data_2W4V
# 
_entry.id   2W4V 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2W4V         
PDBE  EBI-37782    
WWPDB D_1290037782 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB  2W4T     unspecified            'ISOMETRICALLY CONTRACTING INSECT ASYNCHRONOUS FLIGHT MUSCLE' 
PDB  1SR6     unspecified            'STRUCTURE OF NUCLEOTIDE-FREE SCALLOP MYOSIN S1' 
PDB  1S5G     unspecified            'STRUCTURE OF SCALLOP MYOSIN S1 REVEALS A NOVEL NUCLEOTIDECONFORMATION' 
PDB  1KQM     unspecified            'SCALLOP MYOSIN S1-AMPPNP IN THE ACTIN- DETACHED CONFORMATION' 
PDB  1QVI     unspecified            
'CRYSTAL STRUCTURE OF SCALLOP MYOSIN S1 IN THE PRE-POWERSTROKE STATE TO 2.6 ANGSTROM RESOLUTION: FLEXIBILITY ANDFUNCTION IN THE HEAD' 
PDB  1KWO     unspecified            'SCALLOP MYOSIN S1-ATPGAMMAS-P-PDM IN THE ACTIN-DETACHEDCONFORMATION' 
PDB  1DFL     unspecified            'SCALLOP MYOSIN S1 COMPLEXED WITH MGADP: VANADATE-TRANSITION STATE' 
PDB  1SCM     unspecified            'MYOSIN (REGULATORY DOMAIN)' 
PDB  1B7T     unspecified            'MYOSIN DIGESTED BY PAPAIN' 
PDB  1WDC     unspecified            'SCALLOP MYOSIN REGULATORY DOMAIN' 
PDB  1L2O     unspecified            'SCALLOP MYOSIN S1-ADP-P-PDM IN THE ACTIN -DETACHEDCONFORMATION' 
PDB  1KK7     unspecified            'SCALLOP MYOSIN IN THE NEAR RIGOR CONFORMATION' 
PDB  1DFK     unspecified            'NUCLEOTIDE-FREE SCALLOP MYOSIN S1-NEAR RIGOR STATE' 
PDB  1KK8     unspecified            'SCALLOP MYOSIN (S1-ADP-BEFX) IN THE ACTIN -DETACHEDCONFORMATION' 
EMDB EMD-1584 'associated EM volume' 
'ELECTRON TOMOGRAPHY OF ISOMETRICALLY CONTRACTING INSECT FLIGHT MUSCLE QUICK FROZEN AFTER A QUICK RELEASE STEP' 
EMDB EMD-1585 'other EM volume'      
'ELECTRON TOMOGRAPHY OF ISOMETRICALLY CONTRACTING INSECT FLIGHT MUSCLE QUICK FROZEN AFTER A RAPID STRETCH TRANSIENT' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2W4V 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2008-12-02 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wu, S.'                 1  
'Liu, J.'                2  
'Reedy, M.C.'            3  
'Tregear, R.T.'          4  
'Winkler, H.'            5  
'Franzini-Armstrong, C.' 6  
'Sasaki, H.'             7  
'Lucaveche, C.'          8  
'Goldman, Y.E.'          9  
'Reedy, M.K.'            10 
'Taylor, K.A.'           11 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural Changes in Isometrically Contracting Insect Flight Muscle Trapped Following a Mechanical Perturbation.' 
'Plos One'         7   39422 ?   2012 ?      US 1932-6203 ?    ? 22761792 10.1371/JOURNAL.PONE.0039422 
1       
'Methods for identifying and averaging variable molecular conformations in tomograms of actively contracting insect flight muscle.' 
'J. Struct. Biol.' 168 485   502 2009 JSBIEM US 1095-8657 0803 ? 19698791 10.1016/j.jsb.2009.08.007    
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wu, S.'                 1  ? 
primary 'Liu, J.'                2  ? 
primary 'Reedy, M.C.'            3  ? 
primary 'Perz-Edwards, R.J.'     4  ? 
primary 'Tregear, R.T.'          5  ? 
primary 'Winkler, H.'            6  ? 
primary 'Franzini-Armstrong, C.' 7  ? 
primary 'Sasaki, H.'             8  ? 
primary 'Lucaveche, C.'          9  ? 
primary 'Goldman, Y.E.'          10 ? 
primary 'Reedy, M.K.'            11 ? 
primary 'Taylor, K.A.'           12 ? 
1       'Wu, S.'                 13 ? 
1       'Liu, J.'                14 ? 
1       'Reedy, M.C.'            15 ? 
1       'Winkler, H.'            16 ? 
1       'Reedy, M.K.'            17 ? 
1       'Taylor, K.A.'           18 ? 
# 
_cell.entry_id           2W4V 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2W4V 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat 'MYOSIN HEAVY CHAIN, STRIATED MUSCLE'                     94843.883 1 ? ? 'RESIDUES 5-835'  'MYOSIN S1 HEAVY CHAIN' 
2 polymer nat 'MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE' 15575.700 1 ? ? 'RESIDUES 16-151' 
'MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE' 
3 polymer nat 'MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE'  17051.912 1 ? ? 'RESIDUES 5-155'  
'MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE'  
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'MYOSIN S1'       
2 'MYOSIN S1, R-LC' 
3 'MYOSIN S1, E-LC' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;FSDPDFQYLAVDRKKLMKEQTAAFDGKKNCWVPDEKEGFASAEIQSSKGDEITVKIVADSSTRTVKKDDIQSMNPPKFEK
LEDMANMTYLNEASVLYNLRSRYTSGLIYTYSGLFCIAVNPYRRLPIYTDSVIAKYRGKRKTEIPPHLFSVADNAYQNMV
TDRENQSCLITGESGAGKTENTKKVIMYLAKVACAVKKKDEEASDKKEGSLEDQIIQANPVLEAYGNAKTTRNNNSSRFG
KFIRIHFGPTGKIAGADIETYLLEKSRVTYQQSAERNYHIFYQICSNAIPELNDVMLVTPDSGLYSFINQGCLTVDNIDD
VEEFKLCDEAFDILGFTKEEKQSMFKCTASILHMGEMKFKQRPREEQAESDGTAEAEKVAFLCGINAGDLLKALLKPKVK
VGTEMVTKGQNMNQVVNSVGALAKSLYDRMFNWLVRRVNKTLDTKAKRNYYIGVLDIAGFEIFDFNSFEQLCINYTNERL
QQFFNHHMFILEQEEYKKEGIAWEFIDFGMDLQMCIDLIEKPMGILSILEEECMFPKADDKSFQDKLYQNHMGKNRMFTK
PGKPTRPNQGPAHFELHHYAGNVPYSITGWLEKNKDPINENVVALLGASKEPLVAELFKAPEEPAGGGKKKKGKSSAFQT
ISAVHRESLNKLMKNLYSTHPHFVRCIIPNELKQPGLVDAELVLHQLQCNGVLEGIRICRKGFPSRLIYSEFKQRYSILA
PNAIPQGFVDGKTVSEKILAGLQMDPAEYRLGTTKVFFKAGVLGNLEEMRDERLSKIISMFQAHIRGYLIRKAYKKLQDQ
RIGLSVIQRNIRKWLVLRNWQWWKLYSKVKP
;
;FSDPDFQYLAVDRKKLMKEQTAAFDGKKNCWVPDEKEGFASAEIQSSKGDEITVKIVADSSTRTVKKDDIQSMNPPKFEK
LEDMANMTYLNEASVLYNLRSRYTSGLIYTYSGLFCIAVNPYRRLPIYTDSVIAKYRGKRKTEIPPHLFSVADNAYQNMV
TDRENQSCLITGESGAGKTENTKKVIMYLAKVACAVKKKDEEASDKKEGSLEDQIIQANPVLEAYGNAKTTRNNNSSRFG
KFIRIHFGPTGKIAGADIETYLLEKSRVTYQQSAERNYHIFYQICSNAIPELNDVMLVTPDSGLYSFINQGCLTVDNIDD
VEEFKLCDEAFDILGFTKEEKQSMFKCTASILHMGEMKFKQRPREEQAESDGTAEAEKVAFLCGINAGDLLKALLKPKVK
VGTEMVTKGQNMNQVVNSVGALAKSLYDRMFNWLVRRVNKTLDTKAKRNYYIGVLDIAGFEIFDFNSFEQLCINYTNERL
QQFFNHHMFILEQEEYKKEGIAWEFIDFGMDLQMCIDLIEKPMGILSILEEECMFPKADDKSFQDKLYQNHMGKNRMFTK
PGKPTRPNQGPAHFELHHYAGNVPYSITGWLEKNKDPINENVVALLGASKEPLVAELFKAPEEPAGGGKKKKGKSSAFQT
ISAVHRESLNKLMKNLYSTHPHFVRCIIPNELKQPGLVDAELVLHQLQCNGVLEGIRICRKGFPSRLIYSEFKQRYSILA
PNAIPQGFVDGKTVSEKILAGLQMDPAEYRLGTTKVFFKAGVLGNLEEMRDERLSKIISMFQAHIRGYLIRKAYKKLQDQ
RIGLSVIQRNIRKWLVLRNWQWWKLYSKVKP
;
C ? 
2 'polypeptide(L)' no no 
;KQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFA
MFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKG
;
;KQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFA
MFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKG
;
Y ? 
3 'polypeptide(L)' no no 
;SQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTF
ADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYP
;
;SQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTF
ADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYP
;
Z ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PHE n 
1 2   SER n 
1 3   ASP n 
1 4   PRO n 
1 5   ASP n 
1 6   PHE n 
1 7   GLN n 
1 8   TYR n 
1 9   LEU n 
1 10  ALA n 
1 11  VAL n 
1 12  ASP n 
1 13  ARG n 
1 14  LYS n 
1 15  LYS n 
1 16  LEU n 
1 17  MET n 
1 18  LYS n 
1 19  GLU n 
1 20  GLN n 
1 21  THR n 
1 22  ALA n 
1 23  ALA n 
1 24  PHE n 
1 25  ASP n 
1 26  GLY n 
1 27  LYS n 
1 28  LYS n 
1 29  ASN n 
1 30  CYS n 
1 31  TRP n 
1 32  VAL n 
1 33  PRO n 
1 34  ASP n 
1 35  GLU n 
1 36  LYS n 
1 37  GLU n 
1 38  GLY n 
1 39  PHE n 
1 40  ALA n 
1 41  SER n 
1 42  ALA n 
1 43  GLU n 
1 44  ILE n 
1 45  GLN n 
1 46  SER n 
1 47  SER n 
1 48  LYS n 
1 49  GLY n 
1 50  ASP n 
1 51  GLU n 
1 52  ILE n 
1 53  THR n 
1 54  VAL n 
1 55  LYS n 
1 56  ILE n 
1 57  VAL n 
1 58  ALA n 
1 59  ASP n 
1 60  SER n 
1 61  SER n 
1 62  THR n 
1 63  ARG n 
1 64  THR n 
1 65  VAL n 
1 66  LYS n 
1 67  LYS n 
1 68  ASP n 
1 69  ASP n 
1 70  ILE n 
1 71  GLN n 
1 72  SER n 
1 73  MET n 
1 74  ASN n 
1 75  PRO n 
1 76  PRO n 
1 77  LYS n 
1 78  PHE n 
1 79  GLU n 
1 80  LYS n 
1 81  LEU n 
1 82  GLU n 
1 83  ASP n 
1 84  MET n 
1 85  ALA n 
1 86  ASN n 
1 87  MET n 
1 88  THR n 
1 89  TYR n 
1 90  LEU n 
1 91  ASN n 
1 92  GLU n 
1 93  ALA n 
1 94  SER n 
1 95  VAL n 
1 96  LEU n 
1 97  TYR n 
1 98  ASN n 
1 99  LEU n 
1 100 ARG n 
1 101 SER n 
1 102 ARG n 
1 103 TYR n 
1 104 THR n 
1 105 SER n 
1 106 GLY n 
1 107 LEU n 
1 108 ILE n 
1 109 TYR n 
1 110 THR n 
1 111 TYR n 
1 112 SER n 
1 113 GLY n 
1 114 LEU n 
1 115 PHE n 
1 116 CYS n 
1 117 ILE n 
1 118 ALA n 
1 119 VAL n 
1 120 ASN n 
1 121 PRO n 
1 122 TYR n 
1 123 ARG n 
1 124 ARG n 
1 125 LEU n 
1 126 PRO n 
1 127 ILE n 
1 128 TYR n 
1 129 THR n 
1 130 ASP n 
1 131 SER n 
1 132 VAL n 
1 133 ILE n 
1 134 ALA n 
1 135 LYS n 
1 136 TYR n 
1 137 ARG n 
1 138 GLY n 
1 139 LYS n 
1 140 ARG n 
1 141 LYS n 
1 142 THR n 
1 143 GLU n 
1 144 ILE n 
1 145 PRO n 
1 146 PRO n 
1 147 HIS n 
1 148 LEU n 
1 149 PHE n 
1 150 SER n 
1 151 VAL n 
1 152 ALA n 
1 153 ASP n 
1 154 ASN n 
1 155 ALA n 
1 156 TYR n 
1 157 GLN n 
1 158 ASN n 
1 159 MET n 
1 160 VAL n 
1 161 THR n 
1 162 ASP n 
1 163 ARG n 
1 164 GLU n 
1 165 ASN n 
1 166 GLN n 
1 167 SER n 
1 168 CYS n 
1 169 LEU n 
1 170 ILE n 
1 171 THR n 
1 172 GLY n 
1 173 GLU n 
1 174 SER n 
1 175 GLY n 
1 176 ALA n 
1 177 GLY n 
1 178 LYS n 
1 179 THR n 
1 180 GLU n 
1 181 ASN n 
1 182 THR n 
1 183 LYS n 
1 184 LYS n 
1 185 VAL n 
1 186 ILE n 
1 187 MET n 
1 188 TYR n 
1 189 LEU n 
1 190 ALA n 
1 191 LYS n 
1 192 VAL n 
1 193 ALA n 
1 194 CYS n 
1 195 ALA n 
1 196 VAL n 
1 197 LYS n 
1 198 LYS n 
1 199 LYS n 
1 200 ASP n 
1 201 GLU n 
1 202 GLU n 
1 203 ALA n 
1 204 SER n 
1 205 ASP n 
1 206 LYS n 
1 207 LYS n 
1 208 GLU n 
1 209 GLY n 
1 210 SER n 
1 211 LEU n 
1 212 GLU n 
1 213 ASP n 
1 214 GLN n 
1 215 ILE n 
1 216 ILE n 
1 217 GLN n 
1 218 ALA n 
1 219 ASN n 
1 220 PRO n 
1 221 VAL n 
1 222 LEU n 
1 223 GLU n 
1 224 ALA n 
1 225 TYR n 
1 226 GLY n 
1 227 ASN n 
1 228 ALA n 
1 229 LYS n 
1 230 THR n 
1 231 THR n 
1 232 ARG n 
1 233 ASN n 
1 234 ASN n 
1 235 ASN n 
1 236 SER n 
1 237 SER n 
1 238 ARG n 
1 239 PHE n 
1 240 GLY n 
1 241 LYS n 
1 242 PHE n 
1 243 ILE n 
1 244 ARG n 
1 245 ILE n 
1 246 HIS n 
1 247 PHE n 
1 248 GLY n 
1 249 PRO n 
1 250 THR n 
1 251 GLY n 
1 252 LYS n 
1 253 ILE n 
1 254 ALA n 
1 255 GLY n 
1 256 ALA n 
1 257 ASP n 
1 258 ILE n 
1 259 GLU n 
1 260 THR n 
1 261 TYR n 
1 262 LEU n 
1 263 LEU n 
1 264 GLU n 
1 265 LYS n 
1 266 SER n 
1 267 ARG n 
1 268 VAL n 
1 269 THR n 
1 270 TYR n 
1 271 GLN n 
1 272 GLN n 
1 273 SER n 
1 274 ALA n 
1 275 GLU n 
1 276 ARG n 
1 277 ASN n 
1 278 TYR n 
1 279 HIS n 
1 280 ILE n 
1 281 PHE n 
1 282 TYR n 
1 283 GLN n 
1 284 ILE n 
1 285 CYS n 
1 286 SER n 
1 287 ASN n 
1 288 ALA n 
1 289 ILE n 
1 290 PRO n 
1 291 GLU n 
1 292 LEU n 
1 293 ASN n 
1 294 ASP n 
1 295 VAL n 
1 296 MET n 
1 297 LEU n 
1 298 VAL n 
1 299 THR n 
1 300 PRO n 
1 301 ASP n 
1 302 SER n 
1 303 GLY n 
1 304 LEU n 
1 305 TYR n 
1 306 SER n 
1 307 PHE n 
1 308 ILE n 
1 309 ASN n 
1 310 GLN n 
1 311 GLY n 
1 312 CYS n 
1 313 LEU n 
1 314 THR n 
1 315 VAL n 
1 316 ASP n 
1 317 ASN n 
1 318 ILE n 
1 319 ASP n 
1 320 ASP n 
1 321 VAL n 
1 322 GLU n 
1 323 GLU n 
1 324 PHE n 
1 325 LYS n 
1 326 LEU n 
1 327 CYS n 
1 328 ASP n 
1 329 GLU n 
1 330 ALA n 
1 331 PHE n 
1 332 ASP n 
1 333 ILE n 
1 334 LEU n 
1 335 GLY n 
1 336 PHE n 
1 337 THR n 
1 338 LYS n 
1 339 GLU n 
1 340 GLU n 
1 341 LYS n 
1 342 GLN n 
1 343 SER n 
1 344 MET n 
1 345 PHE n 
1 346 LYS n 
1 347 CYS n 
1 348 THR n 
1 349 ALA n 
1 350 SER n 
1 351 ILE n 
1 352 LEU n 
1 353 HIS n 
1 354 MET n 
1 355 GLY n 
1 356 GLU n 
1 357 MET n 
1 358 LYS n 
1 359 PHE n 
1 360 LYS n 
1 361 GLN n 
1 362 ARG n 
1 363 PRO n 
1 364 ARG n 
1 365 GLU n 
1 366 GLU n 
1 367 GLN n 
1 368 ALA n 
1 369 GLU n 
1 370 SER n 
1 371 ASP n 
1 372 GLY n 
1 373 THR n 
1 374 ALA n 
1 375 GLU n 
1 376 ALA n 
1 377 GLU n 
1 378 LYS n 
1 379 VAL n 
1 380 ALA n 
1 381 PHE n 
1 382 LEU n 
1 383 CYS n 
1 384 GLY n 
1 385 ILE n 
1 386 ASN n 
1 387 ALA n 
1 388 GLY n 
1 389 ASP n 
1 390 LEU n 
1 391 LEU n 
1 392 LYS n 
1 393 ALA n 
1 394 LEU n 
1 395 LEU n 
1 396 LYS n 
1 397 PRO n 
1 398 LYS n 
1 399 VAL n 
1 400 LYS n 
1 401 VAL n 
1 402 GLY n 
1 403 THR n 
1 404 GLU n 
1 405 MET n 
1 406 VAL n 
1 407 THR n 
1 408 LYS n 
1 409 GLY n 
1 410 GLN n 
1 411 ASN n 
1 412 MET n 
1 413 ASN n 
1 414 GLN n 
1 415 VAL n 
1 416 VAL n 
1 417 ASN n 
1 418 SER n 
1 419 VAL n 
1 420 GLY n 
1 421 ALA n 
1 422 LEU n 
1 423 ALA n 
1 424 LYS n 
1 425 SER n 
1 426 LEU n 
1 427 TYR n 
1 428 ASP n 
1 429 ARG n 
1 430 MET n 
1 431 PHE n 
1 432 ASN n 
1 433 TRP n 
1 434 LEU n 
1 435 VAL n 
1 436 ARG n 
1 437 ARG n 
1 438 VAL n 
1 439 ASN n 
1 440 LYS n 
1 441 THR n 
1 442 LEU n 
1 443 ASP n 
1 444 THR n 
1 445 LYS n 
1 446 ALA n 
1 447 LYS n 
1 448 ARG n 
1 449 ASN n 
1 450 TYR n 
1 451 TYR n 
1 452 ILE n 
1 453 GLY n 
1 454 VAL n 
1 455 LEU n 
1 456 ASP n 
1 457 ILE n 
1 458 ALA n 
1 459 GLY n 
1 460 PHE n 
1 461 GLU n 
1 462 ILE n 
1 463 PHE n 
1 464 ASP n 
1 465 PHE n 
1 466 ASN n 
1 467 SER n 
1 468 PHE n 
1 469 GLU n 
1 470 GLN n 
1 471 LEU n 
1 472 CYS n 
1 473 ILE n 
1 474 ASN n 
1 475 TYR n 
1 476 THR n 
1 477 ASN n 
1 478 GLU n 
1 479 ARG n 
1 480 LEU n 
1 481 GLN n 
1 482 GLN n 
1 483 PHE n 
1 484 PHE n 
1 485 ASN n 
1 486 HIS n 
1 487 HIS n 
1 488 MET n 
1 489 PHE n 
1 490 ILE n 
1 491 LEU n 
1 492 GLU n 
1 493 GLN n 
1 494 GLU n 
1 495 GLU n 
1 496 TYR n 
1 497 LYS n 
1 498 LYS n 
1 499 GLU n 
1 500 GLY n 
1 501 ILE n 
1 502 ALA n 
1 503 TRP n 
1 504 GLU n 
1 505 PHE n 
1 506 ILE n 
1 507 ASP n 
1 508 PHE n 
1 509 GLY n 
1 510 MET n 
1 511 ASP n 
1 512 LEU n 
1 513 GLN n 
1 514 MET n 
1 515 CYS n 
1 516 ILE n 
1 517 ASP n 
1 518 LEU n 
1 519 ILE n 
1 520 GLU n 
1 521 LYS n 
1 522 PRO n 
1 523 MET n 
1 524 GLY n 
1 525 ILE n 
1 526 LEU n 
1 527 SER n 
1 528 ILE n 
1 529 LEU n 
1 530 GLU n 
1 531 GLU n 
1 532 GLU n 
1 533 CYS n 
1 534 MET n 
1 535 PHE n 
1 536 PRO n 
1 537 LYS n 
1 538 ALA n 
1 539 ASP n 
1 540 ASP n 
1 541 LYS n 
1 542 SER n 
1 543 PHE n 
1 544 GLN n 
1 545 ASP n 
1 546 LYS n 
1 547 LEU n 
1 548 TYR n 
1 549 GLN n 
1 550 ASN n 
1 551 HIS n 
1 552 MET n 
1 553 GLY n 
1 554 LYS n 
1 555 ASN n 
1 556 ARG n 
1 557 MET n 
1 558 PHE n 
1 559 THR n 
1 560 LYS n 
1 561 PRO n 
1 562 GLY n 
1 563 LYS n 
1 564 PRO n 
1 565 THR n 
1 566 ARG n 
1 567 PRO n 
1 568 ASN n 
1 569 GLN n 
1 570 GLY n 
1 571 PRO n 
1 572 ALA n 
1 573 HIS n 
1 574 PHE n 
1 575 GLU n 
1 576 LEU n 
1 577 HIS n 
1 578 HIS n 
1 579 TYR n 
1 580 ALA n 
1 581 GLY n 
1 582 ASN n 
1 583 VAL n 
1 584 PRO n 
1 585 TYR n 
1 586 SER n 
1 587 ILE n 
1 588 THR n 
1 589 GLY n 
1 590 TRP n 
1 591 LEU n 
1 592 GLU n 
1 593 LYS n 
1 594 ASN n 
1 595 LYS n 
1 596 ASP n 
1 597 PRO n 
1 598 ILE n 
1 599 ASN n 
1 600 GLU n 
1 601 ASN n 
1 602 VAL n 
1 603 VAL n 
1 604 ALA n 
1 605 LEU n 
1 606 LEU n 
1 607 GLY n 
1 608 ALA n 
1 609 SER n 
1 610 LYS n 
1 611 GLU n 
1 612 PRO n 
1 613 LEU n 
1 614 VAL n 
1 615 ALA n 
1 616 GLU n 
1 617 LEU n 
1 618 PHE n 
1 619 LYS n 
1 620 ALA n 
1 621 PRO n 
1 622 GLU n 
1 623 GLU n 
1 624 PRO n 
1 625 ALA n 
1 626 GLY n 
1 627 GLY n 
1 628 GLY n 
1 629 LYS n 
1 630 LYS n 
1 631 LYS n 
1 632 LYS n 
1 633 GLY n 
1 634 LYS n 
1 635 SER n 
1 636 SER n 
1 637 ALA n 
1 638 PHE n 
1 639 GLN n 
1 640 THR n 
1 641 ILE n 
1 642 SER n 
1 643 ALA n 
1 644 VAL n 
1 645 HIS n 
1 646 ARG n 
1 647 GLU n 
1 648 SER n 
1 649 LEU n 
1 650 ASN n 
1 651 LYS n 
1 652 LEU n 
1 653 MET n 
1 654 LYS n 
1 655 ASN n 
1 656 LEU n 
1 657 TYR n 
1 658 SER n 
1 659 THR n 
1 660 HIS n 
1 661 PRO n 
1 662 HIS n 
1 663 PHE n 
1 664 VAL n 
1 665 ARG n 
1 666 CYS n 
1 667 ILE n 
1 668 ILE n 
1 669 PRO n 
1 670 ASN n 
1 671 GLU n 
1 672 LEU n 
1 673 LYS n 
1 674 GLN n 
1 675 PRO n 
1 676 GLY n 
1 677 LEU n 
1 678 VAL n 
1 679 ASP n 
1 680 ALA n 
1 681 GLU n 
1 682 LEU n 
1 683 VAL n 
1 684 LEU n 
1 685 HIS n 
1 686 GLN n 
1 687 LEU n 
1 688 GLN n 
1 689 CYS n 
1 690 ASN n 
1 691 GLY n 
1 692 VAL n 
1 693 LEU n 
1 694 GLU n 
1 695 GLY n 
1 696 ILE n 
1 697 ARG n 
1 698 ILE n 
1 699 CYS n 
1 700 ARG n 
1 701 LYS n 
1 702 GLY n 
1 703 PHE n 
1 704 PRO n 
1 705 SER n 
1 706 ARG n 
1 707 LEU n 
1 708 ILE n 
1 709 TYR n 
1 710 SER n 
1 711 GLU n 
1 712 PHE n 
1 713 LYS n 
1 714 GLN n 
1 715 ARG n 
1 716 TYR n 
1 717 SER n 
1 718 ILE n 
1 719 LEU n 
1 720 ALA n 
1 721 PRO n 
1 722 ASN n 
1 723 ALA n 
1 724 ILE n 
1 725 PRO n 
1 726 GLN n 
1 727 GLY n 
1 728 PHE n 
1 729 VAL n 
1 730 ASP n 
1 731 GLY n 
1 732 LYS n 
1 733 THR n 
1 734 VAL n 
1 735 SER n 
1 736 GLU n 
1 737 LYS n 
1 738 ILE n 
1 739 LEU n 
1 740 ALA n 
1 741 GLY n 
1 742 LEU n 
1 743 GLN n 
1 744 MET n 
1 745 ASP n 
1 746 PRO n 
1 747 ALA n 
1 748 GLU n 
1 749 TYR n 
1 750 ARG n 
1 751 LEU n 
1 752 GLY n 
1 753 THR n 
1 754 THR n 
1 755 LYS n 
1 756 VAL n 
1 757 PHE n 
1 758 PHE n 
1 759 LYS n 
1 760 ALA n 
1 761 GLY n 
1 762 VAL n 
1 763 LEU n 
1 764 GLY n 
1 765 ASN n 
1 766 LEU n 
1 767 GLU n 
1 768 GLU n 
1 769 MET n 
1 770 ARG n 
1 771 ASP n 
1 772 GLU n 
1 773 ARG n 
1 774 LEU n 
1 775 SER n 
1 776 LYS n 
1 777 ILE n 
1 778 ILE n 
1 779 SER n 
1 780 MET n 
1 781 PHE n 
1 782 GLN n 
1 783 ALA n 
1 784 HIS n 
1 785 ILE n 
1 786 ARG n 
1 787 GLY n 
1 788 TYR n 
1 789 LEU n 
1 790 ILE n 
1 791 ARG n 
1 792 LYS n 
1 793 ALA n 
1 794 TYR n 
1 795 LYS n 
1 796 LYS n 
1 797 LEU n 
1 798 GLN n 
1 799 ASP n 
1 800 GLN n 
1 801 ARG n 
1 802 ILE n 
1 803 GLY n 
1 804 LEU n 
1 805 SER n 
1 806 VAL n 
1 807 ILE n 
1 808 GLN n 
1 809 ARG n 
1 810 ASN n 
1 811 ILE n 
1 812 ARG n 
1 813 LYS n 
1 814 TRP n 
1 815 LEU n 
1 816 VAL n 
1 817 LEU n 
1 818 ARG n 
1 819 ASN n 
1 820 TRP n 
1 821 GLN n 
1 822 TRP n 
1 823 TRP n 
1 824 LYS n 
1 825 LEU n 
1 826 TYR n 
1 827 SER n 
1 828 LYS n 
1 829 VAL n 
1 830 LYS n 
1 831 PRO n 
2 1   LYS n 
2 2   GLN n 
2 3   ILE n 
2 4   GLN n 
2 5   GLU n 
2 6   MET n 
2 7   LYS n 
2 8   GLU n 
2 9   ALA n 
2 10  PHE n 
2 11  SER n 
2 12  MET n 
2 13  ILE n 
2 14  ASP n 
2 15  VAL n 
2 16  ASP n 
2 17  ARG n 
2 18  ASP n 
2 19  GLY n 
2 20  PHE n 
2 21  VAL n 
2 22  SER n 
2 23  LYS n 
2 24  GLU n 
2 25  ASP n 
2 26  ILE n 
2 27  LYS n 
2 28  ALA n 
2 29  ILE n 
2 30  SER n 
2 31  GLU n 
2 32  GLN n 
2 33  LEU n 
2 34  GLY n 
2 35  ARG n 
2 36  ALA n 
2 37  PRO n 
2 38  ASP n 
2 39  ASP n 
2 40  LYS n 
2 41  GLU n 
2 42  LEU n 
2 43  THR n 
2 44  ALA n 
2 45  MET n 
2 46  LEU n 
2 47  LYS n 
2 48  GLU n 
2 49  ALA n 
2 50  PRO n 
2 51  GLY n 
2 52  PRO n 
2 53  LEU n 
2 54  ASN n 
2 55  PHE n 
2 56  THR n 
2 57  MET n 
2 58  PHE n 
2 59  LEU n 
2 60  SER n 
2 61  ILE n 
2 62  PHE n 
2 63  SER n 
2 64  ASP n 
2 65  LYS n 
2 66  LEU n 
2 67  SER n 
2 68  GLY n 
2 69  THR n 
2 70  ASP n 
2 71  SER n 
2 72  GLU n 
2 73  GLU n 
2 74  THR n 
2 75  ILE n 
2 76  ARG n 
2 77  ASN n 
2 78  ALA n 
2 79  PHE n 
2 80  ALA n 
2 81  MET n 
2 82  PHE n 
2 83  ASP n 
2 84  GLU n 
2 85  GLN n 
2 86  GLU n 
2 87  THR n 
2 88  LYS n 
2 89  LYS n 
2 90  LEU n 
2 91  ASN n 
2 92  ILE n 
2 93  GLU n 
2 94  TYR n 
2 95  ILE n 
2 96  LYS n 
2 97  ASP n 
2 98  LEU n 
2 99  LEU n 
2 100 GLU n 
2 101 ASN n 
2 102 MET n 
2 103 GLY n 
2 104 ASP n 
2 105 ASN n 
2 106 PHE n 
2 107 ASN n 
2 108 LYS n 
2 109 ASP n 
2 110 GLU n 
2 111 MET n 
2 112 ARG n 
2 113 MET n 
2 114 THR n 
2 115 PHE n 
2 116 LYS n 
2 117 GLU n 
2 118 ALA n 
2 119 PRO n 
2 120 VAL n 
2 121 GLU n 
2 122 GLY n 
2 123 GLY n 
2 124 LYS n 
2 125 PHE n 
2 126 ASP n 
2 127 TYR n 
2 128 VAL n 
2 129 LYS n 
2 130 PHE n 
2 131 THR n 
2 132 ALA n 
2 133 MET n 
2 134 ILE n 
2 135 LYS n 
2 136 GLY n 
3 1   SER n 
3 2   GLN n 
3 3   ASP n 
3 4   GLU n 
3 5   ILE n 
3 6   ASP n 
3 7   ASP n 
3 8   LEU n 
3 9   LYS n 
3 10  ASP n 
3 11  VAL n 
3 12  PHE n 
3 13  GLU n 
3 14  LEU n 
3 15  PHE n 
3 16  ASP n 
3 17  PHE n 
3 18  TRP n 
3 19  ASP n 
3 20  GLY n 
3 21  ARG n 
3 22  ASP n 
3 23  GLY n 
3 24  ALA n 
3 25  VAL n 
3 26  ASP n 
3 27  ALA n 
3 28  PHE n 
3 29  LYS n 
3 30  LEU n 
3 31  GLY n 
3 32  ASP n 
3 33  VAL n 
3 34  CYS n 
3 35  ARG n 
3 36  CYS n 
3 37  LEU n 
3 38  GLY n 
3 39  ILE n 
3 40  ASN n 
3 41  PRO n 
3 42  ARG n 
3 43  ASN n 
3 44  GLU n 
3 45  ASP n 
3 46  VAL n 
3 47  PHE n 
3 48  ALA n 
3 49  VAL n 
3 50  GLY n 
3 51  GLY n 
3 52  THR n 
3 53  HIS n 
3 54  LYS n 
3 55  MET n 
3 56  GLY n 
3 57  GLU n 
3 58  LYS n 
3 59  SER n 
3 60  LEU n 
3 61  PRO n 
3 62  PHE n 
3 63  GLU n 
3 64  GLU n 
3 65  PHE n 
3 66  LEU n 
3 67  PRO n 
3 68  ALA n 
3 69  TYR n 
3 70  GLU n 
3 71  GLY n 
3 72  LEU n 
3 73  MET n 
3 74  ASP n 
3 75  CYS n 
3 76  GLU n 
3 77  GLN n 
3 78  GLY n 
3 79  THR n 
3 80  PHE n 
3 81  ALA n 
3 82  ASP n 
3 83  TYR n 
3 84  MET n 
3 85  GLU n 
3 86  ALA n 
3 87  PHE n 
3 88  LYS n 
3 89  THR n 
3 90  PHE n 
3 91  ASP n 
3 92  ARG n 
3 93  GLU n 
3 94  GLY n 
3 95  GLN n 
3 96  GLY n 
3 97  PHE n 
3 98  ILE n 
3 99  SER n 
3 100 GLY n 
3 101 ALA n 
3 102 GLU n 
3 103 LEU n 
3 104 ARG n 
3 105 HIS n 
3 106 VAL n 
3 107 LEU n 
3 108 THR n 
3 109 ALA n 
3 110 LEU n 
3 111 GLY n 
3 112 GLU n 
3 113 ARG n 
3 114 LEU n 
3 115 SER n 
3 116 ASP n 
3 117 GLU n 
3 118 ASP n 
3 119 VAL n 
3 120 ASP n 
3 121 GLU n 
3 122 ILE n 
3 123 ILE n 
3 124 LYS n 
3 125 LEU n 
3 126 THR n 
3 127 ASP n 
3 128 LEU n 
3 129 GLN n 
3 130 GLU n 
3 131 ASP n 
3 132 LEU n 
3 133 GLU n 
3 134 GLY n 
3 135 ASN n 
3 136 VAL n 
3 137 LYS n 
3 138 TYR n 
3 139 GLU n 
3 140 ASP n 
3 141 PHE n 
3 142 VAL n 
3 143 LYS n 
3 144 LYS n 
3 145 VAL n 
3 146 MET n 
3 147 ALA n 
3 148 GLY n 
3 149 PRO n 
3 150 TYR n 
3 151 PRO n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? 'BAY SCALLOP' 'ARGOPECTEN IRRADIANS' 31199 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? 'BAY SCALLOP' 'ARGOPECTEN IRRADIANS' 31199 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? 'BAY SCALLOP' 'ARGOPECTEN IRRADIANS' 31199 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP MYS_AEQIR 1 ? ? P24733 ? 
2 UNP MLR_AEQIR 2 ? ? P13543 ? 
3 UNP MLE_AEQIR 3 ? ? P07291 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2W4V C 1 ? 831 ? P24733 5  ? 835 ? 5  835 
2 2 2W4V Y 1 ? 136 ? P13543 16 ? 151 ? 15 150 
3 3 2W4V Z 1 ? 151 ? P07291 5  ? 155 ? 4  154 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2W4V 
_exptl.method            'ELECTRON MICROSCOPY' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 2W4V 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            35.00 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8501 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               8501 
_refine_hist.d_res_high                       35.00 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  2W4V 
_struct.title                     
'Isometrically contracting insect asynchronous flight muscle quick frozen after a quick release step' 
_struct.pdbx_descriptor           
;MYOSIN HEAVY CHAIN, STRIATED MUSCLE, MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE, MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2W4V 
_struct_keywords.pdbx_keywords   'CONTRACTILE PROTEIN' 
_struct_keywords.text            
;CONTRACTILE PROTEIN, TROPOMYOSIN, LIGHT CHAINS, ACTIN-BINDING, ISOMETRIC CONTRACTION, THIN FILAMENT, MOTOR PROTEIN, THICK FILAMENT, MUSCLE PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 3   ? GLN A 7   ? ASP C 7   GLN C 11  5 ? 5  
HELX_P HELX_P2  2  ASP A 68  ? ILE A 70  ? ASP C 72  ILE C 74  5 ? 3  
HELX_P HELX_P3  3  PRO A 75  ? GLU A 79  ? PRO C 79  GLU C 83  5 ? 5  
HELX_P HELX_P4  4  MET A 84  ? MET A 87  ? MET C 88  MET C 91  5 ? 4  
HELX_P HELX_P5  5  ASN A 91  ? THR A 104 ? ASN C 95  THR C 108 1 ? 14 
HELX_P HELX_P6  6  THR A 129 ? ARG A 137 ? THR C 133 ARG C 141 1 ? 9  
HELX_P HELX_P7  7  HIS A 147 ? ARG A 163 ? HIS C 151 ARG C 167 1 ? 17 
HELX_P HELX_P8  8  GLY A 177 ? VAL A 192 ? GLY C 181 VAL C 196 1 ? 16 
HELX_P HELX_P9  9  GLU A 212 ? GLN A 217 ? GLU C 216 GLN C 221 1 ? 6  
HELX_P HELX_P10 10 GLN A 217 ? GLY A 226 ? GLN C 221 GLY C 230 1 ? 10 
HELX_P HELX_P11 11 GLU A 264 ? THR A 269 ? GLU C 268 THR C 273 5 ? 6  
HELX_P HELX_P12 12 TYR A 278 ? ILE A 284 ? TYR C 282 ILE C 288 1 ? 7  
HELX_P HELX_P13 13 ILE A 289 ? GLU A 291 ? ILE C 293 GLU C 295 5 ? 3  
HELX_P HELX_P14 14 LEU A 292 ? LEU A 297 ? LEU C 296 LEU C 301 1 ? 6  
HELX_P HELX_P15 15 ASP A 301 ? TYR A 305 ? ASP C 305 TYR C 309 5 ? 5  
HELX_P HELX_P16 16 TYR A 305 ? ASN A 309 ? TYR C 309 ASN C 313 5 ? 5  
HELX_P HELX_P17 17 ASP A 319 ? LEU A 334 ? ASP C 323 LEU C 338 1 ? 16 
HELX_P HELX_P18 18 GLU A 339 ? GLY A 355 ? GLU C 343 GLY C 359 1 ? 17 
HELX_P HELX_P19 19 THR A 373 ? CYS A 383 ? THR C 377 CYS C 387 1 ? 11 
HELX_P HELX_P20 20 ASN A 386 ? LYS A 396 ? ASN C 390 LYS C 400 1 ? 11 
HELX_P HELX_P21 21 ASN A 411 ? ASP A 443 ? ASN C 415 ASP C 447 1 ? 33 
HELX_P HELX_P22 22 SER A 467 ? PHE A 489 ? SER C 471 PHE C 493 1 ? 23 
HELX_P HELX_P23 23 PHE A 489 ? GLU A 499 ? PHE C 493 GLU C 503 1 ? 11 
HELX_P HELX_P24 24 LEU A 512 ? LYS A 521 ? LEU C 516 LYS C 525 1 ? 10 
HELX_P HELX_P25 25 GLY A 524 ? MET A 534 ? GLY C 528 MET C 538 1 ? 11 
HELX_P HELX_P26 26 ASP A 539 ? MET A 552 ? ASP C 543 MET C 556 1 ? 14 
HELX_P HELX_P27 27 GLY A 589 ? LYS A 595 ? GLY C 593 LYS C 599 1 ? 7  
HELX_P HELX_P28 28 ASN A 601 ? LEU A 606 ? ASN C 605 LEU C 610 1 ? 6  
HELX_P HELX_P29 29 GLY A 607 ? SER A 609 ? GLY C 611 SER C 613 5 ? 3  
HELX_P HELX_P30 30 GLU A 611 ? GLU A 616 ? GLU C 615 GLU C 620 1 ? 6  
HELX_P HELX_P31 31 THR A 640 ? SER A 658 ? THR C 644 SER C 662 1 ? 19 
HELX_P HELX_P32 32 ASP A 679 ? ASN A 690 ? ASP C 683 ASN C 694 1 ? 12 
HELX_P HELX_P33 33 GLY A 691 ? GLY A 702 ? GLY C 695 GLY C 706 1 ? 12 
HELX_P HELX_P34 34 TYR A 709 ? SER A 717 ? TYR C 713 SER C 721 1 ? 9  
HELX_P HELX_P35 35 ASP A 730 ? LEU A 742 ? ASP C 734 LEU C 746 1 ? 13 
HELX_P HELX_P36 36 GLY A 761 ? ALA A 793 ? GLY C 765 ALA C 797 1 ? 33 
HELX_P HELX_P37 37 LYS A 795 ? LEU A 817 ? LYS C 799 LEU C 821 1 ? 23 
HELX_P HELX_P38 38 TRP A 820 ? LYS A 830 ? TRP C 824 LYS C 834 1 ? 11 
HELX_P HELX_P39 39 LYS B 1   ? ASP B 14  ? LYS Y 15  ASP Y 28  1 ? 14 
HELX_P HELX_P40 40 SER B 22  ? GLN B 32  ? SER Y 36  GLN Y 46  1 ? 11 
HELX_P HELX_P41 41 ASP B 38  ? LYS B 47  ? ASP Y 52  LYS Y 61  1 ? 10 
HELX_P HELX_P42 42 ASN B 54  ? ASP B 64  ? ASN Y 68  ASP Y 78  1 ? 11 
HELX_P HELX_P43 43 SER B 71  ? MET B 81  ? SER Y 85  MET Y 95  1 ? 11 
HELX_P HELX_P44 44 ILE B 92  ? MET B 102 ? ILE Y 106 MET Y 116 1 ? 11 
HELX_P HELX_P45 45 ASN B 107 ? LYS B 116 ? ASN Y 121 LYS Y 130 1 ? 10 
HELX_P HELX_P46 46 ASP B 126 ? LYS B 135 ? ASP Y 140 LYS Y 149 1 ? 10 
HELX_P HELX_P47 47 SER C 1   ? ASP C 19  ? SER Z 4   ASP Z 22  1 ? 19 
HELX_P HELX_P48 48 LYS C 29  ? LEU C 37  ? LYS Z 32  LEU Z 40  1 ? 9  
HELX_P HELX_P49 49 ARG C 42  ? GLY C 50  ? ARG Z 45  GLY Z 53  1 ? 9  
HELX_P HELX_P50 50 PRO C 61  ? LEU C 72  ? PRO Z 64  LEU Z 75  1 ? 12 
HELX_P HELX_P51 51 THR C 79  ? THR C 89  ? THR Z 82  THR Z 92  1 ? 11 
HELX_P HELX_P52 52 SER C 99  ? LEU C 110 ? SER Z 102 LEU Z 113 1 ? 12 
HELX_P HELX_P53 53 SER C 115 ? ASP C 127 ? SER Z 118 ASP Z 130 1 ? 13 
HELX_P HELX_P54 54 LYS C 137 ? GLY C 148 ? LYS Z 140 GLY Z 151 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
CA ? 4 ? 
CB ? 7 ? 
CC ? 2 ? 
CD ? 2 ? 
CE ? 3 ? 
CF ? 2 ? 
YA ? 2 ? 
ZA ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? parallel      
CB 3 4 ? parallel      
CB 4 5 ? parallel      
CB 5 6 ? anti-parallel 
CB 6 7 ? anti-parallel 
CC 1 2 ? anti-parallel 
CD 1 2 ? anti-parallel 
CE 1 2 ? anti-parallel 
CE 2 3 ? anti-parallel 
CF 1 2 ? anti-parallel 
YA 1 2 ? anti-parallel 
ZA 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
CA 1 ASN A 29  ? PRO A 33  ? ASN C 33  PRO C 37  
CA 2 PHE A 39  ? SER A 46  ? PHE C 43  SER C 50  
CA 3 GLU A 51  ? ILE A 56  ? GLU C 55  ILE C 60  
CA 4 THR A 62  ? LYS A 66  ? THR C 66  LYS C 70  
CB 1 TYR A 109 ? SER A 112 ? TYR C 113 SER C 116 
CB 2 PHE A 115 ? VAL A 119 ? PHE C 119 VAL C 123 
CB 3 HIS A 660 ? ILE A 667 ? HIS C 664 ILE C 671 
CB 4 GLN A 166 ? THR A 171 ? GLN C 170 THR C 175 
CB 5 TYR A 450 ? ASP A 456 ? TYR C 454 ASP C 460 
CB 6 GLY A 240 ? PHE A 247 ? GLY C 244 PHE C 251 
CB 7 ILE A 253 ? TYR A 261 ? ILE C 257 TYR C 265 
CC 1 ASN A 227 ? ALA A 228 ? ASN C 231 ALA C 232 
CC 2 SER A 236 ? SER A 237 ? SER C 240 SER C 241 
CD 1 PHE A 359 ? LYS A 360 ? PHE C 363 LYS C 364 
CD 2 GLU A 369 ? SER A 370 ? GLU C 373 SER C 374 
CE 1 PHE A 558 ? THR A 559 ? PHE C 562 THR C 563 
CE 2 PHE A 574 ? HIS A 578 ? PHE C 578 HIS C 582 
CE 3 GLY A 581 ? TYR A 585 ? GLY C 585 TYR C 589 
CF 1 LEU A 707 ? ILE A 708 ? LEU C 711 ILE C 712 
CF 2 LYS A 755 ? VAL A 756 ? LYS C 759 VAL C 760 
YA 1 LEU B 90  ? ASN B 91  ? LEU Y 104 ASN Y 105 
YA 2 LYS B 124 ? PHE B 125 ? LYS Y 138 PHE Y 139 
ZA 1 VAL C 25  ? ASP C 26  ? VAL Z 28  ASP Z 29  
ZA 2 SER C 59  ? LEU C 60  ? SER Z 62  LEU Z 63  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
CA 1 2 N VAL A 32  ? N VAL C 36  O ALA A 40  ? O ALA C 44  
CA 2 3 N GLN A 45  ? N GLN C 49  O THR A 53  ? O THR C 57  
CA 3 4 N VAL A 54  ? N VAL C 58  O ARG A 63  ? O ARG C 67  
CB 1 2 N SER A 112 ? N SER C 116 O PHE A 115 ? O PHE C 119 
CB 2 3 N CYS A 116 ? N CYS C 120 O PHE A 663 ? O PHE C 667 
CB 3 4 N HIS A 662 ? N HIS C 666 O SER A 167 ? O SER C 171 
CB 4 5 N GLN A 166 ? N GLN C 170 O TYR A 451 ? O TYR C 455 
CB 5 6 N ASP A 456 ? N ASP C 460 O LYS A 241 ? O LYS C 245 
CB 6 7 O HIS A 246 ? O HIS C 250 N ALA A 254 ? N ALA C 258 
CC 1 2 N ALA A 228 ? N ALA C 232 O SER A 236 ? O SER C 240 
CD 1 2 N LYS A 360 ? N LYS C 364 O GLU A 369 ? O GLU C 373 
CE 1 2 N THR A 559 ? N THR C 563 O GLU A 575 ? O GLU C 579 
CE 2 3 N HIS A 578 ? N HIS C 582 O GLY A 581 ? O GLY C 585 
CF 1 2 N LEU A 707 ? N LEU C 711 O VAL A 756 ? O VAL C 760 
YA 1 2 N LEU B 90  ? N LEU Y 104 O PHE B 125 ? O PHE Y 139 
ZA 1 2 N VAL C 25  ? N VAL Z 28  O LEU C 60  ? O LEU Z 63  
# 
_database_PDB_matrix.entry_id          2W4V 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2W4V 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      N N   . PHE A 1 1   ? -79.697  52.179  -48.043 1.00 30.00  ? 5   PHE C N   1  
ATOM 2      C CA  . PHE A 1 1   ? -80.698  52.809  -47.126 1.00 30.00  ? 5   PHE C CA  1  
ATOM 3      C C   . PHE A 1 1   ? -80.528  54.323  -47.233 1.00 30.00  ? 5   PHE C C   1  
ATOM 4      O O   . PHE A 1 1   ? -81.205  55.091  -46.534 1.00 30.00  ? 5   PHE C O   1  
ATOM 5      C CB  . PHE A 1 1   ? -80.454  52.348  -45.694 1.00 99.99  ? 5   PHE C CB  1  
ATOM 6      C CG  . PHE A 1 1   ? -81.467  52.987  -44.777 1.00 99.99  ? 5   PHE C CG  1  
ATOM 7      C CD1 . PHE A 1 1   ? -82.742  52.420  -44.638 1.00 99.99  ? 5   PHE C CD1 1  
ATOM 8      C CD2 . PHE A 1 1   ? -81.134  54.146  -44.063 1.00 99.99  ? 5   PHE C CD2 1  
ATOM 9      C CE1 . PHE A 1 1   ? -83.682  53.013  -43.788 1.00 99.99  ? 5   PHE C CE1 1  
ATOM 10     C CE2 . PHE A 1 1   ? -82.077  54.735  -43.214 1.00 99.99  ? 5   PHE C CE2 1  
ATOM 11     C CZ  . PHE A 1 1   ? -83.349  54.172  -43.076 1.00 99.99  ? 5   PHE C CZ  1  
ATOM 12     N N   . SER A 1 2   ? -79.597  54.674  -48.105 1.00 30.00  ? 6   SER C N   1  
ATOM 13     C CA  . SER A 1 2   ? -79.239  56.067  -48.398 1.00 30.00  ? 6   SER C CA  1  
ATOM 14     C C   . SER A 1 2   ? -78.119  56.541  -47.462 1.00 30.00  ? 6   SER C C   1  
ATOM 15     O O   . SER A 1 2   ? -77.706  57.708  -47.502 1.00 30.00  ? 6   SER C O   1  
ATOM 16     C CB  . SER A 1 2   ? -80.454  56.967  -48.206 1.00 99.99  ? 6   SER C CB  1  
ATOM 17     O OG  . SER A 1 2   ? -81.508  56.540  -49.074 1.00 99.99  ? 6   SER C OG  1  
ATOM 18     N N   . ASP A 1 3   ? -77.658  55.613  -46.647 1.00 30.00  ? 7   ASP C N   1  
ATOM 19     C CA  . ASP A 1 3   ? -76.608  55.880  -45.645 1.00 30.00  ? 7   ASP C CA  1  
ATOM 20     C C   . ASP A 1 3   ? -75.227  55.983  -46.298 1.00 30.00  ? 7   ASP C C   1  
ATOM 21     O O   . ASP A 1 3   ? -74.688  54.993  -46.815 1.00 30.00  ? 7   ASP C O   1  
ATOM 22     C CB  . ASP A 1 3   ? -76.574  54.754  -44.618 1.00 99.99  ? 7   ASP C CB  1  
ATOM 23     C CG  . ASP A 1 3   ? -76.570  53.407  -45.338 1.00 99.99  ? 7   ASP C CG  1  
ATOM 24     O OD1 . ASP A 1 3   ? -77.514  53.184  -46.145 1.00 99.99  ? 7   ASP C OD1 1  
ATOM 25     O OD2 . ASP A 1 3   ? -75.625  52.616  -45.077 1.00 99.99  ? 7   ASP C OD2 1  
ATOM 26     N N   . PRO A 1 4   ? -74.702  57.188  -46.239 1.00 30.00  ? 8   PRO C N   1  
ATOM 27     C CA  . PRO A 1 4   ? -73.382  57.509  -46.785 1.00 30.00  ? 8   PRO C CA  1  
ATOM 28     C C   . PRO A 1 4   ? -72.352  56.459  -46.336 1.00 30.00  ? 8   PRO C C   1  
ATOM 29     O O   . PRO A 1 4   ? -71.426  56.106  -47.069 1.00 30.00  ? 8   PRO C O   1  
ATOM 30     C CB  . PRO A 1 4   ? -73.192  58.831  -46.130 1.00 99.99  ? 8   PRO C CB  1  
ATOM 31     C CG  . PRO A 1 4   ? -74.458  59.095  -45.347 1.00 99.99  ? 8   PRO C CG  1  
ATOM 32     C CD  . PRO A 1 4   ? -75.329  58.172  -45.461 1.00 99.99  ? 8   PRO C CD  1  
ATOM 33     N N   . ASP A 1 5   ? -72.540  55.958  -45.133 1.00 30.00  ? 9   ASP C N   1  
ATOM 34     C CA  . ASP A 1 5   ? -71.612  54.988  -44.521 1.00 30.00  ? 9   ASP C CA  1  
ATOM 35     C C   . ASP A 1 5   ? -71.478  53.676  -45.333 1.00 30.00  ? 9   ASP C C   1  
ATOM 36     O O   . ASP A 1 5   ? -70.721  52.770  -44.962 1.00 30.00  ? 9   ASP C O   1  
ATOM 37     C CB  . ASP A 1 5   ? -72.102  54.611  -43.126 1.00 99.99  ? 9   ASP C CB  1  
ATOM 38     C CG  . ASP A 1 5   ? -73.590  54.270  -43.181 1.00 99.99  ? 9   ASP C CG  1  
ATOM 39     O OD1 . ASP A 1 5   ? -74.362  55.145  -43.654 1.00 99.99  ? 9   ASP C OD1 1  
ATOM 40     O OD2 . ASP A 1 5   ? -73.935  53.138  -42.754 1.00 99.99  ? 9   ASP C OD2 1  
ATOM 41     N N   . PHE A 1 6   ? -72.188  53.565  -46.449 1.00 30.00  ? 10  PHE C N   1  
ATOM 42     C CA  . PHE A 1 6   ? -72.181  52.306  -47.240 1.00 30.00  ? 10  PHE C CA  1  
ATOM 43     C C   . PHE A 1 6   ? -71.581  52.462  -48.647 1.00 30.00  ? 10  PHE C C   1  
ATOM 44     O O   . PHE A 1 6   ? -71.842  51.661  -49.551 1.00 30.00  ? 10  PHE C O   1  
ATOM 45     C CB  . PHE A 1 6   ? -73.607  51.797  -47.418 1.00 99.99  ? 10  PHE C CB  1  
ATOM 46     C CG  . PHE A 1 6   ? -74.022  51.941  -48.862 1.00 99.99  ? 10  PHE C CG  1  
ATOM 47     C CD1 . PHE A 1 6   ? -73.430  52.926  -49.662 1.00 99.99  ? 10  PHE C CD1 1  
ATOM 48     C CD2 . PHE A 1 6   ? -74.995  51.092  -49.401 1.00 99.99  ? 10  PHE C CD2 1  
ATOM 49     C CE1 . PHE A 1 6   ? -73.812  53.062  -51.002 1.00 99.99  ? 10  PHE C CE1 1  
ATOM 50     C CE2 . PHE A 1 6   ? -75.378  51.228  -50.742 1.00 99.99  ? 10  PHE C CE2 1  
ATOM 51     C CZ  . PHE A 1 6   ? -74.784  52.213  -51.542 1.00 99.99  ? 10  PHE C CZ  1  
ATOM 52     N N   . GLN A 1 7   ? -70.764  53.469  -48.826 1.00 30.00  ? 11  GLN C N   1  
ATOM 53     C CA  . GLN A 1 7   ? -70.157  53.756  -50.135 1.00 30.00  ? 11  GLN C CA  1  
ATOM 54     C C   . GLN A 1 7   ? -69.380  52.563  -50.694 1.00 30.00  ? 11  GLN C C   1  
ATOM 55     O O   . GLN A 1 7   ? -69.661  52.100  -51.805 1.00 30.00  ? 11  GLN C O   1  
ATOM 56     C CB  . GLN A 1 7   ? -69.185  54.926  -50.012 1.00 99.99  ? 11  GLN C CB  1  
ATOM 57     C CG  . GLN A 1 7   ? -69.020  55.596  -51.372 1.00 99.99  ? 11  GLN C CG  1  
ATOM 58     C CD  . GLN A 1 7   ? -67.961  54.889  -52.207 1.00 99.99  ? 11  GLN C CD  1  
ATOM 59     O OE1 . GLN A 1 7   ? -67.366  53.912  -51.760 1.00 99.99  ? 11  GLN C OE1 1  
ATOM 60     N NE2 . GLN A 1 7   ? -67.729  55.389  -53.424 1.00 99.99  ? 11  GLN C NE2 1  
ATOM 61     N N   . TYR A 1 8   ? -68.415  52.057  -49.937 1.00 30.00  ? 12  TYR C N   1  
ATOM 62     C CA  . TYR A 1 8   ? -67.630  50.920  -50.403 1.00 30.00  ? 12  TYR C CA  1  
ATOM 63     C C   . TYR A 1 8   ? -68.071  49.689  -49.662 1.00 30.00  ? 12  TYR C C   1  
ATOM 64     O O   . TYR A 1 8   ? -67.251  48.819  -49.352 1.00 30.00  ? 12  TYR C O   1  
ATOM 65     C CB  . TYR A 1 8   ? -66.148  51.173  -50.141 1.00 99.99  ? 12  TYR C CB  1  
ATOM 66     C CG  . TYR A 1 8   ? -65.661  50.241  -49.061 1.00 99.99  ? 12  TYR C CG  1  
ATOM 67     C CD1 . TYR A 1 8   ? -66.557  49.749  -48.105 1.00 99.99  ? 12  TYR C CD1 1  
ATOM 68     C CD2 . TYR A 1 8   ? -64.314  49.867  -49.014 1.00 99.99  ? 12  TYR C CD2 1  
ATOM 69     C CE1 . TYR A 1 8   ? -66.105  48.884  -47.101 1.00 99.99  ? 12  TYR C CE1 1  
ATOM 70     C CE2 . TYR A 1 8   ? -63.861  49.003  -48.010 1.00 99.99  ? 12  TYR C CE2 1  
ATOM 71     C CZ  . TYR A 1 8   ? -64.756  48.511  -47.053 1.00 99.99  ? 12  TYR C CZ  1  
ATOM 72     O OH  . TYR A 1 8   ? -64.317  47.669  -46.077 1.00 99.99  ? 12  TYR C OH  1  
ATOM 73     N N   . LEU A 1 9   ? -69.357  49.597  -49.364 1.00 30.00  ? 13  LEU C N   1  
ATOM 74     C CA  . LEU A 1 9   ? -69.835  48.437  -48.630 1.00 30.00  ? 13  LEU C CA  1  
ATOM 75     C C   . LEU A 1 9   ? -71.069  47.751  -49.200 1.00 30.00  ? 13  LEU C C   1  
ATOM 76     O O   . LEU A 1 9   ? -71.229  46.544  -49.027 1.00 30.00  ? 13  LEU C O   1  
ATOM 77     C CB  . LEU A 1 9   ? -70.195  48.837  -47.203 1.00 99.99  ? 13  LEU C CB  1  
ATOM 78     C CG  . LEU A 1 9   ? -69.008  48.579  -46.284 1.00 99.99  ? 13  LEU C CG  1  
ATOM 79     C CD1 . LEU A 1 9   ? -69.462  48.663  -44.831 1.00 99.99  ? 13  LEU C CD1 1  
ATOM 80     C CD2 . LEU A 1 9   ? -68.442  47.191  -46.563 1.00 99.99  ? 13  LEU C CD2 1  
ATOM 81     N N   . ALA A 1 10  ? -71.933  48.507  -49.873 1.00 30.00  ? 14  ALA C N   1  
ATOM 82     C CA  . ALA A 1 10  ? -73.161  47.947  -50.447 1.00 30.00  ? 14  ALA C CA  1  
ATOM 83     C C   . ALA A 1 10  ? -73.131  47.815  -51.965 1.00 30.00  ? 14  ALA C C   1  
ATOM 84     O O   . ALA A 1 10  ? -72.721  48.748  -52.661 1.00 30.00  ? 14  ALA C O   1  
ATOM 85     C CB  . ALA A 1 10  ? -74.343  48.799  -50.045 1.00 30.00  ? 14  ALA C CB  1  
ATOM 86     N N   . VAL A 1 11  ? -73.572  46.657  -52.464 1.00 30.00  ? 15  VAL C N   1  
ATOM 87     C CA  . VAL A 1 11  ? -73.604  46.391  -53.908 1.00 30.00  ? 15  VAL C CA  1  
ATOM 88     C C   . VAL A 1 11  ? -74.494  47.416  -54.594 1.00 30.00  ? 15  VAL C C   1  
ATOM 89     O O   . VAL A 1 11  ? -75.647  47.624  -54.200 1.00 30.00  ? 15  VAL C O   1  
ATOM 90     C CB  . VAL A 1 11  ? -74.156  44.994  -54.164 1.00 99.99  ? 15  VAL C CB  1  
ATOM 91     C CG1 . VAL A 1 11  ? -73.263  43.961  -53.484 1.00 99.99  ? 15  VAL C CG1 1  
ATOM 92     C CG2 . VAL A 1 11  ? -75.571  44.891  -53.603 1.00 99.99  ? 15  VAL C CG2 1  
ATOM 93     N N   . ASP A 1 12  ? -73.952  48.053  -55.621 1.00 30.00  ? 16  ASP C N   1  
ATOM 94     C CA  . ASP A 1 12  ? -74.634  49.082  -56.400 1.00 30.00  ? 16  ASP C CA  1  
ATOM 95     C C   . ASP A 1 12  ? -76.043  48.724  -56.907 1.00 30.00  ? 16  ASP C C   1  
ATOM 96     O O   . ASP A 1 12  ? -76.434  47.541  -56.833 1.00 30.00  ? 16  ASP C O   1  
ATOM 97     C CB  . ASP A 1 12  ? -73.817  49.420  -57.645 1.00 99.99  ? 16  ASP C CB  1  
ATOM 98     C CG  . ASP A 1 12  ? -73.398  48.128  -58.345 1.00 99.99  ? 16  ASP C CG  1  
ATOM 99     O OD1 . ASP A 1 12  ? -72.755  47.287  -57.661 1.00 99.99  ? 16  ASP C OD1 1  
ATOM 100    O OD2 . ASP A 1 12  ? -73.724  47.997  -59.553 1.00 99.99  ? 16  ASP C OD2 1  
ATOM 101    N N   . GLN A 1 20  ? -78.830  44.658  -63.971 1.00 30.00  ? 24  GLN C N   1  
ATOM 102    C CA  . GLN A 1 20  ? -78.316  43.272  -64.081 1.00 30.00  ? 24  GLN C CA  1  
ATOM 103    C C   . GLN A 1 20  ? -79.270  42.415  -64.954 1.00 30.00  ? 24  GLN C C   1  
ATOM 104    O O   . GLN A 1 20  ? -79.931  41.492  -64.467 1.00 30.00  ? 24  GLN C O   1  
ATOM 105    C CB  . GLN A 1 20  ? -78.216  42.644  -62.694 1.00 99.99  ? 24  GLN C CB  1  
ATOM 106    C CG  . GLN A 1 20  ? -78.895  41.280  -62.704 1.00 99.99  ? 24  GLN C CG  1  
ATOM 107    C CD  . GLN A 1 20  ? -80.406  41.416  -62.809 1.00 99.99  ? 24  GLN C CD  1  
ATOM 108    O OE1 . GLN A 1 20  ? -80.928  42.530  -62.876 1.00 99.99  ? 24  GLN C OE1 1  
ATOM 109    N NE2 . GLN A 1 20  ? -81.109  40.282  -62.828 1.00 99.99  ? 24  GLN C NE2 1  
ATOM 110    N N   . THR A 1 21  ? -79.346  42.698  -66.269 1.00 30.00  ? 25  THR C N   1  
ATOM 111    C CA  . THR A 1 21  ? -80.295  41.946  -67.139 1.00 30.00  ? 25  THR C CA  1  
ATOM 112    C C   . THR A 1 21  ? -79.939  41.900  -68.643 1.00 30.00  ? 25  THR C C   1  
ATOM 113    O O   . THR A 1 21  ? -79.079  42.658  -69.126 1.00 30.00  ? 25  THR C O   1  
ATOM 114    C CB  . THR A 1 21  ? -81.685  42.567  -67.050 1.00 99.99  ? 25  THR C CB  1  
ATOM 115    O OG1 . THR A 1 21  ? -82.183  42.439  -65.715 1.00 99.99  ? 25  THR C OG1 1  
ATOM 116    C CG2 . THR A 1 21  ? -82.625  41.852  -68.014 1.00 99.99  ? 25  THR C CG2 1  
ATOM 117    N N   . ALA A 1 22  ? -80.664  40.968  -69.287 1.00 30.00  ? 26  ALA C N   1  
ATOM 118    C CA  . ALA A 1 22  ? -80.649  40.704  -70.747 1.00 30.00  ? 26  ALA C CA  1  
ATOM 119    C C   . ALA A 1 22  ? -79.610  39.645  -71.168 1.00 30.00  ? 26  ALA C C   1  
ATOM 120    O O   . ALA A 1 22  ? -79.257  38.748  -70.382 1.00 30.00  ? 26  ALA C O   1  
ATOM 121    C CB  . ALA A 1 22  ? -80.331  41.979  -71.520 1.00 30.00  ? 26  ALA C CB  1  
ATOM 122    N N   . ALA A 1 23  ? -79.205  39.834  -72.418 1.00 30.00  ? 27  ALA C N   1  
ATOM 123    C CA  . ALA A 1 23  ? -78.221  39.013  -73.152 1.00 30.00  ? 27  ALA C CA  1  
ATOM 124    C C   . ALA A 1 23  ? -77.608  37.925  -72.272 1.00 30.00  ? 27  ALA C C   1  
ATOM 125    O O   . ALA A 1 23  ? -76.479  38.067  -71.778 1.00 30.00  ? 27  ALA C O   1  
ATOM 126    C CB  . ALA A 1 23  ? -77.081  39.897  -73.666 1.00 30.00  ? 27  ALA C CB  1  
ATOM 127    N N   . PHE A 1 24  ? -78.366  36.858  -72.115 1.00 30.00  ? 28  PHE C N   1  
ATOM 128    C CA  . PHE A 1 24  ? -77.940  35.707  -71.308 1.00 30.00  ? 28  PHE C CA  1  
ATOM 129    C C   . PHE A 1 24  ? -78.787  34.473  -71.623 1.00 30.00  ? 28  PHE C C   1  
ATOM 130    O O   . PHE A 1 24  ? -79.955  34.378  -71.212 1.00 30.00  ? 28  PHE C O   1  
ATOM 131    C CB  . PHE A 1 24  ? -78.086  36.030  -69.825 1.00 99.99  ? 28  PHE C CB  1  
ATOM 132    C CG  . PHE A 1 24  ? -77.646  34.844  -69.003 1.00 99.99  ? 28  PHE C CG  1  
ATOM 133    C CD1 . PHE A 1 24  ? -76.288  34.648  -68.727 1.00 99.99  ? 28  PHE C CD1 1  
ATOM 134    C CD2 . PHE A 1 24  ? -78.595  33.937  -68.516 1.00 99.99  ? 28  PHE C CD2 1  
ATOM 135    C CE1 . PHE A 1 24  ? -75.877  33.548  -67.964 1.00 99.99  ? 28  PHE C CE1 1  
ATOM 136    C CE2 . PHE A 1 24  ? -78.187  32.836  -67.754 1.00 99.99  ? 28  PHE C CE2 1  
ATOM 137    C CZ  . PHE A 1 24  ? -76.828  32.643  -67.478 1.00 99.99  ? 28  PHE C CZ  1  
ATOM 138    N N   . ASP A 1 25  ? -78.155  33.567  -72.348 1.00 30.00  ? 29  ASP C N   1  
ATOM 139    C CA  . ASP A 1 25  ? -78.742  32.273  -72.733 1.00 30.00  ? 29  ASP C CA  1  
ATOM 140    C C   . ASP A 1 25  ? -78.063  31.181  -71.906 1.00 30.00  ? 29  ASP C C   1  
ATOM 141    O O   . ASP A 1 25  ? -76.866  30.909  -72.064 1.00 30.00  ? 29  ASP C O   1  
ATOM 142    C CB  . ASP A 1 25  ? -78.515  32.021  -74.219 1.00 99.99  ? 29  ASP C CB  1  
ATOM 143    C CG  . ASP A 1 25  ? -79.330  30.813  -74.664 1.00 99.99  ? 29  ASP C CG  1  
ATOM 144    O OD1 . ASP A 1 25  ? -78.860  29.670  -74.406 1.00 99.99  ? 29  ASP C OD1 1  
ATOM 145    O OD2 . ASP A 1 25  ? -80.420  31.036  -75.256 1.00 99.99  ? 29  ASP C OD2 1  
ATOM 146    N N   . GLY A 1 26  ? -78.857  30.587  -71.037 1.00 30.00  ? 30  GLY C N   1  
ATOM 147    C CA  . GLY A 1 26  ? -78.390  29.563  -70.085 1.00 30.00  ? 30  GLY C CA  1  
ATOM 148    C C   . GLY A 1 26  ? -77.846  28.301  -70.776 1.00 30.00  ? 30  GLY C C   1  
ATOM 149    O O   . GLY A 1 26  ? -77.431  27.338  -70.114 1.00 30.00  ? 30  GLY C O   1  
ATOM 150    N N   . LYS A 1 27  ? -77.831  28.295  -72.097 1.00 30.00  ? 31  LYS C N   1  
ATOM 151    C CA  . LYS A 1 27  ? -77.365  27.113  -72.850 1.00 30.00  ? 31  LYS C CA  1  
ATOM 152    C C   . LYS A 1 27  ? -76.252  27.457  -73.843 1.00 30.00  ? 31  LYS C C   1  
ATOM 153    O O   . LYS A 1 27  ? -75.587  26.568  -74.396 1.00 30.00  ? 31  LYS C O   1  
ATOM 154    C CB  . LYS A 1 27  ? -78.522  26.506  -73.634 1.00 99.99  ? 31  LYS C CB  1  
ATOM 155    C CG  . LYS A 1 27  ? -78.056  25.228  -74.326 1.00 99.99  ? 31  LYS C CG  1  
ATOM 156    C CD  . LYS A 1 27  ? -79.268  24.396  -74.729 1.00 99.99  ? 31  LYS C CD  1  
ATOM 157    C CE  . LYS A 1 27  ? -78.842  23.327  -75.730 1.00 99.99  ? 31  LYS C CE  1  
ATOM 158    N NZ  . LYS A 1 27  ? -78.539  22.079  -75.014 1.00 99.99  ? 31  LYS C NZ  1  
ATOM 159    N N   . LYS A 1 28  ? -76.068  28.738  -74.062 1.00 30.00  ? 32  LYS C N   1  
ATOM 160    C CA  . LYS A 1 28  ? -75.048  29.227  -74.993 1.00 30.00  ? 32  LYS C CA  1  
ATOM 161    C C   . LYS A 1 28  ? -73.827  29.735  -74.225 1.00 30.00  ? 32  LYS C C   1  
ATOM 162    O O   . LYS A 1 28  ? -72.676  29.449  -74.597 1.00 30.00  ? 32  LYS C O   1  
ATOM 163    C CB  . LYS A 1 28  ? -75.614  30.369  -75.831 1.00 99.99  ? 32  LYS C CB  1  
ATOM 164    C CG  . LYS A 1 28  ? -74.579  30.804  -76.863 1.00 99.99  ? 32  LYS C CG  1  
ATOM 165    C CD  . LYS A 1 28  ? -75.267  31.605  -77.964 1.00 99.99  ? 32  LYS C CD  1  
ATOM 166    C CE  . LYS A 1 28  ? -74.217  32.348  -78.785 1.00 99.99  ? 32  LYS C CE  1  
ATOM 167    N NZ  . LYS A 1 28  ? -73.845  31.539  -79.954 1.00 99.99  ? 32  LYS C NZ  1  
ATOM 168    N N   . ASN A 1 29  ? -74.131  30.461  -73.168 1.00 30.00  ? 33  ASN C N   1  
ATOM 169    C CA  . ASN A 1 29  ? -73.120  31.109  -72.320 1.00 30.00  ? 33  ASN C CA  1  
ATOM 170    C C   . ASN A 1 29  ? -72.517  30.155  -71.281 1.00 30.00  ? 33  ASN C C   1  
ATOM 171    O O   . ASN A 1 29  ? -73.230  29.435  -70.580 1.00 30.00  ? 33  ASN C O   1  
ATOM 172    C CB  . ASN A 1 29  ? -73.751  32.274  -71.562 1.00 99.99  ? 33  ASN C CB  1  
ATOM 173    C CG  . ASN A 1 29  ? -72.707  33.322  -71.203 1.00 99.99  ? 33  ASN C CG  1  
ATOM 174    O OD1 . ASN A 1 29  ? -72.882  34.072  -70.245 1.00 99.99  ? 33  ASN C OD1 1  
ATOM 175    N ND2 . ASN A 1 29  ? -71.620  33.372  -71.974 1.00 99.99  ? 33  ASN C ND2 1  
ATOM 176    N N   . CYS A 1 30  ? -71.193  30.156  -71.174 1.00 30.00  ? 34  CYS C N   1  
ATOM 177    C CA  . CYS A 1 30  ? -70.521  29.275  -70.230 1.00 30.00  ? 34  CYS C CA  1  
ATOM 178    C C   . CYS A 1 30  ? -69.092  29.761  -69.903 1.00 30.00  ? 34  CYS C C   1  
ATOM 179    O O   . CYS A 1 30  ? -68.601  30.764  -70.447 1.00 30.00  ? 34  CYS C O   1  
ATOM 180    C CB  . CYS A 1 30  ? -70.422  27.870  -70.812 1.00 99.99  ? 34  CYS C CB  1  
ATOM 181    S SG  . CYS A 1 30  ? -69.713  26.607  -69.728 1.00 99.99  ? 34  CYS C SG  1  
ATOM 182    N N   . TRP A 1 31  ? -68.435  29.028  -69.010 1.00 30.00  ? 35  TRP C N   1  
ATOM 183    C CA  . TRP A 1 31  ? -67.083  29.352  -68.595 1.00 30.00  ? 35  TRP C CA  1  
ATOM 184    C C   . TRP A 1 31  ? -66.099  28.402  -69.252 1.00 30.00  ? 35  TRP C C   1  
ATOM 185    O O   . TRP A 1 31  ? -66.194  27.177  -69.071 1.00 30.00  ? 35  TRP C O   1  
ATOM 186    C CB  . TRP A 1 31  ? -66.963  29.224  -67.078 1.00 99.99  ? 35  TRP C CB  1  
ATOM 187    C CG  . TRP A 1 31  ? -67.714  30.266  -66.287 1.00 99.99  ? 35  TRP C CG  1  
ATOM 188    C CD1 . TRP A 1 31  ? -69.014  30.247  -65.961 1.00 99.99  ? 35  TRP C CD1 1  
ATOM 189    C CD2 . TRP A 1 31  ? -67.210  31.453  -65.741 1.00 99.99  ? 35  TRP C CD2 1  
ATOM 190    N NE1 . TRP A 1 31  ? -69.275  31.437  -65.213 1.00 99.99  ? 35  TRP C NE1 1  
ATOM 191    C CE2 . TRP A 1 31  ? -68.165  32.126  -65.106 1.00 99.99  ? 35  TRP C CE2 1  
ATOM 192    C CE3 . TRP A 1 31  ? -65.910  31.971  -65.784 1.00 99.99  ? 35  TRP C CE3 1  
ATOM 193    C CZ2 . TRP A 1 31  ? -67.971  33.350  -64.458 1.00 99.99  ? 35  TRP C CZ2 1  
ATOM 194    C CZ3 . TRP A 1 31  ? -65.690  33.204  -65.138 1.00 99.99  ? 35  TRP C CZ3 1  
ATOM 195    C CH2 . TRP A 1 31  ? -66.680  33.866  -64.501 1.00 99.99  ? 35  TRP C CH2 1  
ATOM 196    N N   . VAL A 1 32  ? -65.152  28.955  -70.009 1.00 30.00  ? 36  VAL C N   1  
ATOM 197    C CA  . VAL A 1 32  ? -64.129  28.136  -70.663 1.00 30.00  ? 36  VAL C CA  1  
ATOM 198    C C   . VAL A 1 32  ? -62.751  28.510  -70.132 1.00 30.00  ? 36  VAL C C   1  
ATOM 199    O O   . VAL A 1 32  ? -62.434  29.689  -69.993 1.00 30.00  ? 36  VAL C O   1  
ATOM 200    C CB  . VAL A 1 32  ? -64.167  28.364  -72.170 1.00 99.99  ? 36  VAL C CB  1  
ATOM 201    C CG1 . VAL A 1 32  ? -65.541  27.979  -72.709 1.00 99.99  ? 36  VAL C CG1 1  
ATOM 202    C CG2 . VAL A 1 32  ? -63.897  29.834  -72.469 1.00 99.99  ? 36  VAL C CG2 1  
ATOM 203    N N   . PRO A 1 33  ? -61.925  27.509  -69.805 1.00 30.00  ? 37  PRO C N   1  
ATOM 204    C CA  . PRO A 1 33  ? -60.571  27.763  -69.290 1.00 30.00  ? 37  PRO C CA  1  
ATOM 205    C C   . PRO A 1 33  ? -59.770  28.813  -70.059 1.00 30.00  ? 37  PRO C C   1  
ATOM 206    O O   . PRO A 1 33  ? -59.894  28.947  -71.286 1.00 30.00  ? 37  PRO C O   1  
ATOM 207    C CB  . PRO A 1 33  ? -60.011  26.399  -69.485 1.00 99.99  ? 37  PRO C CB  1  
ATOM 208    C CG  . PRO A 1 33  ? -61.137  25.555  -70.029 1.00 99.99  ? 37  PRO C CG  1  
ATOM 209    C CD  . PRO A 1 33  ? -62.236  26.190  -70.160 1.00 99.99  ? 37  PRO C CD  1  
ATOM 210    N N   . ASP A 1 34  ? -58.950  29.561  -69.327 1.00 30.00  ? 38  ASP C N   1  
ATOM 211    C CA  . ASP A 1 34  ? -58.111  30.593  -69.922 1.00 30.00  ? 38  ASP C CA  1  
ATOM 212    C C   . ASP A 1 34  ? -56.736  30.559  -69.252 1.00 30.00  ? 38  ASP C C   1  
ATOM 213    O O   . ASP A 1 34  ? -56.604  30.036  -68.146 1.00 30.00  ? 38  ASP C O   1  
ATOM 214    C CB  . ASP A 1 34  ? -58.750  31.964  -69.711 1.00 99.99  ? 38  ASP C CB  1  
ATOM 215    C CG  . ASP A 1 34  ? -58.007  33.005  -70.542 1.00 99.99  ? 38  ASP C CG  1  
ATOM 216    O OD1 . ASP A 1 34  ? -56.924  33.448  -70.078 1.00 99.99  ? 38  ASP C OD1 1  
ATOM 217    O OD2 . ASP A 1 34  ? -58.530  33.350  -71.638 1.00 99.99  ? 38  ASP C OD2 1  
ATOM 218    N N   . GLU A 1 35  ? -55.714  31.101  -69.919 1.00 30.00  ? 39  GLU C N   1  
ATOM 219    C CA  . GLU A 1 35  ? -54.352  31.117  -69.352 1.00 30.00  ? 39  GLU C CA  1  
ATOM 220    C C   . GLU A 1 35  ? -54.055  32.434  -68.613 1.00 30.00  ? 39  GLU C C   1  
ATOM 221    O O   . GLU A 1 35  ? -53.292  32.456  -67.647 1.00 30.00  ? 39  GLU C O   1  
ATOM 222    C CB  . GLU A 1 35  ? -53.326  30.955  -70.467 1.00 99.99  ? 39  GLU C CB  1  
ATOM 223    C CG  . GLU A 1 35  ? -53.513  32.047  -71.489 1.00 99.99  ? 39  GLU C CG  1  
ATOM 224    C CD  . GLU A 1 35  ? -54.704  31.704  -72.386 1.00 99.99  ? 39  GLU C CD  1  
ATOM 225    O OE1 . GLU A 1 35  ? -55.835  32.115  -72.021 1.00 99.99  ? 39  GLU C OE1 1  
ATOM 226    O OE2 . GLU A 1 35  ? -54.467  31.037  -73.428 1.00 99.99  ? 39  GLU C OE2 1  
ATOM 227    N N   . LYS A 1 36  ? -54.665  33.518  -69.085 1.00 30.00  ? 40  LYS C N   1  
ATOM 228    C CA  . LYS A 1 36  ? -54.495  34.844  -68.496 1.00 30.00  ? 40  LYS C CA  1  
ATOM 229    C C   . LYS A 1 36  ? -55.532  35.093  -67.398 1.00 30.00  ? 40  LYS C C   1  
ATOM 230    O O   . LYS A 1 36  ? -55.183  35.468  -66.282 1.00 30.00  ? 40  LYS C O   1  
ATOM 231    C CB  . LYS A 1 36  ? -54.658  35.913  -69.570 1.00 99.99  ? 40  LYS C CB  1  
ATOM 232    C CG  . LYS A 1 36  ? -54.382  37.287  -68.969 1.00 99.99  ? 40  LYS C CG  1  
ATOM 233    C CD  . LYS A 1 36  ? -54.104  38.286  -70.087 1.00 99.99  ? 40  LYS C CD  1  
ATOM 234    C CE  . LYS A 1 36  ? -54.197  39.705  -69.535 1.00 99.99  ? 40  LYS C CE  1  
ATOM 235    N NZ  . LYS A 1 36  ? -52.857  40.166  -69.139 1.00 99.99  ? 40  LYS C NZ  1  
ATOM 236    N N   . GLU A 1 37  ? -56.800  34.873  -67.734 1.00 30.00  ? 41  GLU C N   1  
ATOM 237    C CA  . GLU A 1 37  ? -57.915  35.085  -66.811 1.00 30.00  ? 41  GLU C CA  1  
ATOM 238    C C   . GLU A 1 37  ? -58.408  33.887  -66.017 1.00 30.00  ? 41  GLU C C   1  
ATOM 239    O O   . GLU A 1 37  ? -59.348  34.020  -65.227 1.00 30.00  ? 41  GLU C O   1  
ATOM 240    C CB  . GLU A 1 37  ? -59.133  35.587  -67.576 1.00 99.99  ? 41  GLU C CB  1  
ATOM 241    C CG  . GLU A 1 37  ? -59.903  36.562  -66.719 1.00 99.99  ? 41  GLU C CG  1  
ATOM 242    C CD  . GLU A 1 37  ? -60.464  35.831  -65.499 1.00 99.99  ? 41  GLU C CD  1  
ATOM 243    O OE1 . GLU A 1 37  ? -59.742  35.791  -64.469 1.00 99.99  ? 41  GLU C OE1 1  
ATOM 244    O OE2 . GLU A 1 37  ? -61.612  35.321  -65.613 1.00 99.99  ? 41  GLU C OE2 1  
ATOM 245    N N   . GLY A 1 38  ? -57.801  32.721  -66.216 1.00 30.00  ? 42  GLY C N   1  
ATOM 246    C CA  . GLY A 1 38  ? -58.248  31.540  -65.481 1.00 30.00  ? 42  GLY C CA  1  
ATOM 247    C C   . GLY A 1 38  ? -59.487  30.909  -66.111 1.00 30.00  ? 42  GLY C C   1  
ATOM 248    O O   . GLY A 1 38  ? -59.565  29.680  -66.257 1.00 30.00  ? 42  GLY C O   1  
ATOM 249    N N   . PHE A 1 39  ? -60.451  31.757  -66.477 1.00 30.00  ? 43  PHE C N   1  
ATOM 250    C CA  . PHE A 1 39  ? -61.700  31.331  -67.101 1.00 30.00  ? 43  PHE C CA  1  
ATOM 251    C C   . PHE A 1 39  ? -62.201  32.460  -67.986 1.00 30.00  ? 43  PHE C C   1  
ATOM 252    O O   . PHE A 1 39  ? -62.059  33.631  -67.640 1.00 30.00  ? 43  PHE C O   1  
ATOM 253    C CB  . PHE A 1 39  ? -62.732  31.014  -66.026 1.00 99.99  ? 43  PHE C CB  1  
ATOM 254    C CG  . PHE A 1 39  ? -62.258  29.849  -65.197 1.00 99.99  ? 43  PHE C CG  1  
ATOM 255    C CD1 . PHE A 1 39  ? -61.463  30.069  -64.067 1.00 99.99  ? 43  PHE C CD1 1  
ATOM 256    C CD2 . PHE A 1 39  ? -62.612  28.540  -65.557 1.00 99.99  ? 43  PHE C CD2 1  
ATOM 257    C CE1 . PHE A 1 39  ? -61.022  28.987  -63.294 1.00 99.99  ? 43  PHE C CE1 1  
ATOM 258    C CE2 . PHE A 1 39  ? -62.170  27.458  -64.787 1.00 99.99  ? 43  PHE C CE2 1  
ATOM 259    C CZ  . PHE A 1 39  ? -61.377  27.681  -63.657 1.00 99.99  ? 43  PHE C CZ  1  
ATOM 260    N N   . ALA A 1 40  ? -62.786  32.114  -69.127 1.00 30.00  ? 44  ALA C N   1  
ATOM 261    C CA  . ALA A 1 40  ? -63.289  33.130  -70.034 1.00 30.00  ? 44  ALA C CA  1  
ATOM 262    C C   . ALA A 1 40  ? -64.753  32.953  -70.324 1.00 30.00  ? 44  ALA C C   1  
ATOM 263    O O   . ALA A 1 40  ? -65.261  31.828  -70.358 1.00 30.00  ? 44  ALA C O   1  
ATOM 264    C CB  . ALA A 1 40  ? -62.512  33.087  -71.328 1.00 30.00  ? 44  ALA C CB  1  
ATOM 265    N N   . SER A 1 41  ? -65.431  34.079  -70.528 1.00 30.00  ? 45  SER C N   1  
ATOM 266    C CA  . SER A 1 41  ? -66.853  34.095  -70.828 1.00 30.00  ? 45  SER C CA  1  
