  ? 329 LYS C N   1  
ATOM 2364   C CA  . LYS A 1 325 ? -61.113  41.144  29.210  1.00 30.00  ? 329 LYS C CA  1  
ATOM 2365   C C   . LYS A 1 325 ? -61.973  40.010  29.758  1.00 30.00  ? 329 LYS C C   1  
ATOM 2366   O O   . LYS A 1 325 ? -62.047  39.809  30.973  1.00 30.00  ? 329 LYS C O   1  
ATOM 2367   C CB  . LYS A 1 325 ? -62.005  42.150  28.488  1.00 99.99  ? 329 LYS C CB  1  
ATOM 2368   C CG  . LYS A 1 325 ? -62.970  42.783  29.485  1.00 99.99  ? 329 LYS C CG  1  
ATOM 2369   C CD  . LYS A 1 325 ? -63.537  44.070  28.895  1.00 99.99  ? 329 LYS C CD  1  
ATOM 2370   C CE  . LYS A 1 325 ? -64.758  44.502  29.703  1.00 99.99  ? 329 LYS C CE  1  
ATOM 2371   N NZ  . LYS A 1 325 ? -64.344  45.460  30.740  1.00 99.99  ? 329 LYS C NZ  1  
ATOM 2372   N N   . LEU A 1 326 ? -62.618  39.268  28.864  1.00 30.00  ? 330 LEU C N   1  
ATOM 2373   C CA  . LEU A 1 326 ? -63.466  38.151  29.277  1.00 30.00  ? 330 LEU C CA  1  
ATOM 2374   C C   . LEU A 1 326 ? -62.711  37.121  30.120  1.00 30.00  ? 330 LEU C C   1  
ATOM 2375   O O   . LEU A 1 326 ? -63.299  36.488  31.025  1.00 30.00  ? 330 LEU C O   1  
ATOM 2376   C CB  . LEU A 1 326 ? -64.014  37.433  28.047  1.00 99.99  ? 330 LEU C CB  1  
ATOM 2377   C CG  . LEU A 1 326 ? -65.396  37.985  27.708  1.00 99.99  ? 330 LEU C CG  1  
ATOM 2378   C CD1 . LEU A 1 326 ? -66.077  37.062  26.703  1.00 99.99  ? 330 LEU C CD1 1  
ATOM 2379   C CD2 . LEU A 1 326 ? -66.236  38.068  28.977  1.00 99.99  ? 330 LEU C CD2 1  
ATOM 2380   N N   . CYS A 1 327 ? -61.419  36.942  29.832  1.00 30.00  ? 331 CYS C N   1  
ATOM 2381   C CA  . CYS A 1 327 ? -60.605  35.977  30.569  1.00 30.00  ? 331 CYS C CA  1  
ATOM 2382   C C   . CYS A 1 327 ? -60.377  36.500  31.973  1.00 30.00  ? 331 CYS C C   1  
ATOM 2383   O O   . CYS A 1 327 ? -60.347  35.746  32.957  1.00 30.00  ? 331 CYS C O   1  
ATOM 2384   C CB  . CYS A 1 327 ? -59.264  35.787  29.868  1.00 99.99  ? 331 CYS C CB  1  
ATOM 2385   S SG  . CYS A 1 327 ? -58.028  37.078  30.154  1.00 99.99  ? 331 CYS C SG  1  
ATOM 2386   N N   . ASP A 1 328 ? -60.217  37.816  32.058  1.00 30.00  ? 332 ASP C N   1  
ATOM 2387   C CA  . ASP A 1 328 ? -60.010  38.488  33.328  1.00 30.00  ? 332 ASP C CA  1  
ATOM 2388   C C   . ASP A 1 328 ? -61.351  38.358  34.088  1.00 30.00  ? 332 ASP C C   1  
ATOM 2389   O O   . ASP A 1 328 ? -61.407  37.917  35.245  1.00 30.00  ? 332 ASP C O   1  
ATOM 2390   C CB  . ASP A 1 328 ? -59.648  39.950  33.090  1.00 99.99  ? 332 ASP C CB  1  
ATOM 2391   C CG  . ASP A 1 328 ? -58.270  40.035  32.440  1.00 99.99  ? 332 ASP C CG  1  
ATOM 2392   O OD1 . ASP A 1 328 ? -57.275  39.765  33.165  1.00 99.99  ? 332 ASP C OD1 1  
ATOM 2393   O OD2 . ASP A 1 328 ? -58.223  40.365  31.226  1.00 99.99  ? 332 ASP C OD2 1  
ATOM 2394   N N   . GLU A 1 329 ? -62.423  38.737  33.400  1.00 30.00  ? 333 GLU C N   1  
ATOM 2395   C CA  . GLU A 1 329 ? -63.778  38.684  33.931  1.00 30.00  ? 333 GLU C CA  1  
ATOM 2396   C C   . GLU A 1 329 ? -64.087  37.291  34.492  1.00 30.00  ? 333 GLU C C   1  
ATOM 2397   O O   . GLU A 1 329 ? -64.744  37.162  35.528  1.00 30.00  ? 333 GLU C O   1  
ATOM 2398   C CB  . GLU A 1 329 ? -64.780  38.998  32.825  1.00 99.99  ? 333 GLU C CB  1  
ATOM 2399   C CG  . GLU A 1 329 ? -64.588  40.421  32.361  1.00 99.99  ? 333 GLU C CG  1  
ATOM 2400   C CD  . GLU A 1 329 ? -65.099  41.380  33.434  1.00 99.99  ? 333 GLU C CD  1  
ATOM 2401   O OE1 . GLU A 1 329 ? -64.275  41.757  34.306  1.00 99.99  ? 333 GLU C OE1 1  
ATOM 2402   O OE2 . GLU A 1 329 ? -66.308  41.726  33.372  1.00 99.99  ? 333 GLU C OE2 1  
ATOM 2403   N N   . ALA A 1 330 ? -63.609  36.255  33.795  1.00 30.00  ? 334 ALA C N   1  
ATOM 2404   C CA  . ALA A 1 330 ? -63.841  34.863  34.187  1.00 30.00  ? 334 ALA C CA  1  
ATOM 2405   C C   . ALA A 1 330 ? -63.068  34.402  35.408  1.00 30.00  ? 334 ALA C C   1  
ATOM 2406   O O   . ALA A 1 330 ? -63.461  33.452  36.090  1.00 30.00  ? 334 ALA C O   1  
ATOM 2407   C CB  . ALA A 1 330 ? -63.515  33.952  33.010  1.00 30.00  ? 334 ALA C CB  1  
ATOM 2408   N N   . PHE A 1 331 ? -61.956  35.075  35.681  1.00 30.00  ? 335 PHE C N   1  
ATOM 2409   C CA  . PHE A 1 331 ? -61.130  34.737  36.835  1.00 30.00  ? 335 PHE C CA  1  
ATOM 2410   C C   . PHE A 1 331 ? -61.853  35.184  38.084  1.00 30.00  ? 335 PHE C C   1  
ATOM 2411   O O   . PHE A 1 331 ? -61.752  34.556  39.137  1.00 30.00  ? 335 PHE C O   1  
ATOM 2412   C CB  . PHE A 1 331 ? -59.782  35.445  36.733  1.00 99.99  ? 335 PHE C CB  1  
ATOM 2413   C CG  . PHE A 1 331 ? -58.914  35.045  37.902  1.00 99.99  ? 335 PHE C CG  1  
ATOM 2414   C CD1 . PHE A 1 331 ? -58.308  33.782  37.923  1.00 99.99  ? 335 PHE C CD1 1  
ATOM 2415   C CD2 . PHE A 1 331 ? -58.715  35.935  38.963  1.00 99.99  ? 335 PHE C CD2 1  
ATOM 2416   C CE1 . PHE A 1 331 ? -57.501  33.413  39.005  1.00 99.99  ? 335 PHE C CE1 1  
ATOM 2417   C CE2 . PHE A 1 331 ? -57.907  35.565  40.046  1.00 99.99  ? 335 PHE C CE2 1  
ATOM 2418   C CZ  . PHE A 1 331 ? -57.302  34.304  40.067  1.00 99.99  ? 335 PHE C CZ  1  
ATOM 2419   N N   . ASP A 1 332 ? -62.583  36.287  37.946  1.00 30.00  ? 336 ASP C N   1  
ATOM 2420   C CA  . ASP A 1 332 ? -63.357  36.851  39.042  1.00 30.00  ? 336 ASP C CA  1  
ATOM 2421   C C   . ASP A 1 332 ? -64.488  35.883  39.412  1.00 30.00  ? 336 ASP C C   1  
ATOM 2422   O O   . ASP A 1 332 ? -64.569  35.423  40.557  1.00 30.00  ? 336 ASP C O   1  
ATOM 2423   C CB  . ASP A 1 332 ? -63.951  38.192  38.620  1.00 99.99  ? 336 ASP C CB  1  
ATOM 2424   C CG  . ASP A 1 332 ? -62.831  39.213  38.440  1.00 99.99  ? 336 ASP C CG  1  
ATOM 2425   O OD1 . ASP A 1 332 ? -62.265  39.638  39.484  1.00 99.99  ? 336 ASP C OD1 1  
ATOM 2426   O OD2 . ASP A 1 332 ? -62.548  39.558  37.262  1.00 99.99  ? 336 ASP C OD2 1  
ATOM 2427   N N   . ILE A 1 333 ? -65.343  35.577  38.433  1.00 30.00  ? 337 ILE C N   1  
ATOM 2428   C CA  . ILE A 1 333 ? -66.477  34.657  38.622  1.00 30.00  ? 337 ILE C CA  1  
ATOM 2429   C C   . ILE A 1 333 ? -66.069  33.294  39.175  1.00 30.00  ? 337 ILE C C   1  
ATOM 2430   O O   . ILE A 1 333 ? -66.822  32.624  39.887  1.00 30.00  ? 337 ILE C O   1  
ATOM 2431   C CB  . ILE A 1 333 ? -67.175  34.413  37.289  1.00 99.99  ? 337 ILE C CB  1  
ATOM 2432   C CG1 . ILE A 1 333 ? -66.483  33.272  36.553  1.00 99.99  ? 337 ILE C CG1 1  
ATOM 2433   C CG2 . ILE A 1 333 ? -67.110  35.682  36.443  1.00 99.99  ? 337 ILE C CG2 1  
ATOM 2434   C CD1 . ILE A 1 333 ? -67.199  31.962  36.856  1.00 99.99  ? 337 ILE C CD1 1  
ATOM 2435   N N   . LEU A 1 334 ? -64.854  32.882  38.840  1.00 30.00  ? 338 LEU C N   1  
ATOM 2436   C CA  . LEU A 1 334 ? -64.337  31.609  39.290  1.00 30.00  ? 338 LEU C CA  1  
ATOM 2437   C C   . LEU A 1 334 ? -63.998  31.721  40.763  1.00 30.00  ? 338 LEU C C   1  
ATOM 2438   O O   . LEU A 1 334 ? -63.770  30.718  41.448  1.00 30.00  ? 338 LEU C O   1  
ATOM 2439   C CB  . LEU A 1 334 ? -63.085  31.248  38.499  1.00 99.99  ? 338 LEU C CB  1  
ATOM 2440   C CG  . LEU A 1 334 ? -63.466  30.357  37.323  1.00 99.99  ? 338 LEU C CG  1  
ATOM 2441   C CD1 . LEU A 1 334 ? -62.207  29.732  36.730  1.00 99.99  ? 338 LEU C CD1 1  
ATOM 2442   C CD2 . LEU A 1 334 ? -64.406  29.257  37.802  1.00 99.99  ? 338 LEU C CD2 1  
ATOM 2443   N N   . GLY A 1 335 ? -63.957  32.961  41.250  1.00 30.00  ? 339 GLY C N   1  
ATOM 2444   C CA  . GLY A 1 335 ? -63.632  33.204  42.637  1.00 30.00  ? 339 GLY C CA  1  
ATOM 2445   C C   . GLY A 1 335 ? -62.128  33.174  42.842  1.00 30.00  ? 339 GLY C C   1  
ATOM 2446   O O   . GLY A 1 335 ? -61.613  32.411  43.656  1.00 30.00  ? 339 GLY C O   1  
ATOM 2447   N N   . PHE A 1 336 ? -61.417  34.009  42.098  1.00 30.00  ? 340 PHE C N   1  
ATOM 2448   C CA  . PHE A 1 336 ? -59.963  34.071  42.203  1.00 30.00  ? 340 PHE C CA  1  
ATOM 2449   C C   . PHE A 1 336 ? -59.589  35.368  42.892  1.00 30.00  ? 340 PHE C C   1  
ATOM 2450   O O   . PHE A 1 336 ? -59.942  36.450  42.409  1.00 30.00  ? 340 PHE C O   1  
ATOM 2451   C CB  . PHE A 1 336 ? -59.342  34.026  40.812  1.00 99.99  ? 340 PHE C CB  1  
ATOM 2452   C CG  . PHE A 1 336 ? -59.565  32.665  40.203  1.00 99.99  ? 340 PHE C CG  1  
ATOM 2453   C CD1 . PHE A 1 336 ? -58.707  31.605  40.520  1.00 99.99  ? 340 PHE C CD1 1  
ATOM 2454   C CD2 . PHE A 1 336 ? -60.633  32.458  39.320  1.00 99.99  ? 340 PHE C CD2 1  
ATOM 2455   C CE1 . PHE A 1 336 ? -58.914  30.342  39.954  1.00 99.99  ? 340 PHE C CE1 1  
ATOM 2456   C CE2 . PHE A 1 336 ? -60.840  31.196  38.753  1.00 99.99  ? 340 PHE C CE2 1  
ATOM 2457   C CZ  . PHE A 1 336 ? -59.982  30.137  39.071  1.00 99.99  ? 340 PHE C CZ  1  
ATOM 2458   N N   . THR A 1 337 ? -58.878  35.294  44.014  1.00 30.00  ? 341 THR C N   1  
ATOM 2459   C CA  . THR A 1 337 ? -58.516  36.547  44.669  1.00 30.00  ? 341 THR C CA  1  
ATOM 2460   C C   . THR A 1 337 ? -57.703  37.353  43.661  1.00 30.00  ? 341 THR C C   1  
ATOM 2461   O O   . THR A 1 337 ? -57.116  36.783  42.740  1.00 30.00  ? 341 THR C O   1  
ATOM 2462   C CB  . THR A 1 337 ? -57.691  36.259  45.918  1.00 99.99  ? 341 THR C CB  1  
ATOM 2463   O OG1 . THR A 1 337 ? -56.418  35.726  45.535  1.00 99.99  ? 341 THR C OG1 1  
ATOM 2464   C CG2 . THR A 1 337 ? -58.423  35.245  46.789  1.00 99.99  ? 341 THR C CG2 1  
ATOM 2465   N N   . LYS A 1 338 ? -57.680  38.670  43.819  1.00 30.00  ? 342 LYS C N   1  
ATOM 2466   C CA  . LYS A 1 338 ? -56.950  39.545  42.906  1.00 30.00  ? 342 LYS C CA  1  
ATOM 2467   C C   . LYS A 1 338 ? -55.459  39.224  42.862  1.00 30.00  ? 342 LYS C C   1  
ATOM 2468   O O   . LYS A 1 338 ? -54.797  39.436  41.844  1.00 30.00  ? 342 LYS C O   1  
ATOM 2469   C CB  . LYS A 1 338 ? -57.102  40.996  43.346  1.00 99.99  ? 342 LYS C CB  1  
ATOM 2470   C CG  . LYS A 1 338 ? -58.572  41.390  43.310  1.00 99.99  ? 342 LYS C CG  1  
ATOM 2471   C CD  . LYS A 1 338 ? -58.993  41.664  41.871  1.00 99.99  ? 342 LYS C CD  1  
ATOM 2472   C CE  . LYS A 1 338 ? -60.413  42.222  41.851  1.00 99.99  ? 342 LYS C CE  1  
ATOM 2473   N NZ  . LYS A 1 338 ? -60.914  42.239  40.471  1.00 99.99  ? 342 LYS C NZ  1  
ATOM 2474   N N   . GLU A 1 339 ? -54.923  38.718  43.959  1.00 30.00  ? 343 GLU C N   1  
ATOM 2475   C CA  . GLU A 1 339 ? -53.509  38.395  43.985  1.00 30.00  ? 343 GLU C CA  1  
ATOM 2476   C C   . GLU A 1 339 ? -53.338  37.148  43.132  1.00 30.00  ? 343 GLU C C   1  
ATOM 2477   O O   . GLU A 1 339 ? -52.511  37.117  42.225  1.00 30.00  ? 343 GLU C O   1  
ATOM 2478   C CB  . GLU A 1 339 ? -53.062  38.135  45.421  1.00 99.99  ? 343 GLU C CB  1  
ATOM 2479   C CG  . GLU A 1 339 ? -53.196  39.405  46.227  1.00 99.99  ? 343 GLU C CG  1  
ATOM 2480   C CD  . GLU A 1 339 ? -52.112  40.393  45.805  1.00 99.99  ? 343 GLU C CD  1  
ATOM 2481   O OE1 . GLU A 1 339 ? -52.388  41.187  44.867  1.00 99.99  ? 343 GLU C OE1 1  
ATOM 2482   O OE2 . GLU A 1 339 ? -51.015  40.343  46.424  1.00 99.99  ? 343 GLU C OE2 1  
ATOM 2483   N N   . GLU A 1 340 ? -54.136  36.130  43.435  1.00 30.00  ? 344 GLU C N   1  
ATOM 2484   C CA  . GLU A 1 340 ? -54.117  34.858  42.716  1.00 30.00  ? 344 GLU C CA  1  
ATOM 2485   C C   . GLU A 1 340 ? -54.080  35.045  41.199  1.00 30.00  ? 344 GLU C C   1  
ATOM 2486   O O   . GLU A 1 340 ? -53.210  34.521  40.503  1.00 30.00  ? 344 GLU C O   1  
ATOM 2487   C CB  . GLU A 1 340 ? -55.369  34.054  43.055  1.00 99.99  ? 344 GLU C CB  1  
ATOM 2488   C CG  . GLU A 1 340 ? -55.349  33.684  44.518  1.00 99.99  ? 344 GLU C CG  1  
ATOM 2489   C CD  . GLU A 1 340 ? -54.289  32.610  44.758  1.00 99.99  ? 344 GLU C CD  1  
ATOM 2490   O OE1 . GLU A 1 340 ? -53.126  33.001  45.039  1.00 99.99  ? 344 GLU C OE1 1  
ATOM 2491   O OE2 . GLU A 1 340 ? -54.655  31.407  44.657  1.00 99.99  ? 344 GLU C OE2 1  
ATOM 2492   N N   . LYS A 1 341 ? -55.042  35.808  40.696  1.00 30.00  ? 345 LYS C N   1  
ATOM 2493   C CA  . LYS A 1 341 ? -55.148  36.059  39.283  1.00 30.00  ? 345 LYS C CA  1  
ATOM 2494   C C   . LYS A 1 341 ? -54.132  37.017  38.726  1.00 30.00  ? 345 LYS C C   1  
ATOM 2495   O O   . LYS A 1 341 ? -54.109  37.277  37.525  1.00 30.00  ? 345 LYS C O   1  
ATOM 2496   C CB  . LYS A 1 341 ? -56.518  36.652  38.964  1.00 99.99  ? 345 LYS C CB  1  
ATOM 2497   C CG  . LYS A 1 341 ? -56.662  36.823  37.456  1.00 99.99  ? 345 LYS C CG  1  
ATOM 2498   C CD  . LYS A 1 341 ? -58.136  36.980  37.100  1.00 99.99  ? 345 LYS C CD  1  
ATOM 2499   C CE  . LYS A 1 341 ? -58.260  37.514  35.676  1.00 99.99  ? 345 LYS C CE  1  
ATOM 2500   N NZ  . LYS A 1 341 ? -58.417  36.391  34.741  1.00 99.99  ? 345 LYS C NZ  1  
ATOM 2501   N N   . GLN A 1 342 ? -53.292  37.562  39.591  1.00 30.00  ? 346 GLN C N   1  
ATOM 2502   C CA  . GLN A 1 342 ? -52.265  38.486  39.144  1.00 30.00  ? 346 GLN C CA  1  
ATOM 2503   C C   . GLN A 1 342 ? -50.961  37.701  39.206  1.00 30.00  ? 346 GLN C C   1  
ATOM 2504   O O   . GLN A 1 342 ? -49.966  38.075  38.599  1.00 30.00  ? 346 GLN C O   1  
ATOM 2505   C CB  . GLN A 1 342 ? -52.228  39.703  40.063  1.00 99.99  ? 346 GLN C CB  1  
ATOM 2506   C CG  . GLN A 1 342 ? -53.538  40.473  39.942  1.00 99.99  ? 346 GLN C CG  1  
ATOM 2507   C CD  . GLN A 1 342 ? -53.628  41.199  38.606  1.00 99.99  ? 346 GLN C CD  1  
ATOM 2508   O OE1 . GLN A 1 342 ? -52.714  41.115  37.789  1.00 99.99  ? 346 GLN C OE1 1  
ATOM 2509   N NE2 . GLN A 1 342 ? -54.736  41.908  38.387  1.00 99.99  ? 346 GLN C NE2 1  
ATOM 2510   N N   . SER A 1 343 ? -50.994  36.608  39.969  1.00 30.00  ? 347 SER C N   1  
ATOM 2511   C CA  . SER A 1 343 ? -49.865  35.702  40.143  1.00 30.00  ? 347 SER C CA  1  
ATOM 2512   C C   . SER A 1 343 ? -49.776  34.966  38.802  1.00 30.00  ? 347 SER C C   1  
ATOM 2513   O O   . SER A 1 343 ? -48.690  34.784  38.240  1.00 30.00  ? 347 SER C O   1  
ATOM 2514   C CB  . SER A 1 343 ? -50.136  34.753  41.303  1.00 99.99  ? 347 SER C CB  1  
ATOM 2515   O OG  . SER A 1 343 ? -50.347  35.507  42.498  1.00 99.99  ? 347 SER C OG  1  
ATOM 2516   N N   . MET A 1 344 ? -50.942  34.544  38.313  1.00 30.00  ? 348 MET C N   1  
ATOM 2517   C CA  . MET A 1 344 ? -51.052  33.845  37.039  1.00 30.00  ? 348 MET C CA  1  
ATOM 2518   C C   . MET A 1 344 ? -50.430  34.751  35.992  1.00 30.00  ? 348 MET C C   1  
ATOM 2519   O O   . MET A 1 344 ? -49.348  34.484  35.484  1.00 30.00  ? 348 MET C O   1  
ATOM 2520   C CB  . MET A 1 344 ? -52.517  33.580  36.716  1.00 99.99  ? 348 MET C CB  1  
ATOM 2521   C CG  . MET A 1 344 ? -53.194  32.935  37.920  1.00 99.99  ? 348 MET C CG  1  
ATOM 2522   S SD  . MET A 1 344 ? -52.813  31.169  37.975  1.00 99.99  ? 348 MET C SD  1  
ATOM 2523   C CE  . MET A 1 344 ? -53.888  30.578  36.684  1.00 99.99  ? 348 MET C CE  1  
ATOM 2524   N N   . PHE A 1 345 ? -51.128  35.833  35.685  1.00 30.00  ? 349 PHE C N   1  
ATOM 2525   C CA  . PHE A 1 345 ? -50.703  36.810  34.697  1.00 30.00  ? 349 PHE C CA  1  
ATOM 2526   C C   . PHE A 1 345 ? -49.236  37.216  34.720  1.00 30.00  ? 349 PHE C C   1  
ATOM 2527   O O   . PHE A 1 345 ? -48.654  37.546  33.688  1.00 30.00  ? 349 PHE C O   1  
ATOM 2528   C CB  . PHE A 1 345 ? -51.488  38.105  34.878  1.00 99.99  ? 349 PHE C CB  1  
ATOM 2529   C CG  . PHE A 1 345 ? -52.902  37.911  34.388  1.00 99.99  ? 349 PHE C CG  1  
ATOM 2530   C CD1 . PHE A 1 345 ? -53.172  37.926  33.014  1.00 99.99  ? 349 PHE C CD1 1  
ATOM 2531   C CD2 . PHE A 1 345 ? -53.942  37.718  35.305  1.00 99.99  ? 349 PHE C CD2 1  
ATOM 2532   C CE1 . PHE A 1 345 ? -54.485  37.745  32.558  1.00 99.99  ? 349 PHE C CE1 1  
ATOM 2533   C CE2 . PHE A 1 345 ? -55.253  37.540  34.847  1.00 99.99  ? 349 PHE C CE2 1  
ATOM 2534   C CZ  . PHE A 1 345 ? -55.525  37.553  33.474  1.00 99.99  ? 349 PHE C CZ  1  
ATOM 2535   N N   . LYS A 1 346 ? -48.635  37.209  35.899  1.00 30.00  ? 350 LYS C N   1  
ATOM 2536   C CA  . LYS A 1 346 ? -47.246  37.606  36.014  1.00 30.00  ? 350 LYS C CA  1  
ATOM 2537   C C   . LYS A 1 346 ? -46.318  36.473  35.641  1.00 30.00  ? 350 LYS C C   1  
ATOM 2538   O O   . LYS A 1 346 ? -45.359  36.673  34.893  1.00 30.00  ? 350 LYS C O   1  
ATOM 2539   C CB  . LYS A 1 346 ? -46.943  38.025  37.448  1.00 99.99  ? 350 LYS C CB  1  
ATOM 2540   C CG  . LYS A 1 346 ? -45.510  38.535  37.539  1.00 99.99  ? 350 LYS C CG  1  
ATOM 2541   C CD  . LYS A 1 346 ? -45.339  39.350  38.815  1.00 99.99  ? 350 LYS C CD  1  
ATOM 2542   C CE  . LYS A 1 346 ? -43.853  39.544  39.100  1.00 99.99  ? 350 LYS C CE  1  
ATOM 2543   N NZ  . LYS A 1 346 ? -43.405  40.822  38.525  1.00 99.99  ? 350 LYS C NZ  1  
ATOM 2544   N N   . CYS A 1 347 ? -46.596  35.283  36.160  1.00 30.00  ? 351 CYS C N   1  
ATOM 2545   C CA  . CYS A 1 347 ? -45.773  34.128  35.845  1.00 30.00  ? 351 CYS C CA  1  
ATOM 2546   C C   . CYS A 1 347 ? -45.746  33.882  34.342  1.00 30.00  ? 351 CYS C C   1  
ATOM 2547   O O   . CYS A 1 347 ? -44.723  33.467  33.797  1.00 30.00  ? 351 CYS C O   1  
ATOM 2548   C CB  . CYS A 1 347 ? -46.328  32.891  36.537  1.00 99.99  ? 351 CYS C CB  1  
ATOM 2549   S SG  . CYS A 1 347 ? -47.953  32.326  35.971  1.00 99.99  ? 351 CYS C SG  1  
ATOM 2550   N N   . THR A 1 348 ? -46.869  34.129  33.674  1.00 30.00  ? 352 THR C N   1  
ATOM 2551   C CA  . THR A 1 348 ? -46.921  33.905  32.243  1.00 30.00  ? 352 THR C CA  1  
ATOM 2552   C C   . THR A 1 348 ? -46.239  35.055  31.502  1.00 30.00  ? 352 THR C C   1  
ATOM 2553   O O   . THR A 1 348 ? -45.664  34.854  30.424  1.00 30.00  ? 352 THR C O   1  
ATOM 2554   C CB  . THR A 1 348 ? -48.372  33.813  31.783  1.00 99.99  ? 352 THR C CB  1  
ATOM 2555   O OG1 . THR A 1 348 ? -48.997  35.092  31.923  1.00 99.99  ? 352 THR C OG1 1  
ATOM 2556   C CG2 . THR A 1 348 ? -49.112  32.791  32.637  1.00 99.99  ? 352 THR C CG2 1  
ATOM 2557   N N   . ALA A 1 349 ? -46.276  36.265  32.059  1.00 30.00  ? 353 ALA C N   1  
ATOM 2558   C CA  . ALA A 1 349 ? -45.619  37.392  31.389  1.00 30.00  ? 353 ALA C CA  1  
ATOM 2559   C C   . ALA A 1 349 ? -44.122  37.265  31.638  1.00 30.00  ? 353 ALA C C   1  
ATOM 2560   O O   . ALA A 1 349 ? -43.304  37.792  30.886  1.00 30.00  ? 353 ALA C O   1  
ATOM 2561   C CB  . ALA A 1 349 ? -46.123  38.710  31.945  1.00 30.00  ? 353 ALA C CB  1  
ATOM 2562   N N   . SER A 1 350 ? -43.776  36.559  32.710  1.00 30.00  ? 354 SER C N   1  
ATOM 2563   C CA  . SER A 1 350 ? -42.397  36.341  33.084  1.00 30.00  ? 354 SER C CA  1  
ATOM 2564   C C   . SER A 1 350 ? -41.763  35.530  31.964  1.00 30.00  ? 354 SER C C   1  
ATOM 2565   O O   . SER A 1 350 ? -40.655  35.820  31.512  1.00 30.00  ? 354 SER C O   1  
ATOM 2566   C CB  . SER A 1 350 ? -42.332  35.581  34.404  1.00 99.99  ? 354 SER C CB  1  
ATOM 2567   O OG  . SER A 1 350 ? -43.003  36.329  35.421  1.00 99.99  ? 354 SER C OG  1  
ATOM 2568   N N   . ILE A 1 351 ? -42.488  34.508  31.522  1.00 30.00  ? 355 ILE C N   1  
ATOM 2569   C CA  . ILE A 1 351 ? -42.045  33.624  30.450  1.00 30.00  ? 355 ILE C CA  1  
ATOM 2570   C C   . ILE A 1 351 ? -41.717  34.487  29.226  1.00 30.00  ? 355 ILE C C   1  
ATOM 2571   O O   . ILE A 1 351 ? -40.654  34.350  28.618  1.00 30.00  ? 355 ILE C O   1  
ATOM 2572   C CB  . ILE A 1 351 ? -43.152  32.631  30.105  1.00 99.99  ? 355 ILE C CB  1  
ATOM 2573   C CG1 . ILE A 1 351 ? -43.113  31.466  31.088  1.00 99.99  ? 355 ILE C CG1 1  
ATOM 2574   C CG2 . ILE A 1 351 ? -42.944  32.112  28.687  1.00 99.99  ? 355 ILE C CG2 1  
ATOM 2575   C CD1 . ILE A 1 351 ? -44.145  31.689  32.184  1.00 99.99  ? 355 ILE C CD1 1  
ATOM 2576   N N   . LEU A 1 352 ? -42.630  35.378  28.878  1.00 30.00  ? 356 LEU C N   1  
ATOM 2577   C CA  . LEU A 1 352 ? -42.422  36.257  27.744  1.00 30.00  ? 356 LEU C CA  1  
ATOM 2578   C C   . LEU A 1 352 ? -41.018  36.889  27.760  1.00 30.00  ? 356 LEU C C   1  
ATOM 2579   O O   . LEU A 1 352 ? -40.423  37.150  26.710  1.00 30.00  ? 356 LEU C O   1  
ATOM 2580   C CB  . LEU A 1 352 ? -43.452  37.383  27.768  1.00 99.99  ? 356 LEU C CB  1  
ATOM 2581   C CG  . LEU A 1 352 ? -44.818  36.834  27.372  1.00 99.99  ? 356 LEU C CG  1  
ATOM 2582   C CD1 . LEU A 1 352 ? -45.217  35.725  28.340  1.00 99.99  ? 356 LEU C CD1 1  
ATOM 2583   C CD2 . LEU A 1 352 ? -45.850  37.953  27.424  1.00 99.99  ? 356 LEU C CD2 1  
ATOM 2584   N N   . HIS A 1 353 ? -40.274  36.774  29.125  1.00 30.00  ? 357 HIS C N   1  
ATOM 2585   C CA  . HIS A 1 353 ? -38.943  37.360  29.341  1.00 30.00  ? 357 HIS C CA  1  
ATOM 2586   C C   . HIS A 1 353 ? -37.807  36.350  29.354  1.00 30.00  ? 357 HIS C C   1  
ATOM 2587   O O   . HIS A 1 353 ? -36.694  36.664  28.910  1.00 30.00  ? 357 HIS C O   1  
ATOM 2588   C CB  . HIS A 1 353 ? -38.911  38.082  30.685  1.00 99.99  ? 357 HIS C CB  1  
ATOM 2589   C CG  . HIS A 1 353 ? -39.964  39.147  30.866  1.00 99.99  ? 357 HIS C CG  1  
ATOM 2590   N ND1 . HIS A 1 353 ? -39.744  40.470  30.504  1.00 99.99  ? 357 HIS C ND1 1  
ATOM 2591   C CD2 . HIS A 1 353 ? -41.229  39.084  31.365  1.00 99.99  ? 357 HIS C CD2 1  
ATOM 2592   C CE1 . HIS A 1 353 ? -40.841  41.154  30.780  1.00 99.99  ? 357 HIS C CE1 1  
ATOM 2593   N NE2 . HIS A 1 353 ? -41.732  40.346  31.293  1.00 99.99  ? 357 HIS C NE2 1  
ATOM 2594   N N   . MET A 1 354 ? -38.073  35.151  29.872  1.00 30.00  ? 358 MET C N   1  
ATOM 2595   C CA  . MET A 1 354 ? -37.069  34.089  29.929  1.00 30.00  ? 358 MET C CA  1  
ATOM 2596   C C   . MET A 1 354 ? -36.436  33.966  28.547  1.00 30.00  ? 358 MET C C   1  
ATOM 2597   O O   . MET A 1 354 ? -35.261  33.618  28.405  1.00 30.00  ? 358 MET C O   1  
ATOM 2598   C CB  . MET A 1 354 ? -37.727  32.771  30.322  1.00 99.99  ? 358 MET C CB  1  
ATOM 2599   C CG  . MET A 1 354 ? -36.674  31.822  30.880  1.00 99.99  ? 358 MET C CG  1  
ATOM 2600   S SD  . MET A 1 354 ? -37.437  30.241  31.323  1.00 99.99  ? 358 MET C SD  1  
ATOM 2601   C CE  . MET A 1 354 ? -35.989  29.326  31.812  1.00 99.99  ? 358 MET C CE  1  
ATOM 2602   N N   . GLY A 1 355 ? -37.237  34.252  27.528  1.00 30.00  ? 359 GLY C N   1  
ATOM 2603   C CA  . GLY A 1 355 ? -36.761  34.162  26.164  1.00 30.00  ? 359 GLY C CA  1  
ATOM 2604   C C   . GLY A 1 355 ? -36.137  35.417  25.625  1.00 30.00  ? 359 GLY C C   1  
ATOM 2605   O O   . GLY A 1 355 ? -35.782  35.477  24.455  1.00 30.00  ? 359 GLY C O   1  
ATOM 2606   N N   . GLU A 1 356 ? -36.003  36.434  26.469  1.00 30.00  ? 360 GLU C N   1  
ATOM 2607   C CA  . GLU A 1 356 ? -35.396  37.677  26.021  1.00 30.00  ? 360 GLU C CA  1  
ATOM 2608   C C   . GLU A 1 356 ? -33.964  37.763  26.551  1.00 30.00  ? 360 GLU C C   1  
ATOM 2609   O O   . GLU A 1 356 ? -33.166  38.599  26.109  1.00 30.00  ? 360 GLU C O   1  
ATOM 2610   C CB  . GLU A 1 356 ? -36.201  38.863  26.540  1.00 99.99  ? 360 GLU C CB  1  
ATOM 2611   C CG  . GLU A 1 356 ? -37.579  38.849  25.925  1.00 99.99  ? 360 GLU C CG  1  
ATOM 2612   C CD  . GLU A 1 356 ? -37.483  39.238  24.454  1.00 99.99  ? 360 GLU C CD  1  
ATOM 2613   O OE1 . GLU A 1 356 ? -37.310  38.309  23.619  1.00 99.99  ? 360 GLU C OE1 1  
ATOM 2614   O OE2 . GLU A 1 356 ? -37.584  40.462  24.175  1.00 99.99  ? 360 GLU C OE2 1  
ATOM 2615   N N   . MET A 1 357 ? -33.657  36.878  27.493  1.00 30.00  ? 361 MET C N   1  
ATOM 2616   C CA  . MET A 1 357 ? -32.333  36.818  28.084  1.00 30.00  ? 361 MET C CA  1  
ATOM 2617   C C   . MET A 1 357 ? -31.294  36.375  27.054  1.00 30.00  ? 361 MET C C   1  
ATOM 2618   O O   . MET A 1 357 ? -31.207  35.192  26.731  1.00 30.00  ? 361 MET C O   1  
ATOM 2619   C CB  . MET A 1 357 ? -32.323  35.825  29.240  1.00 99.99  ? 361 MET C CB  1  
ATOM 2620   C CG  . MET A 1 357 ? -30.951  35.824  29.901  1.00 99.99  ? 361 MET C CG  1  
ATOM 2621   S SD  . MET A 1 357 ? -31.014  34.905  31.459  1.00 99.99  ? 361 MET C SD  1  
ATOM 2622   C CE  . MET A 1 357 ? -29.302  34.991  31.940  1.00 99.99  ? 361 MET C CE  1  
ATOM 2623   N N   . LYS A 1 358 ? -30.506  37.320  26.549  1.00 30.00  ? 362 LYS C N   1  
ATOM 2624   C CA  . LYS A 1 358 ? -29.468  37.042  25.557  1.00 30.00  ? 362 LYS C CA  1  
ATOM 2625   C C   . LYS A 1 358 ? -28.225  36.520  26.275  1.00 30.00  ? 362 LYS C C   1  
ATOM 2626   O O   . LYS A 1 358 ? -28.103  36.619  27.503  1.00 30.00  ? 362 LYS C O   1  
ATOM 2627   C CB  . LYS A 1 358 ? -29.122  38.315  24.796  1.00 99.99  ? 362 LYS C CB  1  
ATOM 2628   C CG  . LYS A 1 358 ? -28.111  37.995  23.699  1.00 99.99  ? 362 LYS C CG  1  
ATOM 2629   C CD  . LYS A 1 358 ? -28.099  39.123  22.674  1.00 99.99  ? 362 LYS C CD  1  
ATOM 2630   C CE  . LYS A 1 358 ? -26.856  38.999  21.797  1.00 99.99  ? 362 LYS C CE  1  
ATOM 2631   N NZ  . LYS A 1 358 ? -27.189  38.242  20.582  1.00 99.99  ? 362 LYS C NZ  1  
ATOM 2632   N N   . PHE A 1 359 ? -27.317  35.968  25.493  1.00 30.00  ? 363 PHE C N   1  
ATOM 2633   C CA  . PHE A 1 359 ? -26.082  35.397  26.039  1.00 30.00  ? 363 PHE C CA  1  
ATOM 2634   C C   . PHE A 1 359 ? -24.906  35.604  25.095  1.00 30.00  ? 363 PHE C C   1  
ATOM 2635   O O   . PHE A 1 359 ? -25.053  36.178  24.005  1.00 30.00  ? 363 PHE C O   1  
ATOM 2636   C CB  . PHE A 1 359 ? -26.257  33.900  26.263  1.00 99.99  ? 363 PHE C CB  1  
ATOM 2637   C CG  . PHE A 1 359 ? -26.360  33.198  24.929  1.00 99.99  ? 363 PHE C CG  1  
ATOM 2638   C CD1 . PHE A 1 359 ? -27.612  33.018  24.331  1.00 99.99  ? 363 PHE C CD1 1  
ATOM 2639   C CD2 . PHE A 1 359 ? -25.205  32.729  24.292  1.00 99.99  ? 363 PHE C CD2 1  
ATOM 2640   C CE1 . PHE A 1 359 ? -27.710  32.368  23.095  1.00 99.99  ? 363 PHE C CE1 1  
ATOM 2641   C CE2 . PHE A 1 359 ? -25.304  32.077  23.057  1.00 99.99  ? 363 PHE C CE2 1  
ATOM 2642   C CZ  . PHE A 1 359 ? -26.556  31.898  22.458  1.00 99.99  ? 363 PHE C CZ  1  
ATOM 2643   N N   . LYS A 1 360 ? -23.787  35.117  25.585  1.00 30.00  ? 364 LYS C N   1  
ATOM 2644   C CA  . LYS A 1 360 ? -22.499  35.160  24.893  1.00 30.00  ? 364 LYS C CA  1  
ATOM 2645   C C   . LYS A 1 360 ? -21.593  34.092  25.492  1.00 30.00  ? 364 LYS C C   1  
ATOM 2646   O O   . LYS A 1 360 ? -21.925  33.474  26.516  1.00 30.00  ? 364 LYS C O   1  
ATOM 2647   C CB  . LYS A 1 360 ? -21.865  36.534  25.067  1.00 99.99  ? 364 LYS C CB  1  
ATOM 2648   C CG  . LYS A 1 360 ? -20.572  36.605  24.262  1.00 99.99  ? 364 LYS C CG  1  
ATOM 2649   C CD  . LYS A 1 360 ? -20.174  38.063  24.064  1.00 99.99  ? 364 LYS C CD  1  
ATOM 2650   C CE  . LYS A 1 360 ? -18.722  38.135  23.598  1.00 99.99  ? 364 LYS C CE  1  
ATOM 2651   N NZ  . LYS A 1 360 ? -18.680  38.189  22.131  1.00 99.99  ? 364 LYS C NZ  1  
ATOM 2652   N N   . GLN A 1 361 ? -20.472  33.899  24.842  1.00 30.00  ? 365 GLN C N   1  
ATOM 2653   C CA  . GLN A 1 361 ? -19.483  32.909  25.268  1.00 30.00  ? 365 GLN C CA  1  
ATOM 2654   C C   . GLN A 1 361 ? -18.323  33.591  25.990  1.00 30.00  ? 365 GLN C C   1  
ATOM 2655   O O   . GLN A 1 361 ? -18.431  33.951  27.172  1.00 30.00  ? 365 GLN C O   1  
ATOM 2656   C CB  . GLN A 1 361 ? -18.940  32.164  24.055  1.00 99.99  ? 365 GLN C CB  1  
ATOM 2657   C CG  . GLN A 1 361 ? -18.343  33.162  23.069  1.00 99.99  ? 365 GLN C CG  1  
ATOM 2658   C CD  . GLN A 1 361 ? -19.437  33.860  22.268  1.00 99.99  ? 365 GLN C CD  1  
ATOM 2659   O OE1 . GLN A 1 361 ? -20.618  33.591  22.464  1.00 99.99  ? 365 GLN C OE1 1  
ATOM 2660   N NE2 . GLN A 1 361 ? -19.035  34.762  21.370  1.00 99.99  ? 365 GLN C NE2 1  
ATOM 2661   N N   . ARG A 1 362 ? -17.260  33.735  25.229  1.00 30.00  ? 366 ARG C N   1  
ATOM 2662   C CA  . ARG A 1 362 ? -16.005  34.333  25.695  1.00 30.00  ? 366 ARG C CA  1  
ATOM 2663   C C   . ARG A 1 362 ? -14.848  33.441  25.252  1.00 30.00  ? 366 ARG C C   1  
ATOM 2664   O O   . ARG A 1 362 ? -14.209  32.772  26.077  1.00 30.00  ? 366 ARG C O   1  
ATOM 2665   C CB  . ARG A 1 362 ? -16.017  34.445  27.216  1.00 99.99  ? 366 ARG C CB  1  
ATOM 2666   C CG  . ARG A 1 362 ? -14.730  35.113  27.687  1.00 99.99  ? 366 ARG C CG  1  
ATOM 2667   C CD  . ARG A 1 362 ? -14.720  35.180  29.210  1.00 99.99  ? 366 ARG C CD  1  
ATOM 2668   N NE  . ARG A 1 362 ? -15.057  33.867  29.801  1.00 99.99  ? 366 ARG C NE  1  
ATOM 2669   C CZ  . ARG A 1 362 ? -14.175  32.878  29.918  1.00 99.99  ? 366 ARG C CZ  1  
ATOM 2670   N NH1 . ARG A 1 362 ? -12.916  33.003  29.506  1.00 99.99  ? 366 ARG C NH1 1  
ATOM 2671   N NH2 . ARG A 1 362 ? -14.587  31.736  30.466  1.00 99.99  ? 366 ARG C NH2 1  
ATOM 2672   N N   . PRO A 1 363 ? -14.640  33.464  23.949  1.00 30.00  ? 367 PRO C N   1  
ATOM 2673   C CA  . PRO A 1 363 ? -13.598  32.682  23.263  1.00 30.00  ? 367 PRO C CA  1  
ATOM 2674   C C   . PRO A 1 363 ? -12.518  32.220  24.256  1.00 30.00  ? 367 PRO C C   1  
ATOM 2675   O O   . PRO A 1 363 ? -11.675  33.013  24.702  1.00 30.00  ? 367 PRO C O   1  
ATOM 2676   C CB  . PRO A 1 363 ? -13.116  33.737  22.332  1.00 99.99  ? 367 PRO C CB  1  
ATOM 2677   C CG  . PRO A 1 363 ? -13.986  34.946  22.581  1.00 99.99  ? 367 PRO C CG  1  
ATOM 2678   C CD  . PRO A 1 363 ? -14.882  34.757  23.469  1.00 99.99  ? 367 PRO C CD  1  
ATOM 2679   N N   . ARG A 1 364 ? -12.565  30.933  24.574  1.00 30.00  ? 368 ARG C N   1  
ATOM 2680   C CA  . ARG A 1 364 ? -11.602  30.306  25.503  1.00 30.00  ? 368 ARG C CA  1  
ATOM 2681   C C   . ARG A 1 364 ? -12.083  28.912  25.924  1.00 30.00  ? 368 ARG C C   1  
ATOM 2682   O O   . ARG A 1 364 ? -11.568  27.886  25.455  1.00 30.00  ? 368 ARG C O   1  
ATOM 2683   C CB  . ARG A 1 364 ? -11.449  31.166  26.750  1.00 99.99  ? 368 ARG C CB  1  
ATOM 2684   C CG  . ARG A 1 364 ? -10.365  30.579  27.646  1.00 99.99  ? 368 ARG C CG  1  
ATOM 2685   C CD  . ARG A 1 364 ? -10.300  31.368  28.949  1.00 99.99  ? 368 ARG C CD  1  
ATOM 2686   N NE  . ARG A 1 364 ? -11.485  31.099  29.792  1.00 99.99  ? 368 ARG C NE  1  
ATOM 2687   C CZ  . ARG A 1 364 ? -11.635  31.604  31.013  1.00 99.99  ? 368 ARG C CZ  1  
ATOM 2688   N NH1 . ARG A 1 364 ? -10.718  32.389  31.570  1.00 99.99  ? 368 ARG C NH1 1  
ATOM 2689   N NH2 . ARG A 1 364 ? -12.742  31.298  31.684  1.00 99.99  ? 368 ARG C NH2 1  
ATOM 2690   N N   . GLU A 1 365 ? -13.052  28.919  26.813  1.00 30.00  ? 369 GLU C N   1  
ATOM 2691   C CA  . GLU A 1 365 ? -13.667  27.690  27.338  1.00 30.00  ? 369 GLU C CA  1  
ATOM 2692   C C   . GLU A 1 365 ? -15.111  27.643  26.878  1.00 30.00  ? 369 GLU C C   1  
ATOM 2693   O O   . GLU A 1 365 ? -15.692  26.562  26.691  1.00 30.00  ? 369 GLU C O   1  
ATOM 2694   C CB  . GLU A 1 365 ? -13.610  27.690  28.862  1.00 99.99  ? 369 GLU C CB  1  
ATOM 2695   C CG  . GLU A 1 365 ? -12.171  27.637  29.312  1.00 99.99  ? 369 GLU C CG  1  
ATOM 2696   C CD  . GLU A 1 365 ? -11.603  26.245  29.043  1.00 99.99  ? 369 GLU C CD  1  
ATOM 2697   O OE1 . GLU A 1 365 ? -11.059  26.051  27.923  1.00 99.99  ? 369 GLU C OE1 1  
ATOM 2698   O OE2 . GLU A 1 365 ? -11.720  25.385  29.959  1.00 99.99  ? 369 GLU C OE2 1  
ATOM 2699   N N   . GLU A 1 366 ? -15.619  28.831  26.719  1.00 30.00  ? 370 GLU C N   1  
ATOM 2700   C CA  . GLU A 1 366 ? -16.964  29.050  26.259  1.00 30.00  ? 370 GLU C CA  1  
ATOM 2701   C C   . GLU A 1 366 ? -17.953  28.920  27.399  1.00 30.00  ? 370 GLU C C   1  
ATOM 2702   O O   . GLU A 1 366 ? -18.990  29.599  27.438  1.00 30.00  ? 370 GLU C O   1  
ATOM 2703   C CB  . GLU A 1 366 ? -17.321  28.026  25.187  1.00 99.99  ? 370 GLU C CB  1  
ATOM 2704   C CG  . GLU A 1 366 ? -18.420  28.577  24.311  1.00 99.99  ? 370 GLU C CG  1  
ATOM 2705   C CD  . GLU A 1 366 ? -19.776  28.294  24.955  1.00 99.99  ? 370 GLU C CD  1  
ATOM 2706   O OE1 . GLU A 1 366 ? -20.231  29.163  25.743  1.00 99.99  ? 370 GLU C OE1 1  
ATOM 2707   O OE2 . GLU A 1 366 ? -20.342  27.208  24.654  1.00 99.99  ? 370 GLU C OE2 1  
ATOM 2708   N N   . GLN A 1 367 ? -17.721  28.045  28.384  1.00 30.00  ? 371 GLN C N   1  
ATOM 2709   C CA  . GLN A 1 367 ? -18.743  28.069  29.395  1.00 30.00  ? 371 GLN C CA  1  
ATOM 2710   C C   . GLN A 1 367 ? -19.491  29.249  28.831  1.00 30.00  ? 371 GLN C C   1  
ATOM 2711   O O   . GLN A 1 367 ? -19.258  29.653  27.683  1.00 30.00  ? 371 GLN C O   1  
ATOM 2712   C CB  . GLN A 1 367 ? -18.113  28.278  30.768  1.00 99.99  ? 371 GLN C CB  1  
ATOM 2713   C CG  . GLN A 1 367 ? -18.834  29.407  31.493  1.00 99.99  ? 371 GLN C CG  1  
ATOM 2714   C CD  . GLN A 1 367 ? -18.519  30.756  30.861  1.00 99.99  ? 371 GLN C CD  1  
ATOM 2715   O OE1 . GLN A 1 367 ? -17.767  30.829  29.891  1.00 99.99  ? 371 GLN C OE1 1  
ATOM 2716   N NE2 . GLN A 1 367 ? -19.097  31.824  31.413  1.00 99.99  ? 371 GLN C NE2 1  
ATOM 2717   N N   . ALA A 1 368 ? -20.356  29.882  29.518  1.00 30.00  ? 372 ALA C N   1  
ATOM 2718   C CA  . ALA A 1 368 ? -20.983  31.036  28.871  1.00 30.00  ? 372 ALA C CA  1  
ATOM 2719   C C   . ALA A 1 368 ? -21.205  32.142  29.865  1.00 30.00  ? 372 ALA C C   1  
ATOM 2720   O O   . ALA A 1 368 ? -21.387  31.888  31.061  1.00 30.00  ? 372 ALA C O   1  
ATOM 2721   C CB  . ALA A 1 368 ? -22.309  30.638  28.238  1.00 30.00  ? 372 ALA C CB  1  
ATOM 2722   N N   . GLU A 1 369 ? -21.178  33.333  29.326  1.00 30.00  ? 373 GLU C N   1  
ATOM 2723   C CA  . GLU A 1 369 ? -21.424  34.552  30.088  1.00 30.00  ? 373 GLU C CA  1  
ATOM 2724   C C   . GLU A 1 369 ? -22.671  35.218  29.528  1.00 30.00  ? 373 GLU C C   1  
ATOM 2725   O O   . GLU A 1 369 ? -23.098  34.929  28.400  1.00 30.00  ? 373 GLU C O   1  
ATOM 2726   C CB  . GLU A 1 369 ? -20.232  35.493  29.964  1.00 99.99  ? 373 GLU C CB  1  
ATOM 2727   C CG  . GLU A 1 369 ? -19.021  34.858  30.605  1.00 99.99  ? 373 GLU C CG  1  
ATOM 2728   C CD  . GLU A 1 369 ? -19.184  34.865  32.123  1.00 99.99  ? 373 GLU C CD  1  
ATOM 2729   O OE1 . GLU A 1 369 ? -19.747  33.867  32.647  1.00 99.99  ? 373 GLU C OE1 1  
ATOM 2730   O OE2 . GLU A 1 369 ? -18.747  35.871  32.745  1.00 99.99  ? 373 GLU C OE2 1  
ATOM 2731   N N   . SER A 1 370 ? -23.236  36.092  30.325  1.00 30.00  ? 374 SER C N   1  
ATOM 2732   C CA  . SER A 1 370 ? -24.453  36.813  29.948  1.00 30.00  ? 374 SER C CA  1  
ATOM 2733   C C   . SER A 1 370 ? -24.133  37.923  28.962  1.00 30.00  ? 374 SER C C   1  
ATOM 2734   O O   . SER A 1 370 ? -22.974  38.208  28.677  1.00 30.00  ? 374 SER C O   1  
ATOM 2735   C CB  . SER A 1 370 ? -25.098  37.424  31.186  1.00 99.99  ? 374 SER C CB  1  
ATOM 2736   O OG  . SER A 1 370 ? -26.298  38.106  30.812  1.00 99.99  ? 374 SER C OG  1  
ATOM 2737   N N   . ASP A 1 371 ? -25.182  38.539  28.438  1.00 30.00  ? 375 ASP C N   1  
ATOM 2738   C CA  . ASP A 1 371 ? -25.035  39.626  27.484  1.00 30.00  ? 375 ASP C CA  1  
ATOM 2739   C C   . ASP A 1 371 ? -26.029  40.663  27.958  1.00 30.00  ? 375 ASP C C   1  
ATOM 2740   O O   . ASP A 1 371 ? -26.900  41.113  27.210  1.00 30.00  ? 375 ASP C O   1  
ATOM 2741   C CB  . ASP A 1 371 ? -25.354  39.128  26.079  1.00 99.99  ? 375 ASP C CB  1  
ATOM 2742   C CG  . ASP A 1 371 ? -24.963  40.193  25.059  1.00 99.99  ? 375 ASP C CG  1  
ATOM 2743   O OD1 . ASP A 1 371 ? -25.762  41.154  24.892  1.00 99.99  ? 375 ASP C OD1 1  
ATOM 2744   O OD2 . ASP A 1 371 ? -23.865  40.043  24.456  1.00 99.99  ? 375 ASP C OD2 1  
ATOM 2745   N N   . GLY A 1 372 ? -25.879  41.019  29.229  1.00 30.00  ? 376 GLY C N   1  
ATOM 2746   C CA  . GLY A 1 372 ? -26.750  41.994  29.844  1.00 30.00  ? 376 GLY C CA  1  
ATOM 2747   C C   . GLY A 1 372 ? -27.356  41.359  31.073  1.00 30.00  ? 376 GLY C C   1  
ATOM 2748   O O   . GLY A 1 372 ? -26.862  40.327  31.545  1.00 30.00  ? 376 GLY C O   1  
ATOM 2749   N N   . THR A 1 373 ? -28.422  41.960  31.590  1.00 30.00  ? 377 THR C N   1  
ATOM 2750   C CA  . THR A 1 373 ? -29.082  41.424  32.771  1.00 30.00  ? 377 THR C CA  1  
ATOM 2751   C C   . THR A 1 373 ? -30.482  42.025  32.960  1.00 30.00  ? 377 THR C C   1  
ATOM 2752   O O   . THR A 1 373 ? -31.282  41.531  33.759  1.00 30.00  ? 377 THR C O   1  
ATOM 2753   C CB  . THR A 1 373 ? -28.255  41.740  34.014  1.00 99.99  ? 377 THR C CB  1  
ATOM 2754   O OG1 . THR A 1 373 ? -26.950  41.168  33.876  1.00 99.99  ? 377 THR C OG1 1  
ATOM 2755   C CG2 . THR A 1 373 ? -28.938  41.151  35.241  1.00 99.99  ? 377 THR C CG2 1  
ATOM 2756   N N   . ALA A 1 374 ? -30.768  43.089  32.204  1.00 30.00  ? 378 ALA C N   1  
ATOM 2757   C CA  . ALA A 1 374 ? -32.054  43.783  32.273  1.00 30.00  ? 378 ALA C CA  1  
ATOM 2758   C C   . ALA A 1 374 ? -33.242  42.834  32.243  1.00 30.00  ? 378 ALA C C   1  
ATOM 2759   O O   . ALA A 1 374 ? -34.089  42.861  33.149  1.00 30.00  ? 378 ALA C O   1  
ATOM 2760   C CB  . ALA A 1 374 ? -32.167  44.782  31.120  1.00 30.00  ? 378 ALA C CB  1  
ATOM 2761   N N   . GLU A 1 375 ? -33.299  42.000  31.205  1.00 30.00  ? 379 GLU C N   1  
ATOM 2762   C CA  . GLU A 1 375 ? -34.392  41.043  31.037  1.00 30.00  ? 379 GLU C CA  1  
ATOM 2763   C C   . GLU A 1 375 ? -34.334  39.867  32.000  1.00 30.00  ? 379 GLU C C   1  
ATOM 2764   O O   . GLU A 1 375 ? -35.372  39.340  32.393  1.00 30.00  ? 379 GLU C O   1  
ATOM 2765   C CB  . GLU A 1 375 ? -34.365  40.468  29.626  1.00 99.99  ? 379 GLU C CB  1  
ATOM 2766   C CG  . GLU A 1 375 ? -33.021  39.832  29.365  1.00 99.99  ? 379 GLU C CG  1  
ATOM 2767   C CD  . GLU A 1 375 ? -31.992  40.918  29.061  1.00 99.99  ? 379 GLU C CD  1  
ATOM 2768   O OE1 . GLU A 1 375 ? -31.361  41.401  30.036  1.00 99.99  ? 379 GLU C OE1 1  
ATOM 2769   O OE2 . GLU A 1 375 ? -31.851  41.254  27.854  1.00 99.99  ? 379 GLU C OE2 1  
ATOM 2770   N N   . ALA A 1 376 ? -33.135  39.457  32.387  1.00 30.00  ? 380 ALA C N   1  
ATOM 2771   C CA  . ALA A 1 376 ? -32.997  38.335  33.314  1.00 30.00  ? 380 ALA C CA  1  
ATOM 2772   C C   . ALA A 1 376 ? -33.394  38.700  34.752  1.00 30.00  ? 380 ALA C C   1  
ATOM 2773   O O   . ALA A 1 376 ? -33.540  37.819  35.609  1.00 30.00  ? 380 ALA C O   1  
ATOM 2774   C CB  . ALA A 1 376 ? -31.566  37.811  33.282  1.00 30.00  ? 380 ALA C CB  1  
ATOM 2775   N N   . GLU A 1 377 ? -33.559  39.995  35.020  1.00 30.00  ? 381 GLU C N   1  
ATOM 2776   C CA  . GLU A 1 377 ? -33.950  40.462  36.353  1.00 30.00  ? 381 GLU C CA  1  
ATOM 2777   C C   . GLU A 1 377 ? -35.464  40.464  36.449  1.00 30.00  ? 381 GLU C C   1  
ATOM 2778   O O   . GLU A 1 377 ? -36.032  39.940  37.409  1.00 30.00  ? 381 GLU C O   1  
ATOM 2779   C CB  . GLU A 1 377 ? -33.421  41.874  36.582  1.00 99.99  ? 381 GLU C CB  1  
ATOM 2780   C CG  . GLU A 1 377 ? -33.283  42.126  38.065  1.00 99.99  ? 381 GLU C CG  1  
ATOM 2781   C CD  . GLU A 1 377 ? -34.623  42.594  38.628  1.00 99.99  ? 381 GLU C CD  1  
ATOM 2782   O OE1 . GLU A 1 377 ? -35.412  41.707  39.048  1.00 99.99  ? 381 GLU C OE1 1  
ATOM 2783   O OE2 . GLU A 1 377 ? -34.845  43.835  38.634  1.00 99.99  ? 381 GLU C OE2 1  
ATOM 2784   N N   . LYS A 1 378 ? -36.102  41.068  35.441  1.00 30.00  ? 382 LYS C N   1  
ATOM 2785   C CA  . LYS A 1 378 ? -37.563  41.135  35.374  1.00 30.00  ? 382 LYS C CA  1  
ATOM 2786   C C   . LYS A 1 378 ? -38.126  39.748  35.658  1.00 30.00  ? 382 LYS C C   1  
ATOM 2787   O O   . LYS A 1 378 ? -39.215  39.587  36.212  1.00 30.00  ? 382 LYS C O   1  
ATOM 2788   C CB  . LYS A 1 378 ? -37.997  41.595  33.986  1.00 99.99  ? 382 LYS C CB  1  
ATOM 2789   C CG  . LYS A 1 378 ? -37.397  42.966  33.690  1.00 99.99  ? 382 LYS C CG  1  
ATOM 2790   C CD  . LYS A 1 378 ? -37.911  43.467  32.345  1.00 99.99  ? 382 LYS C CD  1  
ATOM 2791   C CE  . LYS A 1 378 ? -37.329  44.847  32.063  1.00 99.99  ? 382 LYS C CE  1  
ATOM 2792   N NZ  . LYS A 1 378 ? -38.154  45.531  31.057  1.00 99.99  ? 382 LYS C NZ  1  
ATOM 2793   N N   . VAL A 1 379 ? -37.358  38.748  35.256  1.00 30.00  ? 383 VAL C N   1  
ATOM 2794   C CA  . VAL A 1 379 ? -37.714  37.358  35.425  1.00 30.00  ? 383 VAL C CA  1  
ATOM 2795   C C   . VAL A 1 379 ? -37.578  36.987  36.887  1.00 30.00  ? 383 VAL C C   1  
ATOM 2796   O O   . VAL A 1 379 ? -38.528  36.499  37.490  1.00 30.00  ? 383 VAL C O   1  
ATOM 2797   C CB  . VAL A 1 379 ? -36.792  36.481  34.585  1.00 99.99  ? 383 VAL C CB  1  
ATOM 2798   C CG1 . VAL A 1 379 ? -36.929  36.860  33.115  1.00 99.99  ? 383 VAL C CG1 1  
ATOM 2799   C CG2 . VAL A 1 379 ? -35.349  36.687  35.032  1.00 99.99  ? 383 VAL C CG2 1  
ATOM 2800   N N   . ALA A 1 380 ? -36.400  37.214  37.459  1.00 30.00  ? 384 ALA C N   1  
ATOM 2801   C CA  . ALA A 1 380 ? -36.165  36.883  38.863  1.00 30.00  ? 384 ALA C CA  1  
ATOM 2802   C C   . ALA A 1 380 ? -37.149  37.652  39.744  1.00 30.00  ? 384 ALA C C   1  
ATOM 2803   O O   . ALA A 1 380 ? -37.613  37.156  40.775  1.00 30.00  ? 384 ALA C O   1  
ATOM 2804   C CB  . ALA A 1 380 ? -34.753  37.248  39.241  1.00 30.00  ? 384 ALA C CB  1  
ATOM 2805   N N   . PHE A 1 381 ? -37.448  38.878  39.310  1.00 30.00  ? 385 PHE C N   1  
ATOM 2806   C CA  . PHE A 1 381 ? -38.368  39.771  40.004  1.00 30.00  ? 385 PHE C CA  1  
ATOM 2807   C C   . PHE A 1 381 ? -39.755  39.134  40.141  1.00 30.00  ? 385 PHE C C   1  
ATOM 2808   O O   . PHE A 1 381 ? -40.225  38.877  41.261  1.00 30.00  ? 385 PHE C O   1  
ATOM 2809   C CB  . PHE A 1 381 ? -38.508  41.077  39.228  1.00 99.99  ? 385 PHE C CB  1  
ATOM 2810   C CG  . PHE A 1 381 ? -39.459  41.995  39.954  1.00 99.99  ? 385 PHE C CG  1  
ATOM 2811   C CD1 . PHE A 1 381 ? -38.997  42.786  41.013  1.00 99.99  ? 385 PHE C CD1 1  
ATOM 2812   C CD2 . PHE A 1 381 ? -40.803  42.057  39.569  1.00 99.99  ? 385 PHE C CD2 1  
ATOM 2813   C CE1 . PHE A 1 381 ? -39.879  43.639  41.686  1.00 99.99  ? 385 PHE C CE1 1  
ATOM 2814   C CE2 . PHE A 1 381 ? -41.685  42.909  40.243  1.00 99.99  ? 385 PHE C CE2 1  
ATOM 2815   C CZ  . PHE A 1 381 ? -41.224  43.701  41.303  1.00 99.99  ? 385 PHE C CZ  1  
ATOM 2816   N N   . LEU A 1 382 ? -40.381  38.888  38.984  1.00 30.00  ? 386 LEU C N   1  
ATOM 2817   C CA  . LEU A 1 382 ? -41.712  38.288  38.888  1.00 30.00  ? 386 LEU C CA  1  
ATOM 2818   C C   . LEU A 1 382 ? -41.842  36.924  39.568  1.00 30.00  ? 386 LEU C C   1  
ATOM 2819   O O   . LEU A 1 382 ? -42.939  36.547  40.019  1.00 30.00  ? 386 LEU C O   1  
ATOM 2820   C CB  . LEU A 1 382 ? -42.084  38.085  37.423  1.00 99.99  ? 386 LEU C CB  1  
ATOM 2821   C CG  . LEU A 1 382 ? -42.406  39.432  36.786  1.00 99.99  ? 386 LEU C CG  1  
ATOM 2822   C CD1 . LEU A 1 382 ? -41.196  40.354  36.908  1.00 99.99  ? 386 LEU C CD1 1  
ATOM 2823   C CD2 . LEU A 1 382 ? -42.748  39.233  35.315  1.00 99.99  ? 386 LEU C CD2 1  
ATOM 2824   N N   . CYS A 1 383 ? -40.745  36.187  39.660  1.00 30.00  ? 387 CYS C N   1  
ATOM 2825   C CA  . CYS A 1 383 ? -40.775  34.876  40.298  1.00 30.00  ? 387 CYS C CA  1  
ATOM 2826   C C   . CYS A 1 383 ? -40.289  34.946  41.733  1.00 30.00  ? 387 CYS C C   1  
ATOM 2827   O O   . CYS A 1 383 ? -40.160  33.920  42.406  1.00 30.00  ? 387 CYS C O   1  
ATOM 2828   C CB  . CYS A 1 383 ? -39.879  33.908  39.536  1.00 99.99  ? 387 CYS C CB  1  
ATOM 2829   S SG  . CYS A 1 383 ? -38.106  34.272  39.565  1.00 99.99  ? 387 CYS C SG  1  
ATOM 2830   N N   . GLY A 1 384 ? -40.012  36.165  42.194  1.00 30.00  ? 388 GLY C N   1  
ATOM 2831   C CA  . GLY A 1 384 ? -39.558  36.374  43.555  1.00 30.00  ? 388 GLY C CA  1  
ATOM 2832   C C   . GLY A 1 384 ? -38.301  35.642  43.963  1.00 30.00  ? 388 GLY C C   1  
ATOM 2833   O O   . GLY A 1 384 ? -38.257  34.993  45.016  1.00 30.00  ? 388 GLY C O   1  
ATOM 2834   N N   . ILE A 1 385 ? -37.270  35.728  43.136  1.00 30.00  ? 389 ILE C N   1  
ATOM 2835   C CA  . ILE A 1 385 ? -36.003  35.080  43.442  1.00 30.00  ? 389 ILE C CA  1  
ATOM 2836   C C   . ILE A 1 385 ? -34.908  36.069  43.032  1.00 30.00  ? 389 ILE C C   1  
ATOM 2837   O O   . ILE A 1 385 ? -35.150  37.001  42.251  1.00 30.00  ? 389 ILE C O   1  
ATOM 2838   C CB  . ILE A 1 385 ? -35.882  33.780  42.655  1.00 99.99  ? 389 ILE C CB  1  
ATOM 2839   C CG1 . ILE A 1 385 ? -35.304  34.069  41.273  1.00 99.99  ? 389 ILE C CG1 1  
ATOM 2840   C CG2 . ILE A 1 385 ? -37.262  33.145  42.506  1.00 99.99  ? 389 ILE C CG2 1  
ATOM 2841   C CD1 . ILE A 1 385 ? -33.793  33.872  41.301  1.00 99.99  ? 389 ILE C CD1 1  
ATOM 2842   N N   . ASN A 1 386 ? -33.708  35.870  43.563  1.00 30.00  ? 390 ASN C N   1  
ATOM 2843   C CA  . ASN A 1 386 ? -32.596  36.754  43.255  1.00 30.00  ? 390 ASN C CA  1  
ATOM 2844   C C   . ASN A 1 386 ? -32.053  36.586  41.829  1.00 30.00  ? 390 ASN C C   1  
ATOM 2845   O O   . ASN A 1 386 ? -31.613  35.497  41.457  1.00 30.00  ? 390 ASN C O   1  
ATOM 2846   C CB  . ASN A 1 386 ? -31.439  36.485  44.211  1.00 99.99  ? 390 ASN C CB  1  
ATOM 2847   C CG  . ASN A 1 386 ? -30.274  37.428  43.944  1.00 99.99  ? 390 ASN C CG  1  
ATOM 2848   O OD1 . ASN A 1 386 ? -30.481  38.586  43.588  1.00 99.99  ? 390 ASN C OD1 1  
ATOM 2849   N ND2 . ASN A 1 386 ? -29.048  36.931  44.121  1.00 99.99  ? 390 ASN C ND2 1  
ATOM 2850   N N   . ALA A 1 387 ? -32.085  37.659  41.035  1.00 30.00  ? 391 ALA C N   1  
ATOM 2851   C CA  . ALA A 1 387 ? -31.582  37.609  39.660  1.00 30.00  ? 391 ALA C CA  1  
ATOM 2852   C C   . ALA A 1 387 ? -30.128  37.119  39.648  1.00 30.00  ? 391 ALA C C   1  
ATOM 2853   O O   . ALA A 1 387 ? -29.662  36.504  38.676  1.00 30.00  ? 391 ALA C O   1  
ATOM 2854   C CB  . ALA A 1 387 ? -31.673  39.002  39.009  1.00 30.00  ? 391 ALA C CB  1  
ATOM 2855   N N   . GLY A 1 388 ? -29.410  37.397  40.730  1.00 30.00  ? 392 GLY C N   1  
ATOM 2856   C CA  . GLY A 1 388 ? -28.028  36.978  40.823  1.00 30.00  ? 392 GLY C CA  1  
ATOM 2857   C C   . GLY A 1 388 ? -27.980  35.469  40.944  1.00 30.00  ? 392 GLY C C   1  
ATOM 2858   O O   . GLY A 1 388 ? -27.487  34.785  40.048  1.00 30.00  ? 392 GLY C O   1  
ATOM 2859   N N   . ASP A 1 389 ? -28.508  34.962  42.061  1.00 30.00  ? 393 ASP C N   1  
ATOM 2860   C CA  . ASP A 1 389 ? -28.556  33.530  42.352  1.00 30.00  ? 393 ASP C CA  1  
ATOM 2861   C C   . ASP A 1 389 ? -29.111  32.732  41.161  1.00 30.00  ? 393 ASP C C   1  
ATOM 2862   O O   . ASP A 1 389 ? -28.834  31.537  41.013  1.00 30.00  ? 393 ASP C O   1  
ATOM 2863   C CB  . ASP A 1 389 ? -29.453  33.276  43.558  1.00 99.99  ? 393 ASP C CB  1  
ATOM 2864   C CG  . ASP A 1 389 ? -28.797  33.850  44.813  1.00 99.99  ? 393 ASP C CG  1  
ATOM 2865   O OD1 . ASP A 1 389 ? -27.789  33.242  45.263  1.00 99.99  ? 393 ASP C OD1 1  
ATOM 2866   O OD2 . ASP A 1 389 ? -29.307  34.890  45.306  1.00 99.99  ? 393 ASP C OD2 1  
ATOM 2867   N N   . LEU A 1 390 ? -29.897  33.404  40.320  1.00 30.00  ? 394 LEU C N   1  
ATOM 2868   C CA  . LEU A 1 390 ? -30.489  32.782  39.142  1.00 30.00  ? 394 LEU C CA  1  
ATOM 2869   C C   . LEU A 1 390 ? -29.441  32.547  38.065  1.00 30.00  ? 394 LEU C C   1  
ATOM 2870   O O   . LEU A 1 390 ? -28.934  31.431  37.928  1.00 30.00  ? 394 LEU C O   1  
ATOM 2871   C CB  . LEU A 1 390 ? -31.577  33.683  38.570  1.00 99.99  ? 394 LEU C CB  1  
ATOM 2872   C CG  . LEU A 1 390 ? -32.932  33.262  39.125  1.00 99.99  ? 394 LEU C CG  1  
ATOM 2873   C CD1 . LEU A 1 390 ? -34.043  33.930  38.319  1.00 99.99  ? 394 LEU C CD1 1  
ATOM 2874   C CD2 . LEU A 1 390 ? -33.073  31.747  39.028  1.00 99.99  ? 394 LEU C CD2 1  
ATOM 2875   N N   . LEU A 1 391 ? -29.118  33.592  37.308  1.00 30.00  ? 395 LEU C N   1  
ATOM 2876   C CA  . LEU A 1 391 ? -28.121  33.475  36.246  1.00 30.00  ? 395 LEU C CA  1  
ATOM 2877   C C   . LEU A 1 391 ? -26.917  32.656  36.702  1.00 30.00  ? 395 LEU C C   1  
ATOM 2878   O O   . LEU A 1 391 ? -26.184  32.103  35.887  1.00 30.00  ? 395 LEU C O   1  
ATOM 2879   C CB  . LEU A 1 391 ? -27.635  34.860  35.838  1.00 99.99  ? 395 LEU C CB  1  
ATOM 2880   C CG  . LEU A 1 391 ? -26.511  34.725  34.816  1.00 99.99  ? 395 LEU C CG  1  
ATOM 2881   C CD1 . LEU A 1 391 ? -25.975  36.108  34.462  1.00 99.99  ? 395 LEU C CD1 1  
ATOM 2882   C CD2 . LEU A 1 391 ? -25.388  33.879  35.404  1.00 99.99  ? 395 LEU C CD2 1  
ATOM 2883   N N   . LYS A 1 392 ? -26.714  32.580  38.012  1.00 30.00  ? 396 LYS C N   1  
ATOM 2884   C CA  . LYS A 1 392 ? -25.603  31.824  38.563  1.00 30.00  ? 396 LYS C CA  1  
ATOM 2885   C C   . LYS A 1 392 ? -25.894  30.334  38.400  1.00 30.00  ? 396 LYS C C   1  
ATOM 2886   O O   . LYS A 1 392 ? -25.162  29.628  37.710  1.00 30.00  ? 396 LYS C O   1  
ATOM 2887   C CB  . LYS A 1 392 ? -25.435  32.155  40.044  1.00 99.99  ? 396 LYS C CB  1  
ATOM 2888   C CG  . LYS A 1 392 ? -24.208  31.432  40.590  1.00 99.99  ? 396 LYS C CG  1  
ATOM 2889   C CD  . LYS A 1 392 ? -23.776  32.083  41.898  1.00 99.99  ? 396 LYS C CD  1  
ATOM 2890   C CE  . LYS A 1 392 ? -22.804  31.159  42.629  1.00 99.99  ? 396 LYS C CE  1  
ATOM 2891   N NZ  . LYS A 1 392 ? -21.424  31.529  42.286  1.00 99.99  ? 396 LYS C NZ  1  
ATOM 2892   N N   . ALA A 1 393 ? -26.964  29.867  39.038  1.00 30.00  ? 397 ALA C N   1  
ATOM 2893   C CA  . ALA A 1 393 ? -27.352  28.459  38.965  1.00 30.00  ? 397 ALA C CA  1  
ATOM 2894   C C   . ALA A 1 393 ? -27.827  28.062  37.561  1.00 30.00  ? 397 ALA C C   1  
ATOM 2895   O O   . ALA A 1 393 ? -28.298  26.944  37.357  1.00 30.00  ? 397 ALA C O   1  
ATOM 2896   C CB  . ALA A 1 393 ? -28.454  28.176  39.980  1.00 30.00  ? 397 ALA C CB  1  
ATOM 2897   N N   . LEU A 1 394 ? -27.687  28.980  36.610  1.00 30.00  ? 398 LEU C N   1  
ATOM 2898   C CA  . LEU A 1 394 ? -28.094  28.764  35.221  1.00 30.00  ? 398 LEU C CA  1  
ATOM 2899   C C   . LEU A 1 394 ? -26.901  28.658  34.260  1.00 30.00  ? 398 LEU C C   1  
ATOM 2900   O O   . LEU A 1 394 ? -27.007  28.060  33.185  1.00 30.00  ? 398 LEU C O   1  
ATOM 2901   C CB  . LEU A 1 394 ? -28.966  29.922  34.748  1.00 99.99  ? 398 LEU C CB  1  
ATOM 2902   C CG  . LEU A 1 394 ? -30.435  29.564  34.939  1.00 99.99  ? 398 LEU C CG  1  
ATOM 2903   C CD1 . LEU A 1 394 ? -31.305  30.561  34.175  1.00 99.99  ? 398 LEU C CD1 1  
ATOM 2904   C CD2 . LEU A 1 394 ? -30.690  28.159  34.407  1.00 99.99  ? 398 LEU C CD2 1  
ATOM 2905   N N   . LEU A 1 395 ? -25.771  29.246  34.647  1.00 30.00  ? 399 LEU C N   1  
ATOM 2906   C CA  . LEU A 1 395 ? -24.571  29.224  33.823  1.00 30.00  ? 399 LEU C CA  1  
ATOM 2907   C C   . LEU A 1 395 ? -23.506  28.268  34.358  1.00 30.00  ? 399 LEU C C   1  
ATOM 2908   O O   . LEU A 1 395 ? -22.529  27.980  33.670  1.00 30.00  ? 399 LEU C O   1  
ATOM 2909   C CB  . LEU A 1 395 ? -23.955  30.618  33.768  1.00 99.99  ? 399 LEU C CB  1  
ATOM 2910   C CG  . LEU A 1 395 ? -24.451  31.346  32.524  1.00 99.99  ? 399 LEU C CG  1  
ATOM 2911   C CD1 . LEU A 1 395 ? -23.599  32.590  32.290  1.00 99.99  ? 399 LEU C CD1 1  
ATOM 2912   C CD2 . LEU A 1 395 ? -24.345  30.421  31.317  1.00 99.99  ? 399 LEU C CD2 1  
ATOM 2913   N N   . LYS A 1 396 ? -23.698  27.791  35.565  1.00 30.00  ? 400 LYS C N   1  
ATOM 2914   C CA  . LYS A 1 396 ? -22.769  26.855  36.217  1.00 30.00  ? 400 LYS C CA  1  
ATOM 2915   C C   . LYS A 1 396 ? -23.503  26.058  37.294  1.00 30.00  ? 400 LYS C C   1  
ATOM 2916   O O   . LYS A 1 396 ? -23.176  26.109  38.467  1.00 30.00  ? 400 LYS C O   1  
ATOM 2917   C CB  . LYS A 1 396 ? -21.623  27.627  36.864  1.00 99.99  ? 400 LYS C CB  1  
ATOM 2918   C CG  . LYS A 1 396 ? -20.613  26.645  37.451  1.00 99.99  ? 400 LYS C CG  1  
ATOM 2919   C CD  . LYS A 1 396 ? -19.289  27.359  37.690  1.00 99.99  ? 400 LYS C CD  1  
ATOM 2920   C CE  . LYS A 1 396 ? -18.411  26.510  38.602  1.00 99.99  ? 400 LYS C CE  1  
ATOM 2921   N NZ  . LYS A 1 396 ? -17.521  25.673  37.785  1.00 99.99  ? 400 LYS C NZ  1  
ATOM 2922   N N   . PRO A 1 397 ? -24.541  25.339  36.868  1.00 30.00  ? 401 PRO C N   1  
ATOM 2923   C CA  . PRO A 1 397 ? -25.355  24.536  37.783  1.00 30.00  ? 401 PRO C CA  1  
ATOM 2924   C C   . PRO A 1 397 ? -24.536  23.755  38.792  1.00 30.00  ? 401 PRO C C   1  
ATOM 2925   O O   . PRO A 1 397 ? -23.535  23.143  38.448  1.00 30.00  ? 401 PRO C O   1  
ATOM 2926   C CB  . PRO A 1 397 ? -25.993  23.648  36.776  1.00 99.99  ? 401 PRO C CB  1  
ATOM 2927   C CG  . PRO A 1 397 ? -25.494  24.111  35.429  1.00 99.99  ? 401 PRO C CG  1  
ATOM 2928   C CD  . PRO A 1 397 ? -24.704  25.113  35.494  1.00 99.99  ? 401 PRO C CD  1  
ATOM 2929   N N   . LYS A 1 398 ? -24.965  23.783  40.050  1.00 30.00  ? 402 LYS C N   1  
ATOM 2930   C CA  . LYS A 1 398 ? -24.265  23.061  41.103  1.00 30.00  ? 402 LYS C CA  1  
ATOM 2931   C C   . LYS A 1 398 ? -24.958  21.712  41.367  1.00 30.00  ? 402 LYS C C   1  
ATOM 2932   O O   . LYS A 1 398 ? -25.250  21.385  42.543  1.00 30.00  ? 402 LYS C O   1  
ATOM 2933   C CB  . LYS A 1 398 ? -24.271  23.882  42.388  1.00 99.99  ? 402 LYS C CB  1  
ATOM 2934   C CG  . LYS A 1 398 ? -23.495  23.141  43.470  1.00 99.99  ? 402 LYS C CG  1  
ATOM 2935   C CD  . LYS A 1 398 ? -23.605  23.902  44.786  1.00 99.99  ? 402 LYS C CD  1  
ATOM 2936   C CE  . LYS A 1 398 ? -23.210  22.985  45.938  1.00 99.99  ? 402 LYS C CE  1  
ATOM 2937   N NZ  . LYS A 1 398 ? -21.934  22.322  45.624  1.00 99.99  ? 402 LYS C NZ  1  
ATOM 2938   N N   . VAL A 1 406 ? -21.673  19.576  43.956  1.00 30.00  ? 410 VAL C N   1  
ATOM 2939   C CA  . VAL A 1 406 ? -20.635  19.553  42.880  1.00 30.00  ? 410 VAL C CA  1  
ATOM 2940   C C   . VAL A 1 406 ? -21.060  20.329  41.624  1.00 30.00  ? 410 VAL C C   1  
ATOM 2941   O O   . VAL A 1 406 ? -22.026  19.977  40.951  1.00 30.00  ? 410 VAL C O   1  
ATOM 2942   C CB  . VAL A 1 406 ? -20.357  18.113  42.461  1.00 99.99  ? 410 VAL C CB  1  
ATOM 2943   C CG1 . VAL A 1 406 ? -19.851  17.322  43.662  1.00 99.99  ? 410 VAL C CG1 1  
ATOM 2944   C CG2 . VAL A 1 406 ? -21.638  17.477  41.935  1.00 99.99  ? 410 VAL C CG2 1  
ATOM 2945   N N   . THR A 1 407 ? -20.319  21.388  41.305  1.00 30.00  ? 411 THR C N   1  
ATOM 2946   C CA  . THR A 1 407 ? -20.605  22.229  40.139  1.00 30.00  ? 411 THR C CA  1  
ATOM 2947   C C   . THR A 1 407 ? -20.431  21.511  38.809  1.00 30.00  ? 411 THR C C   1  
ATOM 2948   O O   . THR A 1 407 ? -19.946  20.385  38.770  1.00 30.00  ? 411 THR C O   1  
ATOM 2949   C CB  . THR A 1 407 ? -19.668  23.432  40.125  1.00 99.99  ? 411 THR C CB  1  
ATOM 2950   O OG1 . THR A 1 407 ? -18.331  22.990  39.873  1.00 99.99  ? 411 THR C OG1 1  
ATOM 2951   C CG2 . THR A 1 407 ? -19.724  24.135  41.479  1.00 99.99  ? 411 THR C CG2 1  
ATOM 2952   N N   . LYS A 1 408 ? -20.842  22.179  37.730  1.00 30.00  ? 412 LYS C N   1  
ATOM 2953   C CA  . LYS A 1 408 ? -20.756  21.658  36.363  1.00 30.00  ? 412 LYS C CA  1  
ATOM 2954   C C   . LYS A 1 408 ? -21.242  22.739  35.402  1.00 30.00  ? 412 LYS C C   1  
ATOM 2955   O O   . LYS A 1 408 ? -22.430  22.825  35.101  1.00 30.00  ? 412 LYS C O   1  
ATOM 2956   C CB  . LYS A 1 408 ? -21.629  20.414  36.227  1.00 99.99  ? 412 LYS C CB  1  
ATOM 2957   C CG  . LYS A 1 408 ? -21.459  19.820  34.834  1.00 99.99  ? 412 LYS C CG  1  
ATOM 2958   C CD  . LYS A 1 408 ? -21.952  18.378  34.830  1.00 99.99  ? 412 LYS C CD  1  
ATOM 2959   C CE  . LYS A 1 408 ? -22.131  17.906  33.390  1.00 99.99  ? 412 LYS C CE  1  
ATOM 2960   N NZ  . LYS A 1 408 ? -20.910  17.222  32.942  1.00 99.99  ? 412 LYS C NZ  1  
ATOM 2961   N N   . GLY A 1 409 ? -20.318  23.559  34.918  1.00 30.00  ? 413 GLY C N   1  
ATOM 2962   C CA  . GLY A 1 409 ? -20.689  24.621  34.004  1.00 30.00  ? 413 GLY C CA  1  
ATOM 2963   C C   . GLY A 1 409 ? -21.367  24.171  32.727  1.00 30.00  ? 413 GLY C C   1  
ATOM 2964   O O   . GLY A 1 409 ? -21.212  23.033  32.298  1.00 30.00  ? 413 GLY C O   1  
ATOM 2965   N N   . GLN A 1 410 ? -22.123  25.073  32.113  1.00 30.00  ? 414 GLN C N   1  
ATOM 2966   C CA  . GLN A 1 410 ? -22.838  24.794  30.872  1.00 30.00  ? 414 GLN C CA  1  
ATOM 2967   C C   . GLN A 1 410 ? -22.319  25.731  29.792  1.00 30.00  ? 414 GLN C C   1  
ATOM 2968   O O   . GLN A 1 410 ? -21.950  26.863  30.080  1.00 30.00  ? 414 GLN C O   1  
ATOM 2969   C CB  . GLN A 1 410 ? -24.333  25.018  31.074  1.00 99.99  ? 414 GLN C CB  1  
ATOM 2970   C CG  . GLN A 1 410 ? -24.869  24.002  32.077  1.00 99.99  ? 414 GLN C CG  1  
ATOM 2971   C CD  . GLN A 1 410 ? -24.921  22.608  31.472  1.00 99.99  ? 414 GLN C CD  1  
ATOM 2972   O OE1 . GLN A 1 410 ? -24.561  22.416  30.313  1.00 99.99  ? 414 GLN C OE1 1  
ATOM 2973   N NE2 . GLN A 1 410 ? -25.377  21.630  32.259  1.00 99.99  ? 414 GLN C NE2 1  
ATOM 2974   N N   . ASN A 1 411 ? -22.300  25.260  28.549  1.00 30.00  ? 415 ASN C N   1  
ATOM 2975   C CA  . ASN A 1 411 ? -21.833  26.054  27.414  1.00 30.00  ? 415 ASN C CA  1  
ATOM 2976   C C   . ASN A 1 411 ? -22.880  27.097  27.026  1.00 30.00  ? 415 ASN C C   1  
ATOM 2977   O O   . ASN A 1 411 ? -23.812  27.355  27.781  1.00 30.00  ? 415 ASN C O   1  
ATOM 2978   C CB  . ASN A 1 411 ? -21.573  25.147  26.218  1.00 99.99  ? 415 ASN C CB  1  
ATOM 2979   C CG  . ASN A 1 411 ? -22.834  24.393  25.816  1.00 99.99  ? 415 ASN C CG  1  
ATOM 2980   O OD1 . ASN A 1 411 ? -23.447  24.701  24.797  1.00 99.99  ? 415 ASN C OD1 1  
ATOM 2981   N ND2 . ASN A 1 411 ? -23.220  23.404  26.624  1.00 99.99  ? 415 ASN C ND2 1  
ATOM 2982   N N   . MET A 1 412 ? -22.734  27.685  25.841  1.00 30.00  ? 416 MET C N   1  
ATOM 2983   C CA  . MET A 1 412 ? -23.669  28.702  25.371  1.00 30.00  ? 416 MET C CA  1  
ATOM 2984   C C   . MET A 1 412 ? -25.052  28.203  24.947  1.00 30.00  ? 416 MET C C   1  
ATOM 2985   O O   . MET A 1 412 ? -26.017  28.959  24.990  1.00 30.00  ? 416 MET C O   1  
ATOM 2986   C CB  . MET A 1 412 ? -23.092  29.414  24.153  1.00 99.99  ? 416 MET C CB  1  
ATOM 2987   C CG  . MET A 1 412 ? -21.773  30.078  24.527  1.00 99.99  ? 416 MET C CG  1  
ATOM 2988   S SD  . MET A 1 412 ? -21.430  31.456  23.402  1.00 99.99  ? 416 MET C SD  1  
ATOM 2989   C CE  . MET A 1 412 ? -21.317  30.572  21.861  1.00 99.99  ? 416 MET C CE  1  
ATOM 2990   N N   . ASN A 1 413 ? -25.166  26.943  24.534  1.00 30.00  ? 417 ASN C N   1  
ATOM 2991   C CA  . ASN A 1 413 ? -26.464  26.415  24.119  1.00 30.00  ? 417 ASN C CA  1  
ATOM 2992   C C   . ASN A 1 413 ? -27.088  25.594  25.216  1.00 30.00  ? 417 ASN C C   1  
ATOM 2993   O O   . ASN A 1 413 ? -28.303  25.613  25.395  1.00 30.00  ? 417 ASN C O   1  
ATOM 2994   C CB  . ASN A 1 413 ? -26.294  25.531  22.888  1.00 99.99  ? 417 ASN C CB  1  
ATOM 2995   C CG  . ASN A 1 413 ? -25.531  24.258  23.228  1.00 99.99  ? 417 ASN C CG  1  
ATOM 2996   O OD1 . ASN A 1 413 ? -24.434  24.036  22.723  1.00 99.99  ? 417 ASN C OD1 1  
ATOM 2997   N ND2 . ASN A 1 413 ? -26.119  23.421  24.087  1.00 99.99  ? 417 ASN C ND2 1  
ATOM 2998   N N   . GLN A 1 414 ? -26.253  24.868  25.945  1.00 30.00  ? 418 GLN C N   1  
ATOM 2999   C CA  . GLN A 1 414 ? -26.720  24.044  27.045  1.00 30.00  ? 418 GLN C CA  1  
ATOM 3000   C C   . GLN A 1 414 ? -27.579  24.935  27.927  1.00 30.00  ? 418 GLN C C   1  
ATOM 3001   O O   . GLN A 1 414 ? -28.470  24.463  28.634  1.00 30.00  ? 418 GLN C O   1  
ATOM 3002   C CB  . GLN A 1 414 ? -25.530  23.497  27.827  1.00 99.99  ? 418 GLN C CB  1  
ATOM 3003   C CG  . GLN A 1 414 ? -25.852  22.093  28.328  1.00 99.99  ? 418 GLN C CG  1  
ATOM 3004   C CD  . GLN A 1 414 ? -26.993  22.118  29.334  1.00 99.99  ? 418 GLN C CD  1  
ATOM 3005   O OE1 . GLN A 1 414 ? -27.528  23.179  29.646  1.00 99.99  ? 418 GLN C OE1 1  
ATOM 3006   N NE2 . GLN A 1 414 ? -27.364  20.941  29.845  1.00 99.99  ? 418 GLN C NE2 1  
ATOM 3007   N N   . VAL A 1 415 ? -27.292  26.231  27.874  1.00 30.00  ? 419 VAL C N   1  
ATOM 3008   C CA  . VAL A 1 415 ? -28.015  27.228  28.648  1.00 30.00  ? 419 VAL C CA  1  
ATOM 3009   C C   . VAL A 1 415 ? -29.318  27.629  27.955  1.00 30.00  ? 419 VAL C C   1  
ATOM 3010   O O   . VAL A 1 415 ? -30.401  27.390  28.493  1.00 30.00  ? 419 VAL C O   1  
ATOM 3011   C CB  . VAL A 1 415 ? -27.155  28.477  28.817  1.00 99.99  ? 419 VAL C CB  1  
ATOM 3012   C CG1 . VAL A 1 415 ? -25.864  28.113  29.545  1.00 99.99  ? 419 VAL C CG1 1  
ATOM 3013   C CG2 . VAL A 1 415 ? -26.819  29.053  27.446  1.00 99.99  ? 419 VAL C CG2 1  
ATOM 3014   N N   . VAL A 1 416 ? -29.224  28.229  26.771  1.00 30.00  ? 420 VAL C N   1  
ATOM 3015   C CA  . VAL A 1 416 ? -30.419  28.645  26.040  1.00 30.00  ? 420 VAL C CA  1  
ATOM 3016   C C   . VAL A 1 416 ? -31.442  27.514  25.913  1.00 30.00  ? 420 VAL C C   1  
ATOM 3017   O O   . VAL A 1 416 ? -32.624  27.749  25.653  1.00 30.00  ? 420 VAL C O   1  
ATOM 3018   C CB  . VAL A 1 416 ? -30.037  29.094  24.635  1.00 99.99  ? 420 VAL C CB  1  
ATOM 3019   C CG1 . VAL A 1 416 ? -29.069  30.268  24.720  1.00 99.99  ? 420 VAL C CG1 1  
ATOM 3020   C CG2 . VAL A 1 416 ? -29.374  27.938  23.894  1.00 99.99  ? 420 VAL C CG2 1  
ATOM 3021   N N   . ASN A 1 417 ? -30.988  26.283  26.089  1.00 30.00  ? 421 ASN C N   1  
ATOM 3022   C CA  . ASN A 1 417 ? -31.893  25.165  25.987  1.00 30.00  ? 421 ASN C CA  1  
ATOM 3023   C C   . ASN A 1 417 ? -32.441  24.808  27.360  1.00 30.00  ? 421 ASN C C   1  
ATOM 3024   O O   . ASN A 1 417 ? -33.497  24.185  27.455  1.00 30.00  ? 421 ASN C O   1  
ATOM 3025   C CB  . ASN A 1 417 ? -31.161  23.956  25.416  1.00 99.99  ? 421 ASN C CB  1  
ATOM 3026   C CG  . ASN A 1 417 ? -30.673  24.228  24.000  1.00 99.99  ? 421 ASN C CG  1  
ATOM 3027   O OD1 . ASN A 1 417 ? -31.457  24.612  23.134  1.00 99.99  ? 421 ASN C OD1 1  
ATOM 3028   N ND2 . ASN A 1 417 ? -29.375  24.028  23.768  1.00 99.99  ? 421 ASN C ND2 1  
ATOM 3029   N N   . SER A 1 418 ? -31.743  25.187  28.425  1.00 30.00  ? 422 SER C N   1  
ATOM 3030   C CA  . SER A 1 418 ? -32.244  24.883  29.767  1.00 30.00  ? 422 SER C CA  1  
ATOM 3031   C C   . SER A 1 418 ? -33.175  26.036  30.130  1.00 30.00  ? 422 SER C C   1  
ATOM 3032   O O   . SER A 1 418 ? -33.965  25.952  31.074  1.00 30.00  ? 422 SER C O   1  
ATOM 3033   C CB  . SER A 1 418 ? -31.077  24.791  30.746  1.00 99.99  ? 422 SER C CB  1  
ATOM 3034   O OG  . SER A 1 418 ? -30.490  26.083  30.916  1.00 99.99  ? 422 SER C OG  1  
ATOM 3035   N N   . VAL A 1 419 ? -33.070  27.114  29.365  1.00 30.00  ? 423 VAL C N   1  
ATOM 3036   C CA  . VAL A 1 419 ? -33.913  28.276  29.569  1.00 30.00  ? 423 VAL C CA  1  
ATOM 3037   C C   . VAL A 1 419 ? -35.262  27.751  29.120  1.00 30.00  ? 423 VAL C C   1  
ATOM 3038   O O   . VAL A 1 419 ? -36.249  27.818  29.857  1.00 30.00  ? 423 VAL C O   1  
ATOM 3039   C CB  . VAL A 1 419 ? -33.409  29.439  28.722  1.00 99.99  ? 423 VAL C CB  1  
ATOM 3040   C CG1 . VAL A 1 419 ? -31.978  29.780  29.127  1.00 99.99  ? 423 VAL C CG1 1  
ATOM 3041   C CG2 . VAL A 1 419 ? -33.440  29.047  27.247  1.00 99.99  ? 423 VAL C CG2 1  
ATOM 3042   N N   . GLY A 1 420 ? -35.284  27.217  27.903  1.00 30.00  ? 424 GLY C N   1  
ATOM 3043   C CA  . GLY A 1 420 ? -36.509  26.665  27.372  1.00 30.00  ? 424 GLY C CA  1  
ATOM 3044   C C   . GLY A 1 420 ? -37.019  25.549  28.280  1.00 30.00  ? 424 GLY C C   1  
ATOM 3045   O O   . GLY A 1 420 ? -38.215  25.432  28.517  1.00 30.00  ? 424 GLY C O   1  
ATOM 3046   N N   . ALA A 1 421 ? -36.121  24.726  28.806  1.00 30.00  ? 425 ALA C N   1  
ATOM 3047   C CA  . ALA A 1 421 ? -36.551  23.625  29.675  1.00 30.00  ? 425 ALA C CA  1  
ATOM 3048   C C   . ALA A 1 421 ? -37.314  24.168  30.869  1.00 30.00  ? 425 ALA C C   1  
ATOM 3049   O O   . ALA A 1 421 ? -38.246  23.533  31.384  1.00 30.00  ? 425 ALA C O   1  
ATOM 3050   C CB  . ALA A 1 421 ? -35.328  22.819  30.143  1.00 30.00  ? 425 ALA C CB  1  
ATOM 3051   N N   . LEU A 1 422 ? -36.905  25.352  31.301  1.00 30.00  ? 426 LEU C N   1  
ATOM 3052   C CA  . LEU A 1 422 ? -37.519  26.020  32.438  1.00 30.00  ? 426 LEU C CA  1  
ATOM 3053   C C   . LEU A 1 422 ? -38.866  26.643  32.068  1.00 30.00  ? 426 LEU C C   1  
ATOM 3054   O O   . LEU A 1 422 ? -39.856  26.462  32.785  1.00 30.00  ? 426 LEU C O   1  
ATOM 3055   C CB  . LEU A 1 422 ? -36.603  27.129  32.943  1.00 99.99  ? 426 LEU C CB  1  
ATOM 3056   C CG  . LEU A 1 422 ? -35.740  26.600  34.082  1.00 99.99  ? 426 LEU C CG  1  
ATOM 3057   C CD1 . LEU A 1 422 ? -35.071  27.770  34.800  1.00 99.99  ? 426 LEU C CD1 1  
ATOM 3058   C CD2 . LEU A 1 422 ? -36.611  25.829  35.065  1.00 99.99  ? 426 LEU C CD2 1  
ATOM 3059   N N   . ALA A 1 423 ? -38.895  27.386  30.959  1.00 30.00  ? 427 ALA C N   1  
ATOM 3060   C CA  . ALA A 1 423 ? -40.131  28.013  30.501  1.00 30.00  ? 427 ALA C CA  1  
ATOM 3061   C C   . ALA A 1 423 ? -41.197  26.905  30.441  1.00 30.00  ? 427 ALA C C   1  
ATOM 3062   O O   . ALA A 1 423 ? -42.199  26.954  31.164  1.00 30.00  ? 427 ALA C O   1  
ATOM 3063   C CB  . ALA A 1 423 ? -39.919  28.649  29.113  1.00 30.00  ? 427 ALA C CB  1  
ATOM 3064   N N   . LYS A 1 424 ? -40.947  25.903  29.590  1.00 30.00  ? 428 LYS C N   1  
ATOM 3065   C CA  . LYS A 1 424 ? -41.845  24.755  29.400  1.00 30.00  ? 428 LYS C CA  1  
ATOM 3066   C C   . LYS A 1 424 ? -42.280  24.138  30.726  1.00 30.00  ? 428 LYS C C   1  
ATOM 3067   O O   . LYS A 1 424 ? -43.474  23.974  30.976  1.00 30.00  ? 428 LYS C O   1  
ATOM 3068   C CB  . LYS A 1 424 ? -41.142  23.675  28.587  1.00 99.99  ? 428 LYS C CB  1  
ATOM 3069   C CG  . LYS A 1 424 ? -40.728  24.242  27.236  1.00 99.99  ? 428 LYS C CG  1  
ATOM 3070   C CD  . LYS A 1 424 ? -40.114  23.136  26.385  1.00 99.99  ? 428 LYS C CD  1  
ATOM 3071   C CE  . LYS A 1 424 ? -39.724  23.699  25.023  1.00 99.99  ? 428 LYS C CE  1  
ATOM 3072   N NZ  . LYS A 1 424 ? -39.589  22.598  24.056  1.00 99.99  ? 428 LYS C NZ  1  
ATOM 3073   N N   . SER A 1 425 ? -41.324  23.801  31.581  1.00 30.00  ? 429 SER C N   1  
ATOM 3074   C CA  . SER A 1 425 ? -41.667  23.186  32.863  1.00 30.00  ? 429 SER C CA  1  
ATOM 3075   C C   . SER A 1 425 ? -42.500  24.056  33.808  1.00 30.00  ? 429 SER C C   1  
ATOM 3076   O O   . SER A 1 425 ? -43.286  23.542  34.619  1.00 30.00  ? 429 SER C O   1  
ATOM 3077   C CB  . SER A 1 425 ? -40.394  22.829  33.625  1.00 99.99  ? 429 SER C CB  1  
ATOM 3078   O OG  . SER A 1 425 ? -39.722  24.028  34.021  1.00 99.99  ? 429 SER C OG  1  
ATOM 3079   N N   . LEU A 1 426 ? -42.330  25.375  33.724  1.00 30.00  ? 430 LEU C N   1  
ATOM 3080   C CA  . LEU A 1 426 ? -43.096  26.258  34.586  1.00 30.00  ? 430 LEU C CA  1  
ATOM 3081   C C   . LEU A 1 426 ? -44.543  26.174  34.112  1.00 30.00  ? 430 LEU C C   1  
ATOM 3082   O O   . LEU A 1 426 ? -45.459  25.803  34.857  1.00 30.00  ? 430 LEU C O   1  
ATOM 3083   C CB  . LEU A 1 426 ? -42.570  27.684  34.466  1.00 99.99  ? 430 LEU C CB  1  
ATOM 3084   C CG  . LEU A 1 426 ? -41.556  27.951  35.575  1.00 99.99  ? 430 LEU C CG  1  
ATOM 3085   C CD1 . LEU A 1 426 ? -41.277  29.446  35.662  1.00 99.99  ? 430 LEU C CD1 1  
ATOM 3086   C CD2 . LEU A 1 426 ? -42.115  27.456  36.904  1.00 99.99  ? 430 LEU C CD2 1  
ATOM 3087   N N   . TYR A 1 427 ? -44.720  26.522  32.849  1.00 30.00  ? 431 TYR C N   1  
ATOM 3088   C CA  . TYR A 1 427 ? -46.015  26.514  32.202  1.00 30.00  ? 431 TYR C CA  1  
ATOM 3089   C C   . TYR A 1 427 ? -46.775  25.202  32.363  1.00 30.00  ? 431 TYR C C   1  
ATOM 3090   O O   . TYR A 1 427 ? -48.005  25.199  32.436  1.00 30.00  ? 431 TYR C O   1  
ATOM 3091   C CB  . TYR A 1 427 ? -45.848  26.756  30.706  1.00 99.99  ? 431 TYR C CB  1  
ATOM 3092   C CG  . TYR A 1 427 ? -47.202  26.748  30.039  1.00 99.99  ? 431 TYR C CG  1  
ATOM 3093   C CD1 . TYR A 1 427 ? -47.990  27.907  30.041  1.00 99.99  ? 431 TYR C CD1 1  
ATOM 3094   C CD2 . TYR A 1 427 ? -47.671  25.583  29.420  1.00 99.99  ? 431 TYR C CD2 1  
ATOM 3095   C CE1 . TYR A 1 427 ? -49.246  27.899  29.421  1.00 99.99  ? 431 TYR C CE1 1  
ATOM 3096   C CE2 . TYR A 1 427 ? -48.928  25.577  28.801  1.00 99.99  ? 431 TYR C CE2 1  
ATOM 3097   C CZ  . TYR A 1 427 ? -49.713  26.736  28.803  1.00 99.99  ? 431 TYR C CZ  1  
ATOM 3098   O OH  . TYR A 1 427 ? -50.935  26.729  28.202  1.00 99.99  ? 431 TYR C OH  1  
ATOM 3099   N N   . ASP A 1 428 ? -46.063  24.085  32.420  1.00 30.00  ? 432 ASP C N   1  
ATOM 3100   C CA  . ASP A 1 428 ? -46.745  22.812  32.573  1.00 30.00  ? 432 ASP C CA  1  
ATOM 3101   C C   . ASP A 1 428 ? -47.332  22.796  33.979  1.00 30.00  ? 432 ASP C C   1  
ATOM 3102   O O   . ASP A 1 428 ? -48.524  22.538  34.148  1.00 30.00  ? 432 ASP C O   1  
ATOM 3103   C CB  . ASP A 1 428 ? -45.758  21.665  32.389  1.00 99.99  ? 432 ASP C CB  1  
ATOM 3104   C CG  . ASP A 1 428 ? -45.313  21.605  30.930  1.00 99.99  ? 432 ASP C CG  1  
ATOM 3105   O OD1 . ASP A 1 428 ? -46.199  21.362  30.068  1.00 99.99  ? 432 ASP C OD1 1  
ATOM 3106   O OD2 . ASP A 1 428 ? -44.091  21.803  30.691  1.00 99.99  ? 432 ASP C OD2 1  
ATOM 3107   N N   . ARG A 1 429 ? -46.531  23.506  35.176  1.00 30.00  ? 433 ARG C N   1  
ATOM 3108   C CA  . ARG A 1 429 ? -46.971  23.570  36.580  1.00 30.00  ? 433 ARG C CA  1  
ATOM 3109   C C   . ARG A 1 429 ? -48.126  24.566  36.735  1.00 30.00  ? 433 ARG C C   1  
ATOM 3110   O O   . ARG A 1 429 ? -49.083  24.315  37.475  1.00 30.00  ? 433 ARG C O   1  
ATOM 3111   C CB  . ARG A 1 429 ? -45.814  24.017  37.467  1.00 99.99  ? 433 ARG C CB  1  
ATOM 3112   C CG  . ARG A 1 429 ? -46.241  23.963  38.928  1.00 99.99  ? 433 ARG C CG  1  
ATOM 3113   C CD  . ARG A 1 429 ? -45.129  24.526  39.804  1.00 99.99  ? 433 ARG C CD  1  
ATOM 3114   N NE  . ARG A 1 429 ? -45.012  25.992  39.638  1.00 99.99  ? 433 ARG C NE  1  
ATOM 3115   C CZ  . ARG A 1 429 ? -44.170  26.736  40.347  1.00 99.99  ? 433 ARG C CZ  1  
ATOM 3116   N NH1 . ARG A 1 429 ? -43.366  26.213  41.266  1.00 99.99  ? 433 ARG C NH1 1  
ATOM 3117   N NH2 . ARG A 1 429 ? -44.146  28.046  40.114  1.00 99.99  ? 433 ARG C NH2 1  
ATOM 3118   N N   . MET A 1 430 ? -48.026  25.694  36.042  1.00 30.00  ? 434 MET C N   1  
ATOM 3119   C CA  . MET A 1 430 ? -49.059  26.710  36.088  1.00 30.00  ? 434 MET C CA  1  
ATOM 3120   C C   . MET A 1 430 ? -50.373  26.066  35.671  1.00 30.00  ? 434 MET C C   1  
ATOM 3121   O O   . MET A 1 430 ? -51.344  26.058  36.438  1.00 30.00  ? 434 MET C O   1  
ATOM 3122   C CB  . MET A 1 430 ? -48.712  27.847  35.133  1.00 99.99  ? 434 MET C CB  1  
ATOM 3123   C CG  . MET A 1 430 ? -49.764  28.945  35.242  1.00 99.99  ? 434 MET C CG  1  
ATOM 3124   S SD  . MET A 1 430 ? -49.206  30.429  34.370  1.00 99.99  ? 434 MET C SD  1  
ATOM 3125   C CE  . MET A 1 430 ? -50.632  31.471  34.584  1.00 99.99  ? 434 MET C CE  1  
ATOM 3126   N N   . PHE A 1 431 ? -50.387  25.519  34.451  1.00 30.00  ? 435 PHE C N   1  
ATOM 3127   C CA  . PHE A 1 431 ? -51.571  24.859  33.893  1.00 30.00  ? 435 PHE C CA  1  
ATOM 3128   C C   . PHE A 1 431 ? -52.123  23.781  34.843  1.00 30.00  ? 435 PHE C C   1  
ATOM 3129   O O   . PHE A 1 431 ? -53.342  23.654  35.039  1.00 30.00  ? 435 PHE C O   1  
ATOM 3130   C CB  . PHE A 1 431 ? -51.216  24.189  32.570  1.00 99.99  ? 435 PHE C CB  1  
ATOM 3131   C CG  . PHE A 1 431 ? -52.439  23.511  32.003  1.00 99.99  ? 435 PHE C CG  1  
ATOM 3132   C CD1 . PHE A 1 431 ? -53.372  24.252  31.266  1.00 99.99  ? 435 PHE C CD1 1  
ATOM 3133   C CD2 . PHE A 1 431 ? -52.644  22.143  32.212  1.00 99.99  ? 435 PHE C CD2 1  
ATOM 3134   C CE1 . PHE A 1 431 ? -54.508  23.626  30.741  1.00 99.99  ? 435 PHE C CE1 1  
ATOM 3135   C CE2 . PHE A 1 431 ? -53.779  21.515  31.687  1.00 99.99  ? 435 PHE C CE2 1  
ATOM 3136   C CZ  . PHE A 1 431 ? -54.711  22.258  30.951  1.00 99.99  ? 435 PHE C CZ  1  
ATOM 3137   N N   . ASN A 1 432 ? -51.237  23.006  35.448  1.00 30.00  ? 436 ASN C N   1  
ATOM 3138   C CA  . ASN A 1 432 ? -51.703  21.975  36.355  1.00 30.00  ? 436 ASN C CA  1  
ATOM 3139   C C   . ASN A 1 432 ? -52.291  22.596  37.604  1.00 30.00  ? 436 ASN C C   1  
ATOM 3140   O O   . ASN A 1 432 ? -53.374  22.206  38.024  1.00 30.00  ? 436 ASN C O   1  
ATOM 3141   C CB  . ASN A 1 432 ? -50.541  21.073  36.754  1.00 99.99  ? 436 ASN C CB  1  
ATOM 3142   C CG  . ASN A 1 432 ? -49.970  20.341  35.548  1.00 99.99  ? 436 ASN C CG  1  
ATOM 3143   O OD1 . ASN A 1 432 ? -50.704  19.675  34.820  1.00 99.99  ? 436 ASN C OD1 1  
ATOM 3144   N ND2 . ASN A 1 432 ? -48.659  20.469  35.336  1.00 99.99  ? 436 ASN C ND2 1  
ATOM 3145   N N   . TRP A 1 433 ? -51.599  23.567  38.200  1.00 30.00  ? 437 TRP C N   1  
ATOM 3146   C CA  . TRP A 1 433 ? -52.124  24.206  39.401  1.00 30.00  ? 437 TRP C CA  1  
ATOM 3147   C C   . TRP A 1 433 ? -53.464  24.864  39.035  1.00 30.00  ? 437 TRP C C   1  
ATOM 3148   O O   . TRP A 1 433 ? -54.469  24.702  39.750  1.00 30.00  ? 437 TRP C O   1  
ATOM 3149   C CB  . TRP A 1 433 ? -51.141  25.262  39.897  1.00 99.99  ? 437 TRP C CB  1  
ATOM 3150   C CG  . TRP A 1 433 ? -51.502  25.902  41.217  1.00 99.99  ? 437 TRP C CG  1  
ATOM 3151   C CD1 . TRP A 1 433 ? -52.429  26.845  41.428  1.00 99.99  ? 437 TRP C CD1 1  
ATOM 3152   C CD2 . TRP A 1 433 ? -50.945  25.639  42.473  1.00 99.99  ? 437 TRP C CD2 1  
ATOM 3153   N NE1 . TRP A 1 433 ? -52.415  27.140  42.826  1.00 99.99  ? 437 TRP C NE1 1  
ATOM 3154   C CE2 . TRP A 1 433 ? -51.511  26.393  43.411  1.00 99.99  ? 437 TRP C CE2 1  
ATOM 3155   C CE3 . TRP A 1 433 ? -49.933  24.736  42.827  1.00 99.99  ? 437 TRP C CE3 1  
ATOM 3156   C CZ2 . TRP A 1 433 ? -51.167  26.357  44.768  1.00 99.99  ? 437 TRP C CZ2 1  
ATOM 3157   C CZ3 . TRP A 1 433 ? -49.570  24.685  44.190  1.00 99.99  ? 437 TRP C CZ3 1  
ATOM 3158   C CH2 . TRP A 1 433 ? -50.163  25.462  45.118  1.00 99.99  ? 437 TRP C CH2 1  
ATOM 3159   N N   . LEU A 1 434 ? -53.480  25.590  37.919  1.00 30.00  ? 438 LEU C N   1  
ATOM 3160   C CA  . LEU A 1 434 ? -54.697  26.261  37.463  1.00 30.00  ? 438 LEU C CA  1  
ATOM 3161   C C   . LEU A 1 434 ? -55.929  25.368  37.481  1.00 30.00  ? 438 LEU C C   1  
ATOM 3162   O O   . LEU A 1 434 ? -56.993  25.790  37.929  1.00 30.00  ? 438 LEU C O   1  
ATOM 3163   C CB  . LEU A 1 434 ? -54.518  26.753  36.031  1.00 99.99  ? 438 LEU C CB  1  
ATOM 3164   C CG  . LEU A 1 434 ? -55.829  27.341  35.525  1.00 99.99  ? 438 LEU C CG  1  
ATOM 3165   C CD1 . LEU A 1 434 ? -55.667  27.762  34.067  1.00 99.99  ? 438 LEU C CD1 1  
ATOM 3166   C CD2 . LEU A 1 434 ? -56.932  26.294  35.631  1.00 99.99  ? 438 LEU C CD2 1  
ATOM 3167   N N   . VAL A 1 435 ? -55.789  24.135  36.998  1.00 30.00  ? 439 VAL C N   1  
ATOM 3168   C CA  . VAL A 1 435 ? -56.916  23.201  36.957  1.00 30.00  ? 439 VAL C CA  1  
ATOM 3169   C C   . VAL A 1 435 ? -57.333  22.763  38.359  1.00 30.00  ? 439 VAL C C   1  
ATOM 3170   O O   . VAL A 1 435 ? -58.522  22.695  38.657  1.00 30.00  ? 439 VAL C O   1  
ATOM 3171   C CB  . VAL A 1 435 ? -56.529  21.956  36.166  1.00 99.99  ? 439 VAL C CB  1  
ATOM 3172   C CG1 . VAL A 1 435 ? -56.157  22.355  34.740  1.00 99.99  ? 439 VAL C CG1 1  
ATOM 3173   C CG2 . VAL A 1 435 ? -55.336  21.277  36.830  1.00 99.99  ? 439 VAL C CG2 1  
ATOM 3174   N N   . ARG A 1 436 ? -56.351  22.468  39.209  1.00 30.00  ? 440 ARG C N   1  
ATOM 3175   C CA  . ARG A 1 436 ? -56.577  22.035  40.598  1.00 30.00  ? 440 ARG C CA  1  
ATOM 3176   C C   . ARG A 1 436 ? -57.436  23.076  41.297  1.00 30.00  ? 440 ARG C C   1  
ATOM 3177   O O   . ARG A 1 436 ? -58.356  22.750  42.053  1.00 30.00  ? 440 ARG C O   1  
ATOM 3178   C CB  . ARG A 1 436 ? -55.243  21.897  41.321  1.00 99.99  ? 440 ARG C CB  1  
ATOM 3179   C CG  . ARG A 1 436 ? -54.391  20.843  40.621  1.00 99.99  ? 440 ARG C CG  1  
ATOM 3180   C CD  . ARG A 1 436 ? -53.009  20.795  41.269  1.00 99.99  ? 440 ARG C CD  1  
ATOM 3181   N NE  . ARG A 1 436 ? -52.192  21.960  40.861  1.00 99.99  ? 440 ARG C NE  1  
ATOM 3182   C CZ  . ARG A 1 436 ? -50.976  22.195  41.347  1.00 99.99  ? 440 ARG C CZ  1  
ATOM 3183   N NH1 . ARG A 1 436 ? -50.404  21.391  42.241  1.00 99.99  ? 440 ARG C NH1 1  
ATOM 3184   N NH2 . ARG A 1 436 ? -50.326  23.272  40.912  1.00 99.99  ? 440 ARG C NH2 1  
ATOM 3185   N N   . ARG A 1 437 ? -57.101  24.337  41.021  1.00 30.00  ? 441 ARG C N   1  
ATOM 3186   C CA  . ARG A 1 437 ? -57.772  25.508  41.577  1.00 30.00  ? 441 ARG C CA  1  
ATOM 3187   C C   . ARG A 1 437 ? -59.211  25.660  41.073  1.00 30.00  ? 441 ARG C C   1  
ATOM 3188   O O   . ARG A 1 437 ? -60.112  25.926  41.860  1.00 30.00  ? 441 ARG C O   1  
ATOM 3189   C CB  . ARG A 1 437 ? -57.011  26.773  41.194  1.00 99.99  ? 441 ARG C CB  1  
ATOM 3190   C CG  . ARG A 1 437 ? -57.253  27.852  42.242  1.00 99.99  ? 441 ARG C CG  1  
ATOM 3191   C CD  . ARG A 1 437 ? -56.554  29.139  41.820  1.00 99.99  ? 441 ARG C CD  1  
ATOM 3192   N NE  . ARG A 1 437 ? -55.130  28.889  41.499  1.00 99.99  ? 441 ARG C NE  1  
ATOM 3193   C CZ  . ARG A 1 437 ? -54.490  29.508  40.510  1.00 99.99  ? 441 ARG C CZ  1  
ATOM 3194   N NH1 . ARG A 1 437 ? -55.091  30.406  39.735  1.00 99.99  ? 441 ARG C NH1 1  
ATOM 3195   N NH2 . ARG A 1 437 ? -53.209  29.206  40.311  1.00 99.99  ? 441 ARG C NH2 1  
ATOM 3196   N N   . VAL A 1 438 ? -59.426  25.498  39.768  1.00 30.00  ? 442 VAL C N   1  
ATOM 3197   C CA  . VAL A 1 438 ? -60.766  25.619  39.215  1.00 30.00  ? 442 VAL C CA  1  
ATOM 3198   C C   . VAL A 1 438 ? -61.652  24.461  39.676  1.00 30.00  ? 442 VAL C C   1  
ATOM 3199   O O   . VAL A 1 438 ? -62.870  24.496  39.516  1.00 30.00  ? 442 VAL C O   1  
ATOM 3200   C CB  . VAL A 1 438 ? -60.702  25.605  37.692  1.00 99.99  ? 442 VAL C CB  1  
ATOM 3201   C CG1 . VAL A 1 438 ? -59.853  26.776  37.207  1.00 99.99  ? 442 VAL C CG1 1  
ATOM 3202   C CG2 . VAL A 1 438 ? -60.080  24.296  37.219  1.00 99.99  ? 442 VAL C CG2 1  
ATOM 3203   N N   . ASN A 1 439 ? -61.044  23.437  40.255  1.00 30.00  ? 443 ASN C N   1  
ATOM 3204   C CA  . ASN A 1 439 ? -61.809  22.298  40.725  1.00 30.00  ? 443 ASN C CA  1  
ATOM 3205   C C   . ASN A 1 439 ? -62.162  22.577  42.144  1.00 30.00  ? 443 ASN C C   1  
ATOM 3206   O O   . ASN A 1 439 ? -63.107  22.005  42.688  1.00 30.00  ? 443 ASN C O   1  
ATOM 3207   C CB  . ASN A 1 439 ? -60.972  21.029  40.617  1.00 99.99  ? 443 ASN C CB  1  
ATOM 3208   C CG  . ASN A 1 439 ? -61.805  19.791  40.916  1.00 99.99  ? 443 ASN C CG  1  
ATOM 3209   O OD1 . ASN A 1 439 ? -61.505  19.046  41.846  1.00 99.99  ? 443 ASN C OD1 1  
ATOM 3210   N ND2 . ASN A 1 439 ? -62.857  19.572  40.123  1.00 99.99  ? 443 ASN C ND2 1  
ATOM 3211   N N   . LYS A 1 440 ? -61.365  23.456  42.744  1.00 30.00  ? 444 LYS C N   1  
ATOM 3212   C CA  . LYS A 1 440 ? -61.545  23.889  44.128  1.00 30.00  ? 444 LYS C CA  1  
ATOM 3213   C C   . LYS A 1 440 ? -62.888  24.611  44.150  1.00 30.00  ? 444 LYS C C   1  
ATOM 3214   O O   . LYS A 1 440 ? -63.760  24.327  44.978  1.00 30.00  ? 444 LYS C O   1  
ATOM 3215   C CB  . LYS A 1 440 ? -60.406  24.817  44.533  1.00 99.99  ? 444 LYS C CB  1  
ATOM 3216   C CG  . LYS A 1 440 ? -60.545  25.185  46.006  1.00 99.99  ? 444 LYS C CG  1  
ATOM 3217   C CD  . LYS A 1 440 ? -59.218  25.722  46.526  1.00 99.99  ? 444 LYS C CD  1  
ATOM 3218   C CE  . LYS A 1 440 ? -59.442  26.427  47.859  1.00 99.99  ? 444 LYS C CE  1  
ATOM 3219   N NZ  . LYS A 1 440 ? -59.199  25.483  48.961  1.00 99.99  ? 444 LYS C NZ  1  
ATOM 3220   N N   . THR A 1 441 ? -63.024  25.541  43.213  1.00 30.00  ? 445 THR C N   1  
ATOM 3221   C CA  . THR A 1 441 ? -64.221  26.341  43.055  1.00 30.00  ? 445 THR C CA  1  
ATOM 3222   C C   . THR A 1 441 ? -65.465  25.488  42.755  1.00 30.00  ? 445 THR C C   1  
ATOM 3223   O O   . THR A 1 441 ? -66.575  25.835  43.175  1.00 30.00  ? 445 THR C O   1  
ATOM 3224   C CB  . THR A 1 441 ? -64.041  27.324  41.901  1.00 99.99  ? 445 THR C CB  1  
ATOM 3225   O OG1 . THR A 1 441 ? -63.982  26.603  40.667  1.00 99.99  ? 445 THR C OG1 1  
ATOM 3226   C CG2 . THR A 1 441 ? -62.746  28.103  42.096  1.00 99.99  ? 445 THR C CG2 1  
ATOM 3227   N N   . LEU A 1 442 ? -65.292  24.043  41.922  1.00 30.00  ? 446 LEU C N   1  
ATOM 3228   C CA  . LEU A 1 442 ? -66.376  23.143  41.513  1.00 30.00  ? 446 LEU C CA  1  
ATOM 3229   C C   . LEU A 1 442 ? -66.685  21.926  42.360  1.00 30.00  ? 446 LEU C C   1  
ATOM 3230   O O   . LEU A 1 442 ? -67.825  21.447  42.335  1.00 30.00  ? 446 LEU C O   1  
ATOM 3231   C CB  . LEU A 1 442 ? -66.084  22.574  40.131  1.00 99.99  ? 446 LEU C CB  1  
ATOM 3232   C CG  . LEU A 1 442 ? -66.776  23.425  39.072  1.00 99.99  ? 446 LEU C CG  1  
ATOM 3233   C CD1 . LEU A 1 442 ? -66.765  22.683  37.737  1.00 99.99  ? 446 LEU C CD1 1  
ATOM 3234   C CD2 . LEU A 1 442 ? -68.217  23.693  39.495  1.00 99.99  ? 446 LEU C CD2 1  
ATOM 3235   N N   . ASP A 1 443 ? -65.712  21.405  43.093  1.00 30.00  ? 447 ASP C N   1  
ATOM 3236   C CA  . ASP A 1 443 ? -66.005  20.245  43.914  1.00 30.00  ? 447 ASP C CA  1  
ATOM 3237   C C   . ASP A 1 443 ? -66.893  20.633  45.093  1.00 30.00  ? 447 ASP C C   1  
ATOM 3238   O O   . ASP A 1 443 ? -66.466  20.595  46.247  1.00 30.00  ? 447 ASP C O   1  
ATOM 3239   C CB  . ASP A 1 443 ? -64.709  19.649  44.450  1.00 99.99  ? 447 ASP C CB  1  
ATOM 3240   C CG  . ASP A 1 443 ? -64.998  18.300  45.102  1.00 99.99  ? 447 ASP C CG  1  
ATOM 3241   O OD1 . ASP A 1 443 ? -65.466  18.312  46.271  1.00 99.99  ? 447 ASP C OD1 1  
ATOM 3242   O OD2 . ASP A 1 443 ? -64.750  17.268  44.421  1.00 99.99  ? 447 ASP C OD2 1  
ATOM 3243   N N   . THR A 1 444 ? -68.136  21.017  44.824  1.00 30.00  ? 448 THR C N   1  
ATOM 3244   C CA  . THR A 1 444 ? -69.010  21.382  45.919  1.00 30.00  ? 448 THR C CA  1  
ATOM 3245   C C   . THR A 1 444 ? -69.220  20.091  46.703  1.00 30.00  ? 448 THR C C   1  
ATOM 3246   O O   . THR A 1 444 ? -69.548  19.055  46.124  1.00 30.00  ? 448 THR C O   1  
ATOM 3247   C CB  . THR A 1 444 ? -70.328  21.925  45.372  1.00 99.99  ? 448 THR C CB  1  
ATOM 3248   O OG1 . THR A 1 444 ? -71.047  20.869  44.731  1.00 99.99  ? 448 THR C OG1 1  
ATOM 3249   C CG2 . THR A 1 444 ? -70.040  23.029  44.359  1.00 99.99  ? 448 THR C CG2 1  
ATOM 3250   N N   . LYS A 1 445 ? -69.014  20.152  48.013  1.00 30.00  ? 449 LYS C N   1  
ATOM 3251   C CA  . LYS A 1 445 ? -69.176  18.974  48.844  1.00 30.00  ? 449 LYS C CA  1  
ATOM 3252   C C   . LYS A 1 445 ? -70.621  18.474  48.943  1.00 30.00  ? 449 LYS C C   1  
ATOM 3253   O O   . LYS A 1 445 ? -70.928  17.655  49.801  1.00 30.00  ? 449 LYS C O   1  
ATOM 3254   C CB  . LYS A 1 445 ? -68.710  19.274  50.264  1.00 99.99  ? 449 LYS C CB  1  
ATOM 3255   C CG  . LYS A 1 445 ? -68.791  18.005  51.106  1.00 99.99  ? 449 LYS C CG  1  
ATOM 3256   C CD  . LYS A 1 445 ? -67.935  18.166  52.356  1.00 99.99  ? 449 LYS C CD  1  
ATOM 3257   C CE  . LYS A 1 445 ? -68.295  17.082  53.366  1.00 99.99  ? 449 LYS C CE  1  
ATOM 3258   N NZ  . LYS A 1 445 ? -67.386  15.937  53.200  1.00 99.99  ? 449 LYS C NZ  1  
ATOM 3259   N N   . ALA A 1 446 ? -71.499  18.967  48.066  1.00 30.00  ? 450 ALA C N   1  
ATOM 3260   C CA  . ALA A 1 446 ? -72.910  18.556  48.051  1.00 30.00  ? 450 ALA C CA  1  
ATOM 3261   C C   . ALA A 1 446 ? -73.039  17.044  47.848  1.00 30.00  ? 450 ALA C C   1  
ATOM 3262   O O   . ALA A 1 446 ? -72.030  16.346  47.687  1.00 30.00  ? 450 ALA C O   1  
ATOM 3263   C CB  . ALA A 1 446 ? -73.662  19.308  46.944  1.00 30.00  ? 450 ALA C CB  1  
ATOM 3264   N N   . LYS A 1 447 ? -74.272  16.532  47.846  1.00 30.00  ? 451 LYS C N   1  
ATOM 3265   C CA  . LYS A 1 447 ? -74.504  15.090  47.687  1.00 30.00  ? 451 LYS C CA  1  
ATOM 3266   C C   . LYS A 1 447 ? -74.609  14.591  46.245  1.00 30.00  ? 451 LYS C C   1  
ATOM 3267   O O   . LYS A 1 447 ? -75.479  15.027  45.477  1.00 30.00  ? 451 LYS C O   1  
ATOM 3268   C CB  . LYS A 1 447 ? -75.809  14.696  48.367  1.00 99.99  ? 451 LYS C CB  1  
ATOM 3269   C CG  . LYS A 1 447 ? -75.994  13.185  48.282  1.00 99.99  ? 451 LYS C CG  1  
ATOM 3270   C CD  . LYS A 1 447 ? -77.024  12.738  49.313  1.00 99.99  ? 451 LYS C CD  1  
ATOM 3271   C CE  . LYS A 1 447 ? -77.483  11.320  48.992  1.00 99.99  ? 451 LYS C CE  1  
ATOM 3272   N NZ  . LYS A 1 447 ? -76.678  10.358  49.758  1.00 99.99  ? 451 LYS C NZ  1  
ATOM 3273   N N   . ARG A 1 448 ? -73.720  13.657  45.902  1.00 30.00  ? 452 ARG C N   1  
ATOM 3274   C CA  . ARG A 1 448 ? -73.657  13.071  44.562  1.00 30.00  ? 452 ARG C CA  1  
ATOM 3275   C C   . ARG A 1 448 ? -74.251  11.671  44.418  1.00 30.00  ? 452 ARG C C   1  
ATOM 3276   O O   . ARG A 1 448 ? -74.078  10.806  45.279  1.00 30.00  ? 452 ARG C O   1  
ATOM 3277   C CB  . ARG A 1 448 ? -72.204  12.960  44.113  1.00 99.99  ? 452 ARG C CB  1  
ATOM 3278   C CG  . ARG A 1 448 ? -71.523  14.317  44.251  1.00 99.99  ? 452 ARG C CG  1  
ATOM 3279   C CD  . ARG A 1 448 ? -70.093  14.224  43.733  1.00 99.99  ? 452 ARG C CD  1  
ATOM 3280   N NE  . ARG A 1 448 ? -69.334  15.453  44.047  1.00 99.99  ? 452 ARG C NE  1  
ATOM 3281   C CZ  . ARG A 1 448 ? -68.034  15.590  43.788  1.00 99.99  ? 452 ARG C CZ  1  
ATOM 3282   N NH1 . ARG A 1 448 ? -67.321  14.615  43.228  1.00 99.99  ? 452 ARG C NH1 1  
ATOM 3283   N NH2 . ARG A 1 448 ? -67.449  16.739  44.112  1.00 99.99  ? 452 ARG C NH2 1  
ATOM 3284   N N   . ASN A 1 449 ? -74.950  11.474  43.304  1.00 30.00  ? 453 ASN C N   1  
ATOM 3285   C CA  . ASN A 1 449 ? -75.580  10.202  42.981  1.00 30.00  ? 453 ASN C CA  1  
ATOM 3286   C C   . ASN A 1 449 ? -74.771  9.613   41.832  1.00 30.00  ? 453 ASN C C   1  
ATOM 3287   O O   . ASN A 1 449 ? -73.895  8.773   42.037  1.00 30.00  ? 453 ASN C O   1  
ATOM 3288   C CB  . ASN A 1 449 ? -77.029  10.429  42.571  1.00 99.99  ? 453 ASN C CB  1  
ATOM 3289   C CG  . ASN A 1 449 ? -77.856  10.951  43.737  1.00 99.99  ? 453 ASN C CG  1  
ATOM 3290   O OD1 . ASN A 1 449 ? -78.390  12.058  43.680  1.00 99.99  ? 453 ASN C OD1 1  
ATOM 3291   N ND2 . ASN A 1 449 ? -77.961  10.148  44.800  1.00 99.99  ? 453 ASN C ND2 1  
ATOM 3292   N N   . TYR A 1 450 ? -75.075  10.085  40.628  1.00 30.00  ? 454 TYR C N   1  
ATOM 3293   C CA  . TYR A 1 450 ? -74.392  9.624   39.424  1.00 30.00  ? 454 TYR C CA  1  
ATOM 3294   C C   . TYR A 1 450 ? -73.876  10.821  38.671  1.00 30.00  ? 454 TYR C C   1  
ATOM 3295   O O   . TYR A 1 450 ? -74.095  11.956  39.083  1.00 30.00  ? 454 TYR C O   1  
ATOM 3296   C CB  . TYR A 1 450 ? -75.364  8.845   38.544  1.00 99.99  ? 454 TYR C CB  1  
ATOM 3297   C CG  . TYR A 1 450 ? -76.398  9.788   37.975  1.00 99.99  ? 454 TYR C CG  1  
ATOM 3298   C CD1 . TYR A 1 450 ? -77.587  10.024  38.676  1.00 99.99  ? 454 TYR C CD1 1  
ATOM 3299   C CD2 . TYR A 1 450 ? -76.169  10.426  36.752  1.00 99.99  ? 454 TYR C CD2 1  
ATOM 3300   C CE1 . TYR A 1 450 ? -78.547  10.898  38.150  1.00 99.99  ? 454 TYR C CE1 1  
ATOM 3301   C CE2 . TYR A 1 450 ? -77.126  11.297  36.225  1.00 99.99  ? 454 TYR C CE2 1  
ATOM 3302   C CZ  . TYR A 1 450 ? -78.316  11.535  36.924  1.00 99.99  ? 454 TYR C CZ  1  
ATOM 3303   O OH  . TYR A 1 450 ? -79.249  12.384  36.414  1.00 99.99  ? 454 TYR C OH  1  
ATOM 3304   N N   . TYR A 1 451 ? -73.186  10.569  37.561  1.00 30.00  ? 455 TYR C N   1  
ATOM 3305   C CA  . TYR A 1 451 ? -72.659  11.665  36.758  1.00 30.00  ? 455 TYR C CA  1  
ATOM 3306   C C   . TYR A 1 451 ? -72.683  11.366  35.286  1.00 30.00  ? 455 TYR C C   1  
ATOM 3307   O O   . TYR A 1 451 ? -73.021  10.261  34.855  1.00 30.00  ? 455 TYR C O   1  
ATOM 3308   C CB  . TYR A 1 451 ? -71.213  11.951  37.153  1.00 99.99  ? 455 TYR C CB  1  
ATOM 3309   C CG  . TYR A 1 451 ? -70.350  10.764  36.791  1.00 99.99  ? 455 TYR C CG  1  
ATOM 3310   C CD1 . TYR A 1 451 ? -69.842  10.639  35.493  1.00 99.99  ? 455 TYR C CD1 1  
ATOM 3311   C CD2 . TYR A 1 451 ? -70.060  9.793   37.755  1.00 99.99  ? 455 TYR C CD2 1  
ATOM 3312   C CE1 . TYR A 1 451 ? -69.043  9.541   35.157  1.00 99.99  ? 455 TYR C CE1 1  
ATOM 3313   C CE2 . TYR A 1 451 ? -69.258  8.694   37.420  1.00 99.99  ? 455 TYR C CE2 1  
ATOM 3314   C CZ  . TYR A 1 451 ? -68.751  8.568   36.122  1.00 99.99  ? 455 TYR C CZ  1  
ATOM 3315   O OH  . TYR A 1 451 ? -67.974  7.500   35.796  1.00 99.99  ? 455 TYR C OH  1  
ATOM 3316   N N   . ILE A 1 452 ? -72.310  12.380  34.527  1.00 30.00  ? 456 ILE C N   1  
ATOM 3317   C CA  . ILE A 1 452 ? -72.252  12.304  33.087  1.00 30.00  ? 456 ILE C CA  1  
ATOM 3318   C C   . ILE A 1 452 ? -70.937  12.947  32.654  1.00 30.00  ? 456 ILE C C   1  
ATOM 3319   O O   . ILE A 1 452 ? -70.802  14.162  32.725  1.00 30.00  ? 456 ILE C O   1  
ATOM 3320   C CB  . ILE A 1 452 ? -73.434  13.056  32.480  1.00 99.99  ? 456 ILE C CB  1  
ATOM 3321   C CG1 . ILE A 1 452 ? -73.247  13.166  30.972  1.00 99.99  ? 456 ILE C CG1 1  
ATOM 3322   C CG2 . ILE A 1 452 ? -73.515  14.453  33.088  1.00 99.99  ? 456 ILE C CG2 1  
ATOM 3323   C CD1 . ILE A 1 452 ? -72.749  11.833  30.422  1.00 99.99  ? 456 ILE C CD1 1  
ATOM 3324   N N   . GLY A 1 453 ? -69.970  12.145  32.213  1.00 30.00  ? 457 GLY C N   1  
ATOM 3325   C CA  . GLY A 1 453 ? -68.703  12.714  31.777  1.00 30.00  ? 457 GLY C CA  1  
ATOM 3326   C C   . GLY A 1 453 ? -68.738  13.101  30.303  1.00 30.00  ? 457 GLY C C   1  
ATOM 3327   O O   . GLY A 1 453 ? -69.644  12.704  29.577  1.00 30.00  ? 457 GLY C O   1  
ATOM 3328   N N   . VAL A 1 454 ? -67.782  13.897  29.848  1.00 30.00  ? 458 VAL C N   1  
ATOM 3329   C CA  . VAL A 1 454 ? -67.754  14.274  28.447  1.00 30.00  ? 458 VAL C CA  1  
ATOM 3330   C C   . VAL A 1 454 ? -66.280  14.176  28.131  1.00 30.00  ? 458 VAL C C   1  
ATOM 3331   O O   . VAL A 1 454 ? -65.465  14.687  28.880  1.00 30.00  ? 458 VAL C O   1  
ATOM 3332   C CB  . VAL A 1 454 ? -68.310  15.681  28.275  1.00 99.99  ? 458 VAL C CB  1  
ATOM 3333   C CG1 . VAL A 1 454 ? -68.230  16.085  26.805  1.00 99.99  ? 458 VAL C CG1 1  
ATOM 3334   C CG2 . VAL A 1 454 ? -69.761  15.714  28.731  1.00 99.99  ? 458 VAL C CG2 1  
ATOM 3335   N N   . LEU A 1 455 ? -65.941  13.495  27.039  1.00 30.00  ? 459 LEU C N   1  
ATOM 3336   C CA  . LEU A 1 455 ? -64.552  13.322  26.665  1.00 30.00  ? 459 LEU C CA  1  
ATOM 3337   C C   . LEU A 1 455 ? -64.241  14.035  25.376  1.00 30.00  ? 459 LEU C C   1  
ATOM 3338   O O   . LEU A 1 455 ? -64.866  13.782  24.358  1.00 30.00  ? 459 LEU C O   1  
ATOM 3339   C CB  . LEU A 1 455 ? -64.247  11.839  26.480  1.00 99.99  ? 459 LEU C CB  1  
ATOM 3340   C CG  . LEU A 1 455 ? -63.674  11.272  27.776  1.00 99.99  ? 459 LEU C CG  1  
ATOM 3341   C CD1 . LEU A 1 455 ? -63.066  9.898   27.505  1.00 99.99  ? 459 LEU C CD1 1  
ATOM 3342   C CD2 . LEU A 1 455 ? -62.596  12.210  28.308  1.00 99.99  ? 459 LEU C CD2 1  
ATOM 3343   N N   . ASP A 1 456 ? -63.270  14.936  25.435  1.00 30.00  ? 460 ASP C N   1  
ATOM 3344   C CA  . ASP A 1 456 ? -62.833  15.721  24.284  1.00 30.00  ? 460 ASP C CA  1  
ATOM 3345   C C   . ASP A 1 456 ? -61.321  15.539  24.164  1.00 30.00  ? 460 ASP C C   1  
ATOM 3346   O O   . ASP A 1 456 ? -60.549  16.266  24.778  1.00 30.00  ? 460 ASP C O   1  
ATOM 3347   C CB  . ASP A 1 456 ? -63.182  17.189  24.500  1.00 99.99  ? 460 ASP C CB  1  
ATOM 3348   C CG  . ASP A 1 456 ? -62.420  17.723  25.709  1.00 99.99  ? 460 ASP C CG  1  
ATOM 3349   O OD1 . ASP A 1 456 ? -62.900  17.473  26.848  1.00 99.99  ? 460 ASP C OD1 1  
ATOM 3350   O OD2 . ASP A 1 456 ? -61.364  18.375  25.485  1.00 99.99  ? 460 ASP C OD2 1  
ATOM 3351   N N   . ILE A 1 457 ? -60.909  14.548  23.373  1.00 30.00  ? 461 ILE C N   1  
ATOM 3352   C CA  . ILE A 1 457 ? -59.489  14.247  23.165  1.00 30.00  ? 461 ILE C CA  1  
ATOM 3353   C C   . ILE A 1 457 ? -59.187  14.094  21.694  1.00 30.00  ? 461 ILE C C   1  
ATOM 3354   O O   . ILE A 1 457 ? -60.090  13.846  20.894  1.00 30.00  ? 461 ILE C O   1  
ATOM 3355   C CB  . ILE A 1 457 ? -59.124  12.949  23.875  1.00 99.99  ? 461 ILE C CB  1  
ATOM 3356   C CG1 . ILE A 1 457 ? -59.527  11.763  23.009  1.00 99.99  ? 461 ILE C CG1 1  
ATOM 3357   C CG2 . ILE A 1 457 ? -59.858  12.876  25.210  1.00 99.99  ? 461 ILE C CG2 1  
ATOM 3358   C CD1 . ILE A 1 457 ? -60.927  11.299  23.398  1.00 99.99  ? 461 ILE C CD1 1  
ATOM 3359   N N   . ALA A 1 458 ? -57.782  15.561  22.295  1.00 30.00  ? 462 ALA C N   1  
ATOM 3360   C CA  . ALA A 1 458 ? -57.299  16.343  21.159  1.00 30.00  ? 462 ALA C CA  1  
ATOM 3361   C C   . ALA A 1 458 ? -57.383  15.411  19.942  1.00 30.00  ? 462 ALA C C   1  
ATOM 3362   O O   . ALA A 1 458 ? -57.070  14.215  20.034  1.00 30.00  ? 462 ALA C O   1  
ATOM 3363   C CB  . ALA A 1 458 ? -55.888  16.843  21.402  1.00 30.00  ? 462 ALA C CB  1  
ATOM 3364   N N   . GLY A 1 459 ? -58.029  15.991  18.227  1.00 30.00  ? 463 GLY C N   1  
ATOM 3365   C CA  . GLY A 1 459 ? -58.035  14.712  17.536  1.00 30.00  ? 463 GLY C CA  1  
ATOM 3366   C C   . GLY A 1 459 ? -56.831  14.492  16.646  1.00 30.00  ? 463 GLY C C   1  
ATOM 3367   O O   . GLY A 1 459 ? -55.802  15.148  16.816  1.00 30.00  ? 463 GLY C O   1  
ATOM 3368   N N   . PHE A 1 460 ? -56.967  13.553  15.705  1.00 30.00  ? 464 PHE C N   1  
ATOM 3369   C CA  . PHE A 1 460 ? -55.905  13.215  14.756  1.00 30.00  ? 464 PHE C CA  1  
ATOM 3370   C C   . PHE A 1 460 ? -55.500  14.459  13.986  1.00 30.00  ? 464 PHE C C   1  
ATOM 3371   O O   . PHE A 1 460 ? -56.343  15.296  13.647  1.00 30.00  ? 464 PHE C O   1  
ATOM 3372   C CB  . PHE A 1 460 ? -56.399  12.154  13.781  1.00 99.99  ? 464 PHE C CB  1  
ATOM 3373   C CG  . PHE A 1 460 ? -55.299  11.810  12.808  1.00 99.99  ? 464 PHE C CG  1  
ATOM 3374   C CD1 . PHE A 1 460 ? -54.312  10.883  13.166  1.00 99.99  ? 464 PHE C CD1 1  
ATOM 3375   C CD2 . PHE A 1 460 ? -55.264  12.418  11.548  1.00 99.99  ? 464 PHE C CD2 1  
ATOM 3376   C CE1 . PHE A 1 460 ? -53.291  10.565  12.263  1.00 99.99  ? 464 PHE C CE1 1  
ATOM 3377   C CE2 . PHE A 1 460 ? -54.239  12.101  10.645  1.00 99.99  ? 464 PHE C CE2 1  
ATOM 3378   C CZ  . PHE A 1 460 ? -53.254  11.172  11.003  1.00 99.99  ? 464 PHE C CZ  1  
ATOM 3379   N N   . GLU A 1 461 ? -54.206  14.572  13.712  1.00 30.00  ? 465 GLU C N   1  
ATOM 3380   C CA  . GLU A 1 461 ? -53.676  15.708  12.977  1.00 30.00  ? 465 GLU C CA  1  
ATOM 3381   C C   . GLU A 1 461 ? -52.389  15.293  12.286  1.00 30.00  ? 465 GLU C C   1  
ATOM 3382   O O   . GLU A 1 461 ? -51.495  14.693  12.898  1.00 30.00  ? 465 GLU C O   1  
ATOM 3383   C CB  . GLU A 1 461 ? -53.393  16.861  13.934  1.00 99.99  ? 465 GLU C CB  1  
ATOM 3384   C CG  . GLU A 1 461 ? -53.679  18.172  13.243  1.00 99.99  ? 465 GLU C CG  1  
ATOM 3385   C CD  . GLU A 1 461 ? -52.699  18.361  12.086  1.00 99.99  ? 465 GLU C CD  1  
ATOM 3386   O OE1 . GLU A 1 461 ? -53.040  17.914  10.961  1.00 99.99  ? 465 GLU C OE1 1  
ATOM 3387   O OE2 . GLU A 1 461 ? -51.615  18.952  12.339  1.00 99.99  ? 465 GLU C OE2 1  
ATOM 3388   N N   . ILE A 1 462 ? -52.305  15.605  11.000  1.00 30.00  ? 466 ILE C N   1  
ATOM 3389   C CA  . ILE A 1 462 ? -51.134  15.284  10.210  1.00 30.00  ? 466 ILE C CA  1  
ATOM 3390   C C   . ILE A 1 462 ? -50.637  16.588  9.617   1.00 30.00  ? 466 ILE C C   1  
ATOM 3391   O O   . ILE A 1 462 ? -51.378  17.274  8.916   1.00 30.00  ? 466 ILE C O   1  
ATOM 3392   C CB  . ILE A 1 462 ? -51.505  14.298  9.107   1.00 99.99  ? 466 ILE C CB  1  
ATOM 3393   C CG1 . ILE A 1 462 ? -52.118  15.056  7.934   1.00 99.99  ? 466 ILE C CG1 1  
ATOM 3394   C CG2 . ILE A 1 462 ? -52.516  13.292  9.646   1.00 99.99  ? 466 ILE C CG2 1  
ATOM 3395   C CD1 . ILE A 1 462 ? -53.636  15.087  8.087   1.00 99.99  ? 466 ILE C CD1 1  
ATOM 3396   N N   . PHE A 1 463 ? -49.385  16.935  9.907   1.00 30.00  ? 467 PHE C N   1  
ATOM 3397   C CA  . PHE A 1 463 ? -48.811  18.173  9.397   1.00 30.00  ? 467 PHE C CA  1  
ATOM 3398   C C   . PHE A 1 463 ? -47.672  17.903  8.434   1.00 30.00  ? 467 PHE C C   1  
ATOM 3399   O O   . PHE A 1 463 ? -47.400  16.742  8.075   1.00 30.00  ? 467 PHE C O   1  
ATOM 3400   C CB  . PHE A 1 463 ? -48.275  19.012  10.550  1.00 99.99  ? 467 PHE C CB  1  
ATOM 3401   C CG  . PHE A 1 463 ? -47.683  20.292  10.012  1.00 99.99  ? 467 PHE C CG  1  
ATOM 3402   C CD1 . PHE A 1 463 ? -48.515  21.382  9.734   1.00 99.99  ? 467 PHE C CD1 1  
ATOM 3403   C CD2 . PHE A 1 463 ? -46.305  20.388  9.792   1.00 99.99  ? 467 PHE C CD2 1  
ATOM 3404   C CE1 . PHE A 1 463 ? -47.968  22.570  9.234   1.00 99.99  ? 467 PHE C CE1 1  
ATOM 3405   C CE2 . PHE A 1 463 ? -45.757  21.575  9.290   1.00 99.99  ? 467 PHE C CE2 1  
ATOM 3406   C CZ  . PHE A 1 463 ? -46.589  22.667  9.012   1.00 99.99  ? 467 PHE C CZ  1  
ATOM 3407   N N   . ASP A 1 464 ? -47.017  18.987  8.025   1.00 30.00  ? 468 ASP C N   1  
ATOM 3408   C CA  . ASP A 1 464 ? -45.885  18.943  7.111   1.00 30.00  ? 468 ASP C CA  1  
ATOM 3409   C C   . ASP A 1 464 ? -44.796  18.146  7.814   1.00 30.00  ? 468 ASP C C   1  
ATOM 3410   O O   . ASP A 1 464 ? -44.126  17.294  7.220   1.00 30.00  ? 468 ASP C O   1  
ATOM 3411   C CB  . ASP A 1 464 ? -45.410  20.357  6.802   1.00 99.99  ? 468 ASP C CB  1  
ATOM 3412   C CG  . ASP A 1 464 ? -46.470  21.084  5.981   1.00 99.99  ? 468 ASP C CG  1  
ATOM 3413   O OD1 . ASP A 1 464 ? -46.616  20.727  4.781   1.00 99.99  ? 468 ASP C OD1 1  
ATOM 3414   O OD2 . ASP A 1 464 ? -47.127  21.993  6.559   1.00 99.99  ? 468 ASP C OD2 1  
ATOM 3415   N N   . PHE A 1 465 ? -44.633  18.431  9.099   1.00 30.00  ? 469 PHE C N   1  
ATOM 3416   C CA  . PHE A 1 465 ? -43.639  17.757  9.910   1.00 30.00  ? 469 PHE C CA  1  
ATOM 3417   C C   . PHE A 1 465 ? -44.326  17.257  11.176  1.00 30.00  ? 469 PHE C C   1  
ATOM 3418   O O   . PHE A 1 465 ? -45.007  18.025  11.858  1.00 30.00  ? 469 PHE C O   1  
ATOM 3419   C CB  . PHE A 1 465 ? -42.520  18.730  10.270  1.00 99.99  ? 469 PHE C CB  1  
ATOM 3420   C CG  . PHE A 1 465 ? -41.489  18.021  11.113  1.00 99.99  ? 469 PHE C CG  1  
ATOM 3421   C CD1 . PHE A 1 465 ? -40.495  17.251  10.501  1.00 99.99  ? 469 PHE C CD1 1  
ATOM 3422   C CD2 . PHE A 1 465 ? -41.529  18.133  12.509  1.00 99.99  ? 469 PHE C CD2 1  
ATOM 3423   C CE1 . PHE A 1 465 ? -39.535  16.594  11.284  1.00 99.99  ? 469 PHE C CE1 1  
ATOM 3424   C CE2 . PHE A 1 465 ? -40.572  17.474  13.289  1.00 99.99  ? 469 PHE C CE2 1  
ATOM 3425   C CZ  . PHE A 1 465 ? -39.577  16.705  12.678  1.00 99.99  ? 469 PHE C CZ  1  
ATOM 3426   N N   . ASN A 1 466 ? -44.149  15.973  11.475  1.00 30.00  ? 470 ASN C N   1  
ATOM 3427   C CA  . ASN A 1 466 ? -44.748  15.352  12.657  1.00 30.00  ? 470 ASN C CA  1  
ATOM 3428   C C   . ASN A 1 466 ? -43.666  14.750  13.545  1.00 30.00  ? 470 ASN C C   1  
ATOM 3429   O O   . ASN A 1 466 ? -42.762  14.081  13.048  1.00 30.00  ? 470 ASN C O   1  
ATOM 3430   C CB  . ASN A 1 466 ? -45.711  14.248  12.232  1.00 99.99  ? 470 ASN C CB  1  
ATOM 3431   C CG  . ASN A 1 466 ? -46.870  14.809  11.422  1.00 99.99  ? 470 ASN C CG  1  
ATOM 3432   O OD1 . ASN A 1 466 ? -47.555  15.726  11.869  1.00 99.99  ? 470 ASN C OD1 1  
ATOM 3433   N ND2 . ASN A 1 466 ? -47.086  14.257  10.227  1.00 99.99  ? 470 ASN C ND2 1  
ATOM 3434   N N   . SER A 1 467 ? -43.757  14.991  14.852  1.00 30.00  ? 471 SER C N   1  
ATOM 3435   C CA  . SER A 1 467 ? -42.791  14.442  15.802  1.00 30.00  ? 471 SER C CA  1  
ATOM 3436   C C   . SER A 1 467 ? -43.478  13.809  17.015  1.00 30.00  ? 471 SER C C   1  
ATOM 3437   O O   . SER A 1 467 ? -44.665  13.453  16.971  1.00 30.00  ? 471 SER C O   1  
ATOM 3438   C CB  . SER A 1 467 ? -41.870  15.548  16.302  1.00 99.99  ? 471 SER C CB  1  
ATOM 3439   O OG  . SER A 1 467 ? -42.618  16.462  17.109  1.00 99.99  ? 471 SER C OG  1  
ATOM 3440   N N   . PHE A 1 468 ? -42.725  13.671  18.098  1.00 30.00  ? 472 PHE C N   1  
ATOM 3441   C CA  . PHE A 1 468 ? -43.229  13.072  19.329  1.00 30.00  ? 472 PHE C CA  1  
ATOM 3442   C C   . PHE A 1 468 ? -44.577  13.601  19.805  1.00 30.00  ? 472 PHE C C   1  
ATOM 3443   O O   . PHE A 1 468 ? -45.422  12.834  20.258  1.00 30.00  ? 472 PHE C O   1  
ATOM 3444   C CB  . PHE A 1 468 ? -42.243  13.322  20.467  1.00 99.99  ? 472 PHE C CB  1  
ATOM 3445   C CG  . PHE A 1 468 ? -42.772  12.699  21.735  1.00 99.99  ? 472 PHE C CG  1  
ATOM 3446   C CD1 . PHE A 1 468 ? -42.565  11.337  21.986  1.00 99.99  ? 472 PHE C CD1 1  