ATOM 267    C C   . SER A 1 41  ? -66.992  33.642  -72.264 1.00 30.00  ? 45  SER C C   1  
ATOM 268    O O   . SER A 1 41  ? -66.536  34.324  -73.187 1.00 30.00  ? 45  SER C O   1  
ATOM 269    C CB  . SER A 1 41  ? -67.407  35.504  -70.647 1.00 99.99  ? 45  SER C CB  1  
ATOM 270    O OG  . SER A 1 41  ? -66.865  36.362  -71.655 1.00 99.99  ? 45  SER C OG  1  
ATOM 271    N N   . ALA A 1 42  ? -67.621  32.489  -72.451 1.00 30.00  ? 46  ALA C N   1  
ATOM 272    C CA  . ALA A 1 42  ? -67.795  31.962  -73.788 1.00 30.00  ? 46  ALA C CA  1  
ATOM 273    C C   . ALA A 1 42  ? -69.244  31.720  -74.149 1.00 30.00  ? 46  ALA C C   1  
ATOM 274    O O   . ALA A 1 42  ? -70.109  31.582  -73.277 1.00 30.00  ? 46  ALA C O   1  
ATOM 275    C CB  . ALA A 1 42  ? -67.017  30.672  -73.922 1.00 30.00  ? 46  ALA C CB  1  
ATOM 276    N N   . GLU A 1 43  ? -69.487  31.688  -75.454 1.00 30.00  ? 47  GLU C N   1  
ATOM 277    C CA  . GLU A 1 43  ? -70.804  31.444  -76.028 1.00 30.00  ? 47  GLU C CA  1  
ATOM 278    C C   . GLU A 1 43  ? -70.602  30.334  -77.055 1.00 30.00  ? 47  GLU C C   1  
ATOM 279    O O   . GLU A 1 43  ? -69.926  30.543  -78.070 1.00 30.00  ? 47  GLU C O   1  
ATOM 280    C CB  . GLU A 1 43  ? -71.333  32.717  -76.681 1.00 99.99  ? 47  GLU C CB  1  
ATOM 281    C CG  . GLU A 1 43  ? -71.799  32.410  -78.082 1.00 99.99  ? 47  GLU C CG  1  
ATOM 282    C CD  . GLU A 1 43  ? -70.593  32.128  -78.974 1.00 99.99  ? 47  GLU C CD  1  
ATOM 283    O OE1 . GLU A 1 43  ? -70.195  30.937  -79.049 1.00 99.99  ? 47  GLU C OE1 1  
ATOM 284    O OE2 . GLU A 1 43  ? -70.077  33.112  -79.570 1.00 99.99  ? 47  GLU C OE2 1  
ATOM 285    N N   . ILE A 1 44  ? -71.179  29.163  -76.786 1.00 30.00  ? 48  ILE C N   1  
ATOM 286    C CA  . ILE A 1 44  ? -71.055  28.011  -77.684 1.00 30.00  ? 48  ILE C CA  1  
ATOM 287    C C   . ILE A 1 44  ? -71.565  28.252  -79.100 1.00 30.00  ? 48  ILE C C   1  
ATOM 288    O O   . ILE A 1 44  ? -72.562  28.940  -79.323 1.00 30.00  ? 48  ILE C O   1  
ATOM 289    C CB  . ILE A 1 44  ? -71.849  26.834  -77.130 1.00 99.99  ? 48  ILE C CB  1  
ATOM 290    C CG1 . ILE A 1 44  ? -73.322  26.994  -77.498 1.00 99.99  ? 48  ILE C CG1 1  
ATOM 291    C CG2 . ILE A 1 44  ? -71.710  26.793  -75.612 1.00 99.99  ? 48  ILE C CG2 1  
ATOM 292    C CD1 . ILE A 1 44  ? -74.054  27.709  -76.369 1.00 99.99  ? 48  ILE C CD1 1  
ATOM 293    N N   . GLN A 1 45  ? -70.866  27.662  -80.057 1.00 30.00  ? 49  GLN C N   1  
ATOM 294    C CA  . GLN A 1 45  ? -71.223  27.805  -81.456 1.00 30.00  ? 49  GLN C CA  1  
ATOM 295    C C   . GLN A 1 45  ? -71.622  26.479  -82.083 1.00 30.00  ? 49  GLN C C   1  
ATOM 296    O O   . GLN A 1 45  ? -72.644  26.394  -82.771 1.00 30.00  ? 49  GLN C O   1  
ATOM 297    C CB  . GLN A 1 45  ? -70.035  28.357  -82.239 1.00 99.99  ? 49  GLN C CB  1  
ATOM 298    C CG  . GLN A 1 45  ? -69.724  29.770  -81.762 1.00 99.99  ? 49  GLN C CG  1  
ATOM 299    C CD  . GLN A 1 45  ? -70.784  30.753  -82.230 1.00 99.99  ? 49  GLN C CD  1  
ATOM 300    O OE1 . GLN A 1 45  ? -71.741  30.369  -82.903 1.00 99.99  ? 49  GLN C OE1 1  
ATOM 301    N NE2 . GLN A 1 45  ? -70.621  32.028  -81.873 1.00 99.99  ? 49  GLN C NE2 1  
ATOM 302    N N   . SER A 1 46  ? -70.817  25.449  -81.836 1.00 30.00  ? 50  SER C N   1  
ATOM 303    C CA  . SER A 1 46  ? -71.077  24.142  -82.407 1.00 30.00  ? 50  SER C CA  1  
ATOM 304    C C   . SER A 1 46  ? -70.461  22.970  -81.664 1.00 30.00  ? 50  SER C C   1  
ATOM 305    O O   . SER A 1 46  ? -69.279  22.988  -81.334 1.00 30.00  ? 50  SER C O   1  
ATOM 306    C CB  . SER A 1 46  ? -70.529  24.078  -83.828 1.00 99.99  ? 50  SER C CB  1  
ATOM 307    O OG  . SER A 1 46  ? -70.809  22.795  -84.392 1.00 99.99  ? 50  SER C OG  1  
ATOM 308    N N   . SER A 1 47  ? -71.272  21.946  -81.419 1.00 30.00  ? 51  SER C N   1  
ATOM 309    C CA  . SER A 1 47  ? -70.804  20.747  -80.738 1.00 30.00  ? 51  SER C CA  1  
ATOM 310    C C   . SER A 1 47  ? -70.236  19.826  -81.820 1.00 30.00  ? 51  SER C C   1  
ATOM 311    O O   . SER A 1 47  ? -70.408  20.073  -83.012 1.00 30.00  ? 51  SER C O   1  
ATOM 312    C CB  . SER A 1 47  ? -71.966  20.077  -80.011 1.00 99.99  ? 51  SER C CB  1  
ATOM 313    O OG  . SER A 1 47  ? -72.889  19.550  -80.968 1.00 99.99  ? 51  SER C OG  1  
ATOM 314    N N   . LYS A 1 48  ? -69.566  18.765  -81.397 1.00 30.00  ? 52  LYS C N   1  
ATOM 315    C CA  . LYS A 1 48  ? -68.977  17.822  -82.320 1.00 30.00  ? 52  LYS C CA  1  
ATOM 316    C C   . LYS A 1 48  ? -68.382  16.696  -81.500 1.00 30.00  ? 52  LYS C C   1  
ATOM 317    O O   . LYS A 1 48  ? -67.172  16.505  -81.470 1.00 30.00  ? 52  LYS C O   1  
ATOM 318    C CB  . LYS A 1 48  ? -67.892  18.511  -83.143 1.00 99.99  ? 52  LYS C CB  1  
ATOM 319    C CG  . LYS A 1 48  ? -67.347  17.536  -84.183 1.00 99.99  ? 52  LYS C CG  1  
ATOM 320    C CD  . LYS A 1 48  ? -66.612  18.311  -85.271 1.00 99.99  ? 52  LYS C CD  1  
ATOM 321    C CE  . LYS A 1 48  ? -65.761  17.352  -86.093 1.00 99.99  ? 52  LYS C CE  1  
ATOM 322    N NZ  . LYS A 1 48  ? -66.520  16.909  -87.275 1.00 99.99  ? 52  LYS C NZ  1  
ATOM 323    N N   . GLY A 1 49  ? -69.252  15.949  -80.832 1.00 30.00  ? 53  GLY C N   1  
ATOM 324    C CA  . GLY A 1 49  ? -68.812  14.842  -80.007 1.00 30.00  ? 53  GLY C CA  1  
ATOM 325    C C   . GLY A 1 49  ? -68.369  15.371  -78.655 1.00 30.00  ? 53  GLY C C   1  
ATOM 326    O O   . GLY A 1 49  ? -69.141  15.409  -77.692 1.00 30.00  ? 53  GLY C O   1  
ATOM 327    N N   . ASP A 1 50  ? -67.106  15.781  -78.597 1.00 30.00  ? 54  ASP C N   1  
ATOM 328    C CA  . ASP A 1 50  ? -66.503  16.324  -77.391 1.00 30.00  ? 54  ASP C CA  1  
ATOM 329    C C   . ASP A 1 50  ? -65.903  17.679  -77.717 1.00 30.00  ? 54  ASP C C   1  
ATOM 330    O O   . ASP A 1 50  ? -65.700  18.512  -76.842 1.00 30.00  ? 54  ASP C O   1  
ATOM 331    C CB  . ASP A 1 50  ? -65.410  15.384  -76.888 1.00 99.99  ? 54  ASP C CB  1  
ATOM 332    C CG  . ASP A 1 50  ? -64.957  15.827  -75.503 1.00 99.99  ? 54  ASP C CG  1  
ATOM 333    O OD1 . ASP A 1 50  ? -64.143  16.789  -75.441 1.00 99.99  ? 54  ASP C OD1 1  
ATOM 334    O OD2 . ASP A 1 50  ? -65.424  15.202  -74.513 1.00 99.99  ? 54  ASP C OD2 1  
ATOM 335    N N   . GLU A 1 51  ? -65.624  17.899  -78.988 1.00 30.00  ? 55  GLU C N   1  
ATOM 336    C CA  . GLU A 1 51  ? -65.036  19.141  -79.420 1.00 30.00  ? 55  GLU C CA  1  
ATOM 337    C C   . GLU A 1 51  ? -66.045  20.242  -79.589 1.00 30.00  ? 55  GLU C C   1  
ATOM 338    O O   . GLU A 1 51  ? -66.651  20.371  -80.651 1.00 30.00  ? 55  GLU C O   1  
ATOM 339    C CB  . GLU A 1 51  ? -64.343  18.946  -80.764 1.00 99.99  ? 55  GLU C CB  1  
ATOM 340    C CG  . GLU A 1 51  ? -63.109  19.813  -80.824 1.00 99.99  ? 55  GLU C CG  1  
ATOM 341    C CD  . GLU A 1 51  ? -63.520  21.283  -80.793 1.00 99.99  ? 55  GLU C CD  1  
ATOM 342    O OE1 . GLU A 1 51  ? -63.618  21.834  -79.664 1.00 99.99  ? 55  GLU C OE1 1  
ATOM 343    O OE2 . GLU A 1 51  ? -63.733  21.846  -81.902 1.00 99.99  ? 55  GLU C OE2 1  
ATOM 344    N N   . ILE A 1 52  ? -66.220  21.041  -78.545 1.00 30.00  ? 56  ILE C N   1  
ATOM 345    C CA  . ILE A 1 52  ? -67.160  22.148  -78.598 1.00 30.00  ? 56  ILE C CA  1  
ATOM 346    C C   . ILE A 1 52  ? -66.390  23.326  -79.161 1.00 30.00  ? 56  ILE C C   1  
ATOM 347    O O   . ILE A 1 52  ? -65.200  23.456  -78.910 1.00 30.00  ? 56  ILE C O   1  
ATOM 348    C CB  . ILE A 1 52  ? -67.683  22.454  -77.200 1.00 99.99  ? 56  ILE C CB  1  
ATOM 349    C CG1 . ILE A 1 52  ? -66.726  23.409  -76.496 1.00 99.99  ? 56  ILE C CG1 1  
ATOM 350    C CG2 . ILE A 1 52  ? -67.785  21.156  -76.401 1.00 99.99  ? 56  ILE C CG2 1  
ATOM 351    C CD1 . ILE A 1 52  ? -67.209  24.845  -76.693 1.00 99.99  ? 56  ILE C CD1 1  
ATOM 352    N N   . THR A 1 53  ? -67.066  24.170  -79.925 1.00 30.00  ? 57  THR C N   1  
ATOM 353    C CA  . THR A 1 53  ? -66.452  25.349  -80.525 1.00 30.00  ? 57  THR C CA  1  
ATOM 354    C C   . THR A 1 53  ? -67.230  26.541  -79.991 1.00 30.00  ? 57  THR C C   1  
ATOM 355    O O   . THR A 1 53  ? -68.413  26.722  -80.301 1.00 30.00  ? 57  THR C O   1  
ATOM 356    C CB  . THR A 1 53  ? -66.547  25.265  -82.045 1.00 99.99  ? 57  THR C CB  1  
ATOM 357    O OG1 . THR A 1 53  ? -67.914  25.391  -82.445 1.00 99.99  ? 57  THR C OG1 1  
ATOM 358    C CG2 . THR A 1 53  ? -66.001  23.922  -82.516 1.00 99.99  ? 57  THR C CG2 1  
ATOM 359    N N   . VAL A 1 54  ? -66.544  27.350  -79.184 1.00 30.00  ? 58  VAL C N   1  
ATOM 360    C CA  . VAL A 1 54  ? -67.131  28.532  -78.560 1.00 30.00  ? 58  VAL C CA  1  
ATOM 361    C C   . VAL A 1 54  ? -66.547  29.820  -79.091 1.00 30.00  ? 58  VAL C C   1  
ATOM 362    O O   . VAL A 1 54  ? -65.539  29.814  -79.800 1.00 30.00  ? 58  VAL C O   1  
ATOM 363    C CB  . VAL A 1 54  ? -66.891  28.499  -77.055 1.00 99.99  ? 58  VAL C CB  1  
ATOM 364    C CG1 . VAL A 1 54  ? -67.534  27.247  -76.466 1.00 99.99  ? 58  VAL C CG1 1  
ATOM 365    C CG2 . VAL A 1 54  ? -65.392  28.480  -76.777 1.00 99.99  ? 58  VAL C CG2 1  
ATOM 366    N N   . LYS A 1 55  ? -67.184  30.929  -78.747 1.00 30.00  ? 59  LYS C N   1  
ATOM 367    C CA  . LYS A 1 55  ? -66.709  32.231  -79.166 1.00 30.00  ? 59  LYS C CA  1  
ATOM 368    C C   . LYS A 1 55  ? -66.452  33.005  -77.882 1.00 30.00  ? 59  LYS C C   1  
ATOM 369    O O   . LYS A 1 55  ? -67.291  32.996  -76.970 1.00 30.00  ? 59  LYS C O   1  
ATOM 370    C CB  . LYS A 1 55  ? -67.768  32.918  -80.019 1.00 99.99  ? 59  LYS C CB  1  
ATOM 371    C CG  . LYS A 1 55  ? -67.225  34.245  -80.538 1.00 99.99  ? 59  LYS C CG  1  
ATOM 372    C CD  . LYS A 1 55  ? -68.068  34.715  -81.718 1.00 99.99  ? 59  LYS C CD  1  
ATOM 373    C CE  . LYS A 1 55  ? -67.775  36.186  -82.001 1.00 99.99  ? 59  LYS C CE  1  
ATOM 374    N NZ  . LYS A 1 55  ? -66.731  36.291  -83.031 1.00 99.99  ? 59  LYS C NZ  1  
ATOM 375    N N   . ILE A 1 56  ? -65.294  33.655  -77.804 1.00 30.00  ? 60  ILE C N   1  
ATOM 376    C CA  . ILE A 1 56  ? -64.935  34.441  -76.622 1.00 30.00  ? 60  ILE C CA  1  
ATOM 377    C C   . ILE A 1 56  ? -65.642  35.797  -76.742 1.00 30.00  ? 60  ILE C C   1  
ATOM 378    O O   . ILE A 1 56  ? -65.402  36.549  -77.696 1.00 30.00  ? 60  ILE C O   1  
ATOM 379    C CB  . ILE A 1 56  ? -63.423  34.633  -76.566 1.00 99.99  ? 60  ILE C CB  1  
ATOM 380    C CG1 . ILE A 1 56  ? -63.036  35.854  -77.392 1.00 99.99  ? 60  ILE C CG1 1  
ATOM 381    C CG2 . ILE A 1 56  ? -62.733  33.396  -77.133 1.00 99.99  ? 60  ILE C CG2 1  
ATOM 382    C CD1 . ILE A 1 56  ? -62.948  37.075  -76.484 1.00 99.99  ? 60  ILE C CD1 1  
ATOM 383    N N   . VAL A 1 57  ? -66.516  36.097  -75.783 1.00 30.00  ? 61  VAL C N   1  
ATOM 384    C CA  . VAL A 1 57  ? -67.268  37.357  -75.785 1.00 30.00  ? 61  VAL C CA  1  
ATOM 385    C C   . VAL A 1 57  ? -66.403  38.617  -75.801 1.00 30.00  ? 61  VAL C C   1  
ATOM 386    O O   . VAL A 1 57  ? -66.766  39.621  -76.423 1.00 30.00  ? 61  VAL C O   1  
ATOM 387    C CB  . VAL A 1 57  ? -68.140  37.442  -74.536 1.00 99.99  ? 61  VAL C CB  1  
ATOM 388    C CG1 . VAL A 1 57  ? -68.880  38.778  -74.523 1.00 99.99  ? 61  VAL C CG1 1  
ATOM 389    C CG2 . VAL A 1 57  ? -69.152  36.302  -74.542 1.00 99.99  ? 61  VAL C CG2 1  
ATOM 390    N N   . ALA A 1 58  ? -65.268  38.547  -75.116 1.00 30.00  ? 62  ALA C N   1  
ATOM 391    C CA  . ALA A 1 58  ? -64.327  39.656  -75.027 1.00 30.00  ? 62  ALA C CA  1  
ATOM 392    C C   . ALA A 1 58  ? -63.764  40.097  -76.383 1.00 30.00  ? 62  ALA C C   1  
ATOM 393    O O   . ALA A 1 58  ? -64.275  41.028  -77.009 1.00 30.00  ? 62  ALA C O   1  
ATOM 394    C CB  . ALA A 1 58  ? -63.180  39.271  -74.086 1.00 30.00  ? 62  ALA C CB  1  
ATOM 395    N N   . ASP A 1 59  ? -62.707  39.426  -76.832 1.00 30.00  ? 63  ASP C N   1  
ATOM 396    C CA  . ASP A 1 59  ? -62.064  39.750  -78.102 1.00 30.00  ? 63  ASP C CA  1  
ATOM 397    C C   . ASP A 1 59  ? -62.850  39.291  -79.324 1.00 30.00  ? 63  ASP C C   1  
ATOM 398    O O   . ASP A 1 59  ? -62.612  39.759  -80.440 1.00 30.00  ? 63  ASP C O   1  
ATOM 399    C CB  . ASP A 1 59  ? -60.691  39.089  -78.175 1.00 99.99  ? 63  ASP C CB  1  
ATOM 400    C CG  . ASP A 1 59  ? -59.929  39.630  -79.383 1.00 99.99  ? 63  ASP C CG  1  
ATOM 401    O OD1 . ASP A 1 59  ? -60.216  39.141  -80.511 1.00 99.99  ? 63  ASP C OD1 1  
ATOM 402    O OD2 . ASP A 1 59  ? -59.067  40.523  -79.169 1.00 99.99  ? 63  ASP C OD2 1  
ATOM 403    N N   . SER A 1 60  ? -63.787  38.370  -79.102 1.00 30.00  ? 64  SER C N   1  
ATOM 404    C CA  . SER A 1 60  ? -64.619  37.823  -80.166 1.00 30.00  ? 64  SER C CA  1  
ATOM 405    C C   . SER A 1 60  ? -63.847  36.810  -81.024 1.00 30.00  ? 64  SER C C   1  
ATOM 406    O O   . SER A 1 60  ? -64.165  36.592  -82.192 1.00 30.00  ? 64  SER C O   1  
ATOM 407    C CB  . SER A 1 60  ? -65.104  38.944  -81.076 1.00 99.99  ? 64  SER C CB  1  
ATOM 408    O OG  . SER A 1 60  ? -65.938  38.403  -82.101 1.00 99.99  ? 64  SER C OG  1  
ATOM 409    N N   . SER A 1 61  ? -62.829  36.197  -80.428 1.00 30.00  ? 65  SER C N   1  
ATOM 410    C CA  . SER A 1 61  ? -62.029  35.204  -81.121 1.00 30.00  ? 65  SER C CA  1  
ATOM 411    C C   . SER A 1 61  ? -62.786  33.876  -81.008 1.00 30.00  ? 65  SER C C   1  
ATOM 412    O O   . SER A 1 61  ? -63.860  33.826  -80.398 1.00 30.00  ? 65  SER C O   1  
ATOM 413    C CB  . SER A 1 61  ? -60.654  35.101  -80.472 1.00 99.99  ? 65  SER C CB  1  
ATOM 414    O OG  . SER A 1 61  ? -60.007  36.374  -80.523 1.00 99.99  ? 65  SER C OG  1  
ATOM 415    N N   . THR A 1 62  ? -62.240  32.805  -81.584 1.00 30.00  ? 66  THR C N   1  
ATOM 416    C CA  . THR A 1 62  ? -62.895  31.491  -81.537 1.00 30.00  ? 66  THR C CA  1  
ATOM 417    C C   . THR A 1 62  ? -61.942  30.372  -81.190 1.00 30.00  ? 66  THR C C   1  
ATOM 418    O O   . THR A 1 62  ? -60.749  30.452  -81.463 1.00 30.00  ? 66  THR C O   1  
ATOM 419    C CB  . THR A 1 62  ? -63.511  31.170  -82.894 1.00 99.99  ? 66  THR C CB  1  
ATOM 420    O OG1 . THR A 1 62  ? -64.165  29.900  -82.830 1.00 99.99  ? 66  THR C OG1 1  
ATOM 421    C CG2 . THR A 1 62  ? -62.412  31.122  -83.951 1.00 99.99  ? 66  THR C CG2 1  
ATOM 422    N N   . ARG A 1 63  ? -62.493  29.317  -80.595 1.00 30.00  ? 67  ARG C N   1  
ATOM 423    C CA  . ARG A 1 63  ? -61.687  28.164  -80.226 1.00 30.00  ? 67  ARG C CA  1  
ATOM 424    C C   . ARG A 1 63  ? -62.536  26.969  -79.822 1.00 30.00  ? 67  ARG C C   1  
ATOM 425    O O   . ARG A 1 63  ? -63.747  27.076  -79.653 1.00 30.00  ? 67  ARG C O   1  
ATOM 426    C CB  . ARG A 1 63  ? -60.786  28.517  -79.045 1.00 99.99  ? 67  ARG C CB  1  
ATOM 427    C CG  . ARG A 1 63  ? -61.640  28.738  -77.801 1.00 99.99  ? 67  ARG C CG  1  
ATOM 428    C CD  . ARG A 1 63  ? -60.739  28.821  -76.574 1.00 99.99  ? 67  ARG C CD  1  
ATOM 429    N NE  . ARG A 1 63  ? -61.523  29.154  -75.364 1.00 99.99  ? 67  ARG C NE  1  
ATOM 430    C CZ  . ARG A 1 63  ? -60.963  29.383  -74.177 1.00 99.99  ? 67  ARG C CZ  1  
ATOM 431    N NH1 . ARG A 1 63  ? -59.646  29.320  -73.998 1.00 99.99  ? 67  ARG C NH1 1  
ATOM 432    N NH2 . ARG A 1 63  ? -61.762  29.675  -73.156 1.00 99.99  ? 67  ARG C NH2 1  
ATOM 433    N N   . THR A 1 64  ? -61.867  25.835  -79.678 1.00 30.00  ? 68  THR C N   1  
ATOM 434    C CA  . THR A 1 64  ? -62.519  24.593  -79.307 1.00 30.00  ? 68  THR C CA  1  
ATOM 435    C C   . THR A 1 64  ? -62.155  24.269  -77.866 1.00 30.00  ? 68  THR C C   1  
ATOM 436    O O   . THR A 1 64  ? -61.161  24.777  -77.368 1.00 30.00  ? 68  THR C O   1  
ATOM 437    C CB  . THR A 1 64  ? -62.050  23.467  -80.222 1.00 99.99  ? 68  THR C CB  1  
ATOM 438    O OG1 . THR A 1 64  ? -60.671  23.186  -79.966 1.00 99.99  ? 68  THR C OG1 1  
ATOM 439    C CG2 . THR A 1 64  ? -62.217  23.894  -81.677 1.00 99.99  ? 68  THR C CG2 1  
ATOM 440    N N   . VAL A 1 65  ? -62.945  23.430  -77.201 1.00 30.00  ? 69  VAL C N   1  
ATOM 441    C CA  . VAL A 1 65  ? -62.680  23.079  -75.809 1.00 30.00  ? 69  VAL C CA  1  
ATOM 442    C C   . VAL A 1 65  ? -63.353  21.777  -75.442 1.00 30.00  ? 69  VAL C C   1  
ATOM 443    O O   . VAL A 1 65  ? -64.523  21.606  -75.745 1.00 30.00  ? 69  VAL C O   1  
ATOM 444    C CB  . VAL A 1 65  ? -63.204  24.173  -74.887 1.00 99.99  ? 69  VAL C CB  1  
ATOM 445    C CG1 . VAL A 1 65  ? -62.506  25.491  -75.215 1.00 99.99  ? 69  VAL C CG1 1  
ATOM 446    C CG2 . VAL A 1 65  ? -64.707  24.330  -75.087 1.00 99.99  ? 69  VAL C CG2 1  
ATOM 447    N N   . LYS A 1 66  ? -62.648  20.859  -74.799 1.00 30.00  ? 70  LYS C N   1  
ATOM 448    C CA  . LYS A 1 66  ? -63.277  19.599  -74.413 1.00 30.00  ? 70  LYS C CA  1  
ATOM 449    C C   . LYS A 1 66  ? -64.620  19.941  -73.773 1.00 30.00  ? 70  LYS C C   1  
ATOM 450    O O   . LYS A 1 66  ? -64.762  20.955  -73.098 1.00 30.00  ? 70  LYS C O   1  
ATOM 451    C CB  . LYS A 1 66  ? -62.388  18.858  -73.420 1.00 99.99  ? 70  LYS C CB  1  
ATOM 452    C CG  . LYS A 1 66  ? -63.027  17.522  -73.061 1.00 99.99  ? 70  LYS C CG  1  
ATOM 453    C CD  . LYS A 1 66  ? -62.200  16.838  -71.978 1.00 99.99  ? 70  LYS C CD  1  
ATOM 454    C CE  . LYS A 1 66  ? -63.032  15.741  -71.321 1.00 99.99  ? 70  LYS C CE  1  
ATOM 455    N NZ  . LYS A 1 66  ? -63.642  14.901  -72.363 1.00 99.99  ? 70  LYS C NZ  1  
ATOM 456    N N   . LYS A 1 67  ? -65.614  19.095  -73.995 1.00 30.00  ? 71  LYS C N   1  
ATOM 457    C CA  . LYS A 1 67  ? -66.939  19.333  -73.453 1.00 30.00  ? 71  LYS C CA  1  
ATOM 458    C C   . LYS A 1 67  ? -66.938  19.275  -71.941 1.00 30.00  ? 71  LYS C C   1  
ATOM 459    O O   . LYS A 1 67  ? -67.665  20.015  -71.281 1.00 30.00  ? 71  LYS C O   1  
ATOM 460    C CB  . LYS A 1 67  ? -67.911  18.278  -73.971 1.00 99.99  ? 71  LYS C CB  1  
ATOM 461    C CG  . LYS A 1 67  ? -69.317  18.593  -73.477 1.00 99.99  ? 71  LYS C CG  1  
ATOM 462    C CD  . LYS A 1 67  ? -70.336  17.839  -74.327 1.00 99.99  ? 71  LYS C CD  1  
ATOM 463    C CE  . LYS A 1 67  ? -71.689  17.847  -73.624 1.00 99.99  ? 71  LYS C CE  1  
ATOM 464    N NZ  . LYS A 1 67  ? -72.492  18.974  -74.118 1.00 99.99  ? 71  LYS C NZ  1  
ATOM 465    N N   . ASP A 1 68  ? -66.118  18.396  -71.383 1.00 30.00  ? 72  ASP C N   1  
ATOM 466    C CA  . ASP A 1 68  ? -66.054  18.255  -69.941 1.00 30.00  ? 72  ASP C CA  1  
ATOM 467    C C   . ASP A 1 68  ? -65.162  19.287  -69.262 1.00 30.00  ? 72  ASP C C   1  
ATOM 468    O O   . ASP A 1 68  ? -64.790  19.106  -68.110 1.00 30.00  ? 72  ASP C O   1  
ATOM 469    C CB  . ASP A 1 68  ? -65.501  16.880  -69.578 1.00 99.99  ? 72  ASP C CB  1  
ATOM 470    C CG  . ASP A 1 68  ? -65.666  16.641  -68.079 1.00 99.99  ? 72  ASP C CG  1  
ATOM 471    O OD1 . ASP A 1 68  ? -64.818  17.175  -67.314 1.00 99.99  ? 72  ASP C OD1 1  
ATOM 472    O OD2 . ASP A 1 68  ? -66.639  15.931  -67.711 1.00 99.99  ? 72  ASP C OD2 1  
ATOM 473    N N   . ASP A 1 69  ? -64.824  20.362  -69.973 1.00 30.00  ? 73  ASP C N   1  
ATOM 474    C CA  . ASP A 1 69  ? -63.968  21.430  -69.440 1.00 30.00  ? 73  ASP C CA  1  
ATOM 475    C C   . ASP A 1 69  ? -64.752  22.737  -69.406 1.00 30.00  ? 73  ASP C C   1  
ATOM 476    O O   . ASP A 1 69  ? -64.233  23.788  -69.030 1.00 30.00  ? 73  ASP C O   1  
ATOM 477    C CB  . ASP A 1 69  ? -62.739  21.599  -70.326 1.00 99.99  ? 73  ASP C CB  1  
ATOM 478    C CG  . ASP A 1 69  ? -61.846  20.369  -70.201 1.00 99.99  ? 73  ASP C CG  1  
ATOM 479    O OD1 . ASP A 1 69  ? -61.216  20.219  -69.121 1.00 99.99  ? 73  ASP C OD1 1  
ATOM 480    O OD2 . ASP A 1 69  ? -61.807  19.584  -71.188 1.00 99.99  ? 73  ASP C OD2 1  
ATOM 481    N N   . ILE A 1 70  ? -66.003  22.672  -69.826 1.00 30.00  ? 74  ILE C N   1  
ATOM 482    C CA  . ILE A 1 70  ? -66.853  23.844  -69.826 1.00 30.00  ? 74  ILE C CA  1  
ATOM 483    C C   . ILE A 1 70  ? -67.390  23.879  -68.399 1.00 30.00  ? 74  ILE C C   1  
ATOM 484    O O   . ILE A 1 70  ? -67.596  22.825  -67.772 1.00 30.00  ? 74  ILE C O   1  
ATOM 485    C CB  . ILE A 1 70  ? -67.961  23.682  -70.863 1.00 99.99  ? 74  ILE C CB  1  
ATOM 486    C CG1 . ILE A 1 70  ? -69.135  22.934  -70.242 1.00 99.99  ? 74  ILE C CG1 1  
ATOM 487    C CG2 . ILE A 1 70  ? -67.427  22.893  -72.055 1.00 99.99  ? 74  ILE C CG2 1  
ATOM 488    C CD1 . ILE A 1 70  ? -70.153  23.938  -69.711 1.00 99.99  ? 74  ILE C CD1 1  
ATOM 489    N N   . GLN A 1 71  ? -67.603  25.084  -67.886 1.00 30.00  ? 75  GLN C N   1  
ATOM 490    C CA  . GLN A 1 71  ? -68.113  25.251  -66.534 1.00 30.00  ? 75  GLN C CA  1  
ATOM 491    C C   . GLN A 1 71  ? -69.427  25.989  -66.661 1.00 30.00  ? 75  GLN C C   1  
ATOM 492    O O   . GLN A 1 71  ? -69.548  26.910  -67.483 1.00 30.00  ? 75  GLN C O   1  
ATOM 493    C CB  . GLN A 1 71  ? -67.120  26.051  -65.699 1.00 99.99  ? 75  GLN C CB  1  
ATOM 494    C CG  . GLN A 1 71  ? -65.830  25.255  -65.541 1.00 99.99  ? 75  GLN C CG  1  
ATOM 495    C CD  . GLN A 1 71  ? -66.022  24.075  -64.600 1.00 99.99  ? 75  GLN C CD  1  
ATOM 496    O OE1 . GLN A 1 71  ? -67.116  23.864  -64.078 1.00 99.99  ? 75  GLN C OE1 1  
ATOM 497    N NE2 . GLN A 1 71  ? -64.957  23.302  -64.382 1.00 99.99  ? 75  GLN C NE2 1  
ATOM 498    N N   . SER A 1 72  ? -70.408  25.600  -65.858 1.00 30.00  ? 76  SER C N   1  
ATOM 499    C CA  . SER A 1 72  ? -71.708  26.260  -65.910 1.00 30.00  ? 76  SER C CA  1  
ATOM 500    C C   . SER A 1 72  ? -71.641  27.704  -65.385 1.00 30.00  ? 76  SER C C   1  
ATOM 501    O O   . SER A 1 72  ? -71.095  27.955  -64.311 1.00 30.00  ? 76  SER C O   1  
ATOM 502    C CB  . SER A 1 72  ? -72.713  25.493  -65.057 1.00 99.99  ? 76  SER C CB  1  
ATOM 503    O OG  . SER A 1 72  ? -72.358  25.612  -63.677 1.00 99.99  ? 76  SER C OG  1  
ATOM 504    N N   . MET A 1 73  ? -71.688  28.742  -65.957 1.00 30.00  ? 77  MET C N   1  
ATOM 505    C CA  . MET A 1 73  ? -71.820  30.170  -65.627 1.00 30.00  ? 77  MET C CA  1  
ATOM 506    C C   . MET A 1 73  ? -73.082  30.381  -64.791 1.00 30.00  ? 77  MET C C   1  
ATOM 507    O O   . MET A 1 73  ? -74.001  29.571  -64.843 1.00 30.00  ? 77  MET C O   1  
ATOM 508    C CB  . MET A 1 73  ? -71.917  30.990  -66.907 1.00 99.99  ? 77  MET C CB  1  
ATOM 509    C CG  . MET A 1 73  ? -71.977  32.475  -66.556 1.00 99.99  ? 77  MET C CG  1  
ATOM 510    S SD  . MET A 1 73  ? -71.765  33.474  -68.051 1.00 99.99  ? 77  MET C SD  1  
ATOM 511    C CE  . MET A 1 73  ? -71.968  35.103  -67.365 1.00 99.99  ? 77  MET C CE  1  
ATOM 512    N N   . ASN A 1 74  ? -73.133  31.464  -64.016 1.00 30.00  ? 78  ASN C N   1  
ATOM 513    C CA  . ASN A 1 74  ? -74.321  31.739  -63.204 1.00 30.00  ? 78  ASN C CA  1  
ATOM 514    C C   . ASN A 1 74  ? -75.079  32.860  -63.933 1.00 30.00  ? 78  ASN C C   1  
ATOM 515    O O   . ASN A 1 74  ? -74.469  33.676  -64.645 1.00 30.00  ? 78  ASN C O   1  
ATOM 516    C CB  . ASN A 1 74  ? -73.903  32.180  -61.806 1.00 99.99  ? 78  ASN C CB  1  
ATOM 517    C CG  . ASN A 1 74  ? -73.152  31.072  -61.082 1.00 99.99  ? 78  ASN C CG  1  
ATOM 518    O OD1 . ASN A 1 74  ? -73.647  29.953  -60.969 1.00 99.99  ? 78  ASN C OD1 1  
ATOM 519    N ND2 . ASN A 1 74  ? -71.951  31.385  -60.593 1.00 99.99  ? 78  ASN C ND2 1  
ATOM 520    N N   . PRO A 1 75  ? -76.412  32.899  -63.784 1.00 30.00  ? 79  PRO C N   1  
ATOM 521    C CA  . PRO A 1 75  ? -77.250  33.926  -64.430 1.00 30.00  ? 79  PRO C CA  1  
ATOM 522    C C   . PRO A 1 75  ? -77.040  35.305  -63.802 1.00 30.00  ? 79  PRO C C   1  
ATOM 523    O O   . PRO A 1 75  ? -76.688  35.402  -62.622 1.00 30.00  ? 79  PRO C O   1  
ATOM 524    C CB  . PRO A 1 75  ? -78.584  33.345  -64.105 1.00 99.99  ? 79  PRO C CB  1  
ATOM 525    C CG  . PRO A 1 75  ? -78.311  32.052  -63.375 1.00 99.99  ? 79  PRO C CG  1  
ATOM 526    C CD  . PRO A 1 75  ? -77.069  31.788  -63.245 1.00 99.99  ? 79  PRO C CD  1  
ATOM 527    N N   . PRO A 1 76  ? -77.258  36.385  -64.570 1.00 30.00  ? 80  PRO C N   1  
ATOM 528    C CA  . PRO A 1 76  ? -77.073  37.731  -64.017 1.00 30.00  ? 80  PRO C CA  1  
ATOM 529    C C   . PRO A 1 76  ? -77.804  37.966  -62.682 1.00 30.00  ? 80  PRO C C   1  
ATOM 530    O O   . PRO A 1 76  ? -77.611  38.978  -62.016 1.00 30.00  ? 80  PRO C O   1  
ATOM 531    C CB  . PRO A 1 76  ? -77.687  38.507  -65.128 1.00 99.99  ? 80  PRO C CB  1  
ATOM 532    C CG  . PRO A 1 76  ? -78.083  37.493  -66.178 1.00 99.99  ? 80  PRO C CG  1  
ATOM 533    C CD  . PRO A 1 76  ? -77.788  36.292  -65.866 1.00 99.99  ? 80  PRO C CD  1  
ATOM 534    N N   . LYS A 1 77  ? -78.639  37.008  -62.307 1.00 30.00  ? 81  LYS C N   1  
ATOM 535    C CA  . LYS A 1 77  ? -79.407  37.052  -61.061 1.00 30.00  ? 81  LYS C CA  1  
ATOM 536    C C   . LYS A 1 77  ? -78.440  37.165  -59.868 1.00 30.00  ? 81  LYS C C   1  
ATOM 537    O O   . LYS A 1 77  ? -78.746  37.813  -58.869 1.00 30.00  ? 81  LYS C O   1  
ATOM 538    C CB  . LYS A 1 77  ? -80.239  35.781  -60.918 1.00 99.99  ? 81  LYS C CB  1  
ATOM 539    C CG  . LYS A 1 77  ? -81.108  35.879  -59.669 1.00 99.99  ? 81  LYS C CG  1  
ATOM 540    C CD  . LYS A 1 77  ? -82.234  34.856  -59.752 1.00 99.99  ? 81  LYS C CD  1  
ATOM 541    C CE  . LYS A 1 77  ? -82.875  34.690  -58.377 1.00 99.99  ? 81  LYS C CE  1  
ATOM 542    N NZ  . LYS A 1 77  ? -84.036  35.584  -58.264 1.00 99.99  ? 81  LYS C NZ  1  
ATOM 543    N N   . PHE A 1 78  ? -77.270  36.538  -59.977 1.00 30.00  ? 82  PHE C N   1  
ATOM 544    C CA  . PHE A 1 78  ? -76.279  36.577  -58.902 1.00 30.00  ? 82  PHE C CA  1  
ATOM 545    C C   . PHE A 1 78  ? -75.049  37.442  -59.181 1.00 30.00  ? 82  PHE C C   1  
ATOM 546    O O   . PHE A 1 78  ? -73.926  37.005  -58.978 1.00 30.00  ? 82  PHE C O   1  
ATOM 547    C CB  . PHE A 1 78  ? -75.763  35.170  -58.621 1.00 99.99  ? 82  PHE C CB  1  
ATOM 548    C CG  . PHE A 1 78  ? -76.894  34.305  -58.124 1.00 99.99  ? 82  PHE C CG  1  
ATOM 549    C CD1 . PHE A 1 78  ? -77.693  33.603  -59.035 1.00 99.99  ? 82  PHE C CD1 1  
ATOM 550    C CD2 . PHE A 1 78  ? -77.147  34.204  -56.749 1.00 99.99  ? 82  PHE C CD2 1  
ATOM 551    C CE1 . PHE A 1 78  ? -78.743  32.800  -58.572 1.00 99.99  ? 82  PHE C CE1 1  
ATOM 552    C CE2 . PHE A 1 78  ? -78.198  33.404  -56.287 1.00 99.99  ? 82  PHE C CE2 1  
ATOM 553    C CZ  . PHE A 1 78  ? -78.994  32.701  -57.197 1.00 99.99  ? 82  PHE C CZ  1  
ATOM 554    N N   . GLU A 1 79  ? -75.263  38.666  -59.649 1.00 30.00  ? 83  GLU C N   1  
ATOM 555    C CA  . GLU A 1 79  ? -74.158  39.575  -59.924 1.00 30.00  ? 83  GLU C CA  1  
ATOM 556    C C   . GLU A 1 79  ? -73.646  40.099  -58.580 1.00 30.00  ? 83  GLU C C   1  
ATOM 557    O O   . GLU A 1 79  ? -74.449  40.427  -57.707 1.00 30.00  ? 83  GLU C O   1  
ATOM 558    C CB  . GLU A 1 79  ? -74.644  40.734  -60.790 1.00 99.99  ? 83  GLU C CB  1  
ATOM 559    C CG  . GLU A 1 79  ? -73.477  41.316  -61.551 1.00 99.99  ? 83  GLU C CG  1  
ATOM 560    C CD  . GLU A 1 79  ? -72.763  42.342  -60.676 1.00 99.99  ? 83  GLU C CD  1  
ATOM 561    O OE1 . GLU A 1 79  ? -71.827  41.925  -59.945 1.00 99.99  ? 83  GLU C OE1 1  
ATOM 562    O OE2 . GLU A 1 79  ? -73.157  43.538  -60.748 1.00 99.99  ? 83  GLU C OE2 1  
ATOM 563    N N   . LYS A 1 80  ? -72.326  40.170  -58.408 1.00 30.00  ? 84  LYS C N   1  
ATOM 564    C CA  . LYS A 1 80  ? -71.736  40.656  -57.154 1.00 30.00  ? 84  LYS C CA  1  
ATOM 565    C C   . LYS A 1 80  ? -72.458  40.145  -55.899 1.00 30.00  ? 84  LYS C C   1  
ATOM 566    O O   . LYS A 1 80  ? -72.591  40.871  -54.915 1.00 30.00  ? 84  LYS C O   1  
ATOM 567    C CB  . LYS A 1 80  ? -71.781  42.180  -57.115 1.00 99.99  ? 84  LYS C CB  1  
ATOM 568    C CG  . LYS A 1 80  ? -70.731  42.748  -58.062 1.00 99.99  ? 84  LYS C CG  1  
ATOM 569    C CD  . LYS A 1 80  ? -70.708  44.266  -57.949 1.00 99.99  ? 84  LYS C CD  1  
ATOM 570    C CE  . LYS A 1 80  ? -71.597  44.871  -59.031 1.00 99.99  ? 84  LYS C CE  1  
ATOM 571    N NZ  . LYS A 1 80  ? -71.322  46.309  -59.144 1.00 99.99  ? 84  LYS C NZ  1  
ATOM 572    N N   . LEU A 1 81  ? -72.926  38.905  -55.930 1.00 30.00  ? 85  LEU C N   1  
ATOM 573    C CA  . LEU A 1 81  ? -73.635  38.342  -54.788 1.00 30.00  ? 85  LEU C CA  1  
ATOM 574    C C   . LEU A 1 81  ? -72.872  38.450  -53.451 1.00 30.00  ? 85  LEU C C   1  
ATOM 575    O O   . LEU A 1 81  ? -71.665  38.202  -53.393 1.00 30.00  ? 85  LEU C O   1  
ATOM 576    C CB  . LEU A 1 81  ? -73.903  36.860  -55.024 1.00 99.99  ? 85  LEU C CB  1  
ATOM 577    C CG  . LEU A 1 81  ? -72.623  36.064  -54.786 1.00 99.99  ? 85  LEU C CG  1  
ATOM 578    C CD1 . LEU A 1 81  ? -71.424  36.890  -55.239 1.00 99.99  ? 85  LEU C CD1 1  
ATOM 579    C CD2 . LEU A 1 81  ? -72.493  35.746  -53.301 1.00 99.99  ? 85  LEU C CD2 1  
ATOM 580    N N   . GLU A 1 82  ? -73.588  38.804  -52.381 1.00 30.00  ? 86  GLU C N   1  
ATOM 581    C CA  . GLU A 1 82  ? -72.984  38.946  -51.062 1.00 30.00  ? 86  GLU C CA  1  
ATOM 582    C C   . GLU A 1 82  ? -72.669  37.602  -50.445 1.00 30.00  ? 86  GLU C C   1  
ATOM 583    O O   . GLU A 1 82  ? -71.654  37.465  -49.753 1.00 30.00  ? 86  GLU C O   1  
ATOM 584    C CB  . GLU A 1 82  ? -73.938  39.688  -50.132 1.00 99.99  ? 86  GLU C CB  1  
ATOM 585    C CG  . GLU A 1 82  ? -74.138  41.099  -50.633 1.00 99.99  ? 86  GLU C CG  1  
ATOM 586    C CD  . GLU A 1 82  ? -72.871  41.911  -50.388 1.00 99.99  ? 86  GLU C CD  1  
ATOM 587    O OE1 . GLU A 1 82  ? -72.002  41.915  -51.300 1.00 99.99  ? 86  GLU C OE1 1  
ATOM 588    O OE2 . GLU A 1 82  ? -72.780  42.522  -49.288 1.00 99.99  ? 86  GLU C OE2 1  
ATOM 589    N N   . ASP A 1 83  ? -73.514  36.598  -50.671 1.00 30.00  ? 87  ASP C N   1  
ATOM 590    C CA  . ASP A 1 83  ? -73.229  35.251  -50.143 1.00 30.00  ? 87  ASP C CA  1  
ATOM 591    C C   . ASP A 1 83  ? -73.209  34.257  -51.310 1.00 30.00  ? 87  ASP C C   1  
ATOM 592    O O   . ASP A 1 83  ? -74.225  33.995  -51.950 1.00 30.00  ? 87  ASP C O   1  
ATOM 593    C CB  . ASP A 1 83  ? -74.308  34.846  -49.144 1.00 99.99  ? 87  ASP C CB  1  
ATOM 594    C CG  . ASP A 1 83  ? -73.883  33.571  -48.420 1.00 99.99  ? 87  ASP C CG  1  
ATOM 595    O OD1 . ASP A 1 83  ? -74.046  32.480  -49.028 1.00 99.99  ? 87  ASP C OD1 1  
ATOM 596    O OD2 . ASP A 1 83  ? -73.392  33.698  -47.267 1.00 99.99  ? 87  ASP C OD2 1  
ATOM 597    N N   . MET A 1 84  ? -72.030  33.707  -51.577 1.00 30.00  ? 88  MET C N   1  
ATOM 598    C CA  . MET A 1 84  ? -71.850  32.773  -52.670 1.00 30.00  ? 88  MET C CA  1  
ATOM 599    C C   . MET A 1 84  ? -72.486  31.405  -52.531 1.00 30.00  ? 88  MET C C   1  
ATOM 600    O O   . MET A 1 84  ? -72.665  30.709  -53.520 1.00 30.00  ? 88  MET C O   1  
ATOM 601    C CB  . MET A 1 84  ? -70.366  32.504  -52.882 1.00 99.99  ? 88  MET C CB  1  
ATOM 602    C CG  . MET A 1 84  ? -69.613  33.824  -52.969 1.00 99.99  ? 88  MET C CG  1  
ATOM 603    S SD  . MET A 1 84  ? -69.793  34.534  -54.624 1.00 99.99  ? 88  MET C SD  1  
ATOM 604    C CE  . MET A 1 84  ? -68.667  33.499  -55.530 1.00 99.99  ? 88  MET C CE  1  
ATOM 605    N N   . ALA A 1 85  ? -72.822  31.009  -51.313 1.00 30.00  ? 89  ALA C N   1  
ATOM 606    C CA  . ALA A 1 85  ? -73.443  29.717  -51.108 1.00 30.00  ? 89  ALA C CA  1  
ATOM 607    C C   . ALA A 1 85  ? -74.832  29.741  -51.774 1.00 30.00  ? 89  ALA C C   1  
ATOM 608    O O   . ALA A 1 85  ? -75.414  28.694  -52.071 1.00 30.00  ? 89  ALA C O   1  
ATOM 609    C CB  . ALA A 1 85  ? -73.567  29.439  -49.623 1.00 30.00  ? 89  ALA C CB  1  
ATOM 610    N N   . ASN A 1 86  ? -75.344  30.943  -52.018 1.00 30.00  ? 90  ASN C N   1  
ATOM 611    C CA  . ASN A 1 86  ? -76.653  31.138  -52.647 1.00 30.00  ? 90  ASN C CA  1  
ATOM 612    C C   . ASN A 1 86  ? -76.628  31.135  -54.180 1.00 30.00  ? 90  ASN C C   1  
ATOM 613    O O   . ASN A 1 86  ? -77.654  31.350  -54.822 1.00 30.00  ? 90  ASN C O   1  
ATOM 614    C CB  . ASN A 1 86  ? -77.240  32.478  -52.219 1.00 99.99  ? 90  ASN C CB  1  
ATOM 615    C CG  . ASN A 1 86  ? -77.486  32.518  -50.719 1.00 99.99  ? 90  ASN C CG  1  
ATOM 616    O OD1 . ASN A 1 86  ? -78.161  31.648  -50.175 1.00 99.99  ? 90  ASN C OD1 1  
ATOM 617    N ND2 . ASN A 1 86  ? -76.938  33.535  -50.050 1.00 99.99  ? 90  ASN C ND2 1  
ATOM 618    N N   . MET A 1 87  ? -75.457  30.909  -54.760 1.00 30.00  ? 91  MET C N   1  
ATOM 619    C CA  . MET A 1 87  ? -75.309  30.876  -56.213 1.00 30.00  ? 91  MET C CA  1  
ATOM 620    C C   . MET A 1 87  ? -75.681  29.492  -56.718 1.00 30.00  ? 91  MET C C   1  
ATOM 621    O O   . MET A 1 87  ? -75.587  28.509  -55.974 1.00 30.00  ? 91  MET C O   1  
ATOM 622    C CB  . MET A 1 87  ? -73.865  31.187  -56.593 1.00 99.99  ? 91  MET C CB  1  
ATOM 623    C CG  . MET A 1 87  ? -73.411  32.453  -55.878 1.00 99.99  ? 91  MET C CG  1  
ATOM 624    S SD  . MET A 1 87  ? -74.029  33.914  -56.747 1.00 99.99  ? 91  MET C SD  1  
ATOM 625    C CE  . MET A 1 87  ? -72.913  33.946  -58.133 1.00 99.99  ? 91  MET C CE  1  
ATOM 626    N N   . THR A 1 88  ? -76.098  29.422  -57.984 1.00 30.00  ? 92  THR C N   1  
ATOM 627    C CA  . THR A 1 88  ? -76.468  28.131  -58.574 1.00 30.00  ? 92  THR C CA  1  
ATOM 628    C C   . THR A 1 88  ? -75.184  27.323  -58.703 1.00 30.00  ? 92  THR C C   1  
ATOM 629    O O   . THR A 1 88  ? -75.118  26.173  -58.252 1.00 30.00  ? 92  THR C O   1  
ATOM 630    C CB  . THR A 1 88  ? -77.107  28.350  -59.941 1.00 99.99  ? 92  THR C CB  1  
ATOM 631    O OG1 . THR A 1 88  ? -76.122  28.840  -60.854 1.00 99.99  ? 92  THR C OG1 1  
ATOM 632    C CG2 . THR A 1 88  ? -78.233  29.369  -59.818 1.00 99.99  ? 92  THR C CG2 1  
ATOM 633    N N   . TYR A 1 89  ? -74.164  27.939  -59.314 1.00 30.00  ? 93  TYR C N   1  
ATOM 634    C CA  . TYR A 1 89  ? -72.872  27.285  -59.512 1.00 30.00  ? 93  TYR C CA  1  
ATOM 635    C C   . TYR A 1 89  ? -71.705  27.839  -58.693 1.00 30.00  ? 93  TYR C C   1  
ATOM 636    O O   . TYR A 1 89  ? -71.363  29.028  -58.751 1.00 30.00  ? 93  TYR C O   1  
ATOM 637    C CB  . TYR A 1 89  ? -72.449  27.406  -60.973 1.00 99.99  ? 93  TYR C CB  1  
ATOM 638    C CG  . TYR A 1 89  ? -73.369  26.573  -61.834 1.00 99.99  ? 93  TYR C CG  1  
ATOM 639    C CD1 . TYR A 1 89  ? -73.145  25.200  -61.976 1.00 99.99  ? 93  TYR C CD1 1  
ATOM 640    C CD2 . TYR A 1 89  ? -74.449  27.177  -62.490 1.00 99.99  ? 93  TYR C CD2 1  
ATOM 641    C CE1 . TYR A 1 89  ? -73.999  24.429  -62.774 1.00 99.99  ? 93  TYR C CE1 1  
ATOM 642    C CE2 . TYR A 1 89  ? -75.301  26.410  -63.289 1.00 99.99  ? 93  TYR C CE2 1  
ATOM 643    C CZ  . TYR A 1 89  ? -75.075  25.034  -63.430 1.00 99.99  ? 93  TYR C CZ  1  
ATOM 644    O OH  . TYR A 1 89  ? -75.906  24.283  -64.206 1.00 99.99  ? 93  TYR C OH  1  
ATOM 645    N N   . LEU A 1 90  ? -71.085  26.947  -57.939 1.00 30.00  ? 94  LEU C N   1  
ATOM 646    C CA  . LEU A 1 90  ? -69.956  27.297  -57.105 1.00 30.00  ? 94  LEU C CA  1  
ATOM 647    C C   . LEU A 1 90  ? -68.674  26.633  -57.634 1.00 30.00  ? 94  LEU C C   1  
ATOM 648    O O   . LEU A 1 90  ? -68.080  25.775  -56.973 1.00 30.00  ? 94  LEU C O   1  
ATOM 649    C CB  . LEU A 1 90  ? -70.198  26.827  -55.676 1.00 99.99  ? 94  LEU C CB  1  
ATOM 650    C CG  . LEU A 1 90  ? -70.791  27.970  -54.858 1.00 99.99  ? 94  LEU C CG  1  
ATOM 651    C CD1 . LEU A 1 90  ? -70.730  27.617  -53.374 1.00 99.99  ? 94  LEU C CD1 1  
ATOM 652    C CD2 . LEU A 1 90  ? -69.996  29.245  -55.112 1.00 99.99  ? 94  LEU C CD2 1  
ATOM 653    N N   . ASN A 1 91  ? -68.249  27.022  -58.828 1.00 30.00  ? 95  ASN C N   1  
ATOM 654    C CA  . ASN A 1 91  ? -67.044  26.424  -59.388 1.00 30.00  ? 95  ASN C CA  1  
ATOM 655    C C   . ASN A 1 91  ? -65.961  27.485  -59.502 1.00 30.00  ? 95  ASN C C   1  
ATOM 656    O O   . ASN A 1 91  ? -66.261  28.679  -59.598 1.00 30.00  ? 95  ASN C O   1  
ATOM 657    C CB  . ASN A 1 91  ? -67.345  25.857  -60.772 1.00 99.99  ? 95  ASN C CB  1  
ATOM 658    C CG  . ASN A 1 91  ? -67.851  26.940  -61.713 1.00 99.99  ? 95  ASN C CG  1  
ATOM 659    O OD1 . ASN A 1 91  ? -67.131  27.373  -62.610 1.00 99.99  ? 95  ASN C OD1 1  
ATOM 660    N ND2 . ASN A 1 91  ? -69.092  27.380  -61.501 1.00 99.99  ? 95  ASN C ND2 1  
ATOM 661    N N   . GLU A 1 92  ? -64.705  27.040  -59.489 1.00 30.00  ? 96  GLU C N   1  
ATOM 662    C CA  . GLU A 1 92  ? -63.580  27.957  -59.569 1.00 30.00  ? 96  GLU C CA  1  
ATOM 663    C C   . GLU A 1 92  ? -63.762  29.137  -60.498 1.00 30.00  ? 96  GLU C C   1  
ATOM 664    O O   . GLU A 1 92  ? -63.078  30.143  -60.358 1.00 30.00  ? 96  GLU C O   1  
ATOM 665    C CB  . GLU A 1 92  ? -62.340  27.217  -60.063 1.00 99.99  ? 96  GLU C CB  1  
ATOM 666    C CG  . GLU A 1 92  ? -61.871  26.257  -58.999 1.00 99.99  ? 96  GLU C CG  1  
ATOM 667    C CD  . GLU A 1 92  ? -61.246  27.038  -57.846 1.00 99.99  ? 96  GLU C CD  1  
ATOM 668    O OE1 . GLU A 1 92  ? -62.008  27.396  -56.912 1.00 99.99  ? 96  GLU C OE1 1  
ATOM 669    O OE2 . GLU A 1 92  ? -60.007  27.267  -57.912 1.00 99.99  ? 96  GLU C OE2 1  
ATOM 670    N N   . ALA A 1 93  ? -64.682  29.051  -61.443 1.00 30.00  ? 97  ALA C N   1  
ATOM 671    C CA  . ALA A 1 93  ? -64.849  30.176  -62.349 1.00 30.00  ? 97  ALA C CA  1  
ATOM 672    C C   . ALA A 1 93  ? -65.994  31.095  -61.956 1.00 30.00  ? 97  ALA C C   1  
ATOM 673    O O   . ALA A 1 93  ? -66.001  32.263  -62.331 1.00 30.00  ? 97  ALA C O   1  
ATOM 674    C CB  . ALA A 1 93  ? -65.065  29.658  -63.773 1.00 30.00  ? 97  ALA C CB  1  
ATOM 675    N N   . SER A 1 94  ? -66.964  30.566  -61.211 1.00 30.00  ? 98  SER C N   1  
ATOM 676    C CA  . SER A 1 94  ? -68.115  31.361  -60.768 1.00 30.00  ? 98  SER C CA  1  
ATOM 677    C C   . SER A 1 94  ? -67.677  32.170  -59.566 1.00 30.00  ? 98  SER C C   1  
ATOM 678    O O   . SER A 1 94  ? -68.047  33.332  -59.418 1.00 30.00  ? 98  SER C O   1  
ATOM 679    C CB  . SER A 1 94  ? -69.267  30.435  -60.390 1.00 99.99  ? 98  SER C CB  1  
ATOM 680    O OG  . SER A 1 94  ? -68.923  29.699  -59.214 1.00 99.99  ? 98  SER C OG  1  
ATOM 681    N N   . VAL A 1 95  ? -66.895  31.524  -58.708 1.00 30.00  ? 99  VAL C N   1  
ATOM 682    C CA  . VAL A 1 95  ? -66.370  32.151  -57.509 1.00 30.00  ? 99  VAL C CA  1  
ATOM 683    C C   . VAL A 1 95  ? -65.411  33.285  -57.919 1.00 30.00  ? 99  VAL C C   1  
ATOM 684    O O   . VAL A 1 95  ? -65.633  34.449  -57.590 1.00 30.00  ? 99  VAL C O   1  
ATOM 685    C CB  . VAL A 1 95  ? -65.617  31.119  -56.674 1.00 99.99  ? 99  VAL C CB  1  
ATOM 686    C CG1 . VAL A 1 95  ? -66.566  29.992  -56.279 1.00 99.99  ? 99  VAL C CG1 1  
ATOM 687    C CG2 . VAL A 1 95  ? -64.462  30.549  -57.490 1.00 99.99  ? 99  VAL C CG2 1  
ATOM 688    N N   . LEU A 1 96  ? -64.352  32.951  -58.646 1.00 30.00  ? 100 LEU C N   1  
ATOM 689    C CA  . LEU A 1 96  ? -63.408  33.964  -59.093 1.00 30.00  ? 100 LEU C CA  1  
ATOM 690    C C   . LEU A 1 96  ? -64.125  35.128  -59.789 1.00 30.00  ? 100 LEU C C   1  
ATOM 691    O O   . LEU A 1 96  ? -63.717  36.275  -59.682 1.00 30.00  ? 100 LEU C O   1  
ATOM 692    C CB  . LEU A 1 96  ? -62.416  33.350  -60.078 1.00 99.99  ? 100 LEU C CB  1  
ATOM 693    C CG  . LEU A 1 96  ? -61.160  32.913  -59.332 1.00 99.99  ? 100 LEU C CG  1  
ATOM 694    C CD1 . LEU A 1 96  ? -60.053  32.611  -60.336 1.00 99.99  ? 100 LEU C CD1 1  
ATOM 695    C CD2 . LEU A 1 96  ? -60.710  34.032  -58.397 1.00 99.99  ? 100 LEU C CD2 1  
ATOM 696    N N   . TYR A 1 97  ? -65.194  34.848  -60.515 1.00 30.00  ? 101 TYR C N   1  
ATOM 697    C CA  . TYR A 1 97  ? -65.891  35.925  -61.199 1.00 30.00  ? 101 TYR C CA  1  
ATOM 698    C C   . TYR A 1 97  ? -66.622  36.840  -60.234 1.00 30.00  ? 101 TYR C C   1  
ATOM 699    O O   . TYR A 1 97  ? -66.577  38.061  -60.377 1.00 30.00  ? 101 TYR C O   1  
ATOM 700    C CB  . TYR A 1 97  ? -66.919  35.346  -62.167 1.00 99.99  ? 101 TYR C CB  1  
ATOM 701    C CG  . TYR A 1 97  ? -67.634  36.471  -62.874 1.00 99.99  ? 101 TYR C CG  1  
ATOM 702    C CD1 . TYR A 1 97  ? -67.057  37.075  -63.998 1.00 99.99  ? 101 TYR C CD1 1  
ATOM 703    C CD2 . TYR A 1 97  ? -68.877  36.915  -62.405 1.00 99.99  ? 101 TYR C CD2 1  
ATOM 704    C CE1 . TYR A 1 97  ? -67.720  38.116  -64.653 1.00 99.99  ? 101 TYR C CE1 1  
ATOM 705    C CE2 . TYR A 1 97  ? -69.543  37.958  -63.060 1.00 99.99  ? 101 TYR C CE2 1  
ATOM 706    C CZ  . TYR A 1 97  ? -68.962  38.560  -64.184 1.00 99.99  ? 101 TYR C CZ  1  
ATOM 707    O OH  . TYR A 1 97  ? -69.610  39.572  -64.821 1.00 99.99  ? 101 TYR C OH  1  
ATOM 708    N N   . ASN A 1 98  ? -67.304  36.244  -59.257 1.00 30.00  ? 102 ASN C N   1  
ATOM 709    C CA  . ASN A 1 98  ? -68.055  37.004  -58.269 1.00 30.00  ? 102 ASN C CA  1  
ATOM 710    C C   . ASN A 1 98  ? -67.148  37.934  -57.467 1.00 30.00  ? 102 ASN C C   1  
ATOM 711    O O   . ASN A 1 98  ? -67.413  39.133  -57.342 1.00 30.00  ? 102 ASN C O   1  
ATOM 712    C CB  . ASN A 1 98  ? -68.743  36.053  -57.295 1.00 99.99  ? 102 ASN C CB  1  
ATOM 713    C CG  . ASN A 1 98  ? -69.952  35.388  -57.935 1.00 99.99  ? 102 ASN C CG  1  
ATOM 714    O OD1 . ASN A 1 98  ? -70.195  34.202  -57.732 1.00 99.99  ? 102 ASN C OD1 1  
ATOM 715    N ND2 . ASN A 1 98  ? -70.713  36.159  -58.715 1.00 99.99  ? 102 ASN C ND2 1  
ATOM 716    N N   . LEU A 1 99  ? -66.073  37.372  -56.923 1.00 30.00  ? 103 LEU C N   1  
ATOM 717    C CA  . LEU A 1 99  ? -65.111  38.141  -56.147 1.00 30.00  ? 103 LEU C CA  1  
ATOM 718    C C   . LEU A 1 99  ? -64.638  39.299  -57.008 1.00 30.00  ? 103 LEU C C   1  
ATOM 719    O O   . LEU A 1 99  ? -65.015  40.447  -56.781 1.00 30.00  ? 103 LEU C O   1  
ATOM 720    C CB  . LEU A 1 99  ? -63.929  37.254  -55.767 1.00 99.99  ? 103 LEU C CB  1  
ATOM 721    C CG  . LEU A 1 99  ? -64.159  36.672  -54.375 1.00 99.99  ? 103 LEU C CG  1  
ATOM 722    C CD1 . LEU A 1 99  ? -62.855  36.065  -53.858 1.00 99.99  ? 103 LEU C CD1 1  
ATOM 723    C CD2 . LEU A 1 99  ? -64.614  37.777  -53.430 1.00 99.99  ? 103 LEU C CD2 1  
ATOM 724    N N   . ARG A 1 100 ? -63.818  38.987  -57.999 1.00 30.00  ? 104 ARG C N   1  
ATOM 725    C CA  . ARG A 1 100 ? -63.280  39.964  -58.935 1.00 30.00  ? 104 ARG C CA  1  
ATOM 726    C C   . ARG A 1 100 ? -64.328  41.009  -59.379 1.00 30.00  ? 104 ARG C C   1  
ATOM 727    O O   . ARG A 1 100 ? -63.992  42.143  -59.691 1.00 30.00  ? 104 ARG C O   1  
ATOM 728    C CB  . ARG A 1 100 ? -62.770  39.262  -60.188 1.00 99.99  ? 104 ARG C CB  1  
ATOM 729    C CG  . ARG A 1 100 ? -61.632  40.068  -60.798 1.00 99.99  ? 104 ARG C CG  1  
ATOM 730    C CD  . ARG A 1 100 ? -60.929  39.233  -61.863 1.00 99.99  ? 104 ARG C CD  1  
ATOM 731    N NE  . ARG A 1 100 ? -59.600  39.797  -62.188 1.00 99.99  ? 104 ARG C NE  1  
ATOM 732    C CZ  . ARG A 1 100 ? -58.721  39.175  -62.968 1.00 99.99  ? 104 ARG C CZ  1  
ATOM 733    N NH1 . ARG A 1 100 ? -58.977  37.990  -63.516 1.00 99.99  ? 104 ARG C NH1 1  
ATOM 734    N NH2 . ARG A 1 100 ? -57.555  39.773  -63.195 1.00 99.99  ? 104 ARG C NH2 1  
ATOM 735    N N   . SER A 1 101 ? -65.598  40.621  -59.411 1.00 30.00  ? 105 SER C N   1  
ATOM 736    C CA  . SER A 1 101 ? -66.653  41.551  -59.818 1.00 30.00  ? 105 SER C CA  1  
ATOM 737    C C   . SER A 1 101 ? -66.788  42.598  -58.729 1.00 30.00  ? 105 SER C C   1  
ATOM 738    O O   . SER A 1 101 ? -66.705  43.795  -58.994 1.00 30.00  ? 105 SER C O   1  
ATOM 739    C CB  . SER A 1 101 ? -67.969  40.800  -59.993 1.00 99.99  ? 105 SER C CB  1  
ATOM 740    O OG  . SER A 1 101 ? -67.808  39.779  -60.981 1.00 99.99  ? 105 SER C OG  1  
ATOM 741    N N   . ARG A 1 102 ? -67.000  42.121  -57.506 1.00 30.00  ? 106 ARG C N   1  
ATOM 742    C CA  . ARG A 1 102 ? -67.146  42.960  -56.329 1.00 30.00  ? 106 ARG C CA  1  
ATOM 743    C C   . ARG A 1 102 ? -65.882  43.806  -56.148 1.00 30.00  ? 106 ARG C C   1  
ATOM 744    O O   . ARG A 1 102 ? -65.943  45.040  -56.199 1.00 30.00  ? 106 ARG C O   1  
ATOM 745    C CB  . ARG A 1 102 ? -67.352  42.089  -55.095 1.00 99.99  ? 106 ARG C CB  1  
ATOM 746    C CG  . ARG A 1 102 ? -68.582  41.210  -55.291 1.00 99.99  ? 106 ARG C CG  1  
ATOM 747    C CD  . ARG A 1 102 ? -68.595  40.110  -54.234 1.00 99.99  ? 106 ARG C CD  1  
ATOM 748    N NE  . ARG A 1 102 ? -68.682  40.684  -52.871 1.00 99.99  ? 106 ARG C NE  1  
ATOM 749    C CZ  . ARG A 1 102 ? -69.837  40.921  -52.260 1.00 99.99  ? 106 ARG C CZ  1  
ATOM 750    N NH1 . ARG A 1 102 ? -71.007  40.666  -52.837 1.00 99.99  ? 106 ARG C NH1 1  
ATOM 751    N NH2 . ARG A 1 102 ? -69.801  41.440  -51.034 1.00 99.99  ? 106 ARG C NH2 1  
ATOM 752    N N   . TYR A 1 103 ? -64.746  43.138  -55.950 1.00 30.00  ? 107 TYR C N   1  
ATOM 753    C CA  . TYR A 1 103 ? -63.462  43.815  -55.773 1.00 30.00  ? 107 TYR C CA  1  
ATOM 754    C C   . TYR A 1 103 ? -63.257  45.070  -56.639 1.00 30.00  ? 107 TYR C C   1  
ATOM 755    O O   . TYR A 1 103 ? -62.992  46.147  -56.104 1.00 30.00  ? 107 TYR C O   1  
ATOM 756    C CB  . TYR A 1 103 ? -62.320  42.864  -56.119 1.00 99.99  ? 107 TYR C CB  1  
ATOM 757    C CG  . TYR A 1 103 ? -61.001  43.568  -55.932 1.00 99.99  ? 107 TYR C CG  1  
ATOM 758    C CD1 . TYR A 1 103 ? -60.422  43.646  -54.660 1.00 99.99  ? 107 TYR C CD1 1  
ATOM 759    C CD2 . TYR A 1 103 ? -60.354  44.149  -57.033 1.00 99.99  ? 107 TYR C CD2 1  
ATOM 760    C CE1 . TYR A 1 103 ? -59.196  44.302  -54.489 1.00 99.99  ? 107 TYR C CE1 1  
ATOM 761    C CE2 . TYR A 1 103 ? -59.129  44.804  -56.859 1.00 99.99  ? 107 TYR C CE2 1  
ATOM 762    C CZ  . TYR A 1 103 ? -58.551  44.880  -55.586 1.00 99.99  ? 107 TYR C CZ  1  
ATOM 763    O OH  . TYR A 1 103 ? -57.359  45.519  -55.418 1.00 99.99  ? 107 TYR C OH  1  
ATOM 764    N N   . THR A 1 104 ? -63.374  44.945  -57.959 1.00 30.00  ? 108 THR C N   1  
ATOM 765    C CA  . THR A 1 104 ? -63.184  46.101  -58.839 1.00 30.00  ? 108 THR C CA  1  
ATOM 766    C C   . THR A 1 104 ? -64.263  47.159  -58.646 1.00 30.00  ? 108 THR C C   1  
ATOM 767    O O   . THR A 1 104 ? -64.419  48.064  -59.463 1.00 30.00  ? 108 THR C O   1  
ATOM 768    C CB  . THR A 1 104 ? -63.225  45.655  -60.297 1.00 99.99  ? 108 THR C CB  1  
ATOM 769    O OG1 . THR A 1 104 ? -64.549  45.225  -60.627 1.00 99.99  ? 108 THR C OG1 1  
ATOM 770    C CG2 . THR A 1 104 ? -62.248  44.503  -60.502 1.00 99.99  ? 108 THR C CG2 1  
ATOM 771    N N   . SER A 1 105 ? -65.008  47.051  -57.562 1.00 30.00  ? 109 SER C N   1  
ATOM 772    C CA  . SER A 1 105 ? -66.056  48.009  -57.289 1.00 30.00  ? 109 SER C CA  1  
ATOM 773    C C   . SER A 1 105 ? -65.967  48.516  -55.855 1.00 30.00  ? 109 SER C C   1  
ATOM 774    O O   . SER A 1 105 ? -66.856  49.220  -55.377 1.00 30.00  ? 109 SER C O   1  
ATOM 775    C CB  . SER A 1 105 ? -67.419  47.361  -57.493 1.00 99.99  ? 109 SER C CB  1  
ATOM 776    O OG  . SER A 1 105 ? -67.526  46.889  -58.838 1.00 99.99  ? 109 SER C OG  1  
ATOM 777    N N   . GLY A 1 106 ? -64.889  48.146  -55.165 1.00 30.00  ? 110 GLY C N   1  
ATOM 778    C CA  . GLY A 1 106 ? -64.697  48.583  -53.795 1.00 30.00  ? 110 GLY C CA  1  
ATOM 779    C C   . GLY A 1 106 ? -65.056  47.561  -52.734 1.00 30.00  ? 110 GLY C C   1  
ATOM 780    O O   . GLY A 1 106 ? -64.506  47.590  -51.626 1.00 30.00  ? 110 GLY C O   1  
ATOM 781    N N   . LEU A 1 107 ? -65.974  46.659  -53.068 1.00 30.00  ? 111 LEU C N   1  
ATOM 782    C CA  . LEU A 1 107 ? -66.400  45.627  -52.136 1.00 30.00  ? 111 LEU C CA  1  
ATOM 783    C C   . LEU A 1 107 ? -65.321  44.553  -52.041 1.00 30.00  ? 111 LEU C C   1  
ATOM 784    O O   . LEU A 1 107 ? -65.046  43.846  -53.014 1.00 30.00  ? 111 LEU C O   1  
ATOM 785    C CB  . LEU A 1 107 ? -67.699  44.996  -52.621 1.00 99.99  ? 111 LEU C CB  1  
ATOM 786    C CG  . LEU A 1 107 ? -68.883  45.685  -51.952 1.00 99.99  ? 111 LEU C CG  1  
ATOM 787    C CD1 . LEU A 1 107 ? -70.145  44.859  -52.169 1.00 99.99  ? 111 LEU C CD1 1  
ATOM 788    C CD2 . LEU A 1 107 ? -68.614  45.822  -50.457 1.00 99.99  ? 111 LEU C CD2 1  
ATOM 789    N N   . ILE A 1 108 ? -64.719  44.438  -50.860 1.00 30.00  ? 112 ILE C N   1  
ATOM 790    C CA  . ILE A 1 108 ? -63.650  43.477  -50.626 1.00 30.00  ? 112 ILE C CA  1  
ATOM 791    C C   . ILE A 1 108 ? -64.038  42.357  -49.672 1.00 30.00  ? 112 ILE C C   1  
ATOM 792    O O   . ILE A 1 108 ? -63.226  41.459  -49.393 1.00 30.00  ? 112 ILE C O   1  
ATOM 793    C CB  . ILE A 1 108 ? -62.440  44.181  -50.027 1.00 99.99  ? 112 ILE C CB  1  
ATOM 794    C CG1 . ILE A 1 108 ? -62.643  44.357  -48.527 1.00 99.99  ? 112 ILE C CG1 1  
ATOM 795    C CG2 . ILE A 1 108 ? -62.276  45.551  -50.680 1.00 99.99  ? 112 ILE C CG2 1  
ATOM 796    C CD1 . ILE A 1 108 ? -63.271  45.719  -48.251 1.00 99.99  ? 112 ILE C CD1 1  
ATOM 797    N N   . TYR A 1 109 ? -65.264  42.403  -49.159 1.00 30.00  ? 113 TYR C N   1  
ATOM 798    C CA  . TYR A 1 109 ? -65.737  41.372  -48.232 1.00 30.00  ? 113 TYR C CA  1  
ATOM 799    C C   . TYR A 1 109 ? -66.887  40.575  -48.867 1.00 30.00  ? 113 TYR C C   1  
ATOM 800    O O   . TYR A 1 109 ? -67.808  41.158  -49.460 1.00 30.00  ? 113 TYR C O   1  
ATOM 801    C CB  . TYR A 1 109 ? -66.235  42.020  -46.945 1.00 99.99  ? 113 TYR C CB  1  
ATOM 802    C CG  . TYR A 1 109 ? -66.715  40.951  -45.995 1.00 99.99  ? 113 TYR C CG  1  
ATOM 803    C CD1 . TYR A 1 109 ? -65.801  40.268  -45.184 1.00 99.99  ? 113 TYR C CD1 1  
ATOM 804    C CD2 . TYR A 1 109 ? -68.079  40.640  -45.924 1.00 99.99  ? 113 TYR C CD2 1  
ATOM 805    C CE1 . TYR A 1 109 ? -66.247  39.276  -44.305 1.00 99.99  ? 113 TYR C CE1 1  
ATOM 806    C CE2 . TYR A 1 109 ? -68.527  39.648  -45.043 1.00 99.99  ? 113 TYR C CE2 1  
ATOM 807    C CZ  . TYR A 1 109 ? -67.610  38.966  -44.235 1.00 99.99  ? 113 TYR C CZ  1  
ATOM 808    O OH  . TYR A 1 109 ? -68.046  38.002  -43.379 1.00 99.99  ? 113 TYR C OH  1  
ATOM 809    N N   . THR A 1 110 ? -66.838  39.245  -48.756 1.00 30.00  ? 114 THR C N   1  
ATOM 810    C CA  . THR A 1 110 ? -67.884  38.384  -49.336 1.00 30.00  ? 114 THR C CA  1  
ATOM 811    C C   . THR A 1 110 ? -68.007  37.083  -48.566 1.00 30.00  ? 114 THR C C   1  
ATOM 812    O O   . THR A 1 110 ? -66.997  36.462  -48.217 1.00 30.00  ? 114 THR C O   1  
ATOM 813    C CB  . THR A 1 110 ? -67.543  38.059  -50.786 1.00 99.99  ? 114 THR C CB  1  
ATOM 814    O OG1 . THR A 1 110 ? -67.435  39.275  -51.533 1.00 99.99  ? 114 THR C OG1 1  
ATOM 815    C CG2 . THR A 1 110 ? -68.644  37.189  -51.384 1.00 99.99  ? 114 THR C CG2 1  
ATOM 816    N N   . TYR A 1 111 ? -69.234  36.652  -48.296 1.00 30.00  ? 115 TYR C N   1  
ATOM 817    C CA  . TYR A 1 111 ? -69.399  35.398  -47.570 1.00 30.00  ? 115 TYR C CA  1  
ATOM 818    C C   . TYR A 1 111 ? -69.554  34.260  -48.584 1.00 30.00  ? 115 TYR C C   1  
ATOM 819    O O   . TYR A 1 111 ? -69.804  34.484  -49.780 1.00 30.00  ? 115 TYR C O   1  
ATOM 820    C CB  . TYR A 1 111 ? -70.640  35.470  -46.686 1.00 99.99  ? 115 TYR C CB  1  
ATOM 821    C CG  . TYR A 1 111 ? -70.450  36.540  -45.640 1.00 99.99  ? 115 TYR C CG  1  
ATOM 822    C CD1 . TYR A 1 111 ? -70.829  37.860  -45.910 1.00 99.99  ? 115 TYR C CD1 1  
ATOM 823    C CD2 . TYR A 1 111 ? -69.900  36.212  -44.395 1.00 99.99  ? 115 TYR C CD2 1  
ATOM 824    C CE1 . TYR A 1 111 ? -70.654  38.853  -44.940 1.00 99.99  ? 115 TYR C CE1 1  
ATOM 825    C CE2 . TYR A 1 111 ? -69.725  37.205  -43.424 1.00 99.99  ? 115 TYR C CE2 1  
ATOM 826    C CZ  . TYR A 1 111 ? -70.102  38.525  -43.695 1.00 99.99  ? 115 TYR C CZ  1  
ATOM 827    O OH  . TYR A 1 111 ? -69.934  39.488  -42.749 1.00 99.99  ? 115 TYR C OH  1  
ATOM 828    N N   . SER A 1 112 ? -68.814  33.257  -47.865 1.00 30.00  ? 116 SER C N   1  
ATOM 829    C CA  . SER A 1 112 ? -68.673  32.063  -48.649 1.00 30.00  ? 116 SER C CA  1  
ATOM 830    C C   . SER A 1 112 ? -69.350  31.065  -47.802 1.00 30.00  ? 116 SER C C   1  
ATOM 831    O O   . SER A 1 112 ? -68.755  30.198  -47.207 1.00 30.00  ? 116 SER C O   1  
ATOM 832    C CB  . SER A 1 112 ? -67.196  31.757  -48.869 1.00 99.99  ? 116 SER C CB  1  
ATOM 833    O OG  . SER A 1 112 ? -66.595  31.386  -47.626 1.00 99.99  ? 116 SER C OG  1  
ATOM 834    N N   . GLY A 1 113 ? -70.619  31.244  -47.688 1.00 30.00  ? 117 GLY C N   1  
ATOM 835    C CA  . GLY A 1 113 ? -71.210  30.289  -46.831 1.00 30.00  ? 117 GLY C CA  1  
ATOM 836    C C   . GLY A 1 113 ? -70.957  30.793  -45.439 1.00 30.00  ? 117 GLY C C   1  
ATOM 837    O O   . GLY A 1 113 ? -71.172  31.970  -45.161 1.00 30.00  ? 117 GLY C O   1  
ATOM 838    N N   . LEU A 1 114 ? -70.513  29.880  -44.569 1.00 30.00  ? 118 LEU C N   1  
ATOM 839    C CA  . LEU A 1 114 ? -70.279  30.212  -43.168 1.00 30.00  ? 118 LEU C CA  1  
ATOM 840    C C   . LEU A 1 114 ? -69.063  31.059  -42.761 1.00 30.00  ? 118 LEU C C   1  
ATOM 841    O O   . LEU A 1 114 ? -68.992  31.577  -41.651 1.00 30.00  ? 118 LEU C O   1  
ATOM 842    C CB  . LEU A 1 114 ? -70.111  28.934  -42.355 1.00 99.99  ? 118 LEU C CB  1  
ATOM 843    C CG  . LEU A 1 114 ? -71.452  28.539  -41.744 1.00 99.99  ? 118 LEU C CG  1  
ATOM 844    C CD1 . LEU A 1 114 ? -71.228  27.471  -40.677 1.00 99.99  ? 118 LEU C CD1 1  
ATOM 845    C CD2 . LEU A 1 114 ? -72.100  29.764  -41.108 1.00 99.99  ? 118 LEU C CD2 1  
ATOM 846    N N   . PHE A 1 115 ? -68.102  31.227  -43.653 1.00 30.00  ? 119 PHE C N   1  
ATOM 847    C CA  . PHE A 1 115 ? -66.911  32.007  -43.365 1.00 30.00  ? 119 PHE C CA  1  
ATOM 848    C C   . PHE A 1 115 ? -66.793  33.196  -44.295 1.00 30.00  ? 119 PHE C C   1  
ATOM 849    O O   . PHE A 1 115 ? -67.448  33.257  -45.336 1.00 30.00  ? 119 PHE C O   1  
ATOM 850    C CB  . PHE A 1 115 ? -65.670  31.137  -43.536 1.00 99.99  ? 119 PHE C CB  1  
ATOM 851    C CG  . PHE A 1 115 ? -65.694  30.016  -42.526 1.00 99.99  ? 119 PHE C CG  1  
ATOM 852    C CD1 . PHE A 1 115 ? -66.326  28.807  -42.840 1.00 99.99  ? 119 PHE C CD1 1  
ATOM 853    C CD2 . PHE A 1 115 ? -65.087  30.185  -41.276 1.00 99.99  ? 119 PHE C CD2 1  
ATOM 854    C CE1 . PHE A 1 115 ? -66.349  27.765  -41.905 1.00 99.99  ? 119 PHE C CE1 1  
ATOM 855    C CE2 . PHE A 1 115 ? -65.111  29.146  -40.340 1.00 99.99  ? 119 PHE C CE2 1  
ATOM 856    C CZ  . PHE A 1 115 ? -65.742  27.935  -40.653 1.00 99.99  ? 119 PHE C CZ  1  
ATOM 857    N N   . CYS A 1 116 ? -65.927  34.108  -43.896 1.00 30.00  ? 120 CYS C N   1  
ATOM 858    C CA  . CYS A 1 116 ? -65.715  35.296  -44.670 1.00 30.00  ? 120 CYS C CA  1  
ATOM 859    C C   . CYS A 1 116 ? -64.493  35.242  -45.547 1.00 30.00  ? 120 CYS C C   1  
ATOM 860    O O   . CYS A 1 116 ? -63.491  34.669  -45.170 1.00 30.00  ? 120 CYS C O   1  
ATOM 861    C CB  . CYS A 1 116 ? -65.545  36.496  -43.741 1.00 99.99  ? 120 CYS C CB  1  
ATOM 862    S SG  . CYS A 1 116 ? -64.066  36.485  -42.696 1.00 99.99  ? 120 CYS C SG  1  
ATOM 863    N N   . ILE A 1 117 ? -64.631  36.175  -46.835 1.00 30.00  ? 121 ILE C N   1  
ATOM 864    C CA  . ILE A 1 117 ? -63.495  36.374  -47.742 1.00 30.00  ? 121 ILE C CA  1  
ATOM 865    C C   . ILE A 1 117 ? -63.090  37.825  -47.874 1.00 30.00  ? 121 ILE C C   1  
ATOM 866    O O   . ILE A 1 117 ? -63.901  38.684  -48.256 1.00 30.00  ? 121 ILE C O   1  
ATOM 867    C CB  . ILE A 1 117 ? -63.850  35.869  -49.137 1.00 99.99  ? 121 ILE C CB  1  
ATOM 868    C CG1 . ILE A 1 117 ? -64.557  36.977  -49.915 1.00 99.99  ? 121 ILE C CG1 1  
ATOM 869    C CG2 . ILE A 1 117 ? -64.773  34.661  -49.019 1.00 99.99  ? 121 ILE C CG2 1  
ATOM 870    C CD1 . ILE A 1 117 ? -63.536  37.739  -50.750 1.00 99.99  ? 121 ILE C CD1 1  
ATOM 871    N N   . ALA A 1 118 ? -61.827  38.090  -47.568 1.00 30.00  ? 122 ALA C N   1  
ATOM 872    C CA  . ALA A 1 118 ? -61.298  39.431  -47.641 1.00 30.00  ? 122 ALA C CA  1  
ATOM 873    C C   . ALA A 1 118 ? -60.242  39.514  -48.725 1.00 30.00  ? 122 ALA C C   1  
ATOM 874    O O   . ALA A 1 118 ? -59.256  38.770  -48.701 1.00 30.00  ? 122 ALA C O   1  
ATOM 875    C CB  . ALA A 1 118 ? -60.688  39.801  -46.297 1.00 30.00  ? 122 ALA C CB  1  
ATOM 876    N N   . VAL A 1 119 ? -60.447  40.408  -49.681 1.00 30.00  ? 123 VAL C N   1  
ATOM 877    C CA  . VAL A 1 119 ? -59.476  40.572  -50.756 1.00 30.00  ? 123 VAL C CA  1  
ATOM 878    C C   . VAL A 1 119 ? -58.715  41.878  -50.506 1.00 30.00  ? 123 VAL C C   1  
ATOM 879    O O   . VAL A 1 119 ? -59.302  42.959  -50.520 1.00 30.00  ? 123 VAL C O   1  
ATOM 880    C CB  . VAL A 1 119 ? -60.196  40.636  -52.098 1.00 99.99  ? 123 VAL C CB  1  
ATOM 881    C CG1 . VAL A 1 119 ? -60.975  39.341  -52.318 1.00 99.99  ? 123 VAL C CG1 1  
ATOM 882    C CG2 . VAL A 1 119 ? -61.160  41.817  -52.107 1.00 99.99  ? 123 VAL C CG2 1  
ATOM 883    N N   . ASN A 1 120 ? -57.388  41.868  -50.209 1.00 30.00  ? 124 ASN C N   1  
ATOM 884    C CA  . ASN A 1 120 ? -56.563  43.040  -49.942 1.00 30.00  ? 124 ASN C CA  1  
ATOM 885    C C   . ASN A 1 120 ? -56.811  44.248  -50.871 1.00 30.00  ? 124 ASN C C   1  
ATOM 886    O O   . ASN A 1 120 ? -56.616  44.169  -52.088 1.00 30.00  ? 124 ASN C O   1  
ATOM 887    C CB  . ASN A 1 120 ? -55.089  42.681  -50.092 1.00 99.99  ? 124 ASN C CB  1  
ATOM 888    C CG  . ASN A 1 120 ? -54.772  42.235  -51.512 1.00 99.99  ? 124 ASN C CG  1  
ATOM 889    O OD1 . ASN A 1 120 ? -53.607  42.136  -51.891 1.00 99.99  ? 124 ASN C OD1 1  
ATOM 890    N ND2 . ASN A 1 120 ? -55.818  41.968  -52.298 1.00 99.99  ? 124 ASN C ND2 1  
ATOM 891    N N   . PRO A 1 121 ? -57.216  45.401  -50.297 1.00 30.00  ? 125 PRO C N   1  
ATOM 892    C CA  . PRO A 1 121 ? -57.500  46.629  -51.055 1.00 30.00  ? 125 PRO C CA  1  
ATOM 893    C C   . PRO A 1 121 ? -56.324  47.452  -51.538 1.00 30.00  ? 125 PRO C C   1  
ATOM 894    O O   . PRO A 1 121 ? -56.439  48.161  -52.552 1.00 30.00  ? 125 PRO C O   1  
ATOM 895    C CB  . PRO A 1 121 ? -58.250  47.363  -50.000 1.00 99.99  ? 125 PRO C CB  1  
ATOM 896    C CG  . PRO A 1 121 ? -58.334  46.430  -48.817 1.00 99.99  ? 125 PRO C CG  1  
ATOM 897    C CD  . PRO A 1 121 ? -57.783  45.295  -49.019 1.00 99.99  ? 125 PRO C CD  1  
ATOM 898    N N   . TYR A 1 122 ? -55.206  47.347  -50.817 1.00 30.00  ? 126 TYR C N   1  
ATOM 899    C CA  . TYR A 1 122 ? -53.982  48.096  -51.126 1.00 30.00  ? 126 TYR C CA  1  
ATOM 900    C C   . TYR A 1 122 ? -54.325  49.588  -51.234 1.00 30.00  ? 126 TYR C C   1  
ATOM 901    O O   . TYR A 1 122 ? -53.851  50.299  -52.119 1.00 30.00  ? 126 TYR C O   1  
ATOM 902    C CB  . TYR A 1 122 ? -53.395  47.609  -52.447 1.00 99.99  ? 126 TYR C CB  1  
ATOM 903    C CG  . TYR A 1 122 ? -52.138  48.383  -52.756 1.00 99.99  ? 126 TYR C CG  1  
ATOM 904    C CD1 . TYR A 1 122 ? -50.946  48.086  -52.082 1.00 99.99  ? 126 TYR C CD1 1  
ATOM 905    C CD2 . TYR A 1 122 ? -52.159  49.402  -53.716 1.00 99.99  ? 126 TYR C CD2 1  
ATOM 906    C CE1 . TYR A 1 122 ? -49.779  48.802  -52.369 1.00 99.99  ? 126 TYR C CE1 1  
ATOM 907    C CE2 . TYR A 1 122 ? -50.992  50.123  -54.002 1.00 99.99  ? 126 TYR C CE2 1  
ATOM 908    C CZ  . TYR A 1 122 ? -49.803  49.819  -53.327 1.00 99.99  ? 126 TYR C CZ  1  
ATOM 909    O OH  . TYR A 1 122 ? -48.668  50.521  -53.608 1.00 99.99  ? 126 TYR C OH  1  
ATOM 910    N N   . ARG A 1 123 ? -55.163  50.050  -50.311 1.00 30.00  ? 127 ARG C N   1  
ATOM 911    C CA  . ARG A 1 123 ? -55.595  51.435  -50.268 1.00 30.00  ? 127 ARG C CA  1  
ATOM 912    C C   . ARG A 1 123 ? -56.513  51.594  -49.049 1.00 30.00  ? 127 ARG C C   1  
ATOM 913    O O   . ARG A 1 123 ? -57.150  50.642  -48.607 1.00 30.00  ? 127 ARG C O   1  
ATOM 914    C CB  . ARG A 1 123 ? -56.350  51.781  -51.546 1.00 99.99  ? 127 ARG C CB  1  
ATOM 915    C CG  . ARG A 1 123 ? -56.755  53.251  -51.514 1.00 99.99  ? 127 ARG C CG  1  
ATOM 916    C CD  . ARG A 1 123 ? -57.552  53.588  -52.769 1.00 99.99  ? 127 ARG C CD  1  
ATOM 917    N NE  . ARG A 1 123 ? -58.622  52.591  -52.999 1.00 99.99  ? 127 ARG C NE  1  
ATOM 918    C CZ  . ARG A 1 123 ? -59.785  52.616  -52.351 1.00 99.99  ? 127 ARG C CZ  1  
ATOM 919    N NH1 . ARG A 1 123 ? -60.067  53.546  -51.442 1.00 99.99  ? 127 ARG C NH1 1  
ATOM 920    N NH2 . ARG A 1 123 ? -60.680  51.674  -52.636 1.00 99.99  ? 127 ARG C NH2 1  
ATOM 921    N N   . ARG A 1 124 ? -56.577  52.795  -48.492 1.00 30.00  ? 128 ARG C N   1  
ATOM 922    C CA  . ARG A 1 124 ? -57.410  53.009  -47.321 1.00 30.00  ? 128 ARG C CA  1  
ATOM 923    C C   . ARG A 1 124 ? -58.873  53.187  -47.687 1.00 30.00  ? 128 ARG C C   1  
ATOM 924    O O   . ARG A 1 124 ? -59.205  53.910  -48.629 1.00 30.00  ? 128 ARG C O   1  
ATOM 925    C CB  . ARG A 1 124 ? -56.953  54.265  -46.579 1.00 99.99  ? 128 ARG C CB  1  
ATOM 926    C CG  . ARG A 1 124 ? -57.800  54.452  -45.325 1.00 99.99  ? 128 ARG C CG  1  
ATOM 927    C CD  . ARG A 1 124 ? -57.374  55.731  -44.613 1.00 99.99  ? 128 ARG C CD  1  
ATOM 928    N NE  . ARG A 1 124 ? -57.306  56.866  -45.560 1.00 99.99  ? 128 ARG C NE  1  
ATOM 929    C CZ  . ARG A 1 124 ? -58.376  57.541  -45.963 1.00 99.99  ? 128 ARG C CZ  1  
ATOM 930    N NH1 . ARG A 1 124 ? -59.600  57.238  -45.541 1.00 99.99  ? 128 ARG C NH1 1  
ATOM 931    N NH2 . ARG A 1 124 ? -58.197  58.545  -46.816 1.00 99.99  ? 128 ARG C NH2 1  
ATOM 932    N N   . LEU A 1 125 ? -59.740  52.521  -46.931 1.00 30.00  ? 129 LEU C N   1  
ATOM 933    C CA  . LEU A 1 125 ? -61.178  52.579  -47.162 1.00 30.00  ? 129 LEU C CA  1  
ATOM 934    C C   . LEU A 1 125 ? -61.952  53.085  -45.959 1.00 30.00  ? 129 LEU C C   1  
ATOM 935    O O   . LEU A 1 125 ? -61.709  52.662  -44.836 1.00 30.00  ? 129 LEU C O   1  
ATOM 936    C CB  . LEU A 1 125 ? -61.705  51.188  -47.496 1.00 99.99  ? 129 LEU C CB  1  
ATOM 937    C CG  . LEU A 1 125 ? -61.815  50.363  -46.218 1.00 99.99  ? 129 LEU C CG  1  
ATOM 938    C CD1 . LEU A 1 125 ? -60.677  50.740  -45.272 1.00 99.99  ? 129 LEU C CD1 1  
ATOM 939    C CD2 . LEU A 1 125 ? -63.152  50.646  -45.544 1.00 99.99  ? 129 LEU C CD2 1  
ATOM 940    N N   . PRO A 1 126 ? -62.914  53.994  -46.189 1.00 30.00  ? 130 PRO C N   1  
ATOM 941    C CA  . PRO A 1 126 ? -63.753  54.583  -45.133 1.00 30.00  ? 130 PRO C CA  1  
ATOM 942    C C   . PRO A 1 126 ? -64.840  53.650  -44.622 1.00 30.00  ? 130 PRO C C   1  
ATOM 943    O O   . PRO A 1 126 ? -65.948  54.088  -44.320 1.00 30.00  ? 130 PRO C O   1  
ATOM 944    C CB  . PRO A 1 126 ? -64.316  55.715  -45.916 1.00 99.99  ? 130 PRO C CB  1  
ATOM 945    C CG  . PRO A 1 126 ? -63.677  55.642  -47.280 1.00 99.99  ? 130 PRO C CG  1  
ATOM 946    C CD  . PRO A 1 126 ? -62.843  54.684  -47.405 1.00 99.99  ? 130 PRO C CD  1  
ATOM 947    N N   . ILE A 1 127 ? -64.517  52.370  -44.511 1.00 30.00  ? 131 ILE C N   1  
ATOM 948    C CA  . ILE A 1 127 ? -65.482  51.373  -44.063 1.00 30.00  ? 131 ILE C CA  1  
ATOM 949    C C   . ILE A 1 127 ? -65.299  50.909  -42.622 1.00 30.00  ? 131 ILE C C   1  
ATOM 950    O O   . ILE A 1 127 ? -66.102  50.128  -42.112 1.00 30.00  ? 131 ILE C O   1  
ATOM 951    C CB  . ILE A 1 127 ? -65.385  50.126  -44.935 1.00 99.99  ? 131 ILE C CB  1  
ATOM 952    C CG1 . ILE A 1 127 ? -66.230  49.013  -44.327 1.00 99.99  ? 131 ILE C CG1 1  
ATOM 953    C CG2 . ILE A 1 127 ? -63.931  49.675  -45.016 1.00 99.99  ? 131 ILE C CG2 1  
ATOM 954    C CD1 . ILE A 1 127 ? -67.563  49.581  -43.857 1.00 99.99  ? 131 ILE C CD1 1  
ATOM 955    N N   . TYR A 1 128 ? -64.250  51.398  -41.968 1.00 30.00  ? 132 TYR C N   1  
ATOM 956    C CA  . TYR A 1 128 ? -63.957  51.024  -40.585 1.00 30.00  ? 132 TYR C CA  1  
ATOM 957    C C   . TYR A 1 128 ? -64.275  52.097  -39.537 1.00 30.00  ? 132 TYR C C   1  
ATOM 958    O O   . TYR A 1 128 ? -64.066  51.888  -38.338 1.00 30.00  ? 132 TYR C O   1  
ATOM 959    C CB  . TYR A 1 128 ? -62.473  50.705  -40.437 1.00 99.99  ? 132 TYR C CB  1  
ATOM 960    C CG  . TYR A 1 128 ? -61.667  51.973  -40.594 1.00 99.99  ? 132 TYR C CG  1  
ATOM 961    C CD1 . TYR A 1 128 ? -61.217  52.361  -41.861 1.00 99.99  ? 132 TYR C CD1 1  
ATOM 962    C CD2 . TYR A 1 128 ? -61.369  52.756  -39.474 1.00 99.99  ? 132 TYR C CD2 1  
ATOM 963    C CE1 . TYR A 1 128 ? -60.468  53.536  -42.008 1.00 99.99  ? 132 TYR C CE1 1  
ATOM 964    C CE2 . TYR A 1 128 ? -60.621  53.929  -39.620 1.00 99.99  ? 132 TYR C CE2 1  
ATOM 965    C CZ  . TYR A 1 128 ? -60.172  54.319  -40.888 1.00 99.99  ? 132 TYR C CZ  1  
ATOM 966    O OH  . TYR A 1 128 ? -59.444  55.460  -41.030 1.00 99.99  ? 132 TYR C OH  1  
ATOM 967    N N   . THR A 1 129 ? -64.781  53.240  -39.993 1.00 30.00  ? 133 THR C N   1  
ATOM 968    C CA  . THR A 1 129 ? -65.125  54.342  -39.111 1.00 30.00  ? 133 THR C CA  1  
ATOM 969    C C   . THR A 1 129 ? -66.056  53.943  -37.967 1.00 30.00  ? 133 THR C C   1  
ATOM 970    O O   . THR A 1 129 ? -66.600  52.835  -37.927 1.00 30.00  ? 133 THR C O   1  
ATOM 971    C CB  . THR A 1 129 ? -65.833  55.438  -39.902 1.00 99.99  ? 133 THR C CB  1  
ATOM 972    O OG1 . THR A 1 129 ? -67.110  54.968  -40.333 1.00 99.99  ? 133 THR C OG1 1  
ATOM 973    C CG2 . THR A 1 129 ? -64.990  55.807  -41.118 1.00 99.99  ? 133 THR C CG2 1  
ATOM 974    N N   . ASP A 1 130 ? -66.221  54.867  -37.035 1.00 30.00  ? 134 ASP C N   1  
ATOM 975    C CA  . ASP A 1 130 ? -67.079  54.653  -35.881 1.00 30.00  ? 134 ASP C CA  1  
ATOM 976    C C   . ASP A 1 130 ? -68.521  54.794  -36.354 1.00 30.00  ? 134 ASP C C   1  
ATOM 977    O O   . ASP A 1 130 ? -69.460  54.279  -35.743 1.00 30.00  ? 134 ASP C O   1  
ATOM 978    C CB  . ASP A 1 130 ? -66.768  55.685  -34.803 1.00 99.99  ? 134 ASP C CB  1  
ATOM 979    C CG  . ASP A 1 130 ? -66.722  57.077  -35.431 1.00 99.99  ? 134 ASP C CG  1  
ATOM 980    O OD1 . ASP A 1 130 ? -65.921  57.248  -36.391 1.00 99.99  ? 134 ASP C OD1 1  
ATOM 981    O OD2 . ASP A 1 130 ? -67.482  57.955  -34.946 1.00 99.99  ? 134 ASP C OD2 1  
ATOM 982    N N   . SER A 1 131 ? -68.685  55.518  -37.454 1.00 30.00  ? 135 SER C N   1  
ATOM 983    C CA  . SER A 1 131 ? -70.002  55.722  -38.030 1.00 30.00  ? 135 SER C CA  1  
ATOM 984    C C   . SER A 1 131 ? -70.496  54.332  -38.431 1.00 30.00  ? 135 SER C C   1  
ATOM 985    O O   . SER A 1 131 ? -71.582  53.888  -38.044 1.00 30.00  ? 135 SER C O   1  
ATOM 986    C CB  . SER A 1 131 ? -69.899  56.645  -39.240 1.00 99.99  ? 135 SER C CB  1  
ATOM 987    O OG  . SER A 1 131 ? -69.199  55.978  -40.291 1.00 99.99  ? 135 SER C OG  1  
ATOM 988    N N   . VAL A 1 132 ? -69.667  53.645  -39.205 1.00 30.00  ? 136 VAL C N   1  
ATOM 989    C CA  . VAL A 1 132 ? -69.967  52.311  -39.689 1.00 30.00  ? 136 VAL C CA  1  
ATOM 990    C C   . VAL A 1 132 ? -70.093  51.267  -38.591 1.00 30.00  ? 136 VAL C C   1  
ATOM 991    O O   . VAL A 1 132 ? -70.933  50.370  -38.687 1.00 30.00  ? 136 VAL C O   1  
ATOM 992    C CB  . VAL A 1 132 ? -68.863  51.838  -40.630 1.00 99.99  ? 136 VAL C CB  1  
ATOM 993    C CG1 . VAL A 1 132 ? -68.760  52.793  -41.817 1.00 99.99  ? 136 VAL C CG1 1  
ATOM 994    C CG2 . VAL A 1 132 ? -67.535  51.814  -39.883 1.00 99.99  ? 136 VAL C CG2 1  
ATOM 995    N N   . ILE A 1 133 ? -69.270  51.369  -37.554 1.00 30.00  ? 137 ILE C N   1  
ATOM 996    C CA  . ILE A 1 133 ? -69.338  50.391  -36.470 1.00 30.00  ? 137 ILE C CA  1  
ATOM 997    C C   . ILE A 1 133 ? -70.682  50.422  -35.769 1.00 30.00  ? 137 ILE C C   1  
ATOM 998    O O   . ILE A 1 133 ? -71.187  49.390  -35.311 1.00 30.00  ? 137 ILE C O   1  
ATOM 999    C CB  . ILE A 1 133 ? -68.255  50.686  -35.437 1.00 99.99  ? 137 ILE C CB  1  
ATOM 1000   C CG1 . ILE A 1 133 ? -68.775  51.709  -34.434 1.00 99.99  ? 137 ILE C CG1 1  
ATOM 1001   C CG2 . ILE A 1 133 ? -67.021  51.245  -36.139 1.00 99.99  ? 137 ILE C CG2 1  
ATOM 1002   C CD1 . ILE A 1 133 ? -69.351  50.984  -33.220 1.00 99.99  ? 137 ILE C CD1 1  
ATOM 1003   N N   . ALA A 1 134 ? -71.258  51.620  -35.690 1.00 30.00  ? 138 ALA C N   1  
ATOM 1004   C CA  . ALA A 1 134 ? -72.554  51.839  -35.050 1.00 30.00  ? 138 ALA C CA  1  
ATOM 1005   C C   . ALA A 1 134 ? -73.641  51.000  -35.716 1.00 30.00  ? 138 ALA C C   1  
ATOM 1006   O O   . ALA A 1 134 ? -74.467  50.374  -35.047 1.00 30.00  ? 138 ALA C O   1  
ATOM 1007   C CB  . ALA A 1 134 ? -72.926  53.317  -35.136 1.00 30.00  ? 138 ALA C CB  1  
ATOM 1008   N N   . LYS A 1 135 ? -73.621  50.995  -37.042 1.00 30.00  ? 139 LYS C N   1  
ATOM 1009   C CA  . LYS A 1 135 ? -74.578  50.259  -37.848 1.00 30.00  ? 139 LYS C CA  1  
ATOM 1010   C C   . LYS A 1 135 ? -74.434  48.736  -37.827 1.00 30.00  ? 139 LYS C C   1  
ATOM 1011   O O   . LYS A 1 135 ? -75.414  48.027  -38.013 1.00 30.00  ? 139 LYS C O   1  
ATOM 1012   C CB  . LYS A 1 135 ? -74.452  50.672  -39.311 1.00 99.99  ? 139 LYS C CB  1  
ATOM 1013   C CG  . LYS A 1 135 ? -75.639  50.130  -40.098 1.00 99.99  ? 139 LYS C CG  1  
ATOM 1014   C CD  . LYS A 1 135 ? -75.565  50.629  -41.538 1.00 99.99  ? 139 LYS C CD  1  
ATOM 1015   C CE  . LYS A 1 135 ? -76.741  50.065  -42.330 1.00 99.99  ? 139 LYS C CE  1  
ATOM 1016   N NZ  . LYS A 1 135 ? -76.656  50.526  -43.723 1.00 99.99  ? 139 LYS C NZ  1  
ATOM 1017   N N   . TYR A 1 136 ? -73.228  48.225  -37.597 1.00 30.00  ? 140 TYR C N   1  
ATOM 1018   C CA  . TYR A 1 136 ? -73.033  46.781  -37.574 1.00 30.00  ? 140 TYR C CA  1  
ATOM 1019   C C   . TYR A 1 136 ? -73.319  46.147  -36.237 1.00 30.00  ? 140 TYR C C   1  
ATOM 1020   O O   . TYR A 1 136 ? -73.462  44.923  -36.142 1.00 30.00  ? 140 TYR C O   1  
ATOM 1021   C CB  . TYR A 1 136 ? -71.589  46.449  -37.926 1.00 99.99  ? 140 TYR C CB  1  
ATOM 1022   C CG  . TYR A 1 136 ? -70.882  45.911  -36.704 1.00 99.99  ? 140 TYR C CG  1  
ATOM 1023   C CD1 . TYR A 1 136 ? -71.318  46.283  -35.427 1.00 99.99  ? 140 TYR C CD1 1  
ATOM 1024   C CD2 . TYR A 1 136 ? -69.793  45.044  -36.849 1.00 99.99  ? 140 TYR C CD2 1  
ATOM 1025   C CE1 . TYR A 1 136 ? -70.663  45.786  -34.293 1.00 99.99  ? 140 TYR C CE1 1  
ATOM 1026   C CE2 . TYR A 1 136 ? -69.138  44.547  -35.716 1.00 99.99  ? 140 TYR C CE2 1  
ATOM 1027   C CZ  . TYR A 1 136 ? -69.574  44.919  -34.438 1.00 99.99  ? 140 TYR C CZ  1  
ATOM 1028   O OH  . TYR A 1 136 ? -68.935  44.435  -33.336 1.00 99.99  ? 140 TYR C OH  1  
ATOM 1029   N N   . ARG A 1 137 ? -73.408  46.969  -35.201 1.00 30.00  ? 141 ARG C N   1  
ATOM 1030   C CA  . ARG A 1 137 ? -73.669  46.465  -33.862 1.00 30.00  ? 141 ARG C CA  1  
ATOM 1031   C C   . ARG A 1 137 ? -74.973  45.650  -33.776 1.00 30.00  ? 141 ARG C C   1  
ATOM 1032   O O   . ARG A 1 137 ? -76.053  46.131  -34.149 1.00 30.00  ? 141 ARG C O   1  
ATOM 1033   C CB  . ARG A 1 137 ? -73.787  47.631  -32.884 1.00 99.99  ? 141 ARG C CB  1  
ATOM 1034   C CG  . ARG A 1 137 ? -73.348  47.175  -31.496 1.00 99.99  ? 141 ARG C CG  1  
ATOM 1035   C CD  . ARG A 1 137 ? -73.181  48.394  -30.593 1.00 99.99  ? 141 ARG C CD  1  
ATOM 1036   N NE  . ARG A 1 137 ? -72.381  48.056  -29.394 1.00 99.99  ? 141 ARG C NE  1  
ATOM 1037   C CZ  . ARG A 1 137 ? -71.958  48.970  -28.524 1.00 99.99  ? 141 ARG C CZ  1  
ATOM 1038   N NH1 . ARG A 1 137 ? -72.227  50.266  -28.676 1.00 99.99  ? 141 ARG C NH1 1  
ATOM 1039   N NH2 . ARG A 1 137 ? -71.246  48.558  -27.480 1.00 99.99  ? 141 ARG C NH2 1  
ATOM 1040   N N   . GLY A 1 138 ? -74.787  44.433  -33.278 1.00 30.00  ? 142 GLY C N   1  
ATOM 1041   C CA  . GLY A 1 138 ? -75.865  43.458  -32.995 1.00 30.00  ? 142 GLY C CA  1  
ATOM 1042   C C   . GLY A 1 138 ? -76.634  43.013  -34.253 1.00 30.00  ? 142 GLY C C   1  
ATOM 1043   O O   . GLY A 1 138 ? -77.715  42.417  -34.166 1.00 30.00  ? 142 GLY C O   1  
ATOM 1044   N N   . LYS A 1 139 ? -76.073  43.288  -35.411 1.00 30.00  ? 143 LYS C N   1  
ATOM 1045   C CA  . LYS A 1 139 ? -76.724  42.909  -36.680 1.00 30.00  ? 143 LYS C CA  1  
ATOM 1046   C C   . LYS A 1 139 ? -76.379  41.463  -37.052 1.00 30.00  ? 143 LYS C C   1  
ATOM 1047   O O   . LYS A 1 139 ? -75.235  41.019  -36.882 1.00 30.00  ? 143 LYS C O   1  
ATOM 1048   C CB  . LYS A 1 139 ? -76.249  43.831  -37.799 1.00 99.99  ? 143 LYS C CB  1  
ATOM 1049   C CG  . LYS A 1 139 ? -77.214  45.002  -37.939 1.00 99.99  ? 143 LYS C CG  1  
ATOM 1050   C CD  . LYS A 1 139 ? -76.974  45.996  -36.807 1.00 99.99  ? 143 LYS C CD  1  
ATOM 1051   C CE  . LYS A 1 139 ? -78.062  47.063  -36.827 1.00 99.99  ? 143 LYS C CE  1  
ATOM 1052   N NZ  . LYS A 1 139 ? -77.902  47.949  -35.666 1.00 99.99  ? 143 LYS C NZ  1  
ATOM 1053   N N   . ARG A 1 140 ? -77.400  40.793  -37.543 1.00 30.00  ? 144 ARG C N   1  
ATOM 1054   C CA  . ARG A 1 140 ? -77.324  39.398  -38.005 1.00 30.00  ? 144 ARG C CA  1  
ATOM 1055   C C   . ARG A 1 140 ? -76.848  39.416  -39.480 1.00 30.00  ? 144 ARG C C   1  
ATOM 1056   O O   . ARG A 1 140 ? -77.436  40.099  -40.324 1.00 30.00  ? 144 ARG C O   1  
ATOM 1057   C CB  . ARG A 1 140 ? -78.697  38.742  -37.901 1.00 99.99  ? 144 ARG C CB  1  
ATOM 1058   C CG  . ARG A 1 140 ? -79.642  39.376  -38.916 1.00 99.99  ? 144 ARG C CG  1  
ATOM 1059   C CD  . ARG A 1 140 ? -80.921  38.551  -39.006 1.00 99.99  ? 144 ARG C CD  1  
ATOM 1060   N NE  . ARG A 1 140 ? -81.910  39.202  -39.892 1.00 99.99  ? 144 ARG C NE  1  
ATOM 1061   C CZ  . ARG A 1 140 ? -83.144  38.735  -40.063 1.00 99.99  ? 144 ARG C CZ  1  
ATOM 1062   N NH1 . ARG A 1 140 ? -83.578  37.639  -39.446 1.00 99.99  ? 144 ARG C NH1 1  
ATOM 1063   N NH2 . ARG A 1 140 ? -83.955  39.400  -40.882 1.00 99.99  ? 144 ARG C NH2 1  
ATOM 1064   N N   . LYS A 1 141 ? -75.790  38.652  -39.722 1.00 30.00  ? 145 LYS C N   1  
ATOM 1065   C CA  . LYS A 1 141 ? -75.054  38.565  -41.026 1.00 30.00  ? 145 LYS C CA  1  
ATOM 1066   C C   . LYS A 1 141 ? -75.899  38.846  -42.306 1.00 30.00  ? 145 LYS C C   1  
ATOM 1067   O O   . LYS A 1 141 ? -75.421  39.467  -43.268 1.00 30.00  ? 145 LYS C O   1  
ATOM 1068   C CB  . LYS A 1 141 ? -74.479  37.164  -41.204 1.00 99.99  ? 145 LYS C CB  1  
ATOM 1069   C CG  . LYS A 1 141 ? -73.534  36.851  -40.050 1.00 99.99  ? 145 LYS C CG  1  
ATOM 1070   C CD  . LYS A 1 141 ? -72.882  35.492  -40.279 1.00 99.99  ? 145 LYS C CD  1  
ATOM 1071   C CE  . LYS A 1 141 ? -71.917  35.193  -39.135 1.00 99.99  ? 145 LYS C CE  1  
ATOM 1072   N NZ  . LYS A 1 141 ? -70.958  34.163  -39.563 1.00 99.99  ? 145 LYS C NZ  1  
ATOM 1073   N N   . THR A 1 142 ? -77.143  38.395  -42.347 1.00 30.00  ? 146 THR C N   1  
ATOM 1074   C CA  . THR A 1 142 ? -77.997  38.573  -43.558 1.00 30.00  ? 146 THR C CA  1  
ATOM 1075   C C   . THR A 1 142 ? -78.653  39.961  -43.601 1.00 30.00  ? 146 THR C C   1  
ATOM 1076   O O   . THR A 1 142 ? -79.065  40.443  -44.670 1.00 30.00  ? 146 THR C O   1  
ATOM 1077   C CB  . THR A 1 142 ? -79.109  37.528  -43.568 1.00 99.99  ? 146 THR C CB  1  
ATOM 1078   O OG1 . THR A 1 142 ? -80.021  37.793  -42.499 1.00 99.99  ? 146 THR C OG1 1  
ATOM 1079   C CG2 . THR A 1 142 ? -78.504  36.140  -43.387 1.00 99.99  ? 146 THR C CG2 1  
ATOM 1080   N N   . GLU A 1 143 ? -78.717  40.556  -42.436 1.00 30.00  ? 147 GLU C N   1  
ATOM 1081   C CA  . GLU A 1 143 ? -79.367  41.857  -42.218 1.00 30.00  ? 147 GLU C CA  1  
ATOM 1082   C C   . GLU A 1 143 ? -78.595  43.020  -42.848 1.00 30.00  ? 147 GLU C C   1  
ATOM 1083   O O   . GLU A 1 143 ? -79.188  44.005  -43.310 1.00 30.00  ? 147 GLU C O   1  
ATOM 1084   C CB  . GLU A 1 143 ? -79.483  42.134  -40.724 1.00 99.99  ? 147 GLU C CB  1  
ATOM 1085   C CG  . GLU A 1 143 ? -80.402  41.118  -40.090 1.00 99.99  ? 147 GLU C CG  1  
ATOM 1086   C CD  . GLU A 1 143 ? -81.843  41.403  -40.510 1.00 99.99  ? 147 GLU C CD  1  
ATOM 1087   O OE1 . GLU A 1 143 ? -82.260  40.844  -41.558 1.00 99.99  ? 147 GLU C OE1 1  
ATOM 1088   O OE2 . GLU A 1 143 ? -82.515  42.179  -39.777 1.00 99.99  ? 147 GLU C OE2 1  
ATOM 1089   N N   . ILE A 1 144 ? -77.280  42.912  -42.862 1.00 30.00  ? 148 ILE C N   1  
ATOM 1090   C CA  . ILE A 1 144 ? -76.445  44.013  -43.359 1.00 30.00  ? 148 ILE C CA  1  
ATOM 1091   C C   . ILE A 1 144 ? -75.294  43.520  -44.264 1.00 30.00  ? 148 ILE C C   1  
ATOM 1092   O O   . ILE A 1 144 ? -74.830  42.385  -44.109 1.00 30.00  ? 148 ILE C O   1  
ATOM 1093   C CB  . ILE A 1 144 ? -75.825  44.762  -42.184 1.00 99.99  ? 148 ILE C CB  1  
ATOM 1094   C CG1 . ILE A 1 144 ? -74.589  44.013  -41.696 1.00 99.99  ? 148 ILE C CG1 1  
ATOM 1095   C CG2 . ILE A 1 144 ? -76.842  44.858  -41.049 1.00 99.99  ? 148 ILE C CG2 1  
ATOM 1096   C CD1 . ILE A 1 144 ? -74.981  43.061  -40.572 1.00 99.99  ? 148 ILE C CD1 1  
ATOM 1097   N N   . PRO A 1 145 ? -74.839  44.361  -45.226 1.00 30.00  ? 149 PRO C N   1  
ATOM 1098   C CA  . PRO A 1 145 ? -73.750  44.000  -46.138 1.00 30.00  ? 149 PRO C CA  1  
ATOM 1099   C C   . PRO A 1 145 ? -72.643  43.171  -45.526 1.00 30.00  ? 149 PRO C C   1  
ATOM 1100   O O   . PRO A 1 145 ? -72.473  43.132  -44.305 1.00 30.00  ? 149 PRO C O   1  
ATOM 1101   C CB  . PRO A 1 145 ? -73.281  45.373  -46.467 1.00 99.99  ? 149 PRO C CB  1  
ATOM 1102   C CG  . PRO A 1 145 ? -74.208  46.319  -45.737 1.00 99.99  ? 149 PRO C CG  1  
ATOM 1103   C CD  . PRO A 1 145 ? -75.122  45.725  -45.073 1.00 99.99  ? 149 PRO C CD  1  
ATOM 1104   N N   . PRO A 1 146 ? -71.863  42.481  -46.370 1.00 30.00  ? 150 PRO C N   1  
ATOM 1105   C CA  . PRO A 1 146 ? -70.795  41.676  -45.786 1.00 30.00  ? 150 PRO C CA  1  
ATOM 1106   C C   . PRO A 1 146 ? -69.676  42.571  -45.235 1.00 30.00  ? 150 PRO C C   1  
ATOM 1107   O O   . PRO A 1 146 ? -69.246  43.548  -45.870 1.00 30.00  ? 150 PRO C O   1  
ATOM 1108   C CB  . PRO A 1 146 ? -70.394  40.935  -47.013 1.00 99.99  ? 150 PRO C CB  1  
ATOM 1109   C CG  . PRO A 1 146 ? -71.603  40.942  -47.921 1.00 99.99  ? 150 PRO C CG  1  
ATOM 1110   C CD  . PRO A 1 146 ? -72.332  41.979  -47.788 1.00 99.99  ? 150 PRO C CD  1  
ATOM 1111   N N   . HIS A 1 147 ? -69.212  42.232  -44.045 1.00 30.00  ? 151 HIS C N   1  
ATOM 1112   C CA  . HIS A 1 147 ? -68.158  42.995  -43.422 1.00 30.00  ? 151 HIS C CA  1  
ATOM 1113   C C   . HIS A 1 147 ? -67.519  42.167  -42.341 1.00 30.00  ? 151 HIS C C   1  
ATOM 1114   O O   . HIS A 1 147 ? -68.131  41.240  -41.792 1.00 30.00  ? 151 HIS C O   1  
ATOM 1115   C CB  . HIS A 1 147 ? -68.731  44.269  -42.814 1.00 99.99  ? 151 HIS C CB  1  
ATOM 1116   C CG  . HIS A 1 147 ? -67.710  45.311  -42.425 1.00 99.99  ? 151 HIS C CG  1  
ATOM 1117   N ND1 . HIS A 1 147 ? -67.134  45.341  -41.162 1.00 99.99  ? 151 HIS C ND1 1  
ATOM 1118   C CD2 . HIS A 1 147 ? -67.169  46.342  -43.126 1.00 99.99  ? 151 HIS C CD2 1  
ATOM 1119   C CE1 . HIS A 1 147 ? -66.288  46.354  -41.123 1.00 99.99  ? 151 HIS C CE1 1  
ATOM 1120   N NE2 . HIS A 1 147 ? -66.296  46.961  -42.284 1.00 99.99  ? 151 HIS C NE2 1  
ATOM 1121   N N   . LEU A 1 148 ? -66.276  42.524  -42.042 1.00 30.00  ? 152 LEU C N   1  
ATOM 1122   C CA  . LEU A 1 148 ? -65.502  41.853  -41.020 1.00 30.00  ? 152 LEU C CA  1  
ATOM 1123   C C   . LEU A 1 148 ? -66.144  42.147  -39.652 1.00 30.00  ? 152 LEU C C   1  
ATOM 1124   O O   . LEU A 1 148 ? -66.100  41.314  -38.738 1.00 30.00  ? 152 LEU C O   1  
ATOM 1125   C CB  . LEU A 1 148 ? -64.064  42.366  -41.038 1.00 99.99  ? 152 LEU C CB  1  
ATOM 1126   C CG  . LEU A 1 148 ? -63.208  41.443  -41.894 1.00 99.99  ? 152 LEU C CG  1  
ATOM 1127   C CD1 . LEU A 1 148 ? -61.733  41.750  -41.653 1.00 99.99  ? 152 LEU C CD1 1  
ATOM 1128   C CD2 . LEU A 1 148 ? -63.492  39.991  -41.521 1.00 99.99  ? 152 LEU C CD2 1  
ATOM 1129   N N   . PHE A 1 149 ? -66.760  43.328  -39.516 1.00 30.00  ? 153 PHE C N   1  
ATOM 1130   C CA  . PHE A 1 149 ? -67.393  43.678  -38.242 1.00 30.00  ? 153 PHE C CA  1  
ATOM 1131   C C   . PHE A 1 149 ? -68.451  42.652  -37.935 1.00 30.00  ? 153 PHE C C   1  
ATOM 1132   O O   . PHE A 1 149 ? -68.560  42.185  -36.800 1.00 30.00  ? 153 PHE C O   1  
ATOM 1133   C CB  . PHE A 1 149 ? -68.029  45.061  -38.343 1.00 99.99  ? 153 PHE C CB  1  
ATOM 1134   C CG  . PHE A 1 149 ? -66.947  46.115  -38.338 1.00 99.99  ? 153 PHE C CG  1  
ATOM 1135   C CD1 . PHE A 1 149 ? -66.328  46.474  -37.134 1.00 99.99  ? 153 PHE C CD1 1  
ATOM 1136   C CD2 . PHE A 1 149 ? -66.564  46.732  -39.536 1.00 99.99  ? 153 PHE C CD2 1  
ATOM 1137   C CE1 . PHE A 1 149 ? -65.325  47.454  -37.131 1.00 99.99  ? 153 PHE C CE1 1  
ATOM 1138   C CE2 . PHE A 1 149 ? -65.562  47.710  -39.528 1.00 99.99  ? 153 PHE C CE2 1  
ATOM 1139   C CZ  . PHE A 1 149 ? -64.944  48.068  -38.326 1.00 99.99  ? 153 PHE C CZ  1  
ATOM 1140   N N   . SER A 1 150 ? -69.223  42.299  -38.962 1.00 30.00  ? 154 SER C N   1  
ATOM 1141   C CA  . SER A 1 150 ? -70.294  41.313  -38.857 1.00 30.00  ? 154 SER C CA  1  
ATOM 1142   C C   . SER A 1 150 ? -69.780  39.985  -38.322 1.00 30.00  ? 154 SER C C   1  
ATOM 1143   O O   . SER A 1 150 ? -70.408  39.354  -37.469 1.00 30.00  ? 154 SER C O   1  
ATOM 1144   C CB  . SER A 1 150 ? -70.913  41.072  -40.229 1.00 99.99  ? 154 SER C CB  1  
ATOM 1145   O OG  . SER A 1 150 ? -71.426  42.301  -40.746 1.00 99.99  ? 154 SER C OG  1  
ATOM 1146   N N   . VAL A 1 151 ? -68.628  39.557  -38.826 1.00 30.00  ? 155 VAL C N   1  
ATOM 1147   C CA  . VAL A 1 151 ? -68.042  38.300  -38.375 1.00 30.00  ? 155 VAL C CA  1  
ATOM 1148   C C   . VAL A 1 151 ? -67.730  38.405  -36.882 1.00 30.00  ? 155 VAL C C   1  
ATOM 1149   O O   . VAL A 1 151 ? -68.029  37.484  -36.112 1.00 30.00  ? 155 VAL C O   1  
ATOM 1150   C CB  . VAL A 1 151 ? -66.755  38.020  -39.145 1.00 99.99  ? 155 VAL C CB  1  
ATOM 1151   C CG1 . VAL A 1 151 ? -66.122  36.731  -38.631 1.00 99.99  ? 155 VAL C CG1 1  
ATOM 1152   C CG2 . VAL A 1 151 ? -67.071  37.875  -40.628 1.00 99.99  ? 155 VAL C CG2 1  
ATOM 1153   N N   . ALA A 1 152 ? -67.122  39.539  -36.497 1.00 30.00  ? 156 ALA C N   1  
ATOM 1154   C CA  . ALA A 1 152 ? -66.743  39.828  -35.098 1.00 30.00  ? 156 ALA C CA  1  
ATOM 1155   C C   . ALA A 1 152 ? -68.004  40.001  -34.251 1.00 30.00  ? 156 ALA C C   1  
ATOM 1156   O O   . ALA A 1 152 ? -68.173  39.347  -33.206 1.00 30.00  ? 156 ALA C O   1  
ATOM 1157   C CB  . ALA A 1 152 ? -65.913  41.088  -35.048 1.00 30.00  ? 156 ALA C CB  1  
ATOM 1158   N N   . ASP A 1 153 ? -68.887  40.885  -34.709 1.00 30.00  ? 157 ASP C N   1  
ATOM 1159   C CA  . ASP A 1 153 ? -70.130  41.105  -33.994 1.00 30.00  ? 157 ASP C CA  1  
ATOM 1160   C C   . ASP A 1 153 ? -70.857  39.776  -33.759 1.00 30.00  ? 157 ASP C C   1  
ATOM 1161   O O   . ASP A 1 153 ? -71.398  39.534  -32.679 1.00 30.00  ? 157 ASP C O   1  
ATOM 1162   C CB  . ASP A 1 153 ? -71.037  42.026  -34.802 1.00 99.99  ? 157 ASP C CB  1  
ATOM 1163   C CG  . ASP A 1 153 ? -72.227  42.451  -33.946 1.00 99.99  ? 157 ASP C CG  1  
ATOM 1164   O OD1 . ASP A 1 153 ? -73.175  41.631  -33.829 1.00 99.99  ? 157 ASP C OD1 1  
ATOM 1165   O OD2 . ASP A 1 153 ? -72.175  43.591  -33.412 1.00 99.99  ? 157 ASP C OD2 1  
ATOM 1166   N N   . ASN A 1 154 ? -70.881  38.899  -34.756 1.00 30.00  ? 158 ASN C N   1  
ATOM 1167   C CA  . ASN A 1 154 ? -71.574  37.642  -34.558 1.00 30.00  ? 158 ASN C CA  1  
ATOM 1168   C C   . ASN A 1 154 ? -70.887  36.726  -33.562 1.00 30.00  ? 158 ASN C C   1  
ATOM 1169   O O   . ASN A 1 154 ? -71.556  36.113  -32.745 1.00 30.00  ? 158 ASN C O   1  
ATOM 1170   C CB  . ASN A 1 154 ? -71.665  36.887  -35.879 1.00 99.99  ? 158 ASN C CB  1  
ATOM 1171   C CG  . ASN A 1 154 ? -72.811  37.407  -36.732 1.00 99.99  ? 158 ASN C CG  1  
ATOM 1172   O OD1 . ASN A 1 154 ? -73.970  37.347  -36.323 1.00 99.99  ? 158 ASN C OD1 1  
ATOM 1173   N ND2 . ASN A 1 154 ? -72.486  37.924  -37.920 1.00 99.99  ? 158 ASN C ND2 1  
ATOM 1174   N N   . ALA A 1 155 ? -69.568  36.619  -33.616 1.00 30.00  ? 159 ALA C N   1  
ATOM 1175   C CA  . ALA A 1 155 ? -68.885  35.754  -32.666 1.00 30.00  ? 159 ALA C CA  1  
ATOM 1176   C C   . ALA A 1 155 ? -69.223  36.230  -31.252 1.00 30.00  ? 159 ALA C C   1  
ATOM 1177   O O   . ALA A 1 155 ? -69.335  35.427  -30.326 1.00 30.00  ? 159 ALA C O   1  
ATOM 1178   C CB  . ALA A 1 155 ? -67.379  35.803  -32.893 1.00 30.00  ? 159 ALA C CB  1  
ATOM 1179   N N   . TYR A 1 156 ? -69.394  37.539  -31.082 1.00 30.00  ? 160 TYR C N   1  
ATOM 1180   C CA  . TYR A 1 156 ? -69.720  38.080  -29.768 1.00 30.00  ? 160 TYR C CA  1  
ATOM 1181   C C   . TYR A 1 156 ? -71.067  37.541  -29.303 1.00 30.00  ? 160 TYR C C   1  
ATOM 1182   O O   . TYR A 1 156 ? -71.169  36.947  -28.223 1.00 30.00  ? 160 TYR C O   1  
ATOM 1183   C CB  . TYR A 1 156 ? -69.788  39.602  -29.834 1.00 99.99  ? 160 TYR C CB  1  
ATOM 1184   C CG  . TYR A 1 156 ? -70.126  40.153  -28.471 1.00 99.99  ? 160 TYR C CG  1  
ATOM 1185   C CD1 . TYR A 1 156 ? -69.115  40.334  -27.519 1.00 99.99  ? 160 TYR C CD1 1  
ATOM 1186   C CD2 . TYR A 1 156 ? -71.452  40.480  -28.156 1.00 99.99  ? 160 TYR C CD2 1  
ATOM 1187   C CE1 . TYR A 1 156 ? -69.429  40.847  -26.254 1.00 99.99  ? 160 TYR C CE1 1  
ATOM 1188   C CE2 . TYR A 1 156 ? -71.764  40.991  -26.890 1.00 99.99  ? 160 TYR C CE2 1  
ATOM 1189   C CZ  . TYR A 1 156 ? -70.752  41.174  -25.939 1.00 99.99  ? 160 TYR C CZ  1  
ATOM 1190   O OH  . TYR A 1 156 ? -71.058  41.670  -24.710 1.00 99.99  ? 160 TYR C OH  1  
ATOM 1191   N N   . GLN A 1 157 ? -72.096  37.752  -30.129 1.00 30.00  ? 161 GLN C N   1  
ATOM 1192   C CA  . GLN A 1 157 ? -73.446  37.292  -29.818 1.00 30.00  ? 161 GLN C CA  1  
ATOM 1193   C C   . GLN A 1 157 ? -73.468  35.804  -29.438 1.00 30.00  ? 161 GLN C C   1  
ATOM 1194   O O   . GLN A 1 157 ? -74.139  35.415  -28.476 1.00 30.00  ? 161 GLN C O   1  
ATOM 1195   C CB  . GLN A 1 157 ? -74.352  37.488  -31.028 1.00 99.99  ? 161 GLN C CB  1  
ATOM 1196   C CG  . GLN A 1 157 ? -75.803  37.588  -30.566 1.00 99.99  ? 161 GLN C CG  1  
ATOM 1197   C CD  . GLN A 1 157 ? -76.423  36.208  -30.406 1.00 99.99  ? 161 GLN C CD  1  
ATOM 1198   O OE1 . GLN A 1 157 ? -75.766  35.195  -30.641 1.00 99.99  ? 161 GLN C OE1 1  
ATOM 1199   N NE2 . GLN A 1 157 ? -77.699  36.166  -30.004 1.00 99.99  ? 161 GLN C NE2 1  
ATOM 1200   N N   . ASN A 1 158 ? -72.732  34.977  -30.187 1.00 30.00  ? 162 ASN C N   1  
ATOM 1201   C CA  . ASN A 1 158 ? -72.673  33.530  -29.924 1.00 30.00  ? 162 ASN C CA  1  
ATOM 1202   C C   . ASN A 1 158 ? -72.072  33.221  -28.566 1.00 30.00  ? 162 ASN C C   1  
ATOM 1203   O O   . ASN A 1 158 ? -72.617  32.434  -27.801 1.00 30.00  ? 162 ASN C O   1  
ATOM 1204   C CB  . ASN A 1 158 ? -71.818  32.845  -30.984 1.00 99.99  ? 162 ASN C CB  1  
ATOM 1205   C CG  . ASN A 1 158 ? -72.434  32.993  -32.369 1.00 99.99  ? 162 ASN C CG  1  
ATOM 1206   O OD1 . ASN A 1 158 ? -73.596  32.651  -32.574 1.00 99.99  ? 162 ASN C OD1 1  
ATOM 1207   N ND2 . ASN A 1 158 ? -71.651  33.506  -33.319 1.00 99.99  ? 162 ASN C ND2 1  
ATOM 1208   N N   . MET A 1 159 ? -70.931  33.835  -28.272 1.00 30.00  ? 163 MET C N   1  
ATOM 1209   C CA  . MET A 1 159 ? -70.282  33.599  -26.997 1.00 30.00  ? 163 MET C CA  1  
ATOM 1210   C C   . MET A 1 159 ? -71.251  33.943  -25.881 1.00 30.00  ? 163 MET C C   1  
ATOM 1211   O O   . MET A 1 159 ? -71.370  33.210  -24.888 1.00 30.00  ? 163 MET C O   1  
ATOM 1212   C CB  . MET A 1 159 ? -69.035  34.468  -26.880 1.00 99.99  ? 163 MET C CB  1  
ATOM 1213   C CG  . MET A 1 159 ? -68.067  34.126  -28.007 1.00 99.99  ? 163 MET C CG  1  
ATOM 1214   S SD  . MET A 1 159 ? -66.380  34.572  -27.532 1.00 99.99  ? 163 MET C SD  1  
ATOM 1215   C CE  . MET A 1 159 ? -66.568  36.329  -27.328 1.00 99.99  ? 163 MET C CE  1  
ATOM 1216   N N   . VAL A 1 160 ? -71.942  35.070  -26.062 1.00 30.00  ? 164 VAL C N   1  
ATOM 1217   C CA  . VAL A 1 160 ? -72.922  35.562  -25.098 1.00 30.00  ? 164 VAL C CA  1  
ATOM 1218   C C   . VAL A 1 160 ? -74.105  34.595  -24.954 1.00 30.00  ? 164 VAL C C   1  
ATOM 1219   O O   . VAL A 1 160 ? -74.232  33.894  -23.939 1.00 30.00  ? 164 VAL C O   1  
ATOM 1220   C CB  . VAL A 1 160 ? -73.458  36.917  -25.549 1.00 99.99  ? 164 VAL C CB  1  
ATOM 1221   C CG1 . VAL A 1 160 ? -74.517  37.397  -24.560 1.00 99.99  ? 164 VAL C CG1 1  
ATOM 1222   C CG2 . VAL A 1 160 ? -72.317  37.926  -25.602 1.00 99.99  ? 164 VAL C CG2 1  
ATOM 1223   N N   . THR A 1 161 ? -74.962  34.539  -25.977 1.00 30.00  ? 165 THR C N   1  
ATOM 1224   C CA  . THR A 1 161 ? -76.122  33.659  -25.939 1.00 30.00  ? 165 THR C CA  1  
ATOM 1225   C C   . THR A 1 161 ? -75.776  32.175  -25.775 1.00 30.00  ? 165 THR C C   1  
ATOM 1226   O O   . THR A 1 161 ? -76.367  31.505  -24.930 1.00 30.00  ? 165 THR C O   1  
ATOM 1227   C CB  . THR A 1 161 ? -76.918  33.793  -27.234 1.00 99.99  ? 165 THR C CB  1  
ATOM 1228   O OG1 . THR A 1 161 ? -76.151  33.257  -28.317 1.00 99.99  ? 165 THR C OG1 1  
ATOM 1229   C CG2 . THR A 1 161 ? -77.211  35.262  -27.501 1.00 99.99  ? 165 THR C CG2 1  
ATOM 1230   N N   . ASP A 1 162 ? -74.824  31.669  -26.558 1.00 30.00  ? 166 ASP C N   1  
ATOM 1231   C CA  . ASP A 1 162 ? -74.428  30.250  -26.479 1.00 30.00  ? 166 ASP C CA  1  
ATOM 1232   C C   . ASP A 1 162 ? -73.560  29.924  -25.270 1.00 30.00  ? 166 ASP C C   1  
ATOM 1233   O O   . ASP A 1 162 ? -73.386  28.754  -24.929 1.00 30.00  ? 166 ASP C O   1  
ATOM 1234   C CB  . ASP A 1 162 ? -73.637  29.862  -27.722 1.00 99.99  ? 166 ASP C CB  1  
ATOM 1235   C CG  . ASP A 1 162 ? -74.552  29.884  -28.941 1.00 99.99  ? 166 ASP C CG  1  
ATOM 1236   O OD1 . ASP A 1 162 ? -75.411  28.965  -29.035 1.00 99.99  ? 166 ASP C OD1 1  
ATOM 1237   O OD2 . ASP A 1 162 ? -74.391  30.823  -29.769 1.00 99.99  ? 166 ASP C OD2 1  
ATOM 1238   N N   . ARG A 1 163 ? -73.008  30.946  -24.628 1.00 30.00  ? 167 ARG C N   1  
ATOM 1239   C CA  . ARG A 1 163 ? -72.143  30.774  -23.452 1.00 30.00  ? 167 ARG C CA  1  
ATOM 1240   C C   . ARG A 1 163 ? -71.030  29.769  -23.761 1.00 30.00  ? 167 ARG C C   1  
ATOM 1241   O O   . ARG A 1 163 ? -71.033  28.642  -23.255 1.00 30.00  ? 167 ARG C O   1  
ATOM 1242   C CB  . ARG A 1 163 ? -72.966  30.258  -22.275 1.00 99.99  ? 167 ARG C CB  1  
ATOM 1243   C CG  . ARG A 1 163 ? -73.971  31.323  -21.851 1.00 99.99  ? 167 ARG C CG  1  
ATOM 1244   C CD  . ARG A 1 163 ? -75.027  30.695  -20.947 1.00 99.99  ? 167 ARG C CD  1  
ATOM 1245   N NE  . ARG A 1 163 ? -76.086  31.672  -20.612 1.00 99.99  ? 167 ARG C NE  1  
ATOM 1246   C CZ  . ARG A 1 163 ? -77.064  31.998  -21.453 1.00 99.99  ? 167 ARG C CZ  1  
ATOM 1247   N NH1 . ARG A 1 163 ? -77.155  31.463  -22.670 1.00 99.99  ? 167 ARG C NH1 1  
ATOM 1248   N NH2 . ARG A 1 163 ? -77.966  32.888  -21.051 1.00 99.99  ? 167 ARG C NH2 1  
ATOM 1249   N N   . GLU A 1 164 ? -70.055  30.188  -24.579 1.00 30.00  ? 168 GLU C N   1  
ATOM 1250   C CA  . GLU A 1 164 ? -68.898  29.370  -24.978 1.00 30.00  ? 168 GLU C CA  1  
ATOM 1251   C C   . GLU A 1 164 ? -67.818  30.288  -25.590 1.00 30.00  ? 168 GLU C C   1  
ATOM 1252   O O   . GLU A 1 164 ? -68.122  31.421  -25.979 1.00 30.00  ? 168 GLU C O   1  
ATOM 1253   C CB  . GLU A 1 164 ? -69.328  28.331  -26.009 1.00 99.99  ? 168 GLU C CB  1  
ATOM 1254   C CG  . GLU A 1 164 ? -68.397  28.381  -27.195 1.00 99.99  ? 168 GLU C CG  1  
ATOM 1255   C CD  . GLU A 1 164 ? -68.647  29.662  -27.986 1.00 99.99  ? 168 GLU C CD  1  
ATOM 1256   O OE1 . GLU A 1 164 ? -67.982  30.679  -27.662 1.00 99.99  ? 168 GLU C OE1 1  
ATOM 1257   O OE2 . GLU A 1 164 ? -69.506  29.609  -28.908 1.00 99.99  ? 168 GLU C OE2 1  
ATOM 1258   N N   . ASN A 1 165 ? -66.577  29.810  -25.675 1.00 30.00  ? 169 ASN C N   1  
ATOM 1259   C CA  . ASN A 1 165 ? -65.501  30.621  -26.255 1.00 30.00  ? 169 ASN C CA  1  
ATOM 1260   C C   . ASN A 1 165 ? -65.585  30.655  -27.779 1.00 30.00  ? 169 ASN C C   1  
ATOM 1261   O O   . ASN A 1 165 ? -65.923  29.648  -28.418 1.00 30.00  ? 169 ASN C O   1  
ATOM 1262   C CB  . ASN A 1 165 ? -64.146  30.039  -25.863 1.00 99.99  ? 169 ASN C CB  1  
ATOM 1263   C CG  . ASN A 1 165 ? -63.941  30.088  -24.357 1.00 99.99  ? 169 ASN C CG  1  
ATOM 1264   O OD1 . ASN A 1 165 ? -64.065  31.148  -23.744 1.00 99.99  ? 169 ASN C OD1 1  
ATOM 1265   N ND2 . ASN A 1 165 ? -63.628  28.937  -23.759 1.00 99.99  ? 169 ASN C ND2 1  
ATOM 1266   N N   . GLN A 1 166 ? -65.282  31.813  -28.354 1.00 30.00  ? 170 GLN C N   1  
ATOM 1267   C CA  . GLN A 1 166 ? -65.307  31.969  -29.803 1.00 30.00  ? 170 GLN C CA  1  
ATOM 1268   C C   . GLN A 1 166 ? -63.872  32.040  -30.287 1.00 30.00  ? 170 GLN C C   1  
ATOM 1269   O O   . GLN A 1 166 ? -62.933  31.988  -29.484 1.00 30.00  ? 170 GLN C O   1  
ATOM 1270   C CB  . GLN A 1 166 ? -66.054  33.243  -30.175 1.00 99.99  ? 170 GLN C CB  1  
ATOM 1271   C CG  . GLN A 1 166 ? -67.516  33.118  -29.762 1.00 99.99  ? 170 GLN C CG  1  
ATOM 1272   C CD  . GLN A 1 166 ? -68.260  32.145  -30.666 1.00 99.99  ? 170 GLN C CD  1  
ATOM 1273   O OE1 . GLN A 1 166 ? -67.677  31.578  -31.587 1.00 99.99  ? 170 GLN C OE1 1  
ATOM 1274   N NE2 . GLN A 1 166 ? -69.554  31.952  -30.401 1.00 99.99  ? 170 GLN C NE2 1  
ATOM 1275   N N   . SER A 1 167 ? -63.690  32.154  -31.596 1.00 30.00  ? 171 SER C N   1  
ATOM 1276   C CA  . SER A 1 167 ? -62.347  32.225  -32.153 1.00 30.00  ? 171 SER C CA  1  
ATOM 1277   C C   . SER A 1 167 ? -62.350  32.429  -33.665 1.00 30.00  ? 171 SER C C   1  
ATOM 1278   O O   . SER A 1 167 ? -63.152  31.827  -34.383 1.00 30.00  ? 171 SER C O   1  
ATOM 1279   C CB  . SER A 1 167 ? -61.593  30.931  -31.863 1.00 99.99  ? 171 SER C CB  1  
ATOM 1280   O OG  . SER A 1 167 ? -61.262  30.874  -30.473 1.00 99.99  ? 171 SER C OG  1  
ATOM 1281   N N   . CYS A 1 168 ? -61.456  33.302  -34.134 1.00 30.00  ? 172 CYS C N   1  
ATOM 1282   C CA  . CYS A 1 168 ? -61.319  33.612  -35.548 1.00 30.00  ? 172 CYS C CA  1  
ATOM 1283   C C   . CYS A 1 168 ? -59.953  33.271  -36.027 1.00 30.00  ? 172 CYS C C   1  
ATOM 1284   O O   . CYS A 1 168 ? -58.953  33.768  -35.507 1.00 30.00  ? 172 CYS C O   1  
ATOM 1285   C CB  . CYS A 1 168 ? -61.563  35.097  -35.777 1.00 99.99  ? 172 CYS C CB  1  
ATOM 1286   S SG  . CYS A 1 168 ? -60.348  36.226  -35.050 1.00 99.99  ? 172 CYS C SG  1  
ATOM 1287   N N   . LEU A 1 169 ? -59.913  32.415  -37.034 1.00 30.00  ? 173 LEU C N   1  
ATOM 1288   C CA  . LEU A 1 169 ? -58.654  32.035  -37.601 1.00 30.00  ? 173 LEU C CA  1  
ATOM 1289   C C   . LEU A 1 169 ? -58.695  32.854  -38.897 1.00 30.00  ? 173 LEU C C   1  
ATOM 1290   O O   . LEU A 1 169 ? -59.520  32.599  -39.794 1.00 30.00  ? 173 LEU C O   1  
ATOM 1291   C CB  . LEU A 1 169 ? -58.618  30.528  -37.823 1.00 99.99  ? 173 LEU C CB  1  
ATOM 1292   C CG  . LEU A 1 169 ? -57.961  29.851  -36.624 1.00 99.99  ? 173 LEU C CG  1  
ATOM 1293   C CD1 . LEU A 1 169 ? -57.624  28.406  -36.978 1.00 99.99  ? 173 LEU C CD1 1  
ATOM 1294   C CD2 . LEU A 1 169 ? -56.681  30.597  -36.261 1.00 99.99  ? 173 LEU C CD2 1  
ATOM 1295   N N   . ILE A 1 170 ? -57.826  33.868  -38.978 1.00 30.00  ? 174 ILE C N   1  
ATOM 1296   C CA  . ILE A 1 170 ? -57.760  34.714  -40.156 1.00 30.00  ? 174 ILE C CA  1  
ATOM 1297   C C   . ILE A 1 170 ? -56.583  34.189  -40.938 1.00 30.00  ? 174 ILE C C   1  
ATOM 1298   O O   . ILE A 1 170 ? -55.432  34.382  -40.539 1.00 30.00  ? 174 ILE C O   1  
ATOM 1299   C CB  . ILE A 1 170 ? -57.559  36.167  -39.741 1.00 99.99  ? 174 ILE C CB  1  
ATOM 1300   C CG1 . ILE A 1 170 ? -56.070  36.443  -39.561 1.00 99.99  ? 174 ILE C CG1 1  
ATOM 1301   C CG2 . ILE A 1 170 ? -58.286  36.423  -38.424 1.00 99.99  ? 174 ILE C CG2 1  
ATOM 1302   C CD1 . ILE A 1 170 ? -55.503  37.020  -40.855 1.00 99.99  ? 174 ILE C CD1 1  
ATOM 1303   N N   . THR A 1 171 ? -56.867  33.518  -42.054 1.00 30.00  ? 175 THR C N   1  
ATOM 1304   C CA  . THR A 1 171 ? -55.802  32.962  -42.874 1.00 30.00  ? 175 THR C CA  1  
ATOM 1305   C C   . THR A 1 171 ? -55.659  33.607  -44.240 1.00 30.00  ? 175 THR C C   1  
ATOM 1306   O O   . THR A 1 171 ? -56.505  34.387  -44.686 1.00 30.00  ? 175 THR C O   1  
ATOM 1307   C CB  . THR A 1 171 ? -56.052  31.476  -43.113 1.00 99.99  ? 175 THR C CB  1  
ATOM 1308   O OG1 . THR A 1 171 ? -57.204  31.316  -43.944 1.00 99.99  ? 175 THR C OG1 1  
ATOM 1309   C CG2 . THR A 1 171 ? -56.291  30.781  -41.778 1.00 99.99  ? 175 THR C CG2 1  
ATOM 1310   N N   . GLY A 1 172 ? -54.562  33.260  -44.900 1.00 30.00  ? 176 GLY C N   1  
ATOM 1311   C CA  . GLY A 1 172 ? -54.287  33.815  -46.202 1.00 30.00  ? 176 GLY C CA  1  
ATOM 1312   C C   . GLY A 1 172 ? -52.795  33.761  -46.422 1.00 30.00  ? 176 GLY C C   1  
ATOM 1313   O O   . GLY A 1 172 ? -52.041  33.334  -45.540 1.00 30.00  ? 176 GLY C O   1  
ATOM 1314   N N   . GLU A 1 173 ? -52.369  34.195  -47.608 1.00 30.00  ? 177 GLU C N   1  
ATOM 1315   C CA  . GLU A 1 173 ? -50.957  34.204  -47.982 1.00 30.00  ? 177 GLU C CA  1  
ATOM 1316   C C   . GLU A 1 173 ? -50.295  35.417  -47.356 1.00 30.00  ? 177 GLU C C   1  
ATOM 1317   O O   . GLU A 1 173 ? -50.951  36.229  -46.715 1.00 30.00  ? 177 GLU C O   1  
ATOM 1318   C CB  . GLU A 1 173 ? -50.823  34.274  -49.498 1.00 99.99  ? 177 GLU C CB  1  
ATOM 1319   C CG  . GLU A 1 173 ? -51.546  35.494  -50.014 1.00 99.99  ? 177 GLU C CG  1  
ATOM 1320   C CD  . GLU A 1 173 ? -53.048  35.223  -50.048 1.00 99.99  ? 177 GLU C CD  1  
ATOM 1321   O OE1 . GLU A 1 173 ? -53.709  35.505  -49.016 1.00 99.99  ? 177 GLU C OE1 1  
ATOM 1322   O OE2 . GLU A 1 173 ? -53.520  34.733  -51.111 1.00 99.99  ? 177 GLU C OE2 1  
ATOM 1323   N N   . SER A 1 174 ? -48.990  35.539  -47.554 1.00 30.00  ? 178 SER C N   1  
ATOM 1324   C CA  . SER A 1 174 ? -48.270  36.654  -46.986 1.00 30.00  ? 178 SER C CA  1  
ATOM 1325   C C   . SER A 1 174 ? -48.483  37.930  -47.782 1.00 30.00  ? 178 SER C C   1  
ATOM 1326   O O   . SER A 1 174 ? -48.157  37.991  -48.958 1.00 30.00  ? 178 SER C O   1  
ATOM 1327   C CB  . SER A 1 174 ? -46.774  36.354  -46.970 1.00 99.99  ? 178 SER C CB  1  
ATOM 1328   O OG  . SER A 1 174 ? -46.537  35.172  -46.201 1.00 99.99  ? 178 SER C OG  1  
ATOM 1329   N N   . GLY A 1 175 ? -49.035  38.939  -47.114 1.00 30.00  ? 179 GLY C N   1  
ATOM 1330   C CA  . GLY A 1 175 ? -49.285  40.214  -47.765 1.00 30.00  ? 179 GLY C CA  1  
ATOM 1331   C C   . GLY A 1 175 ? -50.745  40.315  -48.118 1.00 30.00  ? 179 GLY C C   1  
ATOM 1332   O O   . GLY A 1 175 ? -51.146  41.260  -48.802 1.00 30.00  ? 179 GLY C O   1  
ATOM 1333   N N   . ALA A 1 176 ? -51.533  39.345  -47.639 1.00 30.00  ? 180 ALA C N   1  
ATOM 1334   C CA  . ALA A 1 176 ? -52.982  39.278  -47.915 1.00 30.00  ? 180 ALA C CA  1  
ATOM 1335   C C   . ALA A 1 176 ? -53.861  40.232  -47.133 1.00 30.00  ? 180 ALA C C   1  
ATOM 1336   O O   . ALA A 1 176 ? -54.643  40.987  -47.733 1.00 30.00  ? 180 ALA C O   1  
ATOM 1337   C CB  . ALA A 1 176 ? -53.482  37.872  -47.685 1.00 30.00  ? 180 ALA C CB  1  
ATOM 1338   N N   . GLY A 1 177 ? -53.743  40.182  -45.802 1.00 30.00  ? 181 GLY C N   1  
ATOM 1339   C CA  . GLY A 1 177 ? -54.542  41.046  -44.958 1.00 30.00  ? 181 GLY C CA  1  
ATOM 1340   C C   . GLY A 1 177 ? -54.733  40.420  -43.587 1.00 30.00  ? 181 GLY C C   1  
ATOM 1341   O O   . GLY A 1 177 ? -55.506  40.932  -42.765 1.00 30.00  ? 181 GLY C O   1  
ATOM 1342   N N   . LYS A 1 178 ? -54.037  39.319  -43.322 1.00 30.00  ? 182 LYS C N   1  
ATOM 1343   C CA  . LYS A 1 178 ? -54.180  38.660  -42.016 1.00 30.00  ? 182 LYS C CA  1  
ATOM 1344   C C   . LYS A 1 178 ? -54.082  39.643  -40.834 1.00 30.00  ? 182 LYS C C   1  
ATOM 1345   O O   . LYS A 1 178 ? -54.993  39.724  -40.015 1.00 30.00  ? 182 LYS C O   1  
ATOM 1346   C CB  . LYS A 1 178 ? -53.083  37.615  -41.838 1.00 99.99  ? 182 LYS C CB  1  
ATOM 1347   C CG  . LYS A 1 178 ? -53.539  36.291  -42.442 1.00 99.99  ? 182 LYS C CG  1  
ATOM 1348   C CD  . LYS A 1 178 ? -52.661  35.163  -41.910 1.00 99.99  ? 182 LYS C CD  1  
ATOM 1349   C CE  . LYS A 1 178 ? -51.289  35.228  -42.573 1.00 99.99  ? 182 LYS C CE  1  
ATOM 1350   N NZ  . LYS A 1 178 ? -50.565  33.973  -42.329 1.00 99.99  ? 182 LYS C NZ  1  
ATOM 1351   N N   . THR A 1 179 ? -52.968  40.379  -40.758 1.00 30.00  ? 183 THR C N   1  
ATOM 1352   C CA  . THR A 1 179 ? -52.713  41.342  -39.685 1.00 30.00  ? 183 THR C CA  1  
ATOM 1353   C C   . THR A 1 179 ? -53.687  42.517  -39.656 1.00 30.00  ? 183 THR C C   1  
ATOM 1354   O O   . THR A 1 179 ? -54.324  42.765  -38.628 1.00 30.00  ? 183 THR C O   1  
ATOM 1355   C CB  . THR A 1 179 ? -51.314  41.927  -39.838 1.00 99.99  ? 183 THR C CB  1  
ATOM 1356   O OG1 . THR A 1 179 ? -51.265  42.746  -41.010 1.00 99.99  ? 183 THR C OG1 1  
ATOM 1357   C CG2 . THR A 1 179 ? -50.301  40.798  -39.966 1.00 99.99  ? 183 THR C CG2 1  
ATOM 1358   N N   . GLU A 1 180 ? -53.803  43.235  -40.765 1.00 30.00  ? 184 GLU C N   1  
ATOM 1359   C CA  . GLU A 1 180 ? -54.729  44.358  -40.838 1.00 30.00  ? 184 GLU C CA  1  
ATOM 1360   C C   . GLU A 1 180 ? -56.124  44.007  -40.327 1.00 30.00  ? 184 GLU C C   1  
ATOM 1361   O O   . GLU A 1 180 ? -56.747  44.769  -39.581 1.00 30.00  ? 184 GLU C O   1  
ATOM 1362   C CB  . GLU A 1 180 ? -54.867  44.823  -42.283 1.00 99.99  ? 184 GLU C CB  1  
ATOM 1363   C CG  . GLU A 1 180 ? -53.544  45.364  -42.769 1.00 99.99  ? 184 GLU C CG  1  
ATOM 1364   C CD  . GLU A 1 180 ? -53.269  46.708  -42.102 1.00 99.99  ? 184 GLU C CD  1  
ATOM 1365   O OE1 . GLU A 1 180 ? -52.640  46.692  -41.010 1.00 99.99  ? 184 GLU C OE1 1  
ATOM 1366   O OE2 . GLU A 1 180 ? -53.687  47.742  -42.691 1.00 99.99  ? 184 GLU C OE2 1  
ATOM 1367   N N   . ASN A 1 181 ? -56.610  42.845  -40.740 1.00 30.00  ? 185 ASN C N   1  
ATOM 1368   C CA  . ASN A 1 181 ? -57.926  42.376  -40.346 1.00 30.00  ? 185 ASN C CA  1  
ATOM 1369   C C   . ASN A 1 181 ? -57.971  41.916  -38.894 1.00 30.00  ? 185 ASN C C   1  
ATOM 1370   O O   . ASN A 1 181 ? -59.008  42.034  -38.238 1.00 30.00  ? 185 ASN C O   1  
ATOM 1371   C CB  . ASN A 1 181 ? -58.341  41.197  -41.219 1.00 99.99  ? 185 ASN C CB  1  
ATOM 1372   C CG  . ASN A 1 181 ? -58.462  41.611  -42.679 1.00 99.99  ? 185 ASN C CG  1  
ATOM 1373   O OD1 . ASN A 1 181 ? -59.176  42.560  -42.999 1.00 99.99  ? 185 ASN C OD1 1  
ATOM 1374   N ND2 . ASN A 1 181 ? -57.764  40.895  -43.562 1.00 99.99  ? 185 ASN C ND2 1  
ATOM 1375   N N   . THR A 1 182 ? -56.867  41.383  -38.387 1.00 30.00  ? 186 THR C N   1  
ATOM 1376   C CA  . THR A 1 182 ? -56.863  40.949  -37.006 1.00 30.00  ? 186 THR C CA  1  
ATOM 1377   C C   . THR A 1 182 ? -57.002  42.200  -36.147 1.00 30.00  ? 186 THR C C   1  
ATOM 1378   O O   . THR A 1 182 ? -57.761  42.241  -35.179 1.00 30.00  ? 186 THR C O   1  
ATOM 1379   C CB  . THR A 1 182 ? -55.556  40.227  -36.696 1.00 99.99  ? 186 THR C CB  1  
ATOM 1380   O OG1 . THR A 1 182 ? -54.474  41.161  -36.734 1.00 99.99  ? 186 THR C OG1 1  
ATOM 1381   C CG2 . THR A 1 182 ? -55.320  39.136  -37.735 1.00 99.99  ? 186 THR C CG2 1  
ATOM 1382   N N   . LYS A 1 183 ? -56.264  43.235  -36.515 1.00 30.00  ? 187 LYS C N   1  
ATOM 1383   C CA  . LYS A 1 183 ? -56.322  44.456  -35.756 1.00 30.00  ? 187 LYS C CA  1  
ATOM 1384   C C   . LYS A 1 183 ? -57.727  45.074  -35.819 1.00 30.00  ? 187 LYS C C   1  
ATOM 1385   O O   . LYS A 1 183 ? -58.278  45.465  -34.790 1.00 30.00  ? 187 LYS C O   1  
ATOM 1386   C CB  . LYS A 1 183 ? -55.324  45.464  -36.317 1.00 99.99  ? 187 LYS C CB  1  
ATOM 1387   C CG  . LYS A 1 183 ? -55.321  46.717  -35.451 1.00 99.99  ? 187 LYS C CG  1  
ATOM 1388   C CD  . LYS A 1 183 ? -54.053  47.520  -35.717 1.00 99.99  ? 187 LYS C CD  1  
ATOM 1389   C CE  . LYS A 1 183 ? -54.213  48.928  -35.150 1.00 99.99  ? 187 LYS C CE  1  
ATOM 1390   N NZ  . LYS A 1 183 ? -53.653  48.975  -33.793 1.00 99.99  ? 187 LYS C NZ  1  
ATOM 1391   N N   . LYS A 1 184 ? -58.325  45.149  -36.998 1.00 30.00  ? 188 LYS C N   1  
ATOM 1392   C CA  . LYS A 1 184 ? -59.662  45.728  -37.099 1.00 30.00  ? 188 LYS C CA  1  
ATOM 1393   C C   . LYS A 1 184 ? -60.695  44.984  -36.256 1.00 30.00  ? 188 LYS C C   1  
ATOM 1394   O O   . LYS A 1 184 ? -61.689  45.565  -35.829 1.00 30.00  ? 188 LYS C O   1  
ATOM 1395   C CB  . LYS A 1 184 ? -60.136  45.692  -38.548 1.00 99.99  ? 188 LYS C CB  1  
ATOM 1396   C CG  . LYS A 1 184 ? -61.385  46.555  -38.698 1.00 99.99  ? 188 LYS C CG  1  
ATOM 1397   C CD  . LYS A 1 184 ? -61.799  46.597  -40.164 1.00 99.99  ? 188 LYS C CD  1  
ATOM 1398   C CE  . LYS A 1 184 ? -63.063  47.438  -40.311 1.00 99.99  ? 188 LYS C CE  1  
ATOM 1399   N NZ  . LYS A 1 184 ? -63.476  47.461  -41.722 1.00 99.99  ? 188 LYS C NZ  1  
ATOM 1400   N N   . VAL A 1 185 ? -60.474  43.696  -36.017 1.00 30.00  ? 189 VAL C N   1  
ATOM 1401   C CA  . VAL A 1 185 ? -61.413  42.891  -35.231 1.00 30.00  ? 189 VAL C CA  1  
ATOM 1402   C C   . VAL A 1 185 ? -61.333  43.304  -33.785 1.00 30.00  ? 189 VAL C C   1  
ATOM 1403   O O   . VAL A 1 185 ? -62.351  43.492  -33.136 1.00 30.00  ? 189 VAL C O   1  
ATOM 1404   C CB  . VAL A 1 185 ? -61.060  41.412  -35.358 1.00 99.99  ? 189 VAL C CB  1  
ATOM 1405   C CG1 . VAL A 1 185 ? -62.010  40.587  -34.500 1.00 99.99  ? 189 VAL C CG1 1  
ATOM 1406   C CG2 . VAL A 1 185 ? -61.186  40.981  -36.813 1.00 99.99  ? 189 VAL C CG2 1  
ATOM 1407   N N   . ILE A 1 186 ? -60.107  43.426  -33.287 1.00 30.00  ? 190 ILE C N   1  
ATOM 1408   C CA  . ILE A 1 186 ? -59.855  43.840  -31.918 1.00 30.00  ? 190 ILE C CA  1  
ATOM 1409   C C   . ILE A 1 186 ? -60.357  45.294  -31.784 1.00 30.00  ? 190 ILE C C   1  
ATOM 1410   O O   . ILE A 1 186 ? -61.102  45.640  -30.876 1.00 30.00  ? 190 ILE C O   1  
ATOM 1411   C CB  . ILE A 1 186 ? -58.365  43.756  -31.614 1.00 99.99  ? 190 ILE C CB  1  
ATOM 1412   C CG1 . ILE A 1 186 ? -57.683  45.052  -32.040 1.00 99.99  ? 190 ILE C CG1 1  
ATOM 1413   C CG2 . ILE A 1 186 ? -57.755  42.588  -32.382 1.00 99.99  ? 190 ILE C CG2 1  
ATOM 1414   C CD1 . ILE A 1 186 ? -57.597  45.997  -30.846 1.00 99.99  ? 190 ILE C CD1 1  
ATOM 1415   N N   . MET A 1 187 ? -59.942  46.152  -32.704 1.00 30.00  ? 191 MET C N   1  
ATOM 1416   C CA  . MET A 1 187 ? -60.371  47.532  -32.651 1.00 30.00  ? 191 MET C CA  1  
ATOM 1417   C C   . MET A 1 187 ? -61.884  47.575  -32.579 1.00 30.00  ? 191 MET C C   1  
ATOM 1418   O O   . MET A 1 187 ? -62.448  48.428  -31.905 1.00 30.00  ? 191 MET C O   1  
ATOM 1419   C CB  . MET A 1 187 ? -59.896  48.273  -33.898 1.00 99.99  ? 191 MET C CB  1  
ATOM 1420   C CG  . MET A 1 187 ? -58.410  48.017  -34.108 1.00 99.99  ? 191 MET C CG  1  
ATOM 1421   S SD  . MET A 1 187 ? -57.436  49.082  -33.019 1.00 99.99  ? 191 MET C SD  1  
ATOM 1422   C CE  . MET A 1 187 ? -57.591  50.630  -33.884 1.00 99.99  ? 191 MET C CE  1  
ATOM 1423   N N   . TYR A 1 188 ? -62.540  46.643  -33.276 1.00 30.00  ? 192 TYR C N   1  
ATOM 1424   C CA  . TYR A 1 188 ? -64.007  46.578  -33.295 1.00 30.00  ? 192 TYR C CA  1  
ATOM 1425   C C   . TYR A 1 188 ? -64.544  46.152  -31.933 1.00 30.00  ? 192 TYR C C   1  
ATOM 1426   O O   . TYR A 1 188 ? -65.294  46.880  -31.296 1.00 30.00  ? 192 TYR C O   1  
ATOM 1427   C CB  . TYR A 1 188 ? -64.467  45.563  -34.338 1.00 99.99  ? 192 TYR C CB  1  
ATOM 1428   C CG  . TYR A 1 188 ? -65.068  44.364  -33.646 1.00 99.99  ? 192 TYR C CG  1  
ATOM 1429   C CD1 . TYR A 1 188 ? -64.664  44.030  -32.349 1.00 99.99  ? 192 TYR C CD1 1  
ATOM 1430   C CD2 . TYR A 1 188 ? -66.028  43.585  -34.303 1.00 99.99  ? 192 TYR C CD2 1  
ATOM 1431   C CE1 . TYR A 1 188 ? -65.220  42.918  -31.708 1.00 99.99  ? 192 TYR C CE1 1  
ATOM 1432   C CE2 . TYR A 1 188 ? -66.583  42.472  -33.664 1.00 99.99  ? 192 TYR C CE2 1  
ATOM 1433   C CZ  . TYR A 1 188 ? -66.180  42.136  -32.364 1.00 99.99  ? 192 TYR C CZ  1  
ATOM 1434   O OH  . TYR A 1 188 ? -66.721  41.056  -31.741 1.00 99.99  ? 192 TYR C OH  1  
ATOM 1435   N N   . LEU A 1 189 ? -64.153  44.962  -31.505 1.00 30.00  ? 193 LEU C N   1  
ATOM 1436   C CA  . LEU A 1 189 ? -64.562  44.423  -30.214 1.00 30.00  ? 193 LEU C CA  1  
ATOM 1437   C C   . LEU A 1 189 ? -64.226  45.383  -29.068 1.00 30.00  ? 193 LEU C C   1  
ATOM 1438   O O   . LEU A 1 189 ? -64.871  45.384  -28.031 1.00 30.00  ? 193 LEU C O   1  
ATOM 1439   C CB  . LEU A 1 189 ? -63.846  43.100  -29.954 1.00 99.99  ? 193 LEU C CB  1  
ATOM 1440   C CG  . LEU A 1 189 ? -64.186  42.603  -28.554 1.00 99.99  ? 193 LEU C CG  1  
ATOM 1441   C CD1 . LEU A 1 189 ? -63.413  41.322  -28.268 1.00 99.99  ? 193 LEU C CD1 1  
ATOM 1442   C CD2 . LEU A 1 189 ? -63.803  43.667  -27.530 1.00 99.99  ? 193 LEU C CD2 1  
ATOM 1443   N N   . ALA A 1 190 ? -63.193  46.193  -29.251 1.00 30.00  ? 194 ALA C N   1  
ATOM 1444   C CA  . ALA A 1 190 ? -62.788  47.141  -28.223 1.00 30.00  ? 194 ALA C CA  1  
ATOM 1445   C C   . ALA A 1 190 ? -63.771  48.307  -28.190 1.00 30.00  ? 194 ALA C C   1  
ATOM 1446   O O   . ALA A 1 190 ? -64.082  48.835  -27.124 1.00 30.00  ? 194 ALA C O   1  
ATOM 1447   C CB  . ALA A 1 190 ? -61.377  47.658  -28.514 1.00 30.00  ? 194 ALA C CB  1  
ATOM 1448   N N   . LYS A 1 191 ? -64.253  48.696  -29.363 1.00 30.00  ? 195 LYS C N   1  
ATOM 1449   C CA  . LYS A 1 191 ? -65.191  49.806  -29.475 1.00 30.00  ? 195 LYS C CA  1  