ATOM 3447   C CD2 . PHE A 1 468 ? -43.467  13.482  22.665  1.00 99.99  ? 472 PHE C CD2 1  
ATOM 3448   C CE1 . PHE A 1 468 ? -43.055  10.758  23.163  1.00 99.99  ? 472 PHE C CE1 1  
ATOM 3449   C CE2 . PHE A 1 468 ? -43.957  12.902  23.841  1.00 99.99  ? 472 PHE C CE2 1  
ATOM 3450   C CZ  . PHE A 1 468 ? -43.751  11.541  24.090  1.00 99.99  ? 472 PHE C CZ  1  
ATOM 3451   N N   . GLU A 1 469 ? -44.780  14.909  19.704  1.00 30.00  ? 473 GLU C N   1  
ATOM 3452   C CA  . GLU A 1 469 ? -46.025  15.533  20.140  1.00 30.00  ? 473 GLU C CA  1  
ATOM 3453   C C   . GLU A 1 469 ? -47.207  14.884  19.462  1.00 30.00  ? 473 GLU C C   1  
ATOM 3454   O O   . GLU A 1 469 ? -48.186  14.520  20.118  1.00 30.00  ? 473 GLU C O   1  
ATOM 3455   C CB  . GLU A 1 469 ? -46.015  17.016  19.792  1.00 99.99  ? 473 GLU C CB  1  
ATOM 3456   C CG  . GLU A 1 469 ? -44.927  17.711  20.577  1.00 99.99  ? 473 GLU C CG  1  
ATOM 3457   C CD  . GLU A 1 469 ? -45.338  17.802  22.044  1.00 99.99  ? 473 GLU C CD  1  
ATOM 3458   O OE1 . GLU A 1 469 ? -45.005  16.847  22.796  1.00 99.99  ? 473 GLU C OE1 1  
ATOM 3459   O OE2 . GLU A 1 469 ? -45.980  18.828  22.400  1.00 99.99  ? 473 GLU C OE2 1  
ATOM 3460   N N   . GLN A 1 470 ? -47.100  14.748  18.144  1.00 30.00  ? 474 GLN C N   1  
ATOM 3461   C CA  . GLN A 1 470 ? -48.156  14.146  17.347  1.00 30.00  ? 474 GLN C CA  1  
ATOM 3462   C C   . GLN A 1 470 ? -48.350  12.673  17.669  1.00 30.00  ? 474 GLN C C   1  
ATOM 3463   O O   . GLN A 1 470 ? -49.484  12.234  17.887  1.00 30.00  ? 474 GLN C O   1  
ATOM 3464   C CB  . GLN A 1 470 ? -47.817  14.260  15.865  1.00 99.99  ? 474 GLN C CB  1  
ATOM 3465   C CG  . GLN A 1 470 ? -49.100  14.198  15.042  1.00 99.99  ? 474 GLN C CG  1  
ATOM 3466   C CD  . GLN A 1 470 ? -49.510  12.759  14.770  1.00 99.99  ? 474 GLN C CD  1  
ATOM 3467   O OE1 . GLN A 1 470 ? -48.828  11.827  15.197  1.00 99.99  ? 474 GLN C OE1 1  
ATOM 3468   N NE2 . GLN A 1 470 ? -50.621  12.576  14.056  1.00 99.99  ? 474 GLN C NE2 1  
ATOM 3469   N N   . LEU A 1 471 ? -47.274  11.894  17.717  1.00 30.00  ? 475 LEU C N   1  
ATOM 3470   C CA  . LEU A 1 471 ? -47.429  10.470  18.019  1.00 30.00  ? 475 LEU C CA  1  
ATOM 3471   C C   . LEU A 1 471 ? -48.279  10.310  19.281  1.00 30.00  ? 475 LEU C C   1  
ATOM 3472   O O   . LEU A 1 471 ? -49.122  9.415   19.378  1.00 30.00  ? 475 LEU C O   1  
ATOM 3473   C CB  . LEU A 1 471 ? -46.063  9.835   18.246  1.00 99.99  ? 475 LEU C CB  1  
ATOM 3474   C CG  . LEU A 1 471 ? -45.566  9.213   16.945  1.00 99.99  ? 475 LEU C CG  1  
ATOM 3475   C CD1 . LEU A 1 471 ? -44.378  8.303   17.235  1.00 99.99  ? 475 LEU C CD1 1  
ATOM 3476   C CD2 . LEU A 1 471 ? -46.689  8.396   16.312  1.00 99.99  ? 475 LEU C CD2 1  
ATOM 3477   N N   . CYS A 1 472 ? -48.053  11.203  20.238  1.00 30.00  ? 476 CYS C N   1  
ATOM 3478   C CA  . CYS A 1 472 ? -48.767  11.182  21.506  1.00 30.00  ? 476 CYS C CA  1  
ATOM 3479   C C   . CYS A 1 472 ? -50.244  11.470  21.345  1.00 30.00  ? 476 CYS C C   1  
ATOM 3480   O O   . CYS A 1 472 ? -51.068  10.772  21.938  1.00 30.00  ? 476 CYS C O   1  
ATOM 3481   C CB  . CYS A 1 472 ? -48.187  12.237  22.442  1.00 99.99  ? 476 CYS C CB  1  
ATOM 3482   S SG  . CYS A 1 472 ? -46.477  11.976  22.972  1.00 99.99  ? 476 CYS C SG  1  
ATOM 3483   N N   . ILE A 1 473 ? -50.572  12.488  20.549  1.00 30.00  ? 477 ILE C N   1  
ATOM 3484   C CA  . ILE A 1 473 ? -51.962  12.867  20.295  1.00 30.00  ? 477 ILE C CA  1  
ATOM 3485   C C   . ILE A 1 473 ? -52.659  11.751  19.539  1.00 30.00  ? 477 ILE C C   1  
ATOM 3486   O O   . ILE A 1 473 ? -53.773  11.338  19.884  1.00 30.00  ? 477 ILE C O   1  
ATOM 3487   C CB  . ILE A 1 473 ? -52.008  14.147  19.466  1.00 99.99  ? 477 ILE C CB  1  
ATOM 3488   C CG1 . ILE A 1 473 ? -51.922  13.798  17.985  1.00 99.99  ? 477 ILE C CG1 1  
ATOM 3489   C CG2 . ILE A 1 473 ? -50.831  15.040  19.846  1.00 99.99  ? 477 ILE C CG2 1  
ATOM 3490   C CD1 . ILE A 1 473 ? -53.329  13.695  17.405  1.00 99.99  ? 477 ILE C CD1 1  
ATOM 3491   N N   . ASN A 1 474 ? -51.983  11.283  18.490  1.00 30.00  ? 478 ASN C N   1  
ATOM 3492   C CA  . ASN A 1 474 ? -52.461  10.211  17.628  1.00 30.00  ? 478 ASN C CA  1  
ATOM 3493   C C   . ASN A 1 474 ? -52.632  8.907   18.393  1.00 30.00  ? 478 ASN C C   1  
ATOM 3494   O O   . ASN A 1 474 ? -53.680  8.261   18.303  1.00 30.00  ? 478 ASN C O   1  
ATOM 3495   C CB  . ASN A 1 474 ? -51.469  9.973   16.496  1.00 99.99  ? 478 ASN C CB  1  
ATOM 3496   C CG  . ASN A 1 474 ? -52.157  9.378   15.276  1.00 99.99  ? 478 ASN C CG  1  
ATOM 3497   O OD1 . ASN A 1 474 ? -51.522  8.704   14.467  1.00 99.99  ? 478 ASN C OD1 1  
ATOM 3498   N ND2 . ASN A 1 474 ? -53.462  9.624   15.148  1.00 99.99  ? 478 ASN C ND2 1  
ATOM 3499   N N   . TYR A 1 475 ? -51.617  8.508   19.141  1.00 30.00  ? 479 TYR C N   1  
ATOM 3500   C CA  . TYR A 1 475 ? -51.747  7.293   19.929  1.00 30.00  ? 479 TYR C CA  1  
ATOM 3501   C C   . TYR A 1 475 ? -53.012  7.455   20.783  1.00 30.00  ? 479 TYR C C   1  
ATOM 3502   O O   . TYR A 1 475 ? -53.773  6.514   20.982  1.00 30.00  ? 479 TYR C O   1  
ATOM 3503   C CB  . TYR A 1 475 ? -50.517  7.116   20.815  1.00 99.99  ? 479 TYR C CB  1  
ATOM 3504   C CG  . TYR A 1 475 ? -50.660  5.851   21.626  1.00 99.99  ? 479 TYR C CG  1  
ATOM 3505   C CD1 . TYR A 1 475 ? -50.315  4.616   21.066  1.00 99.99  ? 479 TYR C CD1 1  
ATOM 3506   C CD2 . TYR A 1 475 ? -51.135  5.915   22.943  1.00 99.99  ? 479 TYR C CD2 1  
ATOM 3507   C CE1 . TYR A 1 475 ? -50.446  3.443   21.819  1.00 99.99  ? 479 TYR C CE1 1  
ATOM 3508   C CE2 . TYR A 1 475 ? -51.266  4.742   23.696  1.00 99.99  ? 479 TYR C CE2 1  
ATOM 3509   C CZ  . TYR A 1 475 ? -50.923  3.509   23.135  1.00 99.99  ? 479 TYR C CZ  1  
ATOM 3510   O OH  . TYR A 1 475 ? -51.051  2.367   23.867  1.00 99.99  ? 479 TYR C OH  1  
ATOM 3511   N N   . THR A 1 476 ? -53.226  8.661   21.289  1.00 30.00  ? 480 THR C N   1  
ATOM 3512   C CA  . THR A 1 476 ? -54.386  8.946   22.124  1.00 30.00  ? 480 THR C CA  1  
ATOM 3513   C C   . THR A 1 476 ? -55.684  8.729   21.395  1.00 30.00  ? 480 THR C C   1  
ATOM 3514   O O   . THR A 1 476 ? -56.559  8.012   21.885  1.00 30.00  ? 480 THR C O   1  
ATOM 3515   C CB  . THR A 1 476 ? -54.347  10.398  22.590  1.00 99.99  ? 480 THR C CB  1  
ATOM 3516   O OG1 . THR A 1 476 ? -53.141  10.632  23.324  1.00 99.99  ? 480 THR C OG1 1  
ATOM 3517   C CG2 . THR A 1 476 ? -55.547  10.679  23.481  1.00 99.99  ? 480 THR C CG2 1  
ATOM 3518   N N   . ASN A 1 477 ? -55.800  9.370   20.229  1.00 30.00  ? 481 ASN C N   1  
ATOM 3519   C CA  . ASN A 1 477 ? -56.998  9.271   19.395  1.00 30.00  ? 481 ASN C CA  1  
ATOM 3520   C C   . ASN A 1 477 ? -57.294  7.860   18.911  1.00 30.00  ? 481 ASN C C   1  
ATOM 3521   O O   . ASN A 1 477 ? -58.441  7.515   18.648  1.00 30.00  ? 481 ASN C O   1  
ATOM 3522   C CB  . ASN A 1 477 ? -56.837  10.146  18.156  1.00 99.99  ? 481 ASN C CB  1  
ATOM 3523   C CG  . ASN A 1 477 ? -56.783  11.621  18.529  1.00 99.99  ? 481 ASN C CG  1  
ATOM 3524   O OD1 . ASN A 1 477 ? -55.779  12.290  18.282  1.00 99.99  ? 481 ASN C OD1 1  
ATOM 3525   N ND2 . ASN A 1 477 ? -57.866  12.128  19.125  1.00 99.99  ? 481 ASN C ND2 1  
ATOM 3526   N N   . GLU A 1 478 ? -56.259  7.043   18.801  1.00 30.00  ? 482 GLU C N   1  
ATOM 3527   C CA  . GLU A 1 478 ? -56.438  5.666   18.363  1.00 30.00  ? 482 GLU C CA  1  
ATOM 3528   C C   . GLU A 1 478 ? -57.273  4.914   19.392  1.00 30.00  ? 482 GLU C C   1  
ATOM 3529   O O   . GLU A 1 478 ? -58.297  4.326   19.055  1.00 30.00  ? 482 GLU C O   1  
ATOM 3530   C CB  . GLU A 1 478 ? -55.078  4.988   18.221  1.00 99.99  ? 482 GLU C CB  1  
ATOM 3531   C CG  . GLU A 1 478 ? -54.291  5.658   17.121  1.00 99.99  ? 482 GLU C CG  1  
ATOM 3532   C CD  . GLU A 1 478 ? -54.897  5.291   15.766  1.00 99.99  ? 482 GLU C CD  1  
ATOM 3533   O OE1 . GLU A 1 478 ? -55.801  6.042   15.316  1.00 99.99  ? 482 GLU C OE1 1  
ATOM 3534   O OE2 . GLU A 1 478 ? -54.446  4.259   15.196  1.00 99.99  ? 482 GLU C OE2 1  
ATOM 3535   N N   . ARG A 1 479 ? -56.520  5.026   19.952  1.00 30.00  ? 483 ARG C N   1  
ATOM 3536   C CA  . ARG A 1 479 ? -56.980  4.349   21.153  1.00 30.00  ? 483 ARG C CA  1  
ATOM 3537   C C   . ARG A 1 479 ? -58.486  4.412   21.259  1.00 30.00  ? 483 ARG C C   1  
ATOM 3538   O O   . ARG A 1 479 ? -59.179  3.401   21.243  1.00 30.00  ? 483 ARG C O   1  
ATOM 3539   C CB  . ARG A 1 479 ? -56.375  5.012   22.387  1.00 99.99  ? 483 ARG C CB  1  
ATOM 3540   C CG  . ARG A 1 479 ? -56.823  4.265   23.638  1.00 99.99  ? 483 ARG C CG  1  
ATOM 3541   C CD  . ARG A 1 479 ? -56.258  4.959   24.873  1.00 99.99  ? 483 ARG C CD  1  
ATOM 3542   N NE  . ARG A 1 479 ? -56.515  6.416   24.825  1.00 99.99  ? 483 ARG C NE  1  
ATOM 3543   C CZ  . ARG A 1 479 ? -57.683  6.958   25.154  1.00 99.99  ? 483 ARG C CZ  1  
ATOM 3544   N NH1 . ARG A 1 479 ? -58.715  6.218   25.548  1.00 99.99  ? 483 ARG C NH1 1  
ATOM 3545   N NH2 . ARG A 1 479 ? -57.803  8.280   25.075  1.00 99.99  ? 483 ARG C NH2 1  
ATOM 3546   N N   . LEU A 1 480 ? -58.977  5.632   21.388  1.00 30.00  ? 484 LEU C N   1  
ATOM 3547   C CA  . LEU A 1 480 ? -60.392  5.900   21.505  1.00 30.00  ? 484 LEU C CA  1  
ATOM 3548   C C   . LEU A 1 480 ? -61.205  5.178   20.437  1.00 30.00  ? 484 LEU C C   1  
ATOM 3549   O O   . LEU A 1 480 ? -62.144  4.456   20.761  1.00 30.00  ? 484 LEU C O   1  
ATOM 3550   C CB  . LEU A 1 480 ? -60.651  7.396   21.360  1.00 99.99  ? 484 LEU C CB  1  
ATOM 3551   C CG  . LEU A 1 480 ? -62.153  7.657   21.362  1.00 99.99  ? 484 LEU C CG  1  
ATOM 3552   C CD1 . LEU A 1 480 ? -62.411  9.144   21.142  1.00 99.99  ? 484 LEU C CD1 1  
ATOM 3553   C CD2 . LEU A 1 480 ? -62.811  6.854   20.246  1.00 99.99  ? 484 LEU C CD2 1  
ATOM 3554   N N   . GLN A 1 481 ? -60.857  5.370   19.165  1.00 30.00  ? 485 GLN C N   1  
ATOM 3555   C CA  . GLN A 1 481 ? -61.591  4.732   18.079  1.00 30.00  ? 485 GLN C CA  1  
ATOM 3556   C C   . GLN A 1 481 ? -61.833  3.268   18.407  1.00 30.00  ? 485 GLN C C   1  
ATOM 3557   O O   . GLN A 1 481 ? -62.965  2.800   18.382  1.00 30.00  ? 485 GLN C O   1  
ATOM 3558   C CB  . GLN A 1 481 ? -60.790  4.824   16.786  1.00 99.99  ? 485 GLN C CB  1  
ATOM 3559   C CG  . GLN A 1 481 ? -61.740  4.996   15.608  1.00 99.99  ? 485 GLN C CG  1  
ATOM 3560   C CD  . GLN A 1 481 ? -62.619  3.764   15.427  1.00 99.99  ? 485 GLN C CD  1  
ATOM 3561   O OE1 . GLN A 1 481 ? -62.504  2.800   16.182  1.00 99.99  ? 485 GLN C OE1 1  
ATOM 3562   N NE2 . GLN A 1 481 ? -63.496  3.797   14.422  1.00 99.99  ? 485 GLN C NE2 1  
ATOM 3563   N N   . GLN A 1 482 ? -60.755  2.562   18.733  1.00 30.00  ? 486 GLN C N   1  
ATOM 3564   C CA  . GLN A 1 482 ? -60.851  1.153   19.074  1.00 30.00  ? 486 GLN C CA  1  
ATOM 3565   C C   . GLN A 1 482 ? -61.892  0.907   20.157  1.00 30.00  ? 486 GLN C C   1  
ATOM 3566   O O   . GLN A 1 482 ? -62.505  -0.151  20.189  1.00 30.00  ? 486 GLN C O   1  
ATOM 3567   C CB  . GLN A 1 482 ? -59.506  0.651   19.586  1.00 99.99  ? 486 GLN C CB  1  
ATOM 3568   C CG  . GLN A 1 482 ? -59.414  -0.857  19.382  1.00 99.99  ? 486 GLN C CG  1  
ATOM 3569   C CD  . GLN A 1 482 ? -60.056  -1.607  20.538  1.00 99.99  ? 486 GLN C CD  1  
ATOM 3570   O OE1 . GLN A 1 482 ? -60.564  -0.992  21.477  1.00 99.99  ? 486 GLN C OE1 1  
ATOM 3571   N NE2 . GLN A 1 482 ? -60.038  -2.942  20.472  1.00 99.99  ? 486 GLN C NE2 1  
ATOM 3572   N N   . PHE A 1 483 ? -62.082  1.877   21.044  1.00 30.00  ? 487 PHE C N   1  
ATOM 3573   C CA  . PHE A 1 483 ? -63.081  1.737   22.107  1.00 30.00  ? 487 PHE C CA  1  
ATOM 3574   C C   . PHE A 1 483 ? -64.439  1.570   21.448  1.00 30.00  ? 487 PHE C C   1  
ATOM 3575   O O   . PHE A 1 483 ? -65.193  0.648   21.772  1.00 30.00  ? 487 PHE C O   1  
ATOM 3576   C CB  . PHE A 1 483 ? -63.074  2.981   22.992  1.00 99.99  ? 487 PHE C CB  1  
ATOM 3577   C CG  . PHE A 1 483 ? -64.102  2.830   24.082  1.00 99.99  ? 487 PHE C CG  1  
ATOM 3578   C CD1 . PHE A 1 483 ? -63.790  2.118   25.247  1.00 99.99  ? 487 PHE C CD1 1  
ATOM 3579   C CD2 . PHE A 1 483 ? -65.373  3.399   23.935  1.00 99.99  ? 487 PHE C CD2 1  
ATOM 3580   C CE1 . PHE A 1 483 ? -64.744  1.978   26.263  1.00 99.99  ? 487 PHE C CE1 1  
ATOM 3581   C CE2 . PHE A 1 483 ? -66.328  3.258   24.949  1.00 99.99  ? 487 PHE C CE2 1  
ATOM 3582   C CZ  . PHE A 1 483 ? -66.013  2.548   26.112  1.00 99.99  ? 487 PHE C CZ  1  
ATOM 3583   N N   . PHE A 1 484 ? -64.731  2.462   20.504  1.00 30.00  ? 488 PHE C N   1  
ATOM 3584   C CA  . PHE A 1 484 ? -65.986  2.443   19.775  1.00 30.00  ? 488 PHE C CA  1  
ATOM 3585   C C   . PHE A 1 484 ? -66.145  1.125   19.072  1.00 30.00  ? 488 PHE C C   1  
ATOM 3586   O O   . PHE A 1 484 ? -67.241  0.603   19.006  1.00 30.00  ? 488 PHE C O   1  
ATOM 3587   C CB  . PHE A 1 484 ? -66.003  3.566   18.743  1.00 99.99  ? 488 PHE C CB  1  
ATOM 3588   C CG  . PHE A 1 484 ? -67.310  3.538   17.990  1.00 99.99  ? 488 PHE C CG  1  
ATOM 3589   C CD1 . PHE A 1 484 ? -68.445  4.154   18.535  1.00 99.99  ? 488 PHE C CD1 1  
ATOM 3590   C CD2 . PHE A 1 484 ? -67.391  2.901   16.748  1.00 99.99  ? 488 PHE C CD2 1  
ATOM 3591   C CE1 . PHE A 1 484 ? -69.658  4.129   17.838  1.00 99.99  ? 488 PHE C CE1 1  
ATOM 3592   C CE2 . PHE A 1 484 ? -68.604  2.875   16.050  1.00 99.99  ? 488 PHE C CE2 1  
ATOM 3593   C CZ  . PHE A 1 484 ? -69.738  3.490   16.594  1.00 99.99  ? 488 PHE C CZ  1  
ATOM 3594   N N   . ASN A 1 485 ? -65.053  0.604   18.530  1.00 30.00  ? 489 ASN C N   1  
ATOM 3595   C CA  . ASN A 1 485 ? -65.076  -0.676  17.823  1.00 30.00  ? 489 ASN C CA  1  
ATOM 3596   C C   . ASN A 1 485 ? -65.443  -1.800  18.789  1.00 30.00  ? 489 ASN C C   1  
ATOM 3597   O O   . ASN A 1 485 ? -66.202  -2.695  18.455  1.00 30.00  ? 489 ASN C O   1  
ATOM 3598   C CB  . ASN A 1 485 ? -63.703  -0.964  17.226  1.00 99.99  ? 489 ASN C CB  1  
ATOM 3599   C CG  . ASN A 1 485 ? -63.451  -0.107  15.994  1.00 99.99  ? 489 ASN C CG  1  
ATOM 3600   O OD1 . ASN A 1 485 ? -62.346  0.389   15.793  1.00 99.99  ? 489 ASN C OD1 1  
ATOM 3601   N ND2 . ASN A 1 485 ? -64.485  0.065   15.165  1.00 99.99  ? 489 ASN C ND2 1  
ATOM 3602   N N   . HIS A 1 486 ? -64.894  -1.755  19.990  1.00 30.00  ? 490 HIS C N   1  
ATOM 3603   C CA  . HIS A 1 486 ? -65.151  -2.783  20.983  1.00 30.00  ? 490 HIS C CA  1  
ATOM 3604   C C   . HIS A 1 486 ? -66.572  -2.800  21.433  1.00 30.00  ? 490 HIS C C   1  
ATOM 3605   O O   . HIS A 1 486 ? -67.285  -3.791  21.282  1.00 30.00  ? 490 HIS C O   1  
ATOM 3606   C CB  . HIS A 1 486 ? -64.276  -2.547  22.210  1.00 99.99  ? 490 HIS C CB  1  
ATOM 3607   C CG  . HIS A 1 486 ? -64.613  -3.403  23.407  1.00 99.99  ? 490 HIS C CG  1  
ATOM 3608   N ND1 . HIS A 1 486 ? -63.654  -4.170  24.058  1.00 99.99  ? 490 HIS C ND1 1  
ATOM 3609   C CD2 . HIS A 1 486 ? -65.787  -3.610  24.065  1.00 99.99  ? 490 HIS C CD2 1  
ATOM 3610   C CE1 . HIS A 1 486 ? -64.246  -4.801  25.057  1.00 99.99  ? 490 HIS C CE1 1  
ATOM 3611   N NE2 . HIS A 1 486 ? -65.514  -4.478  25.074  1.00 99.99  ? 490 HIS C NE2 1  
ATOM 3612   N N   . HIS A 1 487 ? -66.966  -1.684  22.022  1.00 30.00  ? 491 HIS C N   1  
ATOM 3613   C CA  . HIS A 1 487 ? -68.310  -1.500  22.529  1.00 30.00  ? 491 HIS C CA  1  
ATOM 3614   C C   . HIS A 1 487 ? -69.399  -1.609  21.442  1.00 30.00  ? 491 HIS C C   1  
ATOM 3615   O O   . HIS A 1 487 ? -70.564  -1.906  21.741  1.00 30.00  ? 491 HIS C O   1  
ATOM 3616   C CB  . HIS A 1 487 ? -68.441  -0.119  23.163  1.00 99.99  ? 491 HIS C CB  1  
ATOM 3617   C CG  . HIS A 1 487 ? -69.849  0.290   23.520  1.00 99.99  ? 491 HIS C CG  1  
ATOM 3618   N ND1 . HIS A 1 487 ? -70.189  0.729   24.795  1.00 99.99  ? 491 HIS C ND1 1  
ATOM 3619   C CD2 . HIS A 1 487 ? -70.989  0.330   22.778  1.00 99.99  ? 491 HIS C CD2 1  
ATOM 3620   C CE1 . HIS A 1 487 ? -71.479  1.010   24.797  1.00 99.99  ? 491 HIS C CE1 1  
ATOM 3621   N NE2 . HIS A 1 487 ? -71.968  0.781   23.607  1.00 99.99  ? 491 HIS C NE2 1  
ATOM 3622   N N   . MET A 1 488 ? -69.020  -1.390  20.183  1.00 30.00  ? 492 MET C N   1  
ATOM 3623   C CA  . MET A 1 488 ? -69.965  -1.417  19.065  1.00 30.00  ? 492 MET C CA  1  
ATOM 3624   C C   . MET A 1 488 ? -70.179  -2.789  18.420  1.00 30.00  ? 492 MET C C   1  
ATOM 3625   O O   . MET A 1 488 ? -71.313  -3.180  18.118  1.00 30.00  ? 492 MET C O   1  
ATOM 3626   C CB  . MET A 1 488 ? -69.481  -0.493  17.956  1.00 99.99  ? 492 MET C CB  1  
ATOM 3627   C CG  . MET A 1 488 ? -70.618  -0.233  16.975  1.00 99.99  ? 492 MET C CG  1  
ATOM 3628   S SD  . MET A 1 488 ? -70.106  0.979   15.732  1.00 99.99  ? 492 MET C SD  1  
ATOM 3629   C CE  . MET A 1 488 ? -68.490  0.346   15.334  1.00 99.99  ? 492 MET C CE  1  
ATOM 3630   N N   . PHE A 1 489 ? -69.119  -3.522  18.191  1.00 30.00  ? 493 PHE C N   1  
ATOM 3631   C CA  . PHE A 1 489 ? -69.246  -4.828  17.524  1.00 30.00  ? 493 PHE C CA  1  
ATOM 3632   C C   . PHE A 1 489 ? -68.916  -5.977  18.469  1.00 30.00  ? 493 PHE C C   1  
ATOM 3633   O O   . PHE A 1 489 ? -69.751  -6.848  18.744  1.00 30.00  ? 493 PHE C O   1  
ATOM 3634   C CB  . PHE A 1 489 ? -68.293  -4.899  16.336  1.00 99.99  ? 493 PHE C CB  1  
ATOM 3635   C CG  . PHE A 1 489 ? -68.750  -3.938  15.264  1.00 99.99  ? 493 PHE C CG  1  
ATOM 3636   C CD1 . PHE A 1 489 ? -69.754  -4.318  14.364  1.00 99.99  ? 493 PHE C CD1 1  
ATOM 3637   C CD2 . PHE A 1 489 ? -68.168  -2.669  15.169  1.00 99.99  ? 493 PHE C CD2 1  
ATOM 3638   C CE1 . PHE A 1 489 ? -70.175  -3.429  13.370  1.00 99.99  ? 493 PHE C CE1 1  
ATOM 3639   C CE2 . PHE A 1 489 ? -68.592  -1.778  14.175  1.00 99.99  ? 493 PHE C CE2 1  
ATOM 3640   C CZ  . PHE A 1 489 ? -69.596  -2.158  13.277  1.00 99.99  ? 493 PHE C CZ  1  
ATOM 3641   N N   . ILE A 1 490 ? -67.694  -5.964  18.943  1.00 30.00  ? 494 ILE C N   1  
ATOM 3642   C CA  . ILE A 1 490 ? -67.213  -7.002  19.852  1.00 30.00  ? 494 ILE C CA  1  
ATOM 3643   C C   . ILE A 1 490 ? -68.214  -7.199  20.990  1.00 30.00  ? 494 ILE C C   1  
ATOM 3644   O O   . ILE A 1 490 ? -68.590  -8.338  21.312  1.00 30.00  ? 494 ILE C O   1  
ATOM 3645   C CB  . ILE A 1 490 ? -65.865  -6.593  20.437  1.00 99.99  ? 494 ILE C CB  1  
ATOM 3646   C CG1 . ILE A 1 490 ? -66.086  -5.729  21.675  1.00 99.99  ? 494 ILE C CG1 1  
ATOM 3647   C CG2 . ILE A 1 490 ? -65.080  -5.799  19.396  1.00 99.99  ? 494 ILE C CG2 1  
ATOM 3648   C CD1 . ILE A 1 490 ? -66.053  -6.608  22.920  1.00 99.99  ? 494 ILE C CD1 1  
ATOM 3649   N N   . LEU A 1 491 ? -68.603  -6.059  21.519  1.00 2.00   ? 495 LEU C N   1  
ATOM 3650   C CA  . LEU A 1 491 ? -69.478  -5.933  22.694  1.00 2.00   ? 495 LEU C CA  1  
ATOM 3651   C C   . LEU A 1 491 ? -70.913  -6.447  22.450  1.00 2.00   ? 495 LEU C C   1  
ATOM 3652   O O   . LEU A 1 491 ? -71.349  -7.433  23.060  1.00 45.03  ? 495 LEU C O   1  
ATOM 3653   C CB  . LEU A 1 491 ? -69.588  -4.470  23.107  1.00 99.99  ? 495 LEU C CB  1  
ATOM 3654   C CG  . LEU A 1 491 ? -68.561  -4.167  24.191  1.00 99.99  ? 495 LEU C CG  1  
ATOM 3655   C CD1 . LEU A 1 491 ? -68.881  -2.821  24.833  1.00 99.99  ? 495 LEU C CD1 1  
ATOM 3656   C CD2 . LEU A 1 491 ? -68.608  -5.261  25.253  1.00 99.99  ? 495 LEU C CD2 1  
ATOM 3657   N N   . GLU A 1 492 ? -71.608  -5.752  21.576  1.00 40.00  ? 496 GLU C N   1  
ATOM 3658   C CA  . GLU A 1 492 ? -73.020  -6.031  21.233  1.00 40.00  ? 496 GLU C CA  1  
ATOM 3659   C C   . GLU A 1 492 ? -73.361  -7.535  21.280  1.00 40.00  ? 496 GLU C C   1  
ATOM 3660   O O   . GLU A 1 492 ? -74.309  -7.958  21.960  1.00 31.53  ? 496 GLU C O   1  
ATOM 3661   C CB  . GLU A 1 492 ? -73.322  -5.534  19.823  1.00 99.99  ? 496 GLU C CB  1  
ATOM 3662   C CG  . GLU A 1 492 ? -73.191  -4.030  19.782  1.00 99.99  ? 496 GLU C CG  1  
ATOM 3663   C CD  . GLU A 1 492 ? -74.365  -3.398  20.525  1.00 99.99  ? 496 GLU C CD  1  
ATOM 3664   O OE1 . GLU A 1 492 ? -74.220  -3.183  21.757  1.00 99.99  ? 496 GLU C OE1 1  
ATOM 3665   O OE2 . GLU A 1 492 ? -75.398  -3.134  19.852  1.00 99.99  ? 496 GLU C OE2 1  
ATOM 3666   N N   . GLN A 1 493 ? -72.583  -8.312  20.546  1.00 27.51  ? 497 GLN C N   1  
ATOM 3667   C CA  . GLN A 1 493 ? -72.794  -9.770  20.407  1.00 27.51  ? 497 GLN C CA  1  
ATOM 3668   C C   . GLN A 1 493 ? -72.554  -10.526 21.724  1.00 27.51  ? 497 GLN C C   1  
ATOM 3669   O O   . GLN A 1 493 ? -73.202  -11.546 22.007  1.00 4.76   ? 497 GLN C O   1  
ATOM 3670   C CB  . GLN A 1 493 ? -71.837  -10.337 19.363  1.00 99.99  ? 497 GLN C CB  1  
ATOM 3671   C CG  . GLN A 1 493 ? -72.411  -11.629 18.792  1.00 99.99  ? 497 GLN C CG  1  
ATOM 3672   C CD  . GLN A 1 493 ? -72.056  -12.822 19.667  1.00 99.99  ? 497 GLN C CD  1  
ATOM 3673   O OE1 . GLN A 1 493 ? -71.390  -12.668 20.688  1.00 99.99  ? 497 GLN C OE1 1  
ATOM 3674   N NE2 . GLN A 1 493 ? -72.508  -14.012 19.265  1.00 99.99  ? 497 GLN C NE2 1  
ATOM 3675   N N   . GLU A 1 494 ? -71.623  -10.017 22.505  1.00 5.92   ? 498 GLU C N   1  
ATOM 3676   C CA  . GLU A 1 494 ? -71.253  -10.627 23.793  1.00 5.92   ? 498 GLU C CA  1  
ATOM 3677   C C   . GLU A 1 494 ? -72.472  -10.701 24.725  1.00 5.92   ? 498 GLU C C   1  
ATOM 3678   O O   . GLU A 1 494 ? -72.785  -11.766 25.282  1.00 100.00 ? 498 GLU C O   1  
ATOM 3679   C CB  . GLU A 1 494 ? -70.170  -9.795  24.471  1.00 99.99  ? 498 GLU C CB  1  
ATOM 3680   C CG  . GLU A 1 494 ? -68.910  -9.828  23.639  1.00 99.99  ? 498 GLU C CG  1  
ATOM 3681   C CD  . GLU A 1 494 ? -68.267  -11.209 23.748  1.00 99.99  ? 498 GLU C CD  1  
ATOM 3682   O OE1 . GLU A 1 494 ? -68.618  -12.078 22.905  1.00 99.99  ? 498 GLU C OE1 1  
ATOM 3683   O OE2 . GLU A 1 494 ? -67.429  -11.382 24.673  1.00 99.99  ? 498 GLU C OE2 1  
ATOM 3684   N N   . GLU A 1 495 ? -73.117  -9.557  24.856  1.00 2.00   ? 499 GLU C N   1  
ATOM 3685   C CA  . GLU A 1 495 ? -74.304  -9.389  25.709  1.00 2.00   ? 499 GLU C CA  1  
ATOM 3686   C C   . GLU A 1 495 ? -75.414  -10.350 25.276  1.00 2.00   ? 499 GLU C C   1  
ATOM 3687   O O   . GLU A 1 495 ? -76.162  -10.883 26.109  1.00 97.60  ? 499 GLU C O   1  
ATOM 3688   C CB  . GLU A 1 495 ? -74.823  -7.959  25.605  1.00 99.99  ? 499 GLU C CB  1  
ATOM 3689   C CG  . GLU A 1 495 ? -73.791  -7.006  26.162  1.00 99.99  ? 499 GLU C CG  1  
ATOM 3690   C CD  . GLU A 1 495 ? -73.746  -7.143  27.683  1.00 99.99  ? 499 GLU C CD  1  
ATOM 3691   O OE1 . GLU A 1 495 ? -72.944  -7.986  28.162  1.00 99.99  ? 499 GLU C OE1 1  
ATOM 3692   O OE2 . GLU A 1 495 ? -74.514  -6.399  28.351  1.00 99.99  ? 499 GLU C OE2 1  
ATOM 3693   N N   . TYR A 1 496 ? -75.497  -10.539 23.973  1.00 20.41  ? 500 TYR C N   1  
ATOM 3694   C CA  . TYR A 1 496 ? -76.489  -11.442 23.375  1.00 20.41  ? 500 TYR C CA  1  
ATOM 3695   C C   . TYR A 1 496 ? -76.291  -12.843 23.948  1.00 20.41  ? 500 TYR C C   1  
ATOM 3696   O O   . TYR A 1 496 ? -77.265  -13.558 24.234  1.00 2.00   ? 500 TYR C O   1  
ATOM 3697   C CB  . TYR A 1 496 ? -76.308  -11.478 21.860  1.00 99.99  ? 500 TYR C CB  1  
ATOM 3698   C CG  . TYR A 1 496 ? -76.813  -10.187 21.261  1.00 99.99  ? 500 TYR C CG  1  
ATOM 3699   C CD1 . TYR A 1 496 ? -78.189  -9.980  21.105  1.00 99.99  ? 500 TYR C CD1 1  
ATOM 3700   C CD2 . TYR A 1 496 ? -75.905  -9.198  20.862  1.00 99.99  ? 500 TYR C CD2 1  
ATOM 3701   C CE1 . TYR A 1 496 ? -78.656  -8.781  20.548  1.00 99.99  ? 500 TYR C CE1 1  
ATOM 3702   C CE2 . TYR A 1 496 ? -76.371  -8.002  20.306  1.00 99.99  ? 500 TYR C CE2 1  
ATOM 3703   C CZ  . TYR A 1 496 ? -77.747  -7.796  20.150  1.00 99.99  ? 500 TYR C CZ  1  
ATOM 3704   O OH  . TYR A 1 496 ? -78.204  -6.632  19.609  1.00 99.99  ? 500 TYR C OH  1  
ATOM 3705   N N   . LYS A 1 497 ? -75.022  -13.175 24.093  1.00 2.00   ? 501 LYS C N   1  
ATOM 3706   C CA  . LYS A 1 497 ? -74.586  -14.466 24.639  1.00 2.00   ? 501 LYS C CA  1  
ATOM 3707   C C   . LYS A 1 497 ? -74.894  -14.519 26.136  1.00 2.00   ? 501 LYS C C   1  
ATOM 3708   O O   . LYS A 1 497 ? -75.572  -15.440 26.613  1.00 92.11  ? 501 LYS C O   1  
ATOM 3709   C CB  . LYS A 1 497 ? -73.083  -14.634 24.430  1.00 99.99  ? 501 LYS C CB  1  
ATOM 3710   C CG  . LYS A 1 497 ? -72.656  -16.016 24.910  1.00 99.99  ? 501 LYS C CG  1  
ATOM 3711   C CD  . LYS A 1 497 ? -71.297  -16.362 24.313  1.00 99.99  ? 501 LYS C CD  1  
ATOM 3712   C CE  . LYS A 1 497 ? -70.698  -17.550 25.064  1.00 99.99  ? 501 LYS C CE  1  
ATOM 3713   N NZ  . LYS A 1 497 ? -71.041  -18.796 24.363  1.00 99.99  ? 501 LYS C NZ  1  
ATOM 3714   N N   . LYS A 1 498 ? -74.383  -13.517 26.826  1.00 2.00   ? 502 LYS C N   1  
ATOM 3715   C CA  . LYS A 1 498 ? -74.554  -13.369 28.279  1.00 2.00   ? 502 LYS C CA  1  
ATOM 3716   C C   . LYS A 1 498 ? -76.000  -13.676 28.679  1.00 2.00   ? 502 LYS C C   1  
ATOM 3717   O O   . LYS A 1 498 ? -76.272  -14.665 29.374  1.00 55.60  ? 502 LYS C O   1  
ATOM 3718   C CB  . LYS A 1 498 ? -74.218  -11.943 28.698  1.00 99.99  ? 502 LYS C CB  1  
ATOM 3719   C CG  . LYS A 1 498 ? -72.751  -11.863 29.108  1.00 99.99  ? 502 LYS C CG  1  
ATOM 3720   C CD  . LYS A 1 498 ? -71.872  -11.872 27.862  1.00 99.99  ? 502 LYS C CD  1  
ATOM 3721   C CE  . LYS A 1 498 ? -70.409  -11.994 28.273  1.00 99.99  ? 502 LYS C CE  1  
ATOM 3722   N NZ  . LYS A 1 498 ? -69.572  -12.123 27.071  1.00 99.99  ? 502 LYS C NZ  1  
ATOM 3723   N N   . GLU A 1 499 ? -76.884  -12.806 28.219  1.00 49.72  ? 503 GLU C N   1  
ATOM 3724   C CA  . GLU A 1 499 ? -78.330  -12.907 28.489  1.00 49.72  ? 503 GLU C CA  1  
ATOM 3725   C C   . GLU A 1 499 ? -78.837  -14.305 28.120  1.00 49.72  ? 503 GLU C C   1  
ATOM 3726   O O   . GLU A 1 499 ? -79.798  -14.816 28.711  1.00 22.28  ? 503 GLU C O   1  
ATOM 3727   C CB  . GLU A 1 499 ? -79.086  -11.871 27.663  1.00 99.99  ? 503 GLU C CB  1  
ATOM 3728   C CG  . GLU A 1 499 ? -78.694  -10.485 28.111  1.00 99.99  ? 503 GLU C CG  1  
ATOM 3729   C CD  . GLU A 1 499 ? -79.303  -10.202 29.482  1.00 99.99  ? 503 GLU C CD  1  
ATOM 3730   O OE1 . GLU A 1 499 ? -78.620  -10.515 30.493  1.00 99.99  ? 503 GLU C OE1 1  
ATOM 3731   O OE2 . GLU A 1 499 ? -80.448  -9.676  29.507  1.00 99.99  ? 503 GLU C OE2 1  
ATOM 3732   N N   . GLY A 1 500 ? -78.170  -14.878 27.139  1.00 2.00   ? 504 GLY C N   1  
ATOM 3733   C CA  . GLY A 1 500 ? -78.465  -16.234 26.664  1.00 2.00   ? 504 GLY C CA  1  
ATOM 3734   C C   . GLY A 1 500 ? -79.618  -16.246 25.654  1.00 2.00   ? 504 GLY C C   1  
ATOM 3735   O O   . GLY A 1 500 ? -80.551  -17.060 25.760  1.00 2.00   ? 504 GLY C O   1  
ATOM 3736   N N   . ILE A 1 501 ? -79.528  -15.342 24.700  1.00 11.19  ? 505 ILE C N   1  
ATOM 3737   C CA  . ILE A 1 501 ? -80.503  -15.253 23.603  1.00 11.19  ? 505 ILE C CA  1  
ATOM 3738   C C   . ILE A 1 501 ? -80.028  -16.176 22.481  1.00 11.19  ? 505 ILE C C   1  
ATOM 3739   O O   . ILE A 1 501 ? -79.419  -17.226 22.730  1.00 4.95   ? 505 ILE C O   1  
ATOM 3740   C CB  . ILE A 1 501 ? -80.589  -13.815 23.103  1.00 99.99  ? 505 ILE C CB  1  
ATOM 3741   C CG1 . ILE A 1 501 ? -81.427  -13.769 21.830  1.00 99.99  ? 505 ILE C CG1 1  
ATOM 3742   C CG2 . ILE A 1 501 ? -79.184  -13.294 22.807  1.00 99.99  ? 505 ILE C CG2 1  
ATOM 3743   C CD1 . ILE A 1 501 ? -82.657  -14.655 21.997  1.00 99.99  ? 505 ILE C CD1 1  
ATOM 3744   N N   . ALA A 1 502 ? -80.296  -15.778 21.252  1.00 30.00  ? 506 ALA C N   1  
ATOM 3745   C CA  . ALA A 1 502 ? -79.880  -16.555 20.066  1.00 30.00  ? 506 ALA C CA  1  
ATOM 3746   C C   . ALA A 1 502 ? -79.138  -15.642 19.087  1.00 30.00  ? 506 ALA C C   1  
ATOM 3747   O O   . ALA A 1 502 ? -79.456  -14.452 18.958  1.00 30.00  ? 506 ALA C O   1  
ATOM 3748   C CB  . ALA A 1 502 ? -81.106  -17.145 19.369  1.00 30.00  ? 506 ALA C CB  1  
ATOM 3749   N N   . TRP A 1 503 ? -78.144  -16.202 18.399  1.00 30.00  ? 507 TRP C N   1  
ATOM 3750   C CA  . TRP A 1 503 ? -77.377  -15.410 17.424  1.00 30.00  ? 507 TRP C CA  1  
ATOM 3751   C C   . TRP A 1 503 ? -76.145  -16.142 16.867  1.00 30.00  ? 507 TRP C C   1  
ATOM 3752   O O   . TRP A 1 503 ? -75.639  -17.102 17.473  1.00 30.00  ? 507 TRP C O   1  
ATOM 3753   C CB  . TRP A 1 503 ? -76.877  -14.126 18.076  1.00 99.99  ? 507 TRP C CB  1  
ATOM 3754   C CG  . TRP A 1 503 ? -76.195  -13.158 17.140  1.00 99.99  ? 507 TRP C CG  1  
ATOM 3755   C CD1 . TRP A 1 503 ? -74.947  -13.249 16.656  1.00 99.99  ? 507 TRP C CD1 1  
ATOM 3756   C CD2 . TRP A 1 503 ? -76.721  -11.981 16.594  1.00 99.99  ? 507 TRP C CD2 1  
ATOM 3757   N NE1 . TRP A 1 503 ? -74.741  -12.111 15.815  1.00 99.99  ? 507 TRP C NE1 1  
ATOM 3758   C CE2 . TRP A 1 503 ? -75.831  -11.382 15.811  1.00 99.99  ? 507 TRP C CE2 1  
ATOM 3759   C CE3 . TRP A 1 503 ? -77.988  -11.409 16.769  1.00 99.99  ? 507 TRP C CE3 1  
ATOM 3760   C CZ2 . TRP A 1 503 ? -76.063  -10.184 15.122  1.00 99.99  ? 507 TRP C CZ2 1  
ATOM 3761   C CZ3 . TRP A 1 503 ? -78.244  -10.202 16.087  1.00 99.99  ? 507 TRP C CZ3 1  
ATOM 3762   C CH2 . TRP A 1 503 ? -77.320  -9.616  15.298  1.00 99.99  ? 507 TRP C CH2 1  
ATOM 3763   N N   . GLU A 1 504 ? -75.751  -15.602 15.720  1.00 30.00  ? 508 GLU C N   1  
ATOM 3764   C CA  . GLU A 1 504 ? -74.572  -16.015 14.936  1.00 30.00  ? 508 GLU C CA  1  
ATOM 3765   C C   . GLU A 1 504 ? -73.696  -14.771 14.721  1.00 30.00  ? 508 GLU C C   1  
ATOM 3766   O O   . GLU A 1 504 ? -74.184  -13.709 14.311  1.00 30.00  ? 508 GLU C O   1  
ATOM 3767   C CB  . GLU A 1 504 ? -75.016  -16.584 13.594  1.00 99.99  ? 508 GLU C CB  1  
ATOM 3768   C CG  . GLU A 1 504 ? -73.953  -17.516 13.065  1.00 99.99  ? 508 GLU C CG  1  
ATOM 3769   C CD  . GLU A 1 504 ? -72.895  -16.710 12.313  1.00 99.99  ? 508 GLU C CD  1  
ATOM 3770   O OE1 . GLU A 1 504 ? -71.917  -16.280 12.979  1.00 99.99  ? 508 GLU C OE1 1  
ATOM 3771   O OE2 . GLU A 1 504 ? -73.080  -16.530 11.079  1.00 99.99  ? 508 GLU C OE2 1  
ATOM 3772   N N   . PHE A 1 505 ? -72.420  -14.940 15.010  1.00 30.00  ? 509 PHE C N   1  
ATOM 3773   C CA  . PHE A 1 505 ? -71.420  -13.852 14.935  1.00 30.00  ? 509 PHE C CA  1  
ATOM 3774   C C   . PHE A 1 505 ? -71.333  -13.237 13.530  1.00 30.00  ? 509 PHE C C   1  
ATOM 3775   O O   . PHE A 1 505 ? -71.735  -13.855 12.533  1.00 30.00  ? 509 PHE C O   1  
ATOM 3776   C CB  . PHE A 1 505 ? -70.040  -14.394 15.295  1.00 99.99  ? 509 PHE C CB  1  
ATOM 3777   C CG  . PHE A 1 505 ? -69.026  -13.279 15.216  1.00 99.99  ? 509 PHE C CG  1  
ATOM 3778   C CD1 . PHE A 1 505 ? -68.862  -12.405 16.297  1.00 99.99  ? 509 PHE C CD1 1  
ATOM 3779   C CD2 . PHE A 1 505 ? -68.250  -13.118 14.061  1.00 99.99  ? 509 PHE C CD2 1  
ATOM 3780   C CE1 . PHE A 1 505 ? -67.920  -11.371 16.225  1.00 99.99  ? 509 PHE C CE1 1  
ATOM 3781   C CE2 . PHE A 1 505 ? -67.311  -12.082 13.989  1.00 99.99  ? 509 PHE C CE2 1  
ATOM 3782   C CZ  . PHE A 1 505 ? -67.145  -11.210 15.071  1.00 99.99  ? 509 PHE C CZ  1  
ATOM 3783   N N   . ILE A 1 506 ? -70.796  -12.024 13.540  1.00 30.00  ? 510 ILE C N   1  
ATOM 3784   C CA  . ILE A 1 506 ? -70.564  -11.206 12.336  1.00 30.00  ? 510 ILE C CA  1  
ATOM 3785   C C   . ILE A 1 506 ? -69.270  -10.401 12.527  1.00 30.00  ? 510 ILE C C   1  
ATOM 3786   O O   . ILE A 1 506 ? -69.146  -9.601  13.467  1.00 30.00  ? 510 ILE C O   1  
ATOM 3787   C CB  . ILE A 1 506 ? -71.735  -10.250 12.126  1.00 99.99  ? 510 ILE C CB  1  
ATOM 3788   C CG1 . ILE A 1 506 ? -71.562  -9.029  13.021  1.00 99.99  ? 510 ILE C CG1 1  
ATOM 3789   C CG2 . ILE A 1 506 ? -73.037  -10.961 12.479  1.00 99.99  ? 510 ILE C CG2 1  
ATOM 3790   C CD1 . ILE A 1 506 ? -72.297  -9.255  14.339  1.00 99.99  ? 510 ILE C CD1 1  
ATOM 3791   N N   . ASP A 1 507 ? -68.336  -10.640 11.624  1.00 30.00  ? 511 ASP C N   1  
ATOM 3792   C CA  . ASP A 1 507 ? -67.013  -9.988  11.651  1.00 30.00  ? 511 ASP C CA  1  
ATOM 3793   C C   . ASP A 1 507 ? -67.020  -8.705  10.818  1.00 30.00  ? 511 ASP C C   1  
ATOM 3794   O O   . ASP A 1 507 ? -66.954  -8.746  9.581   1.00 30.00  ? 511 ASP C O   1  
ATOM 3795   C CB  . ASP A 1 507 ? -65.958  -10.932 11.084  1.00 99.99  ? 511 ASP C CB  1  
ATOM 3796   C CG  . ASP A 1 507 ? -66.455  -11.521 9.766   1.00 99.99  ? 511 ASP C CG  1  
ATOM 3797   O OD1 . ASP A 1 507 ? -67.563  -12.125 9.787   1.00 99.99  ? 511 ASP C OD1 1  
ATOM 3798   O OD2 . ASP A 1 507 ? -65.726  -11.362 8.752   1.00 99.99  ? 511 ASP C OD2 1  
ATOM 3799   N N   . PHE A 1 508 ? -67.092  -7.597  11.529  1.00 30.00  ? 512 PHE C N   1  
ATOM 3800   C CA  . PHE A 1 508 ? -67.110  -6.256  10.924  1.00 30.00  ? 512 PHE C CA  1  
ATOM 3801   C C   . PHE A 1 508 ? -65.686  -5.824  10.555  1.00 30.00  ? 512 PHE C C   1  
ATOM 3802   O O   . PHE A 1 508 ? -65.475  -4.749  9.977   1.00 30.00  ? 512 PHE C O   1  
ATOM 3803   C CB  . PHE A 1 508 ? -67.695  -5.250  11.907  1.00 99.99  ? 512 PHE C CB  1  
ATOM 3804   C CG  . PHE A 1 508 ? -69.135  -5.603  12.191  1.00 99.99  ? 512 PHE C CG  1  
ATOM 3805   C CD1 . PHE A 1 508 ? -69.447  -6.483  13.236  1.00 99.99  ? 512 PHE C CD1 1  
ATOM 3806   C CD2 . PHE A 1 508 ? -70.160  -5.050  11.413  1.00 99.99  ? 512 PHE C CD2 1  
ATOM 3807   C CE1 . PHE A 1 508 ? -70.783  -6.810  13.501  1.00 99.99  ? 512 PHE C CE1 1  
ATOM 3808   C CE2 . PHE A 1 508 ? -71.494  -5.378  11.677  1.00 99.99  ? 512 PHE C CE2 1  
ATOM 3809   C CZ  . PHE A 1 508 ? -71.807  -6.256  12.719  1.00 99.99  ? 512 PHE C CZ  1  
ATOM 3810   N N   . GLY A 1 509 ? -64.750  -6.686  10.908  1.00 30.00  ? 513 GLY C N   1  
ATOM 3811   C CA  . GLY A 1 509 ? -63.318  -6.461  10.648  1.00 30.00  ? 513 GLY C CA  1  
ATOM 3812   C C   . GLY A 1 509 ? -62.944  -5.011  10.962  1.00 30.00  ? 513 GLY C C   1  
ATOM 3813   O O   . GLY A 1 509 ? -62.703  -4.200  10.056  1.00 30.00  ? 513 GLY C O   1  
ATOM 3814   N N   . MET A 1 510 ? -62.907  -4.727  12.249  1.00 30.00  ? 514 MET C N   1  
ATOM 3815   C CA  . MET A 1 510 ? -62.567  -3.393  12.765  1.00 30.00  ? 514 MET C CA  1  
ATOM 3816   C C   . MET A 1 510 ? -61.775  -3.524  14.065  1.00 30.00  ? 514 MET C C   1  
ATOM 3817   O O   . MET A 1 510 ? -62.347  -3.548  15.164  1.00 30.00  ? 514 MET C O   1  
ATOM 3818   C CB  . MET A 1 510 ? -63.843  -2.603  13.037  1.00 99.99  ? 514 MET C CB  1  
ATOM 3819   C CG  . MET A 1 510 ? -64.404  -2.072  11.722  1.00 99.99  ? 514 MET C CG  1  
ATOM 3820   S SD  . MET A 1 510 ? -65.335  -0.548  12.015  1.00 99.99  ? 514 MET C SD  1  
ATOM 3821   C CE  . MET A 1 510 ? -64.103  0.406   12.877  1.00 99.99  ? 514 MET C CE  1  
ATOM 3822   N N   . ASP A 1 511 ? -60.467  -3.601  13.899  1.00 30.00  ? 515 ASP C N   1  
ATOM 3823   C CA  . ASP A 1 511 ? -59.538  -3.735  15.028  1.00 30.00  ? 515 ASP C CA  1  
ATOM 3824   C C   . ASP A 1 511 ? -58.235  -2.995  14.740  1.00 30.00  ? 515 ASP C C   1  
ATOM 3825   O O   . ASP A 1 511 ? -57.696  -3.054  13.625  1.00 30.00  ? 515 ASP C O   1  
ATOM 3826   C CB  . ASP A 1 511 ? -59.223  -5.208  15.267  1.00 99.99  ? 515 ASP C CB  1  
ATOM 3827   C CG  . ASP A 1 511 ? -58.462  -5.360  16.581  1.00 99.99  ? 515 ASP C CG  1  
ATOM 3828   O OD1 . ASP A 1 511 ? -57.227  -5.108  16.566  1.00 99.99  ? 515 ASP C OD1 1  
ATOM 3829   O OD2 . ASP A 1 511 ? -59.123  -5.727  17.590  1.00 99.99  ? 515 ASP C OD2 1  
ATOM 3830   N N   . LEU A 1 512 ? -57.765  -2.321  15.767  1.00 30.00  ? 516 LEU C N   1  
ATOM 3831   C CA  . LEU A 1 512 ? -56.524  -1.549  15.700  1.00 30.00  ? 516 LEU C CA  1  
ATOM 3832   C C   . LEU A 1 512 ? -55.607  -1.917  16.860  1.00 30.00  ? 516 LEU C C   1  
ATOM 3833   O O   . LEU A 1 512 ? -54.549  -1.302  17.061  1.00 30.00  ? 516 LEU C O   1  
ATOM 3834   C CB  . LEU A 1 512 ? -56.837  -0.058  15.771  1.00 99.99  ? 516 LEU C CB  1  
ATOM 3835   C CG  . LEU A 1 512 ? -56.935  0.512   14.360  1.00 99.99  ? 516 LEU C CG  1  
ATOM 3836   C CD1 . LEU A 1 512 ? -56.918  2.034   14.424  1.00 99.99  ? 516 LEU C CD1 1  
ATOM 3837   C CD2 . LEU A 1 512 ? -55.755  0.022   13.530  1.00 99.99  ? 516 LEU C CD2 1  
ATOM 3838   N N   . GLN A 1 513 ? -56.025  -2.915  17.614  1.00 30.00  ? 517 GLN C N   1  
ATOM 3839   C CA  . GLN A 1 513 ? -55.229  -3.388  18.747  1.00 30.00  ? 517 GLN C CA  1  
ATOM 3840   C C   . GLN A 1 513 ? -53.758  -3.276  18.360  1.00 30.00  ? 517 GLN C C   1  
ATOM 3841   O O   . GLN A 1 513 ? -52.908  -2.899  19.178  1.00 30.00  ? 517 GLN C O   1  
ATOM 3842   C CB  . GLN A 1 513 ? -55.582  -4.838  19.057  1.00 99.99  ? 517 GLN C CB  1  
ATOM 3843   C CG  . GLN A 1 513 ? -55.249  -5.145  20.513  1.00 99.99  ? 517 GLN C CG  1  
ATOM 3844   C CD  . GLN A 1 513 ? -53.786  -5.537  20.670  1.00 99.99  ? 517 GLN C CD  1  
ATOM 3845   O OE1 . GLN A 1 513 ? -53.043  -5.574  19.690  1.00 99.99  ? 517 GLN C OE1 1  
ATOM 3846   N NE2 . GLN A 1 513 ? -53.374  -5.829  21.906  1.00 99.99  ? 517 GLN C NE2 1  
ATOM 3847   N N   . MET A 1 514 ? -53.530  -3.603  17.103  1.00 30.00  ? 518 MET C N   1  
ATOM 3848   C CA  . MET A 1 514 ? -52.197  -3.582  16.491  1.00 30.00  ? 518 MET C CA  1  
ATOM 3849   C C   . MET A 1 514 ? -51.586  -2.189  16.605  1.00 30.00  ? 518 MET C C   1  
ATOM 3850   O O   . MET A 1 514 ? -50.815  -1.894  17.529  1.00 30.00  ? 518 MET C O   1  
ATOM 3851   C CB  . MET A 1 514 ? -52.296  -3.959  15.017  1.00 99.99  ? 518 MET C CB  1  
ATOM 3852   C CG  . MET A 1 514 ? -53.106  -5.241  14.872  1.00 99.99  ? 518 MET C CG  1  
ATOM 3853   S SD  . MET A 1 514 ? -52.067  -6.675  15.242  1.00 99.99  ? 518 MET C SD  1  
ATOM 3854   C CE  . MET A 1 514 ? -51.111  -6.759  13.742  1.00 99.99  ? 518 MET C CE  1  
ATOM 3855   N N   . CYS A 1 515 ? -51.930  -1.336  15.651  1.00 30.00  ? 519 CYS C N   1  
ATOM 3856   C CA  . CYS A 1 515 ? -51.422  0.035   15.668  1.00 30.00  ? 519 CYS C CA  1  
ATOM 3857   C C   . CYS A 1 515 ? -51.197  0.395   17.128  1.00 30.00  ? 519 CYS C C   1  
ATOM 3858   O O   . CYS A 1 515 ? -50.109  0.829   17.524  1.00 30.00  ? 519 CYS C O   1  
ATOM 3859   C CB  . CYS A 1 515 ? -52.441  0.974   15.030  1.00 99.99  ? 519 CYS C CB  1  
ATOM 3860   S SG  . CYS A 1 515 ? -54.008  1.165   15.915  1.00 99.99  ? 519 CYS C SG  1  
ATOM 3861   N N   . ILE A 1 516 ? -52.253  0.172   17.882  1.00 30.00  ? 520 ILE C N   1  
ATOM 3862   C CA  . ILE A 1 516 ? -52.245  0.399   19.321  1.00 30.00  ? 520 ILE C CA  1  
ATOM 3863   C C   . ILE A 1 516 ? -51.042  -0.332  19.926  1.00 30.00  ? 520 ILE C C   1  
ATOM 3864   O O   . ILE A 1 516 ? -50.223  0.267   20.636  1.00 30.00  ? 520 ILE C O   1  
ATOM 3865   C CB  . ILE A 1 516 ? -53.531  -0.134  19.939  1.00 99.99  ? 520 ILE C CB  1  
ATOM 3866   C CG1 . ILE A 1 516 ? -54.639  0.902   19.781  1.00 99.99  ? 520 ILE C CG1 1  
ATOM 3867   C CG2 . ILE A 1 516 ? -53.306  -0.415  21.422  1.00 99.99  ? 520 ILE C CG2 1  
ATOM 3868   C CD1 . ILE A 1 516 ? -55.498  0.552   18.571  1.00 99.99  ? 520 ILE C CD1 1  
ATOM 3869   N N   . ASP A 1 517 ? -50.974  -1.613  19.595  1.00 30.00  ? 521 ASP C N   1  
ATOM 3870   C CA  . ASP A 1 517 ? -49.929  -2.535  20.086  1.00 30.00  ? 521 ASP C CA  1  
ATOM 3871   C C   . ASP A 1 517 ? -48.519  -2.107  19.632  1.00 30.00  ? 521 ASP C C   1  
ATOM 3872   O O   . ASP A 1 517 ? -47.555  -2.163  20.406  1.00 30.00  ? 521 ASP C O   1  
ATOM 3873   C CB  . ASP A 1 517 ? -50.187  -3.942  19.556  1.00 99.99  ? 521 ASP C CB  1  
ATOM 3874   C CG  . ASP A 1 517 ? -49.260  -4.929  20.259  1.00 99.99  ? 521 ASP C CG  1  
ATOM 3875   O OD1 . ASP A 1 517 ? -48.072  -4.998  19.843  1.00 99.99  ? 521 ASP C OD1 1  
ATOM 3876   O OD2 . ASP A 1 517 ? -49.745  -5.604  21.206  1.00 99.99  ? 521 ASP C OD2 1  
ATOM 3877   N N   . LEU A 1 518 ? -48.419  -1.703  18.379  1.00 30.00  ? 522 LEU C N   1  
ATOM 3878   C CA  . LEU A 1 518 ? -47.131  -1.263  17.795  1.00 30.00  ? 522 LEU C CA  1  
ATOM 3879   C C   . LEU A 1 518 ? -46.528  -0.150  18.654  1.00 30.00  ? 522 LEU C C   1  
ATOM 3880   O O   . LEU A 1 518 ? -45.306  -0.070  18.837  1.00 30.00  ? 522 LEU C O   1  
ATOM 3881   C CB  . LEU A 1 518 ? -47.350  -0.743  16.380  1.00 99.99  ? 522 LEU C CB  1  
ATOM 3882   C CG  . LEU A 1 518 ? -47.098  -1.862  15.378  1.00 99.99  ? 522 LEU C CG  1  
ATOM 3883   C CD1 . LEU A 1 518 ? -46.996  -1.275  13.975  1.00 99.99  ? 522 LEU C CD1 1  
ATOM 3884   C CD2 . LEU A 1 518 ? -45.798  -2.575  15.730  1.00 99.99  ? 522 LEU C CD2 1  
ATOM 3885   N N   . ILE A 1 519 ? -47.406  0.706   19.175  1.00 30.00  ? 523 ILE C N   1  
ATOM 3886   C CA  . ILE A 1 519 ? -47.030  1.842   20.004  1.00 30.00  ? 523 ILE C CA  1  
ATOM 3887   C C   . ILE A 1 519 ? -46.963  1.578   21.517  1.00 30.00  ? 523 ILE C C   1  
ATOM 3888   O O   . ILE A 1 519 ? -45.989  1.951   22.157  1.00 30.00  ? 523 ILE C O   1  
ATOM 3889   C CB  . ILE A 1 519 ? -48.035  2.973   19.820  1.00 99.99  ? 523 ILE C CB  1  
ATOM 3890   C CG1 . ILE A 1 519 ? -47.769  4.066   20.851  1.00 99.99  ? 523 ILE C CG1 1  
ATOM 3891   C CG2 . ILE A 1 519 ? -49.451  2.433   20.006  1.00 99.99  ? 523 ILE C CG2 1  
ATOM 3892   C CD1 . ILE A 1 519 ? -46.266  4.309   20.956  1.00 99.99  ? 523 ILE C CD1 1  
ATOM 3893   N N   . GLU A 1 520 ? -47.978  0.921   22.077  1.00 30.00  ? 524 GLU C N   1  
ATOM 3894   C CA  . GLU A 1 520 ? -48.006  0.667   23.516  1.00 30.00  ? 524 GLU C CA  1  
ATOM 3895   C C   . GLU A 1 520 ? -47.482  -0.646  24.103  1.00 30.00  ? 524 GLU C C   1  
ATOM 3896   O O   . GLU A 1 520 ? -46.855  -0.632  25.151  1.00 30.00  ? 524 GLU C O   1  
ATOM 3897   C CB  . GLU A 1 520 ? -49.444  0.718   24.023  1.00 99.99  ? 524 GLU C CB  1  
ATOM 3898   C CG  . GLU A 1 520 ? -49.448  1.048   25.497  1.00 99.99  ? 524 GLU C CG  1  
ATOM 3899   C CD  . GLU A 1 520 ? -49.265  -0.232  26.305  1.00 99.99  ? 524 GLU C CD  1  
ATOM 3900   O OE1 . GLU A 1 520 ? -48.085  -0.577  26.582  1.00 99.99  ? 524 GLU C OE1 1  
ATOM 3901   O OE2 . GLU A 1 520 ? -50.307  -0.857  26.641  1.00 99.99  ? 524 GLU C OE2 1  
ATOM 3902   N N   . LYS A 1 521 ? -47.727  -1.772  23.448  1.00 30.00  ? 525 LYS C N   1  
ATOM 3903   C CA  . LYS A 1 521 ? -47.278  -3.077  23.959  1.00 30.00  ? 525 LYS C CA  1  
ATOM 3904   C C   . LYS A 1 521 ? -45.815  -3.203  24.395  1.00 30.00  ? 525 LYS C C   1  
ATOM 3905   O O   . LYS A 1 521 ? -44.945  -2.461  23.935  1.00 30.00  ? 525 LYS C O   1  
ATOM 3906   C CB  . LYS A 1 521 ? -47.467  -4.146  22.888  1.00 99.99  ? 525 LYS C CB  1  
ATOM 3907   C CG  . LYS A 1 521 ? -47.093  -5.509  23.461  1.00 99.99  ? 525 LYS C CG  1  
ATOM 3908   C CD  . LYS A 1 521 ? -47.685  -6.607  22.585  1.00 99.99  ? 525 LYS C CD  1  
ATOM 3909   C CE  . LYS A 1 521 ? -47.021  -7.939  22.920  1.00 99.99  ? 525 LYS C CE  1  
ATOM 3910   N NZ  . LYS A 1 521 ? -47.829  -8.653  23.921  1.00 99.99  ? 525 LYS C NZ  1  
ATOM 3911   N N   . PRO A 1 522 ? -45.534  -4.170  25.296  1.00 30.00  ? 526 PRO C N   1  
ATOM 3912   C CA  . PRO A 1 522 ? -44.222  -4.477  25.851  1.00 30.00  ? 526 PRO C CA  1  
ATOM 3913   C C   . PRO A 1 522 ? -43.002  -4.004  25.081  1.00 30.00  ? 526 PRO C C   1  
ATOM 3914   O O   . PRO A 1 522 ? -42.187  -3.266  25.633  1.00 30.00  ? 526 PRO C O   1  
ATOM 3915   C CB  . PRO A 1 522 ? -44.320  -5.963  25.817  1.00 99.99  ? 526 PRO C CB  1  
ATOM 3916   C CG  . PRO A 1 522 ? -45.701  -6.279  25.294  1.00 99.99  ? 526 PRO C CG  1  
ATOM 3917   C CD  . PRO A 1 522 ? -46.404  -5.245  25.045  1.00 99.99  ? 526 PRO C CD  1  
ATOM 3918   N N   . MET A 1 523 ? -42.846  -4.400  23.827  1.00 30.00  ? 527 MET C N   1  
ATOM 3919   C CA  . MET A 1 523 ? -41.659  -3.931  23.118  1.00 30.00  ? 527 MET C CA  1  
ATOM 3920   C C   . MET A 1 523 ? -41.937  -2.788  22.145  1.00 30.00  ? 527 MET C C   1  
ATOM 3921   O O   . MET A 1 523 ? -41.049  -2.377  21.393  1.00 30.00  ? 527 MET C O   1  
ATOM 3922   C CB  . MET A 1 523 ? -41.054  -5.072  22.306  1.00 99.99  ? 527 MET C CB  1  
ATOM 3923   C CG  . MET A 1 523 ? -40.891  -6.298  23.197  1.00 99.99  ? 527 MET C CG  1  
ATOM 3924   S SD  . MET A 1 523 ? -39.400  -6.132  24.211  1.00 99.99  ? 527 MET C SD  1  
ATOM 3925   C CE  . MET A 1 523 ? -38.156  -6.488  22.989  1.00 99.99  ? 527 MET C CE  1  
ATOM 3926   N N   . GLY A 1 524 ? -43.169  -2.279  22.184  1.00 30.00  ? 528 GLY C N   1  
ATOM 3927   C CA  . GLY A 1 524 ? -43.603  -1.196  21.316  1.00 30.00  ? 528 GLY C CA  1  
ATOM 3928   C C   . GLY A 1 524 ? -42.638  -0.058  21.034  1.00 30.00  ? 528 GLY C C   1  
ATOM 3929   O O   . GLY A 1 524 ? -41.479  -0.094  21.420  1.00 30.00  ? 528 GLY C O   1  
ATOM 3930   N N   . ILE A 1 525 ? -43.145  0.958   20.342  1.00 30.00  ? 529 ILE C N   1  
ATOM 3931   C CA  . ILE A 1 525 ? -42.372  2.139   19.968  1.00 30.00  ? 529 ILE C CA  1  
ATOM 3932   C C   . ILE A 1 525 ? -41.945  2.957   21.178  1.00 30.00  ? 529 ILE C C   1  
ATOM 3933   O O   . ILE A 1 525 ? -40.772  3.311   21.328  1.00 30.00  ? 529 ILE C O   1  
ATOM 3934   C CB  . ILE A 1 525 ? -43.209  3.040   19.068  1.00 99.99  ? 529 ILE C CB  1  
ATOM 3935   C CG1 . ILE A 1 525 ? -44.061  3.969   19.926  1.00 99.99  ? 529 ILE C CG1 1  
ATOM 3936   C CG2 . ILE A 1 525 ? -44.117  2.182   18.192  1.00 99.99  ? 529 ILE C CG2 1  
ATOM 3937   C CD1 . ILE A 1 525 ? -43.331  5.296   20.115  1.00 99.99  ? 529 ILE C CD1 1  
ATOM 3938   N N   . LEU A 1 526 ? -42.934  3.255   22.023  1.00 30.00  ? 530 LEU C N   1  
ATOM 3939   C CA  . LEU A 1 526 ? -42.759  4.035   23.249  1.00 30.00  ? 530 LEU C CA  1  
ATOM 3940   C C   . LEU A 1 526 ? -41.910  3.291   24.265  1.00 30.00  ? 530 LEU C C   1  
ATOM 3941   O O   . LEU A 1 526 ? -41.036  3.880   24.897  1.00 30.00  ? 530 LEU C O   1  
ATOM 3942   C CB  . LEU A 1 526 ? -44.119  4.323   23.880  1.00 99.99  ? 530 LEU C CB  1  
ATOM 3943   C CG  . LEU A 1 526 ? -44.617  5.688   23.417  1.00 99.99  ? 530 LEU C CG  1  
ATOM 3944   C CD1 . LEU A 1 526 ? -45.793  6.119   24.284  1.00 99.99  ? 530 LEU C CD1 1  
ATOM 3945   C CD2 . LEU A 1 526 ? -43.489  6.707   23.541  1.00 99.99  ? 530 LEU C CD2 1  
ATOM 3946   N N   . SER A 1 527 ? -42.173  2.006   24.427  1.00 30.00  ? 531 SER C N   1  
ATOM 3947   C CA  . SER A 1 527 ? -41.414  1.217   25.368  1.00 30.00  ? 531 SER C CA  1  
ATOM 3948   C C   . SER A 1 527 ? -39.945  1.185   24.967  1.00 30.00  ? 531 SER C C   1  
ATOM 3949   O O   . SER A 1 527 ? -39.061  1.111   25.813  1.00 30.00  ? 531 SER C O   1  
ATOM 3950   C CB  . SER A 1 527 ? -41.947  -0.210  25.397  1.00 99.99  ? 531 SER C CB  1  
ATOM 3951   O OG  . SER A 1 527 ? -41.666  -0.852  24.152  1.00 99.99  ? 531 SER C OG  1  
ATOM 3952   N N   . ILE A 1 528 ? -39.683  1.230   23.668  1.00 30.00  ? 532 ILE C N   1  
ATOM 3953   C CA  . ILE A 1 528 ? -38.316  1.212   23.172  1.00 30.00  ? 532 ILE C CA  1  
ATOM 3954   C C   . ILE A 1 528 ? -37.694  2.545   23.574  1.00 30.00  ? 532 ILE C C   1  
ATOM 3955   O O   . ILE A 1 528 ? -36.610  2.590   24.157  1.00 30.00  ? 532 ILE C O   1  
ATOM 3956   C CB  . ILE A 1 528 ? -38.318  1.049   21.655  1.00 99.99  ? 532 ILE C CB  1  
ATOM 3957   C CG1 . ILE A 1 528 ? -39.238  -0.102  21.269  1.00 99.99  ? 532 ILE C CG1 1  
ATOM 3958   C CG2 . ILE A 1 528 ? -36.901  0.750   21.177  1.00 99.99  ? 532 ILE C CG2 1  
ATOM 3959   C CD1 . ILE A 1 528 ? -38.598  -1.426  21.675  1.00 99.99  ? 532 ILE C CD1 1  
ATOM 3960   N N   . LEU A 1 529 ? -38.401  3.631   23.258  1.00 30.00  ? 533 LEU C N   1  
ATOM 3961   C CA  . LEU A 1 529 ? -37.949  4.979   23.574  1.00 30.00  ? 533 LEU C CA  1  
ATOM 3962   C C   . LEU A 1 529 ? -37.752  5.158   25.067  1.00 30.00  ? 533 LEU C C   1  
ATOM 3963   O O   . LEU A 1 529 ? -36.778  5.752   25.495  1.00 30.00  ? 533 LEU C O   1  
ATOM 3964   C CB  . LEU A 1 529 ? -38.980  5.996   23.097  1.00 99.99  ? 533 LEU C CB  1  
ATOM 3965   C CG  . LEU A 1 529 ? -38.599  6.496   21.709  1.00 99.99  ? 533 LEU C CG  1  
ATOM 3966   C CD1 . LEU A 1 529 ? -39.423  7.735   21.371  1.00 99.99  ? 533 LEU C CD1 1  
ATOM 3967   C CD2 . LEU A 1 529 ? -37.116  6.851   21.687  1.00 99.99  ? 533 LEU C CD2 1  
ATOM 3968   N N   . GLU A 1 530 ? -38.687  4.651   25.858  1.00 30.00  ? 534 GLU C N   1  
ATOM 3969   C CA  . GLU A 1 530 ? -38.598  4.764   27.310  1.00 30.00  ? 534 GLU C CA  1  
ATOM 3970   C C   . GLU A 1 530 ? -37.325  4.090   27.833  1.00 30.00  ? 534 GLU C C   1  
ATOM 3971   O O   . GLU A 1 530 ? -36.643  4.639   28.692  1.00 30.00  ? 534 GLU C O   1  
ATOM 3972   C CB  . GLU A 1 530 ? -39.804  4.096   27.958  1.00 99.99  ? 534 GLU C CB  1  
ATOM 3973   C CG  . GLU A 1 530 ? -41.059  4.844   27.577  1.00 99.99  ? 534 GLU C CG  1  
ATOM 3974   C CD  . GLU A 1 530 ? -41.096  6.183   28.307  1.00 99.99  ? 534 GLU C CD  1  
ATOM 3975   O OE1 . GLU A 1 530 ? -40.564  7.168   27.730  1.00 99.99  ? 534 GLU C OE1 1  
ATOM 3976   O OE2 . GLU A 1 530 ? -41.654  6.209   29.437  1.00 99.99  ? 534 GLU C OE2 1  
ATOM 3977   N N   . GLU A 1 531 ? -36.993  2.904   27.325  1.00 30.00  ? 535 GLU C N   1  
ATOM 3978   C CA  . GLU A 1 531 ? -35.789  2.204   27.777  1.00 30.00  ? 535 GLU C CA  1  
ATOM 3979   C C   . GLU A 1 531 ? -34.541  2.800   27.152  1.00 30.00  ? 535 GLU C C   1  
ATOM 3980   O O   . GLU A 1 531 ? -33.433  2.467   27.551  1.00 30.00  ? 535 GLU C O   1  
ATOM 3981   C CB  . GLU A 1 531 ? -35.869  0.733   27.385  1.00 99.99  ? 535 GLU C CB  1  
ATOM 3982   C CG  . GLU A 1 531 ? -37.013  0.075   28.119  1.00 99.99  ? 535 GLU C CG  1  
ATOM 3983   C CD  . GLU A 1 531 ? -36.650  -0.078  29.596  1.00 99.99  ? 535 GLU C CD  1  
ATOM 3984   O OE1 . GLU A 1 531 ? -36.954  0.870   30.365  1.00 99.99  ? 535 GLU C OE1 1  
ATOM 3985   O OE2 . GLU A 1 531 ? -36.071  -1.145  29.938  1.00 99.99  ? 535 GLU C OE2 1  
ATOM 3986   N N   . GLU A 1 532 ? -34.723  3.687   26.182  1.00 30.00  ? 536 GLU C N   1  
ATOM 3987   C CA  . GLU A 1 532 ? -33.601  4.334   25.501  1.00 30.00  ? 536 GLU C CA  1  
ATOM 3988   C C   . GLU A 1 532 ? -33.172  5.643   26.202  1.00 30.00  ? 536 GLU C C   1  
ATOM 3989   O O   . GLU A 1 532 ? -32.037  6.115   26.041  1.00 30.00  ? 536 GLU C O   1  
ATOM 3990   C CB  . GLU A 1 532 ? -33.992  4.674   24.067  1.00 99.99  ? 536 GLU C CB  1  
ATOM 3991   C CG  . GLU A 1 532 ? -34.246  3.400   23.297  1.00 99.99  ? 536 GLU C CG  1  
ATOM 3992   C CD  . GLU A 1 532 ? -32.918  2.694   23.034  1.00 99.99  ? 536 GLU C CD  1  
ATOM 3993   O OE1 . GLU A 1 532 ? -32.523  1.867   23.897  1.00 99.99  ? 536 GLU C OE1 1  
ATOM 3994   O OE2 . GLU A 1 532 ? -32.310  2.987   21.969  1.00 99.99  ? 536 GLU C OE2 1  
ATOM 3995   N N   . CYS A 1 533 ? -34.096  6.219   26.970  1.00 30.00  ? 537 CYS C N   1  
ATOM 3996   C CA  . CYS A 1 533 ? -33.872  7.461   27.711  1.00 30.00  ? 537 CYS C CA  1  
ATOM 3997   C C   . CYS A 1 533 ? -32.968  7.222   28.905  1.00 30.00  ? 537 CYS C C   1  
ATOM 3998   O O   . CYS A 1 533 ? -32.049  8.003   29.161  1.00 30.00  ? 537 CYS C O   1  
ATOM 3999   C CB  . CYS A 1 533 ? -35.205  8.016   28.210  1.00 99.99  ? 537 CYS C CB  1  
ATOM 4000   S SG  . CYS A 1 533 ? -36.064  7.017   29.450  1.00 99.99  ? 537 CYS C SG  1  
ATOM 4001   N N   . MET A 1 534 ? -33.241  6.135   29.627  1.00 30.00  ? 538 MET C N   1  
ATOM 4002   C CA  . MET A 1 534 ? -32.472  5.768   30.807  1.00 30.00  ? 538 MET C CA  1  
ATOM 4003   C C   . MET A 1 534 ? -30.971  5.598   30.537  1.00 30.00  ? 538 MET C C   1  
ATOM 4004   O O   . MET A 1 534 ? -30.172  5.437   31.467  1.00 30.00  ? 538 MET C O   1  
ATOM 4005   C CB  . MET A 1 534 ? -32.979  4.443   31.366  1.00 99.99  ? 538 MET C CB  1  
ATOM 4006   C CG  . MET A 1 534 ? -34.494  4.498   31.515  1.00 99.99  ? 538 MET C CG  1  
ATOM 4007   S SD  . MET A 1 534 ? -34.936  5.387   33.029  1.00 99.99  ? 538 MET C SD  1  
ATOM 4008   C CE  . MET A 1 534 ? -34.569  4.136   34.239  1.00 99.99  ? 538 MET C CE  1  
ATOM 4009   N N   . PHE A 1 535 ? -30.584  5.640   29.264  1.00 30.00  ? 539 PHE C N   1  
ATOM 4010   C CA  . PHE A 1 535 ? -29.179  5.507   28.886  1.00 30.00  ? 539 PHE C CA  1  
ATOM 4011   C C   . PHE A 1 535 ? -28.676  6.880   28.464  1.00 30.00  ? 539 PHE C C   1  
ATOM 4012   O O   . PHE A 1 535 ? -29.212  7.488   27.543  1.00 30.00  ? 539 PHE C O   1  
ATOM 4013   C CB  . PHE A 1 535 ? -29.042  4.522   27.730  1.00 99.99  ? 539 PHE C CB  1  
ATOM 4014   C CG  . PHE A 1 535 ? -29.487  3.150   28.181  1.00 99.99  ? 539 PHE C CG  1  
ATOM 4015   C CD1 . PHE A 1 535 ? -30.831  2.778   28.062  1.00 99.99  ? 539 PHE C CD1 1  
ATOM 4016   C CD2 . PHE A 1 535 ? -28.557  2.253   28.718  1.00 99.99  ? 539 PHE C CD2 1  
ATOM 4017   C CE1 . PHE A 1 535 ? -31.246  1.508   28.479  1.00 99.99  ? 539 PHE C CE1 1  
ATOM 4018   C CE2 . PHE A 1 535 ? -28.972  0.982   29.137  1.00 99.99  ? 539 PHE C CE2 1  
ATOM 4019   C CZ  . PHE A 1 535 ? -30.315  0.610   29.017  1.00 99.99  ? 539 PHE C CZ  1  
ATOM 4020   N N   . PRO A 1 536 ? -27.639  7.390   29.139  1.00 30.00  ? 540 PRO C N   1  
ATOM 4021   C CA  . PRO A 1 536 ? -27.094  8.709   28.806  1.00 30.00  ? 540 PRO C CA  1  
ATOM 4022   C C   . PRO A 1 536 ? -26.312  8.671   27.506  1.00 30.00  ? 540 PRO C C   1  
ATOM 4023   O O   . PRO A 1 536 ? -26.106  9.698   26.847  1.00 30.00  ? 540 PRO C O   1  
ATOM 4024   C CB  . PRO A 1 536 ? -26.220  8.890   29.997  1.00 99.99  ? 540 PRO C CB  1  
ATOM 4025   C CG  . PRO A 1 536 ? -26.436  7.671   30.863  1.00 99.99  ? 540 PRO C CG  1  
ATOM 4026   C CD  . PRO A 1 536 ? -27.285  6.848   30.384  1.00 99.99  ? 540 PRO C CD  1  
ATOM 4027   N N   . LYS A 1 537 ? -25.891  7.460   27.146  1.00 30.00  ? 541 LYS C N   1  
ATOM 4028   C CA  . LYS A 1 537 ? -25.130  7.215   25.930  1.00 30.00  ? 541 LYS C CA  1  
ATOM 4029   C C   . LYS A 1 537 ? -25.982  7.407   24.674  1.00 30.00  ? 541 LYS C C   1  
ATOM 4030   O O   . LYS A 1 537 ? -25.540  8.026   23.705  1.00 30.00  ? 541 LYS C O   1  
ATOM 4031   C CB  . LYS A 1 537 ? -24.603  5.783   25.929  1.00 99.99  ? 541 LYS C CB  1  
ATOM 4032   C CG  . LYS A 1 537 ? -23.728  5.563   24.701  1.00 99.99  ? 541 LYS C CG  1  
ATOM 4033   C CD  . LYS A 1 537 ? -22.855  4.330   24.913  1.00 99.99  ? 541 LYS C CD  1  
ATOM 4034   C CE  . LYS A 1 537 ? -22.260  3.894   23.577  1.00 99.99  ? 541 LYS C CE  1  
ATOM 4035   N NZ  . LYS A 1 537 ? -20.928  4.492   23.413  1.00 99.99  ? 541 LYS C NZ  1  
ATOM 4036   N N   . ALA A 1 538 ? -27.203  6.877   24.711  1.00 30.00  ? 542 ALA C N   1  
ATOM 4037   C CA  . ALA A 1 538 ? -28.157  6.954   23.598  1.00 30.00  ? 542 ALA C CA  1  
ATOM 4038   C C   . ALA A 1 538 ? -28.202  8.249   22.774  1.00 30.00  ? 542 ALA C C   1  
ATOM 4039   O O   . ALA A 1 538 ? -27.748  9.302   23.206  1.00 30.00  ? 542 ALA C O   1  
ATOM 4040   C CB  . ALA A 1 538 ? -29.548  6.645   24.129  1.00 30.00  ? 542 ALA C CB  1  
ATOM 4041   N N   . ASP A 1 539 ? -28.766  8.152   21.575  1.00 30.00  ? 543 ASP C N   1  
ATOM 4042   C CA  . ASP A 1 539 ? -28.894  9.282   20.661  1.00 30.00  ? 543 ASP C CA  1  
ATOM 4043   C C   . ASP A 1 539 ? -29.955  9.014   19.578  1.00 30.00  ? 543 ASP C C   1  
ATOM 4044   O O   . ASP A 1 539 ? -30.508  7.917   19.473  1.00 30.00  ? 543 ASP C O   1  
ATOM 4045   C CB  . ASP A 1 539 ? -27.560  9.544   19.971  1.00 99.99  ? 543 ASP C CB  1  
ATOM 4046   C CG  . ASP A 1 539 ? -27.630  10.867  19.212  1.00 99.99  ? 543 ASP C CG  1  
ATOM 4047   O OD1 . ASP A 1 539 ? -28.201  10.858  18.089  1.00 99.99  ? 543 ASP C OD1 1  
ATOM 4048   O OD2 . ASP A 1 539 ? -27.113  11.875  19.764  1.00 99.99  ? 543 ASP C OD2 1  
ATOM 4049   N N   . ASP A 1 540 ? -30.231  10.030  18.767  1.00 30.00  ? 544 ASP C N   1  
ATOM 4050   C CA  . ASP A 1 540 ? -31.228  9.914   17.707  1.00 30.00  ? 544 ASP C CA  1  
ATOM 4051   C C   . ASP A 1 540 ? -30.982  8.788   16.693  1.00 30.00  ? 544 ASP C C   1  
ATOM 4052   O O   . ASP A 1 540 ? -31.859  8.478   15.894  1.00 30.00  ? 544 ASP C O   1  
ATOM 4053   C CB  . ASP A 1 540 ? -31.282  11.208  16.902  1.00 99.99  ? 544 ASP C CB  1  
ATOM 4054   C CG  . ASP A 1 540 ? -32.486  11.178  15.966  1.00 99.99  ? 544 ASP C CG  1  
ATOM 4055   O OD1 . ASP A 1 540 ? -32.365  10.525  14.893  1.00 99.99  ? 544 ASP C OD1 1  
ATOM 4056   O OD2 . ASP A 1 540 ? -33.517  11.804  16.330  1.00 99.99  ? 544 ASP C OD2 1  
ATOM 4057   N N   . LYS A 1 541 ? -29.806  8.167   16.706  1.00 30.00  ? 545 LYS C N   1  
ATOM 4058   C CA  . LYS A 1 541 ? -29.553  7.091   15.755  1.00 30.00  ? 545 LYS C CA  1  
ATOM 4059   C C   . LYS A 1 541 ? -29.675  5.716   16.385  1.00 30.00  ? 545 LYS C C   1  
ATOM 4060   O O   . LYS A 1 541 ? -30.144  4.790   15.737  1.00 30.00  ? 545 LYS C O   1  
ATOM 4061   C CB  . LYS A 1 541 ? -28.143  7.221   15.190  1.00 99.99  ? 545 LYS C CB  1  
ATOM 4062   C CG  . LYS A 1 541 ? -27.922  6.153   14.124  1.00 99.99  ? 545 LYS C CG  1  
ATOM 4063   C CD  . LYS A 1 541 ? -26.726  6.537   13.259  1.00 99.99  ? 545 LYS C CD  1  
ATOM 4064   C CE  . LYS A 1 541 ? -26.273  5.326   12.450  1.00 99.99  ? 545 LYS C CE  1  
ATOM 4065   N NZ  . LYS A 1 541 ? -26.915  5.352   11.127  1.00 99.99  ? 545 LYS C NZ  1  
ATOM 4066   N N   . SER A 1 542 ? -29.258  5.565   17.640  1.00 30.00  ? 546 SER C N   1  
ATOM 4067   C CA  . SER A 1 542 ? -29.363  4.258   18.282  1.00 30.00  ? 546 SER C CA  1  
ATOM 4068   C C   . SER A 1 542 ? -30.844  4.002   18.529  1.00 30.00  ? 546 SER C C   1  
ATOM 4069   O O   . SER A 1 542 ? -31.296  2.851   18.576  1.00 30.00  ? 546 SER C O   1  
ATOM 4070   C CB  . SER A 1 542 ? -28.594  4.261   19.598  1.00 99.99  ? 546 SER C CB  1  
ATOM 4071   O OG  . SER A 1 542 ? -29.249  5.121   20.532  1.00 99.99  ? 546 SER C OG  1  
ATOM 4072   N N   . PHE A 1 543 ? -31.598  5.089   18.676  1.00 30.00  ? 547 PHE C N   1  
ATOM 4073   C CA  . PHE A 1 543 ? -33.030  4.997   18.898  1.00 30.00  ? 547 PHE C CA  1  
ATOM 4074   C C   . PHE A 1 543 ? -33.678  4.611   17.568  1.00 30.00  ? 547 PHE C C   1  
ATOM 4075   O O   . PHE A 1 543 ? -34.495  3.704   17.525  1.00 30.00  ? 547 PHE C O   1  
ATOM 4076   C CB  . PHE A 1 543 ? -33.568  6.340   19.379  1.00 99.99  ? 547 PHE C CB  1  
ATOM 4077   C CG  . PHE A 1 543 ? -33.148  6.569   20.811  1.00 99.99  ? 547 PHE C CG  1  
ATOM 4078   C CD1 . PHE A 1 543 ? -33.820  5.914   21.849  1.00 99.99  ? 547 PHE C CD1 1  
ATOM 4079   C CD2 . PHE A 1 543 ? -32.087  7.435   21.099  1.00 99.99  ? 547 PHE C CD2 1  
ATOM 4080   C CE1 . PHE A 1 543 ? -33.430  6.126   23.179  1.00 99.99  ? 547 PHE C CE1 1  
ATOM 4081   C CE2 . PHE A 1 543 ? -31.696  7.646   22.427  1.00 99.99  ? 547 PHE C CE2 1  
ATOM 4082   C CZ  . PHE A 1 543 ? -32.369  6.992   23.467  1.00 99.99  ? 547 PHE C CZ  1  
ATOM 4083   N N   . GLN A 1 544 ? -33.302  5.298   16.496  1.00 30.00  ? 548 GLN C N   1  
ATOM 4084   C CA  . GLN A 1 544 ? -33.851  5.025   15.175  1.00 30.00  ? 548 GLN C CA  1  
ATOM 4085   C C   . GLN A 1 544 ? -33.544  3.615   14.681  1.00 30.00  ? 548 GLN C C   1  
ATOM 4086   O O   . GLN A 1 544 ? -34.384  2.963   14.061  1.00 30.00  ? 548 GLN C O   1  
ATOM 4087   C CB  . GLN A 1 544 ? -33.270  6.003   14.160  1.00 99.99  ? 548 GLN C CB  1  
ATOM 4088   C CG  . GLN A 1 544 ? -34.223  6.134   12.978  1.00 99.99  ? 548 GLN C CG  1  
ATOM 4089   C CD  . GLN A 1 544 ? -33.983  5.033   11.954  1.00 99.99  ? 548 GLN C CD  1  
ATOM 4090   O OE1 . GLN A 1 544 ? -33.109  4.188   12.141  1.00 99.99  ? 548 GLN C OE1 1  
ATOM 4091   N NE2 . GLN A 1 544 ? -34.761  5.043   10.869  1.00 99.99  ? 548 GLN C NE2 1  
ATOM 4092   N N   . ASP A 1 545 ? -32.334  3.146   14.950  1.00 30.00  ? 549 ASP C N   1  
ATOM 4093   C CA  . ASP A 1 545 ? -31.929  1.816   14.532  1.00 30.00  ? 549 ASP C CA  1  
ATOM 4094   C C   . ASP A 1 545 ? -32.592  0.783   15.427  1.00 30.00  ? 549 ASP C C   1  
ATOM 4095   O O   . ASP A 1 545 ? -33.131  -0.211  14.938  1.00 30.00  ? 549 ASP C O   1  
ATOM 4096   C CB  . ASP A 1 545 ? -30.414  1.676   14.635  1.00 99.99  ? 549 ASP C CB  1  
ATOM 4097   C CG  . ASP A 1 545 ? -29.747  2.570   13.593  1.00 99.99  ? 549 ASP C CG  1  
ATOM 4098   O OD1 . ASP A 1 545 ? -29.834  2.213   12.388  1.00 99.99  ? 549 ASP C OD1 1  
ATOM 4099   O OD2 . ASP A 1 545 ? -29.159  3.603   14.010  1.00 99.99  ? 549 ASP C OD2 1  
ATOM 4100   N N   . LYS A 1 546 ? -32.560  1.023   16.732  1.00 30.00  ? 550 LYS C N   1  
ATOM 4101   C CA  . LYS A 1 546 ? -33.175  0.101   17.690  1.00 30.00  ? 550 LYS C CA  1  
ATOM 4102   C C   . LYS A 1 546 ? -34.674  -0.141  17.384  1.00 30.00  ? 550 LYS C C   1  
ATOM 4103   O O   . LYS A 1 546 ? -35.271  -1.126  17.839  1.00 30.00  ? 550 LYS C O   1  
ATOM 4104   C CB  . LYS A 1 546 ? -33.067  0.668   19.100  1.00 99.99  ? 550 LYS C CB  1  
ATOM 4105   C CG  . LYS A 1 546 ? -33.435  -0.410  20.113  1.00 99.99  ? 550 LYS C CG  1  
ATOM 4106   C CD  . LYS A 1 546 ? -33.231  0.127   21.526  1.00 99.99  ? 550 LYS C CD  1  
ATOM 4107   C CE  . LYS A 1 546 ? -33.621  -0.944  22.539  1.00 99.99  ? 550 LYS C CE  1  
ATOM 4108   N NZ  . LYS A 1 546 ? -33.450  -0.417  23.900  1.00 99.99  ? 550 LYS C NZ  1  
ATOM 4109   N N   . LEU A 1 547 ? -35.258  0.769   16.599  1.00 30.00  ? 551 LEU C N   1  
ATOM 4110   C CA  . LEU A 1 547 ? -36.669  0.710   16.205  1.00 30.00  ? 551 LEU C CA  1  
ATOM 4111   C C   . LEU A 1 547 ? -36.884  -0.273  15.047  1.00 30.00  ? 551 LEU C C   1  
ATOM 4112   O O   . LEU A 1 547 ? -37.691  -1.200  15.154  1.00 30.00  ? 551 LEU C O   1  
ATOM 4113   C CB  . LEU A 1 547 ? -37.139  2.091   15.757  1.00 99.99  ? 551 LEU C CB  1  
ATOM 4114   C CG  . LEU A 1 547 ? -37.791  2.811   16.931  1.00 99.99  ? 551 LEU C CG  1  
ATOM 4115   C CD1 . LEU A 1 547 ? -38.548  4.034   16.421  1.00 99.99  ? 551 LEU C CD1 1  
ATOM 4116   C CD2 . LEU A 1 547 ? -38.763  1.869   17.634  1.00 99.99  ? 551 LEU C CD2 1  
ATOM 4117   N N   . TYR A 1 548 ? -36.174  -0.057  13.940  1.00 30.00  ? 552 TYR C N   1  
ATOM 4118   C CA  . TYR A 1 548 ? -36.293  -0.942  12.785  1.00 30.00  ? 552 TYR C CA  1  
ATOM 4119   C C   . TYR A 1 548 ? -35.902  -2.327  13.278  1.00 30.00  ? 552 TYR C C   1  
ATOM 4120   O O   . TYR A 1 548 ? -36.545  -3.333  12.959  1.00 30.00  ? 552 TYR C O   1  
ATOM 4121   C CB  . TYR A 1 548 ? -35.363  -0.474  11.671  1.00 99.99  ? 552 TYR C CB  1  
ATOM 4122   C CG  . TYR A 1 548 ? -35.493  -1.394  10.483  1.00 99.99  ? 552 TYR C CG  1  
ATOM 4123   C CD1 . TYR A 1 548 ? -36.532  -1.203  9.562   1.00 99.99  ? 552 TYR C CD1 1  
ATOM 4124   C CD2 . TYR A 1 548 ? -34.578  -2.436  10.297  1.00 99.99  ? 552 TYR C CD2 1  
ATOM 4125   C CE1 . TYR A 1 548 ? -36.655  -2.057  8.459   1.00 99.99  ? 552 TYR C CE1 1  
ATOM 4126   C CE2 . TYR A 1 548 ? -34.700  -3.289  9.196   1.00 99.99  ? 552 TYR C CE2 1  
ATOM 4127   C CZ  . TYR A 1 548 ? -35.739  -3.098  8.274   1.00 99.99  ? 552 TYR C CZ  1  
ATOM 4128   O OH  . TYR A 1 548 ? -35.858  -3.928  7.202   1.00 99.99  ? 552 TYR C OH  1  
ATOM 4129   N N   . GLN A 1 549 ? -34.838  -2.353  14.072  1.00 30.00  ? 553 GLN C N   1  
ATOM 4130   C CA  . GLN A 1 549 ? -34.330  -3.590  14.645  1.00 30.00  ? 553 GLN C CA  1  
ATOM 4131   C C   . GLN A 1 549 ? -35.481  -4.455  15.163  1.00 30.00  ? 553 GLN C C   1  
ATOM 4132   O O   . GLN A 1 549 ? -35.468  -5.677  15.026  1.00 30.00  ? 553 GLN C O   1  
ATOM 4133   C CB  . GLN A 1 549 ? -33.394  -3.274  15.806  1.00 99.99  ? 553 GLN C CB  1  
ATOM 4134   C CG  . GLN A 1 549 ? -32.432  -4.438  16.017  1.00 99.99  ? 553 GLN C CG  1  
ATOM 4135   C CD  . GLN A 1 549 ? -33.054  -5.513  16.898  1.00 99.99  ? 553 GLN C CD  1  
ATOM 4136   O OE1 . GLN A 1 549 ? -34.192  -5.374  17.338  1.00 99.99  ? 553 GLN C OE1 1  
ATOM 4137   N NE2 . GLN A 1 549 ? -32.303  -6.586  17.152  1.00 99.99  ? 553 GLN C NE2 1  
ATOM 4138   N N   . ASN A 1 550 ? -36.491  -3.811  15.741  1.00 30.00  ? 554 ASN C N   1  
ATOM 4139   C CA  . ASN A 1 550 ? -37.621  -4.529  16.304  1.00 30.00  ? 554 ASN C CA  1  
ATOM 4140   C C   . ASN A 1 550 ? -38.911  -4.682  15.513  1.00 30.00  ? 554 ASN C C   1  
ATOM 4141   O O   . ASN A 1 550 ? -39.577  -5.718  15.614  1.00 30.00  ? 554 ASN C O   1  
ATOM 4142   C CB  . ASN A 1 550 ? -38.075  -3.856  17.594  1.00 99.99  ? 554 ASN C CB  1  
ATOM 4143   C CG  . ASN A 1 550 ? -39.230  -4.614  18.234  1.00 99.99  ? 554 ASN C CG  1  
ATOM 4144   O OD1 . ASN A 1 550 ? -39.284  -5.839  18.163  1.00 99.99  ? 554 ASN C OD1 1  
ATOM 4145   N ND2 . ASN A 1 550 ? -40.152  -3.880  18.858  1.00 99.99  ? 554 ASN C ND2 1  
ATOM 4146   N N   . HIS A 1 551 ? -39.279  -3.679  14.729  1.00 30.00  ? 555 HIS C N   1  
ATOM 4147   C CA  . HIS A 1 551 ? -40.533  -3.789  13.991  1.00 30.00  ? 555 HIS C CA  1  
ATOM 4148   C C   . HIS A 1 551 ? -40.478  -3.805  12.474  1.00 30.00  ? 555 HIS C C   1  
ATOM 4149   O O   . HIS A 1 551 ? -41.488  -4.113  11.828  1.00 30.00  ? 555 HIS C O   1  
ATOM 4150   C CB  . HIS A 1 551 ? -41.442  -2.613  14.332  1.00 99.99  ? 555 HIS C CB  1  
ATOM 4151   C CG  . HIS A 1 551 ? -41.910  -2.566  15.766  1.00 99.99  ? 555 HIS C CG  1  
ATOM 4152   N ND1 . HIS A 1 551 ? -41.359  -1.690  16.692  1.00 99.99  ? 555 HIS C ND1 1  
ATOM 4153   C CD2 . HIS A 1 551 ? -42.872  -3.273  16.422  1.00 99.99  ? 555 HIS C CD2 1  
ATOM 4154   C CE1 . HIS A 1 551 ? -41.970  -1.879  17.847  1.00 99.99  ? 555 HIS C CE1 1  
ATOM 4155   N NE2 . HIS A 1 551 ? -42.873  -2.818  17.703  1.00 99.99  ? 555 HIS C NE2 1  
ATOM 4156   N N   . MET A 1 552 ? -39.332  -3.484  11.889  1.00 30.00  ? 556 MET C N   1  
ATOM 4157   C CA  . MET A 1 552 ? -39.245  -3.500  10.438  1.00 30.00  ? 556 MET C CA  1  
ATOM 4158   C C   . MET A 1 552 ? -39.466  -4.934  9.985   1.00 30.00  ? 556 MET C C   1  
ATOM 4159   O O   . MET A 1 552 ? -38.698  -5.835  10.335  1.00 30.00  ? 556 MET C O   1  
ATOM 4160   C CB  . MET A 1 552 ? -37.870  -3.010  9.996   1.00 99.99  ? 556 MET C CB  1  
ATOM 4161   C CG  . MET A 1 552 ? -37.718  -1.535  10.342  1.00 99.99  ? 556 MET C CG  1  
ATOM 4162   S SD  . MET A 1 552 ? -38.900  -0.548  9.388   1.00 99.99  ? 556 MET C SD  1  
ATOM 4163   C CE  . MET A 1 552 ? -38.210  -0.736  7.756   1.00 99.99  ? 556 MET C CE  1  
ATOM 4164   N N   . GLY A 1 553 ? -40.534  -5.146  9.220   1.00 30.00  ? 557 GLY C N   1  
ATOM 4165   C CA  . GLY A 1 553 ? -40.826  -6.478  8.734   1.00 30.00  ? 557 GLY C CA  1  
ATOM 4166   C C   . GLY A 1 553 ? -41.428  -7.446  9.735   1.00 30.00  ? 557 GLY C C   1  
ATOM 4167   O O   . GLY A 1 553 ? -41.811  -8.553  9.365   1.00 30.00  ? 557 GLY C O   1  
ATOM 4168   N N   . LYS A 1 554 ? -41.507  -7.058  11.002  1.00 30.00  ? 558 LYS C N   1  
ATOM 4169   C CA  . LYS A 1 554 ? -42.091  -7.943  12.003  1.00 30.00  ? 558 LYS C CA  1  
ATOM 4170   C C   . LYS A 1 554 ? -43.498  -7.431  12.369  1.00 30.00  ? 558 LYS C C   1  
ATOM 4171   O O   . LYS A 1 554 ? -44.218  -8.049  13.149  1.00 30.00  ? 558 LYS C O   1  
ATOM 4172   C CB  . LYS A 1 554 ? -41.215  -7.963  13.252  1.00 99.99  ? 558 LYS C CB  1  
ATOM 4173   C CG  . LYS A 1 554 ? -41.779  -8.965  14.253  1.00 99.99  ? 558 LYS C CG  1  
ATOM 4174   C CD  . LYS A 1 554 ? -40.706  -9.320  15.276  1.00 99.99  ? 558 LYS C CD  1  
ATOM 4175   C CE  . LYS A 1 554 ? -41.353  -10.013 16.472  1.00 99.99  ? 558 LYS C CE  1  
ATOM 4176   N NZ  . LYS A 1 554 ? -41.296  -11.470 16.285  1.00 99.99  ? 558 LYS C NZ  1  
ATOM 4177   N N   . ASN A 1 555 ? -43.869  -6.297  11.776  1.00 30.00  ? 559 ASN C N   1  
ATOM 4178   C CA  . ASN A 1 555 ? -45.174  -5.660  11.980  1.00 30.00  ? 559 ASN C CA  1  
ATOM 4179   C C   . ASN A 1 555 ? -45.419  -4.761  10.766  1.00 30.00  ? 559 ASN C C   1  
ATOM 4180   O O   . ASN A 1 555 ? -44.696  -3.782  10.544  1.00 30.00  ? 559 ASN C O   1  
ATOM 4181   C CB  . ASN A 1 555 ? -45.154  -4.839  13.263  1.00 99.99  ? 559 ASN C CB  1  
ATOM 4182   C CG  . ASN A 1 555 ? -44.928  -5.724  14.479  1.00 99.99  ? 559 ASN C CG  1  
ATOM 4183   O OD1 . ASN A 1 555 ? -45.653  -6.693  14.688  1.00 99.99  ? 559 ASN C OD1 1  
ATOM 4184   N ND2 . ASN A 1 555 ? -43.915  -5.390  15.283  1.00 99.99  ? 559 ASN C ND2 1  
ATOM 4185   N N   . ARG A 1 556 ? -46.453  -5.093  9.998   1.00 30.00  ? 560 ARG C N   1  
ATOM 4186   C CA  . ARG A 1 556 ? -46.765  -4.338  8.794   1.00 30.00  ? 560 ARG C CA  1  
ATOM 4187   C C   . ARG A 1 556 ? -47.276  -2.910  8.932   1.00 30.00  ? 560 ARG C C   1  
ATOM 4188   O O   . ARG A 1 556 ? -47.415  -2.191  7.931   1.00 30.00  ? 560 ARG C O   1  
ATOM 4189   C CB  . ARG A 1 556 ? -47.851  -5.056  8.001   1.00 99.99  ? 560 ARG C CB  1  
ATOM 4190   C CG  . ARG A 1 556 ? -48.135  -4.285  6.716   1.00 99.99  ? 560 ARG C CG  1  
ATOM 4191   C CD  . ARG A 1 556 ? -49.255  -4.976  5.946   1.00 99.99  ? 560 ARG C CD  1  
ATOM 4192   N NE  . ARG A 1 556 ? -50.407  -5.265  6.832   1.00 99.99  ? 560 ARG C NE  1  
ATOM 4193   C CZ  . ARG A 1 556 ? -51.310  -4.348  7.169   1.00 99.99  ? 560 ARG C CZ  1  
ATOM 4194   N NH1 . ARG A 1 556 ? -51.240  -3.094  6.730   1.00 99.99  ? 560 ARG C NH1 1  
ATOM 4195   N NH2 . ARG A 1 556 ? -52.303  -4.719  7.971   1.00 99.99  ? 560 ARG C NH2 1  
ATOM 4196   N N   . MET A 1 557 ? -47.552  -2.483  10.160  1.00 30.00  ? 561 MET C N   1  
ATOM 4197   C CA  . MET A 1 557 ? -48.054  -1.125  10.368  1.00 30.00  ? 561 MET C CA  1  
ATOM 4198   C C   . MET A 1 557 ? -46.887  -0.152  10.307  1.00 30.00  ? 561 MET C C   1  
ATOM 4199   O O   . MET A 1 557 ? -47.051  1.033   10.000  1.00 30.00  ? 561 MET C O   1  
ATOM 4200   C CB  . MET A 1 557 ? -48.731  -1.027  11.731  1.00 99.99  ? 561 MET C CB  1  
ATOM 4201   C CG  . MET A 1 557 ? -49.729  -2.167  11.888  1.00 99.99  ? 561 MET C CG  1  
ATOM 4202   S SD  . MET A 1 557 ? -51.264  -1.772  11.018  1.00 99.99  ? 561 MET C SD  1  
ATOM 4203   C CE  . MET A 1 557 ? -51.975  -0.604  12.158  1.00 99.99  ? 561 MET C CE  1  
ATOM 4204   N N   . PHE A 1 558 ? -45.702  -0.687  10.593  1.00 30.00  ? 562 PHE C N   1  
ATOM 4205   C CA  . PHE A 1 558 ? -44.451  0.069   10.602  1.00 30.00  ? 562 PHE C CA  1  
ATOM 4206   C C   . PHE A 1 558 ? -43.813  0.011   9.218   1.00 30.00  ? 562 PHE C C   1  
ATOM 4207   O O   . PHE A 1 558 ? -43.325  -1.044  8.808   1.00 30.00  ? 562 PHE C O   1  
ATOM 4208   C CB  . PHE A 1 558 ? -43.492  -0.532  11.626  1.00 99.99  ? 562 PHE C CB  1  
ATOM 4209   C CG  . PHE A 1 558 ? -42.224  0.287   11.669  1.00 99.99  ? 562 PHE C CG  1  
ATOM 4210   C CD1 . PHE A 1 558 ? -42.217  1.528   12.314  1.00 99.99  ? 562 PHE C CD1 1  
ATOM 4211   C CD2 . PHE A 1 558 ? -41.058  -0.198  11.066  1.00 99.99  ? 562 PHE C CD2 1  
ATOM 4212   C CE1 . PHE A 1 558 ? -41.041  2.285   12.356  1.00 99.99  ? 562 PHE C CE1 1  
ATOM 4213   C CE2 . PHE A 1 558 ? -39.881  0.561   11.107  1.00 99.99  ? 562 PHE C CE2 1  
ATOM 4214   C CZ  . PHE A 1 558 ? -39.874  1.804   11.751  1.00 99.99  ? 562 PHE C CZ  1  
ATOM 4215   N N   . THR A 1 559 ? -43.805  1.134   8.494   1.00 30.00  ? 563 THR C N   1  
ATOM 4216   C CA  . THR A 1 559 ? -43.226  1.159   7.146   1.00 30.00  ? 563 THR C CA  1  
ATOM 4217   C C   . THR A 1 559 ? -42.265  2.303   6.810   1.00 30.00  ? 563 THR C C   1  
ATOM 4218   O O   . THR A 1 559 ? -42.550  3.459   7.080   1.00 30.00  ? 563 THR C O   1  
ATOM 4219   C CB  . THR A 1 559 ? -44.337  1.252   6.108   1.00 99.99  ? 563 THR C CB  1  
ATOM 4220   O OG1 . THR A 1 559 ? -44.970  2.532   6.202   1.00 99.99  ? 563 THR C OG1 1  
ATOM 4221   C CG2 . THR A 1 559 ? -45.367  0.159   6.364   1.00 99.99  ? 563 THR C CG2 1  
ATOM 4222   N N   . LYS A 1 560 ? -41.126  1.970   6.205   1.00 30.00  ? 564 LYS C N   1  
ATOM 4223   C CA  . LYS A 1 560 ? -40.135  2.975   5.817   1.00 30.00  ? 564 LYS C CA  1  
ATOM 4224   C C   . LYS A 1 560 ? -40.878  4.197   5.236   1.00 30.00  ? 564 LYS C C   1  
ATOM 4225   O O   . LYS A 1 560 ? -41.926  4.057   4.602   1.00 30.00  ? 564 LYS C O   1  
ATOM 4226   C CB  . LYS A 1 560 ? -39.194  2.397   4.766   1.00 99.99  ? 564 LYS C CB  1  
ATOM 4227   C CG  . LYS A 1 560 ? -38.106  3.414   4.440   1.00 99.99  ? 564 LYS C CG  1  
ATOM 4228   C CD  . LYS A 1 560 ? -36.940  2.711   3.757   1.00 99.99  ? 564 LYS C CD  1  
ATOM 4229   C CE  . LYS A 1 560 ? -36.032  3.750   3.103   1.00 99.99  ? 564 LYS C CE  1  
ATOM 4230   N NZ  . LYS A 1 560 ? -34.946  4.103   4.028   1.00 99.99  ? 564 LYS C NZ  1  
ATOM 4231   N N   . PRO A 1 561 ? -40.338  5.410   5.451   1.00 30.00  ? 565 PRO C N   1  
ATOM 4232   C CA  . PRO A 1 561 ? -40.973  6.633   4.940   1.00 30.00  ? 565 PRO C CA  1  
ATOM 4233   C C   . PRO A 1 561 ? -41.222  6.583   3.438   1.00 30.00  ? 565 PRO C C   1  
ATOM 4234   O O   . PRO A 1 561 ? -40.315  6.293   2.664   1.00 30.00  ? 565 PRO C O   1  
ATOM 4235   C CB  . PRO A 1 561 ? -39.898  7.597   5.301   1.00 99.99  ? 565 PRO C CB  1  
ATOM 4236   C CG  . PRO A 1 561 ? -38.837  6.794   6.014   1.00 99.99  ? 565 PRO C CG  1  
ATOM 4237   C CD  . PRO A 1 561 ? -39.126  5.556   6.136   1.00 99.99  ? 565 PRO C CD  1  
ATOM 4238   N N   . GLY A 1 562 ? -42.457  6.870   3.035   1.00 30.00  ? 566 GLY C N   1  
ATOM 4239   C CA  . GLY A 1 562 ? -42.807  6.852   1.622   1.00 30.00  ? 566 GLY C CA  1  
ATOM 4240   C C   . GLY A 1 562 ? -42.386  8.080   0.822   1.00 30.00  ? 566 GLY C C   1  
ATOM 4241   O O   . GLY A 1 562 ? -41.249  8.545   0.930   1.00 30.00  ? 566 GLY C O   1  
ATOM 4242   N N   . LYS A 1 563 ? -43.307  8.613   0.017   1.00 30.00  ? 567 LYS C N   1  
ATOM 4243   C CA  . LYS A 1 563 ? -43.016  9.789   -0.797  1.00 30.00  ? 567 LYS C CA  1  
ATOM 4244   C C   . LYS A 1 563 ? -44.044  10.912  -0.602  1.00 30.00  ? 567 LYS C C   1  
ATOM 4245   O O   . LYS A 1 563 ? -45.251  10.659  -0.498  1.00 30.00  ? 567 LYS C O   1  
ATOM 4246   C CB  . LYS A 1 563 ? -43.020  9.413   -2.275  1.00 99.99  ? 567 LYS C CB  1  
ATOM 4247   C CG  . LYS A 1 563 ? -42.621  10.624  -3.109  1.00 99.99  ? 567 LYS C CG  1  
ATOM 4248   C CD  . LYS A 1 563 ? -42.190  10.165  -4.498  1.00 99.99  ? 567 LYS C CD  1  
ATOM 4249   C CE  . LYS A 1 563 ? -42.150  11.365  -5.440  1.00 99.99  ? 567 LYS C CE  1  
ATOM 4250   N NZ  . LYS A 1 563 ? -40.785  11.913  -5.478  1.00 99.99  ? 567 LYS C NZ  1  
ATOM 4251   N N   . PRO A 1 564 ? -43.568  12.176  -0.547  1.00 30.00  ? 568 PRO C N   1  
ATOM 4252   C CA  . PRO A 1 564 ? -44.380  13.391  -0.363  1.00 30.00  ? 568 PRO C CA  1  
ATOM 4253   C C   . PRO A 1 564 ? -45.805  13.429  -0.942  1.00 30.00  ? 568 PRO C C   1  
ATOM 4254   O O   . PRO A 1 564 ? -46.031  13.159  -2.122  1.00 30.00  ? 568 PRO C O   1  
ATOM 4255   C CB  . PRO A 1 564 ? -43.504  14.344  -1.096  1.00 99.99  ? 568 PRO C CB  1  
ATOM 4256   C CG  . PRO A 1 564 ? -42.300  13.551  -1.543  1.00 99.99  ? 568 PRO C CG  1  
ATOM 4257   C CD  . PRO A 1 564 ? -42.328  12.328  -1.177  1.00 99.99  ? 568 PRO C CD  1  
ATOM 4258   N N   . THR A 1 565 ? -46.754  13.774  -0.075  1.00 30.00  ? 569 THR C N   1  
ATOM 4259   C CA  . THR A 1 565 ? -48.169  13.885  -0.424  1.00 30.00  ? 569 THR C CA  1  
ATOM 4260   C C   . THR A 1 565 ? -48.624  15.294  -0.014  1.00 30.00  ? 569 THR C C   1  
ATOM 4261   O O   . THR A 1 565 ? -49.823  15.552  0.153   1.00 30.00  ? 569 THR C O   1  
ATOM 4262   C CB  . THR A 1 565 ? -48.973  12.828  0.322   1.00 99.99  ? 569 THR C CB  1  
ATOM 4263   O OG1 . THR A 1 565 ? -48.972  13.124  1.720   1.00 99.99  ? 569 THR C OG1 1  
ATOM 4264   C CG2 . THR A 1 565 ? -48.343  11.456  0.096   1.00 99.99  ? 569 THR C CG2 1  
ATOM 4265   N N   . ARG A 1 566 ? -47.646  16.183  0.147   1.00 30.00  ? 570 ARG C N   1  
ATOM 4266   C CA  . ARG A 1 566 ? -47.878  17.579  0.539   1.00 30.00  ? 570 ARG C CA  1  
ATOM 4267   C C   . ARG A 1 566 ? -46.537  18.323  0.532   1.00 30.00  ? 570 ARG C C   1  
ATOM 4268   O O   . ARG A 1 566 ? -45.554  17.847  1.101   1.00 30.00  ? 570 ARG C O   1  
ATOM 4269   C CB  . ARG A 1 566 ? -48.487  17.631  1.937   1.00 99.99  ? 570 ARG C CB  1  
ATOM 4270   C CG  . ARG A 1 566 ? -49.880  17.014  1.909   1.00 99.99  ? 570 ARG C CG  1  
ATOM 4271   C CD  . ARG A 1 566 ? -50.335  16.725  3.336   1.00 99.99  ? 570 ARG C CD  1  
ATOM 4272   N NE  . ARG A 1 566 ? -51.633  16.012  3.344   1.00 99.99  ? 570 ARG C NE  1  
ATOM 4273   C CZ  . ARG A 1 566 ? -51.748  14.712  3.088   1.00 99.99  ? 570 ARG C CZ  1  
ATOM 4274   N NH1 . ARG A 1 566 ? -50.693  13.953  2.805   1.00 99.99  ? 570 ARG C NH1 1  
ATOM 4275   N NH2 . ARG A 1 566 ? -52.965  14.174  3.121   1.00 99.99  ? 570 ARG C NH2 1  
ATOM 4276   N N   . PRO A 1 567 ? -46.479  19.505  -0.113  1.00 30.00  ? 571 PRO C N   1  
ATOM 4277   C CA  . PRO A 1 567 ? -45.236  20.288  -0.175  1.00 30.00  ? 571 PRO C CA  1  
ATOM 4278   C C   . PRO A 1 567 ? -44.725  20.697  1.203   1.00 30.00  ? 571 PRO C C   1  
ATOM 4279   O O   . PRO A 1 567 ? -45.468  20.652  2.191   1.00 30.00  ? 571 PRO C O   1  
ATOM 4280   C CB  . PRO A 1 567 ? -45.751  21.447  -0.952  1.00 99.99  ? 571 PRO C CB  1  
ATOM 4281   C CG  . PRO A 1 567 ? -47.194  21.132  -1.268  1.00 99.99  ? 571 PRO C CG  1  
ATOM 4282   C CD  . PRO A 1 567 ? -47.579  20.000  -0.824  1.00 99.99  ? 571 PRO C CD  1  
ATOM 4283   N N   . ASN A 1 568 ? -43.460  21.095  1.263   1.00 30.00  ? 572 ASN C N   1  
ATOM 4284   C CA  . ASN A 1 568 ? -42.853  21.515  2.522   1.00 30.00  ? 572 ASN C CA  1  
ATOM 4285   C C   . ASN A 1 568 ? -42.853  20.357  3.528   1.00 30.00  ? 572 ASN C C   1  
ATOM 4286   O O   . ASN A 1 568 ? -42.666  20.562  4.724   1.00 30.00  ? 572 ASN C O   1  
ATOM 4287   C CB  . ASN A 1 568 ? -43.641  22.678  3.113   1.00 99.99  ? 572 ASN C CB  1  
ATOM 4288   C CG  . ASN A 1 568 ? -42.759  23.534  4.009   1.00 99.99  ? 572 ASN C CG  1  
ATOM 4289   O OD1 . ASN A 1 568 ? -43.255  24.213  4.910   1.00 99.99  ? 572 ASN C OD1 1  
ATOM 4290   N ND2 . ASN A 1 568 ? -41.448  23.509  3.762   1.00 99.99  ? 572 ASN C ND2 1  
ATOM 4291   N N   . GLN A 1 569 ? -43.059  19.142  3.032   1.00 30.00  ? 573 GLN C N   1  
ATOM 4292   C CA  . GLN A 1 569 ? -43.086  17.959  3.884   1.00 30.00  ? 573 GLN C CA  1  
ATOM 4293   C C   . GLN A 1 569 ? -41.731  17.663  4.527   1.00 30.00  ? 573 GLN C C   1  
ATOM 4294   O O   . GLN A 1 569 ? -40.913  16.941  3.957   1.00 30.00  ? 573 GLN C O   1  
ATOM 4295   C CB  . GLN A 1 569 ? -43.487  16.737  3.065   1.00 99.99  ? 573 GLN C CB  1  
ATOM 4296   C CG  . GLN A 1 569 ? -42.491  15.610  3.312   1.00 99.99  ? 573 GLN C CG  1  
ATOM 4297   C CD  . GLN A 1 569 ? -41.145  15.914  2.672   1.00 99.99  ? 573 GLN C CD  1  
ATOM 4298   O OE1 . GLN A 1 569 ? -40.972  16.962  2.052   1.00 99.99  ? 573 GLN C OE1 1  
ATOM 4299   N NE2 . GLN A 1 569 ? -40.188  14.995  2.822   1.00 99.99  ? 573 GLN C NE2 1  
ATOM 4300   N N   . GLY A 1 570 ? -41.508  18.217  5.716   1.00 30.00  ? 574 GLY C N   1  
ATOM 4301   C CA  . GLY A 1 570 ? -40.256  18.008  6.423   1.00 30.00  ? 574 GLY C CA  1  
ATOM 4302   C C   . GLY A 1 570 ? -39.853  16.553  6.579   1.00 30.00  ? 574 GLY C C   1  
ATOM 4303   O O   . GLY A 1 570 ? -40.616  15.655  6.237   1.00 30.00  ? 574 GLY C O   1  
ATOM 4304   N N   . PRO A 1 571 ? -38.646  16.296  7.096   1.00 30.00  ? 575 PRO C N   1  
ATOM 4305   C CA  . PRO A 1 571 ? -38.110  14.946  7.313   1.00 30.00  ? 575 PRO C CA  1  
ATOM 4306   C C   . PRO A 1 571 ? -39.070  13.924  7.925   1.00 30.00  ? 575 PRO C C   1  
ATOM 4307   O O   . PRO A 1 571 ? -39.963  14.270  8.704   1.00 30.00  ? 575 PRO C O   1  
ATOM 4308   C CB  . PRO A 1 571 ? -37.024  15.300  8.266   1.00 99.99  ? 575 PRO C CB  1  
ATOM 4309   C CG  . PRO A 1 571 ? -37.064  16.802  8.411   1.00 99.99  ? 575 PRO C CG  1  
ATOM 4310   C CD  . PRO A 1 571 ? -37.963  17.362  7.697   1.00 99.99  ? 575 PRO C CD  1  
ATOM 4311   N N   . ALA A 1 572 ? -38.865  12.662  7.560   1.00 30.00  ? 576 ALA C N   1  
ATOM 4312   C CA  . ALA A 1 572 ? -39.671  11.552  8.049   1.00 30.00  ? 576 ALA C CA  1  
ATOM 4313   C C   . ALA A 1 572 ? -38.711  10.378  8.196   1.00 30.00  ? 576 ALA C C   1  
ATOM 4314   O O   . ALA A 1 572 ? -37.902  10.133  7.315   1.00 30.00  ? 576 ALA C O   1  
ATOM 4315   C CB  . ALA A 1 572 ? -40.771  11.214  7.050   1.00 30.00  ? 576 ALA C CB  1  
ATOM 4316   N N   . HIS A 1 573 ? -38.799  9.661   9.311   1.00 30.00  ? 577 HIS C N   1  
ATOM 4317   C CA  . HIS A 1 573 ? -37.925  8.520   9.573   1.00 30.00  ? 577 HIS C CA  1  
ATOM 4318   C C   . HIS A 1 573 ? -38.659  7.190   9.472   1.00 30.00  ? 577 HIS C C   1  
ATOM 4319   O O   . HIS A 1 573 ? -38.032  6.148   9.271   1.00 30.00  ? 577 HIS C O   1  
ATOM 4320   C CB  . HIS A 1 573 ? -37.340  8.626   10.976  1.00 99.99  ? 577 HIS C CB  1  
ATOM 4321   C CG  . HIS A 1 573 ? -36.494  9.852   11.226  1.00 99.99  ? 577 HIS C CG  1  
ATOM 4322   N ND1 . HIS A 1 573 ? -36.932  10.897  12.028  1.00 99.99  ? 577 HIS C ND1 1  
ATOM 4323   C CD2 . HIS A 1 573 ? -35.252  10.191  10.787  1.00 99.99  ? 577 HIS C CD2 1  
ATOM 4324   C CE1 . HIS A 1 573 ? -35.984  11.816  12.055  1.00 99.99  ? 577 HIS C CE1 1  
ATOM 4325   N NE2 . HIS A 1 573 ? -34.978  11.412  11.324  1.00 99.99  ? 577 HIS C NE2 1  
ATOM 4326   N N   . PHE A 1 574 ? -39.977  7.233   9.630   1.00 30.00  ? 578 PHE C N   1  
ATOM 4327   C CA  . PHE A 1 574 ? -40.818  6.041   9.533   1.00 30.00  ? 578 PHE C CA  1  
ATOM 4328   C C   . PHE A 1 574 ? -42.264  6.494   9.391   1.00 30.00  ? 578 PHE C C   1  
ATOM 4329   O O   . PHE A 1 574 ? -42.571  7.674   9.559   1.00 30.00  ? 578 PHE C O   1  
ATOM 4330   C CB  . PHE A 1 574 ? -40.659  5.190   10.788  1.00 99.99  ? 578 PHE C CB  1  
ATOM 4331   C CG  . PHE A 1 574 ? -41.270  5.908   11.966  1.00 99.99  ? 578 PHE C CG  1  
ATOM 4332   C CD1 . PHE A 1 574 ? -40.486  6.776   12.738  1.00 99.99  ? 578 PHE C CD1 1  
ATOM 4333   C CD2 . PHE A 1 574 ? -42.618  5.707   12.287  1.00 99.99  ? 578 PHE C CD2 1  
ATOM 4334   C CE1 . PHE A 1 574 ? -41.054  7.441   13.830  1.00 99.99  ? 578 PHE C CE1 1  
ATOM 4335   C CE2 . PHE A 1 574 ? -43.182  6.373   13.381  1.00 99.99  ? 578 PHE C CE2 1  
ATOM 4336   C CZ  . PHE A 1 574 ? -42.400  7.240   14.154  1.00 99.99  ? 578 PHE C CZ  1  
ATOM 4337   N N   . GLU A 1 575 ? -43.146  5.561   9.065   1.00 30.00  ? 579 GLU C N   1  
ATOM 4338   C CA  . GLU A 1 575 ? -44.554  5.896   8.891   1.00 30.00  ? 579 GLU C CA  1  
ATOM 4339   C C   . GLU A 1 575 ? -45.401  4.949   9.683   1.00 30.00  ? 579 GLU C C   1  
ATOM 4340   O O   . GLU A 1 575 ? -45.039  3.775   9.866   1.00 30.00  ? 579 GLU C O   1  
ATOM 4341   C CB  . GLU A 1 575 ? -44.933  5.795   7.417   1.00 99.99  ? 579 GLU C CB  1  
ATOM 4342   C CG  . GLU A 1 575 ? -46.176  4.952   7.273   1.00 99.99  ? 579 GLU C CG  1  
ATOM 4343   C CD  . GLU A 1 575 ? -45.839  3.490   7.564   1.00 99.99  ? 579 GLU C CD  1  
ATOM 4344   O OE1 . GLU A 1 575 ? -45.947  3.102   8.756   1.00 99.99  ? 579 GLU C OE1 1  
ATOM 4345   O OE2 . GLU A 1 575 ? -45.477  2.776   6.590   1.00 99.99  ? 579 GLU C OE2 1  
ATOM 4346   N N   . LEU A 1 576 ? -46.533  5.460   10.152  1.00 30.00  ? 580 LEU C N   1  
ATOM 4347   C CA  . LEU A 1 576 ? -47.459  4.658   10.924  1.00 30.00  ? 580 LEU C CA  1  
ATOM 4348   C C   . LEU A 1 576 ? -48.776  4.775   10.202  1.00 30.00  ? 580 LEU C C   1  
ATOM 4349   O O   . LEU A 1 576 ? -49.119  5.850   9.684   1.00 30.00  ? 580 LEU C O   1  
ATOM 4350   C CB  . LEU A 1 576 ? -47.554  5.201   12.347  1.00 99.99  ? 580 LEU C CB  1  
ATOM 4351   C CG  . LEU A 1 576 ? -46.589  4.441   13.248  1.00 99.99  ? 580 LEU C CG  1  
ATOM 4352   C CD1 . LEU A 1 576 ? -46.909  4.743   14.708  1.00 99.99  ? 580 LEU C CD1 1  
ATOM 4353   C CD2 . LEU A 1 576 ? -46.729  2.943   12.996  1.00 99.99  ? 580 LEU C CD2 1  
ATOM 4354   N N   . HIS A 1 577 ? -49.508  3.668   10.150  1.00 30.00  ? 581 HIS C N   1  
ATOM 4355   C CA  . HIS A 1 577 ? -50.796  3.644   9.478   1.00 30.00  ? 581 HIS C CA  1  
ATOM 4356   C C   . HIS A 1 577 ? -51.903  3.775   10.519  1.00 30.00  ? 581 HIS C C   1  
ATOM 4357   O O   . HIS A 1 577 ? -52.433  2.790   11.034  1.00 30.00  ? 581 HIS C O   1  
ATOM 4358   C CB  . HIS A 1 577 ? -50.962  2.330   8.720   1.00 99.99  ? 581 HIS C CB  1  
ATOM 4359   C CG  . HIS A 1 577 ? -49.869  2.028   7.723   1.00 99.99  ? 581 HIS C CG  1  
ATOM 4360   N ND1 . HIS A 1 577 ? -49.946  2.440   6.397   1.00 99.99  ? 581 HIS C ND1 1  
ATOM 4361   C CD2 . HIS A 1 577 ? -48.692  1.360   7.854   1.00 99.99  ? 581 HIS C CD2 1  
ATOM 4362   C CE1 . HIS A 1 577 ? -48.854  2.030   5.781   1.00 99.99  ? 581 HIS C CE1 1  
ATOM 4363   N NE2 . HIS A 1 577 ? -48.097  1.386   6.631   1.00 99.99  ? 581 HIS C NE2 1  
ATOM 4364   N N   . HIS A 1 578 ? -52.229  5.029   10.827  1.00 30.00  ? 582 HIS C N   1  
ATOM 4365   C CA  . HIS A 1 578 ? -53.256  5.351   11.809  1.00 30.00  ? 582 HIS C CA  1  
ATOM 4366   C C   . HIS A 1 578 ? -54.633  5.256   11.184  1.00 30.00  ? 582 HIS C C   1  
ATOM 4367   O O   . HIS A 1 578 ? -54.803  5.511   9.992   1.00 30.00  ? 582 HIS C O   1  
ATOM 4368   C CB  . HIS A 1 578 ? -53.049  6.771   12.327  1.00 99.99  ? 582 HIS C CB  1  
ATOM 4369   C CG  . HIS A 1 578 ? -54.177  7.313   13.170  1.00 99.99  ? 582 HIS C CG  1  
ATOM 4370   N ND1 . HIS A 1 578 ? -53.960  7.845   14.437  1.00 99.99  ? 582 HIS C ND1 1  
ATOM 4371   C CD2 . HIS A 1 578 ? -55.512  7.409   12.933  1.00 99.99  ? 582 HIS C CD2 1  
ATOM 4372   C CE1 . HIS A 1 578 ? -55.125  8.235   14.920  1.00 99.99  ? 582 HIS C CE1 1  
ATOM 4373   N NE2 . HIS A 1 578 ? -56.060  7.983   14.038  1.00 99.99  ? 582 HIS C NE2 1  
ATOM 4374   N N   . TYR A 1 579 ? -55.609  4.888   12.003  1.00 30.00  ? 583 TYR C N   1  
ATOM 4375   C CA  . TYR A 1 579 ? -56.984  4.761   11.559  1.00 30.00  ? 583 TYR C CA  1  
ATOM 4376   C C   . TYR A 1 579 ? -57.347  5.815   10.523  1.00 30.00  ? 583 TYR C C   1  
ATOM 4377   O O   . TYR A 1 579 ? -57.804  5.491   9.429   1.00 30.00  ? 583 TYR C O   1  
ATOM 4378   C CB  . TYR A 1 579 ? -57.929  4.922   12.746  1.00 99.99  ? 583 TYR C CB  1  
ATOM 4379   C CG  . TYR A 1 579 ? -57.829  6.329   13.283  1.00 99.99  ? 583 TYR C CG  1  
ATOM 4380   C CD1 . TYR A 1 579 ? -58.583  7.357   12.704  1.00 99.99  ? 583 TYR C CD1 1  
ATOM 4381   C CD2 . TYR A 1 579 ? -56.980  6.606   14.362  1.00 99.99  ? 583 TYR C CD2 1  
ATOM 4382   C CE1 . TYR A 1 579 ? -58.489  8.660   13.204  1.00 99.99  ? 583 TYR C CE1 1  
ATOM 4383   C CE2 . TYR A 1 579 ? -56.887  7.910   14.861  1.00 99.99  ? 583 TYR C CE2 1  
ATOM 4384   C CZ  . TYR A 1 579 ? -57.641  8.938   14.283  1.00 99.99  ? 583 TYR C CZ  1  
ATOM 4385   O OH  . TYR A 1 579 ? -57.549  10.206  14.769  1.00 99.99  ? 583 TYR C OH  1  
ATOM 4386   N N   . ALA A 1 580 ? -57.140  7.083   10.861  1.00 30.00  ? 584 ALA C N   1  
ATOM 4387   C CA  . ALA A 1 580 ? -57.475  8.174   9.953   1.00 30.00  ? 584 ALA C CA  1  
ATOM 4388   C C   . ALA A 1 580 ? -56.335  8.733   9.105   1.00 30.00  ? 584 ALA C C   1  
ATOM 4389   O O   . ALA A 1 580 ? -56.397  9.891   8.676   1.00 30.00  ? 584 ALA C O   1  
ATOM 4390   C CB  . ALA A 1 580 ? -58.110  9.303   10.741  1.00 30.00  ? 584 ALA C CB  1  
ATOM 4391   N N   . GLY A 1 581 ? -55.297  7.947   8.851   1.00 30.00  ? 585 GLY C N   1  
ATOM 4392   C CA  . GLY A 1 581 ? -54.209  8.460   8.043   1.00 30.00  ? 585 GLY C CA  1  
ATOM 4393   C C   . GLY A 1 581 ? -52.845  7.837   8.250   1.00 30.00  ? 585 GLY C C   1  
ATOM 4394   O O   . GLY A 1 581 ? -52.574  7.193   9.265   1.00 30.00  ? 585 GLY C O   1  
ATOM 4395   N N   . ASN A 1 582 ? -51.981  8.038   7.256   1.00 30.00  ? 586 ASN C N   1  
ATOM 4396   C CA  . ASN A 1 582 ? -50.618  7.523   7.287   1.00 30.00  ? 586 ASN C CA  1  
ATOM 4397   C C   . ASN A 1 582 ? -49.731  8.670   7.716   1.00 30.00  ? 586 ASN C C   1  
ATOM 4398   O O   . ASN A 1 582 ? -49.672  9.716   7.053   1.00 30.00  ? 586 ASN C O   1  
ATOM 4399   C CB  . ASN A 1 582 ? -50.222  7.021   5.904   1.00 99.99  ? 586 ASN C CB  1  
ATOM 4400   C CG  . ASN A 1 582 ? -49.148  5.948   5.996   1.00 99.99  ? 586 ASN C CG  1  
ATOM 4401   O OD1 . ASN A 1 582 ? -48.385  5.745   5.053   1.00 99.99  ? 586 ASN C OD1 1  
ATOM 4402   N ND2 . ASN A 1 582 ? -49.089  5.259   7.136   1.00 99.99  ? 586 ASN C ND2 1  
ATOM 4403   N N   . VAL A 1 583 ? -49.030  8.478   8.825   1.00 30.00  ? 587 VAL C N   1  
ATOM 4404   C CA  . VAL A 1 583 ? -48.178  9.541   9.308   1.00 30.00  ? 587 VAL C CA  1  
ATOM 4405   C C   . VAL A 1 583 ? -46.687  9.262   9.345   1.00 30.00  ? 587 VAL C C   1  
ATOM 4406   O O   . VAL A 1 583 ? -46.224  8.325   10.007  1.00 30.00  ? 587 VAL C O   1  
ATOM 4407   C CB  . VAL A 1 583 ? -48.560  9.903   10.739  1.00 99.99  ? 587 VAL C CB  1  
ATOM 4408   C CG1 . VAL A 1 583 ? -50.014  10.368  10.775  1.00 99.99  ? 587 VAL C CG1 1  
ATOM 4409   C CG2 . VAL A 1 583 ? -48.396  8.681   11.635  1.00 99.99  ? 587 VAL C CG2 1  
ATOM 4410   N N   . PRO A 1 584 ? -45.920  10.087  8.609   1.00 30.00  ? 588 PRO C N   1  
ATOM 4411   C CA  . PRO A 1 584 ? -44.459  10.038  8.482   1.00 30.00  ? 588 PRO C CA  1  
ATOM 4412   C C   . PRO A 1 584 ? -43.892  10.806  9.677   1.00 30.00  ? 588 PRO C C   1  
ATOM 4413   O O   . PRO A 1 584 ? -43.980  12.045  9.765   1.00 30.00  ? 588 PRO C O   1  
ATOM 4414   C CB  . PRO A 1 584 ? -44.333  10.749  7.181   1.00 99.99  ? 588 PRO C CB  1  
ATOM 4415   C CG  . PRO A 1 584 ? -45.745  11.050  6.730   1.00 99.99  ? 588 PRO C CG  1  
ATOM 4416   C CD  . PRO A 1 584 ? -46.640  10.622  7.533   1.00 99.99  ? 588 PRO C CD  1  
ATOM 4417   N N   . TYR A 1 585 ? -43.312  10.067  10.599  1.00 30.00  ? 589 TYR C N   1  
ATOM 4418   C CA  . TYR A 1 585 ? -42.749  10.651  11.800  1.00 30.00  ? 589 TYR C CA  1  
ATOM 4419   C C   . TYR A 1 585 ? -41.251  10.877  11.788  1.00 30.00  ? 589 TYR C C   1  
ATOM 4420   O O   . TYR A 1 585 ? -40.489  9.988   11.421  1.00 30.00  ? 589 TYR C O   1  
ATOM 4421   C CB  . TYR A 1 585 ? -43.027  9.746   12.995  1.00 99.99  ? 589 TYR C CB  1  
ATOM 4422   C CG  . TYR A 1 585 ? -44.507  9.743   13.294  1.00 99.99  ? 589 TYR C CG  1  
ATOM 4423   C CD1 . TYR A 1 585 ? -45.067  10.773  14.061  1.00 99.99  ? 589 TYR C CD1 1  
ATOM 4424   C CD2 . TYR A 1 585 ? -45.318  8.713   12.805  1.00 99.99  ? 589 TYR C CD2 1  
ATOM 4425   C CE1 . TYR A 1 585 ? -46.440  10.771  14.337  1.00 99.99  ? 589 TYR C CE1 1  
ATOM 4426   C CE2 . TYR A 1 585 ? -46.691  8.712   13.082  1.00 99.99  ? 589 TYR C CE2 1  
ATOM 4427   C CZ  . TYR A 1 585 ? -47.252  9.742   13.848  1.00 99.99  ? 589 TYR C CZ  1  
ATOM 4428   O OH  . TYR A 1 585 ? -48.586  9.741   14.117  1.00 99.99  ? 589 TYR C OH  1  
ATOM 4429   N N   . SER A 1 586 ? -40.833  12.068  12.202  1.00 30.00  ? 590 SER C N   1  
ATOM 4430   C CA  . SER A 1 586 ? -39.411  12.390  12.278  1.00 30.00  ? 590 SER C CA  1  
ATOM 4431   C C   . SER A 1 586 ? -39.063  12.195  13.754  1.00 30.00  ? 590 SER C C   1  
ATOM 4432   O O   . SER A 1 586 ? -39.630  12.861  14.620  1.00 30.00  ? 590 SER C O   1  
ATOM 4433   C CB  . SER A 1 586 ? -39.179  13.829  11.823  1.00 99.99  ? 590 SER C CB  1  
ATOM 4434   O OG  . SER A 1 586 ? -37.783  14.127  11.877  1.00 99.99  ? 590 SER C OG  1  
ATOM 4435   N N   . ILE A 1 587 ? -38.141  11.285  14.048  1.00 30.00  ? 591 ILE C N   1  
ATOM 4436   C CA  . ILE A 1 587 ? -37.762  11.018  15.436  1.00 30.00  ? 591 ILE C CA  1  
ATOM 4437   C C   . ILE A 1 587 ? -36.581  11.830  15.974  1.00 30.00  ? 591 ILE C C   1  
ATOM 4438   O O   . ILE A 1 587 ? -35.996  11.450  16.991  1.00 30.00  ? 591 ILE C O   1  
ATOM 4439   C CB  . ILE A 1 587 ? -37.371  9.554   15.594  1.00 99.99  ? 591 ILE C CB  1  
ATOM 4440   C CG1 . ILE A 1 587 ? -35.931  9.357   15.136  1.00 99.99  ? 591 ILE C CG1 1  
ATOM 4441   C CG2 . ILE A 1 587 ? -38.296  8.687   14.746  1.00 99.99  ? 591 ILE C CG2 1  
ATOM 4442   C CD1 . ILE A 1 587 ? -35.913  8.952   13.665  1.00 99.99  ? 591 ILE C CD1 1  
ATOM 4443   N N   . THR A 1 588 ? -36.220  12.928  15.314  1.00 30.00  ? 592 THR C N   1  
ATOM 4444   C CA  . THR A 1 588 ? -35.090  13.713  15.798  1.00 30.00  ? 592 THR C CA  1  
ATOM 4445   C C   . THR A 1 588 ? -35.449  14.529  17.050  1.00 30.00  ? 592 THR C C   1  
ATOM 4446   O O   . THR A 1 588 ? -36.405  15.308  17.051  1.00 30.00  ? 592 THR C O   1  
ATOM 4447   C CB  . THR A 1 588 ? -34.635  14.687  14.716  1.00 99.99  ? 592 THR C CB  1  
ATOM 4448   O OG1 . THR A 1 588 ? -35.644  15.680  14.512  1.00 99.99  ? 592 THR C OG1 1  
ATOM 4449   C CG2 . THR A 1 588 ? -34.404  13.927  13.415  1.00 99.99  ? 592 THR C CG2 1  
ATOM 4450   N N   . GLY A 1 589 ? -34.677  14.314  18.121  1.00 30.00  ? 593 GLY C N   1  
ATOM 4451   C CA  . GLY A 1 589 ? -34.898  15.015  19.374  1.00 30.00  ? 593 GLY C CA  1  
ATOM 4452   C C   . GLY A 1 589 ? -35.872  14.353  20.328  1.00 30.00  ? 593 GLY C C   1  
ATOM 4453   O O   . GLY A 1 589 ? -36.184  14.891  21.395  1.00 30.00  ? 593 GLY C O   1  
ATOM 4454   N N   . TRP A 1 590 ? -36.348  13.179  19.951  1.00 30.00  ? 594 TRP C N   1  
ATOM 4455   C CA  . TRP A 1 590 ? -37.312  12.422  20.750  1.00 30.00  ? 594 TRP C CA  1  
ATOM 4456   C C   . TRP A 1 590 ? -36.797  11.949  22.095  1.00 30.00  ? 594 TRP C C   1  
ATOM 4457   O O   . TRP A 1 590 ? -37.594  11.584  22.960  1.00 30.00  ? 594 TRP C O   1  
ATOM 4458   C CB  . TRP A 1 590 ? -37.750  11.175  19.992  1.00 99.99  ? 594 TRP C CB  1  
ATOM 4459   C CG  . TRP A 1 590 ? -38.851  10.380  20.652  1.00 99.99  ? 594 TRP C CG  1  
ATOM 4460   C CD1 . TRP A 1 590 ? -38.734  9.552   21.698  1.00 99.99  ? 594 TRP C CD1 1  
ATOM 4461   C CD2 . TRP A 1 590 ? -40.212  10.353  20.305  1.00 99.99  ? 594 TRP C CD2 1  
ATOM 4462   N NE1 . TRP A 1 590 ? -40.038  9.031   21.967  1.00 99.99  ? 594 TRP C NE1 1  
ATOM 4463   C CE2 . TRP A 1 590 ? -40.886  9.538   21.109  1.00 99.99  ? 594 TRP C CE2 1  
ATOM 4464   C CE3 . TRP A 1 590 ? -40.880  11.033  19.281  1.00 99.99  ? 594 TRP C CE3 1  
ATOM 4465   C CZ2 . TRP A 1 590 ? -42.264  9.299   21.010  1.00 99.99  ? 594 TRP C CZ2 1  
ATOM 4466   C CZ3 . TRP A 1 590 ? -42.268  10.807  19.165  1.00 99.99  ? 594 TRP C CZ3 1  
ATOM 4467   C CH2 . TRP A 1 590 ? -42.929  9.975   19.995  1.00 99.99  ? 594 TRP C CH2 1  
ATOM 4468   N N   . LEU A 1 591 ? -35.483  11.935  22.267  1.00 30.00  ? 595 LEU C N   1  
ATOM 4469   C CA  . LEU A 1 591 ? -34.908  11.471  23.528  1.00 30.00  ? 595 LEU C CA  1  
ATOM 4470   C C   . LEU A 1 591 ? -34.985  12.508  24.650  1.00 30.00  ? 595 LEU C C   1  
ATOM 4471   O O   . LEU A 1 591 ? -35.207  12.166  25.822  1.00 30.00  ? 595 LEU C O   1  
ATOM 4472   C CB  . LEU A 1 591 ? -33.436  11.124  23.331  1.00 99.99  ? 595 LEU C CB  1  
ATOM 4473   C CG  . LEU A 1 591 ? -32.613  12.406  23.282  1.00 99.99  ? 595 LEU C CG  1  
ATOM 4474   C CD1 . LEU A 1 591 ? -33.425  13.504  22.598  1.00 99.99  ? 595 LEU C CD1 1  
ATOM 4475   C CD2 . LEU A 1 591 ? -32.263  12.841  24.701  1.00 99.99  ? 595 LEU C CD2 1  
ATOM 4476   N N   . GLU A 1 592 ? -34.805  13.756  24.299  1.00 30.00  ? 596 GLU C N   1  
ATOM 4477   C CA  . GLU A 1 592 ? -34.856  14.845  25.290  1.00 30.00  ? 596 GLU C CA  1  
ATOM 4478   C C   . GLU A 1 592 ? -36.312  15.223  25.573  1.00 30.00  ? 596 GLU C C   1  
ATOM 4479   O O   . GLU A 1 592 ? -36.662  15.623  26.690  1.00 30.00  ? 596 GLU C O   1  
ATOM 4480   C CB  . GLU A 1 592 ? -34.118  16.067  24.755  1.00 99.99  ? 596 GLU C CB  1  
ATOM 4481   C CG  . GLU A 1 592 ? -32.652  15.743  24.597  1.00 99.99  ? 596 GLU C CG  1  
ATOM 4482   C CD  . GLU A 1 592 ? -32.002  15.641  25.975  1.00 99.99  ? 596 GLU C CD  1  
ATOM 4483   O OE1 . GLU A 1 592 ? -31.995  14.512  26.526  1.00 99.99  ? 596 GLU C OE1 1  
ATOM 4484   O OE2 . GLU A 1 592 ? -31.518  16.700  26.462  1.00 99.99  ? 596 GLU C OE2 1  
ATOM 4485   N N   . LYS A 1 593 ? -37.109  15.072  24.539  1.00 30.00  ? 597 LYS C N   1  
ATOM 4486   C CA  . LYS A 1 593 ? -38.538  15.403  24.572  1.00 30.00  ? 597 LYS C CA  1  
ATOM 4487   C C   . LYS A 1 593 ? -39.291  14.519  25.570  1.00 30.00  ? 597 LYS C C   1  
ATOM 4488   O O   . LYS A 1 593 ? -40.303  14.932  26.152  1.00 30.00  ? 597 LYS C O   1  
ATOM 4489   C CB  . LYS A 1 593 ? -39.150  15.197  23.190  1.00 99.99  ? 597 LYS C CB  1  
ATOM 4490   C CG  . LYS A 1 593 ? -40.542  15.816  23.152  1.00 99.99  ? 597 LYS C CG  1  
ATOM 4491   C CD  . LYS A 1 593 ? -41.112  15.697  21.742  1.00 99.99  ? 597 LYS C CD  1  
ATOM 4492   C CE  . LYS A 1 593 ? -42.515  16.295  21.711  1.00 99.99  ? 597 LYS C CE  1  
ATOM 4493   N NZ  . LYS A 1 593 ? -43.076  16.158  20.358  1.00 99.99  ? 597 LYS C NZ  1  
ATOM 4494   N N   . ASN A 1 594 ? -38.776  13.321  25.755  1.00 30.00  ? 598 ASN C N   1  
ATOM 4495   C CA  . ASN A 1 594 ? -39.415  12.317  26.620  1.00 30.00  ? 598 ASN C CA  1  
ATOM 4496   C C   . ASN A 1 594 ? -38.806  12.255  28.031  1.00 30.00  ? 598 ASN C C   1  
ATOM 4497   O O   . ASN A 1 594 ? -39.393  11.672  28.955  1.00 30.00  ? 598 ASN C O   1  
ATOM 4498   C CB  . ASN A 1 594 ? -39.269  10.930  26.000  1.00 99.99  ? 598 ASN C CB  1  
ATOM 4499   C CG  . ASN A 1 594 ? -40.159  9.917   26.704  1.00 99.99  ? 598 ASN C CG  1  
ATOM 4500   O OD1 . ASN A 1 594 ? -41.175  9.492   26.154  1.00 99.99  ? 598 ASN C OD1 1  
ATOM 4501   N ND2 . ASN A 1 594 ? -39.781  9.533   27.923  1.00 99.99  ? 598 ASN C ND2 1  
ATOM 4502   N N   . LYS A 1 595 ? -37.641  12.859  28.218  1.00 30.00  ? 599 LYS C N   1  
ATOM 4503   C CA  . LYS A 1 595 ? -36.935  12.772  29.520  1.00 30.00  ? 599 LYS C CA  1  
ATOM 4504   C C   . LYS A 1 595 ? -36.807  14.123  30.266  1.00 30.00  ? 599 LYS C C   1  
ATOM 4505   O O   . LYS A 1 595 ? -36.034  14.253  31.231  1.00 30.00  ? 599 LYS C O   1  
ATOM 4506   C CB  . LYS A 1 595 ? -35.519  12.246  29.309  1.00 99.99  ? 599 LYS C CB  1  
ATOM 4507   C CG  . LYS A 1 595 ? -34.835  12.066  30.659  1.00 99.99  ? 599 LYS C CG  1  
ATOM 4508   C CD  . LYS A 1 595 ? -33.628  11.149  30.498  1.00 99.99  ? 599 LYS C CD  1  
ATOM 4509   C CE  . LYS A 1 595 ? -32.739  11.258  31.733  1.00 99.99  ? 599 LYS C CE  1  
ATOM 4510   N NZ  . LYS A 1 595 ? -33.096  10.200  32.691  1.00 99.99  ? 599 LYS C NZ  1  
ATOM 4511   N N   . ASP A 1 596 ? -37.562  15.129  29.842  1.00 30.00  ? 600 ASP C N   1  
ATOM 4512   C CA  . ASP A 1 596 ? -37.523  16.470  30.489  1.00 30.00  ? 600 ASP C CA  1  
ATOM 4513   C C   . ASP A 1 596 ? -36.122  16.718  31.088  1.00 30.00  ? 600 ASP C C   1  
ATOM 4514   O O   . ASP A 1 596 ? -35.305  15.794  31.205  1.00 30.00  ? 600 ASP C O   1  
ATOM 4515   C CB  . ASP A 1 596 ? -38.565  16.540  31.601  1.00 99.99  ? 600 ASP C CB  1  
ATOM 4516   C CG  . ASP A 1 596 ? -38.694  17.979  32.093  1.00 99.99  ? 600 ASP C CG  1  
ATOM 4517   O OD1 . ASP A 1 596 ? -37.819  18.394  32.897  1.00 99.99  ? 600 ASP C OD1 1  
ATOM 4518   O OD2 . ASP A 1 596 ? -39.666  18.651  31.655  1.00 99.99  ? 600 ASP C OD2 1  
ATOM 4519   N N   . PRO A 1 597 ? -35.840  17.968  31.467  1.00 30.00  ? 601 PRO C N   1  
ATOM 4520   C CA  . PRO A 1 597 ? -34.517  18.310  32.048  1.00 30.00  ? 601 PRO C CA  1  
ATOM 4521   C C   . PRO A 1 597 ? -34.351  19.812  32.355  1.00 30.00  ? 601 PRO C C   1  
ATOM 4522   O O   . PRO A 1 597 ? -34.024  20.616  31.470  1.00 30.00  ? 601 PRO C O   1  
ATOM 4523   C CB  . PRO A 1 597 ? -33.665  17.873  30.911  1.00 99.99  ? 601 PRO C CB  1  
ATOM 4524   C CG  . PRO A 1 597 ? -34.540  17.951  29.681  1.00 99.99  ? 601 PRO C CG  1  
ATOM 4525   C CD  . PRO A 1 597 ? -35.776  17.753  29.919  1.00 99.99  ? 601 PRO C CD  1  
ATOM 4526   N N   . ILE A 1 598 ? -34.563  20.139  33.622  1.00 30.00  ? 602 ILE C N   1  
ATOM 4527   C CA  . ILE A 1 598 ? -34.406  21.516  34.150  1.00 30.00  ? 602 ILE C CA  1  
ATOM 4528   C C   . ILE A 1 598 ? -33.402  21.477  35.308  1.00 30.00  ? 602 ILE C C   1  
ATOM 4529   O O   . ILE A 1 598 ? -33.469  20.602  36.183  1.00 30.00  ? 602 ILE C O   1  
ATOM 4530   C CB  . ILE A 1 598 ? -35.749  22.038  34.646  1.00 99.99  ? 602 ILE C CB  1  
ATOM 4531   C CG1 . ILE A 1 598 ? -36.017  21.506  36.050  1.00 99.99  ? 602 ILE C CG1 1  
ATOM 4532   C CG2 . ILE A 1 598 ? -36.854  21.571  33.706  1.00 99.99  ? 602 ILE C CG2 1  
ATOM 4533   C CD1 . ILE A 1 598 ? -36.826  20.214  35.957  1.00 99.99  ? 602 ILE C CD1 1  
ATOM 4534   N N   . ASN A 1 599 ? -32.487  22.425  35.291  1.00 30.00  ? 603 ASN C N   1  
ATOM 4535   C CA  . ASN A 1 599 ? -31.442  22.526  36.321  1.00 30.00  ? 603 ASN C CA  1  
ATOM 4536   C C   . ASN A 1 599 ? -32.051  22.310  37.709  1.00 30.00  ? 603 ASN C C   1  
ATOM 4537   O O   . ASN A 1 599 ? -32.756  23.180  38.241  1.00 30.00  ? 603 ASN C O   1  
ATOM 4538   C CB  . ASN A 1 599 ? -30.796  23.906  36.271  1.00 99.99  ? 603 ASN C CB  1  
ATOM 4539   C CG  . ASN A 1 599 ? -31.811  25.000  36.565  1.00 99.99  ? 603 ASN C CG  1  
ATOM 4540   O OD1 . ASN A 1 599 ? -31.444  26.147  36.806  1.00 99.99  ? 603 ASN C OD1 1  
ATOM 4541   N ND2 . ASN A 1 599 ? -33.098  24.640  36.548  1.00 99.99  ? 603 ASN C ND2 1  
ATOM 4542   N N   . GLU A 1 600 ? -31.764  21.145  38.261  1.00 30.00  ? 604 GLU C N   1  
ATOM 4543   C CA  . GLU A 1 600 ? -32.242  20.776  39.600  1.00 30.00  ? 604 GLU C CA  1  
ATOM 4544   C C   . GLU A 1 600 ? -31.859  21.885  40.575  1.00 30.00  ? 604 GLU C C   1  
ATOM 4545   O O   . GLU A 1 600 ? -32.331  21.919  41.723  1.00 30.00  ? 604 GLU C O   1  
ATOM 4546   C CB  . GLU A 1 600 ? -31.600  19.462  40.035  1.00 99.99  ? 604 GLU C CB  1  
ATOM 4547   C CG  . GLU A 1 600 ? -32.030  18.360  39.100  1.00 99.99  ? 604 GLU C CG  1  
ATOM 4548   C CD  . GLU A 1 600 ? -33.501  18.030  39.340  1.00 99.99  ? 604 GLU C CD  1  
ATOM 4549   O OE1 . GLU A 1 600 ? -34.351  18.670  38.666  1.00 99.99  ? 604 GLU C OE1 1  
ATOM 4550   O OE2 . GLU A 1 600 ? -33.759  17.141  40.196  1.00 99.99  ? 604 GLU C OE2 1  
ATOM 4551   N N   . ASN A 1 601 ? -31.010  22.756  40.055  1.00 30.00  ? 605 ASN C N   1  
ATOM 4552   C CA  . ASN A 1 601 ? -30.485  23.913  40.788  1.00 30.00  ? 605 ASN C CA  1  
ATOM 4553   C C   . ASN A 1 601 ? -31.546  24.997  40.882  1.00 30.00  ? 605 ASN C C   1  
ATOM 4554   O O   . ASN A 1 601 ? -31.910  25.429  41.975  1.00 30.00  ? 605 ASN C O   1  
ATOM 4555   C CB  . ASN A 1 601 ? -29.264  24.474  40.064  1.00 99.99  ? 605 ASN C CB  1  
ATOM 4556   C CG  . ASN A 1 601 ? -28.087  23.515  40.152  1.00 99.99  ? 605 ASN C CG  1  
ATOM 4557   O OD1 . ASN A 1 601 ? -27.486  23.360  41.215  1.00 99.99  ? 605 ASN C OD1 1  
ATOM 4558   N ND2 . ASN A 1 601 ? -27.755  22.872  39.031  1.00 99.99  ? 605 ASN C ND2 1  
ATOM 4559   N N   . VAL A 1 602 ? -32.036  25.432  39.725  1.00 30.00  ? 606 VAL C N   1  
ATOM 4560   C CA  . VAL A 1 602 ? -33.066  26.460  39.665  1.00 30.00  ? 606 VAL C CA  1  
ATOM 4561   C C   . VAL A 1 602 ? -34.337  25.980  40.373  1.00 30.00  ? 606 VAL C C   1  
ATOM 4562   O O   . VAL A 1 602 ? -35.108  26.786  40.895  1.00 30.00  ? 606 VAL C O   1  
ATOM 4563   C CB  . VAL A 1 602 ? -33.399  26.773  38.211  1.00 99.99  ? 606 VAL C CB  1  
ATOM 4564   C CG1 . VAL A 1 602 ? -33.859  25.499  37.509  1.00 99.99  ? 606 VAL C CG1 1  
ATOM 4565   C CG2 . VAL A 1 602 ? -34.515  27.811  38.157  1.00 99.99  ? 606 VAL C CG2 1  
ATOM 4566   N N   . VAL A 1 603 ? -34.554  24.673  40.395  1.00 30.00  ? 607 VAL C N   1  
ATOM 4567   C CA  . VAL A 1 603 ? -35.723  24.114  41.056  1.00 30.00  ? 607 VAL C CA  1  
ATOM 4568   C C   . VAL A 1 603 ? -35.589  24.348  42.563  1.00 30.00  ? 607 VAL C C   1  
ATOM 4569   O O   . VAL A 1 603 ? -36.570  24.295  43.315  1.00 30.00  ? 607 VAL C O   1  
ATOM 4570   C CB  . VAL A 1 603 ? -35.816  22.620  40.770  1.00 99.99  ? 607 VAL C CB  1  
ATOM 4571   C CG1 . VAL A 1 603 ? -35.933  22.392  39.266  1.00 99.99  ? 607 VAL C CG1 1  
ATOM 4572   C CG2 . VAL A 1 603 ? -34.563  21.922  41.291  1.00 99.99  ? 607 VAL C CG2 1  
ATOM 4573   N N   . ALA A 1 604 ? -34.358  24.604  42.997  1.00 30.00  ? 608 ALA C N   1  
ATOM 4574   C CA  . ALA A 1 604 ? -34.079  24.866  44.403  1.00 30.00  ? 608 ALA C CA  1  
ATOM 4575   C C   . ALA A 1 604 ? -34.376  26.351  44.635  1.00 30.00  ? 608 ALA C C   1  
ATOM 4576   O O   . ALA A 1 604 ? -35.017  26.723  45.623  1.00 30.00  ? 608 ALA C O   1  
ATOM 4577   C CB  . ALA A 1 604 ? -32.618  24.555  44.719  1.00 30.00  ? 608 ALA C CB  1  
ATOM 4578   N N   . LEU A 1 605 ? -33.906  27.191  43.716  1.00 30.00  ? 609 LEU C N   1  
ATOM 4579   C CA  . LEU A 1 605 ? -34.120  28.639  43.800  1.00 30.00  ? 609 LEU C CA  1  
ATOM 4580   C C   . LEU A 1 605 ? -35.610  28.921  43.957  1.00 30.00  ? 609 LEU C C   1  
ATOM 4581   O O   . LEU A 1 605 ? -36.043  29.563  44.920  1.00 30.00  ? 609 LEU C O   1  
ATOM 4582   C CB  . LEU A 1 605 ? -33.610  29.313  42.531  1.00 99.99  ? 609 LEU C CB  1  
ATOM 4583   C CG  . LEU A 1 605 ? -32.183  29.799  42.751  1.00 99.99  ? 609 LEU C CG  1  
ATOM 4584   C CD1 . LEU A 1 605 ? -31.789  30.749  41.624  1.00 99.99  ? 609 LEU C CD1 1  
ATOM 4585   C CD2 . LEU A 1 605 ? -32.093  30.528  44.087  1.00 99.99  ? 609 LEU C CD2 1  
ATOM 4586   N N   . LEU A 1 606 ? -36.376  28.430  42.991  1.00 30.00  ? 610 LEU C N   1  
ATOM 4587   C CA  . LEU A 1 606 ? -37.823  28.582  42.940  1.00 30.00  ? 610 LEU C CA  1  
ATOM 4588   C C   . LEU A 1 606 ? -38.496  27.815  44.060  1.00 30.00  ? 610 LEU C C   1  
ATOM 4589   O O   . LEU A 1 606 ? -39.610  28.150  44.466  1.00 30.00  ? 610 LEU C O   1  
ATOM 4590   C CB  . LEU A 1 606 ? -38.354  28.060  41.612  1.00 99.99  ? 610 LEU C CB  1  
ATOM 4591   C CG  . LEU A 1 606 ? -38.482  29.213  40.625  1.00 99.99  ? 610 LEU C CG  1  
ATOM 4592   C CD1 . LEU A 1 606 ? -39.312  28.767  39.425  1.00 99.99  ? 610 LEU C CD1 1  
ATOM 4593   C CD2 . LEU A 1 606 ? -39.169  30.393  41.308  1.00 99.99  ? 610 LEU C CD2 1  
ATOM 4594   N N   . GLY A 1 607 ? -37.828  26.781  44.552  1.00 30.00  ? 611 GLY C N   1  
ATOM 4595   C CA  . GLY A 1 607 ? -38.409  26.014  45.632  1.00 30.00  ? 611 GLY C CA  1  
ATOM 4596   C C   . GLY A 1 607 ? -38.685  26.925  46.820  1.00 30.00  ? 611 GLY C C   1  
ATOM 4597   O O   . GLY A 1 607 ? -39.651  26.718  47.563  1.00 30.00  ? 611 GLY C O   1  
ATOM 4598   N N   . ALA A 1 608 ? -37.849  27.945  47.004  1.00 30.00  ? 612 ALA C N   1  
ATOM 4599   C CA  . ALA A 1 608 ? -38.011  28.880  48.116  1.00 30.00  ? 612 ALA C CA  1  
ATOM 4600   C C   . ALA A 1 608 ? -38.238  30.322  47.659  1.00 30.00  ? 612 ALA C C   1  
ATOM 4601   O O   . ALA A 1 608 ? -37.861  31.274  48.352  1.00 30.00  ? 612 ALA C O   1  
ATOM 4602   C CB  . ALA A 1 608 ? -36.781  28.811  49.016  1.00 30.00  ? 612 ALA C CB  1  
ATOM 4603   N N   . SER A 1 609 ? -38.861  30.484  46.496  1.00 30.00  ? 613 SER C N   1  
ATOM 4604   C CA  . SER A 1 609 ? -39.128  31.808  45.958  1.00 30.00  ? 613 SER C CA  1  
ATOM 4605   C C   . SER A 1 609 ? -40.072  32.607  46.843  1.00 30.00  ? 613 SER C C   1  
ATOM 4606   O O   . SER A 1 609 ? -40.696  32.063  47.755  1.00 30.00  ? 613 SER C O   1  
ATOM 4607   C CB  . SER A 1 609 ? -39.767  31.685  44.577  1.00 99.99  ? 613 SER C CB  1  
ATOM 4608   O OG  . SER A 1 609 ? -41.077  31.131  44.705  1.00 99.99  ? 613 SER C OG  1  
ATOM 4609   N N   . LYS A 1 610 ? -40.156  33.908  46.554  1.00 30.00  ? 614 LYS C N   1  
ATOM 4610   C CA  . LYS A 1 610 ? -41.009  34.834  47.297  1.00 30.00  ? 614 LYS C CA  1  
ATOM 4611   C C   . LYS A 1 610 ? -42.473  34.735  46.856  1.00 30.00  ? 614 LYS C C   1  
ATOM 4612   O O   . LYS A 1 610 ? -43.377  34.733  47.696  1.00 30.00  ? 614 LYS C O   1  
ATOM 4613   C CB  . LYS A 1 610 ? -40.539  36.266  47.072  1.00 99.99  ? 614 LYS C CB  1  
ATOM 4614   C CG  . LYS A 1 610 ? -41.370  37.217  47.926  1.00 99.99  ? 614 LYS C CG  1  
ATOM 4615   C CD  . LYS A 1 610 ? -40.644  38.552  48.056  1.00 99.99  ? 614 LYS C CD  1  
ATOM 4616   C CE  . LYS A 1 610 ? -41.612  39.608  48.578  1.00 99.99  ? 614 LYS C CE  1  
ATOM 4617   N NZ  . LYS A 1 610 ? -41.498  39.696  50.042  1.00 99.99  ? 614 LYS C NZ  1  
ATOM 4618   N N   . GLU A 1 611 ? -42.704  34.659  45.545  1.00 30.00  ? 615 GLU C N   1  
ATOM 4619   C CA  . GLU A 1 611 ? -44.065  34.549  45.037  1.00 30.00  ? 615 GLU C CA  1  
ATOM 4620   C C   . GLU A 1 611 ? -44.683  33.312  45.694  1.00 30.00  ? 615 GLU C C   1  
ATOM 4621   O O   . GLU A 1 611 ? -44.036  32.272  45.790  1.00 30.00  ? 615 GLU C O   1  
ATOM 4622   C CB  . GLU A 1 611 ? -44.040  34.397  43.518  1.00 99.99  ? 615 GLU C CB  1  
ATOM 4623   C CG  . GLU A 1 611 ? -45.354  34.869  42.944  1.00 99.99  ? 615 GLU C CG  1  
ATOM 4624   C CD  . GLU A 1 611 ? -46.368  33.729  42.988  1.00 99.99  ? 615 GLU C CD  1  
ATOM 4625   O OE1 . GLU A 1 611 ? -47.079  33.630  44.022  1.00 99.99  ? 615 GLU C OE1 1  
ATOM 4626   O OE2 . GLU A 1 611 ? -46.424  32.966  41.985  1.00 99.99  ? 615 GLU C OE2 1  
ATOM 4627   N N   . PRO A 1 612 ? -45.939  33.405  46.157  1.00 30.00  ? 616 PRO C N   1  
ATOM 4628   C CA  . PRO A 1 612 ? -46.525  32.217  46.790  1.00 30.00  ? 616 PRO C CA  1  
ATOM 4629   C C   . PRO A 1 612 ? -46.880  31.095  45.787  1.00 30.00  ? 616 PRO C C   1  
ATOM 4630   O O   . PRO A 1 612 ? -46.813  29.905  46.129  1.00 30.00  ? 616 PRO C O   1  
ATOM 4631   C CB  . PRO A 1 612 ? -47.740  32.857  47.363  1.00 99.99  ? 616 PRO C CB  1  
ATOM 4632   C CG  . PRO A 1 612 ? -47.641  34.324  47.022  1.00 99.99  ? 616 PRO C CG  1  
ATOM 4633   C CD  . PRO A 1 612 ? -46.583  34.630  46.377  1.00 99.99  ? 616 PRO C CD  1  
ATOM 4634   N N   . LEU A 1 613 ? -47.250  31.472  44.563  1.00 30.00  ? 617 LEU C N   1  
ATOM 4635   C CA  . LEU A 1 613 ? -47.584  30.473  43.551  1.00 30.00  ? 617 LEU C CA  1  
ATOM 4636   C C   . LEU A 1 613 ? -46.308  29.725  43.168  1.00 30.00  ? 617 LEU C C   1  
ATOM 4637   O O   . LEU A 1 613 ? -46.221  28.507  43.334  1.00 30.00  ? 617 LEU C O   1  
ATOM 4638   C CB  . LEU A 1 613 ? -48.170  31.156  42.320  1.00 99.99  ? 617 LEU C CB  1  
ATOM 4639   C CG  . LEU A 1 613 ? -49.692  31.155  42.412  1.00 99.99  ? 617 LEU C CG  1  
ATOM 4640   C CD1 . LEU A 1 613 ? -50.284  31.530  41.057  1.00 99.99  ? 617 LEU C CD1 1  
ATOM 4641   C CD2 . LEU A 1 613 ? -50.177  29.767  42.814  1.00 99.99  ? 617 LEU C CD2 1  
ATOM 4642   N N   . VAL A 1 614 ? -45.324  30.461  42.662  1.00 30.00  ? 618 VAL C N   1  
ATOM 4643   C CA  . VAL A 1 614 ? -44.055  29.863  42.259  1.00 30.00  ? 618 VAL C CA  1  
ATOM 4644   C C   . VAL A 1 614 ? -43.513  28.891  43.307  1.00 30.00  ? 618 VAL C C   1  
ATOM 4645   O O   . VAL A 1 614 ? -42.961  27.850  42.974  1.00 30.00  ? 618 VAL C O   1  
ATOM 4646   C CB  . VAL A 1 614 ? -43.010  30.955  42.050  1.00 99.99  ? 618 VAL C CB  1  
ATOM 4647   C CG1 . VAL A 1 614 ? -43.486  31.908  40.957  1.00 99.99  ? 618 VAL C CG1 1  
ATOM 4648   C CG2 . VAL A 1 614 ? -42.813  31.726  43.348  1.00 99.99  ? 618 VAL C CG2 1  
ATOM 4649   N N   . ALA A 1 615 ? -43.675  29.230  44.575  1.00 30.00  ? 619 ALA C N   1  
ATOM 4650   C CA  . ALA A 1 615 ? -43.197  28.369  45.643  1.00 30.00  ? 619 ALA C CA  1  
ATOM 4651   C C   . ALA A 1 615 ? -43.890  27.017  45.603  1.00 30.00  ? 619 ALA C C   1  
ATOM 4652   O O   . ALA A 1 615 ? -43.247  25.978  45.772  1.00 30.00  ? 619 ALA C O   1  
ATOM 4653   C CB  . ALA A 1 615 ? -43.445  29.034  46.978  1.00 30.00  ? 619 ALA C CB  1  
ATOM 4654   N N   . GLU A 1 616 ? -45.207  27.038  45.385  1.00 30.00  ? 620 GLU C N   1  
ATOM 4655   C CA  . GLU A 1 616 ? -46.021  25.817  45.328  1.00 30.00  ? 620 GLU C CA  1  
ATOM 4656   C C   . GLU A 1 616 ? -45.740  24.954  44.113  1.00 30.00  ? 620 GLU C C   1  
ATOM 4657   O O   . GLU A 1 616 ? -45.697  23.728  44.213  1.00 30.00  ? 620 GLU C O   1  
ATOM 4658   C CB  . GLU A 1 616 ? -47.503  26.186  45.291  1.00 99.99  ? 620 GLU C CB  1  
ATOM 4659   C CG  . GLU A 1 616 ? -47.887  26.866  46.581  1.00 99.99  ? 620 GLU C CG  1  
ATOM 4660   C CD  . GLU A 1 616 ? -47.917  25.839  47.710  1.00 99.99  ? 620 GLU C CD  1  
ATOM 4661   O OE1 . GLU A 1 616 ? -46.848  25.654  48.349  1.00 99.99  ? 620 GLU C OE1 1  
ATOM 4662   O OE2 . GLU A 1 616 ? -49.010  25.247  47.921  1.00 99.99  ? 620 GLU C OE2 1  
ATOM 4663   N N   . GLN A 1 639 ? -40.214  8.679   36.793  1.00 30.00  ? 643 GLN C N   1  
ATOM 4664   C CA  . GLN A 1 639 ? -41.108  8.226   35.735  1.00 30.00  ? 643 GLN C CA  1  
ATOM 4665   C C   . GLN A 1 639 ? -40.937  9.061   34.445  1.00 30.00  ? 643 GLN C C   1  
ATOM 4666   O O   . GLN A 1 639 ? -40.768  10.286  34.481  1.00 30.00  ? 643 GLN C O   1  
ATOM 4667   C CB  . GLN A 1 639 ? -42.557  8.349   36.193  1.00 99.99  ? 643 GLN C CB  1  
ATOM 4668   C CG  . GLN A 1 639 ? -43.368  9.080   35.131  1.00 99.99  ? 643 GLN C CG  1  
ATOM 4669   C CD  . GLN A 1 639 ? -42.995  10.554  35.075  1.00 99.99  ? 643 GLN C CD  1  
ATOM 4670   O OE1 . GLN A 1 639 ? -42.138  11.010  35.829  1.00 99.99  ? 643 GLN C OE1 1  
ATOM 4671   N NE2 . GLN A 1 639 ? -43.642  11.300  34.176  1.00 99.99  ? 643 GLN C NE2 1  
ATOM 4672   N N   . THR A 1 640 ? -40.968  8.406   33.285  1.00 30.00  ? 644 THR C N   1  
ATOM 4673   C CA  . THR A 1 640 ? -40.846  9.154   32.066  1.00 30.00  ? 644 THR C CA  1  
ATOM 4674   C C   . THR A 1 640 ? -42.223  9.697   31.670  1.00 30.00  ? 644 THR C C   1  
ATOM 4675   O O   . THR A 1 640 ? -43.287  9.340   32.207  1.00 30.00  ? 644 THR C O   1  
ATOM 4676   C CB  . THR A 1 640 ? -40.315  8.254   30.956  1.00 99.99  ? 644 THR C CB  1  
ATOM 4677   O OG1 . THR A 1 640 ? -41.300  7.275   30.624  1.00 99.99  ? 644 THR C OG1 1  
ATOM 4678   C CG2 . THR A 1 640 ? -39.045  7.556   31.432  1.00 99.99  ? 644 THR C CG2 1  
ATOM 4679   N N   . ILE A 1 641 ? -42.167  10.572  30.685  1.00 30.00  ? 645 ILE C N   1  
ATOM 4680   C CA  . ILE A 1 641 ? -43.394  11.161  30.196  1.00 30.00  ? 645 ILE C CA  1  
ATOM 4681   C C   . ILE A 1 641 ? -44.256  10.081  29.582  1.00 30.00  ? 645 ILE C C   1  
ATOM 4682   O O   . ILE A 1 641 ? -45.448  9.960   29.887  1.00 30.00  ? 645 ILE C O   1  
ATOM 4683   C CB  . ILE A 1 641 ? -43.079  12.218  29.143  1.00 99.99  ? 645 ILE C CB  1  
ATOM 4684   C CG1 . ILE A 1 641 ? -42.953  11.555  27.776  1.00 99.99  ? 645 ILE C CG1 1  
ATOM 4685   C CG2 . ILE A 1 641 ? -41.764  12.911  29.496  1.00 99.99  ? 645 ILE C CG2 1  
ATOM 4686   C CD1 . ILE A 1 641 ? -44.293  11.625  27.052  1.00 99.99  ? 645 ILE C CD1 1  
ATOM 4687   N N   . SER A 1 642 ? -43.626  9.283   28.732  1.00 30.00  ? 646 SER C N   1  
ATOM 4688   C CA  . SER A 1 642 ? -44.318  8.176   28.068  1.00 30.00  ? 646 SER C CA  1  
ATOM 4689   C C   . SER A 1 642 ? -45.028  7.271   29.035  1.00 30.00  ? 646 SER C C   1  
ATOM 4690   O O   . SER A 1 642 ? -46.215  6.958   28.927  1.00 30.00  ? 646 SER C O   1  
ATOM 4691   C CB  . SER A 1 642 ? -43.316  7.329   27.289  1.00 99.99  ? 646 SER C CB  1  
ATOM 4692   O OG  . SER A 1 642 ? -42.874  8.049   26.137  1.00 99.99  ? 646 SER C OG  1  
ATOM 4693   N N   . ALA A 1 643 ? -44.305  6.807   30.028  1.00 30.00  ? 647 ALA C N   1  
ATOM 4694   C CA  . ALA A 1 643 ? -44.917  5.884   30.957  1.00 30.00  ? 647 ALA C CA  1  
ATOM 4695   C C   . ALA A 1 643 ? -45.985  6.542   31.757  1.00 30.00  ? 647 ALA C C   1  
ATOM 4696   O O   . ALA A 1 643 ? -46.990  5.979   32.215  1.00 30.00  ? 647 ALA C O   1  
ATOM 4697   C CB  . ALA A 1 643 ? -43.866  5.444   31.971  1.00 30.00  ? 647 ALA C CB  1  
ATOM 4698   N N   . VAL A 1 644 ? -45.691  7.786   31.995  1.00 30.00  ? 648 VAL C N   1  
ATOM 4699   C CA  . VAL A 1 644 ? -46.664  8.452   32.814  1.00 30.00  ? 648 VAL C CA  1  
ATOM 4700   C C   . VAL A 1 644 ? -47.985  8.641   32.072  1.00 30.00  ? 648 VAL C C   1  
ATOM 4701   O O   . VAL A 1 644 ? -49.069  8.418   32.576  1.00 30.00  ? 648 VAL C O   1  
ATOM 4702   C CB  . VAL A 1 644 ? -46.146  9.827   33.224  1.00 99.99  ? 648 VAL C CB  1  
ATOM 4703   C CG1 . VAL A 1 644 ? -45.835  10.646  31.975  1.00 99.99  ? 648 VAL C CG1 1  
ATOM 4704   C CG2 . VAL A 1 644 ? -47.201  10.545  34.052  1.00 99.99  ? 648 VAL C CG2 1  
ATOM 4705   N N   . HIS A 1 645 ? -47.867  9.097   30.852  1.00 30.00  ? 649 HIS C N   1  
ATOM 4706   C CA  . HIS A 1 645 ? -49.052  9.340   30.074  1.00 30.00  ? 649 HIS C CA  1  
ATOM 4707   C C   . HIS A 1 645 ? -49.767  8.061   29.725  1.00 30.00  ? 649 HIS C C   1  
ATOM 4708   O O   . HIS A 1 645 ? -50.991  7.985   29.777  1.00 30.00  ? 649 HIS C O   1  
ATOM 4709   C CB  . HIS A 1 645 ? -48.684  10.048  28.774  1.00 99.99  ? 649 HIS C CB  1  
ATOM 4710   C CG  . HIS A 1 645 ? -48.027  11.396  28.943  1.00 99.99  ? 649 HIS C CG  1  
ATOM 4711   N ND1 . HIS A 1 645 ? -46.677  11.595  28.682  1.00 99.99  ? 649 HIS C ND1 1  
ATOM 4712   C CD2 . HIS A 1 645 ? -48.528  12.597  29.344  1.00 99.99  ? 649 HIS C CD2 1  
ATOM 4713   C CE1 . HIS A 1 645 ? -46.399  12.863  28.920  1.00 99.99  ? 649 HIS C CE1 1  
ATOM 4714   N NE2 . HIS A 1 645 ? -47.488  13.473  29.315  1.00 99.99  ? 649 HIS C NE2 1  
ATOM 4715   N N   . ARG A 1 646 ? -48.972  7.049   29.379  1.00 30.00  ? 650 ARG C N   1  
ATOM 4716   C CA  . ARG A 1 646 ? -49.556  5.774   29.041  1.00 30.00  ? 650 ARG C CA  1  
ATOM 4717   C C   . ARG A 1 646 ? -50.434  5.348   30.195  1.00 30.00  ? 650 ARG C C   1  
ATOM 4718   O O   . ARG A 1 646 ? -51.552  4.851   30.078  1.00 30.00  ? 650 ARG C O   1  
ATOM 4719   C CB  . ARG A 1 646 ? -48.455  4.748   28.808  1.00 99.99  ? 650 ARG C CB  1  
ATOM 4720   C CG  . ARG A 1 646 ? -49.072  3.438   28.331  1.00 99.99  ? 650 ARG C CG  1  
ATOM 4721   C CD  . ARG A 1 646 ? -47.986  2.374   28.217  1.00 99.99  ? 650 ARG C CD  1  
ATOM 4722   N NE  . ARG A 1 646 ? -47.516  1.953   29.554  1.00 99.99  ? 650 ARG C NE  1  
ATOM 4723   C CZ  . ARG A 1 646 ? -46.627  0.980   29.737  1.00 99.99  ? 650 ARG C CZ  1  
ATOM 4724   N NH1 . ARG A 1 646 ? -46.093  0.312   28.716  1.00 99.99  ? 650 ARG C NH1 1  
ATOM 4725   N NH2 . ARG A 1 646 ? -46.273  0.681   30.983  1.00 99.99  ? 650 ARG C NH2 1  
ATOM 4726   N N   . GLU A 1 647 ? -49.934  5.618   31.370  1.00 30.00  ? 651 GLU C N   1  
ATOM 4727   C CA  . GLU A 1 647 ? -50.697  5.291   32.540  1.00 30.00  ? 651 GLU C CA  1  
ATOM 4728   C C   . GLU A 1 647 ? -51.925  6.177   32.686  1.00 30.00  ? 651 GLU C C   1  
ATOM 4729   O O   . GLU A 1 647 ? -52.992  5.704   33.045  1.00 30.00  ? 651 GLU C O   1  
ATOM 4730   C CB  . GLU A 1 647 ? -49.836  5.469   33.787  1.00 99.99  ? 651 GLU C CB  1  
ATOM 4731   C CG  . GLU A 1 647 ? -48.699  4.475   33.762  1.00 99.99  ? 651 GLU C CG  1  
ATOM 4732   C CD  . GLU A 1 647 ? -49.242  3.076   34.033  1.00 99.99  ? 651 GLU C CD  1  
ATOM 4733   O OE1 . GLU A 1 647 ? -49.606  2.396   33.037  1.00 99.99  ? 651 GLU C OE1 1  
ATOM 4734   O OE2 . GLU A 1 647 ? -49.289  2.698   35.234  1.00 99.99  ? 651 GLU C OE2 1  
ATOM 4735   N N   . SER A 1 648 ? -51.827  7.478   32.487  1.00 30.00  ? 652 SER C N   1  
ATOM 4736   C CA  . SER A 1 648 ? -53.005  8.328   32.636  1.00 30.00  ? 652 SER C CA  1  
ATOM 4737   C C   . SER A 1 648 ? -54.155  7.899   31.708  1.00 30.00  ? 652 SER C C   1  
ATOM 4738   O O   . SER A 1 648 ? -55.337  7.815   32.041  1.00 30.00  ? 652 SER C O   1  
ATOM 4739   C CB  . SER A 1 648 ? -52.649  9.773   32.301  1.00 99.99  ? 652 SER C CB  1  
ATOM 4740   O OG  . SER A 1 648 ? -52.357  9.882   30.907  1.00 99.99  ? 652 SER C OG  1  
ATOM 4741   N N   . LEU A 1 649 ? -53.725  7.612   30.508  1.00 30.00  ? 653 LEU C N   1  
ATOM 4742   C CA  . LEU A 1 649 ? -54.587  7.160   29.467  1.00 30.00  ? 653 LEU C CA  1  
ATOM 4743   C C   . LEU A 1 649 ? -55.243  5.832   29.802  1.00 30.00  ? 653 LEU C C   1  
ATOM 4744   O O   . LEU A 1 649 ? -56.431  5.594   29.588  1.00 30.00  ? 653 LEU C O   1  
ATOM 4745   C CB  . LEU A 1 649 ? -53.793  6.980   28.177  1.00 99.99  ? 653 LEU C CB  1  
ATOM 4746   C CG  . LEU A 1 649 ? -53.900  8.243   27.333  1.00 99.99  ? 653 LEU C CG  1  
ATOM 4747   C CD1 . LEU A 1 649 ? -53.397  7.955   25.921  1.00 99.99  ? 653 LEU C CD1 1  
ATOM 4748   C CD2 . LEU A 1 649 ? -55.357  8.691   27.272  1.00 99.99  ? 653 LEU C CD2 1  
ATOM 4749   N N   . ASN A 1 650 ? -54.458  4.907   30.321  1.00 30.00  ? 654 ASN C N   1  
ATOM 4750   C CA  . ASN A 1 650 ? -55.035  3.619   30.648  1.00 30.00  ? 654 ASN C CA  1  
ATOM 4751   C C   . ASN A 1 650 ? -56.043  3.820   31.754  1.00 30.00  ? 654 ASN C C   1  
ATOM 4752   O O   . ASN A 1 650 ? -57.103  3.230   31.849  1.00 30.00  ? 654 ASN C O   1  
ATOM 4753   C CB  . ASN A 1 650 ? -53.942  2.663   31.110  1.00 99.99  ? 654 ASN C CB  1  
ATOM 4754   C CG  . ASN A 1 650 ? -53.361  3.097   32.449  1.00 99.99  ? 654 ASN C CG  1  
ATOM 4755   O OD1 . ASN A 1 650 ? -52.184  3.438   32.538  1.00 99.99  ? 654 ASN C OD1 1  
ATOM 4756   N ND2 . ASN A 1 650 ? -54.194  3.084   33.491  1.00 99.99  ? 654 ASN C ND2 1  
ATOM 4757   N N   . LYS A 1 651 ? -55.734  4.730   32.627  1.00 30.00  ? 655 LYS C N   1  
ATOM 4758   C CA  . LYS A 1 651 ? -56.679  4.950   33.680  1.00 30.00  ? 655 LYS C CA  1  
ATOM 4759   C C   . LYS A 1 651 ? -57.975  5.595   33.162  1.00 30.00  ? 655 LYS C C   1  
ATOM 4760   O O   . LYS A 1 651 ? -59.094  5.361   33.637  1.00 30.00  ? 655 LYS C O   1  
ATOM 4761   C CB  . LYS A 1 651 ? -56.077  5.877   34.733  1.00 99.99  ? 655 LYS C CB  1  
ATOM 4762   C CG  . LYS A 1 651 ? -55.421  5.043   35.827  1.00 99.99  ? 655 LYS C CG  1  
ATOM 4763   C CD  . LYS A 1 651 ? -54.090  4.495   35.321  1.00 99.99  ? 655 LYS C CD  1  
ATOM 4764   C CE  . LYS A 1 651 ? -53.530  3.505   36.337  1.00 99.99  ? 655 LYS C CE  1  
ATOM 4765   N NZ  . LYS A 1 651 ? -52.312  2.885   35.796  1.00 99.99  ? 655 LYS C NZ  1  
ATOM 4766   N N   . LEU A 1 652 ? -57.809  6.456   32.181  1.00 30.00  ? 656 LEU C N   1  
ATOM 4767   C CA  . LEU A 1 652 ? -58.985  7.130   31.605  1.00 30.00  ? 656 LEU C CA  1  
ATOM 4768   C C   . LEU A 1 652 ? -59.933  6.097   30.989  1.00 30.00  ? 656 LEU C C   1  
ATOM 4769   O O   . LEU A 1 652 ? -61.146  6.109   31.251  1.00 30.00  ? 656 LEU C O   1  
ATOM 4770   C CB  . LEU A 1 652 ? -58.542  8.108   30.522  1.00 99.99  ? 656 LEU C CB  1  
ATOM 4771   C CG  . LEU A 1 652 ? -58.392  9.502   31.123  1.00 99.99  ? 656 LEU C CG  1  
ATOM 4772   C CD1 . LEU A 1 652 ? -58.276  10.529  30.003  1.00 99.99  ? 656 LEU C CD1 1  
ATOM 4773   C CD2 . LEU A 1 652 ? -59.611  9.819   31.982  1.00 99.99  ? 656 LEU C CD2 1  
ATOM 4774   N N   . MET A 1 653 ? -59.334  5.236   30.187  1.00 30.00  ? 657 MET C N   1  
ATOM 4775   C CA  . MET A 1 653 ? -60.043  4.167   29.465  1.00 30.00  ? 657 MET C CA  1  
ATOM 4776   C C   . MET A 1 653 ? -60.810  3.265   30.439  1.00 30.00  ? 657 MET C C   1  
ATOM 4777   O O   . MET A 1 653 ? -61.949  2.858   30.172  1.00 30.00  ? 657 MET C O   1  
ATOM 4778   C CB  . MET A 1 653 ? -59.045  3.313   28.692  1.00 99.99  ? 657 MET C CB  1  
ATOM 4779   C CG  . MET A 1 653 ? -59.794  2.254   27.890  1.00 99.99  ? 657 MET C CG  1  
ATOM 4780   S SD  . MET A 1 653 ? -58.665  1.447   26.726  1.00 99.99  ? 657 MET C SD  1  
ATOM 4781   C CE  . MET A 1 653 ? -59.764  0.236   26.021  1.00 99.99  ? 657 MET C CE  1  
ATOM 4782   N N   . LYS A 1 654 ? -60.155  2.974   31.546  1.00 30.00  ? 658 LYS C N   1  
ATOM 4783   C CA  . LYS A 1 654 ? -60.716  2.114   32.597  1.00 30.00  ? 658 LYS C CA  1  
ATOM 4784   C C   . LYS A 1 654 ? -61.985  2.747   33.183  1.00 30.00  ? 658 LYS C C   1  
ATOM 4785   O O   . LYS A 1 654 ? -62.964  2.054   33.487  1.00 30.00  ? 658 LYS C O   1  
ATOM 4786   C CB  . LYS A 1 654 ? -59.698  1.926   33.714  1.00 99.99  ? 658 LYS C CB  1  
ATOM 4787   C CG  . LYS A 1 654 ? -60.250  0.954   34.751  1.00 99.99  ? 658 LYS C CG  1  
ATOM 4788   C CD  . LYS A 1 654 ? -59.108  0.420   35.610  1.00 99.99  ? 658 LYS C CD  1  
ATOM 4789   C CE  . LYS A 1 654 ? -59.679  -0.244  36.859  1.00 99.99  ? 658 LYS C CE  1  
ATOM 4790   N NZ  . LYS A 1 654 ? -59.833  -1.687  36.620  1.00 99.99  ? 658 LYS C NZ  1  
ATOM 4791   N N   . ASN A 1 655 ? -61.917  4.056   33.318  1.00 30.00  ? 659 ASN C N   1  
ATOM 4792   C CA  . ASN A 1 655 ? -63.015  4.858   33.879  1.00 30.00  ? 659 ASN C CA  1  
ATOM 4793   C C   . ASN A 1 655 ? -64.198  4.918   32.905  1.00 30.00  ? 659 ASN C C   1  
ATOM 4794   O O   . ASN A 1 655 ? -65.361  5.020   33.322  1.00 30.00  ? 659 ASN C O   1  
ATOM 4795   C CB  . ASN A 1 655 ? -62.531  6.280   34.145  1.00 99.99  ? 659 ASN C CB  1  
ATOM 4796   C CG  . ASN A 1 655 ? -61.426  6.298   35.190  1.00 99.99  ? 659 ASN C CG  1  
ATOM 4797   O OD1 . ASN A 1 655 ? -61.595  5.769   36.285  1.00 99.99  ? 659 ASN C OD1 1  
ATOM 4798   N ND2 . ASN A 1 655 ? -60.290  6.911   34.846  1.00 99.99  ? 659 ASN C ND2 1  
ATOM 4799   N N   . LEU A 1 656 ? -63.864  4.844   31.631  1.00 30.00  ? 660 LEU C N   1  
ATOM 4800   C CA  . LEU A 1 656 ? -64.844  4.933   30.532  1.00 30.00  ? 660 LEU C CA  1  
ATOM 4801   C C   . LEU A 1 656 ? -65.694  3.656   30.409  1.00 30.00  ? 660 LEU C C   1  
ATOM 4802   O O   . LEU A 1 656 ? -66.930  3.720   30.324  1.00 30.00  ? 660 LEU C O   1  
ATOM 4803   C CB  . LEU A 1 656 ? -64.118  5.144   29.206  1.00 99.99  ? 660 LEU C CB  1  
ATOM 4804   C CG  . LEU A 1 656 ? -64.056  6.636   28.893  1.00 99.99  ? 660 LEU C CG  1  
ATOM 4805   C CD1 . LEU A 1 656 ? -63.640  6.831   27.438  1.00 99.99  ? 660 LEU C CD1 1  
ATOM 4806   C CD2 . LEU A 1 656 ? -65.428  7.259   29.116  1.00 99.99  ? 660 LEU C CD2 1  
ATOM 4807   N N   . TYR A 1 657 ? -65.000  2.530   30.402  1.00 30.00  ? 661 TYR C N   1  
ATOM 4808   C CA  . TYR A 1 657 ? -65.610  1.190   30.234  1.00 30.00  ? 661 TYR C CA  1  
ATOM 4809   C C   . TYR A 1 657 ? -66.797  0.957   31.180  1.00 30.00  ? 661 TYR C C   1  
ATOM 4810   O O   . TYR A 1 657 ? -67.735  0.210   30.868  1.00 30.00  ? 661 TYR C O   1  
ATOM 4811   C CB  . TYR A 1 657 ? -64.571  0.109   30.515  1.00 99.99  ? 661 TYR C CB  1  
ATOM 4812   C CG  . TYR A 1 657 ? -65.200  -1.250  30.339  1.00 99.99  ? 661 TYR C CG  1  
ATOM 4813   C CD1 . TYR A 1 657 ? -65.300  -1.816  29.061  1.00 99.99  ? 661 TYR C CD1 1  
ATOM 4814   C CD2 . TYR A 1 657 ? -65.682  -1.950  31.453  1.00 99.99  ? 661 TYR C CD2 1  
ATOM 4815   C CE1 . TYR A 1 657 ? -65.883  -3.079  28.898  1.00 99.99  ? 661 TYR C CE1 1  
ATOM 4816   C CE2 . TYR A 1 657 ? -66.265  -3.213  31.288  1.00 99.99  ? 661 TYR C CE2 1  
ATOM 4817   C CZ  . TYR A 1 657 ? -66.363  -3.776  30.011  1.00 99.99  ? 661 TYR C CZ  1  
ATOM 4818   O OH  . TYR A 1 657 ? -66.931  -5.003  29.853  1.00 99.99  ? 661 TYR C OH  1  
ATOM 4819   N N   . SER A 1 658 ? -66.740  1.585   32.332  1.00 30.00  ? 662 SER C N   1  
ATOM 4820   C CA  . SER A 1 658 ? -67.805  1.458   33.334  1.00 30.00  ? 662 SER C CA  1  
ATOM 4821   C C   . SER A 1 658 ? -68.971  2.367   32.962  1.00 30.00  ? 662 SER C C   1  
ATOM 4822   O O   . SER A 1 658 ? -69.632  2.953   33.828  1.00 30.00  ? 662 SER C O   1  
ATOM 4823   C CB  . SER A 1 658 ? -67.276  1.852   34.708  1.00 99.99  ? 662 SER C CB  1  
ATOM 4824   O OG  . SER A 1 658 ? -66.999  3.254   34.728  1.00 99.99  ? 662 SER C OG  1  
ATOM 4825   N N   . THR A 1 659 ? -69.229  2.472   31.667  1.00 30.00  ? 663 THR C N   1  
ATOM 4826   C CA  . THR A 1 659 ? -70.262  3.401   31.206  1.00 30.00  ? 663 THR C CA  1  
ATOM 4827   C C   . THR A 1 659 ? -71.121  2.901   30.043  1.00 30.00  ? 663 THR C C   1  
ATOM 4828   O O   . THR A 1 659 ? -70.736  1.969   29.314  1.00 30.00  ? 663 THR C O   1  
ATOM 4829   C CB  . THR A 1 659 ? -69.618  4.697   30.734  1.00 99.99  ? 663 THR C CB  1  
ATOM 4830   O OG1 . THR A 1 659 ? -68.864  4.451   29.543  1.00 99.99  ? 663 THR C OG1 1  
ATOM 4831   C CG2 . THR A 1 659 ? -68.689  5.230   31.818  1.00 99.99  ? 663 THR C CG2 1  
ATOM 4832   N N   . HIS A 1 660 ? -72.239  3.609   30.000  1.00 30.00  ? 664 HIS C N   1  
ATOM 4833   C CA  . HIS A 1 660 ? -73.273  3.531   28.972  1.00 30.00  ? 664 HIS C CA  1  
ATOM 4834   C C   . HIS A 1 660 ? -73.023  4.720   28.054  1.00 30.00  ? 664 HIS C C   1  
ATOM 4835   O O   . HIS A 1 660 ? -73.537  5.826   28.282  1.00 30.00  ? 664 HIS C O   1  
ATOM 4836   C CB  . HIS A 1 660 ? -74.652  3.609   29.616  1.00 99.99  ? 664 HIS C CB  1  
ATOM 4837   C CG  . HIS A 1 660 ? -75.158  2.311   30.202  1.00 99.99  ? 664 HIS C CG  1  
ATOM 4838   N ND1 . HIS A 1 660 ? -74.993  1.998   31.547  1.00 99.99  ? 664 HIS C ND1 1  
ATOM 4839   C CD2 . HIS A 1 660 ? -75.814  1.264   29.635  1.00 99.99  ? 664 HIS C CD2 1  
ATOM 4840   C CE1 . HIS A 1 660 ? -75.535  0.812   31.757  1.00 99.99  ? 664 HIS C CE1 1  
ATOM 4841   N NE2 . HIS A 1 660 ? -76.028  0.360   30.632  1.00 99.99  ? 664 HIS C NE2 1  
ATOM 4842   N N   . PRO A 1 661 ? -72.217  4.435   27.058  1.00 30.00  ? 665 PRO C N   1  
ATOM 4843   C CA  . PRO A 1 661 ? -71.715  5.435   26.115  1.00 30.00  ? 665 PRO C CA  1  
ATOM 4844   C C   . PRO A 1 661 ? -72.691  5.780   24.990  1.00 30.00  ? 665 PRO C C   1  
ATOM 4845   O O   . PRO A 1 661 ? -73.349  4.898   24.419  1.00 30.00  ? 665 PRO C O   1  
ATOM 4846   C CB  . PRO A 1 661 ? -70.535  4.682   25.613  1.00 99.99  ? 665 PRO C CB  1  
ATOM 4847   C CG  . PRO A 1 661 ? -70.507  3.383   26.384  1.00 99.99  ? 665 PRO C CG  1  
ATOM 4848   C CD  . PRO A 1 661 ? -71.447  3.277   27.241  1.00 99.99  ? 665 PRO C CD  1  
ATOM 4849   N N   . HIS A 1 662 ? -72.690  7.077   24.756  1.00 30.00  ? 666 HIS C N   1  
ATOM 4850   C CA  . HIS A 1 662 ? -73.403  7.760   23.674  1.00 30.00  ? 666 HIS C CA  1  
ATOM 4851   C C   . HIS A 1 662 ? -72.313  8.461   22.875  1.00 30.00  ? 666 HIS C C   1  
ATOM 4852   O O   . HIS A 1 662 ? -71.515  9.234   23.421  1.00 30.00  ? 666 HIS C O   1  
ATOM 4853   C CB  . HIS A 1 662 ? -74.402  8.751   24.255  1.00 99.99  ? 666 HIS C CB  1  
ATOM 4854   C CG  . HIS A 1 662 ? -74.161  9.133   25.696  1.00 99.99  ? 666 HIS C CG  1  
ATOM 4855   N ND1 . HIS A 1 662 ? -74.516  10.380  26.197  1.00 99.99  ? 666 HIS C ND1 1  
ATOM 4856   C CD2 . HIS A 1 662 ? -73.608  8.441   26.728  1.00 99.99  ? 666 HIS C CD2 1  
ATOM 4857   C CE1 . HIS A 1 662 ? -74.183  10.416  27.474  1.00 99.99  ? 666 HIS C CE1 1  
ATOM 4858   N NE2 . HIS A 1 662 ? -73.643  9.270   27.807  1.00 99.99  ? 666 HIS C NE2 1  
ATOM 4859   N N   . PHE A 1 663 ? -72.266  8.191   21.592  1.00 30.00  ? 667 PHE C N   1  
ATOM 4860   C CA  . PHE A 1 663 ? -71.168  8.699   20.770  1.00 30.00  ? 667 PHE C CA  1  
ATOM 4861   C C   . PHE A 1 663 ? -71.547  9.816   19.818  1.00 30.00  ? 667 PHE C C   1  
ATOM 4862   O O   . PHE A 1 663 ? -72.602  9.792   19.198  1.00 30.00  ? 667 PHE C O   1  
ATOM 4863   C CB  . PHE A 1 663 ? -70.596  7.575   19.914  1.00 99.99  ? 667 PHE C CB  1  
ATOM 4864   C CG  . PHE A 1 663 ? -69.463  8.107   19.072  1.00 99.99  ? 667 PHE C CG  1  
ATOM 4865   C CD1 . PHE A 1 663 ? -68.177  8.216   19.616  1.00 99.99  ? 667 PHE C CD1 1  
ATOM 4866   C CD2 . PHE A 1 663 ? -69.696  8.493   17.747  1.00 99.99  ? 667 PHE C CD2 1  
ATOM 4867   C CE1 . PHE A 1 663 ? -67.126  8.710   18.837  1.00 99.99  ? 667 PHE C CE1 1  
ATOM 4868   C CE2 . PHE A 1 663 ? -68.647  8.987   16.966  1.00 99.99  ? 667 PHE C CE2 1  
ATOM 4869   C CZ  . PHE A 1 663 ? -67.361  9.096   17.511  1.00 99.99  ? 667 PHE C CZ  1  
ATOM 4870   N N   . VAL A 1 664 ? -70.664  10.806  19.721  1.00 30.00  ? 668 VAL C N   1  
ATOM 4871   C CA  . VAL A 1 664 ? -70.864  11.961  18.834  1.00 30.00  ? 668 VAL C CA  1  
ATOM 4872   C C   . VAL A 1 664 ? -69.713  11.884  17.843  1.00 30.00  ? 668 VAL C C   1  
ATOM 4873   O O   . VAL A 1 664 ? -68.562  11.703  18.260  1.00 30.00  ? 668 VAL C O   1  
ATOM 4874   C CB  . VAL A 1 664 ? -70.826  13.251  19.646  1.00 99.99  ? 668 VAL C CB  1  
ATOM 4875   C CG1 . VAL A 1 664 ? -71.932  13.225  20.694  1.00 99.99  ? 668 VAL C CG1 1  
ATOM 4876   C CG2 . VAL A 1 664 ? -69.474  13.379  20.339  1.00 99.99  ? 668 VAL C CG2 1  
ATOM 4877   N N   . ARG A 1 665 ? -70.022  12.010  16.552  1.00 30.00  ? 669 ARG C N   1  
ATOM 4878   C CA  . ARG A 1 665 ? -69.005  11.937  15.502  1.00 30.00  ? 669 ARG C CA  1  
ATOM 4879   C C   . ARG A 1 665 ? -68.920  13.214  14.704  1.00 30.00  ? 669 ARG C C   1  
ATOM 4880   O O   . ARG A 1 665 ? -69.824  13.543  13.924  1.00 30.00  ? 669 ARG C O   1  
ATOM 4881   C CB  . ARG A 1 665 ? -69.335  10.801  14.541  1.00 99.99  ? 669 ARG C CB  1  
ATOM 4882   C CG  . ARG A 1 665 ? -68.243  10.698  13.481  1.00 99.99  ? 669 ARG C CG  1  
ATOM 4883   C CD  . ARG A 1 665 ? -68.598  9.594   12.491  1.00 99.99  ? 669 ARG C CD  1  
ATOM 4884   N NE  . ARG A 1 665 ? -69.993  9.736   12.015  1.00 99.99  ? 669 ARG C NE  1  
ATOM 4885   C CZ  . ARG A 1 665 ? -70.351  10.594  11.066  1.00 99.99  ? 669 ARG C CZ  1  
ATOM 4886   N NH1 . ARG A 1 665 ? -69.470  11.396  10.471  1.00 99.99  ? 669 ARG C NH1 1  
ATOM 4887   N NH2 . ARG A 1 665 ? -71.635  10.638  10.716  1.00 99.99  ? 669 ARG C NH2 1  
ATOM 4888   N N   . CYS A 1 666 ? -67.810  13.921  14.906  1.00 30.00  ? 670 CYS C N   1  
ATOM 4889   C CA  . CYS A 1 666 ? -67.538  15.192  14.250  1.00 30.00  ? 670 CYS C CA  1  
ATOM 4890   C C   . CYS A 1 666 ? -66.949  14.948  12.873  1.00 30.00  ? 670 CYS C C   1  
ATOM 4891   O O   . CYS A 1 666 ? -66.256  13.959  12.665  1.00 30.00  ? 670 CYS C O   1  
ATOM 4892   C CB  . CYS A 1 666 ? -66.549  16.002  15.080  1.00 99.99  ? 670 CYS C CB  1  
ATOM 4893   S SG  . CYS A 1 666 ? -64.808  15.528  14.928  1.00 99.99  ? 670 CYS C SG  1  
ATOM 4894   N N   . ILE A 1 667 ? -67.206  15.873  11.952  1.00 30.00  ? 671 ILE C N   1  
ATOM 4895   C CA  . ILE A 1 667 ? -66.747  15.722  10.592  1.00 30.00  ? 671 ILE C CA  1  
ATOM 4896   C C   . ILE A 1 667 ? -66.354  17.028  9.953   1.00 30.00  ? 671 ILE C C   1  
ATOM 4897   O O   . ILE A 1 667 ? -67.173  17.953  9.840   1.00 30.00  ? 671 ILE C O   1  
ATOM 4898   C CB  . ILE A 1 667 ? -67.850  15.108  9.735   1.00 99.99  ? 671 ILE C CB  1  
ATOM 4899   C CG1 . ILE A 1 667 ? -68.766  16.212  9.216   1.00 99.99  ? 671 ILE C CG1 1  
ATOM 4900   C CG2 . ILE A 1 667 ? -68.661  14.130  10.580  1.00 99.99  ? 671 ILE C CG2 1  
ATOM 4901   C CD1 . ILE A 1 667 ? -68.305  16.642  7.828   1.00 99.99  ? 671 ILE C CD1 1  
ATOM 4902   N N   . ILE A 1 668 ? -65.103  17.098  9.511   1.00 30.00  ? 672 ILE C N   1  
ATOM 4903   C CA  . ILE A 1 668 ? -64.607  18.299  8.870   1.00 30.00  ? 672 ILE C CA  1  
ATOM 4904   C C   . ILE A 1 668 ? -65.040  18.281  7.402   1.00 30.00  ? 672 ILE C C   1  
ATOM 4905   O O   . ILE A 1 668 ? -64.651  17.413  6.631   1.00 30.00  ? 672 ILE C O   1  
ATOM 4906   C CB  . ILE A 1 668 ? -63.084  18.342  8.959   1.00 99.99  ? 672 ILE C CB  1  
ATOM 4907   C CG1 . ILE A 1 668 ? -62.484  17.478  7.857   1.00 99.99  ? 672 ILE C CG1 1  
ATOM 4908   C CG2 . ILE A 1 668 ? -62.641  17.814  10.319  1.00 99.99  ? 672 ILE C CG2 1  
ATOM 4909   C CD1 . ILE A 1 668 ? -62.236  16.072  8.393   1.00 99.99  ? 672 ILE C CD1 1  
ATOM 4910   N N   . PRO A 1 669 ? -65.877  19.244  7.003   1.00 30.00  ? 673 PRO C N   1  
ATOM 4911   C CA  . PRO A 1 669 ? -66.400  19.391  5.637   1.00 30.00  ? 673 PRO C CA  1  
ATOM 4912   C C   . PRO A 1 669 ? -65.377  19.653  4.535   1.00 30.00  ? 673 PRO C C   1  
ATOM 4913   O O   . PRO A 1 669 ? -65.589  19.263  3.390   1.00 30.00  ? 673 PRO C O   1  
ATOM 4914   C CB  . PRO A 1 669 ? -67.253  20.594  5.867   1.00 99.99  ? 673 PRO C CB  1  
ATOM 4915   C CG  . PRO A 1 669 ? -66.652  21.309  7.052   1.00 99.99  ? 673 PRO C CG  1  
ATOM 4916   C CD  . PRO A 1 669 ? -66.066  20.533  7.877   1.00 99.99  ? 673 PRO C CD  1  
ATOM 4917   N N   . ASN A 1 670 ? -64.283  20.321  4.863   1.00 30.00  ? 674 ASN C N   1  
ATOM 4918   C CA  . ASN A 1 670 ? -63.258  20.611  3.873   1.00 30.00  ? 674 ASN C CA  1  
ATOM 4919   C C   . ASN A 1 670 ? -61.947  21.050  4.499   1.00 30.00  ? 674 ASN C C   1  
ATOM 4920   O O   . ASN A 1 670 ? -61.858  21.236  5.701   1.00 30.00  ? 674 ASN C O   1  
ATOM 4921   C CB  . ASN A 1 670 ? -63.731  21.734  2.954   1.00 99.99  ? 674 ASN C CB  1  
ATOM 4922   C CG  . ASN A 1 670 ? -64.039  22.999  3.742   1.00 99.99  ? 674 ASN C CG  1  
ATOM 4923   O OD1 . ASN A 1 670 ? -63.284  23.965  3.686   1.00 99.99  ? 674 ASN C OD1 1  
ATOM 4924   N ND2 . ASN A 1 670 ? -65.148  22.985  4.482   1.00 99.99  ? 674 ASN C ND2 1  
ATOM 4925   N N   . GLU A 1 671 ? -60.931  21.206  3.659   1.00 30.00  ? 675 GLU C N   1  
ATOM 4926   C CA  . GLU A 1 671 ? -59.588  21.608  4.084   1.00 30.00  ? 675 GLU C CA  1  
ATOM 4927   C C   . GLU A 1 671 ? -59.392  23.117  3.986   1.00 30.00  ? 675 GLU C C   1  
ATOM 4928   O O   . GLU A 1 671 ? -58.290  23.622  4.192   1.00 30.00  ? 675 GLU C O   1  
ATOM 4929   C CB  . GLU A 1 671 ? -58.545  20.936  3.201   1.00 99.99  ? 675 GLU C CB  1  
ATOM 4930   C CG  . GLU A 1 671 ? -57.572  21.971  2.689   1.00 99.99  ? 675 GLU C CG  1  
ATOM 4931   C CD  . GLU A 1 671 ? -58.267  22.853  1.656   1.00 99.99  ? 675 GLU C CD  1  
ATOM 4932   O OE1 . GLU A 1 671 ? -58.850  23.886  2.076   1.00 99.99  ? 675 GLU C OE1 1  
ATOM 4933   O OE2 . GLU A 1 671 ? -58.208  22.484  0.451   1.00 99.99  ? 675 GLU C OE2 1  
ATOM 4934   N N   . LEU A 1 672 ? -60.459  23.839  3.672   1.00 30.00  ? 676 LEU C N   1  
ATOM 4935   C CA  . LEU A 1 672 ? -60.366  25.279  3.529   1.00 30.00  ? 676 LEU C CA  1  
ATOM 4936   C C   . LEU A 1 672 ? -60.893  26.127  4.672   1.00 30.00  ? 676 LEU C C   1  
ATOM 4937   O O   . LEU A 1 672 ? -60.828  27.338  4.599   1.00 30.00  ? 676 LEU C O   1  
ATOM 4938   C CB  . LEU A 1 672 ? -61.149  25.729  2.302   1.00 99.99  ? 676 LEU C CB  1  
ATOM 4939   C CG  . LEU A 1 672 ? -60.208  25.835  1.108   1.00 99.99  ? 676 LEU C CG  1  
ATOM 4940   C CD1 . LEU A 1 672 ? -60.898  26.590  -0.022  1.00 99.99  ? 676 LEU C CD1 1  
ATOM 4941   C CD2 . LEU A 1 672 ? -58.943  26.581  1.520   1.00 99.99  ? 676 LEU C CD2 1  
ATOM 4942   N N   . LYS A 1 673 ? -61.420  25.507  5.714   1.00 30.00  ? 677 LYS C N   1  
ATOM 4943   C CA  . LYS A 1 673 ? -61.940  26.270  6.839   1.00 30.00  ? 677 LYS C CA  1  
ATOM 4944   C C   . LYS A 1 673 ? -63.089  27.183  6.463   1.00 30.00  ? 677 LYS C C   1  
ATOM 4945   O O   . LYS A 1 673 ? -63.497  27.986  7.295   1.00 30.00  ? 677 LYS C O   1  
ATOM 4946   C CB  . LYS A 1 673 ? -60.836  27.142  7.429   1.00 99.99  ? 677 LYS C CB  1  
ATOM 4947   C CG  . LYS A 1 673 ? -61.348  27.823  8.695   1.00 99.99  ? 677 LYS C CG  1  
ATOM 4948   C CD  . LYS A 1 673 ? -60.229  28.658  9.311   1.00 99.99  ? 677 LYS C CD  1  
ATOM 4949   C CE  . LYS A 1 673 ? -60.808  29.565  10.392  1.00 99.99  ? 677 LYS C CE  1  
ATOM 4950   N NZ  . LYS A 1 673 ? -59.732  30.369  10.984  1.00 99.99  ? 677 LYS C NZ  1  
ATOM 4951   N N   . GLN A 1 674 ? -63.613  27.094  5.239   1.00 30.00  ? 678 GLN C N   1  
ATOM 4952   C CA  . GLN A 1 674 ? -64.744  27.959  4.878   1.00 30.00  ? 678 GLN C CA  1  
ATOM 4953   C C   . GLN A 1 674 ? -66.044  27.199  5.111   1.00 30.00  ? 678 GLN C C   1  
ATOM 4954   O O   . GLN A 1 674 ? -66.115  25.988  4.896   1.00 30.00  ? 678 GLN C O   1  
ATOM 4955   C CB  . GLN A 1 674 ? -64.643  28.359  3.410   1.00 99.99  ? 678 GLN C CB  1  
ATOM 4956   C CG  . GLN A 1 674 ? -63.402  29.220  3.201   1.00 99.99  ? 678 GLN C CG  1  
ATOM 4957   C CD  . GLN A 1 674 ? -63.588  30.605  3.805   1.00 99.99  ? 678 GLN C CD  1  
ATOM 4958   O OE1 . GLN A 1 674 ? -64.635  30.905  4.369   1.00 99.99  ? 678 GLN C OE1 1  
ATOM 4959   N NE2 . GLN A 1 674 ? -62.562  31.451  3.683   1.00 99.99  ? 678 GLN C NE2 1  
ATOM 4960   N N   . PRO A 1 675 ? -67.104  27.902  5.555   1.00 30.00  ? 679 PRO C N   1  
ATOM 4961   C CA  . PRO A 1 675 ? -68.431  27.328  5.842   1.00 30.00  ? 679 PRO C CA  1  
ATOM 4962   C C   . PRO A 1 675 ? -69.311  26.894  4.659   1.00 30.00  ? 679 PRO C C   1  
ATOM 4963   O O   . PRO A 1 675 ? -69.173  27.389  3.536   1.00 30.00  ? 679 PRO C O   1  
ATOM 4964   C CB  . PRO A 1 675 ? -69.032  28.506  6.523   1.00 99.99  ? 679 PRO C CB  1  
ATOM 4965   C CG  . PRO A 1 675 ? -68.284  29.714  6.006   1.00 99.99  ? 679 PRO C CG  1  
ATOM 4966   C CD  . PRO A 1 675 ? -67.077  29.466  5.677   1.00 99.99  ? 679 PRO C CD  1  
ATOM 4967   N N   . GLY A 1 676 ? -70.215  25.954  4.937   1.00 30.00  ? 680 GLY C N   1  
ATOM 4968   C CA  . GLY A 1 676 ? -71.133  25.444  3.933   1.00 30.00  ? 680 GLY C CA  1  
ATOM 4969   C C   . GLY A 1 676 ? -70.591  24.813  2.661   1.00 30.00  ? 680 GLY C C   1  
ATOM 4970   O O   . GLY A 1 676 ? -71.367  24.484  1.767   1.00 30.00  ? 680 GLY C O   1  
ATOM 4971   N N   . LEU A 1 677 ? -69.275  24.647  2.574   1.00 30.00  ? 681 LEU C N   1  
ATOM 4972   C CA  . LEU A 1 677 ? -68.642  24.050  1.403   1.00 30.00  ? 681 LEU C CA  1  
ATOM 4973   C C   . LEU A 1 677 ? -68.253  22.601  1.717   1.00 30.00  ? 681 LEU C C   1  
ATOM 4974   O O   . LEU A 1 677 ? -67.669  22.316  2.763   1.00 30.00  ? 681 LEU C O   1  
ATOM 4975   C CB  . LEU A 1 677 ? -67.394  24.839  1.026   1.00 99.99  ? 681 LEU C CB  1  
ATOM 4976   C CG  . LEU A 1 677 ? -67.747  25.873  -0.038  1.00 99.99  ? 681 LEU C CG  1  
ATOM 4977   C CD1 . LEU A 1 677 ? -66.464  26.429  -0.648  1.00 99.99  ? 681 LEU C CD1 1  
ATOM 4978   C CD2 . LEU A 1 677 ? -68.583  25.213  -1.129  1.00 99.99  ? 681 LEU C CD2 1  
ATOM 4979   N N   . VAL A 1 678 ? -68.567  21.685  0.806   1.00 30.00  ? 682 VAL C N   1  
ATOM 4980   C CA  . VAL A 1 678 ? -68.242  20.285  1.040   1.00 30.00  ? 682 VAL C CA  1  
ATOM 4981   C C   . VAL A 1 678 ? -67.197  19.718  0.094   1.00 30.00  ? 682 VAL C C   1  
ATOM 4982   O O   . VAL A 1 678 ? -67.115  20.103  -1.066  1.00 30.00  ? 682 VAL C O   1  
ATOM 4983   C CB  . VAL A 1 678 ? -69.494  19.430  0.878   1.00 99.99  ? 682 VAL C CB  1  
ATOM 4984   C CG1 . VAL A 1 678 ? -70.550  19.876  1.885   1.00 99.99  ? 682 VAL C CG1 1  
ATOM 4985   C CG2 . VAL A 1 678 ? -70.042  19.588  -0.536  1.00 99.99  ? 682 VAL C CG2 1  
ATOM 4986   N N   . ASP A 1 679 ? -66.393  18.803  0.622   1.00 30.00  ? 683 ASP C N   1  
ATOM 4987   C CA  . ASP A 1 679 ? -65.340  18.108  -0.116  1.00 30.00  ? 683 ASP C CA  1  
ATOM 4988   C C   . ASP A 1 679 ? -65.713  16.641  0.118   1.00 30.00  ? 683 ASP C C   1  
ATOM 4989   O O   . ASP A 1 679 ? -65.294  15.993  1.102   1.00 30.00  ? 683 ASP C O   1  
ATOM 4990   C CB  . ASP A 1 679 ? -63.976  18.476  0.457   1.00 99.99  ? 683 ASP C CB  1  
ATOM 4991   C CG  . ASP A 1 679 ? -62.878  17.952  -0.465  1.00 99.99  ? 683 ASP C CG  1  
ATOM 4992   O OD1 . ASP A 1 679 ? -62.578  16.731  -0.370  1.00 99.99  ? 683 ASP C OD1 1  
ATOM 4993   O OD2 . ASP A 1 679 ? -62.348  18.776  -1.259  1.00 99.99  ? 683 ASP C OD2 1  
ATOM 4994   N N   . ALA A 1 680 ? -66.525  16.141  -0.816  1.00 30.00  ? 684 ALA C N   1  
ATOM 4995   C CA  . ALA A 1 680 ? -67.035  14.779  -0.806  1.00 30.00  ? 684 ALA C CA  1  
ATOM 4996   C C   . ALA A 1 680 ? -66.013  13.695  -0.524  1.00 30.00  ? 684 ALA C C   1  
ATOM 4997   O O   . ALA A 1 680 ? -66.265  12.772  0.261   1.00 30.00  ? 684 ALA C O   1  
ATOM 4998   C CB  . ALA A 1 680 ? -67.705  14.511  -2.124  1.00 30.00  ? 684 ALA C CB  1  
ATOM 4999   N N   . GLU A 1 681 ? -64.859  13.809  -1.166  1.00 30.00  ? 685 GLU C N   1  
ATOM 5000   C CA  . GLU A 1 681 ? -63.798  12.828  -1.001  1.00 30.00  ? 685 GLU C CA  1  
ATOM 5001   C C   . GLU A 1 681 ? -63.420  12.698  0.456   1.00 30.00  ? 685 GLU C C   1  
ATOM 5002   O O   . GLU A 1 681 ? -63.381  11.582  1.013   1.00 30.00  ? 685 GLU C O   1  
ATOM 5003   C CB  . GLU A 1 681 ? -62.567  13.257  -1.794  1.00 99.99  ? 685 GLU C CB  1  
ATOM 5004   C CG  . GLU A 1 681 ? -62.889  13.253  -3.268  1.00 99.99  ? 685 GLU C CG  1  
ATOM 5005   C CD  . GLU A 1 681 ? -63.012  11.813  -3.760  1.00 99.99  ? 685 GLU C CD  1  
ATOM 5006   O OE1 . GLU A 1 681 ? -64.151  11.279  -3.705  1.00 99.99  ? 685 GLU C OE1 1  
ATOM 5007   O OE2 . GLU A 1 681 ? -61.963  11.257  -4.185  1.00 99.99  ? 685 GLU C OE2 1  
ATOM 5008   N N   . LEU A 1 682 ? -63.145  13.854  1.061   1.00 30.00  ? 686 LEU C N   1  
ATOM 5009   C CA  . LEU A 1 682 ? -62.758  13.957  2.460   1.00 30.00  ? 686 LEU C CA  1  
ATOM 5010   C C   . LEU A 1 682 ? -63.881  13.440  3.323   1.00 30.00  ? 686 LEU C C   1  
ATOM 5011   O O   . LEU A 1 682 ? -63.667  12.582  4.199   1.00 30.00  ? 686 LEU C O   1  
ATOM 5012   C CB  . LEU A 1 682 ? -62.471  15.412  2.814   1.00 99.99  ? 686 LEU C CB  1  
ATOM 5013   C CG  . LEU A 1 682 ? -60.979  15.689  2.674   1.00 99.99  ? 686 LEU C CG  1  
ATOM 5014   C CD1 . LEU A 1 682 ? -60.643  17.023  3.332   1.00 99.99  ? 686 LEU C CD1 1  
ATOM 5015   C CD2 . LEU A 1 682 ? -60.189  14.572  3.349   1.00 99.99  ? 686 LEU C CD2 1  
ATOM 5016   N N   . VAL A 1 683 ? -65.081  13.952  3.065   1.00 30.00  ? 687 VAL C N   1  
ATOM 5017   C CA  . VAL A 1 683 ? -66.243  13.525  3.832   1.00 30.00  ? 687 VAL C CA  1  
ATOM 5018   C C   . VAL A 1 683 ? -66.371  12.005  3.804   1.00 30.00  ? 687 VAL C C   1  
ATOM 5019   O O   . VAL A 1 683 ? -66.333  11.330  4.860   1.00 30.00  ? 687 VAL C O   1  
ATOM 5020   C CB  . VAL A 1 683 ? -67.509  14.137  3.242   1.00 99.99  ? 687 VAL C CB  1  
ATOM 5021   C CG1 . VAL A 1 683 ? -67.407  15.658  3.289   1.00 99.99  ? 687 VAL C CG1 1  
ATOM 5022   C CG2 . VAL A 1 683 ? -67.668  13.682  1.797   1.00 99.99  ? 687 VAL C CG2 1  
ATOM 5023   N N   . LEU A 1 684 ? -66.531  11.493  2.571   1.00 30.00  ? 688 LEU C N   1  
ATOM 5024   C CA  . LEU A 1 684 ? -66.675  10.067  2.292   1.00 30.00  ? 688 LEU C CA  1  
ATOM 5025   C C   . LEU A 1 684 ? -65.596  9.355   3.053   1.00 30.00  ? 688 LEU C C   1  
ATOM 5026   O O   . LEU A 1 684 ? -65.856  8.388   3.758   1.00 30.00  ? 688 LEU C O   1  
ATOM 5027   C CB  . LEU A 1 684 ? -66.530  9.813   0.796   1.00 99.99  ? 688 LEU C CB  1  
ATOM 5028   C CG  . LEU A 1 684 ? -66.561  8.311   0.529   1.00 99.99  ? 688 LEU C CG  1  
ATOM 5029   C CD1 . LEU A 1 684 ? -66.344  8.056   -0.959  1.00 99.99  ? 688 LEU C CD1 1  
ATOM 5030   C CD2 . LEU A 1 684 ? -65.459  7.630   1.330   1.00 99.99  ? 688 LEU C CD2 1  
ATOM 5031   N N   . HIS A 1 685 ? -64.380  9.858   2.903   1.00 30.00  ? 689 HIS C N   1  
ATOM 5032   C CA  . HIS A 1 685 ? -63.222  9.291   3.575   1.00 30.00  ? 689 HIS C CA  1  
ATOM 5033   C C   . HIS A 1 685 ? -63.437  9.136   5.089   1.00 30.00  ? 689 HIS C C   1  
ATOM 5034   O O   . HIS A 1 685 ? -62.959  8.176   5.702   1.00 30.00  ? 689 HIS C O   1  
ATOM 5035   C CB  . HIS A 1 685 ? -62.009  10.190  3.366   1.00 99.99  ? 689 HIS C CB  1  
ATOM 5036   C CG  . HIS A 1 685 ? -60.805  9.842   4.205   1.00 99.99  ? 689 HIS C CG  1  
ATOM 5037   N ND1 . HIS A 1 685 ? -59.549  9.637   3.642   1.00 99.99  ? 689 HIS C ND1 1  
ATOM 5038   C CD2 . HIS A 1 685 ? -60.660  9.665   5.547   1.00 99.99  ? 689 HIS C CD2 1  
ATOM 5039   C CE1 . HIS A 1 685 ? -58.707  9.351   4.617   1.00 99.99  ? 689 HIS C CE1 1  
ATOM 5040   N NE2 . HIS A 1 685 ? -59.351  9.362   5.757   1.00 99.99  ? 689 HIS C NE2 1  
ATOM 5041   N N   . GLN A 1 686 ? -64.154  10.071  5.706   1.00 30.00  ? 690 GLN C N   1  
ATOM 5042   C CA  . GLN A 1 686 ? -64.363  9.961   7.141   1.00 30.00  ? 690 GLN C CA  1  
ATOM 5043   C C   . GLN A 1 686 ? -65.436  8.958   7.406   1.00 30.00  ? 690 GLN C C   1  
ATOM 5044   O O   . GLN A 1 686 ? -65.307  8.119   8.304   1.00 30.00  ? 690 GLN C O   1  
ATOM 5045   C CB  . GLN A 1 686 ? -64.778  11.312  7.709   1.00 99.99  ? 690 GLN C CB  1  
ATOM 5046   C CG  . GLN A 1 686 ? -64.425  11.375  9.192   1.00 99.99  ? 690 GLN C CG  1  
ATOM 5047   C CD  . GLN A 1 686 ? -65.522  10.753  10.043  1.00 99.99  ? 690 GLN C CD  1  
ATOM 5048   O OE1 . GLN A 1 686 ? -66.533  10.288  9.517   1.00 99.99  ? 690 GLN C OE1 1  
ATOM 5049   N NE2 . GLN A 1 686 ? -65.326  10.748  11.364  1.00 99.99  ? 690 GLN C NE2 1  
ATOM 5050   N N   . LEU A 1 687 ? -66.500  9.038   6.619   1.00 30.00  ? 691 LEU C N   1  
ATOM 5051   C CA  . LEU A 1 687 ? -67.608  8.108   6.765   1.00 30.00  ? 691 LEU C CA  1  
ATOM 5052   C C   . LEU A 1 687 ? -67.058  6.689   6.707   1.00 30.00  ? 691 LEU C C   1  
ATOM 5053   O O   . LEU A 1 687 ? -67.475  5.825   7.484   1.00 30.00  ? 691 LEU C O   1  
ATOM 5054   C CB  . LEU A 1 687 ? -68.614  8.321   5.641   1.00 99.99  ? 691 LEU C CB  1  
ATOM 5055   C CG  . LEU A 1 687 ? -69.714  9.266   6.113   1.00 99.99  ? 691 LEU C CG  1  
ATOM 5056   C CD1 . LEU A 1 687 ? -70.879  9.220   5.129   1.00 99.99  ? 691 LEU C CD1 1  
ATOM 5057   C CD2 . LEU A 1 687 ? -70.196  8.834   7.494   1.00 99.99  ? 691 LEU C CD2 1  
ATOM 5058   N N   . GLN A 1 688 ? -65.523  6.504   6.477   1.00 30.00  ? 692 GLN C N   1  
ATOM 5059   C CA  . GLN A 1 688 ? -64.899  5.206   6.251   1.00 30.00  ? 692 GLN C CA  1  
ATOM 5060   C C   . GLN A 1 688 ? -64.058  4.756   7.452   1.00 30.00  ? 692 GLN C C   1  
ATOM 5061   O O   . GLN A 1 688 ? -64.287  3.691   8.021   1.00 30.00  ? 692 GLN C O   1  
ATOM 5062   C CB  . GLN A 1 688 ? -63.985  5.274   5.034   1.00 99.99  ? 692 GLN C CB  1  
ATOM 5063   C CG  . GLN A 1 688 ? -63.813  3.879   4.444   1.00 99.99  ? 692 GLN C CG  1  
ATOM 5064   C CD  . GLN A 1 688 ? -62.700  3.119   5.154   1.00 99.99  ? 692 GLN C CD  1  
ATOM 5065   O OE1 . GLN A 1 688 ? -62.075  3.643   6.073   1.00 99.99  ? 692 GLN C OE1 1  
ATOM 5066   N NE2 . GLN A 1 688 ? -62.457  1.878   4.723   1.00 99.99  ? 692 GLN C NE2 1  
ATOM 5067   N N   . CYS A 1 689 ? -63.089  5.579   7.836   1.00 30.00  ? 693 CYS C N   1  
ATOM 5068   C CA  . CYS A 1 689 ? -62.199  5.268   8.953   1.00 30.00  ? 693 CYS C CA  1  
ATOM 5069   C C   . CYS A 1 689 ? -62.864  5.358   10.328  1.00 30.00  ? 693 CYS C C   1  
ATOM 5070   O O   . CYS A 1 689 ? -62.274  4.947   11.335  1.00 30.00  ? 693 CYS C O   1  
ATOM 5071   C CB  . CYS A 1 689 ? -61.024  6.241   8.965   1.00 99.99  ? 693 CYS C CB  1  
ATOM 5072   S SG  . CYS A 1 689 ? -59.779  5.999   7.673   1.00 99.99  ? 693 CYS C SG  1  
ATOM 5073   N N   . ASN A 1 690 ? -64.092  5.883   10.368  1.00 30.00  ? 694 ASN C N   1  
ATOM 5074   C CA  . ASN A 1 690 ? -64.843  6.055   11.615  1.00 30.00  ? 694 ASN C CA  1  
ATOM 5075   C C   . ASN A 1 690 ? -65.805  4.912   11.894  1.00 30.00  ? 694 ASN C C   1  
ATOM 5076   O O   . ASN A 1 690 ? -66.292  4.748   13.010  1.00 30.00  ? 694 ASN C O   1  
ATOM 5077   C CB  . ASN A 1 690 ? -65.660  7.340   11.554  1.00 99.99  ? 694 ASN C CB  1  
ATOM 5078   C CG  . ASN A 1 690 ? -66.684  7.287   10.428  1.00 99.99  ? 694 ASN C CG  1  
ATOM 5079   O OD1 . ASN A 1 690 ? -67.589  8.117   10.369  1.00 99.99  ? 694 ASN C OD1 1  
ATOM 5080   N ND2 . ASN A 1 690 ? -66.540  6.305   9.536   1.00 99.99  ? 694 ASN C ND2 1  
ATOM 5081   N N   . GLY A 1 691 ? -66.069  4.120   10.859  1.00 30.00  ? 695 GLY C N   1  
ATOM 5082   C CA  . GLY A 1 691 ? -66.950  2.976   10.997  1.00 30.00  ? 695 GLY C CA  1  
ATOM 5083   C C   . GLY A 1 691 ? -68.433  3.281   11.011  1.00 30.00  ? 695 GLY C C   1  
ATOM 5084   O O   . GLY A 1 691 ? -69.219  2.525   11.576  1.00 30.00  ? 695 GLY C O   1  
ATOM 5085   N N   . VAL A 1 692 ? -68.828  4.373   10.363  1.00 30.00  ? 696 VAL C N   1  
ATOM 5086   C CA  . VAL A 1 692 ? -70.239  4.763   10.336  1.00 30.00  ? 696 VAL C CA  1  
ATOM 5087   C C   . VAL A 1 692 ? -71.142  3.689   9.789   1.00 30.00  ? 696 VAL C C   1  
ATOM 5088   O O   . VAL A 1 692 ? -71.967  3.155   10.510  1.00 30.00  ? 696 VAL C O   1  
ATOM 5089   C CB  . VAL A 1 692 ? -70.419  6.000   9.462   1.00 99.99  ? 696 VAL C CB  1  
ATOM 5090   C CG1 . VAL A 1 692 ? -69.590  7.149   10.028  1.00 99.99  ? 696 VAL C CG1 1  
ATOM 5091   C CG2 . VAL A 1 692 ? -69.956  5.690   8.043   1.00 99.99  ? 696 VAL C CG2 1  
ATOM 5092   N N   . LEU A 1 693 ? -70.990  3.359   8.520   1.00 30.00  ? 697 LEU C N   1  
ATOM 5093   C CA  . LEU A 1 693 ? -71.838  2.344   7.928   1.00 30.00  ? 697 LEU C CA  1  
ATOM 5094   C C   . LEU A 1 693 ? -72.034  1.122   8.816   1.00 30.00  ? 697 LEU C C   1  
ATOM 5095   O O   . LEU A 1 693 ? -73.164  0.797   9.177   1.00 30.00  ? 697 LEU C O   1  
ATOM 5096   C CB  . LEU A 1 693 ? -71.231  1.859   6.618   1.00 99.99  ? 697 LEU C CB  1  
ATOM 5097   C CG  . LEU A 1 693 ? -72.065  0.710   6.064   1.00 99.99  ? 697 LEU C CG  1  
ATOM 5098   C CD1 . LEU A 1 693 ? -71.412  0.176   4.792   1.00 99.99  ? 697 LEU C CD1 1  
ATOM 5099   C CD2 . LEU A 1 693 ? -72.147  -0.406  7.099   1.00 99.99  ? 697 LEU C CD2 1  
ATOM 5100   N N   . GLU A 1 694 ? -70.933  0.448   9.150   1.00 30.00  ? 698 GLU C N   1  
ATOM 5101   C CA  . GLU A 1 694 ? -70.975  -0.739  9.992   1.00 30.00  ? 698 GLU C CA  1  
ATOM 5102   C C   . GLU A 1 694 ? -71.699  -0.347  11.248  1.00 30.00  ? 698 GLU C C   1  
ATOM 5103   O O   . GLU A 1 694 ? -72.585  -1.052  11.710  1.00 30.00  ? 698 GLU C O   1  
ATOM 5104   C CB  . GLU A 1 694 ? -69.557  -1.202  10.306  1.00 99.99  ? 698 GLU C CB  1  
ATOM 5105   C CG  . GLU A 1 694 ? -68.873  -1.641  9.034   1.00 99.99  ? 698 GLU C CG  1  
ATOM 5106   C CD  . GLU A 1 694 ? -69.471  -2.966  8.567   1.00 99.99  ? 698 GLU C CD  1  
ATOM 5107   O OE1 . GLU A 1 694 ? -70.461  -2.913  7.791   1.00 99.99  ? 698 GLU C OE1 1  
ATOM 5108   O OE2 . GLU A 1 694 ? -68.930  -4.024  8.993   1.00 99.99  ? 698 GLU C OE2 1  
ATOM 5109   N N   . GLY A 1 695 ? -71.325  0.804   11.782  1.00 30.00  ? 699 GLY C N   1  
ATOM 5110   C CA  . GLY A 1 695 ? -71.963  1.292   12.985  1.00 30.00  ? 699 GLY C CA  1  
ATOM 5111   C C   . GLY A 1 695 ? -73.471  1.325   12.843  1.00 30.00  ? 699 GLY C C   1  
ATOM 5112   O O   . GLY A 1 695 ? -74.209  1.407   13.829  1.00 30.00  ? 699 GLY C O   1  
ATOM 5113   N N   . ILE A 1 696 ? -73.951  1.246   11.609  1.00 30.00  ? 700 ILE C N   1  
ATOM 5114   C CA  . ILE A 1 696 ? -75.384  1.278   11.375  1.00 30.00  ? 700 ILE C CA  1  
ATOM 5115   C C   . ILE A 1 696 ? -75.956  -0.108  11.047  1.00 30.00  ? 700 ILE C C   1  
ATOM 5116   O O   . ILE A 1 696 ? -77.102  -0.417  11.413  1.00 30.00  ? 700 ILE C O   1  
ATOM 5117   C CB  . ILE A 1 696 ? -75.696  2.201   10.200  1.00 99.99  ? 700 ILE C CB  1  
ATOM 5118   C CG1 . ILE A 1 696 ? -74.964  3.526   10.388  1.00 99.99  ? 700 ILE C CG1 1  
ATOM 5119   C CG2 . ILE A 1 696 ? -77.198  2.455   10.140  1.00 99.99  ? 700 ILE C CG2 1  
ATOM 5120   C CD1 . ILE A 1 696 ? -75.620  4.313   11.521  1.00 99.99  ? 700 ILE C CD1 1  
ATOM 5121   N N   . ARG A 1 697 ? -75.155  -0.942  10.377  1.00 30.00  ? 701 ARG C N   1  
ATOM 5122   C CA  . ARG A 1 697 ? -75.598  -2.279  9.998   1.00 30.00  ? 701 ARG C CA  1  
ATOM 5123   C C   . ARG A 1 697 ? -76.164  -3.041  11.195  1.00 30.00  ? 701 ARG C C   1  
ATOM 5124   O O   . ARG A 1 697 ? -77.288  -3.529  11.137  1.00 30.00  ? 701 ARG C O   1  
ATOM 5125   C CB  . ARG A 1 697 ? -74.426  -3.074  9.434   1.00 99.99  ? 701 ARG C CB  1  
ATOM 5126   C CG  . ARG A 1 697 ? -74.940  -4.097  8.428   1.00 99.99  ? 701 ARG C CG  1  
ATOM 5127   C CD  . ARG A 1 697 ? -73.768  -4.683  7.649   1.00 99.99  ? 701 ARG C CD  1  
ATOM 5128   N NE  . ARG A 1 697 ? -74.230  -5.353  6.415   1.00 99.99  ? 701 ARG C NE  1  
ATOM 5129   C CZ  . ARG A 1 697 ? -73.399  -5.811  5.483   1.00 99.99  ? 701 ARG C CZ  1  
ATOM 5130   N NH1 . ARG A 1 697 ? -72.077  -5.691  5.597   1.00 99.99  ? 701 ARG C NH1 1  
ATOM 5131   N NH2 . ARG A 1 697 ? -73.923  -6.400  4.412   1.00 99.99  ? 701 ARG C NH2 1  
ATOM 5132   N N   . ILE A 1 698 ? -75.389  -3.122  12.280  1.00 30.00  ? 702 ILE C N   1  
ATOM 5133   C CA  . ILE A 1 698 ? -75.829  -3.825  13.484  1.00 30.00  ? 702 ILE C CA  1  
ATOM 5134   C C   . ILE A 1 698 ? -77.110  -3.223  14.078  1.00 30.00  ? 702 ILE C C   1  
ATOM 5135   O O   . ILE A 1 698 ? -77.937  -3.959  14.638  1.00 30.00  ? 702 ILE C O   1  
ATOM 5136   C CB  . ILE A 1 698 ? -74.743  -3.753  14.552  1.00 99.99  ? 702 ILE C CB  1  
ATOM 5137   C CG1 . ILE A 1 698 ? -74.826  -2.414  15.274  1.00 99.99  ? 702 ILE C CG1 1  
ATOM 5138   C CG2 . ILE A 1 698 ? -73.373  -3.892  13.893  1.00 99.99  ? 702 ILE C CG2 1  
ATOM 5139   C CD1 . ILE A 1 698 ? -73.891  -1.413  14.601  1.00 99.99  ? 702 ILE C CD1 1  
ATOM 5140   N N   . CYS A 1 699 ? -77.297  -1.904  13.964  1.00 30.00  ? 703 CYS C N   1  
ATOM 5141   C CA  . CYS A 1 699 ? -78.524  -1.293  14.488  1.00 30.00  ? 703 CYS C CA  1  
ATOM 5142   C C   . CYS A 1 699 ? -79.717  -1.830  13.696  1.00 30.00  ? 703 CYS C C   1  
ATOM 5143   O O   . CYS A 1 699 ? -80.819  -1.961  14.217  1.00 30.00  ? 703 CYS C O   1  
ATOM 5144   C CB  . CYS A 1 699 ? -78.452  0.222   14.345  1.00 99.99  ? 703 CYS C CB  1  
ATOM 5145   S SG  . CYS A 1 699 ? -78.440  0.860   12.650  1.00 99.99  ? 703 CYS C SG  1  
ATOM 5146   N N   . ARG A 1 700 ? -79.477  -2.137  12.426  1.00 30.00  ? 704 ARG C N   1  
ATOM 5147   C CA  . ARG A 1 700 ? -80.511  -2.683  11.583  1.00 30.00  ? 704 ARG C CA  1  
ATOM 5148   C C   . ARG A 1 700 ? -80.440  -4.207  11.685  1.00 30.00  ? 704 ARG C C   1  
ATOM 5149   O O   . ARG A 1 700 ? -81.472  -4.872  11.847  1.00 30.00  ? 704 ARG C O   1  
ATOM 5150   C CB  . ARG A 1 700 ? -80.289  -2.241  10.140  1.00 99.99  ? 704 ARG C CB  1  
ATOM 5151   C CG  . ARG A 1 700 ? -81.465  -2.695  9.281   1.00 99.99  ? 704 ARG C CG  1  
ATOM 5152   C CD  . ARG A 1 700 ? -81.368  -2.051  7.904   1.00 99.99  ? 704 ARG C CD  1  
ATOM 5153   N NE  . ARG A 1 700 ? -80.099  -2.412  7.235   1.00 99.99  ? 704 ARG C NE  1  
ATOM 5154   C CZ  . ARG A 1 700 ? -79.455  -1.590  6.411   1.00 99.99  ? 704 ARG C CZ  1  
ATOM 5155   N NH1 . ARG A 1 700 ? -79.913  -0.372  6.129   1.00 99.99  ? 704 ARG C NH1 1  
ATOM 5156   N NH2 . ARG A 1 700 ? -78.319  -2.018  5.864   1.00 99.99  ? 704 ARG C NH2 1  
ATOM 5157   N N   . LYS A 1 701 ? -79.229  -4.750  11.619  1.00 30.00  ? 705 LYS C N   1  
ATOM 5158   C CA  . LYS A 1 701 ? -79.021  -6.181  11.700  1.00 30.00  ? 705 LYS C CA  1  
ATOM 5159   C C   . LYS A 1 701 ? -79.413  -6.811  13.034  1.00 30.00  ? 705 LYS C C   1  
ATOM 5160   O O   . LYS A 1 701 ? -80.310  -7.653  13.091  1.00 30.00  ? 705 LYS C O   1  
ATOM 5161   C CB  . LYS A 1 701 ? -77.546  -6.503  11.483  1.00 99.99  ? 705 LYS C CB  1  
ATOM 5162   C CG  . LYS A 1 701 ? -77.302  -6.798  10.010  1.00 99.99  ? 705 LYS C CG  1  
ATOM 5163   C CD  . LYS A 1 701 ? -77.293  -5.490  9.224   1.00 99.99  ? 705 LYS C CD  1  
ATOM 5164   C CE  . LYS A 1 701 ? -77.246  -5.796  7.730   1.00 99.99  ? 705 LYS C CE  1  
ATOM 5165   N NZ  . LYS A 1 701 ? -77.360  -4.541  6.971   1.00 99.99  ? 705 LYS C NZ  1  
ATOM 5166   N N   . GLY A 1 702 ? -79.169  -6.389  14.098  1.00 30.00  ? 706 GLY C N   1  
ATOM 5167   C CA  . GLY A 1 702 ? -78.987  -6.961  15.424  1.00 30.00  ? 706 GLY C CA  1  
ATOM 5168   C C   . GLY A 1 702 ? -80.236  -7.276  16.218  1.00 30.00  ? 706 GLY C C   1  
ATOM 5169   O O   . GLY A 1 702 ? -81.312  -7.349  15.662  1.00 30.00  ? 706 GLY C O   1  
ATOM 5170   N N   . PHE A 1 703 ? -80.082  -7.451  17.530  1.00 30.00  ? 707 PHE C N   1  
ATOM 5171   C CA  . PHE A 1 703 ? -81.189  -7.786  18.407  1.00 30.00  ? 707 PHE C CA  1  
ATOM 5172   C C   . PHE A 1 703 ? -81.333  -6.736  19.497  1.00 30.00  ? 707 PHE C C   1  
ATOM 5173   O O   . PHE A 1 703 ? -80.906  -6.962  20.616  1.00 30.00  ? 707 PHE C O   1  
ATOM 5174   C CB  . PHE A 1 703 ? -80.943  -9.143  19.056  1.00 99.99  ? 707 PHE C CB  1  
ATOM 5175   C CG  . PHE A 1 703 ? -80.910  -10.211 17.992  1.00 99.99  ? 707 PHE C CG  1  
ATOM 5176   C CD1 . PHE A 1 703 ? -79.703  -10.532 17.359  1.00 99.99  ? 707 PHE C CD1 1  
ATOM 5177   C CD2 . PHE A 1 703 ? -82.086  -10.883 17.636  1.00 99.99  ? 707 PHE C CD2 1  
ATOM 5178   C CE1 . PHE A 1 703 ? -79.671  -11.524 16.370  1.00 99.99  ? 707 PHE C CE1 1  
ATOM 5179   C CE2 . PHE A 1 703 ? -82.056  -11.875 16.647  1.00 99.99  ? 707 PHE C CE2 1  
ATOM 5180   C CZ  . PHE A 1 703 ? -80.849  -12.195 16.016  1.00 99.99  ? 707 PHE C CZ  1  
ATOM 5181   N N   . PRO A 1 704 ? -81.992  -5.599  19.205  1.00 30.00  ? 708 PRO C N   1  
ATOM 5182   C CA  . PRO A 1 704 ? -82.195  -4.477  20.132  1.00 30.00  ? 708 PRO C CA  1  
ATOM 5183   C C   . PRO A 1 704 ? -82.987  -4.711  21.388  1.00 30.00  ? 708 PRO C C   1  
ATOM 5184   O O   . PRO A 1 704 ? -83.206  -3.778  22.163  1.00 30.00  ? 708 PRO C O   1  
ATOM 5185   C CB  . PRO A 1 704 ? -82.945  -3.574  19.216  1.00 99.99  ? 708 PRO C CB  1  
ATOM 5186   C CG  . PRO A 1 704 ? -83.010  -4.288  17.887  1.00 99.99  ? 708 PRO C CG  1  
ATOM 5187   C CD  . PRO A 1 704 ? -82.420  -5.420  17.883  1.00 99.99  ? 708 PRO C CD  1  
ATOM 5188   N N   . SER A 1 705 ? -83.418  -5.949  21.591  1.00 30.00  ? 709 SER C N   1  
ATOM 5189   C CA  . SER A 1 705 ? -84.177  -6.297  22.785  1.00 30.00  ? 709 SER C CA  1  
ATOM 5190   C C   . SER A 1 705 ? -83.508  -7.453  23.471  1.00 30.00  ? 709 SER C C   1  
ATOM 5191   O O   . SER A 1 705 ? -83.111  -8.421  22.823  1.00 30.00  ? 709 SER C O   1  
ATOM 5192   C CB  . SER A 1 705 ? -85.600  -6.687  22.398  1.00 99.99  ? 709 SER C CB  1  
ATOM 5193   O OG  . SER A 1 705 ? -86.225  -5.594  21.720  1.00 99.99  ? 709 SER C OG  1  
ATOM 5194   N N   . ARG A 1 706 ? -84.289  -6.263  24.783  1.00 30.00  ? 710 ARG C N   1  
ATOM 5195   C CA  . ARG A 1 706 ? -83.582  -6.855  25.915  1.00 30.00  ? 710 ARG C CA  1  
ATOM 5196   C C   . ARG A 1 706 ? -84.457  -6.842  27.143  1.00 30.00  ? 710 ARG C C   1  
ATOM 5197   O O   . ARG A 1 706 ? -85.049  -5.810  27.481  1.00 30.00  ? 710 ARG C O   1  
ATOM 5198   C CB  . ARG A 1 706 ? -82.313  -6.058  26.205  1.00 99.99  ? 710 ARG C CB  1  
ATOM 5199   C CG  . ARG A 1 706 ? -81.486  -5.932  24.930  1.00 99.99  ? 710 ARG C CG  1  
ATOM 5200   C CD  . ARG A 1 706 ? -80.186  -5.200  25.235  1.00 99.99  ? 710 ARG C CD  1  
ATOM 5201   N NE  . ARG A 1 706 ? -79.457  -4.866  23.990  1.00 99.99  ? 710 ARG C NE  1  
ATOM 5202   C CZ  . ARG A 1 706 ? -78.341  -4.145  23.975  1.00 99.99  ? 710 ARG C CZ  1  
ATOM 5203   N NH1 . ARG A 1 706 ? -77.796  -3.664  25.089  1.00 99.99  ? 710 ARG C NH1 1  
ATOM 5204   N NH2 . ARG A 1 706 ? -77.768  -3.906  22.798  1.00 99.99  ? 710 ARG C NH2 1  
ATOM 5205   N N   . LEU A 1 707 ? -84.528  -7.988  27.819  1.00 30.00  ? 711 LEU C N   1  
ATOM 5206   C CA  . LEU A 1 707 ? -85.357  -8.093  29.007  1.00 30.00  ? 711 LEU C CA  1  
ATOM 5207   C C   . LEU A 1 707 ? -84.795  -8.893  30.175  1.00 30.00  ? 711 LEU C C   1  
ATOM 5208   O O   . LEU A 1 707 ? -84.299  -10.012 29.996  1.00 30.00  ? 711 LEU C O   1  
ATOM 5209   C CB  . LEU A 1 707 ? -86.681  -8.767  28.656  1.00 99.99  ? 711 LEU C CB  1  
ATOM 5210   C CG  . LEU A 1 707 ? -87.732  -7.702  28.362  1.00 99.99  ? 711 LEU C CG  1  
ATOM 5211   C CD1 . LEU A 1 707 ? -89.115  -8.345  28.338  1.00 99.99  ? 711 LEU C CD1 1  
ATOM 5212   C CD2 . LEU A 1 707 ? -87.690  -6.630  29.445  1.00 99.99  ? 711 LEU C CD2 1  
ATOM 5213   N N   . ILE A 1 708 ? -84.881  -8.316  31.372  1.00 30.00  ? 712 ILE C N   1  
ATOM 5214   C CA  . ILE A 1 708 ? -84.399  -9.007  32.563  1.00 30.00  ? 712 ILE C CA  1  
ATOM 5215   C C   . ILE A 1 708 ? -85.436  -10.058 32.883  1.00 30.00  ? 712 ILE C C   1  
ATOM 5216   O O   . ILE A 1 708 ? -86.621  -9.744  33.060  1.00 30.00  ? 712 ILE C O   1  
ATOM 5217   C CB  . ILE A 1 708 ? -84.247  -8.018  33.713  1.00 99.99  ? 712 ILE C CB  1  
ATOM 5218   C CG1 . ILE A 1 708 ? -85.603  -7.788  34.369  1.00 99.99  ? 712 ILE C CG1 1  
ATOM 5219   C CG2 . ILE A 1 708 ? -83.710  -6.695  33.178  1.00 99.99  ? 712 ILE C CG2 1  
ATOM 5220   C CD1 . ILE A 1 708 ? -86.277  -6.577  33.733  1.00 99.99  ? 712 ILE C CD1 1  
ATOM 5221   N N   . TYR A 1 709 ? -84.995  -11.306 32.954  1.00 30.00  ? 713 TYR C N   1  
ATOM 5222   C CA  . TYR A 1 709 ? -85.874  -12.414 33.261  1.00 30.00  ? 713 TYR C CA  1  
ATOM 5223   C C   . TYR A 1 709 ? -86.892  -12.099 34.374  1.00 30.00  ? 713 TYR C C   1  
ATOM 5224   O O   . TYR A 1 709 ? -88.021  -12.583 34.333  1.00 30.00  ? 713 TYR C O   1  
ATOM 5225   C CB  . TYR A 1 709 ? -85.051  -13.613 33.726  1.00 99.99  ? 713 TYR C CB  1  
ATOM 5226   C CG  . TYR A 1 709 ? -84.157  -14.079 32.603  1.00 99.99  ? 713 TYR C CG  1  
ATOM 5227   C CD1 . TYR A 1 709 ? -82.879  -13.531 32.449  1.00 99.99  ? 713 TYR C CD1 1  
ATOM 5228   C CD2 . TYR A 1 709 ? -84.609  -15.062 31.713  1.00 99.99  ? 713 TYR C CD2 1  
ATOM 5229   C CE1 . TYR A 1 709 ? -82.051  -13.963 31.407  1.00 99.99  ? 713 TYR C CE1 1  
ATOM 5230   C CE2 . TYR A 1 709 ? -83.780  -15.494 30.670  1.00 99.99  ? 713 TYR C CE2 1  
ATOM 5231   C CZ  . TYR A 1 709 ? -82.502  -14.946 30.517  1.00 99.99  ? 713 TYR C CZ  1  
ATOM 5232   O OH  . TYR A 1 709 ? -81.698  -15.366 29.504  1.00 99.99  ? 713 TYR C OH  1  
ATOM 5233   N N   . SER A 1 710 ? -86.500  -11.288 35.353  1.00 30.00  ? 714 SER C N   1  
ATOM 5234   C CA  . SER A 1 710 ? -87.396  -10.920 36.450  1.00 30.00  ? 714 SER C CA  1  
ATOM 5235   C C   . SER A 1 710 ? -88.630  -10.179 35.944  1.00 30.00  ? 714 SER C C   1  
ATOM 5236   O O   . SER A 1 710 ? -89.751  -10.456 36.373  1.00 30.00  ? 714 SER C O   1  
ATOM 5237   C CB  . SER A 1 710 ? -86.666  -10.012 37.433  1.00 99.99  ? 714 SER C CB  1  
ATOM 5238   O OG  . SER A 1 710 ? -86.401  -8.753  36.813  1.00 99.99  ? 714 SER C OG  1  
ATOM 5239   N N   . GLU A 1 711 ? -88.426  -9.227  35.039  1.00 30.00  ? 715 GLU C N   1  
ATOM 5240   C CA  . GLU A 1 711 ? -89.534  -8.454  34.491  1.00 30.00  ? 715 GLU C CA  1  
ATOM 5241   C C   . GLU A 1 711 ? -90.200  -9.210  33.339  1.00 30.00  ? 715 GLU C C   1  
ATOM 5242   O O   . GLU A 1 711 ? -91.324  -8.901  32.965  1.00 30.00  ? 715 GLU C O   1  
ATOM 5243   C CB  . GLU A 1 711 ? -89.024  -7.114  33.968  1.00 99.99  ? 715 GLU C CB  1  
ATOM 5244   C CG  . GLU A 1 711 ? -88.457  -6.309  35.110  1.00 99.99  ? 715 GLU C CG  1  
ATOM 5245   C CD  . GLU A 1 711 ? -89.594  -5.830  36.008  1.00 99.99  ? 715 GLU C CD  1  
ATOM 5246   O OE1 . GLU A 1 711 ? -89.933  -6.581  36.960  1.00 99.99  ? 715 GLU C OE1 1  
ATOM 5247   O OE2 . GLU A 1 711 ? -90.113  -4.713  35.735  1.00 99.99  ? 715 GLU C OE2 1  
ATOM 5248   N N   . PHE A 1 712 ? -89.508  -10.201 32.783  1.00 30.00  ? 716 PHE C N   1  
ATOM 5249   C CA  . PHE A 1 712 ? -90.054  -10.988 31.679  1.00 30.00  ? 716 PHE C CA  1  
ATOM 5250   C C   . PHE A 1 712 ? -91.022  -12.040 32.181  1.00 30.00  ? 716 PHE C C   1  
ATOM 5251   O O   . PHE A 1 712 ? -92.085  -12.242 31.603  1.00 30.00  ? 716 PHE C O   1  
ATOM 5252   C CB  . PHE A 1 712 ? -88.923  -11.692 30.934  1.00 99.99  ? 716 PHE C CB  1  
ATOM 5253   C CG  . PHE A 1 712 ? -89.495  -12.499 29.796  1.00 99.99  ? 716 PHE C CG  1  
ATOM 5254   C CD1 . PHE A 1 712 ? -89.787  -11.880 28.576  1.00 99.99  ? 716 PHE C CD1 1  
ATOM 5255   C CD2 . PHE A 1 712 ? -89.735  -13.869 29.960  1.00 99.99  ? 716 PHE C CD2 1  
ATOM 5256   C CE1 . PHE A 1 712 ? -90.317  -12.629 27.519  1.00 99.99  ? 716 PHE C CE1 1  
ATOM 5257   C CE2 . PHE A 1 712 ? -90.266  -14.619 28.905  1.00 99.99  ? 716 PHE C CE2 1  
ATOM 5258   C CZ  . PHE A 1 712 ? -90.556  -13.997 27.683  1.00 99.99  ? 716 PHE C CZ  1  
ATOM 5259   N N   . LYS A 1 713 ? -90.629  -12.725 33.247  1.00 30.00  ? 717 LYS C N   1  
ATOM 5260   C CA  . LYS A 1 713 ? -91.479  -13.751 33.818  1.00 30.00  ? 717 LYS C CA  1  
ATOM 5261   C C   . LYS A 1 713 ? -92.786  -13.092 34.233  1.00 30.00  ? 717 LYS C C   1  
ATOM 5262   O O   . LYS A 1 713 ? -93.860  -13.601 33.922  1.00 30.00  ? 717 LYS C O   1  
ATOM 5263   C CB  . LYS A 1 713 ? -90.794  -14.376 35.029  1.00 99.99  ? 717 LYS C CB  1  
ATOM 5264   C CG  . LYS A 1 713 ? -91.647  -15.520 35.561  1.00 99.99  ? 717 LYS C CG  1  
ATOM 5265   C CD  . LYS A 1 713 ? -90.797  -16.416 36.457  1.00 99.99  ? 717 LYS C CD  1  
ATOM 5266   C CE  . LYS A 1 713 ? -91.707  -17.324 37.278  1.00 99.99  ? 717 LYS C CE  1  
ATOM 5267   N NZ  . LYS A 1 713 ? -91.873  -18.609 36.582  1.00 99.99  ? 717 LYS C NZ  1  
ATOM 5268   N N   . GLN A 1 714 ? -92.698  -11.953 34.919  1.00 30.00  ? 718 GLN C N   1  
ATOM 5269   C CA  . GLN A 1 714 ? -93.900  -11.261 35.366  1.00 30.00  ? 718 GLN C CA  1  
ATOM 5270   C C   . GLN A 1 714 ? -94.854  -10.835 34.271  1.00 30.00  ? 718 GLN C C   1  
ATOM 5271   O O   . GLN A 1 714 ? -96.068  -10.761 34.474  1.00 30.00  ? 718 GLN C O   1  
ATOM 5272   C CB  . GLN A 1 714 ? -93.516  -9.985  36.114  1.00 99.99  ? 718 GLN C CB  1  
ATOM 5273   C CG  . GLN A 1 714 ? -94.642  -9.592  37.062  1.00 99.99  ? 718 GLN C CG  1  
ATOM 5274   C CD  . GLN A 1 714 ? -95.702  -8.770  36.342  1.00 99.99  ? 718 GLN C CD  1  
ATOM 5275   O OE1 . GLN A 1 714 ? -95.582  -8.509  35.148  1.00 99.99  ? 718 GLN C OE1 1  
ATOM 5276   N NE2 . GLN A 1 714 ? -96.745  -8.365  37.073  1.00 99.99  ? 718 GLN C NE2 1  
ATOM 5277   N N   . ARG A 1 715 ? -94.321  -10.544 33.099  1.00 30.00  ? 719 ARG C N   1  
ATOM 5278   C CA  . ARG A 1 715 ? -95.173  -10.111 32.019  1.00 30.00  ? 719 ARG C CA  1  
ATOM 5279   C C   . ARG A 1 715 ? -95.564  -11.200 31.012  1.00 30.00  ? 719 ARG C C   1  
ATOM 5280   O O   . ARG A 1 715 ? -96.588  -11.072 30.349  1.00 30.00  ? 719 ARG C O   1  
ATOM 5281   C CB  . ARG A 1 715 ? -94.479  -9.019  31.214  1.00 99.99  ? 719 ARG C CB  1  
ATOM 5282   C CG  . ARG A 1 715 ? -94.198  -7.821  32.117  1.00 99.99  ? 719 ARG C CG  1  
ATOM 5283   C CD  . ARG A 1 715 ? -93.394  -6.780  31.346  1.00 99.99  ? 719 ARG C CD  1  
ATOM 5284   N NE  . ARG A 1 715 ? -91.982  -7.204  31.199  1.00 99.99  ? 719 ARG C NE  1  
ATOM 5285   C CZ  . ARG A 1 715 ? -91.090  -6.509  30.502  1.00 99.99  ? 719 ARG C CZ  1  
ATOM 5286   N NH1 . ARG A 1 715 ? -91.405  -5.376  29.880  1.00 99.99  ? 719 ARG C NH1 1  
ATOM 5287   N NH2 . ARG A 1 715 ? -89.846  -6.980  30.434  1.00 99.99  ? 719 ARG C NH2 1  
ATOM 5288   N N   . TYR A 1 716 ? -94.789  -12.270 30.895  1.00 30.00  ? 720 TYR C N   1  
ATOM 5289   C CA  . TYR A 1 716 ? -95.149  -13.300 29.927  1.00 30.00  ? 720 TYR C CA  1  
ATOM 5290   C C   . TYR A 1 716 ? -95.299  -14.725 30.446  1.00 30.00  ? 720 TYR C C   1  
ATOM 5291   O O   . TYR A 1 716 ? -95.032  -15.694 29.726  1.00 30.00  ? 720 TYR C O   1  
ATOM 5292   C CB  . TYR A 1 716 ? -94.087  -13.383 28.837  1.00 99.99  ? 720 TYR C CB  1  
ATOM 5293   C CG  . TYR A 1 716 ? -94.208  -12.185 27.924  1.00 99.99  ? 720 TYR C CG  1  
ATOM 5294   C CD1 . TYR A 1 716 ? -95.216  -12.147 26.954  1.00 99.99  ? 720 TYR C CD1 1  
ATOM 5295   C CD2 . TYR A 1 716 ? -93.312  -11.117 28.048  1.00 99.99  ? 720 TYR C CD2 1  
ATOM 5296   C CE1 . TYR A 1 716 ? -95.329  -11.035 26.108  1.00 99.99  ? 720 TYR C CE1 1  
ATOM 5297   C CE2 . TYR A 1 716 ? -93.426  -10.008 27.200  1.00 99.99  ? 720 TYR C CE2 1  
ATOM 5298   C CZ  . TYR A 1 716 ? -94.435  -9.969  26.232  1.00 99.99  ? 720 TYR C CZ  1  
ATOM 5299   O OH  . TYR A 1 716 ? -94.544  -8.890  25.406  1.00 99.99  ? 720 TYR C OH  1  
ATOM 5300   N N   . SER A 1 717 ? -95.738  -14.846 31.694  1.00 30.00  ? 721 SER C N   1  
ATOM 5301   C CA  . SER A 1 717 ? -95.942  -16.152 32.308  1.00 30.00  ? 721 SER C CA  1  
ATOM 5302   C C   . SER A 1 717 ? -97.288  -16.649 31.772  1.00 30.00  ? 721 SER C C   1  
ATOM 5303   O O   . SER A 1 717 ? -97.458  -17.817 31.406  1.00 30.00  ? 721 SER C O   1  
ATOM 5304   C CB  . SER A 1 717 ? -95.969  -16.012 33.826  1.00 99.99  ? 721 SER C CB  1  
ATOM 5305   O OG  . SER A 1 717 ? -94.650  -15.740 34.303  1.00 99.99  ? 721 SER C OG  1  
ATOM 5306   N N   . ILE A 1 718 ? -98.234  -15.719 31.725  1.00 30.00  ? 722 ILE C N   1  
ATOM 5307   C CA  . ILE A 1 718 ? -99.587  -15.947 31.248  1.00 30.00  ? 722 ILE C CA  1  
ATOM 5308   C C   . ILE A 1 718 ? -99.634  -16.395 29.784  1.00 30.00  ? 722 ILE C C   1  
ATOM 5309   O O   . ILE A 1 718 ? -100.607 -16.125 29.087  1.00 30.00  ? 722 ILE C O   1  
ATOM 5310   C CB  . ILE A 1 718 ? -100.397 -14.661 31.362  1.00 99.99  ? 722 ILE C CB  1  
ATOM 5311   C CG1 . ILE A 1 718 ? -100.101 -13.763 30.165  1.00 99.99  ? 722 ILE C CG1 1  
ATOM 5312   C CG2 . ILE A 1 718 ? -100.022 -13.932 32.649  1.00 99.99  ? 722 ILE C CG2 1  
ATOM 5313   C CD1 . ILE A 1 718 ? -98.974  -12.798 30.518  1.00 99.99  ? 722 ILE C CD1 1  
ATOM 5314   N N   . LEU A 1 719 ? -98.604  -17.081 29.308  1.00 30.00  ? 723 LEU C N   1  
ATOM 5315   C CA  . LEU A 1 719 ? -98.609  -17.516 27.914  1.00 30.00  ? 723 LEU C CA  1  
ATOM 5316   C C   . LEU A 1 719 ? -98.258  -18.979 27.798  1.00 30.00  ? 723 LEU C C   1  
ATOM 5317   O O   . LEU A 1 719 ? -98.141  -19.514 26.689  1.00 30.00  ? 723 LEU C O   1  
ATOM 5318   C CB  . LEU A 1 719 ? -97.588  -16.711 27.116  1.00 99.99  ? 723 LEU C CB  1  
ATOM 5319   C CG  . LEU A 1 719 ? -98.281  -15.524 26.454  1.00 99.99  ? 723 LEU C CG  1  
ATOM 5320   C CD1 . LEU A 1 719 ? -97.354  -14.917 25.404  1.00 99.99  ? 723 LEU C CD1 1  
ATOM 5321   C CD2 . LEU A 1 719 ? -99.569  -15.996 25.785  1.00 99.99  ? 723 LEU C CD2 1  
ATOM 5322   N N   . ALA A 1 720 ? -98.091  -19.617 28.954  1.00 30.00  ? 724 ALA C N   1  
ATOM 5323   C CA  . ALA A 1 720 ? -97.766  -21.042 29.074  1.00 30.00  ? 724 ALA C CA  1  
ATOM 5324   C C   . ALA A 1 720 ? -97.703  -21.360 30.574  1.00 30.00  ? 724 ALA C C   1  
ATOM 5325   O O   . ALA A 1 720 ? -96.693  -21.864 31.059  1.00 30.00  ? 724 ALA C O   1  
ATOM 5326   C CB  . ALA A 1 720 ? -96.412  -21.346 28.390  1.00 30.00  ? 724 ALA C CB  1  
ATOM 5327   N N   . PRO A 1 721 ? -98.796  -21.082 31.321  1.00 30.00  ? 725 PRO C N   1  
ATOM 5328   C CA  . PRO A 1 721 ? -98.841  -21.344 32.777  1.00 30.00  ? 725 PRO C CA  1  
ATOM 5329   C C   . PRO A 1 721 ? -98.959  -22.824 33.167  1.00 30.00  ? 725 PRO C C   1  
ATOM 5330   O O   . PRO A 1 721 ? -98.812  -23.192 34.338  1.00 30.00  ? 725 PRO C O   1  
ATOM 5331   C CB  . PRO A 1 721 ? -100.088 -20.595 33.088  1.00 99.99  ? 725 PRO C CB  1  
ATOM 5332   C CG  . PRO A 1 721 ? -100.542 -19.975 31.789  1.00 99.99  ? 725 PRO C CG  1  
ATOM 5333   C CD  . PRO A 1 721 ? -99.765  -20.221 30.807  1.00 99.99  ? 725 PRO C CD  1  
ATOM 5334   N N   . ASN A 1 722 ? -99.231  -23.656 32.169  1.00 30.00  ? 726 ASN C N   1  
ATOM 5335   C CA  . ASN A 1 722 ? -99.366  -25.083 32.372  1.00 30.00  ? 726 ASN C CA  1  
ATOM 5336   C C   . ASN A 1 722 ? -98.003  -25.660 32.009  1.00 30.00  ? 726 ASN C C   1  
ATOM 5337   O O   . ASN A 1 722 ? -97.886  -26.622 31.244  1.00 30.00  ? 726 ASN C O   1  
ATOM 5338   C CB  . ASN A 1 722 ? -100.465 -25.633 31.471  1.00 99.99  ? 726 ASN C CB  1  
ATOM 5339   C CG  . ASN A 1 722 ? -100.128 -25.428 30.002  1.00 99.99  ? 726 ASN C CG  1  
ATOM 5340   O OD1 . ASN A 1 722 ? -100.767 -26.009 29.128  1.00 99.99  ? 726 ASN C OD1 1  
ATOM 5341   N ND2 . ASN A 1 722 ? -99.117  -24.600 29.733  1.00 99.99  ? 726 ASN C ND2 1  
ATOM 5342   N N   . ALA A 1 723 ? -96.967  -25.036 32.571  1.00 30.00  ? 727 ALA C N   1  
ATOM 5343   C CA  . ALA A 1 723 ? -95.582  -25.436 32.347  1.00 30.00  ? 727 ALA C CA  1  
ATOM 5344   C C   . ALA A 1 723 ? -94.664  -24.685 33.315  1.00 30.00  ? 727 ALA C C   1  
ATOM 5345   O O   . ALA A 1 723 ? -93.439  -24.734 33.197  1.00 30.00  ? 727 ALA C O   1  
ATOM 5346   C CB  . ALA A 1 723 ? -95.183  -25.136 30.901  1.00 30.00  ? 727 ALA C CB  1  
ATOM 5347   N N   . ILE A 1 724 ? -95.273  -23.998 34.274  1.00 30.00  ? 728 ILE C N   1  
ATOM 5348   C CA  . ILE A 1 724 ? -94.531  -23.228 35.276  1.00 30.00  ? 728 ILE C CA  1  
ATOM 5349   C C   . ILE A 1 724 ? -94.743  -23.774 36.687  1.00 30.00  ? 728 ILE C C   1  
ATOM 5350   O O   . ILE A 1 724 ? -95.710  -23.402 37.358  1.00 30.00  ? 728 ILE C O   1  
ATOM 5351   C CB  . ILE A 1 724 ? -94.993  -21.775 35.255  1.00 99.99  ? 728 ILE C CB  1  
ATOM 5352   C CG1 . ILE A 1 724 ? -96.211  -21.614 36.158  1.00 99.99  ? 728 ILE C CG1 1  
ATOM 5353   C CG2 . ILE A 1 724 ? -95.360  -21.378 33.829  1.00 99.99  ? 728 ILE C CG2 1  
ATOM 5354   C CD1 . ILE A 1 724 ? -95.762  -21.168 37.545  1.00 99.99  ? 728 ILE C CD1 1  
ATOM 5355   N N   . PRO A 1 725 ? -93.841  -24.657 37.165  1.00 30.00  ? 729 PRO C N   1  
ATOM 5356   C CA  . PRO A 1 725 ? -93.972  -25.233 38.520  1.00 30.00  ? 729 PRO C CA  1  
ATOM 5357   C C   . PRO A 1 725 ? -93.982  -24.232 39.696  1.00 30.00  ? 729 PRO C C   1  
ATOM 5358   O O   . PRO A 1 725 ? -93.077  -24.298 40.554  1.00 30.00  ? 729 PRO C O   1  
ATOM 5359   C CB  . PRO A 1 725 ? -92.723  -26.044 38.524  1.00 99.99  ? 729 PRO C CB  1  
ATOM 5360   C CG  . PRO A 1 725 ? -92.097  -25.860 37.161  1.00 99.99  ? 729 PRO C CG  1  
ATOM 5361   C CD  . PRO A 1 725 ? -92.774  -25.107 36.385  1.00 99.99  ? 729 PRO C CD  1  
ATOM 5362   N N   . ASP A 1 730 ? -87.041  -19.812 39.816  1.00 30.00  ? 734 ASP C N   1  
ATOM 5363   C CA  . ASP A 1 730 ? -85.950  -19.062 39.126  1.00 30.00  ? 734 ASP C CA  1  
ATOM 5364   C C   . ASP A 1 730 ? -86.460  -18.367 37.864  1.00 30.00  ? 734 ASP C C   1  
ATOM 5365   O O   . ASP A 1 730 ? -86.979  -19.011 36.943  1.00 30.00  ? 734 ASP C O   1  
ATOM 5366   C CB  . ASP A 1 730 ? -84.833  -20.023 38.724  1.00 99.99  ? 734 ASP C CB  1  
ATOM 5367   C CG  . ASP A 1 730 ? -83.622  -19.229 38.247  1.00 99.99  ? 734 ASP C CG  1  
ATOM 5368   O OD1 . ASP A 1 730 ? -83.651  -18.786 37.068  1.00 99.99  ? 734 ASP C OD1 1  
ATOM 5369   O OD2 . ASP A 1 730 ? -82.676  -19.072 39.067  1.00 99.99  ? 734 ASP C OD2 1  
ATOM 5370   N N   . GLY A 1 731 ? -86.309  -17.047 37.832  1.00 30.00  ? 735 GLY C N   1  
ATOM 5371   C CA  . GLY A 1 731 ? -86.758  -16.282 36.686  1.00 30.00  ? 735 GLY C CA  1  
ATOM 5372   C C   . GLY A 1 731 ? -86.111  -16.639 35.359  1.00 30.00  ? 735 GLY C C   1  
ATOM 5373   O O   . GLY A 1 731 ? -86.749  -16.493 34.324  1.00 30.00  ? 735 GLY C O   1  
ATOM 5374   N N   . LYS A 1 732 ? -84.864  -17.114 35.368  1.00 30.00  ? 736 LYS C N   1  
ATOM 5375   C CA  . LYS A 1 732 ? -84.152  -17.470 34.129  1.00 30.00  ? 736 LYS C CA  1  
ATOM 5376   C C   . LYS A 1 732 ? -84.550  -18.803 33.486  1.00 30.00  ? 736 LYS C C   1  
ATOM 5377   O O   . LYS A 1 732 ? -84.285  -19.045 32.304  1.00 30.00  ? 736 LYS C O   1  
ATOM 5378   C CB  . LYS A 1 732 ? -82.655  -17.569 34.400  1.00 99.99  ? 736 LYS C CB  1  
ATOM 5379   C CG  . LYS A 1 732 ? -82.143  -16.233 34.930  1.00 99.99  ? 736 LYS C CG  1  
ATOM 5380   C CD  . LYS A 1 732 ? -80.631  -16.302 35.107  1.00 99.99  ? 736 LYS C CD  1  
ATOM 5381   C CE  . LYS A 1 732 ? -80.119  -14.956 35.613  1.00 99.99  ? 736 LYS C CE  1  
ATOM 5382   N NZ  . LYS A 1 732 ? -78.678  -14.847 35.335  1.00 99.99  ? 736 LYS C NZ  1  
ATOM 5383   N N   . THR A 1 733 ? -85.184  -19.667 34.266  1.00 30.00  ? 737 THR C N   1  
ATOM 5384   C CA  . THR A 1 733 ? -85.594  -20.962 33.762  1.00 30.00  ? 737 THR C CA  1  
ATOM 5385   C C   . THR A 1 733 ? -87.072  -20.914 33.401  1.00 30.00  ? 737 THR C C   1  
ATOM 5386   O O   . THR A 1 733 ? -87.520  -21.570 32.448  1.00 30.00  ? 737 THR C O   1  
ATOM 5387   C CB  . THR A 1 733 ? -85.368  -22.030 34.826  1.00 99.99  ? 737 THR C CB  1  
ATOM 5388   O OG1 . THR A 1 733 ? -86.271  -21.816 35.915  1.00 99.99  ? 737 THR C OG1 1  
ATOM 5389   C CG2 . THR A 1 733 ? -83.934  -21.944 35.333  1.00 99.99  ? 737 THR C CG2 1  
ATOM 5390   N N   . VAL A 1 734 ? -87.818  -20.127 34.172  1.00 30.00  ? 738 VAL C N   1  
ATOM 5391   C CA  . VAL A 1 734 ? -89.254  -19.955 33.963  1.00 30.00  ? 738 VAL C CA  1  
ATOM 5392   C C   . VAL A 1 734 ? -89.457  -19.498 32.519  1.00 30.00  ? 738 VAL C C   1  
ATOM 5393   O O   . VAL A 1 734 ? -90.317  -20.011 31.795  1.00 30.00  ? 738 VAL C O   1  
ATOM 5394   C CB  . VAL A 1 734 ? -89.798  -18.911 34.930  1.00 99.99  ? 738 VAL C CB  1  
ATOM 5395   C CG1 . VAL A 1 734 ? -89.550  -19.365 36.367  1.00 99.99  ? 738 VAL C CG1 1  
ATOM 5396   C CG2 . VAL A 1 734 ? -89.093  -17.578 34.693  1.00 99.99  ? 738 VAL C CG2 1  
ATOM 5397   N N   . SER A 1 735 ? -88.638  -18.529 32.120  1.00 30.00  ? 739 SER C N   1  
ATOM 5398   C CA  . SER A 1 735 ? -88.671  -17.964 30.774  1.00 30.00  ? 739 SER C CA  1  
ATOM 5399   C C   . SER A 1 735 ? -88.134  -18.989 29.786  1.00 30.00  ? 739 SER C C   1  
ATOM 5400   O O   . SER A 1 735 ? -88.544  -19.044 28.622  1.00 30.00  ? 739 SER C O   1  
ATOM 5401   C CB  . SER A 1 735 ? -87.811  -16.706 30.719  1.00 99.99  ? 739 SER C CB  1  
ATOM 5402   O OG  . SER A 1 735 ? -86.436  -17.060 30.874  1.00 99.99  ? 739 SER C OG  1  
ATOM 5403   N N   . GLU A 1 736 ? -87.191  -19.796 30.256  1.00 30.00  ? 740 GLU C N   1  
ATOM 5404   C CA  . GLU A 1 736 ? -86.611  -20.817 29.414  1.00 30.00  ? 740 GLU C CA  1  
ATOM 5405   C C   . GLU A 1 736 ? -87.775  -21.702 29.021  1.00 30.00  ? 740 GLU C C   1  
ATOM 5406   O O   . GLU A 1 736 ? -87.837  -22.213 27.901  1.00 30.00  ? 740 GLU C O   1  
ATOM 5407   C CB  . GLU A 1 736 ? -85.553  -21.591 30.192  1.00 99.99  ? 740 GLU C CB  1  
ATOM 5408   C CG  . GLU A 1 736 ? -84.411  -20.669 30.544  1.00 99.99  ? 740 GLU C CG  1  
ATOM 5409   C CD  . GLU A 1 736 ? -83.608  -20.348 29.287  1.00 99.99  ? 740 GLU C CD  1  
ATOM 5410   O OE1 . GLU A 1 736 ? -83.960  -19.341 28.620  1.00 99.99  ? 740 GLU C OE1 1  
ATOM 5411   O OE2 . GLU A 1 736 ? -82.648  -21.115 29.005  1.00 99.99  ? 740 GLU C OE2 1  
ATOM 5412   N N   . LYS A 1 737 ? -88.698  -21.857 29.973  1.00 30.00  ? 741 LYS C N   1  
ATOM 5413   C CA  . LYS A 1 737 ? -89.903  -22.666 29.809  1.00 30.00  ? 741 LYS C CA  1  
ATOM 5414   C C   . LYS A 1 737 ? -90.961  -21.972 28.927  1.00 30.00  ? 741 LYS C C   1  
ATOM 5415   O O   . LYS A 1 737 ? -91.323  -22.481 27.864  1.00 30.00  ? 741 LYS C O   1  
ATOM 5416   C CB  . LYS A 1 737 ? -90.536  -22.935 31.171  1.00 99.99  ? 741 LYS C CB  1  
ATOM 5417   C CG  . LYS A 1 737 ? -89.536  -23.661 32.063  1.00 99.99  ? 741 LYS C CG  1  
ATOM 5418   C CD  . LYS A 1 737 ? -90.200  -24.018 33.388  1.00 99.99  ? 741 LYS C CD  1  
ATOM 5419   C CE  . LYS A 1 737 ? -89.206  -24.766 34.269  1.00 99.99  ? 741 LYS C CE  1  
ATOM 5420   N NZ  . LYS A 1 737 ? -89.935  -25.516 35.303  1.00 99.99  ? 741 LYS C NZ  1  
ATOM 5421   N N   . ILE A 1 738 ? -91.448  -20.821 29.367  1.00 30.00  ? 742 ILE C N   1  
ATOM 5422   C CA  . ILE A 1 738 ? -92.450  -20.072 28.606  1.00 30.00  ? 742 ILE C CA  1  
ATOM 5423   C C   . ILE A 1 738 ? -92.145  -20.011 27.115  1.00 30.00  ? 742 ILE C C   1  
ATOM 5424   O O   . ILE A 1 738 ? -92.929  -20.460 26.283  1.00 30.00  ? 742 ILE C O   1  
ATOM 5425   C CB  . ILE A 1 738 ? -92.521  -18.638 29.120  1.00 99.99  ? 742 ILE C CB  1  
ATOM 5426   C CG1 . ILE A 1 738 ? -91.471  -17.791 28.407  1.00 99.99  ? 742 ILE C CG1 1  
ATOM 5427   C CG2 . ILE A 1 738 ? -92.254  -18.621 30.621  1.00 99.99  ? 742 ILE C CG2 1  
ATOM 5428   C CD1 . ILE A 1 738 ? -92.103  -17.102 27.202  1.00 99.99  ? 742 ILE C CD1 1  
ATOM 5429   N N   . LEU A 1 739 ? -90.996  -19.440 26.794  1.00 30.00  ? 743 LEU C N   1  
ATOM 5430   C CA  . LEU A 1 739 ? -90.557  -19.296 25.412  1.00 30.00  ? 743 LEU C CA  1  
ATOM 5431   C C   . LEU A 1 739 ? -90.346  -20.655 24.768  1.00 30.00  ? 743 LEU C C   1  
ATOM 5432   O O   . LEU A 1 739 ? -90.362  -20.788 23.543  1.00 30.00  ? 743 LEU C O   1  
ATOM 5433   C CB  . LEU A 1 739 ? -89.242  -18.523 25.361  1.00 99.99  ? 743 LEU C CB  1  
ATOM 5434   C CG  . LEU A 1 739 ? -89.529  -17.044 25.127  1.00 99.99  ? 743 LEU C CG  1  
ATOM 5435   C CD1 . LEU A 1 739 ? -88.234  -16.329 24.751  1.00 99.99  ? 743 LEU C CD1 1  
ATOM 5436   C CD2 . LEU A 1 739 ? -90.541  -16.894 23.998  1.00 99.99  ? 743 LEU C CD2 1  
ATOM 5437   N N   . ALA A 1 740 ? -90.145  -21.665 25.604  1.00 30.00  ? 744 ALA C N   1  
ATOM 5438   C CA  . ALA A 1 740 ? -89.940  -23.023 25.116  1.00 30.00  ? 744 ALA C CA  1  
ATOM 5439   C C   . ALA A 1 740 ? -91.322  -23.565 24.782  1.00 30.00  ? 744 ALA C C   1  
ATOM 5440   O O   . ALA A 1 740 ? -91.545  -24.106 23.690  1.00 30.00  ? 744 ALA C O   1  
ATOM 5441   C CB  . ALA A 1 740 ? -89.278  -23.873 26.195  1.00 30.00  ? 744 ALA C CB  1  
ATOM 5442   N N   . GLY A 1 741 ? -92.245  -23.417 25.733  1.00 30.00  ? 745 GLY C N   1  
ATOM 5443   C CA  . GLY A 1 741 ? -93.602  -23.884 25.541  1.00 30.00  ? 745 GLY C CA  1  
ATOM 5444   C C   . GLY A 1 741 ? -94.135  -23.338 24.237  1.00 30.00  ? 745 GLY C C   1  
ATOM 5445   O O   . GLY A 1 741 ? -94.515  -24.097 23.350  1.00 30.00  ? 745 GLY C O   1  
ATOM 5446   N N   . LEU A 1 742 ? -94.154  -22.015 24.123  1.00 30.00  ? 746 LEU C N   1  
ATOM 5447   C CA  . LEU A 1 742 ? -94.638  -21.339 22.925  1.00 30.00  ? 746 LEU C CA  1  
ATOM 5448   C C   . LEU A 1 742 ? -94.000  -21.861 21.644  1.00 30.00  ? 746 LEU C C   1  
ATOM 5449   O O   . LEU A 1 742 ? -94.322  -21.389 20.549  1.00 30.00  ? 746 LEU C O   1  
ATOM 5450   C CB  . LEU A 1 742 ? -94.330  -19.847 23.012  1.00 99.99  ? 746 LEU C CB  1  
ATOM 5451   C CG  . LEU A 1 742 ? -95.543  -19.108 23.573  1.00 99.99  ? 746 LEU C CG  1  
ATOM 5452   C CD1 . LEU A 1 742 ? -95.370  -17.609 23.357  1.00 99.99  ? 746 LEU C CD1 1  
ATOM 5453   C CD2 . LEU A 1 742 ? -96.803  -19.586 22.859  1.00 99.99  ? 746 LEU C CD2 1  
ATOM 5454   N N   . GLN A 1 743 ? -93.100  -22.836 21.791  1.00 30.00  ? 747 GLN C N   1  
ATOM 5455   C CA  . GLN A 1 743 ? -92.407  -23.419 20.645  1.00 30.00  ? 747 GLN C CA  1  
ATOM 5456   C C   . GLN A 1 743 ? -91.876  -22.266 19.811  1.00 30.00  ? 747 GLN C C   1  
ATOM 5457   O O   . GLN A 1 743 ? -92.110  -22.179 18.603  1.00 30.00  ? 747 GLN C O   1  
ATOM 5458   C CB  . GLN A 1 743 ? -93.379  -24.266 19.829  1.00 99.99  ? 747 GLN C CB  1  
ATOM 5459   C CG  . GLN A 1 743 ? -93.841  -25.454 20.659  1.00 99.99  ? 747 GLN C CG  1  
ATOM 5460   C CD  . GLN A 1 743 ? -92.726  -26.479 20.823  1.00 99.99  ? 747 GLN C CD  1  
ATOM 5461   O OE1 . GLN A 1 743 ? -91.625  -26.286 20.313  1.00 99.99  ? 747 GLN C OE1 1  
ATOM 5462   N NE2 . GLN A 1 743 ? -93.014  -27.569 21.536  1.00 99.99  ? 747 GLN C NE2 1  
ATOM 5463   N N   . MET A 1 744 ? -91.160  -21.376 20.495  1.00 30.00  ? 748 MET C N   1  
ATOM 5464   C CA  . MET A 1 744 ? -90.568  -20.199 19.882  1.00 30.00  ? 748 MET C CA  1  
ATOM 5465   C C   . MET A 1 744 ? -89.277  -20.529 19.143  1.00 30.00  ? 748 MET C C   1  
ATOM 5466   O O   . MET A 1 744 ? -88.421  -21.252 19.656  1.00 30.00  ? 748 MET C O   1  
ATOM 5467   C CB  . MET A 1 744 ? -90.244  -19.163 20.955  1.00 99.99  ? 748 MET C CB  1  
ATOM 5468   C CG  . MET A 1 744 ? -91.468  -18.947 21.835  1.00 99.99  ? 748 MET C CG  1  
ATOM 5469   S SD  . MET A 1 744 ? -92.637  -17.837 21.015  1.00 99.99  ? 748 MET C SD  1  
ATOM 5470   C CE  . MET A 1 744 ? -91.817  -16.278 21.267  1.00 99.99  ? 748 MET C CE  1  
ATOM 5471   N N   . ASP A 1 745 ? -89.161  -19.992 17.933  1.00 30.00  ? 749 ASP C N   1  
ATOM 5472   C CA  . ASP A 1 745 ? -87.994  -20.205 17.087  1.00 30.00  ? 749 ASP C CA  1  
ATOM 5473   C C   . ASP A 1 745 ? -86.695  -19.718 17.730  1.00 30.00  ? 749 ASP C C   1  
ATOM 5474   O O   . ASP A 1 745 ? -86.582  -18.546 18.085  1.00 30.00  ? 749 ASP C O   1  
ATOM 5475   C CB  . ASP A 1 745 ? -88.166  -19.454 15.771  1.00 99.99  ? 749 ASP C CB  1  
ATOM 5476   C CG  . ASP A 1 745 ? -87.070  -19.875 14.794  1.00 99.99  ? 749 ASP C CG  1  
ATOM 5477   O OD1 . ASP A 1 745 ? -85.935  -19.346 14.940  1.00 99.99  ? 749 ASP C OD1 1  
ATOM 5478   O OD2 . ASP A 1 745 ? -87.377  -20.723 13.916  1.00 99.99  ? 749 ASP C OD2 1  
ATOM 5479   N N   . PRO A 1 746 ? -85.697  -20.615 17.886  1.00 30.00  ? 750 PRO C N   1  
ATOM 5480   C CA  . PRO A 1 746 ? -84.415  -20.217 18.494  1.00 30.00  ? 750 PRO C CA  1  
ATOM 5481   C C   . PRO A 1 746 ? -83.809  -18.993 17.801  1.00 30.00  ? 750 PRO C C   1  
ATOM 5482   O O   . PRO A 1 746 ? -82.976  -18.278 18.377  1.00 30.00  ? 750 PRO C O   1  
ATOM 5483   C CB  . PRO A 1 746 ? -83.654  -21.465 18.221  1.00 99.99  ? 750 PRO C CB  1  
ATOM 5484   C CG  . PRO A 1 746 ? -84.622  -22.410 17.550  1.00 99.99  ? 750 PRO C CG  1  
ATOM 5485   C CD  . PRO A 1 746 ? -85.795  -21.927 17.412  1.00 99.99  ? 750 PRO C CD  1  
ATOM 5486   N N   . ALA A 1 747 ? -84.243  -18.760 16.561  1.00 30.00  ? 751 ALA C N   1  
ATOM 5487   C CA  . ALA A 1 747 ? -83.773  -17.635 15.762  1.00 30.00  ? 751 ALA C CA  1  
ATOM 5488   C C   . ALA A 1 747 ? -84.231  -16.310 16.359  1.00 30.00  ? 751 ALA C C   1  
ATOM 5489   O O   . ALA A 1 747 ? -83.412  -15.485 16.777  1.00 30.00  ? 751 ALA C O   1  
ATOM 5490   C CB  . ALA A 1 747 ? -84.287  -17.762 14.321  1.00 30.00  ? 751 ALA C CB  1  
ATOM 5491   N N   . GLU A 1 748 ? -85.549  -16.116 16.406  1.00 30.00  ? 752 GLU C N   1  
ATOM 5492   C CA  . GLU A 1 748 ? -86.130  -14.890 16.933  1.00 30.00  ? 752 GLU C CA  1  
ATOM 5493   C C   . GLU A 1 748 ? -85.771  -14.522 18.388  1.00 30.00  ? 752 GLU C C   1  
ATOM 5494   O O   . GLU A 1 748 ? -86.450  -13.692 18.992  1.00 30.00  ? 752 GLU C O   1  
ATOM 5495   C CB  . GLU A 1 748 ? -87.653  -14.985 16.898  1.00 99.99  ? 752 GLU C CB  1  
ATOM 5496   C CG  . GLU A 1 748 ? -88.120  -15.064 15.466  1.00 99.99  ? 752 GLU C CG  1  
ATOM 5497   C CD  . GLU A 1 748 ? -87.942  -13.706 14.795  1.00 99.99  ? 752 GLU C CD  1  
ATOM 5498   O OE1 . GLU A 1 748 ? -86.840  -13.487 14.221  1.00 99.99  ? 752 GLU C OE1 1  
ATOM 5499   O OE2 . GLU A 1 748 ? -88.906  -12.897 14.863  1.00 99.99  ? 752 GLU C OE2 1  
ATOM 5500   N N   . TYR A 1 749 ? -84.720  -15.122 18.953  1.00 30.00  ? 753 TYR C N   1  
ATOM 5501   C CA  . TYR A 1 749 ? -84.323  -14.786 20.322  1.00 30.00  ? 753 TYR C CA  1  
ATOM 5502   C C   . TYR A 1 749 ? -82.988  -15.368 20.794  1.00 30.00  ? 753 TYR C C   1  
ATOM 5503   O O   . TYR A 1 749 ? -82.386  -16.215 20.120  1.00 30.00  ? 753 TYR C O   1  
ATOM 5504   C CB  . TYR A 1 749 ? -85.372  -15.290 21.306  1.00 99.99  ? 753 TYR C CB  1  
ATOM 5505   C CG  . TYR A 1 749 ? -85.405  -16.798 21.279  1.00 99.99  ? 753 TYR C CG  1  
ATOM 5506   C CD1 . TYR A 1 749 ? -84.503  -17.533 22.056  1.00 99.99  ? 753 TYR C CD1 1  
ATOM 5507   C CD2 . TYR A 1 749 ? -86.340  -17.463 20.475  1.00 99.99  ? 753 TYR C CD2 1  
ATOM 5508   C CE1 . TYR A 1 749 ? -84.534  -18.933 22.030  1.00 99.99  ? 753 TYR C CE1 1  
ATOM 5509   C CE2 . TYR A 1 749 ? -86.370  -18.863 20.451  1.00 99.99  ? 753 TYR C CE2 1  
ATOM 5510   C CZ  . TYR A 1 749 ? -85.467  -19.598 21.227  1.00 99.99  ? 753 TYR C CZ  1  
ATOM 5511   O OH  . TYR A 1 749 ? -85.497  -20.958 21.201  1.00 99.99  ? 753 TYR C OH  1  
ATOM 5512   N N   . ARG A 1 750 ? -82.517  -14.892 21.947  1.00 30.00  ? 754 ARG C N   1  
ATOM 5513   C CA  . ARG A 1 750 ? -81.251  -15.359 22.487  1.00 30.00  ? 754 ARG C CA  1  
ATOM 5514   C C   . ARG A 1 750 ? -81.163  -15.340 24.006  1.00 30.00  ? 754 ARG C C   1  
ATOM 5515   O O   . ARG A 1 750 ? -81.779  -14.514 24.695  1.00 30.00  ? 754 ARG C O   1  
ATOM 5516   C CB  . ARG A 1 750 ? -80.113  -14.482 21.973  1.00 99.99  ? 754 ARG C CB  1  
ATOM 5517   C CG  . ARG A 1 750 ? -80.141  -14.451 20.449  1.00 99.99  ? 754 ARG C CG  1  
ATOM 5518   C CD  . ARG A 1 750 ? -79.804  -15.836 19.905  1.00 99.99  ? 754 ARG C CD  1  
ATOM 5519   N NE  . ARG A 1 750 ? -78.466  -16.273 20.365  1.00 99.99  ? 754 ARG C NE  1  
ATOM 5520   C CZ  . ARG A 1 750 ? -77.800  -17.277 19.803  1.00 99.99  ? 754 ARG C CZ  1  
ATOM 5521   N NH1 . ARG A 1 750 ? -78.298  -17.968 18.779  1.00 99.99  ? 754 ARG C NH1 1  
ATOM 5522   N NH2 . ARG A 1 750 ? -76.602  -17.587 20.295  1.00 99.99  ? 754 ARG C NH2 1  
ATOM 5523   N N   . LEU A 1 751 ? -80.357  -16.288 24.492  1.00 30.00  ? 755 LEU C N   1  
ATOM 5524   C CA  . LEU A 1 751 ? -80.036  -16.593 25.890  1.00 30.00  ? 755 LEU C CA  1  
ATOM 5525   C C   . LEU A 1 751 ? -79.863  -15.430 26.844  1.00 30.00  ? 755 LEU C C   1  
ATOM 5526   O O   . LEU A 1 751 ? -80.829  -14.762 27.236  1.00 30.00  ? 755 LEU C O   1  
ATOM 5527   C CB  . LEU A 1 751 ? -78.719  -17.362 25.962  1.00 99.99  ? 755 LEU C CB  1  
ATOM 5528   C CG  . LEU A 1 751 ? -79.007  -18.859 25.997  1.00 99.99  ? 755 LEU C CG  1  
ATOM 5529   C CD1 . LEU A 1 751 ? -77.738  -19.608 26.396  1.00 99.99  ? 755 LEU C CD1 1  
ATOM 5530   C CD2 . LEU A 1 751 ? -80.109  -19.143 27.009  1.00 99.99  ? 755 LEU C CD2 1  
ATOM 5531   N N   . GLY A 1 752 ? -78.612  -15.205 27.210  1.00 30.00  ? 756 GLY C N   1  
ATOM 5532   C CA  . GLY A 1 752 ? -78.288  -14.115 28.109  1.00 30.00  ? 756 GLY C CA  1  
ATOM 5533   C C   . GLY A 1 752 ? -78.068  -14.669 29.483  1.00 30.00  ? 756 GLY C C   1  
ATOM 5534   O O   . GLY A 1 752 ? -78.601  -15.720 29.818  1.00 30.00  ? 756 GLY C O   1  
ATOM 5535   N N   . THR A 1 753 ? -77.275  -13.977 30.280  1.00 30.00  ? 757 THR C N   1  
ATOM 5536   C CA  . THR A 1 753 ? -77.016  -14.434 31.625  1.00 30.00  ? 757 THR C CA  1  
ATOM 5537   C C   . THR A 1 753 ? -78.144  -13.868 32.468  1.00 30.00  ? 757 THR C C   1  
ATOM 5538   O O   . THR A 1 753 ? -78.878  -14.613 33.115  1.00 30.00  ? 757 THR C O   1  
ATOM 5539   C CB  . THR A 1 753 ? -75.660  -13.919 32.098  1.00 99.99  ? 757 THR C CB  1  
ATOM 5540   O OG1 . THR A 1 753 ? -75.718  -12.500 32.255  1.00 99.99  ? 757 THR C OG1 1  
ATOM 5541   C CG2 . THR A 1 753 ? -74.596  -14.272 31.063  1.00 99.99  ? 757 THR C CG2 1  
ATOM 5542   N N   . THR A 1 754 ? -78.290  -12.548 32.443  1.00 30.00  ? 758 THR C N   1  
ATOM 5543   C CA  . THR A 1 754 ? -79.326  -11.875 33.210  1.00 30.00  ? 758 THR C CA  1  
ATOM 5544   C C   . THR A 1 754 ? -80.520  -11.406 32.370  1.00 30.00  ? 758 THR C C   1  
ATOM 5545   O O   . THR A 1 754 ? -81.545  -10.984 32.917  1.00 30.00  ? 758 THR C O   1  
ATOM 5546   C CB  . THR A 1 754 ? -78.751  -10.640 33.891  1.00 99.99  ? 758 THR C CB  1  
ATOM 5547   O OG1 . THR A 1 754 ? -78.410  -9.664  32.901  1.00 99.99  ? 758 THR C OG1 1  
ATOM 5548   C CG2 . THR A 1 754 ? -77.499  -11.027 34.671  1.00 99.99  ? 758 THR C CG2 1  
ATOM 5549   N N   . LYS A 1 755 ? -80.407  -11.475 31.045  1.00 30.00  ? 759 LYS C N   1  
ATOM 5550   C CA  . LYS A 1 755 ? -81.523  -11.025 30.228  1.00 30.00  ? 759 LYS C CA  1  
ATOM 5551   C C   . LYS A 1 755 ? -81.744  -11.729 28.894  1.00 30.00  ? 759 LYS C C   1  
ATOM 5552   O O   . LYS A 1 755 ? -80.816  -12.302 28.307  1.00 30.00  ? 759 LYS C O   1  
ATOM 5553   C CB  . LYS A 1 755 ? -81.350  -9.551  29.879  1.00 99.99  ? 759 LYS C CB  1  
ATOM 5554   C CG  . LYS A 1 755 ? -81.273  -8.727  31.159  1.00 99.99  ? 759 LYS C CG  1  
ATOM 5555   C CD  . LYS A 1 755 ? -81.198  -7.244  30.810  1.00 99.99  ? 759 LYS C CD  1  
ATOM 5556   C CE  . LYS A 1 755 ? -81.149  -6.422  32.092  1.00 99.99  ? 759 LYS C CE  1  
ATOM 5557   N NZ  . LYS A 1 755 ? -81.553  -5.038  31.804  1.00 99.99  ? 759 LYS C NZ  1  
ATOM 5558   N N   . VAL A 1 756 ? -83.002  -11.669 28.441  1.00 30.00  ? 760 VAL C N   1  
ATOM 5559   C CA  . VAL A 1 756 ? -83.450  -12.276 27.185  1.00 30.00  ? 760 VAL C CA  1  
ATOM 5560   C C   . VAL A 1 756 ? -83.371  -11.313 26.026  1.00 30.00  ? 760 VAL C C   1  
ATOM 5561   O O   . VAL A 1 756 ? -83.695  -10.125 26.166  1.00 30.00  ? 760 VAL C O   1  
ATOM 5562   C CB  . VAL A 1 756 ? -84.899  -12.734 27.317  1.00 99.99  ? 760 VAL C CB  1  
ATOM 5563   C CG1 . VAL A 1 756 ? -85.006  -13.762 28.437  1.00 99.99  ? 760 VAL C CG1 1  
ATOM 5564   C CG2 . VAL A 1 756 ? -85.784  -11.535 27.639  1.00 99.99  ? 760 VAL C CG2 1  
ATOM 5565   N N   . PHE A 1 757 ? -82.973  -11.844 24.877  1.00 30.00  ? 761 PHE C N   1  
ATOM 5566   C CA  . PHE A 1 757 ? -82.856  -11.026 23.688  1.00 30.00  ? 761 PHE C CA  1  
ATOM 5567   C C   . PHE A 1 757 ? -83.797  -11.490 22.601  1.00 30.00  ? 761 PHE C C   1  
ATOM 5568   O O   . PHE A 1 757 ? -83.636  -12.581 22.059  1.00 30.00  ? 761 PHE C O   1  
ATOM 5569   C CB  . PHE A 1 757 ? -81.431  -11.097 23.149  1.00 99.99  ? 761 PHE C CB  1  
ATOM 5570   C CG  . PHE A 1 757 ? -80.480  -10.507 24.160  1.00 99.99  ? 761 PHE C CG  1  
ATOM 5571   C CD1 . PHE A 1 757 ? -79.920  -11.321 25.152  1.00 99.99  ? 761 PHE C CD1 1  
ATOM 5572   C CD2 . PHE A 1 757 ? -80.156  -9.147  24.107  1.00 99.99  ? 761 PHE C CD2 1  
ATOM 5573   C CE1 . PHE A 1 757 ? -79.035  -10.775 26.091  1.00 99.99  ? 761 PHE C CE1 1  
ATOM 5574   C CE2 . PHE A 1 757 ? -79.274  -8.598  25.046  1.00 99.99  ? 761 PHE C CE2 1  
ATOM 5575   C CZ  . PHE A 1 757 ? -78.713  -9.412  26.037  1.00 99.99  ? 761 PHE C CZ  1  
ATOM 5576   N N   . PHE A 1 758 ? -84.783  -10.661 22.276  1.00 30.00  ? 762 PHE C N   1  
ATOM 5577   C CA  . PHE A 1 758 ? -85.739  -11.010 21.235  1.00 30.00  ? 762 PHE C CA  1  
ATOM 5578   C C   . PHE A 1 758 ? -85.476  -10.206 20.001  1.00 30.00  ? 762 PHE C C   1  
ATOM 5579   O O   . PHE A 1 758 ? -85.391  -8.975  20.055  1.00 30.00  ? 762 PHE C O   1  
ATOM 5580   C CB  . PHE A 1 758 ? -87.157  -10.728 21.716  1.00 99.99  ? 762 PHE C CB  1  
ATOM 5581   C CG  . PHE A 1 758 ? -87.474  -11.615 22.895  1.00 99.99  ? 762 PHE C CG  1  
ATOM 5582   C CD1 . PHE A 1 758 ? -87.175  -11.188 24.195  1.00 99.99  ? 762 PHE C CD1 1  
ATOM 5583   C CD2 . PHE A 1 758 ? -88.071  -12.866 22.691  1.00 99.99  ? 762 PHE C CD2 1  
ATOM 5584   C CE1 . PHE A 1 758 ? -87.472  -12.009 25.289  1.00 99.99  ? 762 PHE C CE1 1  
ATOM 5585   C CE2 . PHE A 1 758 ? -88.366  -13.688 23.785  1.00 99.99  ? 762 PHE C CE2 1  
ATOM 5586   C CZ  . PHE A 1 758 ? -88.066  -13.261 25.083  1.00 99.99  ? 762 PHE C CZ  1  
ATOM 5587   N N   . LYS A 1 759 ? -85.345  -10.902 18.879  1.00 30.00  ? 763 LYS C N   1  
ATOM 5588   C CA  . LYS A 1 759 ? -85.112  -10.247 17.609  1.00 30.00  ? 763 LYS C CA  1  
ATOM 5589   C C   . LYS A 1 759 ? -86.137  -9.119  17.490  1.00 30.00  ? 763 LYS C C   1  
ATOM 5590   O O   . LYS A 1 759 ? -87.018  -8.972  18.336  1.00 30.00  ? 763 LYS C O   1  
ATOM 5591   C CB  . LYS A 1 759 ? -85.282  -11.249 16.472  1.00 99.99  ? 763 LYS C CB  1  
ATOM 5592   C CG  . LYS A 1 759 ? -84.938  -10.577 15.145  1.00 99.99  ? 763 LYS C CG  1  
ATOM 5593   C CD  . LYS A 1 759 ? -84.673  -11.645 14.090  1.00 99.99  ? 763 LYS C CD  1  
ATOM 5594   C CE  . LYS A 1 759 ? -84.697  -11.007 12.706  1.00 99.99  ? 763 LYS C CE  1  
ATOM 5595   N NZ  . LYS A 1 759 ? -83.330  -10.638 12.310  1.00 99.99  ? 763 LYS C NZ  1  
ATOM 5596   N N   . ALA A 1 760 ? -86.033  -8.322  16.437  1.00 30.00  ? 764 ALA C N   1  
ATOM 5597   C CA  . ALA A 1 760 ? -86.955  -7.211  16.240  1.00 30.00  ? 764 ALA C CA  1  
ATOM 5598   C C   . ALA A 1 760 ? -88.407  -7.638  16.044  1.00 30.00  ? 764 ALA C C   1  
ATOM 5599   O O   . ALA A 1 760 ? -88.674  -8.712  15.505  1.00 30.00  ? 764 ALA C O   1  
ATOM 5600   C CB  . ALA A 1 760 ? -86.502  -6.394  15.050  1.00 30.00  ? 764 ALA C CB  1  
ATOM 5601   N N   . GLY A 1 761 ? -89.334  -6.785  16.482  1.00 30.00  ? 765 GLY C N   1  
ATOM 5602   C CA  . GLY A 1 761 ? -90.768  -7.048  16.347  1.00 30.00  ? 765 GLY C CA  1  
ATOM 5603   C C   . GLY A 1 761 ? -91.388  -8.079  17.271  1.00 30.00  ? 765 GLY C C   1  
ATOM 5604   O O   . GLY A 1 761 ? -92.498  -7.904  17.787  1.00 30.00  ? 765 GLY C O   1  
ATOM 5605   N N   . VAL A 1 762 ? -90.665  -9.167  17.474  1.00 30.00  ? 766 VAL C N   1  
ATOM 5606   C CA  . VAL A 1 762 ? -91.100  -10.247 18.320  1.00 30.00  ? 766 VAL C CA  1  
ATOM 5607   C C   . VAL A 1 762 ? -91.765  -9.803  19.623  1.00 30.00  ? 766 VAL C C   1  
ATOM 5608   O O   . VAL A 1 762 ? -92.837  -10.293 19.956  1.00 30.00  ? 766 VAL C O   1  
ATOM 5609   C CB  . VAL A 1 762 ? -89.903  -11.113 18.709  1.00 99.99  ? 766 VAL C CB  1  
ATOM 5610   C CG1 . VAL A 1 762 ? -89.258  -11.686 17.452  1.00 99.99  ? 766 VAL C CG1 1  
ATOM 5611   C CG2 . VAL A 1 762 ? -88.883  -10.264 19.463  1.00 99.99  ? 766 VAL C CG2 1  
ATOM 5612   N N   . LEU A 1 763 ? -91.154  -8.876  20.358  1.00 30.00  ? 767 LEU C N   1  
ATOM 5613   C CA  . LEU A 1 763 ? -91.753  -8.426  21.612  1.00 30.00  ? 767 LEU C CA  1  
ATOM 5614   C C   . LEU A 1 763 ? -93.109  -7.757  21.399  1.00 30.00  ? 767 LEU C C   1  