ATOM 1450   C C   . LYS A 1 191 ? -66.658  49.503  -29.086 1.00 30.00  ? 195 LYS C C   1  
ATOM 1451   O O   . LYS A 1 191 ? -67.470  50.421  -28.978 1.00 30.00  ? 195 LYS C O   1  
ATOM 1452   C CB  . LYS A 1 191 ? -65.240  50.298  -30.920 1.00 99.99  ? 195 LYS C CB  1  
ATOM 1453   C CG  . LYS A 1 191 ? -66.148  51.518  -31.012 1.00 99.99  ? 195 LYS C CG  1  
ATOM 1454   C CD  . LYS A 1 191 ? -65.862  52.269  -32.305 1.00 99.99  ? 195 LYS C CD  1  
ATOM 1455   C CE  . LYS A 1 191 ? -66.995  53.254  -32.583 1.00 99.99  ? 195 LYS C CE  1  
ATOM 1456   N NZ  . LYS A 1 191 ? -66.642  54.573  -32.039 1.00 99.99  ? 195 LYS C NZ  1  
ATOM 1457   N N   . VAL A 1 192 ? -67.010  48.240  -28.854 1.00 30.00  ? 196 VAL C N   1  
ATOM 1458   C CA  . VAL A 1 192 ? -68.394  47.915  -28.509 1.00 30.00  ? 196 VAL C CA  1  
ATOM 1459   C C   . VAL A 1 192 ? -68.600  47.080  -27.239 1.00 30.00  ? 196 VAL C C   1  
ATOM 1460   O O   . VAL A 1 192 ? -69.729  46.879  -26.792 1.00 30.00  ? 196 VAL C O   1  
ATOM 1461   C CB  . VAL A 1 192 ? -69.036  47.117  -29.638 1.00 99.99  ? 196 VAL C CB  1  
ATOM 1462   C CG1 . VAL A 1 192 ? -69.018  47.946  -30.921 1.00 99.99  ? 196 VAL C CG1 1  
ATOM 1463   C CG2 . VAL A 1 192 ? -68.257  45.826  -29.859 1.00 99.99  ? 196 VAL C CG2 1  
ATOM 1464   N N   . GLU A 1 212 ? -58.856  49.440  -22.890 1.00 30.00  ? 216 GLU C N   1  
ATOM 1465   C CA  . GLU A 1 212 ? -59.123  49.443  -24.315 1.00 30.00  ? 216 GLU C CA  1  
ATOM 1466   C C   . GLU A 1 212 ? -57.988  50.146  -25.042 1.00 30.00  ? 216 GLU C C   1  
ATOM 1467   O O   . GLU A 1 212 ? -57.444  49.641  -26.014 1.00 30.00  ? 216 GLU C O   1  
ATOM 1468   C CB  . GLU A 1 212 ? -60.430  50.174  -24.598 1.00 99.99  ? 216 GLU C CB  1  
ATOM 1469   C CG  . GLU A 1 212 ? -60.356  51.574  -24.041 1.00 99.99  ? 216 GLU C CG  1  
ATOM 1470   C CD  . GLU A 1 212 ? -60.577  51.532  -22.529 1.00 99.99  ? 216 GLU C CD  1  
ATOM 1471   O OE1 . GLU A 1 212 ? -59.557  51.398  -21.802 1.00 99.99  ? 216 GLU C OE1 1  
ATOM 1472   O OE2 . GLU A 1 212 ? -61.764  51.641  -22.117 1.00 99.99  ? 216 GLU C OE2 1  
ATOM 1473   N N   . ASP A 1 213 ? -57.634  51.321  -24.551 1.00 30.00  ? 217 ASP C N   1  
ATOM 1474   C CA  . ASP A 1 213 ? -56.568  52.123  -25.136 1.00 30.00  ? 217 ASP C CA  1  
ATOM 1475   C C   . ASP A 1 213 ? -55.187  51.460  -25.171 1.00 30.00  ? 217 ASP C C   1  
ATOM 1476   O O   . ASP A 1 213 ? -54.428  51.651  -26.127 1.00 30.00  ? 217 ASP C O   1  
ATOM 1477   C CB  . ASP A 1 213 ? -56.398  53.415  -24.345 1.00 99.99  ? 217 ASP C CB  1  
ATOM 1478   C CG  . ASP A 1 213 ? -56.339  53.098  -22.853 1.00 99.99  ? 217 ASP C CG  1  
ATOM 1479   O OD1 . ASP A 1 213 ? -57.308  52.455  -22.364 1.00 99.99  ? 217 ASP C OD1 1  
ATOM 1480   O OD2 . ASP A 1 213 ? -55.329  53.499  -22.217 1.00 99.99  ? 217 ASP C OD2 1  
ATOM 1481   N N   . GLN A 1 214 ? -54.857  50.698  -24.132 1.00 30.00  ? 218 GLN C N   1  
ATOM 1482   C CA  . GLN A 1 214 ? -53.568  50.018  -24.042 1.00 30.00  ? 218 GLN C CA  1  
ATOM 1483   C C   . GLN A 1 214 ? -53.494  48.860  -25.011 1.00 30.00  ? 218 GLN C C   1  
ATOM 1484   O O   . GLN A 1 214 ? -52.457  48.623  -25.647 1.00 30.00  ? 218 GLN C O   1  
ATOM 1485   C CB  . GLN A 1 214 ? -53.365  49.478  -22.628 1.00 99.99  ? 218 GLN C CB  1  
ATOM 1486   C CG  . GLN A 1 214 ? -54.519  48.550  -22.266 1.00 99.99  ? 218 GLN C CG  1  
ATOM 1487   C CD  . GLN A 1 214 ? -55.762  49.342  -21.888 1.00 99.99  ? 218 GLN C CD  1  
ATOM 1488   O OE1 . GLN A 1 214 ? -55.746  50.570  -21.901 1.00 99.99  ? 218 GLN C OE1 1  
ATOM 1489   N NE2 . GLN A 1 214 ? -56.842  48.632  -21.549 1.00 99.99  ? 218 GLN C NE2 1  
ATOM 1490   N N   . ILE A 1 215 ? -54.611  48.135  -25.099 1.00 30.00  ? 219 ILE C N   1  
ATOM 1491   C CA  . ILE A 1 215 ? -54.751  46.993  -25.975 1.00 30.00  ? 219 ILE C CA  1  
ATOM 1492   C C   . ILE A 1 215 ? -54.352  47.454  -27.374 1.00 30.00  ? 219 ILE C C   1  
ATOM 1493   O O   . ILE A 1 215 ? -53.342  47.024  -27.946 1.00 30.00  ? 219 ILE C O   1  
ATOM 1494   C CB  . ILE A 1 215 ? -56.197  46.507  -25.967 1.00 99.99  ? 219 ILE C CB  1  
ATOM 1495   C CG1 . ILE A 1 215 ? -57.004  47.290  -26.995 1.00 99.99  ? 219 ILE C CG1 1  
ATOM 1496   C CG2 . ILE A 1 215 ? -56.794  46.720  -24.579 1.00 99.99  ? 219 ILE C CG2 1  
ATOM 1497   C CD1 . ILE A 1 215 ? -57.042  46.518  -28.308 1.00 99.99  ? 219 ILE C CD1 1  
ATOM 1498   N N   . ILE A 1 216 ? -55.144  48.353  -27.925 1.00 30.00  ? 220 ILE C N   1  
ATOM 1499   C CA  . ILE A 1 216 ? -54.863  48.881  -29.238 1.00 30.00  ? 220 ILE C CA  1  
ATOM 1500   C C   . ILE A 1 216 ? -53.408  49.315  -29.352 1.00 30.00  ? 220 ILE C C   1  
ATOM 1501   O O   . ILE A 1 216 ? -52.774  49.184  -30.392 1.00 30.00  ? 220 ILE C O   1  
ATOM 1502   C CB  . ILE A 1 216 ? -55.751  50.090  -29.510 1.00 99.99  ? 220 ILE C CB  1  
ATOM 1503   C CG1 . ILE A 1 216 ? -55.089  51.345  -28.953 1.00 99.99  ? 220 ILE C CG1 1  
ATOM 1504   C CG2 . ILE A 1 216 ? -57.103  49.887  -28.835 1.00 99.99  ? 220 ILE C CG2 1  
ATOM 1505   C CD1 . ILE A 1 216 ? -54.288  52.027  -30.057 1.00 99.99  ? 220 ILE C CD1 1  
ATOM 1506   N N   . GLN A 1 217 ? -52.885  49.844  -28.258 1.00 30.00  ? 221 GLN C N   1  
ATOM 1507   C CA  . GLN A 1 217 ? -51.521  50.341  -28.213 1.00 30.00  ? 221 GLN C CA  1  
ATOM 1508   C C   . GLN A 1 217 ? -50.404  49.336  -28.090 1.00 30.00  ? 221 GLN C C   1  
ATOM 1509   O O   . GLN A 1 217 ? -49.235  49.704  -28.141 1.00 30.00  ? 221 GLN C O   1  
ATOM 1510   C CB  . GLN A 1 217 ? -51.344  51.268  -27.015 1.00 99.99  ? 221 GLN C CB  1  
ATOM 1511   C CG  . GLN A 1 217 ? -52.213  52.507  -27.199 1.00 99.99  ? 221 GLN C CG  1  
ATOM 1512   C CD  . GLN A 1 217 ? -51.648  53.417  -28.278 1.00 99.99  ? 221 GLN C CD  1  
ATOM 1513   O OE1 . GLN A 1 217 ? -50.618  53.112  -28.875 1.00 99.99  ? 221 GLN C OE1 1  
ATOM 1514   N NE2 . GLN A 1 217 ? -52.326  54.539  -28.530 1.00 99.99  ? 221 GLN C NE2 1  
ATOM 1515   N N   . ALA A 1 218 ? -50.758  48.070  -27.925 1.00 30.00  ? 222 ALA C N   1  
ATOM 1516   C CA  . ALA A 1 218 ? -49.737  47.041  -27.809 1.00 30.00  ? 222 ALA C CA  1  
ATOM 1517   C C   . ALA A 1 218 ? -49.216  46.647  -29.183 1.00 30.00  ? 222 ALA C C   1  
ATOM 1518   O O   . ALA A 1 218 ? -48.128  46.107  -29.305 1.00 30.00  ? 222 ALA C O   1  
ATOM 1519   C CB  . ALA A 1 218 ? -50.311  45.820  -27.112 1.00 30.00  ? 222 ALA C CB  1  
ATOM 1520   N N   . ASN A 1 219 ? -49.990  46.930  -30.222 1.00 30.00  ? 223 ASN C N   1  
ATOM 1521   C CA  . ASN A 1 219 ? -49.577  46.578  -31.574 1.00 30.00  ? 223 ASN C CA  1  
ATOM 1522   C C   . ASN A 1 219 ? -48.397  47.393  -32.041 1.00 30.00  ? 223 ASN C C   1  
ATOM 1523   O O   . ASN A 1 219 ? -47.414  46.831  -32.537 1.00 30.00  ? 223 ASN C O   1  
ATOM 1524   C CB  . ASN A 1 219 ? -50.728  46.818  -32.546 1.00 99.99  ? 223 ASN C CB  1  
ATOM 1525   C CG  . ASN A 1 219 ? -51.915  45.922  -32.223 1.00 99.99  ? 223 ASN C CG  1  
ATOM 1526   O OD1 . ASN A 1 219 ? -51.775  44.707  -32.136 1.00 99.99  ? 223 ASN C OD1 1  
ATOM 1527   N ND2 . ASN A 1 219 ? -53.091  46.532  -32.045 1.00 99.99  ? 223 ASN C ND2 1  
ATOM 1528   N N   . PRO A 1 220 ? -48.469  48.724  -31.876 1.00 30.00  ? 224 PRO C N   1  
ATOM 1529   C CA  . PRO A 1 220 ? -47.356  49.571  -32.314 1.00 30.00  ? 224 PRO C CA  1  
ATOM 1530   C C   . PRO A 1 220 ? -46.004  49.165  -31.758 1.00 30.00  ? 224 PRO C C   1  
ATOM 1531   O O   . PRO A 1 220 ? -44.996  49.271  -32.455 1.00 30.00  ? 224 PRO C O   1  
ATOM 1532   C CB  . PRO A 1 220 ? -47.825  50.857  -31.731 1.00 99.99  ? 224 PRO C CB  1  
ATOM 1533   C CG  . PRO A 1 220 ? -49.164  50.564  -31.096 1.00 99.99  ? 224 PRO C CG  1  
ATOM 1534   C CD  . PRO A 1 220 ? -49.542  49.355  -31.231 1.00 99.99  ? 224 PRO C CD  1  
ATOM 1535   N N   . VAL A 1 221 ? -45.959  48.694  -30.513 1.00 30.00  ? 225 VAL C N   1  
ATOM 1536   C CA  . VAL A 1 221 ? -44.661  48.301  -29.977 1.00 30.00  ? 225 VAL C CA  1  
ATOM 1537   C C   . VAL A 1 221 ? -44.263  46.902  -30.433 1.00 30.00  ? 225 VAL C C   1  
ATOM 1538   O O   . VAL A 1 221 ? -43.104  46.679  -30.793 1.00 30.00  ? 225 VAL C O   1  
ATOM 1539   C CB  . VAL A 1 221 ? -44.702  48.308  -28.452 1.00 99.99  ? 225 VAL C CB  1  
ATOM 1540   C CG1 . VAL A 1 221 ? -45.047  49.714  -27.961 1.00 99.99  ? 225 VAL C CG1 1  
ATOM 1541   C CG2 . VAL A 1 221 ? -45.764  47.328  -27.967 1.00 99.99  ? 225 VAL C CG2 1  
ATOM 1542   N N   . LEU A 1 222 ? -45.204  45.962  -30.436 1.00 30.00  ? 226 LEU C N   1  
ATOM 1543   C CA  . LEU A 1 222 ? -44.886  44.597  -30.867 1.00 30.00  ? 226 LEU C CA  1  
ATOM 1544   C C   . LEU A 1 222 ? -44.533  44.553  -32.354 1.00 30.00  ? 226 LEU C C   1  
ATOM 1545   O O   . LEU A 1 222 ? -43.691  43.762  -32.779 1.00 30.00  ? 226 LEU C O   1  
ATOM 1546   C CB  . LEU A 1 222 ? -46.084  43.687  -30.628 1.00 99.99  ? 226 LEU C CB  1  
ATOM 1547   C CG  . LEU A 1 222 ? -45.937  42.992  -29.279 1.00 99.99  ? 226 LEU C CG  1  
ATOM 1548   C CD1 . LEU A 1 222 ? -46.941  41.850  -29.181 1.00 99.99  ? 226 LEU C CD1 1  
ATOM 1549   C CD2 . LEU A 1 222 ? -44.520  42.439  -29.143 1.00 99.99  ? 226 LEU C CD2 1  
ATOM 1550   N N   . GLU A 1 223 ? -45.170  45.411  -33.142 1.00 30.00  ? 227 GLU C N   1  
ATOM 1551   C CA  . GLU A 1 223 ? -44.896  45.447  -34.566 1.00 30.00  ? 227 GLU C CA  1  
ATOM 1552   C C   . GLU A 1 223 ? -43.540  46.076  -34.855 1.00 30.00  ? 227 GLU C C   1  
ATOM 1553   O O   . GLU A 1 223 ? -42.891  45.752  -35.846 1.00 30.00  ? 227 GLU C O   1  
ATOM 1554   C CB  . GLU A 1 223 ? -45.968  46.264  -35.281 1.00 99.99  ? 227 GLU C CB  1  
ATOM 1555   C CG  . GLU A 1 223 ? -47.301  45.569  -35.150 1.00 99.99  ? 227 GLU C CG  1  
ATOM 1556   C CD  . GLU A 1 223 ? -47.314  44.319  -36.027 1.00 99.99  ? 227 GLU C CD  1  
ATOM 1557   O OE1 . GLU A 1 223 ? -46.919  43.244  -35.504 1.00 99.99  ? 227 GLU C OE1 1  
ATOM 1558   O OE2 . GLU A 1 223 ? -47.719  44.454  -37.213 1.00 99.99  ? 227 GLU C OE2 1  
ATOM 1559   N N   . ALA A 1 224 ? -43.112  46.989  -33.994 1.00 30.00  ? 228 ALA C N   1  
ATOM 1560   C CA  . ALA A 1 224 ? -41.835  47.653  -34.194 1.00 30.00  ? 228 ALA C CA  1  
ATOM 1561   C C   . ALA A 1 224 ? -40.714  46.649  -33.973 1.00 30.00  ? 228 ALA C C   1  
ATOM 1562   O O   . ALA A 1 224 ? -39.720  46.626  -34.699 1.00 30.00  ? 228 ALA C O   1  
ATOM 1563   C CB  . ALA A 1 224 ? -41.710  48.816  -33.224 1.00 30.00  ? 228 ALA C CB  1  
ATOM 1564   N N   . TYR A 1 225 ? -40.898  45.804  -32.969 1.00 30.00  ? 229 TYR C N   1  
ATOM 1565   C CA  . TYR A 1 225 ? -39.926  44.790  -32.623 1.00 30.00  ? 229 TYR C CA  1  
ATOM 1566   C C   . TYR A 1 225 ? -40.065  43.433  -33.338 1.00 30.00  ? 229 TYR C C   1  
ATOM 1567   O O   . TYR A 1 225 ? -39.122  42.648  -33.368 1.00 30.00  ? 229 TYR C O   1  
ATOM 1568   C CB  . TYR A 1 225 ? -40.009  44.481  -31.132 1.00 99.99  ? 229 TYR C CB  1  
ATOM 1569   C CG  . TYR A 1 225 ? -39.634  45.711  -30.340 1.00 99.99  ? 229 TYR C CG  1  
ATOM 1570   C CD1 . TYR A 1 225 ? -40.620  46.641  -29.987 1.00 99.99  ? 229 TYR C CD1 1  
ATOM 1571   C CD2 . TYR A 1 225 ? -38.303  45.920  -29.960 1.00 99.99  ? 229 TYR C CD2 1  
ATOM 1572   C CE1 . TYR A 1 225 ? -40.274  47.780  -29.252 1.00 99.99  ? 229 TYR C CE1 1  
ATOM 1573   C CE2 . TYR A 1 225 ? -37.959  47.060  -29.226 1.00 99.99  ? 229 TYR C CE2 1  
ATOM 1574   C CZ  . TYR A 1 225 ? -38.943  47.991  -28.872 1.00 99.99  ? 229 TYR C CZ  1  
ATOM 1575   O OH  . TYR A 1 225 ? -38.606  49.100  -28.158 1.00 99.99  ? 229 TYR C OH  1  
ATOM 1576   N N   . GLY A 1 226 ? -41.238  43.159  -33.909 1.00 30.00  ? 230 GLY C N   1  
ATOM 1577   C CA  . GLY A 1 226 ? -41.447  41.893  -34.589 1.00 30.00  ? 230 GLY C CA  1  
ATOM 1578   C C   . GLY A 1 226 ? -42.022  41.952  -35.995 1.00 30.00  ? 230 GLY C C   1  
ATOM 1579   O O   . GLY A 1 226 ? -42.737  41.060  -36.396 1.00 30.00  ? 230 GLY C O   1  
ATOM 1580   N N   . ASN A 1 227 ? -41.527  43.025  -36.787 1.00 30.00  ? 231 ASN C N   1  
ATOM 1581   C CA  . ASN A 1 227 ? -42.005  43.180  -38.151 1.00 30.00  ? 231 ASN C CA  1  
ATOM 1582   C C   . ASN A 1 227 ? -40.815  43.710  -38.928 1.00 30.00  ? 231 ASN C C   1  
ATOM 1583   O O   . ASN A 1 227 ? -39.858  44.191  -38.346 1.00 30.00  ? 231 ASN C O   1  
ATOM 1584   C CB  . ASN A 1 227 ? -43.175  44.157  -38.186 1.00 99.99  ? 231 ASN C CB  1  
ATOM 1585   C CG  . ASN A 1 227 ? -44.443  43.512  -37.646 1.00 99.99  ? 231 ASN C CG  1  
ATOM 1586   O OD1 . ASN A 1 227 ? -45.211  44.149  -36.929 1.00 99.99  ? 231 ASN C OD1 1  
ATOM 1587   N ND2 . ASN A 1 227 ? -44.663  42.244  -37.994 1.00 99.99  ? 231 ASN C ND2 1  
ATOM 1588   N N   . ALA A 1 228 ? -40.869  43.622  -40.244 1.00 30.00  ? 232 ALA C N   1  
ATOM 1589   C CA  . ALA A 1 228 ? -39.765  44.085  -41.045 1.00 30.00  ? 232 ALA C CA  1  
ATOM 1590   C C   . ALA A 1 228 ? -40.171  44.093  -42.498 1.00 30.00  ? 232 ALA C C   1  
ATOM 1591   O O   . ALA A 1 228 ? -41.078  43.380  -42.904 1.00 30.00  ? 232 ALA C O   1  
ATOM 1592   C CB  . ALA A 1 228 ? -38.582  43.162  -40.845 1.00 30.00  ? 232 ALA C CB  1  
ATOM 1593   N N   . LYS A 1 229 ? -39.491  44.907  -43.283 1.00 30.00  ? 233 LYS C N   1  
ATOM 1594   C CA  . LYS A 1 229 ? -39.783  44.971  -44.689 1.00 30.00  ? 233 LYS C CA  1  
ATOM 1595   C C   . LYS A 1 229 ? -39.285  43.677  -45.296 1.00 30.00  ? 233 LYS C C   1  
ATOM 1596   O O   . LYS A 1 229 ? -38.214  43.170  -44.942 1.00 30.00  ? 233 LYS C O   1  
ATOM 1597   C CB  . LYS A 1 229 ? -39.070  46.168  -45.312 1.00 99.99  ? 233 LYS C CB  1  
ATOM 1598   C CG  . LYS A 1 229 ? -39.465  46.287  -46.781 1.00 99.99  ? 233 LYS C CG  1  
ATOM 1599   C CD  . LYS A 1 229 ? -39.131  47.688  -47.283 1.00 99.99  ? 233 LYS C CD  1  
ATOM 1600   C CE  . LYS A 1 229 ? -39.171  47.702  -48.809 1.00 99.99  ? 233 LYS C CE  1  
ATOM 1601   N NZ  . LYS A 1 229 ? -40.503  48.131  -49.260 1.00 99.99  ? 233 LYS C NZ  1  
ATOM 1602   N N   . THR A 1 230 ? -39.815  43.207  -46.121 1.00 30.00  ? 234 THR C N   1  
ATOM 1603   C CA  . THR A 1 230 ? -39.564  41.974  -46.853 1.00 30.00  ? 234 THR C CA  1  
ATOM 1604   C C   . THR A 1 230 ? -39.986  42.300  -48.298 1.00 30.00  ? 234 THR C C   1  
ATOM 1605   O O   . THR A 1 230 ? -40.631  43.339  -48.557 1.00 30.00  ? 234 THR C O   1  
ATOM 1606   C CB  . THR A 1 230 ? -40.394  40.841  -46.261 1.00 99.99  ? 234 THR C CB  1  
ATOM 1607   O OG1 . THR A 1 230 ? -41.781  41.080  -46.518 1.00 99.99  ? 234 THR C OG1 1  
ATOM 1608   C CG2 . THR A 1 230 ? -40.161  40.773  -44.756 1.00 99.99  ? 234 THR C CG2 1  
ATOM 1609   N N   . THR A 1 231 ? -39.615  41.452  -49.245 1.00 30.00  ? 235 THR C N   1  
ATOM 1610   C CA  . THR A 1 231 ? -39.981  41.705  -50.641 1.00 30.00  ? 235 THR C CA  1  
ATOM 1611   C C   . THR A 1 231 ? -41.496  41.644  -50.742 1.00 30.00  ? 235 THR C C   1  
ATOM 1612   O O   . THR A 1 231 ? -42.127  42.476  -51.399 1.00 30.00  ? 235 THR C O   1  
ATOM 1613   C CB  . THR A 1 231 ? -39.351  40.647  -51.542 1.00 99.99  ? 235 THR C CB  1  
ATOM 1614   O OG1 . THR A 1 231 ? -39.959  39.380  -51.284 1.00 99.99  ? 235 THR C OG1 1  
ATOM 1615   C CG2 . THR A 1 231 ? -37.856  40.560  -51.254 1.00 99.99  ? 235 THR C CG2 1  
ATOM 1616   N N   . ARG A 1 232 ? -42.051  40.773  -50.197 1.00 30.00  ? 236 ARG C N   1  
ATOM 1617   C CA  . ARG A 1 232 ? -43.480  40.520  -50.182 1.00 30.00  ? 236 ARG C CA  1  
ATOM 1618   C C   . ARG A 1 232 ? -44.244  41.591  -49.389 1.00 30.00  ? 236 ARG C C   1  
ATOM 1619   O O   . ARG A 1 232 ? -45.178  42.220  -49.903 1.00 30.00  ? 236 ARG C O   1  
ATOM 1620   C CB  . ARG A 1 232 ? -43.762  39.166  -49.543 1.00 99.99  ? 236 ARG C CB  1  
ATOM 1621   C CG  . ARG A 1 232 ? -45.040  38.577  -50.132 1.00 99.99  ? 236 ARG C CG  1  
ATOM 1622   C CD  . ARG A 1 232 ? -45.163  37.113  -49.724 1.00 99.99  ? 236 ARG C CD  1  
ATOM 1623   N NE  . ARG A 1 232 ? -46.138  36.403  -50.579 1.00 99.99  ? 236 ARG C NE  1  
ATOM 1624   C CZ  . ARG A 1 232 ? -46.318  35.089  -50.537 1.00 99.99  ? 236 ARG C CZ  1  
ATOM 1625   N NH1 . ARG A 1 232 ? -45.624  34.307  -49.711 1.00 99.99  ? 236 ARG C NH1 1  
ATOM 1626   N NH2 . ARG A 1 232 ? -47.222  34.552  -51.351 1.00 99.99  ? 236 ARG C NH2 1  
ATOM 1627   N N   . ASN A 1 233 ? -43.841  41.795  -48.134 1.00 30.00  ? 237 ASN C N   1  
ATOM 1628   C CA  . ASN A 1 233 ? -44.493  42.782  -47.264 1.00 30.00  ? 237 ASN C CA  1  
ATOM 1629   C C   . ASN A 1 233 ? -43.580  43.860  -46.677 1.00 30.00  ? 237 ASN C C   1  
ATOM 1630   O O   . ASN A 1 233 ? -42.567  43.546  -46.046 1.00 30.00  ? 237 ASN C O   1  
ATOM 1631   C CB  . ASN A 1 233 ? -45.132  42.077  -46.072 1.00 99.99  ? 237 ASN C CB  1  
ATOM 1632   C CG  . ASN A 1 233 ? -46.409  41.357  -46.481 1.00 99.99  ? 237 ASN C CG  1  
ATOM 1633   O OD1 . ASN A 1 233 ? -46.675  40.248  -46.025 1.00 99.99  ? 237 ASN C OD1 1  
ATOM 1634   N ND2 . ASN A 1 233 ? -47.202  41.994  -47.347 1.00 99.99  ? 237 ASN C ND2 1  
ATOM 1635   N N   . ASN A 1 234 ? -43.936  45.129  -46.869 1.00 30.00  ? 238 ASN C N   1  
ATOM 1636   C CA  . ASN A 1 234 ? -43.114  46.198  -46.306 1.00 30.00  ? 238 ASN C CA  1  
ATOM 1637   C C   . ASN A 1 234 ? -43.192  46.160  -44.772 1.00 30.00  ? 238 ASN C C   1  
ATOM 1638   O O   . ASN A 1 234 ? -42.311  46.684  -44.083 1.00 30.00  ? 238 ASN C O   1  
ATOM 1639   C CB  . ASN A 1 234 ? -43.615  47.553  -46.799 1.00 99.99  ? 238 ASN C CB  1  
ATOM 1640   C CG  . ASN A 1 234 ? -42.747  48.686  -46.270 1.00 99.99  ? 238 ASN C CG  1  
ATOM 1641   O OD1 . ASN A 1 234 ? -41.538  48.527  -46.123 1.00 99.99  ? 238 ASN C OD1 1  
ATOM 1642   N ND2 . ASN A 1 234 ? -43.370  49.831  -45.983 1.00 99.99  ? 238 ASN C ND2 1  
ATOM 1643   N N   . ASN A 1 235 ? -44.243  45.519  -44.243 1.00 30.00  ? 239 ASN C N   1  
ATOM 1644   C CA  . ASN A 1 235 ? -44.438  45.377  -42.807 1.00 30.00  ? 239 ASN C CA  1  
ATOM 1645   C C   . ASN A 1 235 ? -44.750  43.905  -42.452 1.00 30.00  ? 239 ASN C C   1  
ATOM 1646   O O   . ASN A 1 235 ? -45.778  43.554  -41.826 1.00 30.00  ? 239 ASN C O   1  
ATOM 1647   C CB  . ASN A 1 235 ? -45.600  46.254  -42.353 1.00 99.99  ? 239 ASN C CB  1  
ATOM 1648   C CG  . ASN A 1 235 ? -45.201  47.722  -42.315 1.00 99.99  ? 239 ASN C CG  1  
ATOM 1649   O OD1 . ASN A 1 235 ? -45.981  48.590  -42.696 1.00 99.99  ? 239 ASN C OD1 1  
ATOM 1650   N ND2 . ASN A 1 235 ? -43.980  47.993  -41.854 1.00 99.99  ? 239 ASN C ND2 1  
ATOM 1651   N N   . SER A 1 236 ? -43.832  43.033  -42.847 1.00 30.00  ? 240 SER C N   1  
ATOM 1652   C CA  . SER A 1 236 ? -43.994  41.613  -42.596 1.00 30.00  ? 240 SER C CA  1  
ATOM 1653   C C   . SER A 1 236 ? -43.900  41.205  -41.121 1.00 30.00  ? 240 SER C C   1  
ATOM 1654   O O   . SER A 1 236 ? -42.930  41.495  -40.454 1.00 30.00  ? 240 SER C O   1  
ATOM 1655   C CB  . SER A 1 236 ? -42.916  40.830  -43.334 1.00 99.99  ? 240 SER C CB  1  
ATOM 1656   O OG  . SER A 1 236 ? -43.081  41.000  -44.745 1.00 99.99  ? 240 SER C OG  1  
ATOM 1657   N N   . SER A 1 237 ? -44.914  40.514  -40.622 1.00 30.00  ? 241 SER C N   1  
ATOM 1658   C CA  . SER A 1 237 ? -44.907  40.046  -39.244 1.00 30.00  ? 241 SER C CA  1  
ATOM 1659   C C   . SER A 1 237 ? -43.960  38.851  -39.181 1.00 30.00  ? 241 SER C C   1  
ATOM 1660   O O   . SER A 1 237 ? -44.152  37.877  -39.905 1.00 30.00  ? 241 SER C O   1  
ATOM 1661   C CB  . SER A 1 237 ? -46.316  39.635  -38.828 1.00 99.99  ? 241 SER C CB  1  
ATOM 1662   O OG  . SER A 1 237 ? -46.303  39.201  -37.467 1.00 99.99  ? 241 SER C OG  1  
ATOM 1663   N N   . ARG A 1 238 ? -43.100  38.867  -38.254 1.00 30.00  ? 242 ARG C N   1  
ATOM 1664   C CA  . ARG A 1 238 ? -42.115  37.789  -38.131 1.00 30.00  ? 242 ARG C CA  1  
ATOM 1665   C C   . ARG A 1 238 ? -42.226  36.954  -36.898 1.00 30.00  ? 242 ARG C C   1  
ATOM 1666   O O   . ARG A 1 238 ? -41.218  36.401  -36.393 1.00 30.00  ? 242 ARG C O   1  
ATOM 1667   C CB  . ARG A 1 238 ? -40.705  38.375  -38.120 1.00 99.99  ? 242 ARG C CB  1  
ATOM 1668   C CG  . ARG A 1 238 ? -40.450  39.114  -39.430 1.00 99.99  ? 242 ARG C CG  1  
ATOM 1669   C CD  . ARG A 1 238 ? -39.091  39.801  -39.369 1.00 99.99  ? 242 ARG C CD  1  
ATOM 1670   N NE  . ARG A 1 238 ? -39.147  41.009  -38.514 1.00 99.99  ? 242 ARG C NE  1  
ATOM 1671   C CZ  . ARG A 1 238 ? -38.074  41.745  -38.233 1.00 99.99  ? 242 ARG C CZ  1  
ATOM 1672   N NH1 . ARG A 1 238 ? -36.869  41.446  -38.708 1.00 99.99  ? 242 ARG C NH1 1  
ATOM 1673   N NH2 . ARG A 1 238 ? -38.236  42.809  -37.451 1.00 99.99  ? 242 ARG C NH2 1  
ATOM 1674   N N   . PHE A 1 239 ? -43.455  36.854  -36.407 1.00 30.00  ? 243 PHE C N   1  
ATOM 1675   C CA  . PHE A 1 239 ? -43.729  36.036  -35.209 1.00 30.00  ? 243 PHE C CA  1  
ATOM 1676   C C   . PHE A 1 239 ? -45.221  35.671  -35.289 1.00 30.00  ? 243 PHE C C   1  
ATOM 1677   O O   . PHE A 1 239 ? -46.015  36.353  -35.959 1.00 30.00  ? 243 PHE C O   1  
ATOM 1678   C CB  . PHE A 1 239 ? -43.424  36.842  -33.952 1.00 99.99  ? 243 PHE C CB  1  
ATOM 1679   C CG  . PHE A 1 239 ? -44.435  37.954  -33.807 1.00 99.99  ? 243 PHE C CG  1  
ATOM 1680   C CD1 . PHE A 1 239 ? -44.186  39.204  -34.387 1.00 99.99  ? 243 PHE C CD1 1  
ATOM 1681   C CD2 . PHE A 1 239 ? -45.618  37.735  -33.097 1.00 99.99  ? 243 PHE C CD2 1  
ATOM 1682   C CE1 . PHE A 1 239 ? -45.122  40.237  -34.253 1.00 99.99  ? 243 PHE C CE1 1  
ATOM 1683   C CE2 . PHE A 1 239 ? -46.555  38.768  -32.962 1.00 99.99  ? 243 PHE C CE2 1  
ATOM 1684   C CZ  . PHE A 1 239 ? -46.307  40.019  -33.541 1.00 99.99  ? 243 PHE C CZ  1  
ATOM 1685   N N   . GLY A 1 240 ? -45.609  34.599  -34.613 1.00 30.00  ? 244 GLY C N   1  
ATOM 1686   C CA  . GLY A 1 240 ? -46.999  34.198  -34.652 1.00 30.00  ? 244 GLY C CA  1  
ATOM 1687   C C   . GLY A 1 240 ? -47.724  34.858  -33.513 1.00 30.00  ? 244 GLY C C   1  
ATOM 1688   O O   . GLY A 1 240 ? -47.184  34.934  -32.417 1.00 30.00  ? 244 GLY C O   1  
ATOM 1689   N N   . LYS A 1 241 ? -48.945  35.309  -33.757 1.00 30.00  ? 245 LYS C N   1  
ATOM 1690   C CA  . LYS A 1 241 ? -49.713  35.987  -32.727 1.00 30.00  ? 245 LYS C CA  1  
ATOM 1691   C C   . LYS A 1 241 ? -51.097  35.451  -32.408 1.00 30.00  ? 245 LYS C C   1  
ATOM 1692   O O   . LYS A 1 241 ? -51.965  35.384  -33.272 1.00 30.00  ? 245 LYS C O   1  
ATOM 1693   C CB  . LYS A 1 241 ? -49.932  37.444  -33.117 1.00 99.99  ? 245 LYS C CB  1  
ATOM 1694   C CG  . LYS A 1 241 ? -48.751  38.284  -32.645 1.00 99.99  ? 245 LYS C CG  1  
ATOM 1695   C CD  . LYS A 1 241 ? -49.141  39.759  -32.648 1.00 99.99  ? 245 LYS C CD  1  
ATOM 1696   C CE  . LYS A 1 241 ? -49.192  40.268  -34.083 1.00 99.99  ? 245 LYS C CE  1  
ATOM 1697   N NZ  . LYS A 1 241 ? -49.232  41.739  -34.079 1.00 99.99  ? 245 LYS C NZ  1  
ATOM 1698   N N   . PHE A 1 242 ? -51.311  35.074  -31.158 1.00 30.00  ? 246 PHE C N   1  
ATOM 1699   C CA  . PHE A 1 242 ? -52.613  34.592  -30.743 1.00 30.00  ? 246 PHE C CA  1  
ATOM 1700   C C   . PHE A 1 242 ? -53.014  35.505  -29.590 1.00 30.00  ? 246 PHE C C   1  
ATOM 1701   O O   . PHE A 1 242 ? -52.399  35.460  -28.526 1.00 30.00  ? 246 PHE C O   1  
ATOM 1702   C CB  . PHE A 1 242 ? -52.511  33.136  -30.303 1.00 99.99  ? 246 PHE C CB  1  
ATOM 1703   C CG  . PHE A 1 242 ? -53.871  32.641  -29.876 1.00 99.99  ? 246 PHE C CG  1  
ATOM 1704   C CD1 . PHE A 1 242 ? -54.783  32.186  -30.835 1.00 99.99  ? 246 PHE C CD1 1  
ATOM 1705   C CD2 . PHE A 1 242 ? -54.220  32.638  -28.520 1.00 99.99  ? 246 PHE C CD2 1  
ATOM 1706   C CE1 . PHE A 1 242 ? -56.046  31.726  -30.438 1.00 99.99  ? 246 PHE C CE1 1  
ATOM 1707   C CE2 . PHE A 1 242 ? -55.484  32.181  -28.124 1.00 99.99  ? 246 PHE C CE2 1  
ATOM 1708   C CZ  . PHE A 1 242 ? -56.396  31.725  -29.084 1.00 99.99  ? 246 PHE C CZ  1  
ATOM 1709   N N   . ILE A 1 243 ? -54.040  36.327  -29.782 1.00 30.00  ? 247 ILE C N   1  
ATOM 1710   C CA  . ILE A 1 243 ? -54.478  37.222  -28.721 1.00 30.00  ? 247 ILE C CA  1  
ATOM 1711   C C   . ILE A 1 243 ? -55.906  36.926  -28.275 1.00 30.00  ? 247 ILE C C   1  
ATOM 1712   O O   . ILE A 1 243 ? -56.821  36.976  -29.078 1.00 30.00  ? 247 ILE C O   1  
ATOM 1713   C CB  . ILE A 1 243 ? -54.428  38.668  -29.207 1.00 99.99  ? 247 ILE C CB  1  
ATOM 1714   C CG1 . ILE A 1 243 ? -55.681  38.978  -30.017 1.00 99.99  ? 247 ILE C CG1 1  
ATOM 1715   C CG2 . ILE A 1 243 ? -53.194  38.866  -30.082 1.00 99.99  ? 247 ILE C CG2 1  
ATOM 1716   C CD1 . ILE A 1 243 ? -55.406  38.724  -31.497 1.00 99.99  ? 247 ILE C CD1 1  
ATOM 1717   N N   . ARG A 1 244 ? -56.082  36.614  -26.989 1.00 30.00  ? 248 ARG C N   1  
ATOM 1718   C CA  . ARG A 1 244 ? -57.403  36.329  -26.426 1.00 30.00  ? 248 ARG C CA  1  
ATOM 1719   C C   . ARG A 1 244 ? -57.952  37.579  -25.766 1.00 30.00  ? 248 ARG C C   1  
ATOM 1720   O O   . ARG A 1 244 ? -57.232  38.287  -25.079 1.00 30.00  ? 248 ARG C O   1  
ATOM 1721   C CB  . ARG A 1 244 ? -57.293  35.216  -25.387 1.00 99.99  ? 248 ARG C CB  1  
ATOM 1722   C CG  . ARG A 1 244 ? -56.631  33.995  -26.015 1.00 99.99  ? 248 ARG C CG  1  
ATOM 1723   C CD  . ARG A 1 244 ? -57.552  33.404  -27.076 1.00 99.99  ? 248 ARG C CD  1  
ATOM 1724   N NE  . ARG A 1 244 ? -58.855  33.014  -26.489 1.00 99.99  ? 248 ARG C NE  1  
ATOM 1725   C CZ  . ARG A 1 244 ? -59.714  32.206  -27.105 1.00 99.99  ? 248 ARG C CZ  1  
ATOM 1726   N NH1 . ARG A 1 244 ? -59.457  31.689  -28.305 1.00 99.99  ? 248 ARG C NH1 1  
ATOM 1727   N NH2 . ARG A 1 244 ? -60.855  31.919  -26.488 1.00 99.99  ? 248 ARG C NH2 1  
ATOM 1728   N N   . ILE A 1 245 ? -59.234  37.851  -25.977 1.00 30.00  ? 249 ILE C N   1  
ATOM 1729   C CA  . ILE A 1 245 ? -59.883  39.017  -25.395 1.00 30.00  ? 249 ILE C CA  1  
ATOM 1730   C C   . ILE A 1 245 ? -61.009  38.574  -24.468 1.00 30.00  ? 249 ILE C C   1  
ATOM 1731   O O   . ILE A 1 245 ? -62.068  38.167  -24.927 1.00 30.00  ? 249 ILE C O   1  
ATOM 1732   C CB  . ILE A 1 245 ? -60.459  39.895  -26.499 1.00 99.99  ? 249 ILE C CB  1  
ATOM 1733   C CG1 . ILE A 1 245 ? -61.858  39.405  -26.863 1.00 99.99  ? 249 ILE C CG1 1  
ATOM 1734   C CG2 . ILE A 1 245 ? -59.559  39.822  -27.730 1.00 99.99  ? 249 ILE C CG2 1  
ATOM 1735   C CD1 . ILE A 1 245 ? -62.894  40.191  -26.071 1.00 99.99  ? 249 ILE C CD1 1  
ATOM 1736   N N   . HIS A 1 246 ? -60.771  38.660  -23.162 1.00 30.00  ? 250 HIS C N   1  
ATOM 1737   C CA  . HIS A 1 246 ? -61.749  38.265  -22.155 1.00 30.00  ? 250 HIS C CA  1  
ATOM 1738   C C   . HIS A 1 246 ? -62.935  39.214  -21.938 1.00 30.00  ? 250 HIS C C   1  
ATOM 1739   O O   . HIS A 1 246 ? -62.825  40.436  -22.113 1.00 30.00  ? 250 HIS C O   1  
ATOM 1740   C CB  . HIS A 1 246 ? -61.070  38.139  -20.795 1.00 99.99  ? 250 HIS C CB  1  
ATOM 1741   C CG  . HIS A 1 246 ? -59.894  37.195  -20.752 1.00 99.99  ? 250 HIS C CG  1  
ATOM 1742   N ND1 . HIS A 1 246 ? -60.043  35.845  -20.452 1.00 99.99  ? 250 HIS C ND1 1  
ATOM 1743   C CD2 . HIS A 1 246 ? -58.566  37.400  -20.969 1.00 99.99  ? 250 HIS C CD2 1  
ATOM 1744   C CE1 . HIS A 1 246 ? -58.849  35.286  -20.492 1.00 99.99  ? 250 HIS C CE1 1  
ATOM 1745   N NE2 . HIS A 1 246 ? -57.959  36.193  -20.799 1.00 99.99  ? 250 HIS C NE2 1  
ATOM 1746   N N   . PHE A 1 247 ? -64.071  38.630  -21.559 1.00 30.00  ? 251 PHE C N   1  
ATOM 1747   C CA  . PHE A 1 247 ? -65.302  39.383  -21.326 1.00 30.00  ? 251 PHE C CA  1  
ATOM 1748   C C   . PHE A 1 247 ? -65.938  39.092  -19.966 1.00 30.00  ? 251 PHE C C   1  
ATOM 1749   O O   . PHE A 1 247 ? -65.912  37.950  -19.490 1.00 30.00  ? 251 PHE C O   1  
ATOM 1750   C CB  . PHE A 1 247 ? -66.334  39.036  -22.396 1.00 99.99  ? 251 PHE C CB  1  
ATOM 1751   C CG  . PHE A 1 247 ? -65.939  39.681  -23.703 1.00 99.99  ? 251 PHE C CG  1  
ATOM 1752   C CD1 . PHE A 1 247 ? -66.168  41.045  -23.908 1.00 99.99  ? 251 PHE C CD1 1  
ATOM 1753   C CD2 . PHE A 1 247 ? -65.343  38.911  -24.711 1.00 99.99  ? 251 PHE C CD2 1  
ATOM 1754   C CE1 . PHE A 1 247 ? -65.803  41.642  -25.121 1.00 99.99  ? 251 PHE C CE1 1  
ATOM 1755   C CE2 . PHE A 1 247 ? -64.977  39.509  -25.924 1.00 99.99  ? 251 PHE C CE2 1  
ATOM 1756   C CZ  . PHE A 1 247 ? -65.208  40.873  -26.127 1.00 99.99  ? 251 PHE C CZ  1  
ATOM 1757   N N   . GLY A 1 248 ? -66.521  40.135  -19.358 1.00 30.00  ? 252 GLY C N   1  
ATOM 1758   C CA  . GLY A 1 248 ? -67.160  39.990  -18.059 1.00 30.00  ? 252 GLY C CA  1  
ATOM 1759   C C   . GLY A 1 248 ? -68.657  39.689  -18.067 1.00 30.00  ? 252 GLY C C   1  
ATOM 1760   O O   . GLY A 1 248 ? -69.258  39.572  -19.139 1.00 30.00  ? 252 GLY C O   1  
ATOM 1761   N N   . PRO A 1 249 ? -69.286  39.554  -16.873 1.00 30.00  ? 253 PRO C N   1  
ATOM 1762   C CA  . PRO A 1 249 ? -70.710  39.268  -16.637 1.00 30.00  ? 253 PRO C CA  1  
ATOM 1763   C C   . PRO A 1 249 ? -71.743  40.235  -17.211 1.00 30.00  ? 253 PRO C C   1  
ATOM 1764   O O   . PRO A 1 249 ? -72.945  40.009  -17.097 1.00 30.00  ? 253 PRO C O   1  
ATOM 1765   C CB  . PRO A 1 249 ? -70.699  39.341  -15.150 1.00 99.99  ? 253 PRO C CB  1  
ATOM 1766   C CG  . PRO A 1 249 ? -69.265  39.604  -14.754 1.00 99.99  ? 253 PRO C CG  1  
ATOM 1767   C CD  . PRO A 1 249 ? -68.464  39.675  -15.745 1.00 99.99  ? 253 PRO C CD  1  
ATOM 1768   N N   . THR A 1 250 ? -71.281  41.314  -17.826 1.00 30.00  ? 254 THR C N   1  
ATOM 1769   C CA  . THR A 1 250 ? -72.188  42.287  -18.432 1.00 30.00  ? 254 THR C CA  1  
ATOM 1770   C C   . THR A 1 250 ? -71.837  42.321  -19.918 1.00 30.00  ? 254 THR C C   1  
ATOM 1771   O O   . THR A 1 250 ? -72.298  43.201  -20.654 1.00 30.00  ? 254 THR C O   1  
ATOM 1772   C CB  . THR A 1 250 ? -71.983  43.655  -17.790 1.00 99.99  ? 254 THR C CB  1  
ATOM 1773   O OG1 . THR A 1 250 ? -70.694  44.160  -18.147 1.00 99.99  ? 254 THR C OG1 1  
ATOM 1774   C CG2 . THR A 1 250 ? -72.073  43.525  -16.275 1.00 99.99  ? 254 THR C CG2 1  
ATOM 1775   N N   . GLY A 1 251 ? -71.012  41.355  -20.340 1.00 30.00  ? 255 GLY C N   1  
ATOM 1776   C CA  . GLY A 1 251 ? -70.579  41.243  -21.729 1.00 30.00  ? 255 GLY C CA  1  
ATOM 1777   C C   . GLY A 1 251 ? -69.634  42.346  -22.198 1.00 30.00  ? 255 GLY C C   1  
ATOM 1778   O O   . GLY A 1 251 ? -69.677  42.746  -23.369 1.00 30.00  ? 255 GLY C O   1  
ATOM 1779   N N   . LYS A 1 252 ? -68.779  42.837  -21.301 1.00 30.00  ? 256 LYS C N   1  
ATOM 1780   C CA  . LYS A 1 252 ? -67.838  43.899  -21.648 1.00 30.00  ? 256 LYS C CA  1  
ATOM 1781   C C   . LYS A 1 252 ? -66.394  43.438  -21.476 1.00 30.00  ? 256 LYS C C   1  
ATOM 1782   O O   . LYS A 1 252 ? -66.124  42.511  -20.700 1.00 30.00  ? 256 LYS C O   1  
ATOM 1783   C CB  . LYS A 1 252 ? -68.070  45.111  -20.751 1.00 99.99  ? 256 LYS C CB  1  
ATOM 1784   C CG  . LYS A 1 252 ? -67.153  46.249  -21.186 1.00 99.99  ? 256 LYS C CG  1  
ATOM 1785   C CD  . LYS A 1 252 ? -67.673  47.565  -20.618 1.00 99.99  ? 256 LYS C CD  1  
ATOM 1786   C CE  . LYS A 1 252 ? -66.582  48.630  -20.726 1.00 99.99  ? 256 LYS C CE  1  
ATOM 1787   N NZ  . LYS A 1 252 ? -66.765  49.390  -21.972 1.00 99.99  ? 256 LYS C NZ  1  
ATOM 1788   N N   . ILE A 1 253 ? -65.465  44.074  -22.191 1.00 30.00  ? 257 ILE C N   1  
ATOM 1789   C CA  . ILE A 1 253 ? -64.061  43.682  -22.104 1.00 30.00  ? 257 ILE C CA  1  
ATOM 1790   C C   . ILE A 1 253 ? -63.513  43.834  -20.686 1.00 30.00  ? 257 ILE C C   1  
ATOM 1791   O O   . ILE A 1 253 ? -63.500  44.919  -20.115 1.00 30.00  ? 257 ILE C O   1  
ATOM 1792   C CB  . ILE A 1 253 ? -63.223  44.557  -23.031 1.00 99.99  ? 257 ILE C CB  1  
ATOM 1793   C CG1 . ILE A 1 253 ? -62.920  45.882  -22.344 1.00 99.99  ? 257 ILE C CG1 1  
ATOM 1794   C CG2 . ILE A 1 253 ? -63.994  44.816  -24.320 1.00 99.99  ? 257 ILE C CG2 1  
ATOM 1795   C CD1 . ILE A 1 253 ? -63.979  46.909  -22.731 1.00 99.99  ? 257 ILE C CD1 1  
ATOM 1796   N N   . ALA A 1 254 ? -63.061  42.710  -20.137 1.00 30.00  ? 258 ALA C N   1  
ATOM 1797   C CA  . ALA A 1 254 ? -62.517  42.638  -18.786 1.00 30.00  ? 258 ALA C CA  1  
ATOM 1798   C C   . ALA A 1 254 ? -61.099  42.063  -18.699 1.00 30.00  ? 258 ALA C C   1  
ATOM 1799   O O   . ALA A 1 254 ? -60.765  41.396  -17.707 1.00 30.00  ? 258 ALA C O   1  
ATOM 1800   C CB  . ALA A 1 254 ? -63.444  41.785  -17.942 1.00 30.00  ? 258 ALA C CB  1  
ATOM 1801   N N   . GLY A 1 255 ? -60.276  42.313  -19.716 1.00 30.00  ? 259 GLY C N   1  
ATOM 1802   C CA  . GLY A 1 255 ? -58.913  41.790  -19.711 1.00 30.00  ? 259 GLY C CA  1  
ATOM 1803   C C   . GLY A 1 255 ? -58.478  41.289  -21.076 1.00 30.00  ? 259 GLY C C   1  
ATOM 1804   O O   . GLY A 1 255 ? -59.266  41.328  -22.024 1.00 30.00  ? 259 GLY C O   1  
ATOM 1805   N N   . ALA A 1 256 ? -57.236  40.808  -21.182 1.00 30.00  ? 260 ALA C N   1  
ATOM 1806   C CA  . ALA A 1 256 ? -56.704  40.307  -22.454 1.00 30.00  ? 260 ALA C CA  1  
ATOM 1807   C C   . ALA A 1 256 ? -55.248  39.854  -22.373 1.00 30.00  ? 260 ALA C C   1  
ATOM 1808   O O   . ALA A 1 256 ? -54.454  40.438  -21.649 1.00 30.00  ? 260 ALA C O   1  
ATOM 1809   C CB  . ALA A 1 256 ? -56.824  41.384  -23.514 1.00 30.00  ? 260 ALA C CB  1  
ATOM 1810   N N   . ASP A 1 257 ? -54.892  38.814  -23.117 1.00 30.00  ? 261 ASP C N   1  
ATOM 1811   C CA  . ASP A 1 257 ? -53.513  38.327  -23.114 1.00 30.00  ? 261 ASP C CA  1  
ATOM 1812   C C   . ASP A 1 257 ? -53.015  38.033  -24.521 1.00 30.00  ? 261 ASP C C   1  
ATOM 1813   O O   . ASP A 1 257 ? -53.796  37.804  -25.453 1.00 30.00  ? 261 ASP C O   1  
ATOM 1814   C CB  . ASP A 1 257 ? -53.418  37.042  -22.298 1.00 99.99  ? 261 ASP C CB  1  
ATOM 1815   C CG  . ASP A 1 257 ? -51.950  36.676  -22.091 1.00 99.99  ? 261 ASP C CG  1  
ATOM 1816   O OD1 . ASP A 1 257 ? -51.358  36.103  -23.047 1.00 99.99  ? 261 ASP C OD1 1  
ATOM 1817   O OD2 . ASP A 1 257 ? -51.432  36.972  -20.980 1.00 99.99  ? 261 ASP C OD2 1  
ATOM 1818   N N   . ILE A 1 258 ? -51.700  38.032  -24.662 1.00 30.00  ? 262 ILE C N   1  
ATOM 1819   C CA  . ILE A 1 258 ? -51.066  37.795  -25.940 1.00 30.00  ? 262 ILE C CA  1  
ATOM 1820   C C   . ILE A 1 258 ? -50.069  36.662  -25.872 1.00 30.00  ? 262 ILE C C   1  
ATOM 1821   O O   . ILE A 1 258 ? -49.384  36.483  -24.867 1.00 30.00  ? 262 ILE C O   1  
ATOM 1822   C CB  . ILE A 1 258 ? -50.330  39.049  -26.393 1.00 99.99  ? 262 ILE C CB  1  
ATOM 1823   C CG1 . ILE A 1 258 ? -48.969  39.118  -25.707 1.00 99.99  ? 262 ILE C CG1 1  
ATOM 1824   C CG2 . ILE A 1 258 ? -51.148  40.282  -26.023 1.00 99.99  ? 262 ILE C CG2 1  
ATOM 1825   C CD1 . ILE A 1 258 ? -49.087  39.940  -24.428 1.00 99.99  ? 262 ILE C CD1 1  
ATOM 1826   N N   . GLU A 1 259 ? -50.007  35.893  -26.954 1.00 30.00  ? 263 GLU C N   1  
ATOM 1827   C CA  . GLU A 1 259 ? -49.086  34.769  -27.078 1.00 30.00  ? 263 GLU C CA  1  
ATOM 1828   C C   . GLU A 1 259 ? -48.422  35.000  -28.424 1.00 30.00  ? 263 GLU C C   1  
ATOM 1829   O O   . GLU A 1 259 ? -49.072  35.454  -29.379 1.00 30.00  ? 263 GLU C O   1  
ATOM 1830   C CB  . GLU A 1 259 ? -49.861  33.455  -27.035 1.00 99.99  ? 263 GLU C CB  1  
ATOM 1831   C CG  . GLU A 1 259 ? -50.542  33.315  -25.697 1.00 99.99  ? 263 GLU C CG  1  
ATOM 1832   C CD  . GLU A 1 259 ? -49.496  33.040  -24.618 1.00 99.99  ? 263 GLU C CD  1  
ATOM 1833   O OE1 . GLU A 1 259 ? -48.990  34.041  -24.042 1.00 99.99  ? 263 GLU C OE1 1  
ATOM 1834   O OE2 . GLU A 1 259 ? -49.213  31.836  -24.383 1.00 99.99  ? 263 GLU C OE2 1  
ATOM 1835   N N   . THR A 1 260 ? -47.129  34.719  -28.490 1.00 30.00  ? 264 THR C N   1  
ATOM 1836   C CA  . THR A 1 260 ? -46.390  34.905  -29.721 1.00 30.00  ? 264 THR C CA  1  
ATOM 1837   C C   . THR A 1 260 ? -45.650  33.620  -30.025 1.00 30.00  ? 264 THR C C   1  
ATOM 1838   O O   . THR A 1 260 ? -45.346  32.827  -29.127 1.00 30.00  ? 264 THR C O   1  
ATOM 1839   C CB  . THR A 1 260 ? -45.398  36.051  -29.562 1.00 99.99  ? 264 THR C CB  1  
ATOM 1840   O OG1 . THR A 1 260 ? -44.375  35.673  -28.635 1.00 99.99  ? 264 THR C OG1 1  
ATOM 1841   C CG2 . THR A 1 260 ? -46.126  37.284  -29.035 1.00 99.99  ? 264 THR C CG2 1  
ATOM 1842   N N   . TYR A 1 261 ? -45.356  33.422  -31.309 1.00 30.00  ? 265 TYR C N   1  
ATOM 1843   C CA  . TYR A 1 261 ? -44.675  32.225  -31.741 1.00 30.00  ? 265 TYR C CA  1  
ATOM 1844   C C   . TYR A 1 261 ? -43.594  32.431  -32.795 1.00 30.00  ? 265 TYR C C   1  
ATOM 1845   O O   . TYR A 1 261 ? -43.768  33.203  -33.747 1.00 30.00  ? 265 TYR C O   1  
ATOM 1846   C CB  . TYR A 1 261 ? -45.677  31.247  -32.347 1.00 99.99  ? 265 TYR C CB  1  
ATOM 1847   C CG  . TYR A 1 261 ? -44.958  29.999  -32.795 1.00 99.99  ? 265 TYR C CG  1  
ATOM 1848   C CD1 . TYR A 1 261 ? -44.673  28.985  -31.871 1.00 99.99  ? 265 TYR C CD1 1  
ATOM 1849   C CD2 . TYR A 1 261 ? -44.575  29.852  -34.134 1.00 99.99  ? 265 TYR C CD2 1  
ATOM 1850   C CE1 . TYR A 1 261 ? -44.006  27.828  -32.287 1.00 99.99  ? 265 TYR C CE1 1  
ATOM 1851   C CE2 . TYR A 1 261 ? -43.907  28.697  -34.547 1.00 99.99  ? 265 TYR C CE2 1  
ATOM 1852   C CZ  . TYR A 1 261 ? -43.624  27.683  -33.624 1.00 99.99  ? 265 TYR C CZ  1  
ATOM 1853   O OH  . TYR A 1 261 ? -42.973  26.556  -34.028 1.00 99.99  ? 265 TYR C OH  1  
ATOM 1854   N N   . LEU A 1 262 ? -42.480  31.724  -32.601 1.00 30.00  ? 266 LEU C N   1  
ATOM 1855   C CA  . LEU A 1 262 ? -41.338  31.733  -33.511 1.00 30.00  ? 266 LEU C CA  1  
ATOM 1856   C C   . LEU A 1 262 ? -40.926  33.041  -34.157 1.00 30.00  ? 266 LEU C C   1  
ATOM 1857   O O   . LEU A 1 262 ? -41.199  33.271  -35.347 1.00 30.00  ? 266 LEU C O   1  
ATOM 1858   C CB  . LEU A 1 262 ? -41.605  30.801  -34.689 1.00 99.99  ? 266 LEU C CB  1  
ATOM 1859   C CG  . LEU A 1 262 ? -41.003  29.430  -34.401 1.00 99.99  ? 266 LEU C CG  1  
ATOM 1860   C CD1 . LEU A 1 262 ? -40.975  28.606  -35.683 1.00 99.99  ? 266 LEU C CD1 1  
ATOM 1861   C CD2 . LEU A 1 262 ? -39.582  29.603  -33.873 1.00 99.99  ? 266 LEU C CD2 1  
ATOM 1862   N N   . LEU A 1 263 ? -40.261  33.895  -33.392 1.00 30.00  ? 267 LEU C N   1  
ATOM 1863   C CA  . LEU A 1 263 ? -39.810  35.173  -33.926 1.00 30.00  ? 267 LEU C CA  1  
ATOM 1864   C C   . LEU A 1 263 ? -38.533  34.911  -34.736 1.00 30.00  ? 267 LEU C C   1  
ATOM 1865   O O   . LEU A 1 263 ? -37.670  34.130  -34.319 1.00 30.00  ? 267 LEU C O   1  
ATOM 1866   C CB  . LEU A 1 263 ? -39.521  36.142  -32.784 1.00 99.99  ? 267 LEU C CB  1  
ATOM 1867   C CG  . LEU A 1 263 ? -40.750  37.004  -32.523 1.00 99.99  ? 267 LEU C CG  1  
ATOM 1868   C CD1 . LEU A 1 263 ? -40.368  38.177  -31.625 1.00 99.99  ? 267 LEU C CD1 1  
ATOM 1869   C CD2 . LEU A 1 263 ? -41.290  37.534  -33.847 1.00 99.99  ? 267 LEU C CD2 1  
ATOM 1870   N N   . GLU A 1 264 ? -38.414  35.561  -35.886 1.00 30.00  ? 268 GLU C N   1  
ATOM 1871   C CA  . GLU A 1 264 ? -37.244  35.365  -36.723 1.00 30.00  ? 268 GLU C CA  1  
ATOM 1872   C C   . GLU A 1 264 ? -35.909  35.884  -36.162 1.00 30.00  ? 268 GLU C C   1  
ATOM 1873   O O   . GLU A 1 264 ? -35.432  36.956  -36.558 1.00 30.00  ? 268 GLU C O   1  
ATOM 1874   C CB  . GLU A 1 264 ? -37.437  36.073  -38.059 1.00 99.99  ? 268 GLU C CB  1  
ATOM 1875   C CG  . GLU A 1 264 ? -36.230  36.930  -38.355 1.00 99.99  ? 268 GLU C CG  1  
ATOM 1876   C CD  . GLU A 1 264 ? -36.219  38.135  -37.413 1.00 99.99  ? 268 GLU C CD  1  
ATOM 1877   O OE1 . GLU A 1 264 ? -35.615  38.000  -36.316 1.00 99.99  ? 268 GLU C OE1 1  
ATOM 1878   O OE2 . GLU A 1 264 ? -36.814  39.176  -37.804 1.00 99.99  ? 268 GLU C OE2 1  
ATOM 1879   N N   . LYS A 1 265 ? -35.512  34.963  -35.241 1.00 30.00  ? 269 LYS C N   1  
ATOM 1880   C CA  . LYS A 1 265 ? -34.214  35.317  -34.661 1.00 30.00  ? 269 LYS C CA  1  
ATOM 1881   C C   . LYS A 1 265 ? -33.188  35.729  -35.714 1.00 30.00  ? 269 LYS C C   1  
ATOM 1882   O O   . LYS A 1 265 ? -32.383  36.625  -35.497 1.00 30.00  ? 269 LYS C O   1  
ATOM 1883   C CB  . LYS A 1 265 ? -33.645  34.120  -33.906 1.00 99.99  ? 269 LYS C CB  1  
ATOM 1884   C CG  . LYS A 1 265 ? -34.613  33.705  -32.804 1.00 99.99  ? 269 LYS C CG  1  
ATOM 1885   C CD  . LYS A 1 265 ? -33.999  32.575  -31.987 1.00 99.99  ? 269 LYS C CD  1  
ATOM 1886   C CE  . LYS A 1 265 ? -34.958  32.176  -30.870 1.00 99.99  ? 269 LYS C CE  1  
ATOM 1887   N NZ  . LYS A 1 265 ? -34.217  31.462  -29.819 1.00 99.99  ? 269 LYS C NZ  1  
ATOM 1888   N N   . SER A 1 266 ? -33.216  35.076  -36.863 1.00 30.00  ? 270 SER C N   1  
ATOM 1889   C CA  . SER A 1 266 ? -32.258  35.366  -37.932 1.00 30.00  ? 270 SER C CA  1  
ATOM 1890   C C   . SER A 1 266 ? -32.213  36.736  -38.586 1.00 30.00  ? 270 SER C C   1  
ATOM 1891   O O   . SER A 1 266 ? -31.158  37.142  -39.075 1.00 30.00  ? 270 SER C O   1  
ATOM 1892   C CB  . SER A 1 266 ? -32.492  34.422  -39.106 1.00 99.99  ? 270 SER C CB  1  
ATOM 1893   O OG  . SER A 1 266 ? -33.746  34.726  -39.722 1.00 99.99  ? 270 SER C OG  1  
ATOM 1894   N N   . ARG A 1 267 ? -33.334  37.450  -38.622 1.00 30.00  ? 271 ARG C N   1  
ATOM 1895   C CA  . ARG A 1 267 ? -33.339  38.768  -39.272 1.00 30.00  ? 271 ARG C CA  1  
ATOM 1896   C C   . ARG A 1 267 ? -32.464  39.799  -38.572 1.00 30.00  ? 271 ARG C C   1  
ATOM 1897   O O   . ARG A 1 267 ? -31.981  40.745  -39.199 1.00 30.00  ? 271 ARG C O   1  
ATOM 1898   C CB  . ARG A 1 267 ? -34.758  39.324  -39.301 1.00 99.99  ? 271 ARG C CB  1  
ATOM 1899   C CG  . ARG A 1 267 ? -34.924  40.239  -40.509 1.00 99.99  ? 271 ARG C CG  1  
ATOM 1900   C CD  . ARG A 1 267 ? -36.306  40.031  -41.117 1.00 99.99  ? 271 ARG C CD  1  
ATOM 1901   N NE  . ARG A 1 267 ? -36.352  40.529  -42.510 1.00 99.99  ? 271 ARG C NE  1  
ATOM 1902   C CZ  . ARG A 1 267 ? -37.357  40.266  -43.340 1.00 99.99  ? 271 ARG C CZ  1  
ATOM 1903   N NH1 . ARG A 1 267 ? -38.402  39.529  -42.973 1.00 99.99  ? 271 ARG C NH1 1  
ATOM 1904   N NH2 . ARG A 1 267 ? -37.298  40.765  -44.572 1.00 99.99  ? 271 ARG C NH2 1  
ATOM 1905   N N   . VAL A 1 268 ? -32.275  39.607  -37.270 1.00 30.00  ? 272 VAL C N   1  
ATOM 1906   C CA  . VAL A 1 268 ? -31.473  40.490  -36.433 1.00 30.00  ? 272 VAL C CA  1  
ATOM 1907   C C   . VAL A 1 268 ? -30.106  40.853  -37.031 1.00 30.00  ? 272 VAL C C   1  
ATOM 1908   O O   . VAL A 1 268 ? -29.768  42.032  -37.173 1.00 30.00  ? 272 VAL C O   1  
ATOM 1909   C CB  . VAL A 1 268 ? -31.205  39.829  -35.088 1.00 99.99  ? 272 VAL C CB  1  
ATOM 1910   C CG1 . VAL A 1 268 ? -32.532  39.543  -34.388 1.00 99.99  ? 272 VAL C CG1 1  
ATOM 1911   C CG2 . VAL A 1 268 ? -30.451  38.523  -35.301 1.00 99.99  ? 272 VAL C CG2 1  
ATOM 1912   N N   . THR A 1 269 ? -29.333  39.827  -37.388 1.00 30.00  ? 273 THR C N   1  
ATOM 1913   C CA  . THR A 1 269 ? -27.999  40.015  -37.971 1.00 30.00  ? 273 THR C CA  1  
ATOM 1914   C C   . THR A 1 269 ? -27.932  39.879  -39.496 1.00 30.00  ? 273 THR C C   1  
ATOM 1915   O O   . THR A 1 269 ? -26.993  40.365  -40.122 1.00 30.00  ? 273 THR C O   1  
ATOM 1916   C CB  . THR A 1 269 ? -27.035  38.978  -37.400 1.00 99.99  ? 273 THR C CB  1  
ATOM 1917   O OG1 . THR A 1 269 ? -27.403  37.678  -37.870 1.00 99.99  ? 273 THR C OG1 1  
ATOM 1918   C CG2 . THR A 1 269 ? -27.102  39.006  -35.879 1.00 99.99  ? 273 THR C CG2 1  
ATOM 1919   N N   . TYR A 1 270 ? -28.925  39.220  -40.089 1.00 30.00  ? 274 TYR C N   1  
ATOM 1920   C CA  . TYR A 1 270 ? -28.948  39.028  -41.541 1.00 30.00  ? 274 TYR C CA  1  
ATOM 1921   C C   . TYR A 1 270 ? -30.240  39.444  -42.215 1.00 30.00  ? 274 TYR C C   1  
ATOM 1922   O O   . TYR A 1 270 ? -31.322  39.292  -41.644 1.00 30.00  ? 274 TYR C O   1  
ATOM 1923   C CB  . TYR A 1 270 ? -28.738  37.553  -41.872 1.00 99.99  ? 274 TYR C CB  1  
ATOM 1924   C CG  . TYR A 1 270 ? -28.761  37.362  -43.369 1.00 99.99  ? 274 TYR C CG  1  
ATOM 1925   C CD1 . TYR A 1 270 ? -27.603  37.599  -44.121 1.00 99.99  ? 274 TYR C CD1 1  
ATOM 1926   C CD2 . TYR A 1 270 ? -29.939  36.953  -44.006 1.00 99.99  ? 274 TYR C CD2 1  
ATOM 1927   C CE1 . TYR A 1 270 ? -27.623  37.423  -45.510 1.00 99.99  ? 274 TYR C CE1 1  
ATOM 1928   C CE2 . TYR A 1 270 ? -29.957  36.778  -45.395 1.00 99.99  ? 274 TYR C CE2 1  
ATOM 1929   C CZ  . TYR A 1 270 ? -28.801  37.012  -46.147 1.00 99.99  ? 274 TYR C CZ  1  
ATOM 1930   O OH  . TYR A 1 270 ? -28.824  36.841  -47.496 1.00 99.99  ? 274 TYR C OH  1  
ATOM 1931   N N   . GLN A 1 271 ? -30.118  39.962  -43.435 1.00 30.00  ? 275 GLN C N   1  
ATOM 1932   C CA  . GLN A 1 271 ? -31.293  40.373  -44.189 1.00 30.00  ? 275 GLN C CA  1  
ATOM 1933   C C   . GLN A 1 271 ? -31.062  40.310  -45.691 1.00 30.00  ? 275 GLN C C   1  
ATOM 1934   O O   . GLN A 1 271 ? -30.320  41.121  -46.237 1.00 30.00  ? 275 GLN C O   1  
ATOM 1935   C CB  . GLN A 1 271 ? -31.665  41.807  -43.832 1.00 99.99  ? 275 GLN C CB  1  
ATOM 1936   C CG  . GLN A 1 271 ? -32.088  41.874  -42.367 1.00 99.99  ? 275 GLN C CG  1  
ATOM 1937   C CD  . GLN A 1 271 ? -33.448  41.226  -42.159 1.00 99.99  ? 275 GLN C CD  1  
ATOM 1938   O OE1 . GLN A 1 271 ? -34.056  40.737  -43.109 1.00 99.99  ? 275 GLN C OE1 1  
ATOM 1939   N NE2 . GLN A 1 271 ? -33.925  41.224  -40.912 1.00 99.99  ? 275 GLN C NE2 1  
ATOM 1940   N N   . GLN A 1 272 ? -31.708  39.343  -46.347 1.00 30.00  ? 276 GLN C N   1  
ATOM 1941   C CA  . GLN A 1 272 ? -31.602  39.154  -47.799 1.00 30.00  ? 276 GLN C CA  1  
ATOM 1942   C C   . GLN A 1 272 ? -31.812  40.485  -48.514 1.00 30.00  ? 276 GLN C C   1  
ATOM 1943   O O   . GLN A 1 272 ? -32.451  41.386  -47.979 1.00 30.00  ? 276 GLN C O   1  
ATOM 1944   C CB  . GLN A 1 272 ? -32.659  38.163  -48.271 1.00 99.99  ? 276 GLN C CB  1  
ATOM 1945   C CG  . GLN A 1 272 ? -34.043  38.662  -47.869 1.00 99.99  ? 276 GLN C CG  1  
ATOM 1946   C CD  . GLN A 1 272 ? -34.315  38.394  -46.394 1.00 99.99  ? 276 GLN C CD  1  
ATOM 1947   O OE1 . GLN A 1 272 ? -33.468  37.843  -45.696 1.00 99.99  ? 276 GLN C OE1 1  
ATOM 1948   N NE2 . GLN A 1 272 ? -35.499  38.789  -45.924 1.00 99.99  ? 276 GLN C NE2 1  
ATOM 1949   N N   . SER A 1 273 ? -31.281  40.621  -49.722 1.00 30.00  ? 277 SER C N   1  
ATOM 1950   C CA  . SER A 1 273 ? -31.436  41.874  -50.442 1.00 30.00  ? 277 SER C CA  1  
ATOM 1951   C C   . SER A 1 273 ? -32.891  42.305  -50.512 1.00 30.00  ? 277 SER C C   1  
ATOM 1952   O O   . SER A 1 273 ? -33.795  41.472  -50.397 1.00 30.00  ? 277 SER C O   1  
ATOM 1953   C CB  . SER A 1 273 ? -30.915  41.722  -51.865 1.00 99.99  ? 277 SER C CB  1  
ATOM 1954   O OG  . SER A 1 273 ? -31.769  40.836  -52.595 1.00 99.99  ? 277 SER C OG  1  
ATOM 1955   N N   . ALA A 1 274 ? -33.109  43.611  -50.695 1.00 30.00  ? 278 ALA C N   1  
ATOM 1956   C CA  . ALA A 1 274 ? -34.459  44.187  -50.791 1.00 30.00  ? 278 ALA C CA  1  
ATOM 1957   C C   . ALA A 1 274 ? -35.327  43.988  -49.536 1.00 30.00  ? 278 ALA C C   1  
ATOM 1958   O O   . ALA A 1 274 ? -36.551  44.166  -49.572 1.00 30.00  ? 278 ALA C O   1  
ATOM 1959   C CB  . ALA A 1 274 ? -35.174  43.598  -51.997 1.00 30.00  ? 278 ALA C CB  1  
ATOM 1960   N N   . GLU A 1 275 ? -34.686  43.619  -48.432 1.00 30.00  ? 279 GLU C N   1  
ATOM 1961   C CA  . GLU A 1 275 ? -35.381  43.397  -47.168 1.00 30.00  ? 279 GLU C CA  1  
ATOM 1962   C C   . GLU A 1 275 ? -34.706  44.197  -46.062 1.00 30.00  ? 279 GLU C C   1  
ATOM 1963   O O   . GLU A 1 275 ? -33.518  44.513  -46.147 1.00 30.00  ? 279 GLU C O   1  
ATOM 1964   C CB  . GLU A 1 275 ? -35.347  41.916  -46.810 1.00 99.99  ? 279 GLU C CB  1  
ATOM 1965   C CG  . GLU A 1 275 ? -34.866  41.754  -45.388 1.00 99.99  ? 279 GLU C CG  1  
ATOM 1966   C CD  . GLU A 1 275 ? -33.372  42.081  -45.315 1.00 99.99  ? 279 GLU C CD  1  
ATOM 1967   O OE1 . GLU A 1 275 ? -33.058  43.277  -45.083 1.00 99.99  ? 279 GLU C OE1 1  
ATOM 1968   O OE2 . GLU A 1 275 ? -32.568  41.129  -45.493 1.00 99.99  ? 279 GLU C OE2 1  
ATOM 1969   N N   . ARG A 1 276 ? -35.465  44.512  -45.022 1.00 30.00  ? 280 ARG C N   1  
ATOM 1970   C CA  . ARG A 1 276 ? -34.936  45.262  -43.901 1.00 30.00  ? 280 ARG C CA  1  
ATOM 1971   C C   . ARG A 1 276 ? -34.939  44.424  -42.644 1.00 30.00  ? 280 ARG C C   1  
ATOM 1972   O O   . ARG A 1 276 ? -35.515  43.327  -42.606 1.00 30.00  ? 280 ARG C O   1  
ATOM 1973   C CB  . ARG A 1 276 ? -35.787  46.505  -43.661 1.00 99.99  ? 280 ARG C CB  1  
ATOM 1974   C CG  . ARG A 1 276 ? -35.153  47.351  -42.562 1.00 99.99  ? 280 ARG C CG  1  
ATOM 1975   C CD  . ARG A 1 276 ? -36.067  48.528  -42.236 1.00 99.99  ? 280 ARG C CD  1  
ATOM 1976   N NE  . ARG A 1 276 ? -37.284  48.074  -41.528 1.00 99.99  ? 280 ARG C NE  1  
ATOM 1977   C CZ  . ARG A 1 276 ? -38.206  48.911  -41.062 1.00 99.99  ? 280 ARG C CZ  1  
ATOM 1978   N NH1 . ARG A 1 276 ? -38.097  50.230  -41.202 1.00 99.99  ? 280 ARG C NH1 1  
ATOM 1979   N NH2 . ARG A 1 276 ? -39.263  48.395  -40.441 1.00 99.99  ? 280 ARG C NH2 1  
ATOM 1980   N N   . ASN A 1 277 ? -34.287  44.947  -41.608 1.00 30.00  ? 281 ASN C N   1  
ATOM 1981   C CA  . ASN A 1 277 ? -34.232  44.269  -40.318 1.00 30.00  ? 281 ASN C CA  1  
ATOM 1982   C C   . ASN A 1 277 ? -35.515  44.769  -39.665 1.00 30.00  ? 281 ASN C C   1  
ATOM 1983   O O   . ASN A 1 277 ? -36.303  45.505  -40.301 1.00 30.00  ? 281 ASN C O   1  
ATOM 1984   C CB  . ASN A 1 277 ? -32.970  44.684  -39.568 1.00 99.99  ? 281 ASN C CB  1  
ATOM 1985   C CG  . ASN A 1 277 ? -32.968  46.177  -39.278 1.00 99.99  ? 281 ASN C CG  1  
ATOM 1986   O OD1 . ASN A 1 277 ? -32.163  46.658  -38.485 1.00 99.99  ? 281 ASN C OD1 1  
ATOM 1987   N ND2 . ASN A 1 277 ? -33.876  46.911  -39.927 1.00 99.99  ? 281 ASN C ND2 1  
ATOM 1988   N N   . TYR A 1 278 ? -35.742  44.378  -38.418 1.00 30.00  ? 282 TYR C N   1  
ATOM 1989   C CA  . TYR A 1 278 ? -36.934  44.828  -37.727 1.00 30.00  ? 282 TYR C CA  1  
ATOM 1990   C C   . TYR A 1 278 ? -37.122  46.345  -37.800 1.00 30.00  ? 282 TYR C C   1  
ATOM 1991   O O   . TYR A 1 278 ? -36.159  47.090  -37.938 1.00 30.00  ? 282 TYR C O   1  
ATOM 1992   C CB  . TYR A 1 278 ? -36.858  44.441  -36.253 1.00 99.99  ? 282 TYR C CB  1  
ATOM 1993   C CG  . TYR A 1 278 ? -35.781  45.251  -35.573 1.00 99.99  ? 282 TYR C CG  1  
ATOM 1994   C CD1 . TYR A 1 278 ? -34.468  44.767  -35.529 1.00 99.99  ? 282 TYR C CD1 1  
ATOM 1995   C CD2 . TYR A 1 278 ? -36.094  46.482  -34.990 1.00 99.99  ? 282 TYR C CD2 1  
ATOM 1996   C CE1 . TYR A 1 278 ? -33.467  45.519  -34.897 1.00 99.99  ? 282 TYR C CE1 1  
ATOM 1997   C CE2 . TYR A 1 278 ? -35.097  47.234  -34.358 1.00 99.99  ? 282 TYR C CE2 1  
ATOM 1998   C CZ  . TYR A 1 278 ? -33.783  46.752  -34.313 1.00 99.99  ? 282 TYR C CZ  1  
ATOM 1999   O OH  . TYR A 1 278 ? -32.810  47.481  -33.701 1.00 99.99  ? 282 TYR C OH  1  
ATOM 2000   N N   . HIS A 1 279 ? -38.369  46.793  -37.729 1.00 30.00  ? 283 HIS C N   1  
ATOM 2001   C CA  . HIS A 1 279 ? -38.670  48.222  -37.820 1.00 30.00  ? 283 HIS C CA  1  
ATOM 2002   C C   . HIS A 1 279 ? -37.944  49.159  -36.842 1.00 30.00  ? 283 HIS C C   1  
ATOM 2003   O O   . HIS A 1 279 ? -37.475  50.222  -37.273 1.00 30.00  ? 283 HIS C O   1  
ATOM 2004   C CB  . HIS A 1 279 ? -40.157  48.454  -37.572 1.00 99.99  ? 283 HIS C CB  1  
ATOM 2005   C CG  . HIS A 1 279 ? -41.083  47.685  -38.481 1.00 99.99  ? 283 HIS C CG  1  
ATOM 2006   N ND1 . HIS A 1 279 ? -41.526  48.204  -39.692 1.00 99.99  ? 283 HIS C ND1 1  
ATOM 2007   C CD2 . HIS A 1 279 ? -41.648  46.454  -38.358 1.00 99.99  ? 283 HIS C CD2 1  
ATOM 2008   C CE1 . HIS A 1 279 ? -42.317  47.310  -40.256 1.00 99.99  ? 283 HIS C CE1 1  
ATOM 2009   N NE2 . HIS A 1 279 ? -42.400  46.261  -39.476 1.00 99.99  ? 283 HIS C NE2 1  
ATOM 2010   N N   . ILE A 1 280 ? -37.858  48.784  -35.554 1.00 30.00  ? 284 ILE C N   1  
ATOM 2011   C CA  . ILE A 1 280 ? -37.192  49.614  -34.546 1.00 30.00  ? 284 ILE C CA  1  
ATOM 2012   C C   . ILE A 1 280 ? -35.861  50.192  -35.001 1.00 30.00  ? 284 ILE C C   1  
ATOM 2013   O O   . ILE A 1 280 ? -35.702  51.416  -35.130 1.00 30.00  ? 284 ILE C O   1  
ATOM 2014   C CB  . ILE A 1 280 ? -36.914  48.789  -33.294 1.00 99.99  ? 284 ILE C CB  1  
ATOM 2015   C CG1 . ILE A 1 280 ? -38.168  48.743  -32.430 1.00 99.99  ? 284 ILE C CG1 1  
ATOM 2016   C CG2 . ILE A 1 280 ? -35.779  49.430  -32.504 1.00 99.99  ? 284 ILE C CG2 1  
ATOM 2017   C CD1 . ILE A 1 280 ? -38.917  47.439  -32.688 1.00 99.99  ? 284 ILE C CD1 1  
ATOM 2018   N N   . PHE A 1 281 ? -34.901  49.302  -35.229 1.00 30.00  ? 285 PHE C N   1  
ATOM 2019   C CA  . PHE A 1 281 ? -33.567  49.699  -35.661 1.00 30.00  ? 285 PHE C CA  1  
ATOM 2020   C C   . PHE A 1 281 ? -33.564  50.916  -36.586 1.00 30.00  ? 285 PHE C C   1  
ATOM 2021   O O   . PHE A 1 281 ? -32.698  51.778  -36.481 1.00 30.00  ? 285 PHE C O   1  
ATOM 2022   C CB  . PHE A 1 281 ? -32.905  48.555  -36.419 1.00 99.99  ? 285 PHE C CB  1  
ATOM 2023   C CG  . PHE A 1 281 ? -31.523  48.974  -36.860 1.00 99.99  ? 285 PHE C CG  1  
ATOM 2024   C CD1 . PHE A 1 281 ? -30.445  48.882  -35.972 1.00 99.99  ? 285 PHE C CD1 1  
ATOM 2025   C CD2 . PHE A 1 281 ? -31.322  49.453  -38.161 1.00 99.99  ? 285 PHE C CD2 1  
ATOM 2026   C CE1 . PHE A 1 281 ? -29.166  49.270  -36.384 1.00 99.99  ? 285 PHE C CE1 1  
ATOM 2027   C CE2 . PHE A 1 281 ? -30.040  49.844  -38.570 1.00 99.99  ? 285 PHE C CE2 1  
ATOM 2028   C CZ  . PHE A 1 281 ? -28.963  49.751  -37.682 1.00 99.99  ? 285 PHE C CZ  1  
ATOM 2029   N N   . TYR A 1 282 ? -34.528  51.012  -37.486 1.00 30.00  ? 286 TYR C N   1  
ATOM 2030   C CA  . TYR A 1 282 ? -34.552  52.140  -38.402 1.00 30.00  ? 286 TYR C CA  1  
ATOM 2031   C C   . TYR A 1 282 ? -35.209  53.342  -37.776 1.00 30.00  ? 286 TYR C C   1  
ATOM 2032   O O   . TYR A 1 282 ? -34.917  54.480  -38.147 1.00 30.00  ? 286 TYR C O   1  
ATOM 2033   C CB  . TYR A 1 282 ? -35.328  51.770  -39.662 1.00 99.99  ? 286 TYR C CB  1  
ATOM 2034   C CG  . TYR A 1 282 ? -34.616  50.655  -40.384 1.00 99.99  ? 286 TYR C CG  1  
ATOM 2035   C CD1 . TYR A 1 282 ? -34.903  49.321  -40.072 1.00 99.99  ? 286 TYR C CD1 1  
ATOM 2036   C CD2 . TYR A 1 282 ? -33.667  50.953  -41.370 1.00 99.99  ? 286 TYR C CD2 1  
ATOM 2037   C CE1 . TYR A 1 282 ? -34.242  48.286  -40.741 1.00 99.99  ? 286 TYR C CE1 1  
ATOM 2038   C CE2 . TYR A 1 282 ? -33.005  49.918  -42.040 1.00 99.99  ? 286 TYR C CE2 1  
ATOM 2039   C CZ  . TYR A 1 282 ? -33.293  48.584  -41.728 1.00 99.99  ? 286 TYR C CZ  1  
ATOM 2040   O OH  . TYR A 1 282 ? -32.648  47.579  -42.381 1.00 99.99  ? 286 TYR C OH  1  