ATOM 5615   O O   . LEU A 1 763 ? -93.992  -7.808  22.262  1.00 30.00  ? 767 LEU C O   1  
ATOM 5616   C CB  . LEU A 1 763 ? -90.836  -7.417  22.292  1.00 99.99  ? 767 LEU C CB  1  
ATOM 5617   C CG  . LEU A 1 763 ? -89.948  -8.136  23.303  1.00 99.99  ? 767 LEU C CG  1  
ATOM 5618   C CD1 . LEU A 1 763 ? -89.273  -7.109  24.208  1.00 99.99  ? 767 LEU C CD1 1  
ATOM 5619   C CD2 . LEU A 1 763 ? -90.800  -9.078  24.147  1.00 99.99  ? 767 LEU C CD2 1  
ATOM 5620   N N   . GLY A 1 764 ? -93.272  -7.116  20.247  1.00 30.00  ? 768 GLY C N   1  
ATOM 5621   C CA  . GLY A 1 764 ? -94.536  -6.466  19.978  1.00 30.00  ? 768 GLY C CA  1  
ATOM 5622   C C   . GLY A 1 764 ? -95.588  -7.544  19.841  1.00 30.00  ? 768 GLY C C   1  
ATOM 5623   O O   . GLY A 1 764 ? -96.712  -7.399  20.312  1.00 30.00  ? 768 GLY C O   1  
ATOM 5624   N N   . ASN A 1 765 ? -95.181  -8.635  19.199  1.00 30.00  ? 769 ASN C N   1  
ATOM 5625   C CA  . ASN A 1 765 ? -96.028  -9.793  18.955  1.00 30.00  ? 769 ASN C CA  1  
ATOM 5626   C C   . ASN A 1 765 ? -96.334  -10.617 20.204  1.00 30.00  ? 769 ASN C C   1  
ATOM 5627   O O   . ASN A 1 765 ? -97.323  -11.349 20.251  1.00 30.00  ? 769 ASN C O   1  
ATOM 5628   C CB  . ASN A 1 765 ? -95.351  -10.730 17.960  1.00 99.99  ? 769 ASN C CB  1  
ATOM 5629   C CG  . ASN A 1 765 ? -95.163  -10.055 16.609  1.00 99.99  ? 769 ASN C CG  1  
ATOM 5630   O OD1 . ASN A 1 765 ? -96.122  -9.549  16.026  1.00 99.99  ? 769 ASN C OD1 1  
ATOM 5631   N ND2 . ASN A 1 765 ? -93.925  -10.046 16.111  1.00 99.99  ? 769 ASN C ND2 1  
ATOM 5632   N N   . LEU A 1 766 ? -95.480  -10.506 21.212  1.00 30.00  ? 770 LEU C N   1  
ATOM 5633   C CA  . LEU A 1 766 ? -95.681  -11.229 22.449  1.00 30.00  ? 770 LEU C CA  1  
ATOM 5634   C C   . LEU A 1 766 ? -96.719  -10.460 23.237  1.00 30.00  ? 770 LEU C C   1  
ATOM 5635   O O   . LEU A 1 766 ? -97.498  -11.045 23.982  1.00 30.00  ? 770 LEU C O   1  
ATOM 5636   C CB  . LEU A 1 766 ? -94.370  -11.315 23.221  1.00 99.99  ? 770 LEU C CB  1  
ATOM 5637   C CG  . LEU A 1 766 ? -93.669  -12.628 22.895  1.00 99.99  ? 770 LEU C CG  1  
ATOM 5638   C CD1 . LEU A 1 766 ? -92.543  -12.866 23.896  1.00 99.99  ? 770 LEU C CD1 1  
ATOM 5639   C CD2 . LEU A 1 766 ? -94.675  -13.772 22.978  1.00 99.99  ? 770 LEU C CD2 1  
ATOM 5640   N N   . GLU A 1 767 ? -96.731  -9.140  23.074  1.00 30.00  ? 771 GLU C N   1  
ATOM 5641   C CA  . GLU A 1 767 ? -97.699  -8.319  23.781  1.00 30.00  ? 771 GLU C CA  1  
ATOM 5642   C C   . GLU A 1 767 ? -99.045  -8.531  23.091  1.00 30.00  ? 771 GLU C C   1  
ATOM 5643   O O   . GLU A 1 767 ? -100.100 -8.187  23.630  1.00 30.00  ? 771 GLU C O   1  
ATOM 5644   C CB  . GLU A 1 767 ? -97.284  -6.854  23.715  1.00 99.99  ? 771 GLU C CB  1  
ATOM 5645   C CG  . GLU A 1 767 ? -97.664  -6.163  24.999  1.00 99.99  ? 771 GLU C CG  1  
ATOM 5646   C CD  . GLU A 1 767 ? -99.184  -6.143  25.138  1.00 99.99  ? 771 GLU C CD  1  
ATOM 5647   O OE1 . GLU A 1 767 ? -99.724  -7.118  25.727  1.00 99.99  ? 771 GLU C OE1 1  
ATOM 5648   O OE2 . GLU A 1 767 ? -99.797  -5.154  24.651  1.00 99.99  ? 771 GLU C OE2 1  
ATOM 5649   N N   . GLU A 1 768 ? -98.987  -9.103  21.889  1.00 30.00  ? 772 GLU C N   1  
ATOM 5650   C CA  . GLU A 1 768 ? -100.186 -9.394  21.122  1.00 30.00  ? 772 GLU C CA  1  
ATOM 5651   C C   . GLU A 1 768 ? -100.765 -10.585 21.871  1.00 30.00  ? 772 GLU C C   1  
ATOM 5652   O O   . GLU A 1 768 ? -101.799 -10.468 22.537  1.00 30.00  ? 772 GLU C O   1  
ATOM 5653   C CB  . GLU A 1 768 ? -99.811  -9.725  19.682  1.00 99.99  ? 772 GLU C CB  1  
ATOM 5654   C CG  . GLU A 1 768 ? -100.987 -9.444  18.777  1.00 99.99  ? 772 GLU C CG  1  
ATOM 5655   C CD  . GLU A 1 768 ? -101.917 -10.656 18.759  1.00 99.99  ? 772 GLU C CD  1  
ATOM 5656   O OE1 . GLU A 1 768 ? -102.833 -10.692 19.619  1.00 99.99  ? 772 GLU C OE1 1  
ATOM 5657   O OE2 . GLU A 1 768 ? -101.698 -11.534 17.880  1.00 99.99  ? 772 GLU C OE2 1  
ATOM 5658   N N   . MET A 1 769 ? -100.084 -11.727 21.769  1.00 30.00  ? 773 MET C N   1  
ATOM 5659   C CA  . MET A 1 769 ? -100.511 -12.956 22.434  1.00 30.00  ? 773 MET C CA  1  
ATOM 5660   C C   . MET A 1 769 ? -100.824 -12.704 23.902  1.00 30.00  ? 773 MET C C   1  
ATOM 5661   O O   . MET A 1 769 ? -101.699 -13.335 24.474  1.00 30.00  ? 773 MET C O   1  
ATOM 5662   C CB  . MET A 1 769 ? -99.407  -14.003 22.349  1.00 99.99  ? 773 MET C CB  1  
ATOM 5663   C CG  . MET A 1 769 ? -98.930  -14.123 20.908  1.00 99.99  ? 773 MET C CG  1  
ATOM 5664   S SD  . MET A 1 769 ? -100.077 -15.155 19.960  1.00 99.99  ? 773 MET C SD  1  
ATOM 5665   C CE  . MET A 1 769 ? -99.613  -16.765 20.559  1.00 99.99  ? 773 MET C CE  1  
ATOM 5666   N N   . ARG A 1 770 ? -100.106 -11.777 24.510  1.00 30.00  ? 774 ARG C N   1  
ATOM 5667   C CA  . ARG A 1 770 ? -100.330 -11.468 25.909  1.00 30.00  ? 774 ARG C CA  1  
ATOM 5668   C C   . ARG A 1 770 ? -101.738 -10.935 26.111  1.00 30.00  ? 774 ARG C C   1  
ATOM 5669   O O   . ARG A 1 770 ? -102.394 -11.269 27.085  1.00 30.00  ? 774 ARG C O   1  
ATOM 5670   C CB  . ARG A 1 770 ? -99.332  -10.413 26.372  1.00 99.99  ? 774 ARG C CB  1  
ATOM 5671   C CG  . ARG A 1 770 ? -99.491  -10.181 27.871  1.00 99.99  ? 774 ARG C CG  1  
ATOM 5672   C CD  . ARG A 1 770 ? -98.580  -9.041  28.310  1.00 99.99  ? 774 ARG C CD  1  
ATOM 5673   N NE  . ARG A 1 770 ? -99.079  -7.741  27.806  1.00 99.99  ? 774 ARG C NE  1  
ATOM 5674   C CZ  . ARG A 1 770 ? -98.507  -6.579  28.113  1.00 99.99  ? 774 ARG C CZ  1  
ATOM 5675   N NH1 . ARG A 1 770 ? -97.442  -6.503  28.903  1.00 99.99  ? 774 ARG C NH1 1  
ATOM 5676   N NH2 . ARG A 1 770 ? -99.037  -5.468  27.604  1.00 99.99  ? 774 ARG C NH2 1  
ATOM 5677   N N   . ASP A 1 771 ? -102.205 -10.105 25.191  1.00 30.00  ? 775 ASP C N   1  
ATOM 5678   C CA  . ASP A 1 771 ? -103.543 -9.528  25.307  1.00 30.00  ? 775 ASP C CA  1  
ATOM 5679   C C   . ASP A 1 771 ? -104.657 -10.507 24.970  1.00 30.00  ? 775 ASP C C   1  
ATOM 5680   O O   . ASP A 1 771 ? -105.695 -10.527 25.633  1.00 30.00  ? 775 ASP C O   1  
ATOM 5681   C CB  . ASP A 1 771 ? -103.682 -8.340  24.359  1.00 99.99  ? 775 ASP C CB  1  
ATOM 5682   C CG  . ASP A 1 771 ? -102.861 -7.166  24.888  1.00 99.99  ? 775 ASP C CG  1  
ATOM 5683   O OD1 . ASP A 1 771 ? -103.095 -6.785  26.066  1.00 99.99  ? 775 ASP C OD1 1  
ATOM 5684   O OD2 . ASP A 1 771 ? -102.008 -6.663  24.110  1.00 99.99  ? 775 ASP C OD2 1  
ATOM 5685   N N   . GLU A 1 772 ? -104.325 -11.018 23.899  1.00 30.00  ? 776 GLU C N   1  
ATOM 5686   C CA  . GLU A 1 772 ? -105.331 -12.020 23.583  1.00 30.00  ? 776 GLU C CA  1  
ATOM 5687   C C   . GLU A 1 772 ? -105.717 -12.831 24.826  1.00 30.00  ? 776 GLU C C   1  
ATOM 5688   O O   . GLU A 1 772 ? -106.880 -12.827 25.225  1.00 30.00  ? 776 GLU C O   1  
ATOM 5689   C CB  . GLU A 1 772 ? -104.790 -12.983 22.530  1.00 99.99  ? 776 GLU C CB  1  
ATOM 5690   C CG  . GLU A 1 772 ? -104.552 -12.237 21.238  1.00 99.99  ? 776 GLU C CG  1  
ATOM 5691   C CD  . GLU A 1 772 ? -105.893 -11.893 20.595  1.00 99.99  ? 776 GLU C CD  1  
ATOM 5692   O OE1 . GLU A 1 772 ? -106.418 -10.793 20.910  1.00 99.99  ? 776 GLU C OE1 1  
ATOM 5693   O OE2 . GLU A 1 772 ? -106.381 -12.735 19.795  1.00 99.99  ? 776 GLU C OE2 1  
ATOM 5694   N N   . ARG A 1 773 ? -104.751 -13.513 25.432  1.00 30.00  ? 777 ARG C N   1  
ATOM 5695   C CA  . ARG A 1 773 ? -105.003 -14.320 26.628  1.00 30.00  ? 777 ARG C CA  1  
ATOM 5696   C C   . ARG A 1 773 ? -105.686 -13.516 27.710  1.00 30.00  ? 777 ARG C C   1  
ATOM 5697   O O   . ARG A 1 773 ? -106.657 -13.964 28.310  1.00 30.00  ? 777 ARG C O   1  
ATOM 5698   C CB  . ARG A 1 773 ? -103.684 -14.847 27.185  1.00 99.99  ? 777 ARG C CB  1  
ATOM 5699   C CG  . ARG A 1 773 ? -103.188 -16.000 26.322  1.00 99.99  ? 777 ARG C CG  1  
ATOM 5700   C CD  . ARG A 1 773 ? -101.896 -16.559 26.911  1.00 99.99  ? 777 ARG C CD  1  
ATOM 5701   N NE  . ARG A 1 773 ? -101.335 -17.620 26.045  1.00 99.99  ? 777 ARG C NE  1  
ATOM 5702   C CZ  . ARG A 1 773 ? -101.647 -18.906 26.180  1.00 99.99  ? 777 ARG C CZ  1  
ATOM 5703   N NH1 . ARG A 1 773 ? -102.491 -19.332 27.117  1.00 99.99  ? 777 ARG C NH1 1  
ATOM 5704   N NH2 . ARG A 1 773 ? -101.084 -19.776 25.348  1.00 99.99  ? 777 ARG C NH2 1  
ATOM 5705   N N   . LEU A 1 774 ? -105.189 -12.320 27.967  1.00 30.00  ? 778 LEU C N   1  
ATOM 5706   C CA  . LEU A 1 774 ? -105.794 -11.504 28.991  1.00 30.00  ? 778 LEU C CA  1  
ATOM 5707   C C   . LEU A 1 774 ? -107.250 -11.188 28.674  1.00 30.00  ? 778 LEU C C   1  
ATOM 5708   O O   . LEU A 1 774 ? -108.059 -10.964 29.576  1.00 30.00  ? 778 LEU C O   1  
ATOM 5709   C CB  . LEU A 1 774 ? -105.036 -10.187 29.119  1.00 99.99  ? 778 LEU C CB  1  
ATOM 5710   C CG  . LEU A 1 774 ? -103.989 -10.303 30.223  1.00 99.99  ? 778 LEU C CG  1  
ATOM 5711   C CD1 . LEU A 1 774 ? -103.466 -8.914  30.577  1.00 99.99  ? 778 LEU C CD1 1  
ATOM 5712   C CD2 . LEU A 1 774 ? -104.624 -10.938 31.458  1.00 99.99  ? 778 LEU C CD2 1  
ATOM 5713   N N   . SER A 1 775 ? -107.603 -11.161 27.396  1.00 30.00  ? 779 SER C N   1  
ATOM 5714   C CA  . SER A 1 775 ? -108.987 -10.865 27.057  1.00 30.00  ? 779 SER C CA  1  
ATOM 5715   C C   . SER A 1 775 ? -109.824 -12.104 27.308  1.00 30.00  ? 779 SER C C   1  
ATOM 5716   O O   . SER A 1 775 ? -110.878 -12.023 27.938  1.00 30.00  ? 779 SER C O   1  
ATOM 5717   C CB  . SER A 1 775 ? -109.087 -10.466 25.587  1.00 99.99  ? 779 SER C CB  1  
ATOM 5718   O OG  . SER A 1 775 ? -108.798 -11.598 24.766  1.00 99.99  ? 779 SER C OG  1  
ATOM 5719   N N   . LYS A 1 776 ? -109.350 -13.242 26.815  1.00 30.00  ? 780 LYS C N   1  
ATOM 5720   C CA  . LYS A 1 776 ? -110.039 -14.514 26.995  1.00 30.00  ? 780 LYS C CA  1  
ATOM 5721   C C   . LYS A 1 776 ? -110.339 -14.690 28.480  1.00 30.00  ? 780 LYS C C   1  
ATOM 5722   O O   . LYS A 1 776 ? -111.493 -14.683 28.906  1.00 30.00  ? 780 LYS C O   1  
ATOM 5723   C CB  . LYS A 1 776 ? -109.156 -15.656 26.506  1.00 99.99  ? 780 LYS C CB  1  
ATOM 5724   C CG  . LYS A 1 776 ? -109.923 -16.969 26.605  1.00 99.99  ? 780 LYS C CG  1  
ATOM 5725   C CD  . LYS A 1 776 ? -109.247 -18.020 25.729  1.00 99.99  ? 780 LYS C CD  1  
ATOM 5726   C CE  . LYS A 1 776 ? -109.769 -19.403 26.102  1.00 99.99  ? 780 LYS C CE  1  
ATOM 5727   N NZ  . LYS A 1 776 ? -110.891 -19.758 25.222  1.00 99.99  ? 780 LYS C NZ  1  
ATOM 5728   N N   . ILE A 1 777 ? -109.283 -14.851 29.259  1.00 30.00  ? 781 ILE C N   1  
ATOM 5729   C CA  . ILE A 1 777 ? -109.405 -15.029 30.691  1.00 30.00  ? 781 ILE C CA  1  
ATOM 5730   C C   . ILE A 1 777 ? -110.475 -14.124 31.282  1.00 30.00  ? 781 ILE C C   1  
ATOM 5731   O O   . ILE A 1 777 ? -111.247 -14.550 32.142  1.00 30.00  ? 781 ILE C O   1  
ATOM 5732   C CB  . ILE A 1 777 ? -108.079 -14.703 31.369  1.00 99.99  ? 781 ILE C CB  1  
ATOM 5733   C CG1 . ILE A 1 777 ? -108.005 -13.206 31.649  1.00 99.99  ? 781 ILE C CG1 1  
ATOM 5734   C CG2 . ILE A 1 777 ? -106.929 -15.108 30.456  1.00 99.99  ? 781 ILE C CG2 1  
ATOM 5735   C CD1 . ILE A 1 777 ? -108.489 -12.928 33.069  1.00 99.99  ? 781 ILE C CD1 1  
ATOM 5736   N N   . ILE A 1 778 ? -110.530 -12.885 30.821  1.00 30.00  ? 782 ILE C N   1  
ATOM 5737   C CA  . ILE A 1 778 ? -111.523 -11.938 31.332  1.00 30.00  ? 782 ILE C CA  1  
ATOM 5738   C C   . ILE A 1 778 ? -112.913 -12.365 30.912  1.00 30.00  ? 782 ILE C C   1  
ATOM 5739   O O   . ILE A 1 778 ? -113.885 -12.128 31.614  1.00 30.00  ? 782 ILE C O   1  
ATOM 5740   C CB  . ILE A 1 778 ? -111.242 -10.544 30.781  1.00 99.99  ? 782 ILE C CB  1  
ATOM 5741   C CG1 . ILE A 1 778 ? -109.767 -10.211 30.966  1.00 99.99  ? 782 ILE C CG1 1  
ATOM 5742   C CG2 . ILE A 1 778 ? -112.091 -9.521  31.529  1.00 99.99  ? 782 ILE C CG2 1  
ATOM 5743   C CD1 . ILE A 1 778 ? -109.482 -9.969  32.445  1.00 99.99  ? 782 ILE C CD1 1  
ATOM 5744   N N   . SER A 1 779 ? -112.998 -12.980 29.747  1.00 30.00  ? 783 SER C N   1  
ATOM 5745   C CA  . SER A 1 779 ? -114.263 -13.447 29.227  1.00 30.00  ? 783 SER C CA  1  
ATOM 5746   C C   . SER A 1 779 ? -114.674 -14.658 30.056  1.00 30.00  ? 783 SER C C   1  
ATOM 5747   O O   . SER A 1 779 ? -115.821 -14.763 30.496  1.00 30.00  ? 783 SER C O   1  
ATOM 5748   C CB  . SER A 1 779 ? -114.111 -13.833 27.761  1.00 99.99  ? 783 SER C CB  1  
ATOM 5749   O OG  . SER A 1 779 ? -113.284 -14.993 27.653  1.00 99.99  ? 783 SER C OG  1  
ATOM 5750   N N   . MET A 1 780 ? -113.713 -15.565 30.266  1.00 30.00  ? 784 MET C N   1  
ATOM 5751   C CA  . MET A 1 780 ? -113.923 -16.788 31.026  1.00 30.00  ? 784 MET C CA  1  
ATOM 5752   C C   . MET A 1 780 ? -114.405 -16.543 32.431  1.00 30.00  ? 784 MET C C   1  
ATOM 5753   O O   . MET A 1 780 ? -115.097 -17.386 33.004  1.00 30.00  ? 784 MET C O   1  
ATOM 5754   C CB  . MET A 1 780 ? -112.619 -17.569 31.121  1.00 99.99  ? 784 MET C CB  1  
ATOM 5755   C CG  . MET A 1 780 ? -112.924 -19.053 31.285  1.00 99.99  ? 784 MET C CG  1  
ATOM 5756   S SD  . MET A 1 780 ? -113.766 -19.679 29.810  1.00 99.99  ? 784 MET C SD  1  
ATOM 5757   C CE  . MET A 1 780 ? -112.445 -19.556 28.623  1.00 99.99  ? 784 MET C CE  1  
ATOM 5758   N N   . PHE A 1 781 ? -114.050 -15.401 32.995  1.00 30.00  ? 785 PHE C N   1  
ATOM 5759   C CA  . PHE A 1 781 ? -114.479 -15.060 34.338  1.00 30.00  ? 785 PHE C CA  1  
ATOM 5760   C C   . PHE A 1 781 ? -115.838 -14.389 34.235  1.00 30.00  ? 785 PHE C C   1  
ATOM 5761   O O   . PHE A 1 781 ? -116.579 -14.265 35.215  1.00 30.00  ? 785 PHE C O   1  
ATOM 5762   C CB  . PHE A 1 781 ? -113.469 -14.115 34.979  1.00 99.99  ? 785 PHE C CB  1  
ATOM 5763   C CG  . PHE A 1 781 ? -113.920 -13.769 36.379  1.00 99.99  ? 785 PHE C CG  1  
ATOM 5764   C CD1 . PHE A 1 781 ? -113.638 -14.635 37.440  1.00 99.99  ? 785 PHE C CD1 1  
ATOM 5765   C CD2 . PHE A 1 781 ? -114.624 -12.581 36.613  1.00 99.99  ? 785 PHE C CD2 1  
ATOM 5766   C CE1 . PHE A 1 781 ? -114.055 -14.315 38.736  1.00 99.99  ? 785 PHE C CE1 1  
ATOM 5767   C CE2 . PHE A 1 781 ? -115.042 -12.260 37.911  1.00 99.99  ? 785 PHE C CE2 1  
ATOM 5768   C CZ  . PHE A 1 781 ? -114.758 -13.127 38.972  1.00 99.99  ? 785 PHE C CZ  1  
ATOM 5769   N N   . GLN A 1 782 ? -116.165 -13.933 33.036  1.00 30.00  ? 786 GLN C N   1  
ATOM 5770   C CA  . GLN A 1 782 ? -117.448 -13.295 32.826  1.00 30.00  ? 786 GLN C CA  1  
ATOM 5771   C C   . GLN A 1 782 ? -118.412 -14.439 32.523  1.00 30.00  ? 786 GLN C C   1  
ATOM 5772   O O   . GLN A 1 782 ? -119.591 -14.379 32.862  1.00 30.00  ? 786 GLN C O   1  
ATOM 5773   C CB  . GLN A 1 782 ? -117.353 -12.316 31.661  1.00 99.99  ? 786 GLN C CB  1  
ATOM 5774   C CG  . GLN A 1 782 ? -118.437 -11.252 31.803  1.00 99.99  ? 786 GLN C CG  1  
ATOM 5775   C CD  . GLN A 1 782 ? -119.754 -11.729 31.210  1.00 99.99  ? 786 GLN C CD  1  
ATOM 5776   O OE1 . GLN A 1 782 ? -119.843 -12.844 30.703  1.00 99.99  ? 786 GLN C OE1 1  
ATOM 5777   N NE2 . GLN A 1 782 ? -120.782 -10.878 31.276  1.00 99.99  ? 786 GLN C NE2 1  
ATOM 5778   N N   . ALA A 1 783 ? -117.882 -15.483 31.892  1.00 30.00  ? 787 ALA C N   1  
ATOM 5779   C CA  . ALA A 1 783 ? -118.648 -16.668 31.549  1.00 30.00  ? 787 ALA C CA  1  
ATOM 5780   C C   . ALA A 1 783 ? -119.010 -17.300 32.882  1.00 30.00  ? 787 ALA C C   1  
ATOM 5781   O O   . ALA A 1 783 ? -120.153 -17.707 33.109  1.00 30.00  ? 787 ALA C O   1  
ATOM 5782   C CB  . ALA A 1 783 ? -117.792 -17.622 30.742  1.00 30.00  ? 787 ALA C CB  1  
ATOM 5783   N N   . HIS A 1 784 ? -118.009 -17.370 33.753  1.00 30.00  ? 788 HIS C N   1  
ATOM 5784   C CA  . HIS A 1 784 ? -118.148 -17.932 35.094  1.00 30.00  ? 788 HIS C CA  1  
ATOM 5785   C C   . HIS A 1 784 ? -119.202 -17.179 35.874  1.00 30.00  ? 788 HIS C C   1  
ATOM 5786   O O   . HIS A 1 784 ? -119.907 -17.759 36.693  1.00 30.00  ? 788 HIS C O   1  
ATOM 5787   C CB  . HIS A 1 784 ? -116.821 -17.836 35.837  1.00 99.99  ? 788 HIS C CB  1  
ATOM 5788   C CG  . HIS A 1 784 ? -116.759 -18.588 37.143  1.00 99.99  ? 788 HIS C CG  1  
ATOM 5789   N ND1 . HIS A 1 784 ? -116.492 -17.953 38.350  1.00 99.99  ? 788 HIS C ND1 1  
ATOM 5790   C CD2 . HIS A 1 784 ? -116.931 -19.906 37.428  1.00 99.99  ? 788 HIS C CD2 1  
ATOM 5791   C CE1 . HIS A 1 784 ? -116.507 -18.868 39.303  1.00 99.99  ? 788 HIS C CE1 1  
ATOM 5792   N NE2 . HIS A 1 784 ? -116.767 -20.035 38.771  1.00 99.99  ? 788 HIS C NE2 1  
ATOM 5793   N N   . ILE A 1 785 ? -119.291 -15.876 35.632  1.00 30.00  ? 789 ILE C N   1  
ATOM 5794   C CA  . ILE A 1 785 ? -120.271 -15.050 36.318  1.00 30.00  ? 789 ILE C CA  1  
ATOM 5795   C C   . ILE A 1 785 ? -121.641 -15.258 35.678  1.00 30.00  ? 789 ILE C C   1  
ATOM 5796   O O   . ILE A 1 785 ? -122.677 -15.138 36.336  1.00 30.00  ? 789 ILE C O   1  
ATOM 5797   C CB  . ILE A 1 785 ? -119.876 -13.583 36.215  1.00 99.99  ? 789 ILE C CB  1  
ATOM 5798   C CG1 . ILE A 1 785 ? -120.422 -13.002 34.915  1.00 99.99  ? 789 ILE C CG1 1  
ATOM 5799   C CG2 . ILE A 1 785 ? -118.357 -13.462 36.226  1.00 99.99  ? 789 ILE C CG2 1  
ATOM 5800   C CD1 . ILE A 1 785 ? -121.769 -12.338 35.183  1.00 99.99  ? 789 ILE C CD1 1  
ATOM 5801   N N   . ARG A 1 786 ? -121.647 -15.568 34.390  1.00 30.00  ? 790 ARG C N   1  
ATOM 5802   C CA  . ARG A 1 786 ? -122.898 -15.783 33.688  1.00 30.00  ? 790 ARG C CA  1  
ATOM 5803   C C   . ARG A 1 786 ? -123.483 -17.104 34.135  1.00 30.00  ? 790 ARG C C   1  
ATOM 5804   O O   . ARG A 1 786 ? -124.680 -17.208 34.378  1.00 30.00  ? 790 ARG C O   1  
ATOM 5805   C CB  . ARG A 1 786 ? -122.653 -15.807 32.184  1.00 99.99  ? 790 ARG C CB  1  
ATOM 5806   C CG  . ARG A 1 786 ? -122.433 -14.384 31.678  1.00 99.99  ? 790 ARG C CG  1  
ATOM 5807   C CD  . ARG A 1 786 ? -122.238 -14.405 30.168  1.00 99.99  ? 790 ARG C CD  1  
ATOM 5808   N NE  . ARG A 1 786 ? -121.926 -13.051 29.655  1.00 99.99  ? 790 ARG C NE  1  
ATOM 5809   C CZ  . ARG A 1 786 ? -122.864 -12.195 29.260  1.00 99.99  ? 790 ARG C CZ  1  
ATOM 5810   N NH1 . ARG A 1 786 ? -124.160 -12.499 29.298  1.00 99.99  ? 790 ARG C NH1 1  
ATOM 5811   N NH2 . ARG A 1 786 ? -122.475 -11.004 28.818  1.00 99.99  ? 790 ARG C NH2 1  
ATOM 5812   N N   . GLY A 1 787 ? -122.613 -18.109 34.245  1.00 30.00  ? 791 GLY C N   1  
ATOM 5813   C CA  . GLY A 1 787 ? -123.033 -19.429 34.667  1.00 30.00  ? 791 GLY C CA  1  
ATOM 5814   C C   . GLY A 1 787 ? -123.437 -19.485 36.129  1.00 30.00  ? 791 GLY C C   1  
ATOM 5815   O O   . GLY A 1 787 ? -124.278 -20.293 36.503  1.00 30.00  ? 791 GLY C O   1  
ATOM 5816   N N   . TYR A 1 788 ? -122.851 -18.635 36.963  1.00 30.00  ? 792 TYR C N   1  
ATOM 5817   C CA  . TYR A 1 788 ? -123.187 -18.628 38.384  1.00 30.00  ? 792 TYR C CA  1  
ATOM 5818   C C   . TYR A 1 788 ? -124.586 -18.084 38.567  1.00 30.00  ? 792 TYR C C   1  
ATOM 5819   O O   . TYR A 1 788 ? -125.400 -18.699 39.249  1.00 30.00  ? 792 TYR C O   1  
ATOM 5820   C CB  . TYR A 1 788 ? -122.200 -17.752 39.146  1.00 99.99  ? 792 TYR C CB  1  
ATOM 5821   C CG  . TYR A 1 788 ? -122.903 -16.510 39.638  1.00 99.99  ? 792 TYR C CG  1  
ATOM 5822   C CD1 . TYR A 1 788 ? -124.025 -16.024 38.955  1.00 99.99  ? 792 TYR C CD1 1  
ATOM 5823   C CD2 . TYR A 1 788 ? -122.435 -15.844 40.777  1.00 99.99  ? 792 TYR C CD2 1  
ATOM 5824   C CE1 . TYR A 1 788 ? -124.677 -14.874 39.410  1.00 99.99  ? 792 TYR C CE1 1  
ATOM 5825   C CE2 . TYR A 1 788 ? -123.086 -14.692 41.231  1.00 99.99  ? 792 TYR C CE2 1  
ATOM 5826   C CZ  . TYR A 1 788 ? -124.209 -14.206 40.549  1.00 99.99  ? 792 TYR C CZ  1  
ATOM 5827   O OH  . TYR A 1 788 ? -124.844 -13.088 40.992  1.00 99.99  ? 792 TYR C OH  1  
ATOM 5828   N N   . LEU A 1 789 ? -124.858 -16.931 37.961  1.00 30.00  ? 793 LEU C N   1  
ATOM 5829   C CA  . LEU A 1 789 ? -126.170 -16.291 38.056  1.00 30.00  ? 793 LEU C CA  1  
ATOM 5830   C C   . LEU A 1 789 ? -127.291 -17.180 37.505  1.00 30.00  ? 793 LEU C C   1  
ATOM 5831   O O   . LEU A 1 789 ? -128.399 -17.223 38.064  1.00 30.00  ? 793 LEU C O   1  
ATOM 5832   C CB  . LEU A 1 789 ? -126.171 -14.990 37.259  1.00 99.99  ? 793 LEU C CB  1  
ATOM 5833   C CG  . LEU A 1 789 ? -127.573 -14.393 37.262  1.00 99.99  ? 793 LEU C CG  1  
ATOM 5834   C CD1 . LEU A 1 789 ? -127.587 -13.131 36.405  1.00 99.99  ? 793 LEU C CD1 1  
ATOM 5835   C CD2 . LEU A 1 789 ? -128.560 -15.404 36.693  1.00 99.99  ? 793 LEU C CD2 1  
ATOM 5836   N N   . ILE A 1 790 ? -127.014 -17.888 36.409  1.00 30.00  ? 794 ILE C N   1  
ATOM 5837   C CA  . ILE A 1 790 ? -128.004 -18.781 35.814  1.00 30.00  ? 794 ILE C CA  1  
ATOM 5838   C C   . ILE A 1 790 ? -128.334 -19.852 36.864  1.00 30.00  ? 794 ILE C C   1  
ATOM 5839   O O   . ILE A 1 790 ? -129.445 -19.890 37.384  1.00 30.00  ? 794 ILE C O   1  
ATOM 5840   C CB  . ILE A 1 790 ? -127.428 -19.425 34.556  1.00 99.99  ? 794 ILE C CB  1  
ATOM 5841   C CG1 . ILE A 1 790 ? -126.648 -20.679 34.939  1.00 99.99  ? 794 ILE C CG1 1  
ATOM 5842   C CG2 . ILE A 1 790 ? -126.493 -18.439 33.862  1.00 99.99  ? 794 ILE C CG2 1  
ATOM 5843   C CD1 . ILE A 1 790 ? -127.556 -21.899 34.816  1.00 99.99  ? 794 ILE C CD1 1  
ATOM 5844   N N   . ARG A 1 791 ? -127.360 -20.701 37.181  1.00 30.00  ? 795 ARG C N   1  
ATOM 5845   C CA  . ARG A 1 791 ? -127.525 -21.781 38.164  1.00 30.00  ? 795 ARG C CA  1  
ATOM 5846   C C   . ARG A 1 791 ? -128.113 -21.332 39.510  1.00 30.00  ? 795 ARG C C   1  
ATOM 5847   O O   . ARG A 1 791 ? -128.768 -22.108 40.211  1.00 30.00  ? 795 ARG C O   1  
ATOM 5848   C CB  . ARG A 1 791 ? -126.174 -22.418 38.465  1.00 99.99  ? 795 ARG C CB  1  
ATOM 5849   C CG  . ARG A 1 791 ? -125.709 -23.224 37.258  1.00 99.99  ? 795 ARG C CG  1  
ATOM 5850   C CD  . ARG A 1 791 ? -124.621 -24.205 37.686  1.00 99.99  ? 795 ARG C CD  1  
ATOM 5851   N NE  . ARG A 1 791 ? -123.380 -23.487 38.050  1.00 99.99  ? 795 ARG C NE  1  
ATOM 5852   C CZ  . ARG A 1 791 ? -122.492 -23.073 37.151  1.00 99.99  ? 795 ARG C CZ  1  
ATOM 5853   N NH1 . ARG A 1 791 ? -122.662 -23.278 35.848  1.00 99.99  ? 795 ARG C NH1 1  
ATOM 5854   N NH2 . ARG A 1 791 ? -121.406 -22.439 37.588  1.00 99.99  ? 795 ARG C NH2 1  
ATOM 5855   N N   . LYS A 1 792 ? -127.880 -20.080 39.875  1.00 30.00  ? 796 LYS C N   1  
ATOM 5856   C CA  . LYS A 1 792 ? -128.398 -19.564 41.125  1.00 30.00  ? 796 LYS C CA  1  
ATOM 5857   C C   . LYS A 1 792 ? -129.917 -19.548 41.038  1.00 30.00  ? 796 LYS C C   1  
ATOM 5858   O O   . LYS A 1 792 ? -130.618 -19.871 41.991  1.00 30.00  ? 796 LYS C O   1  
ATOM 5859   C CB  . LYS A 1 792 ? -127.874 -18.152 41.360  1.00 99.99  ? 796 LYS C CB  1  
ATOM 5860   C CG  . LYS A 1 792 ? -128.344 -17.654 42.721  1.00 99.99  ? 796 LYS C CG  1  
ATOM 5861   C CD  . LYS A 1 792 ? -127.486 -16.469 43.154  1.00 99.99  ? 796 LYS C CD  1  
ATOM 5862   C CE  . LYS A 1 792 ? -128.168 -15.742 44.308  1.00 99.99  ? 796 LYS C CE  1  
ATOM 5863   N NZ  . LYS A 1 792 ? -127.648 -16.255 45.585  1.00 99.99  ? 796 LYS C NZ  1  
ATOM 5864   N N   . ALA A 1 793 ? -130.420 -19.149 39.885  1.00 30.00  ? 797 ALA C N   1  
ATOM 5865   C CA  . ALA A 1 793 ? -131.851 -19.107 39.692  1.00 30.00  ? 797 ALA C CA  1  
ATOM 5866   C C   . ALA A 1 793 ? -132.222 -20.394 38.963  1.00 30.00  ? 797 ALA C C   1  
ATOM 5867   O O   . ALA A 1 793 ? -132.481 -20.393 37.765  1.00 30.00  ? 797 ALA C O   1  
ATOM 5868   C CB  . ALA A 1 793 ? -132.229 -17.890 38.860  1.00 30.00  ? 797 ALA C CB  1  
ATOM 5869   N N   . TYR A 1 794 ? -132.228 -21.503 39.689  1.00 30.00  ? 798 TYR C N   1  
ATOM 5870   C CA  . TYR A 1 794 ? -132.584 -22.784 39.088  1.00 30.00  ? 798 TYR C CA  1  
ATOM 5871   C C   . TYR A 1 794 ? -133.692 -23.380 39.916  1.00 30.00  ? 798 TYR C C   1  
ATOM 5872   O O   . TYR A 1 794 ? -134.551 -24.093 39.399  1.00 30.00  ? 798 TYR C O   1  
ATOM 5873   C CB  . TYR A 1 794 ? -131.370 -23.709 39.083  1.00 99.99  ? 798 TYR C CB  1  
ATOM 5874   C CG  . TYR A 1 794 ? -131.746 -25.031 38.458  1.00 99.99  ? 798 TYR C CG  1  
ATOM 5875   C CD1 . TYR A 1 794 ? -131.743 -25.174 37.067  1.00 99.99  ? 798 TYR C CD1 1  
ATOM 5876   C CD2 . TYR A 1 794 ? -132.099 -26.115 39.272  1.00 99.99  ? 798 TYR C CD2 1  
ATOM 5877   C CE1 . TYR A 1 794 ? -132.090 -26.401 36.485  1.00 99.99  ? 798 TYR C CE1 1  
ATOM 5878   C CE2 . TYR A 1 794 ? -132.448 -27.341 38.693  1.00 99.99  ? 798 TYR C CE2 1  
ATOM 5879   C CZ  . TYR A 1 794 ? -132.442 -27.483 37.299  1.00 99.99  ? 798 TYR C CZ  1  
ATOM 5880   O OH  . TYR A 1 794 ? -132.782 -28.674 36.737  1.00 99.99  ? 798 TYR C OH  1  
ATOM 5881   N N   . LYS A 1 795 ? -133.654 -23.097 41.211  1.00 30.00  ? 799 LYS C N   1  
ATOM 5882   C CA  . LYS A 1 795 ? -134.672 -23.590 42.112  1.00 30.00  ? 799 LYS C CA  1  
ATOM 5883   C C   . LYS A 1 795 ? -135.895 -22.802 41.680  1.00 30.00  ? 799 LYS C C   1  
ATOM 5884   O O   . LYS A 1 795 ? -136.935 -23.366 41.347  1.00 30.00  ? 799 LYS C O   1  
ATOM 5885   C CB  . LYS A 1 795 ? -134.268 -23.309 43.556  1.00 99.99  ? 799 LYS C CB  1  
ATOM 5886   C CG  . LYS A 1 795 ? -135.298 -23.920 44.501  1.00 99.99  ? 799 LYS C CG  1  
ATOM 5887   C CD  . LYS A 1 795 ? -134.697 -24.038 45.897  1.00 99.99  ? 799 LYS C CD  1  
ATOM 5888   C CE  . LYS A 1 795 ? -135.811 -24.290 46.909  1.00 99.99  ? 799 LYS C CE  1  
ATOM 5889   N NZ  . LYS A 1 795 ? -135.960 -25.736 47.125  1.00 99.99  ? 799 LYS C NZ  1  
ATOM 5890   N N   . LYS A 1 796 ? -135.747 -21.481 41.675  1.00 30.00  ? 800 LYS C N   1  
ATOM 5891   C CA  . LYS A 1 796 ? -136.829 -20.593 41.287  1.00 30.00  ? 800 LYS C CA  1  
ATOM 5892   C C   . LYS A 1 796 ? -137.477 -21.012 39.969  1.00 30.00  ? 800 LYS C C   1  
ATOM 5893   O O   . LYS A 1 796 ? -138.597 -20.628 39.683  1.00 30.00  ? 800 LYS C O   1  
ATOM 5894   C CB  . LYS A 1 796 ? -136.301 -19.172 41.118  1.00 99.99  ? 800 LYS C CB  1  
ATOM 5895   C CG  . LYS A 1 796 ? -137.459 -18.232 40.808  1.00 99.99  ? 800 LYS C CG  1  
ATOM 5896   C CD  . LYS A 1 796 ? -137.032 -16.792 41.077  1.00 99.99  ? 800 LYS C CD  1  
ATOM 5897   C CE  . LYS A 1 796 ? -138.028 -15.838 40.429  1.00 99.99  ? 800 LYS C CE  1  
ATOM 5898   N NZ  . LYS A 1 796 ? -139.048 -15.449 41.415  1.00 99.99  ? 800 LYS C NZ  1  
ATOM 5899   N N   . LEU A 1 797 ? -136.205 -21.805 38.732  1.00 30.00  ? 801 LEU C N   1  
ATOM 5900   C CA  . LEU A 1 797 ? -137.311 -22.247 37.890  1.00 30.00  ? 801 LEU C CA  1  
ATOM 5901   C C   . LEU A 1 797 ? -137.859 -23.634 38.199  1.00 30.00  ? 801 LEU C C   1  
ATOM 5902   O O   . LEU A 1 797 ? -138.809 -24.087 37.561  1.00 30.00  ? 801 LEU C O   1  
ATOM 5903   C CB  . LEU A 1 797 ? -136.865 -22.284 36.431  1.00 99.99  ? 801 LEU C CB  1  
ATOM 5904   C CG  . LEU A 1 797 ? -137.242 -20.973 35.752  1.00 99.99  ? 801 LEU C CG  1  
ATOM 5905   C CD1 . LEU A 1 797 ? -137.106 -21.126 34.239  1.00 99.99  ? 801 LEU C CD1 1  
ATOM 5906   C CD2 . LEU A 1 797 ? -138.684 -20.615 36.099  1.00 99.99  ? 801 LEU C CD2 1  
ATOM 5907   N N   . GLN A 1 798 ? -137.264 -24.322 39.160  1.00 30.00  ? 802 GLN C N   1  
ATOM 5908   C CA  . GLN A 1 798 ? -137.742 -25.649 39.521  1.00 30.00  ? 802 GLN C CA  1  
ATOM 5909   C C   . GLN A 1 798 ? -138.527 -25.441 40.793  1.00 30.00  ? 802 GLN C C   1  
ATOM 5910   O O   . GLN A 1 798 ? -139.617 -25.989 40.966  1.00 30.00  ? 802 GLN C O   1  
ATOM 5911   C CB  . GLN A 1 798 ? -136.558 -26.585 39.739  1.00 99.99  ? 802 GLN C CB  1  
ATOM 5912   C CG  . GLN A 1 798 ? -135.869 -26.856 38.406  1.00 99.99  ? 802 GLN C CG  1  
ATOM 5913   C CD  . GLN A 1 798 ? -136.719 -27.760 37.523  1.00 99.99  ? 802 GLN C CD  1  
ATOM 5914   O OE1 . GLN A 1 798 ? -137.807 -28.172 37.919  1.00 99.99  ? 802 GLN C OE1 1  
ATOM 5915   N NE2 . GLN A 1 798 ? -136.218 -28.067 36.326  1.00 99.99  ? 802 GLN C NE2 1  
ATOM 5916   N N   . ASP A 1 799 ? -138.173 -24.607 41.414  1.00 30.00  ? 803 ASP C N   1  
ATOM 5917   C CA  . ASP A 1 799 ? -138.769 -24.390 42.723  1.00 30.00  ? 803 ASP C CA  1  
ATOM 5918   C C   . ASP A 1 799 ? -140.143 -23.773 42.547  1.00 30.00  ? 803 ASP C C   1  
ATOM 5919   O O   . ASP A 1 799 ? -141.107 -24.139 43.222  1.00 30.00  ? 803 ASP C O   1  
ATOM 5920   C CB  . ASP A 1 799 ? -137.892 -23.449 43.542  1.00 99.99  ? 803 ASP C CB  1  
ATOM 5921   C CG  . ASP A 1 799 ? -137.824 -22.088 42.857  1.00 99.99  ? 803 ASP C CG  1  
ATOM 5922   O OD1 . ASP A 1 799 ? -137.015 -21.963 41.900  1.00 99.99  ? 803 ASP C OD1 1  
ATOM 5923   O OD2 . ASP A 1 799 ? -138.582 -21.181 43.297  1.00 99.99  ? 803 ASP C OD2 1  
ATOM 5924   N N   . GLN A 1 800 ? -140.226 -22.821 41.636  1.00 30.00  ? 804 GLN C N   1  
ATOM 5925   C CA  . GLN A 1 800 ? -141.489 -22.177 41.410  1.00 30.00  ? 804 GLN C CA  1  
ATOM 5926   C C   . GLN A 1 800 ? -142.410 -23.145 40.690  1.00 30.00  ? 804 GLN C C   1  
ATOM 5927   O O   . GLN A 1 800 ? -143.623 -23.051 40.837  1.00 30.00  ? 804 GLN C O   1  
ATOM 5928   C CB  . GLN A 1 800 ? -141.290 -20.928 40.556  1.00 99.99  ? 804 GLN C CB  1  
ATOM 5929   C CG  . GLN A 1 800 ? -142.438 -19.954 40.800  1.00 99.99  ? 804 GLN C CG  1  
ATOM 5930   C CD  . GLN A 1 800 ? -143.633 -20.284 39.920  1.00 99.99  ? 804 GLN C CD  1  
ATOM 5931   O OE1 . GLN A 1 800 ? -143.589 -21.232 39.139  1.00 99.99  ? 804 GLN C OE1 1  
ATOM 5932   N NE2 . GLN A 1 800 ? -144.703 -19.495 40.046  1.00 99.99  ? 804 GLN C NE2 1  
ATOM 5933   N N   . ARG A 1 801 ? -141.858 -24.089 39.930  1.00 30.00  ? 805 ARG C N   1  
ATOM 5934   C CA  . ARG A 1 801 ? -142.726 -25.039 39.227  1.00 30.00  ? 805 ARG C CA  1  
ATOM 5935   C C   . ARG A 1 801 ? -143.452 -25.964 40.209  1.00 30.00  ? 805 ARG C C   1  
ATOM 5936   O O   . ARG A 1 801 ? -144.548 -26.465 39.936  1.00 30.00  ? 805 ARG C O   1  
ATOM 5937   C CB  . ARG A 1 801 ? -141.892 -25.900 38.282  1.00 99.99  ? 805 ARG C CB  1  
ATOM 5938   C CG  . ARG A 1 801 ? -142.807 -26.852 37.520  1.00 99.99  ? 805 ARG C CG  1  
ATOM 5939   C CD  . ARG A 1 801 ? -141.968 -27.746 36.612  1.00 99.99  ? 805 ARG C CD  1  
ATOM 5940   N NE  . ARG A 1 801 ? -140.838 -28.344 37.356  1.00 99.99  ? 805 ARG C NE  1  
ATOM 5941   C CZ  . ARG A 1 801 ? -140.973 -29.406 38.148  1.00 99.99  ? 805 ARG C CZ  1  
ATOM 5942   N NH1 . ARG A 1 801 ? -142.144 -30.008 38.327  1.00 99.99  ? 805 ARG C NH1 1  
ATOM 5943   N NH2 . ARG A 1 801 ? -139.888 -29.862 38.769  1.00 99.99  ? 805 ARG C NH2 1  
ATOM 5944   N N   . ILE A 1 802 ? -142.806 -26.181 41.349  1.00 30.00  ? 806 ILE C N   1  
ATOM 5945   C CA  . ILE A 1 802 ? -143.330 -27.018 42.412  1.00 30.00  ? 806 ILE C CA  1  
ATOM 5946   C C   . ILE A 1 802 ? -144.242 -26.119 43.237  1.00 30.00  ? 806 ILE C C   1  
ATOM 5947   O O   . ILE A 1 802 ? -145.426 -26.400 43.392  1.00 30.00  ? 806 ILE C O   1  
ATOM 5948   C CB  . ILE A 1 802 ? -142.185 -27.563 43.257  1.00 99.99  ? 806 ILE C CB  1  
ATOM 5949   C CG1 . ILE A 1 802 ? -141.826 -26.555 44.342  1.00 99.99  ? 806 ILE C CG1 1  
ATOM 5950   C CG2 . ILE A 1 802 ? -140.968 -27.805 42.368  1.00 99.99  ? 806 ILE C CG2 1  
ATOM 5951   C CD1 . ILE A 1 802 ? -142.574 -26.902 45.625  1.00 99.99  ? 806 ILE C CD1 1  
ATOM 5952   N N   . GLY A 1 803 ? -143.674 -25.027 43.747  1.00 30.00  ? 807 GLY C N   1  
ATOM 5953   C CA  . GLY A 1 803 ? -144.427 -24.083 44.550  1.00 30.00  ? 807 GLY C CA  1  
ATOM 5954   C C   . GLY A 1 803 ? -145.739 -23.630 43.922  1.00 30.00  ? 807 GLY C C   1  
ATOM 5955   O O   . GLY A 1 803 ? -146.584 -23.070 44.615  1.00 30.00  ? 807 GLY C O   1  
ATOM 5956   N N   . LEU A 1 804 ? -145.903 -23.853 42.619  1.00 30.00  ? 808 LEU C N   1  
ATOM 5957   C CA  . LEU A 1 804 ? -147.135 -23.464 41.916  1.00 30.00  ? 808 LEU C CA  1  
ATOM 5958   C C   . LEU A 1 804 ? -148.072 -24.656 41.875  1.00 30.00  ? 808 LEU C C   1  
ATOM 5959   O O   . LEU A 1 804 ? -149.288 -24.508 41.957  1.00 30.00  ? 808 LEU C O   1  
ATOM 5960   C CB  . LEU A 1 804 ? -146.803 -23.022 40.497  1.00 99.99  ? 808 LEU C CB  1  
ATOM 5961   C CG  . LEU A 1 804 ? -146.640 -21.508 40.457  1.00 99.99  ? 808 LEU C CG  1  
ATOM 5962   C CD1 . LEU A 1 804 ? -146.639 -21.032 39.008  1.00 99.99  ? 808 LEU C CD1 1  
ATOM 5963   C CD2 . LEU A 1 804 ? -147.794 -20.851 41.208  1.00 99.99  ? 808 LEU C CD2 1  
ATOM 5964   N N   . SER A 1 805 ? -147.496 -25.839 41.727  1.00 30.00  ? 809 SER C N   1  
ATOM 5965   C CA  . SER A 1 805 ? -148.286 -27.055 41.682  1.00 30.00  ? 809 SER C CA  1  
ATOM 5966   C C   . SER A 1 805 ? -148.919 -27.283 43.064  1.00 30.00  ? 809 SER C C   1  
ATOM 5967   O O   . SER A 1 805 ? -150.006 -27.849 43.171  1.00 30.00  ? 809 SER C O   1  
ATOM 5968   C CB  . SER A 1 805 ? -147.397 -28.238 41.320  1.00 99.99  ? 809 SER C CB  1  
ATOM 5969   O OG  . SER A 1 805 ? -146.488 -28.498 42.392  1.00 99.99  ? 809 SER C OG  1  
ATOM 5970   N N   . VAL A 1 806 ? -148.235 -26.843 44.118  1.00 30.00  ? 810 VAL C N   1  
ATOM 5971   C CA  . VAL A 1 806 ? -148.758 -26.973 45.466  1.00 30.00  ? 810 VAL C CA  1  
ATOM 5972   C C   . VAL A 1 806 ? -150.062 -26.186 45.385  1.00 30.00  ? 810 VAL C C   1  
ATOM 5973   O O   . VAL A 1 806 ? -151.150 -26.764 45.341  1.00 30.00  ? 810 VAL C O   1  
ATOM 5974   C CB  . VAL A 1 806 ? -147.772 -26.382 46.466  1.00 99.99  ? 810 VAL C CB  1  
ATOM 5975   C CG1 . VAL A 1 806 ? -146.442 -27.125 46.370  1.00 99.99  ? 810 VAL C CG1 1  
ATOM 5976   C CG2 . VAL A 1 806 ? -147.553 -24.907 46.153  1.00 99.99  ? 810 VAL C CG2 1  
ATOM 5977   N N   . ILE A 1 807 ? -149.929 -24.860 45.337  1.00 30.00  ? 811 ILE C N   1  
ATOM 5978   C CA  . ILE A 1 807 ? -151.045 -23.914 45.261  1.00 30.00  ? 811 ILE C CA  1  
ATOM 5979   C C   . ILE A 1 807 ? -152.153 -24.267 44.272  1.00 30.00  ? 811 ILE C C   1  
ATOM 5980   O O   . ILE A 1 807 ? -153.331 -24.119 44.581  1.00 30.00  ? 811 ILE C O   1  
ATOM 5981   C CB  . ILE A 1 807 ? -150.532 -22.539 44.843  1.00 99.99  ? 811 ILE C CB  1  
ATOM 5982   C CG1 . ILE A 1 807 ? -150.470 -22.461 43.323  1.00 99.99  ? 811 ILE C CG1 1  
ATOM 5983   C CG2 . ILE A 1 807 ? -149.138 -22.320 45.422  1.00 99.99  ? 811 ILE C CG2 1  
ATOM 5984   C CD1 . ILE A 1 807 ? -151.759 -21.837 42.795  1.00 99.99  ? 811 ILE C CD1 1  
ATOM 5985   N N   . GLN A 1 808 ? -151.786 -24.734 43.085  1.00 30.00  ? 812 GLN C N   1  
ATOM 5986   C CA  . GLN A 1 808 ? -152.787 -25.084 42.085  1.00 30.00  ? 812 GLN C CA  1  
ATOM 5987   C C   . GLN A 1 808 ? -153.584 -26.319 42.475  1.00 30.00  ? 812 GLN C C   1  
ATOM 5988   O O   . GLN A 1 808 ? -154.802 -26.345 42.318  1.00 30.00  ? 812 GLN C O   1  
ATOM 5989   C CB  . GLN A 1 808 ? -152.107 -25.369 40.749  1.00 99.99  ? 812 GLN C CB  1  
ATOM 5990   C CG  . GLN A 1 808 ? -153.102 -25.146 39.614  1.00 99.99  ? 812 GLN C CG  1  
ATOM 5991   C CD  . GLN A 1 808 ? -153.945 -26.392 39.374  1.00 99.99  ? 812 GLN C CD  1  
ATOM 5992   O OE1 . GLN A 1 808 ? -153.777 -27.401 40.057  1.00 99.99  ? 812 GLN C OE1 1  
ATOM 5993   N NE2 . GLN A 1 808 ? -154.854 -26.317 38.399  1.00 99.99  ? 812 GLN C NE2 1  
ATOM 5994   N N   . ARG A 1 809 ? -152.900 -27.341 42.988  1.00 30.00  ? 813 ARG C N   1  
ATOM 5995   C CA  . ARG A 1 809 ? -153.568 -28.579 43.401  1.00 30.00  ? 813 ARG C CA  1  
ATOM 5996   C C   . ARG A 1 809 ? -154.248 -28.441 44.772  1.00 30.00  ? 813 ARG C C   1  
ATOM 5997   O O   . ARG A 1 809 ? -155.270 -29.077 45.044  1.00 30.00  ? 813 ARG C O   1  
ATOM 5998   C CB  . ARG A 1 809 ? -152.553 -29.712 43.489  1.00 99.99  ? 813 ARG C CB  1  
ATOM 5999   C CG  . ARG A 1 809 ? -151.919 -29.939 42.121  1.00 99.99  ? 813 ARG C CG  1  
ATOM 6000   C CD  . ARG A 1 809 ? -150.818 -30.987 42.238  1.00 99.99  ? 813 ARG C CD  1  
ATOM 6001   N NE  . ARG A 1 809 ? -149.611 -30.418 42.878  1.00 99.99  ? 813 ARG C NE  1  
ATOM 6002   C CZ  . ARG A 1 809 ? -148.534 -31.144 43.167  1.00 99.99  ? 813 ARG C CZ  1  
ATOM 6003   N NH1 . ARG A 1 809 ? -148.469 -32.442 42.897  1.00 99.99  ? 813 ARG C NH1 1  
ATOM 6004   N NH2 . ARG A 1 809 ? -147.504 -30.530 43.744  1.00 99.99  ? 813 ARG C NH2 1  
ATOM 6005   N N   . ASN A 1 810 ? -153.668 -27.608 45.625  1.00 30.00  ? 814 ASN C N   1  
ATOM 6006   C CA  . ASN A 1 810 ? -154.196 -27.390 46.960  1.00 30.00  ? 814 ASN C CA  1  
ATOM 6007   C C   . ASN A 1 810 ? -155.255 -26.307 47.093  1.00 30.00  ? 814 ASN C C   1  
ATOM 6008   O O   . ASN A 1 810 ? -155.652 -25.966 48.206  1.00 30.00  ? 814 ASN C O   1  
ATOM 6009   C CB  . ASN A 1 810 ? -153.068 -26.984 47.903  1.00 99.99  ? 814 ASN C CB  1  
ATOM 6010   C CG  . ASN A 1 810 ? -152.524 -25.605 47.550  1.00 99.99  ? 814 ASN C CG  1  
ATOM 6011   O OD1 . ASN A 1 810 ? -151.363 -25.474 47.170  1.00 99.99  ? 814 ASN C OD1 1  
ATOM 6012   N ND2 . ASN A 1 810 ? -153.369 -24.581 47.681  1.00 99.99  ? 814 ASN C ND2 1  
ATOM 6013   N N   . ILE A 1 811 ? -155.704 -25.739 45.987  1.00 30.00  ? 815 ILE C N   1  
ATOM 6014   C CA  . ILE A 1 811 ? -156.730 -24.715 46.070  1.00 30.00  ? 815 ILE C CA  1  
ATOM 6015   C C   . ILE A 1 811 ? -157.906 -25.425 45.421  1.00 30.00  ? 815 ILE C C   1  
ATOM 6016   O O   . ILE A 1 811 ? -159.059 -25.222 45.799  1.00 30.00  ? 815 ILE C O   1  
ATOM 6017   C CB  . ILE A 1 811 ? -156.281 -23.470 45.312  1.00 99.99  ? 815 ILE C CB  1  
ATOM 6018   C CG1 . ILE A 1 811 ? -157.441 -22.487 45.211  1.00 99.99  ? 815 ILE C CG1 1  
ATOM 6019   C CG2 . ILE A 1 811 ? -155.825 -23.865 43.910  1.00 99.99  ? 815 ILE C CG2 1  
ATOM 6020   C CD1 . ILE A 1 811 ? -158.166 -22.417 46.552  1.00 99.99  ? 815 ILE C CD1 1  
ATOM 6021   N N   . ARG A 1 812 ? -157.586 -26.284 44.450  1.00 30.00  ? 816 ARG C N   1  
ATOM 6022   C CA  . ARG A 1 812 ? -158.584 -27.061 43.737  1.00 30.00  ? 816 ARG C CA  1  
ATOM 6023   C C   . ARG A 1 812 ? -159.215 -28.031 44.734  1.00 30.00  ? 816 ARG C C   1  
ATOM 6024   O O   . ARG A 1 812 ? -160.340 -28.493 44.543  1.00 30.00  ? 816 ARG C O   1  
ATOM 6025   C CB  . ARG A 1 812 ? -157.924 -27.833 42.599  1.00 99.99  ? 816 ARG C CB  1  
ATOM 6026   C CG  . ARG A 1 812 ? -158.995 -28.526 41.766  1.00 99.99  ? 816 ARG C CG  1  
ATOM 6027   C CD  . ARG A 1 812 ? -158.365 -29.086 40.493  1.00 99.99  ? 816 ARG C CD  1  
ATOM 6028   N NE  . ARG A 1 812 ? -157.290 -30.048 40.813  1.00 99.99  ? 816 ARG C NE  1  
ATOM 6029   C CZ  . ARG A 1 812 ? -156.205 -30.203 40.058  1.00 99.99  ? 816 ARG C CZ  1  
ATOM 6030   N NH1 . ARG A 1 812 ? -156.013 -29.492 38.950  1.00 99.99  ? 816 ARG C NH1 1  
ATOM 6031   N NH2 . ARG A 1 812 ? -155.299 -31.097 40.440  1.00 99.99  ? 816 ARG C NH2 1  
ATOM 6032   N N   . LYS A 1 813 ? -158.472 -28.339 45.796  1.00 30.00  ? 817 LYS C N   1  
ATOM 6033   C CA  . LYS A 1 813 ? -158.945 -29.239 46.832  1.00 30.00  ? 817 LYS C CA  1  
ATOM 6034   C C   . LYS A 1 813 ? -159.951 -28.455 47.669  1.00 30.00  ? 817 LYS C C   1  
ATOM 6035   O O   . LYS A 1 813 ? -161.132 -28.805 47.717  1.00 30.00  ? 817 LYS C O   1  
ATOM 6036   C CB  . LYS A 1 813 ? -157.774 -29.704 47.692  1.00 99.99  ? 817 LYS C CB  1  
ATOM 6037   C CG  . LYS A 1 813 ? -158.266 -30.722 48.714  1.00 99.99  ? 817 LYS C CG  1  
ATOM 6038   C CD  . LYS A 1 813 ? -157.078 -31.507 49.259  1.00 99.99  ? 817 LYS C CD  1  
ATOM 6039   C CE  . LYS A 1 813 ? -157.499 -32.252 50.524  1.00 99.99  ? 817 LYS C CE  1  
ATOM 6040   N NZ  . LYS A 1 813 ? -157.915 -33.616 50.174  1.00 99.99  ? 817 LYS C NZ  1  
ATOM 6041   N N   . TRP A 1 814 ? -159.481 -27.395 48.316  1.00 30.00  ? 818 TRP C N   1  
ATOM 6042   C CA  . TRP A 1 814 ? -160.328 -26.538 49.150  1.00 30.00  ? 818 TRP C CA  1  
ATOM 6043   C C   . TRP A 1 814 ? -161.529 -26.023 48.364  1.00 30.00  ? 818 TRP C C   1  
ATOM 6044   O O   . TRP A 1 814 ? -162.517 -25.571 48.937  1.00 30.00  ? 818 TRP C O   1  
ATOM 6045   C CB  . TRP A 1 814 ? -159.521 -25.341 49.645  1.00 99.99  ? 818 TRP C CB  1  
ATOM 6046   C CG  . TRP A 1 814 ? -160.294 -24.363 50.501  1.00 99.99  ? 818 TRP C CG  1  
ATOM 6047   C CD1 . TRP A 1 814 ? -160.981 -24.637 51.619  1.00 99.99  ? 818 TRP C CD1 1  
ATOM 6048   C CD2 . TRP A 1 814 ? -160.440 -22.986 50.300  1.00 99.99  ? 818 TRP C CD2 1  
ATOM 6049   N NE1 . TRP A 1 814 ? -161.540 -23.405 52.078  1.00 99.99  ? 818 TRP C NE1 1  
ATOM 6050   C CE2 . TRP A 1 814 ? -161.188 -22.446 51.256  1.00 99.99  ? 818 TRP C CE2 1  
ATOM 6051   C CE3 . TRP A 1 814 ? -159.927 -22.175 49.281  1.00 99.99  ? 818 TRP C CE3 1  
ATOM 6052   C CZ2 . TRP A 1 814 ? -161.517 -21.086 51.330  1.00 99.99  ? 818 TRP C CZ2 1  
ATOM 6053   C CZ3 . TRP A 1 814 ? -160.245 -20.801 49.334  1.00 99.99  ? 818 TRP C CZ3 1  
ATOM 6054   C CH2 . TRP A 1 814 ? -161.005 -20.281 50.317  1.00 99.99  ? 818 TRP C CH2 1  
ATOM 6055   N N   . LEU A 1 815 ? -161.437 -26.102 47.044  1.00 30.00  ? 819 LEU C N   1  
ATOM 6056   C CA  . LEU A 1 815 ? -162.505 -25.652 46.159  1.00 30.00  ? 819 LEU C CA  1  
ATOM 6057   C C   . LEU A 1 815 ? -163.567 -26.737 46.039  1.00 30.00  ? 819 LEU C C   1  
ATOM 6058   O O   . LEU A 1 815 ? -164.768 -26.463 46.123  1.00 30.00  ? 819 LEU C O   1  
ATOM 6059   C CB  . LEU A 1 815 ? -161.938 -25.350 44.777  1.00 99.99  ? 819 LEU C CB  1  
ATOM 6060   C CG  . LEU A 1 815 ? -161.614 -23.863 44.675  1.00 99.99  ? 819 LEU C CG  1  
ATOM 6061   C CD1 . LEU A 1 815 ? -161.365 -23.498 43.215  1.00 99.99  ? 819 LEU C CD1 1  
ATOM 6062   C CD2 . LEU A 1 815 ? -162.783 -23.045 45.213  1.00 99.99  ? 819 LEU C CD2 1  
ATOM 6063   N N   . VAL A 1 816 ? -163.112 -27.966 45.837  1.00 30.00  ? 820 VAL C N   1  
ATOM 6064   C CA  . VAL A 1 816 ? -163.998 -29.111 45.694  1.00 30.00  ? 820 VAL C CA  1  
ATOM 6065   C C   . VAL A 1 816 ? -164.572 -29.582 47.050  1.00 30.00  ? 820 VAL C C   1  
ATOM 6066   O O   . VAL A 1 816 ? -165.621 -30.221 47.093  1.00 30.00  ? 820 VAL C O   1  
ATOM 6067   C CB  . VAL A 1 816 ? -163.240 -30.280 45.075  1.00 99.99  ? 820 VAL C CB  1  
ATOM 6068   C CG1 . VAL A 1 816 ? -162.717 -29.877 43.701  1.00 99.99  ? 820 VAL C CG1 1  
ATOM 6069   C CG2 . VAL A 1 816 ? -162.067 -30.659 45.975  1.00 99.99  ? 820 VAL C CG2 1  
ATOM 6070   N N   . LEU A 1 817 ? -163.884 -29.258 48.145  1.00 30.00  ? 821 LEU C N   1  
ATOM 6071   C CA  . LEU A 1 817 ? -164.330 -29.624 49.494  1.00 30.00  ? 821 LEU C CA  1  
ATOM 6072   C C   . LEU A 1 817 ? -165.521 -28.753 49.912  1.00 30.00  ? 821 LEU C C   1  
ATOM 6073   O O   . LEU A 1 817 ? -166.335 -29.158 50.742  1.00 30.00  ? 821 LEU C O   1  
ATOM 6074   C CB  . LEU A 1 817 ? -163.192 -29.422 50.489  1.00 99.99  ? 821 LEU C CB  1  
ATOM 6075   C CG  . LEU A 1 817 ? -162.447 -30.736 50.685  1.00 99.99  ? 821 LEU C CG  1  
ATOM 6076   C CD1 . LEU A 1 817 ? -161.538 -30.627 51.906  1.00 99.99  ? 821 LEU C CD1 1  
ATOM 6077   C CD2 . LEU A 1 817 ? -163.453 -31.865 50.898  1.00 99.99  ? 821 LEU C CD2 1  
ATOM 6078   N N   . ARG A 1 818 ? -165.615 -27.554 49.344  1.00 30.00  ? 822 ARG C N   1  
ATOM 6079   C CA  . ARG A 1 818 ? -166.704 -26.631 49.660  1.00 30.00  ? 822 ARG C CA  1  
ATOM 6080   C C   . ARG A 1 818 ? -167.917 -26.979 48.803  1.00 30.00  ? 822 ARG C C   1  
ATOM 6081   O O   . ARG A 1 818 ? -169.023 -26.498 49.043  1.00 30.00  ? 822 ARG C O   1  
ATOM 6082   C CB  . ARG A 1 818 ? -166.272 -25.198 49.370  1.00 99.99  ? 822 ARG C CB  1  
ATOM 6083   C CG  . ARG A 1 818 ? -165.335 -24.714 50.474  1.00 99.99  ? 822 ARG C CG  1  
ATOM 6084   C CD  . ARG A 1 818 ? -164.942 -23.267 50.208  1.00 99.99  ? 822 ARG C CD  1  
ATOM 6085   N NE  . ARG A 1 818 ? -163.959 -22.794 51.208  1.00 99.99  ? 822 ARG C NE  1  
ATOM 6086   C CZ  . ARG A 1 818 ? -164.313 -22.216 52.354  1.00 99.99  ? 822 ARG C CZ  1  
ATOM 6087   N NH1 . ARG A 1 818 ? -165.587 -22.021 52.682  1.00 99.99  ? 822 ARG C NH1 1  
ATOM 6088   N NH2 . ARG A 1 818 ? -163.345 -21.829 53.181  1.00 99.99  ? 822 ARG C NH2 1  
ATOM 6089   N N   . ASN A 1 819 ? -167.697 -27.820 47.797  1.00 30.00  ? 823 ASN C N   1  
ATOM 6090   C CA  . ASN A 1 819 ? -168.760 -28.258 46.904  1.00 30.00  ? 823 ASN C CA  1  
ATOM 6091   C C   . ASN A 1 819 ? -169.106 -29.701 47.287  1.00 30.00  ? 823 ASN C C   1  
ATOM 6092   O O   . ASN A 1 819 ? -169.440 -30.525 46.434  1.00 30.00  ? 823 ASN C O   1  
ATOM 6093   C CB  . ASN A 1 819 ? -168.285 -28.189 45.459  1.00 99.99  ? 823 ASN C CB  1  
ATOM 6094   C CG  . ASN A 1 819 ? -167.961 -26.756 45.054  1.00 99.99  ? 823 ASN C CG  1  
ATOM 6095   O OD1 . ASN A 1 819 ? -168.795 -25.866 45.197  1.00 99.99  ? 823 ASN C OD1 1  
ATOM 6096   N ND2 . ASN A 1 819 ? -166.747 -26.539 44.548  1.00 99.99  ? 823 ASN C ND2 1  
ATOM 6097   N N   . TRP A 1 820 ? -169.006 -29.979 48.584  1.00 30.00  ? 824 TRP C N   1  
ATOM 6098   C CA  . TRP A 1 820 ? -169.296 -31.299 49.165  1.00 30.00  ? 824 TRP C CA  1  
ATOM 6099   C C   . TRP A 1 820 ? -170.475 -31.159 50.114  1.00 30.00  ? 824 TRP C C   1  
ATOM 6100   O O   . TRP A 1 820 ? -170.378 -30.431 51.116  1.00 30.00  ? 824 TRP C O   1  
ATOM 6101   C CB  . TRP A 1 820 ? -168.076 -31.810 49.925  1.00 99.99  ? 824 TRP C CB  1  
ATOM 6102   C CG  . TRP A 1 820 ? -168.197 -33.220 50.450  1.00 99.99  ? 824 TRP C CG  1  
ATOM 6103   C CD1 . TRP A 1 820 ? -168.883 -33.624 51.525  1.00 99.99  ? 824 TRP C CD1 1  
ATOM 6104   C CD2 . TRP A 1 820 ? -167.618 -34.381 49.920  1.00 99.99  ? 824 TRP C CD2 1  
ATOM 6105   N NE1 . TRP A 1 820 ? -168.705 -35.039 51.630  1.00 99.99  ? 824 TRP C NE1 1  
ATOM 6106   C CE2 . TRP A 1 820 ? -167.941 -35.446 50.645  1.00 99.99  ? 824 TRP C CE2 1  
ATOM 6107   C CE3 . TRP A 1 820 ? -166.799 -34.530 48.793  1.00 99.99  ? 824 TRP C CE3 1  
ATOM 6108   C CZ2 . TRP A 1 820 ? -167.514 -36.748 50.366  1.00 99.99  ? 824 TRP C CZ2 1  
ATOM 6109   C CZ3 . TRP A 1 820 ? -166.354 -35.837 48.493  1.00 99.99  ? 824 TRP C CZ3 1  
ATOM 6110   C CH2 . TRP A 1 820 ? -166.700 -36.899 49.249  1.00 99.99  ? 824 TRP C CH2 1  
ATOM 6111   N N   . GLN A 1 821 ? -171.825 -31.275 49.974  1.00 30.00  ? 825 GLN C N   1  
ATOM 6112   C CA  . GLN A 1 821 ? -173.054 -31.171 50.759  1.00 30.00  ? 825 GLN C CA  1  
ATOM 6113   C C   . GLN A 1 821 ? -172.735 -31.291 52.231  1.00 30.00  ? 825 GLN C C   1  
ATOM 6114   O O   . GLN A 1 821 ? -173.087 -30.421 53.039  1.00 30.00  ? 825 GLN C O   1  
ATOM 6115   C CB  . GLN A 1 821 ? -174.017 -32.288 50.366  1.00 99.99  ? 825 GLN C CB  1  
ATOM 6116   C CG  . GLN A 1 821 ? -175.447 -31.870 50.695  1.00 99.99  ? 825 GLN C CG  1  
ATOM 6117   C CD  . GLN A 1 821 ? -175.786 -32.178 52.146  1.00 99.99  ? 825 GLN C CD  1  
ATOM 6118   O OE1 . GLN A 1 821 ? -174.953 -32.700 52.885  1.00 99.99  ? 825 GLN C OE1 1  
ATOM 6119   N NE2 . GLN A 1 821 ? -177.016 -31.854 52.552  1.00 99.99  ? 825 GLN C NE2 1  
ATOM 6120   N N   . TRP A 1 822 ? -172.051 -32.380 52.559  1.00 30.00  ? 826 TRP C N   1  
ATOM 6121   C CA  . TRP A 1 822 ? -171.652 -32.661 53.928  1.00 30.00  ? 826 TRP C CA  1  
ATOM 6122   C C   . TRP A 1 822 ? -170.920 -31.480 54.541  1.00 30.00  ? 826 TRP C C   1  
ATOM 6123   O O   . TRP A 1 822 ? -171.317 -30.972 55.592  1.00 30.00  ? 826 TRP C O   1  
ATOM 6124   C CB  . TRP A 1 822 ? -170.725 -33.869 53.962  1.00 99.99  ? 826 TRP C CB  1  
ATOM 6125   C CG  . TRP A 1 822 ? -170.353 -34.353 55.343  1.00 99.99  ? 826 TRP C CG  1  
ATOM 6126   C CD1 . TRP A 1 822 ? -169.459 -33.801 56.176  1.00 99.99  ? 826 TRP C CD1 1  
ATOM 6127   C CD2 . TRP A 1 822 ? -170.863 -35.462 56.026  1.00 99.99  ? 826 TRP C CD2 1  
ATOM 6128   N NE1 . TRP A 1 822 ? -169.444 -34.599 57.361  1.00 99.99  ? 826 TRP C NE1 1  
ATOM 6129   C CE2 . TRP A 1 822 ? -170.299 -35.582 57.225  1.00 99.99  ? 826 TRP C CE2 1  
ATOM 6130   C CE3 . TRP A 1 822 ? -171.826 -36.394 55.617  1.00 99.99  ? 826 TRP C CE3 1  
ATOM 6131   C CZ2 . TRP A 1 822 ? -170.605 -36.593 58.144  1.00 99.99  ? 826 TRP C CZ2 1  
ATOM 6132   C CZ3 . TRP A 1 822 ? -172.147 -37.423 56.526  1.00 99.99  ? 826 TRP C CZ3 1  
ATOM 6133   C CH2 . TRP A 1 822 ? -171.560 -37.517 57.739  1.00 99.99  ? 826 TRP C CH2 1  
ATOM 6134   N N   . TRP A 1 823 ? -169.851 -31.045 53.867  1.00 30.00  ? 827 TRP C N   1  
ATOM 6135   C CA  . TRP A 1 823 ? -169.054 -29.916 54.334  1.00 30.00  ? 827 TRP C CA  1  
ATOM 6136   C C   . TRP A 1 823 ? -169.908 -28.649 54.406  1.00 30.00  ? 827 TRP C C   1  
ATOM 6137   O O   . TRP A 1 823 ? -169.833 -27.883 55.373  1.00 30.00  ? 827 TRP C O   1  
ATOM 6138   C CB  . TRP A 1 823 ? -167.890 -29.672 53.376  1.00 99.99  ? 827 TRP C CB  1  
ATOM 6139   C CG  . TRP A 1 823 ? -166.906 -28.618 53.823  1.00 99.99  ? 827 TRP C CG  1  
ATOM 6140   C CD1 . TRP A 1 823 ? -167.066 -27.292 53.772  1.00 99.99  ? 827 TRP C CD1 1  
ATOM 6141   C CD2 . TRP A 1 823 ? -165.637 -28.817 54.379  1.00 99.99  ? 827 TRP C CD2 1  
ATOM 6142   N NE1 . TRP A 1 823 ? -165.877 -26.704 54.300  1.00 99.99  ? 827 TRP C NE1 1  
ATOM 6143   C CE2 . TRP A 1 823 ? -165.048 -27.657 54.651  1.00 99.99  ? 827 TRP C CE2 1  
ATOM 6144   C CE3 . TRP A 1 823 ? -164.966 -30.016 54.659  1.00 99.99  ? 827 TRP C CE3 1  
ATOM 6145   C CZ2 . TRP A 1 823 ? -163.775 -27.528 55.214  1.00 99.99  ? 827 TRP C CZ2 1  
ATOM 6146   C CZ3 . TRP A 1 823 ? -163.678 -29.911 55.225  1.00 99.99  ? 827 TRP C CZ3 1  
ATOM 6147   C CH2 . TRP A 1 823 ? -163.109 -28.717 55.491  1.00 99.99  ? 827 TRP C CH2 1  
ATOM 6148   N N   . LYS A 1 824 ? -170.718 -28.431 53.373  1.00 30.00  ? 828 LYS C N   1  
ATOM 6149   C CA  . LYS A 1 824 ? -171.592 -27.268 53.316  1.00 30.00  ? 828 LYS C CA  1  
ATOM 6150   C C   . LYS A 1 824 ? -172.395 -27.238 54.610  1.00 30.00  ? 828 LYS C C   1  
ATOM 6151   O O   . LYS A 1 824 ? -172.264 -26.321 55.427  1.00 30.00  ? 828 LYS C O   1  
ATOM 6152   C CB  . LYS A 1 824 ? -172.521 -27.376 52.114  1.00 99.99  ? 828 LYS C CB  1  
ATOM 6153   C CG  . LYS A 1 824 ? -173.362 -26.111 52.002  1.00 99.99  ? 828 LYS C CG  1  
ATOM 6154   C CD  . LYS A 1 824 ? -173.953 -26.012 50.600  1.00 99.99  ? 828 LYS C CD  1  
ATOM 6155   C CE  . LYS A 1 824 ? -175.072 -24.976 50.590  1.00 99.99  ? 828 LYS C CE  1  
ATOM 6156   N NZ  . LYS A 1 824 ? -174.530 -23.672 50.176  1.00 99.99  ? 828 LYS C NZ  1  
ATOM 6157   N N   . LEU A 1 825 ? -173.221 -28.265 54.780  1.00 30.00  ? 829 LEU C N   1  
ATOM 6158   C CA  . LEU A 1 825 ? -174.066 -28.394 55.958  1.00 30.00  ? 829 LEU C CA  1  
ATOM 6159   C C   . LEU A 1 825 ? -173.220 -28.311 57.224  1.00 30.00  ? 829 LEU C C   1  
ATOM 6160   O O   . LEU A 1 825 ? -173.634 -27.714 58.219  1.00 30.00  ? 829 LEU C O   1  
ATOM 6161   C CB  . LEU A 1 825 ? -174.791 -29.735 55.929  1.00 99.99  ? 829 LEU C CB  1  
ATOM 6162   C CG  . LEU A 1 825 ? -176.171 -29.554 55.307  1.00 99.99  ? 829 LEU C CG  1  
ATOM 6163   C CD1 . LEU A 1 825 ? -177.015 -30.797 55.574  1.00 99.99  ? 829 LEU C CD1 1  
ATOM 6164   C CD2 . LEU A 1 825 ? -176.852 -28.335 55.920  1.00 99.99  ? 829 LEU C CD2 1  
ATOM 6165   N N   . TYR A 1 826 ? -172.036 -28.913 57.182  1.00 30.00  ? 830 TYR C N   1  
ATOM 6166   C CA  . TYR A 1 826 ? -171.161 -28.873 58.341  1.00 30.00  ? 830 TYR C CA  1  
ATOM 6167   C C   . TYR A 1 826 ? -170.859 -27.424 58.676  1.00 30.00  ? 830 TYR C C   1  
ATOM 6168   O O   . TYR A 1 826 ? -171.199 -26.922 59.748  1.00 30.00  ? 830 TYR C O   1  
ATOM 6169   C CB  . TYR A 1 826 ? -169.864 -29.613 58.037  1.00 99.99  ? 830 TYR C CB  1  
ATOM 6170   C CG  . TYR A 1 826 ? -168.963 -29.570 59.247  1.00 99.99  ? 830 TYR C CG  1  
ATOM 6171   C CD1 . TYR A 1 826 ? -169.134 -30.497 60.282  1.00 99.99  ? 830 TYR C CD1 1  
ATOM 6172   C CD2 . TYR A 1 826 ? -167.954 -28.604 59.335  1.00 99.99  ? 830 TYR C CD2 1  
ATOM 6173   C CE1 . TYR A 1 826 ? -168.298 -30.458 61.403  1.00 99.99  ? 830 TYR C CE1 1  
ATOM 6174   C CE2 . TYR A 1 826 ? -167.119 -28.563 60.458  1.00 99.99  ? 830 TYR C CE2 1  
ATOM 6175   C CZ  . TYR A 1 826 ? -167.291 -29.492 61.493  1.00 99.99  ? 830 TYR C CZ  1  
ATOM 6176   O OH  . TYR A 1 826 ? -166.479 -29.451 62.584  1.00 99.99  ? 830 TYR C OH  1  
ATOM 6177   N N   . SER A 1 827 ? -170.199 -26.758 57.736  1.00 30.00  ? 831 SER C N   1  
ATOM 6178   C CA  . SER A 1 827 ? -169.825 -25.366 57.898  1.00 30.00  ? 831 SER C CA  1  
ATOM 6179   C C   . SER A 1 827 ? -170.993 -24.589 58.463  1.00 30.00  ? 831 SER C C   1  
ATOM 6180   O O   . SER A 1 827 ? -170.817 -23.722 59.324  1.00 30.00  ? 831 SER C O   1  
ATOM 6181   C CB  . SER A 1 827 ? -169.433 -24.774 56.549  1.00 99.99  ? 831 SER C CB  1  
ATOM 6182   O OG  . SER A 1 827 ? -170.586 -24.693 55.711  1.00 99.99  ? 831 SER C OG  1  
ATOM 6183   N N   . LYS A 1 828 ? -172.193 -24.910 57.978  1.00 30.00  ? 832 LYS C N   1  
ATOM 6184   C CA  . LYS A 1 828 ? -173.406 -24.243 58.434  1.00 30.00  ? 832 LYS C CA  1  
ATOM 6185   C C   . LYS A 1 828 ? -173.585 -24.393 59.953  1.00 30.00  ? 832 LYS C C   1  
ATOM 6186   O O   . LYS A 1 828 ? -173.676 -23.394 60.672  1.00 30.00  ? 832 LYS C O   1  
ATOM 6187   C CB  . LYS A 1 828 ? -174.623 -24.852 57.743  1.00 99.99  ? 832 LYS C CB  1  
ATOM 6188   C CG  . LYS A 1 828 ? -175.876 -24.085 58.149  1.00 99.99  ? 832 LYS C CG  1  
ATOM 6189   C CD  . LYS A 1 828 ? -176.995 -24.375 57.154  1.00 99.99  ? 832 LYS C CD  1  
ATOM 6190   C CE  . LYS A 1 828 ? -178.329 -23.924 57.743  1.00 99.99  ? 832 LYS C CE  1  
ATOM 6191   N NZ  . LYS A 1 828 ? -178.628 -22.558 57.292  1.00 99.99  ? 832 LYS C NZ  1  
ATOM 6192   N N   . VAL A 1 829 ? -173.628 -25.633 60.437  1.00 30.00  ? 833 VAL C N   1  
ATOM 6193   C CA  . VAL A 1 829 ? -173.800 -25.880 61.865  1.00 30.00  ? 833 VAL C CA  1  
ATOM 6194   C C   . VAL A 1 829 ? -172.748 -25.132 62.684  1.00 30.00  ? 833 VAL C C   1  
ATOM 6195   O O   . VAL A 1 829 ? -173.087 -24.459 63.661  1.00 30.00  ? 833 VAL C O   1  
ATOM 6196   C CB  . VAL A 1 829 ? -173.667 -27.371 62.153  1.00 99.99  ? 833 VAL C CB  1  
ATOM 6197   C CG1 . VAL A 1 829 ? -174.735 -28.137 61.377  1.00 99.99  ? 833 VAL C CG1 1  
ATOM 6198   C CG2 . VAL A 1 829 ? -172.286 -27.851 61.722  1.00 99.99  ? 833 VAL C CG2 1  
ATOM 6199   N N   . LYS A 1 830 ? -171.483 -25.251 62.275  1.00 30.00  ? 834 LYS C N   1  
ATOM 6200   C CA  . LYS A 1 830 ? -170.348 -24.609 62.946  1.00 30.00  ? 834 LYS C CA  1  
ATOM 6201   C C   . LYS A 1 830 ? -170.702 -23.813 64.212  1.00 30.00  ? 834 LYS C C   1  
ATOM 6202   O O   . LYS A 1 830 ? -170.397 -24.248 65.318  1.00 30.00  ? 834 LYS C O   1  
ATOM 6203   C CB  . LYS A 1 830 ? -169.675 -23.627 61.995  1.00 99.99  ? 834 LYS C CB  1  
ATOM 6204   C CG  . LYS A 1 830 ? -168.439 -23.035 62.663  1.00 99.99  ? 834 LYS C CG  1  
ATOM 6205   C CD  . LYS A 1 830 ? -167.531 -22.421 61.604  1.00 99.99  ? 834 LYS C CD  1  
ATOM 6206   C CE  . LYS A 1 830 ? -166.501 -21.515 62.276  1.00 99.99  ? 834 LYS C CE  1  
ATOM 6207   N NZ  . LYS A 1 830 ? -165.270 -22.280 62.525  1.00 99.99  ? 834 LYS C NZ  1  
ATOM 6208   N N   . PRO A 1 831 ? -171.345 -22.638 64.075  1.00 30.00  ? 835 PRO C N   1  
ATOM 6209   C CA  . PRO A 1 831 ? -171.661 -21.910 65.312  1.00 30.00  ? 835 PRO C CA  1  
ATOM 6210   C C   . PRO A 1 831 ? -172.625 -22.673 66.240  1.00 30.00  ? 835 PRO C C   1  
ATOM 6211   O O   . PRO A 1 831 ? -172.146 -23.325 67.198  1.00 30.00  ? 835 PRO C O   1  
ATOM 6212   C CB  . PRO A 1 831 ? -172.302 -20.715 64.701  1.00 99.99  ? 835 PRO C CB  1  
ATOM 6213   C CG  . PRO A 1 831 ? -172.209 -20.909 63.206  1.00 99.99  ? 835 PRO C CG  1  
ATOM 6214   C CD  . PRO A 1 831 ? -171.617 -21.985 62.866  1.00 99.99  ? 835 PRO C CD  1  
ATOM 6215   O OXT . PRO A 1 831 ? -173.850 -22.605 65.990  1.00 30.00  ? 835 PRO C OXT 1  
ATOM 6216   N N   . LYS B 2 1   ? -159.189 -31.461 68.540  1.00 30.00  ? 15  LYS Y N   1  
ATOM 6217   C CA  . LYS B 2 1   ? -160.118 -30.341 68.640  1.00 30.00  ? 15  LYS Y CA  1  
ATOM 6218   C C   . LYS B 2 1   ? -160.951 -30.353 67.362  1.00 30.00  ? 15  LYS Y C   1  
ATOM 6219   O O   . LYS B 2 1   ? -161.998 -29.703 67.275  1.00 30.00  ? 15  LYS Y O   1  
ATOM 6220   C CB  . LYS B 2 1   ? -159.340 -29.035 68.766  1.00 99.99  ? 15  LYS Y CB  1  
ATOM 6221   C CG  . LYS B 2 1   ? -160.313 -27.880 68.967  1.00 99.99  ? 15  LYS Y CG  1  
ATOM 6222   C CD  . LYS B 2 1   ? -159.569 -26.675 69.531  1.00 99.99  ? 15  LYS Y CD  1  
ATOM 6223   C CE  . LYS B 2 1   ? -160.434 -25.429 69.387  1.00 99.99  ? 15  LYS Y CE  1  
ATOM 6224   N NZ  . LYS B 2 1   ? -161.193 -25.214 70.626  1.00 99.99  ? 15  LYS Y NZ  1  
ATOM 6225   N N   . GLN B 2 2   ? -160.471 -31.096 66.370  1.00 30.00  ? 16  GLN Y N   1  
ATOM 6226   C CA  . GLN B 2 2   ? -161.186 -31.202 65.107  1.00 30.00  ? 16  GLN Y CA  1  
ATOM 6227   C C   . GLN B 2 2   ? -162.308 -32.186 65.398  1.00 30.00  ? 16  GLN Y C   1  
ATOM 6228   O O   . GLN B 2 2   ? -163.392 -32.100 64.823  1.00 30.00  ? 16  GLN Y O   1  
ATOM 6229   C CB  . GLN B 2 2   ? -160.245 -31.719 64.025  1.00 99.99  ? 16  GLN Y CB  1  
ATOM 6230   C CG  . GLN B 2 2   ? -159.657 -33.059 64.451  1.00 99.99  ? 16  GLN Y CG  1  
ATOM 6231   C CD  . GLN B 2 2   ? -158.536 -32.864 65.465  1.00 99.99  ? 16  GLN Y CD  1  
ATOM 6232   O OE1 . GLN B 2 2   ? -158.217 -31.737 65.833  1.00 99.99  ? 16  GLN Y OE1 1  
ATOM 6233   N NE2 . GLN B 2 2   ? -157.942 -33.970 65.916  1.00 99.99  ? 16  GLN Y NE2 1  
ATOM 6234   N N   . ILE B 2 3   ? -162.016 -33.112 66.310  1.00 30.00  ? 17  ILE Y N   1  
ATOM 6235   C CA  . ILE B 2 3   ? -162.960 -34.137 66.733  1.00 30.00  ? 17  ILE Y CA  1  
ATOM 6236   C C   . ILE B 2 3   ? -164.019 -33.548 67.657  1.00 30.00  ? 17  ILE Y C   1  
ATOM 6237   O O   . ILE B 2 3   ? -165.219 -33.714 67.425  1.00 30.00  ? 17  ILE Y O   1  
ATOM 6238   C CB  . ILE B 2 3   ? -162.220 -35.243 67.481  1.00 99.99  ? 17  ILE Y CB  1  
ATOM 6239   C CG1 . ILE B 2 3   ? -161.999 -34.819 68.926  1.00 99.99  ? 17  ILE Y CG1 1  
ATOM 6240   C CG2 . ILE B 2 3   ? -160.876 -35.497 66.810  1.00 99.99  ? 17  ILE Y CG2 1  
ATOM 6241   C CD1 . ILE B 2 3   ? -160.632 -34.152 69.056  1.00 99.99  ? 17  ILE Y CD1 1  
ATOM 6242   N N   . GLN B 2 4   ? -163.568 -32.866 68.704  1.00 30.00  ? 18  GLN Y N   1  
ATOM 6243   C CA  . GLN B 2 4   ? -164.466 -32.237 69.668  1.00 30.00  ? 18  GLN Y CA  1  
ATOM 6244   C C   . GLN B 2 4   ? -165.618 -31.540 68.941  1.00 30.00  ? 18  GLN Y C   1  
ATOM 6245   O O   . GLN B 2 4   ? -166.768 -31.609 69.377  1.00 30.00  ? 18  GLN Y O   1  
ATOM 6246   C CB  . GLN B 2 4   ? -163.702 -31.204 70.490  1.00 99.99  ? 18  GLN Y CB  1  
ATOM 6247   C CG  . GLN B 2 4   ? -164.406 -30.989 71.824  1.00 99.99  ? 18  GLN Y CG  1  
ATOM 6248   C CD  . GLN B 2 4   ? -165.525 -29.964 71.694  1.00 99.99  ? 18  GLN Y CD  1  
ATOM 6249   O OE1 . GLN B 2 4   ? -165.754 -29.427 70.613  1.00 99.99  ? 18  GLN Y OE1 1  
ATOM 6250   N NE2 . GLN B 2 4   ? -166.217 -29.691 72.803  1.00 99.99  ? 18  GLN Y NE2 1  
ATOM 6251   N N   . GLU B 2 5   ? -165.314 -30.867 67.833  1.00 30.00  ? 19  GLU Y N   1  
ATOM 6252   C CA  . GLU B 2 5   ? -166.328 -30.165 67.048  1.00 30.00  ? 19  GLU Y CA  1  
ATOM 6253   C C   . GLU B 2 5   ? -167.205 -31.190 66.339  1.00 30.00  ? 19  GLU Y C   1  
ATOM 6254   O O   . GLU B 2 5   ? -168.429 -31.148 66.436  1.00 30.00  ? 19  GLU Y O   1  
ATOM 6255   C CB  . GLU B 2 5   ? -165.657 -29.265 66.020  1.00 99.99  ? 19  GLU Y CB  1  
ATOM 6256   C CG  . GLU B 2 5   ? -164.878 -28.181 66.727  1.00 99.99  ? 19  GLU Y CG  1  
ATOM 6257   C CD  . GLU B 2 5   ? -165.850 -27.175 67.341  1.00 99.99  ? 19  GLU Y CD  1  
ATOM 6258   O OE1 . GLU B 2 5   ? -166.240 -27.396 68.517  1.00 99.99  ? 19  GLU Y OE1 1  
ATOM 6259   O OE2 . GLU B 2 5   ? -166.192 -26.196 66.627  1.00 99.99  ? 19  GLU Y OE2 1  
ATOM 6260   N N   . MET B 2 6   ? -166.565 -32.102 65.615  1.00 30.00  ? 20  MET Y N   1  
ATOM 6261   C CA  . MET B 2 6   ? -167.266 -33.143 64.882  1.00 30.00  ? 20  MET Y CA  1  
ATOM 6262   C C   . MET B 2 6   ? -168.414 -33.724 65.699  1.00 30.00  ? 20  MET Y C   1  
ATOM 6263   O O   . MET B 2 6   ? -169.550 -33.790 65.227  1.00 30.00  ? 20  MET Y O   1  
ATOM 6264   C CB  . MET B 2 6   ? -166.303 -34.275 64.539  1.00 99.99  ? 20  MET Y CB  1  
ATOM 6265   C CG  . MET B 2 6   ? -165.049 -33.698 63.897  1.00 99.99  ? 20  MET Y CG  1  
ATOM 6266   S SD  . MET B 2 6   ? -165.357 -33.335 62.150  1.00 99.99  ? 20  MET Y SD  1  
ATOM 6267   C CE  . MET B 2 6   ? -165.300 -34.981 61.475  1.00 99.99  ? 20  MET Y CE  1  
ATOM 6268   N N   . LYS B 2 7   ? -168.102 -34.143 66.920  1.00 30.00  ? 21  LYS Y N   1  
ATOM 6269   C CA  . LYS B 2 7   ? -169.090 -34.719 67.824  1.00 30.00  ? 21  LYS Y CA  1  
ATOM 6270   C C   . LYS B 2 7   ? -170.209 -33.729 68.083  1.00 30.00  ? 21  LYS Y C   1  
ATOM 6271   O O   . LYS B 2 7   ? -171.342 -33.928 67.637  1.00 30.00  ? 21  LYS Y O   1  
ATOM 6272   C CB  . LYS B 2 7   ? -168.430 -35.080 69.153  1.00 99.99  ? 21  LYS Y CB  1  
ATOM 6273   C CG  . LYS B 2 7   ? -169.446 -35.772 70.055  1.00 99.99  ? 21  LYS Y CG  1  
ATOM 6274   C CD  . LYS B 2 7   ? -168.714 -36.518 71.163  1.00 99.99  ? 21  LYS Y CD  1  
ATOM 6275   C CE  . LYS B 2 7   ? -169.705 -36.893 72.262  1.00 99.99  ? 21  LYS Y CE  1  
ATOM 6276   N NZ  . LYS B 2 7   ? -170.208 -38.255 72.028  1.00 99.99  ? 21  LYS Y NZ  1  
ATOM 6277   N N   . GLU B 2 8   ? -169.884 -32.659 68.805  1.00 30.00  ? 22  GLU Y N   1  
ATOM 6278   C CA  . GLU B 2 8   ? -170.854 -31.618 69.126  1.00 30.00  ? 22  GLU Y CA  1  
ATOM 6279   C C   . GLU B 2 8   ? -171.708 -31.316 67.889  1.00 30.00  ? 22  GLU Y C   1  
ATOM 6280   O O   . GLU B 2 8   ? -172.885 -30.960 68.004  1.00 30.00  ? 22  GLU Y O   1  
ATOM 6281   C CB  . GLU B 2 8   ? -170.130 -30.348 69.560  1.00 99.99  ? 22  GLU Y CB  1  
ATOM 6282   C CG  . GLU B 2 8   ? -169.386 -30.607 70.847  1.00 99.99  ? 22  GLU Y CG  1  
ATOM 6283   C CD  . GLU B 2 8   ? -170.383 -30.730 71.996  1.00 99.99  ? 22  GLU Y CD  1  
ATOM 6284   O OE1 . GLU B 2 8   ? -170.833 -31.879 72.250  1.00 99.99  ? 22  GLU Y OE1 1  
ATOM 6285   O OE2 . GLU B 2 8   ? -170.687 -29.672 72.610  1.00 99.99  ? 22  GLU Y OE2 1  
ATOM 6286   N N   . ALA B 2 9   ? -171.097 -31.454 66.711  1.00 30.00  ? 23  ALA Y N   1  
ATOM 6287   C CA  . ALA B 2 9   ? -171.773 -31.214 65.439  1.00 30.00  ? 23  ALA Y CA  1  
ATOM 6288   C C   . ALA B 2 9   ? -172.767 -32.357 65.231  1.00 30.00  ? 23  ALA Y C   1  
ATOM 6289   O O   . ALA B 2 9   ? -173.979 -32.149 65.183  1.00 30.00  ? 23  ALA Y O   1  
ATOM 6290   C CB  . ALA B 2 9   ? -170.753 -31.189 64.302  1.00 30.00  ? 23  ALA Y CB  1  
ATOM 6291   N N   . PHE B 2 10  ? -172.224 -33.561 65.107  1.00 30.00  ? 24  PHE Y N   1  
ATOM 6292   C CA  . PHE B 2 10  ? -173.020 -34.765 64.918  1.00 30.00  ? 24  PHE Y CA  1  
ATOM 6293   C C   . PHE B 2 10  ? -174.223 -34.700 65.860  1.00 30.00  ? 24  PHE Y C   1  
ATOM 6294   O O   . PHE B 2 10  ? -175.307 -35.188 65.540  1.00 30.00  ? 24  PHE Y O   1  
ATOM 6295   C CB  . PHE B 2 10  ? -172.178 -35.997 65.233  1.00 99.99  ? 24  PHE Y CB  1  
ATOM 6296   C CG  . PHE B 2 10  ? -173.010 -37.240 65.030  1.00 99.99  ? 24  PHE Y CG  1  
ATOM 6297   C CD1 . PHE B 2 10  ? -173.156 -37.785 63.748  1.00 99.99  ? 24  PHE Y CD1 1  
ATOM 6298   C CD2 . PHE B 2 10  ? -173.636 -37.849 66.124  1.00 99.99  ? 24  PHE Y CD2 1  
ATOM 6299   C CE1 . PHE B 2 10  ? -173.928 -38.938 63.563  1.00 99.99  ? 24  PHE Y CE1 1  
ATOM 6300   C CE2 . PHE B 2 10  ? -174.408 -39.000 65.937  1.00 99.99  ? 24  PHE Y CE2 1  
ATOM 6301   C CZ  . PHE B 2 10  ? -174.552 -39.545 64.657  1.00 99.99  ? 24  PHE Y CZ  1  
ATOM 6302   N N   . SER B 2 11  ? -174.028 -34.083 67.026  1.00 30.00  ? 25  SER Y N   1  
ATOM 6303   C CA  . SER B 2 11  ? -175.099 -33.947 68.010  1.00 30.00  ? 25  SER Y CA  1  
ATOM 6304   C C   . SER B 2 11  ? -176.223 -33.054 67.480  1.00 30.00  ? 25  SER Y C   1  
ATOM 6305   O O   . SER B 2 11  ? -177.384 -33.464 67.461  1.00 30.00  ? 25  SER Y O   1  
ATOM 6306   C CB  . SER B 2 11  ? -174.550 -33.326 69.290  1.00 99.99  ? 25  SER Y CB  1  
ATOM 6307   O OG  . SER B 2 11  ? -173.508 -34.152 69.811  1.00 99.99  ? 25  SER Y OG  1  
ATOM 6308   N N   . MET B 2 12  ? -175.868 -31.841 67.047  1.00 30.00  ? 26  MET Y N   1  
ATOM 6309   C CA  . MET B 2 12  ? -176.843 -30.889 66.514  1.00 30.00  ? 26  MET Y CA  1  
ATOM 6310   C C   . MET B 2 12  ? -177.476 -31.419 65.236  1.00 30.00  ? 26  MET Y C   1  
ATOM 6311   O O   . MET B 2 12  ? -178.632 -31.120 64.951  1.00 30.00  ? 26  MET Y O   1  
ATOM 6312   C CB  . MET B 2 12  ? -176.156 -29.564 66.202  1.00 99.99  ? 26  MET Y CB  1  
ATOM 6313   C CG  . MET B 2 12  ? -175.337 -29.118 67.407  1.00 99.99  ? 26  MET Y CG  1  
ATOM 6314   S SD  . MET B 2 12  ? -176.415 -28.350 68.639  1.00 99.99  ? 26  MET Y SD  1  
ATOM 6315   C CE  . MET B 2 12  ? -176.686 -26.767 67.869  1.00 99.99  ? 26  MET Y CE  1  
ATOM 6316   N N   . ILE B 2 13  ? -176.730 -32.206 64.460  1.00 30.00  ? 27  ILE Y N   1  
ATOM 6317   C CA  . ILE B 2 13  ? -177.277 -32.753 63.218  1.00 30.00  ? 27  ILE Y CA  1  
ATOM 6318   C C   . ILE B 2 13  ? -178.224 -33.904 63.549  1.00 30.00  ? 27  ILE Y C   1  
ATOM 6319   O O   . ILE B 2 13  ? -179.327 -33.978 63.000  1.00 30.00  ? 27  ILE Y O   1  
ATOM 6320   C CB  . ILE B 2 13  ? -176.145 -33.263 62.334  1.00 99.99  ? 27  ILE Y CB  1  
ATOM 6321   C CG1 . ILE B 2 13  ? -175.809 -34.700 62.718  1.00 99.99  ? 27  ILE Y CG1 1  
ATOM 6322   C CG2 . ILE B 2 13  ? -174.915 -32.382 62.525  1.00 99.99  ? 27  ILE Y CG2 1  
ATOM 6323   C CD1 . ILE B 2 13  ? -176.579 -35.662 61.819  1.00 99.99  ? 27  ILE Y CD1 1  
ATOM 6324   N N   . ASP B 2 14  ? -177.790 -34.795 64.442  1.00 30.00  ? 28  ASP Y N   1  
ATOM 6325   C CA  . ASP B 2 14  ? -178.587 -35.949 64.870  1.00 30.00  ? 28  ASP Y CA  1  
ATOM 6326   C C   . ASP B 2 14  ? -179.704 -35.424 65.765  1.00 30.00  ? 28  ASP Y C   1  
ATOM 6327   O O   . ASP B 2 14  ? -179.643 -35.530 66.992  1.00 30.00  ? 28  ASP Y O   1  
ATOM 6328   C CB  . ASP B 2 14  ? -177.706 -36.930 65.638  1.00 99.99  ? 28  ASP Y CB  1  
ATOM 6329   C CG  . ASP B 2 14  ? -176.709 -37.577 64.683  1.00 99.99  ? 28  ASP Y CG  1  
ATOM 6330   O OD1 . ASP B 2 14  ? -177.178 -38.284 63.750  1.00 99.99  ? 28  ASP Y OD1 1  
ATOM 6331   O OD2 . ASP B 2 14  ? -175.484 -37.363 64.893  1.00 99.99  ? 28  ASP Y OD2 1  
ATOM 6332   N N   . VAL B 2 15  ? -180.724 -34.847 65.125  1.00 30.00  ? 29  VAL Y N   1  
ATOM 6333   C CA  . VAL B 2 15  ? -181.871 -34.267 65.814  1.00 30.00  ? 29  VAL Y CA  1  
ATOM 6334   C C   . VAL B 2 15  ? -182.639 -35.237 66.694  1.00 30.00  ? 29  VAL Y C   1  
ATOM 6335   O O   . VAL B 2 15  ? -182.737 -35.028 67.905  1.00 30.00  ? 29  VAL Y O   1  
ATOM 6336   C CB  . VAL B 2 15  ? -182.866 -33.722 64.796  1.00 99.99  ? 29  VAL Y CB  1  
ATOM 6337   C CG1 . VAL B 2 15  ? -182.188 -32.644 63.951  1.00 99.99  ? 29  VAL Y CG1 1  
ATOM 6338   C CG2 . VAL B 2 15  ? -183.342 -34.853 63.891  1.00 99.99  ? 29  VAL Y CG2 1  
ATOM 6339   N N   . ASP B 2 16  ? -183.184 -36.299 66.099  1.00 30.00  ? 30  ASP Y N   1  
ATOM 6340   C CA  . ASP B 2 16  ? -183.935 -37.278 66.871  1.00 30.00  ? 30  ASP Y CA  1  
ATOM 6341   C C   . ASP B 2 16  ? -183.024 -37.954 67.893  1.00 30.00  ? 30  ASP Y C   1  
ATOM 6342   O O   . ASP B 2 16  ? -183.264 -39.092 68.295  1.00 30.00  ? 30  ASP Y O   1  
ATOM 6343   C CB  . ASP B 2 16  ? -184.508 -38.342 65.941  1.00 99.99  ? 30  ASP Y CB  1  
ATOM 6344   C CG  . ASP B 2 16  ? -183.417 -38.838 64.994  1.00 99.99  ? 30  ASP Y CG  1  
ATOM 6345   O OD1 . ASP B 2 16  ? -182.826 -37.972 64.295  1.00 99.99  ? 30  ASP Y OD1 1  
ATOM 6346   O OD2 . ASP B 2 16  ? -183.181 -40.075 64.981  1.00 99.99  ? 30  ASP Y OD2 1  
ATOM 6347   N N   . ARG B 2 17  ? -181.982 -37.228 68.303  1.00 30.00  ? 31  ARG Y N   1  
ATOM 6348   C CA  . ARG B 2 17  ? -180.980 -37.657 69.275  1.00 30.00  ? 31  ARG Y CA  1  
ATOM 6349   C C   . ARG B 2 17  ? -180.831 -39.176 69.452  1.00 30.00  ? 31  ARG Y C   1  
ATOM 6350   O O   . ARG B 2 17  ? -180.635 -39.650 70.569  1.00 30.00  ? 31  ARG Y O   1  
ATOM 6351   C CB  . ARG B 2 17  ? -181.322 -37.101 70.654  1.00 99.99  ? 31  ARG Y CB  1  
ATOM 6352   C CG  . ARG B 2 17  ? -181.471 -35.588 70.571  1.00 99.99  ? 31  ARG Y CG  1  
ATOM 6353   C CD  . ARG B 2 17  ? -180.116 -34.960 70.257  1.00 99.99  ? 31  ARG Y CD  1  
ATOM 6354   N NE  . ARG B 2 17  ? -179.118 -35.303 71.296  1.00 99.99  ? 31  ARG Y NE  1  
ATOM 6355   C CZ  . ARG B 2 17  ? -177.969 -34.653 71.438  1.00 99.99  ? 31  ARG Y CZ  1  
ATOM 6356   N NH1 . ARG B 2 17  ? -177.629 -33.637 70.646  1.00 99.99  ? 31  ARG Y NH1 1  
ATOM 6357   N NH2 . ARG B 2 17  ? -177.143 -35.042 72.405  1.00 99.99  ? 31  ARG Y NH2 1  
ATOM 6358   N N   . ASP B 2 18  ? -180.908 -39.933 68.357  1.00 30.00  ? 32  ASP Y N   1  
ATOM 6359   C CA  . ASP B 2 18  ? -180.788 -41.393 68.401  1.00 30.00  ? 32  ASP Y CA  1  
ATOM 6360   C C   . ASP B 2 18  ? -179.394 -41.942 68.068  1.00 30.00  ? 32  ASP Y C   1  
ATOM 6361   O O   . ASP B 2 18  ? -179.242 -43.132 67.767  1.00 30.00  ? 32  ASP Y O   1  
ATOM 6362   C CB  . ASP B 2 18  ? -181.748 -42.023 67.398  1.00 99.99  ? 32  ASP Y CB  1  
ATOM 6363   C CG  . ASP B 2 18  ? -183.188 -41.794 67.854  1.00 99.99  ? 32  ASP Y CG  1  
ATOM 6364   O OD1 . ASP B 2 18  ? -183.583 -42.450 68.854  1.00 99.99  ? 32  ASP Y OD1 1  
ATOM 6365   O OD2 . ASP B 2 18  ? -183.875 -40.964 67.201  1.00 99.99  ? 32  ASP Y OD2 1  
ATOM 6366   N N   . GLY B 2 19  ? -178.383 -41.072 68.118  1.00 30.00  ? 33  GLY Y N   1  
ATOM 6367   C CA  . GLY B 2 19  ? -177.017 -41.486 67.822  1.00 30.00  ? 33  GLY Y CA  1  
ATOM 6368   C C   . GLY B 2 19  ? -176.774 -41.939 66.389  1.00 30.00  ? 33  GLY Y C   1  
ATOM 6369   O O   . GLY B 2 19  ? -175.773 -42.604 66.097  1.00 30.00  ? 33  GLY Y O   1  
ATOM 6370   N N   . PHE B 2 20  ? -177.691 -41.587 65.491  1.00 30.00  ? 34  PHE Y N   1  
ATOM 6371   C CA  . PHE B 2 20  ? -177.583 -41.942 64.077  1.00 30.00  ? 34  PHE Y CA  1  
ATOM 6372   C C   . PHE B 2 20  ? -178.087 -40.800 63.219  1.00 30.00  ? 34  PHE Y C   1  
ATOM 6373   O O   . PHE B 2 20  ? -178.900 -39.994 63.669  1.00 30.00  ? 34  PHE Y O   1  
ATOM 6374   C CB  . PHE B 2 20  ? -178.414 -43.187 63.790  1.00 99.99  ? 34  PHE Y CB  1  
ATOM 6375   C CG  . PHE B 2 20  ? -179.881 -42.856 63.918  1.00 99.99  ? 34  PHE Y CG  1  
ATOM 6376   C CD1 . PHE B 2 20  ? -180.523 -42.994 65.153  1.00 99.99  ? 34  PHE Y CD1 1  
ATOM 6377   C CD2 . PHE B 2 20  ? -180.597 -42.406 62.801  1.00 99.99  ? 34  PHE Y CD2 1  
ATOM 6378   C CE1 . PHE B 2 20  ? -181.886 -42.685 65.271  1.00 99.99  ? 34  PHE Y CE1 1  
ATOM 6379   C CE2 . PHE B 2 20  ? -181.958 -42.100 62.919  1.00 99.99  ? 34  PHE Y CE2 1  
ATOM 6380   C CZ  . PHE B 2 20  ? -182.602 -42.238 64.154  1.00 99.99  ? 34  PHE Y CZ  1  
ATOM 6381   N N   . VAL B 2 21  ? -177.600 -40.727 61.986  1.00 30.00  ? 35  VAL Y N   1  
ATOM 6382   C CA  . VAL B 2 21  ? -178.018 -39.667 61.084  1.00 30.00  ? 35  VAL Y CA  1  
ATOM 6383   C C   . VAL B 2 21  ? -178.838 -40.292 59.969  1.00 30.00  ? 35  VAL Y C   1  
ATOM 6384   O O   . VAL B 2 21  ? -178.360 -41.148 59.217  1.00 30.00  ? 35  VAL Y O   1  
ATOM 6385   C CB  . VAL B 2 21  ? -176.793 -38.968 60.503  1.00 99.99  ? 35  VAL Y CB  1  
ATOM 6386   C CG1 . VAL B 2 21  ? -175.965 -38.368 61.634  1.00 99.99  ? 35  VAL Y CG1 1  
ATOM 6387   C CG2 . VAL B 2 21  ? -175.948 -39.979 59.734  1.00 99.99  ? 35  VAL Y CG2 1  
ATOM 6388   N N   . SER B 2 22  ? -180.086 -39.846 59.878  1.00 30.00  ? 36  SER Y N   1  
ATOM 6389   C CA  . SER B 2 22  ? -181.033 -40.334 58.882  1.00 30.00  ? 36  SER Y CA  1  
ATOM 6390   C C   . SER B 2 22  ? -181.451 -39.228 57.933  1.00 30.00  ? 36  SER Y C   1  
ATOM 6391   O O   . SER B 2 22  ? -181.312 -38.045 58.257  1.00 30.00  ? 36  SER Y O   1  
ATOM 6392   C CB  . SER B 2 22  ? -182.281 -40.873 59.573  1.00 99.99  ? 36  SER Y CB  1  
ATOM 6393   O OG  . SER B 2 22  ? -182.996 -39.792 60.179  1.00 99.99  ? 36  SER Y OG  1  
ATOM 6394   N N   . LYS B 2 23  ? -181.967 -39.612 56.762  1.00 30.00  ? 37  LYS Y N   1  
ATOM 6395   C CA  . LYS B 2 23  ? -182.425 -38.647 55.759  1.00 30.00  ? 37  LYS Y CA  1  
ATOM 6396   C C   . LYS B 2 23  ? -183.246 -37.524 56.417  1.00 30.00  ? 37  LYS Y C   1  
ATOM 6397   O O   . LYS B 2 23  ? -183.197 -36.371 55.991  1.00 30.00  ? 37  LYS Y O   1  
ATOM 6398   C CB  . LYS B 2 23  ? -183.300 -39.348 54.724  1.00 99.99  ? 37  LYS Y CB  1  
ATOM 6399   C CG  . LYS B 2 23  ? -183.691 -38.358 53.633  1.00 99.99  ? 37  LYS Y CG  1  
ATOM 6400   C CD  . LYS B 2 23  ? -184.166 -39.120 52.402  1.00 99.99  ? 37  LYS Y CD  1  
ATOM 6401   C CE  . LYS B 2 23  ? -184.896 -38.165 51.463  1.00 99.99  ? 37  LYS Y CE  1  
ATOM 6402   N NZ  . LYS B 2 23  ? -183.955 -37.644 50.461  1.00 99.99  ? 37  LYS Y NZ  1  
ATOM 6403   N N   . GLU B 2 24  ? -183.992 -37.876 57.463  1.00 30.00  ? 38  GLU Y N   1  
ATOM 6404   C CA  . GLU B 2 24  ? -184.827 -36.928 58.186  1.00 30.00  ? 38  GLU Y CA  1  
ATOM 6405   C C   . GLU B 2 24  ? -183.985 -36.097 59.130  1.00 30.00  ? 38  GLU Y C   1  
ATOM 6406   O O   . GLU B 2 24  ? -184.322 -34.966 59.449  1.00 30.00  ? 38  GLU Y O   1  
ATOM 6407   C CB  . GLU B 2 24  ? -185.881 -37.677 58.995  1.00 99.99  ? 38  GLU Y CB  1  
ATOM 6408   C CG  . GLU B 2 24  ? -186.819 -38.398 58.057  1.00 99.99  ? 38  GLU Y CG  1  
ATOM 6409   C CD  . GLU B 2 24  ? -187.718 -37.385 57.356  1.00 99.99  ? 38  GLU Y CD  1  
ATOM 6410   O OE1 . GLU B 2 24  ? -187.307 -36.904 56.267  1.00 99.99  ? 38  GLU Y OE1 1  
ATOM 6411   O OE2 . GLU B 2 24  ? -188.810 -37.098 57.917  1.00 99.99  ? 38  GLU Y OE2 1  
ATOM 6412   N N   . ASP B 2 25  ? -182.881 -36.666 59.581  1.00 30.00  ? 39  ASP Y N   1  
ATOM 6413   C CA  . ASP B 2 25  ? -182.003 -35.945 60.484  1.00 30.00  ? 39  ASP Y CA  1  
ATOM 6414   C C   . ASP B 2 25  ? -181.419 -34.745 59.738  1.00 30.00  ? 39  ASP Y C   1  
ATOM 6415   O O   . ASP B 2 25  ? -181.496 -33.605 60.214  1.00 30.00  ? 39  ASP Y O   1  
ATOM 6416   C CB  . ASP B 2 25  ? -180.876 -36.863 60.950  1.00 99.99  ? 39  ASP Y CB  1  
ATOM 6417   C CG  . ASP B 2 25  ? -181.431 -37.900 61.923  1.00 99.99  ? 39  ASP Y CG  1  
ATOM 6418   O OD1 . ASP B 2 25  ? -182.058 -37.468 62.930  1.00 99.99  ? 39  ASP Y OD1 1  
ATOM 6419   O OD2 . ASP B 2 25  ? -181.225 -39.114 61.652  1.00 99.99  ? 39  ASP Y OD2 1  
ATOM 6420   N N   . ILE B 2 26  ? -180.841 -35.021 58.565  1.00 30.00  ? 40  ILE Y N   1  
ATOM 6421   C CA  . ILE B 2 26  ? -180.219 -34.004 57.707  1.00 30.00  ? 40  ILE Y CA  1  
ATOM 6422   C C   . ILE B 2 26  ? -181.238 -32.951 57.295  1.00 30.00  ? 40  ILE Y C   1  
ATOM 6423   O O   . ILE B 2 26  ? -181.081 -31.761 57.600  1.00 30.00  ? 40  ILE Y O   1  
ATOM 6424   C CB  . ILE B 2 26  ? -179.657 -34.657 56.450  1.00 99.99  ? 40  ILE Y CB  1  
ATOM 6425   C CG1 . ILE B 2 26  ? -180.751 -34.757 55.395  1.00 99.99  ? 40  ILE Y CG1 1  
ATOM 6426   C CG2 . ILE B 2 26  ? -179.147 -36.057 56.791  1.00 99.99  ? 40  ILE Y CG2 1  
ATOM 6427   C CD1 . ILE B 2 26  ? -180.676 -33.549 54.468  1.00 99.99  ? 40  ILE Y CD1 1  
ATOM 6428   N N   . LYS B 2 27  ? -182.274 -33.407 56.594  1.00 30.00  ? 41  LYS Y N   1  
ATOM 6429   C CA  . LYS B 2 27  ? -183.358 -32.553 56.118  1.00 30.00  ? 41  LYS Y CA  1  
ATOM 6430   C C   . LYS B 2 27  ? -183.840 -31.673 57.267  1.00 30.00  ? 41  LYS Y C   1  
ATOM 6431   O O   . LYS B 2 27  ? -184.004 -30.464 57.126  1.00 30.00  ? 41  LYS Y O   1  
ATOM 6432   C CB  . LYS B 2 27  ? -184.513 -33.411 55.612  1.00 99.99  ? 41  LYS Y CB  1  
ATOM 6433   C CG  . LYS B 2 27  ? -185.599 -32.515 55.027  1.00 99.99  ? 41  LYS Y CG  1  
ATOM 6434   C CD  . LYS B 2 27  ? -186.519 -33.345 54.139  1.00 99.99  ? 41  LYS Y CD  1  
ATOM 6435   C CE  . LYS B 2 27  ? -187.795 -32.556 53.856  1.00 99.99  ? 41  LYS Y CE  1  
ATOM 6436   N NZ  . LYS B 2 27  ? -187.649 -31.827 52.587  1.00 99.99  ? 41  LYS Y NZ  1  
ATOM 6437   N N   . ALA B 2 28  ? -184.061 -32.303 58.411  1.00 30.00  ? 42  ALA Y N   1  
ATOM 6438   C CA  . ALA B 2 28  ? -184.522 -31.611 59.599  1.00 30.00  ? 42  ALA Y CA  1  
ATOM 6439   C C   . ALA B 2 28  ? -183.730 -30.344 59.891  1.00 30.00  ? 42  ALA Y C   1  
ATOM 6440   O O   . ALA B 2 28  ? -184.206 -29.237 59.663  1.00 30.00  ? 42  ALA Y O   1  
ATOM 6441   C CB  . ALA B 2 28  ? -184.442 -32.547 60.797  1.00 30.00  ? 42  ALA Y CB  1  
ATOM 6442   N N   . ILE B 2 29  ? -182.514 -30.520 60.393  1.00 30.00  ? 43  ILE Y N   1  
ATOM 6443   C CA  . ILE B 2 29  ? -181.636 -29.407 60.748  1.00 30.00  ? 43  ILE Y CA  1  
ATOM 6444   C C   . ILE B 2 29  ? -181.316 -28.400 59.639  1.00 30.00  ? 43  ILE Y C   1  
ATOM 6445   O O   . ILE B 2 29  ? -181.207 -27.196 59.904  1.00 30.00  ? 43  ILE Y O   1  
ATOM 6446   C CB  . ILE B 2 29  ? -180.284 -29.940 61.216  1.00 99.99  ? 43  ILE Y CB  1  
ATOM 6447   C CG1 . ILE B 2 29  ? -179.419 -30.268 60.004  1.00 99.99  ? 43  ILE Y CG1 1  
ATOM 6448   C CG2 . ILE B 2 29  ? -180.496 -31.203 62.046  1.00 99.99  ? 43  ILE Y CG2 1  
ATOM 6449   C CD1 . ILE B 2 29  ? -179.599 -31.736 59.633  1.00 99.99  ? 43  ILE Y CD1 1  
ATOM 6450   N N   . SER B 2 30  ? -181.151 -28.880 58.409  1.00 30.00  ? 44  SER Y N   1  
ATOM 6451   C CA  . SER B 2 30  ? -180.853 -27.986 57.292  1.00 30.00  ? 44  SER Y CA  1  
ATOM 6452   C C   . SER B 2 30  ? -181.913 -26.884 57.310  1.00 30.00  ? 44  SER Y C   1  
ATOM 6453   O O   . SER B 2 30  ? -181.600 -25.713 57.515  1.00 30.00  ? 44  SER Y O   1  
ATOM 6454   C CB  . SER B 2 30  ? -180.907 -28.761 55.980  1.00 99.99  ? 44  SER Y CB  1  
ATOM 6455   O OG  . SER B 2 30  ? -182.255 -29.158 55.714  1.00 99.99  ? 44  SER Y OG  1  
ATOM 6456   N N   . GLU B 2 31  ? -183.167 -27.293 57.097  1.00 30.00  ? 45  GLU Y N   1  
ATOM 6457   C CA  . GLU B 2 31  ? -184.314 -26.387 57.074  1.00 30.00  ? 45  GLU Y CA  1  
ATOM 6458   C C   . GLU B 2 31  ? -184.394 -25.457 58.285  1.00 30.00  ? 45  GLU Y C   1  
ATOM 6459   O O   . GLU B 2 31  ? -184.821 -24.313 58.156  1.00 30.00  ? 45  GLU Y O   1  
ATOM 6460   C CB  . GLU B 2 31  ? -185.610 -27.191 57.039  1.00 99.99  ? 45  GLU Y CB  1  
ATOM 6461   C CG  . GLU B 2 31  ? -185.687 -27.965 55.747  1.00 99.99  ? 45  GLU Y CG  1  
ATOM 6462   C CD  . GLU B 2 31  ? -185.961 -27.007 54.592  1.00 99.99  ? 45  GLU Y CD  1  
ATOM 6463   O OE1 . GLU B 2 31  ? -184.962 -26.508 54.008  1.00 99.99  ? 45  GLU Y OE1 1  
ATOM 6464   O OE2 . GLU B 2 31  ? -187.166 -26.780 54.303  1.00 99.99  ? 45  GLU Y OE2 1  
ATOM 6465   N N   . GLN B 2 32  ? -183.994 -25.935 59.456  1.00 30.00  ? 46  GLN Y N   1  
ATOM 6466   C CA  . GLN B 2 32  ? -184.045 -25.093 60.647  1.00 30.00  ? 46  GLN Y CA  1  
ATOM 6467   C C   . GLN B 2 32  ? -183.073 -23.929 60.486  1.00 30.00  ? 46  GLN Y C   1  
ATOM 6468   O O   . GLN B 2 32  ? -183.090 -22.974 61.267  1.00 30.00  ? 46  GLN Y O   1  
ATOM 6469   C CB  . GLN B 2 32  ? -183.659 -25.910 61.877  1.00 99.99  ? 46  GLN Y CB  1  
ATOM 6470   C CG  . GLN B 2 32  ? -184.695 -27.000 62.112  1.00 99.99  ? 46  GLN Y CG  1  
ATOM 6471   C CD  . GLN B 2 32  ? -186.001 -26.411 62.630  1.00 99.99  ? 46  GLN Y CD  1  
ATOM 6472   O OE1 . GLN B 2 32  ? -186.111 -25.200 62.807  1.00 99.99  ? 46  GLN Y OE1 1  
ATOM 6473   N NE2 . GLN B 2 32  ? -186.990 -27.272 62.878  1.00 99.99  ? 46  GLN Y NE2 1  
ATOM 6474   N N   . LEU B 2 33  ? -182.233 -24.014 59.458  1.00 30.00  ? 47  LEU Y N   1  
ATOM 6475   C CA  . LEU B 2 33  ? -181.244 -22.979 59.179  1.00 30.00  ? 47  LEU Y CA  1  
ATOM 6476   C C   . LEU B 2 33  ? -181.375 -22.371 57.771  1.00 30.00  ? 47  LEU Y C   1  
ATOM 6477   O O   . LEU B 2 33  ? -182.018 -21.329 57.590  1.00 30.00  ? 47  LEU Y O   1  
ATOM 6478   C CB  . LEU B 2 33  ? -179.838 -23.563 59.288  1.00 99.99  ? 47  LEU Y CB  1  
ATOM 6479   C CG  . LEU B 2 33  ? -179.291 -23.310 60.689  1.00 99.99  ? 47  LEU Y CG  1  
ATOM 6480   C CD1 . LEU B 2 33  ? -177.792 -23.593 60.707  1.00 99.99  ? 47  LEU Y CD1 1  
ATOM 6481   C CD2 . LEU B 2 33  ? -179.542 -21.857 61.078  1.00 99.99  ? 47  LEU Y CD2 1  
ATOM 6482   N N   . GLY B 2 34  ? -180.768 -23.018 56.779  1.00 30.00  ? 48  GLY Y N   1  
ATOM 6483   C CA  . GLY B 2 34  ? -180.841 -22.517 55.420  1.00 30.00  ? 48  GLY Y CA  1  
ATOM 6484   C C   . GLY B 2 34  ? -181.530 -23.526 54.525  1.00 30.00  ? 48  GLY Y C   1  
ATOM 6485   O O   . GLY B 2 34  ? -181.845 -24.623 54.969  1.00 30.00  ? 48  GLY Y O   1  
ATOM 6486   N N   . ARG B 2 35  ? -181.770 -23.166 53.270  1.00 30.00  ? 49  ARG Y N   1  
ATOM 6487   C CA  . ARG B 2 35  ? -182.428 -24.093 52.356  1.00 30.00  ? 49  ARG Y CA  1  
ATOM 6488   C C   . ARG B 2 35  ? -181.774 -25.469 52.513  1.00 30.00  ? 49  ARG Y C   1  
ATOM 6489   O O   . ARG B 2 35  ? -180.578 -25.569 52.796  1.00 30.00  ? 49  ARG Y O   1  
ATOM 6490   C CB  . ARG B 2 35  ? -182.271 -23.602 50.919  1.00 99.99  ? 49  ARG Y CB  1  
ATOM 6491   C CG  . ARG B 2 35  ? -183.004 -24.549 49.974  1.00 99.99  ? 49  ARG Y CG  1  
ATOM 6492   C CD  . ARG B 2 35  ? -182.929 -24.005 48.552  1.00 99.99  ? 49  ARG Y CD  1  
ATOM 6493   N NE  . ARG B 2 35  ? -181.708 -24.480 47.867  1.00 99.99  ? 49  ARG Y NE  1  
ATOM 6494   C CZ  . ARG B 2 35  ? -181.603 -25.692 47.326  1.00 99.99  ? 49  ARG Y CZ  1  
ATOM 6495   N NH1 . ARG B 2 35  ? -182.601 -26.569 47.364  1.00 99.99  ? 49  ARG Y NH1 1  
ATOM 6496   N NH2 . ARG B 2 35  ? -180.457 -26.014 46.732  1.00 99.99  ? 49  ARG Y NH2 1  
ATOM 6497   N N   . ALA B 2 36  ? -182.563 -26.522 52.336  1.00 30.00  ? 50  ALA Y N   1  
ATOM 6498   C CA  . ALA B 2 36  ? -182.061 -27.879 52.468  1.00 30.00  ? 50  ALA Y CA  1  
ATOM 6499   C C   . ALA B 2 36  ? -182.054 -28.601 51.118  1.00 30.00  ? 50  ALA Y C   1  
ATOM 6500   O O   . ALA B 2 36  ? -182.714 -28.168 50.174  1.00 30.00  ? 50  ALA Y O   1  
ATOM 6501   C CB  . ALA B 2 36  ? -182.927 -28.636 53.465  1.00 30.00  ? 50  ALA Y CB  1  
ATOM 6502   N N   . PRO B 2 37  ? -181.295 -29.705 51.012  1.00 30.00  ? 51  PRO Y N   1  
ATOM 6503   C CA  . PRO B 2 37  ? -181.184 -30.509 49.781  1.00 30.00  ? 51  PRO Y CA  1  
ATOM 6504   C C   . PRO B 2 37  ? -182.451 -31.287 49.424  1.00 30.00  ? 51  PRO Y C   1  
ATOM 6505   O O   . PRO B 2 37  ? -183.265 -31.592 50.291  1.00 30.00  ? 51  PRO Y O   1  
ATOM 6506   C CB  . PRO B 2 37  ? -180.085 -31.411 50.213  1.00 99.99  ? 51  PRO Y CB  1  
ATOM 6507   C CG  . PRO B 2 37  ? -179.690 -30.960 51.600  1.00 99.99  ? 51  PRO Y CG  1  
ATOM 6508   C CD  . PRO B 2 37  ? -180.357 -29.954 52.020  1.00 99.99  ? 51  PRO Y CD  1  
ATOM 6509   N N   . ASP B 2 38  ? -182.605 -31.601 48.141  1.00 30.00  ? 52  ASP Y N   1  
ATOM 6510   C CA  . ASP B 2 38  ? -183.766 -32.346 47.666  1.00 30.00  ? 52  ASP Y CA  1  
ATOM 6511   C C   . ASP B 2 38  ? -183.537 -33.824 47.960  1.00 30.00  ? 52  ASP Y C   1  
ATOM 6512   O O   . ASP B 2 38  ? -182.402 -34.243 48.179  1.00 30.00  ? 52  ASP Y O   1  
ATOM 6513   C CB  . ASP B 2 38  ? -183.938 -32.134 46.164  1.00 99.99  ? 52  ASP Y CB  1  
ATOM 6514   C CG  . ASP B 2 38  ? -182.724 -32.694 45.428  1.00 99.99  ? 52  ASP Y CG  1  
ATOM 6515   O OD1 . ASP B 2 38  ? -181.695 -31.969 45.384  1.00 99.99  ? 52  ASP Y OD1 1  
ATOM 6516   O OD2 . ASP B 2 38  ? -182.837 -33.838 44.915  1.00 99.99  ? 52  ASP Y OD2 1  
ATOM 6517   N N   . ASP B 2 39  ? -184.610 -34.607 47.961  1.00 30.00  ? 53  ASP Y N   1  
ATOM 6518   C CA  . ASP B 2 39  ? -184.505 -36.034 48.236  1.00 30.00  ? 53  ASP Y CA  1  
ATOM 6519   C C   . ASP B 2 39  ? -183.266 -36.654 47.603  1.00 30.00  ? 53  ASP Y C   1  
ATOM 6520   O O   . ASP B 2 39  ? -182.475 -37.297 48.300  1.00 30.00  ? 53  ASP Y O   1  
ATOM 6521   C CB  . ASP B 2 39  ? -185.725 -36.761 47.684  1.00 99.99  ? 53  ASP Y CB  1  
ATOM 6522   C CG  . ASP B 2 39  ? -185.982 -36.310 46.246  1.00 99.99  ? 53  ASP Y CG  1  
ATOM 6523   O OD1 . ASP B 2 39  ? -186.129 -35.074 46.050  1.00 99.99  ? 53  ASP Y OD1 1  
ATOM 6524   O OD2 . ASP B 2 39  ? -186.026 -37.204 45.361  1.00 99.99  ? 53  ASP Y OD2 1  
ATOM 6525   N N   . LYS B 2 40  ? -183.089 -36.458 46.297  1.00 30.00  ? 54  LYS Y N   1  
ATOM 6526   C CA  . LYS B 2 40  ? -181.937 -37.012 45.576  1.00 30.00  ? 54  LYS Y CA  1  
ATOM 6527   C C   . LYS B 2 40  ? -180.602 -36.621 46.210  1.00 30.00  ? 54  LYS Y C   1  
ATOM 6528   O O   . LYS B 2 40  ? -179.668 -37.428 46.279  1.00 30.00  ? 54  LYS Y O   1  
ATOM 6529   C CB  . LYS B 2 40  ? -181.935 -36.510 44.137  1.00 99.99  ? 54  LYS Y CB  1  
ATOM 6530   C CG  . LYS B 2 40  ? -182.664 -37.510 43.248  1.00 99.99  ? 54  LYS Y CG  1  
ATOM 6531   C CD  . LYS B 2 40  ? -184.168 -37.376 43.457  1.00 99.99  ? 54  LYS Y CD  1  
ATOM 6532   C CE  . LYS B 2 40  ? -184.887 -38.502 42.723  1.00 99.99  ? 54  LYS Y CE  1  
ATOM 6533   N NZ  . LYS B 2 40  ? -186.325 -38.445 43.024  1.00 99.99  ? 54  LYS Y NZ  1  
ATOM 6534   N N   . GLU B 2 41  ? -180.517 -35.376 46.669  1.00 30.00  ? 55  GLU Y N   1  
ATOM 6535   C CA  . GLU B 2 41  ? -179.305 -34.871 47.305  1.00 30.00  ? 55  GLU Y CA  1  
ATOM 6536   C C   . GLU B 2 41  ? -179.083 -35.623 48.608  1.00 30.00  ? 55  GLU Y C   1  
ATOM 6537   O O   . GLU B 2 41  ? -177.985 -36.098 48.883  1.00 30.00  ? 55  GLU Y O   1  
ATOM 6538   C CB  . GLU B 2 41  ? -179.452 -33.380 47.592  1.00 99.99  ? 55  GLU Y CB  1  
ATOM 6539   C CG  . GLU B 2 41  ? -179.566 -32.623 46.290  1.00 99.99  ? 55  GLU Y CG  1  
ATOM 6540   C CD  . GLU B 2 41  ? -178.208 -32.608 45.590  1.00 99.99  ? 55  GLU Y CD  1  
ATOM 6541   O OE1 . GLU B 2 41  ? -177.956 -33.553 44.798  1.00 99.99  ? 55  GLU Y OE1 1  
ATOM 6542   O OE2 . GLU B 2 41  ? -177.435 -31.648 45.857  1.00 99.99  ? 55  GLU Y OE2 1  
ATOM 6543   N N   . LEU B 2 42  ? -180.149 -35.715 49.406  1.00 30.00  ? 56  LEU Y N   1  
ATOM 6544   C CA  . LEU B 2 42  ? -180.128 -36.398 50.697  1.00 30.00  ? 56  LEU Y CA  1  
ATOM 6545   C C   . LEU B 2 42  ? -179.834 -37.889 50.542  1.00 30.00  ? 56  LEU Y C   1  
ATOM 6546   O O   . LEU B 2 42  ? -179.111 -38.487 51.345  1.00 30.00  ? 56  LEU Y O   1  
ATOM 6547   C CB  . LEU B 2 42  ? -181.481 -36.249 51.385  1.00 99.99  ? 56  LEU Y CB  1  
ATOM 6548   C CG  . LEU B 2 42  ? -181.467 -37.013 52.705  1.00 99.99  ? 56  LEU Y CG  1  
ATOM 6549   C CD1 . LEU B 2 42  ? -180.986 -38.439 52.460  1.00 99.99  ? 56  LEU Y CD1 1  
ATOM 6550   C CD2 . LEU B 2 42  ? -180.529 -36.319 53.685  1.00 99.99  ? 56  LEU Y CD2 1  
ATOM 6551   N N   . THR B 2 43  ? -180.400 -38.484 49.502  1.00 30.00  ? 57  THR Y N   1  
ATOM 6552   C CA  . THR B 2 43  ? -180.198 -39.892 49.229  1.00 30.00  ? 57  THR Y CA  1  
ATOM 6553   C C   . THR B 2 43  ? -178.734 -40.220 48.980  1.00 30.00  ? 57  THR Y C   1  
ATOM 6554   O O   . THR B 2 43  ? -178.112 -40.932 49.771  1.00 30.00  ? 57  THR Y O   1  
ATOM 6555   C CB  . THR B 2 43  ? -180.993 -40.298 47.992  1.00 99.99  ? 57  THR Y CB  1  
ATOM 6556   O OG1 . THR B 2 43  ? -180.427 -39.672 46.837  1.00 99.99  ? 57  THR Y OG1 1  
ATOM 6557   C CG2 . THR B 2 43  ? -182.441 -39.856 48.150  1.00 99.99  ? 57  THR Y CG2 1  
ATOM 6558   N N   . ALA B 2 44  ? -178.181 -39.702 47.882  1.00 30.00  ? 58  ALA Y N   1  
ATOM 6559   C CA  . ALA B 2 44  ? -176.780 -39.965 47.550  1.00 30.00  ? 58  ALA Y CA  1  
ATOM 6560   C C   . ALA B 2 44  ? -175.816 -39.408 48.600  1.00 30.00  ? 58  ALA Y C   1  
ATOM 6561   O O   . ALA B 2 44  ? -174.647 -39.808 48.670  1.00 30.00  ? 58  ALA Y O   1  
ATOM 6562   C CB  . ALA B 2 44  ? -176.455 -39.375 46.183  1.00 30.00  ? 58  ALA Y CB  1  
ATOM 6563   N N   . MET B 2 45  ? -176.321 -38.488 49.418  1.00 30.00  ? 59  MET Y N   1  
ATOM 6564   C CA  . MET B 2 45  ? -175.542 -37.857 50.478  1.00 30.00  ? 59  MET Y CA  1  
ATOM 6565   C C   . MET B 2 45  ? -175.287 -38.857 51.601  1.00 30.00  ? 59  MET Y C   1  
ATOM 6566   O O   . MET B 2 45  ? -174.306 -38.748 52.341  1.00 30.00  ? 59  MET Y O   1  
ATOM 6567   C CB  . MET B 2 45  ? -176.307 -36.661 51.038  1.00 99.99  ? 59  MET Y CB  1  
ATOM 6568   C CG  . MET B 2 45  ? -175.703 -36.250 52.378  1.00 99.99  ? 59  MET Y CG  1  
ATOM 6569   S SD  . MET B 2 45  ? -176.635 -34.870 53.084  1.00 99.99  ? 59  MET Y SD  1  
ATOM 6570   C CE  . MET B 2 45  ? -176.151 -35.009 54.790  1.00 99.99  ? 59  MET Y CE  1  
ATOM 6571   N N   . LEU B 2 46  ? -176.186 -39.833 51.717  1.00 30.00  ? 60  LEU Y N   1  
ATOM 6572   C CA  . LEU B 2 46  ? -176.089 -40.877 52.731  1.00 30.00  ? 60  LEU Y CA  1  
ATOM 6573   C C   . LEU B 2 46  ? -175.415 -42.093 52.124  1.00 30.00  ? 60  LEU Y C   1  
ATOM 6574   O O   . LEU B 2 46  ? -174.560 -42.711 52.757  1.00 30.00  ? 60  LEU Y O   1  
ATOM 6575   C CB  . LEU B 2 46  ? -177.479 -41.256 53.222  1.00 99.99  ? 60  LEU Y CB  1  
ATOM 6576   C CG  . LEU B 2 46  ? -177.811 -40.461 54.480  1.00 99.99  ? 60  LEU Y CG  1  
ATOM 6577   C CD1 . LEU B 2 46  ? -179.037 -41.064 55.155  1.00 99.99  ? 60  LEU Y CD1 1  
ATOM 6578   C CD2 . LEU B 2 46  ? -176.626 -40.512 55.438  1.00 99.99  ? 60  LEU Y CD2 1  
ATOM 6579   N N   . LYS B 2 47  ? -175.800 -42.426 50.893  1.00 30.00  ? 61  LYS Y N   1  
ATOM 6580   C CA  . LYS B 2 47  ? -175.216 -43.572 50.193  1.00 30.00  ? 61  LYS Y CA  1  
ATOM 6581   C C   . LYS B 2 47  ? -173.687 -43.474 50.228  1.00 30.00  ? 61  LYS Y C   1  
ATOM 6582   O O   . LYS B 2 47  ? -172.979 -44.429 49.904  1.00 30.00  ? 61  LYS Y O   1  
ATOM 6583   C CB  . LYS B 2 47  ? -175.688 -43.586 48.742  1.00 99.99  ? 61  LYS Y CB  1  
ATOM 6584   C CG  . LYS B 2 47  ? -175.155 -44.835 48.048  1.00 99.99  ? 61  LYS Y CG  1  
ATOM 6585   C CD  . LYS B 2 47  ? -175.960 -45.088 46.777  1.00 99.99  ? 61  LYS Y CD  1  
ATOM 6586   C CE  . LYS B 2 47  ? -175.216 -46.089 45.898  1.00 99.99  ? 61  LYS Y CE  1  
ATOM 6587   N NZ  . LYS B 2 47  ? -175.706 -47.446 46.176  1.00 99.99  ? 61  LYS Y NZ  1  
ATOM 6588   N N   . GLU B 2 48  ? -173.192 -42.307 50.626  1.00 30.00  ? 62  GLU Y N   1  
ATOM 6589   C CA  . GLU B 2 48  ? -171.763 -42.052 50.725  1.00 30.00  ? 62  GLU Y CA  1  
ATOM 6590   C C   . GLU B 2 48  ? -171.180 -42.786 51.932  1.00 30.00  ? 62  GLU Y C   1  
ATOM 6591   O O   . GLU B 2 48  ? -169.966 -42.828 52.119  1.00 30.00  ? 62  GLU Y O   1  
ATOM 6592   C CB  . GLU B 2 48  ? -171.513 -40.558 50.884  1.00 99.99  ? 62  GLU Y CB  1  
ATOM 6593   C CG  . GLU B 2 48  ? -171.962 -39.835 49.635  1.00 99.99  ? 62  GLU Y CG  1  
ATOM 6594   C CD  . GLU B 2 48  ? -170.988 -40.130 48.497  1.00 99.99  ? 62  GLU Y CD  1  
ATOM 6595   O OE1 . GLU B 2 48  ? -171.234 -41.132 47.774  1.00 99.99  ? 62  GLU Y OE1 1  
ATOM 6596   O OE2 . GLU B 2 48  ? -170.007 -39.351 48.362  1.00 99.99  ? 62  GLU Y OE2 1  
ATOM 6597   N N   . ALA B 2 49  ? -172.055 -43.367 52.750  1.00 30.00  ? 63  ALA Y N   1  
ATOM 6598   C CA  . ALA B 2 49  ? -171.641 -44.109 53.943  1.00 30.00  ? 63  ALA Y CA  1  
ATOM 6599   C C   . ALA B 2 49  ? -172.222 -45.542 53.916  1.00 30.00  ? 63  ALA Y C   1  
ATOM 6600   O O   . ALA B 2 49  ? -173.418 -45.738 54.137  1.00 30.00  ? 63  ALA Y O   1  
ATOM 6601   C CB  . ALA B 2 49  ? -172.109 -43.369 55.207  1.00 30.00  ? 63  ALA Y CB  1  
ATOM 6602   N N   . PRO B 2 50  ? -171.376 -46.551 53.643  1.00 30.00  ? 64  PRO Y N   1  
ATOM 6603   C CA  . PRO B 2 50  ? -171.748 -47.972 53.577  1.00 30.00  ? 64  PRO Y CA  1  
ATOM 6604   C C   . PRO B 2 50  ? -172.938 -48.384 54.442  1.00 30.00  ? 64  PRO Y C   1  
ATOM 6605   O O   . PRO B 2 50  ? -173.973 -48.818 53.932  1.00 30.00  ? 64  PRO Y O   1  
ATOM 6606   C CB  . PRO B 2 50  ? -170.479 -48.549 54.094  1.00 99.99  ? 64  PRO Y CB  1  
ATOM 6607   C CG  . PRO B 2 50  ? -169.549 -47.382 54.326  1.00 99.99  ? 64  PRO Y CG  1  
ATOM 6608   C CD  . PRO B 2 50  ? -170.059 -46.253 54.017  1.00 99.99  ? 64  PRO Y CD  1  
ATOM 6609   N N   . GLY B 2 51  ? -172.781 -48.251 55.755  1.00 30.00  ? 65  GLY Y N   1  
ATOM 6610   C CA  . GLY B 2 51  ? -173.846 -48.612 56.667  1.00 30.00  ? 65  GLY Y CA  1  
ATOM 6611   C C   . GLY B 2 51  ? -174.240 -47.452 57.563  1.00 30.00  ? 65  GLY Y C   1  
ATOM 6612   O O   . GLY B 2 51  ? -173.671 -46.367 57.454  1.00 30.00  ? 65  GLY Y O   1  
ATOM 6613   N N   . PRO B 2 52  ? -175.213 -47.658 58.465  1.00 30.00  ? 66  PRO Y N   1  
ATOM 6614   C CA  . PRO B 2 52  ? -175.707 -46.642 59.397  1.00 30.00  ? 66  PRO Y CA  1  
ATOM 6615   C C   . PRO B 2 52  ? -174.682 -45.563 59.770  1.00 30.00  ? 66  PRO Y C   1  
ATOM 6616   O O   . PRO B 2 52  ? -173.478 -45.809 59.841  1.00 30.00  ? 66  PRO Y O   1  
ATOM 6617   C CB  . PRO B 2 52  ? -176.005 -47.536 60.549  1.00 99.99  ? 66  PRO Y CB  1  
ATOM 6618   C CG  . PRO B 2 52  ? -175.690 -48.938 60.084  1.00 99.99  ? 66  PRO Y CG  1  
ATOM 6619   C CD  . PRO B 2 52  ? -175.285 -48.998 58.875  1.00 99.99  ? 66  PRO Y CD  1  
ATOM 6620   N N   . LEU B 2 53  ? -175.178 -44.360 60.012  1.00 30.00  ? 67  LEU Y N   1  
ATOM 6621   C CA  . LEU B 2 53  ? -174.298 -43.273 60.345  1.00 30.00  ? 67  LEU Y CA  1  
ATOM 6622   C C   . LEU B 2 53  ? -174.087 -42.987 61.808  1.00 30.00  ? 67  LEU Y C   1  
ATOM 6623   O O   . LEU B 2 53  ? -174.640 -42.031 62.345  1.00 30.00  ? 67  LEU Y O   1  
ATOM 6624   C CB  . LEU B 2 53  ? -174.829 -41.975 59.751  1.00 99.99  ? 67  LEU Y CB  1  
ATOM 6625   C CG  . LEU B 2 53  ? -174.169 -41.722 58.400  1.00 99.99  ? 67  LEU Y CG  1  
ATOM 6626   C CD1 . LEU B 2 53  ? -174.439 -40.287 57.961  1.00 99.99  ? 67  LEU Y CD1 1  
ATOM 6627   C CD2 . LEU B 2 53  ? -172.664 -41.943 58.521  1.00 99.99  ? 67  LEU Y CD2 1  
ATOM 6628   N N   . ASN B 2 54  ? -173.280 -43.822 62.448  1.00 30.00  ? 68  ASN Y N   1  
ATOM 6629   C CA  . ASN B 2 54  ? -172.958 -43.657 63.866  1.00 30.00  ? 68  ASN Y CA  1  
ATOM 6630   C C   . ASN B 2 54  ? -171.896 -42.572 63.850  1.00 30.00  ? 68  ASN Y C   1  
ATOM 6631   O O   . ASN B 2 54  ? -171.423 -42.198 62.780  1.00 30.00  ? 68  ASN Y O   1  
ATOM 6632   C CB  . ASN B 2 54  ? -172.441 -44.973 64.436  1.00 99.99  ? 68  ASN Y CB  1  
ATOM 6633   C CG  . ASN B 2 54  ? -172.690 -45.059 65.933  1.00 99.99  ? 68  ASN Y CG  1  
ATOM 6634   O OD1 . ASN B 2 54  ? -171.986 -45.774 66.645  1.00 99.99  ? 68  ASN Y OD1 1  
ATOM 6635   N ND2 . ASN B 2 54  ? -173.701 -44.332 66.414  1.00 99.99  ? 68  ASN Y ND2 1  
ATOM 6636   N N   . PHE B 2 55  ? -171.505 -42.061 65.008  1.00 30.00  ? 69  PHE Y N   1  
ATOM 6637   C CA  . PHE B 2 55  ? -170.482 -41.034 64.978  1.00 30.00  ? 69  PHE Y CA  1  
ATOM 6638   C C   . PHE B 2 55  ? -169.187 -41.580 64.399  1.00 30.00  ? 69  PHE Y C   1  
ATOM 6639   O O   . PHE B 2 55  ? -168.206 -40.859 64.289  1.00 30.00  ? 69  PHE Y O   1  
ATOM 6640   C CB  . PHE B 2 55  ? -170.215 -40.529 66.394  1.00 99.99  ? 69  PHE Y CB  1  
ATOM 6641   C CG  . PHE B 2 55  ? -169.153 -39.458 66.355  1.00 99.99  ? 69  PHE Y CG  1  
ATOM 6642   C CD1 . PHE B 2 55  ? -169.502 -38.136 66.055  1.00 99.99  ? 69  PHE Y CD1 1  
ATOM 6643   C CD2 . PHE B 2 55  ? -167.817 -39.786 66.619  1.00 99.99  ? 69  PHE Y CD2 1  
ATOM 6644   C CE1 . PHE B 2 55  ? -168.515 -37.143 66.021  1.00 99.99  ? 69  PHE Y CE1 1  
ATOM 6645   C CE2 . PHE B 2 55  ? -166.832 -38.792 66.586  1.00 99.99  ? 69  PHE Y CE2 1  
ATOM 6646   C CZ  . PHE B 2 55  ? -167.181 -37.470 66.285  1.00 99.99  ? 69  PHE Y CZ  1  
ATOM 6647   N N   . THR B 2 56  ? -169.185 -42.857 64.030  1.00 30.00  ? 70  THR Y N   1  
ATOM 6648   C CA  . THR B 2 56  ? -167.986 -43.461 63.473  1.00 30.00  ? 70  THR Y CA  1  
ATOM 6649   C C   . THR B 2 56  ? -167.921 -43.358 61.950  1.00 30.00  ? 70  THR Y C   1  
ATOM 6650   O O   . THR B 2 56  ? -166.995 -42.747 61.431  1.00 30.00  ? 70  THR Y O   1  
ATOM 6651   C CB  . THR B 2 56  ? -167.934 -44.941 63.833  1.00 99.99  ? 70  THR Y CB  1  
ATOM 6652   O OG1 . THR B 2 56  ? -168.983 -45.635 63.152  1.00 99.99  ? 70  THR Y OG1 1  
ATOM 6653   C CG2 . THR B 2 56  ? -168.116 -45.103 65.339  1.00 99.99  ? 70  THR Y CG2 1  
ATOM 6654   N N   . MET B 2 57  ? -168.875 -43.936 61.228  1.00 30.00  ? 71  MET Y N   1  
ATOM 6655   C CA  . MET B 2 57  ? -168.825 -43.844 59.771  1.00 30.00  ? 71  MET Y CA  1  
ATOM 6656   C C   . MET B 2 57  ? -168.858 -42.369 59.366  1.00 30.00  ? 71  MET Y C   1  
ATOM 6657   O O   . MET B 2 57  ? -168.578 -42.017 58.220  1.00 30.00  ? 71  MET Y O   1  
ATOM 6658   C CB  . MET B 2 57  ? -170.021 -44.568 59.163  1.00 99.99  ? 71  MET Y CB  1  
ATOM 6659   C CG  . MET B 2 57  ? -169.659 -46.028 58.909  1.00 99.99  ? 71  MET Y CG  1  
ATOM 6660   S SD  . MET B 2 57  ? -171.020 -46.863 58.056  1.00 99.99  ? 71  MET Y SD  1  
ATOM 6661   C CE  . MET B 2 57  ? -170.212 -48.386 57.607  1.00 99.99  ? 71  MET Y CE  1  
ATOM 6662   N N   . PHE B 2 58  ? -169.207 -41.519 60.329  1.00 30.00  ? 72  PHE Y N   1  
ATOM 6663   C CA  . PHE B 2 58  ? -169.279 -40.070 60.131  1.00 30.00  ? 72  PHE Y CA  1  
ATOM 6664   C C   . PHE B 2 58  ? -167.840 -39.597 60.004  1.00 30.00  ? 72  PHE Y C   1  
ATOM 6665   O O   . PHE B 2 58  ? -167.376 -39.239 58.917  1.00 30.00  ? 72  PHE Y O   1  
ATOM 6666   C CB  . PHE B 2 58  ? -169.970 -39.417 61.325  1.00 99.99  ? 72  PHE Y CB  1  
ATOM 6667   C CG  . PHE B 2 58  ? -170.043 -37.925 61.113  1.00 99.99  ? 72  PHE Y CG  1  
ATOM 6668   C CD1 . PHE B 2 58  ? -171.072 -37.378 60.339  1.00 99.99  ? 72  PHE Y CD1 1  
ATOM 6669   C CD2 . PHE B 2 58  ? -169.079 -37.088 61.688  1.00 99.99  ? 72  PHE Y CD2 1  
ATOM 6670   C CE1 . PHE B 2 58  ? -171.140 -35.994 60.141  1.00 99.99  ? 72  PHE Y CE1 1  
ATOM 6671   C CE2 . PHE B 2 58  ? -169.146 -35.705 61.489  1.00 99.99  ? 72  PHE Y CE2 1  
ATOM 6672   C CZ  . PHE B 2 58  ? -170.178 -35.156 60.717  1.00 99.99  ? 72  PHE Y CZ  1  
ATOM 6673   N N   . LEU B 2 59  ? -167.145 -39.610 61.138  1.00 30.00  ? 73  LEU Y N   1  
ATOM 6674   C CA  . LEU B 2 59  ? -165.755 -39.197 61.193  1.00 30.00  ? 73  LEU Y CA  1  
ATOM 6675   C C   . LEU B 2 59  ? -164.946 -39.909 60.120  1.00 30.00  ? 73  LEU Y C   1  
ATOM 6676   O O   . LEU B 2 59  ? -163.911 -39.417 59.696  1.00 30.00  ? 73  LEU Y O   1  
ATOM 6677   C CB  . LEU B 2 59  ? -165.167 -39.537 62.559  1.00 99.99  ? 73  LEU Y CB  1  
ATOM 6678   C CG  . LEU B 2 59  ? -165.271 -38.321 63.476  1.00 99.99  ? 73  LEU Y CG  1  
ATOM 6679   C CD1 . LEU B 2 59  ? -164.402 -38.542 64.711  1.00 99.99  ? 73  LEU Y CD1 1  
ATOM 6680   C CD2 . LEU B 2 59  ? -164.793 -37.081 62.731  1.00 99.99  ? 73  LEU Y CD2 1  
ATOM 6681   N N   . SER B 2 60  ? -165.416 -41.066 59.668  1.00 30.00  ? 74  SER Y N   1  
ATOM 6682   C CA  . SER B 2 60  ? -164.717 -41.819 58.633  1.00 30.00  ? 74  SER Y CA  1  
ATOM 6683   C C   . SER B 2 60  ? -164.749 -41.102 57.281  1.00 30.00  ? 74  SER Y C   1  
ATOM 6684   O O   . SER B 2 60  ? -163.699 -40.823 56.700  1.00 30.00  ? 74  SER Y O   1  
ATOM 6685   C CB  . SER B 2 60  ? -165.367 -43.188 58.458  1.00 99.99  ? 74  SER Y CB  1  
ATOM 6686   O OG  . SER B 2 60  ? -165.324 -43.898 59.698  1.00 99.99  ? 74  SER Y OG  1  
ATOM 6687   N N   . ILE B 2 61  ? -165.944 -40.801 56.770  1.00 30.00  ? 75  ILE Y N   1  
ATOM 6688   C CA  . ILE B 2 61  ? -166.047 -40.124 55.477  1.00 30.00  ? 75  ILE Y CA  1  
ATOM 6689   C C   . ILE B 2 61  ? -165.489 -38.701 55.513  1.00 30.00  ? 75  ILE Y C   1  
ATOM 6690   O O   . ILE B 2 61  ? -164.944 -38.225 54.516  1.00 30.00  ? 75  ILE Y O   1  
ATOM 6691   C CB  . ILE B 2 61  ? -167.509 -40.040 55.052  1.00 99.99  ? 75  ILE Y CB  1  
ATOM 6692   C CG1 . ILE B 2 61  ? -168.172 -38.858 55.751  1.00 99.99  ? 75  ILE Y CG1 1  
ATOM 6693   C CG2 . ILE B 2 61  ? -168.227 -41.328 55.441  1.00 99.99  ? 75  ILE Y CG2 1  
ATOM 6694   C CD1 . ILE B 2 61  ? -168.826 -39.331 57.044  1.00 99.99  ? 75  ILE Y CD1 1  
ATOM 6695   N N   . PHE B 2 62  ? -165.620 -38.023 56.652  1.00 30.00  ? 76  PHE Y N   1  
ATOM 6696   C CA  . PHE B 2 62  ? -165.101 -36.665 56.776  1.00 30.00  ? 76  PHE Y CA  1  
ATOM 6697   C C   . PHE B 2 62  ? -163.575 -36.677 56.738  1.00 30.00  ? 76  PHE Y C   1  
ATOM 6698   O O   . PHE B 2 62  ? -162.950 -35.827 56.103  1.00 30.00  ? 76  PHE Y O   1  
ATOM 6699   C CB  . PHE B 2 62  ? -165.558 -36.055 58.097  1.00 99.99  ? 76  PHE Y CB  1  
ATOM 6700   C CG  . PHE B 2 62  ? -165.022 -34.650 58.217  1.00 99.99  ? 76  PHE Y CG  1  
ATOM 6701   C CD1 . PHE B 2 62  ? -165.694 -33.587 57.602  1.00 99.99  ? 76  PHE Y CD1 1  
ATOM 6702   C CD2 . PHE B 2 62  ? -163.847 -34.409 58.943  1.00 99.99  ? 76  PHE Y CD2 1  
ATOM 6703   C CE1 . PHE B 2 62  ? -165.195 -32.283 57.714  1.00 99.99  ? 76  PHE Y CE1 1  
ATOM 6704   C CE2 . PHE B 2 62  ? -163.349 -33.106 59.052  1.00 99.99  ? 76  PHE Y CE2 1  
ATOM 6705   C CZ  . PHE B 2 62  ? -164.022 -32.043 58.437  1.00 99.99  ? 76  PHE Y CZ  1  
ATOM 6706   N N   . SER B 2 63  ? -162.974 -37.640 57.422  1.00 30.00  ? 77  SER Y N   1  
ATOM 6707   C CA  . SER B 2 63  ? -161.527 -37.741 57.449  1.00 30.00  ? 77  SER Y CA  1  
ATOM 6708   C C   . SER B 2 63  ? -160.971 -38.160 56.098  1.00 30.00  ? 77  SER Y C   1  
ATOM 6709   O O   . SER B 2 63  ? -159.883 -37.744 55.725  1.00 30.00  ? 77  SER Y O   1  
ATOM 6710   C CB  . SER B 2 63  ? -161.098 -38.776 58.484  1.00 99.99  ? 77  SER Y CB  1  
ATOM 6711   O OG  . SER B 2 63  ? -161.494 -40.080 58.049  1.00 99.99  ? 77  SER Y OG  1  
ATOM 6712   N N   . ASP B 2 64  ? -161.719 -38.977 55.365  1.00 30.00  ? 78  ASP Y N   1  
ATOM 6713   C CA  . ASP B 2 64  ? -161.267 -39.434 54.057  1.00 30.00  ? 78  ASP Y CA  1  
ATOM 6714   C C   . ASP B 2 64  ? -161.435 -38.369 52.976  1.00 30.00  ? 78  ASP Y C   1  
ATOM 6715   O O   . ASP B 2 64  ? -161.105 -38.589 51.806  1.00 30.00  ? 78  ASP Y O   1  
ATOM 6716   C CB  . ASP B 2 64  ? -162.069 -40.659 53.629  1.00 99.99  ? 78  ASP Y CB  1  
ATOM 6717   C CG  . ASP B 2 64  ? -161.717 -41.839 54.532  1.00 99.99  ? 78  ASP Y CG  1  
ATOM 6718   O OD1 . ASP B 2 64  ? -160.580 -42.361 54.381  1.00 99.99  ? 78  ASP Y OD1 1  
ATOM 6719   O OD2 . ASP B 2 64  ? -162.587 -42.206 55.365  1.00 99.99  ? 78  ASP Y OD2 1  
ATOM 6720   N N   . LYS B 2 65  ? -161.955 -37.220 53.387  1.00 30.00  ? 79  LYS Y N   1  
ATOM 6721   C CA  . LYS B 2 65  ? -162.164 -36.097 52.491  1.00 30.00  ? 79  LYS Y CA  1  
ATOM 6722   C C   . LYS B 2 65  ? -160.901 -35.278 52.644  1.00 30.00  ? 79  LYS Y C   1  
ATOM 6723   O O   . LYS B 2 65  ? -160.100 -35.162 51.714  1.00 30.00  ? 79  LYS Y O   1  
ATOM 6724   C CB  . LYS B 2 65  ? -163.406 -35.322 52.914  1.00 99.99  ? 79  LYS Y CB  1  
ATOM 6725   C CG  . LYS B 2 65  ? -164.638 -35.938 52.258  1.00 99.99  ? 79  LYS Y CG  1  
ATOM 6726   C CD  . LYS B 2 65  ? -165.798 -34.950 52.323  1.00 99.99  ? 79  LYS Y CD  1  
ATOM 6727   C CE  . LYS B 2 65  ? -166.334 -34.886 53.748  1.00 99.99  ? 79  LYS Y CE  1  
ATOM 6728   N NZ  . LYS B 2 65  ? -167.638 -34.210 53.752  1.00 99.99  ? 79  LYS Y NZ  1  
ATOM 6729   N N   . LEU B 2 66  ? -160.747 -34.727 53.840  1.00 30.00  ? 80  LEU Y N   1  
ATOM 6730   C CA  . LEU B 2 66  ? -159.609 -33.893 54.211  1.00 30.00  ? 80  LEU Y CA  1  
ATOM 6731   C C   . LEU B 2 66  ? -158.246 -34.611 54.147  1.00 30.00  ? 80  LEU Y C   1  
ATOM 6732   O O   . LEU B 2 66  ? -157.250 -34.120 54.691  1.00 30.00  ? 80  LEU Y O   1  
ATOM 6733   C CB  . LEU B 2 66  ? -159.775 -33.391 55.640  1.00 99.99  ? 80  LEU Y CB  1  
ATOM 6734   C CG  . LEU B 2 66  ? -160.419 -32.011 55.623  1.00 99.99  ? 80  LEU Y CG  1  
ATOM 6735   C CD1 . LEU B 2 66  ? -160.287 -31.371 57.004  1.00 99.99  ? 80  LEU Y CD1 1  
ATOM 6736   C CD2 . LEU B 2 66  ? -159.719 -31.136 54.588  1.00 99.99  ? 80  LEU Y CD2 1  
ATOM 6737   N N   . SER B 2 67  ? -158.207 -35.764 53.486  1.00 30.00  ? 81  SER Y N   1  
ATOM 6738   C CA  . SER B 2 67  ? -156.971 -36.531 53.368  1.00 30.00  ? 81  SER Y CA  1  
ATOM 6739   C C   . SER B 2 67  ? -156.392 -36.369 51.968  1.00 30.00  ? 81  SER Y C   1  
ATOM 6740   O O   . SER B 2 67  ? -157.119 -36.449 50.971  1.00 30.00  ? 81  SER Y O   1  
ATOM 6741   C CB  . SER B 2 67  ? -157.250 -38.006 53.625  1.00 99.99  ? 81  SER Y CB  1  
ATOM 6742   O OG  . SER B 2 67  ? -158.048 -38.534 52.563  1.00 99.99  ? 81  SER Y OG  1  
ATOM 6743   N N   . GLY B 2 68  ? -155.084 -36.149 51.905  1.00 30.00  ? 82  GLY Y N   1  
ATOM 6744   C CA  . GLY B 2 68  ? -154.433 -35.973 50.622  1.00 30.00  ? 82  GLY Y CA  1  
ATOM 6745   C C   . GLY B 2 68  ? -154.156 -34.500 50.414  1.00 30.00  ? 82  GLY Y C   1  
ATOM 6746   O O   . GLY B 2 68  ? -154.344 -33.965 49.317  1.00 30.00  ? 82  GLY Y O   1  
ATOM 6747   N N   . THR B 2 69  ? -153.711 -33.843 51.486  1.00 30.00  ? 83  THR Y N   1  
ATOM 6748   C CA  . THR B 2 69  ? -153.387 -32.421 51.460  1.00 30.00  ? 83  THR Y CA  1  
ATOM 6749   C C   . THR B 2 69  ? -152.147 -32.146 52.317  1.00 30.00  ? 83  THR Y C   1  
ATOM 6750   O O   . THR B 2 69  ? -151.792 -32.958 53.175  1.00 30.00  ? 83  THR Y O   1  
ATOM 6751   C CB  . THR B 2 69  ? -154.557 -31.613 52.009  1.00 99.99  ? 83  THR Y CB  1  
ATOM 6752   O OG1 . THR B 2 69  ? -154.237 -30.218 51.959  1.00 99.99  ? 83  THR Y OG1 1  
ATOM 6753   C CG2 . THR B 2 69  ? -154.825 -32.020 53.453  1.00 99.99  ? 83  THR Y CG2 1  
ATOM 6754   N N   . ASP B 2 70  ? -151.510 -31.002 52.089  1.00 30.00  ? 84  ASP Y N   1  
ATOM 6755   C CA  . ASP B 2 70  ? -150.289 -30.623 52.811  1.00 30.00  ? 84  ASP Y CA  1  
ATOM 6756   C C   . ASP B 2 70  ? -150.432 -29.658 53.967  1.00 30.00  ? 84  ASP Y C   1  
ATOM 6757   O O   . ASP B 2 70  ? -151.508 -29.148 54.233  1.00 30.00  ? 84  ASP Y O   1  
ATOM 6758   C CB  . ASP B 2 70  ? -149.305 -29.959 51.856  1.00 99.99  ? 84  ASP Y CB  1  
ATOM 6759   C CG  . ASP B 2 70  ? -149.916 -28.667 51.313  1.00 99.99  ? 84  ASP Y CG  1  
ATOM 6760   O OD1 . ASP B 2 70  ? -150.730 -28.770 50.360  1.00 99.99  ? 84  ASP Y OD1 1  
ATOM 6761   O OD2 . ASP B 2 70  ? -149.560 -27.589 51.862  1.00 99.99  ? 84  ASP Y OD2 1  
ATOM 6762   N N   . SER B 2 71  ? -149.146 -28.860 54.330  1.00 30.00  ? 85  SER Y N   1  
ATOM 6763   C CA  . SER B 2 71  ? -149.121 -27.989 55.504  1.00 30.00  ? 85  SER Y CA  1  
ATOM 6764   C C   . SER B 2 71  ? -149.434 -26.532 55.230  1.00 30.00  ? 85  SER Y C   1  
ATOM 6765   O O   . SER B 2 71  ? -149.443 -26.091 54.087  1.00 30.00  ? 85  SER Y O   1  
ATOM 6766   C CB  . SER B 2 71  ? -147.737 -28.017 56.144  1.00 99.99  ? 85  SER Y CB  1  
ATOM 6767   O OG  . SER B 2 71  ? -146.793 -27.393 55.271  1.00 99.99  ? 85  SER Y OG  1  
ATOM 6768   N N   . GLU B 2 72  ? -149.695 -25.800 56.307  1.00 30.00  ? 86  GLU Y N   1  
ATOM 6769   C CA  . GLU B 2 72  ? -150.007 -24.383 56.240  1.00 30.00  ? 86  GLU Y CA  1  
ATOM 6770   C C   . GLU B 2 72  ? -148.676 -23.682 56.087  1.00 30.00  ? 86  GLU Y C   1  
ATOM 6771   O O   . GLU B 2 72  ? -148.604 -22.525 55.680  1.00 30.00  ? 86  GLU Y O   1  
ATOM 6772   C CB  . GLU B 2 72  ? -150.718 -23.947 57.516  1.00 99.99  ? 86  GLU Y CB  1  
ATOM 6773   C CG  . GLU B 2 72  ? -149.854 -24.270 58.710  1.00 99.99  ? 86  GLU Y CG  1  
ATOM 6774   C CD  . GLU B 2 72  ? -149.962 -25.761 59.027  1.00 99.99  ? 86  GLU Y CD  1  
ATOM 6775   O OE1 . GLU B 2 72  ? -149.139 -26.530 58.466  1.00 99.99  ? 86  GLU Y OE1 1  
ATOM 6776   O OE2 . GLU B 2 72  ? -150.866 -26.115 59.831  1.00 99.99  ? 86  GLU Y OE2 1  
ATOM 6777   N N   . GLU B 2 73  ? -147.618 -24.413 56.428  1.00 30.00  ? 87  GLU Y N   1  
ATOM 6778   C CA  . GLU B 2 73  ? -146.268 -23.892 56.324  1.00 30.00  ? 87  GLU Y CA  1  
ATOM 6779   C C   . GLU B 2 73  ? -145.796 -24.246 54.916  1.00 30.00  ? 87  GLU Y C   1  
ATOM 6780   O O   . GLU B 2 73  ? -145.199 -23.428 54.232  1.00 30.00  ? 87  GLU Y O   1  
ATOM 6781   C CB  . GLU B 2 73  ? -145.379 -24.538 57.382  1.00 99.99  ? 87  GLU Y CB  1  
ATOM 6782   C CG  . GLU B 2 73  ? -145.857 -24.133 58.756  1.00 99.99  ? 87  GLU Y CG  1  
ATOM 6783   C CD  . GLU B 2 73  ? -145.513 -22.668 59.004  1.00 99.99  ? 87  GLU Y CD  1  
ATOM 6784   O OE1 . GLU B 2 73  ? -146.368 -21.811 58.666  1.00 99.99  ? 87  GLU Y OE1 1  
ATOM 6785   O OE2 . GLU B 2 73  ? -144.394 -22.420 59.532  1.00 99.99  ? 87  GLU Y OE2 1  
ATOM 6786   N N   . THR B 2 74  ? -146.082 -25.466 54.483  1.00 30.00  ? 88  THR Y N   1  
ATOM 6787   C CA  . THR B 2 74  ? -145.679 -25.910 53.163  1.00 30.00  ? 88  THR Y CA  1  
ATOM 6788   C C   . THR B 2 74  ? -146.306 -25.064 52.060  1.00 30.00  ? 88  THR Y C   1  
ATOM 6789   O O   . THR B 2 74  ? -145.694 -24.839 51.012  1.00 30.00  ? 88  THR Y O   1  
ATOM 6790   C CB  . THR B 2 74  ? -146.106 -27.356 52.948  1.00 99.99  ? 88  THR Y CB  1  
ATOM 6791   O OG1 . THR B 2 74  ? -147.533 -27.426 52.878  1.00 99.99  ? 88  THR Y OG1 1  
ATOM 6792   C CG2 . THR B 2 74  ? -145.614 -28.210 54.110  1.00 99.99  ? 88  THR Y CG2 1  
ATOM 6793   N N   . ILE B 2 75  ? -147.531 -24.595 52.294  1.00 30.00  ? 89  ILE Y N   1  
ATOM 6794   C CA  . ILE B 2 75  ? -148.227 -23.781 51.305  1.00 30.00  ? 89  ILE Y CA  1  
ATOM 6795   C C   . ILE B 2 75  ? -147.791 -22.326 51.427  1.00 30.00  ? 89  ILE Y C   1  
ATOM 6796   O O   . ILE B 2 75  ? -147.558 -21.667 50.421  1.00 30.00  ? 89  ILE Y O   1  
ATOM 6797   C CB  . ILE B 2 75  ? -149.733 -23.869 51.529  1.00 99.99  ? 89  ILE Y CB  1  
ATOM 6798   C CG1 . ILE B 2 75  ? -150.140 -22.910 52.642  1.00 99.99  ? 89  ILE Y CG1 1  
ATOM 6799   C CG2 . ILE B 2 75  ? -150.105 -25.295 51.924  1.00 99.99  ? 89  ILE Y CG2 1  
ATOM 6800   C CD1 . ILE B 2 75  ? -150.143 -23.652 53.975  1.00 99.99  ? 89  ILE Y CD1 1  
ATOM 6801   N N   . ARG B 2 76  ? -147.669 -21.828 52.648  1.00 30.00  ? 90  ARG Y N   1  
ATOM 6802   C CA  . ARG B 2 76  ? -147.251 -20.449 52.826  1.00 30.00  ? 90  ARG Y CA  1  
ATOM 6803   C C   . ARG B 2 76  ? -145.887 -20.200 52.184  1.00 30.00  ? 90  ARG Y C   1  
ATOM 6804   O O   . ARG B 2 76  ? -145.511 -19.059 51.928  1.00 30.00  ? 90  ARG Y O   1  
ATOM 6805   C CB  . ARG B 2 76  ? -147.152 -20.123 54.310  1.00 99.99  ? 90  ARG Y CB  1  
ATOM 6806   C CG  . ARG B 2 76  ? -146.757 -18.661 54.489  1.00 99.99  ? 90  ARG Y CG  1  
ATOM 6807   C CD  . ARG B 2 76  ? -146.613 -18.350 55.972  1.00 99.99  ? 90  ARG Y CD  1  
ATOM 6808   N NE  . ARG B 2 76  ? -145.769 -19.364 56.647  1.00 99.99  ? 90  ARG Y NE  1  
ATOM 6809   C CZ  . ARG B 2 76  ? -144.439 -19.352 56.594  1.00 99.99  ? 90  ARG Y CZ  1  
ATOM 6810   N NH1 . ARG B 2 76  ? -143.769 -18.423 55.925  1.00 99.99  ? 90  ARG Y NH1 1  
ATOM 6811   N NH2 . ARG B 2 76  ? -143.784 -20.315 57.237  1.00 99.99  ? 90  ARG Y NH2 1  
ATOM 6812   N N   . ASN B 2 77  ? -145.137 -21.265 51.933  1.00 30.00  ? 91  ASN Y N   1  
ATOM 6813   C CA  . ASN B 2 77  ? -143.814 -21.129 51.327  1.00 30.00  ? 91  ASN Y CA  1  
ATOM 6814   C C   . ASN B 2 77  ? -143.904 -21.198 49.815  1.00 30.00  ? 91  ASN Y C   1  
ATOM 6815   O O   . ASN B 2 77  ? -143.261 -20.416 49.122  1.00 30.00  ? 91  ASN Y O   1  
ATOM 6816   C CB  . ASN B 2 77  ? -142.902 -22.252 51.813  1.00 99.99  ? 91  ASN Y CB  1  
ATOM 6817   C CG  . ASN B 2 77  ? -142.684 -22.170 53.319  1.00 99.99  ? 91  ASN Y CG  1  
ATOM 6818   O OD1 . ASN B 2 77  ? -142.275 -21.130 53.833  1.00 99.99  ? 91  ASN Y OD1 1  
ATOM 6819   N ND2 . ASN B 2 77  ? -142.958 -23.270 54.020  1.00 99.99  ? 91  ASN Y ND2 1  
ATOM 6820   N N   . ALA B 2 78  ? -144.705 -22.133 49.305  1.00 30.00  ? 92  ALA Y N   1  
ATOM 6821   C CA  . ALA B 2 78  ? -144.875 -22.269 47.866  1.00 30.00  ? 92  ALA Y CA  1  
ATOM 6822   C C   . ALA B 2 78  ? -145.347 -20.905 47.355  1.00 30.00  ? 92  ALA Y C   1  
ATOM 6823   O O   . ALA B 2 78  ? -145.300 -20.615 46.160  1.00 30.00  ? 92  ALA Y O   1  
ATOM 6824   C CB  . ALA B 2 78  ? -145.921 -23.340 47.545  1.00 30.00  ? 92  ALA Y CB  1  
ATOM 6825   N N   . PHE B 2 79  ? -145.803 -20.072 48.293  1.00 30.00  ? 93  PHE Y N   1  
ATOM 6826   C CA  . PHE B 2 79  ? -146.291 -18.736 47.988  1.00 30.00  ? 93  PHE Y CA  1  
ATOM 6827   C C   . PHE B 2 79  ? -145.149 -17.736 48.072  1.00 30.00  ? 93  PHE Y C   1  
ATOM 6828   O O   . PHE B 2 79  ? -144.905 -16.997 47.119  1.00 30.00  ? 93  PHE Y O   1  
ATOM 6829   C CB  . PHE B 2 79  ? -147.374 -18.342 48.985  1.00 99.99  ? 93  PHE Y CB  1  
ATOM 6830   C CG  . PHE B 2 79  ? -147.878 -16.957 48.661  1.00 99.99  ? 93  PHE Y CG  1  
ATOM 6831   C CD1 . PHE B 2 79  ? -148.852 -16.779 47.673  1.00 99.99  ? 93  PHE Y CD1 1  
ATOM 6832   C CD2 . PHE B 2 79  ? -147.366 -15.847 49.346  1.00 99.99  ? 93  PHE Y CD2 1  
ATOM 6833   C CE1 . PHE B 2 79  ? -149.319 -15.494 47.372  1.00 99.99  ? 93  PHE Y CE1 1  
ATOM 6834   C CE2 . PHE B 2 79  ? -147.831 -14.563 49.044  1.00 99.99  ? 93  PHE Y CE2 1  
ATOM 6835   C CZ  . PHE B 2 79  ? -148.809 -14.385 48.057  1.00 99.99  ? 93  PHE Y CZ  1  
ATOM 6836   N N   . ALA B 2 80  ? -144.458 -17.710 49.211  1.00 30.00  ? 94  ALA Y N   1  
ATOM 6837   C CA  . ALA B 2 80  ? -143.342 -16.789 49.406  1.00 30.00  ? 94  ALA Y CA  1  
ATOM 6838   C C   . ALA B 2 80  ? -142.263 -17.050 48.349  1.00 30.00  ? 94  ALA Y C   1  
ATOM 6839   O O   . ALA B 2 80  ? -141.264 -16.332 48.274  1.00 30.00  ? 94  ALA Y O   1  
ATOM 6840   C CB  . ALA B 2 80  ? -142.769 -16.958 50.815  1.00 30.00  ? 94  ALA Y CB  1  
ATOM 6841   N N   . MET B 2 81  ? -142.487 -18.088 47.543  1.00 30.00  ? 95  MET Y N   1  
ATOM 6842   C CA  . MET B 2 81  ? -141.576 -18.478 46.470  1.00 30.00  ? 95  MET Y CA  1  
ATOM 6843   C C   . MET B 2 81  ? -141.743 -17.519 45.280  1.00 30.00  ? 95  MET Y C   1  
ATOM 6844   O O   . MET B 2 81  ? -141.042 -17.634 44.263  1.00 30.00  ? 95  MET Y O   1  
ATOM 6845   C CB  . MET B 2 81  ? -141.890 -19.903 46.019  1.00 99.99  ? 95  MET Y CB  1  
ATOM 6846   C CG  . MET B 2 81  ? -140.731 -20.437 45.183  1.00 99.99  ? 95  MET Y CG  1  
ATOM 6847   S SD  . MET B 2 81  ? -141.022 -22.174 44.761  1.00 99.99  ? 95  MET Y SD  1  
ATOM 6848   C CE  . MET B 2 81  ? -142.734 -22.091 44.272  1.00 99.99  ? 95  MET Y CE  1  
ATOM 6849   N N   . PHE B 2 82  ? -142.686 -16.588 45.415  1.00 30.00  ? 96  PHE Y N   1  
ATOM 6850   C CA  . PHE B 2 82  ? -142.962 -15.594 44.388  1.00 30.00  ? 96  PHE Y CA  1  
ATOM 6851   C C   . PHE B 2 82  ? -143.003 -14.259 45.092  1.00 30.00  ? 96  PHE Y C   1  
ATOM 6852   O O   . PHE B 2 82  ? -143.392 -13.247 44.504  1.00 30.00  ? 96  PHE Y O   1  
ATOM 6853   C CB  . PHE B 2 82  ? -144.297 -15.897 43.715  1.00 99.99  ? 96  PHE Y CB  1  
ATOM 6854   C CG  . PHE B 2 82  ? -144.573 -14.865 42.652  1.00 99.99  ? 96  PHE Y CG  1  
ATOM 6855   C CD1 . PHE B 2 82  ? -144.012 -15.005 41.378  1.00 99.99  ? 96  PHE Y CD1 1  
ATOM 6856   C CD2 . PHE B 2 82  ? -145.394 -13.767 42.939  1.00 99.99  ? 96  PHE Y CD2 1  
ATOM 6857   C CE1 . PHE B 2 82  ? -144.267 -14.045 40.391  1.00 99.99  ? 96  PHE Y CE1 1  
ATOM 6858   C CE2 . PHE B 2 82  ? -145.650 -12.809 41.952  1.00 99.99  ? 96  PHE Y CE2 1  
ATOM 6859   C CZ  . PHE B 2 82  ? -145.086 -12.947 40.679  1.00 99.99  ? 96  PHE Y CZ  1  
ATOM 6860   N N   . ASP B 2 83  ? -142.601 -14.273 46.356  1.00 30.00  ? 97  ASP Y N   1  
ATOM 6861   C CA  . ASP B 2 83  ? -142.582 -13.067 47.165  1.00 30.00  ? 97  ASP Y CA  1  
ATOM 6862   C C   . ASP B 2 83  ? -141.130 -12.668 47.419  1.00 30.00  ? 97  ASP Y C   1  
ATOM 6863   O O   . ASP B 2 83  ? -140.721 -12.483 48.569  1.00 30.00  ? 97  ASP Y O   1  
ATOM 6864   C CB  . ASP B 2 83  ? -143.285 -13.320 48.493  1.00 99.99  ? 97  ASP Y CB  1  
ATOM 6865   C CG  . ASP B 2 83  ? -143.479 -11.998 49.228  1.00 99.99  ? 97  ASP Y CG  1  
ATOM 6866   O OD1 . ASP B 2 83  ? -142.488 -11.532 49.851  1.00 99.99  ? 97  ASP Y OD1 1  
ATOM 6867   O OD2 . ASP B 2 83  ? -144.617 -11.461 49.160  1.00 99.99  ? 97  ASP Y OD2 1  
ATOM 6868   N N   . GLU B 2 84  ? -140.361 -12.540 46.334  1.00 30.00  ? 98  GLU Y N   1  
ATOM 6869   C CA  . GLU B 2 84  ? -138.939 -12.172 46.380  1.00 30.00  ? 98  GLU Y CA  1  
ATOM 6870   C C   . GLU B 2 84  ? -138.567 -11.255 47.545  1.00 30.00  ? 98  GLU Y C   1  
ATOM 6871   O O   . GLU B 2 84  ? -137.800 -11.643 48.432  1.00 30.00  ? 98  GLU Y O   1  
ATOM 6872   C CB  . GLU B 2 84  ? -138.551 -11.439 45.099  1.00 99.99  ? 98  GLU Y CB  1  
ATOM 6873   C CG  . GLU B 2 84  ? -139.434 -10.231 44.921  1.00 99.99  ? 98  GLU Y CG  1  
ATOM 6874   C CD  . GLU B 2 84  ? -140.797 -10.668 44.389  1.00 99.99  ? 98  GLU Y CD  1  
ATOM 6875   O OE1 . GLU B 2 84  ? -141.682 -10.951 45.239  1.00 99.99  ? 98  GLU Y OE1 1  
ATOM 6876   O OE2 . GLU B 2 84  ? -140.939 -10.714 43.139  1.00 99.99  ? 98  GLU Y OE2 1  
ATOM 6877   N N   . GLN B 2 85  ? -139.107 -10.040 47.541  1.00 30.00  ? 99  GLN Y N   1  
ATOM 6878   C CA  . GLN B 2 85  ? -138.812 -9.075  48.596  1.00 30.00  ? 99  GLN Y CA  1  
ATOM 6879   C C   . GLN B 2 85  ? -139.211 -9.504  50.006  1.00 30.00  ? 99  GLN Y C   1  
ATOM 6880   O O   . GLN B 2 85  ? -138.834 -8.850  50.980  1.00 30.00  ? 99  GLN Y O   1  
ATOM 6881   C CB  . GLN B 2 85  ? -139.547 -7.767  48.323  1.00 99.99  ? 99  GLN Y CB  1  
ATOM 6882   C CG  . GLN B 2 85  ? -139.009 -7.136  47.047  1.00 99.99  ? 99  GLN Y CG  1  
ATOM 6883   C CD  . GLN B 2 85  ? -137.610 -6.572  47.262  1.00 99.99  ? 99  GLN Y CD  1  
ATOM 6884   O OE1 . GLN B 2 85  ? -137.064 -6.661  48.358  1.00 99.99  ? 99  GLN Y OE1 1  
ATOM 6885   N NE2 . GLN B 2 85  ? -137.032 -5.990  46.207  1.00 99.99  ? 99  GLN Y NE2 1  
ATOM 6886   N N   . GLU B 2 86  ? -139.965 -10.590 50.117  1.00 30.00  ? 100 GLU Y N   1  
ATOM 6887   C CA  . GLU B 2 86  ? -140.408 -11.079 51.425  1.00 30.00  ? 100 GLU Y CA  1  
ATOM 6888   C C   . GLU B 2 86  ? -141.265 -10.010 52.101  1.00 30.00  ? 100 GLU Y C   1  
ATOM 6889   O O   . GLU B 2 86  ? -140.925 -9.512  53.176  1.00 30.00  ? 100 GLU Y O   1  
ATOM 6890   C CB  . GLU B 2 86  ? -139.196 -11.382 52.300  1.00 99.99  ? 100 GLU Y CB  1  
ATOM 6891   C CG  . GLU B 2 86  ? -139.363 -10.712 53.641  1.00 99.99  ? 100 GLU Y CG  1  
ATOM 6892   C CD  . GLU B 2 86  ? -139.201 -9.201  53.479  1.00 99.99  ? 100 GLU Y CD  1  
ATOM 6893   O OE1 . GLU B 2 86  ? -140.241 -8.534  53.234  1.00 99.99  ? 100 GLU Y OE1 1  
ATOM 6894   O OE2 . GLU B 2 86  ? -138.039 -8.730  53.603  1.00 99.99  ? 100 GLU Y OE2 1  
ATOM 6895   N N   . THR B 2 87  ? -142.379 -9.666  51.459  1.00 30.00  ? 101 THR Y N   1  
ATOM 6896   C CA  . THR B 2 87  ? -143.305 -8.656  51.972  1.00 30.00  ? 101 THR Y CA  1  
ATOM 6897   C C   . THR B 2 87  ? -144.565 -9.274  52.562  1.00 30.00  ? 101 THR Y C   1  
ATOM 6898   O O   . THR B 2 87  ? -145.354 -8.599  53.242  1.00 30.00  ? 101 THR Y O   1  
ATOM 6899   C CB  . THR B 2 87  ? -143.724 -7.718  50.844  1.00 99.99  ? 101 THR Y CB  1  
ATOM 6900   O OG1 . THR B 2 87  ? -144.532 -8.435  49.906  1.00 99.99  ? 101 THR Y OG1 1  
ATOM 6901   C CG2 . THR B 2 87  ? -142.484 -7.181  50.139  1.00 99.99  ? 101 THR Y CG2 1  
ATOM 6902   N N   . LYS B 2 88  ? -144.748 -10.562 52.292  1.00 30.00  ? 102 LYS Y N   1  
ATOM 6903   C CA  . LYS B 2 88  ? -145.899 -11.298 52.780  1.00 30.00  ? 102 LYS Y CA  1  
ATOM 6904   C C   . LYS B 2 88  ? -147.166 -10.774 52.107  1.00 30.00  ? 102 LYS Y C   1  
ATOM 6905   O O   . LYS B 2 88  ? -148.152 -10.439 52.764  1.00 30.00  ? 102 LYS Y O   1  
ATOM 6906   C CB  . LYS B 2 88  ? -146.022 -11.126 54.289  1.00 99.99  ? 102 LYS Y CB  1  
ATOM 6907   C CG  . LYS B 2 88  ? -144.776 -11.676 54.969  1.00 99.99  ? 102 LYS Y CG  1  
ATOM 6908   C CD  . LYS B 2 88  ? -144.854 -13.198 55.024  1.00 99.99  ? 102 LYS Y CD  1  
ATOM 6909   C CE  . LYS B 2 88  ? -143.697 -13.740 55.855  1.00 99.99  ? 102 LYS Y CE  1  
ATOM 6910   N NZ  . LYS B 2 88  ? -143.618 -15.198 55.694  1.00 99.99  ? 102 LYS Y NZ  1  
ATOM 6911   N N   . LYS B 2 89  ? -147.110 -10.711 50.780  1.00 30.00  ? 103 LYS Y N   1  
ATOM 6912   C CA  . LYS B 2 89  ? -148.214 -10.252 49.947  1.00 30.00  ? 103 LYS Y CA  1  
ATOM 6913   C C   . LYS B 2 89  ? -147.805 -10.442 48.504  1.00 30.00  ? 103 LYS Y C   1  
ATOM 6914   O O   . LYS B 2 89  ? -146.623 -10.352 48.167  1.00 30.00  ? 103 LYS Y O   1  
ATOM 6915   C CB  . LYS B 2 89  ? -148.497 -8.779  50.229  1.00 99.99  ? 103 LYS Y CB  1  
ATOM 6916   C CG  . LYS B 2 89  ? -148.844 -8.599  51.702  1.00 99.99  ? 103 LYS Y CG  1  
ATOM 6917   C CD  . LYS B 2 89  ? -149.224 -7.145  51.962  1.00 99.99  ? 103 LYS Y CD  1  
ATOM 6918   C CE  . LYS B 2 89  ? -149.595 -6.972  53.431  1.00 99.99  ? 103 LYS Y CE  1  
ATOM 6919   N NZ  . LYS B 2 89  ? -150.398 -5.752  53.593  1.00 99.99  ? 103 LYS Y NZ  1  
ATOM 6920   N N   . LEU B 2 90  ? -148.773 -10.721 47.646  1.00 30.00  ? 104 LEU Y N   1  
ATOM 6921   C CA  . LEU B 2 90  ? -148.499 -10.915 46.231  1.00 30.00  ? 104 LEU Y CA  1  
ATOM 6922   C C   . LEU B 2 90  ? -149.323 -9.871  45.481  1.00 30.00  ? 104 LEU Y C   1  
ATOM 6923   O O   . LEU B 2 90  ? -150.443 -9.563  45.891  1.00 30.00  ? 104 LEU Y O   1  
ATOM 6924   C CB  . LEU B 2 90  ? -148.904 -12.323 45.812  1.00 99.99  ? 104 LEU Y CB  1  
ATOM 6925   C CG  . LEU B 2 90  ? -147.690 -13.244 45.882  1.00 99.99  ? 104 LEU Y CG  1  
ATOM 6926   C CD1 . LEU B 2 90  ? -148.001 -14.551 45.162  1.00 99.99  ? 104 LEU Y CD1 1  
ATOM 6927   C CD2 . LEU B 2 90  ? -146.497 -12.566 45.217  1.00 99.99  ? 104 LEU Y CD2 1  
ATOM 6928   N N   . ASN B 2 91  ? -148.787 -9.317  44.397  1.00 30.00  ? 105 ASN Y N   1  
ATOM 6929   C CA  . ASN B 2 91  ? -149.572 -8.330  43.685  1.00 30.00  ? 105 ASN Y CA  1  
ATOM 6930   C C   . ASN B 2 91  ? -150.598 -9.081  42.867  1.00 30.00  ? 105 ASN Y C   1  
ATOM 6931   O O   . ASN B 2 91  ? -150.270 -9.909  42.012  1.00 30.00  ? 105 ASN Y O   1  
ATOM 6932   C CB  . ASN B 2 91  ? -148.670 -7.501  42.777  1.00 99.99  ? 105 ASN Y CB  1  
ATOM 6933   C CG  . ASN B 2 91  ? -149.261 -6.124  42.519  1.00 99.99  ? 105 ASN Y CG  1  
ATOM 6934   O OD1 . ASN B 2 91  ? -148.965 -5.496  41.506  1.00 99.99  ? 105 ASN Y OD1 1  
ATOM 6935   N ND2 . ASN B 2 91  ? -150.103 -5.656  43.444  1.00 99.99  ? 105 ASN Y ND2 1  
ATOM 6936   N N   . ILE B 2 92  ? -151.848 -8.767  43.182  1.00 30.00  ? 106 ILE Y N   1  
ATOM 6937   C CA  . ILE B 2 92  ? -153.024 -9.347  42.578  1.00 30.00  ? 106 ILE Y CA  1  
ATOM 6938   C C   . ILE B 2 92  ? -153.001 -9.707  41.106  1.00 30.00  ? 106 ILE Y C   1  
ATOM 6939   O O   . ILE B 2 92  ? -153.477 -10.778 40.720  1.00 30.00  ? 106 ILE Y O   1  
ATOM 6940   C CB  . ILE B 2 92  ? -154.200 -8.385  42.710  1.00 99.99  ? 106 ILE Y CB  1  
ATOM 6941   C CG1 . ILE B 2 92  ? -155.371 -8.898  41.882  1.00 99.99  ? 106 ILE Y CG1 1  
ATOM 6942   C CG2 . ILE B 2 92  ? -153.786 -7.005  42.206  1.00 99.99  ? 106 ILE Y CG2 1  
ATOM 6943   C CD1 . ILE B 2 92  ? -155.516 -10.404 42.081  1.00 99.99  ? 106 ILE Y CD1 1  
ATOM 6944   N N   . GLU B 2 93  ? -152.468 -8.819  40.274  1.00 30.00  ? 107 GLU Y N   1  
ATOM 6945   C CA  . GLU B 2 93  ? -152.423 -9.088  38.841  1.00 30.00  ? 107 GLU Y CA  1  
ATOM 6946   C C   . GLU B 2 93  ? -151.498 -10.273 38.587  1.00 30.00  ? 107 GLU Y C   1  
ATOM 6947   O O   . GLU B 2 93  ? -151.741 -11.107 37.699  1.00 30.00  ? 107 GLU Y O   1  
ATOM 6948   C CB  . GLU B 2 93  ? -151.900 -7.863  38.101  1.00 99.99  ? 107 GLU Y CB  1  
ATOM 6949   C CG  . GLU B 2 93  ? -150.541 -7.490  38.642  1.00 99.99  ? 107 GLU Y CG  1  
ATOM 6950   C CD  . GLU B 2 93  ? -150.706 -6.753  39.970  1.00 99.99  ? 107 GLU Y CD  1  
ATOM 6951   O OE1 . GLU B 2 93  ? -150.718 -7.451  41.018  1.00 99.99  ? 107 GLU Y OE1 1  
ATOM 6952   O OE2 . GLU B 2 93  ? -150.819 -5.498  39.921  1.00 99.99  ? 107 GLU Y OE2 1  
ATOM 6953   N N   . TYR B 2 94  ? -150.440 -10.339 39.406  1.00 30.00  ? 108 TYR Y N   1  
ATOM 6954   C CA  . TYR B 2 94  ? -149.424 -11.397 39.342  1.00 30.00  ? 108 TYR Y CA  1  
ATOM 6955   C C   . TYR B 2 94  ? -150.018 -12.784 39.622  1.00 30.00  ? 108 TYR Y C   1  
ATOM 6956   O O   . TYR B 2 94  ? -150.065 -13.668 38.737  1.00 30.00  ? 108 TYR Y O   1  
ATOM 6957   C CB  . TYR B 2 94  ? -148.333 -11.131 40.373  1.00 99.99  ? 108 TYR Y CB  1  
ATOM 6958   C CG  . TYR B 2 94  ? -147.623 -9.841  40.038  1.00 99.99  ? 108 TYR Y CG  1  
ATOM 6959   C CD1 . TYR B 2 94  ? -148.102 -8.626  40.540  1.00 99.99  ? 108 TYR Y CD1 1  
ATOM 6960   C CD2 . TYR B 2 94  ? -146.487 -9.860  39.221  1.00 99.99  ? 108 TYR Y CD2 1  
ATOM 6961   C CE1 . TYR B 2 94  ? -147.443 -7.430  40.228  1.00 99.99  ? 108 TYR Y CE1 1  
ATOM 6962   C CE2 . TYR B 2 94  ? -145.829 -8.665  38.908  1.00 99.99  ? 108 TYR Y CE2 1  
ATOM 6963   C CZ  . TYR B 2 94  ? -146.305 -7.450  39.412  1.00 99.99  ? 108 TYR Y CZ  1  
ATOM 6964   O OH  . TYR B 2 94  ? -145.665 -6.288  39.110  1.00 99.99  ? 108 TYR Y OH  1  
ATOM 6965   N N   . ILE B 2 95  ? -150.470 -12.969 40.863  1.00 30.00  ? 109 ILE Y N   1  
ATOM 6966   C CA  . ILE B 2 95  ? -151.058 -14.240 41.280  1.00 30.00  ? 109 ILE Y CA  1  
ATOM 6967   C C   . ILE B 2 95  ? -152.136 -14.683 40.289  1.00 30.00  ? 109 ILE Y C   1  
ATOM 6968   O O   . ILE B 2 95  ? -152.095 -15.805 39.758  1.00 30.00  ? 109 ILE Y O   1  
ATOM 6969   C CB  . ILE B 2 95  ? -151.692 -14.093 42.660  1.00 99.99  ? 109 ILE Y CB  1  
ATOM 6970   C CG1 . ILE B 2 95  ? -153.075 -13.470 42.519  1.00 99.99  ? 109 ILE Y CG1 1  
ATOM 6971   C CG2 . ILE B 2 95  ? -150.815 -13.193 43.525  1.00 99.99  ? 109 ILE Y CG2 1  
ATOM 6972   C CD1 . ILE B 2 95  ? -152.971 -11.955 42.669  1.00 99.99  ? 109 ILE Y CD1 1  
ATOM 6973   N N   . LYS B 2 96  ? -153.087 -13.793 40.028  1.00 30.00  ? 110 LYS Y N   1  
ATOM 6974   C CA  . LYS B 2 96  ? -154.157 -14.099 39.090  1.00 30.00  ? 110 LYS Y CA  1  
ATOM 6975   C C   . LYS B 2 96  ? -153.570 -14.633 37.784  1.00 30.00  ? 110 LYS Y C   1  
ATOM 6976   O O   . LYS B 2 96  ? -154.079 -15.585 37.187  1.00 30.00  ? 110 LYS Y O   1  
ATOM 6977   C CB  . LYS B 2 96  ? -154.965 -12.838 38.798  1.00 99.99  ? 110 LYS Y CB  1  
ATOM 6978   C CG  . LYS B 2 96  ? -156.142 -13.185 37.892  1.00 99.99  ? 110 LYS Y CG  1  
ATOM 6979   C CD  . LYS B 2 96  ? -157.180 -12.069 37.957  1.00 99.99  ? 110 LYS Y CD  1  
ATOM 6980   C CE  . LYS B 2 96  ? -158.161 -12.223 36.799  1.00 99.99  ? 110 LYS Y CE  1  
ATOM 6981   N NZ  . LYS B 2 96  ? -159.334 -12.989 37.249  1.00 99.99  ? 110 LYS Y NZ  1  
ATOM 6982   N N   . ASP B 2 97  ? -152.482 -14.004 37.344  1.00 30.00  ? 111 ASP Y N   1  
ATOM 6983   C CA  . ASP B 2 97  ? -151.814 -14.388 36.109  1.00 30.00  ? 111 ASP Y CA  1  
ATOM 6984   C C   . ASP B 2 97  ? -151.225 -15.792 36.196  1.00 30.00  ? 111 ASP Y C   1  
ATOM 6985   O O   . ASP B 2 97  ? -151.376 -16.610 35.265  1.00 30.00  ? 111 ASP Y O   1  
ATOM 6986   C CB  . ASP B 2 97  ? -150.679 -13.411 35.809  1.00 99.99  ? 111 ASP Y CB  1  
ATOM 6987   C CG  . ASP B 2 97  ? -150.147 -13.666 34.402  1.00 99.99  ? 111 ASP Y CG  1  
ATOM 6988   O OD1 . ASP B 2 97  ? -149.349 -14.630 34.251  1.00 99.99  ? 111 ASP Y OD1 1  
ATOM 6989   O OD2 . ASP B 2 97  ? -150.546 -12.894 33.486  1.00 99.99  ? 111 ASP Y OD2 1  
ATOM 6990   N N   . LEU B 2 98  ? -150.558 -16.064 37.322  1.00 30.00  ? 112 LEU Y N   1  
ATOM 6991   C CA  . LEU B 2 98  ? -149.934 -17.374 37.559  1.00 30.00  ? 112 LEU Y CA  1  
ATOM 6992   C C   . LEU B 2 98  ? -150.941 -18.501 37.440  1.00 30.00  ? 112 LEU Y C   1  
ATOM 6993   O O   . LEU B 2 98  ? -150.802 -19.381 36.573  1.00 30.00  ? 112 LEU Y O   1  
ATOM 6994   C CB  . LEU B 2 98  ? -149.332 -17.415 38.960  1.00 99.99  ? 112 LEU Y CB  1  
ATOM 6995   C CG  . LEU B 2 98  ? -147.856 -17.040 38.892  1.00 99.99  ? 112 LEU Y CG  1  
ATOM 6996   C CD1 . LEU B 2 98  ? -147.181 -17.398 40.212  1.00 99.99  ? 112 LEU Y CD1 1  
ATOM 6997   C CD2 . LEU B 2 98  ? -147.189 -17.808 37.754  1.00 99.99  ? 112 LEU Y CD2 1  
ATOM 6998   N N   . LEU B 2 99  ? -151.953 -18.460 38.315  1.00 30.00  ? 113 LEU Y N   1  
ATOM 6999   C CA  . LEU B 2 99  ? -153.033 -19.452 38.371  1.00 30.00  ? 113 LEU Y CA  1  
ATOM 7000   C C   . LEU B 2 99  ? -153.794 -19.593 37.056  1.00 30.00  ? 113 LEU Y C   1  
ATOM 7001   O O   . LEU B 2 99  ? -154.039 -20.706 36.572  1.00 30.00  ? 113 LEU Y O   1  
ATOM 7002   C CB  . LEU B 2 99  ? -154.043 -19.059 39.443  1.00 99.99  ? 113 LEU Y CB  1  
ATOM 7003   C CG  . LEU B 2 99  ? -153.706 -19.771 40.749  1.00 99.99  ? 113 LEU Y CG  1  
ATOM 7004   C CD1 . LEU B 2 99  ? -154.879 -19.645 41.713  1.00 99.99  ? 113 LEU Y CD1 1  
ATOM 7005   C CD2 . LEU B 2 99  ? -153.429 -21.243 40.468  1.00 99.99  ? 113 LEU Y CD2 1  
ATOM 7006   N N   . GLU B 2 100 ? -154.157 -18.444 36.488  1.00 30.00  ? 114 GLU Y N   1  
ATOM 7007   C CA  . GLU B 2 100 ? -154.907 -18.388 35.246  1.00 30.00  ? 114 GLU Y CA  1  
ATOM 7008   C C   . GLU B 2 100 ? -154.349 -19.086 34.014  1.00 30.00  ? 114 GLU Y C   1  
ATOM 7009   O O   . GLU B 2 100 ? -155.030 -19.921 33.419  1.00 30.00  ? 114 GLU Y O   1  
ATOM 7010   C CB  . GLU B 2 100 ? -155.080 -16.936 34.811  1.00 99.99  ? 114 GLU Y CB  1  
ATOM 7011   C CG  . GLU B 2 100 ? -155.929 -16.205 35.821  1.00 99.99  ? 114 GLU Y CG  1  
ATOM 7012   C CD  . GLU B 2 100 ? -157.377 -16.673 35.706  1.00 99.99  ? 114 GLU Y CD  1  
ATOM 7013   O OE1 . GLU B 2 100 ? -157.723 -17.654 36.414  1.00 99.99  ? 114 GLU Y OE1 1  
ATOM 7014   O OE2 . GLU B 2 100 ? -158.122 -16.044 34.908  1.00 99.99  ? 114 GLU Y OE2 1  
ATOM 7015   N N   . ASN B 2 101 ? -153.115 -18.753 33.620  1.00 30.00  ? 115 ASN Y N   1  
ATOM 7016   C CA  . ASN B 2 101 ? -152.539 -19.379 32.429  1.00 30.00  ? 115 ASN Y CA  1  
ATOM 7017   C C   . ASN B 2 101 ? -151.139 -19.943 32.588  1.00 30.00  ? 115 ASN Y C   1  
ATOM 7018   O O   . ASN B 2 101 ? -150.332 -19.882 31.658  1.00 30.00  ? 115 ASN Y O   1  
ATOM 7019   C CB  . ASN B 2 101 ? -152.454 -18.358 31.298  1.00 99.99  ? 115 ASN Y CB  1  
ATOM 7020   C CG  . ASN B 2 101 ? -151.545 -17.197 31.670  1.00 99.99  ? 115 ASN Y CG  1  
ATOM 7021   O OD1 . ASN B 2 101 ? -151.163 -16.404 30.813  1.00 99.99  ? 115 ASN Y OD1 1  
ATOM 7022   N ND2 . ASN B 2 101 ? -151.197 -17.101 32.956  1.00 99.99  ? 115 ASN Y ND2 1  
ATOM 7023   N N   . MET B 2 102 ? -150.845 -20.500 33.752  1.00 30.00  ? 116 MET Y N   1  
ATOM 7024   C CA  . MET B 2 102 ? -149.530 -21.065 33.974  1.00 30.00  ? 116 MET Y CA  1  
ATOM 7025   C C   . MET B 2 102 ? -149.543 -22.347 34.780  1.00 30.00  ? 116 MET Y C   1  
ATOM 7026   O O   . MET B 2 102 ? -150.172 -22.435 35.836  1.00 30.00  ? 116 MET Y O   1  
ATOM 7027   C CB  . MET B 2 102 ? -148.658 -20.068 34.730  1.00 99.99  ? 116 MET Y CB  1  
ATOM 7028   C CG  . MET B 2 102 ? -148.724 -18.709 34.043  1.00 99.99  ? 116 MET Y CG  1  
ATOM 7029   S SD  . MET B 2 102 ? -147.628 -18.686 32.604  1.00 99.99  ? 116 MET Y SD  1  
ATOM 7030   C CE  . MET B 2 102 ? -146.052 -18.525 33.419  1.00 99.99  ? 116 MET Y CE  1  
ATOM 7031   N N   . GLY B 2 103 ? -148.826 -23.342 34.276  1.00 30.00  ? 117 GLY Y N   1  
ATOM 7032   C CA  . GLY B 2 103 ? -148.773 -24.619 34.943  1.00 30.00  ? 117 GLY Y CA  1  
ATOM 7033   C C   . GLY B 2 103 ? -150.014 -25.372 34.524  1.00 30.00  ? 117 GLY Y C   1  
ATOM 7034   O O   . GLY B 2 103 ? -150.181 -25.722 33.356  1.00 30.00  ? 117 GLY Y O   1  
ATOM 7035   N N   . ASP B 2 104 ? -150.888 -25.623 35.492  1.00 30.00  ? 118 ASP Y N   1  
ATOM 7036   C CA  . ASP B 2 104 ? -152.136 -26.327 35.229  1.00 30.00  ? 118 ASP Y CA  1  
ATOM 7037   C C   . ASP B 2 104 ? -153.184 -25.236 35.257  1.00 30.00  ? 118 ASP Y C   1  
ATOM 7038   O O   . ASP B 2 104 ? -153.883 -25.038 36.254  1.00 30.00  ? 118 ASP Y O   1  
ATOM 7039   C CB  . ASP B 2 104 ? -152.374 -27.381 36.306  1.00 99.99  ? 118 ASP Y CB  1  
ATOM 7040   C CG  . ASP B 2 104 ? -153.492 -28.322 35.861  1.00 99.99  ? 118 ASP Y CG  1  
ATOM 7041   O OD1 . ASP B 2 104 ? -153.215 -29.162 34.962  1.00 99.99  ? 118 ASP Y OD1 1  
ATOM 7042   O OD2 . ASP B 2 104 ? -154.614 -28.190 36.422  1.00 99.99  ? 118 ASP Y OD2 1  
ATOM 7043   N N   . ASN B 2 105 ? -153.272 -24.510 34.149  1.00 30.00  ? 119 ASN Y N   1  
ATOM 7044   C CA  . ASN B 2 105 ? -154.212 -23.411 34.005  1.00 30.00  ? 119 ASN Y CA  1  
ATOM 7045   C C   . ASN B 2 105 ? -155.542 -23.625 34.712  1.00 30.00  ? 119 ASN Y C   1  
ATOM 7046   O O   . ASN B 2 105 ? -156.150 -24.696 34.629  1.00 30.00  ? 119 ASN Y O   1  
ATOM 7047   C CB  . ASN B 2 105 ? -154.529 -23.188 32.531  1.00 99.99  ? 119 ASN Y CB  1  
ATOM 7048   C CG  . ASN B 2 105 ? -155.320 -24.355 31.955  1.00 99.99  ? 119 ASN Y CG  1  
ATOM 7049   O OD1 . ASN B 2 105 ? -154.841 -25.054 31.066  1.00 99.99  ? 119 ASN Y OD1 1  
ATOM 7050   N ND2 . ASN B 2 105 ? -156.536 -24.559 32.468  1.00 99.99  ? 119 ASN Y ND2 1  
ATOM 7051   N N   . PHE B 2 106 ? -155.984 -22.591 35.409  1.00 30.00  ? 120 PHE Y N   1  
ATOM 7052   C CA  . PHE B 2 106 ? -157.257 -22.644 36.097  1.00 30.00  ? 120 PHE Y CA  1  
ATOM 7053   C C   . PHE B 2 106 ? -158.251 -22.278 35.031  1.00 30.00  ? 120 PHE Y C   1  
ATOM 7054   O O   . PHE B 2 106 ? -157.930 -22.212 33.845  1.00 30.00  ? 120 PHE Y O   1  
ATOM 7055   C CB  . PHE B 2 106 ? -157.262 -21.653 37.255  1.00 99.99  ? 120 PHE Y CB  1  
ATOM 7056   C CG  . PHE B 2 106 ? -156.397 -22.180 38.375  1.00 99.99  ? 120 PHE Y CG  1  
ATOM 7057   C CD1 . PHE B 2 106 ? -156.883 -23.187 39.219  1.00 99.99  ? 120 PHE Y CD1 1  
ATOM 7058   C CD2 . PHE B 2 106 ? -155.112 -21.661 38.568  1.00 99.99  ? 120 PHE Y CD2 1  
ATOM 7059   C CE1 . PHE B 2 106 ? -156.078 -23.675 40.256  1.00 99.99  ? 120 PHE Y CE1 1  
ATOM 7060   C CE2 . PHE B 2 106 ? -154.309 -22.150 39.608  1.00 99.99  ? 120 PHE Y CE2 1  
ATOM 7061   C CZ  . PHE B 2 106 ? -154.793 -23.156 40.450  1.00 99.99  ? 120 PHE Y CZ  1  
ATOM 7062   N N   . ASN B 2 107 ? -159.475 -22.034 35.454  1.00 30.00  ? 121 ASN Y N   1  
ATOM 7063   C CA  . ASN B 2 107 ? -160.509 -21.659 34.518  1.00 30.00  ? 121 ASN Y CA  1  
ATOM 7064   C C   . ASN B 2 107 ? -161.152 -20.440 35.156  1.00 30.00  ? 121 ASN Y C   1  
ATOM 7065   O O   . ASN B 2 107 ? -160.886 -20.145 36.323  1.00 30.00  ? 121 ASN Y O   1  
ATOM 7066   C CB  . ASN B 2 107 ? -161.497 -22.809 34.353  1.00 99.99  ? 121 ASN Y CB  1  
ATOM 7067   C CG  . ASN B 2 107 ? -162.137 -23.180 35.683  1.00 99.99  ? 121 ASN Y CG  1  
ATOM 7068   O OD1 . ASN B 2 107 ? -163.305 -22.886 35.918  1.00 99.99  ? 121 ASN Y OD1 1  
ATOM 7069   N ND2 . ASN B 2 107 ? -161.363 -23.825 36.559  1.00 99.99  ? 121 ASN Y ND2 1  
ATOM 7070   N N   . LYS B 2 108 ? -161.977 -19.733 34.394  1.00 30.00  ? 122 LYS Y N   1  
ATOM 7071   C CA  . LYS B 2 108 ? -162.642 -18.539 34.902  1.00 30.00  ? 122 LYS Y CA  1  
ATOM 7072   C C   . LYS B 2 108 ? -163.408 -18.820 36.204  1.00 30.00  ? 122 LYS Y C   1  
ATOM 7073   O O   . LYS B 2 108 ? -163.349 -18.044 37.168  1.00 30.00  ? 122 LYS Y O   1  
ATOM 7074   C CB  . LYS B 2 108 ? -163.637 -18.024 33.867  1.00 99.99  ? 122 LYS Y CB  1  
ATOM 7075   C CG  . LYS B 2 108 ? -164.255 -16.719 34.360  1.00 99.99  ? 122 LYS Y CG  1  
ATOM 7076   C CD  . LYS B 2 108 ? -164.888 -15.978 33.187  1.00 99.99  ? 122 LYS Y CD  1  
ATOM 7077   C CE  . LYS B 2 108 ? -165.816 -14.888 33.716  1.00 99.99  ? 122 LYS Y CE  1  
ATOM 7078   N NZ  . LYS B 2 108 ? -165.081 -13.615 33.791  1.00 99.99  ? 122 LYS Y NZ  1  
ATOM 7079   N N   . ASP B 2 109 ? -164.125 -19.935 36.227  1.00 30.00  ? 123 ASP Y N   1  
ATOM 7080   C CA  . ASP B 2 109 ? -164.900 -20.309 37.403  1.00 30.00  ? 123 ASP Y CA  1  
ATOM 7081   C C   . ASP B 2 109 ? -163.964 -20.607 38.567  1.00 30.00  ? 123 ASP Y C   1  
ATOM 7082   O O   . ASP B 2 109 ? -164.164 -20.095 39.684  1.00 30.00  ? 123 ASP Y O   1  
ATOM 7083   C CB  . ASP B 2 109 ? -165.731 -21.551 37.103  1.00 99.99  ? 123 ASP Y CB  1  
ATOM 7084   C CG  . ASP B 2 109 ? -166.716 -21.794 38.243  1.00 99.99  ? 123 ASP Y CG  1  
ATOM 7085   O OD1 . ASP B 2 109 ? -166.273 -22.350 39.281  1.00 99.99  ? 123 ASP Y OD1 1  
ATOM 7086   O OD2 . ASP B 2 109 ? -167.907 -21.415 38.064  1.00 99.99  ? 123 ASP Y OD2 1  
ATOM 7087   N N   . GLU B 2 110 ? -162.947 -21.431 38.307  1.00 30.00  ? 124 GLU Y N   1  
ATOM 7088   C CA  . GLU B 2 110 ? -161.971 -21.779 39.328  1.00 30.00  ? 124 GLU Y CA  1  
ATOM 7089   C C   . GLU B 2 110 ? -161.434 -20.429 39.791  1.00 30.00  ? 124 GLU Y C   1  
ATOM 7090   O O   . GLU B 2 110 ? -161.223 -20.192 40.978  1.00 30.00  ? 124 GLU Y O   1  
ATOM 7091   C CB  . GLU B 2 110 ? -160.877 -22.653 38.720  1.00 99.99  ? 124 GLU Y CB  1  
ATOM 7092   C CG  . GLU B 2 110 ? -161.472 -23.967 38.272  1.00 99.99  ? 124 GLU Y CG  1  
ATOM 7093   C CD  . GLU B 2 110 ? -161.815 -24.813 39.496  1.00 99.99  ? 124 GLU Y CD  1  
ATOM 7094   O OE1 . GLU B 2 110 ? -162.969 -24.678 39.984  1.00 99.99  ? 124 GLU Y OE1 1  
ATOM 7095   O OE2 . GLU B 2 110 ? -160.922 -25.588 39.930  1.00 99.99  ? 124 GLU Y OE2 1  
ATOM 7096   N N   . MET B 2 111 ? -161.248 -19.534 38.821  1.00 30.00  ? 125 MET Y N   1  
ATOM 7097   C CA  . MET B 2 111 ? -160.743 -18.179 39.048  1.00 30.00  ? 125 MET Y CA  1  
ATOM 7098   C C   . MET B 2 111 ? -161.678 -17.315 39.882  1.00 30.00  ? 125 MET Y C   1  
ATOM 7099   O O   . MET B 2 111 ? -161.225 -16.598 40.783  1.00 30.00  ? 125 MET Y O   1  
ATOM 7100   C CB  . MET B 2 111 ? -160.544 -17.469 37.714  1.00 99.99  ? 125 MET Y CB  1  
ATOM 7101   C CG  . MET B 2 111 ? -160.409 -15.968 37.950  1.00 99.99  ? 125 MET Y CG  1  
ATOM 7102   S SD  . MET B 2 111 ? -160.230 -15.105 36.369  1.00 99.99  ? 125 MET Y SD  1  
ATOM 7103   C CE  . MET B 2 111 ? -160.698 -13.460 36.860  1.00 99.99  ? 125 MET Y CE  1  
ATOM 7104   N N   . ARG B 2 112 ? -162.972 -17.379 39.581  1.00 30.00  ? 126 ARG Y N   1  
ATOM 7105   C CA  . ARG B 2 112 ? -163.940 -16.586 40.336  1.00 30.00  ? 126 ARG Y CA  1  
ATOM 7106   C C   . ARG B 2 112 ? -164.177 -17.179 41.714  1.00 30.00  ? 126 ARG Y C   1  
ATOM 7107   O O   . ARG B 2 112 ? -164.192 -16.456 42.729  1.00 30.00  ? 126 ARG Y O   1  
ATOM 7108   C CB  . ARG B 2 112 ? -165.271 -16.546 39.591  1.00 99.99  ? 126 ARG Y CB  1  
ATOM 7109   C CG  . ARG B 2 112 ? -165.073 -15.894 38.227  1.00 99.99  ? 126 ARG Y CG  1  
ATOM 7110   C CD  . ARG B 2 112 ? -166.374 -15.966 37.434  1.00 99.99  ? 126 ARG Y CD  1  
ATOM 7111   N NE  . ARG B 2 112 ? -166.608 -17.336 36.924  1.00 99.99  ? 126 ARG Y NE  1  
ATOM 7112   C CZ  . ARG B 2 112 ? -167.711 -17.684 36.268  1.00 99.99  ? 126 ARG Y CZ  1  
ATOM 7113   N NH1 . ARG B 2 112 ? -168.688 -16.819 36.021  1.00 99.99  ? 126 ARG Y NH1 1  
ATOM 7114   N NH2 . ARG B 2 112 ? -167.817 -18.944 35.853  1.00 99.99  ? 126 ARG Y NH2 1  
ATOM 7115   N N   . MET B 2 113 ? -164.378 -18.497 41.740  1.00 30.00  ? 127 MET Y N   1  
ATOM 7116   C CA  . MET B 2 113 ? -164.635 -19.195 42.986  1.00 30.00  ? 127 MET Y CA  1  
ATOM 7117   C C   . MET B 2 113 ? -163.510 -18.875 43.947  1.00 30.00  ? 127 MET Y C   1  
ATOM 7118   O O   . MET B 2 113 ? -163.746 -18.627 45.142  1.00 30.00  ? 127 MET Y O   1  
ATOM 7119   C CB  . MET B 2 113 ? -164.691 -20.698 42.735  1.00 99.99  ? 127 MET Y CB  1  
ATOM 7120   C CG  . MET B 2 113 ? -165.634 -20.986 41.573  1.00 99.99  ? 127 MET Y CG  1  
ATOM 7121   S SD  . MET B 2 113 ? -167.351 -20.942 42.141  1.00 99.99  ? 127 MET Y SD  1  
ATOM 7122   C CE  . MET B 2 113 ? -167.438 -22.509 42.980  1.00 99.99  ? 127 MET Y CE  1  
ATOM 7123   N N   . THR B 2 114 ? -162.284 -18.860 43.413  1.00 30.00  ? 128 THR Y N   1  
ATOM 7124   C CA  . THR B 2 114 ? -161.099 -18.581 44.221  1.00 30.00  ? 128 THR Y CA  1  
ATOM 7125   C C   . THR B 2 114 ? -160.960 -17.175 44.756  1.00 30.00  ? 128 THR Y C   1  
ATOM 7126   O O   . THR B 2 114 ? -160.602 -16.978 45.921  1.00 30.00  ? 128 THR Y O   1  
ATOM 7127   C CB  . THR B 2 114 ? -159.842 -18.833 43.397  1.00 99.99  ? 128 THR Y CB  1  
ATOM 7128   O OG1 . THR B 2 114 ? -159.748 -17.855 42.356  1.00 99.99  ? 128 THR Y OG1 1  
ATOM 7129   C CG2 . THR B 2 114 ? -159.908 -20.225 42.780  1.00 99.99  ? 128 THR Y CG2 1  
ATOM 7130   N N   . PHE B 2 115 ? -161.229 -16.191 43.909  1.00 30.00  ? 129 PHE Y N   1  
ATOM 7131   C CA  . PHE B 2 115 ? -161.086 -14.821 44.357  1.00 30.00  ? 129 PHE Y CA  1  
ATOM 7132   C C   . PHE B 2 115 ? -162.294 -14.202 45.015  1.00 30.00  ? 129 PHE Y C   1  
ATOM 7133   O O   . PHE B 2 115 ? -162.213 -13.091 45.544  1.00 30.00  ? 129 PHE Y O   1  
ATOM 7134   C CB  . PHE B 2 115 ? -160.752 -13.920 43.173  1.00 99.99  ? 129 PHE Y CB  1  
ATOM 7135   C CG  . PHE B 2 115 ? -160.601 -12.496 43.649  1.00 99.99  ? 129 PHE Y CG  1  
ATOM 7136   C CD1 . PHE B 2 115 ? -159.388 -12.065 44.198  1.00 99.99  ? 129 PHE Y CD1 1  
ATOM 7137   C CD2 . PHE B 2 115 ? -161.677 -11.607 43.541  1.00 99.99  ? 129 PHE Y CD2 1  
ATOM 7138   C CE1 . PHE B 2 115 ? -159.249 -10.742 44.640  1.00 99.99  ? 129 PHE Y CE1 1  
ATOM 7139   C CE2 . PHE B 2 115 ? -161.539 -10.284 43.984  1.00 99.99  ? 129 PHE Y CE2 1  
ATOM 7140   C CZ  . PHE B 2 115 ? -160.324 -9.854  44.533  1.00 99.99  ? 129 PHE Y CZ  1  
ATOM 7141   N N   . LYS B 2 116 ? -163.411 -14.922 44.996  1.00 30.00  ? 130 LYS Y N   1  
ATOM 7142   C CA  . LYS B 2 116 ? -164.631 -14.426 45.613  1.00 30.00  ? 130 LYS Y CA  1  
ATOM 7143   C C   . LYS B 2 116 ? -164.366 -14.274 47.114  1.00 30.00  ? 130 LYS Y C   1  
ATOM 7144   O O   . LYS B 2 116 ? -164.981 -13.454 47.796  1.00 30.00  ? 130 LYS Y O   1  
ATOM 7145   C CB  . LYS B 2 116 ? -165.771 -15.411 45.377  1.00 99.99  ? 130 LYS Y CB  1  
ATOM 7146   C CG  . LYS B 2 116 ? -166.232 -15.320 43.926  1.00 99.99  ? 130 LYS Y CG  1  
ATOM 7147   C CD  . LYS B 2 116 ? -167.433 -16.234 43.716  1.00 99.99  ? 130 LYS Y CD  1  
ATOM 7148   C CE  . LYS B 2 116 ? -166.959 -17.582 43.179  1.00 99.99  ? 130 LYS Y CE  1  
ATOM 7149   N NZ  . LYS B 2 116 ? -168.112 -18.335 42.662  1.00 99.99  ? 130 LYS Y NZ  1  
ATOM 7150   N N   . GLU B 2 117 ? -163.423 -15.066 47.610  1.00 30.00  ? 131 GLU Y N   1  
ATOM 7151   C CA  . GLU B 2 117 ? -163.048 -15.055 49.021  1.00 30.00  ? 131 GLU Y CA  1  
ATOM 7152   C C   . GLU B 2 117 ? -161.760 -14.272 49.289  1.00 30.00  ? 131 GLU Y C   1  
ATOM 7153   O O   . GLU B 2 117 ? -161.676 -13.495 50.249  1.00 30.00  ? 131 GLU Y O   1  
ATOM 7154   C CB  . GLU B 2 117 ? -162.834 -16.482 49.514  1.00 99.99  ? 131 GLU Y CB  1  
ATOM 7155   C CG  . GLU B 2 117 ? -164.140 -17.241 49.453  1.00 99.99  ? 131 GLU Y CG  1  
ATOM 7156   C CD  . GLU B 2 117 ? -165.072 -16.737 50.552  1.00 99.99  ? 131 GLU Y CD  1  
ATOM 7157   O OE1 . GLU B 2 117 ? -165.837 -15.777 50.265  1.00 99.99  ? 131 GLU Y OE1 1  
ATOM 7158   O OE2 . GLU B 2 117 ? -165.011 -17.316 51.670  1.00 99.99  ? 131 GLU Y OE2 1  
ATOM 7159   N N   . ALA B 2 118 ? -160.770 -14.504 48.429  1.00 30.00  ? 132 ALA Y N   1  
ATOM 7160   C CA  . ALA B 2 118 ? -159.458 -13.871 48.513  1.00 30.00  ? 132 ALA Y CA  1  
ATOM 7161   C C   . ALA B 2 118 ? -159.433 -12.509 49.198  1.00 30.00  ? 132 ALA Y C   1  
ATOM 7162   O O   . ALA B 2 118 ? -160.282 -11.654 48.931  1.00 30.00  ? 132 ALA Y O   1  
ATOM 7163   C CB  . ALA B 2 118 ? -158.884 -13.757 47.126  1.00 30.00  ? 132 ALA Y CB  1  
ATOM 7164   N N   . PRO B 2 119 ? -158.457 -12.290 50.099  1.00 30.00  ? 133 PRO Y N   1  
ATOM 7165   C CA  . PRO B 2 119 ? -158.231 -11.058 50.872  1.00 30.00  ? 133 PRO Y CA  1  
ATOM 7166   C C   . PRO B 2 119 ? -157.320 -9.991  50.217  1.00 30.00  ? 133 PRO Y C   1  
ATOM 7167   O O   . PRO B 2 119 ? -156.212 -9.731  50.704  1.00 30.00  ? 133 PRO Y O   1  
ATOM 7168   C CB  . PRO B 2 119 ? -157.573 -11.670 52.058  1.00 99.99  ? 133 PRO Y CB  1  
ATOM 7169   C CG  . PRO B 2 119 ? -157.567 -13.161 51.812  1.00 99.99  ? 133 PRO Y CG  1  
ATOM 7170   C CD  . PRO B 2 119 ? -158.121 -13.500 50.714  1.00 99.99  ? 133 PRO Y CD  1  
ATOM 7171   N N   . VAL B 2 120 ? -157.781 -9.369  49.131  1.00 30.00  ? 134 VAL Y N   1  
ATOM 7172   C CA  . VAL B 2 120 ? -157.005 -8.345  48.413  1.00 30.00  ? 134 VAL Y CA  1  
ATOM 7173   C C   . VAL B 2 120 ? -157.386 -6.893  48.715  1.00 30.00  ? 134 VAL Y C   1  
ATOM 7174   O O   . VAL B 2 120 ? -158.499 -6.469  48.394  1.00 30.00  ? 134 VAL Y O   1  
ATOM 7175   C CB  . VAL B 2 120 ? -157.179 -8.526  46.910  1.00 99.99  ? 134 VAL Y CB  1  
ATOM 7176   C CG1 . VAL B 2 120 ? -156.683 -9.912  46.504  1.00 99.99  ? 134 VAL Y CG1 1  
ATOM 7177   C CG2 . VAL B 2 120 ? -158.651 -8.388  46.545  1.00 99.99  ? 134 VAL Y CG2 1  
ATOM 7178   N N   . GLU B 2 121 ? -156.484 -6.121  49.321  1.00 30.00  ? 135 GLU Y N   1  
ATOM 7179   C CA  . GLU B 2 121 ? -156.797 -4.724  49.611  1.00 30.00  ? 135 GLU Y CA  1  
ATOM 7180   C C   . GLU B 2 121 ? -155.603 -3.772  49.544  1.00 30.00  ? 135 GLU Y C   1  
ATOM 7181   O O   . GLU B 2 121 ? -154.810 -3.671  50.488  1.00 30.00  ? 135 GLU Y O   1  
ATOM 7182   C CB  . GLU B 2 121 ? -157.372 -4.603  51.019  1.00 99.99  ? 135 GLU Y CB  1  
ATOM 7183   C CG  . GLU B 2 121 ? -156.392 -5.174  52.015  1.00 99.99  ? 135 GLU Y CG  1  
ATOM 7184   C CD  . GLU B 2 121 ? -156.472 -6.699  51.992  1.00 99.99  ? 135 GLU Y CD  1  
ATOM 7185   O OE1 . GLU B 2 121 ? -155.713 -7.305  51.189  1.00 99.99  ? 135 GLU Y OE1 1  
ATOM 7186   O OE2 . GLU B 2 121 ? -157.291 -7.244  52.779  1.00 99.99  ? 135 GLU Y OE2 1  
ATOM 7187   N N   . GLY B 2 122 ? -155.511 -3.066  48.420  1.00 30.00  ? 136 GLY Y N   1  
ATOM 7188   C CA  . GLY B 2 122 ? -154.438 -2.121  48.186  1.00 30.00  ? 136 GLY Y CA  1  
ATOM 7189   C C   . GLY B 2 122 ? -153.645 -2.664  47.015  1.00 30.00  ? 136 GLY Y C   1  
ATOM 7190   O O   . GLY B 2 122 ? -152.487 -2.313  46.819  1.00 30.00  ? 136 GLY Y O   1  
ATOM 7191   N N   . GLY B 2 123 ? -154.285 -3.534  46.238  1.00 30.00  ? 137 GLY Y N   1  
ATOM 7192   C CA  . GLY B 2 123 ? -153.632 -4.131  45.093  1.00 30.00  ? 137 GLY Y CA  1  
ATOM 7193   C C   . GLY B 2 123 ? -152.947 -5.441  45.441  1.00 30.00  ? 137 GLY Y C   1  
ATOM 7194   O O   . GLY B 2 123 ? -152.845 -6.346  44.598  1.00 30.00  ? 137 GLY Y O   1  
ATOM 7195   N N   . LYS B 2 124 ? -152.478 -5.541  46.691  1.00 30.00  ? 138 LYS Y N   1  
ATOM 7196   C CA  . LYS B 2 124 ? -151.786 -6.746  47.184  1.00 30.00  ? 138 LYS Y CA  1  
ATOM 7197   C C   . LYS B 2 124 ? -152.671 -7.833  47.858  1.00 30.00  ? 138 LYS Y C   1  
ATOM 7198   O O   . LYS B 2 124 ? -153.419 -7.571  48.807  1.00 30.00  ? 138 LYS Y O   1  
ATOM 7199   C CB  . LYS B 2 124 ? -150.752 -6.353  48.235  1.00 99.99  ? 138 LYS Y CB  1  
ATOM 7200   C CG  . LYS B 2 124 ? -149.745 -5.386  47.623  1.00 99.99  ? 138 LYS Y CG  1  
ATOM 7201   C CD  . LYS B 2 124 ? -148.654 -5.073  48.641  1.00 99.99  ? 138 LYS Y CD  1  
ATOM 7202   C CE  . LYS B 2 124 ? -147.635 -4.125  48.019  1.00 99.99  ? 138 LYS Y CE  1  
ATOM 7203   N NZ  . LYS B 2 124 ? -146.375 -4.193  48.776  1.00 99.99  ? 138 LYS Y NZ  1  
ATOM 7204   N N   . PHE B 2 125 ? -152.549 -9.059  47.346  1.00 30.00  ? 139 PHE Y N   1  
ATOM 7205   C CA  . PHE B 2 125 ? -153.298 -10.214 47.849  1.00 30.00  ? 139 PHE Y CA  1  
ATOM 7206   C C   . PHE B 2 125 ? -152.518 -10.978 48.923  1.00 30.00  ? 139 PHE Y C   1  
ATOM 7207   O O   . PHE B 2 125 ? -151.636 -11.773 48.605  1.00 30.00  ? 139 PHE Y O   1  
ATOM 7208   C CB  . PHE B 2 125 ? -153.596 -11.175 46.704  1.00 99.99  ? 139 PHE Y CB  1  
ATOM 7209   C CG  . PHE B 2 125 ? -154.371 -12.359 47.230  1.00 99.99  ? 139 PHE Y CG  1  
ATOM 7210   C CD1 . PHE B 2 125 ? -155.759 -12.274 47.392  1.00 99.99  ? 139 PHE Y CD1 1  
ATOM 7211   C CD2 . PHE B 2 125 ? -153.701 -13.544 47.555  1.00 99.99  ? 139 PHE Y CD2 1  
ATOM 7212   C CE1 . PHE B 2 125 ? -156.476 -13.372 47.880  1.00 99.99  ? 139 PHE Y CE1 1  
ATOM 7213   C CE2 . PHE B 2 125 ? -154.419 -14.641 48.043  1.00 99.99  ? 139 PHE Y CE2 1  
ATOM 7214   C CZ  . PHE B 2 125 ? -155.806 -14.556 48.206  1.00 99.99  ? 139 PHE Y CZ  1  
ATOM 7215   N N   . ASP B 2 126 ? -152.857 -10.732 50.190  1.00 30.00  ? 140 ASP Y N   1  
ATOM 7216   C CA  . ASP B 2 126 ? -152.202 -11.384 51.337  1.00 30.00  ? 140 ASP Y CA  1  
ATOM 7217   C C   . ASP B 2 126 ? -152.345 -12.911 51.366  1.00 30.00  ? 140 ASP Y C   1  
ATOM 7218   O O   . ASP B 2 126 ? -153.380 -13.420 51.786  1.00 30.00  ? 140 ASP Y O   1  
ATOM 7219   C CB  . ASP B 2 126 ? -152.797 -10.863 52.640  1.00 99.99  ? 140 ASP Y CB  1  
ATOM 7220   C CG  . ASP B 2 126 ? -151.899 -11.264 53.810  1.00 99.99  ? 140 ASP Y CG  1  
ATOM 7221   O OD1 . ASP B 2 126 ? -152.024 -12.438 54.250  1.00 99.99  ? 140 ASP Y OD1 1  
ATOM 7222   O OD2 . ASP B 2 126 ? -151.099 -10.397 54.247  1.00 99.99  ? 140 ASP Y OD2 1  
ATOM 7223   N N   . TYR B 2 127 ? -151.300 -13.624 50.942  1.00 30.00  ? 141 TYR Y N   1  
ATOM 7224   C CA  . TYR B 2 127 ? -151.312 -15.083 50.891  1.00 30.00  ? 141 TYR Y CA  1  
ATOM 7225   C C   . TYR B 2 127 ? -151.155 -15.772 52.233  1.00 30.00  ? 141 TYR Y C   1  
ATOM 7226   O O   . TYR B 2 127 ? -151.278 -16.992 52.335  1.00 30.00  ? 141 TYR Y O   1  
ATOM 7227   C CB  . TYR B 2 127 ? -150.169 -15.581 50.012  1.00 99.99  ? 141 TYR Y CB  1  
ATOM 7228   C CG  . TYR B 2 127 ? -150.189 -17.090 49.965  1.00 99.99  ? 141 TYR Y CG  1  
ATOM 7229   C CD1 . TYR B 2 127 ? -151.037 -17.750 49.068  1.00 99.99  ? 141 TYR Y CD1 1  
ATOM 7230   C CD2 . TYR B 2 127 ? -149.358 -17.827 50.817  1.00 99.99  ? 141 TYR Y CD2 1  
ATOM 7231   C CE1 . TYR B 2 127 ? -151.056 -19.149 49.024  1.00 99.99  ? 141 TYR Y CE1 1  
ATOM 7232   C CE2 . TYR B 2 127 ? -149.379 -19.228 50.771  1.00 99.99  ? 141 TYR Y CE2 1  
ATOM 7233   C CZ  . TYR B 2 127 ? -150.226 -19.887 49.874  1.00 99.99  ? 141 TYR Y CZ  1  
ATOM 7234   O OH  . TYR B 2 127 ? -150.245 -21.247 49.833  1.00 99.99  ? 141 TYR Y OH  1  
ATOM 7235   N N   . VAL B 2 128 ? -150.867 -14.997 53.266  1.00 30.00  ? 142 VAL Y N   1  
ATOM 7236   C CA  . VAL B 2 128 ? -150.727 -15.568 54.595  1.00 30.00  ? 142 VAL Y CA  1  
ATOM 7237   C C   . VAL B 2 128 ? -152.178 -15.790 55.048  1.00 30.00  ? 142 VAL Y C   1  
ATOM 7238   O O   . VAL B 2 128 ? -152.659 -16.929 55.136  1.00 30.00  ? 142 VAL Y O   1  
ATOM 7239   C CB  . VAL B 2 128 ? -149.984 -14.593 55.501  1.00 99.99  ? 142 VAL Y CB  1  
ATOM 7240   C CG1 . VAL B 2 128 ? -149.887 -15.180 56.907  1.00 99.99  ? 142 VAL Y CG1 1  
ATOM 7241   C CG2 . VAL B 2 128 ? -148.582 -14.352 54.954  1.00 99.99  ? 142 VAL Y CG2 1  
ATOM 7242   N N   . LYS B 2 129 ? -152.868 -14.685 55.317  1.00 30.00  ? 143 LYS Y N   1  
ATOM 7243   C CA  . LYS B 2 129 ? -154.255 -14.708 55.742  1.00 30.00  ? 143 LYS Y CA  1  
ATOM 7244   C C   . LYS B 2 129 ? -155.070 -15.665 54.891  1.00 30.00  ? 143 LYS Y C   1  
ATOM 7245   O O   . LYS B 2 129 ? -155.966 -16.329 55.396  1.00 30.00  ? 143 LYS Y O   1  
ATOM 7246   C CB  . LYS B 2 129 ? -154.858 -13.311 55.615  1.00 99.99  ? 143 LYS Y CB  1  
ATOM 7247   C CG  . LYS B 2 129 ? -156.282 -13.322 56.156  1.00 99.99  ? 143 LYS Y CG  1  
ATOM 7248   C CD  . LYS B 2 129 ? -156.725 -11.890 56.448  1.00 99.99  ? 143 LYS Y CD  1  
ATOM 7249   C CE  . LYS B 2 129 ? -158.241 -11.856 56.628  1.00 99.99  ? 143 LYS Y CE  1  
ATOM 7250   N NZ  . LYS B 2 129 ? -158.566 -11.977 58.057  1.00 99.99  ? 143 LYS Y NZ  1  
ATOM 7251   N N   . PHE B 2 130 ? -154.760 -15.740 53.604  1.00 30.00  ? 144 PHE Y N   1  
ATOM 7252   C CA  . PHE B 2 130 ? -155.494 -16.613 52.709  1.00 30.00  ? 144 PHE Y CA  1  
ATOM 7253   C C   . PHE B 2 130 ? -155.063 -18.036 52.820  1.00 30.00  ? 144 PHE Y C   1  
ATOM 7254   O O   . PHE B 2 130 ? -155.813 -18.929 52.450  1.00 30.00  ? 144 PHE Y O   1  
ATOM 7255   C CB  . PHE B 2 130 ? -155.282 -16.171 51.266  1.00 99.99  ? 144 PHE Y CB  1  
ATOM 7256   C CG  . PHE B 2 130 ? -156.052 -17.082 50.341  1.00 99.99  ? 144 PHE Y CG  1  
ATOM 7257   C CD1 . PHE B 2 130 ? -157.414 -16.854 50.108  1.00 99.99  ? 144 PHE Y CD1 1  
ATOM 7258   C CD2 . PHE B 2 130 ? -155.403 -18.154 49.714  1.00 99.99  ? 144 PHE Y CD2 1  
ATOM 7259   C CE1 . PHE B 2 130 ? -158.127 -17.702 49.251  1.00 99.99  ? 144 PHE Y CE1 1  
ATOM 7260   C CE2 . PHE B 2 130 ? -156.117 -19.000 48.859  1.00 99.99  ? 144 PHE Y CE2 1  
ATOM 7261   C CZ  . PHE B 2 130 ? -157.480 -18.772 48.625  1.00 99.99  ? 144 PHE Y CZ  1  
ATOM 7262   N N   . THR B 2 131 ? -153.849 -18.266 53.318  1.00 30.00  ? 145 THR Y N   1  
ATOM 7263   C CA  . THR B 2 131 ? -153.375 -19.644 53.457  1.00 30.00  ? 145 THR Y CA  1  
ATOM 7264   C C   . THR B 2 131 ? -154.043 -20.210 54.696  1.00 30.00  ? 145 THR Y C   1  
ATOM 7265   O O   . THR B 2 131 ? -154.352 -21.393 54.765  1.00 30.00  ? 145 THR Y O   1  
ATOM 7266   C CB  . THR B 2 131 ? -151.857 -19.655 53.609  1.00 99.99  ? 145 THR Y CB  1  
ATOM 7267   O OG1 . THR B 2 131 ? -151.249 -19.331 52.354  1.00 99.99  ? 145 THR Y OG1 1  
ATOM 7268   C CG2 . THR B 2 131 ? -151.402 -21.043 54.047  1.00 99.99  ? 145 THR Y CG2 1  
ATOM 7269   N N   . ALA B 2 132 ? -154.253 -19.342 55.677  1.00 30.00  ? 146 ALA Y N   1  
ATOM 7270   C CA  . ALA B 2 132 ? -154.904 -19.748 56.902  1.00 30.00  ? 146 ALA Y CA  1  
ATOM 7271   C C   . ALA B 2 132 ? -156.347 -20.087 56.496  1.00 30.00  ? 146 ALA Y C   1  
ATOM 7272   O O   . ALA B 2 132 ? -156.786 -21.224 56.622  1.00 30.00  ? 146 ALA Y O   1  
ATOM 7273   C CB  . ALA B 2 132 ? -154.875 -18.602 57.908  1.00 30.00  ? 146 ALA Y CB  1  
ATOM 7274   N N   . MET B 2 133 ? -157.075 -19.093 55.993  1.00 30.00  ? 147 MET Y N   1  
ATOM 7275   C CA  . MET B 2 133 ? -158.460 -19.281 55.565  1.00 30.00  ? 147 MET Y CA  1  
ATOM 7276   C C   . MET B 2 133 ? -158.672 -20.593 54.808  1.00 30.00  ? 147 MET Y C   1  
ATOM 7277   O O   . MET B 2 133 ? -159.635 -21.320 55.064  1.00 30.00  ? 147 MET Y O   1  
ATOM 7278   C CB  . MET B 2 133 ? -158.880 -18.142 54.643  1.00 99.99  ? 147 MET Y CB  1  
ATOM 7279   C CG  . MET B 2 133 ? -158.528 -16.808 55.289  1.00 99.99  ? 147 MET Y CG  1  
ATOM 7280   S SD  . MET B 2 133 ? -159.779 -16.365 56.521  1.00 99.99  ? 147 MET Y SD  1  
ATOM 7281   C CE  . MET B 2 133 ? -161.094 -15.833 55.446  1.00 99.99  ? 147 MET Y CE  1  
ATOM 7282   N N   . ILE B 2 134 ? -157.786 -20.893 53.882  1.00 30.00  ? 148 ILE Y N   1  
ATOM 7283   C CA  . ILE B 2 134 ? -157.882 -22.111 53.103  1.00 30.00  ? 148 ILE Y CA  1  
ATOM 7284   C C   . ILE B 2 134 ? -157.494 -23.352 53.916  1.00 30.00  ? 148 ILE Y C   1  
ATOM 7285   O O   . ILE B 2 134 ? -157.868 -24.467 53.565  1.00 30.00  ? 148 ILE Y O   1  
ATOM 7286   C CB  . ILE B 2 134 ? -156.953 -22.029 51.898  1.00 99.99  ? 148 ILE Y CB  1  
ATOM 7287   C CG1 . ILE B 2 134 ? -155.559 -22.497 52.299  1.00 99.99  ? 148 ILE Y CG1 1  
ATOM 7288   C CG2 . ILE B 2 134 ? -156.884 -20.590 51.402  1.00 99.99  ? 148 ILE Y CG2 1  
ATOM 7289   C CD1 . ILE B 2 134 ? -155.404 -23.979 51.975  1.00 99.99  ? 148 ILE Y CD1 1  
ATOM 7290   N N   . LYS B 2 135 ? -156.758 -23.134 55.012  1.00 30.00  ? 149 LYS Y N   1  
ATOM 7291   C CA  . LYS B 2 135 ? -156.301 -24.244 55.899  1.00 30.00  ? 149 LYS Y CA  1  
ATOM 7292   C C   . LYS B 2 135 ? -157.079 -24.185 57.259  1.00 30.00  ? 149 LYS Y C   1  
ATOM 7293   O O   . LYS B 2 135 ? -158.299 -24.181 57.206  1.00 30.00  ? 149 LYS Y O   1  
ATOM 7294   C CB  . LYS B 2 135 ? -154.808 -24.110 56.170  1.00 99.99  ? 149 LYS Y CB  1  
ATOM 7295   C CG  . LYS B 2 135 ? -154.330 -25.300 56.995  1.00 99.99  ? 149 LYS Y CG  1  
ATOM 7296   C CD  . LYS B 2 135 ? -152.812 -25.415 56.893  1.00 99.99  ? 149 LYS Y CD  1  
ATOM 7297   C CE  . LYS B 2 135 ? -152.298 -26.346 57.987  1.00 99.99  ? 149 LYS Y CE  1  
ATOM 7298   N NZ  . LYS B 2 135 ? -152.180 -27.711 57.452  1.00 99.99  ? 149 LYS Y NZ  1  
ATOM 7299   N N   . GLY B 2 136 ? -156.337 -24.161 58.378  1.00 30.00  ? 150 GLY Y N   1  
ATOM 7300   C CA  . GLY B 2 136 ? -156.836 -24.078 59.742  1.00 30.00  ? 150 GLY Y CA  1  
ATOM 7301   C C   . GLY B 2 136 ? -157.542 -22.746 60.003  1.00 30.00  ? 150 GLY Y C   1  
ATOM 7302   O O   . GLY B 2 136 ? -156.861 -21.743 60.376  1.00 30.00  ? 150 GLY Y O   1  
ATOM 7303   O OXT . GLY B 2 136 ? -158.769 -22.694 59.859  1.00 30.00  ? 150 GLY Y OXT 1  
ATOM 7304   N N   . SER C 3 1   ? -121.840 -40.193 29.664  1.00 30.00  ? 4   SER Z N   1  
ATOM 7305   C CA  . SER C 3 1   ? -122.321 -41.412 30.290  1.00 30.00  ? 4   SER Z CA  1  
ATOM 7306   C C   . SER C 3 1   ? -123.841 -41.313 30.379  1.00 30.00  ? 4   SER Z C   1  
ATOM 7307   O O   . SER C 3 1   ? -124.416 -40.267 30.069  1.00 30.00  ? 4   SER Z O   1  
ATOM 7308   C CB  . SER C 3 1   ? -121.717 -41.554 31.683  1.00 99.99  ? 4   SER Z CB  1  
ATOM 7309   O OG  . SER C 3 1   ? -122.241 -40.535 32.538  1.00 99.99  ? 4   SER Z OG  1  
ATOM 7310   N N   . GLN C 3 2   ? -124.494 -42.389 30.811  1.00 30.00  ? 5   GLN Z N   1  
ATOM 7311   C CA  . GLN C 3 2   ? -125.945 -42.373 30.920  1.00 30.00  ? 5   GLN Z CA  1  
ATOM 7312   C C   . GLN C 3 2   ? -126.432 -41.415 31.999  1.00 30.00  ? 5   GLN Z C   1  
ATOM 7313   O O   . GLN C 3 2   ? -127.167 -40.471 31.701  1.00 30.00  ? 5   GLN Z O   1  
ATOM 7314   C CB  . GLN C 3 2   ? -126.456 -43.767 31.266  1.00 99.99  ? 5   GLN Z CB  1  
ATOM 7315   C CG  . GLN C 3 2   ? -127.904 -43.909 30.810  1.00 99.99  ? 5   GLN Z CG  1  
ATOM 7316   C CD  . GLN C 3 2   ? -128.864 -43.371 31.858  1.00 99.99  ? 5   GLN Z CD  1  
ATOM 7317   O OE1 . GLN C 3 2   ? -128.439 -42.898 32.911  1.00 99.99  ? 5   GLN Z OE1 1  
ATOM 7318   N NE2 . GLN C 3 2   ? -130.166 -43.441 31.569  1.00 99.99  ? 5   GLN Z NE2 1  
ATOM 7319   N N   . ASP C 3 3   ? -126.029 -41.642 33.247  1.00 30.00  ? 6   ASP Z N   1  
ATOM 7320   C CA  . ASP C 3 3   ? -126.455 -40.760 34.330  1.00 30.00  ? 6   ASP Z CA  1  
ATOM 7321   C C   . ASP C 3 3   ? -126.223 -39.309 33.894  1.00 30.00  ? 6   ASP Z C   1  
ATOM 7322   O O   . ASP C 3 3   ? -126.876 -38.380 34.377  1.00 30.00  ? 6   ASP Z O   1  
ATOM 7323   C CB  . ASP C 3 3   ? -125.649 -41.056 35.589  1.00 99.99  ? 6   ASP Z CB  1  
ATOM 7324   C CG  . ASP C 3 3   ? -124.163 -41.123 35.241  1.00 99.99  ? 6   ASP Z CG  1  
ATOM 7325   O OD1 . ASP C 3 3   ? -123.818 -41.940 34.344  1.00 99.99  ? 6   ASP Z OD1 1  
ATOM 7326   O OD2 . ASP C 3 3   ? -123.388 -40.357 35.871  1.00 99.99  ? 6   ASP Z OD2 1  
ATOM 7327   N N   . GLU C 3 4   ? -125.287 -39.129 32.958  1.00 30.00  ? 7   GLU Z N   1  
ATOM 7328   C CA  . GLU C 3 4   ? -124.938 -37.816 32.413  1.00 30.00  ? 7   GLU Z CA  1  
ATOM 7329   C C   . GLU C 3 4   ? -125.992 -37.365 31.414  1.00 30.00  ? 7   GLU Z C   1  
ATOM 7330   O O   . GLU C 3 4   ? -126.654 -36.345 31.620  1.00 30.00  ? 7   GLU Z O   1  
ATOM 7331   C CB  . GLU C 3 4   ? -123.589 -37.890 31.707  1.00 99.99  ? 7   GLU Z CB  1  
ATOM 7332   C CG  . GLU C 3 4   ? -122.508 -38.202 32.713  1.00 99.99  ? 7   GLU Z CG  1  
ATOM 7333   C CD  . GLU C 3 4   ? -122.264 -36.979 33.593  1.00 99.99  ? 7   GLU Z CD  1  
ATOM 7334   O OE1 . GLU C 3 4   ? -122.947 -36.878 34.645  1.00 99.99  ? 7   GLU Z OE1 1  
ATOM 7335   O OE2 . GLU C 3 4   ? -121.393 -36.154 33.203  1.00 99.99  ? 7   GLU Z OE2 1  
ATOM 7336   N N   . ILE C 3 5   ? -126.141 -38.120 30.332  1.00 30.00  ? 8   ILE Z N   1  
ATOM 7337   C CA  . ILE C 3 5   ? -127.124 -37.795 29.308  1.00 30.00  ? 8   ILE Z CA  1  
ATOM 7338   C C   . ILE C 3 5   ? -128.509 -37.633 29.935  1.00 30.00  ? 8   ILE Z C   1  
ATOM 7339   O O   . ILE C 3 5   ? -129.346 -36.880 29.442  1.00 30.00  ? 8   ILE Z O   1  
ATOM 7340   C CB  . ILE C 3 5   ? -127.180 -38.910 28.268  1.00 99.99  ? 8   ILE Z CB  1  
ATOM 7341   C CG1 . ILE C 3 5   ? -128.060 -40.042 28.784  1.00 99.99  ? 8   ILE Z CG1 1  
ATOM 7342   C CG2 . ILE C 3 5   ? -125.772 -39.436 28.012  1.00 99.99  ? 8   ILE Z CG2 1  
ATOM 7343   C CD1 . ILE C 3 5   ? -127.191 -41.078 29.495  1.00 99.99  ? 8   ILE Z CD1 1  
ATOM 7344   N N   . ASP C 3 6   ? -128.737 -38.355 31.027  1.00 30.00  ? 9   ASP Z N   1  
ATOM 7345   C CA  . ASP C 3 6   ? -130.008 -38.291 31.737  1.00 30.00  ? 9   ASP Z CA  1  
ATOM 7346   C C   . ASP C 3 6   ? -130.137 -36.892 32.308  1.00 30.00  ? 9   ASP Z C   1  
ATOM 7347   O O   . ASP C 3 6   ? -131.218 -36.306 32.337  1.00 30.00  ? 9   ASP Z O   1  
ATOM 7348   C CB  . ASP C 3 6   ? -130.029 -39.324 32.855  1.00 99.99  ? 9   ASP Z CB  1  
ATOM 7349   C CG  . ASP C 3 6   ? -131.439 -39.425 33.432  1.00 99.99  ? 9   ASP Z CG  1  
ATOM 7350   O OD1 . ASP C 3 6   ? -131.790 -38.537 34.254  1.00 99.99  ? 9   ASP Z OD1 1  
ATOM 7351   O OD2 . ASP C 3 6   ? -132.154 -40.386 33.039  1.00 99.99  ? 9   ASP Z OD2 1  
ATOM 7352   N N   . ASP C 3 7   ? -129.016 -36.367 32.765  1.00 30.00  ? 10  ASP Z N   1  
ATOM 7353   C CA  . ASP C 3 7   ? -128.989 -35.039 33.339  1.00 30.00  ? 10  ASP Z CA  1  
ATOM 7354   C C   . ASP C 3 7   ? -129.315 -33.982 32.299  1.00 30.00  ? 10  ASP Z C   1  
ATOM 7355   O O   . ASP C 3 7   ? -129.992 -33.000 32.590  1.00 30.00  ? 10  ASP Z O   1  
ATOM 7356   C CB  . ASP C 3 7   ? -127.605 -34.744 33.906  1.00 99.99  ? 10  ASP Z CB  1  
ATOM 7357   C CG  . ASP C 3 7   ? -127.389 -35.563 35.176  1.00 99.99  ? 10  ASP Z CG  1  
ATOM 7358   O OD1 . ASP C 3 7   ? -128.246 -35.441 36.092  1.00 99.99  ? 10  ASP Z OD1 1  
ATOM 7359   O OD2 . ASP C 3 7   ? -126.371 -36.304 35.219  1.00 99.99  ? 10  ASP Z OD2 1  
ATOM 7360   N N   . LEU C 3 8   ? -128.816 -34.181 31.081  1.00 30.00  ? 11  LEU Z N   1  
ATOM 7361   C CA  . LEU C 3 8   ? -129.088 -33.241 30.003  1.00 30.00  ? 11  LEU Z CA  1  
ATOM 7362   C C   . LEU C 3 8   ? -130.609 -33.282 29.846  1.00 30.00  ? 11  LEU Z C   1  
ATOM 7363   O O   . LEU C 3 8   ? -131.270 -32.240 29.783  1.00 30.00  ? 11  LEU Z O   1  
ATOM 7364   C CB  . LEU C 3 8   ? -128.373 -33.693 28.732  1.00 99.99  ? 11  LEU Z CB  1  
ATOM 7365   C CG  . LEU C 3 8   ? -127.025 -32.986 28.627  1.00 99.99  ? 11  LEU Z CG  1  
ATOM 7366   C CD1 . LEU C 3 8   ? -126.461 -33.172 27.223  1.00 99.99  ? 11  LEU Z CD1 1  
ATOM 7367   C CD2 . LEU C 3 8   ? -127.209 -31.498 28.909  1.00 99.99  ? 11  LEU Z CD2 1  
ATOM 7368   N N   . LYS C 3 9   ? -131.143 -34.505 29.794  1.00 30.00  ? 12  LYS Z N   1  
ATOM 7369   C CA  . LYS C 3 9   ? -132.581 -34.743 29.672  1.00 30.00  ? 12  LYS Z CA  1  
ATOM 7370   C C   . LYS C 3 9   ? -133.296 -33.930 30.754  1.00 30.00  ? 12  LYS Z C   1  
ATOM 7371   O O   . LYS C 3 9   ? -134.048 -33.003 30.461  1.00 30.00  ? 12  LYS Z O   1  
ATOM 7372   C CB  . LYS C 3 9   ? -132.878 -36.227 29.854  1.00 99.99  ? 12  LYS Z CB  1  
ATOM 7373   C CG  . LYS C 3 9   ? -134.364 -36.483 29.626  1.00 99.99  ? 12  LYS Z CG  1  
ATOM 7374   C CD  . LYS C 3 9   ? -134.591 -37.968 29.364  1.00 99.99  ? 12  LYS Z CD  1  
ATOM 7375   C CE  . LYS C 3 9   ? -136.076 -38.285 29.505  1.00 99.99  ? 12  LYS Z CE  1  
ATOM 7376   N NZ  . LYS C 3 9   ? -136.721 -38.216 28.187  1.00 99.99  ? 12  LYS Z NZ  1  
ATOM 7377   N N   . ASP C 3 10  ? -133.054 -34.277 32.008  1.00 30.00  ? 13  ASP Z N   1  
ATOM 7378   C CA  . ASP C 3 10  ? -133.683 -33.571 33.110  1.00 30.00  ? 13  ASP Z CA  1  
ATOM 7379   C C   . ASP C 3 10  ? -133.830 -32.080 32.811  1.00 30.00  ? 13  ASP Z C   1  
ATOM 7380   O O   . ASP C 3 10  ? -134.939 -31.579 32.676  1.00 30.00  ? 13  ASP Z O   1  
ATOM 7381   C CB  . ASP C 3 10  ? -132.839 -33.725 34.372  1.00 99.99  ? 13  ASP Z CB  1  
ATOM 7382   C CG  . ASP C 3 10  ? -132.881 -35.176 34.841  1.00 99.99  ? 13  ASP Z CG  1  
ATOM 7383   O OD1 . ASP C 3 10  ? -133.961 -35.586 35.349  1.00 99.99  ? 13  ASP Z OD1 1  
ATOM 7384   O OD2 . ASP C 3 10  ? -131.835 -35.862 34.686  1.00 99.99  ? 13  ASP Z OD2 1  
ATOM 7385   N N   . VAL C 3 11  ? -132.708 -31.374 32.700  1.00 30.00  ? 14  VAL Z N   1  
ATOM 7386   C CA  . VAL C 3 11  ? -132.718 -29.939 32.428  1.00 30.00  ? 14  VAL Z CA  1  
ATOM 7387   C C   . VAL C 3 11  ? -133.406 -29.516 31.136  1.00 30.00  ? 14  VAL Z C   1  
ATOM 7388   O O   . VAL C 3 11  ? -134.138 -28.531 31.132  1.00 30.00  ? 14  VAL Z O   1  
ATOM 7389   C CB  . VAL C 3 11  ? -131.286 -29.418 32.333  1.00 99.99  ? 14  VAL Z CB  1  
ATOM 7390   C CG1 . VAL C 3 11  ? -130.563 -29.675 33.652  1.00 99.99  ? 14  VAL Z CG1 1  
ATOM 7391   C CG2 . VAL C 3 11  ? -130.555 -30.138 31.204  1.00 99.99  ? 14  VAL Z CG2 1  
ATOM 7392   N N   . PHE C 3 12  ? -133.173 -30.247 30.044  1.00 30.00  ? 15  PHE Z N   1  
ATOM 7393   C CA  . PHE C 3 12  ? -133.807 -29.913 28.762  1.00 30.00  ? 15  PHE Z CA  1  
ATOM 7394   C C   . PHE C 3 12  ? -135.301 -29.689 28.960  1.00 30.00  ? 15  PHE Z C   1  
ATOM 7395   O O   . PHE C 3 12  ? -135.892 -28.787 28.368  1.00 30.00  ? 15  PHE Z O   1  
ATOM 7396   C CB  . PHE C 3 12  ? -133.603 -31.052 27.769  1.00 99.99  ? 15  PHE Z CB  1  
ATOM 7397   C CG  . PHE C 3 12  ? -134.255 -30.701 26.456  1.00 99.99  ? 15  PHE Z CG  1  
ATOM 7398   C CD1 . PHE C 3 12  ? -133.576 -29.902 25.529  1.00 99.99  ? 15  PHE Z CD1 1  
ATOM 7399   C CD2 . PHE C 3 12  ? -135.540 -31.175 26.161  1.00 99.99  ? 15  PHE Z CD2 1  
ATOM 7400   C CE1 . PHE C 3 12  ? -134.181 -29.576 24.309  1.00 99.99  ? 15  PHE Z CE1 1  
ATOM 7401   C CE2 . PHE C 3 12  ? -136.144 -30.849 24.942  1.00 99.99  ? 15  PHE Z CE2 1  
ATOM 7402   C CZ  . PHE C 3 12  ? -135.466 -30.049 24.015  1.00 99.99  ? 15  PHE Z CZ  1  
ATOM 7403   N N   . GLU C 3 13  ? -135.916 -30.511 29.795  1.00 30.00  ? 16  GLU Z N   1  
ATOM 7404   C CA  . GLU C 3 13  ? -137.338 -30.385 30.055  1.00 30.00  ? 16  GLU Z CA  1  
ATOM 7405   C C   . GLU C 3 13  ? -137.665 -29.042 30.700  1.00 30.00  ? 16  GLU Z C   1  
ATOM 7406   O O   . GLU C 3 13  ? -138.379 -28.236 30.110  1.00 30.00  ? 16  GLU Z O   1  
ATOM 7407   C CB  . GLU C 3 13  ? -137.795 -31.495 30.995  1.00 99.99  ? 16  GLU Z CB  1  
ATOM 7408   C CG  . GLU C 3 13  ? -137.632 -32.832 30.313  1.00 99.99  ? 16  GLU Z CG  1  
ATOM 7409   C CD  . GLU C 3 13  ? -138.690 -32.977 29.221  1.00 99.99  ? 16  GLU Z CD  1  
ATOM 7410   O OE1 . GLU C 3 13  ? -138.388 -32.571 28.070  1.00 99.99  ? 16  GLU Z OE1 1  
ATOM 7411   O OE2 . GLU C 3 13  ? -139.792 -33.497 29.551  1.00 99.99  ? 16  GLU Z OE2 1  
ATOM 7412   N N   . LEU C 3 14  ? -137.142 -28.796 31.905  1.00 30.00  ? 17  LEU Z N   1  
ATOM 7413   C CA  . LEU C 3 14  ? -137.429 -27.540 32.591  1.00 30.00  ? 17  LEU Z CA  1  
ATOM 7414   C C   . LEU C 3 14  ? -137.434 -26.364 31.640  1.00 30.00  ? 17  LEU Z C   1  
ATOM 7415   O O   . LEU C 3 14  ? -138.238 -25.430 31.786  1.00 30.00  ? 17  LEU Z O   1  
ATOM 7416   C CB  . LEU C 3 14  ? -136.372 -27.281 33.658  1.00 99.99  ? 17  LEU Z CB  1  
ATOM 7417   C CG  . LEU C 3 14  ? -136.609 -25.913 34.287  1.00 99.99  ? 17  LEU Z CG  1  
ATOM 7418   C CD1 . LEU C 3 14  ? -135.508 -25.623 35.303  1.00 99.99  ? 17  LEU Z CD1 1  
ATOM 7419   C CD2 . LEU C 3 14  ? -136.594 -24.843 33.201  1.00 99.99  ? 17  LEU Z CD2 1  
ATOM 7420   N N   . PHE C 3 15  ? -136.540 -26.407 30.661  1.00 30.00  ? 18  PHE Z N   1  
ATOM 7421   C CA  . PHE C 3 15  ? -136.434 -25.330 29.685  1.00 30.00  ? 18  PHE Z CA  1  
ATOM 7422   C C   . PHE C 3 15  ? -137.483 -25.437 28.587  1.00 30.00  ? 18  PHE Z C   1  
ATOM 7423   O O   . PHE C 3 15  ? -138.358 -24.572 28.478  1.00 30.00  ? 18  PHE Z O   1  
ATOM 7424   C CB  . PHE C 3 15  ? -135.061 -25.366 29.026  1.00 99.99  ? 18  PHE Z CB  1  
ATOM 7425   C CG  . PHE C 3 15  ? -134.956 -24.247 28.018  1.00 99.99  ? 18  PHE Z CG  1  
ATOM 7426   C CD1 . PHE C 3 15  ? -134.616 -22.955 28.440  1.00 99.99  ? 18  PHE Z CD1 1  
ATOM 7427   C CD2 . PHE C 3 15  ? -135.201 -24.498 26.663  1.00 99.99  ? 18  PHE Z CD2 1  
ATOM 7428   C CE1 . PHE C 3 15  ? -134.519 -21.916 27.506  1.00 99.99  ? 18  PHE Z CE1 1  
ATOM 7429   C CE2 . PHE C 3 15  ? -135.104 -23.458 25.729  1.00 99.99  ? 18  PHE Z CE2 1  
ATOM 7430   C CZ  . PHE C 3 15  ? -134.764 -22.167 26.153  1.00 99.99  ? 18  PHE Z CZ  1  
ATOM 7431   N N   . ASP C 3 16  ? -137.397 -26.498 27.787  1.00 30.00  ? 19  ASP Z N   1  
ATOM 7432   C CA  . ASP C 3 16  ? -138.341 -26.719 26.698  1.00 30.00  ? 19  ASP Z CA  1  
ATOM 7433   C C   . ASP C 3 16  ? -139.781 -26.490 27.145  1.00 30.00  ? 19  ASP Z C   1  
ATOM 7434   O O   . ASP C 3 16  ? -140.660 -26.240 26.333  1.00 30.00  ? 19  ASP Z O   1  
ATOM 7435   C CB  . ASP C 3 16  ? -138.222 -28.151 26.190  1.00 99.99  ? 19  ASP Z CB  1  
ATOM 7436   C CG  . ASP C 3 16  ? -138.235 -29.115 27.374  1.00 99.99  ? 19  ASP Z CG  1  
ATOM 7437   O OD1 . ASP C 3 16  ? -137.367 -28.936 28.272  1.00 99.99  ? 19  ASP Z OD1 1  
ATOM 7438   O OD2 . ASP C 3 16  ? -139.113 -30.019 27.372  1.00 99.99  ? 19  ASP Z OD2 1  
ATOM 7439   N N   . PHE C 3 17  ? -140.016 -26.572 28.447  1.00 30.00  ? 20  PHE Z N   1  
ATOM 7440   C CA  . PHE C 3 17  ? -141.349 -26.366 28.967  1.00 30.00  ? 20  PHE Z CA  1  
ATOM 7441   C C   . PHE C 3 17  ? -141.627 -24.887 29.053  1.00 30.00  ? 20  PHE Z C   1  
ATOM 7442   O O   . PHE C 3 17  ? -142.644 -24.412 28.548  1.00 30.00  ? 20  PHE Z O   1  
ATOM 7443   C CB  . PHE C 3 17  ? -141.463 -26.989 30.354  1.00 99.99  ? 20  PHE Z CB  1  
ATOM 7444   C CG  . PHE C 3 17  ? -142.856 -26.773 30.890  1.00 99.99  ? 20  PHE Z CG  1  
ATOM 7445   C CD1 . PHE C 3 17  ? -143.892 -27.641 30.522  1.00 99.99  ? 20  PHE Z CD1 1  
ATOM 7446   C CD2 . PHE C 3 17  ? -143.115 -25.703 31.756  1.00 99.99  ? 20  PHE Z CD2 1  
ATOM 7447   C CE1 . PHE C 3 17  ? -145.184 -27.441 31.019  1.00 99.99  ? 20  PHE Z CE1 1  
ATOM 7448   C CE2 . PHE C 3 17  ? -144.411 -25.502 32.251  1.00 99.99  ? 20  PHE Z CE2 1  
ATOM 7449   C CZ  . PHE C 3 17  ? -145.445 -26.373 31.882  1.00 99.99  ? 20  PHE Z CZ  1  
ATOM 7450   N N   . TRP C 3 18  ? -140.720 -24.154 29.686  1.00 30.00  ? 21  TRP Z N   1  
ATOM 7451   C CA  . TRP C 3 18  ? -140.890 -22.721 29.865  1.00 30.00  ? 21  TRP Z CA  1  
ATOM 7452   C C   . TRP C 3 18  ? -140.996 -21.830 28.636  1.00 30.00  ? 21  TRP Z C   1  
ATOM 7453   O O   . TRP C 3 18  ? -141.507 -20.711 28.722  1.00 30.00  ? 21  TRP Z O   1  
ATOM 7454   C CB  . TRP C 3 18  ? -139.708 -22.150 30.641  1.00 99.99  ? 21  TRP Z CB  1  
ATOM 7455   C CG  . TRP C 3 18  ? -139.834 -20.694 31.018  1.00 99.99  ? 21  TRP Z CG  1  
ATOM 7456   C CD1 . TRP C 3 18  ? -139.657 -19.636 30.214  1.00 99.99  ? 21  TRP Z CD1 1  
ATOM 7457   C CD2 . TRP C 3 18  ? -140.159 -20.158 32.269  1.00 99.99  ? 21  TRP Z CD2 1  
ATOM 7458   N NE1 . TRP C 3 18  ? -139.879 -18.467 31.005  1.00 99.99  ? 21  TRP Z NE1 1  
ATOM 7459   C CE2 . TRP C 3 18  ? -140.178 -18.832 32.228  1.00 99.99  ? 21  TRP Z CE2 1  
ATOM 7460   C CE3 . TRP C 3 18  ? -140.443 -20.820 33.472  1.00 99.99  ? 21  TRP Z CE3 1  
ATOM 7461   C CZ2 . TRP C 3 18  ? -140.469 -18.010 33.326  1.00 99.99  ? 21  TRP Z CZ2 1  
ATOM 7462   C CZ3 . TRP C 3 18  ? -140.739 -20.012 34.589  1.00 99.99  ? 21  TRP Z CZ3 1  
ATOM 7463   C CH2 . TRP C 3 18  ? -140.751 -18.666 34.519  1.00 99.99  ? 21  TRP Z CH2 1  
ATOM 7464   N N   . ASP C 3 19  ? -140.511 -22.302 27.496  1.00 30.00  ? 22  ASP Z N   1  
ATOM 7465   C CA  . ASP C 3 19  ? -140.611 -21.503 26.282  1.00 30.00  ? 22  ASP Z CA  1  
ATOM 7466   C C   . ASP C 3 19  ? -141.674 -22.226 25.462  1.00 30.00  ? 22  ASP Z C   1  
ATOM 7467   O O   . ASP C 3 19  ? -141.584 -22.347 24.237  1.00 30.00  ? 22  ASP Z O   1  
ATOM 7468   C CB  . ASP C 3 19  ? -139.262 -21.472 25.572  1.00 99.99  ? 22  ASP Z CB  1  
ATOM 7469   C CG  . ASP C 3 19  ? -138.700 -22.887 25.472  1.00 99.99  ? 22  ASP Z CG  1  
ATOM 7470   O OD1 . ASP C 3 19  ? -138.571 -23.531 26.548  1.00 99.99  ? 22  ASP Z OD1 1  
ATOM 7471   O OD2 . ASP C 3 19  ? -138.412 -23.312 24.322  1.00 99.99  ? 22  ASP Z OD2 1  
ATOM 7472   N N   . GLY C 3 20  ? -142.690 -22.698 26.187  1.00 30.00  ? 23  GLY Z N   1  
ATOM 7473   C CA  . GLY C 3 20  ? -143.805 -23.425 25.599  1.00 30.00  ? 23  GLY Z CA  1  
ATOM 7474   C C   . GLY C 3 20  ? -143.473 -24.892 25.424  1.00 30.00  ? 23  GLY Z C   1  
ATOM 7475   O O   . GLY C 3 20  ? -142.768 -25.251 24.490  1.00 30.00  ? 23  GLY Z O   1  
ATOM 7476   N N   . ARG C 3 21  ? -143.977 -25.747 26.311  1.00 30.00  ? 24  ARG Z N   1  
ATOM 7477   C CA  . ARG C 3 21  ? -143.701 -27.181 26.218  1.00 30.00  ? 24  ARG Z CA  1  
ATOM 7478   C C   . ARG C 3 21  ? -144.109 -27.789 24.874  1.00 30.00  ? 24  ARG Z C   1  
ATOM 7479   O O   . ARG C 3 21  ? -145.272 -27.713 24.472  1.00 30.00  ? 24  ARG Z O   1  
ATOM 7480   C CB  . ARG C 3 21  ? -144.466 -27.928 27.308  1.00 99.99  ? 24  ARG Z CB  1  
ATOM 7481   C CG  . ARG C 3 21  ? -144.078 -29.401 27.284  1.00 99.99  ? 24  ARG Z CG  1  
ATOM 7482   C CD  . ARG C 3 21  ? -144.932 -30.168 28.288  1.00 99.99  ? 24  ARG Z CD  1  
ATOM 7483   N NE  . ARG C 3 21  ? -146.332 -30.275 27.821  1.00 99.99  ? 24  ARG Z NE  1  
ATOM 7484   C CZ  . ARG C 3 21  ? -147.265 -30.960 28.476  1.00 99.99  ? 24  ARG Z CZ  1  
ATOM 7485   N NH1 . ARG C 3 21  ? -147.000 -31.609 29.606  1.00 99.99  ? 24  ARG Z NH1 1  
ATOM 7486   N NH2 . ARG C 3 21  ? -148.494 -30.990 27.967  1.00 99.99  ? 24  ARG Z NH2 1  
ATOM 7487   N N   . ASP C 3 22  ? -143.146 -28.398 24.194  1.00 30.00  ? 25  ASP Z N   1  
ATOM 7488   C CA  . ASP C 3 22  ? -143.407 -29.001 22.896  1.00 30.00  ? 25  ASP Z CA  1  
ATOM 7489   C C   . ASP C 3 22  ? -142.236 -29.845 22.420  1.00 30.00  ? 25  ASP Z C   1  
ATOM 7490   O O   . ASP C 3 22  ? -142.156 -30.190 21.238  1.00 30.00  ? 25  ASP Z O   1  
ATOM 7491   C CB  . ASP C 3 22  ? -143.656 -27.910 21.861  1.00 99.99  ? 25  ASP Z CB  1  
ATOM 7492   C CG  . ASP C 3 22  ? -144.974 -27.204 22.169  1.00 99.99  ? 25  ASP Z CG  1  
ATOM 7493   O OD1 . ASP C 3 22  ? -146.037 -27.846 21.951  1.00 99.99  ? 25  ASP Z OD1 1  
ATOM 7494   O OD2 . ASP C 3 22  ? -144.907 -26.031 22.624  1.00 99.99  ? 25  ASP Z OD2 1  
ATOM 7495   N N   . GLY C 3 23  ? -141.322 -30.171 23.335  1.00 30.00  ? 26  GLY Z N   1  
ATOM 7496   C CA  . GLY C 3 23  ? -140.167 -30.980 22.977  1.00 30.00  ? 26  GLY Z CA  1  
ATOM 7497   C C   . GLY C 3 23  ? -139.138 -30.275 22.105  1.00 30.00  ? 26  GLY Z C   1  
ATOM 7498   O O   . GLY C 3 23  ? -138.452 -30.916 21.302  1.00 30.00  ? 26  GLY Z O   1  
ATOM 7499   N N   . ALA C 3 24  ? -139.032 -28.957 22.264  1.00 30.00  ? 27  ALA Z N   1  
ATOM 7500   C CA  . ALA C 3 24  ? -138.079 -28.154 21.495  1.00 30.00  ? 27  ALA Z CA  1  
ATOM 7501   C C   . ALA C 3 24  ? -137.657 -26.956 22.337  1.00 30.00  ? 27  ALA Z C   1  
ATOM 7502   O O   . ALA C 3 24  ? -138.461 -26.412 23.078  1.00 30.00  ? 27  ALA Z O   1  
ATOM 7503   C CB  . ALA C 3 24  ? -138.715 -27.671 20.195  1.00 30.00  ? 27  ALA Z CB  1  
ATOM 7504   N N   . VAL C 3 25  ? -136.390 -26.551 22.226  1.00 30.00  ? 28  VAL Z N   1  
ATOM 7505   C CA  . VAL C 3 25  ? -135.883 -25.408 22.991  1.00 30.00  ? 28  VAL Z CA  1  
ATOM 7506   C C   . VAL C 3 25  ? -135.326 -24.331 22.076  1.00 30.00  ? 28  VAL Z C   1  
ATOM 7507   O O   . VAL C 3 25  ? -134.698 -24.640 21.053  1.00 30.00  ? 28  VAL Z O   1  
ATOM 7508   C CB  . VAL C 3 25  ? -134.769 -25.862 23.927  1.00 99.99  ? 28  VAL Z CB  1  
ATOM 7509   C CG1 . VAL C 3 25  ? -135.314 -26.911 24.894  1.00 99.99  ? 28  VAL Z CG1 1  
ATOM 7510   C CG2 . VAL C 3 25  ? -133.631 -26.469 23.112  1.00 99.99  ? 28  VAL Z CG2 1  
ATOM 7511   N N   . ASP C 3 26  ? -135.554 -23.069 22.447  1.00 30.00  ? 29  ASP Z N   1  
ATOM 7512   C CA  . ASP C 3 26  ? -135.060 -21.944 21.661  1.00 30.00  ? 29  ASP Z CA  1  
ATOM 7513   C C   . ASP C 3 26  ? -133.534 -21.948 21.696  1.00 30.00  ? 29  ASP Z C   1  
ATOM 7514   O O   . ASP C 3 26  ? -132.925 -21.839 22.768  1.00 30.00  ? 29  ASP Z O   1  
ATOM 7515   C CB  . ASP C 3 26  ? -135.580 -20.635 22.243  1.00 99.99  ? 29  ASP Z CB  1  
ATOM 7516   C CG  . ASP C 3 26  ? -135.269 -19.489 21.285  1.00 99.99  ? 29  ASP Z CG  1  
ATOM 7517   O OD1 . ASP C 3 26  ? -134.099 -19.023 21.306  1.00 99.99  ? 29  ASP Z OD1 1  
ATOM 7518   O OD2 . ASP C 3 26  ? -136.204 -19.092 20.537  1.00 99.99  ? 29  ASP Z OD2 1  
ATOM 7519   N N   . ALA C 3 27  ? -132.921 -22.079 20.519  1.00 30.00  ? 30  ALA Z N   1  
ATOM 7520   C CA  . ALA C 3 27  ? -131.467 -22.115 20.381  1.00 30.00  ? 30  ALA Z CA  1  
ATOM 7521   C C   . ALA C 3 27  ? -130.786 -20.953 21.131  1.00 30.00  ? 30  ALA Z C   1  
ATOM 7522   O O   . ALA C 3 27  ? -129.584 -20.984 21.400  1.00 30.00  ? 30  ALA Z O   1  
ATOM 7523   C CB  . ALA C 3 27  ? -131.098 -22.087 18.888  1.00 30.00  ? 30  ALA Z CB  1  
ATOM 7524   N N   . PHE C 3 28  ? -131.566 -19.938 21.474  1.00 30.00  ? 31  PHE Z N   1  
ATOM 7525   C CA  . PHE C 3 28  ? -131.048 -18.783 22.186  1.00 30.00  ? 31  PHE Z CA  1  
ATOM 7526   C C   . PHE C 3 28  ? -130.875 -19.103 23.674  1.00 30.00  ? 31  PHE Z C   1  
ATOM 7527   O O   . PHE C 3 28  ? -130.362 -18.287 24.446  1.00 30.00  ? 31  PHE Z O   1  
ATOM 7528   C CB  . PHE C 3 28  ? -132.014 -17.610 22.045  1.00 99.99  ? 31  PHE Z CB  1  
ATOM 7529   C CG  . PHE C 3 28  ? -131.466 -16.416 22.786  1.00 99.99  ? 31  PHE Z CG  1  
ATOM 7530   C CD1 . PHE C 3 28  ? -130.519 -15.585 22.174  1.00 99.99  ? 31  PHE Z CD1 1  
ATOM 7531   C CD2 . PHE C 3 28  ? -131.907 -16.136 24.085  1.00 99.99  ? 31  PHE Z CD2 1  
ATOM 7532   C CE1 . PHE C 3 28  ? -130.012 -14.476 22.863  1.00 99.99  ? 31  PHE Z CE1 1  
ATOM 7533   C CE2 . PHE C 3 28  ? -131.398 -15.030 24.774  1.00 99.99  ? 31  PHE Z CE2 1  
ATOM 7534   C CZ  . PHE C 3 28  ? -130.452 -14.199 24.162  1.00 99.99  ? 31  PHE Z CZ  1  
ATOM 7535   N N   . LYS C 3 29  ? -131.295 -20.295 24.081  1.00 30.00  ? 32  LYS Z N   1  
ATOM 7536   C CA  . LYS C 3 29  ? -131.173 -20.675 25.481  1.00 30.00  ? 32  LYS Z CA  1  
ATOM 7537   C C   . LYS C 3 29  ? -130.148 -21.776 25.686  1.00 30.00  ? 32  LYS Z C   1  
ATOM 7538   O O   . LYS C 3 29  ? -129.749 -22.047 26.822  1.00 30.00  ? 32  LYS Z O   1  
ATOM 7539   C CB  . LYS C 3 29  ? -132.516 -21.180 26.000  1.00 99.99  ? 32  LYS Z CB  1  
ATOM 7540   C CG  . LYS C 3 29  ? -133.282 -20.030 26.635  1.00 99.99  ? 32  LYS Z CG  1  
ATOM 7541   C CD  . LYS C 3 29  ? -133.867 -19.137 25.541  1.00 99.99  ? 32  LYS Z CD  1  
ATOM 7542   C CE  . LYS C 3 29  ? -134.461 -17.883 26.171  1.00 99.99  ? 32  LYS Z CE  1  
ATOM 7543   N NZ  . LYS C 3 29  ? -134.912 -16.972 25.110  1.00 99.99  ? 32  LYS Z NZ  1  
ATOM 7544   N N   . LEU C 3 30  ? -129.719 -22.395 24.585  1.00 30.00  ? 33  LEU Z N   1  
ATOM 7545   C CA  . LEU C 3 30  ? -128.721 -23.471 24.622  1.00 30.00  ? 33  LEU Z CA  1  
ATOM 7546   C C   . LEU C 3 30  ? -127.570 -23.116 25.564  1.00 30.00  ? 33  LEU Z C   1  
ATOM 7547   O O   . LEU C 3 30  ? -126.899 -23.988 26.119  1.00 30.00  ? 33  LEU Z O   1  
ATOM 7548   C CB  . LEU C 3 30  ? -128.154 -23.702 23.226  1.00 99.99  ? 33  LEU Z CB  1  
ATOM 7549   C CG  . LEU C 3 30  ? -128.926 -24.825 22.540  1.00 99.99  ? 33  LEU Z CG  1  
ATOM 7550   C CD1 . LEU C 3 30  ? -128.166 -25.278 21.298  1.00 99.99  ? 33  LEU Z CD1 1  
ATOM 7551   C CD2 . LEU C 3 30  ? -129.075 -25.999 23.503  1.00 99.99  ? 33  LEU Z CD2 1  
ATOM 7552   N N   . GLY C 3 31  ? -127.336 -21.827 25.740  1.00 30.00  ? 34  GLY Z N   1  
ATOM 7553   C CA  . GLY C 3 31  ? -126.278 -21.437 26.633  1.00 30.00  ? 34  GLY Z CA  1  
ATOM 7554   C C   . GLY C 3 31  ? -126.728 -21.818 28.029  1.00 30.00  ? 34  GLY Z C   1  
ATOM 7555   O O   . GLY C 3 31  ? -126.257 -22.802 28.598  1.00 30.00  ? 34  GLY Z O   1  
ATOM 7556   N N   . ASP C 3 32  ? -127.659 -21.040 28.565  1.00 30.00  ? 35  ASP Z N   1  
ATOM 7557   C CA  . ASP C 3 32  ? -128.181 -21.272 29.895  1.00 30.00  ? 35  ASP Z CA  1  
ATOM 7558   C C   . ASP C 3 32  ? -128.446 -22.736 30.236  1.00 30.00  ? 35  ASP Z C   1  
ATOM 7559   O O   . ASP C 3 32  ? -128.333 -23.137 31.390  1.00 30.00  ? 35  ASP Z O   1  
ATOM 7560   C CB  . ASP C 3 32  ? -129.505 -20.539 30.068  1.00 99.99  ? 35  ASP Z CB  1  
ATOM 7561   C CG  . ASP C 3 32  ? -129.924 -20.579 31.535  1.00 99.99  ? 35  ASP Z CG  1  
ATOM 7562   O OD1 . ASP C 3 32  ? -130.467 -21.638 31.951  1.00 99.99  ? 35  ASP Z OD1 1  
ATOM 7563   O OD2 . ASP C 3 32  ? -129.697 -19.551 32.227  1.00 99.99  ? 35  ASP Z OD2 1  
ATOM 7564   N N   . VAL C 3 33  ? -128.804 -23.537 29.240  1.00 30.00  ? 36  VAL Z N   1  
ATOM 7565   C CA  . VAL C 3 33  ? -129.069 -24.946 29.488  1.00 30.00  ? 36  VAL Z CA  1  
ATOM 7566   C C   . VAL C 3 33  ? -127.805 -25.551 30.091  1.00 30.00  ? 36  VAL Z C   1  
ATOM 7567   O O   . VAL C 3 33  ? -127.802 -25.995 31.242  1.00 30.00  ? 36  VAL Z O   1  
ATOM 7568   C CB  . VAL C 3 33  ? -129.419 -25.648 28.180  1.00 99.99  ? 36  VAL Z CB  1  
ATOM 7569   C CG1 . VAL C 3 33  ? -130.662 -25.002 27.574  1.00 99.99  ? 36  VAL Z CG1 1  
ATOM 7570   C CG2 . VAL C 3 33  ? -128.254 -25.521 27.206  1.00 99.99  ? 36  VAL Z CG2 1  
ATOM 7571   N N   . CYS C 3 34  ? -126.733 -25.537 29.300  1.00 30.00  ? 37  CYS Z N   1  
ATOM 7572   C CA  . CYS C 3 34  ? -125.442 -26.075 29.703  1.00 30.00  ? 37  CYS Z CA  1  
ATOM 7573   C C   . CYS C 3 34  ? -124.867 -25.376 30.935  1.00 30.00  ? 37  CYS Z C   1  
ATOM 7574   O O   . CYS C 3 34  ? -124.139 -25.991 31.716  1.00 30.00  ? 37  CYS Z O   1  
ATOM 7575   C CB  . CYS C 3 34  ? -124.436 -25.909 28.569  1.00 99.99  ? 37  CYS Z CB  1  
ATOM 7576   S SG  . CYS C 3 34  ? -123.992 -24.210 28.141  1.00 99.99  ? 37  CYS Z SG  1  
ATOM 7577   N N   . ARG C 3 35  ? -125.200 -24.100 31.105  1.00 30.00  ? 38  ARG Z N   1  
ATOM 7578   C CA  . ARG C 3 35  ? -124.716 -23.347 32.256  1.00 30.00  ? 38  ARG Z CA  1  
ATOM 7579   C C   . ARG C 3 35  ? -125.298 -23.962 33.530  1.00 30.00  ? 38  ARG Z C   1  
ATOM 7580   O O   . ARG C 3 35  ? -124.779 -23.753 34.622  1.00 30.00  ? 38  ARG Z O   1  
ATOM 7581   C CB  . ARG C 3 35  ? -125.158 -21.891 32.143  1.00 99.99  ? 38  ARG Z CB  1  
ATOM 7582   C CG  . ARG C 3 35  ? -124.293 -21.174 31.115  1.00 99.99  ? 38  ARG Z CG  1  
ATOM 7583   C CD  . ARG C 3 35  ? -124.700 -19.707 31.038  1.00 99.99  ? 38  ARG Z CD  1  
ATOM 7584   N NE  . ARG C 3 35  ? -123.942 -18.999 29.981  1.00 99.99  ? 38  ARG Z NE  1  
ATOM 7585   C CZ  . ARG C 3 35  ? -122.780 -18.393 30.206  1.00 99.99  ? 38  ARG Z CZ  1  
ATOM 7586   N NH1 . ARG C 3 35  ? -122.212 -18.381 31.410  1.00 99.99  ? 38  ARG Z NH1 1  
ATOM 7587   N NH2 . ARG C 3 35  ? -122.185 -17.788 29.185  1.00 99.99  ? 38  ARG Z NH2 1  
ATOM 7588   N N   . CYS C 3 36  ? -126.382 -24.725 33.371  1.00 30.00  ? 39  CYS Z N   1  
ATOM 7589   C CA  . CYS C 3 36  ? -127.073 -25.384 34.488  1.00 30.00  ? 39  CYS Z CA  1  
ATOM 7590   C C   . CYS C 3 36  ? -126.445 -26.712 34.873  1.00 30.00  ? 39  CYS Z C   1  
ATOM 7591   O O   . CYS C 3 36  ? -126.526 -27.127 36.028  1.00 30.00  ? 39  CYS Z O   1  
ATOM 7592   C CB  . CYS C 3 36  ? -128.527 -25.654 34.112  1.00 99.99  ? 39  CYS Z CB  1  
ATOM 7593   S SG  . CYS C 3 36  ? -129.561 -24.197 33.838  1.00 99.99  ? 39  CYS Z SG  1  
ATOM 7594   N N   . LEU C 3 37  ? -125.830 -27.362 33.893  1.00 30.00  ? 40  LEU Z N   1  
ATOM 7595   C CA  . LEU C 3 37  ? -125.171 -28.643 34.088  1.00 30.00  ? 40  LEU Z CA  1  
ATOM 7596   C C   . LEU C 3 37  ? -123.739 -28.428 34.582  1.00 30.00  ? 40  LEU Z C   1  
ATOM 7597   O O   . LEU C 3 37  ? -122.862 -29.283 34.396  1.00 30.00  ? 40  LEU Z O   1  
ATOM 7598   C CB  . LEU C 3 37  ? -125.128 -29.411 32.772  1.00 99.99  ? 40  LEU Z CB  1  
ATOM 7599   C CG  . LEU C 3 37  ? -126.324 -30.358 32.696  1.00 99.99  ? 40  LEU Z CG  1  
ATOM 7600   C CD1 . LEU C 3 37  ? -126.113 -31.351 31.558  1.00 99.99  ? 40  LEU Z CD1 1  
ATOM 7601   C CD2 . LEU C 3 37  ? -126.457 -31.114 34.015  1.00 99.99  ? 40  LEU Z CD2 1  
ATOM 7602   N N   . GLY C 3 38  ? -123.511 -27.282 35.211  1.00 30.00  ? 41  GLY Z N   1  
ATOM 7603   C CA  . GLY C 3 38  ? -122.184 -26.963 35.719  1.00 30.00  ? 41  GLY Z CA  1  
ATOM 7604   C C   . GLY C 3 38  ? -121.437 -25.986 34.825  1.00 30.00  ? 41  GLY Z C   1  
ATOM 7605   O O   . GLY C 3 38  ? -121.249 -24.832 35.194  1.00 30.00  ? 41  GLY Z O   1  
ATOM 7606   N N   . ILE C 3 39  ? -121.012 -26.457 33.654  1.00 30.00  ? 42  ILE Z N   1  
ATOM 7607   C CA  . ILE C 3 39  ? -120.280 -25.657 32.662  1.00 30.00  ? 42  ILE Z CA  1  
ATOM 7608   C C   . ILE C 3 39  ? -120.609 -24.148 32.540  1.00 30.00  ? 42  ILE Z C   1  
ATOM 7609   O O   . ILE C 3 39  ? -121.711 -23.724 32.881  1.00 30.00  ? 42  ILE Z O   1  
ATOM 7610   C CB  . ILE C 3 39  ? -120.520 -26.218 31.264  1.00 99.99  ? 42  ILE Z CB  1  
ATOM 7611   C CG1 . ILE C 3 39  ? -121.797 -25.612 30.686  1.00 99.99  ? 42  ILE Z CG1 1  
ATOM 7612   C CG2 . ILE C 3 39  ? -120.666 -27.735 31.343  1.00 99.99  ? 42  ILE Z CG2 1  
ATOM 7613   C CD1 . ILE C 3 39  ? -121.441 -24.395 29.839  1.00 99.99  ? 42  ILE Z CD1 1  
ATOM 7614   N N   . ASN C 3 40  ? -119.641 -23.357 32.058  1.00 30.00  ? 43  ASN Z N   1  
ATOM 7615   C CA  . ASN C 3 40  ? -119.830 -21.909 31.834  1.00 30.00  ? 43  ASN Z CA  1  
ATOM 7616   C C   . ASN C 3 40  ? -119.130 -21.582 30.534  1.00 30.00  ? 43  ASN Z C   1  
ATOM 7617   O O   . ASN C 3 40  ? -118.000 -21.088 30.539  1.00 30.00  ? 43  ASN Z O   1  
ATOM 7618   C CB  . ASN C 3 40  ? -119.220 -21.122 32.988  1.00 99.99  ? 43  ASN Z CB  1  
ATOM 7619   C CG  . ASN C 3 40  ? -120.016 -21.323 34.271  1.00 99.99  ? 43  ASN Z CG  1  
ATOM 7620   O OD1 . ASN C 3 40  ? -121.127 -20.813 34.403  1.00 99.99  ? 43  ASN Z OD1 1  
ATOM 7621   N ND2 . ASN C 3 40  ? -119.444 -22.070 35.217  1.00 99.99  ? 43  ASN Z ND2 1  
ATOM 7622   N N   . PRO C 3 41  ? -119.785 -21.838 29.400  1.00 30.00  ? 44  PRO Z N   1  
ATOM 7623   C CA  . PRO C 3 41  ? -119.084 -21.508 28.159  1.00 30.00  ? 44  PRO Z CA  1  
ATOM 7624   C C   . PRO C 3 41  ? -119.115 -20.014 27.945  1.00 30.00  ? 44  PRO Z C   1  
ATOM 7625   O O   . PRO C 3 41  ? -119.785 -19.282 28.681  1.00 30.00  ? 44  PRO Z O   1  
ATOM 7626   C CB  . PRO C 3 41  ? -119.954 -22.258 27.216  1.00 99.99  ? 44  PRO Z CB  1  
ATOM 7627   C CG  . PRO C 3 41  ? -120.994 -22.952 28.064  1.00 99.99  ? 44  PRO Z CG  1  
ATOM 7628   C CD  . PRO C 3 41  ? -120.855 -22.742 29.315  1.00 99.99  ? 44  PRO Z CD  1  
ATOM 7629   N N   . ARG C 3 42  ? -118.384 -19.562 26.933  1.00 30.00  ? 45  ARG Z N   1  
ATOM 7630   C CA  . ARG C 3 42  ? -118.332 -18.142 26.606  1.00 30.00  ? 45  ARG Z CA  1  
ATOM 7631   C C   . ARG C 3 42  ? -119.310 -17.924 25.448  1.00 30.00  ? 45  ARG Z C   1  
ATOM 7632   O O   . ARG C 3 42  ? -119.521 -18.821 24.632  1.00 30.00  ? 45  ARG Z O   1  
ATOM 7633   C CB  . ARG C 3 42  ? -116.916 -17.754 26.199  1.00 99.99  ? 45  ARG Z CB  1  
ATOM 7634   C CG  . ARG C 3 42  ? -116.838 -16.244 26.001  1.00 99.99  ? 45  ARG Z CG  1  
ATOM 7635   C CD  . ARG C 3 42  ? -115.382 -15.828 25.838  1.00 99.99  ? 45  ARG Z CD  1  
ATOM 7636   N NE  . ARG C 3 42  ? -114.761 -16.508 24.680  1.00 99.99  ? 45  ARG Z NE  1  
ATOM 7637   C CZ  . ARG C 3 42  ? -113.478 -16.859 24.647  1.00 99.99  ? 45  ARG Z CZ  1  
ATOM 7638   N NH1 . ARG C 3 42  ? -112.655 -16.619 25.665  1.00 99.99  ? 45  ARG Z NH1 1  
ATOM 7639   N NH2 . ARG C 3 42  ? -113.024 -17.468 23.557  1.00 99.99  ? 45  ARG Z NH2 1  
ATOM 7640   N N   . ASN C 3 43  ? -119.917 -16.747 25.370  1.00 30.00  ? 46  ASN Z N   1  
ATOM 7641   C CA  . ASN C 3 43  ? -120.845 -16.496 24.284  1.00 30.00  ? 46  ASN Z CA  1  
ATOM 7642   C C   . ASN C 3 43  ? -120.164 -16.889 22.969  1.00 30.00  ? 46  ASN Z C   1  
ATOM 7643   O O   . ASN C 3 43  ? -120.759 -17.566 22.141  1.00 30.00  ? 46  ASN Z O   1  
ATOM 7644   C CB  . ASN C 3 43  ? -121.222 -15.019 24.253  1.00 99.99  ? 46  ASN Z CB  1  
ATOM 7645   C CG  . ASN C 3 43  ? -120.001 -14.147 23.999  1.00 99.99  ? 46  ASN Z CG  1  
ATOM 7646   O OD1 . ASN C 3 43  ? -120.131 -12.959 23.705  1.00 99.99  ? 46  ASN Z OD1 1  
ATOM 7647   N ND2 . ASN C 3 43  ? -118.810 -14.740 24.112  1.00 99.99  ? 46  ASN Z ND2 1  
ATOM 7648   N N   . GLU C 3 44  ? -118.913 -16.481 22.773  1.00 30.00  ? 47  GLU Z N   1  
ATOM 7649   C CA  . GLU C 3 44  ? -118.219 -16.851 21.543  1.00 30.00  ? 47  GLU Z CA  1  
ATOM 7650   C C   . GLU C 3 44  ? -118.367 -18.368 21.375  1.00 30.00  ? 47  GLU Z C   1  
ATOM 7651   O O   . GLU C 3 44  ? -118.641 -18.864 20.279  1.00 30.00  ? 47  GLU Z O   1  
ATOM 7652   C CB  . GLU C 3 44  ? -116.748 -16.466 21.644  1.00 99.99  ? 47  GLU Z CB  1  
ATOM 7653   C CG  . GLU C 3 44  ? -116.623 -14.962 21.738  1.00 99.99  ? 47  GLU Z CG  1  
ATOM 7654   C CD  . GLU C 3 44  ? -116.949 -14.341 20.384  1.00 99.99  ? 47  GLU Z CD  1  
ATOM 7655   O OE1 . GLU C 3 44  ? -118.150 -14.034 20.166  1.00 99.99  ? 47  GLU Z OE1 1  
ATOM 7656   O OE2 . GLU C 3 44  ? -115.994 -14.176 19.579  1.00 99.99  ? 47  GLU Z OE2 1  
ATOM 7657   N N   . ASP C 3 45  ? -118.186 -19.081 22.488  1.00 30.00  ? 48  ASP Z N   1  
ATOM 7658   C CA  . ASP C 3 45  ? -118.269 -20.545 22.575  1.00 30.00  ? 48  ASP Z CA  1  
ATOM 7659   C C   . ASP C 3 45  ? -119.623 -21.089 22.105  1.00 30.00  ? 48  ASP Z C   1  
ATOM 7660   O O   . ASP C 3 45  ? -119.690 -21.895 21.173  1.00 30.00  ? 48  ASP Z O   1  
ATOM 7661   C CB  . ASP C 3 45  ? -118.067 -20.991 24.021  1.00 99.99  ? 48  ASP Z CB  1  
ATOM 7662   C CG  . ASP C 3 45  ? -117.906 -22.509 24.069  1.00 99.99  ? 48  ASP Z CG  1  
ATOM 7663   O OD1 . ASP C 3 45  ? -118.958 -23.202 24.011  1.00 99.99  ? 48  ASP Z OD1 1  
ATOM 7664   O OD2 . ASP C 3 45  ? -116.735 -22.961 24.164  1.00 99.99  ? 48  ASP Z OD2 1  
ATOM 7665   N N   . VAL C 3 46  ? -120.688 -20.649 22.766  1.00 30.00  ? 49  VAL Z N   1  
ATOM 7666   C CA  . VAL C 3 46  ? -122.046 -21.095 22.450  1.00 30.00  ? 49  VAL Z CA  1  
ATOM 7667   C C   . VAL C 3 46  ? -122.482 -20.949 20.997  1.00 30.00  ? 49  VAL Z C   1  
ATOM 7668   O O   . VAL C 3 46  ? -122.946 -21.921 20.397  1.00 30.00  ? 49  VAL Z O   1  
ATOM 7669   C CB  . VAL C 3 46  ? -123.057 -20.300 23.269  1.00 99.99  ? 49  VAL Z CB  1  
ATOM 7670   C CG1 . VAL C 3 46  ? -122.789 -20.519 24.756  1.00 99.99  ? 49  VAL Z CG1 1  
ATOM 7671   C CG2 . VAL C 3 46  ? -122.929 -18.818 22.941  1.00 99.99  ? 49  VAL Z CG2 1  
ATOM 7672   N N   . PHE C 3 47  ? -122.329 -19.751 20.432  1.00 30.00  ? 50  PHE Z N   1  
ATOM 7673   C CA  . PHE C 3 47  ? -122.715 -19.513 19.046  1.00 30.00  ? 50  PHE Z CA  1  
ATOM 7674   C C   . PHE C 3 47  ? -122.002 -20.520 18.151  1.00 30.00  ? 50  PHE Z C   1  
ATOM 7675   O O   . PHE C 3 47  ? -122.560 -21.014 17.180  1.00 30.00  ? 50  PHE Z O   1  
ATOM 7676   C CB  . PHE C 3 47  ? -122.326 -18.096 18.635  1.00 99.99  ? 50  PHE Z CB  1  
ATOM 7677   C CG  . PHE C 3 47  ? -122.733 -17.858 17.201  1.00 99.99  ? 50  PHE Z CG  1  
ATOM 7678   C CD1 . PHE C 3 47  ? -124.046 -17.480 16.898  1.00 99.99  ? 50  PHE Z CD1 1  
ATOM 7679   C CD2 . PHE C 3 47  ? -121.796 -18.013 16.172  1.00 99.99  ? 50  PHE Z CD2 1  
ATOM 7680   C CE1 . PHE C 3 47  ? -124.423 -17.259 15.568  1.00 99.99  ? 50  PHE Z CE1 1  
ATOM 7681   C CE2 . PHE C 3 47  ? -122.173 -17.792 14.843  1.00 99.99  ? 50  PHE Z CE2 1  
ATOM 7682   C CZ  . PHE C 3 47  ? -123.487 -17.413 14.542  1.00 99.99  ? 50  PHE Z CZ  1  
ATOM 7683   N N   . ALA C 3 48  ? -120.763 -20.830 18.493  1.00 30.00  ? 51  ALA Z N   1  
ATOM 7684   C CA  . ALA C 3 48  ? -119.977 -21.778 17.715  1.00 30.00  ? 51  ALA Z CA  1  
ATOM 7685   C C   . ALA C 3 48  ? -120.683 -23.115 17.507  1.00 30.00  ? 51  ALA Z C   1  
ATOM 7686   O O   . ALA C 3 48  ? -120.543 -23.745 16.461  1.00 30.00  ? 51  ALA Z O   1  
ATOM 7687   C CB  . ALA C 3 48  ? -118.643 -22.012 18.398  1.00 30.00  ? 51  ALA Z CB  1  
ATOM 7688   N N   . VAL C 3 49  ? -121.448 -23.550 18.507  1.00 30.00  ? 52  VAL Z N   1  
ATOM 7689   C CA  . VAL C 3 49  ? -122.145 -24.832 18.395  1.00 30.00  ? 52  VAL Z CA  1  
ATOM 7690   C C   . VAL C 3 49  ? -123.571 -24.751 17.845  1.00 30.00  ? 52  VAL Z C   1  
ATOM 7691   O O   . VAL C 3 49  ? -124.080 -25.740 17.304  1.00 30.00  ? 52  VAL Z O   1  
ATOM 7692   C CB  . VAL C 3 49  ? -122.253 -25.485 19.769  1.00 99.99  ? 52  VAL Z CB  1  
ATOM 7693   C CG1 . VAL C 3 49  ? -120.854 -25.721 20.331  1.00 99.99  ? 52  VAL Z CG1 1  
ATOM 7694   C CG2 . VAL C 3 49  ? -123.028 -24.567 20.709  1.00 99.99  ? 52  VAL Z CG2 1  
ATOM 7695   N N   . GLY C 3 50  ? -124.217 -23.593 17.967  1.00 30.00  ? 53  GLY Z N   1  
ATOM 7696   C CA  . GLY C 3 50  ? -125.567 -23.460 17.452  1.00 30.00  ? 53  GLY Z CA  1  
ATOM 7697   C C   . GLY C 3 50  ? -126.401 -22.362 18.074  1.00 30.00  ? 53  GLY Z C   1  
ATOM 7698   O O   . GLY C 3 50  ? -127.459 -22.024 17.544  1.00 30.00  ? 53  GLY Z O   1  
ATOM 7699   N N   . GLY C 3 51  ? -125.942 -21.799 19.190  1.00 30.00  ? 54  GLY Z N   1  
ATOM 7700   C CA  . GLY C 3 51  ? -126.686 -20.738 19.851  1.00 30.00  ? 54  GLY Z CA  1  
ATOM 7701   C C   . GLY C 3 51  ? -127.096 -19.602 18.932  1.00 30.00  ? 54  GLY Z C   1  
ATOM 7702   O O   . GLY C 3 51  ? -126.566 -19.468 17.823  1.00 30.00  ? 54  GLY Z O   1  
ATOM 7703   N N   . THR C 3 52  ? -128.043 -18.782 19.377  1.00 30.00  ? 55  THR Z N   1  
ATOM 7704   C CA  . THR C 3 52  ? -128.502 -17.658 18.574  1.00 30.00  ? 55  THR Z CA  1  
ATOM 7705   C C   . THR C 3 52  ? -128.573 -16.403 19.430  1.00 30.00  ? 55  THR Z C   1  
ATOM 7706   O O   . THR C 3 52  ? -128.671 -16.479 20.659  1.00 30.00  ? 55  THR Z O   1  
ATOM 7707   C CB  . THR C 3 52  ? -129.886 -17.957 18.009  1.00 99.99  ? 55  THR Z CB  1  
ATOM 7708   O OG1 . THR C 3 52  ? -130.841 -17.990 19.074  1.00 99.99  ? 55  THR Z OG1 1  
ATOM 7709   C CG2 . THR C 3 52  ? -129.868 -19.308 17.304  1.00 99.99  ? 55  THR Z CG2 1  
ATOM 7710   N N   . HIS C 3 53  ? -128.518 -15.251 18.766  1.00 30.00  ? 56  HIS Z N   1  
ATOM 7711   C CA  . HIS C 3 53  ? -128.567 -13.954 19.434  1.00 30.00  ? 56  HIS Z CA  1  
ATOM 7712   C C   . HIS C 3 53  ? -129.952 -13.604 19.967  1.00 30.00  ? 56  HIS Z C   1  
ATOM 7713   O O   . HIS C 3 53  ? -130.070 -12.889 20.964  1.00 30.00  ? 56  HIS Z O   1  
ATOM 7714   C CB  . HIS C 3 53  ? -128.159 -12.855 18.460  1.00 99.99  ? 56  HIS Z CB  1  
ATOM 7715   C CG  . HIS C 3 53  ? -128.391 -11.447 18.954  1.00 99.99  ? 56  HIS Z CG  1  
ATOM 7716   N ND1 . HIS C 3 53  ? -127.381 -10.493 18.960  1.00 99.99  ? 56  HIS Z ND1 1  
ATOM 7717   C CD2 . HIS C 3 53  ? -129.504 -10.839 19.449  1.00 99.99  ? 56  HIS Z CD2 1  
ATOM 7718   C CE1 . HIS C 3 53  ? -127.885 -9.369  19.442  1.00 99.99  ? 56  HIS Z CE1 1  
ATOM 7719   N NE2 . HIS C 3 53  ? -129.144 -9.559  19.737  1.00 99.99  ? 56  HIS Z NE2 1  
ATOM 7720   N N   . LYS C 3 54  ? -130.998 -14.099 19.305  1.00 30.00  ? 57  LYS Z N   1  
ATOM 7721   C CA  . LYS C 3 54  ? -132.370 -13.804 19.726  1.00 30.00  ? 57  LYS Z CA  1  
ATOM 7722   C C   . LYS C 3 54  ? -133.293 -15.009 19.825  1.00 30.00  ? 57  LYS Z C   1  
ATOM 7723   O O   . LYS C 3 54  ? -133.017 -16.093 19.286  1.00 30.00  ? 57  LYS Z O   1  
ATOM 7724   C CB  . LYS C 3 54  ? -133.022 -12.848 18.732  1.00 99.99  ? 57  LYS Z CB  1  
ATOM 7725   C CG  . LYS C 3 54  ? -134.412 -12.471 19.228  1.00 99.99  ? 57  LYS Z CG  1  
ATOM 7726   C CD  . LYS C 3 54  ? -134.884 -11.209 18.510  1.00 99.99  ? 57  LYS Z CD  1  
ATOM 7727   C CE  . LYS C 3 54  ? -136.385 -11.039 18.716  1.00 99.99  ? 57  LYS Z CE  1  
ATOM 7728   N NZ  . LYS C 3 54  ? -136.627 -10.165 19.872  1.00 99.99  ? 57  LYS Z NZ  1  
ATOM 7729   N N   . MET C 3 55  ? -134.406 -14.793 20.524  1.00 30.00  ? 58  MET Z N   1  
ATOM 7730   C CA  . MET C 3 55  ? -135.419 -15.816 20.701  1.00 30.00  ? 58  MET Z CA  1  
ATOM 7731   C C   . MET C 3 55  ? -136.042 -15.965 19.314  1.00 30.00  ? 58  MET Z C   1  
ATOM 7732   O O   . MET C 3 55  ? -135.592 -15.330 18.363  1.00 30.00  ? 58  MET Z O   1  
ATOM 7733   C CB  . MET C 3 55  ? -136.439 -15.361 21.739  1.00 99.99  ? 58  MET Z CB  1  
ATOM 7734   C CG  . MET C 3 55  ? -137.458 -16.471 21.972  1.00 99.99  ? 58  MET Z CG  1  
ATOM 7735   S SD  . MET C 3 55  ? -138.476 -16.086 23.417  1.00 99.99  ? 58  MET Z SD  1  
ATOM 7736   C CE  . MET C 3 55  ? -139.595 -17.470 23.387  1.00 99.99  ? 58  MET Z CE  1  
ATOM 7737   N N   . GLY C 3 56  ? -137.066 -16.798 19.190  1.00 30.00  ? 59  GLY Z N   1  
ATOM 7738   C CA  . GLY C 3 56  ? -137.711 -16.977 17.902  1.00 30.00  ? 59  GLY Z CA  1  
ATOM 7739   C C   . GLY C 3 56  ? -136.832 -17.449 16.759  1.00 30.00  ? 59  GLY Z C   1  
ATOM 7740   O O   . GLY C 3 56  ? -137.240 -18.299 15.973  1.00 30.00  ? 59  GLY Z O   1  
ATOM 7741   N N   . GLU C 3 57  ? -135.631 -16.903 16.662  1.00 30.00  ? 60  GLU Z N   1  
ATOM 7742   C CA  . GLU C 3 57  ? -134.691 -17.271 15.611  1.00 30.00  ? 60  GLU Z CA  1  
ATOM 7743   C C   . GLU C 3 57  ? -134.798 -18.734 15.226  1.00 30.00  ? 60  GLU Z C   1  
ATOM 7744   O O   . GLU C 3 57  ? -134.820 -19.068 14.044  1.00 30.00  ? 60  GLU Z O   1  
ATOM 7745   C CB  . GLU C 3 57  ? -133.262 -17.012 16.077  1.00 99.99  ? 60  GLU Z CB  1  
ATOM 7746   C CG  . GLU C 3 57  ? -133.060 -15.530 16.293  1.00 99.99  ? 60  GLU Z CG  1  
ATOM 7747   C CD  . GLU C 3 57  ? -133.013 -14.824 14.940  1.00 99.99  ? 60  GLU Z CD  1  
ATOM 7748   O OE1 . GLU C 3 57  ? -134.104 -14.412 14.468  1.00 99.99  ? 60  GLU Z OE1 1  
ATOM 7749   O OE2 . GLU C 3 57  ? -131.883 -14.701 14.396  1.00 99.99  ? 60  GLU Z OE2 1  
ATOM 7750   N N   . LYS C 3 58  ? -134.860 -19.608 16.225  1.00 30.00  ? 61  LYS Z N   1  
ATOM 7751   C CA  . LYS C 3 58  ? -134.968 -21.042 15.965  1.00 30.00  ? 61  LYS Z CA  1  
ATOM 7752   C C   . LYS C 3 58  ? -135.036 -21.890 17.240  1.00 30.00  ? 61  LYS Z C   1  
ATOM 7753   O O   . LYS C 3 58  ? -134.526 -21.490 18.294  1.00 30.00  ? 61  LYS Z O   1  
ATOM 7754   C CB  . LYS C 3 58  ? -133.757 -21.517 15.171  1.00 99.99  ? 61  LYS Z CB  1  
ATOM 7755   C CG  . LYS C 3 58  ? -133.922 -22.991 14.818  1.00 99.99  ? 61  LYS Z CG  1  
ATOM 7756   C CD  . LYS C 3 58  ? -132.975 -23.354 13.681  1.00 99.99  ? 61  LYS Z CD  1  
ATOM 7757   C CE  . LYS C 3 58  ? -132.864 -24.871 13.577  1.00 99.99  ? 61  LYS Z CE  1  
ATOM 7758   N NZ  . LYS C 3 58  ? -133.835 -25.368 12.589  1.00 99.99  ? 61  LYS Z NZ  1  
ATOM 7759   N N   . SER C 3 59  ? -135.676 -23.057 17.127  1.00 30.00  ? 62  SER Z N   1  
ATOM 7760   C CA  . SER C 3 59  ? -135.836 -23.994 18.243  1.00 30.00  ? 62  SER Z CA  1  
ATOM 7761   C C   . SER C 3 59  ? -135.088 -25.285 17.925  1.00 30.00  ? 62  SER Z C   1  
ATOM 7762   O O   . SER C 3 59  ? -134.825 -25.591 16.755  1.00 30.00  ? 62  SER Z O   1  
ATOM 7763   C CB  . SER C 3 59  ? -137.315 -24.302 18.451  1.00 99.99  ? 62  SER Z CB  1  
ATOM 7764   O OG  . SER C 3 59  ? -137.464 -25.197 19.554  1.00 99.99  ? 62  SER Z OG  1  
ATOM 7765   N N   . LEU C 3 60  ? -134.753 -26.044 18.965  1.00 30.00  ? 63  LEU Z N   1  
ATOM 7766   C CA  . LEU C 3 60  ? -134.018 -27.286 18.772  1.00 30.00  ? 63  LEU Z CA  1  
ATOM 7767   C C   . LEU C 3 60  ? -134.489 -28.486 19.592  1.00 30.00  ? 63  LEU Z C   1  
ATOM 7768   O O   . LEU C 3 60  ? -134.970 -28.335 20.715  1.00 30.00  ? 63  LEU Z O   1  
ATOM 7769   C CB  . LEU C 3 60  ? -132.552 -27.084 19.140  1.00 99.99  ? 63  LEU Z CB  1  
ATOM 7770   C CG  . LEU C 3 60  ? -131.753 -26.748 17.884  1.00 99.99  ? 63  LEU Z CG  1  
ATOM 7771   C CD1 . LEU C 3 60  ? -130.263 -26.868 18.184  1.00 99.99  ? 63  LEU Z CD1 1  
ATOM 7772   C CD2 . LEU C 3 60  ? -132.130 -27.715 16.768  1.00 99.99  ? 63  LEU Z CD2 1  
ATOM 7773   N N   . PRO C 3 61  ? -134.355 -29.703 19.026  1.00 30.00  ? 64  PRO Z N   1  
ATOM 7774   C CA  . PRO C 3 61  ? -134.763 -30.941 19.701  1.00 30.00  ? 64  PRO Z CA  1  
ATOM 7775   C C   . PRO C 3 61  ? -133.677 -31.392 20.666  1.00 30.00  ? 64  PRO Z C   1  
ATOM 7776   O O   . PRO C 3 61  ? -132.702 -30.684 20.889  1.00 30.00  ? 64  PRO Z O   1  
ATOM 7777   C CB  . PRO C 3 61  ? -134.875 -31.811 18.497  1.00 99.99  ? 64  PRO Z CB  1  
ATOM 7778   C CG  . PRO C 3 61  ? -134.570 -30.929 17.311  1.00 99.99  ? 64  PRO Z CG  1  
ATOM 7779   C CD  . PRO C 3 61  ? -134.325 -29.715 17.626  1.00 99.99  ? 64  PRO Z CD  1  
ATOM 7780   N N   . PHE C 3 62  ? -133.846 -32.576 21.239  1.00 30.00  ? 65  PHE Z N   1  
ATOM 7781   C CA  . PHE C 3 62  ? -132.867 -33.103 22.167  1.00 30.00  ? 65  PHE Z CA  1  