ATOM 2041   N N   . GLN A 1 283 ? -36.099  53.090  -36.823 1.00 30.00  ? 287 GLN C N   1  
ATOM 2042   C CA  . GLN A 1 283 ? -36.800  54.156  -36.121 1.00 30.00  ? 287 GLN C CA  1  
ATOM 2043   C C   . GLN A 1 283 ? -35.716  54.880  -35.297 1.00 30.00  ? 287 GLN C C   1  
ATOM 2044   O O   . GLN A 1 283 ? -35.547  56.109  -35.366 1.00 30.00  ? 287 GLN C O   1  
ATOM 2045   C CB  . GLN A 1 283 ? -37.880  53.565  -35.220 1.00 99.99  ? 287 GLN C CB  1  
ATOM 2046   C CG  . GLN A 1 283 ? -38.944  52.889  -36.078 1.00 99.99  ? 287 GLN C CG  1  
ATOM 2047   C CD  . GLN A 1 283 ? -39.792  53.918  -36.810 1.00 99.99  ? 287 GLN C CD  1  
ATOM 2048   O OE1 . GLN A 1 283 ? -39.578  55.119  -36.668 1.00 99.99  ? 287 GLN C OE1 1  
ATOM 2049   N NE2 . GLN A 1 283 ? -40.763  53.442  -37.595 1.00 99.99  ? 287 GLN C NE2 1  
ATOM 2050   N N   . ILE A 1 284 ? -34.983  54.081  -34.531 1.00 30.00  ? 288 ILE C N   1  
ATOM 2051   C CA  . ILE A 1 284 ? -33.891  54.531  -33.677 1.00 30.00  ? 288 ILE C CA  1  
ATOM 2052   C C   . ILE A 1 284 ? -32.814  55.439  -34.338 1.00 30.00  ? 288 ILE C C   1  
ATOM 2053   O O   . ILE A 1 284 ? -32.140  56.198  -33.646 1.00 30.00  ? 288 ILE C O   1  
ATOM 2054   C CB  . ILE A 1 284 ? -33.130  53.333  -33.127 1.00 99.99  ? 288 ILE C CB  1  
ATOM 2055   C CG1 . ILE A 1 284 ? -32.060  52.905  -34.126 1.00 99.99  ? 288 ILE C CG1 1  
ATOM 2056   C CG2 . ILE A 1 284 ? -34.099  52.179  -32.897 1.00 99.99  ? 288 ILE C CG2 1  
ATOM 2057   C CD1 . ILE A 1 284 ? -30.735  53.566  -33.765 1.00 99.99  ? 288 ILE C CD1 1  
ATOM 2058   N N   . CYS A 1 285 ? -32.641  55.368  -35.651 1.00 30.00  ? 289 CYS C N   1  
ATOM 2059   C CA  . CYS A 1 285 ? -31.636  56.189  -36.326 1.00 30.00  ? 289 CYS C CA  1  
ATOM 2060   C C   . CYS A 1 285 ? -32.237  57.246  -37.217 1.00 30.00  ? 289 CYS C C   1  
ATOM 2061   O O   . CYS A 1 285 ? -31.648  57.583  -38.253 1.00 30.00  ? 289 CYS C O   1  
ATOM 2062   C CB  . CYS A 1 285 ? -30.747  55.304  -37.195 1.00 99.99  ? 289 CYS C CB  1  
ATOM 2063   S SG  . CYS A 1 285 ? -31.555  54.509  -38.606 1.00 99.99  ? 289 CYS C SG  1  
ATOM 2064   N N   . SER A 1 286 ? -33.396  57.787  -36.840 1.00 30.00  ? 290 SER C N   1  
ATOM 2065   C CA  . SER A 1 286 ? -34.044  58.808  -37.674 1.00 30.00  ? 290 SER C CA  1  
ATOM 2066   C C   . SER A 1 286 ? -34.024  60.233  -37.157 1.00 30.00  ? 290 SER C C   1  
ATOM 2067   O O   . SER A 1 286 ? -34.072  61.167  -37.953 1.00 30.00  ? 290 SER C O   1  
ATOM 2068   C CB  . SER A 1 286 ? -35.516  58.464  -37.863 1.00 99.99  ? 290 SER C CB  1  
ATOM 2069   O OG  . SER A 1 286 ? -36.202  58.601  -36.616 1.00 99.99  ? 290 SER C OG  1  
ATOM 2070   N N   . ASN A 1 287 ? -33.977  60.375  -35.831 1.00 30.00  ? 291 ASN C N   1  
ATOM 2071   C CA  . ASN A 1 287 ? -33.954  61.664  -35.135 1.00 30.00  ? 291 ASN C CA  1  
ATOM 2072   C C   . ASN A 1 287 ? -35.348  62.165  -34.786 1.00 30.00  ? 291 ASN C C   1  
ATOM 2073   O O   . ASN A 1 287 ? -35.613  63.375  -34.797 1.00 30.00  ? 291 ASN C O   1  
ATOM 2074   C CB  . ASN A 1 287 ? -33.289  62.718  -36.014 1.00 99.99  ? 291 ASN C CB  1  
ATOM 2075   C CG  . ASN A 1 287 ? -32.677  63.830  -35.175 1.00 99.99  ? 291 ASN C CG  1  
ATOM 2076   O OD1 . ASN A 1 287 ? -32.510  64.951  -35.648 1.00 99.99  ? 291 ASN C OD1 1  
ATOM 2077   N ND2 . ASN A 1 287 ? -32.340  63.514  -33.921 1.00 99.99  ? 291 ASN C ND2 1  
ATOM 2078   N N   . ALA A 1 288 ? -36.232  61.227  -34.478 1.00 30.00  ? 292 ALA C N   1  
ATOM 2079   C CA  . ALA A 1 288 ? -37.596  61.562  -34.112 1.00 30.00  ? 292 ALA C CA  1  
ATOM 2080   C C   . ALA A 1 288 ? -37.519  62.187  -32.724 1.00 30.00  ? 292 ALA C C   1  
ATOM 2081   O O   . ALA A 1 288 ? -38.319  63.034  -32.349 1.00 30.00  ? 292 ALA C O   1  
ATOM 2082   C CB  . ALA A 1 288 ? -38.446  60.301  -34.077 1.00 30.00  ? 292 ALA C CB  1  
ATOM 2083   N N   . ILE A 1 289 ? -36.526  61.747  -31.965 1.00 30.00  ? 293 ILE C N   1  
ATOM 2084   C CA  . ILE A 1 289 ? -36.313  62.246  -30.621 1.00 30.00  ? 293 ILE C CA  1  
ATOM 2085   C C   . ILE A 1 289 ? -34.810  62.398  -30.454 1.00 30.00  ? 293 ILE C C   1  
ATOM 2086   O O   . ILE A 1 289 ? -34.139  61.496  -29.938 1.00 30.00  ? 293 ILE C O   1  
ATOM 2087   C CB  . ILE A 1 289 ? -36.874  61.258  -29.605 1.00 99.99  ? 293 ILE C CB  1  
ATOM 2088   C CG1 . ILE A 1 289 ? -35.869  60.137  -29.375 1.00 99.99  ? 293 ILE C CG1 1  
ATOM 2089   C CG2 . ILE A 1 289 ? -38.178  60.668  -30.136 1.00 99.99  ? 293 ILE C CG2 1  
ATOM 2090   C CD1 . ILE A 1 289 ? -36.175  58.974  -30.315 1.00 99.99  ? 293 ILE C CD1 1  
ATOM 2091   N N   . PRO A 1 290 ? -34.265  63.536  -30.905 1.00 30.00  ? 294 PRO C N   1  
ATOM 2092   C CA  . PRO A 1 290 ? -32.831  63.840  -30.819 1.00 30.00  ? 294 PRO C CA  1  
ATOM 2093   C C   . PRO A 1 290 ? -32.308  63.639  -29.404 1.00 30.00  ? 294 PRO C C   1  
ATOM 2094   O O   . PRO A 1 290 ? -31.202  63.149  -29.205 1.00 30.00  ? 294 PRO C O   1  
ATOM 2095   C CB  . PRO A 1 290 ? -32.893  65.274  -31.211 1.00 99.99  ? 294 PRO C CB  1  
ATOM 2096   C CG  . PRO A 1 290 ? -34.345  65.564  -31.516 1.00 99.99  ? 294 PRO C CG  1  
ATOM 2097   C CD  . PRO A 1 290 ? -35.108  64.549  -31.385 1.00 99.99  ? 294 PRO C CD  1  
ATOM 2098   N N   . GLU A 1 291 ? -33.115  64.015  -28.416 1.00 30.00  ? 295 GLU C N   1  
ATOM 2099   C CA  . GLU A 1 291 ? -32.742  63.870  -27.020 1.00 30.00  ? 295 GLU C CA  1  
ATOM 2100   C C   . GLU A 1 291 ? -32.178  62.475  -26.726 1.00 30.00  ? 295 GLU C C   1  
ATOM 2101   O O   . GLU A 1 291 ? -31.236  62.321  -25.950 1.00 30.00  ? 295 GLU C O   1  
ATOM 2102   C CB  . GLU A 1 291 ? -33.964  64.085  -26.133 1.00 99.99  ? 295 GLU C CB  1  
ATOM 2103   C CG  . GLU A 1 291 ? -34.442  65.512  -26.272 1.00 99.99  ? 295 GLU C CG  1  
ATOM 2104   C CD  . GLU A 1 291 ? -33.460  66.448  -25.573 1.00 99.99  ? 295 GLU C CD  1  
ATOM 2105   O OE1 . GLU A 1 291 ? -32.508  66.903  -26.262 1.00 99.99  ? 295 GLU C OE1 1  
ATOM 2106   O OE2 . GLU A 1 291 ? -33.670  66.700  -24.357 1.00 99.99  ? 295 GLU C OE2 1  
ATOM 2107   N N   . LEU A 1 292 ? -32.750  61.460  -27.360 1.00 30.00  ? 296 LEU C N   1  
ATOM 2108   C CA  . LEU A 1 292 ? -32.323  60.069  -27.168 1.00 30.00  ? 296 LEU C CA  1  
ATOM 2109   C C   . LEU A 1 292 ? -31.010  59.635  -27.827 1.00 30.00  ? 296 LEU C C   1  
ATOM 2110   O O   . LEU A 1 292 ? -30.395  58.641  -27.411 1.00 30.00  ? 296 LEU C O   1  
ATOM 2111   C CB  . LEU A 1 292 ? -33.381  59.121  -27.725 1.00 99.99  ? 296 LEU C CB  1  
ATOM 2112   C CG  . LEU A 1 292 ? -34.321  58.689  -26.604 1.00 99.99  ? 296 LEU C CG  1  
ATOM 2113   C CD1 . LEU A 1 292 ? -35.160  57.506  -27.073 1.00 99.99  ? 296 LEU C CD1 1  
ATOM 2114   C CD2 . LEU A 1 292 ? -33.502  58.283  -25.383 1.00 99.99  ? 296 LEU C CD2 1  
ATOM 2115   N N   . ASN A 1 293 ? -30.581  60.366  -28.852 1.00 30.00  ? 297 ASN C N   1  
ATOM 2116   C CA  . ASN A 1 293 ? -29.346  60.028  -29.545 1.00 30.00  ? 297 ASN C CA  1  
ATOM 2117   C C   . ASN A 1 293 ? -28.190  59.736  -28.597 1.00 30.00  ? 297 ASN C C   1  
ATOM 2118   O O   . ASN A 1 293 ? -27.478  58.738  -28.759 1.00 30.00  ? 297 ASN C O   1  
ATOM 2119   C CB  . ASN A 1 293 ? -28.921  61.185  -30.441 1.00 99.99  ? 297 ASN C CB  1  
ATOM 2120   C CG  . ASN A 1 293 ? -28.638  62.438  -29.625 1.00 99.99  ? 297 ASN C CG  1  
ATOM 2121   O OD1 . ASN A 1 293 ? -28.060  63.397  -30.132 1.00 99.99  ? 297 ASN C OD1 1  
ATOM 2122   N ND2 . ASN A 1 293 ? -29.050  62.427  -28.355 1.00 99.99  ? 297 ASN C ND2 1  
ATOM 2123   N N   . ASP A 1 294 ? -28.001  60.591  -27.598 1.00 30.00  ? 298 ASP C N   1  
ATOM 2124   C CA  . ASP A 1 294 ? -26.917  60.393  -26.646 1.00 30.00  ? 298 ASP C CA  1  
ATOM 2125   C C   . ASP A 1 294 ? -27.196  59.307  -25.611 1.00 30.00  ? 298 ASP C C   1  
ATOM 2126   O O   . ASP A 1 294 ? -26.272  58.784  -24.990 1.00 30.00  ? 298 ASP C O   1  
ATOM 2127   C CB  . ASP A 1 294 ? -26.658  61.685  -25.880 1.00 99.99  ? 298 ASP C CB  1  
ATOM 2128   C CG  . ASP A 1 294 ? -27.895  62.055  -25.067 1.00 99.99  ? 298 ASP C CG  1  
ATOM 2129   O OD1 . ASP A 1 294 ? -28.833  62.636  -25.678 1.00 99.99  ? 298 ASP C OD1 1  
ATOM 2130   O OD2 . ASP A 1 294 ? -27.899  61.751  -23.844 1.00 99.99  ? 298 ASP C OD2 1  
ATOM 2131   N N   . VAL A 1 295 ? -28.468  58.963  -25.431 1.00 30.00  ? 299 VAL C N   1  
ATOM 2132   C CA  . VAL A 1 295 ? -28.837  57.924  -24.474 1.00 30.00  ? 299 VAL C CA  1  
ATOM 2133   C C   . VAL A 1 295 ? -28.499  56.555  -25.036 1.00 30.00  ? 299 VAL C C   1  
ATOM 2134   O O   . VAL A 1 295 ? -28.134  55.631  -24.303 1.00 30.00  ? 299 VAL C O   1  
ATOM 2135   C CB  . VAL A 1 295 ? -30.336  57.988  -24.192 1.00 99.99  ? 299 VAL C CB  1  
ATOM 2136   C CG1 . VAL A 1 295 ? -30.685  59.355  -23.612 1.00 99.99  ? 299 VAL C CG1 1  
ATOM 2137   C CG2 . VAL A 1 295 ? -31.107  57.775  -25.491 1.00 99.99  ? 299 VAL C CG2 1  
ATOM 2138   N N   . MET A 1 296 ? -28.621  56.437  -26.351 1.00 30.00  ? 300 MET C N   1  
ATOM 2139   C CA  . MET A 1 296 ? -28.337  55.190  -27.037 1.00 30.00  ? 300 MET C CA  1  
ATOM 2140   C C   . MET A 1 296 ? -26.928  55.183  -27.630 1.00 30.00  ? 300 MET C C   1  
ATOM 2141   O O   . MET A 1 296 ? -26.373  54.116  -27.928 1.00 30.00  ? 300 MET C O   1  
ATOM 2142   C CB  . MET A 1 296 ? -29.333  54.986  -28.174 1.00 99.99  ? 300 MET C CB  1  
ATOM 2143   C CG  . MET A 1 296 ? -30.749  54.939  -27.610 1.00 99.99  ? 300 MET C CG  1  
ATOM 2144   S SD  . MET A 1 296 ? -31.836  54.027  -28.736 1.00 99.99  ? 300 MET C SD  1  
ATOM 2145   C CE  . MET A 1 296 ? -31.727  55.070  -30.176 1.00 99.99  ? 300 MET C CE  1  
ATOM 2146   N N   . LEU A 1 297 ? -26.350  56.372  -27.793 1.00 30.00  ? 301 LEU C N   1  
ATOM 2147   C CA  . LEU A 1 297 ? -25.006  56.518  -28.347 1.00 30.00  ? 301 LEU C CA  1  
ATOM 2148   C C   . LEU A 1 297 ? -25.029  56.215  -29.835 1.00 30.00  ? 301 LEU C C   1  
ATOM 2149   O O   . LEU A 1 297 ? -24.093  55.631  -30.382 1.00 30.00  ? 301 LEU C O   1  
ATOM 2150   C CB  . LEU A 1 297 ? -24.053  55.551  -27.652 1.00 99.99  ? 301 LEU C CB  1  
ATOM 2151   C CG  . LEU A 1 297 ? -23.350  56.265  -26.504 1.00 99.99  ? 301 LEU C CG  1  
ATOM 2152   C CD1 . LEU A 1 297 ? -22.174  55.420  -26.024 1.00 99.99  ? 301 LEU C CD1 1  
ATOM 2153   C CD2 . LEU A 1 297 ? -22.843  57.622  -26.981 1.00 99.99  ? 301 LEU C CD2 1  
ATOM 2154   N N   . VAL A 1 298 ? -26.101  56.628  -30.500 1.00 30.00  ? 302 VAL C N   1  
ATOM 2155   C CA  . VAL A 1 298 ? -26.213  56.375  -31.921 1.00 30.00  ? 302 VAL C CA  1  
ATOM 2156   C C   . VAL A 1 298 ? -26.134  57.608  -32.782 1.00 30.00  ? 302 VAL C C   1  
ATOM 2157   O O   . VAL A 1 298 ? -26.588  58.681  -32.401 1.00 30.00  ? 302 VAL C O   1  
ATOM 2158   C CB  . VAL A 1 298 ? -27.551  55.711  -32.226 1.00 99.99  ? 302 VAL C CB  1  
ATOM 2159   C CG1 . VAL A 1 298 ? -27.649  54.390  -31.469 1.00 99.99  ? 302 VAL C CG1 1  
ATOM 2160   C CG2 . VAL A 1 298 ? -28.686  56.632  -31.787 1.00 99.99  ? 302 VAL C CG2 1  
ATOM 2161   N N   . THR A 1 299 ? -25.537  57.437  -33.952 1.00 30.00  ? 303 THR C N   1  
ATOM 2162   C CA  . THR A 1 299 ? -25.411  58.509  -34.920 1.00 30.00  ? 303 THR C CA  1  
ATOM 2163   C C   . THR A 1 299 ? -26.627  58.230  -35.798 1.00 30.00  ? 303 THR C C   1  
ATOM 2164   O O   . THR A 1 299 ? -26.779  57.130  -36.326 1.00 30.00  ? 303 THR C O   1  
ATOM 2165   C CB  . THR A 1 299 ? -24.080  58.389  -35.655 1.00 99.99  ? 303 THR C CB  1  
ATOM 2166   O OG1 . THR A 1 299 ? -24.098  57.221  -36.482 1.00 99.99  ? 303 THR C OG1 1  
ATOM 2167   C CG2 . THR A 1 299 ? -22.947  58.274  -34.642 1.00 99.99  ? 303 THR C CG2 1  
ATOM 2168   N N   . PRO A 1 300 ? -27.523  59.217  -35.949 1.00 30.00  ? 304 PRO C N   1  
ATOM 2169   C CA  . PRO A 1 300 ? -28.727  59.028  -36.773 1.00 30.00  ? 304 PRO C CA  1  
ATOM 2170   C C   . PRO A 1 300 ? -28.539  58.656  -38.245 1.00 30.00  ? 304 PRO C C   1  
ATOM 2171   O O   . PRO A 1 300 ? -29.029  59.357  -39.133 1.00 30.00  ? 304 PRO C O   1  
ATOM 2172   C CB  . PRO A 1 300 ? -29.289  60.398  -36.650 1.00 99.99  ? 304 PRO C CB  1  
ATOM 2173   C CG  . PRO A 1 300 ? -28.358  61.154  -35.733 1.00 99.99  ? 304 PRO C CG  1  
ATOM 2174   C CD  . PRO A 1 300 ? -27.381  60.451  -35.302 1.00 99.99  ? 304 PRO C CD  1  
ATOM 2175   N N   . ASP A 1 301 ? -27.838  57.548  -38.486 1.00 30.00  ? 305 ASP C N   1  
ATOM 2176   C CA  . ASP A 1 301 ? -27.575  57.031  -39.836 1.00 30.00  ? 305 ASP C CA  1  
ATOM 2177   C C   . ASP A 1 301 ? -27.717  55.513  -39.756 1.00 30.00  ? 305 ASP C C   1  
ATOM 2178   O O   . ASP A 1 301 ? -26.930  54.857  -39.071 1.00 30.00  ? 305 ASP C O   1  
ATOM 2179   C CB  . ASP A 1 301 ? -26.169  57.421  -40.277 1.00 99.99  ? 305 ASP C CB  1  
ATOM 2180   C CG  . ASP A 1 301 ? -25.989  57.104  -41.759 1.00 99.99  ? 305 ASP C CG  1  
ATOM 2181   O OD1 . ASP A 1 301 ? -25.747  55.905  -42.066 1.00 99.99  ? 305 ASP C OD1 1  
ATOM 2182   O OD2 . ASP A 1 301 ? -26.103  58.061  -42.572 1.00 99.99  ? 305 ASP C OD2 1  
ATOM 2183   N N   . SER A 1 302 ? -28.715  54.955  -40.436 1.00 30.00  ? 306 SER C N   1  
ATOM 2184   C CA  . SER A 1 302 ? -28.891  53.506  -40.391 1.00 30.00  ? 306 SER C CA  1  
ATOM 2185   C C   . SER A 1 302 ? -27.862  52.800  -41.285 1.00 30.00  ? 306 SER C C   1  
ATOM 2186   O O   . SER A 1 302 ? -27.321  51.750  -40.912 1.00 30.00  ? 306 SER C O   1  
ATOM 2187   C CB  . SER A 1 302 ? -30.291  53.141  -40.877 1.00 99.99  ? 306 SER C CB  1  
ATOM 2188   O OG  . SER A 1 302 ? -30.400  53.429  -42.272 1.00 99.99  ? 306 SER C OG  1  
ATOM 2189   N N   . GLY A 1 303 ? -27.587  53.399  -42.449 1.00 30.00  ? 307 GLY C N   1  
ATOM 2190   C CA  . GLY A 1 303 ? -26.631  52.833  -43.393 1.00 30.00  ? 307 GLY C CA  1  
ATOM 2191   C C   . GLY A 1 303 ? -25.206  52.829  -42.883 1.00 30.00  ? 307 GLY C C   1  
ATOM 2192   O O   . GLY A 1 303 ? -24.244  52.648  -43.630 1.00 30.00  ? 307 GLY C O   1  
ATOM 2193   N N   . LEU A 1 304 ? -25.099  53.020  -41.579 1.00 30.00  ? 308 LEU C N   1  
ATOM 2194   C CA  . LEU A 1 304 ? -23.835  53.069  -40.875 1.00 30.00  ? 308 LEU C CA  1  
ATOM 2195   C C   . LEU A 1 304 ? -23.587  51.772  -40.130 1.00 30.00  ? 308 LEU C C   1  
ATOM 2196   O O   . LEU A 1 304 ? -22.441  51.393  -39.891 1.00 30.00  ? 308 LEU C O   1  
ATOM 2197   C CB  . LEU A 1 304 ? -23.845  54.216  -39.871 1.00 99.99  ? 308 LEU C CB  1  
ATOM 2198   C CG  . LEU A 1 304 ? -23.216  55.452  -40.506 1.00 99.99  ? 308 LEU C CG  1  
ATOM 2199   C CD1 . LEU A 1 304 ? -22.926  56.486  -39.420 1.00 99.99  ? 308 LEU C CD1 1  
ATOM 2200   C CD2 . LEU A 1 304 ? -21.919  55.063  -41.201 1.00 99.99  ? 308 LEU C CD2 1  
ATOM 2201   N N   . TYR A 1 305 ? -24.669  51.093  -39.765 1.00 30.00  ? 309 TYR C N   1  
ATOM 2202   C CA  . TYR A 1 305 ? -24.561  49.848  -39.026 1.00 30.00  ? 309 TYR C CA  1  
ATOM 2203   C C   . TYR A 1 305 ? -24.778  48.632  -39.889 1.00 30.00  ? 309 TYR C C   1  
ATOM 2204   O O   . TYR A 1 305 ? -25.842  48.450  -40.471 1.00 30.00  ? 309 TYR C O   1  
ATOM 2205   C CB  . TYR A 1 305 ? -25.606  49.812  -37.914 1.00 99.99  ? 309 TYR C CB  1  
ATOM 2206   C CG  . TYR A 1 305 ? -25.326  50.917  -36.924 1.00 99.99  ? 309 TYR C CG  1  
ATOM 2207   C CD1 . TYR A 1 305 ? -25.880  52.189  -37.116 1.00 99.99  ? 309 TYR C CD1 1  
ATOM 2208   C CD2 . TYR A 1 305 ? -24.510  50.669  -35.813 1.00 99.99  ? 309 TYR C CD2 1  
ATOM 2209   C CE1 . TYR A 1 305 ? -25.618  53.212  -36.198 1.00 99.99  ? 309 TYR C CE1 1  
ATOM 2210   C CE2 . TYR A 1 305 ? -24.249  51.692  -34.895 1.00 99.99  ? 309 TYR C CE2 1  
ATOM 2211   C CZ  . TYR A 1 305 ? -24.805  52.963  -35.085 1.00 99.99  ? 309 TYR C CZ  1  
ATOM 2212   O OH  . TYR A 1 305 ? -24.550  53.959  -34.193 1.00 99.99  ? 309 TYR C OH  1  
ATOM 2213   N N   . SER A 1 306 ? -23.741  47.802  -39.962 1.00 30.00  ? 310 SER C N   1  
ATOM 2214   C CA  . SER A 1 306 ? -23.765  46.580  -40.758 1.00 30.00  ? 310 SER C CA  1  
ATOM 2215   C C   . SER A 1 306 ? -25.011  45.750  -40.487 1.00 30.00  ? 310 SER C C   1  
ATOM 2216   O O   . SER A 1 306 ? -25.767  45.458  -41.411 1.00 30.00  ? 310 SER C O   1  
ATOM 2217   C CB  . SER A 1 306 ? -22.546  45.726  -40.429 1.00 99.99  ? 310 SER C CB  1  
ATOM 2218   O OG  . SER A 1 306 ? -22.657  45.230  -39.093 1.00 99.99  ? 310 SER C OG  1  
ATOM 2219   N N   . PHE A 1 307 ? -25.228  45.379  -39.229 1.00 30.00  ? 311 PHE C N   1  
ATOM 2220   C CA  . PHE A 1 307 ? -26.399  44.583  -38.847 1.00 30.00  ? 311 PHE C CA  1  
ATOM 2221   C C   . PHE A 1 307 ? -27.757  45.048  -39.370 1.00 30.00  ? 311 PHE C C   1  
ATOM 2222   O O   . PHE A 1 307 ? -28.730  44.308  -39.228 1.00 30.00  ? 311 PHE C O   1  
ATOM 2223   C CB  . PHE A 1 307 ? -26.536  44.557  -37.328 1.00 99.99  ? 311 PHE C CB  1  
ATOM 2224   C CG  . PHE A 1 307 ? -27.752  45.354  -36.920 1.00 99.99  ? 311 PHE C CG  1  
ATOM 2225   C CD1 . PHE A 1 307 ? -28.217  46.390  -37.739 1.00 99.99  ? 311 PHE C CD1 1  
ATOM 2226   C CD2 . PHE A 1 307 ? -28.413  45.058  -35.724 1.00 99.99  ? 311 PHE C CD2 1  
ATOM 2227   C CE1 . PHE A 1 307 ? -29.344  47.129  -37.362 1.00 99.99  ? 311 PHE C CE1 1  
ATOM 2228   C CE2 . PHE A 1 307 ? -29.540  45.794  -35.345 1.00 99.99  ? 311 PHE C CE2 1  
ATOM 2229   C CZ  . PHE A 1 307 ? -30.005  46.832  -36.164 1.00 99.99  ? 311 PHE C CZ  1  
ATOM 2230   N N   . ILE A 1 308 ? -27.850  46.240  -39.955 1.00 30.00  ? 312 ILE C N   1  
ATOM 2231   C CA  . ILE A 1 308 ? -29.131  46.727  -40.461 1.00 30.00  ? 312 ILE C CA  1  
ATOM 2232   C C   . ILE A 1 308 ? -29.090  47.449  -41.805 1.00 30.00  ? 312 ILE C C   1  
ATOM 2233   O O   . ILE A 1 308 ? -30.058  48.113  -42.196 1.00 30.00  ? 312 ILE C O   1  
ATOM 2234   C CB  . ILE A 1 308 ? -29.735  47.718  -39.472 1.00 99.99  ? 312 ILE C CB  1  
ATOM 2235   C CG1 . ILE A 1 308 ? -30.952  48.387  -40.103 1.00 99.99  ? 312 ILE C CG1 1  
ATOM 2236   C CG2 . ILE A 1 308 ? -28.697  48.780  -39.118 1.00 99.99  ? 312 ILE C CG2 1  
ATOM 2237   C CD1 . ILE A 1 308 ? -31.788  47.341  -40.833 1.00 99.99  ? 312 ILE C CD1 1  
ATOM 2238   N N   . ASN A 1 309 ? -27.976  47.347  -42.528 1.00 30.00  ? 313 ASN C N   1  
ATOM 2239   C CA  . ASN A 1 309 ? -27.923  48.010  -43.827 1.00 30.00  ? 313 ASN C CA  1  
ATOM 2240   C C   . ASN A 1 309 ? -27.594  47.017  -44.939 1.00 30.00  ? 313 ASN C C   1  
ATOM 2241   O O   . ASN A 1 309 ? -27.305  47.425  -46.066 1.00 30.00  ? 313 ASN C O   1  
ATOM 2242   C CB  . ASN A 1 309 ? -26.847  49.091  -43.812 1.00 99.99  ? 313 ASN C CB  1  
ATOM 2243   C CG  . ASN A 1 309 ? -25.472  48.495  -43.562 1.00 99.99  ? 313 ASN C CG  1  
ATOM 2244   O OD1 . ASN A 1 309 ? -24.458  49.166  -43.752 1.00 99.99  ? 313 ASN C OD1 1  
ATOM 2245   N ND2 . ASN A 1 309 ? -25.437  47.230  -43.140 1.00 99.99  ? 313 ASN C ND2 1  
ATOM 2246   N N   . GLN A 1 310 ? -27.653  45.719  -44.614 1.00 30.00  ? 314 GLN C N   1  
ATOM 2247   C CA  . GLN A 1 310 ? -27.388  44.629  -45.564 1.00 30.00  ? 314 GLN C CA  1  
ATOM 2248   C C   . GLN A 1 310 ? -28.334  44.755  -46.758 1.00 30.00  ? 314 GLN C C   1  
ATOM 2249   O O   . GLN A 1 310 ? -27.921  44.945  -47.905 1.00 30.00  ? 314 GLN C O   1  
ATOM 2250   C CB  . GLN A 1 310 ? -27.606  43.281  -44.885 1.00 99.99  ? 314 GLN C CB  1  
ATOM 2251   C CG  . GLN A 1 310 ? -29.028  43.212  -44.336 1.00 99.99  ? 314 GLN C CG  1  
ATOM 2252   C CD  . GLN A 1 310 ? -29.150  43.998  -43.035 1.00 99.99  ? 314 GLN C CD  1  
ATOM 2253   O OE1 . GLN A 1 310 ? -28.176  44.580  -42.565 1.00 99.99  ? 314 GLN C OE1 1  
ATOM 2254   N NE2 . GLN A 1 310 ? -30.354  44.011  -42.458 1.00 99.99  ? 314 GLN C NE2 1  
ATOM 2255   N N   . GLY A 1 311 ? -29.622  44.645  -46.478 1.00 30.00  ? 315 GLY C N   1  
ATOM 2256   C CA  . GLY A 1 311 ? -30.598  44.755  -47.536 1.00 30.00  ? 315 GLY C CA  1  
ATOM 2257   C C   . GLY A 1 311 ? -31.017  46.194  -47.760 1.00 30.00  ? 315 GLY C C   1  
ATOM 2258   O O   . GLY A 1 311 ? -30.261  47.009  -48.244 1.00 30.00  ? 315 GLY C O   1  
ATOM 2259   N N   . CYS A 1 312 ? -32.254  46.491  -47.389 1.00 30.00  ? 316 CYS C N   1  
ATOM 2260   C CA  . CYS A 1 312 ? -32.833  47.818  -47.540 1.00 30.00  ? 316 CYS C CA  1  
ATOM 2261   C C   . CYS A 1 312 ? -32.618  48.774  -46.347 1.00 30.00  ? 316 CYS C C   1  
ATOM 2262   O O   . CYS A 1 312 ? -32.253  48.360  -45.237 1.00 30.00  ? 316 CYS C O   1  
ATOM 2263   C CB  . CYS A 1 312 ? -34.343  47.709  -47.730 1.00 99.99  ? 316 CYS C CB  1  
ATOM 2264   S SG  . CYS A 1 312 ? -35.221  49.258  -48.046 1.00 99.99  ? 316 CYS C SG  1  
ATOM 2265   N N   . LEU A 1 313 ? -32.864  50.052  -46.596 1.00 30.00  ? 317 LEU C N   1  
ATOM 2266   C CA  . LEU A 1 313 ? -32.706  51.075  -45.581 1.00 30.00  ? 317 LEU C CA  1  
ATOM 2267   C C   . LEU A 1 313 ? -34.020  51.804  -45.333 1.00 30.00  ? 317 LEU C C   1  
ATOM 2268   O O   . LEU A 1 313 ? -34.511  51.836  -44.206 1.00 30.00  ? 317 LEU C O   1  
ATOM 2269   C CB  . LEU A 1 313 ? -31.665  52.095  -46.031 1.00 99.99  ? 317 LEU C CB  1  
ATOM 2270   C CG  . LEU A 1 313 ? -30.302  51.719  -45.459 1.00 99.99  ? 317 LEU C CG  1  
ATOM 2271   C CD1 . LEU A 1 313 ? -29.339  52.891  -45.625 1.00 99.99  ? 317 LEU C CD1 1  
ATOM 2272   C CD2 . LEU A 1 313 ? -30.447  51.380  -43.978 1.00 99.99  ? 317 LEU C CD2 1  
ATOM 2273   N N   . THR A 1 314 ? -34.576  52.382  -46.389 1.00 30.00  ? 318 THR C N   1  
ATOM 2274   C CA  . THR A 1 314 ? -35.847  53.106  -46.298 1.00 30.00  ? 318 THR C CA  1  
ATOM 2275   C C   . THR A 1 314 ? -37.022  52.176  -46.682 1.00 30.00  ? 318 THR C C   1  
ATOM 2276   O O   . THR A 1 314 ? -36.805  51.021  -47.044 1.00 30.00  ? 318 THR C O   1  
ATOM 2277   C CB  . THR A 1 314 ? -35.832  54.302  -47.248 1.00 99.99  ? 318 THR C CB  1  
ATOM 2278   O OG1 . THR A 1 314 ? -35.832  53.836  -48.599 1.00 99.99  ? 318 THR C OG1 1  
ATOM 2279   C CG2 . THR A 1 314 ? -34.579  55.132  -46.996 1.00 99.99  ? 318 THR C CG2 1  
ATOM 2280   N N   . VAL A 1 315 ? -38.256  52.662  -46.600 1.00 30.00  ? 319 VAL C N   1  
ATOM 2281   C CA  . VAL A 1 315 ? -39.410  51.822  -46.950 1.00 30.00  ? 319 VAL C CA  1  
ATOM 2282   C C   . VAL A 1 315 ? -40.614  52.589  -47.487 1.00 30.00  ? 319 VAL C C   1  
ATOM 2283   O O   . VAL A 1 315 ? -41.421  53.101  -46.723 1.00 30.00  ? 319 VAL C O   1  
ATOM 2284   C CB  . VAL A 1 315 ? -39.890  51.058  -45.720 1.00 99.99  ? 319 VAL C CB  1  
ATOM 2285   C CG1 . VAL A 1 315 ? -38.765  50.171  -45.201 1.00 99.99  ? 319 VAL C CG1 1  
ATOM 2286   C CG2 . VAL A 1 315 ? -40.301  52.047  -44.637 1.00 99.99  ? 319 VAL C CG2 1  
ATOM 2287   N N   . ASP A 1 316 ? -40.738  52.657  -48.806 1.00 30.00  ? 320 ASP C N   1  
ATOM 2288   C CA  . ASP A 1 316 ? -41.853  53.359  -49.425 1.00 30.00  ? 320 ASP C CA  1  
ATOM 2289   C C   . ASP A 1 316 ? -43.096  53.249  -48.537 1.00 30.00  ? 320 ASP C C   1  
ATOM 2290   O O   . ASP A 1 316 ? -43.612  52.160  -48.309 1.00 30.00  ? 320 ASP C O   1  
ATOM 2291   C CB  . ASP A 1 316 ? -42.159  52.745  -50.786 1.00 99.99  ? 320 ASP C CB  1  
ATOM 2292   C CG  . ASP A 1 316 ? -42.231  51.227  -50.658 1.00 99.99  ? 320 ASP C CG  1  
ATOM 2293   O OD1 . ASP A 1 316 ? -41.225  50.643  -50.175 1.00 99.99  ? 320 ASP C OD1 1  
ATOM 2294   O OD2 . ASP A 1 316 ? -43.290  50.664  -51.044 1.00 99.99  ? 320 ASP C OD2 1  
ATOM 2295   N N   . ASN A 1 317 ? -43.540  54.386  -48.017 1.00 30.00  ? 321 ASN C N   1  
ATOM 2296   C CA  . ASN A 1 317 ? -44.722  54.454  -47.161 1.00 30.00  ? 321 ASN C CA  1  
ATOM 2297   C C   . ASN A 1 317 ? -44.627  54.075  -45.685 1.00 30.00  ? 321 ASN C C   1  
ATOM 2298   O O   . ASN A 1 317 ? -45.597  53.615  -45.090 1.00 30.00  ? 321 ASN C O   1  
ATOM 2299   C CB  . ASN A 1 317 ? -45.806  53.526  -47.699 1.00 99.99  ? 321 ASN C CB  1  
ATOM 2300   C CG  . ASN A 1 317 ? -47.190  53.999  -47.283 1.00 99.99  ? 321 ASN C CG  1  
ATOM 2301   O OD1 . ASN A 1 317 ? -48.126  53.206  -47.206 1.00 99.99  ? 321 ASN C OD1 1  
ATOM 2302   N ND2 . ASN A 1 317 ? -47.322  55.300  -47.013 1.00 99.99  ? 321 ASN C ND2 1  
ATOM 2303   N N   . ILE A 1 318 ? -43.455  54.281  -45.106 1.00 30.00  ? 322 ILE C N   1  
ATOM 2304   C CA  . ILE A 1 318 ? -43.217  54.006  -43.697 1.00 30.00  ? 322 ILE C CA  1  
ATOM 2305   C C   . ILE A 1 318 ? -42.302  55.141  -43.286 1.00 30.00  ? 322 ILE C C   1  
ATOM 2306   O O   . ILE A 1 318 ? -41.164  55.210  -43.744 1.00 30.00  ? 322 ILE C O   1  
ATOM 2307   C CB  . ILE A 1 318 ? -42.562  52.638  -43.540 1.00 99.99  ? 322 ILE C CB  1  
ATOM 2308   C CG1 . ILE A 1 318 ? -43.335  51.608  -44.354 1.00 99.99  ? 322 ILE C CG1 1  
ATOM 2309   C CG2 . ILE A 1 318 ? -42.573  52.239  -42.068 1.00 99.99  ? 322 ILE C CG2 1  
ATOM 2310   C CD1 . ILE A 1 318 ? -44.678  51.333  -43.684 1.00 99.99  ? 322 ILE C CD1 1  
ATOM 2311   N N   . ASP A 1 319 ? -42.810  56.036  -42.445 1.00 30.00  ? 323 ASP C N   1  
ATOM 2312   C CA  . ASP A 1 319 ? -42.027  57.167  -41.970 1.00 30.00  ? 323 ASP C CA  1  
ATOM 2313   C C   . ASP A 1 319 ? -41.423  56.740  -40.633 1.00 30.00  ? 323 ASP C C   1  
ATOM 2314   O O   . ASP A 1 319 ? -42.108  56.765  -39.611 1.00 30.00  ? 323 ASP C O   1  
ATOM 2315   C CB  . ASP A 1 319 ? -42.928  58.387  -41.794 1.00 99.99  ? 323 ASP C CB  1  
ATOM 2316   C CG  . ASP A 1 319 ? -42.073  59.623  -41.539 1.00 99.99  ? 323 ASP C CG  1  
ATOM 2317   O OD1 . ASP A 1 319 ? -41.636  59.787  -40.368 1.00 99.99  ? 323 ASP C OD1 1  
ATOM 2318   O OD2 . ASP A 1 319 ? -41.862  60.391  -42.516 1.00 99.99  ? 323 ASP C OD2 1  
ATOM 2319   N N   . ASP A 1 320 ? -40.150  56.350  -40.646 1.00 30.00  ? 324 ASP C N   1  
ATOM 2320   C CA  . ASP A 1 320 ? -39.475  55.912  -39.431 1.00 30.00  ? 324 ASP C CA  1  
ATOM 2321   C C   . ASP A 1 320 ? -39.433  56.970  -38.316 1.00 30.00  ? 324 ASP C C   1  
ATOM 2322   O O   . ASP A 1 320 ? -39.375  56.637  -37.122 1.00 30.00  ? 324 ASP C O   1  
ATOM 2323   C CB  . ASP A 1 320 ? -38.027  55.546  -39.748 1.00 99.99  ? 324 ASP C CB  1  
ATOM 2324   C CG  . ASP A 1 320 ? -37.995  54.291  -40.616 1.00 99.99  ? 324 ASP C CG  1  
ATOM 2325   O OD1 . ASP A 1 320 ? -38.296  53.199  -40.062 1.00 99.99  ? 324 ASP C OD1 1  
ATOM 2326   O OD2 . ASP A 1 320 ? -37.677  54.435  -41.827 1.00 99.99  ? 324 ASP C OD2 1  
ATOM 2327   N N   . VAL A 1 321 ? -39.464  58.240  -38.717 1.00 30.00  ? 325 VAL C N   1  
ATOM 2328   C CA  . VAL A 1 321 ? -39.448  59.378  -37.802 1.00 30.00  ? 325 VAL C CA  1  
ATOM 2329   C C   . VAL A 1 321 ? -40.714  59.307  -36.938 1.00 30.00  ? 325 VAL C C   1  
ATOM 2330   O O   . VAL A 1 321 ? -40.665  59.129  -35.711 1.00 30.00  ? 325 VAL C O   1  
ATOM 2331   C CB  . VAL A 1 321 ? -39.426  60.681  -38.593 1.00 99.99  ? 325 VAL C CB  1  
ATOM 2332   C CG1 . VAL A 1 321 ? -39.460  61.864  -37.629 1.00 99.99  ? 325 VAL C CG1 1  
ATOM 2333   C CG2 . VAL A 1 321 ? -38.155  60.747  -39.433 1.00 99.99  ? 325 VAL C CG2 1  
ATOM 2334   N N   . GLU A 1 322 ? -41.854  59.447  -37.610 1.00 30.00  ? 326 GLU C N   1  
ATOM 2335   C CA  . GLU A 1 322 ? -43.160  59.401  -36.966 1.00 30.00  ? 326 GLU C CA  1  
ATOM 2336   C C   . GLU A 1 322 ? -43.493  58.066  -36.312 1.00 30.00  ? 326 GLU C C   1  
ATOM 2337   O O   . GLU A 1 322 ? -44.199  58.013  -35.307 1.00 30.00  ? 326 GLU C O   1  
ATOM 2338   C CB  . GLU A 1 322 ? -44.256  59.676  -37.992 1.00 99.99  ? 326 GLU C CB  1  
ATOM 2339   C CG  . GLU A 1 322 ? -44.115  61.084  -38.514 1.00 99.99  ? 326 GLU C CG  1  
ATOM 2340   C CD  . GLU A 1 322 ? -44.538  62.073  -37.428 1.00 99.99  ? 326 GLU C CD  1  
ATOM 2341   O OE1 . GLU A 1 322 ? -43.644  62.481  -36.640 1.00 99.99  ? 326 GLU C OE1 1  
ATOM 2342   O OE2 . GLU A 1 322 ? -45.752  62.410  -37.396 1.00 99.99  ? 326 GLU C OE2 1  
ATOM 2343   N N   . GLU A 1 323 ? -43.006  56.978  -36.879 1.00 30.00  ? 327 GLU C N   1  
ATOM 2344   C CA  . GLU A 1 323 ? -43.311  55.696  -36.283 1.00 30.00  ? 327 GLU C CA  1  
ATOM 2345   C C   . GLU A 1 323 ? -42.554  55.620  -34.969 1.00 30.00  ? 327 GLU C C   1  
ATOM 2346   O O   . GLU A 1 323 ? -43.061  55.065  -33.991 1.00 30.00  ? 327 GLU C O   1  
ATOM 2347   C CB  . GLU A 1 323 ? -42.869  54.573  -37.218 1.00 99.99  ? 327 GLU C CB  1  
ATOM 2348   C CG  . GLU A 1 323 ? -43.675  53.329  -36.926 1.00 99.99  ? 327 GLU C CG  1  
ATOM 2349   C CD  . GLU A 1 323 ? -43.024  52.558  -35.781 1.00 99.99  ? 327 GLU C CD  1  
ATOM 2350   O OE1 . GLU A 1 323 ? -43.397  52.840  -34.613 1.00 99.99  ? 327 GLU C OE1 1  
ATOM 2351   O OE2 . GLU A 1 323 ? -42.157  51.692  -36.086 1.00 99.99  ? 327 GLU C OE2 1  
ATOM 2352   N N   . PHE A 1 324 ? -41.344  56.182  -34.937 1.00 30.00  ? 328 PHE C N   1  
ATOM 2353   C CA  . PHE A 1 324 ? -40.554  56.160  -33.702 1.00 30.00  ? 328 PHE C CA  1  
ATOM 2354   C C   . PHE A 1 324 ? -41.311  56.925  -32.613 1.00 30.00  ? 328 PHE C C   1  
ATOM 2355   O O   . PHE A 1 324 ? -41.487  56.419  -31.488 1.00 30.00  ? 328 PHE C O   1  
ATOM 2356   C CB  . PHE A 1 324 ? -39.199  56.814  -33.941 1.00 99.99  ? 328 PHE C CB  1  
ATOM 2357   C CG  . PHE A 1 324 ? -38.394  56.784  -32.667 1.00 99.99  ? 328 PHE C CG  1  
ATOM 2358   C CD1 . PHE A 1 324 ? -37.667  55.635  -32.324 1.00 99.99  ? 328 PHE C CD1 1  
ATOM 2359   C CD2 . PHE A 1 324 ? -38.368  57.903  -31.826 1.00 99.99  ? 328 PHE C CD2 1  
ATOM 2360   C CE1 . PHE A 1 324 ? -36.920  55.605  -31.141 1.00 99.99  ? 328 PHE C CE1 1  
ATOM 2361   C CE2 . PHE A 1 324 ? -37.620  57.874  -30.643 1.00 99.99  ? 328 PHE C CE2 1  
ATOM 2362   C CZ  . PHE A 1 324 ? -36.895  56.724  -30.301 1.00 99.99  ? 328 PHE C CZ  1  
ATOM 2363   N N   . LYS A 1 325 ? -41.762  58.131  -32.957 1.00 30.00  ? 329 LYS C N   1  
ATOM 2364   C CA  . LYS A 1 325 ? -42.508  58.972  -32.034 1.00 30.00  ? 329 LYS C CA  1  
ATOM 2365   C C   . LYS A 1 325 ? -43.701  58.195  -31.486 1.00 30.00  ? 329 LYS C C   1  
ATOM 2366   O O   . LYS A 1 325 ? -43.839  58.030  -30.271 1.00 30.00  ? 329 LYS C O   1  
ATOM 2367   C CB  . LYS A 1 325 ? -43.009  60.220  -32.756 1.00 99.99  ? 329 LYS C CB  1  
ATOM 2368   C CG  . LYS A 1 325 ? -43.703  61.141  -31.759 1.00 99.99  ? 329 LYS C CG  1  
ATOM 2369   C CD  . LYS A 1 325 ? -43.804  62.544  -32.349 1.00 99.99  ? 329 LYS C CD  1  
ATOM 2370   C CE  . LYS A 1 325 ? -44.807  63.363  -31.542 1.00 99.99  ? 329 LYS C CE  1  
ATOM 2371   N NZ  . LYS A 1 325 ? -44.094  64.125  -30.505 1.00 99.99  ? 329 LYS C NZ  1  
ATOM 2372   N N   . LEU A 1 326 ? -44.558  57.713  -32.380 1.00 30.00  ? 330 LEU C N   1  
ATOM 2373   C CA  . LEU A 1 326 ? -45.733  56.948  -31.967 1.00 30.00  ? 330 LEU C CA  1  
ATOM 2374   C C   . LEU A 1 326 ? -45.370  55.724  -31.124 1.00 30.00  ? 330 LEU C C   1  
ATOM 2375   O O   . LEU A 1 326 ? -46.137  55.325  -30.219 1.00 30.00  ? 330 LEU C O   1  
ATOM 2376   C CB  . LEU A 1 326 ? -46.491  56.457  -33.197 1.00 99.99  ? 330 LEU C CB  1  
ATOM 2377   C CG  . LEU A 1 326 ? -47.605  57.443  -33.536 1.00 99.99  ? 330 LEU C CG  1  
ATOM 2378   C CD1 . LEU A 1 326 ? -48.559  56.803  -34.541 1.00 99.99  ? 330 LEU C CD1 1  
ATOM 2379   C CD2 . LEU A 1 326 ? -48.369  57.804  -32.267 1.00 99.99  ? 330 LEU C CD2 1  
ATOM 2380   N N   . CYS A 1 327 ? -44.215  55.119  -31.412 1.00 30.00  ? 331 CYS C N   1  
ATOM 2381   C CA  . CYS A 1 327 ? -43.774  53.936  -30.675 1.00 30.00  ? 331 CYS C CA  1  
ATOM 2382   C C   . CYS A 1 327 ? -43.383  54.352  -29.271 1.00 30.00  ? 331 CYS C C   1  
ATOM 2383   O O   . CYS A 1 327 ? -43.608  53.632  -28.287 1.00 30.00  ? 331 CYS C O   1  
ATOM 2384   C CB  . CYS A 1 327 ? -42.575  53.305  -31.376 1.00 99.99  ? 331 CYS C CB  1  
ATOM 2385   S SG  . CYS A 1 327 ? -40.976  54.103  -31.090 1.00 99.99  ? 331 CYS C SG  1  
ATOM 2386   N N   . ASP A 1 328 ? -42.788  55.537  -29.186 1.00 30.00  ? 332 ASP C N   1  
ATOM 2387   C CA  . ASP A 1 328 ? -42.366  56.100  -27.916 1.00 30.00  ? 332 ASP C CA  1  
ATOM 2388   C C   . ASP A 1 328 ? -43.673  56.430  -27.156 1.00 30.00  ? 332 ASP C C   1  
ATOM 2389   O O   . ASP A 1 328 ? -43.874  56.033  -25.999 1.00 30.00  ? 332 ASP C O   1  
ATOM 2390   C CB  . ASP A 1 328 ? -41.533  57.354  -28.154 1.00 99.99  ? 332 ASP C CB  1  
ATOM 2391   C CG  . ASP A 1 328 ? -40.207  56.968  -28.804 1.00 99.99  ? 332 ASP C CG  1  
ATOM 2392   O OD1 . ASP A 1 328 ? -39.361  56.380  -28.079 1.00 99.99  ? 332 ASP C OD1 1  
ATOM 2393   O OD2 . ASP A 1 328 ? -40.050  57.264  -30.018 1.00 99.99  ? 332 ASP C OD2 1  
ATOM 2394   N N   . GLU A 1 329 ? -44.554  57.148  -27.844 1.00 30.00  ? 333 GLU C N   1  
ATOM 2395   C CA  . GLU A 1 329 ? -45.848  57.555  -27.313 1.00 30.00  ? 333 GLU C CA  1  
ATOM 2396   C C   . GLU A 1 329 ? -46.608  56.348  -26.752 1.00 30.00  ? 333 GLU C C   1  
ATOM 2397   O O   . GLU A 1 329 ? -47.270  56.448  -25.716 1.00 30.00  ? 333 GLU C O   1  
ATOM 2398   C CB  . GLU A 1 329 ? -46.685  58.188  -28.419 1.00 99.99  ? 333 GLU C CB  1  
ATOM 2399   C CG  . GLU A 1 329 ? -46.025  59.464  -28.883 1.00 99.99  ? 333 GLU C CG  1  
ATOM 2400   C CD  . GLU A 1 329 ? -46.181  60.539  -27.810 1.00 99.99  ? 333 GLU C CD  1  
ATOM 2401   O OE1 . GLU A 1 329 ? -45.278  60.616  -26.938 1.00 99.99  ? 333 GLU C OE1 1  
ATOM 2402   O OE2 . GLU A 1 329 ? -47.203  61.272  -27.872 1.00 99.99  ? 333 GLU C OE2 1  
ATOM 2403   N N   . ALA A 1 330 ? -46.508  55.211  -27.449 1.00 30.00  ? 334 ALA C N   1  
ATOM 2404   C CA  . ALA A 1 330 ? -47.196  53.979  -27.057 1.00 30.00  ? 334 ALA C CA  1  
ATOM 2405   C C   . ALA A 1 330 ? -46.623  53.285  -25.836 1.00 30.00  ? 334 ALA C C   1  
ATOM 2406   O O   . ALA A 1 330 ? -47.314  52.523  -25.154 1.00 30.00  ? 334 ALA C O   1  
ATOM 2407   C CB  . ALA A 1 330 ? -47.196  53.011  -28.234 1.00 30.00  ? 334 ALA C CB  1  
ATOM 2408   N N   . PHE A 1 331 ? -45.349  53.543  -25.563 1.00 30.00  ? 335 PHE C N   1  
ATOM 2409   C CA  . PHE A 1 331 ? -44.686  52.946  -24.409 1.00 30.00  ? 335 PHE C CA  1  
ATOM 2410   C C   . PHE A 1 331 ? -45.217  53.611  -23.160 1.00 30.00  ? 335 PHE C C   1  
ATOM 2411   O O   . PHE A 1 331 ? -45.333  52.986  -22.107 1.00 30.00  ? 335 PHE C O   1  
ATOM 2412   C CB  . PHE A 1 331 ? -43.178  53.159  -24.511 1.00 99.99  ? 335 PHE C CB  1  
ATOM 2413   C CG  . PHE A 1 331 ? -42.496  52.488  -23.342 1.00 99.99  ? 335 PHE C CG  1  
ATOM 2414   C CD1 . PHE A 1 331 ? -42.352  51.096  -23.320 1.00 99.99  ? 335 PHE C CD1 1  
ATOM 2415   C CD2 . PHE A 1 331 ? -42.008  53.260  -22.281 1.00 99.99  ? 335 PHE C CD2 1  
ATOM 2416   C CE1 . PHE A 1 331 ? -41.716  50.476  -22.238 1.00 99.99  ? 335 PHE C CE1 1  
ATOM 2417   C CE2 . PHE A 1 331 ? -41.372  52.639  -21.198 1.00 99.99  ? 335 PHE C CE2 1  
ATOM 2418   C CZ  . PHE A 1 331 ? -41.229  51.248  -21.176 1.00 99.99  ? 335 PHE C CZ  1  
ATOM 2419   N N   . ASP A 1 332 ? -45.531  54.895  -23.298 1.00 30.00  ? 336 ASP C N   1  
ATOM 2420   C CA  . ASP A 1 332 ? -46.069  55.688  -22.202 1.00 30.00  ? 336 ASP C CA  1  
ATOM 2421   C C   . ASP A 1 332 ? -47.461  55.158  -21.832 1.00 30.00  ? 336 ASP C C   1  
ATOM 2422   O O   . ASP A 1 332 ? -47.692  54.752  -20.687 1.00 30.00  ? 336 ASP C O   1  
ATOM 2423   C CB  . ASP A 1 332 ? -46.176  57.151  -22.624 1.00 99.99  ? 336 ASP C CB  1  
ATOM 2424   C CG  . ASP A 1 332 ? -44.777  57.734  -22.804 1.00 99.99  ? 336 ASP C CG  1  
ATOM 2425   O OD1 . ASP A 1 332 ? -44.101  57.944  -21.760 1.00 99.99  ? 336 ASP C OD1 1  
ATOM 2426   O OD2 . ASP A 1 332 ? -44.396  57.963  -23.982 1.00 99.99  ? 336 ASP C OD2 1  
ATOM 2427   N N   . ILE A 1 333 ? -48.369  55.158  -22.811 1.00 30.00  ? 337 ILE C N   1  
ATOM 2428   C CA  . ILE A 1 333 ? -49.747  54.675  -22.622 1.00 30.00  ? 337 ILE C CA  1  
ATOM 2429   C C   . ILE A 1 333 ? -49.822  53.254  -22.069 1.00 30.00  ? 337 ILE C C   1  
ATOM 2430   O O   . ILE A 1 333 ? -50.757  52.878  -21.357 1.00 30.00  ? 337 ILE C O   1  
ATOM 2431   C CB  . ILE A 1 333 ? -50.486  54.680  -23.955 1.00 99.99  ? 337 ILE C CB  1  
ATOM 2432   C CG1 . ILE A 1 333 ? -50.219  53.373  -24.691 1.00 99.99  ? 337 ILE C CG1 1  
ATOM 2433   C CG2 . ILE A 1 333 ? -49.997  55.853  -24.801 1.00 99.99  ? 337 ILE C CG2 1  
ATOM 2434   C CD1 . ILE A 1 333 ? -51.336  52.381  -24.388 1.00 99.99  ? 337 ILE C CD1 1  
ATOM 2435   N N   . LEU A 1 334 ? -48.818  52.457  -22.404 1.00 30.00  ? 338 LEU C N   1  
ATOM 2436   C CA  . LEU A 1 334 ? -48.761  51.084  -21.954 1.00 30.00  ? 338 LEU C CA  1  
ATOM 2437   C C   . LEU A 1 334 ? -48.403  51.075  -20.481 1.00 30.00  ? 338 LEU C C   1  
ATOM 2438   O O   . LEU A 1 334 ? -48.528  50.054  -19.795 1.00 30.00  ? 338 LEU C O   1  
ATOM 2439   C CB  . LEU A 1 334 ? -47.703  50.321  -22.744 1.00 99.99  ? 338 LEU C CB  1  
ATOM 2440   C CG  . LEU A 1 334 ? -48.362  49.612  -23.920 1.00 99.99  ? 338 LEU C CG  1  
ATOM 2441   C CD1 . LEU A 1 334 ? -47.388  48.598  -24.513 1.00 99.99  ? 338 LEU C CD1 1  
ATOM 2442   C CD2 . LEU A 1 334 ? -49.618  48.892  -23.441 1.00 99.99  ? 338 LEU C CD2 1  
ATOM 2443   N N   . GLY A 1 335 ? -47.946  52.228  -19.994 1.00 30.00  ? 339 GLY C N   1  
ATOM 2444   C CA  . GLY A 1 335 ? -47.559  52.347  -18.607 1.00 30.00  ? 339 GLY C CA  1  
ATOM 2445   C C   . GLY A 1 335 ? -46.153  51.812  -18.402 1.00 30.00  ? 339 GLY C C   1  
ATOM 2446   O O   . GLY A 1 335 ? -45.925  50.920  -17.587 1.00 30.00  ? 339 GLY C O   1  
ATOM 2447   N N   . PHE A 1 336 ? -45.202  52.358  -19.146 1.00 30.00  ? 340 PHE C N   1  
ATOM 2448   C CA  . PHE A 1 336 ? -43.813  51.926  -19.041 1.00 30.00  ? 340 PHE C CA  1  
ATOM 2449   C C   . PHE A 1 336 ? -43.022  53.021  -18.352 1.00 30.00  ? 340 PHE C C   1  
ATOM 2450   O O   . PHE A 1 336 ? -42.991  54.158  -18.835 1.00 30.00  ? 340 PHE C O   1  
ATOM 2451   C CB  . PHE A 1 336 ? -43.242  51.675  -20.432 1.00 99.99  ? 340 PHE C CB  1  
ATOM 2452   C CG  . PHE A 1 336 ? -43.912  50.468  -21.040 1.00 99.99  ? 340 PHE C CG  1  
ATOM 2453   C CD1 . PHE A 1 336 ? -43.462  49.180  -20.723 1.00 99.99  ? 340 PHE C CD1 1  
ATOM 2454   C CD2 . PHE A 1 336 ? -44.987  50.634  -21.923 1.00 99.99  ? 340 PHE C CD2 1  
ATOM 2455   C CE1 . PHE A 1 336 ? -44.082  48.061  -21.289 1.00 99.99  ? 340 PHE C CE1 1  
ATOM 2456   C CE2 . PHE A 1 336 ? -45.609  49.516  -22.490 1.00 99.99  ? 340 PHE C CE2 1  
ATOM 2457   C CZ  . PHE A 1 336 ? -45.157  48.229  -22.172 1.00 99.99  ? 340 PHE C CZ  1  
ATOM 2458   N N   . THR A 1 337 ? -42.379  52.712  -17.230 1.00 30.00  ? 341 THR C N   1  
ATOM 2459   C CA  . THR A 1 337 ? -41.615  53.770  -16.575 1.00 30.00  ? 341 THR C CA  1  
ATOM 2460   C C   . THR A 1 337 ? -40.577  54.254  -17.583 1.00 30.00  ? 341 THR C C   1  
ATOM 2461   O O   . THR A 1 337 ? -40.218  53.518  -18.504 1.00 30.00  ? 341 THR C O   1  
ATOM 2462   C CB  . THR A 1 337 ? -40.935  53.221  -15.326 1.00 99.99  ? 341 THR C CB  1  
ATOM 2463   O OG1 . THR A 1 337 ? -39.917  52.289  -15.709 1.00 99.99  ? 341 THR C OG1 1  
ATOM 2464   C CG2 . THR A 1 337 ? -41.966  52.513  -14.455 1.00 99.99  ? 341 THR C CG2 1  
ATOM 2465   N N   . LYS A 1 338 ? -40.112  55.486  -17.425 1.00 30.00  ? 342 LYS C N   1  
ATOM 2466   C CA  . LYS A 1 338 ? -39.130  56.063  -18.338 1.00 30.00  ? 342 LYS C CA  1  
ATOM 2467   C C   . LYS A 1 338 ? -37.833  55.257  -18.382 1.00 30.00  ? 342 LYS C C   1  
ATOM 2468   O O   . LYS A 1 338 ? -37.140  55.233  -19.400 1.00 30.00  ? 342 LYS C O   1  
ATOM 2469   C CB  . LYS A 1 338 ? -38.783  57.481  -17.898 1.00 99.99  ? 342 LYS C CB  1  
ATOM 2470   C CG  . LYS A 1 338 ? -40.034  58.347  -17.934 1.00 99.99  ? 342 LYS C CG  1  
ATOM 2471   C CD  . LYS A 1 338 ? -40.338  58.747  -19.373 1.00 99.99  ? 342 LYS C CD  1  
ATOM 2472   C CE  . LYS A 1 338 ? -41.486  59.752  -19.393 1.00 99.99  ? 342 LYS C CE  1  
ATOM 2473   N NZ  . LYS A 1 338 ? -41.953  59.936  -20.773 1.00 99.99  ? 342 LYS C NZ  1  
ATOM 2474   N N   . GLU A 1 339 ? -37.500  54.601  -17.285 1.00 30.00  ? 343 GLU C N   1  
ATOM 2475   C CA  . GLU A 1 339 ? -36.278  53.820  -17.259 1.00 30.00  ? 343 GLU C CA  1  
ATOM 2476   C C   . GLU A 1 339 ? -36.538  52.589  -18.111 1.00 30.00  ? 343 GLU C C   1  
ATOM 2477   O O   . GLU A 1 339 ? -35.769  52.281  -19.018 1.00 30.00  ? 343 GLU C O   1  
ATOM 2478   C CB  . GLU A 1 339 ? -35.945  53.424  -15.823 1.00 99.99  ? 343 GLU C CB  1  
ATOM 2479   C CG  . GLU A 1 339 ? -35.642  54.665  -15.017 1.00 99.99  ? 343 GLU C CG  1  
ATOM 2480   C CD  . GLU A 1 339 ? -34.289  55.229  -15.439 1.00 99.99  ? 343 GLU C CD  1  
ATOM 2481   O OE1 . GLU A 1 339 ? -34.281  56.070  -16.377 1.00 99.99  ? 343 GLU C OE1 1  
ATOM 2482   O OE2 . GLU A 1 339 ? -33.273  54.813  -14.820 1.00 99.99  ? 343 GLU C OE2 1  
ATOM 2483   N N   . GLU A 1 340 ? -37.632  51.900  -17.808 1.00 30.00  ? 344 GLU C N   1  
ATOM 2484   C CA  . GLU A 1 340 ? -38.044  50.696  -18.527 1.00 30.00  ? 344 GLU C CA  1  
ATOM 2485   C C   . GLU A 1 340 ? -37.945  50.858  -20.044 1.00 30.00  ? 344 GLU C C   1  
ATOM 2486   O O   . GLU A 1 340 ? -37.303  50.071  -20.740 1.00 30.00  ? 344 GLU C O   1  
ATOM 2487   C CB  . GLU A 1 340 ? -39.493  50.360  -18.188 1.00 99.99  ? 344 GLU C CB  1  
ATOM 2488   C CG  . GLU A 1 340 ? -39.600  50.006  -16.725 1.00 99.99  ? 344 GLU C CG  1  
ATOM 2489   C CD  . GLU A 1 340 ? -38.963  48.638  -16.485 1.00 99.99  ? 344 GLU C CD  1  
ATOM 2490   O OE1 . GLU A 1 340 ? -37.736  48.613  -16.204 1.00 99.99  ? 344 GLU C OE1 1  
ATOM 2491   O OE2 . GLU A 1 340 ? -39.714  47.629  -16.586 1.00 99.99  ? 344 GLU C OE2 1  
ATOM 2492   N N   . LYS A 1 341 ? -38.594  51.901  -20.547 1.00 30.00  ? 345 LYS C N   1  
ATOM 2493   C CA  . LYS A 1 341 ? -38.610  52.174  -21.960 1.00 30.00  ? 345 LYS C CA  1  
ATOM 2494   C C   . LYS A 1 341 ? -37.330  52.733  -22.518 1.00 30.00  ? 345 LYS C C   1  
ATOM 2495   O O   . LYS A 1 341 ? -37.221  52.970  -23.719 1.00 30.00  ? 345 LYS C O   1  
ATOM 2496   C CB  . LYS A 1 341 ? -39.699  53.193  -22.280 1.00 99.99  ? 345 LYS C CB  1  
ATOM 2497   C CG  . LYS A 1 341 ? -39.777  53.403  -23.788 1.00 99.99  ? 345 LYS C CG  1  
ATOM 2498   C CD  . LYS A 1 341 ? -41.111  54.048  -24.144 1.00 99.99  ? 345 LYS C CD  1  
ATOM 2499   C CE  . LYS A 1 341 ? -41.048  54.592  -25.568 1.00 99.99  ? 345 LYS C CE  1  
ATOM 2500   N NZ  . LYS A 1 341 ? -41.574  53.588  -26.503 1.00 99.99  ? 345 LYS C NZ  1  
ATOM 2501   N N   . GLN A 1 342 ? -36.354  52.962  -21.653 1.00 30.00  ? 346 GLN C N   1  
ATOM 2502   C CA  . GLN A 1 342 ? -35.077  53.485  -22.100 1.00 30.00  ? 346 GLN C CA  1  
ATOM 2503   C C   . GLN A 1 342 ? -34.113  52.307  -22.037 1.00 30.00  ? 346 GLN C C   1  
ATOM 2504   O O   . GLN A 1 342 ? -33.050  52.323  -22.644 1.00 30.00  ? 346 GLN C O   1  
ATOM 2505   C CB  . GLN A 1 342 ? -34.631  54.618  -21.181 1.00 99.99  ? 346 GLN C CB  1  
ATOM 2506   C CG  . GLN A 1 342 ? -35.605  55.786  -21.302 1.00 99.99  ? 346 GLN C CG  1  
ATOM 2507   C CD  . GLN A 1 342 ? -35.444  56.499  -22.638 1.00 99.99  ? 346 GLN C CD  1  
ATOM 2508   O OE1 . GLN A 1 342 ? -34.613  56.112  -23.455 1.00 99.99  ? 346 GLN C OE1 1  
ATOM 2509   N NE2 . GLN A 1 342 ? -36.247  57.540  -22.857 1.00 99.99  ? 346 GLN C NE2 1  
ATOM 2510   N N   . SER A 1 343 ? -34.513  51.288  -21.274 1.00 30.00  ? 347 SER C N   1  
ATOM 2511   C CA  . SER A 1 343 ? -33.756  50.056  -21.100 1.00 30.00  ? 347 SER C CA  1  
ATOM 2512   C C   . SER A 1 343 ? -33.920  49.333  -22.441 1.00 30.00  ? 347 SER C C   1  
ATOM 2513   O O   . SER A 1 343 ? -32.959  48.794  -23.003 1.00 30.00  ? 347 SER C O   1  
ATOM 2514   C CB  . SER A 1 343 ? -34.331  49.253  -19.940 1.00 99.99  ? 347 SER C CB  1  
ATOM 2515   O OG  . SER A 1 343 ? -34.275  50.033  -18.745 1.00 99.99  ? 347 SER C OG  1  
ATOM 2516   N N   . MET A 1 344 ? -35.161  49.328  -22.930 1.00 30.00  ? 348 MET C N   1  
ATOM 2517   C CA  . MET A 1 344 ? -35.500  48.707  -24.204 1.00 30.00  ? 348 MET C CA  1  
ATOM 2518   C C   . MET A 1 344 ? -34.608  49.351  -25.251 1.00 30.00  ? 348 MET C C   1  
ATOM 2519   O O   . MET A 1 344 ? -33.680  48.733  -25.759 1.00 30.00  ? 348 MET C O   1  
ATOM 2520   C CB  . MET A 1 344 ? -36.968  48.952  -24.527 1.00 99.99  ? 348 MET C CB  1  
ATOM 2521   C CG  . MET A 1 344 ? -37.824  48.573  -23.323 1.00 99.99  ? 348 MET C CG  1  
ATOM 2522   S SD  . MET A 1 344 ? -38.061  46.782  -23.268 1.00 99.99  ? 348 MET C SD  1  
ATOM 2523   C CE  . MET A 1 344 ? -39.271  46.588  -24.559 1.00 99.99  ? 348 MET C CE  1  
ATOM 2524   N N   . PHE A 1 345 ? -34.901  50.604  -25.558 1.00 30.00  ? 349 PHE C N   1  
ATOM 2525   C CA  . PHE A 1 345 ? -34.171  51.381  -26.546 1.00 30.00  ? 349 PHE C CA  1  
ATOM 2526   C C   . PHE A 1 345 ? -32.653  51.268  -26.523 1.00 30.00  ? 349 PHE C C   1  
ATOM 2527   O O   . PHE A 1 345 ? -31.994  51.381  -27.555 1.00 30.00  ? 349 PHE C O   1  
ATOM 2528   C CB  . PHE A 1 345 ? -34.473  52.865  -26.365 1.00 99.99  ? 349 PHE C CB  1  
ATOM 2529   C CG  . PHE A 1 345 ? -35.870  53.158  -26.856 1.00 99.99  ? 349 PHE C CG  1  
ATOM 2530   C CD1 . PHE A 1 345 ? -36.118  53.263  -28.230 1.00 99.99  ? 349 PHE C CD1 1  
ATOM 2531   C CD2 . PHE A 1 345 ? -36.914  53.328  -25.939 1.00 99.99  ? 349 PHE C CD2 1  
ATOM 2532   C CE1 . PHE A 1 345 ? -37.416  53.536  -28.686 1.00 99.99  ? 349 PHE C CE1 1  
ATOM 2533   C CE2 . PHE A 1 345 ? -38.208  53.602  -26.397 1.00 99.99  ? 349 PHE C CE2 1  
ATOM 2534   C CZ  . PHE A 1 345 ? -38.459  53.706  -27.770 1.00 99.99  ? 349 PHE C CZ  1  
ATOM 2535   N N   . LYS A 1 346 ? -32.090  51.058  -25.344 1.00 30.00  ? 350 LYS C N   1  
ATOM 2536   C CA  . LYS A 1 346 ? -30.648  50.964  -25.229 1.00 30.00  ? 350 LYS C CA  1  
ATOM 2537   C C   . LYS A 1 346 ? -30.156  49.584  -25.602 1.00 30.00  ? 350 LYS C C   1  
ATOM 2538   O O   . LYS A 1 346 ? -29.187  49.449  -26.350 1.00 30.00  ? 350 LYS C O   1  
ATOM 2539   C CB  . LYS A 1 346 ? -30.222  51.257  -23.795 1.00 99.99  ? 350 LYS C CB  1  
ATOM 2540   C CG  . LYS A 1 346 ? -28.701  51.253  -23.704 1.00 99.99  ? 350 LYS C CG  1  
ATOM 2541   C CD  . LYS A 1 346 ? -28.264  51.962  -22.428 1.00 99.99  ? 350 LYS C CD  1  
ATOM 2542   C CE  . LYS A 1 346 ? -26.800  51.644  -22.143 1.00 99.99  ? 350 LYS C CE  1  
ATOM 2543   N NZ  . LYS A 1 346 ? -25.947  52.696  -22.718 1.00 99.99  ? 350 LYS C NZ  1  
ATOM 2544   N N   . CYS A 1 347 ? -30.820  48.556  -25.083 1.00 30.00  ? 351 CYS C N   1  
ATOM 2545   C CA  . CYS A 1 347 ? -30.434  47.192  -25.398 1.00 30.00  ? 351 CYS C CA  1  
ATOM 2546   C C   . CYS A 1 347 ? -30.492  46.952  -26.901 1.00 30.00  ? 351 CYS C C   1  
ATOM 2547   O O   . CYS A 1 347 ? -29.669  46.216  -27.446 1.00 30.00  ? 351 CYS C O   1  
ATOM 2548   C CB  . CYS A 1 347 ? -31.375  46.216  -24.706 1.00 99.99  ? 351 CYS C CB  1  
ATOM 2549   S SG  . CYS A 1 347 ? -33.094  46.232  -25.272 1.00 99.99  ? 351 CYS C SG  1  
ATOM 2550   N N   . THR A 1 348 ? -31.467  47.563  -27.569 1.00 30.00  ? 352 THR C N   1  
ATOM 2551   C CA  . THR A 1 348 ? -31.591  47.370  -29.000 1.00 30.00  ? 352 THR C CA  1  
ATOM 2552   C C   . THR A 1 348 ? -30.561  48.223  -29.741 1.00 30.00  ? 352 THR C C   1  
ATOM 2553   O O   . THR A 1 348 ? -30.086  47.839  -30.819 1.00 30.00  ? 352 THR C O   1  
ATOM 2554   C CB  . THR A 1 348 ? -32.988  47.772  -29.460 1.00 99.99  ? 352 THR C CB  1  
ATOM 2555   O OG1 . THR A 1 348 ? -33.145  49.188  -29.320 1.00 99.99  ? 352 THR C OG1 1  
ATOM 2556   C CG2 . THR A 1 348 ? -34.029  47.061  -28.606 1.00 99.99  ? 352 THR C CG2 1  
ATOM 2557   N N   . ALA A 1 349 ? -30.187  49.374  -29.184 1.00 30.00  ? 353 ALA C N   1  
ATOM 2558   C CA  . ALA A 1 349 ? -29.189  50.214  -29.854 1.00 30.00  ? 353 ALA C CA  1  
ATOM 2559   C C   . ALA A 1 349 ? -27.823  49.589  -29.605 1.00 30.00  ? 353 ALA C C   1  
ATOM 2560   O O   . ALA A 1 349 ? -26.875  49.809  -30.357 1.00 30.00  ? 353 ALA C O   1  
ATOM 2561   C CB  . ALA A 1 349 ? -29.218  51.625  -29.298 1.00 30.00  ? 353 ALA C CB  1  
ATOM 2562   N N   . SER A 1 350 ? -27.736  48.807  -28.533 1.00 30.00  ? 354 SER C N   1  
ATOM 2563   C CA  . SER A 1 350 ? -26.509  48.137  -28.159 1.00 30.00  ? 354 SER C CA  1  
ATOM 2564   C C   . SER A 1 350 ? -26.187  47.160  -29.279 1.00 30.00  ? 354 SER C C   1  
ATOM 2565   O O   . SER A 1 350 ? -25.045  47.059  -29.731 1.00 30.00  ? 354 SER C O   1  
ATOM 2566   C CB  . SER A 1 350 ? -26.705  47.399  -26.839 1.00 99.99  ? 354 SER C CB  1  
ATOM 2567   O OG  . SER A 1 350 ? -27.084  48.330  -25.822 1.00 99.99  ? 354 SER C OG  1  
ATOM 2568   N N   . ILE A 1 351 ? -27.214  46.442  -29.721 1.00 30.00  ? 355 ILE C N   1  
ATOM 2569   C CA  . ILE A 1 351 ? -27.096  45.461  -30.793 1.00 30.00  ? 355 ILE C CA  1  
ATOM 2570   C C   . ILE A 1 351 ? -26.495  46.162  -32.017 1.00 30.00  ? 355 ILE C C   1  
ATOM 2571   O O   . ILE A 1 351 ? -25.541  45.674  -32.625 1.00 30.00  ? 355 ILE C O   1  
ATOM 2572   C CB  . ILE A 1 351 ? -28.472  44.900  -31.138 1.00 99.99  ? 355 ILE C CB  1  
ATOM 2573   C CG1 . ILE A 1 351 ? -28.829  43.789  -30.155 1.00 99.99  ? 355 ILE C CG1 1  
ATOM 2574   C CG2 . ILE A 1 351 ? -28.451  44.340  -32.556 1.00 99.99  ? 355 ILE C CG2 1  
ATOM 2575   C CD1 . ILE A 1 351 ? -29.725  44.347  -29.059 1.00 99.99  ? 355 ILE C CD1 1  
ATOM 2576   N N   . LEU A 1 352 ? -27.054  47.308  -32.365 1.00 30.00  ? 356 LEU C N   1  
ATOM 2577   C CA  . LEU A 1 352 ? -26.562  48.067  -33.499 1.00 30.00  ? 356 LEU C CA  1  
ATOM 2578   C C   . LEU A 1 352 ? -25.027  48.187  -33.483 1.00 30.00  ? 356 LEU C C   1  
ATOM 2579   O O   . LEU A 1 352 ? -24.379  48.232  -34.533 1.00 30.00  ? 356 LEU C O   1  
ATOM 2580   C CB  . LEU A 1 352 ? -27.151  49.473  -33.475 1.00 99.99  ? 356 LEU C CB  1  
ATOM 2581   C CG  . LEU A 1 352 ? -28.623  49.417  -33.871 1.00 99.99  ? 356 LEU C CG  1  
ATOM 2582   C CD1 . LEU A 1 352 ? -29.372  48.507  -32.903 1.00 99.99  ? 356 LEU C CD1 1  
ATOM 2583   C CD2 . LEU A 1 352 ? -29.217  50.818  -33.819 1.00 99.99  ? 356 LEU C CD2 1  
ATOM 2584   N N   . HIS A 1 353 ? -24.365  47.828  -32.118 1.00 30.00  ? 357 HIS C N   1  
ATOM 2585   C CA  . HIS A 1 353 ? -22.915  47.930  -31.902 1.00 30.00  ? 357 HIS C CA  1  
ATOM 2586   C C   . HIS A 1 353 ? -22.186  46.597  -31.889 1.00 30.00  ? 357 HIS C C   1  
ATOM 2587   O O   . HIS A 1 353 ? -21.032  46.516  -32.333 1.00 30.00  ? 357 HIS C O   1  
ATOM 2588   C CB  . HIS A 1 353 ? -22.641  48.600  -30.558 1.00 99.99  ? 357 HIS C CB  1  
ATOM 2589   C CG  . HIS A 1 353 ? -23.272  49.957  -30.377 1.00 99.99  ? 357 HIS C CG  1  
ATOM 2590   N ND1 . HIS A 1 353 ? -22.620  51.129  -30.739 1.00 99.99  ? 357 HIS C ND1 1  
ATOM 2591   C CD2 . HIS A 1 353 ? -24.486  50.325  -29.878 1.00 99.99  ? 357 HIS C CD2 1  
ATOM 2592   C CE1 . HIS A 1 353 ? -23.422  52.143  -30.463 1.00 99.99  ? 357 HIS C CE1 1  
ATOM 2593   N NE2 . HIS A 1 353 ? -24.533  51.683  -29.950 1.00 99.99  ? 357 HIS C NE2 1  
ATOM 2594   N N   . MET A 1 354 ? -22.841  45.558  -31.371 1.00 30.00  ? 358 MET C N   1  
ATOM 2595   C CA  . MET A 1 354 ? -22.253  44.219  -31.314 1.00 30.00  ? 358 MET C CA  1  
ATOM 2596   C C   . MET A 1 354 ? -21.700  43.890  -32.696 1.00 30.00  ? 358 MET C C   1  
ATOM 2597   O O   . MET A 1 354 ? -20.711  43.166  -32.837 1.00 30.00  ? 358 MET C O   1  
ATOM 2598   C CB  . MET A 1 354 ? -23.317  43.200  -30.920 1.00 99.99  ? 358 MET C CB  1  
ATOM 2599   C CG  . MET A 1 354 ? -22.647  41.952  -30.362 1.00 99.99  ? 358 MET C CG  1  
ATOM 2600   S SD  . MET A 1 354 ? -23.899  40.721  -29.919 1.00 99.99  ? 358 MET C SD  1  
ATOM 2601   C CE  . MET A 1 354 ? -22.845  39.372  -29.430 1.00 99.99  ? 358 MET C CE  1  
ATOM 2602   N N   . GLY A 1 355 ? -22.357  44.429  -33.715 1.00 30.00  ? 359 GLY C N   1  
ATOM 2603   C CA  . GLY A 1 355 ? -21.940  44.184  -35.079 1.00 30.00  ? 359 GLY C CA  1  
ATOM 2604   C C   . GLY A 1 355 ? -20.929  45.155  -35.618 1.00 30.00  ? 359 GLY C C   1  
ATOM 2605   O O   . GLY A 1 355 ? -20.574  45.091  -36.788 1.00 30.00  ? 359 GLY C O   1  
ATOM 2606   N N   . GLU A 1 356 ? -20.459  46.066  -34.774 1.00 30.00  ? 360 GLU C N   1  
ATOM 2607   C CA  . GLU A 1 356 ? -19.469  47.033  -35.222 1.00 30.00  ? 360 GLU C CA  1  
ATOM 2608   C C   . GLU A 1 356 ? -18.092  46.630  -34.692 1.00 30.00  ? 360 GLU C C   1  
ATOM 2609   O O   . GLU A 1 356 ? -17.058  47.148  -35.134 1.00 30.00  ? 360 GLU C O   1  
ATOM 2610   C CB  . GLU A 1 356 ? -19.826  48.421  -34.703 1.00 99.99  ? 360 GLU C CB  1  
ATOM 2611   C CG  . GLU A 1 356 ? -21.128  48.871  -35.318 1.00 99.99  ? 360 GLU C CG  1  
ATOM 2612   C CD  . GLU A 1 356 ? -20.907  49.206  -36.789 1.00 99.99  ? 360 GLU C CD  1  
ATOM 2613   O OE1 . GLU A 1 356 ? -21.057  48.272  -37.624 1.00 99.99  ? 360 GLU C OE1 1  
ATOM 2614   O OE2 . GLU A 1 356 ? -20.588  50.392  -37.068 1.00 99.99  ? 360 GLU C OE2 1  
ATOM 2615   N N   . MET A 1 357 ? -18.102  45.694  -33.750 1.00 30.00  ? 361 MET C N   1  
ATOM 2616   C CA  . MET A 1 357 ? -16.875  45.191  -33.159 1.00 30.00  ? 361 MET C CA  1  
ATOM 2617   C C   . MET A 1 357 ? -16.046  44.424  -34.188 1.00 30.00  ? 361 MET C C   1  
ATOM 2618   O O   . MET A 1 357 ? -16.364  43.281  -34.511 1.00 30.00  ? 361 MET C O   1  
ATOM 2619   C CB  . MET A 1 357 ? -17.200  44.254  -32.002 1.00 99.99  ? 361 MET C CB  1  
ATOM 2620   C CG  . MET A 1 357 ? -15.909  43.788  -31.341 1.00 99.99  ? 361 MET C CG  1  
ATOM 2621   S SD  . MET A 1 357 ? -16.279  42.945  -29.783 1.00 99.99  ? 361 MET C SD  1  
ATOM 2622   C CE  . MET A 1 357 ? -14.638  42.448  -29.302 1.00 99.99  ? 361 MET C CE  1  
ATOM 2623   N N   . LYS A 1 358 ? -14.986  45.046  -34.694 1.00 30.00  ? 362 LYS C N   1  
ATOM 2624   C CA  . LYS A 1 358 ? -14.102  44.434  -35.685 1.00 30.00  ? 362 LYS C CA  1  
ATOM 2625   C C   . LYS A 1 358 ? -13.108  43.524  -34.967 1.00 30.00  ? 362 LYS C C   1  
ATOM 2626   O O   . LYS A 1 358 ? -12.959  43.577  -33.739 1.00 30.00  ? 362 LYS C O   1  
ATOM 2627   C CB  . LYS A 1 358 ? -13.347  45.516  -36.447 1.00 99.99  ? 362 LYS C CB  1  
ATOM 2628   C CG  . LYS A 1 358 ? -12.503  44.874  -37.543 1.00 99.99  ? 362 LYS C CG  1  
ATOM 2629   C CD  . LYS A 1 358 ? -12.111  45.932  -38.569 1.00 99.99  ? 362 LYS C CD  1  
ATOM 2630   C CE  . LYS A 1 358 ? -10.983  45.397  -39.445 1.00 99.99  ? 362 LYS C CE  1  
ATOM 2631   N NZ  . LYS A 1 358 ? -11.552  44.795  -40.660 1.00 99.99  ? 362 LYS C NZ  1  
ATOM 2632   N N   . PHE A 1 359 ? -12.439  42.699  -35.749 1.00 30.00  ? 363 PHE C N   1  