ATOM 7782   C C   . PHE C 3 62  ? -131.861 -33.859 21.316  1.00 30.00  ? 65  PHE Z C   1  
ATOM 7783   O O   . PHE C 3 62  ? -130.734 -34.101 21.731  1.00 30.00  ? 65  PHE Z O   1  
ATOM 7784   C CB  . PHE C 3 62  ? -133.547 -34.029 23.170  1.00 99.99  ? 65  PHE Z CB  1  
ATOM 7785   C CG  . PHE C 3 62  ? -132.521 -34.570 24.133  1.00 99.99  ? 65  PHE Z CG  1  
ATOM 7786   C CD1 . PHE C 3 62  ? -132.131 -33.812 25.244  1.00 99.99  ? 65  PHE Z CD1 1  
ATOM 7787   C CD2 . PHE C 3 62  ? -131.956 -35.834 23.918  1.00 99.99  ? 65  PHE Z CD2 1  
ATOM 7788   C CE1 . PHE C 3 62  ? -131.180 -34.315 26.138  1.00 99.99  ? 65  PHE Z CE1 1  
ATOM 7789   C CE2 . PHE C 3 62  ? -131.003 -36.336 24.811  1.00 99.99  ? 65  PHE Z CE2 1  
ATOM 7790   C CZ  . PHE C 3 62  ? -130.615 -35.577 25.920  1.00 99.99  ? 65  PHE Z CZ  1  
ATOM 7791   N N   . GLU C 3 63  ? -132.265 -34.224 20.108  1.00 30.00  ? 66  GLU Z N   1  
ATOM 7792   C CA  . GLU C 3 63  ? -131.381 -34.955 19.212  1.00 30.00  ? 66  GLU Z CA  1  
ATOM 7793   C C   . GLU C 3 63  ? -130.171 -34.105 18.791  1.00 30.00  ? 66  GLU Z C   1  
ATOM 7794   O O   . GLU C 3 63  ? -129.035 -34.588 18.779  1.00 30.00  ? 66  GLU Z O   1  
ATOM 7795   C CB  . GLU C 3 63  ? -132.139 -35.361 17.953  1.00 99.99  ? 66  GLU Z CB  1  
ATOM 7796   C CG  . GLU C 3 63  ? -133.234 -36.335 18.315  1.00 99.99  ? 66  GLU Z CG  1  
ATOM 7797   C CD  . GLU C 3 63  ? -132.617 -37.684 18.677  1.00 99.99  ? 66  GLU Z CD  1  
ATOM 7798   O OE1 . GLU C 3 63  ? -132.314 -37.874 19.885  1.00 99.99  ? 66  GLU Z OE1 1  
ATOM 7799   O OE2 . GLU C 3 63  ? -132.451 -38.515 17.741  1.00 99.99  ? 66  GLU Z OE2 1  
ATOM 7800   N N   . GLU C 3 64  ? -130.425 -32.843 18.454  1.00 30.00  ? 67  GLU Z N   1  
ATOM 7801   C CA  . GLU C 3 64  ? -129.370 -31.929 18.028  1.00 30.00  ? 67  GLU Z CA  1  
ATOM 7802   C C   . GLU C 3 64  ? -128.646 -31.343 19.235  1.00 30.00  ? 67  GLU Z C   1  
ATOM 7803   O O   . GLU C 3 64  ? -127.507 -30.889 19.146  1.00 30.00  ? 67  GLU Z O   1  
ATOM 7804   C CB  . GLU C 3 64  ? -129.969 -30.787 17.216  1.00 99.99  ? 67  GLU Z CB  1  
ATOM 7805   C CG  . GLU C 3 64  ? -130.561 -31.332 15.938  1.00 99.99  ? 67  GLU Z CG  1  
ATOM 7806   C CD  . GLU C 3 64  ? -129.436 -31.745 14.992  1.00 99.99  ? 67  GLU Z CD  1  
ATOM 7807   O OE1 . GLU C 3 64  ? -129.020 -32.931 15.078  1.00 99.99  ? 67  GLU Z OE1 1  
ATOM 7808   O OE2 . GLU C 3 64  ? -129.007 -30.873 14.193  1.00 99.99  ? 67  GLU Z OE2 1  
ATOM 7809   N N   . PHE C 3 65  ? -129.320 -31.359 20.372  1.00 30.00  ? 68  PHE Z N   1  
ATOM 7810   C CA  . PHE C 3 65  ? -128.775 -30.839 21.615  1.00 30.00  ? 68  PHE Z CA  1  
ATOM 7811   C C   . PHE C 3 65  ? -127.586 -31.607 22.194  1.00 30.00  ? 68  PHE Z C   1  
ATOM 7812   O O   . PHE C 3 65  ? -126.660 -31.017 22.737  1.00 30.00  ? 68  PHE Z O   1  
ATOM 7813   C CB  . PHE C 3 65  ? -129.849 -30.846 22.696  1.00 99.99  ? 68  PHE Z CB  1  
ATOM 7814   C CG  . PHE C 3 65  ? -129.277 -30.301 23.983  1.00 99.99  ? 68  PHE Z CG  1  
ATOM 7815   C CD1 . PHE C 3 65  ? -129.215 -28.918 24.191  1.00 99.99  ? 68  PHE Z CD1 1  
ATOM 7816   C CD2 . PHE C 3 65  ? -128.810 -31.179 24.967  1.00 99.99  ? 68  PHE Z CD2 1  
ATOM 7817   C CE1 . PHE C 3 65  ? -128.683 -28.414 25.384  1.00 99.99  ? 68  PHE Z CE1 1  
ATOM 7818   C CE2 . PHE C 3 65  ? -128.278 -30.676 26.160  1.00 99.99  ? 68  PHE Z CE2 1  
ATOM 7819   C CZ  . PHE C 3 65  ? -128.214 -29.293 26.368  1.00 99.99  ? 68  PHE Z CZ  1  
ATOM 7820   N N   . LEU C 3 66  ? -127.629 -32.924 22.088  1.00 30.00  ? 69  LEU Z N   1  
ATOM 7821   C CA  . LEU C 3 66  ? -126.564 -33.778 22.610  1.00 30.00  ? 69  LEU Z CA  1  
ATOM 7822   C C   . LEU C 3 66  ? -125.152 -33.340 22.216  1.00 30.00  ? 69  LEU Z C   1  
ATOM 7823   O O   . LEU C 3 66  ? -124.261 -33.268 23.066  1.00 30.00  ? 69  LEU Z O   1  
ATOM 7824   C CB  . LEU C 3 66  ? -126.744 -35.200 22.095  1.00 99.99  ? 69  LEU Z CB  1  
ATOM 7825   C CG  . LEU C 3 66  ? -127.517 -36.021 23.120  1.00 99.99  ? 69  LEU Z CG  1  
ATOM 7826   C CD1 . LEU C 3 66  ? -127.412 -37.503 22.773  1.00 99.99  ? 69  LEU Z CD1 1  
ATOM 7827   C CD2 . LEU C 3 66  ? -126.931 -35.784 24.510  1.00 99.99  ? 69  LEU Z CD2 1  
ATOM 7828   N N   . PRO C 3 67  ? -124.923 -33.047 20.924  1.00 30.00  ? 70  PRO Z N   1  
ATOM 7829   C CA  . PRO C 3 67  ? -123.604 -32.621 20.445  1.00 30.00  ? 70  PRO Z CA  1  
ATOM 7830   C C   . PRO C 3 67  ? -123.199 -31.186 20.811  1.00 30.00  ? 70  PRO Z C   1  
ATOM 7831   O O   . PRO C 3 67  ? -122.012 -30.845 20.824  1.00 30.00  ? 70  PRO Z O   1  
ATOM 7832   C CB  . PRO C 3 67  ? -123.852 -32.757 18.984  1.00 99.99  ? 70  PRO Z CB  1  
ATOM 7833   C CG  . PRO C 3 67  ? -125.258 -33.294 18.845  1.00 99.99  ? 70  PRO Z CG  1  
ATOM 7834   C CD  . PRO C 3 67  ? -125.838 -33.500 19.963  1.00 99.99  ? 70  PRO Z CD  1  
ATOM 7835   N N   . ALA C 3 68  ? -124.185 -30.338 21.105  1.00 30.00  ? 71  ALA Z N   1  
ATOM 7836   C CA  . ALA C 3 68  ? -123.884 -28.964 21.481  1.00 30.00  ? 71  ALA Z CA  1  
ATOM 7837   C C   . ALA C 3 68  ? -123.210 -29.053 22.840  1.00 30.00  ? 71  ALA Z C   1  
ATOM 7838   O O   . ALA C 3 68  ? -122.292 -28.290 23.145  1.00 30.00  ? 71  ALA Z O   1  
ATOM 7839   C CB  . ALA C 3 68  ? -125.166 -28.151 21.581  1.00 30.00  ? 71  ALA Z CB  1  
ATOM 7840   N N   . TYR C 3 69  ? -123.676 -30.000 23.651  1.00 30.00  ? 72  TYR Z N   1  
ATOM 7841   C CA  . TYR C 3 69  ? -123.126 -30.216 24.980  1.00 30.00  ? 72  TYR Z CA  1  
ATOM 7842   C C   . TYR C 3 69  ? -121.851 -31.045 24.894  1.00 30.00  ? 72  TYR Z C   1  
ATOM 7843   O O   . TYR C 3 69  ? -121.011 -30.989 25.778  1.00 30.00  ? 72  TYR Z O   1  
ATOM 7844   C CB  . TYR C 3 69  ? -124.138 -30.958 25.847  1.00 99.99  ? 72  TYR Z CB  1  
ATOM 7845   C CG  . TYR C 3 69  ? -123.559 -31.177 27.222  1.00 99.99  ? 72  TYR Z CG  1  
ATOM 7846   C CD1 . TYR C 3 69  ? -123.626 -30.160 28.182  1.00 99.99  ? 72  TYR Z CD1 1  
ATOM 7847   C CD2 . TYR C 3 69  ? -122.954 -32.401 27.540  1.00 99.99  ? 72  TYR Z CD2 1  
ATOM 7848   C CE1 . TYR C 3 69  ? -123.088 -30.364 29.457  1.00 99.99  ? 72  TYR Z CE1 1  
ATOM 7849   C CE2 . TYR C 3 69  ? -122.417 -32.605 28.817  1.00 99.99  ? 72  TYR Z CE2 1  
ATOM 7850   C CZ  . TYR C 3 69  ? -122.484 -31.586 29.776  1.00 99.99  ? 72  TYR Z CZ  1  
ATOM 7851   O OH  . TYR C 3 69  ? -121.959 -31.785 31.016  1.00 99.99  ? 72  TYR Z OH  1  
ATOM 7852   N N   . GLU C 3 70  ? -121.723 -31.833 23.835  1.00 30.00  ? 73  GLU Z N   1  
ATOM 7853   C CA  . GLU C 3 70  ? -120.524 -32.635 23.669  1.00 30.00  ? 73  GLU Z CA  1  
ATOM 7854   C C   . GLU C 3 70  ? -119.491 -31.573 23.339  1.00 30.00  ? 73  GLU Z C   1  
ATOM 7855   O O   . GLU C 3 70  ? -118.354 -31.613 23.812  1.00 30.00  ? 73  GLU Z O   1  
ATOM 7856   C CB  . GLU C 3 70  ? -120.727 -33.646 22.545  1.00 99.99  ? 73  GLU Z CB  1  
ATOM 7857   C CG  . GLU C 3 70  ? -121.811 -34.623 22.934  1.00 99.99  ? 73  GLU Z CG  1  
ATOM 7858   C CD  . GLU C 3 70  ? -121.285 -35.559 24.017  1.00 99.99  ? 73  GLU Z CD  1  
ATOM 7859   O OE1 . GLU C 3 70  ? -121.444 -35.203 25.214  1.00 99.99  ? 73  GLU Z OE1 1  
ATOM 7860   O OE2 . GLU C 3 70  ? -120.730 -36.626 23.639  1.00 99.99  ? 73  GLU Z OE2 1  
ATOM 7861   N N   . GLY C 3 71  ? -119.922 -30.614 22.522  1.00 30.00  ? 74  GLY Z N   1  
ATOM 7862   C CA  . GLY C 3 71  ? -119.058 -29.520 22.120  1.00 30.00  ? 74  GLY Z CA  1  
ATOM 7863   C C   . GLY C 3 71  ? -118.618 -28.660 23.293  1.00 30.00  ? 74  GLY Z C   1  
ATOM 7864   O O   . GLY C 3 71  ? -117.433 -28.650 23.636  1.00 30.00  ? 74  GLY Z O   1  
ATOM 7865   N N   . LEU C 3 72  ? -119.559 -27.949 23.912  1.00 30.00  ? 75  LEU Z N   1  
ATOM 7866   C CA  . LEU C 3 72  ? -119.262 -27.073 25.051  1.00 30.00  ? 75  LEU Z CA  1  
ATOM 7867   C C   . LEU C 3 72  ? -118.602 -27.737 26.255  1.00 30.00  ? 75  LEU Z C   1  
ATOM 7868   O O   . LEU C 3 72  ? -118.544 -27.150 27.335  1.00 30.00  ? 75  LEU Z O   1  
ATOM 7869   C CB  . LEU C 3 72  ? -120.554 -26.450 25.573  1.00 99.99  ? 75  LEU Z CB  1  
ATOM 7870   C CG  . LEU C 3 72  ? -120.255 -25.639 26.830  1.00 99.99  ? 75  LEU Z CG  1  
ATOM 7871   C CD1 . LEU C 3 72  ? -121.557 -25.075 27.393  1.00 99.99  ? 75  LEU Z CD1 1  
ATOM 7872   C CD2 . LEU C 3 72  ? -119.594 -26.535 27.869  1.00 99.99  ? 75  LEU Z CD2 1  
ATOM 7873   N N   . MET C 3 73  ? -118.117 -28.958 26.074  1.00 30.00  ? 76  MET Z N   1  
ATOM 7874   C CA  . MET C 3 73  ? -117.457 -29.677 27.149  1.00 30.00  ? 76  MET Z CA  1  
ATOM 7875   C C   . MET C 3 73  ? -115.957 -29.565 26.929  1.00 30.00  ? 76  MET Z C   1  
ATOM 7876   O O   . MET C 3 73  ? -115.201 -29.217 27.838  1.00 30.00  ? 76  MET Z O   1  
ATOM 7877   C CB  . MET C 3 73  ? -117.884 -31.141 27.130  1.00 99.99  ? 76  MET Z CB  1  
ATOM 7878   C CG  . MET C 3 73  ? -117.243 -31.872 28.306  1.00 99.99  ? 76  MET Z CG  1  
ATOM 7879   S SD  . MET C 3 73  ? -117.984 -33.514 28.491  1.00 99.99  ? 76  MET Z SD  1  
ATOM 7880   C CE  . MET C 3 73  ? -117.007 -34.145 29.838  1.00 99.99  ? 76  MET Z CE  1  
ATOM 7881   N N   . ASP C 3 74  ? -115.542 -29.848 25.702  1.00 30.00  ? 77  ASP Z N   1  
ATOM 7882   C CA  . ASP C 3 74  ? -114.142 -29.790 25.325  1.00 30.00  ? 77  ASP Z CA  1  
ATOM 7883   C C   . ASP C 3 74  ? -113.572 -28.368 25.330  1.00 30.00  ? 77  ASP Z C   1  
ATOM 7884   O O   . ASP C 3 74  ? -112.381 -28.184 25.067  1.00 30.00  ? 77  ASP Z O   1  
ATOM 7885   C CB  . ASP C 3 74  ? -113.959 -30.347 23.917  1.00 99.99  ? 77  ASP Z CB  1  
ATOM 7886   C CG  . ASP C 3 74  ? -114.241 -31.849 23.923  1.00 99.99  ? 77  ASP Z CG  1  
ATOM 7887   O OD1 . ASP C 3 74  ? -113.387 -32.591 24.473  1.00 99.99  ? 77  ASP Z OD1 1  
ATOM 7888   O OD2 . ASP C 3 74  ? -115.310 -32.235 23.376  1.00 99.99  ? 77  ASP Z OD2 1  
ATOM 7889   N N   . CYS C 3 75  ? -114.402 -27.364 25.632  1.00 30.00  ? 78  CYS Z N   1  
ATOM 7890   C CA  . CYS C 3 75  ? -113.939 -25.976 25.653  1.00 30.00  ? 78  CYS Z CA  1  
ATOM 7891   C C   . CYS C 3 75  ? -113.361 -25.544 27.010  1.00 30.00  ? 78  CYS Z C   1  
ATOM 7892   O O   . CYS C 3 75  ? -113.873 -25.889 28.076  1.00 30.00  ? 78  CYS Z O   1  
ATOM 7893   C CB  . CYS C 3 75  ? -115.098 -25.038 25.338  1.00 99.99  ? 78  CYS Z CB  1  
ATOM 7894   S SG  . CYS C 3 75  ? -116.433 -24.983 26.558  1.00 99.99  ? 78  CYS Z SG  1  
ATOM 7895   N N   . GLU C 3 76  ? -112.273 -24.782 26.937  1.00 30.00  ? 79  GLU Z N   1  
ATOM 7896   C CA  . GLU C 3 76  ? -111.545 -24.283 28.099  1.00 30.00  ? 79  GLU Z CA  1  
ATOM 7897   C C   . GLU C 3 76  ? -112.309 -23.560 29.193  1.00 30.00  ? 79  GLU Z C   1  
ATOM 7898   O O   . GLU C 3 76  ? -113.130 -22.684 28.914  1.00 30.00  ? 79  GLU Z O   1  
ATOM 7899   C CB  . GLU C 3 76  ? -110.486 -23.281 27.652  1.00 99.99  ? 79  GLU Z CB  1  
ATOM 7900   C CG  . GLU C 3 76  ? -111.142 -22.162 26.883  1.00 99.99  ? 79  GLU Z CG  1  
ATOM 7901   C CD  . GLU C 3 76  ? -111.452 -22.633 25.463  1.00 99.99  ? 79  GLU Z CD  1  
ATOM 7902   O OE1 . GLU C 3 76  ? -112.573 -23.170 25.266  1.00 99.99  ? 79  GLU Z OE1 1  
ATOM 7903   O OE2 . GLU C 3 76  ? -110.560 -22.454 24.589  1.00 99.99  ? 79  GLU Z OE2 1  
ATOM 7904   N N   . GLN C 3 77  ? -112.005 -23.937 30.443  1.00 30.00  ? 80  GLN Z N   1  
ATOM 7905   C CA  . GLN C 3 77  ? -112.612 -23.335 31.639  1.00 30.00  ? 80  GLN Z CA  1  
ATOM 7906   C C   . GLN C 3 77  ? -111.495 -22.577 32.384  1.00 30.00  ? 80  GLN Z C   1  
ATOM 7907   O O   . GLN C 3 77  ? -110.348 -23.027 32.441  1.00 30.00  ? 80  GLN Z O   1  
ATOM 7908   C CB  . GLN C 3 77  ? -113.200 -24.426 32.527  1.00 99.99  ? 80  GLN Z CB  1  
ATOM 7909   C CG  . GLN C 3 77  ? -114.298 -23.833 33.401  1.00 99.99  ? 80  GLN Z CG  1  
ATOM 7910   C CD  . GLN C 3 77  ? -113.719 -23.209 34.663  1.00 99.99  ? 80  GLN Z CD  1  
ATOM 7911   O OE1 . GLN C 3 77  ? -112.507 -23.230 34.868  1.00 99.99  ? 80  GLN Z OE1 1  
ATOM 7912   N NE2 . GLN C 3 77  ? -114.590 -22.653 35.510  1.00 99.99  ? 80  GLN Z NE2 1  
ATOM 7913   N N   . GLY C 3 78  ? -111.814 -21.428 32.958  1.00 30.00  ? 81  GLY Z N   1  
ATOM 7914   C CA  . GLY C 3 78  ? -110.786 -20.671 33.651  1.00 30.00  ? 81  GLY Z CA  1  
ATOM 7915   C C   . GLY C 3 78  ? -110.426 -21.097 35.057  1.00 30.00  ? 81  GLY Z C   1  
ATOM 7916   O O   . GLY C 3 78  ? -111.291 -21.164 35.923  1.00 30.00  ? 81  GLY Z O   1  
ATOM 7917   N N   . THR C 3 79  ? -109.148 -21.381 35.298  1.00 30.00  ? 82  THR Z N   1  
ATOM 7918   C CA  . THR C 3 79  ? -108.698 -21.787 36.626  1.00 30.00  ? 82  THR Z CA  1  
ATOM 7919   C C   . THR C 3 79  ? -108.586 -20.583 37.558  1.00 30.00  ? 82  THR Z C   1  
ATOM 7920   O O   . THR C 3 79  ? -108.831 -19.455 37.150  1.00 30.00  ? 82  THR Z O   1  
ATOM 7921   C CB  . THR C 3 79  ? -107.328 -22.451 36.531  1.00 99.99  ? 82  THR Z CB  1  
ATOM 7922   O OG1 . THR C 3 79  ? -106.351 -21.478 36.151  1.00 99.99  ? 82  THR Z OG1 1  
ATOM 7923   C CG2 . THR C 3 79  ? -107.375 -23.560 35.483  1.00 99.99  ? 82  THR Z CG2 1  
ATOM 7924   N N   . PHE C 3 80  ? -108.223 -20.822 38.817  1.00 30.00  ? 83  PHE Z N   1  
ATOM 7925   C CA  . PHE C 3 80  ? -108.080 -19.741 39.799  1.00 30.00  ? 83  PHE Z CA  1  
ATOM 7926   C C   . PHE C 3 80  ? -106.831 -18.930 39.433  1.00 30.00  ? 83  PHE Z C   1  
ATOM 7927   O O   . PHE C 3 80  ? -106.786 -17.708 39.591  1.00 30.00  ? 83  PHE Z O   1  
ATOM 7928   C CB  . PHE C 3 80  ? -107.929 -20.329 41.199  1.00 99.99  ? 83  PHE Z CB  1  
ATOM 7929   C CG  . PHE C 3 80  ? -107.784 -19.211 42.202  1.00 99.99  ? 83  PHE Z CG  1  
ATOM 7930   C CD1 . PHE C 3 80  ? -108.920 -18.565 42.699  1.00 99.99  ? 83  PHE Z CD1 1  
ATOM 7931   C CD2 . PHE C 3 80  ? -106.511 -18.821 42.635  1.00 99.99  ? 83  PHE Z CD2 1  
ATOM 7932   C CE1 . PHE C 3 80  ? -108.786 -17.526 43.630  1.00 99.99  ? 83  PHE Z CE1 1  
ATOM 7933   C CE2 . PHE C 3 80  ? -106.375 -17.783 43.565  1.00 99.99  ? 83  PHE Z CE2 1  
ATOM 7934   C CZ  . PHE C 3 80  ? -107.514 -17.136 44.064  1.00 99.99  ? 83  PHE Z CZ  1  
ATOM 7935   N N   . ALA C 3 81  ? -105.822 -19.651 38.952  1.00 30.00  ? 84  ALA Z N   1  
ATOM 7936   C CA  . ALA C 3 81  ? -104.555 -19.056 38.536  1.00 30.00  ? 84  ALA Z CA  1  
ATOM 7937   C C   . ALA C 3 81  ? -104.852 -17.949 37.534  1.00 30.00  ? 84  ALA Z C   1  
ATOM 7938   O O   . ALA C 3 81  ? -104.487 -16.788 37.749  1.00 30.00  ? 84  ALA Z O   1  
ATOM 7939   C CB  . ALA C 3 81  ? -103.662 -20.117 37.889  1.00 30.00  ? 84  ALA Z CB  1  
ATOM 7940   N N   . ASP C 3 82  ? -105.520 -18.335 36.449  1.00 30.00  ? 85  ASP Z N   1  
ATOM 7941   C CA  . ASP C 3 82  ? -105.881 -17.421 35.391  1.00 30.00  ? 85  ASP Z CA  1  
ATOM 7942   C C   . ASP C 3 82  ? -106.656 -16.208 35.891  1.00 30.00  ? 85  ASP Z C   1  
ATOM 7943   O O   . ASP C 3 82  ? -106.321 -15.081 35.549  1.00 30.00  ? 85  ASP Z O   1  
ATOM 7944   C CB  . ASP C 3 82  ? -106.754 -18.133 34.365  1.00 99.99  ? 85  ASP Z CB  1  
ATOM 7945   C CG  . ASP C 3 82  ? -105.925 -19.184 33.629  1.00 99.99  ? 85  ASP Z CG  1  
ATOM 7946   O OD1 . ASP C 3 82  ? -105.066 -18.766 32.807  1.00 99.99  ? 85  ASP Z OD1 1  
ATOM 7947   O OD2 . ASP C 3 82  ? -106.157 -20.393 33.896  1.00 99.99  ? 85  ASP Z OD2 1  
ATOM 7948   N N   . TYR C 3 83  ? -107.690 -16.409 36.701  1.00 30.00  ? 86  TYR Z N   1  
ATOM 7949   C CA  . TYR C 3 83  ? -108.436 -15.244 37.160  1.00 30.00  ? 86  TYR Z CA  1  
ATOM 7950   C C   . TYR C 3 83  ? -107.599 -14.369 38.057  1.00 30.00  ? 86  TYR Z C   1  
ATOM 7951   O O   . TYR C 3 83  ? -107.807 -13.164 38.105  1.00 30.00  ? 86  TYR Z O   1  
ATOM 7952   C CB  . TYR C 3 83  ? -109.665 -15.692 37.940  1.00 99.99  ? 86  TYR Z CB  1  
ATOM 7953   C CG  . TYR C 3 83  ? -110.593 -16.453 37.027  1.00 99.99  ? 86  TYR Z CG  1  
ATOM 7954   C CD1 . TYR C 3 83  ? -110.447 -17.836 36.875  1.00 99.99  ? 86  TYR Z CD1 1  
ATOM 7955   C CD2 . TYR C 3 83  ? -111.603 -15.776 36.329  1.00 99.99  ? 86  TYR Z CD2 1  
ATOM 7956   C CE1 . TYR C 3 83  ? -111.309 -18.547 36.028  1.00 99.99  ? 86  TYR Z CE1 1  
ATOM 7957   C CE2 . TYR C 3 83  ? -112.465 -16.483 35.482  1.00 99.99  ? 86  TYR Z CE2 1  
ATOM 7958   C CZ  . TYR C 3 83  ? -112.317 -17.866 35.331  1.00 99.99  ? 86  TYR Z CZ  1  
ATOM 7959   O OH  . TYR C 3 83  ? -113.154 -18.553 34.506  1.00 99.99  ? 86  TYR Z OH  1  
ATOM 7960   N N   . MET C 3 84  ? -106.655 -14.971 38.771  1.00 30.00  ? 87  MET Z N   1  
ATOM 7961   C CA  . MET C 3 84  ? -105.783 -14.220 39.674  1.00 30.00  ? 87  MET Z CA  1  
ATOM 7962   C C   . MET C 3 84  ? -104.763 -13.410 38.850  1.00 30.00  ? 87  MET Z C   1  
ATOM 7963   O O   . MET C 3 84  ? -104.501 -12.231 39.131  1.00 30.00  ? 87  MET Z O   1  
ATOM 7964   C CB  . MET C 3 84  ? -105.040 -15.183 40.593  1.00 99.99  ? 87  MET Z CB  1  
ATOM 7965   C CG  . MET C 3 84  ? -106.030 -16.151 41.228  1.00 99.99  ? 87  MET Z CG  1  
ATOM 7966   S SD  . MET C 3 84  ? -106.868 -15.356 42.620  1.00 99.99  ? 87  MET Z SD  1  
ATOM 7967   C CE  . MET C 3 84  ? -105.571 -15.421 43.840  1.00 99.99  ? 87  MET Z CE  1  
ATOM 7968   N N   . GLU C 3 85  ? -104.205 -14.062 37.835  1.00 30.00  ? 88  GLU Z N   1  
ATOM 7969   C CA  . GLU C 3 85  ? -103.227 -13.453 36.939  1.00 30.00  ? 88  GLU Z CA  1  
ATOM 7970   C C   . GLU C 3 85  ? -103.771 -12.155 36.340  1.00 30.00  ? 88  GLU Z C   1  
ATOM 7971   O O   . GLU C 3 85  ? -103.272 -11.054 36.613  1.00 30.00  ? 88  GLU Z O   1  
ATOM 7972   C CB  . GLU C 3 85  ? -102.897 -14.412 35.800  1.00 99.99  ? 88  GLU Z CB  1  
ATOM 7973   C CG  . GLU C 3 85  ? -102.214 -15.638 36.359  1.00 99.99  ? 88  GLU Z CG  1  
ATOM 7974   C CD  . GLU C 3 85  ? -100.800 -15.279 36.799  1.00 99.99  ? 88  GLU Z CD  1  
ATOM 7975   O OE1 . GLU C 3 85  ? -100.647 -14.889 37.989  1.00 99.99  ? 88  GLU Z OE1 1  
ATOM 7976   O OE2 . GLU C 3 85  ? -99.880  -15.394 35.942  1.00 99.99  ? 88  GLU Z OE2 1  
ATOM 7977   N N   . ALA C 3 86  ? -104.808 -12.306 35.525  1.00 30.00  ? 89  ALA Z N   1  
ATOM 7978   C CA  . ALA C 3 86  ? -105.464 -11.194 34.864  1.00 30.00  ? 89  ALA Z CA  1  
ATOM 7979   C C   . ALA C 3 86  ? -105.827 -10.049 35.793  1.00 30.00  ? 89  ALA Z C   1  
ATOM 7980   O O   . ALA C 3 86  ? -105.642 -8.881  35.449  1.00 30.00  ? 89  ALA Z O   1  
ATOM 7981   C CB  . ALA C 3 86  ? -106.708 -11.683 34.168  1.00 30.00  ? 89  ALA Z CB  1  
ATOM 7982   N N   . PHE C 3 87  ? -106.341 -10.365 36.963  1.00 30.00  ? 90  PHE Z N   1  
ATOM 7983   C CA  . PHE C 3 87  ? -106.727 -9.329  37.899  1.00 30.00  ? 90  PHE Z CA  1  
ATOM 7984   C C   . PHE C 3 87  ? -105.529 -8.596  38.459  1.00 30.00  ? 90  PHE Z C   1  
ATOM 7985   O O   . PHE C 3 87  ? -105.634 -7.450  38.891  1.00 30.00  ? 90  PHE Z O   1  
ATOM 7986   C CB  . PHE C 3 87  ? -107.494 -9.943  39.064  1.00 99.99  ? 90  PHE Z CB  1  
ATOM 7987   C CG  . PHE C 3 87  ? -107.896 -8.856  40.032  1.00 99.99  ? 90  PHE Z CG  1  
ATOM 7988   C CD1 . PHE C 3 87  ? -109.049 -8.098  39.796  1.00 99.99  ? 90  PHE Z CD1 1  
ATOM 7989   C CD2 . PHE C 3 87  ? -107.114 -8.603  41.167  1.00 99.99  ? 90  PHE Z CD2 1  
ATOM 7990   C CE1 . PHE C 3 87  ? -109.422 -7.092  40.693  1.00 99.99  ? 90  PHE Z CE1 1  
ATOM 7991   C CE2 . PHE C 3 87  ? -107.485 -7.595  42.062  1.00 99.99  ? 90  PHE Z CE2 1  
ATOM 7992   C CZ  . PHE C 3 87  ? -108.639 -6.840  41.826  1.00 99.99  ? 90  PHE Z CZ  1  
ATOM 7993   N N   . LYS C 3 88  ? -104.376 -9.250  38.461  1.00 30.00  ? 91  LYS Z N   1  
ATOM 7994   C CA  . LYS C 3 88  ? -103.185 -8.606  38.987  1.00 30.00  ? 91  LYS Z CA  1  
ATOM 7995   C C   . LYS C 3 88  ? -102.771 -7.411  38.117  1.00 30.00  ? 91  LYS Z C   1  
ATOM 7996   O O   . LYS C 3 88  ? -102.333 -6.373  38.637  1.00 30.00  ? 91  LYS Z O   1  
ATOM 7997   C CB  . LYS C 3 88  ? -102.031 -9.601  39.030  1.00 99.99  ? 91  LYS Z CB  1  
ATOM 7998   C CG  . LYS C 3 88  ? -100.815 -8.945  39.675  1.00 99.99  ? 91  LYS Z CG  1  
ATOM 7999   C CD  . LYS C 3 88  ? -99.832  -10.023 40.119  1.00 99.99  ? 91  LYS Z CD  1  
ATOM 8000   C CE  . LYS C 3 88  ? -98.480  -9.385  40.420  1.00 99.99  ? 91  LYS Z CE  1  
ATOM 8001   N NZ  . LYS C 3 88  ? -98.392  -9.071  41.854  1.00 99.99  ? 91  LYS Z NZ  1  
ATOM 8002   N N   . THR C 3 89  ? -102.931 -7.565  36.799  1.00 30.00  ? 92  THR Z N   1  
ATOM 8003   C CA  . THR C 3 89  ? -102.576 -6.521  35.841  1.00 30.00  ? 92  THR Z CA  1  
ATOM 8004   C C   . THR C 3 89  ? -103.335 -5.194  36.003  1.00 30.00  ? 92  THR Z C   1  
ATOM 8005   O O   . THR C 3 89  ? -103.117 -4.253  35.234  1.00 30.00  ? 92  THR Z O   1  
ATOM 8006   C CB  . THR C 3 89  ? -102.856 -7.004  34.423  1.00 99.99  ? 92  THR Z CB  1  
ATOM 8007   O OG1 . THR C 3 89  ? -104.268 -7.133  34.234  1.00 99.99  ? 92  THR Z OG1 1  
ATOM 8008   C CG2 . THR C 3 89  ? -102.188 -8.355  34.201  1.00 99.99  ? 92  THR Z CG2 1  
ATOM 8009   N N   . PHE C 3 90  ? -104.210 -5.103  36.992  1.00 30.00  ? 93  PHE Z N   1  
ATOM 8010   C CA  . PHE C 3 90  ? -104.964 -3.864  37.220  1.00 30.00  ? 93  PHE Z CA  1  
ATOM 8011   C C   . PHE C 3 90  ? -104.593 -3.307  38.593  1.00 30.00  ? 93  PHE Z C   1  
ATOM 8012   O O   . PHE C 3 90  ? -105.054 -2.227  38.993  1.00 30.00  ? 93  PHE Z O   1  
ATOM 8013   C CB  . PHE C 3 90  ? -106.460 -4.149  37.169  1.00 99.99  ? 93  PHE Z CB  1  
ATOM 8014   C CG  . PHE C 3 90  ? -107.226 -2.870  37.402  1.00 99.99  ? 93  PHE Z CG  1  
ATOM 8015   C CD1 . PHE C 3 90  ? -107.455 -1.989  36.339  1.00 99.99  ? 93  PHE Z CD1 1  
ATOM 8016   C CD2 . PHE C 3 90  ? -107.708 -2.568  38.681  1.00 99.99  ? 93  PHE Z CD2 1  
ATOM 8017   C CE1 . PHE C 3 90  ? -108.168 -0.802  36.556  1.00 99.99  ? 93  PHE Z CE1 1  
ATOM 8018   C CE2 . PHE C 3 90  ? -108.419 -1.380  38.896  1.00 99.99  ? 93  PHE Z CE2 1  
ATOM 8019   C CZ  . PHE C 3 90  ? -108.649 -0.498  37.835  1.00 99.99  ? 93  PHE Z CZ  1  
ATOM 8020   N N   . ASP C 3 91  ? -103.749 -4.056  39.307  1.00 30.00  ? 94  ASP Z N   1  
ATOM 8021   C CA  . ASP C 3 91  ? -103.291 -3.671  40.639  1.00 30.00  ? 94  ASP Z CA  1  
ATOM 8022   C C   . ASP C 3 91  ? -101.912 -3.007  40.612  1.00 30.00  ? 94  ASP Z C   1  
ATOM 8023   O O   . ASP C 3 91  ? -100.897 -3.691  40.485  1.00 30.00  ? 94  ASP Z O   1  
ATOM 8024   C CB  . ASP C 3 91  ? -103.199 -4.904  41.531  1.00 99.99  ? 94  ASP Z CB  1  
ATOM 8025   C CG  . ASP C 3 91  ? -104.601 -5.444  41.804  1.00 99.99  ? 94  ASP Z CG  1  
ATOM 8026   O OD1 . ASP C 3 91  ? -105.334 -4.773  42.575  1.00 99.99  ? 94  ASP Z OD1 1  
ATOM 8027   O OD2 . ASP C 3 91  ? -104.926 -6.520  41.235  1.00 99.99  ? 94  ASP Z OD2 1  
ATOM 8028   N N   . ARG C 3 92  ? -101.885 -1.680  40.734  1.00 30.00  ? 95  ARG Z N   1  
ATOM 8029   C CA  . ARG C 3 92  ? -100.629 -0.936  40.731  1.00 30.00  ? 95  ARG Z CA  1  
ATOM 8030   C C   . ARG C 3 92  ? -99.955  -1.135  42.083  1.00 30.00  ? 95  ARG Z C   1  
ATOM 8031   O O   . ARG C 3 92  ? -98.731  -1.249  42.163  1.00 30.00  ? 95  ARG Z O   1  
ATOM 8032   C CB  . ARG C 3 92  ? -100.904 0.545   40.503  1.00 99.99  ? 95  ARG Z CB  1  
ATOM 8033   C CG  . ARG C 3 92  ? -99.583  1.296   40.378  1.00 99.99  ? 95  ARG Z CG  1  
ATOM 8034   C CD  . ARG C 3 92  ? -99.857  2.794   40.275  1.00 99.99  ? 95  ARG Z CD  1  
ATOM 8035   N NE  . ARG C 3 92  ? -100.331 3.337   41.565  1.00 99.99  ? 95  ARG Z NE  1  
ATOM 8036   C CZ  . ARG C 3 92  ? -100.566 4.631   41.764  1.00 99.99  ? 95  ARG Z CZ  1  
ATOM 8037   N NH1 . ARG C 3 92  ? -100.388 5.536   40.805  1.00 99.99  ? 95  ARG Z NH1 1  
ATOM 8038   N NH2 . ARG C 3 92  ? -100.990 5.014   42.966  1.00 99.99  ? 95  ARG Z NH2 1  
ATOM 8039   N N   . GLU C 3 93  ? -100.763 -1.179  43.139  1.00 30.00  ? 96  GLU Z N   1  
ATOM 8040   C CA  . GLU C 3 93  ? -100.258 -1.374  44.497  1.00 30.00  ? 96  GLU Z CA  1  
ATOM 8041   C C   . GLU C 3 93  ? -99.631  -2.760  44.686  1.00 30.00  ? 96  GLU Z C   1  
ATOM 8042   O O   . GLU C 3 93  ? -98.613  -2.904  45.370  1.00 30.00  ? 96  GLU Z O   1  
ATOM 8043   C CB  . GLU C 3 93  ? -101.396 -1.235  45.500  1.00 99.99  ? 96  GLU Z CB  1  
ATOM 8044   C CG  . GLU C 3 93  ? -102.488 -2.222  45.166  1.00 99.99  ? 96  GLU Z CG  1  
ATOM 8045   C CD  . GLU C 3 93  ? -103.309 -1.694  43.990  1.00 99.99  ? 96  GLU Z CD  1  
ATOM 8046   O OE1 . GLU C 3 93  ? -102.931 -2.011  42.835  1.00 99.99  ? 96  GLU Z OE1 1  
ATOM 8047   O OE2 . GLU C 3 93  ? -104.309 -0.973  44.265  1.00 99.99  ? 96  GLU Z OE2 1  
ATOM 8048   N N   . GLY C 3 94  ? -100.251 -3.771  44.079  1.00 30.00  ? 97  GLY Z N   1  
ATOM 8049   C CA  . GLY C 3 94  ? -99.773  -5.142  44.172  1.00 30.00  ? 97  GLY Z CA  1  
ATOM 8050   C C   . GLY C 3 94  ? -100.305 -5.895  45.385  1.00 30.00  ? 97  GLY Z C   1  
ATOM 8051   O O   . GLY C 3 94  ? -100.026 -7.078  45.574  1.00 30.00  ? 97  GLY Z O   1  
ATOM 8052   N N   . GLN C 3 95  ? -101.090 -5.206  46.208  1.00 30.00  ? 98  GLN Z N   1  
ATOM 8053   C CA  . GLN C 3 95  ? -101.640 -5.805  47.414  1.00 30.00  ? 98  GLN Z CA  1  
ATOM 8054   C C   . GLN C 3 95  ? -103.052 -6.386  47.350  1.00 30.00  ? 98  GLN Z C   1  
ATOM 8055   O O   . GLN C 3 95  ? -103.825 -6.244  48.303  1.00 30.00  ? 98  GLN Z O   1  
ATOM 8056   C CB  . GLN C 3 95  ? -101.696 -4.769  48.530  1.00 99.99  ? 98  GLN Z CB  1  
ATOM 8057   C CG  . GLN C 3 95  ? -103.087 -4.765  49.153  1.00 99.99  ? 98  GLN Z CG  1  
ATOM 8058   C CD  . GLN C 3 95  ? -104.113 -4.168  48.203  1.00 99.99  ? 98  GLN Z CD  1  
ATOM 8059   O OE1 . GLN C 3 95  ? -103.773 -3.765  47.093  1.00 99.99  ? 98  GLN Z OE1 1  
ATOM 8060   N NE2 . GLN C 3 95  ? -105.373 -4.112  48.640  1.00 99.99  ? 98  GLN Z NE2 1  
ATOM 8061   N N   . GLY C 3 96  ? -103.378 -7.037  46.236  1.00 30.00  ? 99  GLY Z N   1  
ATOM 8062   C CA  . GLY C 3 96  ? -104.692 -7.642  46.075  1.00 30.00  ? 99  GLY Z CA  1  
ATOM 8063   C C   . GLY C 3 96  ? -105.919 -6.742  46.155  1.00 30.00  ? 99  GLY Z C   1  
ATOM 8064   O O   . GLY C 3 96  ? -106.985 -7.185  46.568  1.00 30.00  ? 99  GLY Z O   1  
ATOM 8065   N N   . PHE C 3 97  ? -105.783 -5.484  45.763  1.00 30.00  ? 100 PHE Z N   1  
ATOM 8066   C CA  . PHE C 3 97  ? -106.918 -4.577  45.805  1.00 30.00  ? 100 PHE Z CA  1  
ATOM 8067   C C   . PHE C 3 97  ? -107.346 -4.093  44.444  1.00 30.00  ? 100 PHE Z C   1  
ATOM 8068   O O   . PHE C 3 97  ? -106.777 -4.451  43.419  1.00 30.00  ? 100 PHE Z O   1  
ATOM 8069   C CB  . PHE C 3 97  ? -106.567 -3.347  46.634  1.00 99.99  ? 100 PHE Z CB  1  
ATOM 8070   C CG  . PHE C 3 97  ? -106.464 -2.143  45.730  1.00 99.99  ? 100 PHE Z CG  1  
ATOM 8071   C CD1 . PHE C 3 97  ? -106.124 -2.304  44.381  1.00 99.99  ? 100 PHE Z CD1 1  
ATOM 8072   C CD2 . PHE C 3 97  ? -106.705 -0.860  46.240  1.00 99.99  ? 100 PHE Z CD2 1  
ATOM 8073   C CE1 . PHE C 3 97  ? -106.029 -1.186  43.544  1.00 99.99  ? 100 PHE Z CE1 1  
ATOM 8074   C CE2 . PHE C 3 97  ? -106.607 0.256   45.403  1.00 99.99  ? 100 PHE Z CE2 1  
ATOM 8075   C CZ  . PHE C 3 97  ? -106.270 0.093   44.054  1.00 99.99  ? 100 PHE Z CZ  1  
ATOM 8076   N N   . ILE C 3 98  ? -108.369 -3.259  44.453  1.00 30.00  ? 101 ILE Z N   1  
ATOM 8077   C CA  . ILE C 3 98  ? -108.921 -2.696  43.238  1.00 30.00  ? 101 ILE Z CA  1  
ATOM 8078   C C   . ILE C 3 98  ? -110.038 -1.852  43.802  1.00 30.00  ? 101 ILE Z C   1  
ATOM 8079   O O   . ILE C 3 98  ? -110.381 -1.992  44.974  1.00 30.00  ? 101 ILE Z O   1  
ATOM 8080   C CB  . ILE C 3 98  ? -109.404 -3.813  42.321  1.00 99.99  ? 101 ILE Z CB  1  
ATOM 8081   C CG1 . ILE C 3 98  ? -109.839 -3.224  40.983  1.00 99.99  ? 101 ILE Z CG1 1  
ATOM 8082   C CG2 . ILE C 3 98  ? -110.585 -4.528  42.970  1.00 99.99  ? 101 ILE Z CG2 1  
ATOM 8083   C CD1 . ILE C 3 98  ? -109.890 -4.329  39.933  1.00 99.99  ? 101 ILE Z CD1 1  
ATOM 8084   N N   . SER C 3 99  ? -110.586 -0.960  43.003  1.00 30.00  ? 102 SER Z N   1  
ATOM 8085   C CA  . SER C 3 99  ? -111.662 -0.132  43.502  1.00 30.00  ? 102 SER Z CA  1  
ATOM 8086   C C   . SER C 3 99  ? -112.935 -0.716  42.924  1.00 30.00  ? 102 SER Z C   1  
ATOM 8087   O O   . SER C 3 99  ? -112.896 -1.509  41.968  1.00 30.00  ? 102 SER Z O   1  
ATOM 8088   C CB  . SER C 3 99  ? -111.460 1.310   43.048  1.00 99.99  ? 102 SER Z CB  1  
ATOM 8089   O OG  . SER C 3 99  ? -111.636 1.392   41.631  1.00 99.99  ? 102 SER Z OG  1  
ATOM 8090   N N   . GLY C 3 100 ? -114.065 -0.330  43.507  1.00 30.00  ? 103 GLY Z N   1  
ATOM 8091   C CA  . GLY C 3 100 ? -115.326 -0.830  43.009  1.00 30.00  ? 103 GLY Z CA  1  
ATOM 8092   C C   . GLY C 3 100 ? -115.405 -0.375  41.573  1.00 30.00  ? 103 GLY Z C   1  
ATOM 8093   O O   . GLY C 3 100 ? -115.433 -1.195  40.647  1.00 30.00  ? 103 GLY Z O   1  
ATOM 8094   N N   . ALA C 3 101 ? -115.417 0.950   41.413  1.00 30.00  ? 104 ALA Z N   1  
ATOM 8095   C CA  . ALA C 3 101 ? -115.494 1.609   40.107  1.00 30.00  ? 104 ALA Z CA  1  
ATOM 8096   C C   . ALA C 3 101 ? -114.703 0.936   38.988  1.00 30.00  ? 104 ALA Z C   1  
ATOM 8097   O O   . ALA C 3 101 ? -115.222 0.760   37.875  1.00 30.00  ? 104 ALA Z O   1  
ATOM 8098   C CB  . ALA C 3 101 ? -115.041 3.050   40.256  1.00 30.00  ? 104 ALA Z CB  1  
ATOM 8099   N N   . GLU C 3 102 ? -113.455 0.569   39.269  1.00 30.00  ? 105 GLU Z N   1  
ATOM 8100   C CA  . GLU C 3 102 ? -112.627 -0.076  38.256  1.00 30.00  ? 105 GLU Z CA  1  
ATOM 8101   C C   . GLU C 3 102 ? -113.109 -1.496  37.983  1.00 30.00  ? 105 GLU Z C   1  
ATOM 8102   O O   . GLU C 3 102 ? -113.263 -1.891  36.823  1.00 30.00  ? 105 GLU Z O   1  
ATOM 8103   C CB  . GLU C 3 102 ? -111.179 -0.140  38.734  1.00 99.99  ? 105 GLU Z CB  1  
ATOM 8104   C CG  . GLU C 3 102 ? -110.631 1.260   38.864  1.00 99.99  ? 105 GLU Z CG  1  
ATOM 8105   C CD  . GLU C 3 102 ? -110.409 1.851   37.474  1.00 99.99  ? 105 GLU Z CD  1  
ATOM 8106   O OE1 . GLU C 3 102 ? -111.367 2.483   36.957  1.00 99.99  ? 105 GLU Z OE1 1  
ATOM 8107   O OE2 . GLU C 3 102 ? -109.282 1.666   36.943  1.00 99.99  ? 105 GLU Z OE2 1  
ATOM 8108   N N   . LEU C 3 103 ? -113.345 -2.256  39.046  1.00 30.00  ? 106 LEU Z N   1  
ATOM 8109   C CA  . LEU C 3 103 ? -113.816 -3.626  38.904  1.00 30.00  ? 106 LEU Z CA  1  
ATOM 8110   C C   . LEU C 3 103 ? -115.032 -3.607  37.983  1.00 30.00  ? 106 LEU Z C   1  
ATOM 8111   O O   . LEU C 3 103 ? -115.157 -4.420  37.060  1.00 30.00  ? 106 LEU Z O   1  
ATOM 8112   C CB  . LEU C 3 103 ? -114.198 -4.187  40.268  1.00 99.99  ? 106 LEU Z CB  1  
ATOM 8113   C CG  . LEU C 3 103 ? -113.017 -4.955  40.852  1.00 99.99  ? 106 LEU Z CG  1  
ATOM 8114   C CD1 . LEU C 3 103 ? -113.491 -5.784  42.044  1.00 99.99  ? 106 LEU Z CD1 1  
ATOM 8115   C CD2 . LEU C 3 103 ? -112.434 -5.879  39.790  1.00 99.99  ? 106 LEU Z CD2 1  
ATOM 8116   N N   . ARG C 3 104 ? -115.922 -2.659  38.255  1.00 30.00  ? 107 ARG Z N   1  
ATOM 8117   C CA  . ARG C 3 104 ? -117.131 -2.481  37.475  1.00 30.00  ? 107 ARG Z CA  1  
ATOM 8118   C C   . ARG C 3 104 ? -116.729 -2.326  35.997  1.00 30.00  ? 107 ARG Z C   1  
ATOM 8119   O O   . ARG C 3 104 ? -117.275 -2.985  35.108  1.00 30.00  ? 107 ARG Z O   1  
ATOM 8120   C CB  . ARG C 3 104 ? -117.874 -1.235  37.945  1.00 99.99  ? 107 ARG Z CB  1  
ATOM 8121   C CG  . ARG C 3 104 ? -119.167 -1.084  37.154  1.00 99.99  ? 107 ARG Z CG  1  
ATOM 8122   C CD  . ARG C 3 104 ? -119.886 0.188   37.590  1.00 99.99  ? 107 ARG Z CD  1  
ATOM 8123   N NE  . ARG C 3 104 ? -118.959 1.341   37.602  1.00 99.99  ? 107 ARG Z NE  1  
ATOM 8124   C CZ  . ARG C 3 104 ? -118.616 2.008   36.503  1.00 99.99  ? 107 ARG Z CZ  1  
ATOM 8125   N NH1 . ARG C 3 104 ? -119.084 1.677   35.304  1.00 99.99  ? 107 ARG Z NH1 1  
ATOM 8126   N NH2 . ARG C 3 104 ? -117.775 3.032   36.630  1.00 99.99  ? 107 ARG Z NH2 1  
ATOM 8127   N N   . HIS C 3 105 ? -115.756 -1.451  35.751  1.00 30.00  ? 108 HIS Z N   1  
ATOM 8128   C CA  . HIS C 3 105 ? -115.246 -1.190  34.406  1.00 30.00  ? 108 HIS Z CA  1  
ATOM 8129   C C   . HIS C 3 105 ? -114.749 -2.462  33.697  1.00 30.00  ? 108 HIS Z C   1  
ATOM 8130   O O   . HIS C 3 105 ? -115.016 -2.677  32.512  1.00 30.00  ? 108 HIS Z O   1  
ATOM 8131   C CB  . HIS C 3 105 ? -114.077 -0.212  34.476  1.00 99.99  ? 108 HIS Z CB  1  
ATOM 8132   C CG  . HIS C 3 105 ? -113.311 -0.044  33.187  1.00 99.99  ? 108 HIS Z CG  1  
ATOM 8133   N ND1 . HIS C 3 105 ? -113.077 1.209   32.628  1.00 99.99  ? 108 HIS Z ND1 1  
ATOM 8134   C CD2 . HIS C 3 105 ? -112.728 -0.952  32.356  1.00 99.99  ? 108 HIS Z CD2 1  
ATOM 8135   C CE1 . HIS C 3 105 ? -112.387 1.038   31.515  1.00 99.99  ? 108 HIS Z CE1 1  
ATOM 8136   N NE2 . HIS C 3 105 ? -112.174 -0.241  31.339  1.00 99.99  ? 108 HIS Z NE2 1  
ATOM 8137   N N   . VAL C 3 106 ? -114.013 -3.296  34.426  1.00 30.00  ? 109 VAL Z N   1  
ATOM 8138   C CA  . VAL C 3 106 ? -113.461 -4.537  33.879  1.00 30.00  ? 109 VAL Z CA  1  
ATOM 8139   C C   . VAL C 3 106 ? -114.544 -5.488  33.396  1.00 30.00  ? 109 VAL Z C   1  
ATOM 8140   O O   . VAL C 3 106 ? -114.461 -6.094  32.322  1.00 30.00  ? 109 VAL Z O   1  
ATOM 8141   C CB  . VAL C 3 106 ? -112.646 -5.260  34.947  1.00 99.99  ? 109 VAL Z CB  1  
ATOM 8142   C CG1 . VAL C 3 106 ? -111.504 -4.360  35.410  1.00 99.99  ? 109 VAL Z CG1 1  
ATOM 8143   C CG2 . VAL C 3 106 ? -113.543 -5.589  36.135  1.00 99.99  ? 109 VAL Z CG2 1  
ATOM 8144   N N   . LEU C 3 107 ? -115.561 -5.610  34.232  1.00 30.00  ? 110 LEU Z N   1  
ATOM 8145   C CA  . LEU C 3 107 ? -116.679 -6.490  33.956  1.00 30.00  ? 110 LEU Z CA  1  
ATOM 8146   C C   . LEU C 3 107 ? -117.558 -5.977  32.829  1.00 30.00  ? 110 LEU Z C   1  
ATOM 8147   O O   . LEU C 3 107 ? -117.803 -6.687  31.849  1.00 30.00  ? 110 LEU Z O   1  
ATOM 8148   C CB  . LEU C 3 107 ? -117.550 -6.630  35.200  1.00 99.99  ? 110 LEU Z CB  1  
ATOM 8149   C CG  . LEU C 3 107 ? -117.130 -7.875  35.977  1.00 99.99  ? 110 LEU Z CG  1  
ATOM 8150   C CD1 . LEU C 3 107 ? -118.193 -8.201  37.023  1.00 99.99  ? 110 LEU Z CD1 1  
ATOM 8151   C CD2 . LEU C 3 107 ? -116.982 -9.048  35.018  1.00 99.99  ? 110 LEU Z CD2 1  
ATOM 8152   N N   . THR C 3 108 ? -118.020 -4.738  32.971  1.00 30.00  ? 111 THR Z N   1  
ATOM 8153   C CA  . THR C 3 108 ? -118.883 -4.126  31.971  1.00 30.00  ? 111 THR Z CA  1  
ATOM 8154   C C   . THR C 3 108 ? -118.197 -3.691  30.672  1.00 30.00  ? 111 THR Z C   1  
ATOM 8155   O O   . THR C 3 108 ? -118.748 -3.872  29.582  1.00 30.00  ? 111 THR Z O   1  
ATOM 8156   C CB  . THR C 3 108 ? -119.530 -2.868  32.544  1.00 99.99  ? 111 THR Z CB  1  
ATOM 8157   O OG1 . THR C 3 108 ? -118.529 -1.868  32.751  1.00 99.99  ? 111 THR Z OG1 1  
ATOM 8158   C CG2 . THR C 3 108 ? -120.194 -3.202  33.876  1.00 99.99  ? 111 THR Z CG2 1  
ATOM 8159   N N   . ALA C 3 109 ? -116.993 -3.134  30.783  1.00 30.00  ? 112 ALA Z N   1  
ATOM 8160   C CA  . ALA C 3 109 ? -116.260 -2.655  29.616  1.00 30.00  ? 112 ALA Z CA  1  
ATOM 8161   C C   . ALA C 3 109 ? -115.318 -3.580  28.868  1.00 30.00  ? 112 ALA Z C   1  
ATOM 8162   O O   . ALA C 3 109 ? -115.290 -3.532  27.646  1.00 30.00  ? 112 ALA Z O   1  
ATOM 8163   C CB  . ALA C 3 109 ? -115.505 -1.390  29.998  1.00 30.00  ? 112 ALA Z CB  1  
ATOM 8164   N N   . LEU C 3 110 ? -114.552 -4.421  29.554  1.00 30.00  ? 113 LEU Z N   1  
ATOM 8165   C CA  . LEU C 3 110 ? -113.627 -5.304  28.828  1.00 30.00  ? 113 LEU Z CA  1  
ATOM 8166   C C   . LEU C 3 110 ? -114.130 -6.723  28.556  1.00 30.00  ? 113 LEU Z C   1  
ATOM 8167   O O   . LEU C 3 110 ? -115.059 -7.196  29.211  1.00 30.00  ? 113 LEU Z O   1  
ATOM 8168   C CB  . LEU C 3 110 ? -112.333 -5.461  29.620  1.00 99.99  ? 113 LEU Z CB  1  
ATOM 8169   C CG  . LEU C 3 110 ? -111.306 -4.449  29.123  1.00 99.99  ? 113 LEU Z CG  1  
ATOM 8170   C CD1 . LEU C 3 110 ? -109.929 -4.816  29.667  1.00 99.99  ? 113 LEU Z CD1 1  
ATOM 8171   C CD2 . LEU C 3 110 ? -111.271 -4.465  27.599  1.00 99.99  ? 113 LEU Z CD2 1  
ATOM 8172   N N   . GLY C 3 111 ? -113.502 -7.393  27.586  1.00 30.00  ? 114 GLY Z N   1  
ATOM 8173   C CA  . GLY C 3 111 ? -113.886 -8.754  27.225  1.00 30.00  ? 114 GLY Z CA  1  
ATOM 8174   C C   . GLY C 3 111 ? -115.365 -8.839  26.881  1.00 30.00  ? 114 GLY Z C   1  
ATOM 8175   O O   . GLY C 3 111 ? -116.014 -7.802  26.759  1.00 30.00  ? 114 GLY Z O   1  
ATOM 8176   N N   . GLU C 3 112 ? -115.899 -10.054 26.717  1.00 30.00  ? 115 GLU Z N   1  
ATOM 8177   C CA  . GLU C 3 112 ? -117.327 -10.228 26.401  1.00 30.00  ? 115 GLU Z CA  1  
ATOM 8178   C C   . GLU C 3 112 ? -118.104 -9.495  27.493  1.00 30.00  ? 115 GLU Z C   1  
ATOM 8179   O O   . GLU C 3 112 ? -118.476 -10.100 28.495  1.00 30.00  ? 115 GLU Z O   1  
ATOM 8180   C CB  . GLU C 3 112 ? -117.676 -11.712 26.392  1.00 99.99  ? 115 GLU Z CB  1  
ATOM 8181   C CG  . GLU C 3 112 ? -118.893 -11.937 25.529  1.00 99.99  ? 115 GLU Z CG  1  
ATOM 8182   C CD  . GLU C 3 112 ? -120.156 -11.702 26.354  1.00 99.99  ? 115 GLU Z CD  1  
ATOM 8183   O OE1 . GLU C 3 112 ? -120.622 -10.534 26.372  1.00 99.99  ? 115 GLU Z OE1 1  
ATOM 8184   O OE2 . GLU C 3 112 ? -120.642 -12.694 26.962  1.00 99.99  ? 115 GLU Z OE2 1  
ATOM 8185   N N   . ARG C 3 113 ? -118.364 -8.204  27.305  1.00 30.00  ? 116 ARG Z N   1  
ATOM 8186   C CA  . ARG C 3 113 ? -119.070 -7.414  28.310  1.00 30.00  ? 116 ARG Z CA  1  
ATOM 8187   C C   . ARG C 3 113 ? -120.170 -8.103  29.112  1.00 30.00  ? 116 ARG Z C   1  
ATOM 8188   O O   . ARG C 3 113 ? -120.673 -9.160  28.747  1.00 30.00  ? 116 ARG Z O   1  
ATOM 8189   C CB  . ARG C 3 113 ? -119.754 -6.222  27.647  1.00 99.99  ? 116 ARG Z CB  1  
ATOM 8190   C CG  . ARG C 3 113 ? -118.714 -5.374  26.925  1.00 99.99  ? 116 ARG Z CG  1  
ATOM 8191   C CD  . ARG C 3 113 ? -119.414 -4.400  25.985  1.00 99.99  ? 116 ARG Z CD  1  
ATOM 8192   N NE  . ARG C 3 113 ? -120.284 -3.470  26.739  1.00 99.99  ? 116 ARG Z NE  1  
ATOM 8193   C CZ  . ARG C 3 113 ? -119.859 -2.303  27.213  1.00 99.99  ? 116 ARG Z CZ  1  
ATOM 8194   N NH1 . ARG C 3 113 ? -118.606 -1.887  27.039  1.00 99.99  ? 116 ARG Z NH1 1  
ATOM 8195   N NH2 . ARG C 3 113 ? -120.724 -1.543  27.876  1.00 99.99  ? 116 ARG Z NH2 1  
ATOM 8196   N N   . LEU C 3 114 ? -120.526 -7.478  30.225  1.00 30.00  ? 117 LEU Z N   1  
ATOM 8197   C CA  . LEU C 3 114 ? -121.556 -7.979  31.125  1.00 30.00  ? 117 LEU Z CA  1  
ATOM 8198   C C   . LEU C 3 114 ? -122.471 -6.808  31.425  1.00 30.00  ? 117 LEU Z C   1  
ATOM 8199   O O   . LEU C 3 114 ? -122.009 -5.783  31.911  1.00 30.00  ? 117 LEU Z O   1  
ATOM 8200   C CB  . LEU C 3 114 ? -120.915 -8.508  32.405  1.00 99.99  ? 117 LEU Z CB  1  
ATOM 8201   C CG  . LEU C 3 114 ? -120.522 -7.339  33.299  1.00 99.99  ? 117 LEU Z CG  1  
ATOM 8202   C CD1 . LEU C 3 114 ? -120.072 -6.167  32.433  1.00 99.99  ? 117 LEU Z CD1 1  
ATOM 8203   C CD2 . LEU C 3 114 ? -121.721 -6.919  34.142  1.00 99.99  ? 117 LEU Z CD2 1  
ATOM 8204   N N   . SER C 3 115 ? -123.761 -6.956  31.145  1.00 30.00  ? 118 SER Z N   1  
ATOM 8205   C CA  . SER C 3 115 ? -124.722 -5.883  31.408  1.00 30.00  ? 118 SER Z CA  1  
ATOM 8206   C C   . SER C 3 115 ? -124.495 -5.248  32.781  1.00 30.00  ? 118 SER Z C   1  
ATOM 8207   O O   . SER C 3 115 ? -123.896 -5.835  33.674  1.00 30.00  ? 118 SER Z O   1  
ATOM 8208   C CB  . SER C 3 115 ? -126.141 -6.436  31.366  1.00 99.99  ? 118 SER Z CB  1  
ATOM 8209   O OG  . SER C 3 115 ? -126.344 -7.316  32.474  1.00 99.99  ? 118 SER Z OG  1  
ATOM 8210   N N   . ASP C 3 116 ? -124.986 -4.038  32.948  1.00 30.00  ? 119 ASP Z N   1  
ATOM 8211   C CA  . ASP C 3 116 ? -124.806 -3.353  34.210  1.00 30.00  ? 119 ASP Z CA  1  
ATOM 8212   C C   . ASP C 3 116 ? -125.614 -3.996  35.315  1.00 30.00  ? 119 ASP Z C   1  
ATOM 8213   O O   . ASP C 3 116 ? -125.327 -3.805  36.493  1.00 30.00  ? 119 ASP Z O   1  
ATOM 8214   C CB  . ASP C 3 116 ? -125.247 -1.900  34.081  1.00 99.99  ? 119 ASP Z CB  1  
ATOM 8215   C CG  . ASP C 3 116 ? -126.616 -1.841  33.406  1.00 99.99  ? 119 ASP Z CG  1  
ATOM 8216   O OD1 . ASP C 3 116 ? -126.725 -2.393  32.278  1.00 99.99  ? 119 ASP Z OD1 1  
ATOM 8217   O OD2 . ASP C 3 116 ? -127.536 -1.246  34.023  1.00 99.99  ? 119 ASP Z OD2 1  
ATOM 8218   N N   . GLU C 3 117 ? -126.627 -4.764  34.922  1.00 30.00  ? 120 GLU Z N   1  
ATOM 8219   C CA  . GLU C 3 117 ? -127.518 -5.444  35.862  1.00 30.00  ? 120 GLU Z CA  1  
ATOM 8220   C C   . GLU C 3 117 ? -126.913 -6.690  36.478  1.00 30.00  ? 120 GLU Z C   1  
ATOM 8221   O O   . GLU C 3 117 ? -126.995 -6.883  37.695  1.00 30.00  ? 120 GLU Z O   1  
ATOM 8222   C CB  . GLU C 3 117 ? -128.797 -5.870  35.147  1.00 99.99  ? 120 GLU Z CB  1  
ATOM 8223   C CG  . GLU C 3 117 ? -129.555 -4.644  34.693  1.00 99.99  ? 120 GLU Z CG  1  
ATOM 8224   C CD  . GLU C 3 117 ? -130.167 -3.950  35.906  1.00 99.99  ? 120 GLU Z CD  1  
ATOM 8225   O OE1 . GLU C 3 117 ? -129.472 -3.071  36.480  1.00 99.99  ? 120 GLU Z OE1 1  
ATOM 8226   O OE2 . GLU C 3 117 ? -131.327 -4.304  36.249  1.00 99.99  ? 120 GLU Z OE2 1  
ATOM 8227   N N   . ASP C 3 118 ? -126.314 -7.529  35.635  1.00 30.00  ? 121 ASP Z N   1  
ATOM 8228   C CA  . ASP C 3 118 ? -125.675 -8.767  36.074  1.00 30.00  ? 121 ASP Z CA  1  
ATOM 8229   C C   . ASP C 3 118 ? -124.598 -8.420  37.074  1.00 30.00  ? 121 ASP Z C   1  
ATOM 8230   O O   . ASP C 3 118 ? -124.274 -9.201  37.965  1.00 30.00  ? 121 ASP Z O   1  
ATOM 8231   C CB  . ASP C 3 118 ? -125.059 -9.486  34.878  1.00 99.99  ? 121 ASP Z CB  1  
ATOM 8232   C CG  . ASP C 3 118 ? -126.169 -10.011 33.973  1.00 99.99  ? 121 ASP Z CG  1  
ATOM 8233   O OD1 . ASP C 3 118 ? -126.950 -10.876 34.459  1.00 99.99  ? 121 ASP Z OD1 1  
ATOM 8234   O OD2 . ASP C 3 118 ? -126.230 -9.546  32.803  1.00 99.99  ? 121 ASP Z OD2 1  
ATOM 8235   N N   . VAL C 3 119 ? -124.044 -7.230  36.908  1.00 30.00  ? 122 VAL Z N   1  
ATOM 8236   C CA  . VAL C 3 119 ? -122.999 -6.772  37.785  1.00 30.00  ? 122 VAL Z CA  1  
ATOM 8237   C C   . VAL C 3 119 ? -123.544 -6.436  39.175  1.00 30.00  ? 122 VAL Z C   1  
ATOM 8238   O O   . VAL C 3 119 ? -123.138 -7.063  40.151  1.00 30.00  ? 122 VAL Z O   1  
ATOM 8239   C CB  . VAL C 3 119 ? -122.351 -5.519  37.207  1.00 99.99  ? 122 VAL Z CB  1  
ATOM 8240   C CG1 . VAL C 3 119 ? -123.332 -4.822  36.271  1.00 99.99  ? 122 VAL Z CG1 1  
ATOM 8241   C CG2 . VAL C 3 119 ? -121.973 -4.572  38.342  1.00 99.99  ? 122 VAL Z CG2 1  
ATOM 8242   N N   . ASP C 3 120 ? -124.455 -5.468  39.274  1.00 30.00  ? 123 ASP Z N   1  
ATOM 8243   C CA  . ASP C 3 120 ? -125.022 -5.094  40.579  1.00 30.00  ? 123 ASP Z CA  1  
ATOM 8244   C C   . ASP C 3 120 ? -125.578 -6.355  41.216  1.00 30.00  ? 123 ASP Z C   1  
ATOM 8245   O O   . ASP C 3 120 ? -125.684 -6.466  42.446  1.00 30.00  ? 123 ASP Z O   1  
ATOM 8246   C CB  . ASP C 3 120 ? -126.131 -4.066  40.389  1.00 99.99  ? 123 ASP Z CB  1  
ATOM 8247   C CG  . ASP C 3 120 ? -127.266 -4.685  39.576  1.00 99.99  ? 123 ASP Z CG  1  
ATOM 8248   O OD1 . ASP C 3 120 ? -127.121 -4.724  38.324  1.00 99.99  ? 123 ASP Z OD1 1  
ATOM 8249   O OD2 . ASP C 3 120 ? -128.264 -5.113  40.212  1.00 99.99  ? 123 ASP Z OD2 1  
ATOM 8250   N N   . GLU C 3 121 ? -125.939 -7.291  40.344  1.00 30.00  ? 124 GLU Z N   1  
ATOM 8251   C CA  . GLU C 3 121 ? -126.486 -8.579  40.725  1.00 30.00  ? 124 GLU Z CA  1  
ATOM 8252   C C   . GLU C 3 121 ? -125.463 -9.316  41.561  1.00 30.00  ? 124 GLU Z C   1  
ATOM 8253   O O   . GLU C 3 121 ? -125.515 -9.292  42.793  1.00 30.00  ? 124 GLU Z O   1  
ATOM 8254   C CB  . GLU C 3 121 ? -126.811 -9.394  39.479  1.00 99.99  ? 124 GLU Z CB  1  
ATOM 8255   C CG  . GLU C 3 121 ? -127.910 -8.708  38.699  1.00 99.99  ? 124 GLU Z CG  1  
ATOM 8256   C CD  . GLU C 3 121 ? -129.231 -8.855  39.447  1.00 99.99  ? 124 GLU Z CD  1  
ATOM 8257   O OE1 . GLU C 3 121 ? -129.527 -7.960  40.278  1.00 99.99  ? 124 GLU Z OE1 1  
ATOM 8258   O OE2 . GLU C 3 121 ? -129.935 -9.866  39.175  1.00 99.99  ? 124 GLU Z OE2 1  
ATOM 8259   N N   . ILE C 3 122 ? -124.534 -9.964  40.864  1.00 30.00  ? 125 ILE Z N   1  
ATOM 8260   C CA  . ILE C 3 122 ? -123.462 -10.739 41.481  1.00 30.00  ? 125 ILE Z CA  1  
ATOM 8261   C C   . ILE C 3 122 ? -122.747 -10.019 42.613  1.00 30.00  ? 125 ILE Z C   1  
ATOM 8262   O O   . ILE C 3 122 ? -122.191 -10.660 43.506  1.00 30.00  ? 125 ILE Z O   1  
ATOM 8263   C CB  . ILE C 3 122 ? -122.402 -11.083 40.436  1.00 99.99  ? 125 ILE Z CB  1  
ATOM 8264   C CG1 . ILE C 3 122 ? -121.468 -9.896  40.249  1.00 99.99  ? 125 ILE Z CG1 1  
ATOM 8265   C CG2 . ILE C 3 122 ? -123.086 -11.410 39.112  1.00 99.99  ? 125 ILE Z CG2 1  
ATOM 8266   C CD1 . ILE C 3 122 ? -121.972 -9.026  39.101  1.00 99.99  ? 125 ILE Z CD1 1  
ATOM 8267   N N   . ILE C 3 123 ? -122.748 -8.694  42.577  1.00 30.00  ? 126 ILE Z N   1  
ATOM 8268   C CA  . ILE C 3 123 ? -122.114 -7.933  43.639  1.00 30.00  ? 126 ILE Z CA  1  
ATOM 8269   C C   . ILE C 3 123 ? -122.937 -8.281  44.873  1.00 30.00  ? 126 ILE Z C   1  
ATOM 8270   O O   . ILE C 3 123 ? -122.417 -8.849  45.832  1.00 30.00  ? 126 ILE Z O   1  
ATOM 8271   C CB  . ILE C 3 123 ? -122.165 -6.445  43.312  1.00 99.99  ? 126 ILE Z CB  1  
ATOM 8272   C CG1 . ILE C 3 123 ? -123.605 -5.960  43.380  1.00 99.99  ? 126 ILE Z CG1 1  
ATOM 8273   C CG2 . ILE C 3 123 ? -121.615 -6.218  41.905  1.00 99.99  ? 126 ILE Z CG2 1  
ATOM 8274   C CD1 . ILE C 3 123 ? -123.662 -4.481  43.004  1.00 99.99  ? 126 ILE Z CD1 1  
ATOM 8275   N N   . LYS C 3 124 ? -124.225 -7.939  44.810  1.00 30.00  ? 127 LYS Z N   1  
ATOM 8276   C CA  . LYS C 3 124 ? -125.187 -8.183  45.887  1.00 30.00  ? 127 LYS Z CA  1  
ATOM 8277   C C   . LYS C 3 124 ? -125.253 -9.656  46.299  1.00 30.00  ? 127 LYS Z C   1  
ATOM 8278   O O   . LYS C 3 124 ? -125.332 -9.964  47.490  1.00 30.00  ? 127 LYS Z O   1  
ATOM 8279   C CB  . LYS C 3 124 ? -126.582 -7.769  45.437  1.00 99.99  ? 127 LYS Z CB  1  
ATOM 8280   C CG  . LYS C 3 124 ? -127.562 -7.931  46.595  1.00 99.99  ? 127 LYS Z CG  1  
ATOM 8281   C CD  . LYS C 3 124 ? -128.824 -7.123  46.316  1.00 99.99  ? 127 LYS Z CD  1  
ATOM 8282   C CE  . LYS C 3 124 ? -129.932 -7.568  47.264  1.00 99.99  ? 127 LYS Z CE  1  
ATOM 8283   N NZ  . LYS C 3 124 ? -129.943 -6.697  48.451  1.00 99.99  ? 127 LYS Z NZ  1  
ATOM 8284   N N   . LEU C 3 125 ? -125.228 -10.560 45.318  1.00 30.00  ? 128 LEU Z N   1  
ATOM 8285   C CA  . LEU C 3 125 ? -125.272 -11.990 45.610  1.00 30.00  ? 128 LEU Z CA  1  
ATOM 8286   C C   . LEU C 3 125 ? -124.101 -12.306 46.524  1.00 30.00  ? 128 LEU Z C   1  
ATOM 8287   O O   . LEU C 3 125 ? -124.287 -12.512 47.728  1.00 30.00  ? 128 LEU Z O   1  
ATOM 8288   C CB  . LEU C 3 125 ? -125.162 -12.788 44.316  1.00 99.99  ? 128 LEU Z CB  1  
ATOM 8289   C CG  . LEU C 3 125 ? -126.559 -13.136 43.813  1.00 99.99  ? 128 LEU Z CG  1  
ATOM 8290   C CD1 . LEU C 3 125 ? -126.454 -14.197 42.721  1.00 99.99  ? 128 LEU Z CD1 1  
ATOM 8291   C CD2 . LEU C 3 125 ? -127.396 -13.673 44.967  1.00 99.99  ? 128 LEU Z CD2 1  
ATOM 8292   N N   . THR C 3 126 ? -122.898 -12.331 45.942  1.00 30.00  ? 129 THR Z N   1  
ATOM 8293   C CA  . THR C 3 126 ? -121.657 -12.612 46.665  1.00 30.00  ? 129 THR Z CA  1  
ATOM 8294   C C   . THR C 3 126 ? -121.458 -11.651 47.836  1.00 30.00  ? 129 THR Z C   1  
ATOM 8295   O O   . THR C 3 126 ? -120.521 -11.793 48.610  1.00 30.00  ? 129 THR Z O   1  
ATOM 8296   C CB  . THR C 3 126 ? -120.466 -12.469 45.722  1.00 99.99  ? 129 THR Z CB  1  
ATOM 8297   O OG1 . THR C 3 126 ? -120.312 -11.094 45.356  1.00 99.99  ? 129 THR Z OG1 1  
ATOM 8298   C CG2 . THR C 3 126 ? -120.705 -13.304 44.469  1.00 99.99  ? 129 THR Z CG2 1  
ATOM 8299   N N   . ASP C 3 127 ? -122.342 -10.671 47.955  1.00 30.00  ? 130 ASP Z N   1  
ATOM 8300   C CA  . ASP C 3 127 ? -122.263 -9.699  49.032  1.00 30.00  ? 130 ASP Z CA  1  
ATOM 8301   C C   . ASP C 3 127 ? -120.877 -9.096  49.164  1.00 30.00  ? 130 ASP Z C   1  
ATOM 8302   O O   . ASP C 3 127 ? -120.325 -9.033  50.266  1.00 30.00  ? 130 ASP Z O   1  
ATOM 8303   C CB  . ASP C 3 127 ? -122.613 -10.366 50.358  1.00 99.99  ? 130 ASP Z CB  1  
ATOM 8304   C CG  . ASP C 3 127 ? -124.095 -10.728 50.373  1.00 99.99  ? 130 ASP Z CG  1  
ATOM 8305   O OD1 . ASP C 3 127 ? -124.921 -9.779  50.302  1.00 99.99  ? 130 ASP Z OD1 1  
ATOM 8306   O OD2 . ASP C 3 127 ? -124.388 -11.952 50.454  1.00 99.99  ? 130 ASP Z OD2 1  
ATOM 8307   N N   . LEU C 3 128 ? -120.315 -8.653  48.042  1.00 30.00  ? 131 LEU Z N   1  
ATOM 8308   C CA  . LEU C 3 128 ? -118.991 -8.038  48.009  1.00 30.00  ? 131 LEU Z CA  1  
ATOM 8309   C C   . LEU C 3 128 ? -119.068 -6.640  48.644  1.00 30.00  ? 131 LEU Z C   1  
ATOM 8310   O O   . LEU C 3 128 ? -119.989 -5.874  48.362  1.00 30.00  ? 131 LEU Z O   1  
ATOM 8311   C CB  . LEU C 3 128 ? -118.509 -7.915  46.568  1.00 99.99  ? 131 LEU Z CB  1  
ATOM 8312   C CG  . LEU C 3 128 ? -117.645 -9.120  46.214  1.00 99.99  ? 131 LEU Z CG  1  
ATOM 8313   C CD1 . LEU C 3 128 ? -116.902 -8.847  44.910  1.00 99.99  ? 131 LEU Z CD1 1  
ATOM 8314   C CD2 . LEU C 3 128 ? -116.640 -9.370  47.332  1.00 99.99  ? 131 LEU Z CD2 1  
ATOM 8315   N N   . GLN C 3 129 ? -118.110 -6.302  49.503  1.00 30.00  ? 132 GLN Z N   1  
ATOM 8316   C CA  . GLN C 3 129 ? -118.133 -4.991  50.151  1.00 30.00  ? 132 GLN Z CA  1  
ATOM 8317   C C   . GLN C 3 129 ? -116.823 -4.205  50.055  1.00 30.00  ? 132 GLN Z C   1  
ATOM 8318   O O   . GLN C 3 129 ? -115.735 -4.774  50.111  1.00 30.00  ? 132 GLN Z O   1  
ATOM 8319   C CB  . GLN C 3 129 ? -118.434 -5.152  51.636  1.00 99.99  ? 132 GLN Z CB  1  
ATOM 8320   C CG  . GLN C 3 129 ? -117.408 -4.378  52.453  1.00 99.99  ? 132 GLN Z CG  1  
ATOM 8321   C CD  . GLN C 3 129 ? -116.043 -5.049  52.400  1.00 99.99  ? 132 GLN Z CD  1  
ATOM 8322   O OE1 . GLN C 3 129 ? -115.882 -6.083  51.753  1.00 99.99  ? 132 GLN Z OE1 1  
ATOM 8323   N NE2 . GLN C 3 129 ? -115.057 -4.458  53.081  1.00 99.99  ? 132 GLN Z NE2 1  
ATOM 8324   N N   . GLU C 3 130 ? -116.948 -2.888  49.917  1.00 30.00  ? 133 GLU Z N   1  
ATOM 8325   C CA  . GLU C 3 130 ? -115.794 -2.000  49.816  1.00 30.00  ? 133 GLU Z CA  1  
ATOM 8326   C C   . GLU C 3 130 ? -115.491 -1.400  51.180  1.00 30.00  ? 133 GLU Z C   1  
ATOM 8327   O O   . GLU C 3 130 ? -116.359 -1.371  52.053  1.00 30.00  ? 133 GLU Z O   1  
ATOM 8328   C CB  . GLU C 3 130 ? -116.084 -0.877  48.829  1.00 99.99  ? 133 GLU Z CB  1  
ATOM 8329   C CG  . GLU C 3 130 ? -117.323 -0.133  49.262  1.00 99.99  ? 133 GLU Z CG  1  
ATOM 8330   C CD  . GLU C 3 130 ? -118.564 -0.939  48.880  1.00 99.99  ? 133 GLU Z CD  1  
ATOM 8331   O OE1 . GLU C 3 130 ? -118.996 -1.764  49.727  1.00 99.99  ? 133 GLU Z OE1 1  
ATOM 8332   O OE2 . GLU C 3 130 ? -119.065 -0.722  47.745  1.00 99.99  ? 133 GLU Z OE2 1  
ATOM 8333   N N   . ASP C 3 131 ? -114.263 -0.918  51.356  1.00 30.00  ? 134 ASP Z N   1  
ATOM 8334   C CA  . ASP C 3 131 ? -113.861 -0.311  52.617  1.00 30.00  ? 134 ASP Z CA  1  
ATOM 8335   C C   . ASP C 3 131 ? -114.119 1.185   52.543  1.00 30.00  ? 134 ASP Z C   1  
ATOM 8336   O O   . ASP C 3 131 ? -114.882 1.652   51.693  1.00 30.00  ? 134 ASP Z O   1  
ATOM 8337   C CB  . ASP C 3 131 ? -112.380 -0.564  52.864  1.00 99.99  ? 134 ASP Z CB  1  
ATOM 8338   C CG  . ASP C 3 131 ? -111.584 -0.230  51.605  1.00 99.99  ? 134 ASP Z CG  1  
ATOM 8339   O OD1 . ASP C 3 131 ? -111.916 -0.819  50.543  1.00 99.99  ? 134 ASP Z OD1 1  
ATOM 8340   O OD2 . ASP C 3 131 ? -110.653 0.611   51.718  1.00 99.99  ? 134 ASP Z OD2 1  
ATOM 8341   N N   . LEU C 3 132 ? -113.478 1.933   53.435  1.00 30.00  ? 135 LEU Z N   1  
ATOM 8342   C CA  . LEU C 3 132 ? -113.631 3.389   53.490  1.00 30.00  ? 135 LEU Z CA  1  
ATOM 8343   C C   . LEU C 3 132 ? -113.109 4.092   52.233  1.00 30.00  ? 135 LEU Z C   1  
ATOM 8344   O O   . LEU C 3 132 ? -113.670 5.102   51.792  1.00 30.00  ? 135 LEU Z O   1  
ATOM 8345   C CB  . LEU C 3 132 ? -112.864 3.946   54.683  1.00 99.99  ? 135 LEU Z CB  1  
ATOM 8346   C CG  . LEU C 3 132 ? -113.805 4.086   55.874  1.00 99.99  ? 135 LEU Z CG  1  
ATOM 8347   C CD1 . LEU C 3 132 ? -113.139 4.938   56.950  1.00 99.99  ? 135 LEU Z CD1 1  
ATOM 8348   C CD2 . LEU C 3 132 ? -115.101 4.754   55.424  1.00 99.99  ? 135 LEU Z CD2 1  
ATOM 8349   N N   . GLU C 3 133 ? -112.031 3.557   51.667  1.00 30.00  ? 136 GLU Z N   1  
ATOM 8350   C CA  . GLU C 3 133 ? -111.426 4.119   50.470  1.00 30.00  ? 136 GLU Z CA  1  
ATOM 8351   C C   . GLU C 3 133 ? -112.169 3.673   49.214  1.00 30.00  ? 136 GLU Z C   1  
ATOM 8352   O O   . GLU C 3 133 ? -111.878 4.137   48.111  1.00 30.00  ? 136 GLU Z O   1  
ATOM 8353   C CB  . GLU C 3 133 ? -109.976 3.663   50.359  1.00 99.99  ? 136 GLU Z CB  1  
ATOM 8354   C CG  . GLU C 3 133 ? -109.180 4.228   51.508  1.00 99.99  ? 136 GLU Z CG  1  
ATOM 8355   C CD  . GLU C 3 133 ? -108.985 5.730   51.305  1.00 99.99  ? 136 GLU Z CD  1  
ATOM 8356   O OE1 . GLU C 3 133 ? -109.862 6.496   51.785  1.00 99.99  ? 136 GLU Z OE1 1  
ATOM 8357   O OE2 . GLU C 3 133 ? -107.960 6.097   50.668  1.00 99.99  ? 136 GLU Z OE2 1  
ATOM 8358   N N   . GLY C 3 134 ? -113.125 2.767   49.394  1.00 30.00  ? 137 GLY Z N   1  
ATOM 8359   C CA  . GLY C 3 134 ? -113.907 2.258   48.283  1.00 30.00  ? 137 GLY Z CA  1  
ATOM 8360   C C   . GLY C 3 134 ? -113.189 1.191   47.468  1.00 30.00  ? 137 GLY Z C   1  
ATOM 8361   O O   . GLY C 3 134 ? -113.372 1.114   46.247  1.00 30.00  ? 137 GLY Z O   1  
ATOM 8362   N N   . ASN C 3 135 ? -112.380 0.362   48.131  1.00 30.00  ? 138 ASN Z N   1  
ATOM 8363   C CA  . ASN C 3 135 ? -111.633 -0.700  47.458  1.00 30.00  ? 138 ASN Z CA  1  
ATOM 8364   C C   . ASN C 3 135 ? -112.099 -2.073  47.891  1.00 30.00  ? 138 ASN Z C   1  
ATOM 8365   O O   . ASN C 3 135 ? -112.718 -2.230  48.938  1.00 30.00  ? 138 ASN Z O   1  
ATOM 8366   C CB  . ASN C 3 135 ? -110.148 -0.576  47.784  1.00 99.99  ? 138 ASN Z CB  1  
ATOM 8367   C CG  . ASN C 3 135 ? -109.881 -0.885  49.249  1.00 99.99  ? 138 ASN Z CG  1  
ATOM 8368   O OD1 . ASN C 3 135 ? -109.441 -0.018  49.999  1.00 99.99  ? 138 ASN Z OD1 1  
ATOM 8369   N ND2 . ASN C 3 135 ? -110.146 -2.129  49.656  1.00 99.99  ? 138 ASN Z ND2 1  
ATOM 8370   N N   . VAL C 3 136 ? -111.787 -3.071  47.078  1.00 30.00  ? 139 VAL Z N   1  
ATOM 8371   C CA  . VAL C 3 136 ? -112.185 -4.433  47.373  1.00 30.00  ? 139 VAL Z CA  1  
ATOM 8372   C C   . VAL C 3 136 ? -111.100 -5.444  47.058  1.00 30.00  ? 139 VAL Z C   1  
ATOM 8373   O O   . VAL C 3 136 ? -110.346 -5.293  46.093  1.00 30.00  ? 139 VAL Z O   1  
ATOM 8374   C CB  . VAL C 3 136 ? -113.414 -4.802  46.547  1.00 99.99  ? 139 VAL Z CB  1  
ATOM 8375   C CG1 . VAL C 3 136 ? -114.561 -3.858  46.889  1.00 99.99  ? 139 VAL Z CG1 1  
ATOM 8376   C CG2 . VAL C 3 136 ? -113.084 -4.686  45.063  1.00 99.99  ? 139 VAL Z CG2 1  
ATOM 8377   N N   . LYS C 3 137 ? -111.014 -6.485  47.882  1.00 30.00  ? 140 LYS Z N   1  
ATOM 8378   C CA  . LYS C 3 137 ? -110.022 -7.525  47.675  1.00 30.00  ? 140 LYS Z CA  1  
ATOM 8379   C C   . LYS C 3 137 ? -110.528 -8.411  46.545  1.00 30.00  ? 140 LYS Z C   1  
ATOM 8380   O O   . LYS C 3 137 ? -111.427 -9.225  46.728  1.00 30.00  ? 140 LYS Z O   1  
ATOM 8381   C CB  . LYS C 3 137 ? -109.848 -8.338  48.952  1.00 99.99  ? 140 LYS Z CB  1  
ATOM 8382   C CG  . LYS C 3 137 ? -109.361 -7.429  50.075  1.00 99.99  ? 140 LYS Z CG  1  
ATOM 8383   C CD  . LYS C 3 137 ? -107.869 -7.166  49.904  1.00 99.99  ? 140 LYS Z CD  1  
ATOM 8384   C CE  . LYS C 3 137 ? -107.347 -6.404  51.116  1.00 99.99  ? 140 LYS Z CE  1  
ATOM 8385   N NZ  . LYS C 3 137 ? -105.986 -5.921  50.843  1.00 99.99  ? 140 LYS Z NZ  1  
ATOM 8386   N N   . TYR C 3 138 ? -109.960 -8.245  45.362  1.00 30.00  ? 141 TYR Z N   1  
ATOM 8387   C CA  . TYR C 3 138 ? -110.409 -9.049  44.251  1.00 30.00  ? 141 TYR Z CA  1  
ATOM 8388   C C   . TYR C 3 138 ? -110.145 -10.515 44.485  1.00 30.00  ? 141 TYR Z C   1  
ATOM 8389   O O   . TYR C 3 138 ? -110.698 -11.360 43.778  1.00 30.00  ? 141 TYR Z O   1  
ATOM 8390   C CB  . TYR C 3 138 ? -109.679 -8.630  42.980  1.00 99.99  ? 141 TYR Z CB  1  
ATOM 8391   C CG  . TYR C 3 138 ? -110.155 -9.477  41.824  1.00 99.99  ? 141 TYR Z CG  1  
ATOM 8392   C CD1 . TYR C 3 138 ? -111.333 -9.134  41.147  1.00 99.99  ? 141 TYR Z CD1 1  
ATOM 8393   C CD2 . TYR C 3 138 ? -109.419 -10.599 41.428  1.00 99.99  ? 141 TYR Z CD2 1  
ATOM 8394   C CE1 . TYR C 3 138 ? -111.775 -9.918  40.074  1.00 99.99  ? 141 TYR Z CE1 1  
ATOM 8395   C CE2 . TYR C 3 138 ? -109.862 -11.384 40.357  1.00 99.99  ? 141 TYR Z CE2 1  
ATOM 8396   C CZ  . TYR C 3 138 ? -111.040 -11.042 39.678  1.00 99.99  ? 141 TYR Z CZ  1  
ATOM 8397   O OH  . TYR C 3 138 ? -111.469 -11.806 38.636  1.00 99.99  ? 141 TYR Z OH  1  
ATOM 8398   N N   . GLU C 3 139 ? -109.313 -10.839 45.463  1.00 30.00  ? 142 GLU Z N   1  
ATOM 8399   C CA  . GLU C 3 139 ? -109.051 -12.252 45.694  1.00 30.00  ? 142 GLU Z CA  1  
ATOM 8400   C C   . GLU C 3 139 ? -110.294 -12.945 46.244  1.00 30.00  ? 142 GLU Z C   1  
ATOM 8401   O O   . GLU C 3 139 ? -110.653 -14.037 45.796  1.00 30.00  ? 142 GLU Z O   1  
ATOM 8402   C CB  . GLU C 3 139 ? -107.915 -12.411 46.698  1.00 99.99  ? 142 GLU Z CB  1  
ATOM 8403   C CG  . GLU C 3 139 ? -106.638 -11.860 46.108  1.00 99.99  ? 142 GLU Z CG  1  
ATOM 8404   C CD  . GLU C 3 139 ? -106.136 -12.801 45.013  1.00 99.99  ? 142 GLU Z CD  1  
ATOM 8405   O OE1 . GLU C 3 139 ? -106.543 -12.588 43.842  1.00 99.99  ? 142 GLU Z OE1 1  
ATOM 8406   O OE2 . GLU C 3 139 ? -105.350 -13.720 45.363  1.00 99.99  ? 142 GLU Z OE2 1  
ATOM 8407   N N   . ASP C 3 140 ? -110.935 -12.299 47.216  1.00 30.00  ? 143 ASP Z N   1  
ATOM 8408   C CA  . ASP C 3 140 ? -112.146 -12.816 47.849  1.00 30.00  ? 143 ASP Z CA  1  
ATOM 8409   C C   . ASP C 3 140 ? -113.218 -13.030 46.783  1.00 30.00  ? 143 ASP Z C   1  
ATOM 8410   O O   . ASP C 3 140 ? -113.719 -14.144 46.585  1.00 30.00  ? 143 ASP Z O   1  
ATOM 8411   C CB  . ASP C 3 140 ? -112.652 -11.818 48.884  1.00 99.99  ? 143 ASP Z CB  1  
ATOM 8412   C CG  . ASP C 3 140 ? -113.764 -12.463 49.712  1.00 99.99  ? 143 ASP Z CG  1  
ATOM 8413   O OD1 . ASP C 3 140 ? -114.914 -12.505 49.198  1.00 99.99  ? 143 ASP Z OD1 1  
ATOM 8414   O OD2 . ASP C 3 140 ? -113.452 -12.912 50.847  1.00 99.99  ? 143 ASP Z OD2 1  
ATOM 8415   N N   . PHE C 3 141 ? -113.567 -11.948 46.097  1.00 30.00  ? 144 PHE Z N   1  
ATOM 8416   C CA  . PHE C 3 141 ? -114.565 -11.991 45.038  1.00 30.00  ? 144 PHE Z CA  1  
ATOM 8417   C C   . PHE C 3 141 ? -114.375 -13.201 44.116  1.00 30.00  ? 144 PHE Z C   1  
ATOM 8418   O O   . PHE C 3 141 ? -115.251 -14.037 44.006  1.00 30.00  ? 144 PHE Z O   1  
ATOM 8419   C CB  . PHE C 3 141 ? -114.470 -10.730 44.187  1.00 99.99  ? 144 PHE Z CB  1  
ATOM 8420   C CG  . PHE C 3 141 ? -115.509 -10.784 43.093  1.00 99.99  ? 144 PHE Z CG  1  
ATOM 8421   C CD1 . PHE C 3 141 ? -116.852 -10.521 43.387  1.00 99.99  ? 144 PHE Z CD1 1  
ATOM 8422   C CD2 . PHE C 3 141 ? -115.130 -11.096 41.782  1.00 99.99  ? 144 PHE Z CD2 1  
ATOM 8423   C CE1 . PHE C 3 141 ? -117.814 -10.569 42.375  1.00 99.99  ? 144 PHE Z CE1 1  
ATOM 8424   C CE2 . PHE C 3 141 ? -116.095 -11.146 40.768  1.00 99.99  ? 144 PHE Z CE2 1  
ATOM 8425   C CZ  . PHE C 3 141 ? -117.437 -10.882 41.065  1.00 99.99  ? 144 PHE Z CZ  1  
ATOM 8426   N N   . VAL C 3 142 ? -113.231 -13.297 43.454  1.00 30.00  ? 145 VAL Z N   1  
ATOM 8427   C CA  . VAL C 3 142 ? -112.973 -14.420 42.544  1.00 30.00  ? 145 VAL Z CA  1  
ATOM 8428   C C   . VAL C 3 142 ? -113.297 -15.754 43.178  1.00 30.00  ? 145 VAL Z C   1  
ATOM 8429   O O   . VAL C 3 142 ? -113.811 -16.656 42.515  1.00 30.00  ? 145 VAL Z O   1  
ATOM 8430   C CB  . VAL C 3 142 ? -111.502 -14.437 42.145  1.00 99.99  ? 145 VAL Z CB  1  
ATOM 8431   C CG1 . VAL C 3 142 ? -111.151 -13.131 41.439  1.00 99.99  ? 145 VAL Z CG1 1  
ATOM 8432   C CG2 . VAL C 3 142 ? -110.635 -14.592 43.390  1.00 99.99  ? 145 VAL Z CG2 1  
ATOM 8433   N N   . LYS C 3 143 ? -112.986 -15.875 44.466  1.00 30.00  ? 146 LYS Z N   1  
ATOM 8434   C CA  . LYS C 3 143 ? -113.225 -17.114 45.201  1.00 30.00  ? 146 LYS Z CA  1  
ATOM 8435   C C   . LYS C 3 143 ? -114.719 -17.473 45.347  1.00 30.00  ? 146 LYS Z C   1  
ATOM 8436   O O   . LYS C 3 143 ? -115.096 -18.648 45.252  1.00 30.00  ? 146 LYS Z O   1  
ATOM 8437   C CB  . LYS C 3 143 ? -112.654 -17.002 46.610  1.00 99.99  ? 146 LYS Z CB  1  
ATOM 8438   C CG  . LYS C 3 143 ? -112.820 -18.331 47.336  1.00 99.99  ? 146 LYS Z CG  1  
ATOM 8439   C CD  . LYS C 3 143 ? -111.881 -18.377 48.538  1.00 99.99  ? 146 LYS Z CD  1  
ATOM 8440   C CE  . LYS C 3 143 ? -112.298 -19.514 49.464  1.00 99.99  ? 146 LYS Z CE  1  
ATOM 8441   N NZ  . LYS C 3 143 ? -111.524 -20.721 49.138  1.00 99.99  ? 146 LYS Z NZ  1  
ATOM 8442   N N   . LYS C 3 144 ? -115.555 -16.456 45.571  1.00 30.00  ? 147 LYS Z N   1  
ATOM 8443   C CA  . LYS C 3 144 ? -116.988 -16.654 45.712  1.00 30.00  ? 147 LYS Z CA  1  
ATOM 8444   C C   . LYS C 3 144 ? -117.549 -17.073 44.361  1.00 30.00  ? 147 LYS Z C   1  
ATOM 8445   O O   . LYS C 3 144 ? -118.117 -18.151 44.234  1.00 30.00  ? 147 LYS Z O   1  
ATOM 8446   C CB  . LYS C 3 144 ? -117.648 -15.355 46.164  1.00 99.99  ? 147 LYS Z CB  1  
ATOM 8447   C CG  . LYS C 3 144 ? -117.048 -14.914 47.495  1.00 99.99  ? 147 LYS Z CG  1  
ATOM 8448   C CD  . LYS C 3 144 ? -117.776 -13.672 47.995  1.00 99.99  ? 147 LYS Z CD  1  
ATOM 8449   C CE  . LYS C 3 144 ? -117.191 -13.249 49.339  1.00 99.99  ? 147 LYS Z CE  1  
ATOM 8450   N NZ  . LYS C 3 144 ? -118.154 -12.387 50.042  1.00 99.99  ? 147 LYS Z NZ  1  
ATOM 8451   N N   . VAL C 3 145 ? -117.388 -16.214 43.358  1.00 30.00  ? 148 VAL Z N   1  
ATOM 8452   C CA  . VAL C 3 145 ? -117.867 -16.498 42.005  1.00 30.00  ? 148 VAL Z CA  1  
ATOM 8453   C C   . VAL C 3 145 ? -117.507 -17.929 41.630  1.00 30.00  ? 148 VAL Z C   1  
ATOM 8454   O O   . VAL C 3 145 ? -118.293 -18.650 41.011  1.00 30.00  ? 148 VAL Z O   1  
ATOM 8455   C CB  . VAL C 3 145 ? -117.222 -15.536 41.012  1.00 99.99  ? 148 VAL Z CB  1  
ATOM 8456   C CG1 . VAL C 3 145 ? -117.583 -14.101 41.386  1.00 99.99  ? 148 VAL Z CG1 1  
ATOM 8457   C CG2 . VAL C 3 145 ? -115.706 -15.706 41.053  1.00 99.99  ? 148 VAL Z CG2 1  
ATOM 8458   N N   . MET C 3 146 ? -116.304 -18.322 42.014  1.00 30.00  ? 149 MET Z N   1  
ATOM 8459   C CA  . MET C 3 146 ? -115.808 -19.656 41.731  1.00 30.00  ? 149 MET Z CA  1  
ATOM 8460   C C   . MET C 3 146 ? -116.558 -20.671 42.592  1.00 30.00  ? 149 MET Z C   1  
ATOM 8461   O O   . MET C 3 146 ? -116.857 -21.779 42.143  1.00 30.00  ? 149 MET Z O   1  
ATOM 8462   C CB  . MET C 3 146 ? -114.316 -19.736 42.040  1.00 99.99  ? 149 MET Z CB  1  
ATOM 8463   C CG  . MET C 3 146 ? -113.547 -18.856 41.064  1.00 99.99  ? 149 MET Z CG  1  
ATOM 8464   S SD  . MET C 3 146 ? -113.712 -19.508 39.382  1.00 99.99  ? 149 MET Z SD  1  
ATOM 8465   C CE  . MET C 3 146 ? -112.762 -21.007 39.539  1.00 99.99  ? 149 MET Z CE  1  
ATOM 8466   N N   . ALA C 3 147 ? -116.853 -20.264 43.827  1.00 30.00  ? 150 ALA Z N   1  
ATOM 8467   C CA  . ALA C 3 147 ? -117.563 -21.082 44.813  1.00 30.00  ? 150 ALA Z CA  1  
ATOM 8468   C C   . ALA C 3 147 ? -118.861 -21.671 44.276  1.00 30.00  ? 150 ALA Z C   1  
ATOM 8469   O O   . ALA C 3 147 ? -119.026 -22.894 44.198  1.00 30.00  ? 150 ALA Z O   1  
ATOM 8470   C CB  . ALA C 3 147 ? -117.863 -20.240 46.071  1.00 30.00  ? 150 ALA Z CB  1  
ATOM 8471   N N   . GLY C 3 148 ? -119.781 -20.785 43.911  1.00 30.00  ? 151 GLY Z N   1  
ATOM 8472   C CA  . GLY C 3 148 ? -121.059 -21.218 43.393  1.00 30.00  ? 151 GLY Z CA  1  
ATOM 8473   C C   . GLY C 3 148 ? -122.098 -20.435 44.158  1.00 30.00  ? 151 GLY Z C   1  
ATOM 8474   O O   . GLY C 3 148 ? -121.753 -19.738 45.120  1.00 30.00  ? 151 GLY Z O   1  
ATOM 8475   N N   . PRO C 3 149 ? -123.386 -20.524 43.757  1.00 30.00  ? 152 PRO Z N   1  
ATOM 8476   C CA  . PRO C 3 149 ? -124.458 -19.790 44.446  1.00 30.00  ? 152 PRO Z CA  1  
ATOM 8477   C C   . PRO C 3 149 ? -124.779 -20.450 45.787  1.00 30.00  ? 152 PRO Z C   1  
ATOM 8478   O O   . PRO C 3 149 ? -125.234 -19.806 46.744  1.00 30.00  ? 152 PRO Z O   1  
ATOM 8479   C CB  . PRO C 3 149 ? -125.532 -19.980 43.432  1.00 99.99  ? 152 PRO Z CB  1  
ATOM 8480   C CG  . PRO C 3 149 ? -124.899 -20.744 42.292  1.00 99.99  ? 152 PRO Z CG  1  
ATOM 8481   C CD  . PRO C 3 149 ? -123.664 -21.001 42.471  1.00 99.99  ? 152 PRO Z CD  1  
ATOM 8482   N N   . TYR C 3 150 ? -124.521 -21.753 45.835  1.00 30.00  ? 153 TYR Z N   1  
ATOM 8483   C CA  . TYR C 3 150 ? -124.748 -22.550 47.031  1.00 30.00  ? 153 TYR Z CA  1  
ATOM 8484   C C   . TYR C 3 150 ? -123.441 -23.290 47.339  1.00 30.00  ? 153 TYR Z C   1  
ATOM 8485   O O   . TYR C 3 150 ? -123.076 -24.256 46.662  1.00 30.00  ? 153 TYR Z O   1  
ATOM 8486   C CB  . TYR C 3 150 ? -125.876 -23.546 46.784  1.00 99.99  ? 153 TYR Z CB  1  
ATOM 8487   C CG  . TYR C 3 150 ? -126.105 -24.367 48.030  1.00 99.99  ? 153 TYR Z CG  1  
ATOM 8488   C CD1 . TYR C 3 150 ? -126.903 -23.864 49.064  1.00 99.99  ? 153 TYR Z CD1 1  
ATOM 8489   C CD2 . TYR C 3 150 ? -125.516 -25.632 48.153  1.00 99.99  ? 153 TYR Z CD2 1  
ATOM 8490   C CE1 . TYR C 3 150 ? -127.117 -24.625 50.218  1.00 99.99  ? 153 TYR Z CE1 1  
ATOM 8491   C CE2 . TYR C 3 150 ? -125.730 -26.393 49.307  1.00 99.99  ? 153 TYR Z CE2 1  
ATOM 8492   C CZ  . TYR C 3 150 ? -126.528 -25.889 50.339  1.00 99.99  ? 153 TYR Z CZ  1  
ATOM 8493   O OH  . TYR C 3 150 ? -126.734 -26.632 51.464  1.00 99.99  ? 153 TYR Z OH  1  
ATOM 8494   N N   . PRO C 3 151 ? -122.702 -22.811 48.356  1.00 30.00  ? 154 PRO Z N   1  
ATOM 8495   C CA  . PRO C 3 151 ? -121.427 -23.387 48.797  1.00 30.00  ? 154 PRO Z CA  1  
ATOM 8496   C C   . PRO C 3 151 ? -121.528 -24.322 50.020  1.00 30.00  ? 154 PRO Z C   1  
ATOM 8497   O O   . PRO C 3 151 ? -121.929 -23.845 51.111  1.00 30.00  ? 154 PRO Z O   1  
ATOM 8498   C CB  . PRO C 3 151 ? -120.725 -22.119 49.132  1.00 99.99  ? 154 PRO Z CB  1  
ATOM 8499   C CG  . PRO C 3 151 ? -121.681 -21.002 48.783  1.00 99.99  ? 154 PRO Z CG  1  
ATOM 8500   C CD  . PRO C 3 151 ? -122.787 -21.413 48.294  1.00 99.99  ? 154 PRO Z CD  1  
ATOM 8501   O OXT . PRO C 3 151 ? -121.197 -25.523 49.881  1.00 30.00  ? 154 PRO Z OXT 1  
ATOM 8502   N N   . PHE A 1 1   ? -100.584 -23.476 13.201  1.00 30.00  ? 5   PHE C N   2  
ATOM 8503   C CA  . PHE A 1 1   ? -101.675 -23.936 14.118  1.00 30.00  ? 5   PHE C CA  2  
ATOM 8504   C C   . PHE A 1 1   ? -102.817 -22.929 14.011  1.00 30.00  ? 5   PHE C C   2  
ATOM 8505   O O   . PHE A 1 1   ? -103.835 -23.045 14.710  1.00 30.00  ? 5   PHE C O   2  
ATOM 8506   C CB  . PHE A 1 1   ? -101.156 -23.999 15.550  1.00 99.99  ? 5   PHE C CB  2  
ATOM 8507   C CG  . PHE A 1 1   ? -102.259 -24.464 16.467  1.00 99.99  ? 5   PHE C CG  2  
ATOM 8508   C CD1 . PHE A 1 1   ? -102.524 -25.833 16.606  1.00 99.99  ? 5   PHE C CD1 2  
ATOM 8509   C CD2 . PHE A 1 1   ? -103.018 -23.528 17.181  1.00 99.99  ? 5   PHE C CD2 2  
ATOM 8510   C CE1 . PHE A 1 1   ? -103.551 -26.264 17.456  1.00 99.99  ? 5   PHE C CE1 2  
ATOM 8511   C CE2 . PHE A 1 1   ? -104.042 -23.962 18.030  1.00 99.99  ? 5   PHE C CE2 2  
ATOM 8512   C CZ  . PHE A 1 1   ? -104.310 -25.327 18.168  1.00 99.99  ? 5   PHE C CZ  2  
ATOM 8513   N N   . SER A 1 2   ? -102.571 -21.964 13.139  1.00 30.00  ? 6   SER C N   2  
ATOM 8514   C CA  . SER A 1 2   ? -103.509 -20.873 12.846  1.00 30.00  ? 6   SER C CA  2  
ATOM 8515   C C   . SER A 1 2   ? -103.255 -19.684 13.782  1.00 30.00  ? 6   SER C C   2  
ATOM 8516   O O   . SER A 1 2   ? -103.974 -18.676 13.743  1.00 30.00  ? 6   SER C O   2  
ATOM 8517   C CB  . SER A 1 2   ? -104.943 -21.353 13.039  1.00 99.99  ? 6   SER C CB  2  
ATOM 8518   O OG  . SER A 1 2   ? -105.195 -22.463 12.171  1.00 99.99  ? 6   SER C OG  2  
ATOM 8519   N N   . ASP A 1 3   ? -102.230 -19.837 14.597  1.00 30.00  ? 7   ASP C N   2  
ATOM 8520   C CA  . ASP A 1 3   ? -101.848 -18.823 15.599  1.00 30.00  ? 7   ASP C CA  2  
ATOM 8521   C C   . ASP A 1 3   ? -101.141 -17.633 14.946  1.00 30.00  ? 7   ASP C C   2  
ATOM 8522   O O   . ASP A 1 3   ? -100.021 -17.758 14.429  1.00 30.00  ? 7   ASP C O   2  
ATOM 8523   C CB  . ASP A 1 3   ? -100.904 -19.442 16.626  1.00 99.99  ? 7   ASP C CB  2  
ATOM 8524   C CG  . ASP A 1 3   ? -99.798  -20.209 15.906  1.00 99.99  ? 7   ASP C CG  2  
ATOM 8525   O OD1 . ASP A 1 3   ? -100.157 -21.112 15.099  1.00 99.99  ? 7   ASP C OD1 2  
ATOM 8526   O OD2 . ASP A 1 3   ? -98.609  -19.888 16.167  1.00 99.99  ? 7   ASP C OD2 2  
ATOM 8527   N N   . PRO A 1 4   ? -101.827 -16.513 15.005  1.00 30.00  ? 8   PRO C N   2  
ATOM 8528   C CA  . PRO A 1 4   ? -101.334 -15.247 14.459  1.00 30.00  ? 8   PRO C CA  2  
ATOM 8529   C C   . PRO A 1 4   ? -99.884  -15.004 14.908  1.00 30.00  ? 8   PRO C C   2  
ATOM 8530   O O   . PRO A 1 4   ? -99.064  -14.447 14.175  1.00 30.00  ? 8   PRO C O   2  
ATOM 8531   C CB  . PRO A 1 4   ? -102.309 -14.334 15.115  1.00 99.99  ? 8   PRO C CB  2  
ATOM 8532   C CG  . PRO A 1 4   ? -103.250 -15.220 15.898  1.00 99.99  ? 8   PRO C CG  2  
ATOM 8533   C CD  . PRO A 1 4   ? -102.993 -16.463 15.784  1.00 99.99  ? 8   PRO C CD  2  
ATOM 8534   N N   . ASP A 1 5   ? -99.581  -15.445 16.111  1.00 30.00  ? 9   ASP C N   2  
ATOM 8535   C CA  . ASP A 1 5   ? -98.254  -15.240 16.723  1.00 30.00  ? 9   ASP C CA  2  
ATOM 8536   C C   . ASP A 1 5   ? -97.101  -15.882 15.911  1.00 30.00  ? 9   ASP C C   2  
ATOM 8537   O O   . ASP A 1 5   ? -95.925  -15.781 16.282  1.00 30.00  ? 9   ASP C O   2  
ATOM 8538   C CB  . ASP A 1 5   ? -98.226  -15.857 18.118  1.00 99.99  ? 9   ASP C CB  2  
ATOM 8539   C CG  . ASP A 1 5   ? -98.799  -17.272 18.063  1.00 99.99  ? 9   ASP C CG  2  
ATOM 8540   O OD1 . ASP A 1 5   ? -99.958  -17.404 17.590  1.00 99.99  ? 9   ASP C OD1 2  
ATOM 8541   O OD2 . ASP A 1 5   ? -98.069  -18.204 18.490  1.00 99.99  ? 9   ASP C OD2 2  
ATOM 8542   N N   . PHE A 1 6   ? -97.417  -16.527 14.795  1.00 30.00  ? 10  PHE C N   2  
ATOM 8543   C CA  . PHE A 1 6   ? -96.381  -17.244 14.004  1.00 30.00  ? 10  PHE C CA  2  
ATOM 8544   C C   . PHE A 1 6   ? -96.166  -16.661 12.597  1.00 30.00  ? 10  PHE C C   2  
ATOM 8545   O O   . PHE A 1 6   ? -95.658  -17.335 11.693  1.00 30.00  ? 10  PHE C O   2  
ATOM 8546   C CB  . PHE A 1 6   ? -96.782  -18.705 13.826  1.00 99.99  ? 10  PHE C CB  2  
ATOM 8547   C CG  . PHE A 1 6   ? -97.138  -18.961 12.382  1.00 99.99  ? 10  PHE C CG  2  
ATOM 8548   C CD1 . PHE A 1 6   ? -97.606  -17.911 11.582  1.00 99.99  ? 10  PHE C CD1 2  
ATOM 8549   C CD2 . PHE A 1 6   ? -96.998  -20.245 11.843  1.00 99.99  ? 10  PHE C CD2 2  
ATOM 8550   C CE1 . PHE A 1 6   ? -97.936  -18.147 10.242  1.00 99.99  ? 10  PHE C CE1 2  
ATOM 8551   C CE2 . PHE A 1 6   ? -97.330  -20.481 10.502  1.00 99.99  ? 10  PHE C CE2 2  
ATOM 8552   C CZ  . PHE A 1 6   ? -97.798  -19.430 9.702   1.00 99.99  ? 10  PHE C CZ  2  
ATOM 8553   N N   . GLN A 1 7   ? -96.524  -15.415 12.418  1.00 30.00  ? 11  GLN C N   2  
ATOM 8554   C CA  . GLN A 1 7   ? -96.411  -14.753 11.109  1.00 30.00  ? 11  GLN C CA  2  
ATOM 8555   C C   . GLN A 1 7   ? -94.988  -14.801 10.550  1.00 30.00  ? 11  GLN C C   2  
ATOM 8556   O O   . GLN A 1 7   ? -94.769  -15.295 9.439   1.00 30.00  ? 11  GLN C O   2  
ATOM 8557   C CB  . GLN A 1 7   ? -96.813  -13.288 11.232  1.00 99.99  ? 11  GLN C CB  2  
ATOM 8558   C CG  . GLN A 1 7   ? -97.268  -12.767 9.872   1.00 99.99  ? 11  GLN C CG  2  
ATOM 8559   C CD  . GLN A 1 7   ? -96.081  -12.305 9.037   1.00 99.99  ? 11  GLN C CD  2  
ATOM 8560   O OE1 . GLN A 1 7   ? -94.940  -12.377 9.484   1.00 99.99  ? 11  GLN C OE1 2  
ATOM 8561   N NE2 . GLN A 1 7   ? -96.359  -11.828 7.820   1.00 99.99  ? 11  GLN C NE2 2  
ATOM 8562   N N   . TYR A 1 8   ? -94.021  -14.300 11.307  1.00 30.00  ? 12  TYR C N   2  
ATOM 8563   C CA  . TYR A 1 8   ? -92.639  -14.307 10.841  1.00 30.00  ? 12  TYR C CA  2  
ATOM 8564   C C   . TYR A 1 8   ? -91.883  -15.374 11.582  1.00 30.00  ? 12  TYR C C   2  
ATOM 8565   O O   . TYR A 1 8   ? -90.701  -15.200 11.892  1.00 30.00  ? 12  TYR C O   2  
ATOM 8566   C CB  . TYR A 1 8   ? -91.998  -12.949 11.103  1.00 99.99  ? 12  TYR C CB  2  
ATOM 8567   C CG  . TYR A 1 8   ? -90.954  -13.083 12.183  1.00 99.99  ? 12  TYR C CG  2  
ATOM 8568   C CD1 . TYR A 1 8   ? -91.065  -14.098 13.139  1.00 99.99  ? 12  TYR C CD1 2  
ATOM 8569   C CD2 . TYR A 1 8   ? -89.875  -12.192 12.230  1.00 99.99  ? 12  TYR C CD2 2  
ATOM 8570   C CE1 . TYR A 1 8   ? -90.096  -14.224 14.143  1.00 99.99  ? 12  TYR C CE1 2  
ATOM 8571   C CE2 . TYR A 1 8   ? -88.907  -12.316 13.234  1.00 99.99  ? 12  TYR C CE2 2  
ATOM 8572   C CZ  . TYR A 1 8   ? -89.018  -13.332 14.191  1.00 99.99  ? 12  TYR C CZ  2  
ATOM 8573   O OH  . TYR A 1 8   ? -88.076  -13.455 15.166  1.00 99.99  ? 12  TYR C OH  2  
ATOM 8574   N N   . LEU A 1 9   ? -92.543  -16.481 11.880  1.00 30.00  ? 13  LEU C N   2  
ATOM 8575   C CA  . LEU A 1 9   ? -91.865  -17.536 12.614  1.00 30.00  ? 13  LEU C CA  2  
ATOM 8576   C C   . LEU A 1 9   ? -92.011  -18.942 12.044  1.00 30.00  ? 13  LEU C C   2  
ATOM 8577   O O   . LEU A 1 9   ? -91.114  -19.764 12.216  1.00 30.00  ? 13  LEU C O   2  
ATOM 8578   C CB  . LEU A 1 9   ? -92.402  -17.602 14.041  1.00 99.99  ? 13  LEU C CB  2  
ATOM 8579   C CG  . LEU A 1 9   ? -91.509  -16.778 14.960  1.00 99.99  ? 13  LEU C CG  2  
ATOM 8580   C CD1 . LEU A 1 9   ? -91.838  -17.102 16.413  1.00 99.99  ? 13  LEU C CD1 2  
ATOM 8581   C CD2 . LEU A 1 9   ? -90.047  -17.109 14.680  1.00 99.99  ? 13  LEU C CD2 2  
ATOM 8582   N N   . ALA A 1 10  ? -93.126  -19.218 11.371  1.00 30.00  ? 14  ALA C N   2  
ATOM 8583   C CA  . ALA A 1 10  ? -93.371  -20.543 10.797  1.00 30.00  ? 14  ALA C CA  2  
ATOM 8584   C C   . ALA A 1 10  ? -93.246  -20.595 9.279   1.00 30.00  ? 14  ALA C C   2  
ATOM 8585   O O   . ALA A 1 10  ? -93.775  -19.723 8.583   1.00 30.00  ? 14  ALA C O   2  
ATOM 8586   C CB  . ALA A 1 10  ? -94.747  -21.024 11.199  1.00 30.00  ? 14  ALA C CB  2  
ATOM 8587   N N   . VAL A 1 11  ? -92.549  -21.620 8.780   1.00 30.00  ? 15  VAL C N   2  
ATOM 8588   C CA  . VAL A 1 11  ? -92.350  -21.799 7.336   1.00 30.00  ? 15  VAL C CA  2  
ATOM 8589   C C   . VAL A 1 11  ? -93.700  -21.940 6.650   1.00 30.00  ? 15  VAL C C   2  
ATOM 8590   O O   . VAL A 1 11  ? -94.530  -22.767 7.044   1.00 30.00  ? 15  VAL C O   2  
ATOM 8591   C CB  . VAL A 1 11  ? -91.520  -23.051 7.079   1.00 99.99  ? 15  VAL C CB  2  
ATOM 8592   C CG1 . VAL A 1 11  ? -90.162  -22.911 7.759   1.00 99.99  ? 15  VAL C CG1 2  
ATOM 8593   C CG2 . VAL A 1 11  ? -92.247  -24.270 7.640   1.00 99.99  ? 15  VAL C CG2 2  
ATOM 8594   N N   . ASP A 1 12  ? -93.911  -21.130 5.623   1.00 30.00  ? 16  ASP C N   2  
ATOM 8595   C CA  . ASP A 1 12  ? -95.146  -21.101 4.844   1.00 30.00  ? 16  ASP C CA  2  
ATOM 8596   C C   . ASP A 1 12  ? -95.659  -22.460 4.337   1.00 30.00  ? 16  ASP C C   2  
ATOM 8597   O O   . ASP A 1 12  ? -94.913  -23.459 4.411   1.00 30.00  ? 16  ASP C O   2  
ATOM 8598   C CB  . ASP A 1 12  ? -94.954  -20.238 3.599   1.00 99.99  ? 16  ASP C CB  2  
ATOM 8599   C CG  . ASP A 1 12  ? -93.656  -20.635 2.899   1.00 99.99  ? 16  ASP C CG  2  
ATOM 8600   O OD1 . ASP A 1 12  ? -92.598  -20.589 3.583   1.00 99.99  ? 16  ASP C OD1 2  
ATOM 8601   O OD2 . ASP A 1 12  ? -93.734  -20.976 1.691   1.00 99.99  ? 16  ASP C OD2 2  
ATOM 8602   N N   . GLN A 1 20  ? -93.923  -27.074 -2.728  1.00 30.00  ? 24  GLN C N   2  
ATOM 8603   C CA  . GLN A 1 20  ? -92.493  -27.447 -2.838  1.00 30.00  ? 24  GLN C CA  2  
ATOM 8604   C C   . GLN A 1 20  ? -92.338  -28.719 -3.711  1.00 30.00  ? 24  GLN C C   2  
ATOM 8605   O O   . GLN A 1 20  ? -91.960  -29.790 -3.224  1.00 30.00  ? 24  GLN C O   2  
ATOM 8606   C CB  . GLN A 1 20  ? -91.921  -27.724 -1.451  1.00 99.99  ? 24  GLN C CB  2  
ATOM 8607   C CG  . GLN A 1 20  ? -91.192  -29.062 -1.461  1.00 99.99  ? 24  GLN C CG  2  
ATOM 8608   C CD  . GLN A 1 20  ? -92.170  -30.222 -1.566  1.00 99.99  ? 24  GLN C CD  2  
ATOM 8609   O OE1 . GLN A 1 20  ? -93.381  -30.013 -1.633  1.00 99.99  ? 24  GLN C OE1 2  
ATOM 8610   N NE2 . GLN A 1 20  ? -91.644  -31.449 -1.585  1.00 99.99  ? 24  GLN C NE2 2  
ATOM 8611   N N   . THR A 1 21  ? -92.614  -28.618 -5.026  1.00 30.00  ? 25  THR C N   2  
ATOM 8612   C CA  . THR A 1 21  ? -92.540  -29.829 -5.896  1.00 30.00  ? 25  THR C CA  2  
ATOM 8613   C C   . THR A 1 21  ? -92.299  -29.562 -7.400  1.00 30.00  ? 25  THR C C   2  
ATOM 8614   O O   . THR A 1 21  ? -92.427  -28.424 -7.883  1.00 30.00  ? 25  THR C O   2  
ATOM 8615   C CB  . THR A 1 21  ? -93.846  -30.612 -5.807  1.00 99.99  ? 25  THR C CB  2  
ATOM 8616   O OG1 . THR A 1 21  ? -94.027  -31.093 -4.472  1.00 99.99  ? 25  THR C OG1 2  
ATOM 8617   C CG2 . THR A 1 21  ? -93.799  -31.792 -6.771  1.00 99.99  ? 25  THR C CG2 2  
ATOM 8618   N N   . ALA A 1 22  ? -91.951  -30.691 -8.044  1.00 30.00  ? 26  ALA C N   2  
ATOM 8619   C CA  . ALA A 1 22  ? -91.725  -30.830 -9.504  1.00 30.00  ? 26  ALA C CA  2  
ATOM 8620   C C   . ALA A 1 22  ? -90.262  -30.586 -9.925  1.00 30.00  ? 26  ALA C C   2  
ATOM 8621   O O   . ALA A 1 22  ? -89.326  -30.810 -9.139  1.00 30.00  ? 26  ALA C O   2  
ATOM 8622   C CB  . ALA A 1 22  ? -92.589  -29.838 -10.277 1.00 30.00  ? 26  ALA C CB  2  
ATOM 8623   N N   . ALA A 1 23  ? -90.185  -30.144 -11.175 1.00 30.00  ? 27  ALA C N   2  
ATOM 8624   C CA  . ALA A 1 23  ? -88.949  -29.807 -11.909 1.00 30.00  ? 27  ALA C CA  2  
ATOM 8625   C C   . ALA A 1 23  ? -87.706  -29.928 -11.029 1.00 30.00  ? 27  ALA C C   2  
ATOM 8626   O O   . ALA A 1 23  ? -87.175  -28.922 -10.535 1.00 30.00  ? 27  ALA C O   2  
ATOM 8627   C CB  . ALA A 1 23  ? -89.020  -28.368 -12.423 1.00 30.00  ? 27  ALA C CB  2  
ATOM 8628   N N   . PHE A 1 24  ? -87.266  -31.162 -10.872 1.00 30.00  ? 28  PHE C N   2  
ATOM 8629   C CA  . PHE A 1 24  ? -86.078  -31.472 -10.065 1.00 30.00  ? 28  PHE C CA  2  
ATOM 8630   C C   . PHE A 1 24  ? -85.552  -32.873 -10.380 1.00 30.00  ? 28  PHE C C   2  
ATOM 8631   O O   . PHE A 1 24  ? -86.143  -33.885 -9.969  1.00 30.00  ? 28  PHE C O   2  
ATOM 8632   C CB  . PHE A 1 24  ? -86.427  -31.407 -8.582  1.00 99.99  ? 28  PHE C CB  2  
ATOM 8633   C CG  . PHE A 1 24  ? -85.202  -31.725 -7.760  1.00 99.99  ? 28  PHE C CG  2  
ATOM 8634   C CD1 . PHE A 1 24  ? -84.263  -30.724 -7.484  1.00 99.99  ? 28  PHE C CD1 2  
ATOM 8635   C CD2 . PHE A 1 24  ? -85.003  -33.023 -7.274  1.00 99.99  ? 28  PHE C CD2 2  
ATOM 8636   C CE1 . PHE A 1 24  ? -83.127  -31.019 -6.722  1.00 99.99  ? 28  PHE C CE1 2  
ATOM 8637   C CE2 . PHE A 1 24  ? -83.866  -33.319 -6.512  1.00 99.99  ? 28  PHE C CE2 2  
ATOM 8638   C CZ  . PHE A 1 24  ? -82.928  -32.316 -6.236  1.00 99.99  ? 28  PHE C CZ  2  
ATOM 8639   N N   . ASP A 1 25  ? -84.448  -32.873 -11.106 1.00 30.00  ? 29  ASP C N   2  
ATOM 8640   C CA  . ASP A 1 25  ? -83.723  -34.097 -11.491 1.00 30.00  ? 29  ASP C CA  2  
ATOM 8641   C C   . ASP A 1 25  ? -82.439  -34.165 -10.664 1.00 30.00  ? 29  ASP C C   2  
ATOM 8642   O O   . ASP A 1 25  ? -81.530  -33.341 -10.822 1.00 30.00  ? 29  ASP C O   2  
ATOM 8643   C CB  . ASP A 1 25  ? -83.387  -34.055 -12.977 1.00 99.99  ? 29  ASP C CB  2  
ATOM 8644   C CG  . ASP A 1 25  ? -82.863  -35.415 -13.422 1.00 99.99  ? 29  ASP C CG  2  
ATOM 8645   O OD1 . ASP A 1 25  ? -81.657  -35.684 -13.164 1.00 99.99  ? 29  ASP C OD1 2  
ATOM 8646   O OD2 . ASP A 1 25  ? -83.670  -36.180 -14.014 1.00 99.99  ? 29  ASP C OD2 2  
ATOM 8647   N N   . GLY A 1 26  ? -82.407  -35.158 -9.795  1.00 30.00  ? 30  GLY C N   2  
ATOM 8648   C CA  . GLY A 1 26  ? -81.299  -35.361 -8.843  1.00 30.00  ? 30  GLY C CA  2  
ATOM 8649   C C   . GLY A 1 26  ? -79.954  -35.637 -9.534  1.00 30.00  ? 30  GLY C C   2  
ATOM 8650   O O   . GLY A 1 26  ? -78.927  -35.849 -8.872  1.00 30.00  ? 30  GLY C O   2  
ATOM 8651   N N   . LYS A 1 27  ? -79.942  -35.628 -10.855 1.00 30.00  ? 31  LYS C N   2  
ATOM 8652   C CA  . LYS A 1 27  ? -78.705  -35.924 -11.608 1.00 30.00  ? 31  LYS C CA  2  
ATOM 8653   C C   . LYS A 1 27  ? -78.349  -34.815 -12.601 1.00 30.00  ? 31  LYS C C   2  
ATOM 8654   O O   . LYS A 1 27  ? -77.240  -34.780 -13.154 1.00 30.00  ? 31  LYS C O   2  
ATOM 8655   C CB  . LYS A 1 27  ? -78.870  -37.221 -12.392 1.00 99.99  ? 31  LYS C CB  2  
ATOM 8656   C CG  . LYS A 1 27  ? -77.556  -37.570 -13.084 1.00 99.99  ? 31  LYS C CG  2  
ATOM 8657   C CD  . LYS A 1 27  ? -77.568  -39.041 -13.487 1.00 99.99  ? 31  LYS C CD  2  
ATOM 8658   C CE  . LYS A 1 27  ? -76.449  -39.304 -14.488 1.00 99.99  ? 31  LYS C CE  2  
ATOM 8659   N NZ  . LYS A 1 27  ? -75.252  -39.771 -13.773 1.00 99.99  ? 31  LYS C NZ  2  
ATOM 8660   N N   . LYS A 1 28  ? -79.294  -33.931 -12.820 1.00 30.00  ? 32  LYS C N   2  
ATOM 8661   C CA  . LYS A 1 28  ? -79.110  -32.814 -13.751 1.00 30.00  ? 32  LYS C CA  2  
ATOM 8662   C C   . LYS A 1 28  ? -78.827  -31.523 -12.983 1.00 30.00  ? 32  LYS C C   2  
ATOM 8663   O O   . LYS A 1 28  ? -77.934  -30.743 -13.355 1.00 30.00  ? 32  LYS C O   2  
ATOM 8664   C CB  . LYS A 1 28  ? -80.370  -32.623 -14.589 1.00 99.99  ? 32  LYS C CB  2  
ATOM 8665   C CG  . LYS A 1 28  ? -80.136  -31.526 -15.621 1.00 99.99  ? 32  LYS C CG  2  
ATOM 8666   C CD  . LYS A 1 28  ? -81.184  -31.631 -16.722 1.00 99.99  ? 32  LYS C CD  2  
ATOM 8667   C CE  . LYS A 1 28  ? -81.192  -30.344 -17.543 1.00 99.99  ? 32  LYS C CE  2  
ATOM 8668   N NZ  . LYS A 1 28  ? -80.317  -30.503 -18.712 1.00 99.99  ? 32  LYS C NZ  2  
ATOM 8669   N N   . ASN A 1 29  ? -79.596  -31.355 -11.926 1.00 30.00  ? 33  ASN C N   2  
ATOM 8670   C CA  . ASN A 1 29  ? -79.549  -30.156 -11.078 1.00 30.00  ? 33  ASN C CA  2  
ATOM 8671   C C   . ASN A 1 29  ? -78.421  -30.209 -10.039 1.00 30.00  ? 33  ASN C C   2  
ATOM 8672   O O   . ASN A 1 29  ? -78.239  -31.205 -9.338  1.00 30.00  ? 33  ASN C O   2  
ATOM 8673   C CB  . ASN A 1 29  ? -80.864  -30.006 -10.320 1.00 99.99  ? 33  ASN C CB  2  
ATOM 8674   C CG  . ASN A 1 29  ? -81.126  -28.550 -9.961  1.00 99.99  ? 33  ASN C CG  2  
ATOM 8675   O OD1 . ASN A 1 29  ? -81.841  -28.263 -9.003  1.00 99.99  ? 33  ASN C OD1 2  
ATOM 8676   N ND2 . ASN A 1 29  ? -80.543  -27.629 -10.732 1.00 99.99  ? 33  ASN C ND2 2  
ATOM 8677   N N   . CYS A 1 30  ? -77.664  -29.122 -9.932  1.00 30.00  ? 34  CYS C N   2  
ATOM 8678   C CA  . CYS A 1 30  ? -76.556  -29.076 -8.988  1.00 30.00  ? 34  CYS C CA  2  
ATOM 8679   C C   . CYS A 1 30  ? -76.136  -27.627 -8.661  1.00 30.00  ? 34  CYS C C   2  
ATOM 8680   O O   . CYS A 1 30  ? -76.676  -26.651 -9.205  1.00 30.00  ? 34  CYS C O   2  
ATOM 8681   C CB  . CYS A 1 30  ? -75.348  -29.799 -9.570  1.00 99.99  ? 34  CYS C CB  2  
ATOM 8682   S SG  . CYS A 1 30  ? -73.907  -29.943 -8.486  1.00 99.99  ? 34  CYS C SG  2  
ATOM 8683   N N   . TRP A 1 31  ? -75.157  -27.508 -7.768  1.00 30.00  ? 35  TRP C N   2  
ATOM 8684   C CA  . TRP A 1 31  ? -74.649  -26.215 -7.353  1.00 30.00  ? 35  TRP C CA  2  
ATOM 8685   C C   . TRP A 1 31  ? -73.307  -25.951 -8.010  1.00 30.00  ? 35  TRP C C   2  
ATOM 8686   O O   . TRP A 1 31  ? -72.357  -26.731 -7.829  1.00 30.00  ? 35  TRP C O   2  
ATOM 8687   C CB  . TRP A 1 31  ? -74.475  -26.188 -5.836  1.00 99.99  ? 35  TRP C CB  2  
ATOM 8688   C CG  . TRP A 1 31  ? -75.759  -26.208 -5.045  1.00 99.99  ? 35  TRP C CG  2  
ATOM 8689   C CD1 . TRP A 1 31  ? -76.489  -27.284 -4.719  1.00 99.99  ? 35  TRP C CD1 2  
ATOM 8690   C CD2 . TRP A 1 31  ? -76.444  -25.114 -4.499  1.00 99.99  ? 35  TRP C CD2 2  
ATOM 8691   N NE1 . TRP A 1 31  ? -77.613  -26.816 -3.971  1.00 99.99  ? 35  TRP C NE1 2  
ATOM 8692   C CE2 . TRP A 1 31  ? -77.543  -25.512 -3.864  1.00 99.99  ? 35  TRP C CE2 2  
ATOM 8693   C CE3 . TRP A 1 31  ? -76.123  -23.752 -4.542  1.00 99.99  ? 35  TRP C CE3 2  
ATOM 8694   C CZ2 . TRP A 1 31  ? -78.434  -24.652 -3.216  1.00 99.99  ? 35  TRP C CZ2 2  
ATOM 8695   C CZ3 . TRP A 1 31  ? -77.008  -22.866 -3.896  1.00 99.99  ? 35  TRP C CZ3 2  
ATOM 8696   C CH2 . TRP A 1 31  ? -78.117  -23.299 -3.259  1.00 99.99  ? 35  TRP C CH2 2  
ATOM 8697   N N   . VAL A 1 32  ? -73.218  -24.858 -8.767  1.00 30.00  ? 36  VAL C N   2  
ATOM 8698   C CA  . VAL A 1 32  ? -71.960  -24.490 -9.421  1.00 30.00  ? 36  VAL C CA  2  
ATOM 8699   C C   . VAL A 1 32  ? -71.478  -23.147 -8.890  1.00 30.00  ? 36  VAL C C   2  
ATOM 8700   O O   . VAL A 1 32  ? -72.263  -22.211 -8.751  1.00 30.00  ? 36  VAL C O   2  
ATOM 8701   C CB  . VAL A 1 32  ? -72.168  -24.390 -10.928 1.00 99.99  ? 36  VAL C CB  2  
ATOM 8702   C CG1 . VAL A 1 32  ? -72.641  -25.737 -11.467 1.00 99.99  ? 36  VAL C CG1 2  
ATOM 8703   C CG2 . VAL A 1 32  ? -73.219  -23.326 -11.227 1.00 99.99  ? 36  VAL C CG2 2  
ATOM 8704   N N   . PRO A 1 33  ? -70.183  -23.042 -8.563  1.00 30.00  ? 37  PRO C N   2  
ATOM 8705   C CA  . PRO A 1 33  ? -69.615  -21.787 -8.048  1.00 30.00  ? 37  PRO C CA  2  
ATOM 8706   C C   . PRO A 1 33  ? -70.019  -20.529 -8.817  1.00 30.00  ? 37  PRO C C   2  
ATOM 8707   O O   . PRO A 1 33  ? -70.199  -20.554 -10.044 1.00 30.00  ? 37  PRO C O   2  
ATOM 8708   C CB  . PRO A 1 33  ? -68.177  -22.110 -8.243  1.00 99.99  ? 37  PRO C CB  2  
ATOM 8709   C CG  . PRO A 1 33  ? -68.131  -23.516 -8.788  1.00 99.99  ? 37  PRO C CG  2  
ATOM 8710   C CD  . PRO A 1 33  ? -69.280  -24.053 -8.918  1.00 99.99  ? 37  PRO C CD  2  
ATOM 8711   N N   . ASP A 1 34  ? -70.162  -19.428 -8.085  1.00 30.00  ? 38  ASP C N   2  
ATOM 8712   C CA  . ASP A 1 34  ? -70.527  -18.148 -8.680  1.00 30.00  ? 38  ASP C CA  2  
ATOM 8713   C C   . ASP A 1 34  ? -69.711  -17.042 -8.010  1.00 30.00  ? 38  ASP C C   2  
ATOM 8714   O O   . ASP A 1 34  ? -69.206  -17.233 -6.904  1.00 30.00  ? 38  ASP C O   2  
ATOM 8715   C CB  . ASP A 1 34  ? -72.017  -17.888 -8.469  1.00 99.99  ? 38  ASP C CB  2  
ATOM 8716   C CG  . ASP A 1 34  ? -72.445  -16.682 -9.300  1.00 99.99  ? 38  ASP C CG  2  
ATOM 8717   O OD1 . ASP A 1 34  ? -72.186  -15.541 -8.836  1.00 99.99  ? 38  ASP C OD1 2  
ATOM 8718   O OD2 . ASP A 1 34  ? -73.026  -16.913 -10.396 1.00 99.99  ? 38  ASP C OD2 2  
ATOM 8719   N N   . GLU A 1 35  ? -69.569  -15.894 -8.677  1.00 30.00  ? 39  GLU C N   2  
ATOM 8720   C CA  . GLU A 1 35  ? -68.802  -14.769 -8.110  1.00 30.00  ? 39  GLU C CA  2  
ATOM 8721   C C   . GLU A 1 35  ? -69.712  -13.769 -7.371  1.00 30.00  ? 39  GLU C C   2  
ATOM 8722   O O   . GLU A 1 35  ? -69.293  -13.131 -6.405  1.00 30.00  ? 39  GLU C O   2  
ATOM 8723   C CB  . GLU A 1 35  ? -68.081  -14.021 -9.225  1.00 99.99  ? 39  GLU C CB  2  
ATOM 8724   C CG  . GLU A 1 35  ? -69.084  -13.548 -10.247 1.00 99.99  ? 39  GLU C CG  2  
ATOM 8725   C CD  . GLU A 1 35  ? -69.484  -14.720 -11.144 1.00 99.99  ? 39  GLU C CD  2  
ATOM 8726   O OE1 . GLU A 1 35  ? -70.470  -15.413 -10.779 1.00 99.99  ? 39  GLU C OE1 2  
ATOM 8727   O OE2 . GLU A 1 35  ? -68.802  -14.909 -12.186 1.00 99.99  ? 39  GLU C OE2 2  
ATOM 8728   N N   . LYS A 1 36  ? -70.949  -13.650 -7.843  1.00 30.00  ? 40  LYS C N   2  
ATOM 8729   C CA  . LYS A 1 36  ? -71.939  -12.750 -7.254  1.00 30.00  ? 40  LYS C CA  2  
ATOM 8730   C C   . LYS A 1 36  ? -72.736  -13.458 -6.156  1.00 30.00  ? 40  LYS C C   2  
ATOM 8731   O O   . LYS A 1 36  ? -72.845  -12.957 -5.040  1.00 30.00  ? 40  LYS C O   2  
ATOM 8732   C CB  . LYS A 1 36  ? -72.909  -12.271 -8.328  1.00 99.99  ? 40  LYS C CB  2  
ATOM 8733   C CG  . LYS A 1 36  ? -73.876  -11.258 -7.727  1.00 99.99  ? 40  LYS C CG  2  
ATOM 8734   C CD  . LYS A 1 36  ? -74.537  -10.458 -8.845  1.00 99.99  ? 40  LYS C CD  2  
ATOM 8735   C CE  . LYS A 1 36  ? -75.753  -9.721  -8.292  1.00 99.99  ? 40  LYS C CE  2  
ATOM 8736   N NZ  . LYS A 1 36  ? -75.363  -8.359  -7.896  1.00 99.99  ? 40  LYS C NZ  2  
ATOM 8737   N N   . GLU A 1 37  ? -73.284  -14.624 -6.492  1.00 30.00  ? 41  GLU C N   2  
ATOM 8738   C CA  . GLU A 1 37  ? -74.095  -15.414 -5.569  1.00 30.00  ? 41  GLU C CA  2  
ATOM 8739   C C   . GLU A 1 37  ? -73.396  -16.506 -4.775  1.00 30.00  ? 41  GLU C C   2  
ATOM 8740   O O   . GLU A 1 37  ? -74.043  -17.200 -3.985  1.00 30.00  ? 41  GLU C O   2  
ATOM 8741   C CB  . GLU A 1 37  ? -75.205  -16.126 -6.334  1.00 99.99  ? 41  GLU C CB  2  
ATOM 8742   C CG  . GLU A 1 37  ? -76.445  -16.199 -5.477  1.00 99.99  ? 41  GLU C CG  2  
ATOM 8743   C CD  . GLU A 1 37  ? -76.167  -17.077 -4.257  1.00 99.99  ? 41  GLU C CD  2  
ATOM 8744   O OE1 . GLU A 1 37  ? -75.721  -16.508 -3.227  1.00 99.99  ? 41  GLU C OE1 2  
ATOM 8745   O OE2 . GLU A 1 37  ? -76.407  -18.310 -4.371  1.00 99.99  ? 41  GLU C OE2 2  
ATOM 8746   N N   . GLY A 1 38  ? -72.094  -16.676 -4.974  1.00 30.00  ? 42  GLY C N   2  
ATOM 8747   C CA  . GLY A 1 38  ? -71.382  -17.718 -4.239  1.00 30.00  ? 42  GLY C CA  2  
ATOM 8748   C C   . GLY A 1 38  ? -71.574  -19.097 -4.869  1.00 30.00  ? 42  GLY C C   2  
ATOM 8749   O O   . GLY A 1 38  ? -70.611  -19.864 -5.015  1.00 30.00  ? 42  GLY C O   2  
ATOM 8750   N N   . PHE A 1 39  ? -72.821  -19.401 -5.235  1.00 30.00  ? 43  PHE C N   2  
ATOM 8751   C CA  . PHE A 1 39  ? -73.188  -20.668 -5.859  1.00 30.00  ? 43  PHE C CA  2  
ATOM 8752   C C   . PHE A 1 39  ? -74.400  -20.431 -6.744  1.00 30.00  ? 43  PHE C C   2  
ATOM 8753   O O   . PHE A 1 39  ? -75.278  -19.645 -6.398  1.00 30.00  ? 43  PHE C O   2  
ATOM 8754   C CB  . PHE A 1 39  ? -73.520  -21.697 -4.784  1.00 99.99  ? 43  PHE C CB  2  
ATOM 8755   C CG  . PHE A 1 39  ? -72.291  -21.976 -3.955  1.00 99.99  ? 43  PHE C CG  2  
ATOM 8756   C CD1 . PHE A 1 39  ? -72.018  -21.197 -2.825  1.00 99.99  ? 43  PHE C CD1 2  
ATOM 8757   C CD2 . PHE A 1 39  ? -71.422  -23.015 -4.315  1.00 99.99  ? 43  PHE C CD2 2  
ATOM 8758   C CE1 . PHE A 1 39  ? -70.876  -21.455 -2.052  1.00 99.99  ? 43  PHE C CE1 2  
ATOM 8759   C CE2 . PHE A 1 39  ? -70.282  -23.272 -3.545  1.00 99.99  ? 43  PHE C CE2 2  
ATOM 8760   C CZ  . PHE A 1 39  ? -70.010  -22.495 -2.415  1.00 99.99  ? 43  PHE C CZ  2  
ATOM 8761   N N   . ALA A 1 40  ? -74.451  -21.110 -7.885  1.00 30.00  ? 44  ALA C N   2  
ATOM 8762   C CA  . ALA A 1 40  ? -75.572  -20.939 -8.792  1.00 30.00  ? 44  ALA C CA  2  
ATOM 8763   C C   . ALA A 1 40  ? -76.266  -22.242 -9.082  1.00 30.00  ? 44  ALA C C   2  
ATOM 8764   O O   . ALA A 1 40  ? -75.635  -23.302 -9.116  1.00 30.00  ? 44  ALA C O   2  
ATOM 8765   C CB  . ALA A 1 40  ? -75.092  -20.328 -10.086 1.00 30.00  ? 44  ALA C CB  2  
ATOM 8766   N N   . SER A 1 41  ? -77.578  -22.152 -9.286  1.00 30.00  ? 45  SER C N   2  
ATOM 8767   C CA  . SER A 1 41  ? -78.405  -23.309 -9.586  1.00 30.00  ? 45  SER C CA  2  
ATOM 8768   C C   . SER A 1 41  ? -78.113  -23.680 -11.022 1.00 30.00  ? 45  SER C C   2  
ATOM 8769   O O   . SER A 1 41  ? -78.411  -22.917 -11.945 1.00 30.00  ? 45  SER C O   2  
ATOM 8770   C CB  . SER A 1 41  ? -79.878  -22.956 -9.405  1.00 99.99  ? 45  SER C CB  2  
ATOM 8771   O OG  . SER A 1 41  ? -80.270  -22.019 -10.412 1.00 99.99  ? 45  SER C OG  2  
ATOM 8772   N N   . ALA A 1 42  ? -77.529  -24.859 -11.209 1.00 30.00  ? 46  ALA C N   2  
ATOM 8773   C CA  . ALA A 1 42  ? -77.195  -25.303 -12.546 1.00 30.00  ? 46  ALA C CA  2  
ATOM 8774   C C   . ALA A 1 42  ? -77.829  -26.628 -12.907 1.00 30.00  ? 46  ALA C C   2  
ATOM 8775   O O   . ALA A 1 42  ? -78.211  -27.416 -12.035 1.00 30.00  ? 46  ALA C O   2  
ATOM 8776   C CB  . ALA A 1 42  ? -75.693  -25.404 -12.680 1.00 30.00  ? 46  ALA C CB  2  
ATOM 8777   N N   . GLU A 1 43  ? -77.942  -26.845 -14.212 1.00 30.00  ? 47  GLU C N   2  
ATOM 8778   C CA  . GLU A 1 43  ? -78.496  -28.066 -14.786 1.00 30.00  ? 47  GLU C CA  2  
ATOM 8779   C C   . GLU A 1 43  ? -77.471  -28.534 -15.813 1.00 30.00  ? 47  GLU C C   2  
ATOM 8780   O O   . GLU A 1 43  ? -77.255  -27.861 -16.828 1.00 30.00  ? 47  GLU C O   2  
ATOM 8781   C CB  . GLU A 1 43  ? -79.842  -27.768 -15.439 1.00 99.99  ? 47  GLU C CB  2  
ATOM 8782   C CG  . GLU A 1 43  ? -79.858  -28.328 -16.840 1.00 99.99  ? 47  GLU C CG  2  
ATOM 8783   C CD  . GLU A 1 43  ? -78.937  -27.501 -17.732 1.00 99.99  ? 47  GLU C CD  2  
ATOM 8784   O OE1 . GLU A 1 43  ? -77.732  -27.857 -17.807 1.00 99.99  ? 47  GLU C OE1 2  
ATOM 8785   O OE2 . GLU A 1 43  ? -79.447  -26.513 -18.328 1.00 99.99  ? 47  GLU C OE2 2  
ATOM 8786   N N   . ILE A 1 44  ? -76.843  -29.680 -15.544 1.00 30.00  ? 48  ILE C N   2  
ATOM 8787   C CA  . ILE A 1 44  ? -75.827  -30.238 -16.442 1.00 30.00  ? 48  ILE C CA  2  
ATOM 8788   C C   . ILE A 1 44  ? -76.316  -30.516 -17.858 1.00 30.00  ? 48  ILE C C   2  
ATOM 8789   O O   . ILE A 1 44  ? -77.451  -30.941 -18.081 1.00 30.00  ? 48  ILE C O   2  
ATOM 8790   C CB  . ILE A 1 44  ? -75.317  -31.563 -15.888 1.00 99.99  ? 48  ILE C CB  2  
ATOM 8791   C CG1 . ILE A 1 44  ? -76.291  -32.679 -16.256 1.00 99.99  ? 48  ILE C CG1 2  
ATOM 8792   C CG2 . ILE A 1 44  ? -75.204  -31.472 -14.370 1.00 99.99  ? 48  ILE C CG2 2  
ATOM 8793   C CD1 . ILE A 1 44  ? -77.297  -32.869 -15.127 1.00 99.99  ? 48  ILE C CD1 2  
ATOM 8794   N N   . GLN A 1 45  ? -75.433  -30.282 -18.815 1.00 30.00  ? 49  GLN C N   2  
ATOM 8795   C CA  . GLN A 1 45  ? -75.754  -30.494 -20.214 1.00 30.00  ? 49  GLN C CA  2  
ATOM 8796   C C   . GLN A 1 45  ? -74.897  -31.579 -20.841 1.00 30.00  ? 49  GLN C C   2  
ATOM 8797   O O   . GLN A 1 45  ? -75.412  -32.467 -21.529 1.00 30.00  ? 49  GLN C O   2  
ATOM 8798   C CB  . GLN A 1 45  ? -75.524  -29.204 -20.997 1.00 99.99  ? 49  GLN C CB  2  
ATOM 8799   C CG  . GLN A 1 45  ? -76.505  -28.139 -20.520 1.00 99.99  ? 49  GLN C CG  2  
ATOM 8800   C CD  . GLN A 1 45  ? -77.920  -28.444 -20.988 1.00 99.99  ? 49  GLN C CD  2  
ATOM 8801   O OE1 . GLN A 1 45  ? -78.153  -29.448 -21.661 1.00 99.99  ? 49  GLN C OE1 2  
ATOM 8802   N NE2 . GLN A 1 45  ? -78.871  -27.580 -20.631 1.00 99.99  ? 49  GLN C NE2 2  
ATOM 8803   N N   . SER A 1 46  ? -73.591  -31.511 -20.594 1.00 30.00  ? 50  SER C N   2  
ATOM 8804   C CA  . SER A 1 46  ? -72.668  -32.472 -21.166 1.00 30.00  ? 50  SER C CA  2  
ATOM 8805   C C   . SER A 1 46  ? -71.354  -32.638 -20.423 1.00 30.00  ? 50  SER C C   2  
ATOM 8806   O O   . SER A 1 46  ? -70.693  -31.660 -20.093 1.00 30.00  ? 50  SER C O   2  
ATOM 8807   C CB  . SER A 1 46  ? -72.301  -32.060 -22.587 1.00 99.99  ? 50  SER C CB  2  
ATOM 8808   O OG  . SER A 1 46  ? -71.411  -33.023 -23.151 1.00 99.99  ? 50  SER C OG  2  
ATOM 8809   N N   . SER A 1 47  ? -70.980  -33.890 -20.178 1.00 30.00  ? 51  SER C N   2  
ATOM 8810   C CA  . SER A 1 47  ? -69.729  -34.194 -19.497 1.00 30.00  ? 51  SER C CA  2  
ATOM 8811   C C   . SER A 1 47  ? -68.649  -34.255 -20.579 1.00 30.00  ? 51  SER C C   2  
ATOM 8812   O O   . SER A 1 47  ? -68.951  -34.254 -21.771 1.00 30.00  ? 51  SER C O   2  
ATOM 8813   C CB  . SER A 1 47  ? -69.844  -35.530 -18.770 1.00 99.99  ? 51  SER C CB  2  
ATOM 8814   O OG  . SER A 1 47  ? -69.942  -36.587 -19.727 1.00 99.99  ? 51  SER C OG  2  
ATOM 8815   N N   . LYS A 1 48  ? -67.395  -34.313 -20.156 1.00 30.00  ? 52  LYS C N   2  
ATOM 8816   C CA  . LYS A 1 48  ? -66.284  -34.371 -21.079 1.00 30.00  ? 52  LYS C CA  2  
ATOM 8817   C C   . LYS A 1 48  ? -65.020  -34.530 -20.259 1.00 30.00  ? 52  LYS C C   2  
ATOM 8818   O O   . LYS A 1 48  ? -64.172  -33.647 -20.229 1.00 30.00  ? 52  LYS C O   2  
ATOM 8819   C CB  . LYS A 1 48  ? -66.227  -33.089 -21.902 1.00 99.99  ? 52  LYS C CB  2  
ATOM 8820   C CG  . LYS A 1 48  ? -65.116  -33.198 -22.942 1.00 99.99  ? 52  LYS C CG  2  
ATOM 8821   C CD  . LYS A 1 48  ? -65.332  -32.152 -24.030 1.00 99.99  ? 52  LYS C CD  2  
ATOM 8822   C CE  . LYS A 1 48  ? -64.057  -32.005 -24.852 1.00 99.99  ? 52  LYS C CE  2  
ATOM 8823   N NZ  . LYS A 1 48  ? -64.130  -32.879 -26.034 1.00 99.99  ? 52  LYS C NZ  2  
ATOM 8824   N N   . GLY A 1 49  ? -64.907  -35.670 -19.591 1.00 30.00  ? 53  GLY C N   2  
ATOM 8825   C CA  . GLY A 1 49  ? -63.749  -35.943 -18.766 1.00 30.00  ? 53  GLY C CA  2  
ATOM 8826   C C   . GLY A 1 49  ? -63.927  -35.279 -17.414 1.00 30.00  ? 53  GLY C C   2  
ATOM 8827   O O   . GLY A 1 49  ? -64.401  -35.889 -16.451 1.00 30.00  ? 53  GLY C O   2  
ATOM 8828   N N   . ASP A 1 50  ? -63.541  -34.007 -17.356 1.00 30.00  ? 54  ASP C N   2  
ATOM 8829   C CA  . ASP A 1 50  ? -63.639  -33.202 -16.150 1.00 30.00  ? 54  ASP C CA  2  
ATOM 8830   C C   . ASP A 1 50  ? -64.407  -31.933 -16.476 1.00 30.00  ? 54  ASP C C   2  
ATOM 8831   O O   . ASP A 1 50  ? -64.973  -31.291 -15.601 1.00 30.00  ? 54  ASP C O   2  
ATOM 8832   C CB  . ASP A 1 50  ? -62.244  -32.845 -15.647 1.00 99.99  ? 54  ASP C CB  2  
ATOM 8833   C CG  . ASP A 1 50  ? -62.346  -32.220 -14.262 1.00 99.99  ? 54  ASP C CG  2  
ATOM 8834   O OD1 . ASP A 1 50  ? -62.669  -31.001 -14.200 1.00 99.99  ? 54  ASP C OD1 2  
ATOM 8835   O OD2 . ASP A 1 50  ? -62.101  -32.962 -13.272 1.00 99.99  ? 54  ASP C OD2 2  
ATOM 8836   N N   . GLU A 1 51  ? -64.429  -31.579 -17.747 1.00 30.00  ? 55  GLU C N   2  
ATOM 8837   C CA  . GLU A 1 51  ? -65.108  -30.386 -18.179 1.00 30.00  ? 55  GLU C CA  2  
ATOM 8838   C C   . GLU A 1 51  ? -66.589  -30.582 -18.348 1.00 30.00  ? 55  GLU C C   2  
ATOM 8839   O O   . GLU A 1 51  ? -67.042  -31.006 -19.410 1.00 30.00  ? 55  GLU C O   2  
ATOM 8840   C CB  . GLU A 1 51  ? -64.551  -29.929 -19.523 1.00 99.99  ? 55  GLU C CB  2  
ATOM 8841   C CG  . GLU A 1 51  ? -64.556  -28.421 -19.583 1.00 99.99  ? 55  GLU C CG  2  
ATOM 8842   C CD  . GLU A 1 51  ? -65.995  -27.915 -19.552 1.00 99.99  ? 55  GLU C CD  2  
ATOM 8843   O OE1 . GLU A 1 51  ? -66.503  -27.681 -18.423 1.00 99.99  ? 55  GLU C OE1 2  
ATOM 8844   O OE2 . GLU A 1 51  ? -66.579  -27.768 -20.661 1.00 99.99  ? 55  GLU C OE2 2  
ATOM 8845   N N   . ILE A 1 52  ? -67.344  -30.268 -17.304 1.00 30.00  ? 56  ILE C N   2  
ATOM 8846   C CA  . ILE A 1 52  ? -68.790  -30.404 -17.357 1.00 30.00  ? 56  ILE C CA  2  
ATOM 8847   C C   . ILE A 1 52  ? -69.314  -29.099 -17.920 1.00 30.00  ? 56  ILE C C   2  
ATOM 8848   O O   . ILE A 1 52  ? -68.739  -28.049 -17.669 1.00 30.00  ? 56  ILE C O   2  
ATOM 8849   C CB  . ILE A 1 52  ? -69.339  -30.658 -15.959 1.00 99.99  ? 56  ILE C CB  2  
ATOM 8850   C CG1 . ILE A 1 52  ? -69.575  -29.326 -15.255 1.00 99.99  ? 56  ILE C CG1 2  
ATOM 8851   C CG2 . ILE A 1 52  ? -68.335  -31.484 -15.160 1.00 99.99  ? 56  ILE C CG2 2  
ATOM 8852   C CD1 . ILE A 1 52  ? -71.028  -28.899 -15.452 1.00 99.99  ? 56  ILE C CD1 2  
ATOM 8853   N N   . THR A 1 53  ? -70.393  -29.169 -18.684 1.00 30.00  ? 57  THR C N   2  
ATOM 8854   C CA  . THR A 1 53  ? -71.007  -27.989 -19.283 1.00 30.00  ? 57  THR C CA  2  
ATOM 8855   C C   . THR A 1 53  ? -72.431  -27.943 -18.749 1.00 30.00  ? 57  THR C C   2  
ATOM 8856   O O   . THR A 1 53  ? -73.256  -28.811 -19.059 1.00 30.00  ? 57  THR C O   2  
ATOM 8857   C CB  . THR A 1 53  ? -70.993  -28.116 -20.803 1.00 99.99  ? 57  THR C CB  2  
ATOM 8858   O OG1 . THR A 1 53  ? -71.880  -29.165 -21.203 1.00 99.99  ? 57  THR C OG1 2  
ATOM 8859   C CG2 . THR A 1 53  ? -69.581  -28.437 -21.275 1.00 99.99  ? 57  THR C CG2 2  
ATOM 8860   N N   . VAL A 1 54  ? -72.701  -26.919 -17.942 1.00 30.00  ? 58  VAL C N   2  
ATOM 8861   C CA  . VAL A 1 54  ? -74.007  -26.723 -17.318 1.00 30.00  ? 58  VAL C CA  2  
ATOM 8862   C C   . VAL A 1 54  ? -74.727  -25.506 -17.849 1.00 30.00  ? 58  VAL C C   2  
ATOM 8863   O O   . VAL A 1 54  ? -74.144  -24.684 -18.558 1.00 30.00  ? 58  VAL C O   2  
ATOM 8864   C CB  . VAL A 1 54  ? -73.842  -26.546 -15.813 1.00 99.99  ? 58  VAL C CB  2  
ATOM 8865   C CG1 . VAL A 1 54  ? -73.183  -27.790 -15.224 1.00 99.99  ? 58  VAL C CG1 2  
ATOM 8866   C CG2 . VAL A 1 54  ? -72.967  -25.328 -15.535 1.00 99.99  ? 58  VAL C CG2 2  
ATOM 8867   N N   . LYS A 1 55  ? -76.000  -25.393 -17.505 1.00 30.00  ? 59  LYS C N   2  
ATOM 8868   C CA  . LYS A 1 55  ? -76.795  -24.259 -17.924 1.00 30.00  ? 59  LYS C CA  2  
ATOM 8869   C C   . LYS A 1 55  ? -77.283  -23.603 -16.640 1.00 30.00  ? 59  LYS C C   2  
ATOM 8870   O O   . LYS A 1 55  ? -77.756  -24.295 -15.728 1.00 30.00  ? 59  LYS C O   2  
ATOM 8871   C CB  . LYS A 1 55  ? -77.966  -24.733 -18.777 1.00 99.99  ? 59  LYS C CB  2  
ATOM 8872   C CG  . LYS A 1 55  ? -78.742  -23.527 -19.296 1.00 99.99  ? 59  LYS C CG  2  
ATOM 8873   C CD  . LYS A 1 55  ? -79.610  -23.949 -20.476 1.00 99.99  ? 59  LYS C CD  2  
ATOM 8874   C CE  . LYS A 1 55  ? -80.648  -22.865 -20.758 1.00 99.99  ? 59  LYS C CE  2  
ATOM 8875   N NZ  . LYS A 1 55  ? -80.135  -21.950 -21.788 1.00 99.99  ? 59  LYS C NZ  2  
ATOM 8876   N N   . ILE A 1 56  ? -77.152  -22.282 -16.562 1.00 30.00  ? 60  ILE C N   2  
ATOM 8877   C CA  . ILE A 1 56  ? -77.590  -21.537 -15.380 1.00 30.00  ? 60  ILE C CA  2  
ATOM 8878   C C   . ILE A 1 56  ? -79.106  -21.342 -15.500 1.00 30.00  ? 60  ILE C C   2  
ATOM 8879   O O   . ILE A 1 56  ? -79.586  -20.713 -16.453 1.00 30.00  ? 60  ILE C O   2  
ATOM 8880   C CB  . ILE A 1 56  ? -76.881  -20.189 -15.324 1.00 99.99  ? 60  ILE C CB  2  
ATOM 8881   C CG1 . ILE A 1 56  ? -77.660  -19.172 -16.150 1.00 99.99  ? 60  ILE C CG1 2  
ATOM 8882   C CG2 . ILE A 1 56  ? -75.472  -20.332 -15.891 1.00 99.99  ? 60  ILE C CG2 2  
ATOM 8883   C CD1 . ILE A 1 56  ? -78.611  -18.400 -15.241 1.00 99.99  ? 60  ILE C CD1 2  
ATOM 8884   N N   . VAL A 1 57  ? -79.853  -21.884 -14.541 1.00 30.00  ? 61  VAL C N   2  
ATOM 8885   C CA  . VAL A 1 57  ? -81.316  -21.779 -14.542 1.00 30.00  ? 61  VAL C CA  2  
ATOM 8886   C C   . VAL A 1 57  ? -81.854  -20.349 -14.558 1.00 30.00  ? 61  VAL C C   2  
ATOM 8887   O O   . VAL A 1 57  ? -82.885  -20.071 -15.180 1.00 30.00  ? 61  VAL C O   2  
ATOM 8888   C CB  . VAL A 1 57  ? -81.886  -22.445 -13.293 1.00 99.99  ? 61  VAL C CB  2  
ATOM 8889   C CG1 . VAL A 1 57  ? -83.404  -22.287 -13.280 1.00 99.99  ? 61  VAL C CG1 2  
ATOM 8890   C CG2 . VAL A 1 57  ? -81.531  -23.928 -13.299 1.00 99.99  ? 61  VAL C CG2 2  
ATOM 8891   N N   . ALA A 1 58  ? -81.146  -19.458 -13.873 1.00 30.00  ? 62  ALA C N   2  
ATOM 8892   C CA  . ALA A 1 58  ? -81.516  -18.052 -13.784 1.00 30.00  ? 62  ALA C CA  2  
ATOM 8893   C C   . ALA A 1 58  ? -81.555  -17.337 -15.140 1.00 30.00  ? 62  ALA C C   2  
ATOM 8894   O O   . ALA A 1 58  ? -82.611  -17.222 -15.766 1.00 30.00  ? 62  ALA C O   2  
ATOM 8895   C CB  . ALA A 1 58  ? -80.544  -17.332 -12.843 1.00 30.00  ? 62  ALA C CB  2  
ATOM 8896   N N   . ASP A 1 59  ? -80.399  -16.854 -15.589 1.00 30.00  ? 63  ASP C N   2  
ATOM 8897   C CA  . ASP A 1 59  ? -80.298  -16.142 -16.859 1.00 30.00  ? 63  ASP C CA  2  
ATOM 8898   C C   . ASP A 1 59  ? -80.371  -17.051 -18.081 1.00 30.00  ? 63  ASP C C   2  
ATOM 8899   O O   . ASP A 1 59  ? -80.619  -16.587 -19.197 1.00 30.00  ? 63  ASP C O   2  
ATOM 8900   C CB  . ASP A 1 59  ? -78.970  -15.397 -16.932 1.00 99.99  ? 63  ASP C CB  2  
ATOM 8901   C CG  . ASP A 1 59  ? -78.975  -14.462 -18.140 1.00 99.99  ? 63  ASP C CG  2  
ATOM 8902   O OD1 . ASP A 1 59  ? -78.741  -14.977 -19.268 1.00 99.99  ? 63  ASP C OD1 2  
ATOM 8903   O OD2 . ASP A 1 59  ? -79.214  -13.245 -17.926 1.00 99.99  ? 63  ASP C OD2 2  
ATOM 8904   N N   . SER A 1 60  ? -80.152  -18.346 -17.859 1.00 30.00  ? 64  SER C N   2  
ATOM 8905   C CA  . SER A 1 60  ? -80.181  -19.341 -18.923 1.00 30.00  ? 64  SER C CA  2  
ATOM 8906   C C   . SER A 1 60  ? -78.910  -19.289 -19.781 1.00 30.00  ? 64  SER C C   2  
ATOM 8907   O O   . SER A 1 60  ? -78.913  -19.676 -20.950 1.00 30.00  ? 64  SER C O   2  
ATOM 8908   C CB  . SER A 1 60  ? -81.380  -19.096 -19.833 1.00 99.99  ? 64  SER C CB  2  
ATOM 8909   O OG  . SER A 1 60  ? -81.413  -20.091 -20.858 1.00 99.99  ? 64  SER C OG  2  
ATOM 8910   N N   . SER A 1 61  ? -77.824  -18.805 -19.186 1.00 30.00  ? 65  SER C N   2  
ATOM 8911   C CA  . SER A 1 61  ? -76.551  -18.718 -19.879 1.00 30.00  ? 65  SER C CA  2  
ATOM 8912   C C   . SER A 1 61  ? -75.895  -20.101 -19.766 1.00 30.00  ? 65  SER C C   2  
ATOM 8913   O O   . SER A 1 61  ? -76.470  -21.008 -19.156 1.00 30.00  ? 65  SER C O   2  
ATOM 8914   C CB  . SER A 1 61  ? -75.679  -17.651 -19.230 1.00 99.99  ? 65  SER C CB  2  
ATOM 8915   O OG  . SER A 1 61  ? -76.351  -16.391 -19.281 1.00 99.99  ? 65  SER C OG  2  
ATOM 8916   N N   . THR A 1 62  ? -74.707  -20.267 -20.342 1.00 30.00  ? 66  THR C N   2  
ATOM 8917   C CA  . THR A 1 62  ? -74.005  -21.555 -20.295 1.00 30.00  ? 66  THR C CA  2  
ATOM 8918   C C   . THR A 1 62  ? -72.542  -21.416 -19.948 1.00 30.00  ? 66  THR C C   2  
ATOM 8919   O O   . THR A 1 62  ? -71.923  -20.392 -20.221 1.00 30.00  ? 66  THR C O   2  
ATOM 8920   C CB  . THR A 1 62  ? -74.094  -22.244 -21.652 1.00 99.99  ? 66  THR C CB  2  
ATOM 8921   O OG1 . THR A 1 62  ? -73.429  -23.508 -21.588 1.00 99.99  ? 66  THR C OG1 2  
ATOM 8922   C CG2 . THR A 1 62  ? -73.425  -21.371 -22.709 1.00 99.99  ? 66  THR C CG2 2  
ATOM 8923   N N   . ARG A 1 63  ? -71.991  -22.471 -19.353 1.00 30.00  ? 67  ARG C N   2  
ATOM 8924   C CA  . ARG A 1 63  ? -70.585  -22.472 -18.984 1.00 30.00  ? 67  ARG C CA  2  
ATOM 8925   C C   . ARG A 1 63  ? -70.091  -23.852 -18.580 1.00 30.00  ? 67  ARG C C   2  
ATOM 8926   O O   . ARG A 1 63  ? -70.874  -24.784 -18.411 1.00 30.00  ? 67  ARG C O   2  
ATOM 8927   C CB  . ARG A 1 63  ? -70.358  -21.531 -17.803 1.00 99.99  ? 67  ARG C CB  2  
ATOM 8928   C CG  . ARG A 1 63  ? -71.028  -22.104 -16.559 1.00 99.99  ? 67  ARG C CG  2  
ATOM 8929   C CD  . ARG A 1 63  ? -70.580  -21.319 -15.332 1.00 99.99  ? 67  ARG C CD  2  
ATOM 8930   N NE  . ARG A 1 63  ? -71.303  -21.770 -14.122 1.00 99.99  ? 67  ARG C NE  2  
ATOM 8931   C CZ  . ARG A 1 63  ? -71.169  -21.181 -12.935 1.00 99.99  ? 67  ARG C CZ  2  
ATOM 8932   N NH1 . ARG A 1 63  ? -70.363  -20.136 -12.756 1.00 99.99  ? 67  ARG C NH1 2  
ATOM 8933   N NH2 . ARG A 1 63  ? -71.866  -21.668 -11.914 1.00 99.99  ? 67  ARG C NH2 2  
ATOM 8934   N N   . THR A 1 64  ? -68.779  -23.954 -18.436 1.00 30.00  ? 68  THR C N   2  
ATOM 8935   C CA  . THR A 1 64  ? -68.135  -25.200 -18.066 1.00 30.00  ? 68  THR C CA  2  
ATOM 8936   C C   . THR A 1 64  ? -67.661  -25.087 -16.625 1.00 30.00  ? 68  THR C C   2  
ATOM 8937   O O   . THR A 1 64  ? -67.507  -23.981 -16.127 1.00 30.00  ? 68  THR C O   2  
ATOM 8938   C CB  . THR A 1 64  ? -66.943  -25.460 -18.981 1.00 99.99  ? 68  THR C CB  2  
ATOM 8939   O OG1 . THR A 1 64  ? -65.923  -24.491 -18.725 1.00 99.99  ? 68  THR C OG1 2  
ATOM 8940   C CG2 . THR A 1 64  ? -67.389  -25.353 -20.436 1.00 99.99  ? 68  THR C CG2 2  
ATOM 8941   N N   . VAL A 1 65  ? -67.426  -26.214 -15.960 1.00 30.00  ? 69  VAL C N   2  
ATOM 8942   C CA  . VAL A 1 65  ? -66.985  -26.198 -14.568 1.00 30.00  ? 69  VAL C CA  2  
ATOM 8943   C C   . VAL A 1 65  ? -66.304  -27.497 -14.201 1.00 30.00  ? 69  VAL C C   2  
ATOM 8944   O O   . VAL A 1 65  ? -66.834  -28.553 -14.504 1.00 30.00  ? 69  VAL C O   2  
ATOM 8945   C CB  . VAL A 1 65  ? -68.182  -26.002 -13.646 1.00 99.99  ? 69  VAL C CB  2  
ATOM 8946   C CG1 . VAL A 1 65  ? -68.863  -24.674 -13.974 1.00 99.99  ? 69  VAL C CG1 2  
ATOM 8947   C CG2 . VAL A 1 65  ? -69.172  -27.143 -13.846 1.00 99.99  ? 69  VAL C CG2 2  
ATOM 8948   N N   . LYS A 1 66  ? -65.147  -27.443 -13.558 1.00 30.00  ? 70  LYS C N   2  
ATOM 8949   C CA  . LYS A 1 66  ? -64.475  -28.682 -13.172 1.00 30.00  ? 70  LYS C CA  2  
ATOM 8950   C C   . LYS A 1 66  ? -65.525  -29.587 -12.532 1.00 30.00  ? 70  LYS C C   2  
ATOM 8951   O O   . LYS A 1 66  ? -66.437  -29.122 -11.857 1.00 30.00  ? 70  LYS C O   2  
ATOM 8952   C CB  . LYS A 1 66  ? -63.359  -28.378 -12.179 1.00 99.99  ? 70  LYS C CB  2  
ATOM 8953   C CG  . LYS A 1 66  ? -62.630  -29.666 -11.820 1.00 99.99  ? 70  LYS C CG  2  
ATOM 8954   C CD  . LYS A 1 66  ? -61.594  -29.381 -10.737 1.00 99.99  ? 70  LYS C CD  2  
ATOM 8955   C CE  . LYS A 1 66  ? -61.173  -30.691 -10.080 1.00 99.99  ? 70  LYS C CE  2  
ATOM 8956   N NZ  . LYS A 1 66  ? -60.835  -31.673 -11.122 1.00 99.99  ? 70  LYS C NZ  2  
ATOM 8957   N N   . LYS A 1 67  ? -65.402  -30.886 -12.754 1.00 30.00  ? 71  LYS C N   2  
ATOM 8958   C CA  . LYS A 1 67  ? -66.355  -31.836 -12.212 1.00 30.00  ? 71  LYS C CA  2  
ATOM 8959   C C   . LYS A 1 67  ? -66.307  -31.868 -10.700 1.00 30.00  ? 71  LYS C C   2  
ATOM 8960   O O   . LYS A 1 67  ? -67.329  -32.041 -10.040 1.00 30.00  ? 71  LYS C O   2  
ATOM 8961   C CB  . LYS A 1 67  ? -66.047  -33.236 -12.730 1.00 99.99  ? 71  LYS C CB  2  
ATOM 8962   C CG  . LYS A 1 67  ? -67.111  -34.209 -12.236 1.00 99.99  ? 71  LYS C CG  2  
ATOM 8963   C CD  . LYS A 1 67  ? -67.077  -35.477 -13.086 1.00 99.99  ? 71  LYS C CD  2  
ATOM 8964   C CE  . LYS A 1 67  ? -67.858  -36.580 -12.383 1.00 99.99  ? 71  LYS C CE  2  
ATOM 8965   N NZ  . LYS A 1 67  ? -69.243  -36.593 -12.877 1.00 99.99  ? 71  LYS C NZ  2  
ATOM 8966   N N   . ASP A 1 68  ? -65.116  -31.699 -10.142 1.00 30.00  ? 72  ASP C N   2  
ATOM 8967   C CA  . ASP A 1 68  ? -64.965  -31.728 -8.700  1.00 30.00  ? 72  ASP C CA  2  
ATOM 8968   C C   . ASP A 1 68  ? -65.299  -30.407 -8.021  1.00 30.00  ? 72  ASP C C   2  
ATOM 8969   O O   . ASP A 1 68  ? -64.938  -30.205 -6.869  1.00 30.00  ? 72  ASP C O   2  
ATOM 8970   C CB  . ASP A 1 68  ? -63.520  -32.063 -8.337  1.00 99.99  ? 72  ASP C CB  2  
ATOM 8971   C CG  . ASP A 1 68  ? -63.420  -32.334 -6.838  1.00 99.99  ? 72  ASP C CG  2  
ATOM 8972   O OD1 . ASP A 1 68  ? -63.371  -31.333 -6.073  1.00 99.99  ? 72  ASP C OD1 2  
ATOM 8973   O OD2 . ASP A 1 68  ? -63.396  -33.540 -6.470  1.00 99.99  ? 72  ASP C OD2 2  
ATOM 8974   N N   . ASP A 1 69  ? -65.987  -29.513 -8.732  1.00 30.00  ? 73  ASP C N   2  
ATOM 8975   C CA  . ASP A 1 69  ? -66.372  -28.200 -8.199  1.00 30.00  ? 73  ASP C CA  2  
ATOM 8976   C C   . ASP A 1 69  ? -67.893  -28.094 -8.165  1.00 30.00  ? 73  ASP C C   2  
ATOM 8977   O O   . ASP A 1 69  ? -68.457  -27.066 -7.789  1.00 30.00  ? 73  ASP C O   2  
ATOM 8978   C CB  . ASP A 1 69  ? -65.807  -27.094 -9.085  1.00 99.99  ? 73  ASP C CB  2  
ATOM 8979   C CG  . ASP A 1 69  ? -64.287  -27.068 -8.960  1.00 99.99  ? 73  ASP C CG  2  
ATOM 8980   O OD1 . ASP A 1 69  ? -63.803  -26.637 -7.880  1.00 99.99  ? 73  ASP C OD1 2  
ATOM 8981   O OD2 . ASP A 1 69  ? -63.620  -27.486 -9.947  1.00 99.99  ? 73  ASP C OD2 2  
ATOM 8982   N N   . ILE A 1 70  ? -68.556  -29.156 -8.585  1.00 30.00  ? 74  ILE C N   2  
ATOM 8983   C CA  . ILE A 1 70  ? -70.002  -29.181 -8.585  1.00 30.00  ? 74  ILE C CA  2  
ATOM 8984   C C   . ILE A 1 70  ? -70.339  -29.602 -7.158  1.00 30.00  ? 74  ILE C C   2  
ATOM 8985   O O   . ILE A 1 70  ? -69.594  -30.375 -6.531  1.00 30.00  ? 74  ILE C O   2  
ATOM 8986   C CB  . ILE A 1 70  ? -70.504  -30.182 -9.622  1.00 99.99  ? 74  ILE C CB  2  
ATOM 8987   C CG1 . ILE A 1 70  ? -70.564  -31.572 -9.001  1.00 99.99  ? 74  ILE C CG1 2  
ATOM 8988   C CG2 . ILE A 1 70  ? -69.554  -30.196 -10.814 1.00 99.99  ? 74  ILE C CG2 2  
ATOM 8989   C CD1 . ILE A 1 70  ? -71.971  -31.832 -8.470  1.00 99.99  ? 74  ILE C CD1 2  
ATOM 8990   N N   . GLN A 1 71  ? -71.448  -29.085 -6.644  1.00 30.00  ? 75  GLN C N   2  
ATOM 8991   C CA  . GLN A 1 71  ? -71.877  -29.408 -5.292  1.00 30.00  ? 75  GLN C CA  2  
ATOM 8992   C C   . GLN A 1 71  ? -73.235  -30.062 -5.419  1.00 30.00  ? 75  GLN C C   2  
ATOM 8993   O O   . GLN A 1 71  ? -74.060  -29.633 -6.241  1.00 30.00  ? 75  GLN C O   2  
ATOM 8994   C CB  . GLN A 1 71  ? -71.964  -28.136 -4.457  1.00 99.99  ? 75  GLN C CB  2  
ATOM 8995   C CG  . GLN A 1 71  ? -70.573  -27.534 -4.299  1.00 99.99  ? 75  GLN C CG  2  
ATOM 8996   C CD  . GLN A 1 71  ? -69.716  -28.368 -3.359  1.00 99.99  ? 75  GLN C CD  2  
ATOM 8997   O OE1 . GLN A 1 71  ? -70.170  -29.384 -2.837  1.00 99.99  ? 75  GLN C OE1 2  
ATOM 8998   N NE2 . GLN A 1 71  ? -68.472  -27.938 -3.141  1.00 99.99  ? 75  GLN C NE2 2  
ATOM 8999   N N   . SER A 1 72  ? -73.478  -31.089 -4.616  1.00 30.00  ? 76  SER C N   2  
ATOM 9000   C CA  . SER A 1 72  ? -74.764  -31.777 -4.668  1.00 30.00  ? 76  SER C CA  2  
ATOM 9001   C C   . SER A 1 72  ? -75.909  -30.895 -4.143  1.00 30.00  ? 76  SER C C   2  
ATOM 9002   O O   . SER A 1 72  ? -75.802  -30.303 -3.069  1.00 30.00  ? 76  SER C O   2  
ATOM 9003   C CB  . SER A 1 72  ? -74.712  -33.039 -3.815  1.00 99.99  ? 76  SER C CB  2  
ATOM 9004   O OG  . SER A 1 72  ? -74.605  -32.681 -2.435  1.00 99.99  ? 76  SER C OG  2  
ATOM 9005   N N   . MET A 1 73  ? -76.788  -30.339 -4.715  1.00 30.00  ? 77  MET C N   2  
ATOM 9006   C CA  . MET A 1 73  ? -78.033  -29.628 -4.385  1.00 30.00  ? 77  MET C CA  2  
ATOM 9007   C C   . MET A 1 73  ? -78.930  -30.542 -3.549  1.00 30.00  ? 77  MET C C   2  
ATOM 9008   O O   . MET A 1 73  ? -78.792  -31.759 -3.601  1.00 30.00  ? 77  MET C O   2  
ATOM 9009   C CB  . MET A 1 73  ? -78.761  -29.238 -5.665  1.00 99.99  ? 77  MET C CB  2  
ATOM 9010   C CG  . MET A 1 73  ? -80.014  -28.436 -5.314  1.00 99.99  ? 77  MET C CG  2  
ATOM 9011   S SD  . MET A 1 73  ? -80.710  -27.690 -6.809  1.00 99.99  ? 77  MET C SD  2  
ATOM 9012   C CE  . MET A 1 73  ? -82.162  -26.923 -6.123  1.00 99.99  ? 77  MET C CE  2  
ATOM 9013   N N   . ASN A 1 74  ? -79.846  -29.963 -2.774  1.00 30.00  ? 78  ASN C N   2  
ATOM 9014   C CA  . ASN A 1 74  ? -80.751  -30.779 -1.962  1.00 30.00  ? 78  ASN C CA  2  
ATOM 9015   C C   . ASN A 1 74  ? -82.105  -30.758 -2.691  1.00 30.00  ? 78  ASN C C   2  
ATOM 9016   O O   . ASN A 1 74  ? -82.425  -29.792 -3.403  1.00 30.00  ? 78  ASN C O   2  
ATOM 9017   C CB  . ASN A 1 74  ? -80.874  -30.184 -0.564  1.00 99.99  ? 78  ASN C CB  2  
ATOM 9018   C CG  . ASN A 1 74  ? -79.534  -30.203 0.160   1.00 99.99  ? 78  ASN C CG  2  
ATOM 9019   O OD1 . ASN A 1 74  ? -78.901  -31.250 0.273   1.00 99.99  ? 78  ASN C OD1 2  
ATOM 9020   N ND2 . ASN A 1 74  ? -79.104  -29.040 0.649   1.00 99.99  ? 78  ASN C ND2 2  
ATOM 9021   N N   . PRO A 1 75  ? -82.901  -31.829 -2.542  1.00 30.00  ? 79  PRO C N   2  
ATOM 9022   C CA  . PRO A 1 75  ? -84.223  -31.928 -3.188  1.00 30.00  ? 79  PRO C CA  2  
ATOM 9023   C C   . PRO A 1 75  ? -85.233  -30.965 -2.559  1.00 30.00  ? 79  PRO C C   2  
ATOM 9024   O O   . PRO A 1 75  ? -85.111  -30.621 -1.379  1.00 30.00  ? 79  PRO C O   2  
ATOM 9025   C CB  . PRO A 1 75  ? -84.511  -33.353 -2.863  1.00 99.99  ? 79  PRO C CB  2  
ATOM 9026   C CG  . PRO A 1 75  ? -83.294  -33.871 -2.133  1.00 99.99  ? 79  PRO C CG  2  
ATOM 9027   C CD  . PRO A 1 75  ? -82.367  -33.003 -2.003  1.00 99.99  ? 79  PRO C CD  2  
ATOM 9028   N N   . PRO A 1 76  ? -86.244  -30.525 -3.327  1.00 30.00  ? 80  PRO C N   2  
ATOM 9029   C CA  . PRO A 1 76  ? -87.240  -29.601 -2.774  1.00 30.00  ? 80  PRO C CA  2  
ATOM 9030   C C   . PRO A 1 76  ? -87.850  -30.066 -1.439  1.00 30.00  ? 80  PRO C C   2  
ATOM 9031   O O   . PRO A 1 76  ? -88.571  -29.329 -0.773  1.00 30.00  ? 80  PRO C O   2  
ATOM 9032   C CB  . PRO A 1 76  ? -88.228  -29.660 -3.885  1.00 99.99  ? 80  PRO C CB  2  
ATOM 9033   C CG  . PRO A 1 76  ? -87.623  -30.566 -4.935  1.00 99.99  ? 80  PRO C CG  2  
ATOM 9034   C CD  . PRO A 1 76  ? -86.470  -31.012 -4.623  1.00 99.99  ? 80  PRO C CD  2  
ATOM 9035   N N   . LYS A 1 77  ? -87.544  -31.300 -1.064  1.00 30.00  ? 81  LYS C N   2  
ATOM 9036   C CA  . LYS A 1 77  ? -88.019  -31.904 0.182   1.00 30.00  ? 81  LYS C CA  2  
ATOM 9037   C C   . LYS A 1 77  ? -87.559  -31.046 1.375   1.00 30.00  ? 81  LYS C C   2  
ATOM 9038   O O   . LYS A 1 77  ? -88.266  -30.927 2.374   1.00 30.00  ? 81  LYS C O   2  
ATOM 9039   C CB  . LYS A 1 77  ? -87.455  -33.314 0.325   1.00 99.99  ? 81  LYS C CB  2  
ATOM 9040   C CG  . LYS A 1 77  ? -88.034  -33.969 1.574   1.00 99.99  ? 81  LYS C CG  2  
ATOM 9041   C CD  . LYS A 1 77  ? -87.841  -35.480 1.491   1.00 99.99  ? 81  LYS C CD  2  
ATOM 9042   C CE  . LYS A 1 77  ? -88.070  -36.100 2.866   1.00 99.99  ? 81  LYS C CE  2  
ATOM 9043   N NZ  . LYS A 1 77  ? -89.469  -36.539 2.979   1.00 99.99  ? 81  LYS C NZ  2  
ATOM 9044   N N   . PHE A 1 78  ? -86.374  -30.447 1.266   1.00 30.00  ? 82  PHE C N   2  
ATOM 9045   C CA  . PHE A 1 78  ? -85.839  -29.613 2.341   1.00 30.00  ? 82  PHE C CA  2  
ATOM 9046   C C   . PHE A 1 78  ? -85.843  -28.108 2.062   1.00 30.00  ? 82  PHE C C   2  
ATOM 9047   O O   . PHE A 1 78  ? -84.842  -27.438 2.265   1.00 30.00  ? 82  PHE C O   2  
ATOM 9048   C CB  . PHE A 1 78  ? -84.389  -29.996 2.622   1.00 99.99  ? 82  PHE C CB  2  
ATOM 9049   C CG  . PHE A 1 78  ? -84.328  -31.418 3.118   1.00 99.99  ? 82  PHE C CG  2  
ATOM 9050   C CD1 . PHE A 1 78  ? -84.210  -32.476 2.207   1.00 99.99  ? 82  PHE C CD1 2  
ATOM 9051   C CD2 . PHE A 1 78  ? -84.391  -31.682 4.493   1.00 99.99  ? 82  PHE C CD2 2  
ATOM 9052   C CE1 . PHE A 1 78  ? -84.155  -33.797 2.670   1.00 99.99  ? 82  PHE C CE1 2  
ATOM 9053   C CE2 . PHE A 1 78  ? -84.337  -33.003 4.955   1.00 99.99  ? 82  PHE C CE2 2  
ATOM 9054   C CZ  . PHE A 1 78  ? -84.217  -34.058 4.045   1.00 99.99  ? 82  PHE C CZ  2  
ATOM 9055   N N   . GLU A 1 79  ? -86.969  -27.583 1.594   1.00 30.00  ? 83  GLU C N   2  
ATOM 9056   C CA  . GLU A 1 79  ? -87.081  -26.157 1.319   1.00 30.00  ? 83  GLU C CA  2  
ATOM 9057   C C   . GLU A 1 79  ? -87.217  -25.437 2.663   1.00 30.00  ? 83  GLU C C   2  
ATOM 9058   O O   . GLU A 1 79  ? -87.946  -25.906 3.536   1.00 30.00  ? 83  GLU C O   2  
ATOM 9059   C CB  . GLU A 1 79  ? -88.308  -25.892 0.453   1.00 99.99  ? 83  GLU C CB  2  
ATOM 9060   C CG  . GLU A 1 79  ? -88.119  -24.602 -0.308  1.00 99.99  ? 83  GLU C CG  2  
ATOM 9061   C CD  . GLU A 1 79  ? -88.549  -23.427 0.567   1.00 99.99  ? 83  GLU C CD  2  
ATOM 9062   O OE1 . GLU A 1 79  ? -87.671  -22.899 1.298   1.00 99.99  ? 83  GLU C OE1 2  
ATOM 9063   O OE2 . GLU A 1 79  ? -89.755  -23.065 0.495   1.00 99.99  ? 83  GLU C OE2 2  
ATOM 9064   N N   . LYS A 1 80  ? -86.520  -24.314 2.835   1.00 30.00  ? 84  LYS C N   2  
ATOM 9065   C CA  . LYS A 1 80  ? -86.579  -23.552 4.089   1.00 30.00  ? 84  LYS C CA  2  
ATOM 9066   C C   . LYS A 1 80  ? -86.574  -24.437 5.344   1.00 30.00  ? 84  LYS C C   2  
ATOM 9067   O O   . LYS A 1 80  ? -87.245  -24.130 6.328   1.00 30.00  ? 84  LYS C O   2  
ATOM 9068   C CB  . LYS A 1 80  ? -87.854  -22.716 4.128   1.00 99.99  ? 84  LYS C CB  2  
ATOM 9069   C CG  . LYS A 1 80  ? -87.718  -21.530 3.181   1.00 99.99  ? 84  LYS C CG  2  
ATOM 9070   C CD  . LYS A 1 80  ? -88.950  -20.642 3.294   1.00 99.99  ? 84  LYS C CD  2  
ATOM 9071   C CE  . LYS A 1 80  ? -89.954  -21.023 2.212   1.00 99.99  ? 84  LYS C CE  2  
ATOM 9072   N NZ  . LYS A 1 80  ? -90.976  -19.975 2.099   1.00 99.99  ? 84  LYS C NZ  2  
ATOM 9073   N N   . LEU A 1 81  ? -85.826  -25.531 5.313   1.00 30.00  ? 85  LEU C N   2  
ATOM 9074   C CA  . LEU A 1 81  ? -85.770  -26.434 6.455   1.00 30.00  ? 85  LEU C CA  2  
ATOM 9075   C C   . LEU A 1 81  ? -85.421  -25.748 7.792   1.00 30.00  ? 85  LEU C C   2  
ATOM 9076   O O   . LEU A 1 81  ? -84.527  -24.899 7.850   1.00 30.00  ? 85  LEU C O   2  
ATOM 9077   C CB  . LEU A 1 81  ? -84.708  -27.503 6.219   1.00 99.99  ? 85  LEU C CB  2  
ATOM 9078   C CG  . LEU A 1 81  ? -83.324  -26.910 6.457   1.00 99.99  ? 85  LEU C CG  2  
ATOM 9079   C CD1 . LEU A 1 81  ? -83.313  -25.453 6.004   1.00 99.99  ? 85  LEU C CD1 2  
ATOM 9080   C CD2 . LEU A 1 81  ? -82.988  -26.984 7.942   1.00 99.99  ? 85  LEU C CD2 2  
ATOM 9081   N N   . GLU A 1 82  ? -86.122  -26.132 8.862   1.00 30.00  ? 86  GLU C N   2  
ATOM 9082   C CA  . GLU A 1 82  ? -85.892  -25.553 10.181  1.00 30.00  ? 86  GLU C CA  2  
ATOM 9083   C C   . GLU A 1 82  ? -84.610  -26.066 10.798  1.00 30.00  ? 86  GLU C C   2  
ATOM 9084   O O   . GLU A 1 82  ? -83.916  -25.313 11.490  1.00 30.00  ? 86  GLU C O   2  
ATOM 9085   C CB  . GLU A 1 82  ? -87.047  -25.912 11.111  1.00 99.99  ? 86  GLU C CB  2  
ATOM 9086   C CG  . GLU A 1 82  ? -88.318  -25.269 10.610  1.00 99.99  ? 86  GLU C CG  2  
ATOM 9087   C CD  . GLU A 1 82  ? -88.258  -23.764 10.855  1.00 99.99  ? 86  GLU C CD  2  
ATOM 9088   O OE1 . GLU A 1 82  ? -87.764  -23.048 9.943   1.00 99.99  ? 86  GLU C OE1 2  
ATOM 9089   O OE2 . GLU A 1 82  ? -88.707  -23.338 11.955  1.00 99.99  ? 86  GLU C OE2 2  
ATOM 9090   N N   . ASP A 1 83  ? -84.273  -27.335 10.572  1.00 30.00  ? 87  ASP C N   2  
ATOM 9091   C CA  . ASP A 1 83  ? -83.004  -27.873 11.100  1.00 30.00  ? 87  ASP C CA  2  
ATOM 9092   C C   . ASP A 1 83  ? -82.177  -28.426 9.932   1.00 30.00  ? 87  ASP C C   2  
ATOM 9093   O O   . ASP A 1 83  ? -82.545  -29.407 9.292   1.00 30.00  ? 87  ASP C O   2  
ATOM 9094   C CB  . ASP A 1 83  ? -83.290  -28.989 12.098  1.00 99.99  ? 87  ASP C CB  2  
ATOM 9095   C CG  . ASP A 1 83  ? -82.001  -29.371 12.822  1.00 99.99  ? 87  ASP C CG  2  
ATOM 9096   O OD1 . ASP A 1 83  ? -81.202  -30.130 12.214  1.00 99.99  ? 87  ASP C OD1 2  
ATOM 9097   O OD2 . ASP A 1 83  ? -81.824  -28.897 13.975  1.00 99.99  ? 87  ASP C OD2 2  
ATOM 9098   N N   . MET A 1 84  ? -81.052  -27.774 9.665   1.00 30.00  ? 88  MET C N   2  
ATOM 9099   C CA  . MET A 1 84  ? -80.183  -28.162 8.572   1.00 30.00  ? 88  MET C CA  2  
ATOM 9100   C C   . MET A 1 84  ? -79.425  -29.467 8.711   1.00 30.00  ? 88  MET C C   2  
ATOM 9101   O O   . MET A 1 84  ? -78.958  -30.013 7.722   1.00 30.00  ? 88  MET C O   2  
ATOM 9102   C CB  . MET A 1 84  ? -79.112  -27.100 8.360   1.00 99.99  ? 88  MET C CB  2  
ATOM 9103   C CG  . MET A 1 84  ? -79.762  -25.726 8.273   1.00 99.99  ? 88  MET C CG  2  
ATOM 9104   S SD  . MET A 1 84  ? -80.448  -25.467 6.618   1.00 99.99  ? 88  MET C SD  2  
ATOM 9105   C CE  . MET A 1 84  ? -78.955  -25.136 5.712   1.00 99.99  ? 88  MET C CE  2  
ATOM 9106   N N   . ALA A 1 85  ? -79.294  -29.970 9.929   1.00 30.00  ? 89  ALA C N   2  
ATOM 9107   C CA  . ALA A 1 85  ? -78.590  -31.218 10.134  1.00 30.00  ? 89  ALA C CA  2  
ATOM 9108   C C   . ALA A 1 85  ? -79.405  -32.342 9.468   1.00 30.00  ? 89  ALA C C   2  
ATOM 9109   O O   . ALA A 1 85  ? -78.882  -33.420 9.171   1.00 30.00  ? 89  ALA C O   2  
ATOM 9110   C CB  . ALA A 1 85  ? -78.434  -31.480 11.619  1.00 30.00  ? 89  ALA C CB  2  
ATOM 9111   N N   . ASN A 1 86  ? -80.685  -32.074 9.224   1.00 30.00  ? 90  ASN C N   2  
ATOM 9112   C CA  . ASN A 1 86  ? -81.595  -33.035 8.595   1.00 30.00  ? 90  ASN C CA  2  
ATOM 9113   C C   . ASN A 1 86  ? -81.578  -33.017 7.062   1.00 30.00  ? 90  ASN C C   2  
ATOM 9114   O O   . ASN A 1 86  ? -82.342  -33.735 6.420   1.00 30.00  ? 90  ASN C O   2  
ATOM 9115   C CB  . ASN A 1 86  ? -83.029  -32.749 9.023   1.00 99.99  ? 90  ASN C CB  2  
ATOM 9116   C CG  . ASN A 1 86  ? -83.203  -32.928 10.523  1.00 99.99  ? 90  ASN C CG  2  
ATOM 9117   O OD1 . ASN A 1 86  ? -82.876  -33.979 11.067  1.00 99.99  ? 90  ASN C OD1 2  
ATOM 9118   N ND2 . ASN A 1 86  ? -83.721  -31.896 11.192  1.00 99.99  ? 90  ASN C ND2 2  
ATOM 9119   N N   . MET A 1 87  ? -80.722  -32.187 6.482   1.00 30.00  ? 91  MET C N   2  
ATOM 9120   C CA  . MET A 1 87  ? -80.610  -32.083 5.029   1.00 30.00  ? 91  MET C CA  2  
ATOM 9121   C C   . MET A 1 87  ? -79.689  -33.182 4.524   1.00 30.00  ? 91  MET C C   2  
ATOM 9122   O O   . MET A 1 87  ? -78.830  -33.668 5.268   1.00 30.00  ? 91  MET C O   2  
ATOM 9123   C CB  . MET A 1 87  ? -80.038  -30.722 4.649   1.00 99.99  ? 91  MET C CB  2  
ATOM 9124   C CG  . MET A 1 87  ? -80.816  -29.624 5.364   1.00 99.99  ? 91  MET C CG  2  
ATOM 9125   S SD  . MET A 1 87  ? -82.367  -29.295 4.495   1.00 99.99  ? 91  MET C SD  2  
ATOM 9126   C CE  . MET A 1 87  ? -81.753  -28.361 3.109   1.00 99.99  ? 91  MET C CE  2  
ATOM 9127   N N   . THR A 1 88  ? -79.871  -33.563 3.258   1.00 30.00  ? 92  THR C N   2  
ATOM 9128   C CA  . THR A 1 88  ? -79.024  -34.606 2.668   1.00 30.00  ? 92  THR C CA  2  
ATOM 9129   C C   . THR A 1 88  ? -77.626  -34.017 2.539   1.00 30.00  ? 92  THR C C   2  
ATOM 9130   O O   . THR A 1 88  ? -76.647  -34.622 2.990   1.00 30.00  ? 92  THR C O   2  
ATOM 9131   C CB  . THR A 1 88  ? -79.570  -35.004 1.301   1.00 99.99  ? 92  THR C CB  2  
ATOM 9132   O OG1 . THR A 1 88  ? -79.407  -33.915 0.388   1.00 99.99  ? 92  THR C OG1 2  
ATOM 9133   C CG2 . THR A 1 88  ? -81.051  -35.344 1.424   1.00 99.99  ? 92  THR C CG2 2  
ATOM 9134   N N   . TYR A 1 89  ? -77.547  -32.828 1.928   1.00 30.00  ? 93  TYR C N   2  
ATOM 9135   C CA  . TYR A 1 89  ? -76.272  -32.142 1.730   1.00 30.00  ? 93  TYR C CA  2  
ATOM 9136   C C   . TYR A 1 89  ? -76.056  -30.869 2.549   1.00 30.00  ? 93  TYR C C   2  
ATOM 9137   O O   . TYR A 1 89  ? -76.834  -29.909 2.491   1.00 30.00  ? 93  TYR C O   2  
ATOM 9138   C CB  . TYR A 1 89  ? -76.128  -31.726 0.269   1.00 99.99  ? 93  TYR C CB  2  
ATOM 9139   C CG  . TYR A 1 89  ? -75.973  -32.959 -0.592  1.00 99.99  ? 93  TYR C CG  2  
ATOM 9140   C CD1 . TYR A 1 89  ? -74.719  -33.561 -0.734  1.00 99.99  ? 93  TYR C CD1 2  
ATOM 9141   C CD2 . TYR A 1 89  ? -77.086  -33.498 -1.248  1.00 99.99  ? 93  TYR C CD2 2  
ATOM 9142   C CE1 . TYR A 1 89  ? -74.576  -34.703 -1.532  1.00 99.99  ? 93  TYR C CE1 2  
ATOM 9143   C CE2 . TYR A 1 89  ? -76.945  -34.636 -2.047  1.00 99.99  ? 93  TYR C CE2 2  
ATOM 9144   C CZ  . TYR A 1 89  ? -75.688  -35.239 -2.188  1.00 99.99  ? 93  TYR C CZ  2  
ATOM 9145   O OH  . TYR A 1 89  ? -75.549  -36.350 -2.964  1.00 99.99  ? 93  TYR C OH  2  
ATOM 9146   N N   . LEU A 1 90  ? -74.970  -30.873 3.303   1.00 30.00  ? 94  LEU C N   2  
ATOM 9147   C CA  . LEU A 1 90  ? -74.610  -29.746 4.137   1.00 30.00  ? 94  LEU C CA  2  
ATOM 9148   C C   . LEU A 1 90  ? -73.332  -29.077 3.608   1.00 30.00  ? 94  LEU C C   2  
ATOM 9149   O O   . LEU A 1 90  ? -72.287  -29.081 4.269   1.00 30.00  ? 94  LEU C O   2  
ATOM 9150   C CB  . LEU A 1 90  ? -74.363  -30.214 5.566   1.00 99.99  ? 94  LEU C CB  2  
ATOM 9151   C CG  . LEU A 1 90  ? -75.639  -30.046 6.384   1.00 99.99  ? 94  LEU C CG  2  
ATOM 9152   C CD1 . LEU A 1 90  ? -75.316  -30.198 7.868   1.00 99.99  ? 94  LEU C CD1 2  
ATOM 9153   C CD2 . LEU A 1 90  ? -76.229  -28.664 6.130   1.00 99.99  ? 94  LEU C CD2 2  
ATOM 9154   N N   . ASN A 1 91  ? -73.406  -28.505 2.414   1.00 30.00  ? 95  ASN C N   2  
ATOM 9155   C CA  . ASN A 1 91  ? -72.226  -27.861 1.854   1.00 30.00  ? 95  ASN C CA  2  
ATOM 9156   C C   . ASN A 1 91  ? -72.476  -26.365 1.740   1.00 30.00  ? 95  ASN C C   2  
ATOM 9157   O O   . ASN A 1 91  ? -73.626  -25.926 1.644   1.00 30.00  ? 95  ASN C O   2  
ATOM 9158   C CB  . ASN A 1 91  ? -71.934  -28.431 0.470   1.00 99.99  ? 95  ASN C CB  2  
ATOM 9159   C CG  . ASN A 1 91  ? -73.112  -28.225 -0.471  1.00 99.99  ? 95  ASN C CG  2  
ATOM 9160   O OD1 . ASN A 1 91  ? -73.054  -27.389 -1.368  1.00 99.99  ? 95  ASN C OD1 2  
ATOM 9161   N ND2 . ASN A 1 91  ? -74.184  -28.990 -0.259  1.00 99.99  ? 95  ASN C ND2 2  
ATOM 9162   N N   . GLU A 1 92  ? -71.390  -25.590 1.753   1.00 30.00  ? 96  GLU C N   2  
ATOM 9163   C CA  . GLU A 1 92  ? -71.499  -24.143 1.673   1.00 30.00  ? 96  GLU C CA  2  
ATOM 9164   C C   . GLU A 1 92  ? -72.569  -23.615 0.744   1.00 30.00  ? 96  GLU C C   2  
ATOM 9165   O O   . GLU A 1 92  ? -73.002  -22.479 0.884   1.00 30.00  ? 96  GLU C O   2  
ATOM 9166   C CB  . GLU A 1 92  ? -70.182  -23.551 1.179   1.00 99.99  ? 96  GLU C CB  2  
ATOM 9167   C CG  . GLU A 1 92  ? -69.125  -23.716 2.243   1.00 99.99  ? 96  GLU C CG  2  
ATOM 9168   C CD  . GLU A 1 92  ? -69.408  -22.756 3.396   1.00 99.99  ? 96  GLU C CD  2  
ATOM 9169   O OE1 . GLU A 1 92  ? -70.139  -23.176 4.330   1.00 99.99  ? 96  GLU C OE1 2  
ATOM 9170   O OE2 . GLU A 1 92  ? -68.886  -21.610 3.330   1.00 99.99  ? 96  GLU C OE2 2  
ATOM 9171   N N   . ALA A 1 93  ? -73.025  -24.419 -0.201  1.00 30.00  ? 97  ALA C N   2  
ATOM 9172   C CA  . ALA A 1 93  ? -74.044  -23.912 -1.107  1.00 30.00  ? 97  ALA C CA  2  
ATOM 9173   C C   . ALA A 1 93  ? -75.453  -24.323 -0.714  1.00 30.00  ? 97  ALA C C   2  
ATOM 9174   O O   . ALA A 1 93  ? -76.414  -23.659 -1.089  1.00 30.00  ? 97  ALA C O   2  
ATOM 9175   C CB  . ALA A 1 93  ? -73.744  -24.384 -2.531  1.00 30.00  ? 97  ALA C CB  2  
ATOM 9176   N N   . SER A 1 94  ? -75.576  -25.422 0.031   1.00 30.00  ? 98  SER C N   2  
ATOM 9177   C CA  . SER A 1 94  ? -76.886  -25.910 0.474   1.00 30.00  ? 98  SER C CA  2  
ATOM 9178   C C   . SER A 1 94  ? -77.299  -25.088 1.676   1.00 30.00  ? 98  SER C C   2  
ATOM 9179   O O   . SER A 1 94  ? -78.463  -24.724 1.824   1.00 30.00  ? 98  SER C O   2  
ATOM 9180   C CB  . SER A 1 94  ? -76.788  -27.383 0.852   1.00 99.99  ? 98  SER C CB  2  
ATOM 9181   O OG  . SER A 1 94  ? -75.987  -27.524 2.028   1.00 99.99  ? 98  SER C OG  2  
ATOM 9182   N N   . VAL A 1 95  ? -76.321  -24.815 2.534   1.00 30.00  ? 99  VAL C N   2  
ATOM 9183   C CA  . VAL A 1 95  ? -76.533  -24.027 3.733   1.00 30.00  ? 99  VAL C CA  2  
ATOM 9184   C C   . VAL A 1 95  ? -76.914  -22.590 3.323   1.00 30.00  ? 99  VAL C C   2  
ATOM 9185   O O   . VAL A 1 95  ? -77.996  -22.106 3.652   1.00 30.00  ? 99  VAL C O   2  
ATOM 9186   C CB  . VAL A 1 95  ? -75.256  -24.000 4.568   1.00 99.99  ? 99  VAL C CB  2  
ATOM 9187   C CG1 . VAL A 1 95  ? -74.876  -25.424 4.963   1.00 99.99  ? 99  VAL C CG1 2  
ATOM 9188   C CG2 . VAL A 1 95  ? -74.129  -23.381 3.752   1.00 99.99  ? 99  VAL C CG2 2  
ATOM 9189   N N   . LEU A 1 96  ? -76.033  -21.914 2.596   1.00 30.00  ? 100 LEU C N   2  
ATOM 9190   C CA  . LEU A 1 96  ? -76.323  -20.559 2.149   1.00 30.00  ? 100 LEU C CA  2  
ATOM 9191   C C   . LEU A 1 96  ? -77.688  -20.481 1.453   1.00 30.00  ? 100 LEU C C   2  
ATOM 9192   O O   . LEU A 1 96  ? -78.394  -19.489 1.560   1.00 30.00  ? 100 LEU C O   2  
ATOM 9193   C CB  . LEU A 1 96  ? -75.252  -20.098 1.164   1.00 99.99  ? 100 LEU C CB  2  
ATOM 9194   C CG  . LEU A 1 96  ? -74.174  -19.320 1.910   1.00 99.99  ? 100 LEU C CG  2  
ATOM 9195   C CD1 . LEU A 1 96  ? -73.293  -18.585 0.906   1.00 99.99  ? 100 LEU C CD1 2  
ATOM 9196   C CD2 . LEU A 1 96  ? -74.833  -18.311 2.845   1.00 99.99  ? 100 LEU C CD2 2  
ATOM 9197   N N   . TYR A 1 97  ? -78.071  -21.518 0.727   1.00 30.00  ? 101 TYR C N   2  
ATOM 9198   C CA  . TYR A 1 97  ? -79.354  -21.471 0.043   1.00 30.00  ? 101 TYR C CA  2  
ATOM 9199   C C   . TYR A 1 97  ? -80.521  -21.547 1.009   1.00 30.00  ? 101 TYR C C   2  
ATOM 9200   O O   . TYR A 1 97  ? -81.497  -20.810 0.866   1.00 30.00  ? 101 TYR C O   2  
ATOM 9201   C CB  . TYR A 1 97  ? -79.468  -22.647 -0.925  1.00 99.99  ? 101 TYR C CB  2  
ATOM 9202   C CG  . TYR A 1 97  ? -80.800  -22.587 -1.631  1.00 99.99  ? 101 TYR C CG  2  
ATOM 9203   C CD1 . TYR A 1 97  ? -80.964  -21.768 -2.755  1.00 99.99  ? 101 TYR C CD1 2  
ATOM 9204   C CD2 . TYR A 1 97  ? -81.876  -23.352 -1.162  1.00 99.99  ? 101 TYR C CD2 2  
ATOM 9205   C CE1 . TYR A 1 97  ? -82.198  -21.715 -3.410  1.00 99.99  ? 101 TYR C CE1 2  
ATOM 9206   C CE2 . TYR A 1 97  ? -83.111  -23.300 -1.817  1.00 99.99  ? 101 TYR C CE2 2  
ATOM 9207   C CZ  . TYR A 1 97  ? -83.272  -22.480 -2.941  1.00 99.99  ? 101 TYR C CZ  2  
ATOM 9208   O OH  . TYR A 1 97  ? -84.474  -22.430 -3.578  1.00 99.99  ? 101 TYR C OH  2  
ATOM 9209   N N   . ASN A 1 98  ? -80.425  -22.447 1.986   1.00 30.00  ? 102 ASN C N   2  
ATOM 9210   C CA  . ASN A 1 98  ? -81.477  -22.628 2.974   1.00 30.00  ? 102 ASN C CA  2  
ATOM 9211   C C   . ASN A 1 98  ? -81.720  -21.351 3.776   1.00 30.00  ? 102 ASN C C   2  
ATOM 9212   O O   . ASN A 1 98  ? -82.854  -20.881 3.901   1.00 30.00  ? 102 ASN C O   2  
ATOM 9213   C CB  . ASN A 1 98  ? -81.091  -23.737 3.948   1.00 99.99  ? 102 ASN C CB  2  
ATOM 9214   C CG  . ASN A 1 98  ? -81.239  -25.108 3.307   1.00 99.99  ? 102 ASN C CG  2  
ATOM 9215   O OD1 . ASN A 1 98  ? -80.406  -25.987 3.510   1.00 99.99  ? 102 ASN C OD1 2  
ATOM 9216   N ND2 . ASN A 1 98  ? -82.308  -25.290 2.528   1.00 99.99  ? 102 ASN C ND2 2  
ATOM 9217   N N   . LEU A 1 99  ? -80.644  -20.792 4.320   1.00 30.00  ? 103 LEU C N   2  
ATOM 9218   C CA  . LEU A 1 99  ? -80.722  -19.563 5.096   1.00 30.00  ? 103 LEU C CA  2  
ATOM 9219   C C   . LEU A 1 99  ? -81.400  -18.512 4.235   1.00 30.00  ? 103 LEU C C   2  
ATOM 9220   O O   . LEU A 1 99  ? -82.557  -18.163 4.462   1.00 30.00  ? 103 LEU C O   2  
ATOM 9221   C CB  . LEU A 1 99  ? -79.318  -19.102 5.476   1.00 99.99  ? 103 LEU C CB  2  
ATOM 9222   C CG  . LEU A 1 99  ? -78.972  -19.624 6.867   1.00 99.99  ? 103 LEU C CG  2  
ATOM 9223   C CD1 . LEU A 1 99  ? -77.729  -18.903 7.384   1.00 99.99  ? 103 LEU C CD1 2  
ATOM 9224   C CD2 . LEU A 1 99  ? -80.139  -19.364 7.813   1.00 99.99  ? 103 LEU C CD2 2  
ATOM 9225   N N   . ARG A 1 100 ? -80.675  -18.018 3.244   1.00 30.00  ? 104 ARG C N   2  
ATOM 9226   C CA  . ARG A 1 100 ? -81.168  -17.017 2.308   1.00 30.00  ? 104 ARG C CA  2  
ATOM 9227   C C   . ARG A 1 100 ? -82.624  -17.279 1.864   1.00 30.00  ? 104 ARG C C   2  
ATOM 9228   O O   . ARG A 1 100 ? -83.361  -16.353 1.552   1.00 30.00  ? 104 ARG C O   2  
ATOM 9229   C CB  . ARG A 1 100 ? -80.300  -17.002 1.055   1.00 99.99  ? 104 ARG C CB  2  
ATOM 9230   C CG  . ARG A 1 100 ? -80.310  -15.607 0.445   1.00 99.99  ? 104 ARG C CG  2  
ATOM 9231   C CD  . ARG A 1 100 ? -79.221  -15.509 -0.620  1.00 99.99  ? 104 ARG C CD  2  
ATOM 9232   N NE  . ARG A 1 100 ? -78.923  -14.098 -0.945  1.00 99.99  ? 104 ARG C NE  2  
ATOM 9233   C CZ  . ARG A 1 100 ? -77.909  -13.733 -1.725  1.00 99.99  ? 104 ARG C CZ  2  
ATOM 9234   N NH1 . ARG A 1 100 ? -77.085  -14.622 -2.273  1.00 99.99  ? 104 ARG C NH1 2  
ATOM 9235   N NH2 . ARG A 1 100 ? -77.730  -12.434 -1.952  1.00 99.99  ? 104 ARG C NH2 2  
ATOM 9236   N N   . SER A 1 101 ? -83.033  -18.543 1.832   1.00 30.00  ? 105 SER C N   2  
ATOM 9237   C CA  . SER A 1 101 ? -84.401  -18.873 1.425   1.00 30.00  ? 105 SER C CA  2  
ATOM 9238   C C   . SER A 1 101 ? -85.336  -18.384 2.514   1.00 30.00  ? 105 SER C C   2  
ATOM 9239   O O   . SER A 1 101 ? -86.270  -17.631 2.249   1.00 30.00  ? 105 SER C O   2  
ATOM 9240   C CB  . SER A 1 101 ? -84.539  -20.382 1.250   1.00 99.99  ? 105 SER C CB  2  
ATOM 9241   O OG  . SER A 1 101 ? -83.612  -20.836 0.262   1.00 99.99  ? 105 SER C OG  2  
ATOM 9242   N N   . ARG A 1 102 ? -85.066  -18.830 3.737   1.00 30.00  ? 106 ARG C N   2  
ATOM 9243   C CA  . ARG A 1 102 ? -85.837  -18.471 4.914   1.00 30.00  ? 106 ARG C CA  2  
ATOM 9244   C C   . ARG A 1 102 ? -85.808  -16.949 5.095   1.00 30.00  ? 106 ARG C C   2  
ATOM 9245   O O   . ARG A 1 102 ? -86.853  -16.292 5.044   1.00 30.00  ? 106 ARG C O   2  
ATOM 9246   C CB  . ARG A 1 102 ? -85.243  -19.137 6.148   1.00 99.99  ? 106 ARG C CB  2  
ATOM 9247   C CG  . ARG A 1 102 ? -85.225  -20.650 5.952   1.00 99.99  ? 106 ARG C CG  2  
ATOM 9248   C CD  . ARG A 1 102 ? -84.331  -21.290 7.009   1.00 99.99  ? 106 ARG C CD  2  
ATOM 9249   N NE  . ARG A 1 102 ? -84.851  -21.033 8.372   1.00 99.99  ? 106 ARG C NE  2  
ATOM 9250   C CZ  . ARG A 1 102 ? -85.709  -21.843 8.983   1.00 99.99  ? 106 ARG C CZ  2  
ATOM 9251   N NH1 . ARG A 1 102 ? -86.168  -22.949 8.406   1.00 99.99  ? 106 ARG C NH1 2  
ATOM 9252   N NH2 . ARG A 1 102 ? -86.112  -21.517 10.209  1.00 99.99  ? 106 ARG C NH2 2  
ATOM 9253   N N   . TYR A 1 103 ? -84.608  -16.401 5.293   1.00 30.00  ? 107 TYR C N   2  
ATOM 9254   C CA  . TYR A 1 103 ? -84.428  -14.960 5.470   1.00 30.00  ? 107 TYR C CA  2  
ATOM 9255   C C   . TYR A 1 103 ? -85.338  -14.074 4.604   1.00 30.00  ? 107 TYR C C   2  
ATOM 9256   O O   . TYR A 1 103 ? -86.071  -13.239 5.139   1.00 30.00  ? 107 TYR C O   2  
ATOM 9257   C CB  . TYR A 1 103 ? -82.995  -14.570 5.124   1.00 99.99  ? 107 TYR C CB  2  
ATOM 9258   C CG  . TYR A 1 103 ? -82.817  -13.085 5.311   1.00 99.99  ? 107 TYR C CG  2  
ATOM 9259   C CD1 . TYR A 1 103 ? -82.547  -12.566 6.583   1.00 99.99  ? 107 TYR C CD1 2  
ATOM 9260   C CD2 . TYR A 1 103 ? -82.921  -12.222 4.210   1.00 99.99  ? 107 TYR C CD2 2  
ATOM 9261   C CE1 . TYR A 1 103 ? -82.383  -11.186 6.754   1.00 99.99  ? 107 TYR C CE1 2  
ATOM 9262   C CE2 . TYR A 1 103 ? -82.756  -10.843 4.384   1.00 99.99  ? 107 TYR C CE2 2  
ATOM 9263   C CZ  . TYR A 1 103 ? -82.487  -10.326 5.657   1.00 99.99  ? 107 TYR C CZ  2  
ATOM 9264   O OH  . TYR A 1 103 ? -82.329  -8.983  5.825   1.00 99.99  ? 107 TYR C OH  2  
ATOM 9265   N N   . THR A 1 104 ? -85.304  -14.242 3.284   1.00 30.00  ? 108 THR C N   2  
ATOM 9266   C CA  . THR A 1 104 ? -86.143  -13.423 2.404   1.00 30.00  ? 108 THR C CA  2  
ATOM 9267   C C   . THR A 1 104 ? -87.628  -13.701 2.597   1.00 30.00  ? 108 THR C C   2  
ATOM 9268   O O   . THR A 1 104 ? -88.459  -13.310 1.781   1.00 30.00  ? 108 THR C O   2  
ATOM 9269   C CB  . THR A 1 104 ? -85.801  -13.711 0.946   1.00 99.99  ? 108 THR C CB  2  
ATOM 9270   O OG1 . THR A 1 104 ? -86.207  -15.045 0.616   1.00 99.99  ? 108 THR C OG1 2  
ATOM 9271   C CG2 . THR A 1 104 ? -84.297  -13.572 0.741   1.00 99.99  ? 108 THR C CG2 2  
ATOM 9272   N N   . SER A 1 105 ? -87.965  -14.374 3.681   1.00 30.00  ? 109 SER C N   2  
ATOM 9273   C CA  . SER A 1 105 ? -89.352  -14.685 3.955   1.00 30.00  ? 109 SER C CA  2  
ATOM 9274   C C   . SER A 1 105 ? -89.716  -14.320 5.389   1.00 30.00  ? 109 SER C C   2  
ATOM 9275   O O   . SER A 1 105 ? -90.803  -14.645 5.867   1.00 30.00  ? 109 SER C O   2  
ATOM 9276   C CB  . SER A 1 105 ? -89.602  -16.173 3.750   1.00 99.99  ? 109 SER C CB  2  
ATOM 9277   O OG  . SER A 1 105 ? -89.277  -16.531 2.405   1.00 99.99  ? 109 SER C OG  2  
ATOM 9278   N N   . GLY A 1 106 ? -88.795  -13.650 6.079   1.00 30.00  ? 110 GLY C N   2  
ATOM 9279   C CA  . GLY A 1 106 ? -89.043  -13.241 7.449   1.00 30.00  ? 110 GLY C CA  2  
ATOM 9280   C C   . GLY A 1 106 ? -88.411  -14.120 8.509   1.00 30.00  ? 110 GLY C C   2  
ATOM 9281   O O   . GLY A 1 106 ? -88.120  -13.654 9.617   1.00 30.00  ? 110 GLY C O   2  
ATOM 9282   N N   . LEU A 1 107 ? -88.199  -15.390 8.175   1.00 30.00  ? 111 LEU C N   2  
ATOM 9283   C CA  . LEU A 1 107 ? -87.596  -16.330 9.107   1.00 30.00  ? 111 LEU C CA  2  
ATOM 9284   C C   . LEU A 1 107 ? -86.097  -16.062 9.202   1.00 30.00  ? 111 LEU C C   2  
ATOM 9285   O O   . LEU A 1 107 ? -85.362  -16.242 8.229   1.00 30.00  ? 111 LEU C O   2  
ATOM 9286   C CB  . LEU A 1 107 ? -87.824  -17.757 8.622   1.00 99.99  ? 111 LEU C CB  2  
ATOM 9287   C CG  . LEU A 1 107 ? -89.067  -18.333 9.291   1.00 99.99  ? 111 LEU C CG  2  
ATOM 9288   C CD1 . LEU A 1 107 ? -89.111  -19.841 9.074   1.00 99.99  ? 111 LEU C CD1 2  
ATOM 9289   C CD2 . LEU A 1 107 ? -89.024  -18.034 10.786  1.00 99.99  ? 111 LEU C CD2 2  
ATOM 9290   N N   . ILE A 1 108 ? -85.659  -15.634 10.383  1.00 30.00  ? 112 ILE C N   2  
ATOM 9291   C CA  . ILE A 1 108 ? -84.259  -15.310 10.617  1.00 30.00  ? 112 ILE C CA  2  
ATOM 9292   C C   . ILE A 1 108 ? -83.563  -16.268 11.571  1.00 30.00  ? 112 ILE C C   2  
ATOM 9293   O O   . ILE A 1 108 ? -82.362  -16.118 11.850  1.00 30.00  ? 112 ILE C O   2  
ATOM 9294   C CB  . ILE A 1 108 ? -84.142  -13.913 11.216  1.00 99.99  ? 112 ILE C CB  2  
ATOM 9295   C CG1 . ILE A 1 108 ? -84.402  -13.980 12.716  1.00 99.99  ? 112 ILE C CG1 2  
ATOM 9296   C CG2 . ILE A 1 108 ? -85.171  -12.994 10.563  1.00 99.99  ? 112 ILE C CG2 2  
ATOM 9297   C CD1 . ILE A 1 108 ? -85.879  -13.714 12.992  1.00 99.99  ? 112 ILE C CD1 2  
ATOM 9298   N N   . TYR A 1 109 ? -84.302  -17.247 12.084  1.00 30.00  ? 113 TYR C N   2  
ATOM 9299   C CA  . TYR A 1 109 ? -83.728  -18.225 13.011  1.00 30.00  ? 113 TYR C CA  2  
ATOM 9300   C C   . TYR A 1 109 ? -83.733  -19.626 12.376  1.00 30.00  ? 113 TYR C C   2  
ATOM 9301   O O   . TYR A 1 109 ? -84.740  -20.045 11.783  1.00 30.00  ? 113 TYR C O   2  
ATOM 9302   C CB  . TYR A 1 109 ? -84.545  -18.262 14.298  1.00 99.99  ? 113 TYR C CB  2  
ATOM 9303   C CG  . TYR A 1 109 ? -83.944  -19.268 15.248  1.00 99.99  ? 113 TYR C CG  2  
ATOM 9304   C CD1 . TYR A 1 109 ? -82.860  -18.910 16.059  1.00 99.99  ? 113 TYR C CD1 2  
ATOM 9305   C CD2 . TYR A 1 109 ? -84.469  -20.565 15.319  1.00 99.99  ? 113 TYR C CD2 2  
ATOM 9306   C CE1 . TYR A 1 109 ? -82.303  -19.844 16.938  1.00 99.99  ? 113 TYR C CE1 2  
ATOM 9307   C CE2 . TYR A 1 109 ? -83.913  -21.499 16.200  1.00 99.99  ? 113 TYR C CE2 2  
ATOM 9308   C CZ  . TYR A 1 109 ? -82.829  -21.140 17.008  1.00 99.99  ? 113 TYR C CZ  2  
ATOM 9309   O OH  . TYR A 1 109 ? -82.288  -22.049 17.864  1.00 99.99  ? 113 TYR C OH  2  
ATOM 9310   N N   . THR A 1 110 ? -82.616  -20.347 12.487  1.00 30.00  ? 114 THR C N   2  
ATOM 9311   C CA  . THR A 1 110 ? -82.510  -21.697 11.907  1.00 30.00  ? 114 THR C CA  2  
ATOM 9312   C C   . THR A 1 110 ? -81.513  -22.544 12.677  1.00 30.00  ? 114 THR C C   2  
ATOM 9313   O O   . THR A 1 110 ? -80.426  -22.072 13.026  1.00 30.00  ? 114 THR C O   2  
ATOM 9314   C CB  . THR A 1 110 ? -82.048  -21.603 10.457  1.00 99.99  ? 114 THR C CB  2  
ATOM 9315   O OG1 . THR A 1 110 ? -82.982  -20.819 9.710   1.00 99.99  ? 114 THR C OG1 2  
ATOM 9316   C CG2 . THR A 1 110 ? -81.966  -23.004 9.859   1.00 99.99  ? 114 THR C CG2 2  
ATOM 9317   N N   . TYR A 1 111 ? -81.864  -23.796 12.947  1.00 30.00  ? 115 TYR C N   2  
ATOM 9318   C CA  . TYR A 1 111 ? -80.930  -24.649 13.672  1.00 30.00  ? 115 TYR C CA  2  
ATOM 9319   C C   . TYR A 1 111 ? -80.087  -25.428 12.658  1.00 30.00  ? 115 TYR C C   2  
ATOM 9320   O O   . TYR A 1 111 ? -80.413  -25.505 11.462  1.00 30.00  ? 115 TYR C O   2  
ATOM 9321   C CB  . TYR A 1 111 ? -81.699  -25.624 14.556  1.00 99.99  ? 115 TYR C CB  2  
ATOM 9322   C CG  . TYR A 1 111 ? -82.468  -24.858 15.603  1.00 99.99  ? 115 TYR C CG  2  
ATOM 9323   C CD1 . TYR A 1 111 ? -83.766  -24.411 15.333  1.00 99.99  ? 115 TYR C CD1 2  
ATOM 9324   C CD2 . TYR A 1 111 ? -81.884  -24.594 16.848  1.00 99.99  ? 115 TYR C CD2 2  
ATOM 9325   C CE1 . TYR A 1 111 ? -84.480  -23.699 16.303  1.00 99.99  ? 115 TYR C CE1 2  
ATOM 9326   C CE2 . TYR A 1 111 ? -82.596  -23.881 17.819  1.00 99.99  ? 115 TYR C CE2 2  
ATOM 9327   C CZ  . TYR A 1 111 ? -83.895  -23.434 17.548  1.00 99.99  ? 115 TYR C CZ  2  
ATOM 9328   O OH  . TYR A 1 111 ? -84.588  -22.744 18.494  1.00 99.99  ? 115 TYR C OH  2  
ATOM 9329   N N   . SER A 1 112 ? -78.840  -25.397 13.377  1.00 30.00  ? 116 SER C N   2  
ATOM 9330   C CA  . SER A 1 112 ? -77.780  -25.965 12.593  1.00 30.00  ? 116 SER C CA  2  
ATOM 9331   C C   . SER A 1 112 ? -77.350  -27.092 13.440  1.00 30.00  ? 116 SER C C   2  
ATOM 9332   O O   . SER A 1 112 ? -76.298  -27.101 14.035  1.00 30.00  ? 116 SER C O   2  
ATOM 9333   C CB  . SER A 1 112 ? -76.683  -24.929 12.373  1.00 99.99  ? 116 SER C CB  2  
ATOM 9334   O OG  . SER A 1 112 ? -76.034  -24.650 13.616  1.00 99.99  ? 116 SER C OG  2  
ATOM 9335   N N   . GLY A 1 113 ? -78.224  -28.030 13.554  1.00 30.00  ? 117 GLY C N   2  
ATOM 9336   C CA  . GLY A 1 113 ? -77.780  -29.061 14.411  1.00 30.00  ? 117 GLY C CA  2  
ATOM 9337   C C   . GLY A 1 113 ? -78.047  -28.565 15.803  1.00 30.00  ? 117 GLY C C   2  
ATOM 9338   O O   . GLY A 1 113 ? -79.136  -28.066 16.081  1.00 30.00  ? 117 GLY C O   2  
ATOM 9339   N N   . LEU A 1 114 ? -77.046  -28.723 16.673  1.00 30.00  ? 118 LEU C N   2  
ATOM 9340   C CA  . LEU A 1 114 ? -77.184  -28.342 18.074  1.00 30.00  ? 118 LEU C CA  2  
ATOM 9341   C C   . LEU A 1 114 ? -77.181  -26.860 18.481  1.00 30.00  ? 118 LEU C C   2  
ATOM 9342   O O   . LEU A 1 114 ? -77.564  -26.504 19.591  1.00 30.00  ? 118 LEU C O   2  
ATOM 9343   C CB  . LEU A 1 114 ? -76.038  -28.937 18.887  1.00 99.99  ? 118 LEU C CB  2  
ATOM 9344   C CG  . LEU A 1 114 ? -76.484  -30.261 19.498  1.00 99.99  ? 118 LEU C CG  2  
ATOM 9345   C CD1 . LEU A 1 114 ? -75.480  -30.690 20.565  1.00 99.99  ? 118 LEU C CD1 2  
ATOM 9346   C CD2 . LEU A 1 114 ? -77.859  -30.092 20.134  1.00 99.99  ? 118 LEU C CD2 2  
ATOM 9347   N N   . PHE A 1 115 ? -76.768  -25.977 17.589  1.00 30.00  ? 119 PHE C N   2  
ATOM 9348   C CA  . PHE A 1 115 ? -76.726  -24.553 17.877  1.00 30.00  ? 119 PHE C CA  2  
ATOM 9349   C C   . PHE A 1 115 ? -77.632  -23.774 16.947  1.00 30.00  ? 119 PHE C C   2  
ATOM 9350   O O   . PHE A 1 115 ? -78.057  -24.277 15.906  1.00 30.00  ? 119 PHE C O   2  
ATOM 9351   C CB  . PHE A 1 115 ? -75.301  -24.034 17.706  1.00 99.99  ? 119 PHE C CB  2  
ATOM 9352   C CG  . PHE A 1 115 ? -74.397  -24.696 18.716  1.00 99.99  ? 119 PHE C CG  2  
ATOM 9353   C CD1 . PHE A 1 115 ? -73.767  -25.907 18.402  1.00 99.99  ? 119 PHE C CD1 2  
ATOM 9354   C CD2 . PHE A 1 115 ? -74.186  -24.101 19.966  1.00 99.99  ? 119 PHE C CD2 2  
ATOM 9355   C CE1 . PHE A 1 115 ? -72.925  -26.523 19.337  1.00 99.99  ? 119 PHE C CE1 2  
ATOM 9356   C CE2 . PHE A 1 115 ? -73.349  -24.717 20.902  1.00 99.99  ? 119 PHE C CE2 2  
ATOM 9357   C CZ  . PHE A 1 115 ? -72.718  -25.927 20.589  1.00 99.99  ? 119 PHE C CZ  2  
ATOM 9358   N N   . CYS A 1 116 ? -77.883  -22.544 17.346  1.00 30.00  ? 120 CYS C N   2  
ATOM 9359   C CA  . CYS A 1 116 ? -78.736  -21.689 16.572  1.00 30.00  ? 120 CYS C CA  2  
ATOM 9360   C C   . CYS A 1 116 ? -77.991  -20.718 15.695  1.00 30.00  ? 120 CYS C C   2  
ATOM 9361   O O   . CYS A 1 116 ? -76.947  -20.225 16.072  1.00 30.00  ? 120 CYS C O   2  
ATOM 9362   C CB  . CYS A 1 116 ? -79.620  -20.862 17.502  1.00 99.99  ? 120 CYS C CB  2  
ATOM 9363   S SG  . CYS A 1 116 ? -78.766  -19.655 18.546  1.00 99.99  ? 120 CYS C SG  2  
ATOM 9364   N N   . ILE A 1 117 ? -78.836  -20.296 14.407  1.00 30.00  ? 121 ILE C N   2  
ATOM 9365   C CA  . ILE A 1 117 ? -78.347  -19.251 13.500  1.00 30.00  ? 121 ILE C CA  2  
ATOM 9366   C C   . ILE A 1 117 ? -79.306  -18.088 13.369  1.00 30.00  ? 121 ILE C C   2  
ATOM 9367   O O   . ILE A 1 117 ? -80.474  -18.259 12.987  1.00 30.00  ? 121 ILE C O   2  
ATOM 9368   C CB  . ILE A 1 117 ? -78.137  -19.831 12.105  1.00 99.99  ? 121 ILE C CB  2  
ATOM 9369   C CG1 . ILE A 1 117 ? -79.449  -19.777 11.328  1.00 99.99  ? 121 ILE C CG1 2  
ATOM 9370   C CG2 . ILE A 1 117 ? -77.676  -21.281 12.223  1.00 99.99  ? 121 ILE C CG2 2  
ATOM 9371   C CD1 . ILE A 1 117 ? -79.490  -18.502 10.493  1.00 99.99  ? 121 ILE C CD1 2  
ATOM 9372   N N   . ALA A 1 118 ? -78.798  -16.901 13.675  1.00 30.00  ? 122 ALA C N   2  
ATOM 9373   C CA  . ALA A 1 118 ? -79.594  -15.700 13.602  1.00 30.00  ? 122 ALA C CA  2  
ATOM 9374   C C   . ALA A 1 118 ? -79.058  -14.787 12.518  1.00 30.00  ? 122 ALA C C   2  
ATOM 9375   O O   . ALA A 1 118 ? -77.884  -14.403 12.542  1.00 30.00  ? 122 ALA C O   2  
ATOM 9376   C CB  . ALA A 1 118 ? -79.548  -14.987 14.946  1.00 30.00  ? 122 ALA C CB  2  
ATOM 9377   N N   . VAL A 1 119 ? -79.907  -14.442 11.562  1.00 30.00  ? 123 VAL C N   2  
ATOM 9378   C CA  . VAL A 1 119 ? -79.486  -13.552 10.487  1.00 30.00  ? 123 VAL C CA  2  
ATOM 9379   C C   . VAL A 1 119 ? -80.120  -12.180 10.737  1.00 30.00  ? 123 VAL C C   2  
ATOM 9380   O O   . VAL A 1 119 ? -81.342  -12.042 10.723  1.00 30.00  ? 123 VAL C O   2  
ATOM 9381   C CB  . VAL A 1 119 ? -79.951  -14.106 9.145   1.00 99.99  ? 123 VAL C CB  2  
ATOM 9382   C CG1 . VAL A 1 119 ? -79.336  -15.485 8.925   1.00 99.99  ? 123 VAL C CG1 2  
ATOM 9383   C CG2 . VAL A 1 119 ? -81.471  -14.219 9.136   1.00 99.99  ? 123 VAL C CG2 2  
ATOM 9384   N N   . ASN A 1 120 ? -79.352  -11.098 11.034  1.00 30.00  ? 124 ASN C N   2  
ATOM 9385   C CA  . ASN A 1 120 ? -79.841  -9.749  11.301  1.00 30.00  ? 124 ASN C CA  2  
ATOM 9386   C C   . ASN A 1 120 ? -80.972  -9.262  10.372  1.00 30.00  ? 124 ASN C C   2  
ATOM 9387   O O   . ASN A 1 120 ? -80.796  -9.147  9.155   1.00 30.00  ? 124 ASN C O   2  
ATOM 9388   C CB  . ASN A 1 120 ? -78.701  -8.747  11.151  1.00 99.99  ? 124 ASN C CB  2  
ATOM 9389   C CG  . ASN A 1 120 ? -78.154  -8.744  9.731   1.00 99.99  ? 124 ASN C CG  2  
ATOM 9390   O OD1 . ASN A 1 120 ? -77.406  -7.846  9.352   1.00 99.99  ? 124 ASN C OD1 2  
ATOM 9391   N ND2 . ASN A 1 120 ? -78.534  -9.753  8.945   1.00 99.99  ? 124 ASN C ND2 2  
ATOM 9392   N N   . PRO A 1 121 ? -82.149  -8.933  10.946  1.00 30.00  ? 125 PRO C N   2  
ATOM 9393   C CA  . PRO A 1 121 ? -83.320  -8.463  10.188  1.00 30.00  ? 125 PRO C CA  2  
ATOM 9394   C C   . PRO A 1 121 ? -83.318  -7.026  9.705   1.00 30.00  ? 125 PRO C C   2  
ATOM 9395   O O   . PRO A 1 121 ? -83.967  -6.715  8.691   1.00 30.00  ? 125 PRO C O   2  
ATOM 9396   C CB  . PRO A 1 121 ? -84.349  -8.657  11.243  1.00 99.99  ? 125 PRO C CB  2  
ATOM 9397   C CG  . PRO A 1 121 ? -83.632  -9.260  12.426  1.00 99.99  ? 125 PRO C CG  2  
ATOM 9398   C CD  . PRO A 1 121 ? -82.387  -9.458  12.224  1.00 99.99  ? 125 PRO C CD  2  
ATOM 9399   N N   . TYR A 1 122 ? -82.591  -6.170  10.426  1.00 30.00  ? 126 TYR C N   2  
ATOM 9400   C CA  . TYR A 1 122 ? -82.505  -4.739  10.117  1.00 30.00  ? 126 TYR C CA  2  
ATOM 9401   C C   . TYR A 1 122 ? -83.925  -4.165  10.009  1.00 30.00  ? 126 TYR C C   2  
ATOM 9402   O O   . TYR A 1 122 ? -84.235  -3.369  9.125   1.00 30.00  ? 126 TYR C O   2  
ATOM 9403   C CB  . TYR A 1 122 ? -81.770  -4.536  8.796   1.00 99.99  ? 126 TYR C CB  2  
ATOM 9404   C CG  . TYR A 1 122 ? -81.685  -3.062  8.487   1.00 99.99  ? 126 TYR C CG  2  
ATOM 9405   C CD1 . TYR A 1 122 ? -80.758  -2.257  9.161   1.00 99.99  ? 126 TYR C CD1 2  
ATOM 9406   C CD2 . TYR A 1 122 ? -82.531  -2.496  7.527   1.00 99.99  ? 126 TYR C CD2 2  
ATOM 9407   C CE1 . TYR A 1 122 ? -80.675  -0.889  8.874   1.00 99.99  ? 126 TYR C CE1 2  
ATOM 9408   C CE2 . TYR A 1 122 ? -82.453  -1.127  7.241   1.00 99.99  ? 126 TYR C CE2 2  
ATOM 9409   C CZ  . TYR A 1 122 ? -81.523  -0.326  7.916   1.00 99.99  ? 126 TYR C CZ  2  
ATOM 9410   O OH  . TYR A 1 122 ? -81.448  1.005   7.635   1.00 99.99  ? 126 TYR C OH  2  
ATOM 9411   N N   . ARG A 1 123 ? -84.783  -4.587  10.933  1.00 30.00  ? 127 ARG C N   2  
ATOM 9412   C CA  . ARG A 1 123 ? -86.165  -4.147  10.976  1.00 30.00  ? 127 ARG C CA  2  
ATOM 9413   C C   . ARG A 1 123 ? -86.823  -4.809  12.195  1.00 30.00  ? 127 ARG C C   2  
ATOM 9414   O O   . ARG A 1 123 ? -86.406  -5.877  12.637  1.00 30.00  ? 127 ARG C O   2  
ATOM 9415   C CB  . ARG A 1 123 ? -86.883  -4.567  9.698   1.00 99.99  ? 127 ARG C CB  2  
ATOM 9416   C CG  . ARG A 1 123 ? -88.319  -4.059  9.730   1.00 99.99  ? 127 ARG C CG  2  
ATOM 9417   C CD  . ARG A 1 123 ? -89.051  -4.519  8.475   1.00 99.99  ? 127 ARG C CD  2  
ATOM 9418   N NE  . ARG A 1 123 ? -88.849  -5.966  8.245   1.00 99.99  ? 127 ARG C NE  2  
ATOM 9419   C CZ  . ARG A 1 123 ? -89.535  -6.905  8.893   1.00 99.99  ? 127 ARG C CZ  2  
ATOM 9420   N NH1 . ARG A 1 123 ? -90.458  -6.603  9.802   1.00 99.99  ? 127 ARG C NH1 2  
ATOM 9421   N NH2 . ARG A 1 123 ? -89.275  -8.178  8.608   1.00 99.99  ? 127 ARG C NH2 2  
ATOM 9422   N N   . ARG A 1 124 ? -87.844  -4.171  12.752  1.00 30.00  ? 128 ARG C N   2  
ATOM 9423   C CA  . ARG A 1 124 ? -88.496  -4.733  13.923  1.00 30.00  ? 128 ARG C CA  2  
ATOM 9424   C C   . ARG A 1 124 ? -89.481  -5.831  13.557  1.00 30.00  ? 128 ARG C C   2  
ATOM 9425   O O   . ARG A 1 124 ? -90.263  -5.689  12.615  1.00 30.00  ? 128 ARG C O   2  
ATOM 9426   C CB  . ARG A 1 124 ? -89.263  -3.641  14.665  1.00 99.99  ? 128 ARG C CB  2  
ATOM 9427   C CG  . ARG A 1 124 ? -89.902  -4.227  15.919  1.00 99.99  ? 128 ARG C CG  2  
ATOM 9428   C CD  . ARG A 1 124 ? -90.707  -3.145  16.631  1.00 99.99  ? 128 ARG C CD  2  
ATOM 9429   N NE  . ARG A 1 124 ? -91.597  -2.439  15.684  1.00 99.99  ? 128 ARG C NE  2  
ATOM 9430   C CZ  . ARG A 1 124 ? -92.765  -2.930  15.281  1.00 99.99  ? 128 ARG C CZ  2  
ATOM 9431   N NH1 . ARG A 1 124 ? -93.217  -4.107  15.703  1.00 99.99  ? 128 ARG C NH1 2  
ATOM 9432   N NH2 . ARG A 1 124 ? -93.486  -2.208  14.428  1.00 99.99  ? 128 ARG C NH2 2  
ATOM 9433   N N   . LEU A 1 125 ? -89.431  -6.923  14.313  1.00 30.00  ? 129 LEU C N   2  
ATOM 9434   C CA  . LEU A 1 125 ? -90.302  -8.069  14.082  1.00 30.00  ? 129 LEU C CA  2  
ATOM 9435   C C   . LEU A 1 125 ? -91.160  -8.414  15.285  1.00 30.00  ? 129 LEU C C   2  
ATOM 9436   O O   . LEU A 1 125 ? -90.674  -8.457  16.408  1.00 30.00  ? 129 LEU C O   2  
ATOM 9437   C CB  . LEU A 1 125 ? -89.463  -9.297  13.748  1.00 99.99  ? 129 LEU C CB  2  
ATOM 9438   C CG  . LEU A 1 125 ? -88.851  -9.860  15.026  1.00 99.99  ? 129 LEU C CG  2  
ATOM 9439   C CD1 . LEU A 1 125 ? -88.509  -8.711  15.972  1.00 99.99  ? 129 LEU C CD1 2  
ATOM 9440   C CD2 . LEU A 1 125 ? -89.849  -10.794 15.700  1.00 99.99  ? 129 LEU C CD2 2  
ATOM 9441   N N   . PRO A 1 126 ? -92.455  -8.681  15.055  1.00 30.00  ? 130 PRO C N   2  
ATOM 9442   C CA  . PRO A 1 126 ? -93.420  -9.030  16.111  1.00 30.00  ? 130 PRO C CA  2  
ATOM 9443   C C   . PRO A 1 126 ? -93.277  -10.455 16.622  1.00 30.00  ? 130 PRO C C   2  
ATOM 9444   O O   . PRO A 1 126 ? -94.270  -11.114 16.924  1.00 30.00  ? 130 PRO C O   2  
ATOM 9445   C CB  . PRO A 1 126 ? -94.670  -8.843  15.328  1.00 99.99  ? 130 PRO C CB  2  
ATOM 9446   C CG  . PRO A 1 126 ? -94.244  -8.362  13.964  1.00 99.99  ? 130 PRO C CG  2  
ATOM 9447   C CD  . PRO A 1 126 ? -92.981  -8.228  13.839  1.00 99.99  ? 130 PRO C CD  2  
ATOM 9448   N N   . ILE A 1 127 ? -92.044  -10.924 16.733  1.00 30.00  ? 131 ILE C N   2  
ATOM 9449   C CA  . ILE A 1 127 ? -91.779  -12.287 17.181  1.00 30.00  ? 131 ILE C CA  2  
ATOM 9450   C C   . ILE A 1 127 ? -91.294  -12.403 18.622  1.00 30.00  ? 131 ILE C C   2  
ATOM 9451   O O   . ILE A 1 127 ? -91.114  -13.509 19.132  1.00 30.00  ? 131 ILE C O   2  
ATOM 9452   C CB  . ILE A 1 127 ? -90.702  -12.921 16.309  1.00 99.99  ? 131 ILE C CB  2  
ATOM 9453   C CG1 . ILE A 1 127 ? -90.272  -14.253 16.917  1.00 99.99  ? 131 ILE C CG1 2  
ATOM 9454   C CG2 . ILE A 1 127 ? -89.498  -11.988 16.228  1.00 99.99  ? 131 ILE C CG2 2  
ATOM 9455   C CD1 . ILE A 1 127 ? -91.504  -15.018 17.387  1.00 99.99  ? 131 ILE C CD1 2  
ATOM 9456   N N   . TYR A 1 128 ? -91.094  -11.263 19.276  1.00 30.00  ? 132 TYR C N   2  
ATOM 9457   C CA  . TYR A 1 128 ? -90.619  -11.237 20.659  1.00 30.00  ? 132 TYR C CA  2  
ATOM 9458   C C   . TYR A 1 128 ? -91.680  -10.882 21.707  1.00 30.00  ? 132 TYR C C   2  
ATOM 9459   O O   . TYR A 1 128 ? -91.388  -10.832 22.906  1.00 30.00  ? 132 TYR C O   2  
ATOM 9460   C CB  . TYR A 1 128 ? -89.507  -10.204 20.807  1.00 99.99  ? 132 TYR C CB  2  
ATOM 9461   C CG  . TYR A 1 128 ? -90.085  -8.817  20.650  1.00 99.99  ? 132 TYR C CG  2  
ATOM 9462   C CD1 . TYR A 1 128 ? -90.145  -8.226  19.383  1.00 99.99  ? 132 TYR C CD1 2  
ATOM 9463   C CD2 . TYR A 1 128 ? -90.555  -8.124  21.770  1.00 99.99  ? 132 TYR C CD2 2  
ATOM 9464   C CE1 . TYR A 1 128 ? -90.680  -6.938  19.236  1.00 99.99  ? 132 TYR C CE1 2  
ATOM 9465   C CE2 . TYR A 1 128 ? -91.088  -6.839  21.624  1.00 99.99  ? 132 TYR C CE2 2  
ATOM 9466   C CZ  . TYR A 1 128 ? -91.151  -6.246  20.356  1.00 99.99  ? 132 TYR C CZ  2  
ATOM 9467   O OH  . TYR A 1 128 ? -91.670  -4.996  20.214  1.00 99.99  ? 132 TYR C OH  2  
ATOM 9468   N N   . THR A 1 129 ? -92.908  -10.642 21.251  1.00 30.00  ? 133 THR C N   2  
ATOM 9469   C CA  . THR A 1 129 ? -94.008  -10.293 22.133  1.00 30.00  ? 133 THR C CA  2  
ATOM 9470   C C   . THR A 1 129 ? -94.214  -11.286 23.277  1.00 30.00  ? 133 THR C C   2  
ATOM 9471   O O   . THR A 1 129 ? -93.617  -12.366 23.317  1.00 30.00  ? 133 THR C O   2  
ATOM 9472   C CB  . THR A 1 129 ? -95.312  -10.245 21.342  1.00 99.99  ? 133 THR C CB  2  
ATOM 9473   O OG1 . THR A 1 129 ? -95.658  -11.562 20.911  1.00 99.99  ? 133 THR C OG1 2  
ATOM 9474   C CG2 . THR A 1 129 ? -95.131  -9.343  20.126  1.00 99.99  ? 133 THR C CG2 2  
ATOM 9475   N N   . ASP A 1 130 ? -95.065  -10.890 24.209  1.00 30.00  ? 134 ASP C N   2  
ATOM 9476   C CA  . ASP A 1 130 ? -95.381  -11.717 25.363  1.00 30.00  ? 134 ASP C CA  2  
ATOM 9477   C C   . ASP A 1 130 ? -96.323  -12.818 24.890  1.00 30.00  ? 134 ASP C C   2  
ATOM 9478   O O   . ASP A 1 130 ? -96.440  -13.883 25.501  1.00 30.00  ? 134 ASP C O   2  
ATOM 9479   C CB  . ASP A 1 130 ? -96.049  -10.871 26.441  1.00 99.99  ? 134 ASP C CB  2  
ATOM 9480   C CG  . ASP A 1 130 ? -97.164  -10.035 25.813  1.00 99.99  ? 134 ASP C CG  2  
ATOM 9481   O OD1 . ASP A 1 130 ? -96.846  -9.281  24.853  1.00 99.99  ? 134 ASP C OD1 2  
ATOM 9482   O OD2 . ASP A 1 130 ? -98.318  -10.156 26.298  1.00 99.99  ? 134 ASP C OD2 2  
ATOM 9483   N N   . SER A 1 131 ? -97.011  -12.539 23.790  1.00 30.00  ? 135 SER C N   2  
ATOM 9484   C CA  . SER A 1 131 ? -97.933  -13.501 23.214  1.00 30.00  ? 135 SER C CA  2  
ATOM 9485   C C   . SER A 1 131 ? -97.077  -14.702 22.813  1.00 30.00  ? 135 SER C C   2  
ATOM 9486   O O   . SER A 1 131 ? -97.334  -15.846 23.200  1.00 30.00  ? 135 SER C O   2  
ATOM 9487   C CB  . SER A 1 131 ? -98.629  -12.888 22.004  1.00 99.99  ? 135 SER C CB  2  
ATOM 9488   O OG  . SER A 1 131 ? -97.683  -12.696 20.953  1.00 99.99  ? 135 SER C OG  2  
ATOM 9489   N N   . VAL A 1 132 ? -96.038  -14.417 22.039  1.00 30.00  ? 136 VAL C N   2  
ATOM 9490   C CA  . VAL A 1 132 ? -95.116  -15.427 21.555  1.00 30.00  ? 136 VAL C CA  2  
ATOM 9491   C C   . VAL A 1 132 ? -94.333  -16.127 22.653  1.00 30.00  ? 136 VAL C C   2  
ATOM 9492   O O   . VAL A 1 132 ? -94.080  -17.329 22.557  1.00 30.00  ? 136 VAL C O   2  
ATOM 9493   C CB  . VAL A 1 132 ? -94.097  -14.792 20.614  1.00 99.99  ? 136 VAL C CB  2  
ATOM 9494   C CG1 . VAL A 1 132 ? -94.821  -14.161 19.427  1.00 99.99  ? 136 VAL C CG1 2  
ATOM 9495   C CG2 . VAL A 1 132 ? -93.315  -13.717 21.361  1.00 99.99  ? 136 VAL C CG2 2  
ATOM 9496   N N   . ILE A 1 133 ? -93.944  -15.394 23.690  1.00 30.00  ? 137 ILE C N   2  
ATOM 9497   C CA  . ILE A 1 133 ? -93.183  -16.010 24.774  1.00 30.00  ? 137 ILE C CA  2  
ATOM 9498   C C   . ILE A 1 133 ? -93.978  -17.094 25.475  1.00 30.00  ? 137 ILE C C   2  
ATOM 9499   O O   . ILE A 1 133 ? -93.421  -18.100 25.933  1.00 30.00  ? 137 ILE C O   2  
ATOM 9500   C CB  . ILE A 1 133 ? -92.803  -14.954 25.807  1.00 99.99  ? 137 ILE C CB  2  
ATOM 9501   C CG1 . ILE A 1 133 ? -93.940  -14.794 26.810  1.00 99.99  ? 137 ILE C CG1 2  
ATOM 9502   C CG2 . ILE A 1 133 ? -92.555  -13.621 25.105  1.00 99.99  ? 137 ILE C CG2 2  
ATOM 9503   C CD1 . ILE A 1 133 ? -93.676  -15.682 28.024  1.00 99.99  ? 137 ILE C CD1 2  
ATOM 9504   N N   . ALA A 1 134 ? -95.291  -16.880 25.554  1.00 30.00  ? 138 ALA C N   2  
ATOM 9505   C CA  . ALA A 1 134 ? -96.213  -17.817 26.194  1.00 30.00  ? 138 ALA C CA  2  
ATOM 9506   C C   . ALA A 1 134 ? -96.147  -19.190 25.528  1.00 30.00  ? 138 ALA C C   2  
ATOM 9507   O O   . ALA A 1 134 ? -96.108  -20.225 26.197  1.00 30.00  ? 138 ALA C O   2  
ATOM 9508   C CB  . ALA A 1 134 ? -97.636  -17.274 26.108  1.00 30.00  ? 138 ALA C CB  2  
ATOM 9509   N N   . LYS A 1 135 ? -96.132  -19.174 24.202  1.00 30.00  ? 139 LYS C N   2  
ATOM 9510   C CA  . LYS A 1 135 ? -96.075  -20.381 23.396  1.00 30.00  ? 139 LYS C CA  2  
ATOM 9511   C C   . LYS A 1 135 ? -94.745  -21.136 23.417  1.00 30.00  ? 139 LYS C C   2  
ATOM 9512   O O   . LYS A 1 135 ? -94.726  -22.344 23.231  1.00 30.00  ? 139 LYS C O   2  
ATOM 9513   C CB  . LYS A 1 135 ? -96.343  -20.040 21.933  1.00 99.99  ? 139 LYS C CB  2  
ATOM 9514   C CG  . LYS A 1 135 ? -96.580  -21.324 21.146  1.00 99.99  ? 139 LYS C CG  2  
ATOM 9515   C CD  . LYS A 1 135 ? -96.945  -20.978 19.706  1.00 99.99  ? 139 LYS C CD  2  
ATOM 9516   C CE  . LYS A 1 135 ? -97.157  -22.264 18.914  1.00 99.99  ? 139 LYS C CE  2  
ATOM 9517   N NZ  . LYS A 1 135 ? -97.486  -21.930 17.521  1.00 99.99  ? 139 LYS C NZ  2  
ATOM 9518   N N   . TYR A 1 136 ? -93.636  -20.440 23.647  1.00 30.00  ? 140 TYR C N   2  
ATOM 9519   C CA  . TYR A 1 136 ? -92.341  -21.107 23.670  1.00 30.00  ? 140 TYR C CA  2  
ATOM 9520   C C   . TYR A 1 136 ? -91.985  -21.705 25.006  1.00 30.00  ? 140 TYR C C   2  
ATOM 9521   O O   . TYR A 1 136 ? -91.064  -22.524 25.101  1.00 30.00  ? 140 TYR C O   2  
ATOM 9522   C CB  . TYR A 1 136 ? -91.241  -20.114 23.317  1.00 99.99  ? 140 TYR C CB  2  
ATOM 9523   C CG  . TYR A 1 136 ? -90.396  -19.843 24.539  1.00 99.99  ? 140 TYR C CG  2  
ATOM 9524   C CD1 . TYR A 1 136 ? -90.949  -19.985 25.816  1.00 99.99  ? 140 TYR C CD1 2  
ATOM 9525   C CD2 . TYR A 1 136 ? -89.061  -19.446 24.394  1.00 99.99  ? 140 TYR C CD2 2  
ATOM 9526   C CE1 . TYR A 1 136 ? -90.166  -19.734 26.950  1.00 99.99  ? 140 TYR C CE1 2  
ATOM 9527   C CE2 . TYR A 1 136 ? -88.279  -19.194 25.527  1.00 99.99  ? 140 TYR C CE2 2  
ATOM 9528   C CZ  . TYR A 1 136 ? -88.832  -19.339 26.805  1.00 99.99  ? 140 TYR C CZ  2  
ATOM 9529   O OH  . TYR A 1 136 ? -88.070  -19.093 27.907  1.00 99.99  ? 140 TYR C OH  2  
ATOM 9530   N N   . ARG A 1 137 ? -92.710  -21.306 26.043  1.00 30.00  ? 141 ARG C N   2  
ATOM 9531   C CA  . ARG A 1 137 ? -92.445  -21.810 27.382  1.00 30.00  ? 141 ARG C CA  2  
ATOM 9532   C C   . ARG A 1 137 ? -92.525  -23.346 27.467  1.00 30.00  ? 141 ARG C C   2  
ATOM 9533   O O   . ARG A 1 137 ? -93.537  -23.954 27.095  1.00 30.00  ? 141 ARG C O   2  
ATOM 9534   C CB  . ARG A 1 137 ? -93.469  -21.238 28.360  1.00 99.99  ? 141 ARG C CB  2  
ATOM 9535   C CG  . ARG A 1 137 ? -92.843  -21.139 29.748  1.00 99.99  ? 141 ARG C CG  2  
ATOM 9536   C CD  . ARG A 1 137 ? -93.746  -20.305 30.651  1.00 99.99  ? 141 ARG C CD  2  
ATOM 9537   N NE  . ARG A 1 137 ? -93.012  -19.842 31.850  1.00 99.99  ? 141 ARG C NE  2  
ATOM 9538   C CZ  . ARG A 1 137 ? -93.518  -18.972 32.720  1.00 99.99  ? 141 ARG C CZ  2  
ATOM 9539   N NH1 . ARG A 1 137 ? -94.734  -18.450 32.568  1.00 99.99  ? 141 ARG C NH1 2  
ATOM 9540   N NH2 . ARG A 1 137 ? -92.773  -18.624 33.764  1.00 99.99  ? 141 ARG C NH2 2  
ATOM 9541   N N   . GLY A 1 138 ? -91.422  -23.890 27.965  1.00 30.00  ? 142 GLY C N   2  
ATOM 9542   C CA  . GLY A 1 138 ? -91.240  -25.333 28.248  1.00 30.00  ? 142 GLY C CA  2  
ATOM 9543   C C   . GLY A 1 138 ? -91.315  -26.217 26.990  1.00 30.00  ? 142 GLY C C   2  
ATOM 9544   O O   . GLY A 1 138 ? -91.446  -27.444 27.077  1.00 30.00  ? 142 GLY C O   2  
ATOM 9545   N N   . LYS A 1 139 ? -91.220  -25.600 25.832  1.00 30.00  ? 143 LYS C N   2  
ATOM 9546   C CA  . LYS A 1 139 ? -91.282  -26.349 24.563  1.00 30.00  ? 143 LYS C CA  2  
ATOM 9547   C C   . LYS A 1 139 ? -89.900  -26.895 24.191  1.00 30.00  ? 143 LYS C C   2  
ATOM 9548   O O   . LYS A 1 139 ? -88.878  -26.213 24.361  1.00 30.00  ? 143 LYS C O   2  
ATOM 9549   C CB  . LYS A 1 139 ? -91.766  -25.433 23.444  1.00 99.99  ? 143 LYS C CB  2  
ATOM 9550   C CG  . LYS A 1 139 ? -93.278  -25.553 23.304  1.00 99.99  ? 143 LYS C CG  2  
ATOM 9551   C CD  . LYS A 1 139 ? -93.955  -24.787 24.437  1.00 99.99  ? 143 LYS C CD  2  
ATOM 9552   C CE  . LYS A 1 139 ? -95.454  -25.068 24.417  1.00 99.99  ? 143 LYS C CE  2  
ATOM 9553   N NZ  . LYS A 1 139 ? -96.088  -24.429 25.578  1.00 99.99  ? 143 LYS C NZ  2  
ATOM 9554   N N   . ARG A 1 140 ? -89.934  -28.117 23.700  1.00 30.00  ? 144 ARG C N   2  
ATOM 9555   C CA  . ARG A 1 140 ? -88.748  -28.854 23.238  1.00 30.00  ? 144 ARG C CA  2  
ATOM 9556   C C   . ARG A 1 140 ? -88.490  -28.454 21.763  1.00 30.00  ? 144 ARG C C   2  
ATOM 9557   O O   . ARG A 1 140 ? -89.387  -28.543 20.919  1.00 30.00  ? 144 ARG C O   2  
ATOM 9558   C CB  . ARG A 1 140 ? -88.996  -30.354 23.342  1.00 99.99  ? 144 ARG C CB  2  
ATOM 9559   C CG  . ARG A 1 140 ? -90.058  -30.767 22.327  1.00 99.99  ? 144 ARG C CG  2  
ATOM 9560   C CD  . ARG A 1 140 ? -90.114  -32.288 22.237  1.00 99.99  ? 144 ARG C CD  2  
ATOM 9561   N NE  . ARG A 1 140 ? -91.215  -32.726 21.351  1.00 99.99  ? 144 ARG C NE  2  
ATOM 9562   C CZ  . ARG A 1 140 ? -91.539  -34.004 21.180  1.00 99.99  ? 144 ARG C CZ  2  
ATOM 9563   N NH1 . ARG A 1 140 ? -90.888  -34.988 21.797  1.00 99.99  ? 144 ARG C NH1 2  
ATOM 9564   N NH2 . ARG A 1 140 ? -92.549  -34.287 20.361  1.00 99.99  ? 144 ARG C NH2 2  
ATOM 9565   N N   . LYS A 1 141 ? -87.258  -28.024 21.521  1.00 30.00  ? 145 LYS C N   2  
ATOM 9566   C CA  . LYS A 1 141 ? -86.765  -27.471 20.217  1.00 30.00  ? 145 LYS C CA  2  
ATOM 9567   C C   . LYS A 1 141 ? -87.479  -28.002 18.937  1.00 30.00  ? 145 LYS C C   2  
ATOM 9568   O O   . LYS A 1 141 ? -87.713  -27.254 17.975  1.00 30.00  ? 145 LYS C O   2  
ATOM 9569   C CB  . LYS A 1 141 ? -85.287  -27.801 20.039  1.00 99.99  ? 145 LYS C CB  2  
ATOM 9570   C CG  . LYS A 1 141 ? -84.490  -27.205 21.193  1.00 99.99  ? 145 LYS C CG  2  
ATOM 9571   C CD  . LYS A 1 141 ? -83.002  -27.450 20.964  1.00 99.99  ? 145 LYS C CD  2  
ATOM 9572   C CE  . LYS A 1 141 ? -82.204  -26.829 22.107  1.00 99.99  ? 145 LYS C CE  2  
ATOM 9573   N NZ  . LYS A 1 141 ? -80.810  -26.634 21.679  1.00 99.99  ? 145 LYS C NZ  2  
ATOM 9574   N N   . THR A 1 142 ? -87.823  -29.280 18.896  1.00 30.00  ? 146 THR C N   2  
ATOM 9575   C CA  . THR A 1 142 ? -88.459  -29.878 17.685  1.00 30.00  ? 146 THR C CA  2  
ATOM 9576   C C   . THR A 1 142 ? -89.971  -29.619 17.642  1.00 30.00  ? 146 THR C C   2  
ATOM 9577   O O   . THR A 1 142 ? -90.601  -29.681 16.573  1.00 30.00  ? 146 THR C O   2  
ATOM 9578   C CB  . THR A 1 142 ? -88.239  -31.387 17.675  1.00 99.99  ? 146 THR C CB  2  
ATOM 9579   O OG1 . THR A 1 142 ? -88.977  -31.984 18.744  1.00 99.99  ? 146 THR C OG1 2  
ATOM 9580   C CG2 . THR A 1 142 ? -86.754  -31.687 17.856  1.00 99.99  ? 146 THR C CG2 2  
ATOM 9581   N N   . GLU A 1 143 ? -90.495  -29.331 18.807  1.00 30.00  ? 147 GLU C N   2  
ATOM 9582   C CA  . GLU A 1 143 ? -91.934  -29.119 19.025  1.00 30.00  ? 147 GLU C CA  2  
ATOM 9583   C C   . GLU A 1 143 ? -92.446  -27.820 18.395  1.00 30.00  ? 147 GLU C C   2  
ATOM 9584   O O   . GLU A 1 143 ? -93.592  -27.742 17.933  1.00 30.00  ? 147 GLU C O   2  
ATOM 9585   C CB  . GLU A 1 143 ? -92.227  -29.055 20.519  1.00 99.99  ? 147 GLU C CB  2  
ATOM 9586   C CG  . GLU A 1 143 ? -91.921  -30.391 21.153  1.00 99.99  ? 147 GLU C CG  2  
ATOM 9587   C CD  . GLU A 1 143 ? -92.980  -31.409 20.733  1.00 99.99  ? 147 GLU C CD  2  
ATOM 9588   O OE1 . GLU A 1 143 ? -92.762  -32.071 19.685  1.00 99.99  ? 147 GLU C OE1 2  
ATOM 9589   O OE2 . GLU A 1 143 ? -94.002  -31.514 21.466  1.00 99.99  ? 147 GLU C OE2 2  
ATOM 9590   N N   . ILE A 1 144 ? -91.603  -26.804 18.381  1.00 30.00  ? 148 ILE C N   2  
ATOM 9591   C CA  . ILE A 1 144 ? -92.028  -25.488 17.884  1.00 30.00  ? 148 ILE C CA  2  
ATOM 9592   C C   . ILE A 1 144 ? -90.964  -24.828 16.979  1.00 30.00  ? 148 ILE C C   2  
ATOM 9593   O O   . ILE A 1 144 ? -89.768  -25.098 17.134  1.00 30.00  ? 148 ILE C O   2  
ATOM 9594   C CB  . ILE A 1 144 ? -92.287  -24.552 19.059  1.00 99.99  ? 148 ILE C CB  2  
ATOM 9595   C CG1 . ILE A 1 144 ? -90.964  -23.969 19.547  1.00 99.99  ? 148 ILE C CG1 2  
ATOM 9596   C CG2 . ILE A 1 144 ? -92.947  -25.332 20.194  1.00 99.99  ? 148 ILE C CG2 2  
ATOM 9597   C CD1 . ILE A 1 144 ? -90.408  -24.834 20.671  1.00 99.99  ? 148 ILE C CD1 2  
ATOM 9598   N N   . PRO A 1 145 ? -91.392  -23.973 16.017  1.00 30.00  ? 149 PRO C N   2  
ATOM 9599   C CA  . PRO A 1 145 ? -90.473  -23.287 15.105  1.00 30.00  ? 149 PRO C CA  2  
ATOM 9600   C C   . PRO A 1 145 ? -89.159  -22.855 15.717  1.00 30.00  ? 149 PRO C C   2  
ATOM 9601   O O   . PRO A 1 145 ? -89.029  -22.737 16.938  1.00 30.00  ? 149 PRO C O   2  
ATOM 9602   C CB  . PRO A 1 145 ? -91.329  -22.117 14.776  1.00 99.99  ? 149 PRO C CB  2  
ATOM 9603   C CG  . PRO A 1 145 ? -92.636  -22.335 15.507  1.00 99.99  ? 149 PRO C CG  2  
ATOM 9604   C CD  . PRO A 1 145 ? -92.672  -23.423 16.170  1.00 99.99  ? 149 PRO C CD  2  
ATOM 9605   N N   . PRO A 1 146 ? -88.146  -22.611 14.873  1.00 30.00  ? 150 PRO C N   2  
ATOM 9606   C CA  . PRO A 1 146 ? -86.876  -22.197 15.457  1.00 30.00  ? 150 PRO C CA  2  
ATOM 9607   C C   . PRO A 1 146 ? -86.967  -20.766 16.008  1.00 30.00  ? 150 PRO C C   2  
ATOM 9608   O O   . PRO A 1 146 ? -87.522  -19.855 15.373  1.00 30.00  ? 150 PRO C O   2  
ATOM 9609   C CB  . PRO A 1 146 ? -86.037  -22.292 14.230  1.00 99.99  ? 150 PRO C CB  2  
ATOM 9610   C CG  . PRO A 1 146 ? -86.736  -23.279 13.322  1.00 99.99  ? 150 PRO C CG  2  
ATOM 9611   C CD  . PRO A 1 146 ? -88.004  -23.284 13.455  1.00 99.99  ? 150 PRO C CD  2  
ATOM 9612   N N   . HIS A 1 147 ? -86.423  -20.582 17.198  1.00 30.00  ? 151 HIS C N   2  
ATOM 9613   C CA  . HIS A 1 147 ? -86.445  -19.279 17.821  1.00 30.00  ? 151 HIS C CA  2  
ATOM 9614   C C   . HIS A 1 147 ? -85.401  -19.230 18.902  1.00 30.00  ? 151 HIS C C   2  
ATOM 9615   O O   . HIS A 1 147 ? -84.991  -20.264 19.451  1.00 30.00  ? 151 HIS C O   2  
ATOM 9616   C CB  . HIS A 1 147 ? -87.818  -19.020 18.429  1.00 99.99  ? 151 HIS C CB  2  
ATOM 9617   C CG  . HIS A 1 147 ? -88.087  -17.586 18.818  1.00 99.99  ? 151 HIS C CG  2  
ATOM 9618   N ND1 . HIS A 1 147 ? -87.782  -17.098 20.081  1.00 99.99  ? 151 HIS C ND1 2  
ATOM 9619   C CD2 . HIS A 1 147 ? -88.622  -16.552 18.117  1.00 99.99  ? 151 HIS C CD2 2  
ATOM 9620   C CE1 . HIS A 1 147 ? -88.127  -15.824 20.120  1.00 99.99  ? 151 HIS C CE1 2  
ATOM 9621   N NE2 . HIS A 1 147 ? -88.630  -15.481 18.959  1.00 99.99  ? 151 HIS C NE2 2  
ATOM 9622   N N   . LEU A 1 148 ? -84.981  -18.007 19.201  1.00 30.00  ? 152 LEU C N   2  
ATOM 9623   C CA  . LEU A 1 148 ? -83.988  -17.757 20.223  1.00 30.00  ? 152 LEU C CA  2  
ATOM 9624   C C   . LEU A 1 148 ? -84.596  -18.114 21.591  1.00 30.00  ? 152 LEU C C   2  
ATOM 9625   O O   . LEU A 1 148 ? -83.888  -18.556 22.505  1.00 30.00  ? 152 LEU C O   2  
ATOM 9626   C CB  . LEU A 1 148 ? -83.584  -16.285 20.205  1.00 99.99  ? 152 LEU C CB  2  
ATOM 9627   C CG  . LEU A 1 148 ? -82.337  -16.112 19.349  1.00 99.99  ? 152 LEU C CG  2  
ATOM 9628   C CD1 . LEU A 1 148 ? -81.743  -14.728 19.590  1.00 99.99  ? 152 LEU C CD1 2  
ATOM 9629   C CD2 . LEU A 1 148 ? -81.310  -17.176 19.722  1.00 99.99  ? 152 LEU C CD2 2  
ATOM 9630   N N   . PHE A 1 149 ? -85.917  -17.944 21.727  1.00 30.00  ? 153 PHE C N   2  
ATOM 9631   C CA  . PHE A 1 149 ? -86.567  -18.261 23.001  1.00 30.00  ? 153 PHE C CA  2  
ATOM 9632   C C   . PHE A 1 149 ? -86.331  -19.717 23.308  1.00 30.00  ? 153 PHE C C   2  
ATOM 9633   O O   . PHE A 1 149 ? -86.011  -20.075 24.443  1.00 30.00  ? 153 PHE C O   2  
ATOM 9634   C CB  . PHE A 1 149 ? -88.064  -17.991 22.900  1.00 99.99  ? 153 PHE C CB  2  
ATOM 9635   C CG  . PHE A 1 149 ? -88.309  -16.501 22.905  1.00 99.99  ? 153 PHE C CG  2  
ATOM 9636   C CD1 . PHE A 1 149 ? -88.249  -15.788 24.109  1.00 99.99  ? 153 PHE C CD1 2  
ATOM 9637   C CD2 . PHE A 1 149 ? -88.594  -15.834 21.707  1.00 99.99  ? 153 PHE C CD2 2  
ATOM 9638   C CE1 . PHE A 1 149 ? -88.476  -14.405 24.112  1.00 99.99  ? 153 PHE C CE1 2  
ATOM 9639   C CE2 . PHE A 1 149 ? -88.822  -14.452 21.715  1.00 99.99  ? 153 PHE C CE2 2  
ATOM 9640   C CZ  . PHE A 1 149 ? -88.762  -13.740 22.918  1.00 99.99  ? 153 PHE C CZ  2  
ATOM 9641   N N   . SER A 1 150 ? -86.485  -20.552 22.281  1.00 30.00  ? 154 SER C N   2  
ATOM 9642   C CA  . SER A 1 150 ? -86.290  -21.995 22.386  1.00 30.00  ? 154 SER C CA  2  
ATOM 9643   C C   . SER A 1 150 ? -84.907  -22.334 22.921  1.00 30.00  ? 154 SER C C   2  
ATOM 9644   O O   . SER A 1 150 ? -84.749  -23.211 23.774  1.00 30.00  ? 154 SER C O   2  
ATOM 9645   C CB  . SER A 1 150 ? -86.448  -22.640 21.014  1.00 99.99  ? 154 SER C CB  2  
ATOM 9646   O OG  . SER A 1 150 ? -87.748  -22.355 20.497  1.00 99.99  ? 154 SER C OG  2  
ATOM 9647   N N   . VAL A 1 151 ? -83.896  -21.635 22.417  1.00 30.00  ? 155 VAL C N   2  
ATOM 9648   C CA  . VAL A 1 151 ? -82.531  -21.875 22.868  1.00 30.00  ? 155 VAL C CA  2  
ATOM 9649   C C   . VAL A 1 151 ? -82.438  -21.560 24.361  1.00 30.00  ? 155 VAL C C   2  
ATOM 9650   O O   . VAL A 1 151 ? -81.855  -22.331 25.131  1.00 30.00  ? 155 VAL C O   2  
ATOM 9651   C CB  . VAL A 1 151 ? -81.563  -20.979 22.098  1.00 99.99  ? 155 VAL C CB  2  
ATOM 9652   C CG1 . VAL A 1 151 ? -80.144  -21.200 22.612  1.00 99.99  ? 155 VAL C CG1 2  
ATOM 9653   C CG2 . VAL A 1 151 ? -81.625  -21.322 20.615  1.00 99.99  ? 155 VAL C CG2 2  
ATOM 9654   N N   . ALA A 1 152 ? -83.019  -20.410 24.746  1.00 30.00  ? 156 ALA C N   2  
ATOM 9655   C CA  . ALA A 1 152 ? -83.038  -19.935 26.145  1.00 30.00  ? 156 ALA C CA  2  
ATOM 9656   C C   . ALA A 1 152 ? -83.902  -20.870 26.992  1.00 30.00  ? 156 ALA C C   2  
ATOM 9657   O O   . ALA A 1 152 ? -83.463  -21.382 28.037  1.00 30.00  ? 156 ALA C O   2  
ATOM 9658   C CB  . ALA A 1 152 ? -83.596  -18.532 26.195  1.00 30.00  ? 156 ALA C CB  2  
ATOM 9659   N N   . ASP A 1 153 ? -85.132  -21.087 26.534  1.00 30.00  ? 157 ASP C N   2  
ATOM 9660   C CA  . ASP A 1 153 ? -86.025  -21.980 27.249  1.00 30.00  ? 157 ASP C CA  2  
ATOM 9661   C C   . ASP A 1 153 ? -85.353  -23.337 27.484  1.00 30.00  ? 157 ASP C C   2  
ATOM 9662   O O   . ASP A 1 153 ? -85.464  -23.919 28.564  1.00 30.00  ? 157 ASP C O   2  
ATOM 9663   C CB  . ASP A 1 153 ? -87.299  -22.196 26.441  1.00 99.99  ? 157 ASP C CB  2  
ATOM 9664   C CG  . ASP A 1 153 ? -88.329  -22.927 27.297  1.00 99.99  ? 157 ASP C CG  2  
ATOM 9665   O OD1 . ASP A 1 153 ? -88.201  -24.175 27.414  1.00 99.99  ? 157 ASP C OD1 2  
ATOM 9666   O OD2 . ASP A 1 153 ? -89.235  -22.232 27.831  1.00 99.99  ? 157 ASP C OD2 2  
ATOM 9667   N N   . ASN A 1 154 ? -84.648  -23.859 26.487  1.00 30.00  ? 158 ASN C N   2  
ATOM 9668   C CA  . ASN A 1 154 ? -84.013  -25.147 26.685  1.00 30.00  ? 158 ASN C CA  2  
ATOM 9669   C C   . ASN A 1 154 ? -82.870  -25.109 27.681  1.00 30.00  ? 158 ASN C C   2  
ATOM 9670   O O   . ASN A 1 154 ? -82.751  -26.008 28.498  1.00 30.00  ? 158 ASN C O   2  
ATOM 9671   C CB  . ASN A 1 154 ? -83.448  -25.654 25.364  1.00 99.99  ? 158 ASN C CB  2  
ATOM 9672   C CG  . ASN A 1 154 ? -84.532  -26.295 24.511  1.00 99.99  ? 158 ASN C CG  2  
ATOM 9673   O OD1 . ASN A 1 154 ? -85.145  -27.279 24.920  1.00 99.99  ? 158 ASN C OD1 2  
ATOM 9674   N ND2 . ASN A 1 154 ? -84.769  -25.733 23.323  1.00 99.99  ? 158 ASN C ND2 2  
ATOM 9675   N N   . ALA A 1 155 ? -82.027  -24.088 27.627  1.00 30.00  ? 159 ALA C N   2  
ATOM 9676   C CA  . ALA A 1 155 ? -80.926  -24.024 28.576  1.00 30.00  ? 159 ALA C CA  2  
ATOM 9677   C C   . ALA A 1 155 ? -81.510  -24.029 29.991  1.00 30.00  ? 159 ALA C C   2  
ATOM 9678   O O   . ALA A 1 155 ? -80.916  -24.581 30.916  1.00 30.00  ? 159 ALA C O   2  
ATOM 9679   C CB  . ALA A 1 155 ? -80.103  -22.762 28.349  1.00 30.00  ? 159 ALA C CB  2  
ATOM 9680   N N   . TYR A 1 156 ? -82.680  -23.419 30.161  1.00 30.00  ? 160 TYR C N   2  
ATOM 9681   C CA  . TYR A 1 156 ? -83.310  -23.377 31.475  1.00 30.00  ? 160 TYR C CA  2  
ATOM 9682   C C   . TYR A 1 156 ? -83.641  -24.790 31.940  1.00 30.00  ? 160 TYR C C   2  
ATOM 9683   O O   . TYR A 1 156 ? -83.212  -25.214 33.020  1.00 30.00  ? 160 TYR C O   2  
ATOM 9684   C CB  . TYR A 1 156 ? -84.597  -22.561 31.409  1.00 99.99  ? 160 TYR C CB  2  
ATOM 9685   C CG  . TYR A 1 156 ? -85.242  -22.522 32.772  1.00 99.99  ? 160 TYR C CG  2  
ATOM 9686   C CD1 . TYR A 1 156 ? -84.811  -21.590 33.724  1.00 99.99  ? 160 TYR C CD1 2  
ATOM 9687   C CD2 . TYR A 1 156 ? -86.270  -23.421 33.087  1.00 99.99  ? 160 TYR C CD2 2  
ATOM 9688   C CE1 . TYR A 1 156 ? -85.412  -21.553 34.989  1.00 99.99  ? 160 TYR C CE1 2  
ATOM 9689   C CE2 . TYR A 1 156 ? -86.867  -23.383 34.353  1.00 99.99  ? 160 TYR C CE2 2  
ATOM 9690   C CZ  . TYR A 1 156 ? -86.438  -22.452 35.304  1.00 99.99  ? 160 TYR C CZ  2  
ATOM 9691   O OH  . TYR A 1 156 ? -87.019  -22.416 36.533  1.00 99.99  ? 160 TYR C OH  2  
ATOM 9692   N N   . GLN A 1 157 ? -84.403  -25.512 31.114  1.00 30.00  ? 161 GLN C N   2  
ATOM 9693   C CA  . GLN A 1 157 ? -84.800  -26.882 31.425  1.00 30.00  ? 161 GLN C CA  2  
ATOM 9694   C C   . GLN A 1 157 ? -83.591  -27.753 31.805  1.00 30.00  ? 161 GLN C C   2  
ATOM 9695   O O   . GLN A 1 157 ? -83.658  -28.526 32.767  1.00 30.00  ? 161 GLN C O   2  
ATOM 9696   C CB  . GLN A 1 157 ? -85.479  -27.513 30.215  1.00 99.99  ? 161 GLN C CB  2  
ATOM 9697   C CG  . GLN A 1 157 ? -86.392  -28.645 30.677  1.00 99.99  ? 161 GLN C CG  2  
ATOM 9698   C CD  . GLN A 1 157 ? -85.617  -29.944 30.837  1.00 99.99  ? 161 GLN C CD  2  
ATOM 9699   O OE1 . GLN A 1 157 ? -84.411  -29.985 30.602  1.00 99.99  ? 161 GLN C OE1 2  
ATOM 9700   N NE2 . GLN A 1 157 ? -86.313  -31.012 31.239  1.00 99.99  ? 161 GLN C NE2 2  
ATOM 9701   N N   . ASN A 1 158 ? -82.493  -27.623 31.055  1.00 30.00  ? 162 ASN C N   2  
ATOM 9702   C CA  . ASN A 1 158 ? -81.273  -28.403 31.318  1.00 30.00  ? 162 ASN C CA  2  
ATOM 9703   C C   . ASN A 1 158 ? -80.675  -28.088 32.676  1.00 30.00  ? 162 ASN C C   2  
ATOM 9704   O O   . ASN A 1 158 ? -80.343  -28.986 33.441  1.00 30.00  ? 162 ASN C O   2  
ATOM 9705   C CB  . ASN A 1 158 ? -80.220  -28.095 30.258  1.00 99.99  ? 162 ASN C CB  2  
ATOM 9706   C CG  . ASN A 1 158 ? -80.696  -28.514 28.873  1.00 99.99  ? 162 ASN C CG  2  
ATOM 9707   O OD1 . ASN A 1 158 ? -81.081  -29.663 28.668  1.00 99.99  ? 162 ASN C OD1 2  
ATOM 9708   N ND2 . ASN A 1 158 ? -80.668  -27.579 27.923  1.00 99.99  ? 162 ASN C ND2 2  
ATOM 9709   N N   . MET A 1 159 ? -80.525  -26.801 32.970  1.00 30.00  ? 163 MET C N   2  
ATOM 9710   C CA  . MET A 1 159 ? -79.959  -26.405 34.245  1.00 30.00  ? 163 MET C CA  2  
ATOM 9711   C C   . MET A 1 159 ? -80.797  -27.002 35.361  1.00 30.00  ? 163 MET C C   2  
ATOM 9712   O O   . MET A 1 159 ? -80.265  -27.519 36.354  1.00 30.00  ? 163 MET C O   2  
ATOM 9713   C CB  . MET A 1 159 ? -79.957  -24.885 34.362  1.00 99.99  ? 163 MET C CB  2  
ATOM 9714   C CG  . MET A 1 159 ? -79.124  -24.288 33.235  1.00 99.99  ? 163 MET C CG  2  
ATOM 9715   S SD  . MET A 1 159 ? -78.522  -22.649 33.710  1.00 99.99  ? 163 MET C SD  2  
ATOM 9716   C CE  . MET A 1 159 ? -80.069  -21.797 33.915  1.00 99.99  ? 163 MET C CE  2  
ATOM 9717   N N   . VAL A 1 160 ? -82.115  -26.922 35.180  1.00 30.00  ? 164 VAL C N   2  
ATOM 9718   C CA  . VAL A 1 160 ? -83.082  -27.443 36.145  1.00 30.00  ? 164 VAL C CA  2  
ATOM 9719   C C   . VAL A 1 160 ? -82.966  -28.968 36.288  1.00 30.00  ? 164 VAL C C   2  
ATOM 9720   O O   . VAL A 1 160 ? -82.463  -29.472 37.303  1.00 30.00  ? 164 VAL C O   2  
ATOM 9721   C CB  . VAL A 1 160 ? -84.498  -27.107 35.694  1.00 99.99  ? 164 VAL C CB  2  
ATOM 9722   C CG1 . VAL A 1 160 ? -85.498  -27.700 36.683  1.00 99.99  ? 164 VAL C CG1 2  
ATOM 9723   C CG2 . VAL A 1 160 ? -84.672  -25.594 35.641  1.00 99.99  ? 164 VAL C CG2 2  
ATOM 9724   N N   . THR A 1 161 ? -83.411  -29.703 35.265  1.00 30.00  ? 165 THR C N   2  
ATOM 9725   C CA  . THR A 1 161 ? -83.355  -31.157 35.303  1.00 30.00  ? 165 THR C CA  2  
ATOM 9726   C C   . THR A 1 161 ? -81.940  -31.723 35.467  1.00 30.00  ? 165 THR C C   2  
ATOM 9727   O O   . THR A 1 161 ? -81.729  -32.591 36.312  1.00 30.00  ? 165 THR C O   2  
ATOM 9728   C CB  . THR A 1 161 ? -83.920  -31.732 34.008  1.00 99.99  ? 165 THR C CB  2  
ATOM 9729   O OG1 . THR A 1 161 ? -83.042  -31.412 32.925  1.00 99.99  ? 165 THR C OG1 2  
ATOM 9730   C CG2 . THR A 1 161 ? -85.293  -31.130 33.742  1.00 99.99  ? 165 THR C CG2 2  
ATOM 9731   N N   . ASP A 1 162 ? -80.980  -31.233 34.684  1.00 30.00  ? 166 ASP C N   2  
ATOM 9732   C CA  . ASP A 1 162 ? -79.589  -31.721 34.763  1.00 30.00  ? 166 ASP C CA  2  
ATOM 9733   C C   . ASP A 1 162 ? -78.825  -31.197 35.972  1.00 30.00  ? 166 ASP C C   2  
ATOM 9734   O O   . ASP A 1 162 ? -77.766  -31.724 36.313  1.00 30.00  ? 166 ASP C O   2  
ATOM 9735   C CB  . ASP A 1 162 ? -78.819  -31.294 33.520  1.00 99.99  ? 166 ASP C CB  2  
ATOM 9736   C CG  . ASP A 1 162 ? -79.361  -32.033 32.301  1.00 99.99  ? 166 ASP C CG  2  
ATOM 9737   O OD1 . ASP A 1 162 ? -79.099  -33.263 32.207  1.00 99.99  ? 166 ASP C OD1 2  
ATOM 9738   O OD2 . ASP A 1 162 ? -80.039  -31.364 31.473  1.00 99.99  ? 166 ASP C OD2 2  
ATOM 9739   N N   . ARG A 1 163 ? -79.347  -30.159 36.614  1.00 30.00  ? 167 ARG C N   2  
ATOM 9740   C CA  . ARG A 1 163 ? -78.710  -29.549 37.790  1.00 30.00  ? 167 ARG C CA  2  
ATOM 9741   C C   . ARG A 1 163 ? -77.249  -29.212 37.481  1.00 30.00  ? 167 ARG C C   2  
ATOM 9742   O O   . ARG A 1 163 ? -76.328  -29.860 37.987  1.00 30.00  ? 167 ARG C O   2  
ATOM 9743   C CB  . ARG A 1 163 ? -78.757  -30.519 38.967  1.00 99.99  ? 167 ARG C CB  2  
ATOM 9744   C CG  . ARG A 1 163 ? -80.207  -30.732 39.391  1.00 99.99  ? 167 ARG C CG  2  
ATOM 9745   C CD  . ARG A 1 163 ? -80.297  -31.957 40.295  1.00 99.99  ? 167 ARG C CD  2  
ATOM 9746   N NE  . ARG A 1 163 ? -81.706  -32.266 40.630  1.00 99.99  ? 167 ARG C NE  2  
ATOM 9747   C CZ  . ARG A 1 163 ? -82.532  -32.881 39.789  1.00 99.99  ? 167 ARG C CZ  2  
ATOM 9748   N NH1 . ARG A 1 163 ? -82.146  -33.262 38.572  1.00 99.99  ? 167 ARG C NH1 2  
ATOM 9749   N NH2 . ARG A 1 163 ? -83.778  -33.110 40.191  1.00 99.99  ? 167 ARG C NH2 2  
ATOM 9750   N N   . GLU A 1 164 ? -77.033  -28.174 36.663  1.00 30.00  ? 168 GLU C N   2  
ATOM 9751   C CA  . GLU A 1 164 ? -75.700  -27.694 36.264  1.00 30.00  ? 168 GLU C CA  2  
ATOM 9752   C C   . GLU A 1 164 ? -75.835  -26.282 35.652  1.00 30.00  ? 168 GLU C C   2  
ATOM 9753   O O   . GLU A 1 164 ? -76.937  -25.882 35.263  1.00 30.00  ? 168 GLU C O   2  
ATOM 9754   C CB  . GLU A 1 164 ? -75.095  -28.641 35.233  1.00 99.99  ? 168 GLU C CB  2  
ATOM 9755   C CG  . GLU A 1 164 ? -74.602  -27.849 34.047  1.00 99.99  ? 168 GLU C CG  2  
ATOM 9756   C CD  . GLU A 1 164 ? -75.795  -27.319 33.256  1.00 99.99  ? 168 GLU C CD  2  
ATOM 9757   O OE1 . GLU A 1 164 ? -76.249  -26.192 33.580  1.00 99.99  ? 168 GLU C OE1 2  
ATOM 9758   O OE2 . GLU A 1 164 ? -76.244  -28.054 32.334  1.00 99.99  ? 168 GLU C OE2 2  
ATOM 9759   N N   . ASN A 1 165 ? -74.731  -25.539 35.567  1.00 30.00  ? 169 ASN C N   2  
ATOM 9760   C CA  . ASN A 1 165 ? -74.779  -24.191 34.987  1.00 30.00  ? 169 ASN C CA  2  
ATOM 9761   C C   . ASN A 1 165 ? -74.856  -24.241 33.463  1.00 30.00  ? 169 ASN C C   2  
ATOM 9762   O O   . ASN A 1 165 ? -74.224  -25.095 32.824  1.00 30.00  ? 169 ASN C O   2  
ATOM 9763   C CB  . ASN A 1 165 ? -73.527  -23.414 35.379  1.00 99.99  ? 169 ASN C CB  2  
ATOM 9764   C CG  . ASN A 1 165 ? -73.448  -23.219 36.885  1.00 99.99  ? 169 ASN C CG  2  
ATOM 9765   O OD1 . ASN A 1 165 ? -74.389  -22.712 37.498  1.00 99.99  ? 169 ASN C OD1 2  
ATOM 9766   N ND2 . ASN A 1 165 ? -72.326  -23.622 37.483  1.00 99.99  ? 169 ASN C ND2 2  
ATOM 9767   N N   . GLN A 1 166 ? -75.631  -23.330 32.888  1.00 30.00  ? 170 GLN C N   2  
ATOM 9768   C CA  . GLN A 1 166 ? -75.774  -23.262 31.439  1.00 30.00  ? 170 GLN C CA  2  
ATOM 9769   C C   . GLN A 1 166 ? -75.010  -22.043 30.955  1.00 30.00  ? 170 GLN C C   2  
ATOM 9770   O O   . GLN A 1 166 ? -74.428  -21.305 31.758  1.00 30.00  ? 170 GLN C O   2  
ATOM 9771   C CB  . GLN A 1 166 ? -77.245  -23.144 31.067  1.00 99.99  ? 170 GLN C CB  2  
ATOM 9772   C CG  . GLN A 1 166 ? -77.981  -24.412 31.480  1.00 99.99  ? 170 GLN C CG  2  
ATOM 9773   C CD  . GLN A 1 166 ? -77.609  -25.580 30.576  1.00 99.99  ? 170 GLN C CD  2  
ATOM 9774   O OE1 . GLN A 1 166 ? -76.811  -25.426 29.655  1.00 99.99  ? 170 GLN C OE1 2  
ATOM 9775   N NE2 . GLN A 1 166 ? -78.193  -26.750 30.841  1.00 99.99  ? 170 GLN C NE2 2  
ATOM 9776   N N   . SER A 1 167 ? -74.998  -21.830 29.646  1.00 30.00  ? 171 SER C N   2  
ATOM 9777   C CA  . SER A 1 167 ? -74.287  -20.687 29.089  1.00 30.00  ? 171 SER C CA  2  
ATOM 9778   C C   . SER A 1 167 ? -74.457  -20.573 27.577  1.00 30.00  ? 171 SER C C   2  
ATOM 9779   O O   . SER A 1 167 ? -74.423  -21.576 26.859  1.00 30.00  ? 171 SER C O   2  
ATOM 9780   C CB  . SER A 1 167 ? -72.795  -20.812 29.379  1.00 99.99  ? 171 SER C CB  2  
ATOM 9781   O OG  . SER A 1 167 ? -72.560  -20.573 30.769  1.00 99.99  ? 171 SER C OG  2  
ATOM 9782   N N   . CYS A 1 168 ? -74.659  -19.341 27.108  1.00 30.00  ? 172 CYS C N   2  
ATOM 9783   C CA  . CYS A 1 168 ? -74.835  -19.051 25.694  1.00 30.00  ? 172 CYS C CA  2  
ATOM 9784   C C   . CYS A 1 168 ? -73.775  -18.126 25.215  1.00 30.00  ? 172 CYS C C   2  
ATOM 9785   O O   . CYS A 1 168 ? -73.608  -17.021 25.735  1.00 30.00  ? 172 CYS C O   2  
ATOM 9786   C CB  . CYS A 1 168 ? -76.193  -18.399 25.465  1.00 99.99  ? 172 CYS C CB  2  
ATOM 9787   S SG  . CYS A 1 168 ? -76.422  -16.757 26.192  1.00 99.99  ? 172 CYS C SG  2  
ATOM 9788   N N   . LEU A 1 169 ? -73.050  -18.585 24.208  1.00 30.00  ? 173 LEU C N   2  
ATOM 9789   C CA  . LEU A 1 169 ? -72.017  -17.769 23.641  1.00 30.00  ? 173 LEU C CA  2  
ATOM 9790   C C   . LEU A 1 169 ? -72.711  -17.334 22.345  1.00 30.00  ? 173 LEU C C   2  
ATOM 9791   O O   . LEU A 1 169 ? -72.975  -18.156 21.448  1.00 30.00  ? 173 LEU C O   2  
ATOM 9792   C CB  . LEU A 1 169 ? -70.762  -18.604 23.419  1.00 99.99  ? 173 LEU C CB  2  
ATOM 9793   C CG  . LEU A 1 169 ? -69.831  -18.452 24.618  1.00 99.99  ? 173 LEU C CG  2  
ATOM 9794   C CD1 . LEU A 1 169 ? -68.453  -19.004 24.264  1.00 99.99  ? 173 LEU C CD1 2  
ATOM 9795   C CD2 . LEU A 1 169 ? -69.707  -16.976 24.981  1.00 99.99  ? 173 LEU C CD2 2  
ATOM 9796   N N   . ILE A 1 170 ? -73.045  -16.041 22.264  1.00 30.00  ? 174 ILE C N   2  
ATOM 9797   C CA  . ILE A 1 170 ? -73.701  -15.501 21.086  1.00 30.00  ? 174 ILE C CA  2  
ATOM 9798   C C   . ILE A 1 170 ? -72.596  -14.838 20.304  1.00 30.00  ? 174 ILE C C   2  
ATOM 9799   O O   . ILE A 1 170 ? -72.094  -13.783 20.703  1.00 30.00  ? 174 ILE C O   2  
ATOM 9800   C CB  . ILE A 1 170 ? -74.776  -14.504 21.501  1.00 99.99  ? 174 ILE C CB  2  
ATOM 9801   C CG1 . ILE A 1 170 ? -74.150  -13.127 21.681  1.00 99.99  ? 174 ILE C CG1 2  
ATOM 9802   C CG2 . ILE A 1 170 ? -75.402  -14.953 22.818  1.00 99.99  ? 174 ILE C CG2 2  
ATOM 9803   C CD1 . ILE A 1 170 ? -74.297  -12.330 20.387  1.00 99.99  ? 174 ILE C CD1 2  
ATOM 9804   N N   . THR A 1 171 ? -72.209  -15.455 19.188  1.00 30.00  ? 175 THR C N   2  
ATOM 9805   C CA  . THR A 1 171 ? -71.142  -14.901 18.368  1.00 30.00  ? 175 THR C CA  2  
ATOM 9806   C C   . THR A 1 171 ? -71.591  -14.413 17.002  1.00 30.00  ? 175 THR C C   2  
ATOM 9807   O O   . THR A 1 171 ? -72.715  -14.660 16.556  1.00 30.00  ? 175 THR C O   2  
ATOM 9808   C CB  . THR A 1 171 ? -70.069  -15.957 18.129  1.00 99.99  ? 175 THR C CB  2  
ATOM 9809   O OG1 . THR A 1 171 ? -70.598  -16.993 17.298  1.00 99.99  ? 175 THR C OG1 2  
ATOM 9810   C CG2 . THR A 1 171 ? -69.635  -16.551 19.464  1.00 99.99  ? 175 THR C CG2 2  
ATOM 9811   N N   . GLY A 1 172 ? -70.677  -13.713 16.342  1.00 30.00  ? 176 GLY C N   2  
ATOM 9812   C CA  . GLY A 1 172 ? -70.973  -13.169 15.040  1.00 30.00  ? 176 GLY C CA  2  
ATOM 9813   C C   . GLY A 1 172 ? -70.076  -11.978 14.820  1.00 30.00  ? 176 GLY C C   2  
ATOM 9814   O O   . GLY A 1 172 ? -69.294  -11.605 15.702  1.00 30.00  ? 176 GLY C O   2  
ATOM 9815   N N   . GLU A 1 173 ? -70.188  -11.381 13.634  1.00 30.00  ? 177 GLU C N   2  
ATOM 9816   C CA  . GLU A 1 173 ? -69.387  -10.218 13.260  1.00 30.00  ? 177 GLU C CA  2  
ATOM 9817   C C   . GLU A 1 173 ? -70.000  -8.980  13.886  1.00 30.00  ? 177 GLU C C   2  
ATOM 9818   O O   . GLU A 1 173 ? -71.041  -9.053  14.527  1.00 30.00  ? 177 GLU C O   2  
ATOM 9819   C CB  . GLU A 1 173 ? -69.366  -10.067 11.744  1.00 99.99  ? 177 GLU C CB  2  
ATOM 9820   C CG  . GLU A 1 173 ? -70.781  -9.961  11.228  1.00 99.99  ? 177 GLU C CG  2  
ATOM 9821   C CD  . GLU A 1 173 ? -71.419  -11.349 11.194  1.00 99.99  ? 177 GLU C CD  2  
ATOM 9822   O OE1 . GLU A 1 173 ? -72.029  -11.727 12.226  1.00 99.99  ? 177 GLU C OE1 2  
ATOM 9823   O OE2 . GLU A 1 173 ? -71.288  -12.015 10.131  1.00 99.99  ? 177 GLU C OE2 2  
ATOM 9824   N N   . SER A 1 174 ? -69.354  -7.841  13.688  1.00 30.00  ? 178 SER C N   2  
ATOM 9825   C CA  . SER A 1 174 ? -69.855  -6.612  14.256  1.00 30.00  ? 178 SER C CA  2  
ATOM 9826   C C   . SER A 1 174 ? -71.021  -6.056  13.460  1.00 30.00  ? 178 SER C C   2  
ATOM 9827   O O   . SER A 1 174 ? -70.887  -5.753  12.284  1.00 30.00  ? 178 SER C O   2  
ATOM 9828   C CB  . SER A 1 174 ? -68.751  -5.558  14.272  1.00 99.99  ? 178 SER C CB  2  
ATOM 9829   O OG  . SER A 1 174 ? -67.646  -6.041  15.041  1.00 99.99  ? 178 SER C OG  2  
ATOM 9830   N N   . GLY A 1 175 ? -72.165  -5.929  14.128  1.00 30.00  ? 179 GLY C N   2  
ATOM 9831   C CA  . GLY A 1 175 ? -73.354  -5.405  13.478  1.00 30.00  ? 179 GLY C CA  2  
ATOM 9832   C C   . GLY A 1 175 ? -74.272  -6.543  13.125  1.00 30.00  ? 179 GLY C C   2  
ATOM 9833   O O   . GLY A 1 175 ? -75.277  -6.331  12.441  1.00 30.00  ? 179 GLY C O   2  
ATOM 9834   N N   . ALA A 1 176 ? -73.929  -7.746  13.604  1.00 30.00  ? 180 ALA C N   2  
ATOM 9835   C CA  . ALA A 1 176 ? -74.704  -8.970  13.328  1.00 30.00  ? 180 ALA C CA  2  
ATOM 9836   C C   . ALA A 1 176 ? -75.990  -9.144  14.110  1.00 30.00  ? 180 ALA C C   2  
ATOM 9837   O O   . ALA A 1 176 ? -77.057  -9.353  13.510  1.00 30.00  ? 180 ALA C O   2  
ATOM 9838   C CB  . ALA A 1 176 ? -73.839  -10.185 13.557  1.00 30.00  ? 180 ALA C CB  2  
ATOM 9839   N N   . GLY A 1 177 ? -75.882  -9.076  15.441  1.00 30.00  ? 181 GLY C N   2  
ATOM 9840   C CA  . GLY A 1 177 ? -77.048  -9.237  16.285  1.00 30.00  ? 181 GLY C CA  2  
ATOM 9841   C C   . GLY A 1 177 ? -76.643  -9.752  17.656  1.00 30.00  ? 181 GLY C C   2  
ATOM 9842   O O   . GLY A 1 177 ? -77.505  -10.092 18.478  1.00 30.00  ? 181 GLY C O   2  
ATOM 9843   N N   . LYS A 1 178 ? -75.342  -9.812  17.921  1.00 30.00  ? 182 LYS C N   2  
ATOM 9844   C CA  . LYS A 1 178 ? -74.884  -10.307 19.227  1.00 30.00  ? 182 LYS C CA  2  
ATOM 9845   C C   . LYS A 1 178 ? -75.633  -9.664  20.409  1.00 30.00  ? 182 LYS C C   2  
ATOM 9846   O O   . LYS A 1 178 ? -76.222  -10.364 21.228  1.00 30.00  ? 182 LYS C O   2  
ATOM 9847   C CB  . LYS A 1 178 ? -73.400  -10.006 19.404  1.00 99.99  ? 182 LYS C CB  2  
ATOM 9848   C CG  . LYS A 1 178 ? -72.575  -11.138 18.800  1.00 99.99  ? 182 LYS C CG  2  
ATOM 9849   C CD  . LYS A 1 178 ? -71.148  -11.067 19.332  1.00 99.99  ? 182 LYS C CD  2  
ATOM 9850   C CE  . LYS A 1 178 ? -70.414  -9.903  18.669  1.00 99.99  ? 182 LYS C CE  2  
ATOM 9851   N NZ  . LYS A 1 178 ? -68.971  -10.030 18.913  1.00 99.99  ? 182 LYS C NZ  2  
ATOM 9852   N N   . THR A 1 179 ? -75.598  -8.329  20.485  1.00 30.00  ? 183 THR C N   2  
ATOM 9853   C CA  . THR A 1 179 ? -76.243  -7.568  21.558  1.00 30.00  ? 183 THR C CA  2  
ATOM 9854   C C   . THR A 1 179 ? -77.763  -7.693  21.587  1.00 30.00  ? 183 THR C C   2  
ATOM 9855   O O   . THR A 1 179 ? -78.331  -8.074  22.615  1.00 30.00  ? 183 THR C O   2  
ATOM 9856   C CB  . THR A 1 179 ? -75.920  -6.086  21.405  1.00 99.99  ? 183 THR C CB  2  
ATOM 9857   O OG1 . THR A 1 179 ? -76.563  -5.577  20.233  1.00 99.99  ? 183 THR C OG1 2  
ATOM 9858   C CG2 . THR A 1 179 ? -74.414  -5.902  21.277  1.00 99.99  ? 183 THR C CG2 2  
ATOM 9859   N N   . GLU A 1 180 ? -78.418  -7.378  20.478  1.00 30.00  ? 184 GLU C N   2  
ATOM 9860   C CA  . GLU A 1 180 ? -79.868  -7.492  20.405  1.00 30.00  ? 184 GLU C CA  2  
ATOM 9861   C C   . GLU A 1 180 ? -80.381  -8.837  20.916  1.00 30.00  ? 184 GLU C C   2  
ATOM 9862   O O   . GLU A 1 180 ? -81.361  -8.912  21.662  1.00 30.00  ? 184 GLU C O   2  
ATOM 9863   C CB  . GLU A 1 180 ? -80.329  -7.339  18.960  1.00 99.99  ? 184 GLU C CB  2  
ATOM 9864   C CG  . GLU A 1 180 ? -80.014  -5.945  18.474  1.00 99.99  ? 184 GLU C CG  2  
ATOM 9865   C CD  . GLU A 1 180 ? -80.958  -4.950  19.141  1.00 99.99  ? 184 GLU C CD  2  
ATOM 9866   O OE1 . GLU A 1 180 ? -80.585  -4.444  20.233  1.00 99.99  ? 184 GLU C OE1 2  
ATOM 9867   O OE2 . GLU A 1 180 ? -82.045  -4.699  18.552  1.00 99.99  ? 184 GLU C OE2 2  
ATOM 9868   N N   . ASN A 1 181 ? -79.706  -9.902  20.503  1.00 30.00  ? 185 ASN C N   2  
ATOM 9869   C CA  . ASN A 1 181 ? -80.076  -11.247 20.897  1.00 30.00  ? 185 ASN C CA  2  
ATOM 9870   C C   . ASN A 1 181 ? -79.724  -11.550 22.349  1.00 30.00  ? 185 ASN C C   2  
ATOM 9871   O O   . ASN A 1 181 ? -80.415  -12.331 23.005  1.00 30.00  ? 185 ASN C O   2  
ATOM 9872   C CB  . ASN A 1 181 ? -79.348  -12.264 20.024  1.00 99.99  ? 185 ASN C CB  2  
ATOM 9873   C CG  . ASN A 1 181 ? -79.756  -12.127 18.564  1.00 99.99  ? 185 ASN C CG  2  
ATOM 9874   O OD1 . ASN A 1 181 ? -80.942  -12.167 18.244  1.00 99.99  ? 185 ASN C OD1 2  
ATOM 9875   N ND2 . ASN A 1 181 ? -78.770  -11.964 17.681  1.00 99.99  ? 185 ASN C ND2 2  
ATOM 9876   N N   . THR A 1 182 ? -78.656  -10.950 22.856  1.00 30.00  ? 186 THR C N   2  
ATOM 9877   C CA  . THR A 1 182 ? -78.296  -11.195 24.237  1.00 30.00  ? 186 THR C CA  2  
ATOM 9878   C C   . THR A 1 182 ? -79.402  -10.592 25.096  1.00 30.00  ? 186 THR C C   2  
ATOM 9879   O O   . THR A 1 182 ? -79.869  -11.191 26.064  1.00 30.00  ? 186 THR C O   2  
ATOM 9880   C CB  . THR A 1 182 ? -76.956  -10.537 24.547  1.00 99.99  ? 186 THR C CB  2  
ATOM 9881   O OG1 . THR A 1 182 ? -77.103  -9.115  24.509  1.00 99.99  ? 186 THR C OG1 2  
ATOM 9882   C CG2 . THR A 1 182 ? -75.927  -10.969 23.508  1.00 99.99  ? 186 THR C CG2 2  
ATOM 9883   N N   . LYS A 1 183 ? -79.827  -9.395  24.728  1.00 30.00  ? 187 LYS C N   2  
ATOM 9884   C CA  . LYS A 1 183 ? -80.862  -8.742  25.487  1.00 30.00  ? 187 LYS C CA  2  
ATOM 9885   C C   . LYS A 1 183 ? -82.173  -9.539  25.424  1.00 30.00  ? 187 LYS C C   2  
ATOM 9886   O O   . LYS A 1 183 ? -82.809  -9.767  26.453  1.00 30.00  ? 187 LYS C O   2  
ATOM 9887   C CB  . LYS A 1 183 ? -81.116  -7.347  24.926  1.00 99.99  ? 187 LYS C CB  2  
ATOM 9888   C CG  . LYS A 1 183 ? -82.141  -6.627  25.792  1.00 99.99  ? 187 LYS C CG  2  
ATOM 9889   C CD  . LYS A 1 183 ? -82.073  -5.127  25.526  1.00 99.99  ? 187 LYS C CD  2  
ATOM 9890   C CE  . LYS A 1 183 ? -83.319  -4.452  26.093  1.00 99.99  ? 187 LYS C CE  2  
ATOM 9891   N NZ  . LYS A 1 183 ? -83.036  -3.965  27.450  1.00 99.99  ? 187 LYS C NZ  2  
ATOM 9892   N N   . LYS A 1 184 ? -82.576  -9.987  24.245  1.00 30.00  ? 188 LYS C N   2  
ATOM 9893   C CA  . LYS A 1 184 ? -83.818  -10.751 24.144  1.00 30.00  ? 188 LYS C CA  2  
ATOM 9894   C C   . LYS A 1 184 ? -83.799  -12.024 24.987  1.00 30.00  ? 188 LYS C C   2  
ATOM 9895   O O   . LYS A 1 184 ? -84.845  -12.506 25.414  1.00 30.00  ? 188 LYS C O   2  
ATOM 9896   C CB  . LYS A 1 184 ? -84.060  -11.160 22.695  1.00 99.99  ? 188 LYS C CB  2  
ATOM 9897   C CG  . LYS A 1 184 ? -85.482  -11.689 22.545  1.00 99.99  ? 188 LYS C CG  2  
ATOM 9898   C CD  . LYS A 1 184 ? -85.755  -12.004 21.079  1.00 99.99  ? 188 LYS C CD  2  
ATOM 9899   C CE  . LYS A 1 184 ? -87.168  -12.558 20.932  1.00 99.99  ? 188 LYS C CE  2  
ATOM 9900   N NZ  . LYS A 1 184 ? -87.423  -12.884 19.521  1.00 99.99  ? 188 LYS C NZ  2  
ATOM 9901   N N   . VAL A 1 185 ? -82.617  -12.580 25.226  1.00 30.00  ? 189 VAL C N   2  
ATOM 9902   C CA  . VAL A 1 185 ? -82.495  -13.811 26.012  1.00 30.00  ? 189 VAL C CA  2  
ATOM 9903   C C   . VAL A 1 185 ? -82.787  -13.509 27.458  1.00 30.00  ? 189 VAL C C   2  
ATOM 9904   O O   . VAL A 1 185 ? -83.524  -14.236 28.107  1.00 30.00  ? 189 VAL C O   2  
ATOM 9905   C CB  . VAL A 1 185 ? -81.081  -14.369 25.885  1.00 99.99  ? 189 VAL C CB  2  
ATOM 9906   C CG1 . VAL A 1 185 ? -80.949  -15.621 26.743  1.00 99.99  ? 189 VAL C CG1 2  
ATOM 9907   C CG2 . VAL A 1 185 ? -80.800  -14.720 24.430  1.00 99.99  ? 189 VAL C CG2 2  
ATOM 9908   N N   . ILE A 1 186 ? -82.184  -12.435 27.956  1.00 30.00  ? 190 ILE C N   2  
ATOM 9909   C CA  . ILE A 1 186 ? -82.380  -11.992 29.325  1.00 30.00  ? 190 ILE C CA  2  
ATOM 9910   C C   . ILE A 1 186 ? -83.859  -11.570 29.459  1.00 30.00  ? 190 ILE C C   2  
ATOM 9911   O O   . ILE A 1 186 ? -84.569  -11.982 30.367  1.00 30.00  ? 190 ILE C O   2  
ATOM 9912   C CB  . ILE A 1 186 ? -81.458  -10.819 29.629  1.00 99.99  ? 190 ILE C CB  2  
ATOM 9913   C CG1 . ILE A 1 186 ? -82.130  -9.517  29.203  1.00 99.99  ? 190 ILE C CG1 2  
ATOM 9914   C CG2 . ILE A 1 186 ? -80.151  -10.987 28.861  1.00 99.99  ? 190 ILE C CG2 2  
ATOM 9915   C CD1 . ILE A 1 186 ? -82.855  -8.904  30.397  1.00 99.99  ? 190 ILE C CD1 2  
ATOM 9916   N N   . MET A 1 187 ? -84.325  -10.737 28.539  1.00 30.00  ? 191 MET C N   2  
ATOM 9917   C CA  . MET A 1 187 ? -85.701  -10.299 28.592  1.00 30.00  ? 191 MET C CA  2  
ATOM 9918   C C   . MET A 1 187 ? -86.603  -11.515 28.664  1.00 30.00  ? 191 MET C C   2  
ATOM 9919   O O   . MET A 1 187 ? -87.627  -11.488 29.339  1.00 30.00  ? 191 MET C O   2  
ATOM 9920   C CB  . MET A 1 187 ? -86.037  -9.485  27.345  1.00 99.99  ? 191 MET C CB  2  
ATOM 9921   C CG  . MET A 1 187 ? -84.976  -8.414  27.135  1.00 99.99  ? 191 MET C CG  2  
ATOM 9922   S SD  . MET A 1 187 ? -85.291  -7.005  28.224  1.00 99.99  ? 191 MET C SD  2  
ATOM 9923   C CE  . MET A 1 187 ? -86.649  -6.244  27.360  1.00 99.99  ? 191 MET C CE  2  
ATOM 9924   N N   . TYR A 1 188 ? -86.217  -12.586 27.967  1.00 30.00  ? 192 TYR C N   2  
ATOM 9925   C CA  . TYR A 1 188 ? -87.003  -13.827 27.948  1.00 30.00  ? 192 TYR C CA  2  
ATOM 9926   C C   . TYR A 1 188 ? -86.961  -14.510 29.310  1.00 30.00  ? 192 TYR C C   2  
ATOM 9927   O O   . TYR A 1 188 ? -87.988  -14.708 29.947  1.00 30.00  ? 192 TYR C O   2  
ATOM 9928   C CB  . TYR A 1 188 ? -86.434  -14.784 26.905  1.00 99.99  ? 192 TYR C CB  2  
ATOM 9929   C CG  . TYR A 1 188 ? -85.795  -15.964 27.597  1.00 99.99  ? 192 TYR C CG  2  
ATOM 9930   C CD1 . TYR A 1 188 ? -85.291  -15.823 28.894  1.00 99.99  ? 192 TYR C CD1 2  
ATOM 9931   C CD2 . TYR A 1 188 ? -85.708  -17.196 26.940  1.00 99.99  ? 192 TYR C CD2 2  
ATOM 9932   C CE1 . TYR A 1 188 ? -84.698  -16.917 29.535  1.00 99.99  ? 192 TYR C CE1 2  
ATOM 9933   C CE2 . TYR A 1 188 ? -85.113  -18.289 27.579  1.00 99.99  ? 192 TYR C CE2 2  
ATOM 9934   C CZ  . TYR A 1 188 ? -84.608  -18.151 28.879  1.00 99.99  ? 192 TYR C CZ  2  
ATOM 9935   O OH  . TYR A 1 188 ? -84.032  -19.214 29.502  1.00 99.99  ? 192 TYR C OH  2  
ATOM 9936   N N   . LEU A 1 189 ? -85.763  -14.871 29.738  1.00 30.00  ? 193 LEU C N   2  
ATOM 9937   C CA  . LEU A 1 189 ? -85.555  -15.515 31.029  1.00 30.00  ? 193 LEU C CA  2  
ATOM 9938   C C   . LEU A 1 189 ? -86.148  -14.690 32.175  1.00 30.00  ? 193 LEU C C   2  
ATOM 9939   O O   . LEU A 1 189 ? -86.519  -15.218 33.212  1.00 30.00  ? 193 LEU C O   2  
ATOM 9940   C CB  . LEU A 1 189 ? -84.060  -15.686 31.289  1.00 99.99  ? 193 LEU C CB  2  
ATOM 9941   C CG  . LEU A 1 189 ? -83.848  -16.249 32.689  1.00 99.99  ? 193 LEU C CG  2  
ATOM 9942   C CD1 . LEU A 1 189 ? -82.353  -16.349 32.975  1.00 99.99  ? 193 LEU C CD1 2  
ATOM 9943   C CD2 . LEU A 1 189 ? -84.500  -15.326 33.713  1.00 99.99  ? 193 LEU C CD2 2  
ATOM 9944   N N   . ALA A 1 190 ? -86.221  -13.379 31.992  1.00 30.00  ? 194 ALA C N   2  
ATOM 9945   C CA  . ALA A 1 190 ? -86.767  -12.503 33.020  1.00 30.00  ? 194 ALA C CA  2  
ATOM 9946   C C   . ALA A 1 190 ? -88.285  -12.641 33.054  1.00 30.00  ? 194 ALA C C   2  
ATOM 9947   O O   . ALA A 1 190 ? -88.896  -12.593 34.120  1.00 30.00  ? 194 ALA C O   2  
ATOM 9948   C CB  . ALA A 1 190 ? -86.382  -11.051 32.729  1.00 30.00  ? 194 ALA C CB  2  
ATOM 9949   N N   . LYS A 1 191 ? -88.881  -12.813 31.881  1.00 30.00  ? 195 LYS C N   2  