ATOM 2633   C CA  . PHE A 1 359 ? -11.469  41.744  -35.203 1.00 30.00  ? 363 PHE C CA  1  
ATOM 2634   C C   . PHE A 1 359 ? -10.293  41.543  -36.147 1.00 30.00  ? 363 PHE C C   1  
ATOM 2635   O O   . PHE A 1 359 ? -10.237  42.133  -37.237 1.00 30.00  ? 363 PHE C O   1  
ATOM 2636   C CB  . PHE A 1 359 ? -12.139  40.393  -34.979 1.00 99.99  ? 363 PHE C CB  1  
ATOM 2637   C CG  . PHE A 1 359 ? -12.473  39.767  -36.313 1.00 99.99  ? 363 PHE C CG  1  
ATOM 2638   C CD1 . PHE A 1 359 ? -13.712  40.021  -36.911 1.00 99.99  ? 363 PHE C CD1 1  
ATOM 2639   C CD2 . PHE A 1 359 ? -11.544  38.938  -36.950 1.00 99.99  ? 363 PHE C CD2 1  
ATOM 2640   C CE1 . PHE A 1 359 ? -14.024  39.441  -38.147 1.00 99.99  ? 363 PHE C CE1 1  
ATOM 2641   C CE2 . PHE A 1 359 ? -11.857  38.357  -38.185 1.00 99.99  ? 363 PHE C CE2 1  
ATOM 2642   C CZ  . PHE A 1 359 ? -13.096  38.610  -38.784 1.00 99.99  ? 363 PHE C CZ  1  
ATOM 2643   N N   . LYS A 1 360 ? -9.405   40.707  -35.657 1.00 30.00  ? 364 LYS C N   1  
ATOM 2644   C CA  . LYS A 1 360 ? -8.177   40.313  -36.349 1.00 30.00  ? 364 LYS C CA  1  
ATOM 2645   C C   . LYS A 1 360 ? -7.684   39.001  -35.750 1.00 30.00  ? 364 LYS C C   1  
ATOM 2646   O O   . LYS A 1 360 ? -8.205   38.532  -34.726 1.00 30.00  ? 364 LYS C O   1  
ATOM 2647   C CB  . LYS A 1 360 ? -7.117   41.392  -36.175 1.00 99.99  ? 364 LYS C CB  1  
ATOM 2648   C CG  . LYS A 1 360 ? -5.875   41.023  -36.980 1.00 99.99  ? 364 LYS C CG  1  
ATOM 2649   C CD  . LYS A 1 360 ? -5.009   42.261  -37.178 1.00 99.99  ? 364 LYS C CD  1  
ATOM 2650   C CE  . LYS A 1 360 ? -3.616   41.839  -37.644 1.00 99.99  ? 364 LYS C CE  1  
ATOM 2651   N NZ  . LYS A 1 360 ? -3.560   41.876  -39.111 1.00 99.99  ? 364 LYS C NZ  1  
ATOM 2652   N N   . GLN A 1 361 ? -6.693   38.441  -36.400 1.00 30.00  ? 365 GLN C N   1  
ATOM 2653   C CA  . GLN A 1 361 ? -6.096   37.175  -35.974 1.00 30.00  ? 365 GLN C CA  1  
ATOM 2654   C C   . GLN A 1 361 ? -4.775   37.427  -35.252 1.00 30.00  ? 365 GLN C C   1  
ATOM 2655   O O   . GLN A 1 361 ? -4.753   37.802  -34.070 1.00 30.00  ? 365 GLN C O   1  
ATOM 2656   C CB  . GLN A 1 361 ? -5.837   36.291  -37.187 1.00 99.99  ? 365 GLN C CB  1  
ATOM 2657   C CG  . GLN A 1 361 ? -4.939   37.030  -38.173 1.00 99.99  ? 365 GLN C CG  1  
ATOM 2658   C CD  . GLN A 1 361 ? -5.732   38.055  -38.974 1.00 99.99  ? 365 GLN C CD  1  
ATOM 2659   O OE1 . GLN A 1 361 ? -6.935   38.200  -38.778 1.00 99.99  ? 365 GLN C OE1 1  
ATOM 2660   N NE2 . GLN A 1 361 ? -5.049   38.768  -39.872 1.00 99.99  ? 365 GLN C NE2 1  
ATOM 2661   N N   . ARG A 1 362 ? -3.725   37.204  -36.013 1.00 30.00  ? 366 ARG C N   1  
ATOM 2662   C CA  . ARG A 1 362 ? -2.342   37.344  -35.547 1.00 30.00  ? 366 ARG C CA  1  
ATOM 2663   C C   . ARG A 1 362 ? -1.553   36.112  -35.990 1.00 30.00  ? 366 ARG C C   1  
ATOM 2664   O O   . ARG A 1 362 ? -1.178   35.267  -35.164 1.00 30.00  ? 366 ARG C O   1  
ATOM 2665   C CB  . ARG A 1 362 ? -2.315   37.453  -34.026 1.00 99.99  ? 366 ARG C CB  1  
ATOM 2666   C CG  . ARG A 1 362 ? -0.879   37.647  -33.555 1.00 99.99  ? 366 ARG C CG  1  
ATOM 2667   C CD  . ARG A 1 362 ? -0.846   37.707  -32.032 1.00 99.99  ? 366 ARG C CD  1  
ATOM 2668   N NE  . ARG A 1 362 ? -1.607   36.585  -31.441 1.00 99.99  ? 366 ARG C NE  1  
ATOM 2669   C CZ  . ARG A 1 362 ? -1.110   35.357  -31.323 1.00 99.99  ? 366 ARG C CZ  1  
ATOM 2670   N NH1 . ARG A 1 362 ? 0.117    35.049  -31.735 1.00 99.99  ? 366 ARG C NH1 1  
ATOM 2671   N NH2 . ARG A 1 362 ? -1.882   34.421  -30.775 1.00 99.99  ? 366 ARG C NH2 1  
ATOM 2672   N N   . PRO A 1 363 ? -1.351   36.064  -37.293 1.00 30.00  ? 367 PRO C N   1  
ATOM 2673   C CA  . PRO A 1 363 ? -0.633   34.977  -37.978 1.00 30.00  ? 367 PRO C CA  1  
ATOM 2674   C C   . PRO A 1 363 ? 0.227    34.178  -36.985 1.00 30.00  ? 367 PRO C C   1  
ATOM 2675   O O   . PRO A 1 363 ? 1.289    34.641  -36.539 1.00 30.00  ? 367 PRO C O   1  
ATOM 2676   C CB  . PRO A 1 363 ? 0.177    35.807  -38.909 1.00 99.99  ? 367 PRO C CB  1  
ATOM 2677   C CG  . PRO A 1 363 ? -0.235   37.238  -38.661 1.00 99.99  ? 367 PRO C CG  1  
ATOM 2678   C CD  . PRO A 1 363 ? -1.142   37.362  -37.773 1.00 99.99  ? 367 PRO C CD  1  
ATOM 2679   N N   . ARG A 1 364 ? -0.251   32.982  -36.667 1.00 30.00  ? 368 ARG C N   1  
ATOM 2680   C CA  . ARG A 1 364 ? 0.445    32.067  -35.738 1.00 30.00  ? 368 ARG C CA  1  
ATOM 2681   C C   . ARG A 1 364 ? -0.478   30.916  -35.317 1.00 30.00  ? 368 ARG C C   1  
ATOM 2682   O O   . ARG A 1 364 ? -0.340   29.778  -35.786 1.00 30.00  ? 368 ARG C O   1  
ATOM 2683   C CB  . ARG A 1 364 ? 0.879    32.826  -34.491 1.00 99.99  ? 368 ARG C CB  1  
ATOM 2684   C CG  . ARG A 1 364 ? 1.700    31.907  -33.595 1.00 99.99  ? 368 ARG C CG  1  
ATOM 2685   C CD  . ARG A 1 364 ? 2.029    32.628  -32.292 1.00 99.99  ? 368 ARG C CD  1  
ATOM 2686   N NE  . ARG A 1 364 ? 0.822    32.774  -31.449 1.00 99.99  ? 368 ARG C NE  1  
ATOM 2687   C CZ  . ARG A 1 364 ? 0.851    33.300  -30.228 1.00 99.99  ? 368 ARG C CZ  1  
ATOM 2688   N NH1 . ARG A 1 364 ? 1.979    33.731  -29.671 1.00 99.99  ? 368 ARG C NH1 1  
ATOM 2689   N NH2 . ARG A 1 364 ? -0.294   33.386  -29.557 1.00 99.99  ? 368 ARG C NH2 1  
ATOM 2690   N N   . GLU A 1 365 ? -1.388   31.251  -34.428 1.00 30.00  ? 369 GLU C N   1  
ATOM 2691   C CA  . GLU A 1 365 ? -2.382   30.301  -33.903 1.00 30.00  ? 369 GLU C CA  1  
ATOM 2692   C C   . GLU A 1 365 ? -3.756   30.744  -34.363 1.00 30.00  ? 369 GLU C C   1  
ATOM 2693   O O   . GLU A 1 365 ? -4.668   29.922  -34.550 1.00 30.00  ? 369 GLU C O   1  
ATOM 2694   C CB  . GLU A 1 365 ? -2.328   30.283  -32.379 1.00 99.99  ? 369 GLU C CB  1  
ATOM 2695   C CG  . GLU A 1 365 ? -0.992   29.747  -31.929 1.00 99.99  ? 369 GLU C CG  1  
ATOM 2696   C CD  . GLU A 1 365 ? -0.926   28.245  -32.198 1.00 99.99  ? 369 GLU C CD  1  
ATOM 2697   O OE1 . GLU A 1 365 ? -0.480   27.879  -33.318 1.00 99.99  ? 369 GLU C OE1 1  
ATOM 2698   O OE2 . GLU A 1 365 ? -1.326   27.476  -31.282 1.00 99.99  ? 369 GLU C OE2 1  
ATOM 2699   N N   . GLU A 1 366 ? -3.834   32.033  -34.522 1.00 30.00  ? 370 GLU C N   1  
ATOM 2700   C CA  . GLU A 1 366 ? -5.027   32.693  -34.982 1.00 30.00  ? 370 GLU C CA  1  
ATOM 2701   C C   . GLU A 1 366 ? -6.001   32.905  -33.842 1.00 30.00  ? 370 GLU C C   1  
ATOM 2702   O O   . GLU A 1 366 ? -6.750   33.893  -33.803 1.00 30.00  ? 370 GLU C O   1  
ATOM 2703   C CB  . GLU A 1 366 ? -5.708   31.850  -36.054 1.00 99.99  ? 370 GLU C CB  1  
ATOM 2704   C CG  . GLU A 1 366 ? -6.558   32.739  -36.930 1.00 99.99  ? 370 GLU C CG  1  
ATOM 2705   C CD  . GLU A 1 366 ? -7.929   32.931  -36.286 1.00 99.99  ? 370 GLU C CD  1  
ATOM 2706   O OE1 . GLU A 1 366 ? -8.065   33.903  -35.498 1.00 99.99  ? 370 GLU C OE1 1  
ATOM 2707   O OE2 . GLU A 1 366 ? -8.829   32.099  -36.587 1.00 99.99  ? 370 GLU C OE2 1  
ATOM 2708   N N   . GLN A 1 367 ? -6.079   32.003  -32.857 1.00 30.00  ? 371 GLN C N   1  
ATOM 2709   C CA  . GLN A 1 367 ? -7.033   32.370  -31.846 1.00 30.00  ? 371 GLN C CA  1  
ATOM 2710   C C   . GLN A 1 367 ? -7.339   33.733  -32.410 1.00 30.00  ? 371 GLN C C   1  
ATOM 2711   O O   . GLN A 1 367 ? -6.983   34.036  -33.558 1.00 30.00  ? 371 GLN C O   1  
ATOM 2712   C CB  . GLN A 1 367 ? -6.369   32.355  -30.473 1.00 99.99  ? 371 GLN C CB  1  
ATOM 2713   C CG  . GLN A 1 367 ? -6.667   33.661  -29.748 1.00 99.99  ? 371 GLN C CG  1  
ATOM 2714   C CD  . GLN A 1 367 ? -5.916   34.824  -30.380 1.00 99.99  ? 371 GLN C CD  1  
ATOM 2715   O OE1 . GLN A 1 367 ? -5.183   34.639  -31.350 1.00 99.99  ? 371 GLN C OE1 1  
ATOM 2716   N NE2 . GLN A 1 367 ? -6.099   36.026  -29.829 1.00 99.99  ? 371 GLN C NE2 1  
ATOM 2717   N N   . ALA A 1 368 ? -7.939   34.622  -31.723 1.00 30.00  ? 372 ALA C N   1  
ATOM 2718   C CA  . ALA A 1 368 ? -8.141   35.919  -32.371 1.00 30.00  ? 372 ALA C CA  1  
ATOM 2719   C C   . ALA A 1 368 ? -7.976   37.035  -31.377 1.00 30.00  ? 372 ALA C C   1  
ATOM 2720   O O   . ALA A 1 368 ? -8.234   36.857  -30.181 1.00 30.00  ? 372 ALA C O   1  
ATOM 2721   C CB  . ALA A 1 368 ? -9.523   35.992  -33.004 1.00 30.00  ? 372 ALA C CB  1  
ATOM 2722   N N   . GLU A 1 369 ? -7.549   38.147  -31.916 1.00 30.00  ? 373 GLU C N   1  
ATOM 2723   C CA  . GLU A 1 369 ? -7.371   39.378  -31.154 1.00 30.00  ? 373 GLU C CA  1  
ATOM 2724   C C   . GLU A 1 369 ? -8.319   40.426  -31.714 1.00 30.00  ? 373 GLU C C   1  
ATOM 2725   O O   . GLU A 1 369 ? -8.819   40.297  -32.842 1.00 30.00  ? 373 GLU C O   1  
ATOM 2726   C CB  . GLU A 1 369 ? -5.930   39.861  -31.278 1.00 99.99  ? 373 GLU C CB  1  
ATOM 2727   C CG  . GLU A 1 369 ? -5.005   38.855  -30.637 1.00 99.99  ? 373 GLU C CG  1  
ATOM 2728   C CD  . GLU A 1 369 ? -5.155   38.917  -29.119 1.00 99.99  ? 373 GLU C CD  1  
ATOM 2729   O OE1 . GLU A 1 369 ? -6.022   38.168  -28.595 1.00 99.99  ? 373 GLU C OE1 1  
ATOM 2730   O OE2 . GLU A 1 369 ? -4.405   39.716  -28.497 1.00 99.99  ? 373 GLU C OE2 1  
ATOM 2731   N N   . SER A 1 370 ? -8.556   41.439  -30.917 1.00 30.00  ? 374 SER C N   1  
ATOM 2732   C CA  . SER A 1 370 ? -9.459   42.528  -31.294 1.00 30.00  ? 374 SER C CA  1  
ATOM 2733   C C   . SER A 1 370 ? -8.782   43.465  -32.280 1.00 30.00  ? 374 SER C C   1  
ATOM 2734   O O   . SER A 1 370 ? -7.595   43.343  -32.565 1.00 30.00  ? 374 SER C O   1  
ATOM 2735   C CB  . SER A 1 370 ? -9.860   43.322  -30.056 1.00 99.99  ? 374 SER C CB  1  
ATOM 2736   O OG  . SER A 1 370 ? -10.760  44.368  -30.430 1.00 99.99  ? 374 SER C OG  1  
ATOM 2737   N N   . ASP A 1 371 ? -9.562   44.399  -32.804 1.00 30.00  ? 375 ASP C N   1  
ATOM 2738   C CA  . ASP A 1 371 ? -9.058   45.372  -33.758 1.00 30.00  ? 375 ASP C CA  1  
ATOM 2739   C C   . ASP A 1 371 ? -9.645   46.684  -33.285 1.00 30.00  ? 375 ASP C C   1  
ATOM 2740   O O   . ASP A 1 371 ? -10.311  47.402  -34.033 1.00 30.00  ? 375 ASP C O   1  
ATOM 2741   C CB  . ASP A 1 371 ? -9.526   45.011  -35.163 1.00 99.99  ? 375 ASP C CB  1  
ATOM 2742   C CG  . ASP A 1 371 ? -8.798   45.882  -36.183 1.00 99.99  ? 375 ASP C CG  1  
ATOM 2743   O OD1 . ASP A 1 371 ? -9.227   47.055  -36.351 1.00 99.99  ? 375 ASP C OD1 1  
ATOM 2744   O OD2 . ASP A 1 371 ? -7.815   45.371  -36.786 1.00 99.99  ? 375 ASP C OD2 1  
ATOM 2745   N N   . GLY A 1 372 ? -9.382   46.969  -32.014 1.00 30.00  ? 376 GLY C N   1  
ATOM 2746   C CA  . GLY A 1 372 ? -9.872   48.180  -31.399 1.00 30.00  ? 376 GLY C CA  1  
ATOM 2747   C C   . GLY A 1 372 ? -10.657  47.787  -30.170 1.00 30.00  ? 376 GLY C C   1  
ATOM 2748   O O   . GLY A 1 372 ? -10.541  46.649  -29.698 1.00 30.00  ? 376 GLY C O   1  
ATOM 2749   N N   . THR A 1 373 ? -11.459  48.712  -29.653 1.00 30.00  ? 377 THR C N   1  
ATOM 2750   C CA  . THR A 1 373 ? -12.262  48.431  -28.472 1.00 30.00  ? 377 THR C CA  1  
ATOM 2751   C C   . THR A 1 373 ? -13.375  49.469  -28.283 1.00 30.00  ? 377 THR C C   1  
ATOM 2752   O O   . THR A 1 373 ? -14.296  49.274  -27.484 1.00 30.00  ? 377 THR C O   1  
ATOM 2753   C CB  . THR A 1 373 ? -11.376  48.449  -27.229 1.00 99.99  ? 377 THR C CB  1  
ATOM 2754   O OG1 . THR A 1 373 ? -10.340  47.470  -27.367 1.00 99.99  ? 377 THR C OG1 1  
ATOM 2755   C CG2 . THR A 1 373 ? -12.217  48.126  -26.002 1.00 99.99  ? 377 THR C CG2 1  
ATOM 2756   N N   . ALA A 1 374 ? -13.286  50.566  -29.039 1.00 30.00  ? 378 ALA C N   1  
ATOM 2757   C CA  . ALA A 1 374 ? -14.262  51.654  -28.970 1.00 30.00  ? 378 ALA C CA  1  
ATOM 2758   C C   . ALA A 1 374 ? -15.701  51.161  -29.000 1.00 30.00  ? 378 ALA C C   1  
ATOM 2759   O O   . ALA A 1 374 ? -16.490  51.471  -28.094 1.00 30.00  ? 378 ALA C O   1  
ATOM 2760   C CB  . ALA A 1 374 ? -14.032  52.633  -30.123 1.00 30.00  ? 378 ALA C CB  1  
ATOM 2761   N N   . GLU A 1 375 ? -16.037  50.395  -30.038 1.00 30.00  ? 379 GLU C N   1  
ATOM 2762   C CA  . GLU A 1 375 ? -17.387  49.863  -30.206 1.00 30.00  ? 379 GLU C CA  1  
ATOM 2763   C C   . GLU A 1 375 ? -17.730  48.736  -29.243 1.00 30.00  ? 379 GLU C C   1  
ATOM 2764   O O   . GLU A 1 375 ? -18.885  48.591  -28.850 1.00 30.00  ? 379 GLU C O   1  
ATOM 2765   C CB  . GLU A 1 375 ? -17.557  49.313  -31.617 1.00 99.99  ? 379 GLU C CB  1  
ATOM 2766   C CG  . GLU A 1 375 ? -16.507  48.261  -31.878 1.00 99.99  ? 379 GLU C CG  1  
ATOM 2767   C CD  . GLU A 1 375 ? -15.171  48.936  -32.182 1.00 99.99  ? 379 GLU C CD  1  
ATOM 2768   O OE1 . GLU A 1 375 ? -14.413  49.177  -31.207 1.00 99.99  ? 379 GLU C OE1 1  
ATOM 2769   O OE2 . GLU A 1 375 ? -14.925  49.204  -33.389 1.00 99.99  ? 379 GLU C OE2 1  
ATOM 2770   N N   . ALA A 1 376 ? -16.740  47.945  -28.856 1.00 30.00  ? 380 ALA C N   1  
ATOM 2771   C CA  . ALA A 1 376 ? -16.988  46.843  -27.929 1.00 30.00  ? 380 ALA C CA  1  
ATOM 2772   C C   . ALA A 1 376 ? -17.238  47.320  -26.491 1.00 30.00  ? 380 ALA C C   1  
ATOM 2773   O O   . ALA A 1 376 ? -17.673  46.542  -25.634 1.00 30.00  ? 380 ALA C O   1  
ATOM 2774   C CB  . ALA A 1 376 ? -15.818  45.868  -27.961 1.00 30.00  ? 380 ALA C CB  1  
ATOM 2775   N N   . GLU A 1 377 ? -16.958  48.596  -26.223 1.00 30.00  ? 381 GLU C N   1  
ATOM 2776   C CA  . GLU A 1 377 ? -17.167  49.168  -24.890 1.00 30.00  ? 381 GLU C CA  1  
ATOM 2777   C C   . GLU A 1 377 ? -18.593  49.681  -24.794 1.00 30.00  ? 381 GLU C C   1  
ATOM 2778   O O   . GLU A 1 377 ? -19.304  49.378  -23.834 1.00 30.00  ? 381 GLU C O   1  
ATOM 2779   C CB  . GLU A 1 377 ? -16.193  50.318  -24.661 1.00 99.99  ? 381 GLU C CB  1  
ATOM 2780   C CG  . GLU A 1 377 ? -15.978  50.510  -23.178 1.00 99.99  ? 381 GLU C CG  1  
ATOM 2781   C CD  . GLU A 1 377 ? -17.083  51.402  -22.615 1.00 99.99  ? 381 GLU C CD  1  
ATOM 2782   O OE1 . GLU A 1 377 ? -18.125  50.833  -22.195 1.00 99.99  ? 381 GLU C OE1 1  
ATOM 2783   O OE2 . GLU A 1 377 ? -16.873  52.645  -22.609 1.00 99.99  ? 381 GLU C OE2 1  
ATOM 2784   N N   . LYS A 1 378 ? -18.989  50.464  -25.802 1.00 30.00  ? 382 LYS C N   1  
ATOM 2785   C CA  . LYS A 1 378 ? -20.341  51.019  -25.869 1.00 30.00  ? 382 LYS C CA  1  
ATOM 2786   C C   . LYS A 1 378 ? -21.340  49.904  -25.585 1.00 30.00  ? 382 LYS C C   1  
ATOM 2787   O O   . LYS A 1 378 ? -22.420  50.120  -25.031 1.00 30.00  ? 382 LYS C O   1  
ATOM 2788   C CB  . LYS A 1 378 ? -20.595  51.599  -27.257 1.00 99.99  ? 382 LYS C CB  1  
ATOM 2789   C CG  . LYS A 1 378 ? -19.569  52.687  -27.553 1.00 99.99  ? 382 LYS C CG  1  
ATOM 2790   C CD  . LYS A 1 378 ? -19.884  53.333  -28.898 1.00 99.99  ? 382 LYS C CD  1  
ATOM 2791   C CE  . LYS A 1 378 ? -18.869  54.435  -29.180 1.00 99.99  ? 382 LYS C CE  1  
ATOM 2792   N NZ  . LYS A 1 378 ? -19.416  55.357  -30.186 1.00 99.99  ? 382 LYS C NZ  1  
ATOM 2793   N N   . VAL A 1 379 ? -20.955  48.703  -25.987 1.00 30.00  ? 383 VAL C N   1  
ATOM 2794   C CA  . VAL A 1 379 ? -21.759  47.514  -25.818 1.00 30.00  ? 383 VAL C CA  1  
ATOM 2795   C C   . VAL A 1 379 ? -21.756  47.120  -24.356 1.00 30.00  ? 383 VAL C C   1  
ATOM 2796   O O   . VAL A 1 379 ? -22.815  46.982  -23.753 1.00 30.00  ? 383 VAL C O   1  
ATOM 2797   C CB  . VAL A 1 379 ? -21.186  46.379  -26.658 1.00 99.99  ? 383 VAL C CB  1  
ATOM 2798   C CG1 . VAL A 1 379 ? -21.187  46.782  -28.128 1.00 99.99  ? 383 VAL C CG1 1  
ATOM 2799   C CG2 . VAL A 1 379 ? -19.758  46.085  -26.211 1.00 99.99  ? 383 VAL C CG2 1  
ATOM 2800   N N   . ALA A 1 380 ? -20.570  46.936  -23.784 1.00 30.00  ? 384 ALA C N   1  
ATOM 2801   C CA  . ALA A 1 380 ? -20.460  46.545  -22.380 1.00 30.00  ? 384 ALA C CA  1  
ATOM 2802   C C   . ALA A 1 380 ? -21.127  47.601  -21.499 1.00 30.00  ? 384 ALA C C   1  
ATOM 2803   O O   . ALA A 1 380 ? -21.731  47.292  -20.468 1.00 30.00  ? 384 ALA C O   1  
ATOM 2804   C CB  . ALA A 1 380 ? -19.009  46.412  -22.002 1.00 30.00  ? 384 ALA C CB  1  
ATOM 2805   N N   . PHE A 1 381 ? -20.996  48.856  -21.933 1.00 30.00  ? 385 PHE C N   1  
ATOM 2806   C CA  . PHE A 1 381 ? -21.560  50.007  -21.239 1.00 30.00  ? 385 PHE C CA  1  
ATOM 2807   C C   . PHE A 1 381 ? -23.081  49.876  -21.102 1.00 30.00  ? 385 PHE C C   1  
ATOM 2808   O O   . PHE A 1 381 ? -23.610  49.792  -19.982 1.00 30.00  ? 385 PHE C O   1  
ATOM 2809   C CB  . PHE A 1 381 ? -21.251  51.284  -22.015 1.00 99.99  ? 385 PHE C CB  1  
ATOM 2810   C CG  . PHE A 1 381 ? -21.837  52.470  -21.289 1.00 99.99  ? 385 PHE C CG  1  
ATOM 2811   C CD1 . PHE A 1 381 ? -21.136  53.058  -20.230 1.00 99.99  ? 385 PHE C CD1 1  
ATOM 2812   C CD2 . PHE A 1 381 ? -23.081  52.981  -21.674 1.00 99.99  ? 385 PHE C CD2 1  
ATOM 2813   C CE1 . PHE A 1 381 ? -21.678  54.159  -19.557 1.00 99.99  ? 385 PHE C CE1 1  
ATOM 2814   C CE2 . PHE A 1 381 ? -23.625  54.081  -21.000 1.00 99.99  ? 385 PHE C CE2 1  
ATOM 2815   C CZ  . PHE A 1 381 ? -22.923  54.671  -19.940 1.00 99.99  ? 385 PHE C CZ  1  
ATOM 2816   N N   . LEU A 1 382 ? -23.753  49.855  -22.259 1.00 30.00  ? 386 LEU C N   1  
ATOM 2817   C CA  . LEU A 1 382 ? -25.208  49.739  -22.355 1.00 30.00  ? 386 LEU C CA  1  
ATOM 2818   C C   . LEU A 1 382 ? -25.792  48.500  -21.675 1.00 30.00  ? 386 LEU C C   1  
ATOM 2819   O O   . LEU A 1 382 ? -26.951  48.514  -21.224 1.00 30.00  ? 386 LEU C O   1  
ATOM 2820   C CB  . LEU A 1 382 ? -25.627  49.673  -23.820 1.00 99.99  ? 386 LEU C CB  1  
ATOM 2821   C CG  . LEU A 1 382 ? -25.476  51.051  -24.457 1.00 99.99  ? 386 LEU C CG  1  
ATOM 2822   C CD1 . LEU A 1 382 ? -24.026  51.510  -24.335 1.00 99.99  ? 386 LEU C CD1 1  
ATOM 2823   C CD2 . LEU A 1 382 ? -25.865  50.979  -25.928 1.00 99.99  ? 386 LEU C CD2 1  
ATOM 2824   N N   . CYS A 1 383 ? -25.006  47.435  -21.583 1.00 30.00  ? 387 CYS C N   1  
ATOM 2825   C CA  . CYS A 1 383 ? -25.477  46.212  -20.945 1.00 30.00  ? 387 CYS C CA  1  
ATOM 2826   C C   . CYS A 1 383 ? -24.997  46.114  -19.510 1.00 30.00  ? 387 CYS C C   1  
ATOM 2827   O O   . CYS A 1 383 ? -25.221  45.104  -18.837 1.00 30.00  ? 387 CYS C O   1  
ATOM 2828   C CB  . CYS A 1 383 ? -24.960  44.998  -21.707 1.00 99.99  ? 387 CYS C CB  1  
ATOM 2829   S SG  . CYS A 1 383 ? -23.169  44.742  -21.678 1.00 99.99  ? 387 CYS C SG  1  
ATOM 2830   N N   . GLY A 1 384 ? -24.325  47.168  -19.049 1.00 30.00  ? 388 GLY C N   1  
ATOM 2831   C CA  . GLY A 1 384 ? -23.826  47.211  -17.688 1.00 30.00  ? 388 GLY C CA  1  
ATOM 2832   C C   . GLY A 1 384 ? -22.890  46.098  -17.280 1.00 30.00  ? 388 GLY C C   1  
ATOM 2833   O O   . GLY A 1 384 ? -23.067  45.472  -16.227 1.00 30.00  ? 388 GLY C O   1  
ATOM 2834   N N   . ILE A 1 385 ? -21.891  45.832  -18.107 1.00 30.00  ? 389 ILE C N   1  
ATOM 2835   C CA  . ILE A 1 385 ? -20.916  44.794  -17.801 1.00 30.00  ? 389 ILE C CA  1  
ATOM 2836   C C   . ILE A 1 385 ? -19.551  45.356  -18.211 1.00 30.00  ? 389 ILE C C   1  
ATOM 2837   O O   . ILE A 1 385 ? -19.465  46.315  -18.992 1.00 30.00  ? 389 ILE C O   1  
ATOM 2838   C CB  . ILE A 1 385 ? -21.241  43.529  -18.587 1.00 99.99  ? 389 ILE C CB  1  
ATOM 2839   C CG1 . ILE A 1 385 ? -20.600  43.607  -19.969 1.00 99.99  ? 389 ILE C CG1 1  
ATOM 2840   C CG2 . ILE A 1 385 ? -22.754  43.397  -18.736 1.00 99.99  ? 389 ILE C CG2 1  
ATOM 2841   C CD1 . ILE A 1 385 ? -19.244  42.912  -19.941 1.00 99.99  ? 389 ILE C CD1 1  
ATOM 2842   N N   . ASN A 1 386 ? -18.489  44.763  -17.680 1.00 30.00  ? 390 ASN C N   1  
ATOM 2843   C CA  . ASN A 1 386 ? -17.144  45.221  -17.988 1.00 30.00  ? 390 ASN C CA  1  
ATOM 2844   C C   . ASN A 1 386 ? -16.690  44.879  -19.414 1.00 30.00  ? 390 ASN C C   1  
ATOM 2845   O O   . ASN A 1 386 ? -16.644  43.706  -19.785 1.00 30.00  ? 390 ASN C O   1  
ATOM 2846   C CB  . ASN A 1 386 ? -16.147  44.577  -17.031 1.00 99.99  ? 390 ASN C CB  1  
ATOM 2847   C CG  . ASN A 1 386 ? -14.731  45.071  -17.299 1.00 99.99  ? 390 ASN C CG  1  
ATOM 2848   O OD1 . ASN A 1 386 ? -14.534  46.232  -17.655 1.00 99.99  ? 390 ASN C OD1 1  
ATOM 2849   N ND2 . ASN A 1 386 ? -13.745  44.190  -17.121 1.00 99.99  ? 390 ASN C ND2 1  
ATOM 2850   N N   . ALA A 1 387 ? -16.358  45.900  -20.208 1.00 30.00  ? 391 ALA C N   1  
ATOM 2851   C CA  . ALA A 1 387 ? -15.901  45.683  -21.583 1.00 30.00  ? 391 ALA C CA  1  
ATOM 2852   C C   . ALA A 1 387 ? -14.698  44.732  -21.594 1.00 30.00  ? 391 ALA C C   1  
ATOM 2853   O O   . ALA A 1 387 ? -14.467  43.995  -22.566 1.00 30.00  ? 391 ALA C O   1  
ATOM 2854   C CB  . ALA A 1 387 ? -15.516  47.025  -22.234 1.00 30.00  ? 391 ALA C CB  1  
ATOM 2855   N N   . GLY A 1 388 ? -13.927  44.750  -20.512 1.00 30.00  ? 392 GLY C N   1  
ATOM 2856   C CA  . GLY A 1 388 ? -12.769  43.890  -20.419 1.00 30.00  ? 392 GLY C CA  1  
ATOM 2857   C C   . GLY A 1 388 ? -13.232  42.454  -20.298 1.00 30.00  ? 392 GLY C C   1  
ATOM 2858   O O   . GLY A 1 388 ? -12.999  41.643  -21.194 1.00 30.00  ? 392 GLY C O   1  
ATOM 2859   N N   . ASP A 1 389 ? -13.901  42.155  -19.181 1.00 30.00  ? 393 ASP C N   1  
ATOM 2860   C CA  . ASP A 1 389 ? -14.429  40.822  -18.890 1.00 30.00  ? 393 ASP C CA  1  
ATOM 2861   C C   . ASP A 1 389 ? -15.221  40.259  -20.081 1.00 30.00  ? 393 ASP C C   1  
ATOM 2862   O O   . ASP A 1 389 ? -15.363  39.041  -20.229 1.00 30.00  ? 393 ASP C O   1  
ATOM 2863   C CB  . ASP A 1 389 ? -15.359  40.887  -17.684 1.00 99.99  ? 393 ASP C CB  1  
ATOM 2864   C CG  . ASP A 1 389 ? -14.548  41.205  -16.429 1.00 99.99  ? 393 ASP C CG  1  
ATOM 2865   O OD1 . ASP A 1 389 ? -13.803  40.292  -15.979 1.00 99.99  ? 393 ASP C OD1 1  
ATOM 2866   O OD2 . ASP A 1 389 ? -14.677  42.356  -15.936 1.00 99.99  ? 393 ASP C OD2 1  
ATOM 2867   N N   . LEU A 1 390 ? -15.733  41.156  -20.922 1.00 30.00  ? 394 LEU C N   1  
ATOM 2868   C CA  . LEU A 1 390 ? -16.501  40.771  -22.100 1.00 30.00  ? 394 LEU C CA  1  
ATOM 2869   C C   . LEU A 1 390 ? -15.593  40.195  -23.177 1.00 30.00  ? 394 LEU C C   1  
ATOM 2870   O O   . LEU A 1 390 ? -15.492  38.974  -23.314 1.00 30.00  ? 394 LEU C O   1  
ATOM 2871   C CB  . LEU A 1 390 ? -17.221  41.986  -22.672 1.00 99.99  ? 394 LEU C CB  1  
ATOM 2872   C CG  . LEU A 1 390 ? -18.638  42.046  -22.117 1.00 99.99  ? 394 LEU C CG  1  
ATOM 2873   C CD1 . LEU A 1 390 ? -19.459  43.050  -22.923 1.00 99.99  ? 394 LEU C CD1 1  
ATOM 2874   C CD2 . LEU A 1 390 ? -19.283  40.667  -22.214 1.00 99.99  ? 394 LEU C CD2 1  
ATOM 2875   N N   . LEU A 1 391 ? -14.936  41.070  -23.934 1.00 30.00  ? 395 LEU C N   1  
ATOM 2876   C CA  . LEU A 1 391 ? -14.037  40.624  -24.996 1.00 30.00  ? 395 LEU C CA  1  
ATOM 2877   C C   . LEU A 1 391 ? -13.180  39.446  -24.540 1.00 30.00  ? 395 LEU C C   1  
ATOM 2878   O O   . LEU A 1 391 ? -12.677  38.679  -25.355 1.00 30.00  ? 395 LEU C O   1  
ATOM 2879   C CB  . LEU A 1 391 ? -13.113  41.763  -25.404 1.00 99.99  ? 395 LEU C CB  1  
ATOM 2880   C CG  . LEU A 1 391 ? -12.100  41.257  -26.426 1.00 99.99  ? 395 LEU C CG  1  
ATOM 2881   C CD1 . LEU A 1 391 ? -11.129  42.378  -26.780 1.00 99.99  ? 395 LEU C CD1 1  
ATOM 2882   C CD2 . LEU A 1 391 ? -11.328  40.082  -25.838 1.00 99.99  ? 395 LEU C CD2 1  
ATOM 2883   N N   . LYS A 1 392 ? -13.016  39.307  -23.230 1.00 30.00  ? 396 LYS C N   1  
ATOM 2884   C CA  . LYS A 1 392 ? -12.224  38.220  -22.679 1.00 30.00  ? 396 LYS C CA  1  
ATOM 2885   C C   . LYS A 1 392 ? -13.000  36.915  -22.842 1.00 30.00  ? 396 LYS C C   1  
ATOM 2886   O O   . LYS A 1 392 ? -12.550  36.003  -23.532 1.00 30.00  ? 396 LYS C O   1  
ATOM 2887   C CB  . LYS A 1 392 ? -11.954  38.475  -21.198 1.00 99.99  ? 396 LYS C CB  1  
ATOM 2888   C CG  . LYS A 1 392 ? -11.043  37.380  -20.652 1.00 99.99  ? 396 LYS C CG  1  
ATOM 2889   C CD  . LYS A 1 392 ? -10.418  37.847  -19.344 1.00 99.99  ? 396 LYS C CD  1  
ATOM 2890   C CE  . LYS A 1 392 ? -9.814   36.651  -18.613 1.00 99.99  ? 396 LYS C CE  1  
ATOM 2891   N NZ  . LYS A 1 392 ? -8.390   36.533  -18.956 1.00 99.99  ? 396 LYS C NZ  1  
ATOM 2892   N N   . ALA A 1 393 ? -14.165  36.837  -22.204 1.00 30.00  ? 397 ALA C N   1  
ATOM 2893   C CA  . ALA A 1 393 ? -15.007  35.643  -22.277 1.00 30.00  ? 397 ALA C CA  1  
ATOM 2894   C C   . ALA A 1 393 ? -15.587  35.429  -23.681 1.00 30.00  ? 397 ALA C C   1  
ATOM 2895   O O   . ALA A 1 393 ? -16.407  34.535  -23.885 1.00 30.00  ? 397 ALA C O   1  
ATOM 2896   C CB  . ALA A 1 393 ? -16.138  35.748  -21.262 1.00 30.00  ? 397 ALA C CB  1  
ATOM 2897   N N   . LEU A 1 394 ? -15.146  36.246  -24.632 1.00 30.00  ? 398 LEU C N   1  
ATOM 2898   C CA  . LEU A 1 394 ? -15.600  36.180  -26.021 1.00 30.00  ? 398 LEU C CA  1  
ATOM 2899   C C   . LEU A 1 394 ? -14.514  35.677  -26.982 1.00 30.00  ? 398 LEU C C   1  
ATOM 2900   O O   . LEU A 1 394 ? -14.815  35.149  -28.057 1.00 30.00  ? 398 LEU C O   1  
ATOM 2901   C CB  . LEU A 1 394 ? -16.032  37.563  -26.494 1.00 99.99  ? 398 LEU C CB  1  
ATOM 2902   C CG  . LEU A 1 394 ? -17.535  37.722  -26.303 1.00 99.99  ? 398 LEU C CG  1  
ATOM 2903   C CD1 . LEU A 1 394 ? -18.018  38.955  -27.067 1.00 99.99  ? 398 LEU C CD1 1  
ATOM 2904   C CD2 . LEU A 1 394 ? -18.250  36.485  -26.835 1.00 99.99  ? 398 LEU C CD2 1  
ATOM 2905   N N   . LEU A 1 395 ? -13.252  35.850  -26.595 1.00 30.00  ? 399 LEU C N   1  
ATOM 2906   C CA  . LEU A 1 395 ? -12.129  35.424  -27.419 1.00 30.00  ? 399 LEU C CA  1  
ATOM 2907   C C   . LEU A 1 395 ? -11.450  34.164  -26.883 1.00 30.00  ? 399 LEU C C   1  
ATOM 2908   O O   . LEU A 1 395 ? -10.628  33.564  -27.571 1.00 30.00  ? 399 LEU C O   1  
ATOM 2909   C CB  . LEU A 1 395 ? -11.079  36.529  -27.474 1.00 99.99  ? 399 LEU C CB  1  
ATOM 2910   C CG  . LEU A 1 395 ? -11.300  37.382  -28.718 1.00 99.99  ? 399 LEU C CG  1  
ATOM 2911   C CD1 . LEU A 1 395 ? -10.079  38.265  -28.952 1.00 99.99  ? 399 LEU C CD1 1  
ATOM 2912   C CD2 . LEU A 1 395 ? -11.514  36.474  -29.925 1.00 99.99  ? 399 LEU C CD2 1  
ATOM 2913   N N   . LYS A 1 396 ? -11.791  33.781  -25.676 1.00 30.00  ? 400 LYS C N   1  
ATOM 2914   C CA  . LYS A 1 396 ? -11.232  32.586  -25.024 1.00 30.00  ? 400 LYS C CA  1  
ATOM 2915   C C   . LYS A 1 396 ? -12.192  32.083  -23.947 1.00 30.00  ? 400 LYS C C   1  
ATOM 2916   O O   . LYS A 1 396 ? -11.867  32.021  -22.774 1.00 30.00  ? 400 LYS C O   1  
ATOM 2917   C CB  . LYS A 1 396 ? -9.893   32.926  -24.377 1.00 99.99  ? 400 LYS C CB  1  
ATOM 2918   C CG  . LYS A 1 396 ? -9.273   31.661  -23.790 1.00 99.99  ? 400 LYS C CG  1  
ATOM 2919   C CD  . LYS A 1 396 ? -7.786   31.887  -23.551 1.00 99.99  ? 400 LYS C CD  1  
ATOM 2920   C CE  . LYS A 1 396 ? -7.247   30.791  -22.639 1.00 99.99  ? 400 LYS C CE  1  
ATOM 2921   N NZ  . LYS A 1 396 ? -6.691   29.703  -23.456 1.00 99.99  ? 400 LYS C NZ  1  
ATOM 2922   N N   . PRO A 1 397 ? -13.412  31.757  -24.373 1.00 30.00  ? 401 PRO C N   1  
ATOM 2923   C CA  . PRO A 1 397 ? -14.449  31.276  -23.458 1.00 30.00  ? 401 PRO C CA  1  
ATOM 2924   C C   . PRO A 1 397 ? -13.941  30.265  -22.449 1.00 30.00  ? 401 PRO C C   1  
ATOM 2925   O O   . PRO A 1 397 ? -13.205  29.350  -22.793 1.00 30.00  ? 401 PRO C O   1  
ATOM 2926   C CB  . PRO A 1 397 ? -15.350  30.654  -24.465 1.00 99.99  ? 401 PRO C CB  1  
ATOM 2927   C CG  . PRO A 1 397 ? -14.724  30.922  -25.812 1.00 99.99  ? 401 PRO C CG  1  
ATOM 2928   C CD  . PRO A 1 397 ? -13.643  31.599  -25.747 1.00 99.99  ? 401 PRO C CD  1  
ATOM 2929   N N   . LYS A 1 398 ? -14.337  30.435  -21.191 1.00 30.00  ? 402 LYS C N   1  
ATOM 2930   C CA  . LYS A 1 398 ? -13.921  29.520  -20.138 1.00 30.00  ? 402 LYS C CA  1  
ATOM 2931   C C   . LYS A 1 398 ? -15.029  28.484  -19.874 1.00 30.00  ? 402 LYS C C   1  
ATOM 2932   O O   . LYS A 1 398 ? -15.414  28.275  -18.698 1.00 30.00  ? 402 LYS C O   1  
ATOM 2933   C CB  . LYS A 1 398 ? -13.649  30.294  -18.853 1.00 99.99  ? 402 LYS C CB  1  
ATOM 2934   C CG  . LYS A 1 398 ? -13.169  29.335  -17.771 1.00 99.99  ? 402 LYS C CG  1  
ATOM 2935   C CD  . LYS A 1 398 ? -13.015  30.089  -16.455 1.00 99.99  ? 402 LYS C CD  1  
ATOM 2936   C CE  . LYS A 1 398 ? -12.953  29.092  -15.303 1.00 99.99  ? 402 LYS C CE  1  
ATOM 2937   N NZ  . LYS A 1 398 ? -11.976  28.038  -15.617 1.00 99.99  ? 402 LYS C NZ  1  
ATOM 2938   N N   . VAL A 1 406 ? -12.656  25.364  -17.285 1.00 30.00  ? 410 VAL C N   1  
ATOM 2939   C CA  . VAL A 1 406 ? -11.687  24.993  -18.361 1.00 30.00  ? 410 VAL C CA  1  
ATOM 2940   C C   . VAL A 1 406 ? -11.825  25.867  -19.617 1.00 30.00  ? 410 VAL C C   1  
ATOM 2941   O O   . VAL A 1 406 ? -12.854  25.861  -20.290 1.00 30.00  ? 410 VAL C O   1  
ATOM 2942   C CB  . VAL A 1 406 ? -11.910  23.544  -18.780 1.00 99.99  ? 410 VAL C CB  1  
ATOM 2943   C CG1 . VAL A 1 406 ? -11.700  22.629  -17.578 1.00 99.99  ? 410 VAL C CG1 1  
ATOM 2944   C CG2 . VAL A 1 406 ? -13.331  23.377  -19.306 1.00 99.99  ? 410 VAL C CG2 1  
ATOM 2945   N N   . THR A 1 407 ? -10.770  26.613  -19.936 1.00 30.00  ? 411 THR C N   1  
ATOM 2946   C CA  . THR A 1 407 ? -10.757  27.501  -21.102 1.00 30.00  ? 411 THR C CA  1  
ATOM 2947   C C   . THR A 1 407 ? -10.833  26.767  -22.432 1.00 30.00  ? 411 THR C C   1  
ATOM 2948   O O   . THR A 1 407 ? -10.757  25.544  -22.471 1.00 30.00  ? 411 THR C O   1  
ATOM 2949   C CB  . THR A 1 407 ? -9.468   28.317  -21.116 1.00 99.99  ? 411 THR C CB  1  
ATOM 2950   O OG1 . THR A 1 407 ? -8.358   27.451  -21.368 1.00 99.99  ? 411 THR C OG1 1  
ATOM 2951   C CG2 . THR A 1 407 ? -9.284   28.998  -19.762 1.00 99.99  ? 411 THR C CG2 1  
ATOM 2952   N N   . LYS A 1 408 ? -10.995  27.534  -23.511 1.00 30.00  ? 412 LYS C N   1  
ATOM 2953   C CA  . LYS A 1 408 ? -11.091  27.015  -24.878 1.00 30.00  ? 412 LYS C CA  1  
ATOM 2954   C C   . LYS A 1 408 ? -11.183  28.195  -25.839 1.00 30.00  ? 412 LYS C C   1  
ATOM 2955   O O   . LYS A 1 408 ? -12.273  28.678  -26.140 1.00 30.00  ? 412 LYS C O   1  
ATOM 2956   C CB  . LYS A 1 408 ? -12.333  26.138  -25.014 1.00 99.99  ? 412 LYS C CB  1  
ATOM 2957   C CG  . LYS A 1 408 ? -12.372  25.522  -26.407 1.00 99.99  ? 412 LYS C CG  1  
ATOM 2958   C CD  . LYS A 1 408 ? -13.322  24.331  -26.411 1.00 99.99  ? 412 LYS C CD  1  
ATOM 2959   C CE  . LYS A 1 408 ? -13.650  23.946  -27.851 1.00 99.99  ? 412 LYS C CE  1  
ATOM 2960   N NZ  . LYS A 1 408 ? -12.732  22.890  -28.299 1.00 99.99  ? 412 LYS C NZ  1  
ATOM 2961   N N   . GLY A 1 409 ? -10.036  28.656  -26.323 1.00 30.00  ? 413 GLY C N   1  
ATOM 2962   C CA  . GLY A 1 409 ? -10.027  29.782  -27.237 1.00 30.00  ? 413 GLY C CA  1  
ATOM 2963   C C   . GLY A 1 409 ? -10.818  29.586  -28.514 1.00 30.00  ? 413 GLY C C   1  
ATOM 2964   O O   . GLY A 1 409 ? -11.056  28.462  -28.943 1.00 30.00  ? 413 GLY C O   1  
ATOM 2965   N N   . GLN A 1 410 ? -11.226  30.691  -29.128 1.00 30.00  ? 414 GLN C N   1  
ATOM 2966   C CA  . GLN A 1 410 ? -11.993  30.668  -30.369 1.00 30.00  ? 414 GLN C CA  1  
ATOM 2967   C C   . GLN A 1 410 ? -11.188  31.375  -31.449 1.00 30.00  ? 414 GLN C C   1  
ATOM 2968   O O   . GLN A 1 410 ? -10.458  32.316  -31.161 1.00 30.00  ? 414 GLN C O   1  
ATOM 2969   C CB  . GLN A 1 410 ? -13.325  31.384  -30.167 1.00 99.99  ? 414 GLN C CB  1  
ATOM 2970   C CG  . GLN A 1 410 ? -14.172  30.608  -29.164 1.00 99.99  ? 414 GLN C CG  1  
ATOM 2971   C CD  . GLN A 1 410 ? -14.692  29.314  -29.769 1.00 99.99  ? 414 GLN C CD  1  
ATOM 2972   O OE1 . GLN A 1 410 ? -14.416  29.011  -30.928 1.00 99.99  ? 414 GLN C OE1 1  
ATOM 2973   N NE2 . GLN A 1 410 ? -15.450  28.546  -28.982 1.00 99.99  ? 414 GLN C NE2 1  
ATOM 2974   N N   . ASN A 1 411 ? -11.330  30.926  -32.692 1.00 30.00  ? 415 ASN C N   1  
ATOM 2975   C CA  . ASN A 1 411 ? -10.621  31.515  -33.827 1.00 30.00  ? 415 ASN C CA  1  
ATOM 2976   C C   . ASN A 1 411 ? -11.254  32.851  -34.215 1.00 30.00  ? 415 ASN C C   1  
ATOM 2977   O O   . ASN A 1 411 ? -12.045  33.408  -33.460 1.00 30.00  ? 415 ASN C O   1  
ATOM 2978   C CB  . ASN A 1 411 ? -10.683  30.574  -35.023 1.00 99.99  ? 415 ASN C CB  1  
ATOM 2979   C CG  . ASN A 1 411 ? -12.123  30.289  -35.425 1.00 99.99  ? 415 ASN C CG  1  
ATOM 2980   O OD1 . ASN A 1 411 ? -12.598  30.786  -36.444 1.00 99.99  ? 415 ASN C OD1 1  
ATOM 2981   N ND2 . ASN A 1 411 ? -12.821  29.489  -34.617 1.00 99.99  ? 415 ASN C ND2 1  
ATOM 2982   N N   . MET A 1 412 ? -10.918  33.354  -35.400 1.00 30.00  ? 416 MET C N   1  
ATOM 2983   C CA  . MET A 1 412 ? -11.456  34.627  -35.871 1.00 30.00  ? 416 MET C CA  1  
ATOM 2984   C C   . MET A 1 412 ? -12.926  34.625  -36.295 1.00 30.00  ? 416 MET C C   1  
ATOM 2985   O O   . MET A 1 412 ? -13.580  35.662  -36.252 1.00 30.00  ? 416 MET C O   1  
ATOM 2986   C CB  . MET A 1 412 ? -10.673  35.103  -37.089 1.00 99.99  ? 416 MET C CB  1  
ATOM 2987   C CG  . MET A 1 412 ? -9.207   35.283  -36.715 1.00 99.99  ? 416 MET C CG  1  
ATOM 2988   S SD  . MET A 1 412 ? -8.420   36.464  -37.840 1.00 99.99  ? 416 MET C SD  1  
ATOM 2989   C CE  . MET A 1 412 ? -8.612   35.594  -39.381 1.00 99.99  ? 416 MET C CE  1  
ATOM 2990   N N   . ASN A 1 413 ? -13.459  33.478  -36.707 1.00 30.00  ? 417 ASN C N   1  
ATOM 2991   C CA  . ASN A 1 413 ? -14.858  33.417  -37.122 1.00 30.00  ? 417 ASN C CA  1  
ATOM 2992   C C   . ASN A 1 413 ? -15.723  32.854  -36.025 1.00 30.00  ? 417 ASN C C   1  
ATOM 2993   O O   . ASN A 1 413 ? -16.860  33.283  -35.846 1.00 30.00  ? 417 ASN C O   1  
ATOM 2994   C CB  . ASN A 1 413 ? -14.997  32.528  -38.353 1.00 99.99  ? 417 ASN C CB  1  
ATOM 2995   C CG  . ASN A 1 413 ? -14.709  31.073  -38.013 1.00 99.99  ? 417 ASN C CG  1  
ATOM 2996   O OD1 . ASN A 1 413 ? -13.751  30.493  -38.518 1.00 99.99  ? 417 ASN C OD1 1  
ATOM 2997   N ND2 . ASN A 1 413 ? -15.544  30.482  -37.154 1.00 99.99  ? 417 ASN C ND2 1  
ATOM 2998   N N   . GLN A 1 414 ? -15.183  31.890  -35.296 1.00 30.00  ? 418 GLN C N   1  
ATOM 2999   C CA  . GLN A 1 414 ? -15.900  31.273  -34.196 1.00 30.00  ? 418 GLN C CA  1  
ATOM 3000   C C   . GLN A 1 414 ? -16.409  32.400  -33.314 1.00 30.00  ? 418 GLN C C   1  
ATOM 3001   O O   . GLN A 1 414 ? -17.406  32.256  -32.607 1.00 30.00  ? 418 GLN C O   1  
ATOM 3002   C CB  . GLN A 1 414 ? -14.965  30.355  -33.414 1.00 99.99  ? 418 GLN C CB  1  
ATOM 3003   C CG  . GLN A 1 414 ? -15.741  29.143  -32.913 1.00 99.99  ? 418 GLN C CG  1  
ATOM 3004   C CD  . GLN A 1 414 ? -16.806  29.551  -31.907 1.00 99.99  ? 418 GLN C CD  1  
ATOM 3005   O OE1 . GLN A 1 414 ? -16.952  30.730  -31.595 1.00 99.99  ? 418 GLN C OE1 1  
ATOM 3006   N NE2 . GLN A 1 414 ? -17.552  28.569  -31.396 1.00 99.99  ? 418 GLN C NE2 1  
ATOM 3007   N N   . VAL A 1 415 ? -15.700  33.524  -33.368 1.00 30.00  ? 419 VAL C N   1  
ATOM 3008   C CA  . VAL A 1 415 ? -16.045  34.706  -32.594 1.00 30.00  ? 419 VAL C CA  1  
ATOM 3009   C C   . VAL A 1 415 ? -17.136  35.522  -33.287 1.00 30.00  ? 419 VAL C C   1  
ATOM 3010   O O   . VAL A 1 415 ? -18.237  35.664  -32.749 1.00 30.00  ? 419 VAL C O   1  
ATOM 3011   C CB  . VAL A 1 415 ? -14.813  35.592  -32.425 1.00 99.99  ? 419 VAL C CB  1  
ATOM 3012   C CG1 . VAL A 1 415 ? -13.721  34.813  -31.697 1.00 99.99  ? 419 VAL C CG1 1  
ATOM 3013   C CG2 . VAL A 1 415 ? -14.304  36.021  -33.796 1.00 99.99  ? 419 VAL C CG2 1  
ATOM 3014   N N   . VAL A 1 416 ? -16.845  36.057  -34.471 1.00 30.00  ? 420 VAL C N   1  
ATOM 3015   C CA  . VAL A 1 416 ? -17.831  36.851  -35.202 1.00 30.00  ? 420 VAL C CA  1  
ATOM 3016   C C   . VAL A 1 416 ? -19.175  36.132  -35.329 1.00 30.00  ? 420 VAL C C   1  
ATOM 3017   O O   . VAL A 1 416 ? -20.208  36.752  -35.589 1.00 30.00  ? 420 VAL C O   1  
ATOM 3018   C CB  . VAL A 1 416 ? -17.320  37.145  -36.607 1.00 99.99  ? 420 VAL C CB  1  
ATOM 3019   C CG1 . VAL A 1 416 ? -16.011  37.923  -36.522 1.00 99.99  ? 420 VAL C CG1 1  
ATOM 3020   C CG2 . VAL A 1 416 ? -17.084  35.832  -37.348 1.00 99.99  ? 420 VAL C CG2 1  
ATOM 3021   N N   . ASN A 1 417 ? -19.162  34.820  -35.153 1.00 30.00  ? 421 ASN C N   1  
ATOM 3022   C CA  . ASN A 1 417 ? -20.391  34.072  -35.255 1.00 30.00  ? 421 ASN C CA  1  
ATOM 3023   C C   . ASN A 1 417 ? -21.028  33.921  -33.882 1.00 30.00  ? 421 ASN C C   1  
ATOM 3024   O O   . ASN A 1 417 ? -22.231  33.691  -33.787 1.00 30.00  ? 421 ASN C O   1  
ATOM 3025   C CB  . ASN A 1 417 ? -20.111  32.687  -35.825 1.00 99.99  ? 421 ASN C CB  1  
ATOM 3026   C CG  . ASN A 1 417 ? -19.559  32.778  -37.241 1.00 99.99  ? 421 ASN C CG  1  
ATOM 3027   O OD1 . ASN A 1 417 ? -20.168  33.404  -38.108 1.00 99.99  ? 421 ASN C OD1 1  
ATOM 3028   N ND2 . ASN A 1 417 ? -18.405  32.152  -37.473 1.00 99.99  ? 421 ASN C ND2 1  
ATOM 3029   N N   . SER A 1 418 ? -20.243  34.041  -32.817 1.00 30.00  ? 422 SER C N   1  
ATOM 3030   C CA  . SER A 1 418 ? -20.816  33.925  -31.475 1.00 30.00  ? 422 SER C CA  1  
ATOM 3031   C C   . SER A 1 418 ? -21.305  35.325  -31.112 1.00 30.00  ? 422 SER C C   1  
ATOM 3032   O O   . SER A 1 418 ? -22.076  35.513  -30.168 1.00 30.00  ? 422 SER C O   1  
ATOM 3033   C CB  . SER A 1 418 ? -19.750  33.445  -30.496 1.00 99.99  ? 422 SER C CB  1  
ATOM 3034   O OG  . SER A 1 418 ? -18.762  34.464  -30.326 1.00 99.99  ? 422 SER C OG  1  
ATOM 3035   N N   . VAL A 1 419 ? -20.842  36.304  -31.877 1.00 30.00  ? 423 VAL C N   1  
ATOM 3036   C CA  . VAL A 1 419 ? -21.244  37.682  -31.673 1.00 30.00  ? 423 VAL C CA  1  
ATOM 3037   C C   . VAL A 1 419 ? -22.690  37.644  -32.122 1.00 30.00  ? 423 VAL C C   1  
ATOM 3038   O O   . VAL A 1 419 ? -23.598  38.040  -31.385 1.00 30.00  ? 423 VAL C O   1  
ATOM 3039   C CB  . VAL A 1 419 ? -20.377  38.607  -32.520 1.00 99.99  ? 423 VAL C CB  1  
ATOM 3040   C CG1 . VAL A 1 419 ? -18.914  38.445  -32.115 1.00 99.99  ? 423 VAL C CG1 1  
ATOM 3041   C CG2 . VAL A 1 419 ? -20.539  38.249  -33.995 1.00 99.99  ? 423 VAL C CG2 1  
ATOM 3042   N N   . GLY A 1 420 ? -22.892  37.148  -33.339 1.00 30.00  ? 424 GLY C N   1  
ATOM 3043   C CA  . GLY A 1 420 ? -24.231  37.042  -33.870 1.00 30.00  ? 424 GLY C CA  1  
ATOM 3044   C C   . GLY A 1 420 ? -25.087  36.163  -32.962 1.00 30.00  ? 424 GLY C C   1  
ATOM 3045   O O   . GLY A 1 420 ? -26.253  36.457  -32.725 1.00 30.00  ? 424 GLY C O   1  
ATOM 3046   N N   . ALA A 1 421 ? -24.520  35.085  -32.436 1.00 30.00  ? 425 ALA C N   1  
ATOM 3047   C CA  . ALA A 1 421 ? -25.296  34.194  -31.567 1.00 30.00  ? 425 ALA C CA  1  
ATOM 3048   C C   . ALA A 1 421 ? -25.831  34.962  -30.373 1.00 30.00  ? 425 ALA C C   1  
ATOM 3049   O O   . ALA A 1 421 ? -26.922  34.680  -29.858 1.00 30.00  ? 425 ALA C O   1  
ATOM 3050   C CB  . ALA A 1 421 ? -24.418  33.023  -31.099 1.00 30.00  ? 425 ALA C CB  1  
ATOM 3051   N N   . LEU A 1 422 ? -25.047  35.940  -29.941 1.00 30.00  ? 426 LEU C N   1  
ATOM 3052   C CA  . LEU A 1 422 ? -25.399  36.776  -28.804 1.00 30.00  ? 426 LEU C CA  1  
ATOM 3053   C C   . LEU A 1 422 ? -26.458  37.817  -29.174 1.00 30.00  ? 426 LEU C C   1  
ATOM 3054   O O   . LEU A 1 422 ? -27.450  37.980  -28.457 1.00 30.00  ? 426 LEU C O   1  
ATOM 3055   C CB  . LEU A 1 422 ? -24.163  37.511  -28.299 1.00 99.99  ? 426 LEU C CB  1  
ATOM 3056   C CG  . LEU A 1 422 ? -23.529  36.721  -27.160 1.00 99.99  ? 426 LEU C CG  1  
ATOM 3057   C CD1 . LEU A 1 422 ? -22.505  37.598  -26.442 1.00 99.99  ? 426 LEU C CD1 1  
ATOM 3058   C CD2 . LEU A 1 422 ? -24.609  36.289  -26.177 1.00 99.99  ? 426 LEU C CD2 1  
ATOM 3059   N N   . ALA A 1 423 ? -26.235  38.525  -30.283 1.00 30.00  ? 427 ALA C N   1  
ATOM 3060   C CA  . ALA A 1 423 ? -27.186  39.533  -30.741 1.00 30.00  ? 427 ALA C CA  1  
ATOM 3061   C C   . ALA A 1 423 ? -28.563  38.849  -30.801 1.00 30.00  ? 427 ALA C C   1  
ATOM 3062   O O   . ALA A 1 423 ? -29.490  39.233  -30.078 1.00 30.00  ? 427 ALA C O   1  
ATOM 3063   C CB  . ALA A 1 423 ? -26.772  40.060  -32.129 1.00 30.00  ? 427 ALA C CB  1  
ATOM 3064   N N   . LYS A 1 424 ? -28.666  37.822  -31.652 1.00 30.00  ? 428 LYS C N   1  
ATOM 3065   C CA  . LYS A 1 424 ? -29.899  37.044  -31.842 1.00 30.00  ? 428 LYS C CA  1  
ATOM 3066   C C   . LYS A 1 424 ? -30.516  36.610  -30.516 1.00 30.00  ? 428 LYS C C   1  
ATOM 3067   O O   . LYS A 1 424 ? -31.695  36.858  -30.266 1.00 30.00  ? 428 LYS C O   1  
ATOM 3068   C CB  . LYS A 1 424 ? -29.601  35.790  -32.655 1.00 99.99  ? 428 LYS C CB  1  
ATOM 3069   C CG  . LYS A 1 424 ? -29.021  36.184  -34.006 1.00 99.99  ? 428 LYS C CG  1  
ATOM 3070   C CD  . LYS A 1 424 ? -28.815  34.934  -34.857 1.00 99.99  ? 428 LYS C CD  1  
ATOM 3071   C CE  . LYS A 1 424 ? -28.258  35.334  -36.219 1.00 99.99  ? 428 LYS C CE  1  
ATOM 3072   N NZ  . LYS A 1 424 ? -28.502  34.251  -37.186 1.00 99.99  ? 428 LYS C NZ  1  
ATOM 3073   N N   . SER A 1 425 ? -29.731  35.969  -29.661 1.00 30.00  ? 429 SER C N   1  
ATOM 3074   C CA  . SER A 1 425 ? -30.260  35.506  -28.379 1.00 30.00  ? 429 SER C CA  1  
ATOM 3075   C C   . SER A 1 425 ? -30.751  36.607  -27.434 1.00 30.00  ? 429 SER C C   1  
ATOM 3076   O O   . SER A 1 425 ? -31.663  36.388  -26.623 1.00 30.00  ? 429 SER C O   1  
ATOM 3077   C CB  . SER A 1 425 ? -29.182  34.742  -27.617 1.00 99.99  ? 429 SER C CB  1  
ATOM 3078   O OG  . SER A 1 425 ? -28.145  35.644  -27.221 1.00 99.99  ? 429 SER C OG  1  
ATOM 3079   N N   . LEU A 1 426 ? -30.146  37.792  -27.518 1.00 30.00  ? 430 LEU C N   1  
ATOM 3080   C CA  . LEU A 1 426 ? -30.570  38.882  -26.656 1.00 30.00  ? 430 LEU C CA  1  
ATOM 3081   C C   . LEU A 1 426 ? -31.960  39.290  -27.130 1.00 30.00  ? 430 LEU C C   1  
ATOM 3082   O O   . LEU A 1 426 ? -32.948  39.250  -26.385 1.00 30.00  ? 430 LEU C O   1  
ATOM 3083   C CB  . LEU A 1 426 ? -29.594  40.046  -26.776 1.00 99.99  ? 430 LEU C CB  1  
ATOM 3084   C CG  . LEU A 1 426 ? -28.549  39.955  -25.667 1.00 99.99  ? 430 LEU C CG  1  
ATOM 3085   C CD1 . LEU A 1 426 ? -27.782  41.268  -25.580 1.00 99.99  ? 430 LEU C CD1 1  
ATOM 3086   C CD2 . LEU A 1 426 ? -29.243  39.678  -24.338 1.00 99.99  ? 430 LEU C CD2 1  
ATOM 3087   N N   . TYR A 1 427 ? -32.009  39.678  -28.393 1.00 30.00  ? 431 TYR C N   1  
ATOM 3088   C CA  . TYR A 1 427 ? -33.231  40.107  -29.040 1.00 30.00  ? 431 TYR C CA  1  
ATOM 3089   C C   . TYR A 1 427 ? -34.388  39.128  -28.879 1.00 30.00  ? 431 TYR C C   1  
ATOM 3090   O O   . TYR A 1 427 ? -35.548  39.540  -28.806 1.00 30.00  ? 431 TYR C O   1  
ATOM 3091   C CB  . TYR A 1 427 ? -32.992  40.277  -30.536 1.00 99.99  ? 431 TYR C CB  1  
ATOM 3092   C CG  . TYR A 1 427 ? -34.270  40.727  -31.203 1.00 99.99  ? 431 TYR C CG  1  
ATOM 3093   C CD1 . TYR A 1 427 ? -34.620  42.084  -31.202 1.00 99.99  ? 431 TYR C CD1 1  
ATOM 3094   C CD2 . TYR A 1 427 ? -35.104  39.788  -31.822 1.00 99.99  ? 431 TYR C CD2 1  
ATOM 3095   C CE1 . TYR A 1 427 ? -35.805  42.500  -31.822 1.00 99.99  ? 431 TYR C CE1 1  
ATOM 3096   C CE2 . TYR A 1 427 ? -36.290  40.207  -32.441 1.00 99.99  ? 431 TYR C CE2 1  
ATOM 3097   C CZ  . TYR A 1 427 ? -36.637  41.562  -32.440 1.00 99.99  ? 431 TYR C CZ  1  
ATOM 3098   O OH  . TYR A 1 427 ? -37.790  41.969  -33.041 1.00 99.99  ? 431 TYR C OH  1  
ATOM 3099   N N   . ASP A 1 428 ? -34.096  37.835  -28.822 1.00 30.00  ? 432 ASP C N   1  
ATOM 3100   C CA  . ASP A 1 428 ? -35.167  36.868  -28.669 1.00 30.00  ? 432 ASP C CA  1  
ATOM 3101   C C   . ASP A 1 428 ? -35.725  37.051  -27.263 1.00 30.00  ? 432 ASP C C   1  
ATOM 3102   O O   . ASP A 1 428 ? -36.934  37.210  -27.094 1.00 30.00  ? 432 ASP C O   1  
ATOM 3103   C CB  . ASP A 1 428 ? -34.625  35.456  -28.853 1.00 99.99  ? 432 ASP C CB  1  
ATOM 3104   C CG  . ASP A 1 428 ? -34.227  35.247  -30.312 1.00 99.99  ? 432 ASP C CG  1  
ATOM 3105   O OD1 . ASP A 1 428 ? -35.142  35.319  -31.174 1.00 99.99  ? 432 ASP C OD1 1  
ATOM 3106   O OD2 . ASP A 1 428 ? -33.009  35.023  -30.551 1.00 99.99  ? 432 ASP C OD2 1  
ATOM 3107   N N   . ARG A 1 429 ? -34.731  37.449  -26.066 1.00 30.00  ? 433 ARG C N   1  
ATOM 3108   C CA  . ARG A 1 429 ? -35.125  37.657  -24.662 1.00 30.00  ? 433 ARG C CA  1  
ATOM 3109   C C   . ARG A 1 429 ? -35.876  38.986  -24.507 1.00 30.00  ? 433 ARG C C   1  
ATOM 3110   O O   . ARG A 1 429 ? -36.860  39.071  -23.767 1.00 30.00  ? 433 ARG C O   1  
ATOM 3111   C CB  . ARG A 1 429 ? -33.884  37.689  -23.775 1.00 99.99  ? 433 ARG C CB  1  
ATOM 3112   C CG  . ARG A 1 429 ? -34.304  37.782  -22.314 1.00 99.99  ? 433 ARG C CG  1  
ATOM 3113   C CD  . ARG A 1 429 ? -33.067  37.937  -21.438 1.00 99.99  ? 433 ARG C CD  1  
ATOM 3114   N NE  . ARG A 1 429 ? -32.462  39.277  -21.604 1.00 99.99  ? 433 ARG C NE  1  
ATOM 3115   C CZ  . ARG A 1 429 ? -31.419  39.693  -20.895 1.00 99.99  ? 433 ARG C CZ  1  
ATOM 3116   N NH1 . ARG A 1 429 ? -30.838  38.930  -19.976 1.00 99.99  ? 433 ARG C NH1 1  
ATOM 3117   N NH2 . ARG A 1 429 ? -30.955  40.919  -21.128 1.00 99.99  ? 433 ARG C NH2 1  
ATOM 3118   N N   . MET A 1 430 ? -35.401  40.013  -25.200 1.00 30.00  ? 434 MET C N   1  
ATOM 3119   C CA  . MET A 1 430 ? -36.030  41.318  -25.154 1.00 30.00  ? 434 MET C CA  1  
ATOM 3120   C C   . MET A 1 430 ? -37.484  41.155  -25.571 1.00 30.00  ? 434 MET C C   1  
ATOM 3121   O O   . MET A 1 430 ? -38.402  41.475  -24.805 1.00 30.00  ? 434 MET C O   1  
ATOM 3122   C CB  . MET A 1 430 ? -35.320  42.271  -26.110 1.00 99.99  ? 434 MET C CB  1  
ATOM 3123   C CG  . MET A 1 430 ? -35.941  43.659  -26.001 1.00 99.99  ? 434 MET C CG  1  
ATOM 3124   S SD  . MET A 1 430 ? -34.915  44.868  -26.873 1.00 99.99  ? 434 MET C SD  1  
ATOM 3125   C CE  . MET A 1 430 ? -35.905  46.330  -26.659 1.00 99.99  ? 434 MET C CE  1  
ATOM 3126   N N   . PHE A 1 431 ? -37.682  40.645  -26.791 1.00 30.00  ? 435 PHE C N   1  
ATOM 3127   C CA  . PHE A 1 431 ? -39.019  40.423  -27.349 1.00 30.00  ? 435 PHE C CA  1  
ATOM 3128   C C   . PHE A 1 431 ? -39.903  39.594  -26.399 1.00 30.00  ? 435 PHE C C   1  
ATOM 3129   O O   . PHE A 1 431 ? -41.092  39.885  -26.203 1.00 30.00  ? 435 PHE C O   1  
ATOM 3130   C CB  . PHE A 1 431 ? -38.911  39.672  -28.672 1.00 99.99  ? 435 PHE C CB  1  
ATOM 3131   C CG  . PHE A 1 431 ? -40.292  39.446  -29.239 1.00 99.99  ? 435 PHE C CG  1  
ATOM 3132   C CD1 . PHE A 1 431 ? -40.920  40.459  -29.976 1.00 99.99  ? 435 PHE C CD1 1  
ATOM 3133   C CD2 . PHE A 1 431 ? -40.946  38.227  -29.030 1.00 99.99  ? 435 PHE C CD2 1  
ATOM 3134   C CE1 . PHE A 1 431 ? -42.200  40.252  -30.501 1.00 99.99  ? 435 PHE C CE1 1  
ATOM 3135   C CE2 . PHE A 1 431 ? -42.226  38.019  -29.555 1.00 99.99  ? 435 PHE C CE2 1  
ATOM 3136   C CZ  . PHE A 1 431 ? -42.853  39.033  -30.291 1.00 99.99  ? 435 PHE C CZ  1  
ATOM 3137   N N   . ASN A 1 432 ? -39.331  38.566  -25.794 1.00 30.00  ? 436 ASN C N   1  
ATOM 3138   C CA  . ASN A 1 432 ? -40.117  37.752  -24.887 1.00 30.00  ? 436 ASN C CA  1  
ATOM 3139   C C   . ASN A 1 432 ? -40.461  38.535  -23.638 1.00 30.00  ? 436 ASN C C   1  
ATOM 3140   O O   . ASN A 1 432 ? -41.612  38.534  -23.218 1.00 30.00  ? 436 ASN C O   1  
ATOM 3141   C CB  . ASN A 1 432 ? -39.327  36.511  -24.488 1.00 99.99  ? 436 ASN C CB  1  
ATOM 3142   C CG  . ASN A 1 432 ? -39.037  35.629  -25.694 1.00 99.99  ? 436 ASN C CG  1  
ATOM 3143   O OD1 . ASN A 1 432 ? -39.951  35.250  -26.422 1.00 99.99  ? 436 ASN C OD1 1  
ATOM 3144   N ND2 . ASN A 1 432 ? -37.758  35.308  -25.906 1.00 99.99  ? 436 ASN C ND2 1  
ATOM 3145   N N   . TRP A 1 433 ? -39.482  39.217  -23.042 1.00 30.00  ? 437 TRP C N   1  
ATOM 3146   C CA  . TRP A 1 433 ? -39.761  39.996  -21.841 1.00 30.00  ? 437 TRP C CA  1  
ATOM 3147   C C   . TRP A 1 433 ? -40.800  41.066  -22.208 1.00 30.00  ? 437 TRP C C   1  
ATOM 3148   O O   . TRP A 1 433 ? -41.801  41.254  -21.493 1.00 30.00  ? 437 TRP C O   1  
ATOM 3149   C CB  . TRP A 1 433 ? -38.479  40.658  -21.345 1.00 99.99  ? 437 TRP C CB  1  
ATOM 3150   C CG  . TRP A 1 433 ? -38.603  41.383  -20.026 1.00 99.99  ? 437 TRP C CG  1  
ATOM 3151   C CD1 . TRP A 1 433 ? -39.159  42.582  -19.815 1.00 99.99  ? 437 TRP C CD1 1  
ATOM 3152   C CD2 . TRP A 1 433 ? -38.167  40.947  -18.769 1.00 99.99  ? 437 TRP C CD2 1  
ATOM 3153   N NE1 . TRP A 1 433 ? -39.044  42.855  -18.417 1.00 99.99  ? 437 TRP C NE1 1  
ATOM 3154   C CE2 . TRP A 1 433 ? -38.445  41.848  -17.832 1.00 99.99  ? 437 TRP C CE2 1  
ATOM 3155   C CE3 . TRP A 1 433 ? -37.519  39.755  -18.415 1.00 99.99  ? 437 TRP C CE3 1  
ATOM 3156   C CZ2 . TRP A 1 433 ? -38.134  41.698  -16.475 1.00 99.99  ? 437 TRP C CZ2 1  
ATOM 3157   C CZ3 . TRP A 1 433 ? -37.194  39.585  -17.052 1.00 99.99  ? 437 TRP C CZ3 1  
ATOM 3158   C CH2 . TRP A 1 433 ? -37.491  40.517  -16.124 1.00 99.99  ? 437 TRP C CH2 1  
ATOM 3159   N N   . LEU A 1 434 ? -40.570  41.755  -23.324 1.00 30.00  ? 438 LEU C N   1  
ATOM 3160   C CA  . LEU A 1 434 ? -41.490  42.797  -23.780 1.00 30.00  ? 438 LEU C CA  1  
ATOM 3161   C C   . LEU A 1 434 ? -42.950  42.373  -23.762 1.00 30.00  ? 438 LEU C C   1  
ATOM 3162   O O   . LEU A 1 434 ? -43.810  43.128  -23.314 1.00 30.00  ? 438 LEU C O   1  
ATOM 3163   C CB  . LEU A 1 434 ? -41.155  43.200  -25.212 1.00 99.99  ? 438 LEU C CB  1  
ATOM 3164   C CG  . LEU A 1 434 ? -42.191  44.196  -25.718 1.00 99.99  ? 438 LEU C CG  1  
ATOM 3165   C CD1 . LEU A 1 434 ? -41.896  44.538  -27.176 1.00 99.99  ? 438 LEU C CD1 1  
ATOM 3166   C CD2 . LEU A 1 434 ? -43.582  43.582  -25.612 1.00 99.99  ? 438 LEU C CD2 1  
ATOM 3167   N N   . VAL A 1 435 ? -43.234  41.163  -24.245 1.00 30.00  ? 439 VAL C N   1  
ATOM 3168   C CA  . VAL A 1 435 ? -44.610  40.665  -24.286 1.00 30.00  ? 439 VAL C CA  1  
ATOM 3169   C C   . VAL A 1 435 ? -45.151  40.394  -22.884 1.00 30.00  ? 439 VAL C C   1  
ATOM 3170   O O   . VAL A 1 435 ? -46.293  40.731  -22.586 1.00 30.00  ? 439 VAL C O   1  
ATOM 3171   C CB  . VAL A 1 435 ? -44.666  39.363  -25.076 1.00 99.99  ? 439 VAL C CB  1  
ATOM 3172   C CG1 . VAL A 1 435 ? -44.182  39.613  -26.502 1.00 99.99  ? 439 VAL C CG1 1  
ATOM 3173   C CG2 . VAL A 1 435 ? -43.772  38.321  -24.412 1.00 99.99  ? 439 VAL C CG2 1  
ATOM 3174   N N   . ARG A 1 436 ? -44.325  39.785  -22.033 1.00 30.00  ? 440 ARG C N   1  
ATOM 3175   C CA  . ARG A 1 436 ? -44.685  39.453  -20.644 1.00 30.00  ? 440 ARG C CA  1  
ATOM 3176   C C   . ARG A 1 436 ? -45.142  40.722  -19.946 1.00 30.00  ? 440 ARG C C   1  
ATOM 3177   O O   . ARG A 1 436 ? -46.119  40.726  -19.190 1.00 30.00  ? 440 ARG C O   1  
ATOM 3178   C CB  . ARG A 1 436 ? -43.476  38.874  -19.921 1.00 99.99  ? 440 ARG C CB  1  
ATOM 3179   C CG  . ARG A 1 436 ? -43.029  37.594  -20.621 1.00 99.99  ? 440 ARG C CG  1  
ATOM 3180   C CD  . ARG A 1 436 ? -41.745  37.084  -19.973 1.00 99.99  ? 440 ARG C CD  1  
ATOM 3181   N NE  . ARG A 1 436 ? -40.582  37.904  -20.381 1.00 99.99  ? 440 ARG C NE  1  
ATOM 3182   C CZ  . ARG A 1 436 ? -39.357  37.715  -19.895 1.00 99.99  ? 440 ARG C CZ  1  
ATOM 3183   N NH1 . ARG A 1 436 ? -39.091  36.765  -19.001 1.00 99.99  ? 440 ARG C NH1 1  
ATOM 3184   N NH2 . ARG A 1 436 ? -38.383  38.509  -20.330 1.00 99.99  ? 440 ARG C NH2 1  
ATOM 3185   N N   . ARG A 1 437 ? -44.401  41.798  -20.222 1.00 30.00  ? 441 ARG C N   1  
ATOM 3186   C CA  . ARG A 1 437 ? -44.638  43.125  -19.666 1.00 30.00  ? 441 ARG C CA  1  
ATOM 3187   C C   . ARG A 1 437 ? -45.942  43.754  -20.170 1.00 30.00  ? 441 ARG C C   1  
ATOM 3188   O O   . ARG A 1 437 ? -46.700  44.308  -19.383 1.00 30.00  ? 441 ARG C O   1  
ATOM 3189   C CB  . ARG A 1 437 ? -43.496  44.060  -20.049 1.00 99.99  ? 441 ARG C CB  1  
ATOM 3190   C CG  . ARG A 1 437 ? -43.359  45.158  -19.001 1.00 99.99  ? 441 ARG C CG  1  
ATOM 3191   C CD  . ARG A 1 437 ? -42.267  46.134  -19.423 1.00 99.99  ? 441 ARG C CD  1  
ATOM 3192   N NE  . ARG A 1 437 ? -41.010  45.417  -19.744 1.00 99.99  ? 441 ARG C NE  1  
ATOM 3193   C CZ  . ARG A 1 437 ? -40.199  45.784  -20.733 1.00 99.99  ? 441 ARG C CZ  1  
ATOM 3194   N NH1 . ARG A 1 437 ? -40.462  46.833  -21.508 1.00 99.99  ? 441 ARG C NH1 1  
ATOM 3195   N NH2 . ARG A 1 437 ? -39.095  45.067  -20.932 1.00 99.99  ? 441 ARG C NH2 1  
ATOM 3196   N N   . VAL A 1 438 ? -46.198  43.675  -21.475 1.00 30.00  ? 442 VAL C N   1  
ATOM 3197   C CA  . VAL A 1 438 ? -47.419  44.241  -22.028 1.00 30.00  ? 442 VAL C CA  1  
ATOM 3198   C C   . VAL A 1 438 ? -48.644  43.449  -21.567 1.00 30.00  ? 442 VAL C C   1  
ATOM 3199   O O   . VAL A 1 438 ? -49.779  43.892  -21.727 1.00 30.00  ? 442 VAL C O   1  
ATOM 3200   C CB  . VAL A 1 438 ? -47.364  44.206  -23.551 1.00 99.99  ? 442 VAL C CB  1  
ATOM 3201   C CG1 . VAL A 1 438 ? -46.169  45.022  -24.036 1.00 99.99  ? 442 VAL C CG1 1  
ATOM 3202   C CG2 . VAL A 1 438 ? -47.220  42.763  -24.024 1.00 99.99  ? 442 VAL C CG2 1  
ATOM 3203   N N   . ASN A 1 439 ? -48.418  42.281  -20.988 1.00 30.00  ? 443 ASN C N   1  
ATOM 3204   C CA  . ASN A 1 439 ? -49.522  41.466  -20.518 1.00 30.00  ? 443 ASN C CA  1  
ATOM 3205   C C   . ASN A 1 439 ? -49.759  41.848  -19.099 1.00 30.00  ? 443 ASN C C   1  
ATOM 3206   O O   . ASN A 1 439 ? -50.842  41.628  -18.555 1.00 30.00  ? 443 ASN C O   1  
ATOM 3207   C CB  . ASN A 1 439 ? -49.161  39.988  -20.626 1.00 99.99  ? 443 ASN C CB  1  
ATOM 3208   C CG  . ASN A 1 439 ? -50.362  39.105  -20.327 1.00 99.99  ? 443 ASN C CG  1  
ATOM 3209   O OD1 . ASN A 1 439 ? -50.332  38.303  -19.396 1.00 99.99  ? 443 ASN C OD1 1  
ATOM 3210   N ND2 . ASN A 1 439 ? -51.427  39.253  -21.120 1.00 99.99  ? 443 ASN C ND2 1  
ATOM 3211   N N   . LYS A 1 440 ? -48.713  42.406  -18.499 1.00 30.00  ? 444 LYS C N   1  
ATOM 3212   C CA  . LYS A 1 440 ? -48.737  42.875  -17.115 1.00 30.00  ? 444 LYS C CA  1  
ATOM 3213   C C   . LYS A 1 440 ? -49.758  44.007  -17.093 1.00 30.00  ? 444 LYS C C   1  
ATOM 3214   O O   . LYS A 1 440 ? -50.673  44.034  -16.265 1.00 30.00  ? 444 LYS C O   1  
ATOM 3215   C CB  . LYS A 1 440 ? -47.351  43.364  -16.710 1.00 99.99  ? 444 LYS C CB  1  
ATOM 3216   C CG  . LYS A 1 440 ? -47.357  43.758  -15.237 1.00 99.99  ? 444 LYS C CG  1  
ATOM 3217   C CD  . LYS A 1 440 ? -45.928  43.816  -14.717 1.00 99.99  ? 444 LYS C CD  1  
ATOM 3218   C CE  . LYS A 1 440 ? -45.900  44.555  -13.384 1.00 99.99  ? 444 LYS C CE  1  
ATOM 3219   N NZ  . LYS A 1 440 ? -45.990  43.585  -12.282 1.00 99.99  ? 444 LYS C NZ  1  
ATOM 3220   N N   . THR A 1 441 ? -49.571  44.929  -18.030 1.00 30.00  ? 445 THR C N   1  
ATOM 3221   C CA  . THR A 1 441 ? -50.428  46.086  -18.188 1.00 30.00  ? 445 THR C CA  1  
ATOM 3222   C C   . THR A 1 441 ? -51.886  45.703  -18.488 1.00 30.00  ? 445 THR C C   1  
ATOM 3223   O O   . THR A 1 441 ? -52.815  46.403  -18.068 1.00 30.00  ? 445 THR C O   1  