ATOM 9950   C CA  . LYS A 1 191 ? -90.326  -12.948 31.769  1.00 30.00  ? 195 LYS C CA  2  
ATOM 9951   C C   . LYS A 1 191 ? -90.918  -14.322 32.158  1.00 30.00  ? 195 LYS C C   2  
ATOM 9952   O O   . LYS A 1 191 ? -92.136  -14.462 32.266  1.00 30.00  ? 195 LYS C O   2  
ATOM 9953   C CB  . LYS A 1 191 ? -90.758  -12.705 30.324  1.00 99.99  ? 195 LYS C CB  2  
ATOM 9954   C CG  . LYS A 1 191 ? -92.278  -12.752 30.232  1.00 99.99  ? 195 LYS C CG  2  
ATOM 9955   C CD  . LYS A 1 191 ? -92.730  -12.086 28.939  1.00 99.99  ? 195 LYS C CD  2  
ATOM 9956   C CE  . LYS A 1 191 ? -94.187  -12.450 28.661  1.00 99.99  ? 195 LYS C CE  2  
ATOM 9957   N NZ  . LYS A 1 191 ? -95.066  -11.405 29.205  1.00 99.99  ? 195 LYS C NZ  2  
ATOM 9958   N N   . VAL A 1 192 ? -90.084  -15.335 32.390  1.00 30.00  ? 196 VAL C N   2  
ATOM 9959   C CA  . VAL A 1 192 ? -90.612  -16.655 32.735  1.00 30.00  ? 196 VAL C CA  2  
ATOM 9960   C C   . VAL A 1 192 ? -90.045  -17.304 34.004  1.00 30.00  ? 196 VAL C C   2  
ATOM 9961   O O   . VAL A 1 192 ? -90.527  -18.343 34.451  1.00 30.00  ? 196 VAL C O   2  
ATOM 9962   C CB  . VAL A 1 192 ? -90.326  -17.640 31.605  1.00 99.99  ? 196 VAL C CB  2  
ATOM 9963   C CG1 . VAL A 1 192 ? -90.995  -17.148 30.323  1.00 99.99  ? 196 VAL C CG1 2  
ATOM 9964   C CG2 . VAL A 1 192 ? -88.821  -17.740 31.384  1.00 99.99  ? 196 VAL C CG2 2  
ATOM 9965   N N   . GLU A 1 212 ? -86.396  -7.965  38.354  1.00 30.00  ? 216 GLU C N   2  
ATOM 9966   C CA  . GLU A 1 212 ? -86.552  -8.181  36.929  1.00 30.00  ? 216 GLU C CA  2  
ATOM 9967   C C   . GLU A 1 212 ? -86.479  -6.849  36.202  1.00 30.00  ? 216 GLU C C   2  
ATOM 9968   O O   . GLU A 1 212 ? -85.753  -6.692  35.230  1.00 30.00  ? 216 GLU C O   2  
ATOM 9969   C CB  . GLU A 1 212 ? -87.900  -8.834  36.646  1.00 99.99  ? 216 GLU C CB  2  
ATOM 9970   C CG  . GLU A 1 212 ? -89.004  -7.971  37.203  1.00 99.99  ? 216 GLU C CG  2  
ATOM 9971   C CD  . GLU A 1 212 ? -89.098  -8.177  38.715  1.00 99.99  ? 216 GLU C CD  2  
ATOM 9972   O OE1 . GLU A 1 212 ? -88.403  -7.417  39.442  1.00 99.99  ? 216 GLU C OE1 2  
ATOM 9973   O OE2 . GLU A 1 212 ? -89.867  -9.087  39.127  1.00 99.99  ? 216 GLU C OE2 2  
ATOM 9974   N N   . ASP A 1 213 ? -87.239  -5.886  36.693  1.00 30.00  ? 217 ASP C N   2  
ATOM 9975   C CA  . ASP A 1 213 ? -87.286  -4.552  36.108  1.00 30.00  ? 217 ASP C CA  2  
ATOM 9976   C C   . ASP A 1 213 ? -85.951  -3.800  36.073  1.00 30.00  ? 217 ASP C C   2  
ATOM 9977   O O   . ASP A 1 213 ? -85.672  -3.069  35.117  1.00 30.00  ? 217 ASP C O   2  
ATOM 9978   C CB  . ASP A 1 213 ? -88.248  -3.672  36.899  1.00 99.99  ? 217 ASP C CB  2  
ATOM 9979   C CG  . ASP A 1 213 ? -87.953  -3.806  38.391  1.00 99.99  ? 217 ASP C CG  2  
ATOM 9980   O OD1 . ASP A 1 213 ? -87.981  -4.969  38.880  1.00 99.99  ? 217 ASP C OD1 2  
ATOM 9981   O OD2 . ASP A 1 213 ? -87.704  -2.749  39.027  1.00 99.99  ? 217 ASP C OD2 2  
ATOM 9982   N N   . GLN A 1 214 ? -85.136  -3.967  37.112  1.00 30.00  ? 218 GLN C N   2  
ATOM 9983   C CA  . GLN A 1 214 ? -83.841  -3.299  37.202  1.00 30.00  ? 218 GLN C CA  2  
ATOM 9984   C C   . GLN A 1 214 ? -82.850  -3.902  36.232  1.00 30.00  ? 218 GLN C C   2  
ATOM 9985   O O   . GLN A 1 214 ? -82.062  -3.187  35.596  1.00 30.00  ? 218 GLN C O   2  
ATOM 9986   C CB  . GLN A 1 214 ? -83.283  -3.443  38.615  1.00 99.99  ? 218 GLN C CB  2  
ATOM 9987   C CG  . GLN A 1 214 ? -83.182  -4.918  38.977  1.00 99.99  ? 218 GLN C CG  2  
ATOM 9988   C CD  . GLN A 1 214 ? -84.544  -5.485  39.355  1.00 99.99  ? 218 GLN C CD  2  
ATOM 9989   O OE1 . GLN A 1 214 ? -85.542  -4.768  39.343  1.00 99.99  ? 218 GLN C OE1 2  
ATOM 9990   N NE2 . GLN A 1 214 ? -84.581  -6.776  39.694  1.00 99.99  ? 218 GLN C NE2 2  
ATOM 9991   N N   . ILE A 1 215 ? -82.895  -5.231  36.144  1.00 30.00  ? 219 ILE C N   2  
ATOM 9992   C CA  . ILE A 1 215 ? -82.039  -6.002  35.268  1.00 30.00  ? 219 ILE C CA  2  
ATOM 9993   C C   . ILE A 1 215 ? -82.189  -5.410  33.869  1.00 30.00  ? 219 ILE C C   2  
ATOM 9994   O O   . ILE A 1 215 ? -81.257  -4.829  33.297  1.00 30.00  ? 219 ILE C O   2  
ATOM 9995   C CB  . ILE A 1 215 ? -82.469  -7.465  35.276  1.00 99.99  ? 219 ILE C CB  2  
ATOM 9996   C CG1 . ILE A 1 215 ? -83.574  -7.678  34.248  1.00 99.99  ? 219 ILE C CG1 2  
ATOM 9997   C CG2 . ILE A 1 215 ? -82.987  -7.832  36.664  1.00 99.99  ? 219 ILE C CG2 2  
ATOM 9998   C CD1 . ILE A 1 215 ? -82.963  -8.151  32.935  1.00 99.99  ? 219 ILE C CD1 2  
ATOM 9999   N N   . ILE A 1 216 ? -83.379  -5.544  33.318  1.00 30.00  ? 220 ILE C N   2  
ATOM 10000  C CA  . ILE A 1 216 ? -83.652  -5.011  32.005  1.00 30.00  ? 220 ILE C CA  2  
ATOM 10001  C C   . ILE A 1 216 ? -83.174  -3.570  31.891  1.00 30.00  ? 220 ILE C C   2  
ATOM 10002  O O   . ILE A 1 216 ? -82.703  -3.126  30.851  1.00 30.00  ? 220 ILE C O   2  
ATOM 10003  C CB  . ILE A 1 216 ? -85.152  -5.047  31.734  1.00 99.99  ? 220 ILE C CB  2  
ATOM 10004  C CG1 . ILE A 1 216 ? -85.800  -3.784  32.291  1.00 99.99  ? 220 ILE C CG1 2  
ATOM 10005  C CG2 . ILE A 1 216 ? -85.760  -6.272  32.409  1.00 99.99  ? 220 ILE C CG2 2  
ATOM 10006  C CD1 . ILE A 1 216 ? -85.901  -2.737  31.187  1.00 99.99  ? 220 ILE C CD1 2  
ATOM 10007  N N   . GLN A 1 217 ? -83.308  -2.839  32.985  1.00 30.00  ? 221 GLN C N   2  
ATOM 10008  C CA  . GLN A 1 217 ? -82.934  -1.436  33.031  1.00 30.00  ? 221 GLN C CA  2  
ATOM 10009  C C   . GLN A 1 217 ? -81.470  -1.097  33.153  1.00 30.00  ? 221 GLN C C   2  
ATOM 10010  O O   . GLN A 1 217 ? -81.101  0.071   33.102  1.00 30.00  ? 221 GLN C O   2  
ATOM 10011  C CB  . GLN A 1 217 ? -83.592  -0.761  34.229  1.00 99.99  ? 221 GLN C CB  2  
ATOM 10012  C CG  . GLN A 1 217 ? -85.105  -0.763  34.045  1.00 99.99  ? 221 GLN C CG  2  
ATOM 10013  C CD  . GLN A 1 217 ? -85.527  0.223   32.966  1.00 99.99  ? 221 GLN C CD  2  
ATOM 10014  O OE1 . GLN A 1 217 ? -84.687  0.892   32.369  1.00 99.99  ? 221 GLN C OE1 2  
ATOM 10015  N NE2 . GLN A 1 217 ? -86.835  0.309   32.714  1.00 99.99  ? 221 GLN C NE2 2  
ATOM 10016  N N   . ALA A 1 218 ? -80.635  -2.112  33.318  1.00 30.00  ? 222 ALA C N   2  
ATOM 10017  C CA  . ALA A 1 218 ? -79.207  -1.864  33.434  1.00 30.00  ? 222 ALA C CA  2  
ATOM 10018  C C   . ALA A 1 218 ? -78.586  -1.662  32.060  1.00 30.00  ? 222 ALA C C   2  
ATOM 10019  O O   . ALA A 1 218 ? -77.520  -1.080  31.938  1.00 30.00  ? 222 ALA C O   2  
ATOM 10020  C CB  . ALA A 1 218 ? -78.535  -3.033  34.131  1.00 30.00  ? 222 ALA C CB  2  
ATOM 10021  N N   . ASN A 1 219 ? -79.262  -2.135  31.021  1.00 30.00  ? 223 ASN C N   2  
ATOM 10022  C CA  . ASN A 1 219 ? -78.735  -1.999  29.669  1.00 30.00  ? 223 ASN C CA  2  
ATOM 10023  C C   . ASN A 1 219 ? -78.728  -0.564  29.202  1.00 30.00  ? 223 ASN C C   2  
ATOM 10024  O O   . ASN A 1 219 ? -77.704  -0.081  28.706  1.00 30.00  ? 223 ASN C O   2  
ATOM 10025  C CB  . ASN A 1 219 ? -79.592  -2.805  28.697  1.00 99.99  ? 223 ASN C CB  2  
ATOM 10026  C CG  . ASN A 1 219 ? -79.539  -4.291  29.020  1.00 99.99  ? 223 ASN C CG  2  
ATOM 10027  O OD1 . ASN A 1 219 ? -78.461  -4.872  29.107  1.00 99.99  ? 223 ASN C OD1 2  
ATOM 10028  N ND2 . ASN A 1 219 ? -80.712  -4.904  29.198  1.00 99.99  ? 223 ASN C ND2 2  
ATOM 10029  N N   . PRO A 1 220 ? -79.860  0.140   29.367  1.00 30.00  ? 224 PRO C N   2  
ATOM 10030  C CA  . PRO A 1 220 ? -79.916  1.537   28.929  1.00 30.00  ? 224 PRO C CA  2  
ATOM 10031  C C   . PRO A 1 220 ? -78.809  2.412   29.485  1.00 30.00  ? 224 PRO C C   2  
ATOM 10032  O O   . PRO A 1 220 ? -78.317  3.299   28.788  1.00 30.00  ? 224 PRO C O   2  
ATOM 10033  C CB  . PRO A 1 220 ? -81.240  1.889   29.513  1.00 99.99  ? 224 PRO C CB  2  
ATOM 10034  C CG  . PRO A 1 220 ? -81.767  0.624   30.148  1.00 99.99  ? 224 PRO C CG  2  
ATOM 10035  C CD  . PRO A 1 220 ? -80.992  -0.378  30.012  1.00 99.99  ? 224 PRO C CD  2  
ATOM 10036  N N   . VAL A 1 221 ? -78.397  2.178   30.730  1.00 30.00  ? 225 VAL C N   2  
ATOM 10037  C CA  . VAL A 1 221 ? -77.331  3.018   31.266  1.00 30.00  ? 225 VAL C CA  2  
ATOM 10038  C C   . VAL A 1 221 ? -75.958  2.543   30.810  1.00 30.00  ? 225 VAL C C   2  
ATOM 10039  O O   . VAL A 1 221 ? -75.111  3.365   30.450  1.00 30.00  ? 225 VAL C O   2  
ATOM 10040  C CB  . VAL A 1 221 ? -77.361  2.988   32.791  1.00 99.99  ? 225 VAL C CB  2  
ATOM 10041  C CG1 . VAL A 1 221 ? -78.710  3.511   33.282  1.00 99.99  ? 225 VAL C CG1 2  
ATOM 10042  C CG2 . VAL A 1 221 ? -77.167  1.556   33.276  1.00 99.99  ? 225 VAL C CG2 2  
ATOM 10043  N N   . LEU A 1 222 ? -75.725  1.234   30.807  1.00 30.00  ? 226 LEU C N   2  
ATOM 10044  C CA  . LEU A 1 222 ? -74.425  0.713   30.376  1.00 30.00  ? 226 LEU C CA  2  
ATOM 10045  C C   . LEU A 1 222 ? -74.187  0.976   28.889  1.00 30.00  ? 226 LEU C C   2  
ATOM 10046  O O   . LEU A 1 222 ? -73.056  1.213   28.464  1.00 30.00  ? 226 LEU C O   2  
ATOM 10047  C CB  . LEU A 1 222 ? -74.365  -0.792  30.615  1.00 99.99  ? 226 LEU C CB  2  
ATOM 10048  C CG  . LEU A 1 222 ? -73.711  -1.069  31.964  1.00 99.99  ? 226 LEU C CG  2  
ATOM 10049  C CD1 . LEU A 1 222 ? -73.350  -2.546  32.062  1.00 99.99  ? 226 LEU C CD1 2  
ATOM 10050  C CD2 . LEU A 1 222 ? -72.447  -0.225  32.100  1.00 99.99  ? 226 LEU C CD2 2  
ATOM 10051  N N   . GLU A 1 223 ? -75.256  0.946   28.101  1.00 30.00  ? 227 GLU C N   2  
ATOM 10052  C CA  . GLU A 1 223 ? -75.127  1.190   26.677  1.00 30.00  ? 227 GLU C CA  2  
ATOM 10053  C C   . GLU A 1 223 ? -74.867  2.662   26.388  1.00 30.00  ? 227 GLU C C   2  
ATOM 10054  O O   . GLU A 1 223 ? -74.229  3.009   25.397  1.00 30.00  ? 227 GLU C O   2  
ATOM 10055  C CB  . GLU A 1 223 ? -76.410  0.780   25.962  1.00 99.99  ? 227 GLU C CB  2  
ATOM 10056  C CG  . GLU A 1 223 ? -76.605  -0.710  26.093  1.00 99.99  ? 227 GLU C CG  2  
ATOM 10057  C CD  . GLU A 1 223 ? -75.589  -1.437  25.216  1.00 99.99  ? 227 GLU C CD  2  
ATOM 10058  O OE1 . GLU A 1 223 ? -74.482  -1.729  25.739  1.00 99.99  ? 227 GLU C OE1 2  
ATOM 10059  O OE2 . GLU A 1 223 ? -75.931  -1.692  24.030  1.00 99.99  ? 227 GLU C OE2 2  
ATOM 10060  N N   . ALA A 1 224 ? -75.370  3.536   27.249  1.00 30.00  ? 228 ALA C N   2  
ATOM 10061  C CA  . ALA A 1 224 ? -75.182  4.963   27.049  1.00 30.00  ? 228 ALA C CA  2  
ATOM 10062  C C   . ALA A 1 224 ? -73.717  5.306   27.270  1.00 30.00  ? 228 ALA C C   2  
ATOM 10063  O O   . ALA A 1 224 ? -73.129  6.108   26.544  1.00 30.00  ? 228 ALA C O   2  
ATOM 10064  C CB  . ALA A 1 224 ? -76.062  5.731   28.019  1.00 30.00  ? 228 ALA C CB  2  
ATOM 10065  N N   . TYR A 1 225 ? -73.129  4.673   28.274  1.00 30.00  ? 229 TYR C N   2  
ATOM 10066  C CA  . TYR A 1 225 ? -71.741  4.888   28.620  1.00 30.00  ? 229 TYR C CA  2  
ATOM 10067  C C   . TYR A 1 225 ? -70.710  3.996   27.905  1.00 30.00  ? 229 TYR C C   2  
ATOM 10068  O O   . TYR A 1 225 ? -69.527  4.320   27.875  1.00 30.00  ? 229 TYR C O   2  
ATOM 10069  C CB  . TYR A 1 225 ? -71.535  4.643   30.111  1.00 99.99  ? 229 TYR C CB  2  
ATOM 10070  C CG  . TYR A 1 225 ? -72.329  5.654   30.903  1.00 99.99  ? 229 TYR C CG  2  
ATOM 10071  C CD1 . TYR A 1 225 ? -73.655  5.378   31.256  1.00 99.99  ? 229 TYR C CD1 2  
ATOM 10072  C CD2 . TYR A 1 225 ? -71.738  6.865   31.283  1.00 99.99  ? 229 TYR C CD2 2  
ATOM 10073  C CE1 . TYR A 1 225 ? -74.391  6.315   31.991  1.00 99.99  ? 229 TYR C CE1 2  
ATOM 10074  C CE2 . TYR A 1 225 ? -72.474  7.800   32.017  1.00 99.99  ? 229 TYR C CE2 2  
ATOM 10075  C CZ  . TYR A 1 225 ? -73.802  7.527   32.371  1.00 99.99  ? 229 TYR C CZ  2  
ATOM 10076  O OH  . TYR A 1 225 ? -74.518  8.438   33.085  1.00 99.99  ? 229 TYR C OH  2  
ATOM 10077  N N   . GLY A 1 226 ? -71.157  2.878   27.334  1.00 30.00  ? 230 GLY C N   2  
ATOM 10078  C CA  . GLY A 1 226 ? -70.239  1.981   26.654  1.00 30.00  ? 230 GLY C CA  2  
ATOM 10079  C C   . GLY A 1 226 ? -70.616  1.543   25.248  1.00 30.00  ? 230 GLY C C   2  
ATOM 10080  O O   . GLY A 1 226 ? -70.295  0.446   24.847  1.00 30.00  ? 230 GLY C O   2  
ATOM 10081  N N   . ASN A 1 227 ? -71.213  2.564   24.456  1.00 30.00  ? 231 ASN C N   2  
ATOM 10082  C CA  . ASN A 1 227 ? -71.613  2.261   23.092  1.00 30.00  ? 231 ASN C CA  2  
ATOM 10083  C C   . ASN A 1 227 ? -71.366  3.541   22.315  1.00 30.00  ? 231 ASN C C   2  
ATOM 10084  O O   . ASN A 1 227 ? -71.212  4.600   22.897  1.00 30.00  ? 231 ASN C O   2  
ATOM 10085  C CB  . ASN A 1 227 ? -73.084  1.862   23.057  1.00 99.99  ? 231 ASN C CB  2  
ATOM 10086  C CG  . ASN A 1 227 ? -73.282  0.453   23.597  1.00 99.99  ? 231 ASN C CG  2  
ATOM 10087  O OD1 . ASN A 1 227 ? -74.245  0.189   24.314  1.00 99.99  ? 231 ASN C OD1 2  
ATOM 10088  N ND2 . ASN A 1 227 ? -72.368  -0.454  23.249  1.00 99.99  ? 231 ASN C ND2 2  
ATOM 10089  N N   . ALA A 1 228 ? -71.325  3.446   20.999  1.00 30.00  ? 232 ALA C N   2  
ATOM 10090  C CA  . ALA A 1 228 ? -71.073  4.616   20.198  1.00 30.00  ? 232 ALA C CA  2  
ATOM 10091  C C   . ALA A 1 228 ? -71.311  4.288   18.745  1.00 30.00  ? 232 ALA C C   2  
ATOM 10092  O O   . ALA A 1 228 ? -71.247  3.135   18.339  1.00 30.00  ? 232 ALA C O   2  
ATOM 10093  C CB  . ALA A 1 228 ? -69.638  5.056   20.398  1.00 30.00  ? 232 ALA C CB  2  
ATOM 10094  N N   . LYS A 1 229 ? -71.590  5.311   17.960  1.00 30.00  ? 233 LYS C N   2  
ATOM 10095  C CA  . LYS A 1 229 ? -71.808  5.109   16.554  1.00 30.00  ? 233 LYS C CA  2  
ATOM 10096  C C   . LYS A 1 229 ? -70.463  4.776   15.947  1.00 30.00  ? 233 LYS C C   2  
ATOM 10097  O O   . LYS A 1 229 ? -69.434  5.363   16.301  1.00 30.00  ? 233 LYS C O   2  
ATOM 10098  C CB  . LYS A 1 229 ? -72.382  6.379   15.931  1.00 99.99  ? 233 LYS C CB  2  
ATOM 10099  C CG  . LYS A 1 229 ? -72.706  6.125   14.462  1.00 99.99  ? 233 LYS C CG  2  
ATOM 10100  C CD  . LYS A 1 229 ? -73.664  7.200   13.960  1.00 99.99  ? 233 LYS C CD  2  
ATOM 10101  C CE  . LYS A 1 229 ? -73.697  7.175   12.434  1.00 99.99  ? 233 LYS C CE  2  
ATOM 10102  N NZ  . LYS A 1 229 ? -74.811  6.330   11.983  1.00 99.99  ? 233 LYS C NZ  2  
ATOM 10103  N N   . THR A 1 230 ? -70.382  4.071   15.122  1.00 30.00  ? 234 THR C N   2  
ATOM 10104  C CA  . THR A 1 230 ? -69.228  3.572   14.390  1.00 30.00  ? 234 THR C CA  2  
ATOM 10105  C C   . THR A 1 230 ? -69.736  3.413   12.945  1.00 30.00  ? 234 THR C C   2  
ATOM 10106  O O   . THR A 1 230 ? -70.957  3.478   12.686  1.00 30.00  ? 234 THR C O   2  
ATOM 10107  C CB  . THR A 1 230 ? -68.774  2.241   14.982  1.00 99.99  ? 234 THR C CB  2  
ATOM 10108  O OG1 . THR A 1 230 ? -69.765  1.242   14.725  1.00 99.99  ? 234 THR C OG1 2  
ATOM 10109  C CG2 . THR A 1 230 ? -68.585  2.394   16.487  1.00 99.99  ? 234 THR C CG2 2  
ATOM 10110  N N   . THR A 1 231 ? -68.830  3.230   11.998  1.00 30.00  ? 235 THR C N   2  
ATOM 10111  C CA  . THR A 1 231 ? -69.246  3.075   10.602  1.00 30.00  ? 235 THR C CA  2  
ATOM 10112  C C   . THR A 1 231 ? -70.064  1.799   10.501  1.00 30.00  ? 235 THR C C   2  
ATOM 10113  O O   . THR A 1 231 ? -71.108  1.759   9.844   1.00 30.00  ? 235 THR C O   2  
ATOM 10114  C CB  . THR A 1 231 ? -68.018  2.986   9.700   1.00 99.99  ? 235 THR C CB  2  
ATOM 10115  O OG1 . THR A 1 231 ? -67.328  1.761   9.958   1.00 99.99  ? 235 THR C OG1 2  
ATOM 10116  C CG2 . THR A 1 231 ? -67.091  4.161   9.988   1.00 99.99  ? 235 THR C CG2 2  
ATOM 10117  N N   . ARG A 1 232 ? -69.668  0.845   11.046  1.00 30.00  ? 236 ARG C N   2  
ATOM 10118  C CA  . ARG A 1 232 ? -70.279  -0.471  11.061  1.00 30.00  ? 236 ARG C CA  2  
ATOM 10119  C C   . ARG A 1 232 ? -71.594  -0.484  11.854  1.00 30.00  ? 236 ARG C C   2  
ATOM 10120  O O   . ARG A 1 232 ? -72.645  -0.888  11.340  1.00 30.00  ? 236 ARG C O   2  
ATOM 10121  C CB  . ARG A 1 232 ? -69.331  -1.479  11.699  1.00 99.99  ? 236 ARG C CB  2  
ATOM 10122  C CG  . ARG A 1 232 ? -69.581  -2.862  11.110  1.00 99.99  ? 236 ARG C CG  2  
ATOM 10123  C CD  . ARG A 1 232 ? -68.450  -3.802  11.518  1.00 99.99  ? 236 ARG C CD  2  
ATOM 10124  N NE  . ARG A 1 232 ? -68.428  -5.009  10.663  1.00 99.99  ? 236 ARG C NE  2  
ATOM 10125  C CZ  . ARG A 1 232 ? -67.453  -5.909  10.705  1.00 99.99  ? 236 ARG C CZ  2  
ATOM 10126  N NH1 . ARG A 1 232 ? -66.416  -5.786  11.531  1.00 99.99  ? 236 ARG C NH1 2  
ATOM 10127  N NH2 . ARG A 1 232 ? -67.532  -6.958  9.891   1.00 99.99  ? 236 ARG C NH2 2  
ATOM 10128  N N   . ASN A 1 233 ? -71.530  -0.036  13.109  1.00 30.00  ? 237 ASN C N   2  
ATOM 10129  C CA  . ASN A 1 233 ? -72.713  -0.006  13.979  1.00 30.00  ? 237 ASN C CA  2  
ATOM 10130  C C   . ASN A 1 233 ? -73.074  1.359   14.566  1.00 30.00  ? 237 ASN C C   2  
ATOM 10131  O O   . ASN A 1 233 ? -72.236  2.011   15.197  1.00 30.00  ? 237 ASN C O   2  
ATOM 10132  C CB  . ASN A 1 233 ? -72.501  -0.933  15.171  1.00 99.99  ? 237 ASN C CB  2  
ATOM 10133  C CG  . ASN A 1 233 ? -72.644  -2.392  14.762  1.00 99.99  ? 237 ASN C CG  2  
ATOM 10134  O OD1 . ASN A 1 233 ? -71.885  -3.246  15.218  1.00 99.99  ? 237 ASN C OD1 2  
ATOM 10135  N ND2 . ASN A 1 233 ? -73.619  -2.677  13.896  1.00 99.99  ? 237 ASN C ND2 2  
ATOM 10136  N N   . ASN A 1 234 ? -74.318  1.795   14.374  1.00 30.00  ? 238 ASN C N   2  
ATOM 10137  C CA  . ASN A 1 234 ? -74.724  3.082   14.937  1.00 30.00  ? 238 ASN C CA  2  
ATOM 10138  C C   . ASN A 1 234 ? -74.737  2.996   16.471  1.00 30.00  ? 238 ASN C C   2  
ATOM 10139  O O   . ASN A 1 234 ? -74.661  4.018   17.160  1.00 30.00  ? 238 ASN C O   2  
ATOM 10140  C CB  . ASN A 1 234 ? -76.120  3.447   14.444  1.00 99.99  ? 238 ASN C CB  2  
ATOM 10141  C CG  . ASN A 1 234 ? -76.553  4.807   14.973  1.00 99.99  ? 238 ASN C CG  2  
ATOM 10142  O OD1 . ASN A 1 234 ? -75.729  5.709   15.120  1.00 99.99  ? 238 ASN C OD1 2  
ATOM 10143  N ND2 . ASN A 1 234 ? -77.847  4.953   15.260  1.00 99.99  ? 238 ASN C ND2 2  
ATOM 10144  N N   . ASN A 1 235 ? -74.813  1.767   17.000  1.00 30.00  ? 239 ASN C N   2  
ATOM 10145  C CA  . ASN A 1 235 ? -74.808  1.525   18.436  1.00 30.00  ? 239 ASN C CA  2  
ATOM 10146  C C   . ASN A 1 235 ? -73.780  0.427   18.791  1.00 30.00  ? 239 ASN C C   2  
ATOM 10147  O O   . ASN A 1 235 ? -74.082  -0.617  19.417  1.00 30.00  ? 239 ASN C O   2  
ATOM 10148  C CB  . ASN A 1 235 ? -76.193  1.076   18.890  1.00 99.99  ? 239 ASN C CB  2  
ATOM 10149  C CG  . ASN A 1 235 ? -77.166  2.244   18.928  1.00 99.99  ? 239 ASN C CG  2  
ATOM 10150  O OD1 . ASN A 1 235 ? -78.326  2.103   18.547  1.00 99.99  ? 239 ASN C OD1 2  
ATOM 10151  N ND2 . ASN A 1 235 ? -76.690  3.401   19.389  1.00 99.99  ? 239 ASN C ND2 2  
ATOM 10152  N N   . SER A 1 236 ? -72.540  0.680   18.396  1.00 30.00  ? 240 SER C N   2  
ATOM 10153  C CA  . SER A 1 236 ? -71.470  -0.265  18.647  1.00 30.00  ? 240 SER C CA  2  
ATOM 10154  C C   . SER A 1 236 ? -71.080  -0.423  20.122  1.00 30.00  ? 240 SER C C   2  
ATOM 10155  O O   . SER A 1 236 ? -70.762  0.538   20.789  1.00 30.00  ? 240 SER C O   2  
ATOM 10156  C CB  . SER A 1 236 ? -70.209  0.168   17.909  1.00 99.99  ? 240 SER C CB  2  
ATOM 10157  O OG  . SER A 1 236 ? -70.444  0.131   16.498  1.00 99.99  ? 240 SER C OG  2  
ATOM 10158  N N   . SER A 1 237 ? -71.095  -1.651  20.621  1.00 30.00  ? 241 SER C N   2  
ATOM 10159  C CA  . SER A 1 237 ? -70.707  -1.913  21.999  1.00 30.00  ? 241 SER C CA  2  
ATOM 10160  C C   . SER A 1 237 ? -69.185  -1.821  22.061  1.00 30.00  ? 241 SER C C   2  
ATOM 10161  O O   . SER A 1 237 ? -68.497  -2.535  21.337  1.00 30.00  ? 241 SER C O   2  
ATOM 10162  C CB  . SER A 1 237 ? -71.178  -3.303  22.414  1.00 99.99  ? 241 SER C CB  2  
ATOM 10163  O OG  . SER A 1 237 ? -70.815  -3.541  23.775  1.00 99.99  ? 241 SER C OG  2  
ATOM 10164  N N   . ARG A 1 238 ? -68.704  -1.107  22.988  1.00 30.00  ? 242 ARG C N   2  
ATOM 10165  C CA  . ARG A 1 238 ? -67.257  -0.917  23.111  1.00 30.00  ? 242 ARG C CA  2  
ATOM 10166  C C   . ARG A 1 238 ? -66.637  -1.487  24.344  1.00 30.00  ? 242 ARG C C   2  
ATOM 10167  O O   . ARG A 1 238 ? -65.606  -0.977  24.849  1.00 30.00  ? 242 ARG C O   2  
ATOM 10168  C CB  . ARG A 1 238 ? -66.932  0.573   23.122  1.00 99.99  ? 242 ARG C CB  2  
ATOM 10169  C CG  . ARG A 1 238 ? -67.389  1.207   21.812  1.00 99.99  ? 242 ARG C CG  2  
ATOM 10170  C CD  . ARG A 1 238 ? -67.174  2.714   21.873  1.00 99.99  ? 242 ARG C CD  2  
ATOM 10171  N NE  . ARG A 1 238 ? -68.195  3.360   22.729  1.00 99.99  ? 242 ARG C NE  2  
ATOM 10172  C CZ  . ARG A 1 238 ? -68.185  4.661   23.010  1.00 99.99  ? 242 ARG C CZ  2  
ATOM 10173  N NH1 . ARG A 1 238 ? -67.250  5.478   22.535  1.00 99.99  ? 242 ARG C NH1 2  
ATOM 10174  N NH2 . ARG A 1 238 ? -69.150  5.138   23.792  1.00 99.99  ? 242 ARG C NH2 2  
ATOM 10175  N N   . PHE A 1 239 ? -67.259  -2.551  24.835  1.00 30.00  ? 243 PHE C N   2  
ATOM 10176  C CA  . PHE A 1 239 ? -66.746  -3.244  26.033  1.00 30.00  ? 243 PHE C CA  2  
ATOM 10177  C C   . PHE A 1 239 ? -67.301  -4.677  25.953  1.00 30.00  ? 243 PHE C C   2  
ATOM 10178  O O   . PHE A 1 239 ? -68.315  -4.936  25.283  1.00 30.00  ? 243 PHE C O   2  
ATOM 10179  C CB  . PHE A 1 239 ? -67.231  -2.533  27.290  1.00 99.99  ? 243 PHE C CB  2  
ATOM 10180  C CG  . PHE A 1 239 ? -68.722  -2.724  27.435  1.00 99.99  ? 243 PHE C CG  2  
ATOM 10181  C CD1 . PHE A 1 239 ? -69.604  -1.804  26.855  1.00 99.99  ? 243 PHE C CD1 2  
ATOM 10182  C CD2 . PHE A 1 239 ? -69.221  -3.820  28.145  1.00 99.99  ? 243 PHE C CD2 2  
ATOM 10183  C CE1 . PHE A 1 239 ? -70.986  -1.980  26.990  1.00 99.99  ? 243 PHE C CE1 2  
ATOM 10184  C CE2 . PHE A 1 239 ? -70.605  -3.996  28.280  1.00 99.99  ? 243 PHE C CE2 2  
ATOM 10185  C CZ  . PHE A 1 239 ? -71.486  -3.075  27.702  1.00 99.99  ? 243 PHE C CZ  2  
ATOM 10186  N N   . GLY A 1 240 ? -66.645  -5.610  26.629  1.00 30.00  ? 244 GLY C N   2  
ATOM 10187  C CA  . GLY A 1 240 ? -67.112  -6.978  26.590  1.00 30.00  ? 244 GLY C CA  2  
ATOM 10188  C C   . GLY A 1 240 ? -68.069  -7.194  27.729  1.00 30.00  ? 244 GLY C C   2  
ATOM 10189  O O   . GLY A 1 240 ? -67.822  -6.707  28.825  1.00 30.00  ? 244 GLY C O   2  
ATOM 10190  N N   . LYS A 1 241 ? -69.137  -7.937  27.485  1.00 30.00  ? 245 LYS C N   2  
ATOM 10191  C CA  . LYS A 1 241 ? -70.133  -8.178  28.515  1.00 30.00  ? 245 LYS C CA  2  
ATOM 10192  C C   . LYS A 1 241 ? -70.487  -9.619  28.834  1.00 30.00  ? 245 LYS C C   2  
ATOM 10193  O O   . LYS A 1 241 ? -70.930  -10.369 27.970  1.00 30.00  ? 245 LYS C O   2  
ATOM 10194  C CB  . LYS A 1 241 ? -71.453  -7.522  28.125  1.00 99.99  ? 245 LYS C CB  2  
ATOM 10195  C CG  . LYS A 1 241 ? -71.464  -6.074  28.597  1.00 99.99  ? 245 LYS C CG  2  
ATOM 10196  C CD  . LYS A 1 241 ? -72.897  -5.548  28.595  1.00 99.99  ? 245 LYS C CD  2  
ATOM 10197  C CE  . LYS A 1 241 ? -73.343  -5.298  27.160  1.00 99.99  ? 245 LYS C CE  2  
ATOM 10198  N NZ  . LYS A 1 241 ? -74.572  -4.488  27.164  1.00 99.99  ? 245 LYS C NZ  2  
ATOM 10199  N N   . PHE A 1 242 ? -70.300  -10.011 30.084  1.00 30.00  ? 246 PHE C N   2  
ATOM 10200  C CA  . PHE A 1 242 ? -70.651  -11.353 30.499  1.00 30.00  ? 246 PHE C CA  2  
ATOM 10201  C C   . PHE A 1 242 ? -71.629  -11.159 31.652  1.00 30.00  ? 246 PHE C C   2  
ATOM 10202  O O   . PHE A 1 242 ? -71.240  -10.681 32.716  1.00 30.00  ? 246 PHE C O   2  
ATOM 10203  C CB  . PHE A 1 242 ? -69.399  -12.106 30.939  1.00 99.99  ? 246 PHE C CB  2  
ATOM 10204  C CG  . PHE A 1 242 ? -69.773  -13.502 31.366  1.00 99.99  ? 246 PHE C CG  2  
ATOM 10205  C CD1 . PHE A 1 242 ? -69.922  -14.512 30.407  1.00 99.99  ? 246 PHE C CD1 2  
ATOM 10206  C CD2 . PHE A 1 242 ? -69.970  -13.791 32.722  1.00 99.99  ? 246 PHE C CD2 2  
ATOM 10207  C CE1 . PHE A 1 242 ? -70.270  -15.808 30.804  1.00 99.99  ? 246 PHE C CE1 2  
ATOM 10208  C CE2 . PHE A 1 242 ? -70.319  -15.088 33.118  1.00 99.99  ? 246 PHE C CE2 2  
ATOM 10209  C CZ  . PHE A 1 242 ? -70.469  -16.097 32.158  1.00 99.99  ? 246 PHE C CZ  2  
ATOM 10210  N N   . ILE A 1 243 ? -72.892  -11.530 31.460  1.00 30.00  ? 247 ILE C N   2  
ATOM 10211  C CA  . ILE A 1 243 ? -73.876  -11.375 32.521  1.00 30.00  ? 247 ILE C CA  2  
ATOM 10212  C C   . ILE A 1 243 ? -74.450  -12.716 32.967  1.00 30.00  ? 247 ILE C C   2  
ATOM 10213  O O   . ILE A 1 243 ? -75.016  -13.437 32.164  1.00 30.00  ? 247 ILE C O   2  
ATOM 10214  C CB  . ILE A 1 243 ? -75.031  -10.506 32.036  1.00 99.99  ? 247 ILE C CB  2  
ATOM 10215  C CG1 . ILE A 1 243 ? -76.003  -11.356 31.226  1.00 99.99  ? 247 ILE C CG1 2  
ATOM 10216  C CG2 . ILE A 1 243 ? -74.487  -9.382  31.161  1.00 99.99  ? 247 ILE C CG2 2  
ATOM 10217  C CD1 . ILE A 1 243 ? -75.638  -11.276 29.746  1.00 99.99  ? 247 ILE C CD1 2  
ATOM 10218  N N   . ARG A 1 244 ? -74.296  -13.040 34.253  1.00 30.00  ? 248 ARG C N   2  
ATOM 10219  C CA  . ARG A 1 244 ? -74.818  -14.285 34.816  1.00 30.00  ? 248 ARG C CA  2  
ATOM 10220  C C   . ARG A 1 244 ? -76.158  -14.018 35.476  1.00 30.00  ? 248 ARG C C   2  
ATOM 10221  O O   . ARG A 1 244 ? -76.325  -13.022 36.164  1.00 30.00  ? 248 ARG C O   2  
ATOM 10222  C CB  . ARG A 1 244 ? -73.843  -14.832 35.855  1.00 99.99  ? 248 ARG C CB  2  
ATOM 10223  C CG  . ARG A 1 244 ? -72.463  -14.989 35.227  1.00 99.99  ? 248 ARG C CG  2  
ATOM 10224  C CD  . ARG A 1 244 ? -72.507  -16.081 34.166  1.00 99.99  ? 248 ARG C CD  2  
ATOM 10225  N NE  . ARG A 1 244 ? -72.934  -17.374 34.753  1.00 99.99  ? 248 ARG C NE  2  
ATOM 10226  C CZ  . ARG A 1 244 ? -72.763  -18.540 34.137  1.00 99.99  ? 248 ARG C CZ  2  
ATOM 10227  N NH1 . ARG A 1 244 ? -72.193  -18.627 32.937  1.00 99.99  ? 248 ARG C NH1 2  
ATOM 10228  N NH2 . ARG A 1 244 ? -73.182  -19.640 34.754  1.00 99.99  ? 248 ARG C NH2 2  
ATOM 10229  N N   . ILE A 1 245 ? -77.114  -14.914 35.266  1.00 30.00  ? 249 ILE C N   2  
ATOM 10230  C CA  . ILE A 1 245 ? -78.443  -14.778 35.848  1.00 30.00  ? 249 ILE C CA  2  
ATOM 10231  C C   . ILE A 1 245 ? -78.725  -15.954 36.775  1.00 30.00  ? 249 ILE C C   2  
ATOM 10232  O O   . ILE A 1 245 ? -78.998  -17.055 36.316  1.00 30.00  ? 249 ILE C O   2  
ATOM 10233  C CB  . ILE A 1 245 ? -79.492  -14.747 34.744  1.00 99.99  ? 249 ILE C CB  2  
ATOM 10234  C CG1 . ILE A 1 245 ? -79.892  -16.173 34.380  1.00 99.99  ? 249 ILE C CG1 2  
ATOM 10235  C CG2 . ILE A 1 245 ? -78.917  -14.051 33.513  1.00 99.99  ? 249 ILE C CG2 2  
ATOM 10236  C CD1 . ILE A 1 245 ? -81.130  -16.572 35.172  1.00 99.99  ? 249 ILE C CD1 2  
ATOM 10237  N N   . HIS A 1 246 ? -78.659  -15.710 38.081  1.00 30.00  ? 250 HIS C N   2  
ATOM 10238  C CA  . HIS A 1 246 ? -78.895  -16.738 39.088  1.00 30.00  ? 250 HIS C CA  2  
ATOM 10239  C C   . HIS A 1 246 ? -80.351  -17.166 39.305  1.00 30.00  ? 250 HIS C C   2  
ATOM 10240  O O   . HIS A 1 246 ? -81.290  -16.376 39.130  1.00 30.00  ? 250 HIS C O   2  
ATOM 10241  C CB  . HIS A 1 246 ? -78.403  -16.254 40.448  1.00 99.99  ? 250 HIS C CB  2  
ATOM 10242  C CG  . HIS A 1 246 ? -76.955  -15.831 40.490  1.00 99.99  ? 250 HIS C CG  2  
ATOM 10243  N ND1 . HIS A 1 246 ? -75.935  -16.726 40.790  1.00 99.99  ? 250 HIS C ND1 2  
ATOM 10244  C CD2 . HIS A 1 246 ? -76.362  -14.625 40.273  1.00 99.99  ? 250 HIS C CD2 2  
ATOM 10245  C CE1 . HIS A 1 246 ? -74.792  -16.067 40.750  1.00 99.99  ? 250 HIS C CE1 2  
ATOM 10246  N NE2 . HIS A 1 246 ? -75.024  -14.818 40.443  1.00 99.99  ? 250 HIS C NE2 2  
ATOM 10247  N N   . PHE A 1 247 ? -80.524  -18.432 39.684  1.00 30.00  ? 251 PHE C N   2  
ATOM 10248  C CA  . PHE A 1 247 ? -81.846  -19.010 39.917  1.00 30.00  ? 251 PHE C CA  2  
ATOM 10249  C C   . PHE A 1 247 ? -81.972  -19.699 41.277  1.00 30.00  ? 251 PHE C C   2  
ATOM 10250  O O   . PHE A 1 247 ? -81.022  -20.330 41.753  1.00 30.00  ? 251 PHE C O   2  
ATOM 10251  C CB  . PHE A 1 247 ? -82.154  -20.053 38.847  1.00 99.99  ? 251 PHE C CB  2  
ATOM 10252  C CG  . PHE A 1 247 ? -82.456  -19.360 37.540  1.00 99.99  ? 251 PHE C CG  2  
ATOM 10253  C CD1 . PHE A 1 247 ? -83.706  -18.767 37.335  1.00 99.99  ? 251 PHE C CD1 2  
ATOM 10254  C CD2 . PHE A 1 247 ? -81.484  -19.314 36.532  1.00 99.99  ? 251 PHE C CD2 2  
ATOM 10255  C CE1 . PHE A 1 247 ? -83.985  -18.127 36.122  1.00 99.99  ? 251 PHE C CE1 2  
ATOM 10256  C CE2 . PHE A 1 247 ? -81.764  -18.671 35.319  1.00 99.99  ? 251 PHE C CE2 2  
ATOM 10257  C CZ  . PHE A 1 247 ? -83.015  -18.080 35.116  1.00 99.99  ? 251 PHE C CZ  2  
ATOM 10258  N N   . GLY A 1 248 ? -83.160  -19.578 41.885  1.00 30.00  ? 252 GLY C N   2  
ATOM 10259  C CA  . GLY A 1 248 ? -83.408  -20.185 43.184  1.00 30.00  ? 252 GLY C CA  2  
ATOM 10260  C C   . GLY A 1 248 ? -84.019  -21.584 43.176  1.00 30.00  ? 252 GLY C C   2  
ATOM 10261  O O   . GLY A 1 248 ? -84.267  -22.143 42.104  1.00 30.00  ? 252 GLY C O   2  
ATOM 10262  N N   . PRO A 1 249 ? -84.269  -22.177 44.370  1.00 30.00  ? 253 PRO C N   2  
ATOM 10263  C CA  . PRO A 1 249 ? -84.849  -23.508 44.606  1.00 30.00  ? 253 PRO C CA  2  
ATOM 10264  C C   . PRO A 1 249 ? -86.236  -23.800 44.032  1.00 30.00  ? 253 PRO C C   2  
ATOM 10265  O O   . PRO A 1 249 ? -86.738  -24.915 44.146  1.00 30.00  ? 253 PRO C O   2  
ATOM 10266  C CB  . PRO A 1 249 ? -84.904  -23.457 46.093  1.00 99.99  ? 253 PRO C CB  2  
ATOM 10267  C CG  . PRO A 1 249 ? -84.298  -22.132 46.489  1.00 99.99  ? 253 PRO C CG  2  
ATOM 10268  C CD  . PRO A 1 249 ? -83.897  -21.435 45.498  1.00 99.99  ? 253 PRO C CD  2  
ATOM 10269  N N   . THR A 1 250 ? -86.855  -22.803 43.417  1.00 30.00  ? 254 THR C N   2  
ATOM 10270  C CA  . THR A 1 250 ? -88.171  -22.989 42.811  1.00 30.00  ? 254 THR C CA  2  
ATOM 10271  C C   . THR A 1 250 ? -87.998  -22.683 41.325  1.00 30.00  ? 254 THR C C   2  
ATOM 10272  O O   . THR A 1 250 ? -88.984  -22.555 40.589  1.00 30.00  ? 254 THR C O   2  
ATOM 10273  C CB  . THR A 1 250 ? -89.175  -22.038 43.453  1.00 99.99  ? 254 THR C CB  2  
ATOM 10274  O OG1 . THR A 1 250 ? -88.852  -20.692 43.096  1.00 99.99  ? 254 THR C OG1 2  
ATOM 10275  C CG2 . THR A 1 250 ? -89.121  -22.188 44.968  1.00 99.99  ? 254 THR C CG2 2  
ATOM 10276  N N   . GLY A 1 251 ? -86.734  -22.560 40.903  1.00 30.00  ? 255 GLY C N   2  
ATOM 10277  C CA  . GLY A 1 251 ? -86.394  -22.267 39.514  1.00 30.00  ? 255 GLY C CA  2  
ATOM 10278  C C   . GLY A 1 251 ? -86.757  -20.862 39.045  1.00 30.00  ? 255 GLY C C   2  
ATOM 10279  O O   . GLY A 1 251 ? -87.110  -20.668 37.874  1.00 30.00  ? 255 GLY C O   2  
ATOM 10280  N N   . LYS A 1 252 ? -86.670  -19.881 39.942  1.00 30.00  ? 256 LYS C N   2  
ATOM 10281  C CA  . LYS A 1 252 ? -87.002  -18.500 39.595  1.00 30.00  ? 256 LYS C CA  2  
ATOM 10282  C C   . LYS A 1 252 ? -85.795  -17.581 39.767  1.00 30.00  ? 256 LYS C C   2  
ATOM 10283  O O   . LYS A 1 252 ? -84.882  -17.891 40.543  1.00 30.00  ? 256 LYS C O   2  
ATOM 10284  C CB  . LYS A 1 252 ? -88.127  -17.997 40.492  1.00 99.99  ? 256 LYS C CB  2  
ATOM 10285  C CG  . LYS A 1 252 ? -88.534  -16.594 40.057  1.00 99.99  ? 256 LYS C CG  2  
ATOM 10286  C CD  . LYS A 1 252 ? -89.911  -16.264 40.626  1.00 99.99  ? 256 LYS C CD  2  
ATOM 10287  C CE  . LYS A 1 252 ? -90.158  -14.762 40.518  1.00 99.99  ? 256 LYS C CE  2  
ATOM 10288  N NZ  . LYS A 1 252 ? -90.887  -14.476 39.272  1.00 99.99  ? 256 LYS C NZ  2  
ATOM 10289  N N   . ILE A 1 253 ? -85.785  -16.456 39.052  1.00 30.00  ? 257 ILE C N   2  
ATOM 10290  C CA  . ILE A 1 253 ? -84.660  -15.529 39.139  1.00 30.00  ? 257 ILE C CA  2  
ATOM 10291  C C   . ILE A 1 253 ? -84.470  -14.993 40.557  1.00 30.00  ? 257 ILE C C   2  
ATOM 10292  O O   . ILE A 1 253 ? -85.352  -14.361 41.128  1.00 30.00  ? 257 ILE C O   2  
ATOM 10293  C CB  . ILE A 1 253 ? -84.896  -14.341 38.212  1.00 99.99  ? 257 ILE C CB  2  
ATOM 10294  C CG1 . ILE A 1 253 ? -85.808  -13.333 38.899  1.00 99.99  ? 257 ILE C CG1 2  
ATOM 10295  C CG2 . ILE A 1 253 ? -85.550  -14.824 36.923  1.00 99.99  ? 257 ILE C CG2 2  
ATOM 10296  C CD1 . ILE A 1 253 ? -87.257  -13.613 38.512  1.00 99.99  ? 257 ILE C CD1 2  
ATOM 10297  N N   . ALA A 1 254 ? -83.291  -15.266 41.106  1.00 30.00  ? 258 ALA C N   2  
ATOM 10298  C CA  . ALA A 1 254 ? -82.919  -14.862 42.457  1.00 30.00  ? 258 ALA C CA  2  
ATOM 10299  C C   . ALA A 1 254 ? -81.635  -14.030 42.544  1.00 30.00  ? 258 ALA C C   2  
ATOM 10300  O O   . ALA A 1 254 ? -80.897  -14.138 43.536  1.00 30.00  ? 258 ALA C O   2  
ATOM 10301  C CB  . ALA A 1 254 ? -82.750  -16.111 43.301  1.00 30.00  ? 258 ALA C CB  2  
ATOM 10302  N N   . GLY A 1 255 ? -81.369  -13.212 41.527  1.00 30.00  ? 259 GLY C N   2  
ATOM 10303  C CA  . GLY A 1 255 ? -80.160  -12.394 41.532  1.00 30.00  ? 259 GLY C CA  2  
ATOM 10304  C C   . GLY A 1 255 ? -79.499  -12.325 40.167  1.00 30.00  ? 259 GLY C C   2  
ATOM 10305  O O   . GLY A 1 255 ? -79.984  -12.947 39.219  1.00 30.00  ? 259 GLY C O   2  
ATOM 10306  N N   . ALA A 1 256 ? -78.393  -11.583 40.061  1.00 30.00  ? 260 ALA C N   2  
ATOM 10307  C CA  . ALA A 1 256 ? -77.679  -11.433 38.789  1.00 30.00  ? 260 ALA C CA  2  
ATOM 10308  C C   . ALA A 1 256 ? -76.473  -10.498 38.870  1.00 30.00  ? 260 ALA C C   2  
ATOM 10309  O O   . ALA A 1 256 ? -76.497  -9.513  39.594  1.00 30.00  ? 260 ALA C O   2  
ATOM 10310  C CB  . ALA A 1 256 ? -78.631  -10.915 37.729  1.00 30.00  ? 260 ALA C CB  2  
ATOM 10311  N N   . ASP A 1 257 ? -75.417  -10.802 38.126  1.00 30.00  ? 261 ASP C N   2  
ATOM 10312  C CA  . ASP A 1 257 ? -74.228  -9.952  38.128  1.00 30.00  ? 261 ASP C CA  2  
ATOM 10313  C C   . ASP A 1 257 ? -73.701  -9.712  36.721  1.00 30.00  ? 261 ASP C C   2  
ATOM 10314  O O   . ASP A 1 257 ? -73.961  -10.483 35.789  1.00 30.00  ? 261 ASP C O   2  
ATOM 10315  C CB  . ASP A 1 257 ? -73.120  -10.609 38.944  1.00 99.99  ? 261 ASP C CB  2  
ATOM 10316  C CG  . ASP A 1 257 ? -71.979  -9.617  39.151  1.00 99.99  ? 261 ASP C CG  2  
ATOM 10317  O OD1 . ASP A 1 257 ? -71.171  -9.459  38.195  1.00 99.99  ? 261 ASP C OD1 2  
ATOM 10318  O OD2 . ASP A 1 257 ? -71.925  -9.022  40.262  1.00 99.99  ? 261 ASP C OD2 2  
ATOM 10319  N N   . ILE A 1 258 ? -72.947  -8.636  36.580  1.00 30.00  ? 262 ILE C N   2  
ATOM 10320  C CA  . ILE A 1 258 ? -72.390  -8.251  35.302  1.00 30.00  ? 262 ILE C CA  2  
ATOM 10321  C C   . ILE A 1 258 ? -70.890  -8.082  35.370  1.00 30.00  ? 262 ILE C C   2  
ATOM 10322  O O   . ILE A 1 258 ? -70.351  -7.624  36.375  1.00 30.00  ? 262 ILE C O   2  
ATOM 10323  C CB  . ILE A 1 258 ? -72.996  -6.929  34.850  1.00 99.99  ? 262 ILE C CB  2  
ATOM 10324  C CG1 . ILE A 1 258 ? -72.272  -5.774  35.535  1.00 99.99  ? 262 ILE C CG1 2  
ATOM 10325  C CG2 . ILE A 1 258 ? -74.476  -6.893  35.220  1.00 99.99  ? 262 ILE C CG2 2  
ATOM 10326  C CD1 . ILE A 1 258 ? -73.014  -5.399  36.815  1.00 99.99  ? 262 ILE C CD1 2  
ATOM 10327  N N   . GLU A 1 259 ? -70.225  -8.471  34.288  1.00 30.00  ? 263 GLU C N   2  
ATOM 10328  C CA  . GLU A 1 259 ? -68.775  -8.361  34.164  1.00 30.00  ? 263 GLU C CA  2  
ATOM 10329  C C   . GLU A 1 259 ? -68.585  -7.686  32.818  1.00 30.00  ? 263 GLU C C   2  
ATOM 10330  O O   . GLU A 1 259 ? -69.328  -7.957  31.863  1.00 30.00  ? 263 GLU C O   2  
ATOM 10331  C CB  . GLU A 1 259 ? -68.143  -9.749  34.207  1.00 99.99  ? 263 GLU C CB  2  
ATOM 10332  C CG  . GLU A 1 259 ? -68.418  -10.388 35.545  1.00 99.99  ? 263 GLU C CG  2  
ATOM 10333  C CD  . GLU A 1 259 ? -67.593  -9.688  36.624  1.00 99.99  ? 263 GLU C CD  2  
ATOM 10334  O OE1 . GLU A 1 259 ? -68.123  -8.701  37.200  1.00 99.99  ? 263 GLU C OE1 2  
ATOM 10335  O OE2 . GLU A 1 259 ? -66.445  -10.146 36.859  1.00 99.99  ? 263 GLU C OE2 2  
ATOM 10336  N N   . THR A 1 260 ? -67.614  -6.786  32.752  1.00 30.00  ? 264 THR C N   2  
ATOM 10337  C CA  . THR A 1 260 ? -67.342  -6.073  31.521  1.00 30.00  ? 264 THR C CA  2  
ATOM 10338  C C   . THR A 1 260 ? -65.866  -6.204  31.217  1.00 30.00  ? 264 THR C C   2  
ATOM 10339  O O   . THR A 1 260 ? -65.040  -6.409  32.115  1.00 30.00  ? 264 THR C O   2  
ATOM 10340  C CB  . THR A 1 260 ? -67.714  -4.603  31.680  1.00 99.99  ? 264 THR C CB  2  
ATOM 10341  O OG1 . THR A 1 260 ? -66.817  -3.982  32.607  1.00 99.99  ? 264 THR C OG1 2  
ATOM 10342  C CG2 . THR A 1 260 ? -69.139  -4.495  32.207  1.00 99.99  ? 264 THR C CG2 2  
ATOM 10343  N N   . TYR A 1 261 ? -65.535  -6.076  29.933  1.00 30.00  ? 265 TYR C N   2  
ATOM 10344  C CA  . TYR A 1 261 ? -64.163  -6.204  29.501  1.00 30.00  ? 265 TYR C CA  2  
ATOM 10345  C C   . TYR A 1 261 ? -63.713  -5.199  28.447  1.00 30.00  ? 265 TYR C C   2  
ATOM 10346  O O   . TYR A 1 261 ? -64.446  -4.900  27.495  1.00 30.00  ? 265 TYR C O   2  
ATOM 10347  C CB  . TYR A 1 261 ? -63.937  -7.585  28.895  1.00 99.99  ? 265 TYR C CB  2  
ATOM 10348  C CG  . TYR A 1 261 ? -62.501  -7.711  28.447  1.00 99.99  ? 265 TYR C CG  2  
ATOM 10349  C CD1 . TYR A 1 261 ? -61.508  -8.058  29.371  1.00 99.99  ? 265 TYR C CD1 2  
ATOM 10350  C CD2 . TYR A 1 261 ? -62.162  -7.480  27.108  1.00 99.99  ? 265 TYR C CD2 2  
ATOM 10351  C CE1 . TYR A 1 261 ? -60.176  -8.175  28.954  1.00 99.99  ? 265 TYR C CE1 2  
ATOM 10352  C CE2 . TYR A 1 261 ? -60.831  -7.595  26.694  1.00 99.99  ? 265 TYR C CE2 2  
ATOM 10353  C CZ  . TYR A 1 261 ? -59.838  -7.944  27.617  1.00 99.99  ? 265 TYR C CZ  2  
ATOM 10354  O OH  . TYR A 1 261 ? -58.542  -8.056  27.213  1.00 99.99  ? 265 TYR C OH  2  
ATOM 10355  N N   . LEU A 1 262 ? -62.496  -4.691  28.641  1.00 30.00  ? 266 LEU C N   2  
ATOM 10356  C CA  . LEU A 1 262 ? -61.849  -3.750  27.731  1.00 30.00  ? 266 LEU C CA  2  
ATOM 10357  C C   . LEU A 1 262 ? -62.684  -2.662  27.085  1.00 30.00  ? 266 LEU C C   2  
ATOM 10358  O O   . LEU A 1 262 ? -63.030  -2.755  25.895  1.00 30.00  ? 266 LEU C O   2  
ATOM 10359  C CB  . LEU A 1 262 ? -61.238  -4.504  26.553  1.00 99.99  ? 266 LEU C CB  2  
ATOM 10360  C CG  . LEU A 1 262 ? -59.769  -4.794  26.841  1.00 99.99  ? 266 LEU C CG  2  
ATOM 10361  C CD1 . LEU A 1 262 ? -59.078  -5.244  25.558  1.00 99.99  ? 266 LEU C CD1 2  
ATOM 10362  C CD2 . LEU A 1 262 ? -59.096  -3.531  27.369  1.00 99.99  ? 266 LEU C CD2 2  
ATOM 10363  N N   . LEU A 1 263 ? -63.004  -1.628  27.850  1.00 30.00  ? 267 LEU C N   2  
ATOM 10364  C CA  . LEU A 1 263 ? -63.793  -0.526  27.316  1.00 30.00  ? 267 LEU C CA  2  
ATOM 10365  C C   . LEU A 1 263 ? -62.847  0.369   26.506  1.00 30.00  ? 267 LEU C C   2  
ATOM 10366  O O   . LEU A 1 263 ? -61.712  0.630   26.923  1.00 30.00  ? 267 LEU C O   2  
ATOM 10367  C CB  . LEU A 1 263 ? -64.421  0.265   28.458  1.00 99.99  ? 267 LEU C CB  2  
ATOM 10368  C CG  . LEU A 1 263 ? -65.832  -0.248  28.719  1.00 99.99  ? 267 LEU C CG  2  
ATOM 10369  C CD1 . LEU A 1 263 ? -66.574  0.736   29.617  1.00 99.99  ? 267 LEU C CD1 2  
ATOM 10370  C CD2 . LEU A 1 263 ? -66.576  -0.387  27.395  1.00 99.99  ? 267 LEU C CD2 2  
ATOM 10371  N N   . GLU A 1 264 ? -63.312  0.840   25.356  1.00 30.00  ? 268 GLU C N   2  
ATOM 10372  C CA  . GLU A 1 264 ? -62.479  1.686   24.519  1.00 30.00  ? 268 GLU C CA  2  
ATOM 10373  C C   . GLU A 1 264 ? -62.142  3.078   25.080  1.00 30.00  ? 268 GLU C C   2  
ATOM 10374  O O   . GLU A 1 264 ? -62.747  4.083   24.684  1.00 30.00  ? 268 GLU C O   2  
ATOM 10375  C CB  . GLU A 1 264 ? -63.172  1.935   23.183  1.00 99.99  ? 268 GLU C CB  2  
ATOM 10376  C CG  . GLU A 1 264 ? -63.182  3.414   22.887  1.00 99.99  ? 268 GLU C CG  2  
ATOM 10377  C CD  . GLU A 1 264 ? -64.163  4.114   23.829  1.00 99.99  ? 268 GLU C CD  2  
ATOM 10378  O OE1 . GLU A 1 264 ? -63.707  4.532   24.926  1.00 99.99  ? 268 GLU C OE1 2  
ATOM 10379  O OE2 . GLU A 1 264 ? -65.357  4.222   23.438  1.00 99.99  ? 268 GLU C OE2 2  
ATOM 10380  N N   . LYS A 1 265 ? -61.159  2.876   26.001  1.00 30.00  ? 269 LYS C N   2  
ATOM 10381  C CA  . LYS A 1 265 ? -60.705  4.143   26.581  1.00 30.00  ? 269 LYS C CA  2  
ATOM 10382  C C   . LYS A 1 265 ? -60.455  5.219   25.528  1.00 30.00  ? 269 LYS C C   2  
ATOM 10383  O O   . LYS A 1 265 ? -60.728  6.392   25.745  1.00 30.00  ? 269 LYS C O   2  
ATOM 10384  C CB  . LYS A 1 265 ? -59.399  3.923   27.336  1.00 99.99  ? 269 LYS C CB  2  
ATOM 10385  C CG  . LYS A 1 265 ? -59.612  2.892   28.438  1.00 99.99  ? 269 LYS C CG  2  
ATOM 10386  C CD  . LYS A 1 265 ? -58.333  2.747   29.255  1.00 99.99  ? 269 LYS C CD  2  
ATOM 10387  C CE  . LYS A 1 265 ? -58.557  1.733   30.372  1.00 99.99  ? 269 LYS C CE  2  
ATOM 10388  N NZ  . LYS A 1 265 ? -57.547  1.930   31.423  1.00 99.99  ? 269 LYS C NZ  2  
ATOM 10389  N N   . SER A 1 266 ? -59.936  4.822   24.379  1.00 30.00  ? 270 SER C N   2  
ATOM 10390  C CA  . SER A 1 266 ? -59.624  5.772   23.310  1.00 30.00  ? 270 SER C CA  2  
ATOM 10391  C C   . SER A 1 266 ? -60.722  6.595   22.656  1.00 30.00  ? 270 SER C C   2  
ATOM 10392  O O   . SER A 1 266 ? -60.449  7.693   22.167  1.00 30.00  ? 270 SER C O   2  
ATOM 10393  C CB  . SER A 1 266 ? -58.986  5.042   22.136  1.00 99.99  ? 270 SER C CB  2  
ATOM 10394  O OG  . SER A 1 266 ? -59.952  4.188   21.520  1.00 99.99  ? 270 SER C OG  2  
ATOM 10395  N N   . ARG A 1 267 ? -61.949  6.086   22.620  1.00 30.00  ? 271 ARG C N   2  
ATOM 10396  C CA  . ARG A 1 267 ? -63.032  6.835   21.970  1.00 30.00  ? 271 ARG C CA  2  
ATOM 10397  C C   . ARG A 1 267 ? -63.375  8.144   22.670  1.00 30.00  ? 271 ARG C C   2  
ATOM 10398  O O   . ARG A 1 267 ? -63.875  9.083   22.043  1.00 30.00  ? 271 ARG C O   2  
ATOM 10399  C CB  . ARG A 1 267 ? -64.302  5.993   21.941  1.00 99.99  ? 271 ARG C CB  2  
ATOM 10400  C CG  . ARG A 1 267 ? -65.146  6.380   20.733  1.00 99.99  ? 271 ARG C CG  2  
ATOM 10401  C CD  . ARG A 1 267 ? -65.769  5.128   20.125  1.00 99.99  ? 271 ARG C CD  2  
ATOM 10402  N NE  . ARG A 1 267 ? -66.202  5.376   18.732  1.00 99.99  ? 271 ARG C NE  2  
ATOM 10403  C CZ  . ARG A 1 267 ? -66.563  4.402   17.902  1.00 99.99  ? 271 ARG C CZ  2  
ATOM 10404  N NH1 . ARG A 1 267 ? -66.557  3.123   18.269  1.00 99.99  ? 271 ARG C NH1 2  
ATOM 10405  N NH2 . ARG A 1 267 ? -66.937  4.735   16.670  1.00 99.99  ? 271 ARG C NH2 2  
ATOM 10406  N N   . VAL A 1 268 ? -63.111  8.190   23.972  1.00 30.00  ? 272 VAL C N   2  
ATOM 10407  C CA  . VAL A 1 268 ? -63.376  9.353   24.809  1.00 30.00  ? 272 VAL C CA  2  
ATOM 10408  C C   . VAL A 1 268 ? -62.890  10.681  24.211  1.00 30.00  ? 272 VAL C C   2  
ATOM 10409  O O   . VAL A 1 268 ? -63.662  11.634  24.069  1.00 30.00  ? 272 VAL C O   2  
ATOM 10410  C CB  . VAL A 1 268 ? -62.680  9.193   26.154  1.00 99.99  ? 272 VAL C CB  2  
ATOM 10411  C CG1 . VAL A 1 268 ? -63.205  7.942   26.854  1.00 99.99  ? 272 VAL C CG1 2  
ATOM 10412  C CG2 . VAL A 1 268 ? -61.176  9.063   25.941  1.00 99.99  ? 272 VAL C CG2 2  
ATOM 10413  N N   . THR A 1 269 ? -61.606  10.727  23.854  1.00 30.00  ? 273 THR C N   2  
ATOM 10414  C CA  . THR A 1 269 ? -60.994  11.927  23.271  1.00 30.00  ? 273 THR C CA  2  
ATOM 10415  C C   . THR A 1 269 ? -60.846  11.904  21.746  1.00 30.00  ? 273 THR C C   2  
ATOM 10416  O O   . THR A 1 269 ? -60.705  12.953  21.120  1.00 30.00  ? 273 THR C O   2  
ATOM 10417  C CB  . THR A 1 269 ? -59.593  12.124  23.842  1.00 99.99  ? 273 THR C CB  2  
ATOM 10418  O OG1 . THR A 1 269 ? -58.738  11.079  23.372  1.00 99.99  ? 273 THR C OG1 2  
ATOM 10419  C CG2 . THR A 1 269 ? -59.654  12.085  25.363  1.00 99.99  ? 273 THR C CG2 2  
ATOM 10420  N N   . TYR A 1 270 ? -60.875  10.713  21.153  1.00 30.00  ? 274 TYR C N   2  
ATOM 10421  C CA  . TYR A 1 270 ? -60.729  10.585  19.701  1.00 30.00  ? 274 TYR C CA  2  
ATOM 10422  C C   . TYR A 1 270 ? -61.811  9.764   19.027  1.00 30.00  ? 274 TYR C C   2  
ATOM 10423  O O   . TYR A 1 270 ? -62.307  8.791   19.598  1.00 30.00  ? 274 TYR C O   2  
ATOM 10424  C CB  . TYR A 1 270 ? -59.401  9.912   19.370  1.00 99.99  ? 274 TYR C CB  2  
ATOM 10425  C CG  . TYR A 1 270 ? -59.258  9.784   17.873  1.00 99.99  ? 274 TYR C CG  2  
ATOM 10426  C CD1 . TYR A 1 270 ? -58.789  10.868  17.121  1.00 99.99  ? 274 TYR C CD1 2  
ATOM 10427  C CD2 . TYR A 1 270 ? -59.598  8.584   17.236  1.00 99.99  ? 274 TYR C CD2 2  
ATOM 10428  C CE1 . TYR A 1 270 ? -58.656  10.752  15.732  1.00 99.99  ? 274 TYR C CE1 2  
ATOM 10429  C CE2 . TYR A 1 270 ? -59.465  8.468   15.847  1.00 99.99  ? 274 TYR C CE2 2  
ATOM 10430  C CZ  . TYR A 1 270 ? -58.995  9.550   15.095  1.00 99.99  ? 274 TYR C CZ  2  
ATOM 10431  O OH  . TYR A 1 270 ? -58.867  9.435   13.746  1.00 99.99  ? 274 TYR C OH  2  
ATOM 10432  N N   . GLN A 1 271 ? -62.166  10.160  17.807  1.00 30.00  ? 275 GLN C N   2  
ATOM 10433  C CA  . GLN A 1 271 ? -63.176  9.434   17.053  1.00 30.00  ? 275 GLN C CA  2  
ATOM 10434  C C   . GLN A 1 271 ? -62.992  9.586   15.551  1.00 30.00  ? 275 GLN C C   2  
ATOM 10435  O O   . GLN A 1 271 ? -63.231  10.659  15.005  1.00 30.00  ? 275 GLN C O   2  
ATOM 10436  C CB  . GLN A 1 271 ? -64.566  9.950   17.410  1.00 99.99  ? 275 GLN C CB  2  
ATOM 10437  C CG  . GLN A 1 271 ? -64.862  9.642   18.875  1.00 99.99  ? 275 GLN C CG  2  
ATOM 10438  C CD  . GLN A 1 271 ? -65.109  8.155   19.083  1.00 99.99  ? 275 GLN C CD  2  
ATOM 10439  O OE1 . GLN A 1 271 ? -65.057  7.377   18.133  1.00 99.99  ? 275 GLN C OE1 2  
ATOM 10440  N NE2 . GLN A 1 271 ? -65.382  7.763   20.330  1.00 99.99  ? 275 GLN C NE2 2  
ATOM 10441  N N   . GLN A 1 272 ? -62.570  8.504   14.895  1.00 30.00  ? 276 GLN C N   2  
ATOM 10442  C CA  . GLN A 1 272 ? -62.355  8.482   13.443  1.00 30.00  ? 276 GLN C CA  2  
ATOM 10443  C C   . GLN A 1 272 ? -63.566  9.072   12.728  1.00 30.00  ? 276 GLN C C   2  
ATOM 10444  O O   . GLN A 1 272 ? -64.670  9.065   13.263  1.00 30.00  ? 276 GLN C O   2  
ATOM 10445  C CB  . GLN A 1 272 ? -62.148  7.048   12.971  1.00 99.99  ? 276 GLN C CB  2  
ATOM 10446  C CG  . GLN A 1 272 ? -63.350  6.199   13.373  1.00 99.99  ? 276 GLN C CG  2  
ATOM 10447  C CD  . GLN A 1 272 ? -63.286  5.823   14.848  1.00 99.99  ? 276 GLN C CD  2  
ATOM 10448  O OE1 . GLN A 1 272 ? -62.349  6.202   15.546  1.00 99.99  ? 276 GLN C OE1 2  
ATOM 10449  N NE2 . GLN A 1 272 ? -64.287  5.079   15.318  1.00 99.99  ? 276 GLN C NE2 2  
ATOM 10450  N N   . SER A 1 273 ? -63.373  9.585   11.520  1.00 30.00  ? 277 SER C N   2  
ATOM 10451  C CA  . SER A 1 273 ? -64.490  10.177  10.800  1.00 30.00  ? 277 SER C CA  2  
ATOM 10452  C C   . SER A 1 273 ? -65.675  9.231   10.731  1.00 30.00  ? 277 SER C C   2  
ATOM 10453  O O   . SER A 1 273 ? -65.511  8.012   10.845  1.00 30.00  ? 277 SER C O   2  
ATOM 10454  C CB  . SER A 1 273 ? -64.065  10.517  9.377   1.00 99.99  ? 277 SER C CB  2  
ATOM 10455  O OG  . SER A 1 273 ? -63.829  9.310   8.647   1.00 99.99  ? 277 SER C OG  2  
ATOM 10456  N N   . ALA A 1 274 ? -66.871  9.801   10.548  1.00 30.00  ? 278 ALA C N   2  
ATOM 10457  C CA  . ALA A 1 274 ? -68.116  9.024   10.452  1.00 30.00  ? 278 ALA C CA  2  
ATOM 10458  C C   . ALA A 1 274 ? -68.451  8.199   11.707  1.00 30.00  ? 278 ALA C C   2  
ATOM 10459  O O   . ALA A 1 274 ? -69.298  7.297   11.671  1.00 30.00  ? 278 ALA C O   2  
ATOM 10460  C CB  . ALA A 1 274 ? -68.043  8.101   9.246   1.00 30.00  ? 278 ALA C CB  2  
ATOM 10461  N N   . GLU A 1 275 ? -67.781  8.512   12.811  1.00 30.00  ? 279 GLU C N   2  
ATOM 10462  C CA  . GLU A 1 275 ? -67.998  7.816   14.075  1.00 30.00  ? 279 GLU C CA  2  
ATOM 10463  C C   . GLU A 1 275 ? -68.266  8.827   15.181  1.00 30.00  ? 279 GLU C C   2  
ATOM 10464  O O   . GLU A 1 275 ? -67.846  9.982   15.096  1.00 30.00  ? 279 GLU C O   2  
ATOM 10465  C CB  . GLU A 1 275 ? -66.763  6.995   14.433  1.00 99.99  ? 279 GLU C CB  2  
ATOM 10466  C CG  . GLU A 1 275 ? -66.356  7.296   15.855  1.00 99.99  ? 279 GLU C CG  2  
ATOM 10467  C CD  . GLU A 1 275 ? -65.769  8.707   15.928  1.00 99.99  ? 279 GLU C CD  2  
ATOM 10468  O OE1 . GLU A 1 275 ? -66.567  9.650   16.160  1.00 99.99  ? 279 GLU C OE1 2  
ATOM 10469  O OE2 . GLU A 1 275 ? -64.527  8.823   15.749  1.00 99.99  ? 279 GLU C OE2 2  
ATOM 10470  N N   . ARG A 1 276 ? -68.959  8.385   16.221  1.00 30.00  ? 280 ARG C N   2  
ATOM 10471  C CA  . ARG A 1 276 ? -69.270  9.249   17.342  1.00 30.00  ? 280 ARG C CA  2  
ATOM 10472  C C   . ARG A 1 276 ? -68.586  8.765   18.599  1.00 30.00  ? 280 ARG C C   2  
ATOM 10473  O O   . ARG A 1 276 ? -68.016  7.666   18.637  1.00 30.00  ? 280 ARG C O   2  
ATOM 10474  C CB  . ARG A 1 276 ? -70.777  9.264   17.582  1.00 99.99  ? 280 ARG C CB  2  
ATOM 10475  C CG  . ARG A 1 276 ? -71.107  10.266  18.681  1.00 99.99  ? 280 ARG C CG  2  
ATOM 10476  C CD  . ARG A 1 276 ? -72.594  10.191  19.007  1.00 99.99  ? 280 ARG C CD  2  
ATOM 10477  N NE  . ARG A 1 276 ? -72.920  8.934   19.715  1.00 99.99  ? 280 ARG C NE  2  
ATOM 10478  C CZ  . ARG A 1 276 ? -74.136  8.659   20.181  1.00 99.99  ? 280 ARG C CZ  2  
ATOM 10479  N NH1 . ARG A 1 276 ? -75.154  9.503   20.041  1.00 99.99  ? 280 ARG C NH1 2  
ATOM 10480  N NH2 . ARG A 1 276 ? -74.317  7.497   20.802  1.00 99.99  ? 280 ARG C NH2 2  
ATOM 10481  N N   . ASN A 1 277 ? -68.641  9.600   19.635  1.00 30.00  ? 281 ASN C N   2  
ATOM 10482  C CA  . ASN A 1 277 ? -68.054  9.256   20.925  1.00 30.00  ? 281 ASN C CA  2  
ATOM 10483  C C   . ASN A 1 277 ? -69.198  8.492   21.578  1.00 30.00  ? 281 ASN C C   2  
ATOM 10484  O O   . ASN A 1 277 ? -70.252  8.267   20.942  1.00 30.00  ? 281 ASN C O   2  
ATOM 10485  C CB  . ASN A 1 277 ? -67.671  10.528  21.675  1.00 99.99  ? 281 ASN C CB  2  
ATOM 10486  C CG  . ASN A 1 277 ? -68.892  11.386  21.965  1.00 99.99  ? 281 ASN C CG  2  
ATOM 10487  O OD1 . ASN A 1 277 ? -68.825  12.320  22.758  1.00 99.99  ? 281 ASN C OD1 2  
ATOM 10488  N ND2 . ASN A 1 277 ? -70.014  11.062  21.316  1.00 99.99  ? 281 ASN C ND2 2  
ATOM 10489  N N   . TYR A 1 278 ? -69.008  8.082   22.825  1.00 30.00  ? 282 TYR C N   2  
ATOM 10490  C CA  . TYR A 1 278 ? -70.059  7.362   23.516  1.00 30.00  ? 282 TYR C CA  2  
ATOM 10491  C C   . TYR A 1 278 ? -71.409  8.077   23.443  1.00 30.00  ? 282 TYR C C   2  
ATOM 10492  O O   . TYR A 1 278 ? -71.469  9.292   23.305  1.00 30.00  ? 282 TYR C O   2  
ATOM 10493  C CB  . TYR A 1 278 ? -69.699  7.202   24.990  1.00 99.99  ? 282 TYR C CB  2  
ATOM 10494  C CG  . TYR A 1 278 ? -69.744  8.549   25.670  1.00 99.99  ? 282 TYR C CG  2  
ATOM 10495  C CD1 . TYR A 1 278 ? -68.596  9.348   25.714  1.00 99.99  ? 282 TYR C CD1 2  
ATOM 10496  C CD2 . TYR A 1 278 ? -70.933  8.997   26.253  1.00 99.99  ? 282 TYR C CD2 2  
ATOM 10497  C CE1 . TYR A 1 278 ? -68.640  10.599  26.346  1.00 99.99  ? 282 TYR C CE1 2  
ATOM 10498  C CE2 . TYR A 1 278 ? -70.978  10.245  26.885  1.00 99.99  ? 282 TYR C CE2 2  
ATOM 10499  C CZ  . TYR A 1 278 ? -69.830  11.046  26.930  1.00 99.99  ? 282 TYR C CZ  2  
ATOM 10500  O OH  . TYR A 1 278 ? -69.870  12.262  27.542  1.00 99.99  ? 282 TYR C OH  2  
ATOM 10501  N N   . HIS A 1 279 ? -72.492  7.311   23.514  1.00 30.00  ? 283 HIS C N   2  
ATOM 10502  C CA  . HIS A 1 279 ? -73.836  7.883   23.423  1.00 30.00  ? 283 HIS C CA  2  
ATOM 10503  C C   . HIS A 1 279 ? -74.188  9.015   24.401  1.00 30.00  ? 283 HIS C C   2  
ATOM 10504  O O   . HIS A 1 279 ? -74.790  10.009  23.970  1.00 30.00  ? 283 HIS C O   2  
ATOM 10505  C CB  . HIS A 1 279 ? -74.877  6.798   23.671  1.00 99.99  ? 283 HIS C CB  2  
ATOM 10506  C CG  . HIS A 1 279 ? -74.778  5.598   22.762  1.00 99.99  ? 283 HIS C CG  2  
ATOM 10507  N ND1 . HIS A 1 279 ? -75.457  5.532   21.551  1.00 99.99  ? 283 HIS C ND1 2  
ATOM 10508  C CD2 . HIS A 1 279 ? -74.092  4.430   22.885  1.00 99.99  ? 283 HIS C CD2 2  
ATOM 10509  C CE1 . HIS A 1 279 ? -75.178  4.372   20.987  1.00 99.99  ? 283 HIS C CE1 2  
ATOM 10510  N NE2 . HIS A 1 279 ? -74.365  3.703   21.767  1.00 99.99  ? 283 HIS C NE2 2  
ATOM 10511  N N   . ILE A 1 280 ? -73.830  8.872   25.689  1.00 30.00  ? 284 ILE C N   2  
ATOM 10512  C CA  . ILE A 1 280 ? -74.130  9.893   26.697  1.00 30.00  ? 284 ILE C CA  2  
ATOM 10513  C C   . ILE A 1 280 ? -73.840  11.315  26.242  1.00 30.00  ? 284 ILE C C   2  
ATOM 10514  O O   . ILE A 1 280 ? -74.753  12.146  26.113  1.00 30.00  ? 284 ILE C O   2  
ATOM 10515  C CB  . ILE A 1 280 ? -73.294  9.647   27.949  1.00 99.99  ? 284 ILE C CB  2  
ATOM 10516  C CG1 . ILE A 1 280 ? -73.975  8.593   28.813  1.00 99.99  ? 284 ILE C CG1 2  
ATOM 10517  C CG2 . ILE A 1 280 ? -73.169  10.945  28.739  1.00 99.99  ? 284 ILE C CG2 2  
ATOM 10518  C CD1 . ILE A 1 280 ? -73.334  7.232   28.555  1.00 99.99  ? 284 ILE C CD1 2  
ATOM 10519  N N   . PHE A 1 281 ? -72.561  11.592  26.014  1.00 30.00  ? 285 PHE C N   2  
ATOM 10520  C CA  . PHE A 1 281 ? -72.123  12.912  25.582  1.00 30.00  ? 285 PHE C CA  2  
ATOM 10521  C C   . PHE A 1 281 ? -73.118  13.612  24.657  1.00 30.00  ? 285 PHE C C   2  
ATOM 10522  O O   . PHE A 1 281 ? -73.329  14.814  24.762  1.00 30.00  ? 285 PHE C O   2  
ATOM 10523  C CB  . PHE A 1 281 ? -70.804  12.799  24.824  1.00 99.99  ? 285 PHE C CB  2  
ATOM 10524  C CG  . PHE A 1 281 ? -70.357  14.172  24.383  1.00 99.99  ? 285 PHE C CG  2  
ATOM 10525  C CD1 . PHE A 1 281 ? -69.664  15.003  25.271  1.00 99.99  ? 285 PHE C CD1 2  
ATOM 10526  C CD2 . PHE A 1 281 ? -70.635  14.612  23.082  1.00 99.99  ? 285 PHE C CD2 2  
ATOM 10527  C CE1 . PHE A 1 281 ? -69.249  16.274  24.859  1.00 99.99  ? 285 PHE C CE1 2  
ATOM 10528  C CE2 . PHE A 1 281 ? -70.220  15.886  22.673  1.00 99.99  ? 285 PHE C CE2 2  
ATOM 10529  C CZ  . PHE A 1 281 ? -69.528  16.716  23.561  1.00 99.99  ? 285 PHE C CZ  2  
ATOM 10530  N N   . TYR A 1 282 ? -73.749  12.876  23.757  1.00 30.00  ? 286 TYR C N   2  
ATOM 10531  C CA  . TYR A 1 282 ? -74.688  13.503  22.841  1.00 30.00  ? 286 TYR C CA  2  
ATOM 10532  C C   . TYR A 1 282 ? -76.049  13.653  23.468  1.00 30.00  ? 286 TYR C C   2  
ATOM 10533  O O   . TYR A 1 282 ? -76.815  14.544  23.097  1.00 30.00  ? 286 TYR C O   2  
ATOM 10534  C CB  . TYR A 1 282 ? -74.829  12.654  21.581  1.00 99.99  ? 286 TYR C CB  2  
ATOM 10535  C CG  . TYR A 1 282 ? -73.507  12.601  20.859  1.00 99.99  ? 286 TYR C CG  2  
ATOM 10536  C CD1 . TYR A 1 282 ? -72.578  11.600  21.171  1.00 99.99  ? 286 TYR C CD1 2  
ATOM 10537  C CD2 . TYR A 1 282 ? -73.208  13.547  19.873  1.00 99.99  ? 286 TYR C CD2 2  
ATOM 10538  C CE1 . TYR A 1 282 ? -71.352  11.549  20.502  1.00 99.99  ? 286 TYR C CE1 2  
ATOM 10539  C CE2 . TYR A 1 282 ? -71.979  13.498  19.203  1.00 99.99  ? 286 TYR C CE2 2  
ATOM 10540  C CZ  . TYR A 1 282 ? -71.052  12.499  19.515  1.00 99.99  ? 286 TYR C CZ  2  
ATOM 10541  O OH  . TYR A 1 282 ? -69.859  12.451  18.862  1.00 99.99  ? 286 TYR C OH  2  
ATOM 10542  N N   . GLN A 1 283 ? -76.352  12.780  24.421  1.00 30.00  ? 287 GLN C N   2  
ATOM 10543  C CA  . GLN A 1 283 ? -77.628  12.816  25.123  1.00 30.00  ? 287 GLN C CA  2  
ATOM 10544  C C   . GLN A 1 283 ? -77.601  14.118  25.947  1.00 30.00  ? 287 GLN C C   2  
ATOM 10545  O O   . GLN A 1 283 ? -78.510  14.961  25.878  1.00 30.00  ? 287 GLN C O   2  
ATOM 10546  C CB  . GLN A 1 283 ? -77.761  11.592  26.024  1.00 99.99  ? 287 GLN C CB  2  
ATOM 10547  C CG  . GLN A 1 283 ? -77.817  10.333  25.166  1.00 99.99  ? 287 GLN C CG  2  
ATOM 10548  C CD  . GLN A 1 283 ? -79.147  10.227  24.434  1.00 99.99  ? 287 GLN C CD  2  
ATOM 10549  O OE1 . GLN A 1 283 ? -80.008  11.091  24.576  1.00 99.99  ? 287 GLN C OE1 2  
ATOM 10550  N NE2 . GLN A 1 283 ? -79.313  9.159   23.649  1.00 99.99  ? 287 GLN C NE2 2  
ATOM 10551  N N   . ILE A 1 284 ? -76.524  14.261  26.713  1.00 30.00  ? 288 ILE C N   2  
ATOM 10552  C CA  . ILE A 1 284 ? -76.268  15.415  27.567  1.00 30.00  ? 288 ILE C CA  2  
ATOM 10553  C C   . ILE A 1 284 ? -76.395  16.817  26.906  1.00 30.00  ? 288 ILE C C   2  
ATOM 10554  O O   . ILE A 1 284 ? -76.632  17.805  27.598  1.00 30.00  ? 288 ILE C O   2  
ATOM 10555  C CB  . ILE A 1 284 ? -74.850  15.352  28.117  1.00 99.99  ? 288 ILE C CB  2  
ATOM 10556  C CG1 . ILE A 1 284 ? -73.886  15.983  27.117  1.00 99.99  ? 288 ILE C CG1 2  
ATOM 10557  C CG2 . ILE A 1 284 ? -74.459  13.895  28.346  1.00 99.99  ? 288 ILE C CG2 2  
ATOM 10558  C CD1 . ILE A 1 284 ? -73.668  17.449  27.478  1.00 99.99  ? 288 ILE C CD1 2  
ATOM 10559  N N   . CYS A 1 285 ? -76.239  16.919  25.593  1.00 30.00  ? 289 CYS C N   2  
ATOM 10560  C CA  . CYS A 1 285 ? -76.334  18.213  24.918  1.00 30.00  ? 289 CYS C CA  2  
ATOM 10561  C C   . CYS A 1 285 ? -77.546  18.325  24.027  1.00 30.00  ? 289 CYS C C   2  
ATOM 10562  O O   . CYS A 1 285 ? -77.485  19.001  22.991  1.00 30.00  ? 289 CYS C O   2  
ATOM 10563  C CB  . CYS A 1 285 ? -75.101  18.435  24.049  1.00 99.99  ? 289 CYS C CB  2  
ATOM 10564  S SG  . CYS A 1 285 ? -74.912  17.316  22.638  1.00 99.99  ? 289 CYS C SG  2  
ATOM 10565  N N   . SER A 1 286 ? -78.653  17.686  24.404  1.00 30.00  ? 290 SER C N   2  
ATOM 10566  C CA  . SER A 1 286 ? -79.860  17.740  23.570  1.00 30.00  ? 290 SER C CA  2  
ATOM 10567  C C   . SER A 1 286 ? -81.019  18.572  24.087  1.00 30.00  ? 290 SER C C   2  
ATOM 10568  O O   . SER A 1 286 ? -81.812  19.067  23.291  1.00 30.00  ? 290 SER C O   2  
ATOM 10569  C CB  . SER A 1 286 ? -80.423  16.337  23.381  1.00 99.99  ? 290 SER C CB  2  
ATOM 10570  O OG  . SER A 1 286 ? -80.928  15.852  24.628  1.00 99.99  ? 290 SER C OG  2  
ATOM 10571  N N   . ASN A 1 287 ? -81.108  18.693  25.413  1.00 30.00  ? 291 ASN C N   2  
ATOM 10572  C CA  . ASN A 1 287 ? -82.151  19.450  26.109  1.00 30.00  ? 291 ASN C CA  2  
ATOM 10573  C C   . ASN A 1 287 ? -83.360  18.595  26.458  1.00 30.00  ? 291 ASN C C   2  
ATOM 10574  O O   . ASN A 1 287 ? -84.504  19.070  26.447  1.00 30.00  ? 291 ASN C O   2  
ATOM 10575  C CB  . ASN A 1 287 ? -82.634  20.598  25.230  1.00 99.99  ? 291 ASN C CB  2  
ATOM 10576  C CG  . ASN A 1 287 ? -83.194  21.737  26.069  1.00 99.99  ? 291 ASN C CG  2  
ATOM 10577  O OD1 . ASN A 1 287 ? -84.018  22.516  25.597  1.00 99.99  ? 291 ASN C OD1 2  
ATOM 10578  N ND2 . ASN A 1 287 ? -82.742  21.833  27.323  1.00 99.99  ? 291 ASN C ND2 2  
ATOM 10579  N N   . ALA A 1 288 ? -83.097  17.331  26.766  1.00 30.00  ? 292 ALA C N   2  
ATOM 10580  C CA  . ALA A 1 288 ? -84.153  16.405  27.132  1.00 30.00  ? 292 ALA C CA  2  
ATOM 10581  C C   . ALA A 1 288 ? -84.620  16.828  28.520  1.00 30.00  ? 292 ALA C C   2  
ATOM 10582  O O   . ALA A 1 288 ? -85.774  16.656  28.895  1.00 30.00  ? 292 ALA C O   2  
ATOM 10583  C CB  . ALA A 1 288 ? -83.606  14.987  27.167  1.00 30.00  ? 292 ALA C CB  2  
ATOM 10584  N N   . ILE A 1 289 ? -83.693  17.388  29.279  1.00 30.00  ? 293 ILE C N   2  
ATOM 10585  C CA  . ILE A 1 289 ? -83.979  17.850  30.623  1.00 30.00  ? 293 ILE C CA  2  
ATOM 10586  C C   . ILE A 1 289 ? -83.243  19.168  30.790  1.00 30.00  ? 293 ILE C C   2  
ATOM 10587  O O   . ILE A 1 289 ? -82.119  19.202  31.306  1.00 30.00  ? 293 ILE C O   2  
ATOM 10588  C CB  . ILE A 1 289 ? -83.491  16.823  31.639  1.00 99.99  ? 293 ILE C CB  2  
ATOM 10589  C CG1 . ILE A 1 289 ? -81.995  17.006  31.869  1.00 99.99  ? 293 ILE C CG1 2  
ATOM 10590  C CG2 . ILE A 1 289 ? -83.754  15.417  31.108  1.00 99.99  ? 293 ILE C CG2 2  
ATOM 10591  C CD1 . ILE A 1 289 ? -81.218  16.088  30.929  1.00 99.99  ? 293 ILE C CD1 2  
ATOM 10592  N N   . PRO A 1 290 ? -83.864  20.267  30.339  1.00 30.00  ? 294 PRO C N   2  
ATOM 10593  C CA  . PRO A 1 290 ? -83.291  21.616  30.425  1.00 30.00  ? 294 PRO C CA  2  
ATOM 10594  C C   . PRO A 1 290 ? -82.827  21.930  31.840  1.00 30.00  ? 294 PRO C C   2  
ATOM 10595  O O   . PRO A 1 290 ? -81.791  22.556  32.039  1.00 30.00  ? 294 PRO C O   2  
ATOM 10596  C CB  . PRO A 1 290 ? -84.502  22.387  30.034  1.00 99.99  ? 294 PRO C CB  2  
ATOM 10597  C CG  . PRO A 1 290 ? -85.571  21.362  29.729  1.00 99.99  ? 294 PRO C CG  2  
ATOM 10598  C CD  . PRO A 1 290 ? -85.175  20.157  29.860  1.00 99.99  ? 294 PRO C CD  2  
ATOM 10599  N N   . GLU A 1 291 ? -83.596  21.485  32.828  1.00 30.00  ? 295 GLU C N   2  
ATOM 10600  C CA  . GLU A 1 291 ? -83.264  21.708  34.224  1.00 30.00  ? 295 GLU C CA  2  
ATOM 10601  C C   . GLU A 1 291 ? -81.797  21.370  34.518  1.00 30.00  ? 295 GLU C C   2  
ATOM 10602  O O   . GLU A 1 291 ? -81.132  22.053  35.294  1.00 30.00  ? 295 GLU C O   2  
ATOM 10603  C CB  . GLU A 1 291 ? -84.140  20.829  35.111  1.00 99.99  ? 295 GLU C CB  2  
ATOM 10604  C CG  . GLU A 1 291 ? -85.583  21.253  34.973  1.00 99.99  ? 295 GLU C CG  2  
ATOM 10605  C CD  . GLU A 1 291 ? -85.788  22.596  35.672  1.00 99.99  ? 295 GLU C CD  2  
ATOM 10606  O OE1 . GLU A 1 291 ? -85.616  23.636  34.983  1.00 99.99  ? 295 GLU C OE1 2  
ATOM 10607  O OE2 . GLU A 1 291 ? -86.115  22.567  36.888  1.00 99.99  ? 295 GLU C OE2 2  
ATOM 10608  N N   . LEU A 1 292 ? -81.294  20.320  33.884  1.00 30.00  ? 296 LEU C N   2  
ATOM 10609  C CA  . LEU A 1 292 ? -79.909  19.871  34.076  1.00 30.00  ? 296 LEU C CA  2  
ATOM 10610  C C   . LEU A 1 292 ? -78.801  20.700  33.417  1.00 30.00  ? 296 LEU C C   2  
ATOM 10611  O O   . LEU A 1 292 ? -77.634  20.634  33.833  1.00 30.00  ? 296 LEU C O   2  
ATOM 10612  C CB  . LEU A 1 292 ? -79.736  18.461  33.519  1.00 99.99  ? 296 LEU C CB  2  
ATOM 10613  C CG  . LEU A 1 292 ? -79.922  17.445  34.640  1.00 99.99  ? 296 LEU C CG  2  
ATOM 10614  C CD1 . LEU A 1 292 ? -79.433  16.079  34.171  1.00 99.99  ? 296 LEU C CD1 2  
ATOM 10615  C CD2 . LEU A 1 292 ? -79.121  17.883  35.861  1.00 99.99  ? 296 LEU C CD2 2  
ATOM 10616  N N   . ASN A 1 293 ? -79.154  21.470  32.392  1.00 30.00  ? 297 ASN C N   2  
ATOM 10617  C CA  . ASN A 1 293 ? -78.170  22.288  31.699  1.00 30.00  ? 297 ASN C CA  2  
ATOM 10618  C C   . ASN A 1 293 ? -77.268  23.068  32.647  1.00 30.00  ? 297 ASN C C   2  
ATOM 10619  O O   . ASN A 1 293 ? -76.042  23.079  32.485  1.00 30.00  ? 297 ASN C O   2  
ATOM 10620  C CB  . ASN A 1 293 ? -78.876  23.300  30.803  1.00 99.99  ? 297 ASN C CB  2  
ATOM 10621  C CG  . ASN A 1 293 ? -79.740  24.249  31.619  1.00 99.99  ? 297 ASN C CG  2  
ATOM 10622  O OD1 . ASN A 1 293 ? -80.194  25.273  31.112  1.00 99.99  ? 297 ASN C OD1 2  
ATOM 10623  N ND2 . ASN A 1 293 ? -79.966  23.906  32.889  1.00 99.99  ? 297 ASN C ND2 2  
ATOM 10624  N N   . ASP A 1 294 ? -77.860  23.714  33.646  1.00 30.00  ? 298 ASP C N   2  
ATOM 10625  C CA  . ASP A 1 294 ? -77.078  24.489  34.598  1.00 30.00  ? 298 ASP C CA  2  
ATOM 10626  C C   . ASP A 1 294 ? -76.346  23.638  35.633  1.00 30.00  ? 298 ASP C C   2  
ATOM 10627  O O   . ASP A 1 294 ? -75.388  24.096  36.254  1.00 30.00  ? 298 ASP C O   2  
ATOM 10628  C CB  . ASP A 1 294 ? -77.987  25.441  35.364  1.00 99.99  ? 298 ASP C CB  2  
ATOM 10629  C CG  . ASP A 1 294 ? -78.999  24.638  36.177  1.00 99.99  ? 298 ASP C CG  2  
ATOM 10630  O OD1 . ASP A 1 294 ? -80.012  24.203  35.566  1.00 99.99  ? 298 ASP C OD1 2  
ATOM 10631  O OD2 . ASP A 1 294 ? -78.753  24.462  37.400  1.00 99.99  ? 298 ASP C OD2 2  
ATOM 10632  N N   . VAL A 1 295 ? -76.794  22.399  35.813  1.00 30.00  ? 299 VAL C N   2  
ATOM 10633  C CA  . VAL A 1 295 ? -76.153  21.500  36.770  1.00 30.00  ? 299 VAL C CA  2  
ATOM 10634  C C   . VAL A 1 295 ? -74.837  20.993  36.208  1.00 30.00  ? 299 VAL C C   2  
ATOM 10635  O O   . VAL A 1 295 ? -73.871  20.764  36.941  1.00 30.00  ? 299 VAL C O   2  
ATOM 10636  C CB  . VAL A 1 295 ? -77.064  20.309  37.052  1.00 99.99  ? 299 VAL C CB  2  
ATOM 10637  C CG1 . VAL A 1 295 ? -78.384  20.805  37.632  1.00 99.99  ? 299 VAL C CG1 2  
ATOM 10638  C CG2 . VAL A 1 295 ? -77.332  19.554  35.753  1.00 99.99  ? 299 VAL C CG2 2  
ATOM 10639  N N   . MET A 1 296 ? -74.811  20.826  34.893  1.00 30.00  ? 300 MET C N   2  
ATOM 10640  C CA  . MET A 1 296 ? -73.627  20.344  34.207  1.00 30.00  ? 300 MET C CA  2  
ATOM 10641  C C   . MET A 1 296 ? -72.812  21.496  33.614  1.00 30.00  ? 300 MET C C   2  
ATOM 10642  O O   . MET A 1 296 ? -71.621  21.339  33.315  1.00 30.00  ? 300 MET C O   2  
ATOM 10643  C CB  . MET A 1 296 ? -74.029  19.411  33.070  1.00 99.99  ? 300 MET C CB  2  
ATOM 10644  C CG  . MET A 1 296 ? -74.802  18.223  33.634  1.00 99.99  ? 300 MET C CG  2  
ATOM 10645  S SD  . MET A 1 296 ? -74.678  16.810  32.508  1.00 99.99  ? 300 MET C SD  2  
ATOM 10646  C CE  . MET A 1 296 ? -75.471  17.496  31.068  1.00 99.99  ? 300 MET C CE  2  
ATOM 10647  N N   . LEU A 1 297 ? -73.456  22.650  33.451  1.00 30.00  ? 301 LEU C N   2  
ATOM 10648  C CA  . LEU A 1 297 ? -72.805  23.834  32.897  1.00 30.00  ? 301 LEU C CA  2  
ATOM 10649  C C   . LEU A 1 297 ? -72.571  23.642  31.409  1.00 30.00  ? 301 LEU C C   2  
ATOM 10650  O O   . LEU A 1 297 ? -71.557  24.076  30.862  1.00 30.00  ? 301 LEU C O   2  
ATOM 10651  C CB  . LEU A 1 297 ? -71.467  24.062  33.592  1.00 99.99  ? 301 LEU C CB  2  
ATOM 10652  C CG  . LEU A 1 297 ? -71.651  25.047  34.740  1.00 99.99  ? 301 LEU C CG  2  
ATOM 10653  C CD1 . LEU A 1 297 ? -70.283  25.527  35.220  1.00 99.99  ? 301 LEU C CD1 2  
ATOM 10654  C CD2 . LEU A 1 297 ? -72.472  26.239  34.263  1.00 99.99  ? 301 LEU C CD2 2  
ATOM 10655  N N   . VAL A 1 298 ? -73.524  23.001  30.744  1.00 30.00  ? 302 VAL C N   2  
ATOM 10656  C CA  . VAL A 1 298 ? -73.381  22.763  29.323  1.00 30.00  ? 302 VAL C CA  2  
ATOM 10657  C C   . VAL A 1 298 ? -74.346  23.535  28.462  1.00 30.00  ? 302 VAL C C   2  
ATOM 10658  O O   . VAL A 1 298 ? -75.487  23.778  28.843  1.00 30.00  ? 302 VAL C O   2  
ATOM 10659  C CB  . VAL A 1 298 ? -73.604  21.286  29.018  1.00 99.99  ? 302 VAL C CB  2  
ATOM 10660  C CG1 . VAL A 1 298 ? -72.577  20.450  29.775  1.00 99.99  ? 302 VAL C CG1 2  
ATOM 10661  C CG2 . VAL A 1 298 ? -75.009  20.884  29.457  1.00 99.99  ? 302 VAL C CG2 2  
ATOM 10662  N N   . THR A 1 299 ? -73.864  23.926  27.292  1.00 30.00  ? 303 THR C N   2  
ATOM 10663  C CA  . THR A 1 299 ? -74.671  24.645  26.324  1.00 30.00  ? 303 THR C CA  2  
ATOM 10664  C C   . THR A 1 299 ? -75.138  23.487  25.446  1.00 30.00  ? 303 THR C C   2  
ATOM 10665  O O   . THR A 1 299 ? -74.324  22.732  24.918  1.00 30.00  ? 303 THR C O   2  
ATOM 10666  C CB  . THR A 1 299 ? -73.809  25.666  25.589  1.00 99.99  ? 303 THR C CB  2  
ATOM 10667  O OG1 . THR A 1 299 ? -72.862  24.982  24.762  1.00 99.99  ? 303 THR C OG1 2  
ATOM 10668  C CG2 . THR A 1 299 ? -73.066  26.529  26.602  1.00 99.99  ? 303 THR C CG2 2  
ATOM 10669  N N   . PRO A 1 300 ? -76.461  23.319  25.295  1.00 30.00  ? 304 PRO C N   2  
ATOM 10670  C CA  . PRO A 1 300 ? -76.995  22.223  24.471  1.00 30.00  ? 304 PRO C CA  2  
ATOM 10671  C C   . PRO A 1 300 ? -76.583  22.165  22.999  1.00 30.00  ? 304 PRO C C   2  
ATOM 10672  O O   . PRO A 1 300 ? -77.439  22.164  22.111  1.00 30.00  ? 304 PRO C O   2  
ATOM 10673  C CB  . PRO A 1 300 ? -78.441  22.548  24.594  1.00 99.99  ? 304 PRO C CB  2  
ATOM 10674  C CG  . PRO A 1 300 ? -78.527  23.744  25.511  1.00 99.99  ? 304 PRO C CG  2  
ATOM 10675  C CD  . PRO A 1 300 ? -77.391  24.143  25.942  1.00 99.99  ? 304 PRO C CD  2  
ATOM 10676  N N   . ASP A 1 301 ? -75.273  22.104  22.758  1.00 30.00  ? 305 ASP C N   2  
ATOM 10677  C CA  . ASP A 1 301 ? -74.699  22.024  21.408  1.00 30.00  ? 305 ASP C CA  2  
ATOM 10678  C C   . ASP A 1 301 ? -73.536  21.039  21.488  1.00 30.00  ? 305 ASP C C   2  
ATOM 10679  O O   . ASP A 1 301 ? -72.547  21.307  22.173  1.00 30.00  ? 305 ASP C O   2  
ATOM 10680  C CB  . ASP A 1 301 ? -74.213  23.400  20.967  1.00 99.99  ? 305 ASP C CB  2  
ATOM 10681  C CG  . ASP A 1 301 ? -73.852  23.366  19.485  1.00 99.99  ? 305 ASP C CG  2  
ATOM 10682  O OD1 . ASP A 1 301 ? -72.729  22.878  19.178  1.00 99.99  ? 305 ASP C OD1 2  
ATOM 10683  O OD2 . ASP A 1 301 ? -74.700  23.820  18.672  1.00 99.99  ? 305 ASP C OD2 2  
ATOM 10684  N N   . SER A 1 302 ? -73.650  19.900  20.808  1.00 30.00  ? 306 SER C N   2  
ATOM 10685  C CA  . SER A 1 302 ? -72.565  18.926  20.852  1.00 30.00  ? 306 SER C CA  2  
ATOM 10686  C C   . SER A 1 302 ? -71.395  19.364  19.958  1.00 30.00  ? 306 SER C C   2  
ATOM 10687  O O   . SER A 1 302 ? -70.225  19.207  20.331  1.00 30.00  ? 306 SER C O   2  
ATOM 10688  C CB  . SER A 1 302 ? -73.068  17.570  20.366  1.00 99.99  ? 306 SER C CB  2  
ATOM 10689  O OG  . SER A 1 302 ? -73.367  17.644  18.971  1.00 99.99  ? 306 SER C OG  2  
ATOM 10690  N N   . GLY A 1 303 ? -71.729  19.935  18.794  1.00 30.00  ? 307 GLY C N   2  
ATOM 10691  C CA  . GLY A 1 303 ? -70.718  20.392  17.850  1.00 30.00  ? 307 GLY C CA  2  
ATOM 10692  C C   . GLY A 1 303 ? -69.898  21.558  18.360  1.00 30.00  ? 307 GLY C C   2  
ATOM 10693  O O   . GLY A 1 303 ? -69.199  22.243  17.613  1.00 30.00  ? 307 GLY C O   2  
ATOM 10694  N N   . LEU A 1 304 ? -69.993  21.756  19.664  1.00 30.00  ? 308 LEU C N   2  
ATOM 10695  C CA  . LEU A 1 304 ? -69.310  22.820  20.368  1.00 30.00  ? 308 LEU C CA  2  
ATOM 10696  C C   . LEU A 1 304 ? -68.104  22.280  21.113  1.00 30.00  ? 308 LEU C C   2  
ATOM 10697  O O   . LEU A 1 304 ? -67.138  23.002  21.352  1.00 30.00  ? 308 LEU C O   2  
ATOM 10698  C CB  . LEU A 1 304 ? -70.255  23.469  21.372  1.00 99.99  ? 308 LEU C CB  2  
ATOM 10699  C CG  . LEU A 1 304 ? -70.908  24.691  20.738  1.00 99.99  ? 308 LEU C CG  2  
ATOM 10700  C CD1 . LEU A 1 304 ? -71.589  25.523  21.824  1.00 99.99  ? 308 LEU C CD1 2  
ATOM 10701  C CD2 . LEU A 1 304 ? -69.845  25.532  20.043  1.00 99.99  ? 308 LEU C CD2 2  
ATOM 10702  N N   . TYR A 1 305 ? -68.168  21.004  21.478  1.00 30.00  ? 309 TYR C N   2  
ATOM 10703  C CA  . TYR A 1 305 ? -67.086  20.378  22.217  1.00 30.00  ? 309 TYR C CA  2  
ATOM 10704  C C   . TYR A 1 305 ? -66.213  19.505  21.354  1.00 30.00  ? 309 TYR C C   2  
ATOM 10705  O O   . TYR A 1 305 ? -66.673  18.528  20.772  1.00 30.00  ? 309 TYR C O   2  
ATOM 10706  C CB  . TYR A 1 305 ? -67.654  19.502  23.329  1.00 99.99  ? 309 TYR C CB  2  
ATOM 10707  C CG  . TYR A 1 305 ? -68.399  20.365  24.319  1.00 99.99  ? 309 TYR C CG  2  
ATOM 10708  C CD1 . TYR A 1 305 ? -69.759  20.638  24.127  1.00 99.99  ? 309 TYR C CD1 2  
ATOM 10709  C CD2 . TYR A 1 305 ? -67.728  20.892  25.430  1.00 99.99  ? 309 TYR C CD2 2  
ATOM 10710  C CE1 . TYR A 1 305 ? -70.448  21.439  25.045  1.00 99.99  ? 309 TYR C CE1 2  
ATOM 10711  C CE2 . TYR A 1 305 ? -68.418  21.692  26.348  1.00 99.99  ? 309 TYR C CE2 2  
ATOM 10712  C CZ  . TYR A 1 305 ? -69.778  21.964  26.158  1.00 99.99  ? 309 TYR C CZ  2  
ATOM 10713  O OH  . TYR A 1 305 ? -70.448  22.744  27.050  1.00 99.99  ? 309 TYR C OH  2  
ATOM 10714  N N   . SER A 1 306 ? -64.938  19.880  21.281  1.00 30.00  ? 310 SER C N   2  
ATOM 10715  C CA  . SER A 1 306 ? -63.951  19.160  20.485  1.00 30.00  ? 310 SER C CA  2  
ATOM 10716  C C   . SER A 1 306 ? -63.985  17.662  20.756  1.00 30.00  ? 310 SER C C   2  
ATOM 10717  O O   . SER A 1 306 ? -64.178  16.876  19.832  1.00 30.00  ? 310 SER C O   2  
ATOM 10718  C CB  . SER A 1 306 ? -62.552  19.669  20.814  1.00 99.99  ? 310 SER C CB  2  
ATOM 10719  O OG  . SER A 1 306 ? -62.209  19.294  22.150  1.00 99.99  ? 310 SER C OG  2  
ATOM 10720  N N   . PHE A 1 307 ? -63.803  17.272  22.014  1.00 30.00  ? 311 PHE C N   2  
ATOM 10721  C CA  . PHE A 1 307 ? -63.822  15.856  22.396  1.00 30.00  ? 311 PHE C CA  2  
ATOM 10722  C C   . PHE A 1 307 ? -64.982  15.009  21.873  1.00 30.00  ? 311 PHE C C   2  
ATOM 10723  O O   . PHE A 1 307 ? -64.932  13.788  22.015  1.00 30.00  ? 311 PHE C O   2  
ATOM 10724  C CB  . PHE A 1 307 ? -63.880  15.730  23.915  1.00 99.99  ? 311 PHE C CB  2  
ATOM 10725  C CG  . PHE A 1 307 ? -65.230  15.189  24.323  1.00 99.99  ? 311 PHE C CG  2  
ATOM 10726  C CD1 . PHE A 1 307 ? -66.345  15.401  23.504  1.00 99.99  ? 311 PHE C CD1 2  
ATOM 10727  C CD2 . PHE A 1 307 ? -65.365  14.477  25.519  1.00 99.99  ? 311 PHE C CD2 2  
ATOM 10728  C CE1 . PHE A 1 307 ? -67.597  14.901  23.881  1.00 99.99  ? 311 PHE C CE1 2  
ATOM 10729  C CE2 . PHE A 1 307 ? -66.614  13.976  25.898  1.00 99.99  ? 311 PHE C CE2 2  
ATOM 10730  C CZ  . PHE A 1 307 ? -67.731  14.188  25.079  1.00 99.99  ? 311 PHE C CZ  2  
ATOM 10731  N N   . ILE A 1 308 ? -66.014  15.616  21.288  1.00 30.00  ? 312 ILE C N   2  
ATOM 10732  C CA  . ILE A 1 308 ? -67.145  14.845  20.782  1.00 30.00  ? 312 ILE C CA  2  
ATOM 10733  C C   . ILE A 1 308 ? -67.713  15.292  19.438  1.00 30.00  ? 312 ILE C C   2  
ATOM 10734  O O   . ILE A 1 308 ? -68.813  14.880  19.047  1.00 30.00  ? 312 ILE C O   2  
ATOM 10735  C CB  . ILE A 1 308 ? -68.304  14.918  21.771  1.00 99.99  ? 312 ILE C CB  2  
ATOM 10736  C CG1 . ILE A 1 308 ? -69.549  14.304  21.140  1.00 99.99  ? 312 ILE C CG1 2  
ATOM 10737  C CG2 . ILE A 1 308 ? -68.579  16.377  22.125  1.00 99.99  ? 312 ILE C CG2 2  
ATOM 10738  C CD1 . ILE A 1 308 ? -69.170  13.020  20.410  1.00 99.99  ? 312 ILE C CD1 2  
ATOM 10739  N N   . ASN A 1 309 ? -66.993  16.147  18.715  1.00 30.00  ? 313 ASN C N   2  
ATOM 10740  C CA  . ASN A 1 309 ? -67.505  16.571  17.416  1.00 30.00  ? 313 ASN C CA  2  
ATOM 10741  C C   . ASN A 1 309 ? -66.503  16.272  16.304  1.00 30.00  ? 313 ASN C C   2  
ATOM 10742  O O   . ASN A 1 309 ? -66.672  16.742  15.177  1.00 30.00  ? 313 ASN C O   2  
ATOM 10743  C CB  . ASN A 1 309 ? -67.775  18.072  17.431  1.00 99.99  ? 313 ASN C CB  2  
ATOM 10744  C CG  . ASN A 1 309 ? -66.499  18.858  17.681  1.00 99.99  ? 313 ASN C CG  2  
ATOM 10745  O OD1 . ASN A 1 309 ? -66.467  20.073  17.491  1.00 99.99  ? 313 ASN C OD1 2  
ATOM 10746  N ND2 . ASN A 1 309 ? -65.442  18.162  18.103  1.00 99.99  ? 313 ASN C ND2 2  
ATOM 10747  N N   . GLN A 1 310 ? -65.472  15.479  16.629  1.00 30.00  ? 314 GLN C N   2  
ATOM 10748  C CA  . GLN A 1 310 ? -64.426  15.072  15.679  1.00 30.00  ? 314 GLN C CA  2  
ATOM 10749  C C   . GLN A 1 310 ? -65.073  14.370  14.485  1.00 30.00  ? 314 GLN C C   2  
ATOM 10750  O O   . GLN A 1 310 ? -64.992  14.817  13.338  1.00 30.00  ? 314 GLN C O   2  
ATOM 10751  C CB  . GLN A 1 310 ? -63.449  14.122  16.358  1.00 99.99  ? 314 GLN C CB  2  
ATOM 10752  C CG  . GLN A 1 310 ? -64.205  12.917  16.907  1.00 99.99  ? 314 GLN C CG  2  
ATOM 10753  C CD  . GLN A 1 310 ? -64.919  13.267  18.208  1.00 99.99  ? 314 GLN C CD  2  
ATOM 10754  O OE1 . GLN A 1 310 ? -64.838  14.398  18.678  1.00 99.99  ? 314 GLN C OE1 2  
ATOM 10755  N NE2 . GLN A 1 310 ? -65.620  12.288  18.785  1.00 99.99  ? 314 GLN C NE2 2  
ATOM 10756  N N   . GLY A 1 311 ? -65.721  13.251  14.765  1.00 30.00  ? 315 GLY C N   2  
ATOM 10757  C CA  . GLY A 1 311 ? -66.370  12.514  13.707  1.00 30.00  ? 315 GLY C CA  2  
ATOM 10758  C C   . GLY A 1 311 ? -67.790  12.994  13.483  1.00 30.00  ? 315 GLY C C   2  
ATOM 10759  O O   . GLY A 1 311 ? -68.024  14.081  12.999  1.00 30.00  ? 315 GLY C O   2  
ATOM 10760  N N   . CYS A 1 312 ? -68.742  12.151  13.854  1.00 30.00  ? 316 CYS C N   2  
ATOM 10761  C CA  . CYS A 1 312 ? -70.162  12.437  13.703  1.00 30.00  ? 316 CYS C CA  2  
ATOM 10762  C C   . CYS A 1 312 ? -70.821  13.159  14.896  1.00 30.00  ? 316 CYS C C   2  
ATOM 10763  O O   . CYS A 1 312 ? -70.272  13.222  16.006  1.00 30.00  ? 316 CYS C O   2  
ATOM 10764  C CB  . CYS A 1 312 ? -70.936  11.136  13.513  1.00 99.99  ? 316 CYS C CB  2  
ATOM 10765  S SG  . CYS A 1 312 ? -72.709  11.305  13.197  1.00 99.99  ? 316 CYS C SG  2  
ATOM 10766  N N   . LEU A 1 313 ? -72.010  13.691  14.647  1.00 30.00  ? 317 LEU C N   2  
ATOM 10767  C CA  . LEU A 1 313 ? -72.758  14.407  15.662  1.00 30.00  ? 317 LEU C CA  2  
ATOM 10768  C C   . LEU A 1 313 ? -74.108  13.746  15.910  1.00 30.00  ? 317 LEU C C   2  
ATOM 10769  O O   . LEU A 1 313 ? -74.415  13.361  17.037  1.00 30.00  ? 317 LEU C O   2  
ATOM 10770  C CB  . LEU A 1 313 ? -72.997  15.843  15.212  1.00 99.99  ? 317 LEU C CB  2  
ATOM 10771  C CG  . LEU A 1 313 ? -71.908  16.745  15.784  1.00 99.99  ? 317 LEU C CG  2  
ATOM 10772  C CD1 . LEU A 1 313 ? -72.317  18.206  15.618  1.00 99.99  ? 317 LEU C CD1 2  
ATOM 10773  C CD2 . LEU A 1 313 ? -71.713  16.432  17.265  1.00 99.99  ? 317 LEU C CD2 2  
ATOM 10774  N N   . THR A 1 314 ? -74.900  13.623  14.854  1.00 30.00  ? 318 THR C N   2  
ATOM 10775  C CA  . THR A 1 314 ? -76.222  12.996  14.946  1.00 30.00  ? 318 THR C CA  2  
ATOM 10776  C C   . THR A 1 314 ? -76.132  11.501  14.561  1.00 30.00  ? 318 THR C C   2  
ATOM 10777  O O   . THR A 1 314 ? -75.062  11.016  14.199  1.00 30.00  ? 318 THR C O   2  
ATOM 10778  C CB  . THR A 1 314 ? -77.194  13.692  13.996  1.00 99.99  ? 318 THR C CB  2  
ATOM 10779  O OG1 . THR A 1 314 ? -76.812  13.427  12.645  1.00 99.99  ? 318 THR C OG1 2  
ATOM 10780  C CG2 . THR A 1 314 ? -77.155  15.195  14.248  1.00 99.99  ? 318 THR C CG2 2  
ATOM 10781  N N   . VAL A 1 315 ? -77.238  10.766  14.644  1.00 30.00  ? 319 VAL C N   2  
ATOM 10782  C CA  . VAL A 1 315 ? -77.211  9.340   14.293  1.00 30.00  ? 319 VAL C CA  2  
ATOM 10783  C C   . VAL A 1 315 ? -78.529  8.792   13.757  1.00 30.00  ? 319 VAL C C   2  
ATOM 10784  O O   . VAL A 1 315 ? -79.411  8.423   14.521  1.00 30.00  ? 319 VAL C O   2  
ATOM 10785  C CB  . VAL A 1 315 ? -76.860  8.509   15.523  1.00 99.99  ? 319 VAL C CB  2  
ATOM 10786  C CG1 . VAL A 1 315 ? -75.487  8.922   16.042  1.00 99.99  ? 319 VAL C CG1 2  
ATOM 10787  C CG2 . VAL A 1 315 ? -77.905  8.738   16.607  1.00 99.99  ? 319 VAL C CG2 2  
ATOM 10788  N N   . ASP A 1 316 ? -78.656  8.729   12.438  1.00 30.00  ? 320 ASP C N   2  
ATOM 10789  C CA  . ASP A 1 316 ? -79.870  8.218   11.819  1.00 30.00  ? 320 ASP C CA  2  
ATOM 10790  C C   . ASP A 1 316 ? -80.491  7.137   12.707  1.00 30.00  ? 320 ASP C C   2  
ATOM 10791  O O   . ASP A 1 316 ? -79.894  6.089   12.935  1.00 30.00  ? 320 ASP C O   2  
ATOM 10792  C CB  . ASP A 1 316 ? -79.543  7.615   10.458  1.00 99.99  ? 320 ASP C CB  2  
ATOM 10793  C CG  . ASP A 1 316 ? -78.340  6.687   10.585  1.00 99.99  ? 320 ASP C CG  2  
ATOM 10794  O OD1 . ASP A 1 316 ? -77.284  7.177   11.068  1.00 99.99  ? 320 ASP C OD1 2  
ATOM 10795  O OD2 . ASP A 1 316 ? -78.484  5.496   10.199  1.00 99.99  ? 320 ASP C OD2 2  
ATOM 10796  N N   . ASN A 1 317 ? -81.677  7.423   13.227  1.00 30.00  ? 321 ASN C N   2  
ATOM 10797  C CA  . ASN A 1 317 ? -82.411  6.494   14.083  1.00 30.00  ? 321 ASN C CA  2  
ATOM 10798  C C   . ASN A 1 317 ? -82.047  6.355   15.559  1.00 30.00  ? 321 ASN C C   2  
ATOM 10799  O O   . ASN A 1 317 ? -82.224  5.296   16.154  1.00 30.00  ? 321 ASN C O   2  
ATOM 10800  C CB  . ASN A 1 317 ? -82.272  5.074   13.545  1.00 99.99  ? 321 ASN C CB  2  
ATOM 10801  C CG  . ASN A 1 317 ? -83.453  4.210   13.961  1.00 99.99  ? 321 ASN C CG  2  
ATOM 10802  O OD1 . ASN A 1 317 ? -83.339  2.989   14.038  1.00 99.99  ? 321 ASN C OD1 2  
ATOM 10803  N ND2 . ASN A 1 317 ? -84.594  4.848   14.231  1.00 99.99  ? 321 ASN C ND2 2  
ATOM 10804  N N   . ILE A 1 318 ? -81.543  7.433   16.138  1.00 30.00  ? 322 ILE C N   2  
ATOM 10805  C CA  . ILE A 1 318 ? -81.182  7.470   17.547  1.00 30.00  ? 322 ILE C CA  2  
ATOM 10806  C C   . ILE A 1 318 ? -81.587  8.870   17.958  1.00 30.00  ? 322 ILE C C   2  
ATOM 10807  O O   . ILE A 1 318 ? -80.991  9.843   17.500  1.00 30.00  ? 322 ILE C O   2  
ATOM 10808  C CB  . ILE A 1 318 ? -79.685  7.224   17.704  1.00 99.99  ? 322 ILE C CB  2  
ATOM 10809  C CG1 . ILE A 1 318 ? -79.283  6.000   16.890  1.00 99.99  ? 322 ILE C CG1 2  
ATOM 10810  C CG2 . ILE A 1 318 ? -79.363  6.986   19.176  1.00 99.99  ? 322 ILE C CG2 2  
ATOM 10811  C CD1 . ILE A 1 318 ? -79.827  4.742   17.560  1.00 99.99  ? 322 ILE C CD1 2  
ATOM 10812  N N   . ASP A 1 319 ? -82.612  8.966   18.799  1.00 30.00  ? 323 ASP C N   2  
ATOM 10813  C CA  . ASP A 1 319 ? -83.090  10.258  19.274  1.00 30.00  ? 323 ASP C CA  2  
ATOM 10814  C C   . ASP A 1 319 ? -82.395  10.507  20.611  1.00 30.00  ? 323 ASP C C   2  
ATOM 10815  O O   . ASP A 1 319 ? -82.808  9.960   21.633  1.00 30.00  ? 323 ASP C O   2  
ATOM 10816  C CB  . ASP A 1 319 ? -84.606  10.216  19.450  1.00 99.99  ? 323 ASP C CB  2  
ATOM 10817  C CG  . ASP A 1 319 ? -85.129  11.625  19.705  1.00 99.99  ? 323 ASP C CG  2  
ATOM 10818  O OD1 . ASP A 1 319 ? -85.014  12.079  20.876  1.00 99.99  ? 323 ASP C OD1 2  
ATOM 10819  O OD2 . ASP A 1 319 ? -85.638  12.239  18.728  1.00 99.99  ? 323 ASP C OD2 2  
ATOM 10820  N N   . ASP A 1 320 ? -81.346  11.327  20.598  1.00 30.00  ? 324 ASP C N   2  
ATOM 10821  C CA  . ASP A 1 320 ? -80.600  11.630  21.813  1.00 30.00  ? 324 ASP C CA  2  
ATOM 10822  C C   . ASP A 1 320 ? -81.442  12.270  22.928  1.00 30.00  ? 324 ASP C C   2  
ATOM 10823  O O   . ASP A 1 320 ? -81.137  12.128  24.122  1.00 30.00  ? 324 ASP C O   2  
ATOM 10824  C CB  . ASP A 1 320 ? -79.470  12.606  21.496  1.00 99.99  ? 324 ASP C CB  2  
ATOM 10825  C CG  . ASP A 1 320 ? -78.424  11.913  20.628  1.00 99.99  ? 324 ASP C CG  2  
ATOM 10826  O OD1 . ASP A 1 320 ? -77.700  11.042  21.182  1.00 99.99  ? 324 ASP C OD1 2  
ATOM 10827  O OD2 . ASP A 1 320 ? -78.359  12.256  19.417  1.00 99.99  ? 324 ASP C OD2 2  
ATOM 10828  N N   . VAL A 1 321 ? -82.503  12.972  22.527  1.00 30.00  ? 325 VAL C N   2  
ATOM 10829  C CA  . VAL A 1 321 ? -83.425  13.637  23.442  1.00 30.00  ? 325 VAL C CA  2  
ATOM 10830  C C   . VAL A 1 321 ? -84.092  12.559  24.306  1.00 30.00  ? 325 VAL C C   2  
ATOM 10831  O O   . VAL A 1 321 ? -83.918  12.497  25.533  1.00 30.00  ? 325 VAL C O   2  
ATOM 10832  C CB  . VAL A 1 321 ? -84.481  14.402  22.651  1.00 99.99  ? 325 VAL C CB  2  
ATOM 10833  C CG1 . VAL A 1 321 ? -85.470  15.051  23.615  1.00 99.99  ? 325 VAL C CG1 2  
ATOM 10834  C CG2 . VAL A 1 321 ? -83.805  15.481  21.811  1.00 99.99  ? 325 VAL C CG2 2  
ATOM 10835  N N   . GLU A 1 322 ? -84.859  11.704  23.634  1.00 30.00  ? 326 GLU C N   2  
ATOM 10836  C CA  . GLU A 1 322 ? -85.570  10.608  24.278  1.00 30.00  ? 326 GLU C CA  2  
ATOM 10837  C C   . GLU A 1 322 ? -84.667  9.570   24.932  1.00 30.00  ? 326 GLU C C   2  
ATOM 10838  O O   . GLU A 1 322 ? -85.027  8.960   25.937  1.00 30.00  ? 326 GLU C O   2  
ATOM 10839  C CB  . GLU A 1 322 ? -86.423  9.867   23.252  1.00 99.99  ? 326 GLU C CB  2  
ATOM 10840  C CG  . GLU A 1 322 ? -87.497  10.789  22.730  1.00 99.99  ? 326 GLU C CG  2  
ATOM 10841  C CD  . GLU A 1 322 ? -88.549  11.008  23.816  1.00 99.99  ? 326 GLU C CD  2  
ATOM 10842  O OE1 . GLU A 1 322 ? -88.373  11.976  24.604  1.00 99.99  ? 326 GLU C OE1 2  
ATOM 10843  O OE2 . GLU A 1 322 ? -89.522  10.208  23.848  1.00 99.99  ? 326 GLU C OE2 2  
ATOM 10844  N N   . GLU A 1 323 ? -83.496  9.346   24.365  1.00 30.00  ? 327 GLU C N   2  
ATOM 10845  C CA  . GLU A 1 323 ? -82.619  8.362   24.961  1.00 30.00  ? 327 GLU C CA  2  
ATOM 10846  C C   . GLU A 1 323 ? -82.124  8.938   26.275  1.00 30.00  ? 327 GLU C C   2  
ATOM 10847  O O   . GLU A 1 323 ? -81.959  8.204   27.253  1.00 30.00  ? 327 GLU C O   2  
ATOM 10848  C CB  . GLU A 1 323 ? -81.447  8.080   24.026  1.00 99.99  ? 327 GLU C CB  2  
ATOM 10849  C CG  . GLU A 1 323 ? -80.888  6.707   24.318  1.00 99.99  ? 327 GLU C CG  2  
ATOM 10850  C CD  . GLU A 1 323 ? -79.884  6.799   25.463  1.00 99.99  ? 327 GLU C CD  2  
ATOM 10851  O OE1 . GLU A 1 323 ? -80.329  6.655   26.631  1.00 99.99  ? 327 GLU C OE1 2  
ATOM 10852  O OE2 . GLU A 1 323 ? -78.677  7.013   25.158  1.00 99.99  ? 327 GLU C OE2 2  
ATOM 10853  N N   . PHE A 1 324 ? -81.892  10.252  26.307  1.00 30.00  ? 328 PHE C N   2  
ATOM 10854  C CA  . PHE A 1 324 ? -81.420  10.886  27.542  1.00 30.00  ? 328 PHE C CA  2  
ATOM 10855  C C   . PHE A 1 324 ? -82.480  10.703  28.631  1.00 30.00  ? 328 PHE C C   2  
ATOM 10856  O O   . PHE A 1 324 ? -82.166  10.270  29.756  1.00 30.00  ? 328 PHE C O   2  
ATOM 10857  C CB  . PHE A 1 324 ? -81.180  12.371  27.303  1.00 99.99  ? 328 PHE C CB  2  
ATOM 10858  C CG  . PHE A 1 324 ? -80.694  13.015  28.577  1.00 99.99  ? 328 PHE C CG  2  
ATOM 10859  C CD1 . PHE A 1 324 ? -79.336  12.952  28.920  1.00 99.99  ? 328 PHE C CD1 2  
ATOM 10860  C CD2 . PHE A 1 324 ? -81.596  13.676  29.418  1.00 99.99  ? 328 PHE C CD2 2  
ATOM 10861  C CE1 . PHE A 1 324 ? -78.884  13.548  30.103  1.00 99.99  ? 328 PHE C CE1 2  
ATOM 10862  C CE2 . PHE A 1 324 ? -81.144  14.274  30.601  1.00 99.99  ? 328 PHE C CE2 2  
ATOM 10863  C CZ  . PHE A 1 324 ? -79.787  14.208  30.943  1.00 99.99  ? 328 PHE C CZ  2  
ATOM 10864  N N   . LYS A 1 325 ? -83.728  11.026  28.287  1.00 30.00  ? 329 LYS C N   2  
ATOM 10865  C CA  . LYS A 1 325 ? -84.845  10.895  29.210  1.00 30.00  ? 329 LYS C CA  2  
ATOM 10866  C C   . LYS A 1 325 ? -84.891  9.473   29.758  1.00 30.00  ? 329 LYS C C   2  
ATOM 10867  O O   . LYS A 1 325 ? -84.835  9.266   30.973  1.00 30.00  ? 329 LYS C O   2  
ATOM 10868  C CB  . LYS A 1 325 ? -86.154  11.200  28.488  1.00 99.99  ? 329 LYS C CB  2  
ATOM 10869  C CG  . LYS A 1 325 ? -87.308  11.158  29.485  1.00 99.99  ? 329 LYS C CG  2  
ATOM 10870  C CD  . LYS A 1 325 ? -88.514  11.880  28.895  1.00 99.99  ? 329 LYS C CD  2  
ATOM 10871  C CE  . LYS A 1 325 ? -89.760  11.527  29.703  1.00 99.99  ? 329 LYS C CE  2  
ATOM 10872  N NZ  . LYS A 1 325 ? -89.977  12.548  30.740  1.00 99.99  ? 329 LYS C NZ  2  
ATOM 10873  N N   . LEU A 1 326 ? -84.988  8.494   28.864  1.00 30.00  ? 330 LEU C N   2  
ATOM 10874  C CA  . LEU A 1 326 ? -85.033  7.093   29.277  1.00 30.00  ? 330 LEU C CA  2  
ATOM 10875  C C   . LEU A 1 326 ? -83.822  6.689   30.120  1.00 30.00  ? 330 LEU C C   2  
ATOM 10876  O O   . LEU A 1 326 ? -83.935  5.833   31.025  1.00 30.00  ? 330 LEU C O   2  
ATOM 10877  C CB  . LEU A 1 326 ? -85.065  6.190   28.047  1.00 99.99  ? 330 LEU C CB  2  
ATOM 10878  C CG  . LEU A 1 326 ? -86.512  5.841   27.708  1.00 99.99  ? 330 LEU C CG  2  
ATOM 10879  C CD1 . LEU A 1 326 ? -86.534  4.694   26.703  1.00 99.99  ? 330 LEU C CD1 2  
ATOM 10880  C CD2 . LEU A 1 326 ? -87.245  5.423   28.977  1.00 99.99  ? 330 LEU C CD2 2  
ATOM 10881  N N   . CYS A 1 327 ? -82.664  7.290   29.832  1.00 30.00  ? 331 CYS C N   2  
ATOM 10882  C CA  . CYS A 1 327 ? -81.442  6.974   30.569  1.00 30.00  ? 331 CYS C CA  2  
ATOM 10883  C C   . CYS A 1 327 ? -81.559  7.532   31.973  1.00 30.00  ? 331 CYS C C   2  
ATOM 10884  O O   . CYS A 1 327 ? -81.098  6.934   32.957  1.00 30.00  ? 331 CYS C O   2  
ATOM 10885  C CB  . CYS A 1 327 ? -80.238  7.594   29.868  1.00 99.99  ? 331 CYS C CB  2  
ATOM 10886  S SG  . CYS A 1 327 ? -79.976  9.362   30.154  1.00 99.99  ? 331 CYS C SG  2  
ATOM 10887  N N   . ASP A 1 328 ? -82.189  8.698   32.058  1.00 30.00  ? 332 ASP C N   2  
ATOM 10888  C CA  . ASP A 1 328 ? -82.409  9.366   33.328  1.00 30.00  ? 332 ASP C CA  2  
ATOM 10889  C C   . ASP A 1 328 ? -83.428  8.485   34.088  1.00 30.00  ? 332 ASP C C   2  
ATOM 10890  O O   . ASP A 1 328 ? -83.218  8.093   35.245  1.00 30.00  ? 332 ASP C O   2  
ATOM 10891  C CB  . ASP A 1 328 ? -82.959  10.768  33.090  1.00 99.99  ? 332 ASP C CB  2  
ATOM 10892  C CG  . ASP A 1 328 ? -81.884  11.635  32.440  1.00 99.99  ? 332 ASP C CG  2  
ATOM 10893  O OD1 . ASP A 1 328 ? -80.916  11.990  33.165  1.00 99.99  ? 332 ASP C OD1 2  
ATOM 10894  O OD2 . ASP A 1 328 ? -82.037  11.931  31.226  1.00 99.99  ? 332 ASP C OD2 2  
ATOM 10895  N N   . GLU A 1 329 ? -84.521  8.174   33.400  1.00 30.00  ? 333 GLU C N   2  
ATOM 10896  C CA  . GLU A 1 329 ? -85.596  7.347   33.931  1.00 30.00  ? 333 GLU C CA  2  
ATOM 10897  C C   . GLU A 1 329 ? -85.043  6.032   34.492  1.00 30.00  ? 333 GLU C C   2  
ATOM 10898  O O   . GLU A 1 329 ? -85.504  5.547   35.528  1.00 30.00  ? 333 GLU C O   2  
ATOM 10899  C CB  . GLU A 1 329 ? -86.595  7.024   32.825  1.00 99.99  ? 333 GLU C CB  2  
ATOM 10900  C CG  . GLU A 1 329 ? -87.262  8.296   32.361  1.00 99.99  ? 333 GLU C CG  2  
ATOM 10901  C CD  . GLU A 1 329 ? -88.233  8.782   33.434  1.00 99.99  ? 333 GLU C CD  2  
ATOM 10902  O OE1 . GLU A 1 329 ? -87.779  9.567   34.306  1.00 99.99  ? 333 GLU C OE1 2  
ATOM 10903  O OE2 . GLU A 1 329 ? -89.419  8.365   33.372  1.00 99.99  ? 333 GLU C OE2 2  
ATOM 10904  N N   . ALA A 1 330 ? -84.054  5.463   33.795  1.00 30.00  ? 334 ALA C N   2  
ATOM 10905  C CA  . ALA A 1 330 ? -83.438  4.193   34.187  1.00 30.00  ? 334 ALA C CA  2  
ATOM 10906  C C   . ALA A 1 330 ? -82.541  4.264   35.408  1.00 30.00  ? 334 ALA C C   2  
ATOM 10907  O O   . ALA A 1 330 ? -82.312  3.262   36.090  1.00 30.00  ? 334 ALA C O   2  
ATOM 10908  C CB  . ALA A 1 330 ? -82.645  3.639   33.010  1.00 30.00  ? 334 ALA C CB  2  
ATOM 10909  N N   . PHE A 1 331 ? -82.023  5.456   35.681  1.00 30.00  ? 335 PHE C N   2  
ATOM 10910  C CA  . PHE A 1 331 ? -81.153  5.658   36.835  1.00 30.00  ? 335 PHE C CA  2  
ATOM 10911  C C   . PHE A 1 331 ? -82.002  5.605   38.084  1.00 30.00  ? 335 PHE C C   2  
ATOM 10912  O O   . PHE A 1 331 ? -81.556  5.151   39.137  1.00 30.00  ? 335 PHE C O   2  
ATOM 10913  C CB  . PHE A 1 331 ? -80.463  7.016   36.733  1.00 99.99  ? 335 PHE C CB  2  
ATOM 10914  C CG  . PHE A 1 331 ? -79.524  7.191   37.902  1.00 99.99  ? 335 PHE C CG  2  
ATOM 10915  C CD1 . PHE A 1 331 ? -78.299  6.511   37.923  1.00 99.99  ? 335 PHE C CD1 2  
ATOM 10916  C CD2 . PHE A 1 331 ? -79.876  8.032   38.963  1.00 99.99  ? 335 PHE C CD2 2  
ATOM 10917  C CE1 . PHE A 1 331 ? -77.427  6.677   39.005  1.00 99.99  ? 335 PHE C CE1 2  
ATOM 10918  C CE2 . PHE A 1 331 ? -79.003  8.198   40.046  1.00 99.99  ? 335 PHE C CE2 2  
ATOM 10919  C CZ  . PHE A 1 331 ? -77.780  7.519   40.067  1.00 99.99  ? 335 PHE C CZ  2  
ATOM 10920  N N   . ASP A 1 332 ? -83.235  6.083   37.946  1.00 30.00  ? 336 ASP C N   2  
ATOM 10921  C CA  . ASP A 1 332 ? -84.193  6.095   39.042  1.00 30.00  ? 336 ASP C CA  2  
ATOM 10922  C C   . ASP A 1 332 ? -84.555  4.651   39.412  1.00 30.00  ? 336 ASP C C   2  
ATOM 10923  O O   . ASP A 1 332 ? -84.356  4.229   40.557  1.00 30.00  ? 336 ASP C O   2  
ATOM 10924  C CB  . ASP A 1 332 ? -85.453  6.846   38.620  1.00 99.99  ? 336 ASP C CB  2  
ATOM 10925  C CG  . ASP A 1 332 ? -85.130  8.326   38.440  1.00 99.99  ? 336 ASP C CG  2  
ATOM 10926  O OD1 . ASP A 1 332 ? -84.914  9.000   39.484  1.00 99.99  ? 336 ASP C OD1 2  
ATOM 10927  O OD2 . ASP A 1 332 ? -85.098  8.771   37.262  1.00 99.99  ? 336 ASP C OD2 2  
ATOM 10928  N N   . ILE A 1 333 ? -85.076  3.907   38.433  1.00 30.00  ? 337 ILE C N   2  
ATOM 10929  C CA  . ILE A 1 333 ? -85.469  2.501   38.622  1.00 30.00  ? 337 ILE C CA  2  
ATOM 10930  C C   . ILE A 1 333 ? -84.348  1.625   39.175  1.00 30.00  ? 337 ILE C C   2  
ATOM 10931  O O   . ILE A 1 333 ? -84.575  0.643   39.887  1.00 30.00  ? 337 ILE C O   2  
ATOM 10932  C CB  . ILE A 1 333 ? -85.897  1.898   37.289  1.00 99.99  ? 337 ILE C CB  2  
ATOM 10933  C CG1 . ILE A 1 333 ? -84.673  1.367   36.553  1.00 99.99  ? 337 ILE C CG1 2  
ATOM 10934  C CG2 . ILE A 1 333 ? -86.578  2.971   36.443  1.00 99.99  ? 337 ILE C CG2 2  
ATOM 10935  C CD1 . ILE A 1 333 ? -84.499  -0.115  36.856  1.00 99.99  ? 337 ILE C CD1 2  
ATOM 10936  N N   . LEU A 1 334 ? -83.118  1.991   38.840  1.00 30.00  ? 338 LEU C N   2  
ATOM 10937  C CA  . LEU A 1 334 ? -81.960  1.252   39.290  1.00 30.00  ? 338 LEU C CA  2  
ATOM 10938  C C   . LEU A 1 334 ? -81.749  1.539   40.763  1.00 30.00  ? 338 LEU C C   2  
ATOM 10939  O O   . LEU A 1 334 ? -80.983  0.853   41.448  1.00 30.00  ? 338 LEU C O   2  
ATOM 10940  C CB  . LEU A 1 334 ? -80.730  1.681   38.499  1.00 99.99  ? 338 LEU C CB  2  
ATOM 10941  C CG  . LEU A 1 334 ? -80.526  0.734   37.323  1.00 99.99  ? 338 LEU C CG  2  
ATOM 10942  C CD1 . LEU A 1 334 ? -79.137  0.953   36.730  1.00 99.99  ? 338 LEU C CD1 2  
ATOM 10943  C CD2 . LEU A 1 334 ? -80.657  -0.707  37.802  1.00 99.99  ? 338 LEU C CD2 2  
ATOM 10944  N N   . GLY A 1 335 ? -82.432  2.575   41.250  1.00 30.00  ? 339 GLY C N   2  
ATOM 10945  C CA  . GLY A 1 335 ? -82.308  2.961   42.637  1.00 30.00  ? 339 GLY C CA  2  
ATOM 10946  C C   . GLY A 1 335 ? -81.063  3.806   42.842  1.00 30.00  ? 339 GLY C C   2  
ATOM 10947  O O   . GLY A 1 335 ? -80.202  3.482   43.656  1.00 30.00  ? 339 GLY C O   2  
ATOM 10948  N N   . PHE A 1 336 ? -80.966  4.899   42.098  1.00 30.00  ? 340 PHE C N   2  
ATOM 10949  C CA  . PHE A 1 336 ? -79.816  5.790   42.203  1.00 30.00  ? 340 PHE C CA  2  
ATOM 10950  C C   . PHE A 1 336 ? -80.261  7.064   42.892  1.00 30.00  ? 340 PHE C C   2  
ATOM 10951  O O   . PHE A 1 336 ? -81.175  7.743   42.409  1.00 30.00  ? 340 PHE C O   2  
ATOM 10952  C CB  . PHE A 1 336 ? -79.283  6.112   40.812  1.00 99.99  ? 340 PHE C CB  2  
ATOM 10953  C CG  . PHE A 1 336 ? -78.678  4.873   40.203  1.00 99.99  ? 340 PHE C CG  2  
ATOM 10954  C CD1 . PHE A 1 336 ? -77.365  4.505   40.520  1.00 99.99  ? 340 PHE C CD1 2  
ATOM 10955  C CD2 . PHE A 1 336 ? -79.430  4.087   39.320  1.00 99.99  ? 340 PHE C CD2 2  
ATOM 10956  C CE1 . PHE A 1 336 ? -76.804  3.355   39.954  1.00 99.99  ? 340 PHE C CE1 2  
ATOM 10957  C CE2 . PHE A 1 336 ? -78.869  2.937   38.753  1.00 99.99  ? 340 PHE C CE2 2  
ATOM 10958  C CZ  . PHE A 1 336 ? -77.556  2.570   39.071  1.00 99.99  ? 340 PHE C CZ  2  
ATOM 10959  N N   . THR A 1 337 ? -79.638  7.415   44.014  1.00 30.00  ? 341 THR C N   2  
ATOM 10960  C CA  . THR A 1 337 ? -80.068  8.647   44.669  1.00 30.00  ? 341 THR C CA  2  
ATOM 10961  C C   . THR A 1 337 ? -79.870  9.775   43.661  1.00 30.00  ? 341 THR C C   2  
ATOM 10962  O O   . THR A 1 337 ? -79.062  9.649   42.740  1.00 30.00  ? 341 THR C O   2  
ATOM 10963  C CB  . THR A 1 337 ? -79.228  8.889   45.918  1.00 99.99  ? 341 THR C CB  2  
ATOM 10964  O OG1 . THR A 1 337 ? -77.881  9.190   45.535  1.00 99.99  ? 341 THR C OG1 2  
ATOM 10965  C CG2 . THR A 1 337 ? -79.239  7.638   46.789  1.00 99.99  ? 341 THR C CG2 2  
ATOM 10966  N N   . LYS A 1 338 ? -80.613  10.862  43.819  1.00 30.00  ? 342 LYS C N   2  
ATOM 10967  C CA  . LYS A 1 338 ? -80.524  11.998  42.906  1.00 30.00  ? 342 LYS C CA  2  
ATOM 10968  C C   . LYS A 1 338 ? -79.122  12.599  42.862  1.00 30.00  ? 342 LYS C C   2  
ATOM 10969  O O   . LYS A 1 338 ? -78.704  13.154  41.844  1.00 30.00  ? 342 LYS C O   2  
ATOM 10970  C CB  . LYS A 1 338 ? -81.487  13.094  43.346  1.00 99.99  ? 342 LYS C CB  2  
ATOM 10971  C CG  . LYS A 1 338 ? -82.914  12.565  43.310  1.00 99.99  ? 342 LYS C CG  2  
ATOM 10972  C CD  . LYS A 1 338 ? -83.416  12.545  41.871  1.00 99.99  ? 342 LYS C CD  2  
ATOM 10973  C CE  . LYS A 1 338 ? -84.897  12.179  41.851  1.00 99.99  ? 342 LYS C CE  2  
ATOM 10974  N NZ  . LYS A 1 338 ? -85.316  11.904  40.471  1.00 99.99  ? 342 LYS C NZ  2  
ATOM 10975  N N   . GLU A 1 339 ? -78.392  12.496  43.959  1.00 30.00  ? 343 GLU C N   2  
ATOM 10976  C CA  . GLU A 1 339 ? -77.052  13.050  43.985  1.00 30.00  ? 343 GLU C CA  2  
ATOM 10977  C C   . GLU A 1 339 ? -76.191  12.132  43.132  1.00 30.00  ? 343 GLU C C   2  
ATOM 10978  O O   . GLU A 1 339 ? -75.498  12.585  42.225  1.00 30.00  ? 343 GLU C O   2  
ATOM 10979  C CB  . GLU A 1 339 ? -76.537  13.097  45.421  1.00 99.99  ? 343 GLU C CB  2  
ATOM 10980  C CG  . GLU A 1 339 ? -77.380  14.055  46.227  1.00 99.99  ? 343 GLU C CG  2  
ATOM 10981  C CD  . GLU A 1 339 ? -77.067  15.488  45.805  1.00 99.99  ? 343 GLU C CD  2  
ATOM 10982  O OE1 . GLU A 1 339 ? -77.752  15.976  44.867  1.00 99.99  ? 343 GLU C OE1 2  
ATOM 10983  O OE2 . GLU A 1 339 ? -76.144  16.082  46.424  1.00 99.99  ? 343 GLU C OE2 2  
ATOM 10984  N N   . GLU A 1 340 ? -76.253  10.840  43.435  1.00 30.00  ? 344 GLU C N   2  
ATOM 10985  C CA  . GLU A 1 340 ? -75.502  9.813   42.716  1.00 30.00  ? 344 GLU C CA  2  
ATOM 10986  C C   . GLU A 1 340 ? -75.580  9.987   41.199  1.00 30.00  ? 344 GLU C C   2  
ATOM 10987  O O   . GLU A 1 340 ? -74.567  10.063  40.503  1.00 30.00  ? 344 GLU C O   2  
ATOM 10988  C CB  . GLU A 1 340 ? -76.058  8.433   43.055  1.00 99.99  ? 344 GLU C CB  2  
ATOM 10989  C CG  . GLU A 1 340 ? -75.828  8.143   44.518  1.00 99.99  ? 344 GLU C CG  2  
ATOM 10990  C CD  . GLU A 1 340 ? -74.342  7.880   44.758  1.00 99.99  ? 344 GLU C CD  2  
ATOM 10991  O OE1 . GLU A 1 340 ? -73.620  8.871   45.039  1.00 99.99  ? 344 GLU C OE1 2  
ATOM 10992  O OE2 . GLU A 1 340 ? -73.945  6.687   44.657  1.00 99.99  ? 344 GLU C OE2 2  
ATOM 10993  N N   . LYS A 1 341 ? -76.806  10.053  40.696  1.00 30.00  ? 345 LYS C N   2  
ATOM 10994  C CA  . LYS A 1 341 ? -77.038  10.197  39.283  1.00 30.00  ? 345 LYS C CA  2  
ATOM 10995  C C   . LYS A 1 341 ? -76.763  11.566  38.726  1.00 30.00  ? 345 LYS C C   2  
ATOM 10996  O O   . LYS A 1 341 ? -76.894  11.791  37.525  1.00 30.00  ? 345 LYS C O   2  
ATOM 10997  C CB  . LYS A 1 341 ? -78.498  9.888   38.964  1.00 99.99  ? 345 LYS C CB  2  
ATOM 10998  C CG  . LYS A 1 341 ? -78.715  9.944   37.456  1.00 99.99  ? 345 LYS C CG  2  
ATOM 10999  C CD  . LYS A 1 341 ? -80.008  9.220   37.100  1.00 99.99  ? 345 LYS C CD  2  
ATOM 11000  C CE  . LYS A 1 341 ? -80.418  9.584   35.676  1.00 99.99  ? 345 LYS C CE  2  
ATOM 11001  N NZ  . LYS A 1 341 ? -79.897  8.577   34.741  1.00 99.99  ? 345 LYS C NZ  2  
ATOM 11002  N N   . GLN A 1 342 ? -76.393  12.496  39.591  1.00 30.00  ? 346 GLN C N   2  
ATOM 11003  C CA  . GLN A 1 342 ? -76.089  13.844  39.144  1.00 30.00  ? 346 GLN C CA  2  
ATOM 11004  C C   . GLN A 1 342 ? -74.572  13.958  39.206  1.00 30.00  ? 346 GLN C C   2  
ATOM 11005  O O   . GLN A 1 342 ? -73.976  14.838  38.599  1.00 30.00  ? 346 GLN C O   2  
ATOM 11006  C CB  . GLN A 1 342 ? -76.763  14.858  40.063  1.00 99.99  ? 346 GLN C CB  2  
ATOM 11007  C CG  . GLN A 1 342 ? -78.277  14.729  39.942  1.00 99.99  ? 346 GLN C CG  2  
ATOM 11008  C CD  . GLN A 1 342 ? -78.770  15.269  38.606  1.00 99.99  ? 346 GLN C CD  2  
ATOM 11009  O OE1 . GLN A 1 342 ? -77.976  15.729  37.789  1.00 99.99  ? 346 GLN C OE1 2  
ATOM 11010  N NE2 . GLN A 1 342 ? -80.084  15.206  38.387  1.00 99.99  ? 346 GLN C NE2 2  
ATOM 11011  N N   . SER A 1 343 ? -73.966  13.047  39.969  1.00 30.00  ? 347 SER C N   2  
ATOM 11012  C CA  . SER A 1 343 ? -72.521  12.961  40.143  1.00 30.00  ? 347 SER C CA  2  
ATOM 11013  C C   . SER A 1 343 ? -72.023  12.412  38.802  1.00 30.00  ? 347 SER C C   2  
ATOM 11014  O O   . SER A 1 343 ? -71.032  12.891  38.240  1.00 30.00  ? 347 SER C O   2  
ATOM 11015  C CB  . SER A 1 343 ? -72.194  12.030  41.303  1.00 99.99  ? 347 SER C CB  2  
ATOM 11016  O OG  . SER A 1 343 ? -72.802  12.523  42.498  1.00 99.99  ? 347 SER C OG  2  
ATOM 11017  N N   . MET A 1 344 ? -72.730  11.393  38.313  1.00 30.00  ? 348 MET C N   2  
ATOM 11018  C CA  . MET A 1 344 ? -72.416  10.759  37.039  1.00 30.00  ? 348 MET C CA  2  
ATOM 11019  C C   . MET A 1 344 ? -72.432  11.858  35.992  1.00 30.00  ? 348 MET C C   2  
ATOM 11020  O O   . MET A 1 344 ? -71.395  12.266  35.484  1.00 30.00  ? 348 MET C O   2  
ATOM 11021  C CB  . MET A 1 344 ? -73.458  9.696   36.716  1.00 99.99  ? 348 MET C CB  2  
ATOM 11022  C CG  . MET A 1 344 ? -73.637  8.778   37.920  1.00 99.99  ? 348 MET C CG  2  
ATOM 11023  S SD  . MET A 1 344 ? -72.305  7.558   37.975  1.00 99.99  ? 348 MET C SD  2  
ATOM 11024  C CE  . MET A 1 344 ? -72.840  6.454   36.684  1.00 99.99  ? 348 MET C CE  2  
ATOM 11025  N N   . PHE A 1 345 ? -73.627  12.337  35.685  1.00 30.00  ? 349 PHE C N   2  
ATOM 11026  C CA  . PHE A 1 345 ? -73.846  13.380  34.697  1.00 30.00  ? 349 PHE C CA  2  
ATOM 11027  C C   . PHE A 1 345 ? -72.884  14.560  34.720  1.00 30.00  ? 349 PHE C C   2  
ATOM 11028  O O   . PHE A 1 345 ? -72.600  15.165  33.688  1.00 30.00  ? 349 PHE C O   2  
ATOM 11029  C CB  . PHE A 1 345 ? -75.235  13.982  34.878  1.00 99.99  ? 349 PHE C CB  2  
ATOM 11030  C CG  . PHE A 1 345 ? -76.276  13.006  34.388  1.00 99.99  ? 349 PHE C CG  2  
ATOM 11031  C CD1 . PHE A 1 345 ? -76.505  12.862  33.014  1.00 99.99  ? 349 PHE C CD1 2  
ATOM 11032  C CD2 . PHE A 1 345 ? -77.013  12.247  35.305  1.00 99.99  ? 349 PHE C CD2 2  
ATOM 11033  C CE1 . PHE A 1 3