ATOM 3224   C CB  . THR A 1 441 ? -49.927  46.950  -19.342 1.00 99.99  ? 445 THR C CB  1  
ATOM 3225   O OG1 . THR A 1 441 ? -50.115  46.251  -20.576 1.00 99.99  ? 445 THR C OG1 1  
ATOM 3226   C CG2 . THR A 1 441 ? -48.446  47.247  -19.147 1.00 99.99  ? 445 THR C CG2 1  
ATOM 3227   N N   . LEU A 1 442 ? -52.212  44.284  -19.321 1.00 30.00  ? 446 LEU C N   1  
ATOM 3228   C CA  . LEU A 1 442 ? -53.536  43.802  -19.730 1.00 30.00  ? 446 LEU C CA  1  
ATOM 3229   C C   . LEU A 1 442 ? -54.237  42.761  -18.883 1.00 30.00  ? 446 LEU C C   1  
ATOM 3230   O O   . LEU A 1 442 ? -55.472  42.695  -18.908 1.00 30.00  ? 446 LEU C O   1  
ATOM 3231   C CB  . LEU A 1 442 ? -53.453  43.167  -21.112 1.00 99.99  ? 446 LEU C CB  1  
ATOM 3232   C CG  . LEU A 1 442 ? -53.817  44.203  -22.171 1.00 99.99  ? 446 LEU C CG  1  
ATOM 3233   C CD1 . LEU A 1 442 ? -54.057  43.500  -23.506 1.00 99.99  ? 446 LEU C CD1 1  
ATOM 3234   C CD2 . LEU A 1 442 ? -55.083  44.941  -21.748 1.00 99.99  ? 446 LEU C CD2 1  
ATOM 3235   N N   . ASP A 1 443 ? -53.497  41.943  -18.150 1.00 30.00  ? 447 ASP C N   1  
ATOM 3236   C CA  . ASP A 1 443 ? -54.164  40.949  -17.329 1.00 30.00  ? 447 ASP C CA  1  
ATOM 3237   C C   . ASP A 1 443 ? -54.869  41.614  -16.150 1.00 30.00  ? 447 ASP C C   1  
ATOM 3238   O O   . ASP A 1 443 ? -54.481  41.434  -14.996 1.00 30.00  ? 447 ASP C O   1  
ATOM 3239   C CB  . ASP A 1 443 ? -53.146  39.951  -16.793 1.00 99.99  ? 447 ASP C CB  1  
ATOM 3240   C CG  . ASP A 1 443 ? -53.873  38.779  -16.141 1.00 99.99  ? 447 ASP C CG  1  
ATOM 3241   O OD1 . ASP A 1 443 ? -54.310  38.948  -14.972 1.00 99.99  ? 447 ASP C OD1 1  
ATOM 3242   O OD2 . ASP A 1 443 ? -53.987  37.722  -16.821 1.00 99.99  ? 447 ASP C OD2 1  
ATOM 3243   N N   . THR A 1 444 ? -55.910  42.394  -16.419 1.00 30.00  ? 448 THR C N   1  
ATOM 3244   C CA  . THR A 1 444 ? -56.609  43.033  -15.324 1.00 30.00  ? 448 THR C CA  1  
ATOM 3245   C C   . THR A 1 444 ? -57.243  41.889  -14.540 1.00 30.00  ? 448 THR C C   1  
ATOM 3246   O O   . THR A 1 444 ? -57.901  41.023  -15.119 1.00 30.00  ? 448 THR C O   1  
ATOM 3247   C CB  . THR A 1 444 ? -57.667  43.989  -15.871 1.00 99.99  ? 448 THR C CB  1  
ATOM 3248   O OG1 . THR A 1 444 ? -58.701  43.237  -16.512 1.00 99.99  ? 448 THR C OG1 1  
ATOM 3249   C CG2 . THR A 1 444 ? -57.024  44.931  -16.884 1.00 99.99  ? 448 THR C CG2 1  
ATOM 3250   N N   . LYS A 1 445 ? -57.028  41.877  -13.230 1.00 30.00  ? 449 LYS C N   1  
ATOM 3251   C CA  . LYS A 1 445 ? -57.578  40.823  -12.399 1.00 30.00  ? 449 LYS C CA  1  
ATOM 3252   C C   . LYS A 1 445 ? -59.107  40.840  -12.300 1.00 30.00  ? 449 LYS C C   1  
ATOM 3253   O O   . LYS A 1 445 ? -59.673  40.173  -11.442 1.00 30.00  ? 449 LYS C O   1  
ATOM 3254   C CB  . LYS A 1 445 ? -57.038  40.948  -10.979 1.00 99.99  ? 449 LYS C CB  1  
ATOM 3255   C CG  . LYS A 1 445 ? -57.542  39.780  -10.137 1.00 99.99  ? 449 LYS C CG  1  
ATOM 3256   C CD  . LYS A 1 445 ? -56.682  39.644  -8.887  1.00 99.99  ? 449 LYS C CD  1  
ATOM 3257   C CE  . LYS A 1 445 ? -57.386  38.745  -7.877  1.00 99.99  ? 449 LYS C CE  1  
ATOM 3258   N NZ  . LYS A 1 445 ? -56.918  37.359  -8.042  1.00 99.99  ? 449 LYS C NZ  1  
ATOM 3259   N N   . ALA A 1 446 ? -59.768  41.599  -13.177 1.00 30.00  ? 450 ALA C N   1  
ATOM 3260   C CA  . ALA A 1 446 ? -61.234  41.689  -13.192 1.00 30.00  ? 450 ALA C CA  1  
ATOM 3261   C C   . ALA A 1 446 ? -61.866  40.309  -13.395 1.00 30.00  ? 450 ALA C C   1  
ATOM 3262   O O   . ALA A 1 446 ? -61.150  39.311  -13.556 1.00 30.00  ? 450 ALA C O   1  
ATOM 3263   C CB  . ALA A 1 446 ? -61.689  42.650  -14.299 1.00 30.00  ? 450 ALA C CB  1  
ATOM 3264   N N   . LYS A 1 447 ? -63.200  40.242  -13.397 1.00 30.00  ? 451 LYS C N   1  
ATOM 3265   C CA  . LYS A 1 447 ? -63.904  38.963  -13.556 1.00 30.00  ? 451 LYS C CA  1  
ATOM 3266   C C   . LYS A 1 447 ? -64.171  38.528  -14.998 1.00 30.00  ? 451 LYS C C   1  
ATOM 3267   O O   . LYS A 1 447 ? -64.843  39.234  -15.766 1.00 30.00  ? 451 LYS C O   1  
ATOM 3268   C CB  . LYS A 1 447 ? -65.266  39.033  -12.876 1.00 99.99  ? 451 LYS C CB  1  
ATOM 3269   C CG  . LYS A 1 447 ? -65.949  37.674  -12.961 1.00 99.99  ? 451 LYS C CG  1  
ATOM 3270   C CD  . LYS A 1 447 ? -67.070  37.599  -11.930 1.00 99.99  ? 451 LYS C CD  1  
ATOM 3271   C CE  . LYS A 1 447 ? -67.980  36.420  -12.251 1.00 99.99  ? 451 LYS C CE  1  
ATOM 3272   N NZ  . LYS A 1 447 ? -67.546  35.243  -11.484 1.00 99.99  ? 451 LYS C NZ  1  
ATOM 3273   N N   . ARG A 1 448 ? -63.650  37.349  -15.341 1.00 30.00  ? 452 ARG C N   1  
ATOM 3274   C CA  . ARG A 1 448 ? -63.787  36.777  -16.681 1.00 30.00  ? 452 ARG C CA  1  
ATOM 3275   C C   . ARG A 1 448 ? -64.818  35.659  -16.824 1.00 30.00  ? 452 ARG C C   1  
ATOM 3276   O O   . ARG A 1 448 ? -64.948  34.787  -15.963 1.00 30.00  ? 452 ARG C O   1  
ATOM 3277   C CB  . ARG A 1 448 ? -62.457  36.182  -17.129 1.00 99.99  ? 452 ARG C CB  1  
ATOM 3278   C CG  . ARG A 1 448 ? -61.358  37.229  -16.992 1.00 99.99  ? 452 ARG C CG  1  
ATOM 3279   C CD  . ARG A 1 448 ? -60.044  36.660  -17.509 1.00 99.99  ? 452 ARG C CD  1  
ATOM 3280   N NE  . ARG A 1 448 ? -58.915  37.561  -17.195 1.00 99.99  ? 452 ARG C NE  1  
ATOM 3281   C CZ  . ARG A 1 448 ? -57.644  37.252  -17.454 1.00 99.99  ? 452 ARG C CZ  1  
ATOM 3282   N NH1 . ARG A 1 448 ? -57.303  36.093  -18.014 1.00 99.99  ? 452 ARG C NH1 1  
ATOM 3283   N NH2 . ARG A 1 448 ? -56.706  38.136  -17.131 1.00 99.99  ? 452 ARG C NH2 1  
ATOM 3284   N N   . ASN A 1 449 ? -65.544  35.710  -17.938 1.00 30.00  ? 453 ASN C N   1  
ATOM 3285   C CA  . ASN A 1 449 ? -66.566  34.724  -18.261 1.00 30.00  ? 453 ASN C CA  1  
ATOM 3286   C C   . ASN A 1 449 ? -66.003  33.898  -19.410 1.00 30.00  ? 453 ASN C C   1  
ATOM 3287   O O   . ASN A 1 449 ? -65.461  32.810  -19.205 1.00 30.00  ? 453 ASN C O   1  
ATOM 3288   C CB  . ASN A 1 449 ? -67.854  35.427  -18.671 1.00 99.99  ? 453 ASN C CB  1  
ATOM 3289   C CG  . ASN A 1 449 ? -68.457  36.197  -17.506 1.00 99.99  ? 453 ASN C CG  1  
ATOM 3290   O OD1 . ASN A 1 449 ? -68.585  37.419  -17.563 1.00 99.99  ? 453 ASN C OD1 1  
ATOM 3291   N ND2 . ASN A 1 449 ? -68.825  35.477  -16.442 1.00 99.99  ? 453 ASN C ND2 1  
ATOM 3292   N N   . TYR A 1 450 ? -66.130  34.443  -20.614 1.00 30.00  ? 454 TYR C N   1  
ATOM 3293   C CA  . TYR A 1 450 ? -65.642  33.779  -21.818 1.00 30.00  ? 454 TYR C CA  1  
ATOM 3294   C C   . TYR A 1 450 ? -64.753  34.732  -22.571 1.00 30.00  ? 454 TYR C C   1  
ATOM 3295   O O   . TYR A 1 450 ? -64.576  35.875  -22.159 1.00 30.00  ? 454 TYR C O   1  
ATOM 3296   C CB  . TYR A 1 450 ? -66.820  33.373  -22.698 1.00 99.99  ? 454 TYR C CB  1  
ATOM 3297   C CG  . TYR A 1 450 ? -67.475  34.610  -23.267 1.00 99.99  ? 454 TYR C CG  1  
ATOM 3298   C CD1 . TYR A 1 450 ? -68.515  35.233  -22.566 1.00 99.99  ? 454 TYR C CD1 1  
ATOM 3299   C CD2 . TYR A 1 450 ? -67.044  35.133  -24.490 1.00 99.99  ? 454 TYR C CD2 1  
ATOM 3300   C CE1 . TYR A 1 450 ? -69.123  36.380  -23.093 1.00 99.99  ? 454 TYR C CE1 1  
ATOM 3301   C CE2 . TYR A 1 450 ? -67.651  36.276  -25.018 1.00 99.99  ? 454 TYR C CE2 1  
ATOM 3302   C CZ  . TYR A 1 450 ? -68.692  36.902  -24.319 1.00 99.99  ? 454 TYR C CZ  1  
ATOM 3303   O OH  . TYR A 1 450 ? -69.284  38.015  -24.829 1.00 99.99  ? 454 TYR C OH  1  
ATOM 3304   N N   . TYR A 1 451 ? -64.188  34.261  -23.681 1.00 30.00  ? 455 TYR C N   1  
ATOM 3305   C CA  . TYR A 1 451 ? -63.323  35.116  -24.484 1.00 30.00  ? 455 TYR C CA  1  
ATOM 3306   C C   . TYR A 1 451 ? -63.446  34.843  -25.956 1.00 30.00  ? 455 TYR C C   1  
ATOM 3307   O O   . TYR A 1 451 ? -64.138  33.917  -26.387 1.00 30.00  ? 455 TYR C O   1  
ATOM 3308   C CB  . TYR A 1 451 ? -61.865  34.897  -24.089 1.00 99.99  ? 455 TYR C CB  1  
ATOM 3309   C CG  . TYR A 1 451 ? -61.452  33.489  -24.451 1.00 99.99  ? 455 TYR C CG  1  
ATOM 3310   C CD1 . TYR A 1 451 ? -61.017  33.200  -25.749 1.00 99.99  ? 455 TYR C CD1 1  
ATOM 3311   C CD2 . TYR A 1 451 ? -61.507  32.477  -23.487 1.00 99.99  ? 455 TYR C CD2 1  
ATOM 3312   C CE1 . TYR A 1 451 ? -60.634  31.897  -26.085 1.00 99.99  ? 455 TYR C CE1 1  
ATOM 3313   C CE2 . TYR A 1 451 ? -61.123  31.172  -23.822 1.00 99.99  ? 455 TYR C CE2 1  
ATOM 3314   C CZ  . TYR A 1 451 ? -60.688  30.882  -25.120 1.00 99.99  ? 455 TYR C CZ  1  
ATOM 3315   O OH  . TYR A 1 451 ? -60.316  29.614  -25.446 1.00 99.99  ? 455 TYR C OH  1  
ATOM 3316   N N   . ILE A 1 452 ? -62.753  35.671  -26.715 1.00 30.00  ? 456 ILE C N   1  
ATOM 3317   C CA  . ILE A 1 452 ? -62.724  35.580  -28.155 1.00 30.00  ? 456 ILE C CA  1  
ATOM 3318   C C   . ILE A 1 452 ? -61.269  35.740  -28.588 1.00 30.00  ? 456 ILE C C   1  
ATOM 3319   O O   . ILE A 1 452 ? -60.731  36.840  -28.517 1.00 30.00  ? 456 ILE C O   1  
ATOM 3320   C CB  . ILE A 1 452 ? -63.582  36.687  -28.762 1.00 99.99  ? 456 ILE C CB  1  
ATOM 3321   C CG1 . ILE A 1 452 ? -63.369  36.727  -30.270 1.00 99.99  ? 456 ILE C CG1 1  
ATOM 3322   C CG2 . ILE A 1 452 ? -63.187  38.028  -28.155 1.00 99.99  ? 456 ILE C CG2 1  
ATOM 3323   C CD1 . ILE A 1 452 ? -63.350  35.303  -30.820 1.00 99.99  ? 456 ILE C CD1 1  
ATOM 3324   N N   . GLY A 1 453 ? -60.628  34.661  -29.029 1.00 30.00  ? 457 GLY C N   1  
ATOM 3325   C CA  . GLY A 1 453 ? -59.244  34.768  -29.465 1.00 30.00  ? 457 GLY C CA  1  
ATOM 3326   C C   . GLY A 1 453 ? -59.148  35.144  -30.939 1.00 30.00  ? 457 GLY C C   1  
ATOM 3327   O O   . GLY A 1 453 ? -60.133  35.077  -31.665 1.00 30.00  ? 457 GLY C O   1  
ATOM 3328   N N   . VAL A 1 454 ? -57.978  35.572  -31.394 1.00 30.00  ? 458 VAL C N   1  
ATOM 3329   C CA  . VAL A 1 454 ? -57.825  35.915  -32.795 1.00 30.00  ? 458 VAL C CA  1  
ATOM 3330   C C   . VAL A 1 454 ? -56.470  35.327  -33.111 1.00 30.00  ? 458 VAL C C   1  
ATOM 3331   O O   . VAL A 1 454 ? -55.530  35.533  -32.362 1.00 30.00  ? 458 VAL C O   1  
ATOM 3332   C CB  . VAL A 1 454 ? -57.872  37.429  -32.967 1.00 99.99  ? 458 VAL C CB  1  
ATOM 3333   C CG1 . VAL A 1 454 ? -57.662  37.782  -34.438 1.00 99.99  ? 458 VAL C CG1 1  
ATOM 3334   C CG2 . VAL A 1 454 ? -59.228  37.950  -32.512 1.00 99.99  ? 458 VAL C CG2 1  
ATOM 3335   N N   . LEU A 1 455 ? -56.381  34.572  -34.203 1.00 30.00  ? 459 LEU C N   1  
ATOM 3336   C CA  . LEU A 1 455 ? -55.131  33.940  -34.577 1.00 30.00  ? 459 LEU C CA  1  
ATOM 3337   C C   . LEU A 1 455 ? -54.598  34.506  -35.866 1.00 30.00  ? 459 LEU C C   1  
ATOM 3338   O O   . LEU A 1 455 ? -55.272  34.478  -36.884 1.00 30.00  ? 459 LEU C O   1  
ATOM 3339   C CB  . LEU A 1 455 ? -55.344  32.442  -34.762 1.00 99.99  ? 459 LEU C CB  1  
ATOM 3340   C CG  . LEU A 1 455 ? -54.996  31.714  -33.466 1.00 99.99  ? 459 LEU C CG  1  
ATOM 3341   C CD1 . LEU A 1 455 ? -54.888  30.215  -33.737 1.00 99.99  ? 459 LEU C CD1 1  
ATOM 3342   C CD2 . LEU A 1 455 ? -53.665  32.233  -32.934 1.00 99.99  ? 459 LEU C CD2 1  
ATOM 3343   N N   . ASP A 1 456 ? -53.380  35.027  -35.807 1.00 30.00  ? 460 ASP C N   1  
ATOM 3344   C CA  . ASP A 1 456 ? -52.705  35.618  -36.958 1.00 30.00  ? 460 ASP C CA  1  
ATOM 3345   C C   . ASP A 1 456 ? -51.342  34.937  -37.078 1.00 30.00  ? 460 ASP C C   1  
ATOM 3346   O O   . ASP A 1 456 ? -50.370  35.361  -36.464 1.00 30.00  ? 460 ASP C O   1  
ATOM 3347   C CB  . ASP A 1 456 ? -52.538  37.118  -36.742 1.00 99.99  ? 460 ASP C CB  1  
ATOM 3348   C CG  . ASP A 1 456 ? -51.639  37.364  -35.533 1.00 99.99  ? 460 ASP C CG  1  
ATOM 3349   O OD1 . ASP A 1 456 ? -52.176  37.290  -34.394 1.00 99.99  ? 460 ASP C OD1 1  
ATOM 3350   O OD2 . ASP A 1 456 ? -50.426  37.622  -35.757 1.00 99.99  ? 460 ASP C OD2 1  
ATOM 3351   N N   . ILE A 1 457 ? -51.287  33.866  -37.869 1.00 30.00  ? 461 ILE C N   1  
ATOM 3352   C CA  . ILE A 1 457 ? -50.052  33.103  -38.077 1.00 30.00  ? 461 ILE C CA  1  
ATOM 3353   C C   . ILE A 1 457 ? -49.819  32.856  -39.548 1.00 30.00  ? 461 ILE C C   1  
ATOM 3354   O O   . ILE A 1 457 ? -50.754  32.928  -40.348 1.00 30.00  ? 461 ILE C O   1  
ATOM 3355   C CB  . ILE A 1 457 ? -50.147  31.758  -37.367 1.00 99.99  ? 461 ILE C CB  1  
ATOM 3356   C CG1 . ILE A 1 457 ? -50.927  30.777  -38.233 1.00 99.99  ? 461 ILE C CG1 1  
ATOM 3357   C CG2 . ILE A 1 457 ? -50.863  31.937  -36.032 1.00 99.99  ? 461 ILE C CG2 1  
ATOM 3358   C CD1 . ILE A 1 457 ? -52.401  30.812  -37.844 1.00 99.99  ? 461 ILE C CD1 1  
ATOM 3359   N N   . ALA A 1 458 ? -48.003  33.763  -38.947 1.00 30.00  ? 462 ALA C N   1  
ATOM 3360   C CA  . ALA A 1 458 ? -47.284  34.338  -40.083 1.00 30.00  ? 462 ALA C CA  1  
ATOM 3361   C C   . ALA A 1 458 ? -47.678  33.488  -41.300 1.00 30.00  ? 462 ALA C C   1  
ATOM 3362   O O   . ALA A 1 458 ? -47.788  32.257  -41.208 1.00 30.00  ? 462 ALA C O   1  
ATOM 3363   C CB  . ALA A 1 458 ? -45.786  34.331  -39.840 1.00 30.00  ? 462 ALA C CB  1  
ATOM 3364   N N   . GLY A 1 459 ? -48.091  34.252  -43.015 1.00 30.00  ? 463 GLY C N   1  
ATOM 3365   C CA  . GLY A 1 459 ? -48.527  33.050  -43.706 1.00 30.00  ? 463 GLY C CA  1  
ATOM 3366   C C   . GLY A 1 459 ? -47.469  32.436  -44.596 1.00 30.00  ? 463 GLY C C   1  
ATOM 3367   O O   . GLY A 1 459 ? -46.278  32.707  -44.426 1.00 30.00  ? 463 GLY C O   1  
ATOM 3368   N N   . PHE A 1 460 ? -47.912  31.598  -45.537 1.00 30.00  ? 464 PHE C N   1  
ATOM 3369   C CA  . PHE A 1 460 ? -47.027  30.922  -46.486 1.00 30.00  ? 464 PHE C CA  1  
ATOM 3370   C C   . PHE A 1 460 ? -46.226  31.956  -47.256 1.00 30.00  ? 464 PHE C C   1  
ATOM 3371   O O   . PHE A 1 460 ? -46.737  33.028  -47.595 1.00 30.00  ? 464 PHE C O   1  
ATOM 3372   C CB  . PHE A 1 460 ? -47.850  30.089  -47.461 1.00 99.99  ? 464 PHE C CB  1  
ATOM 3373   C CG  . PHE A 1 460 ? -46.930  29.395  -48.434 1.00 99.99  ? 464 PHE C CG  1  
ATOM 3374   C CD1 . PHE A 1 460 ? -46.314  28.189  -48.075 1.00 99.99  ? 464 PHE C CD1 1  
ATOM 3375   C CD2 . PHE A 1 460 ? -46.693  29.955  -49.694 1.00 99.99  ? 464 PHE C CD2 1  
ATOM 3376   C CE1 . PHE A 1 460 ? -45.460  27.544  -48.978 1.00 99.99  ? 464 PHE C CE1 1  
ATOM 3377   C CE2 . PHE A 1 460 ? -45.835  29.311  -50.597 1.00 99.99  ? 464 PHE C CE2 1  
ATOM 3378   C CZ  . PHE A 1 460 ? -45.220  28.104  -50.238 1.00 99.99  ? 464 PHE C CZ  1  
ATOM 3379   N N   . GLU A 1 461 ? -44.970  31.626  -47.530 1.00 30.00  ? 465 GLU C N   1  
ATOM 3380   C CA  . GLU A 1 461 ? -44.087  32.517  -48.265 1.00 30.00  ? 465 GLU C CA  1  
ATOM 3381   C C   . GLU A 1 461 ? -43.015  31.691  -48.956 1.00 30.00  ? 465 GLU C C   1  
ATOM 3382   O O   . GLU A 1 461 ? -42.377  30.825  -48.344 1.00 30.00  ? 465 GLU C O   1  
ATOM 3383   C CB  . GLU A 1 461 ? -43.433  33.507  -47.308 1.00 99.99  ? 465 GLU C CB  1  
ATOM 3384   C CG  . GLU A 1 461 ? -43.259  34.837  -47.999 1.00 99.99  ? 465 GLU C CG  1  
ATOM 3385   C CD  . GLU A 1 461 ? -42.273  34.683  -49.156 1.00 99.99  ? 465 GLU C CD  1  
ATOM 3386   O OE1 . GLU A 1 461 ? -42.746  34.378  -50.281 1.00 99.99  ? 465 GLU C OE1 1  
ATOM 3387   O OE2 . GLU A 1 461 ? -41.053  34.875  -48.903 1.00 99.99  ? 465 GLU C OE2 1  
ATOM 3388   N N   . ILE A 1 462 ? -42.832  31.957  -50.242 1.00 30.00  ? 466 ILE C N   1  
ATOM 3389   C CA  . ILE A 1 462 ? -41.838  31.259  -51.032 1.00 30.00  ? 466 ILE C CA  1  
ATOM 3390   C C   . ILE A 1 462 ? -40.929  32.319  -51.625 1.00 30.00  ? 466 ILE C C   1  
ATOM 3391   O O   . ILE A 1 462 ? -41.396  33.215  -52.326 1.00 30.00  ? 466 ILE C O   1  
ATOM 3392   C CB  . ILE A 1 462 ? -42.520  30.456  -52.135 1.00 99.99  ? 466 ILE C CB  1  
ATOM 3393   C CG1 . ILE A 1 462 ? -42.841  31.376  -53.308 1.00 99.99  ? 466 ILE C CG1 1  
ATOM 3394   C CG2 . ILE A 1 462 ? -43.811  29.849  -51.596 1.00 99.99  ? 466 ILE C CG2 1  
ATOM 3395   C CD1 . ILE A 1 462 ? -44.260  31.917  -53.155 1.00 99.99  ? 466 ILE C CD1 1  
ATOM 3396   N N   . PHE A 1 463 ? -39.634  32.224  -51.335 1.00 30.00  ? 467 PHE C N   1  
ATOM 3397   C CA  . PHE A 1 463 ? -38.676  33.195  -51.845 1.00 30.00  ? 467 PHE C CA  1  
ATOM 3398   C C   . PHE A 1 463 ? -37.696  32.557  -52.808 1.00 30.00  ? 467 PHE C C   1  
ATOM 3399   O O   . PHE A 1 463 ? -37.831  31.372  -53.167 1.00 30.00  ? 467 PHE C O   1  
ATOM 3400   C CB  . PHE A 1 463 ? -37.888  33.804  -50.692 1.00 99.99  ? 467 PHE C CB  1  
ATOM 3401   C CG  . PHE A 1 463 ? -36.900  34.810  -51.230 1.00 99.99  ? 467 PHE C CG  1  
ATOM 3402   C CD1 . PHE A 1 463 ? -37.315  36.116  -51.508 1.00 99.99  ? 467 PHE C CD1 1  
ATOM 3403   C CD2 . PHE A 1 463 ? -35.569  34.436  -51.450 1.00 99.99  ? 467 PHE C CD2 1  
ATOM 3404   C CE1 . PHE A 1 463 ? -36.399  37.050  -52.008 1.00 99.99  ? 467 PHE C CE1 1  
ATOM 3405   C CE2 . PHE A 1 463 ? -34.653  35.368  -51.952 1.00 99.99  ? 467 PHE C CE2 1  
ATOM 3406   C CZ  . PHE A 1 463 ? -35.069  36.676  -52.230 1.00 99.99  ? 467 PHE C CZ  1  
ATOM 3407   N N   . ASP A 1 464 ? -36.714  33.356  -53.217 1.00 30.00  ? 468 ASP C N   1  
ATOM 3408   C CA  . ASP A 1 464 ? -35.662  32.933  -54.131 1.00 30.00  ? 468 ASP C CA  1  
ATOM 3409   C C   . ASP A 1 464 ? -34.906  31.816  -53.428 1.00 30.00  ? 468 ASP C C   1  
ATOM 3410   O O   . ASP A 1 464 ? -34.564  30.788  -54.022 1.00 30.00  ? 468 ASP C O   1  
ATOM 3411   C CB  . ASP A 1 464 ? -34.738  34.104  -54.440 1.00 99.99  ? 468 ASP C CB  1  
ATOM 3412   C CG  . ASP A 1 464 ? -35.490  35.146  -55.261 1.00 99.99  ? 468 ASP C CG  1  
ATOM 3413   O OD1 . ASP A 1 464 ? -35.749  34.859  -56.461 1.00 99.99  ? 468 ASP C OD1 1  
ATOM 3414   O OD2 . ASP A 1 464 ? -35.802  36.223  -54.683 1.00 99.99  ? 468 ASP C OD2 1  
ATOM 3415   N N   . PHE A 1 465 ? -34.656  32.028  -52.143 1.00 30.00  ? 469 PHE C N   1  
ATOM 3416   C CA  . PHE A 1 465 ? -33.948  31.059  -51.332 1.00 30.00  ? 469 PHE C CA  1  
ATOM 3417   C C   . PHE A 1 465 ? -34.763  30.820  -50.066 1.00 30.00  ? 469 PHE C C   1  
ATOM 3418   O O   . PHE A 1 465 ? -35.146  31.773  -49.384 1.00 30.00  ? 469 PHE C O   1  
ATOM 3419   C CB  . PHE A 1 465 ? -32.566  31.598  -50.972 1.00 99.99  ? 469 PHE C CB  1  
ATOM 3420   C CG  . PHE A 1 465 ? -31.834  30.583  -50.128 1.00 99.99  ? 469 PHE C CG  1  
ATOM 3421   C CD1 . PHE A 1 465 ? -31.159  29.522  -50.740 1.00 99.99  ? 469 PHE C CD1 1  
ATOM 3422   C CD2 . PHE A 1 465 ? -31.835  30.702  -48.732 1.00 99.99  ? 469 PHE C CD2 1  
ATOM 3423   C CE1 . PHE A 1 465 ? -30.477  28.580  -49.957 1.00 99.99  ? 469 PHE C CE1 1  
ATOM 3424   C CE2 . PHE A 1 465 ? -31.155  29.758  -47.952 1.00 99.99  ? 469 PHE C CE2 1  
ATOM 3425   C CZ  . PHE A 1 465 ? -30.479  28.698  -48.563 1.00 99.99  ? 469 PHE C CZ  1  
ATOM 3426   N N   . ASN A 1 466 ? -35.030  29.552  -49.766 1.00 30.00  ? 470 ASN C N   1  
ATOM 3427   C CA  . ASN A 1 466 ? -35.803  29.169  -48.584 1.00 30.00  ? 470 ASN C CA  1  
ATOM 3428   C C   . ASN A 1 466 ? -34.987  28.237  -47.696 1.00 30.00  ? 470 ASN C C   1  
ATOM 3429   O O   . ASN A 1 466 ? -34.362  27.303  -48.193 1.00 30.00  ? 470 ASN C O   1  
ATOM 3430   C CB  . ASN A 1 466 ? -37.081  28.455  -49.009 1.00 99.99  ? 470 ASN C CB  1  
ATOM 3431   C CG  . ASN A 1 466 ? -37.985  29.374  -49.819 1.00 99.99  ? 470 ASN C CG  1  
ATOM 3432   O OD1 . ASN A 1 466 ? -38.320  30.468  -49.373 1.00 99.99  ? 470 ASN C OD1 1  
ATOM 3433   N ND2 . ASN A 1 466 ? -38.373  28.927  -51.014 1.00 99.99  ? 470 ASN C ND2 1  
ATOM 3434   N N   . SER A 1 467 ? -34.992  28.495  -46.389 1.00 30.00  ? 471 SER C N   1  
ATOM 3435   C CA  . SER A 1 467 ? -34.267  27.653  -45.439 1.00 30.00  ? 471 SER C CA  1  
ATOM 3436   C C   . SER A 1 467 ? -35.129  27.289  -44.226 1.00 30.00  ? 471 SER C C   1  
ATOM 3437   O O   . SER A 1 467 ? -36.365  27.354  -44.270 1.00 30.00  ? 471 SER C O   1  
ATOM 3438   C CB  . SER A 1 467 ? -33.028  28.383  -44.939 1.00 99.99  ? 471 SER C CB  1  
ATOM 3439   O OG  . SER A 1 467 ? -33.424  29.496  -44.132 1.00 99.99  ? 471 SER C OG  1  
ATOM 3440   N N   . PHE A 1 468 ? -34.466  26.904  -43.143 1.00 30.00  ? 472 PHE C N   1  
ATOM 3441   C CA  . PHE A 1 468 ? -35.142  26.512  -41.912 1.00 30.00  ? 472 PHE C CA  1  
ATOM 3442   C C   . PHE A 1 468 ? -36.232  27.464  -41.436 1.00 30.00  ? 472 PHE C C   1  
ATOM 3443   O O   . PHE A 1 468 ? -37.287  27.026  -40.983 1.00 30.00  ? 472 PHE C O   1  
ATOM 3444   C CB  . PHE A 1 468 ? -34.130  26.414  -40.774 1.00 99.99  ? 472 PHE C CB  1  
ATOM 3445   C CG  . PHE A 1 468 ? -34.838  26.006  -39.506 1.00 99.99  ? 472 PHE C CG  1  
ATOM 3446   C CD1 . PHE A 1 468 ? -35.102  24.655  -39.255 1.00 99.99  ? 472 PHE C CD1 1  
ATOM 3447   C CD2 . PHE A 1 468 ? -35.229  26.977  -38.576 1.00 99.99  ? 472 PHE C CD2 1  
ATOM 3448   C CE1 . PHE A 1 468 ? -35.759  24.275  -38.078 1.00 99.99  ? 472 PHE C CE1 1  
ATOM 3449   C CE2 . PHE A 1 468 ? -35.886  26.597  -37.400 1.00 99.99  ? 472 PHE C CE2 1  
ATOM 3450   C CZ  . PHE A 1 468 ? -36.150  25.247  -37.151 1.00 99.99  ? 472 PHE C CZ  1  
ATOM 3451   N N   . GLU A 1 469 ? -35.983  28.763  -41.537 1.00 30.00  ? 473 GLU C N   1  
ATOM 3452   C CA  . GLU A 1 469 ? -36.945  29.771  -41.101 1.00 30.00  ? 473 GLU C CA  1  
ATOM 3453   C C   . GLU A 1 469 ? -38.276  29.559  -41.779 1.00 30.00  ? 473 GLU C C   1  
ATOM 3454   O O   . GLU A 1 469 ? -39.321  29.548  -41.124 1.00 30.00  ? 473 GLU C O   1  
ATOM 3455   C CB  . GLU A 1 469 ? -36.434  31.163  -41.450 1.00 99.99  ? 473 GLU C CB  1  
ATOM 3456   C CG  . GLU A 1 469 ? -35.175  31.450  -40.665 1.00 99.99  ? 473 GLU C CG  1  
ATOM 3457   C CD  . GLU A 1 469 ? -35.533  31.675  -39.198 1.00 99.99  ? 473 GLU C CD  1  
ATOM 3458   O OE1 . GLU A 1 469 ? -35.541  30.665  -38.446 1.00 99.99  ? 473 GLU C OE1 1  
ATOM 3459   O OE2 . GLU A 1 469 ? -35.791  32.858  -38.842 1.00 99.99  ? 473 GLU C OE2 1  
ATOM 3460   N N   . GLN A 1 470 ? -38.221  29.395  -43.097 1.00 30.00  ? 474 GLN C N   1  
ATOM 3461   C CA  . GLN A 1 470 ? -39.418  29.184  -43.894 1.00 30.00  ? 474 GLN C CA  1  
ATOM 3462   C C   . GLN A 1 470 ? -40.098  27.863  -43.572 1.00 30.00  ? 474 GLN C C   1  
ATOM 3463   O O   . GLN A 1 470 ? -41.314  27.832  -43.354 1.00 30.00  ? 474 GLN C O   1  
ATOM 3464   C CB  . GLN A 1 470 ? -39.061  29.177  -45.376 1.00 99.99  ? 474 GLN C CB  1  
ATOM 3465   C CG  . GLN A 1 470 ? -40.291  29.551  -46.200 1.00 99.99  ? 474 GLN C CG  1  
ATOM 3466   C CD  . GLN A 1 470 ? -41.160  28.334  -46.471 1.00 99.99  ? 474 GLN C CD  1  
ATOM 3467   O OE1 . GLN A 1 470 ? -40.834  27.228  -46.044 1.00 99.99  ? 474 GLN C OE1 1  
ATOM 3468   N NE2 . GLN A 1 470 ? -42.268  28.537  -47.185 1.00 99.99  ? 474 GLN C NE2 1  
ATOM 3469   N N   . LEU A 1 471 ? -39.347  26.767  -43.524 1.00 30.00  ? 475 LEU C N   1  
ATOM 3470   C CA  . LEU A 1 471 ? -39.973  25.479  -43.222 1.00 30.00  ? 475 LEU C CA  1  
ATOM 3471   C C   . LEU A 1 471 ? -40.828  25.615  -41.960 1.00 30.00  ? 475 LEU C C   1  
ATOM 3472   O O   . LEU A 1 471 ? -41.924  25.057  -41.863 1.00 30.00  ? 475 LEU C O   1  
ATOM 3473   C CB  . LEU A 1 471 ? -38.902  24.419  -42.995 1.00 99.99  ? 475 LEU C CB  1  
ATOM 3474   C CG  . LEU A 1 471 ? -38.644  23.666  -44.296 1.00 99.99  ? 475 LEU C CG  1  
ATOM 3475   C CD1 . LEU A 1 471 ? -37.833  22.409  -44.006 1.00 99.99  ? 475 LEU C CD1 1  
ATOM 3476   C CD2 . LEU A 1 471 ? -39.977  23.277  -44.929 1.00 99.99  ? 475 LEU C CD2 1  
ATOM 3477   N N   . CYS A 1 472 ? -40.314  26.379  -41.003 1.00 30.00  ? 476 CYS C N   1  
ATOM 3478   C CA  . CYS A 1 472 ? -40.993  26.600  -39.735 1.00 30.00  ? 476 CYS C CA  1  
ATOM 3479   C C   . CYS A 1 472 ? -42.287  27.371  -39.896 1.00 30.00  ? 476 CYS C C   1  
ATOM 3480   O O   . CYS A 1 472 ? -43.297  26.990  -39.303 1.00 30.00  ? 476 CYS C O   1  
ATOM 3481   C CB  . CYS A 1 472 ? -40.092  27.398  -38.799 1.00 99.99  ? 476 CYS C CB  1  
ATOM 3482   S SG  . CYS A 1 472 ? -38.569  26.575  -38.269 1.00 99.99  ? 476 CYS C SG  1  
ATOM 3483   N N   . ILE A 1 473 ? -42.251  28.438  -40.692 1.00 30.00  ? 477 ILE C N   1  
ATOM 3484   C CA  . ILE A 1 473 ? -43.432  29.264  -40.947 1.00 30.00  ? 477 ILE C CA  1  
ATOM 3485   C C   . ILE A 1 473 ? -44.465  28.449  -41.702 1.00 30.00  ? 477 ILE C C   1  
ATOM 3486   O O   . ILE A 1 473 ? -45.653  28.436  -41.357 1.00 30.00  ? 477 ILE C O   1  
ATOM 3487   C CB  . ILE A 1 473 ? -43.044  30.485  -41.776 1.00 99.99  ? 477 ILE C CB  1  
ATOM 3488   C CG1 . ILE A 1 473 ? -43.081  30.126  -43.257 1.00 99.99  ? 477 ILE C CG1 1  
ATOM 3489   C CG2 . ILE A 1 473 ? -41.635  30.928  -41.396 1.00 99.99  ? 477 ILE C CG2 1  
ATOM 3490   C CD1 . ILE A 1 473 ? -44.441  30.504  -43.837 1.00 99.99  ? 477 ILE C CD1 1  
ATOM 3491   N N   . ASN A 1 474 ? -43.987  27.779  -42.751 1.00 30.00  ? 478 ASN C N   1  
ATOM 3492   C CA  . ASN A 1 474 ? -44.798  26.932  -43.613 1.00 30.00  ? 478 ASN C CA  1  
ATOM 3493   C C   . ASN A 1 474 ? -45.400  25.763  -42.848 1.00 30.00  ? 478 ASN C C   1  
ATOM 3494   O O   . ASN A 1 474 ? -46.604  25.507  -42.938 1.00 30.00  ? 478 ASN C O   1  
ATOM 3495   C CB  . ASN A 1 474 ? -43.944  26.373  -44.745 1.00 99.99  ? 478 ASN C CB  1  
ATOM 3496   C CG  . ASN A 1 474 ? -44.793  26.045  -45.965 1.00 99.99  ? 478 ASN C CG  1  
ATOM 3497   O OD1 . ASN A 1 474 ? -44.423  25.197  -46.774 1.00 99.99  ? 478 ASN C OD1 1  
ATOM 3498   N ND2 . ASN A 1 474 ? -45.938  26.716  -46.093 1.00 99.99  ? 478 ASN C ND2 1  
ATOM 3499   N N   . TYR A 1 475 ? -44.578  25.044  -42.100 1.00 30.00  ? 479 TYR C N   1  
ATOM 3500   C CA  . TYR A 1 475 ? -45.110  23.945  -41.312 1.00 30.00  ? 479 TYR C CA  1  
ATOM 3501   C C   . TYR A 1 475 ? -46.247  24.523  -40.458 1.00 30.00  ? 479 TYR C C   1  
ATOM 3502   O O   . TYR A 1 475 ? -47.281  23.896  -40.259 1.00 30.00  ? 479 TYR C O   1  
ATOM 3503   C CB  . TYR A 1 475 ? -44.012  23.362  -40.426 1.00 99.99  ? 479 TYR C CB  1  
ATOM 3504   C CG  . TYR A 1 475 ? -44.574  22.220  -39.615 1.00 99.99  ? 479 TYR C CG  1  
ATOM 3505   C CD1 . TYR A 1 475 ? -44.666  20.942  -40.175 1.00 99.99  ? 479 TYR C CD1 1  
ATOM 3506   C CD2 . TYR A 1 475 ? -44.999  22.441  -38.298 1.00 99.99  ? 479 TYR C CD2 1  
ATOM 3507   C CE1 . TYR A 1 475 ? -45.185  19.882  -39.422 1.00 99.99  ? 479 TYR C CE1 1  
ATOM 3508   C CE2 . TYR A 1 475 ? -45.518  21.380  -37.545 1.00 99.99  ? 479 TYR C CE2 1  
ATOM 3509   C CZ  . TYR A 1 475 ? -45.611  20.104  -38.106 1.00 99.99  ? 479 TYR C CZ  1  
ATOM 3510   O OH  . TYR A 1 475 ? -46.116  19.072  -37.374 1.00 99.99  ? 479 TYR C OH  1  
ATOM 3511   N N   . THR A 1 476 ? -46.041  25.731  -39.952 1.00 30.00  ? 480 THR C N   1  
ATOM 3512   C CA  . THR A 1 476 ? -47.037  26.391  -39.117 1.00 30.00  ? 480 THR C CA  1  
ATOM 3513   C C   . THR A 1 476 ? -48.332  26.625  -39.846 1.00 30.00  ? 480 THR C C   1  
ATOM 3514   O O   . THR A 1 476 ? -49.398  26.245  -39.356 1.00 30.00  ? 480 THR C O   1  
ATOM 3515   C CB  . THR A 1 476 ? -46.511  27.744  -38.651 1.00 99.99  ? 480 THR C CB  1  
ATOM 3516   O OG1 . THR A 1 476 ? -45.296  27.558  -37.917 1.00 99.99  ? 480 THR C OG1 1  
ATOM 3517   C CG2 . THR A 1 476 ? -47.546  28.414  -37.761 1.00 99.99  ? 480 THR C CG2 1  
ATOM 3518   N N   . ASN A 1 477 ? -48.225  27.266  -41.012 1.00 30.00  ? 481 ASN C N   1  
ATOM 3519   C CA  . ASN A 1 477 ? -49.386  27.578  -41.846 1.00 30.00  ? 481 ASN C CA  1  
ATOM 3520   C C   . ASN A 1 477 ? -50.141  26.350  -42.330 1.00 30.00  ? 481 ASN C C   1  
ATOM 3521   O O   . ASN A 1 477 ? -51.337  26.412  -42.593 1.00 30.00  ? 481 ASN C O   1  
ATOM 3522   C CB  . ASN A 1 477 ? -48.939  28.348  -43.086 1.00 99.99  ? 481 ASN C CB  1  
ATOM 3523   C CG  . ASN A 1 477 ? -48.390  29.718  -42.713 1.00 99.99  ? 481 ASN C CG  1  
ATOM 3524   O OD1 . ASN A 1 477 ? -47.220  30.008  -42.960 1.00 99.99  ? 481 ASN C OD1 1  
ATOM 3525   N ND2 . ASN A 1 477 ? -49.240  30.560  -42.117 1.00 99.99  ? 481 ASN C ND2 1  
ATOM 3526   N N   . GLU A 1 478 ? -49.442  25.230  -42.440 1.00 30.00  ? 482 GLU C N   1  
ATOM 3527   C CA  . GLU A 1 478 ? -50.075  23.995  -42.878 1.00 30.00  ? 482 GLU C CA  1  
ATOM 3528   C C   . GLU A 1 478 ? -51.116  23.570  -41.849 1.00 30.00  ? 482 GLU C C   1  
ATOM 3529   O O   . GLU A 1 478 ? -52.277  23.361  -42.186 1.00 30.00  ? 482 GLU C O   1  
ATOM 3530   C CB  . GLU A 1 478 ? -49.023  22.897  -43.020 1.00 99.99  ? 482 GLU C CB  1  
ATOM 3531   C CG  . GLU A 1 478 ? -48.057  23.264  -44.120 1.00 99.99  ? 482 GLU C CG  1  
ATOM 3532   C CD  . GLU A 1 478 ? -48.751  23.121  -45.475 1.00 99.99  ? 482 GLU C CD  1  
ATOM 3533   O OE1 . GLU A 1 478 ? -49.349  24.134  -45.925 1.00 99.99  ? 482 GLU C OE1 1  
ATOM 3534   O OE2 . GLU A 1 478 ? -48.674  21.999  -46.045 1.00 99.99  ? 482 GLU C OE2 1  
ATOM 3535   N N   . ARG A 1 479 ? -50.369  23.419  -41.289 1.00 30.00  ? 483 ARG C N   1  
ATOM 3536   C CA  . ARG A 1 479 ? -51.029  22.938  -40.088 1.00 30.00  ? 483 ARG C CA  1  
ATOM 3537   C C   . ARG A 1 479 ? -52.426  23.506  -39.982 1.00 30.00  ? 483 ARG C C   1  
ATOM 3538   O O   . ARG A 1 479 ? -53.420  22.788  -39.998 1.00 30.00  ? 483 ARG C O   1  
ATOM 3539   C CB  . ARG A 1 479 ? -50.237  23.358  -38.854 1.00 99.99  ? 483 ARG C CB  1  
ATOM 3540   C CG  . ARG A 1 479 ? -50.911  22.805  -37.603 1.00 99.99  ? 483 ARG C CG  1  
ATOM 3541   C CD  . ARG A 1 479 ? -50.144  23.270  -36.368 1.00 99.99  ? 483 ARG C CD  1  
ATOM 3542   N NE  . ARG A 1 479 ? -49.895  24.727  -36.416 1.00 99.99  ? 483 ARG C NE  1  
ATOM 3543   C CZ  . ARG A 1 479 ? -50.812  25.631  -36.087 1.00 99.99  ? 483 ARG C CZ  1  
ATOM 3544   N NH1 . ARG A 1 479 ? -52.033  25.284  -35.693 1.00 99.99  ? 483 ARG C NH1 1  
ATOM 3545   N NH2 . ARG A 1 479 ? -50.479  26.917  -36.166 1.00 99.99  ? 483 ARG C NH2 1  
ATOM 3546   N N   . LEU A 1 480 ? -52.477  24.820  -39.853 1.00 30.00  ? 484 LEU C N   1  
ATOM 3547   C CA  . LEU A 1 480 ? -53.719  25.549  -39.736 1.00 30.00  ? 484 LEU C CA  1  
ATOM 3548   C C   . LEU A 1 480 ? -54.727  25.143  -40.804 1.00 30.00  ? 484 LEU C C   1  
ATOM 3549   O O   . LEU A 1 480 ? -55.855  24.780  -40.480 1.00 30.00  ? 484 LEU C O   1  
ATOM 3550   C CB  . LEU A 1 480 ? -53.458  27.045  -39.881 1.00 99.99  ? 484 LEU C CB  1  
ATOM 3551   C CG  . LEU A 1 480 ? -54.784  27.797  -39.880 1.00 99.99  ? 484 LEU C CG  1  
ATOM 3552   C CD1 . LEU A 1 480 ? -54.525  29.284  -40.100 1.00 99.99  ? 484 LEU C CD1 1  
ATOM 3553   C CD2 . LEU A 1 480 ? -55.675  27.263  -40.996 1.00 99.99  ? 484 LEU C CD2 1  
ATOM 3554   N N   . GLN A 1 481 ? -54.334  25.207  -42.076 1.00 30.00  ? 485 GLN C N   1  
ATOM 3555   C CA  . GLN A 1 481 ? -55.242  24.854  -43.162 1.00 30.00  ? 485 GLN C CA  1  
ATOM 3556   C C   . GLN A 1 481 ? -55.963  23.558  -42.834 1.00 30.00  ? 485 GLN C C   1  
ATOM 3557   O O   . GLN A 1 481 ? -57.186  23.498  -42.859 1.00 30.00  ? 485 GLN C O   1  
ATOM 3558   C CB  . GLN A 1 481 ? -54.457  24.671  -44.455 1.00 99.99  ? 485 GLN C CB  1  
ATOM 3559   C CG  . GLN A 1 481 ? -55.293  25.152  -45.633 1.00 99.99  ? 485 GLN C CG  1  
ATOM 3560   C CD  . GLN A 1 481 ? -56.536  24.288  -45.814 1.00 99.99  ? 485 GLN C CD  1  
ATOM 3561   O OE1 . GLN A 1 481 ? -56.753  23.343  -45.059 1.00 99.99  ? 485 GLN C OE1 1  
ATOM 3562   N NE2 . GLN A 1 481 ? -57.349  24.616  -46.819 1.00 99.99  ? 485 GLN C NE2 1  
ATOM 3563   N N   . GLN A 1 482 ? -55.186  22.529  -42.508 1.00 30.00  ? 486 GLN C N   1  
ATOM 3564   C CA  . GLN A 1 482 ? -55.752  21.236  -42.167 1.00 30.00  ? 486 GLN C CA  1  
ATOM 3565   C C   . GLN A 1 482 ? -56.815  21.355  -41.084 1.00 30.00  ? 486 GLN C C   1  
ATOM 3566   O O   . GLN A 1 482 ? -57.750  20.566  -41.052 1.00 30.00  ? 486 GLN C O   1  
ATOM 3567   C CB  . GLN A 1 482 ? -54.655  20.309  -41.655 1.00 99.99  ? 486 GLN C CB  1  
ATOM 3568   C CG  . GLN A 1 482 ? -55.078  18.858  -41.859 1.00 99.99  ? 486 GLN C CG  1  
ATOM 3569   C CD  . GLN A 1 482 ? -55.934  18.369  -40.703 1.00 99.99  ? 486 GLN C CD  1  
ATOM 3570   O OE1 . GLN A 1 482 ? -56.205  19.120  -39.764 1.00 99.99  ? 486 GLN C OE1 1  
ATOM 3571   N NE2 . GLN A 1 482 ? -56.369  17.107  -40.769 1.00 99.99  ? 486 GLN C NE2 1  
ATOM 3572   N N   . PHE A 1 483 ? -56.667  22.333  -40.197 1.00 30.00  ? 487 PHE C N   1  
ATOM 3573   C CA  . PHE A 1 483 ? -57.655  22.538  -39.134 1.00 30.00  ? 487 PHE C CA  1  
ATOM 3574   C C   . PHE A 1 483 ? -58.989  22.838  -39.793 1.00 30.00  ? 487 PHE C C   1  
ATOM 3575   O O   . PHE A 1 483 ? -60.010  22.225  -39.469 1.00 30.00  ? 487 PHE C O   1  
ATOM 3576   C CB  . PHE A 1 483 ? -57.228  23.706  -38.249 1.00 99.99  ? 487 PHE C CB  1  
ATOM 3577   C CG  . PHE A 1 483 ? -58.248  23.911  -37.159 1.00 99.99  ? 487 PHE C CG  1  
ATOM 3578   C CD1 . PHE A 1 483 ? -58.193  23.136  -35.994 1.00 99.99  ? 487 PHE C CD1 1  
ATOM 3579   C CD2 . PHE A 1 483 ? -59.252  24.876  -37.306 1.00 99.99  ? 487 PHE C CD2 1  
ATOM 3580   C CE1 . PHE A 1 483 ? -59.138  23.326  -34.978 1.00 99.99  ? 487 PHE C CE1 1  
ATOM 3581   C CE2 . PHE A 1 483 ? -60.199  25.065  -36.292 1.00 99.99  ? 487 PHE C CE2 1  
ATOM 3582   C CZ  . PHE A 1 483 ? -60.141  24.290  -35.129 1.00 99.99  ? 487 PHE C CZ  1  
ATOM 3583   N N   . PHE A 1 484 ? -58.963  23.777  -40.737 1.00 30.00  ? 488 PHE C N   1  
ATOM 3584   C CA  . PHE A 1 484 ? -60.150  24.182  -41.466 1.00 30.00  ? 488 PHE C CA  1  
ATOM 3585   C C   . PHE A 1 484 ? -60.745  22.995  -42.169 1.00 30.00  ? 488 PHE C C   1  
ATOM 3586   O O   . PHE A 1 484 ? -61.953  22.873  -42.235 1.00 30.00  ? 488 PHE C O   1  
ATOM 3587   C CB  . PHE A 1 484 ? -59.788  25.244  -42.498 1.00 99.99  ? 488 PHE C CB  1  
ATOM 3588   C CG  . PHE A 1 484 ? -61.027  25.659  -43.251 1.00 99.99  ? 488 PHE C CG  1  
ATOM 3589   C CD1 . PHE A 1 484 ? -61.889  26.622  -42.707 1.00 99.99  ? 488 PHE C CD1 1  
ATOM 3590   C CD2 . PHE A 1 484 ? -61.319  25.086  -44.493 1.00 99.99  ? 488 PHE C CD2 1  
ATOM 3591   C CE1 . PHE A 1 484 ? -63.039  27.008  -43.404 1.00 99.99  ? 488 PHE C CE1 1  
ATOM 3592   C CE2 . PHE A 1 484 ? -62.470  25.472  -45.191 1.00 99.99  ? 488 PHE C CE2 1  
ATOM 3593   C CZ  . PHE A 1 484 ? -63.329  26.433  -44.648 1.00 99.99  ? 488 PHE C CZ  1  
ATOM 3594   N N   . ASN A 1 485 ? -59.894  22.136  -42.711 1.00 30.00  ? 489 ASN C N   1  
ATOM 3595   C CA  . ASN A 1 485 ? -60.346  20.940  -43.418 1.00 30.00  ? 489 ASN C CA  1  
ATOM 3596   C C   . ASN A 1 485 ? -61.071  20.004  -42.452 1.00 30.00  ? 489 ASN C C   1  
ATOM 3597   O O   . ASN A 1 485 ? -62.088  19.417  -42.786 1.00 30.00  ? 489 ASN C O   1  
ATOM 3598   C CB  . ASN A 1 485 ? -59.152  20.205  -44.015 1.00 99.99  ? 489 ASN C CB  1  
ATOM 3599   C CG  . ASN A 1 485 ? -58.626  20.927  -45.247 1.00 99.99  ? 489 ASN C CG  1  
ATOM 3600   O OD1 . ASN A 1 485 ? -57.417  21.020  -45.448 1.00 99.99  ? 489 ASN C OD1 1  
ATOM 3601   N ND2 . ASN A 1 485 ? -59.540  21.437  -46.076 1.00 99.99  ? 489 ASN C ND2 1  
ATOM 3602   N N   . HIS A 1 486 ? -60.540  19.862  -41.251 1.00 30.00  ? 490 HIS C N   1  
ATOM 3603   C CA  . HIS A 1 486 ? -61.127  18.981  -40.258 1.00 30.00  ? 490 HIS C CA  1  
ATOM 3604   C C   . HIS A 1 486 ? -62.472  19.444  -39.808 1.00 30.00  ? 490 HIS C C   1  
ATOM 3605   O O   . HIS A 1 486 ? -63.477  18.751  -39.959 1.00 30.00  ? 490 HIS C O   1  
ATOM 3606   C CB  . HIS A 1 486 ? -60.224  18.907  -39.031 1.00 99.99  ? 490 HIS C CB  1  
ATOM 3607   C CG  . HIS A 1 486 ? -60.830  18.215  -37.834 1.00 99.99  ? 490 HIS C CG  1  
ATOM 3608   N ND1 . HIS A 1 486 ? -60.187  17.171  -37.183 1.00 99.99  ? 490 HIS C ND1 1  
ATOM 3609   C CD2 . HIS A 1 486 ? -62.006  18.418  -37.176 1.00 99.99  ? 490 HIS C CD2 1  
ATOM 3610   C CE1 . HIS A 1 486 ? -60.958  16.776  -36.184 1.00 99.99  ? 490 HIS C CE1 1  
ATOM 3611   N NE2 . HIS A 1 486 ? -62.041  17.508  -36.167 1.00 99.99  ? 490 HIS C NE2 1  
ATOM 3612   N N   . HIS A 1 487 ? -62.465  20.628  -39.219 1.00 30.00  ? 491 HIS C N   1  
ATOM 3613   C CA  . HIS A 1 487 ? -63.670  21.255  -38.712 1.00 30.00  ? 491 HIS C CA  1  
ATOM 3614   C C   . HIS A 1 487 ? -64.731  21.519  -39.799 1.00 30.00  ? 491 HIS C C   1  
ATOM 3615   O O   . HIS A 1 487 ? -65.927  21.632  -39.500 1.00 30.00  ? 491 HIS C O   1  
ATOM 3616   C CB  . HIS A 1 487 ? -63.327  22.598  -38.078 1.00 99.99  ? 491 HIS C CB  1  
ATOM 3617   C CG  . HIS A 1 487 ? -64.513  23.458  -37.721 1.00 99.99  ? 491 HIS C CG  1  
ATOM 3618   N ND1 . HIS A 1 487 ? -64.686  23.987  -36.446 1.00 99.99  ? 491 HIS C ND1 1  
ATOM 3619   C CD2 . HIS A 1 487 ? -65.573  23.881  -38.463 1.00 99.99  ? 491 HIS C CD2 1  
ATOM 3620   C CE1 . HIS A 1 487 ? -65.806  24.687  -36.444 1.00 99.99  ? 491 HIS C CE1 1  
ATOM 3621   N NE2 . HIS A 1 487 ? -66.344  24.635  -37.634 1.00 99.99  ? 491 HIS C NE2 1  
ATOM 3622   N N   . MET A 1 488 ? -64.301  21.597  -41.058 1.00 30.00  ? 492 MET C N   1  
ATOM 3623   C CA  . MET A 1 488 ? -65.198  21.891  -42.176 1.00 30.00  ? 492 MET C CA  1  
ATOM 3624   C C   . MET A 1 488 ? -65.863  20.671  -42.821 1.00 30.00  ? 492 MET C C   1  
ATOM 3625   O O   . MET A 1 488 ? -67.063  20.685  -43.123 1.00 30.00  ? 492 MET C O   1  
ATOM 3626   C CB  . MET A 1 488 ? -64.431  22.597  -43.285 1.00 99.99  ? 492 MET C CB  1  
ATOM 3627   C CG  . MET A 1 488 ? -65.415  23.224  -44.266 1.00 99.99  ? 492 MET C CG  1  
ATOM 3628   S SD  . MET A 1 488 ? -64.523  24.193  -45.509 1.00 99.99  ? 492 MET C SD  1  
ATOM 3629   C CE  . MET A 1 488 ? -63.215  23.053  -45.907 1.00 99.99  ? 492 MET C CE  1  
ATOM 3630   N N   . PHE A 1 489 ? -65.112  19.622  -43.050 1.00 30.00  ? 493 PHE C N   1  
ATOM 3631   C CA  . PHE A 1 489 ? -65.672  18.436  -43.717 1.00 30.00  ? 493 PHE C CA  1  
ATOM 3632   C C   . PHE A 1 489 ? -65.750  17.244  -42.772 1.00 30.00  ? 493 PHE C C   1  
ATOM 3633   O O   . PHE A 1 489 ? -66.829  16.706  -42.497 1.00 30.00  ? 493 PHE C O   1  
ATOM 3634   C CB  . PHE A 1 489 ? -64.799  18.049  -44.905 1.00 99.99  ? 493 PHE C CB  1  
ATOM 3635   C CG  . PHE A 1 489 ? -64.905  19.107  -45.977 1.00 99.99  ? 493 PHE C CG  1  
ATOM 3636   C CD1 . PHE A 1 489 ? -65.979  19.087  -46.877 1.00 99.99  ? 493 PHE C CD1 1  
ATOM 3637   C CD2 . PHE A 1 489 ? -63.930  20.106  -46.072 1.00 99.99  ? 493 PHE C CD2 1  
ATOM 3638   C CE1 . PHE A 1 489 ? -66.074  20.066  -47.871 1.00 99.99  ? 493 PHE C CE1 1  
ATOM 3639   C CE2 . PHE A 1 489 ? -64.029  21.087  -47.066 1.00 99.99  ? 493 PHE C CE2 1  
ATOM 3640   C CZ  . PHE A 1 489 ? -65.101  21.068  -47.964 1.00 99.99  ? 493 PHE C CZ  1  
ATOM 3641   N N   . ILE A 1 490 ? -64.595  16.844  -42.298 1.00 30.00  ? 494 ILE C N   1  
ATOM 3642   C CA  . ILE A 1 490 ? -64.492  15.705  -41.389 1.00 30.00  ? 494 ILE C CA  1  
ATOM 3643   C C   . ILE A 1 490 ? -65.501  15.857  -40.251 1.00 30.00  ? 494 ILE C C   1  
ATOM 3644   O O   . ILE A 1 490 ? -66.240  14.912  -39.929 1.00 30.00  ? 494 ILE C O   1  
ATOM 3645   C CB  . ILE A 1 490 ? -63.085  15.634  -40.804 1.00 99.99  ? 494 ILE C CB  1  
ATOM 3646   C CG1 . ILE A 1 490 ? -63.002  16.523  -39.566 1.00 99.99  ? 494 ILE C CG1 1  
ATOM 3647   C CG2 . ILE A 1 490 ? -62.079  16.117  -41.845 1.00 99.99  ? 494 ILE C CG2 1  
ATOM 3648   C CD1 . ILE A 1 490 ? -63.267  15.684  -38.321 1.00 99.99  ? 494 ILE C CD1 1  
ATOM 3649   N N   . LEU A 1 491 ? -65.482  17.062  -39.722 1.00 2.00   ? 495 LEU C N   1  
ATOM 3650   C CA  . LEU A 1 491 ? -66.264  17.475  -38.547 1.00 2.00   ? 495 LEU C CA  1  
ATOM 3651   C C   . LEU A 1 491 ? -67.788  17.475  -38.791 1.00 2.00   ? 495 LEU C C   1  
ATOM 3652   O O   . LEU A 1 491 ? -68.532  16.695  -38.181 1.00 45.03  ? 495 LEU C O   1  
ATOM 3653   C CB  . LEU A 1 491 ? -65.873  18.890  -38.134 1.00 99.99  ? 495 LEU C CB  1  
ATOM 3654   C CG  . LEU A 1 491 ? -64.805  18.828  -37.050 1.00 99.99  ? 495 LEU C CG  1  
ATOM 3655   C CD1 . LEU A 1 491 ? -64.651  20.204  -36.408 1.00 99.99  ? 495 LEU C CD1 1  
ATOM 3656   C CD2 . LEU A 1 491 ? -65.217  17.815  -35.988 1.00 99.99  ? 495 LEU C CD2 1  
ATOM 3657   N N   . GLU A 1 492 ? -68.208  18.364  -39.665 1.00 40.00  ? 496 GLU C N   1  
ATOM 3658   C CA  . GLU A 1 492 ? -69.631  18.576  -40.008 1.00 40.00  ? 496 GLU C CA  1  
ATOM 3659   C C   . GLU A 1 492 ? -70.460  17.276  -39.961 1.00 40.00  ? 496 GLU C C   1  
ATOM 3660   O O   . GLU A 1 492 ? -71.494  17.199  -39.281 1.00 31.53  ? 496 GLU C O   1  
ATOM 3661   C CB  . GLU A 1 492 ? -69.747  19.146  -41.418 1.00 99.99  ? 496 GLU C CB  1  
ATOM 3662   C CG  . GLU A 1 492 ? -69.117  20.519  -41.459 1.00 99.99  ? 496 GLU C CG  1  
ATOM 3663   C CD  . GLU A 1 492 ? -70.009  21.510  -40.716 1.00 99.99  ? 496 GLU C CD  1  
ATOM 3664   O OE1 . GLU A 1 492 ? -69.800  21.664  -39.484 1.00 99.99  ? 496 GLU C OE1 1  
ATOM 3665   O OE2 . GLU A 1 492 ? -70.893  22.107  -41.389 1.00 99.99  ? 496 GLU C OE2 1  
ATOM 3666   N N   . GLN A 1 493 ? -69.989  16.283  -40.695 1.00 27.51  ? 497 GLN C N   1  
ATOM 3667   C CA  . GLN A 1 493 ? -70.680  14.981  -40.834 1.00 27.51  ? 497 GLN C CA  1  
ATOM 3668   C C   . GLN A 1 493 ? -70.709  14.189  -39.517 1.00 27.51  ? 497 GLN C C   1  
ATOM 3669   O O   . GLN A 1 493 ? -71.662  13.447  -39.234 1.00 4.76   ? 497 GLN C O   1  
ATOM 3670   C CB  . GLN A 1 493 ? -69.971  14.124  -41.878 1.00 99.99  ? 497 GLN C CB  1  
ATOM 3671   C CG  . GLN A 1 493 ? -70.946  13.102  -42.449 1.00 99.99  ? 497 GLN C CG  1  
ATOM 3672   C CD  . GLN A 1 493 ? -71.015  11.859  -41.573 1.00 99.99  ? 497 GLN C CD  1  
ATOM 3673   O OE1 . GLN A 1 493 ? -70.336  11.779  -40.552 1.00 99.99  ? 497 GLN C OE1 1  
ATOM 3674   N NE2 . GLN A 1 493 ? -71.842  10.891  -41.975 1.00 99.99  ? 497 GLN C NE2 1  
ATOM 3675   N N   . GLU A 1 494 ? -69.661  14.353  -38.736 1.00 5.92   ? 498 GLU C N   1  
ATOM 3676   C CA  . GLU A 1 494 ? -69.519  13.655  -37.448 1.00 5.92   ? 498 GLU C CA  1  
ATOM 3677   C C   . GLU A 1 494 ? -70.690  13.997  -36.516 1.00 5.92   ? 498 GLU C C   1  
ATOM 3678   O O   . GLU A 1 494 ? -71.345  13.100  -35.959 1.00 100.00 ? 498 GLU C O   1  
ATOM 3679   C CB  . GLU A 1 494 ? -68.218  14.073  -36.770 1.00 99.99  ? 498 GLU C CB  1  
ATOM 3680   C CG  . GLU A 1 494 ? -67.044  13.617  -37.602 1.00 99.99  ? 498 GLU C CG  1  
ATOM 3681   C CD  . GLU A 1 494 ? -66.903  12.100  -37.492 1.00 99.99  ? 498 GLU C CD  1  
ATOM 3682   O OE1 . GLU A 1 494 ? -67.528  11.401  -38.335 1.00 99.99  ? 498 GLU C OE1 1  
ATOM 3683   O OE2 . GLU A 1 494 ? -66.173  11.655  -36.567 1.00 99.99  ? 498 GLU C OE2 1  
ATOM 3684   N N   . GLU A 1 495 ? -70.912  15.291  -36.385 1.00 2.00   ? 499 GLU C N   1  
ATOM 3685   C CA  . GLU A 1 495 ? -71.973  15.850  -35.532 1.00 2.00   ? 499 GLU C CA  1  
ATOM 3686   C C   . GLU A 1 495 ? -73.342  15.320  -35.965 1.00 2.00   ? 499 GLU C C   1  
ATOM 3687   O O   . GLU A 1 495 ? -74.226  15.070  -35.132 1.00 97.60  ? 499 GLU C O   1  
ATOM 3688   C CB  . GLU A 1 495 ? -71.978  17.371  -35.636 1.00 99.99  ? 499 GLU C CB  1  
ATOM 3689   C CG  . GLU A 1 495 ? -70.686  17.920  -35.079 1.00 99.99  ? 499 GLU C CG  1  
ATOM 3690   C CD  . GLU A 1 495 ? -70.690  17.776  -33.558 1.00 99.99  ? 499 GLU C CD  1  
ATOM 3691   O OE1 . GLU A 1 495 ? -70.220  16.713  -33.079 1.00 99.99  ? 499 GLU C OE1 1  
ATOM 3692   O OE2 . GLU A 1 495 ? -71.162  18.735  -32.890 1.00 99.99  ? 499 GLU C OE2 1  
ATOM 3693   N N   . TYR A 1 496 ? -73.484  15.170  -37.268 1.00 20.41  ? 500 TYR C N   1  
ATOM 3694   C CA  . TYR A 1 496 ? -74.723  14.655  -37.866 1.00 20.41  ? 500 TYR C CA  1  
ATOM 3695   C C   . TYR A 1 496 ? -75.008  13.268  -37.293 1.00 20.41  ? 500 TYR C C   1  
ATOM 3696   O O   . TYR A 1 496 ? -76.166  12.923  -37.007 1.00 2.00   ? 500 TYR C O   1  
ATOM 3697   C CB  . TYR A 1 496 ? -74.564  14.559  -39.381 1.00 99.99  ? 500 TYR C CB  1  
ATOM 3698   C CG  . TYR A 1 496 ? -74.604  15.944  -39.980 1.00 99.99  ? 500 TYR C CG  1  
ATOM 3699   C CD1 . TYR A 1 496 ? -75.829  16.604  -40.136 1.00 99.99  ? 500 TYR C CD1 1  
ATOM 3700   C CD2 . TYR A 1 496 ? -73.415  16.570  -40.379 1.00 99.99  ? 500 TYR C CD2 1  
ATOM 3701   C CE1 . TYR A 1 496 ? -75.865  17.890  -40.693 1.00 99.99  ? 500 TYR C CE1 1  
ATOM 3702   C CE2 . TYR A 1 496 ? -73.450  17.852  -40.935 1.00 99.99  ? 500 TYR C CE2 1  
ATOM 3703   C CZ  . TYR A 1 496 ? -74.677  18.511  -41.091 1.00 99.99  ? 500 TYR C CZ  1  
ATOM 3704   O OH  . TYR A 1 496 ? -74.714  19.761  -41.632 1.00 99.99  ? 500 TYR C OH  1  
ATOM 3705   N N   . LYS A 1 497 ? -73.925  12.527  -37.148 1.00 2.00   ? 501 LYS C N   1  
ATOM 3706   C CA  . LYS A 1 497 ? -73.950  11.166  -36.601 1.00 2.00   ? 501 LYS C CA  1  
ATOM 3707   C C   . LYS A 1 497 ? -74.259  11.219  -35.104 1.00 2.00   ? 501 LYS C C   1  
ATOM 3708   O O   . LYS A 1 497 ? -75.208  10.581  -34.627 1.00 92.11  ? 501 LYS C O   1  
ATOM 3709   C CB  . LYS A 1 497 ? -72.592  10.501  -36.810 1.00 99.99  ? 501 LYS C CB  1  
ATOM 3710   C CG  . LYS A 1 497 ? -72.657  9.055   -36.330 1.00 99.99  ? 501 LYS C CG  1  
ATOM 3711   C CD  . LYS A 1 497 ? -71.494  8.271   -36.927 1.00 99.99  ? 501 LYS C CD  1  
ATOM 3712   C CE  . LYS A 1 497 ? -71.332  6.951   -36.176 1.00 99.99  ? 501 LYS C CE  1  
ATOM 3713   N NZ  . LYS A 1 497 ? -72.075  5.893   -36.877 1.00 99.99  ? 501 LYS C NZ  1  
ATOM 3714   N N   . LYS A 1 498 ? -73.439  11.991  -34.414 1.00 2.00   ? 502 LYS C N   1  
ATOM 3715   C CA  . LYS A 1 498 ? -73.551  12.188  -32.961 1.00 2.00   ? 502 LYS C CA  1  
ATOM 3716   C C   . LYS A 1 498 ? -75.016  12.387  -32.562 1.00 2.00   ? 502 LYS C C   1  
ATOM 3717   O O   . LYS A 1 498 ? -75.605  11.546  -31.866 1.00 55.60  ? 502 LYS C O   1  
ATOM 3718   C CB  . LYS A 1 498 ? -72.753  13.416  -32.543 1.00 99.99  ? 502 LYS C CB  1  
ATOM 3719   C CG  . LYS A 1 498 ? -71.345  12.997  -32.133 1.00 99.99  ? 502 LYS C CG  1  
ATOM 3720   C CD  . LYS A 1 498 ? -70.521  12.692  -33.378 1.00 99.99  ? 502 LYS C CD  1  
ATOM 3721   C CE  . LYS A 1 498 ? -69.185  12.084  -32.967 1.00 99.99  ? 502 LYS C CE  1  
ATOM 3722   N NZ  . LYS A 1 498 ? -68.441  11.680  -34.169 1.00 99.99  ? 502 LYS C NZ  1  
ATOM 3723   N N   . GLU A 1 499 ? -75.555  13.503  -33.022 1.00 49.72  ? 503 GLU C N   1  
ATOM 3724   C CA  . GLU A 1 499 ? -76.949  13.896  -32.752 1.00 49.72  ? 503 GLU C CA  1  
ATOM 3725   C C   . GLU A 1 499 ? -77.899  12.751  -33.121 1.00 49.72  ? 503 GLU C C   1  
ATOM 3726   O O   . GLU A 1 499 ? -78.975  12.595  -32.530 1.00 22.28  ? 503 GLU C O   1  
ATOM 3727   C CB  . GLU A 1 499 ? -77.313  15.125  -33.578 1.00 99.99  ? 503 GLU C CB  1  
ATOM 3728   C CG  . GLU A 1 499 ? -76.475  16.300  -33.130 1.00 99.99  ? 503 GLU C CG  1  
ATOM 3729   C CD  . GLU A 1 499 ? -76.953  16.771  -31.759 1.00 99.99  ? 503 GLU C CD  1  
ATOM 3730   O OE1 . GLU A 1 499 ? -76.415  16.246  -30.748 1.00 99.99  ? 503 GLU C OE1 1  
ATOM 3731   O OE2 . GLU A 1 499 ? -77.854  17.653  -31.734 1.00 99.99  ? 503 GLU C OE2 1  
ATOM 3732   N N   . GLY A 1 500 ? -77.463  11.987  -34.102 1.00 2.00   ? 504 GLY C N   1  
ATOM 3733   C CA  . GLY A 1 500 ? -78.199  10.810  -34.576 1.00 2.00   ? 504 GLY C CA  1  
ATOM 3734   C C   . GLY A 1 500 ? -79.289  11.187  -35.586 1.00 2.00   ? 504 GLY C C   1  
ATOM 3735   O O   . GLY A 1 500 ? -80.442  10.736  -35.480 1.00 2.00   ? 504 GLY C O   1  
ATOM 3736   N N   . ILE A 1 501 ? -78.899  12.008  -36.541 1.00 11.19  ? 505 ILE C N   1  
ATOM 3737   C CA  . ILE A 1 501 ? -79.786  12.421  -37.638 1.00 11.19  ? 505 ILE C CA  1  
ATOM 3738   C C   . ILE A 1 501 ? -79.650  11.391  -38.759 1.00 11.19  ? 505 ILE C C   1  
ATOM 3739   O O   . ILE A 1 501 ? -79.432  10.198  -38.510 1.00 4.95   ? 505 ILE C O   1  
ATOM 3740   C CB  . ILE A 1 501 ? -79.383  13.803  -38.138 1.00 99.99  ? 505 ILE C CB  1  
ATOM 3741   C CG1 . ILE A 1 501 ? -80.156  14.130  -39.411 1.00 99.99  ? 505 ILE C CG1 1  
ATOM 3742   C CG2 . ILE A 1 501 ? -77.884  13.820  -38.434 1.00 99.99  ? 505 ILE C CG2 1  
ATOM 3743   C CD1 . ILE A 1 501 ? -81.612  13.709  -39.244 1.00 99.99  ? 505 ILE C CD1 1  
ATOM 3744   N N   . ALA A 1 502 ? -79.769  11.856  -39.989 1.00 30.00  ? 506 ALA C N   1  
ATOM 3745   C CA  . ALA A 1 502 ? -79.638  10.984  -41.174 1.00 30.00  ? 506 ALA C CA  1  
ATOM 3746   C C   . ALA A 1 502 ? -78.633  11.594  -42.153 1.00 30.00  ? 506 ALA C C   1  
ATOM 3747   O O   . ALA A 1 502 ? -78.530  12.821  -42.283 1.00 30.00  ? 506 ALA C O   1  
ATOM 3748   C CB  . ALA A 1 502 ? -80.992  10.841  -41.871 1.00 30.00  ? 506 ALA C CB  1  
ATOM 3749   N N   . TRP A 1 503 ? -77.885  10.731  -42.841 1.00 30.00  ? 507 TRP C N   1  
ATOM 3750   C CA  . TRP A 1 503 ? -76.897  11.217  -43.816 1.00 30.00  ? 507 TRP C CA  1  
ATOM 3751   C C   . TRP A 1 503 ? -75.983  10.113  -44.373 1.00 30.00  ? 507 TRP C C   1  
ATOM 3752   O O   . TRP A 1 503 ? -75.832  9.038   -43.767 1.00 30.00  ? 507 TRP C O   1  
ATOM 3753   C CB  . TRP A 1 503 ? -75.993  12.258  -43.165 1.00 99.99  ? 507 TRP C CB  1  
ATOM 3754   C CG  . TRP A 1 503 ? -75.023  12.939  -44.101 1.00 99.99  ? 507 TRP C CG  1  
ATOM 3755   C CD1 . TRP A 1 503 ? -73.880  12.433  -44.585 1.00 99.99  ? 507 TRP C CD1 1  
ATOM 3756   C CD2 . TRP A 1 503 ? -75.122  14.224  -44.647 1.00 99.99  ? 507 TRP C CD2 1  
ATOM 3757   N NE1 . TRP A 1 503 ? -73.303  13.434  -45.426 1.00 99.99  ? 507 TRP C NE1 1  
ATOM 3758   C CE2 . TRP A 1 503 ? -74.082  14.488  -45.430 1.00 99.99  ? 507 TRP C CE2 1  
ATOM 3759   C CE3 . TRP A 1 503 ? -76.122  15.190  -44.472 1.00 99.99  ? 507 TRP C CE3 1  
ATOM 3760   C CZ2 . TRP A 1 503 ? -73.896  15.695  -46.119 1.00 99.99  ? 507 TRP C CZ2 1  
ATOM 3761   C CZ3 . TRP A 1 503 ? -75.957  16.412  -45.154 1.00 99.99  ? 507 TRP C CZ3 1  
ATOM 3762   C CH2 . TRP A 1 503 ? -74.888  16.653  -45.943 1.00 99.99  ? 507 TRP C CH2 1  
ATOM 3763   N N   . GLU A 1 504 ? -75.429  10.488  -45.520 1.00 30.00  ? 508 GLU C N   1  
ATOM 3764   C CA  . GLU A 1 504 ? -74.460  9.702   -46.304 1.00 30.00  ? 508 GLU C CA  1  
ATOM 3765   C C   . GLU A 1 504 ? -73.216  10.578  -46.519 1.00 30.00  ? 508 GLU C C   1  
ATOM 3766   O O   . GLU A 1 504 ? -73.318  11.742  -46.929 1.00 30.00  ? 508 GLU C O   1  
ATOM 3767   C CB  . GLU A 1 504 ? -75.070  9.315   -47.646 1.00 99.99  ? 508 GLU C CB  1  
ATOM 3768   C CG  . GLU A 1 504 ? -74.384  8.080   -48.175 1.00 99.99  ? 508 GLU C CG  1  
ATOM 3769   C CD  . GLU A 1 504 ? -73.115  8.481   -48.927 1.00 99.99  ? 508 GLU C CD  1  
ATOM 3770   O OE1 . GLU A 1 504 ? -72.050  8.557   -48.261 1.00 99.99  ? 508 GLU C OE1 1  
ATOM 3771   O OE2 . GLU A 1 504 ? -73.229  8.713   -50.161 1.00 99.99  ? 508 GLU C OE2 1  
ATOM 3772   N N   . PHE A 1 505 ? -72.071  9.988   -46.230 1.00 30.00  ? 509 PHE C N   1  
ATOM 3773   C CA  . PHE A 1 505 ? -70.762  10.675  -46.305 1.00 30.00  ? 509 PHE C CA  1  
ATOM 3774   C C   . PHE A 1 505 ? -70.474  11.225  -47.710 1.00 30.00  ? 509 PHE C C   1  
ATOM 3775   O O   . PHE A 1 505 ? -71.061  10.777  -48.707 1.00 30.00  ? 509 PHE C O   1  
ATOM 3776   C CB  . PHE A 1 505 ? -69.646  9.698   -45.945 1.00 99.99  ? 509 PHE C CB  1  
ATOM 3777   C CG  . PHE A 1 505 ? -68.316  10.407  -46.024 1.00 99.99  ? 509 PHE C CG  1  
ATOM 3778   C CD1 . PHE A 1 505 ? -67.867  11.174  -44.943 1.00 99.99  ? 509 PHE C CD1 1  
ATOM 3779   C CD2 . PHE A 1 505 ? -67.531  10.296  -47.179 1.00 99.99  ? 509 PHE C CD2 1  
ATOM 3780   C CE1 . PHE A 1 505 ? -66.632  11.830  -45.015 1.00 99.99  ? 509 PHE C CE1 1  
ATOM 3781   C CE2 . PHE A 1 505 ? -66.297  10.954  -47.251 1.00 99.99  ? 509 PHE C CE2 1  
ATOM 3782   C CZ  . PHE A 1 505 ? -65.848  11.720  -46.169 1.00 99.99  ? 509 PHE C CZ  1  
ATOM 3783   N N   . ILE A 1 506 ? -69.559  12.184  -47.700 1.00 30.00  ? 510 ILE C N   1  
ATOM 3784   C CA  . ILE A 1 506 ? -69.064  12.877  -48.904 1.00 30.00  ? 510 ILE C CA  1  
ATOM 3785   C C   . ILE A 1 506 ? -67.576  13.198  -48.713 1.00 30.00  ? 510 ILE C C   1  
ATOM 3786   O O   . ILE A 1 506 ? -67.189  13.909  -47.774 1.00 30.00  ? 510 ILE C O   1  
ATOM 3787   C CB  . ILE A 1 506 ? -69.845  14.171  -49.115 1.00 99.99  ? 510 ILE C CB  1  
ATOM 3788   C CG1 . ILE A 1 506 ? -69.271  15.263  -48.220 1.00 99.99  ? 510 ILE C CG1 1  
ATOM 3789   C CG2 . ILE A 1 506 ? -71.310  13.941  -48.762 1.00 99.99  ? 510 ILE C CG2 1  
ATOM 3790   C CD1 . ILE A 1 506 ? -70.038  15.299  -46.902 1.00 99.99  ? 510 ILE C CD1 1  
ATOM 3791   N N   . ASP A 1 507 ? -66.776  12.657  -49.616 1.00 30.00  ? 511 ASP C N   1  
ATOM 3792   C CA  . ASP A 1 507 ? -65.311  12.824  -49.589 1.00 30.00  ? 511 ASP C CA  1  
ATOM 3793   C C   . ASP A 1 507 ? -64.885  14.036  -50.423 1.00 30.00  ? 511 ASP C C   1  
ATOM 3794   O O   . ASP A 1 507 ? -64.838  13.974  -51.660 1.00 30.00  ? 511 ASP C O   1  
ATOM 3795   C CB  . ASP A 1 507 ? -64.636  11.580  -50.156 1.00 99.99  ? 511 ASP C CB  1  
ATOM 3796   C CG  . ASP A 1 507 ? -65.303  11.193  -51.474 1.00 99.99  ? 511 ASP C CG  1  
ATOM 3797   O OD1 . ASP A 1 507 ? -66.549  10.999  -51.453 1.00 99.99  ? 511 ASP C OD1 1  
ATOM 3798   O OD2 . ASP A 1 507 ? -64.562  11.097  -52.488 1.00 99.99  ? 511 ASP C OD2 1  
ATOM 3799   N N   . PHE A 1 508 ? -64.578  15.102  -49.712 1.00 30.00  ? 512 PHE C N   1  
ATOM 3800   C CA  . PHE A 1 508 ? -64.144  16.372  -50.317 1.00 30.00  ? 512 PHE C CA  1  
ATOM 3801   C C   . PHE A 1 508 ? -62.657  16.298  -50.686 1.00 30.00  ? 512 PHE C C   1  
ATOM 3802   O O   . PHE A 1 508 ? -62.096  17.239  -51.264 1.00 30.00  ? 512 PHE C O   1  
ATOM 3803   C CB  . PHE A 1 508 ? -64.355  17.516  -49.334 1.00 99.99  ? 512 PHE C CB  1  
ATOM 3804   C CG  . PHE A 1 508 ? -65.831  17.670  -49.050 1.00 99.99  ? 512 PHE C CG  1  
ATOM 3805   C CD1 . PHE A 1 508 ? -66.420  16.947  -48.005 1.00 99.99  ? 512 PHE C CD1 1  
ATOM 3806   C CD2 . PHE A 1 508 ? -66.607  18.535  -49.828 1.00 99.99  ? 512 PHE C CD2 1  
ATOM 3807   C CE1 . PHE A 1 508 ? -67.788  17.089  -47.740 1.00 99.99  ? 512 PHE C CE1 1  
ATOM 3808   C CE2 . PHE A 1 508 ? -67.975  18.677  -49.564 1.00 99.99  ? 512 PHE C CE2 1  
ATOM 3809   C CZ  . PHE A 1 508 ? -68.564  17.955  -48.522 1.00 99.99  ? 512 PHE C CZ  1  
ATOM 3810   N N   . GLY A 1 509 ? -62.067  15.169  -50.333 1.00 30.00  ? 513 GLY C N   1  
ATOM 3811   C CA  . GLY A 1 509 ? -60.643  14.899  -50.593 1.00 30.00  ? 513 GLY C CA  1  
ATOM 3812   C C   . GLY A 1 509 ? -59.801  16.137  -50.279 1.00 30.00  ? 513 GLY C C   1  
ATOM 3813   O O   . GLY A 1 509 ? -59.301  16.819  -51.185 1.00 30.00  ? 513 GLY C O   1  
ATOM 3814   N N   . MET A 1 510 ? -59.671  16.392  -48.992 1.00 30.00  ? 514 MET C N   1  
ATOM 3815   C CA  . MET A 1 510 ? -58.901  17.534  -48.476 1.00 30.00  ? 514 MET C CA  1  
ATOM 3816   C C   . MET A 1 510 ? -58.199  17.144  -47.176 1.00 30.00  ? 514 MET C C   1  
ATOM 3817   O O   . MET A 1 510 ? -58.747  17.314  -46.077 1.00 30.00  ? 514 MET C O   1  
ATOM 3818   C CB  . MET A 1 510 ? -59.835  18.709  -48.204 1.00 99.99  ? 514 MET C CB  1  
ATOM 3819   C CG  . MET A 1 510 ? -60.184  19.397  -49.519 1.00 99.99  ? 514 MET C CG  1  
ATOM 3820   S SD  . MET A 1 510 ? -60.547  21.146  -49.226 1.00 99.99  ? 514 MET C SD  1  
ATOM 3821   C CE  . MET A 1 510 ? -59.065  21.628  -48.364 1.00 99.99  ? 514 MET C CE  1  
ATOM 3822   N N   . ASP A 1 511 ? -56.995  16.631  -47.342 1.00 30.00  ? 515 ASP C N   1  
ATOM 3823   C CA  . ASP A 1 511 ? -56.165  16.190  -46.213 1.00 30.00  ? 515 ASP C CA  1  
ATOM 3824   C C   . ASP A 1 511 ? -54.688  16.448  -46.501 1.00 30.00  ? 515 ASP C C   1  
ATOM 3825   O O   . ASP A 1 511 ? -54.201  16.210  -47.616 1.00 30.00  ? 515 ASP C O   1  
ATOM 3826   C CB  . ASP A 1 511 ? -56.366  14.698  -45.973 1.00 99.99  ? 515 ASP C CB  1  
ATOM 3827   C CG  . ASP A 1 511 ? -55.701  14.298  -44.659 1.00 99.99  ? 515 ASP C CG  1  
ATOM 3828   O OD1 . ASP A 1 511 ? -54.453  14.118  -44.674 1.00 99.99  ? 515 ASP C OD1 1  
ATOM 3829   O OD2 . ASP A 1 511 ? -56.446  14.175  -43.650 1.00 99.99  ? 515 ASP C OD2 1  
ATOM 3830   N N   . LEU A 1 512 ? -54.018  16.923  -45.474 1.00 30.00  ? 516 LEU C N   1  
ATOM 3831   C CA  . LEU A 1 512 ? -52.590  17.232  -45.541 1.00 30.00  ? 516 LEU C CA  1  
ATOM 3832   C C   . LEU A 1 512 ? -51.851  16.576  -44.381 1.00 30.00  ? 516 LEU C C   1  
ATOM 3833   O O   . LEU A 1 512 ? -50.647  16.798  -44.180 1.00 30.00  ? 516 LEU C O   1  
ATOM 3834   C CB  . LEU A 1 512 ? -52.382  18.741  -45.470 1.00 99.99  ? 516 LEU C CB  1  
ATOM 3835   C CG  . LEU A 1 512 ? -52.282  19.310  -46.881 1.00 99.99  ? 516 LEU C CG  1  
ATOM 3836   C CD1 . LEU A 1 512 ? -51.752  20.738  -46.817 1.00 99.99  ? 516 LEU C CD1 1  
ATOM 3837   C CD2 . LEU A 1 512 ? -51.337  18.451  -47.711 1.00 99.99  ? 516 LEU C CD2 1  
ATOM 3838   N N   . GLN A 1 513 ? -52.581  15.778  -43.626 1.00 30.00  ? 517 GLN C N   1  
ATOM 3839   C CA  . GLN A 1 513 ? -51.991  15.064  -42.493 1.00 30.00  ? 517 GLN C CA  1  
ATOM 3840   C C   . GLN A 1 513 ? -50.569  14.673  -42.880 1.00 30.00  ? 517 GLN C C   1  
ATOM 3841   O O   . GLN A 1 513 ? -49.642  14.741  -42.062 1.00 30.00  ? 517 GLN C O   1  
ATOM 3842   C CB  . GLN A 1 513 ? -52.814  13.818  -42.183 1.00 99.99  ? 517 GLN C CB  1  
ATOM 3843   C CG  . GLN A 1 513 ? -52.603  13.416  -40.727 1.00 99.99  ? 517 GLN C CG  1  
ATOM 3844   C CD  . GLN A 1 513 ? -51.358  12.554  -40.570 1.00 99.99  ? 517 GLN C CD  1  
ATOM 3845   O OE1 . GLN A 1 513 ? -50.671  12.269  -41.550 1.00 99.99  ? 517 GLN C OE1 1  
ATOM 3846   N NE2 . GLN A 1 513 ? -51.069  12.140  -39.334 1.00 99.99  ? 517 GLN C NE2 1  
ATOM 3847   N N   . MET A 1 514 ? -50.464  14.287  -44.137 1.00 30.00  ? 518 MET C N   1  
ATOM 3848   C CA  . MET A 1 514 ? -49.203  13.858  -44.749 1.00 30.00  ? 518 MET C CA  1  
ATOM 3849   C C   . MET A 1 514 ? -48.157  14.964  -44.635 1.00 30.00  ? 518 MET C C   1  
ATOM 3850   O O   . MET A 1 514 ? -47.332  14.981  -43.711 1.00 30.00  ? 518 MET C O   1  
ATOM 3851   C CB  . MET A 1 514 ? -49.423  13.537  -46.223 1.00 99.99  ? 518 MET C CB  1  
ATOM 3852   C CG  . MET A 1 514 ? -50.618  12.603  -46.368 1.00 99.99  ? 518 MET C CG  1  
ATOM 3853   S SD  . MET A 1 514 ? -50.123  10.902  -45.998 1.00 99.99  ? 518 MET C SD  1  
ATOM 3854   C CE  . MET A 1 514 ? -49.251  10.501  -47.498 1.00 99.99  ? 518 MET C CE  1  
ATOM 3855   N N   . CYS A 1 515 ? -48.194  15.882  -45.589 1.00 30.00  ? 519 CYS C N   1  
ATOM 3856   C CA  . CYS A 1 515 ? -47.253  17.002  -45.573 1.00 30.00  ? 519 CYS C CA  1  
ATOM 3857   C C   . CYS A 1 515 ? -46.921  17.265  -44.113 1.00 30.00  ? 519 CYS C C   1  
ATOM 3858   O O   . CYS A 1 515 ? -45.750  17.307  -43.717 1.00 30.00  ? 519 CYS C O   1  
ATOM 3859   C CB  . CYS A 1 515 ? -47.895  18.228  -46.211 1.00 99.99  ? 519 CYS C CB  1  
ATOM 3860   S SG  . CYS A 1 515 ? -49.306  18.938  -45.326 1.00 99.99  ? 519 CYS C SG  1  
ATOM 3861   N N   . ILE A 1 516 ? -47.988  17.411  -43.359 1.00 30.00  ? 520 ILE C N   1  
ATOM 3862   C CA  . ILE A 1 516 ? -47.905  17.622  -41.920 1.00 30.00  ? 520 ILE C CA  1  
ATOM 3863   C C   . ILE A 1 516 ? -47.019  16.528  -41.314 1.00 30.00  ? 520 ILE C C   1  
ATOM 3864   O O   . ILE A 1 516 ? -46.046  16.816  -40.604 1.00 30.00  ? 520 ILE C O   1  
ATOM 3865   C CB  . ILE A 1 516 ? -49.295  17.554  -41.302 1.00 99.99  ? 520 ILE C CB  1  
ATOM 3866   C CG1 . ILE A 1 516 ? -49.989  18.903  -41.460 1.00 99.99  ? 520 ILE C CG1 1  
ATOM 3867   C CG2 . ILE A 1 516 ? -49.178  17.215  -39.819 1.00 99.99  ? 520 ILE C CG2 1  
ATOM 3868   C CD1 . ILE A 1 516 ? -50.916  18.863  -42.670 1.00 99.99  ? 520 ILE C CD1 1  
ATOM 3869   N N   . ASP A 1 517 ? -47.388  15.299  -41.645 1.00 30.00  ? 521 ASP C N   1  
ATOM 3870   C CA  . ASP A 1 517 ? -46.715  14.080  -41.154 1.00 30.00  ? 521 ASP C CA  1  
ATOM 3871   C C   . ASP A 1 517 ? -45.243  14.006  -41.608 1.00 30.00  ? 521 ASP C C   1  
ATOM 3872   O O   . ASP A 1 517 ? -44.354  13.628  -40.834 1.00 30.00  ? 521 ASP C O   1  
ATOM 3873   C CB  . ASP A 1 517 ? -47.432  12.841  -41.684 1.00 99.99  ? 521 ASP C CB  1  
ATOM 3874   C CG  . ASP A 1 517 ? -46.892  11.600  -40.981 1.00 99.99  ? 521 ASP C CG  1  
ATOM 3875   O OD1 . ASP A 1 517 ? -45.798  11.135  -41.397 1.00 99.99  ? 521 ASP C OD1 1  
ATOM 3876   O OD2 . ASP A 1 517 ? -47.576  11.127  -40.034 1.00 99.99  ? 521 ASP C OD2 1  
ATOM 3877   N N   . LEU A 1 518 ? -45.012  14.353  -42.861 1.00 30.00  ? 522 LEU C N   1  
ATOM 3878   C CA  . LEU A 1 518 ? -43.651  14.333  -43.445 1.00 30.00  ? 522 LEU C CA  1  
ATOM 3879   C C   . LEU A 1 518 ? -42.707  15.177  -42.586 1.00 30.00  ? 522 LEU C C   1  
ATOM 3880   O O   . LEU A 1 518 ? -41.531  14.839  -42.403 1.00 30.00  ? 522 LEU C O   1  
ATOM 3881   C CB  . LEU A 1 518 ? -43.682  14.897  -44.860 1.00 99.99  ? 522 LEU C CB  1  
ATOM 3882   C CG  . LEU A 1 518 ? -43.823  13.758  -45.862 1.00 99.99  ? 522 LEU C CG  1  
ATOM 3883   C CD1 . LEU A 1 518 ? -43.528  14.275  -47.265 1.00 99.99  ? 522 LEU C CD1 1  
ATOM 3884   C CD2 . LEU A 1 518 ? -42.839  12.648  -45.510 1.00 99.99  ? 522 LEU C CD2 1  
ATOM 3885   N N   . ILE A 1 519 ? -43.245  16.279  -42.065 1.00 30.00  ? 523 ILE C N   1  
ATOM 3886   C CA  . ILE A 1 519 ? -42.509  17.222  -41.236 1.00 30.00  ? 523 ILE C CA  1  
ATOM 3887   C C   . ILE A 1 519 ? -42.535  16.951  -39.723 1.00 30.00  ? 523 ILE C C   1  
ATOM 3888   O O   . ILE A 1 519 ? -41.493  16.974  -39.083 1.00 30.00  ? 523 ILE C O   1  
ATOM 3889   C CB  . ILE A 1 519 ? -43.074  18.626  -41.421 1.00 99.99  ? 523 ILE C CB  1  
ATOM 3890   C CG1 . ILE A 1 519 ? -42.455  19.563  -40.390 1.00 99.99  ? 523 ILE C CG1 1  
ATOM 3891   C CG2 . ILE A 1 519 ? -44.589  18.594  -41.235 1.00 99.99  ? 523 ILE C CG2 1  
ATOM 3892   C CD1 . ILE A 1 519 ? -40.957  19.286  -40.285 1.00 99.99  ? 523 ILE C CD1 1  
ATOM 3893   N N   . GLU A 1 520 ? -43.711  16.674  -39.163 1.00 30.00  ? 524 GLU C N   1  
ATOM 3894   C CA  . GLU A 1 520 ? -43.825  16.445  -37.724 1.00 30.00  ? 524 GLU C CA  1  
ATOM 3895   C C   . GLU A 1 520 ? -43.774  15.033  -37.137 1.00 30.00  ? 524 GLU C C   1  
ATOM 3896   O O   . GLU A 1 520 ? -43.178  14.834  -36.089 1.00 30.00  ? 524 GLU C O   1  
ATOM 3897   C CB  . GLU A 1 520 ? -45.160  16.977  -37.217 1.00 99.99  ? 524 GLU C CB  1  
ATOM 3898   C CG  . GLU A 1 520 ? -45.053  17.290  -35.744 1.00 99.99  ? 524 GLU C CG  1  
ATOM 3899   C CD  . GLU A 1 520 ? -45.313  16.023  -34.935 1.00 99.99  ? 524 GLU C CD  1  
ATOM 3900   O OE1 . GLU A 1 520 ? -44.318  15.301  -34.658 1.00 99.99  ? 524 GLU C OE1 1  
ATOM 3901   O OE2 . GLU A 1 520 ? -46.505  15.787  -34.599 1.00 99.99  ? 524 GLU C OE2 1  
ATOM 3902   N N   . LYS A 1 521 ? -44.384  14.056  -37.792 1.00 30.00  ? 525 LYS C N   1  
ATOM 3903   C CA  . LYS A 1 521 ? -44.401  12.674  -37.281 1.00 30.00  ? 525 LYS C CA  1  
ATOM 3904   C C   . LYS A 1 521 ? -43.067  12.062  -36.845 1.00 30.00  ? 525 LYS C C   1  
ATOM 3905   O O   . LYS A 1 521 ? -41.997  12.468  -37.305 1.00 30.00  ? 525 LYS C O   1  
ATOM 3906   C CB  . LYS A 1 521 ? -44.940  11.734  -38.352 1.00 99.99  ? 525 LYS C CB  1  
ATOM 3907   C CG  . LYS A 1 521 ? -45.048  10.323  -37.779 1.00 99.99  ? 525 LYS C CG  1  
ATOM 3908   C CD  . LYS A 1 521 ? -45.976  9.489   -38.655 1.00 99.99  ? 525 LYS C CD  1  
ATOM 3909   C CE  . LYS A 1 521 ? -45.799  8.012   -38.320 1.00 99.99  ? 525 LYS C CE  1  
ATOM 3910   N NZ  . LYS A 1 521 ? -46.801  7.612   -37.319 1.00 99.99  ? 525 LYS C NZ  1  
ATOM 3911   N N   . PRO A 1 522 ? -43.128  11.057  -35.944 1.00 30.00  ? 526 PRO C N   1  
ATOM 3912   C CA  . PRO A 1 522 ? -41.997  10.326  -35.389 1.00 30.00  ? 526 PRO C CA  1  
ATOM 3913   C C   . PRO A 1 522 ? -40.689  10.360  -36.159 1.00 30.00  ? 526 PRO C C   1  
ATOM 3914   O O   . PRO A 1 522 ? -39.673  10.779  -35.607 1.00 30.00  ? 526 PRO C O   1  
ATOM 3915   C CB  . PRO A 1 522 ? -42.591  8.960   -35.423 1.00 99.99  ? 526 PRO C CB  1  
ATOM 3916   C CG  . PRO A 1 522 ? -43.997  9.128   -35.946 1.00 99.99  ? 526 PRO C CG  1  
ATOM 3917   C CD  . PRO A 1 522 ? -44.311  10.340  -36.195 1.00 99.99  ? 526 PRO C CD  1  
ATOM 3918   N N   . MET A 1 523 ? -40.676  9.934   -37.413 1.00 30.00  ? 527 MET C N   1  
ATOM 3919   C CA  . MET A 1 523 ? -39.400  9.976   -38.122 1.00 30.00  ? 527 MET C CA  1  
ATOM 3920   C C   . MET A 1 523 ? -39.275  11.146  -39.095 1.00 30.00  ? 527 MET C C   1  
ATOM 3921   O O   . MET A 1 523 ? -38.302  11.233  -39.847 1.00 30.00  ? 527 MET C O   1  
ATOM 3922   C CB  . MET A 1 523 ? -39.216  8.697   -38.934 1.00 99.99  ? 527 MET C CB  1  
ATOM 3923   C CG  . MET A 1 523 ? -39.475  7.488   -38.043 1.00 99.99  ? 527 MET C CG  1  
ATOM 3924   S SD  . MET A 1 523 ? -38.015  7.142   -37.029 1.00 99.99  ? 527 MET C SD  1  
ATOM 3925   C CE  . MET A 1 523 ? -36.965  6.386   -38.250 1.00 99.99  ? 527 MET C CE  1  
ATOM 3926   N N   . GLY A 1 524 ? -40.264  12.040  -39.056 1.00 30.00  ? 528 GLY C N   1  
ATOM 3927   C CA  . GLY A 1 524 ? -40.307  13.206  -39.924 1.00 30.00  ? 528 GLY C CA  1  
ATOM 3928   C C   . GLY A 1 524 ? -39.015  13.951  -40.206 1.00 30.00  ? 528 GLY C C   1  
ATOM 3929   O O   . GLY A 1 524 ? -37.936  13.527  -39.820 1.00 30.00  ? 528 GLY C O   1  
ATOM 3930   N N   . ILE A 1 525 ? -39.150  15.078  -40.898 1.00 30.00  ? 529 ILE C N   1  
ATOM 3931   C CA  . ILE A 1 525 ? -38.023  15.930  -41.272 1.00 30.00  ? 529 ILE C CA  1  
ATOM 3932   C C   . ILE A 1 525 ? -37.345  16.557  -40.062 1.00 30.00  ? 529 ILE C C   1  
ATOM 3933   O O   . ILE A 1 525 ? -36.123  16.494  -39.912 1.00 30.00  ? 529 ILE C O   1  
ATOM 3934   C CB  . ILE A 1 525 ? -38.508  17.060  -42.172 1.00 99.99  ? 529 ILE C CB  1  
ATOM 3935   C CG1 . ILE A 1 525 ? -38.995  18.223  -41.314 1.00 99.99  ? 529 ILE C CG1 1  
ATOM 3936   C CG2 . ILE A 1 525 ? -39.651  16.559  -43.048 1.00 99.99  ? 529 ILE C CG2 1  
ATOM 3937   C CD1 . ILE A 1 525 ? -37.861  19.226  -41.126 1.00 99.99  ? 529 ILE C CD1 1  
ATOM 3938   N N   . LEU A 1 526 ? -38.177  17.170  -39.217 1.00 30.00  ? 530 LEU C N   1  
ATOM 3939   C CA  . LEU A 1 526 ? -37.748  17.846  -37.991 1.00 30.00  ? 530 LEU C CA  1  
ATOM 3940   C C   . LEU A 1 526 ? -37.200  16.859  -36.975 1.00 30.00  ? 530 LEU C C   1  
ATOM 3941   O O   . LEU A 1 526 ? -36.180  17.119  -36.343 1.00 30.00  ? 530 LEU C O   1  
ATOM 3942   C CB  . LEU A 1 526 ? -38.931  18.575  -37.361 1.00 99.99  ? 530 LEU C CB  1  
ATOM 3943   C CG  . LEU A 1 526 ? -38.939  20.028  -37.824 1.00 99.99  ? 530 LEU C CG  1  
ATOM 3944   C CD1 . LEU A 1 526 ? -39.902  20.831  -36.957 1.00 99.99  ? 530 LEU C CD1 1  
ATOM 3945   C CD2 . LEU A 1 526 ? -37.535  20.607  -37.700 1.00 99.99  ? 530 LEU C CD2 1  
ATOM 3946   N N   . SER A 1 527 ? -37.882  15.739  -36.813 1.00 30.00  ? 531 SER C N   1  
ATOM 3947   C CA  . SER A 1 527 ? -37.433  14.739  -35.872 1.00 30.00  ? 531 SER C CA  1  
ATOM 3948   C C   . SER A 1 527 ? -36.060  14.213  -36.273 1.00 30.00  ? 531 SER C C   1  
ATOM 3949   O O   . SER A 1 527 ? -35.254  13.846  -35.427 1.00 30.00  ? 531 SER C O   1  
ATOM 3950   C CB  . SER A 1 527 ? -38.417  13.576  -35.843 1.00 99.99  ? 531 SER C CB  1  
ATOM 3951   O OG  . SER A 1 527 ? -38.368  12.876  -37.088 1.00 99.99  ? 531 SER C OG  1  
ATOM 3952   N N   . ILE A 1 528 ? -35.800  14.167  -37.572 1.00 30.00  ? 532 ILE C N   1  
ATOM 3953   C CA  . ILE A 1 528 ? -34.517  13.689  -38.068 1.00 30.00  ? 532 ILE C CA  1  
ATOM 3954   C C   . ILE A 1 528 ? -33.483  14.735  -37.666 1.00 30.00  ? 532 ILE C C   1  
ATOM 3955   O O   . ILE A 1 528 ? -32.447  14.411  -37.083 1.00 30.00  ? 532 ILE C O   1  
ATOM 3956   C CB  . ILE A 1 528 ? -34.575  13.537  -39.585 1.00 99.99  ? 532 ILE C CB  1  
ATOM 3957   C CG1 . ILE A 1 528 ? -35.830  12.764  -39.971 1.00 99.99  ? 532 ILE C CG1 1  
ATOM 3958   C CG2 . ILE A 1 528 ? -33.341  12.777  -40.063 1.00 99.99  ? 532 ILE C CG2 1  
ATOM 3959   C CD1 . ILE A 1 528 ? -35.673  11.301  -39.565 1.00 99.99  ? 532 ILE C CD1 1  
ATOM 3960   N N   . LEU A 1 529 ? -33.782  15.995  -37.982 1.00 30.00  ? 533 LEU C N   1  
ATOM 3961   C CA  . LEU A 1 529 ? -32.902  17.112  -37.666 1.00 30.00  ? 533 LEU C CA  1  
ATOM 3962   C C   . LEU A 1 529 ? -32.656  17.214  -36.173 1.00 30.00  ? 533 LEU C C   1  
ATOM 3963   O O   . LEU A 1 529 ? -31.538  17.445  -35.745 1.00 30.00  ? 533 LEU C O   1  
ATOM 3964   C CB  . LEU A 1 529 ? -33.530  18.417  -38.143 1.00 99.99  ? 533 LEU C CB  1  
ATOM 3965   C CG  . LEU A 1 529 ? -33.003  18.759  -39.531 1.00 99.99  ? 533 LEU C CG  1  
ATOM 3966   C CD1 . LEU A 1 529 ? -33.361  20.204  -39.870 1.00 99.99  ? 533 LEU C CD1 1  
ATOM 3967   C CD2 . LEU A 1 529 ? -31.486  18.593  -39.553 1.00 99.99  ? 533 LEU C CD2 1  
ATOM 3968   N N   . GLU A 1 530 ? -33.708  17.052  -35.382 1.00 30.00  ? 534 GLU C N   1  
ATOM 3969   C CA  . GLU A 1 530 ? -33.585  17.128  -33.930 1.00 30.00  ? 534 GLU C CA  1  
ATOM 3970   C C   . GLU A 1 530 ? -32.615  16.065  -33.407 1.00 30.00  ? 534 GLU C C   1  
ATOM 3971   O O   . GLU A 1 530 ? -31.787  16.353  -32.548 1.00 30.00  ? 534 GLU C O   1  
ATOM 3972   C CB  . GLU A 1 530 ? -34.946  16.908  -33.282 1.00 99.99  ? 534 GLU C CB  1  
ATOM 3973   C CG  . GLU A 1 530 ? -35.876  18.034  -33.663 1.00 99.99  ? 534 GLU C CG  1  
ATOM 3974   C CD  . GLU A 1 530 ? -35.458  19.307  -32.934 1.00 99.99  ? 534 GLU C CD  1  
ATOM 3975   O OE1 . GLU A 1 530 ? -34.625  20.055  -33.511 1.00 99.99  ? 534 GLU C OE1 1  
ATOM 3976   O OE2 . GLU A 1 530 ? -35.976  19.520  -31.804 1.00 99.99  ? 534 GLU C OE2 1  
ATOM 3977   N N   . GLU A 1 531 ? -32.702  14.837  -33.915 1.00 30.00  ? 535 GLU C N   1  
ATOM 3978   C CA  . GLU A 1 531 ? -31.805  13.771  -33.463 1.00 30.00  ? 535 GLU C CA  1  
ATOM 3979   C C   . GLU A 1 531 ? -30.429  13.911  -34.088 1.00 30.00  ? 535 GLU C C   1  
ATOM 3980   O O   . GLU A 1 531 ? -29.499  13.224  -33.689 1.00 30.00  ? 535 GLU C O   1  
ATOM 3981   C CB  . GLU A 1 531 ? -32.377  12.413  -33.855 1.00 99.99  ? 535 GLU C CB  1  
ATOM 3982   C CG  . GLU A 1 531 ? -33.676  12.180  -33.121 1.00 99.99  ? 535 GLU C CG  1  
ATOM 3983   C CD  . GLU A 1 531 ? -33.385  11.914  -31.644 1.00 99.99  ? 535 GLU C CD  1  
ATOM 3984   O OE1 . GLU A 1 531 ? -33.351  12.909  -30.875 1.00 99.99  ? 535 GLU C OE1 1  
ATOM 3985   O OE2 . GLU A 1 531 ? -33.200  10.713  -31.302 1.00 99.99  ? 535 GLU C OE2 1  
ATOM 3986   N N   . GLU A 1 532 ? -30.301  14.808  -35.058 1.00 30.00  ? 536 GLU C N   1  
ATOM 3987   C CA  . GLU A 1 532 ? -29.027  15.037  -35.739 1.00 30.00  ? 536 GLU C CA  1  
ATOM 3988   C C   . GLU A 1 532 ? -28.181  16.126  -35.038 1.00 30.00  ? 536 GLU C C   1  
ATOM 3989   O O   . GLU A 1 532 ? -26.953  16.187  -35.199 1.00 30.00  ? 536 GLU C O   1  
ATOM 3990   C CB  . GLU A 1 532 ? -29.280  15.490  -37.173 1.00 99.99  ? 536 GLU C CB  1  
ATOM 3991   C CG  . GLU A 1 532 ? -29.949  14.376  -37.943 1.00 99.99  ? 536 GLU C CG  1  
ATOM 3992   C CD  . GLU A 1 532 ? -28.937  13.264  -38.206 1.00 99.99  ? 536 GLU C CD  1  
ATOM 3993   O OE1 . GLU A 1 532 ? -28.844  12.352  -37.343 1.00 99.99  ? 536 GLU C OE1 1  
ATOM 3994   O OE2 . GLU A 1 532 ? -28.266  13.333  -39.271 1.00 99.99  ? 536 GLU C OE2 1  
ATOM 3995   N N   . CYS A 1 533 ? -28.856  16.980  -34.270 1.00 30.00  ? 537 CYS C N   1  
ATOM 3996   C CA  . CYS A 1 533 ? -28.226  18.074  -33.529 1.00 30.00  ? 537 CYS C CA  1  
ATOM 3997   C C   . CYS A 1 533 ? -27.456  17.543  -32.335 1.00 30.00  ? 537 CYS C C   1  
ATOM 3998   O O   . CYS A 1 533 ? -26.327  17.970  -32.079 1.00 30.00  ? 537 CYS C O   1  
ATOM 3999   C CB  . CYS A 1 533 ? -29.294  19.045  -33.030 1.00 99.99  ? 537 CYS C CB  1  
ATOM 4000   S SG  . CYS A 1 533 ? -30.441  18.395  -31.790 1.00 99.99  ? 537 CYS C SG  1  
ATOM 4001   N N   . MET A 1 534 ? -28.080  16.613  -31.613 1.00 30.00  ? 538 MET C N   1  
ATOM 4002   C CA  . MET A 1 534 ? -27.480  16.007  -30.433 1.00 30.00  ? 538 MET C CA  1  
ATOM 4003   C C   . MET A 1 534 ? -26.124  15.341  -30.703 1.00 30.00  ? 538 MET C C   1  
ATOM 4004   O O   . MET A 1 534 ? -25.426  14.921  -29.773 1.00 30.00  ? 538 MET C O   1  
ATOM 4005   C CB  . MET A 1 534 ? -28.404  14.931  -29.874 1.00 99.99  ? 538 MET C CB  1  
ATOM 4006   C CG  . MET A 1 534 ? -29.812  15.494  -29.725 1.00 99.99  ? 538 MET C CG  1  
ATOM 4007   S SD  . MET A 1 534 ? -29.928  16.481  -28.211 1.00 99.99  ? 538 MET C SD  1  
ATOM 4008   C CE  . MET A 1 534 ? -30.005  15.180  -27.001 1.00 99.99  ? 538 MET C CE  1  
ATOM 4009   N N   . PHE A 1 535 ? -25.746  15.250  -31.976 1.00 30.00  ? 539 PHE C N   1  
ATOM 4010   C CA  . PHE A 1 535 ? -24.467  14.651  -32.354 1.00 30.00  ? 539 PHE C CA  1  
ATOM 4011   C C   . PHE A 1 535 ? -23.532  15.774  -32.776 1.00 30.00  ? 539 PHE C C   1  
ATOM 4012   O O   . PHE A 1 535 ? -23.831  16.528  -33.697 1.00 30.00  ? 539 PHE C O   1  
ATOM 4013   C CB  . PHE A 1 535 ? -24.672  13.677  -33.510 1.00 99.99  ? 539 PHE C CB  1  
ATOM 4014   C CG  . PHE A 1 535 ? -25.552  12.537  -33.059 1.00 99.99  ? 539 PHE C CG  1  
ATOM 4015   C CD1 . PHE A 1 535 ? -26.944  12.640  -33.178 1.00 99.99  ? 539 PHE C CD1 1  
ATOM 4016   C CD2 . PHE A 1 535 ? -24.980  11.378  -32.522 1.00 99.99  ? 539 PHE C CD2 1  
ATOM 4017   C CE1 . PHE A 1 535 ? -27.762  11.584  -32.761 1.00 99.99  ? 539 PHE C CE1 1  
ATOM 4018   C CE2 . PHE A 1 535 ? -25.799  10.322  -32.103 1.00 99.99  ? 539 PHE C CE2 1  
ATOM 4019   C CZ  . PHE A 1 535 ? -27.190  10.424  -32.223 1.00 99.99  ? 539 PHE C CZ  1  
ATOM 4020   N N   . PRO A 1 536 ? -22.383  15.904  -32.101 1.00 30.00  ? 540 PRO C N   1  
ATOM 4021   C CA  . PRO A 1 536 ? -21.424  16.962  -32.434 1.00 30.00  ? 540 PRO C CA  1  
ATOM 4022   C C   . PRO A 1 536 ? -20.702  16.662  -33.734 1.00 30.00  ? 540 PRO C C   1  
ATOM 4023   O O   . PRO A 1 536 ? -20.161  17.559  -34.393 1.00 30.00  ? 540 PRO C O   1  
ATOM 4024   C CB  . PRO A 1 536 ? -20.540  16.837  -31.243 1.00 99.99  ? 540 PRO C CB  1  
ATOM 4025   C CG  . PRO A 1 536 ? -21.156  15.763  -30.377 1.00 99.99  ? 540 PRO C CG  1  
ATOM 4026   C CD  . PRO A 1 536 ? -22.232  15.275  -30.856 1.00 99.99  ? 540 PRO C CD  1  
ATOM 4027   N N   . LYS A 1 537 ? -20.714  15.380  -34.094 1.00 30.00  ? 541 LYS C N   1  
ATOM 4028   C CA  . LYS A 1 537 ? -20.080  14.893  -35.310 1.00 30.00  ? 541 LYS C CA  1  
ATOM 4029   C C   . LYS A 1 537 ? -20.818  15.361  -36.566 1.00 30.00  ? 541 LYS C C   1  
ATOM 4030   O O   . LYS A 1 537 ? -20.192  15.794  -37.535 1.00 30.00  ? 541 LYS C O   1  
ATOM 4031   C CB  . LYS A 1 537 ? -20.067  13.367  -35.311 1.00 99.99  ? 541 LYS C CB  1  
ATOM 4032   C CG  . LYS A 1 537 ? -19.318  12.865  -36.539 1.00 99.99  ? 541 LYS C CG  1  
ATOM 4033   C CD  . LYS A 1 537 ? -18.911  11.410  -36.327 1.00 99.99  ? 541 LYS C CD  1  
ATOM 4034   C CE  . LYS A 1 537 ? -18.499  10.798  -37.663 1.00 99.99  ? 541 LYS C CE  1  
ATOM 4035   N NZ  . LYS A 1 537 ? -17.043  10.912  -37.827 1.00 99.99  ? 541 LYS C NZ  1  
ATOM 4036   N N   . ALA A 1 538 ? -22.146  15.274  -36.529 1.00 30.00  ? 542 ALA C N   1  
ATOM 4037   C CA  . ALA A 1 538 ? -23.018  15.669  -37.642 1.00 30.00  ? 542 ALA C CA  1  
ATOM 4038   C C   . ALA A 1 538 ? -22.624  16.902  -38.466 1.00 30.00  ? 542 ALA C C   1  
ATOM 4039   O O   . ALA A 1 538 ? -21.840  17.740  -38.034 1.00 30.00  ? 542 ALA C O   1  
ATOM 4040   C CB  . ALA A 1 538 ? -24.431  15.847  -37.111 1.00 30.00  ? 542 ALA C CB  1  
ATOM 4041   N N   . ASP A 1 539 ? -23.186  17.001  -39.665 1.00 30.00  ? 543 ASP C N   1  
ATOM 4042   C CA  . ASP A 1 539 ? -22.926  18.107  -40.579 1.00 30.00  ? 543 ASP C CA  1  
ATOM 4043   C C   . ASP A 1 539 ? -24.015  18.213  -41.662 1.00 30.00  ? 543 ASP C C   1  
ATOM 4044   O O   . ASP A 1 539 ? -24.906  17.367  -41.767 1.00 30.00  ? 543 ASP C O   1  
ATOM 4045   C CB  . ASP A 1 539 ? -21.582  17.905  -41.269 1.00 99.99  ? 543 ASP C CB  1  
ATOM 4046   C CG  . ASP A 1 539 ? -21.201  19.174  -42.028 1.00 99.99  ? 543 ASP C CG  1  
ATOM 4047   O OD1 . ASP A 1 539 ? -21.742  19.357  -43.151 1.00 99.99  ? 543 ASP C OD1 1  
ATOM 4048   O OD2 . ASP A 1 539 ? -20.375  19.949  -41.476 1.00 99.99  ? 543 ASP C OD2 1  
ATOM 4049   N N   . ASP A 1 540 ? -23.933  19.263  -42.473 1.00 30.00  ? 544 ASP C N   1  
ATOM 4050   C CA  . ASP A 1 540 ? -24.910  19.490  -43.533 1.00 30.00  ? 544 ASP C CA  1  
ATOM 4051   C C   . ASP A 1 540 ? -25.058  18.347  -44.547 1.00 30.00  ? 544 ASP C C   1  
ATOM 4052   O O   . ASP A 1 540 ? -25.988  18.352  -45.346 1.00 30.00  ? 544 ASP C O   1  
ATOM 4053   C CB  . ASP A 1 540 ? -24.524  20.726  -44.339 1.00 99.99  ? 544 ASP C CB  1  
ATOM 4054   C CG  . ASP A 1 540 ? -25.668  21.104  -45.275 1.00 99.99  ? 544 ASP C CG  1  
ATOM 4055   O OD1 . ASP A 1 540 ? -25.775  20.449  -46.347 1.00 99.99  ? 544 ASP C OD1 1  
ATOM 4056   O OD2 . ASP A 1 540 ? -26.427  22.041  -44.911 1.00 99.99  ? 544 ASP C OD2 1  
ATOM 4057   N N   . LYS A 1 541 ? -24.161  17.366  -44.534 1.00 30.00  ? 545 LYS C N   1  
ATOM 4058   C CA  . LYS A 1 541 ? -24.285  16.268  -45.485 1.00 30.00  ? 545 LYS C CA  1  
ATOM 4059   C C   . LYS A 1 541 ? -24.865  15.014  -44.855 1.00 30.00  ? 545 LYS C C   1  
ATOM 4060   O O   . LYS A 1 541 ? -25.617  14.301  -45.503 1.00 30.00  ? 545 LYS C O   1  
ATOM 4061   C CB  . LYS A 1 541 ? -22.915  15.913  -46.050 1.00 99.99  ? 545 LYS C CB  1  
ATOM 4062   C CG  . LYS A 1 541 ? -23.066  14.834  -47.116 1.00 99.99  ? 545 LYS C CG  1  
ATOM 4063   C CD  . LYS A 1 541 ? -21.811  14.792  -47.981 1.00 99.99  ? 545 LYS C CD  1  
ATOM 4064   C CE  . LYS A 1 541 ? -21.793  13.499  -48.790 1.00 99.99  ? 545 LYS C CE  1  
ATOM 4065   N NZ  . LYS A 1 541 ? -22.390  13.739  -50.113 1.00 99.99  ? 545 LYS C NZ  1  
ATOM 4066   N N   . SER A 1 542 ? -24.522  14.731  -43.600 1.00 30.00  ? 546 SER C N   1  
ATOM 4067   C CA  . SER A 1 542 ? -25.063  13.536  -42.958 1.00 30.00  ? 546 SER C CA  1  
ATOM 4068   C C   . SER A 1 542 ? -26.543  13.795  -42.711 1.00 30.00  ? 546 SER C C   1  
ATOM 4069   O O   . SER A 1 542 ? -27.357  12.864  -42.664 1.00 30.00  ? 546 SER C O   1  
ATOM 4070   C CB  . SER A 1 542 ? -24.337  13.280  -41.642 1.00 99.99  ? 546 SER C CB  1  
ATOM 4071   O OG  . SER A 1 542 ? -24.664  14.310  -40.708 1.00 99.99  ? 546 SER C OG  1  
ATOM 4072   N N   . PHE A 1 543 ? -26.885  15.073  -42.564 1.00 30.00  ? 547 PHE C N   1  
ATOM 4073   C CA  . PHE A 1 543 ? -28.265  15.469  -42.342 1.00 30.00  ? 547 PHE C CA  1  
ATOM 4074   C C   . PHE A 1 543 ? -29.006  15.325  -43.672 1.00 30.00  ? 547 PHE C C   1  
ATOM 4075   O O   . PHE A 1 543 ? -30.081  14.745  -43.715 1.00 30.00  ? 547 PHE C O   1  
ATOM 4076   C CB  . PHE A 1 543 ? -28.318  16.916  -41.861 1.00 99.99  ? 547 PHE C CB  1  
ATOM 4077   C CG  . PHE A 1 543 ? -27.846  16.988  -40.429 1.00 99.99  ? 547 PHE C CG  1  
ATOM 4078   C CD1 . PHE A 1 543 ? -28.699  16.599  -39.391 1.00 99.99  ? 547 PHE C CD1 1  
ATOM 4079   C CD2 . PHE A 1 543 ? -26.554  17.447  -40.141 1.00 99.99  ? 547 PHE C CD2 1  
ATOM 4080   C CE1 . PHE A 1 543 ? -28.261  16.667  -38.061 1.00 99.99  ? 547 PHE C CE1 1  
ATOM 4081   C CE2 . PHE A 1 543 ? -26.116  17.513  -38.813 1.00 99.99  ? 547 PHE C CE2 1  
ATOM 4082   C CZ  . PHE A 1 543 ? -26.970  17.125  -37.773 1.00 99.99  ? 547 PHE C CZ  1  
ATOM 4083   N N   . GLN A 1 544 ? -28.420  15.843  -44.744 1.00 30.00  ? 548 GLN C N   1  
ATOM 4084   C CA  . GLN A 1 544 ? -29.028  15.773  -46.065 1.00 30.00  ? 548 GLN C CA  1  
ATOM 4085   C C   . GLN A 1 544 ? -29.216  14.342  -46.559 1.00 30.00  ? 548 GLN C C   1  
ATOM 4086   O O   . GLN A 1 544 ? -30.226  14.010  -47.179 1.00 30.00  ? 548 GLN C O   1  
ATOM 4087   C CB  . GLN A 1 544 ? -28.152  16.497  -47.080 1.00 99.99  ? 548 GLN C CB  1  
ATOM 4088   C CG  . GLN A 1 544 ? -29.005  16.942  -48.262 1.00 99.99  ? 548 GLN C CG  1  
ATOM 4089   C CD  . GLN A 1 544 ? -29.150  15.824  -49.286 1.00 99.99  ? 548 GLN C CD  1  
ATOM 4090   O OE1 . GLN A 1 544 ? -28.613  14.734  -49.099 1.00 99.99  ? 548 GLN C OE1 1  
ATOM 4091   N NE2 . GLN A 1 544 ? -29.879  16.096  -50.371 1.00 99.99  ? 548 GLN C NE2 1  
ATOM 4092   N N   . ASP A 1 545 ? -28.234  13.492  -46.290 1.00 30.00  ? 549 ASP C N   1  
ATOM 4093   C CA  . ASP A 1 545 ? -28.302  12.103  -46.708 1.00 30.00  ? 549 ASP C CA  1  
ATOM 4094   C C   . ASP A 1 545 ? -29.275  11.354  -45.813 1.00 30.00  ? 549 ASP C C   1  
ATOM 4095   O O   . ASP A 1 545 ? -30.116  10.599  -46.302 1.00 30.00  ? 549 ASP C O   1  
ATOM 4096   C CB  . ASP A 1 545 ? -26.922  11.460  -46.605 1.00 99.99  ? 549 ASP C CB  1  
ATOM 4097   C CG  . ASP A 1 545 ? -25.994  12.076  -47.647 1.00 99.99  ? 549 ASP C CG  1  
ATOM 4098   O OD1 . ASP A 1 545 ? -26.195  11.769  -48.852 1.00 99.99  ? 549 ASP C OD1 1  
ATOM 4099   O OD2 . ASP A 1 545 ? -25.091  12.851  -47.230 1.00 99.99  ? 549 ASP C OD2 1  
ATOM 4100   N N   . LYS A 1 546 ? -29.163  11.569  -44.508 1.00 30.00  ? 550 LYS C N   1  
ATOM 4101   C CA  . LYS A 1 546 ? -30.053  10.908  -43.550 1.00 30.00  ? 550 LYS C CA  1  
ATOM 4102   C C   . LYS A 1 546 ? -31.546  11.186  -43.856 1.00 30.00  ? 550 LYS C C   1  
ATOM 4103   O O   . LYS A 1 546 ? -32.440  10.461  -43.401 1.00 30.00  ? 550 LYS C O   1  
ATOM 4104   C CB  . LYS A 1 546 ? -29.761  11.407  -42.140 1.00 99.99  ? 550 LYS C CB  1  
ATOM 4105   C CG  . LYS A 1 546 ? -30.470  10.516  -41.127 1.00 99.99  ? 550 LYS C CG  1  
ATOM 4106   C CD  . LYS A 1 546 ? -30.097  10.953  -39.714 1.00 99.99  ? 550 LYS C CD  1  
ATOM 4107   C CE  . LYS A 1 546 ? -30.825  10.077  -38.701 1.00 99.99  ? 550 LYS C CE  1  
ATOM 4108   N NZ  . LYS A 1 546 ? -30.486  10.515  -37.340 1.00 99.99  ? 550 LYS C NZ  1  
ATOM 4109   N N   . LEU A 1 547 ? -31.789  12.241  -44.641 1.00 30.00  ? 551 LEU C N   1  
ATOM 4110   C CA  . LEU A 1 547 ? -33.137  12.661  -45.035 1.00 30.00  ? 551 LEU C CA  1  
ATOM 4111   C C   . LEU A 1 547 ? -33.671  11.807  -46.193 1.00 30.00  ? 551 LEU C C   1  
ATOM 4112   O O   . LEU A 1 547 ? -34.744  11.208  -46.086 1.00 30.00  ? 551 LEU C O   1  
ATOM 4113   C CB  . LEU A 1 547 ? -33.113  14.119  -45.483 1.00 99.99  ? 551 LEU C CB  1  
ATOM 4114   C CG  . LEU A 1 547 ? -33.484  15.017  -44.309 1.00 99.99  ? 551 LEU C CG  1  
ATOM 4115   C CD1 . LEU A 1 547 ? -33.785  16.423  -44.819 1.00 99.99  ? 551 LEU C CD1 1  
ATOM 4116   C CD2 . LEU A 1 547 ? -34.717  14.458  -43.606 1.00 99.99  ? 551 LEU C CD2 1  
ATOM 4117   N N   . TYR A 1 548 ? -32.929  11.771  -47.300 1.00 30.00  ? 552 TYR C N   1  
ATOM 4118   C CA  . TYR A 1 548 ? -33.340  10.977  -48.455 1.00 30.00  ? 552 TYR C CA  1  
ATOM 4119   C C   . TYR A 1 548 ? -33.440  9.544   -47.962 1.00 30.00  ? 552 TYR C C   1  
ATOM 4120   O O   . TYR A 1 548 ? -34.385  8.813   -48.281 1.00 30.00  ? 552 TYR C O   1  
ATOM 4121   C CB  . TYR A 1 548 ? -32.307  11.105  -49.569 1.00 99.99  ? 552 TYR C CB  1  
ATOM 4122   C CG  . TYR A 1 548 ? -32.739  10.283  -50.757 1.00 99.99  ? 552 TYR C CG  1  
ATOM 4123   C CD1 . TYR A 1 548 ? -33.653  10.813  -51.678 1.00 99.99  ? 552 TYR C CD1 1  
ATOM 4124   C CD2 . TYR A 1 548 ? -32.231  8.992   -50.943 1.00 99.99  ? 552 TYR C CD2 1  
ATOM 4125   C CE1 . TYR A 1 548 ? -34.056  10.050  -52.781 1.00 99.99  ? 552 TYR C CE1 1  
ATOM 4126   C CE2 . TYR A 1 548 ? -32.632  8.231   -52.044 1.00 99.99  ? 552 TYR C CE2 1  
ATOM 4127   C CZ  . TYR A 1 548 ? -33.545  8.761   -52.966 1.00 99.99  ? 552 TYR C CZ  1  
ATOM 4128   O OH  . TYR A 1 548 ? -33.937  8.021   -54.038 1.00 99.99  ? 552 TYR C OH  1  
ATOM 4129   N N   . GLN A 1 549 ? -32.446  9.160   -47.168 1.00 30.00  ? 553 GLN C N   1  
ATOM 4130   C CA  . GLN A 1 549 ? -32.386  7.824   -46.594 1.00 30.00  ? 553 GLN C CA  1  
ATOM 4131   C C   . GLN A 1 549 ? -33.761  7.398   -46.076 1.00 30.00  ? 553 GLN C C   1  
ATOM 4132   O O   . GLN A 1 549 ? -34.161  6.242   -46.213 1.00 30.00  ? 553 GLN C O   1  
ATOM 4133   C CB  . GLN A 1 549 ? -31.398  7.806   -45.433 1.00 99.99  ? 553 GLN C CB  1  
ATOM 4134   C CG  . GLN A 1 549 ? -30.885  6.386   -45.222 1.00 99.99  ? 553 GLN C CG  1  
ATOM 4135   C CD  . GLN A 1 549 ? -31.833  5.583   -44.341 1.00 99.99  ? 553 GLN C CD  1  
ATOM 4136   O OE1 . GLN A 1 549 ? -32.857  6.098   -43.901 1.00 99.99  ? 553 GLN C OE1 1  
ATOM 4137   N NE2 . GLN A 1 549 ? -31.488  4.319   -44.087 1.00 99.99  ? 553 GLN C NE2 1  
ATOM 4138   N N   . ASN A 1 550 ? -34.494  8.344   -45.499 1.00 30.00  ? 554 ASN C N   1  
ATOM 4139   C CA  . ASN A 1 550 ? -35.801  8.050   -44.936 1.00 30.00  ? 554 ASN C CA  1  
ATOM 4140   C C   . ASN A 1 550 ? -37.066  8.341   -45.727 1.00 30.00  ? 554 ASN C C   1  
ATOM 4141   O O   . ASN A 1 550 ? -38.043  7.590   -45.626 1.00 30.00  ? 554 ASN C O   1  
ATOM 4142   C CB  . ASN A 1 550 ? -36.000  8.836   -43.646 1.00 99.99  ? 554 ASN C CB  1  
ATOM 4143   C CG  . ASN A 1 550 ? -37.344  8.512   -43.006 1.00 99.99  ? 554 ASN C CG  1  
ATOM 4144   O OD1 . ASN A 1 550 ? -37.808  7.377   -43.077 1.00 99.99  ? 554 ASN C OD1 1  
ATOM 4145   N ND2 . ASN A 1 550 ? -37.964  9.514   -42.382 1.00 99.99  ? 554 ASN C ND2 1  
ATOM 4146   N N   . HIS A 1 551 ? -37.074  9.409   -46.511 1.00 30.00  ? 555 HIS C N   1  
ATOM 4147   C CA  . HIS A 1 551 ? -38.292  9.728   -47.249 1.00 30.00  ? 555 HIS C CA  1  
ATOM 4148   C C   . HIS A 1 551 ? -38.246  9.695   -48.766 1.00 30.00  ? 555 HIS C C   1  
ATOM 4149   O O   . HIS A 1 551 ? -39.301  9.745   -49.412 1.00 30.00  ? 555 HIS C O   1  
ATOM 4150   C CB  . HIS A 1 551 ? -38.751  11.142  -46.908 1.00 99.99  ? 555 HIS C CB  1  
ATOM 4151   C CG  . HIS A 1 551 ? -39.176  11.345  -45.474 1.00 99.99  ? 555 HIS C CG  1  
ATOM 4152   N ND1 . HIS A 1 551 ? -38.361  11.984  -44.548 1.00 99.99  ? 555 HIS C ND1 1  
ATOM 4153   C CD2 . HIS A 1 551 ? -40.320  11.004  -44.818 1.00 99.99  ? 555 HIS C CD2 1  
ATOM 4154   C CE1 . HIS A 1 551 ? -39.001  12.012  -43.393 1.00 99.99  ? 555 HIS C CE1 1  
ATOM 4155   N NE2 . HIS A 1 551 ? -40.167  11.432  -43.537 1.00 99.99  ? 555 HIS C NE2 1  
ATOM 4156   N N   . MET A 1 552 ? -37.058  9.611   -49.351 1.00 30.00  ? 556 MET C N   1  
ATOM 4157   C CA  . MET A 1 552 ? -36.982  9.566   -50.802 1.00 30.00  ? 556 MET C CA  1  
ATOM 4158   C C   . MET A 1 552 ? -37.674  8.289   -51.255 1.00 30.00  ? 556 MET C C   1  
ATOM 4159   O O   . MET A 1 552 ? -37.254  7.182   -50.904 1.00 30.00  ? 556 MET C O   1  
ATOM 4160   C CB  . MET A 1 552 ? -35.522  9.563   -51.244 1.00 99.99  ? 556 MET C CB  1  
ATOM 4161   C CG  . MET A 1 552 ? -34.882  10.901  -50.898 1.00 99.99  ? 556 MET C CG  1  
ATOM 4162   S SD  . MET A 1 552 ? -35.661  12.228  -51.852 1.00 99.99  ? 556 MET C SD  1  
ATOM 4163   C CE  . MET A 1 552 ? -35.075  11.817  -53.484 1.00 99.99  ? 556 MET C CE  1  
ATOM 4164   N N   . GLY A 1 553 ? -38.751  8.452   -52.020 1.00 30.00  ? 557 GLY C N   1  
ATOM 4165   C CA  . GLY A 1 553 ? -39.475  7.296   -52.506 1.00 30.00  ? 557 GLY C CA  1  
ATOM 4166   C C   . GLY A 1 553 ? -40.369  6.587   -51.504 1.00 30.00  ? 557 GLY C C   1  
ATOM 4167   O O   . GLY A 1 553 ? -41.102  5.675   -51.874 1.00 30.00  ? 557 GLY C O   1  
ATOM 4168   N N   . LYS A 1 554 ? -40.311  6.980   -50.238 1.00 30.00  ? 558 LYS C N   1  
ATOM 4169   C CA  . LYS A 1 554 ? -41.160  6.343   -49.236 1.00 30.00  ? 558 LYS C CA  1  
ATOM 4170   C C   . LYS A 1 554 ? -42.312  7.300   -48.871 1.00 30.00  ? 558 LYS C C   1  
ATOM 4171   O O   . LYS A 1 554 ? -43.198  6.962   -48.091 1.00 30.00  ? 558 LYS C O   1  
ATOM 4172   C CB  . LYS A 1 554 ? -40.343  6.030   -47.987 1.00 99.99  ? 558 LYS C CB  1  
ATOM 4173   C CG  . LYS A 1 554 ? -41.210  5.276   -46.986 1.00 99.99  ? 558 LYS C CG  1  
ATOM 4174   C CD  . LYS A 1 554 ? -40.321  4.580   -45.963 1.00 99.99  ? 558 LYS C CD  1  
ATOM 4175   C CE  . LYS A 1 554 ? -41.164  4.146   -44.767 1.00 99.99  ? 558 LYS C CE  1  
ATOM 4176   N NZ  . LYS A 1 554 ? -41.601  2.755   -44.954 1.00 99.99  ? 558 LYS C NZ  1  
ATOM 4177   N N   . ASN A 1 555 ? -42.278  8.492   -49.464 1.00 30.00  ? 559 ASN C N   1  
ATOM 4178   C CA  . ASN A 1 555 ? -43.293  9.532   -49.260 1.00 30.00  ? 559 ASN C CA  1  
ATOM 4179   C C   . ASN A 1 555 ? -43.220  10.462  -50.474 1.00 30.00  ? 559 ASN C C   1  
ATOM 4180   O O   . ASN A 1 555 ? -42.209  11.139  -50.696 1.00 30.00  ? 559 ASN C O   1  
ATOM 4181   C CB  . ASN A 1 555 ? -42.996  10.298  -47.977 1.00 99.99  ? 559 ASN C CB  1  
ATOM 4182   C CG  . ASN A 1 555 ? -43.083  9.390   -46.761 1.00 99.99  ? 559 ASN C CG  1  
ATOM 4183   O OD1 . ASN A 1 555 ? -44.092  8.722   -46.552 1.00 99.99  ? 559 ASN C OD1 1  
ATOM 4184   N ND2 . ASN A 1 555 ? -42.016  9.362   -45.957 1.00 99.99  ? 559 ASN C ND2 1  
ATOM 4185   N N   . ARG A 1 556 ? -44.305  10.497  -51.242 1.00 30.00  ? 560 ARG C N   1  
ATOM 4186   C CA  . ARG A 1 556 ? -44.345  11.315  -52.446 1.00 30.00  ? 560 ARG C CA  1  
ATOM 4187   C C   . ARG A 1 556 ? -44.343  12.830  -52.308 1.00 30.00  ? 560 ARG C C   1  
ATOM 4188   O O   . ARG A 1 556 ? -44.231  13.554  -53.309 1.00 30.00  ? 560 ARG C O   1  
ATOM 4189   C CB  . ARG A 1 556 ? -45.609  11.004  -53.239 1.00 99.99  ? 560 ARG C CB  1  
ATOM 4190   C CG  . ARG A 1 556 ? -45.616  11.826  -54.524 1.00 99.99  ? 560 ARG C CG  1  
ATOM 4191   C CD  . ARG A 1 556 ? -46.904  11.554  -55.294 1.00 99.99  ? 560 ARG C CD  1  
ATOM 4192   N NE  . ARG A 1 556 ? -48.084  11.669  -54.408 1.00 99.99  ? 560 ARG C NE  1  
ATOM 4193   C CZ  . ARG A 1 556 ? -48.626  12.837  -54.071 1.00 99.99  ? 560 ARG C CZ  1  
ATOM 4194   N NH1 . ARG A 1 556 ? -48.138  13.995  -54.510 1.00 99.99  ? 560 ARG C NH1 1  
ATOM 4195   N NH2 . ARG A 1 556 ? -49.687  12.824  -53.269 1.00 99.99  ? 560 ARG C NH2 1  
ATOM 4196   N N   . MET A 1 557 ? -44.459  13.326  -51.080 1.00 30.00  ? 561 MET C N   1  
ATOM 4197   C CA  . MET A 1 557 ? -44.473  14.774  -50.872 1.00 30.00  ? 561 MET C CA  1  
ATOM 4198   C C   . MET A 1 557 ? -43.047  15.295  -50.933 1.00 30.00  ? 561 MET C C   1  
ATOM 4199   O O   . MET A 1 557 ? -42.802  16.467  -51.240 1.00 30.00  ? 561 MET C O   1  
ATOM 4200   C CB  . MET A 1 557 ? -45.078  15.095  -49.509 1.00 99.99  ? 561 MET C CB  1  
ATOM 4201   C CG  . MET A 1 557 ? -46.402  14.357  -49.352 1.00 99.99  ? 561 MET C CG  1  
ATOM 4202   S SD  . MET A 1 557 ? -47.714  15.247  -50.222 1.00 99.99  ? 561 MET C SD  1  
ATOM 4203   C CE  . MET A 1 557 ? -47.989  16.587  -49.082 1.00 99.99  ? 561 MET C CE  1  
ATOM 4204   N N   . PHE A 1 558 ? -42.111  14.393  -50.647 1.00 30.00  ? 562 PHE C N   1  
ATOM 4205   C CA  . PHE A 1 558 ? -40.679  14.682  -50.638 1.00 30.00  ? 562 PHE C CA  1  
ATOM 4206   C C   . PHE A 1 558 ? -40.098  14.412  -52.022 1.00 30.00  ? 562 PHE C C   1  
ATOM 4207   O O   . PHE A 1 558 ? -39.994  13.253  -52.432 1.00 30.00  ? 562 PHE C O   1  
ATOM 4208   C CB  . PHE A 1 558 ? -39.980  13.793  -49.614 1.00 99.99  ? 562 PHE C CB  1  
ATOM 4209   C CG  . PHE A 1 558 ? -38.510  14.136  -49.571 1.00 99.99  ? 562 PHE C CG  1  
ATOM 4210   C CD1 . PHE A 1 558 ? -38.083  15.303  -48.926 1.00 99.99  ? 562 PHE C CD1 1  
ATOM 4211   C CD2 . PHE A 1 558 ? -37.575  13.287  -50.174 1.00 99.99  ? 562 PHE C CD2 1  
ATOM 4212   C CE1 . PHE A 1 558 ? -36.722  15.618  -48.884 1.00 99.99  ? 562 PHE C CE1 1  
ATOM 4213   C CE2 . PHE A 1 558 ? -36.211  13.603  -50.133 1.00 99.99  ? 562 PHE C CE2 1  
ATOM 4214   C CZ  . PHE A 1 558 ? -35.785  14.771  -49.489 1.00 99.99  ? 562 PHE C CZ  1  
ATOM 4215   N N   . THR A 1 559 ? -39.712  15.466  -52.746 1.00 30.00  ? 563 THR C N   1  
ATOM 4216   C CA  . THR A 1 559 ? -39.158  15.295  -54.094 1.00 30.00  ? 563 THR C CA  1  
ATOM 4217   C C   . THR A 1 559 ? -37.867  16.047  -54.430 1.00 30.00  ? 563 THR C C   1  
ATOM 4218   O O   . THR A 1 559 ? -37.746  17.231  -54.160 1.00 30.00  ? 563 THR C O   1  
ATOM 4219   C CB  . THR A 1 559 ? -40.172  15.756  -55.132 1.00 99.99  ? 563 THR C CB  1  
ATOM 4220   O OG1 . THR A 1 559 ? -40.336  17.175  -55.038 1.00 99.99  ? 563 THR C OG1 1  
ATOM 4221   C CG2 . THR A 1 559 ? -41.510  15.076  -54.876 1.00 99.99  ? 563 THR C CG2 1  
ATOM 4222   N N   . LYS A 1 560 ? -36.908  15.348  -55.035 1.00 30.00  ? 564 LYS C N   1  
ATOM 4223   C CA  . LYS A 1 560 ? -35.636  15.961  -55.423 1.00 30.00  ? 564 LYS C CA  1  
ATOM 4224   C C   . LYS A 1 560 ? -35.923  17.362  -56.004 1.00 30.00  ? 564 LYS C C   1  
ATOM 4225   O O   . LYS A 1 560 ? -36.957  17.584  -56.638 1.00 30.00  ? 564 LYS C O   1  
ATOM 4226   C CB  . LYS A 1 560 ? -34.944  15.100  -56.474 1.00 99.99  ? 564 LYS C CB  1  
ATOM 4227   C CG  . LYS A 1 560 ? -33.577  15.689  -56.800 1.00 99.99  ? 564 LYS C CG  1  
ATOM 4228   C CD  . LYS A 1 560 ? -32.717  14.634  -57.483 1.00 99.99  ? 564 LYS C CD  1  
ATOM 4229   C CE  . LYS A 1 560 ? -31.511  15.306  -58.137 1.00 99.99  ? 564 LYS C CE  1  
ATOM 4230   N NZ  . LYS A 1 560 ? -30.370  15.272  -57.212 1.00 99.99  ? 564 LYS C NZ  1  
ATOM 4231   N N   . PRO A 1 561 ? -35.005  18.322  -55.789 1.00 30.00  ? 565 PRO C N   1  
ATOM 4232   C CA  . PRO A 1 561 ? -35.191  19.687  -56.301 1.00 30.00  ? 565 PRO C CA  1  
ATOM 4233   C C   . PRO A 1 561 ? -35.442  19.724  -57.803 1.00 30.00  ? 565 PRO C C   1  
ATOM 4234   O O   . PRO A 1 561 ? -34.686  19.145  -58.577 1.00 30.00  ? 565 PRO C O   1  
ATOM 4235   C CB  . PRO A 1 561 ? -33.853  20.232  -55.940 1.00 99.99  ? 565 PRO C CB  1  
ATOM 4236   C CG  . PRO A 1 561 ? -33.125  19.119  -55.226 1.00 99.99  ? 565 PRO C CG  1  
ATOM 4237   C CD  . PRO A 1 561 ? -33.815  18.050  -55.104 1.00 99.99  ? 565 PRO C CD  1  
ATOM 4238   N N   . GLY A 1 562 ? -36.507  20.411  -58.206 1.00 30.00  ? 566 GLY C N   1  
ATOM 4239   C CA  . GLY A 1 562 ? -36.843  20.511  -59.619 1.00 30.00  ? 566 GLY C CA  1  
ATOM 4240   C C   . GLY A 1 562 ? -36.033  21.524  -60.419 1.00 30.00  ? 566 GLY C C   1  
ATOM 4241   O O   . GLY A 1 562 ? -34.805  21.580  -60.311 1.00 30.00  ? 566 GLY C O   1  
ATOM 4242   N N   . LYS A 1 563 ? -36.720  22.338  -61.224 1.00 30.00  ? 567 LYS C N   1  
ATOM 4243   C CA  . LYS A 1 563 ? -36.049  23.347  -62.038 1.00 30.00  ? 567 LYS C CA  1  
ATOM 4244   C C   . LYS A 1 563 ? -36.638  24.751  -61.843 1.00 30.00  ? 567 LYS C C   1  
ATOM 4245   O O   . LYS A 1 563 ? -37.859  24.920  -61.739 1.00 30.00  ? 567 LYS C O   1  
ATOM 4246   C CB  . LYS A 1 563 ? -36.180  22.994  -63.516 1.00 99.99  ? 567 LYS C CB  1  
ATOM 4247   C CG  . LYS A 1 563 ? -35.396  24.001  -64.350 1.00 99.99  ? 567 LYS C CG  1  
ATOM 4248   C CD  . LYS A 1 563 ? -35.145  23.422  -65.739 1.00 99.99  ? 567 LYS C CD  1  
ATOM 4249   C CE  . LYS A 1 563 ? -34.702  24.538  -66.681 1.00 99.99  ? 567 LYS C CE  1  
ATOM 4250   N NZ  . LYS A 1 563 ? -33.233  24.594  -66.719 1.00 99.99  ? 567 LYS C NZ  1  
ATOM 4251   N N   . PRO A 1 564 ? -35.764  25.781  -61.788 1.00 30.00  ? 568 PRO C N   1  
ATOM 4252   C CA  . PRO A 1 564 ? -36.118  27.199  -61.604 1.00 30.00  ? 568 PRO C CA  1  
ATOM 4253   C C   . PRO A 1 564 ? -37.447  27.715  -62.183 1.00 30.00  ? 568 PRO C C   1  
ATOM 4254   O O   . PRO A 1 564 ? -37.750  27.536  -63.363 1.00 30.00  ? 568 PRO C O   1  
ATOM 4255   C CB  . PRO A 1 564 ? -34.971  27.800  -62.337 1.00 99.99  ? 568 PRO C CB  1  
ATOM 4256   C CG  . PRO A 1 564 ? -34.106  26.646  -62.784 1.00 99.99  ? 568 PRO C CG  1  
ATOM 4257   C CD  . PRO A 1 564 ? -34.544  25.505  -62.418 1.00 99.99  ? 568 PRO C CD  1  
ATOM 4258   N N   . THR A 1 565 ? -38.224  28.360  -61.316 1.00 30.00  ? 569 THR C N   1  
ATOM 4259   C CA  . THR A 1 565 ? -39.519  28.942  -61.665 1.00 30.00  ? 569 THR C CA  1  
ATOM 4260   C C   . THR A 1 565 ? -39.472  30.422  -61.256 1.00 30.00  ? 569 THR C C   1  
ATOM 4261   O O   . THR A 1 565 ? -40.514  31.068  -61.089 1.00 30.00  ? 569 THR C O   1  
ATOM 4262   C CB  . THR A 1 565 ? -40.632  28.217  -60.919 1.00 99.99  ? 569 THR C CB  1  
ATOM 4263   O OG1 . THR A 1 565 ? -40.531  28.496  -59.521 1.00 99.99  ? 569 THR C OG1 1  
ATOM 4264   C CG2 . THR A 1 565 ? -40.501  26.713  -61.145 1.00 99.99  ? 569 THR C CG2 1  
ATOM 4265   N N   . ARG A 1 566 ? -38.251  30.929  -61.095 1.00 30.00  ? 570 ARG C N   1  
ATOM 4266   C CA  . ARG A 1 566 ? -37.998  32.320  -60.703 1.00 30.00  ? 570 ARG C CA  1  
ATOM 4267   C C   . ARG A 1 566 ? -36.484  32.569  -60.710 1.00 30.00  ? 570 ARG C C   1  
ATOM 4268   O O   . ARG A 1 566 ? -35.719  31.788  -60.141 1.00 30.00  ? 570 ARG C O   1  
ATOM 4269   C CB  . ARG A 1 566 ? -38.554  32.574  -59.305 1.00 99.99  ? 570 ARG C CB  1  
ATOM 4270   C CG  . ARG A 1 566 ? -40.074  32.464  -59.333 1.00 99.99  ? 570 ARG C CG  1  
ATOM 4271   C CD  . ARG A 1 566 ? -40.599  32.345  -57.906 1.00 99.99  ? 570 ARG C CD  1  
ATOM 4272   N NE  . ARG A 1 566 ? -42.062  32.112  -57.898 1.00 99.99  ? 570 ARG C NE  1  
ATOM 4273   C CZ  . ARG A 1 566 ? -42.608  30.927  -58.154 1.00 99.99  ? 570 ARG C CZ  1  
ATOM 4274   N NH1 . ARG A 1 566 ? -41.871  29.857  -58.437 1.00 99.99  ? 570 ARG C NH1 1  
ATOM 4275   N NH2 . ARG A 1 566 ? -43.935  30.831  -58.121 1.00 99.99  ? 570 ARG C NH2 1  
ATOM 4276   N N   . PRO A 1 567 ? -36.031  33.662  -61.355 1.00 30.00  ? 571 PRO C N   1  
ATOM 4277   C CA  . PRO A 1 567 ? -34.597  33.980  -61.417 1.00 30.00  ? 571 PRO C CA  1  
ATOM 4278   C C   . PRO A 1 567 ? -33.979  34.193  -60.039 1.00 30.00  ? 571 PRO C C   1  
ATOM 4279   O O   . PRO A 1 567 ? -34.693  34.401  -59.051 1.00 30.00  ? 571 PRO C O   1  
ATOM 4280   C CB  . PRO A 1 567 ? -34.692  35.245  -62.194 1.00 99.99  ? 571 PRO C CB  1  
ATOM 4281   C CG  . PRO A 1 567 ? -36.156  35.434  -62.510 1.00 99.99  ? 571 PRO C CG  1  
ATOM 4282   C CD  . PRO A 1 567 ? -36.899  34.499  -62.066 1.00 99.99  ? 571 PRO C CD  1  
ATOM 4283   N N   . ASN A 1 568 ? -32.653  34.140  -59.979 1.00 30.00  ? 572 ASN C N   1  
ATOM 4284   C CA  . ASN A 1 568 ? -31.941  34.331  -58.720 1.00 30.00  ? 572 ASN C CA  1  
ATOM 4285   C C   . ASN A 1 568 ? -32.331  33.241  -57.714 1.00 30.00  ? 572 ASN C C   1  
ATOM 4286   O O   . ASN A 1 568 ? -32.085  33.371  -56.518 1.00 30.00  ? 572 ASN C O   1  
ATOM 4287   C CB  . ASN A 1 568 ? -32.290  35.692  -58.129 1.00 99.99  ? 572 ASN C CB  1  
ATOM 4288   C CG  . ASN A 1 568 ? -31.171  36.200  -57.233 1.00 99.99  ? 572 ASN C CG  1  
ATOM 4289   O OD1 . ASN A 1 568 ? -31.408  37.007  -56.332 1.00 99.99  ? 572 ASN C OD1 1  
ATOM 4290   N ND2 . ASN A 1 568 ? -29.944  35.735  -57.480 1.00 99.99  ? 572 ASN C ND2 1  
ATOM 4291   N N   . GLN A 1 569 ? -32.935  32.166  -58.210 1.00 30.00  ? 573 GLN C N   1  
ATOM 4292   C CA  . GLN A 1 569 ? -33.360  31.062  -57.358 1.00 30.00  ? 573 GLN C CA  1  
ATOM 4293   C C   . GLN A 1 569 ? -32.184  30.327  -56.714 1.00 30.00  ? 573 GLN C C   1  
ATOM 4294   O O   . GLN A 1 569 ? -31.658  29.371  -57.284 1.00 30.00  ? 573 GLN C O   1  
ATOM 4295   C CB  . GLN A 1 569 ? -34.149  30.047  -58.176 1.00 99.99  ? 573 GLN C CB  1  
ATOM 4296   C CG  . GLN A 1 569 ? -33.591  28.650  -57.929 1.00 99.99  ? 573 GLN C CG  1  
ATOM 4297   C CD  . GLN A 1 569 ? -32.221  28.482  -58.569 1.00 99.99  ? 573 GLN C CD  1  
ATOM 4298   O OE1 . GLN A 1 569 ? -31.705  29.410  -59.189 1.00 99.99  ? 573 GLN C OE1 1  
ATOM 4299   N NE2 . GLN A 1 569 ? -31.630  27.295  -58.419 1.00 99.99  ? 573 GLN C NE2 1  
ATOM 4300   N N   . GLY A 1 570 ? -31.787  30.773  -55.525 1.00 30.00  ? 574 GLY C N   1  
ATOM 4301   C CA  . GLY A 1 570 ? -30.678  30.154  -54.818 1.00 30.00  ? 574 GLY C CA  1  
ATOM 4302   C C   . GLY A 1 570 ? -30.789  28.649  -54.662 1.00 30.00  ? 574 GLY C C   1  
ATOM 4303   O O   . GLY A 1 570 ? -31.810  28.060  -55.004 1.00 30.00  ? 574 GLY C O   1  
ATOM 4304   N N   . PRO A 1 571 ? -29.741  27.999  -54.145 1.00 30.00  ? 575 PRO C N   1  
ATOM 4305   C CA  . PRO A 1 571 ? -29.692  26.548  -53.928 1.00 30.00  ? 575 PRO C CA  1  
ATOM 4306   C C   . PRO A 1 571 ? -30.940  25.910  -53.316 1.00 30.00  ? 575 PRO C C   1  
ATOM 4307   O O   . PRO A 1 571 ? -31.663  26.537  -52.537 1.00 30.00  ? 575 PRO C O   1  
ATOM 4308   C CB  . PRO A 1 571 ? -28.549  26.515  -52.975 1.00 99.99  ? 575 PRO C CB  1  
ATOM 4309   C CG  . PRO A 1 571 ? -28.080  27.943  -52.830 1.00 99.99  ? 575 PRO C CG  1  
ATOM 4310   C CD  . PRO A 1 571 ? -28.738  28.772  -53.544 1.00 99.99  ? 575 PRO C CD  1  
ATOM 4311   N N   . ALA A 1 572 ? -31.173  24.652  -53.681 1.00 30.00  ? 576 ALA C N   1  
ATOM 4312   C CA  . ALA A 1 572 ? -32.305  23.878  -53.192 1.00 30.00  ? 576 ALA C CA  1  
ATOM 4313   C C   . ALA A 1 572 ? -31.798  22.450  -53.045 1.00 30.00  ? 576 ALA C C   1  
ATOM 4314   O O   . ALA A 1 572 ? -31.118  21.946  -53.926 1.00 30.00  ? 576 ALA C O   1  
ATOM 4315   C CB  . ALA A 1 572 ? -33.455  23.932  -54.191 1.00 30.00  ? 576 ALA C CB  1  
ATOM 4316   N N   . HIS A 1 573 ? -32.123  21.806  -51.930 1.00 30.00  ? 577 HIS C N   1  
ATOM 4317   C CA  . HIS A 1 573 ? -31.685  20.436  -51.668 1.00 30.00  ? 577 HIS C CA  1  
ATOM 4318   C C   . HIS A 1 573 ? -32.824  19.431  -51.769 1.00 30.00  ? 577 HIS C C   1  
ATOM 4319   O O   . HIS A 1 573 ? -32.586  18.240  -51.969 1.00 30.00  ? 577 HIS C O   1  
ATOM 4320   C CB  . HIS A 1 573 ? -31.099  20.339  -50.265 1.00 99.99  ? 577 HIS C CB  1  
ATOM 4321   C CG  . HIS A 1 573 ? -29.888  21.207  -50.015 1.00 99.99  ? 577 HIS C CG  1  
ATOM 4322   N ND1 . HIS A 1 573 ? -29.949  22.340  -49.213 1.00 99.99  ? 577 HIS C ND1 1  
ATOM 4323   C CD2 . HIS A 1 573 ? -28.605  21.108  -50.454 1.00 99.99  ? 577 HIS C CD2 1  
ATOM 4324   C CE1 . HIS A 1 573 ? -28.746  22.885  -49.186 1.00 99.99  ? 577 HIS C CE1 1  
ATOM 4325   N NE2 . HIS A 1 573 ? -27.936  22.163  -49.917 1.00 99.99  ? 577 HIS C NE2 1  
ATOM 4326   N N   . PHE A 1 574 ? -34.050  19.917  -51.611 1.00 30.00  ? 578 PHE C N   1  
ATOM 4327   C CA  . PHE A 1 574 ? -35.245  19.078  -51.708 1.00 30.00  ? 578 PHE C CA  1  
ATOM 4328   C C   . PHE A 1 574 ? -36.452  19.992  -51.850 1.00 30.00  ? 578 PHE C C   1  
ATOM 4329   O O   . PHE A 1 574 ? -36.344  21.207  -51.682 1.00 30.00  ? 578 PHE C O   1  
ATOM 4330   C CB  . PHE A 1 574 ? -35.382  18.224  -50.452 1.00 99.99  ? 578 PHE C CB  1  
ATOM 4331   C CG  . PHE A 1 574 ? -35.715  19.105  -49.275 1.00 99.99  ? 578 PHE C CG  1  
ATOM 4332   C CD1 . PHE A 1 574 ? -34.684  19.658  -48.503 1.00 99.99  ? 578 PHE C CD1 1  
ATOM 4333   C CD2 . PHE A 1 574 ? -37.052  19.371  -48.954 1.00 99.99  ? 578 PHE C CD2 1  
ATOM 4334   C CE1 . PHE A 1 574 ? -34.994  20.476  -47.411 1.00 99.99  ? 578 PHE C CE1 1  
ATOM 4335   C CE2 . PHE A 1 574 ? -37.357  20.189  -47.860 1.00 99.99  ? 578 PHE C CE2 1  
ATOM 4336   C CZ  . PHE A 1 574 ? -36.329  20.742  -47.087 1.00 99.99  ? 578 PHE C CZ  1  
ATOM 4337   N N   . GLU A 1 575 ? -37.598  19.411  -52.176 1.00 30.00  ? 579 GLU C N   1  
ATOM 4338   C CA  . GLU A 1 575 ? -38.810  20.202  -52.350 1.00 30.00  ? 579 GLU C CA  1  
ATOM 4339   C C   . GLU A 1 575 ? -39.927  19.597  -51.558 1.00 30.00  ? 579 GLU C C   1  
ATOM 4340   O O   . GLU A 1 575 ? -39.982  18.369  -51.375 1.00 30.00  ? 579 GLU C O   1  
ATOM 4341   C CB  . GLU A 1 575 ? -39.201  20.233  -53.824 1.00 99.99  ? 579 GLU C CB  1  
ATOM 4342   C CG  . GLU A 1 575 ? -40.656  19.860  -53.968 1.00 99.99  ? 579 GLU C CG  1  
ATOM 4343   C CD  . GLU A 1 575 ? -40.832  18.371  -53.677 1.00 99.99  ? 579 GLU C CD  1  
ATOM 4344   O OE1 . GLU A 1 575 ? -41.064  18.041  -52.485 1.00 99.99  ? 579 GLU C OE1 1  
ATOM 4345   O OE2 . GLU A 1 575 ? -40.731  17.576  -54.650 1.00 99.99  ? 579 GLU C OE2 1  
ATOM 4346   N N   . LEU A 1 576 ? -40.820  20.459  -51.089 1.00 30.00  ? 580 LEU C N   1  
ATOM 4347   C CA  . LEU A 1 576 ? -41.963  20.016  -50.317 1.00 30.00  ? 580 LEU C CA  1  
ATOM 4348   C C   . LEU A 1 576 ? -43.163  20.571  -51.039 1.00 30.00  ? 580 LEU C C   1  
ATOM 4349   O O   . LEU A 1 576 ? -43.123  21.699  -51.557 1.00 30.00  ? 580 LEU C O   1  
ATOM 4350   C CB  . LEU A 1 576 ? -41.868  20.560  -48.894 1.00 99.99  ? 580 LEU C CB  1  
ATOM 4351   C CG  . LEU A 1 576 ? -41.217  19.520  -47.993 1.00 99.99  ? 580 LEU C CG  1  
ATOM 4352   C CD1 . LEU A 1 576 ? -41.417  19.911  -46.533 1.00 99.99  ? 580 LEU C CD1 1  
ATOM 4353   C CD2 . LEU A 1 576 ? -41.854  18.156  -48.245 1.00 99.99  ? 580 LEU C CD2 1  
ATOM 4354   N N   . HIS A 1 577 ? -44.225  19.776  -51.091 1.00 30.00  ? 581 HIS C N   1  
ATOM 4355   C CA  . HIS A 1 577 ? -45.447  20.187  -51.763 1.00 30.00  ? 581 HIS C CA  1  
ATOM 4356   C C   . HIS A 1 577 ? -46.444  20.685  -50.722 1.00 30.00  ? 581 HIS C C   1  
ATOM 4357   O O   . HIS A 1 577 ? -47.276  19.937  -50.207 1.00 30.00  ? 581 HIS C O   1  
ATOM 4358   C CB  . HIS A 1 577 ? -46.046  19.006  -52.521 1.00 99.99  ? 581 HIS C CB  1  
ATOM 4359   C CG  . HIS A 1 577 ? -45.118  18.353  -53.518 1.00 99.99  ? 581 HIS C CG  1  
ATOM 4360   N ND1 . HIS A 1 577 ? -45.052  18.767  -54.844 1.00 99.99  ? 581 HIS C ND1 1  
ATOM 4361   C CD2 . HIS A 1 577 ? -44.236  17.328  -53.386 1.00 99.99  ? 581 HIS C CD2 1  
ATOM 4362   C CE1 . HIS A 1 577 ? -44.162  18.014  -55.460 1.00 99.99  ? 581 HIS C CE1 1  
ATOM 4363   N NE2 . HIS A 1 577 ? -43.667  17.152  -54.609 1.00 99.99  ? 581 HIS C NE2 1  
ATOM 4364   N N   . HIS A 1 578 ? -46.328  21.975  -50.414 1.00 30.00  ? 582 HIS C N   1  
ATOM 4365   C CA  . HIS A 1 578 ? -47.187  22.626  -49.432 1.00 30.00  ? 582 HIS C CA  1  
ATOM 4366   C C   . HIS A 1 578 ? -48.514  23.000  -50.057 1.00 30.00  ? 582 HIS C C   1  
ATOM 4367   O O   . HIS A 1 578 ? -48.587  23.297  -51.249 1.00 30.00  ? 582 HIS C O   1  
ATOM 4368   C CB  . HIS A 1 578 ? -46.512  23.891  -48.914 1.00 99.99  ? 582 HIS C CB  1  
ATOM 4369   C CG  . HIS A 1 578 ? -47.391  24.782  -48.071 1.00 99.99  ? 582 HIS C CG  1  
ATOM 4370   N ND1 . HIS A 1 578 ? -47.008  25.210  -46.804 1.00 99.99  ? 582 HIS C ND1 1  
ATOM 4371   C CD2 . HIS A 1 578 ? -48.615  25.323  -48.308 1.00 99.99  ? 582 HIS C CD2 1  
ATOM 4372   C CE1 . HIS A 1 578 ? -47.972  25.970  -46.321 1.00 99.99  ? 582 HIS C CE1 1  
ATOM 4373   N NE2 . HIS A 1 578 ? -48.938  26.048  -47.203 1.00 99.99  ? 582 HIS C NE2 1  
ATOM 4374   N N   . TYR A 1 579 ? -49.557  22.983  -49.238 1.00 30.00  ? 583 TYR C N   1  
ATOM 4375   C CA  . TYR A 1 579 ? -50.895  23.327  -49.682 1.00 30.00  ? 583 TYR C CA  1  
ATOM 4376   C C   . TYR A 1 579 ? -50.881  24.441  -50.718 1.00 30.00  ? 583 TYR C C   1  
ATOM 4377   O O   . TYR A 1 579 ? -51.420  24.289  -51.812 1.00 30.00  ? 583 TYR C O   1  
ATOM 4378   C CB  . TYR A 1 579 ? -51.730  23.796  -48.495 1.00 99.99  ? 583 TYR C CB  1  
ATOM 4379   C CG  . TYR A 1 579 ? -51.161  25.088  -47.958 1.00 99.99  ? 583 TYR C CG  1  
ATOM 4380   C CD1 . TYR A 1 579 ? -51.523  26.309  -48.537 1.00 99.99  ? 583 TYR C CD1 1  
ATOM 4381   C CD2 . TYR A 1 579 ? -50.268  25.062  -46.879 1.00 99.99  ? 583 TYR C CD2 1  
ATOM 4382   C CE1 . TYR A 1 579 ? -50.996  27.505  -48.037 1.00 99.99  ? 583 TYR C CE1 1  
ATOM 4383   C CE2 . TYR A 1 579 ? -49.741  26.258  -46.380 1.00 99.99  ? 583 TYR C CE2 1  
ATOM 4384   C CZ  . TYR A 1 579 ? -50.104  27.480  -46.958 1.00 99.99  ? 583 TYR C CZ  1  
ATOM 4385   O OH  . TYR A 1 579 ? -49.589  28.643  -46.473 1.00 99.99  ? 583 TYR C OH  1  
ATOM 4386   N N   . ALA A 1 580 ? -50.258  25.566  -50.380 1.00 30.00  ? 584 ALA C N   1  
ATOM 4387   C CA  . ALA A 1 580 ? -50.205  26.705  -51.288 1.00 30.00  ? 584 ALA C CA  1  
ATOM 4388   C C   . ALA A 1 580 ? -48.944  26.847  -52.136 1.00 30.00  ? 584 ALA C C   1  
ATOM 4389   O O   . ALA A 1 580 ? -48.612  27.958  -52.565 1.00 30.00  ? 584 ALA C O   1  
ATOM 4390   C CB  . ALA A 1 580 ? -50.423  27.982  -50.501 1.00 30.00  ? 584 ALA C CB  1  
ATOM 4391   N N   . GLY A 1 581 ? -48.232  25.757  -52.390 1.00 30.00  ? 585 GLY C N   1  
ATOM 4392   C CA  . GLY A 1 581 ? -47.034  25.873  -53.198 1.00 30.00  ? 585 GLY C CA  1  
ATOM 4393   C C   . GLY A 1 581 ? -45.960  24.825  -52.991 1.00 30.00  ? 585 GLY C C   1  
ATOM 4394   O O   . GLY A 1 581 ? -45.923  24.128  -51.976 1.00 30.00  ? 585 GLY C O   1  
ATOM 4395   N N   . ASN A 1 582 ? -45.080  24.723  -53.985 1.00 30.00  ? 586 ASN C N   1  
ATOM 4396   C CA  . ASN A 1 582 ? -43.970  23.778  -53.954 1.00 30.00  ? 586 ASN C CA  1  
ATOM 4397   C C   . ASN A 1 582 ? -42.748  24.559  -53.525 1.00 30.00  ? 586 ASN C C   1  
ATOM 4398   O O   . ASN A 1 582 ? -42.340  25.524  -54.188 1.00 30.00  ? 586 ASN C O   1  
ATOM 4399   C CB  . ASN A 1 582 ? -43.767  23.172  -55.337 1.00 99.99  ? 586 ASN C CB  1  
ATOM 4400   C CG  . ASN A 1 582 ? -43.117  21.799  -55.245 1.00 99.99  ? 586 ASN C CG  1  
ATOM 4401   O OD1 . ASN A 1 582 ? -42.468  21.352  -56.188 1.00 99.99  ? 586 ASN C OD1 1  
ATOM 4402   N ND2 . ASN A 1 582 ? -43.295  21.131  -54.105 1.00 99.99  ? 586 ASN C ND2 1  
ATOM 4403   N N   . VAL A 1 583 ? -42.153  24.142  -52.416 1.00 30.00  ? 587 VAL C N   1  
ATOM 4404   C CA  . VAL A 1 583 ? -40.992  24.856  -51.933 1.00 30.00  ? 587 VAL C CA  1  
ATOM 4405   C C   . VAL A 1 583 ? -39.682  24.089  -51.896 1.00 30.00  ? 587 VAL C C   1  
ATOM 4406   O O   . VAL A 1 583 ? -39.562  23.052  -51.234 1.00 30.00  ? 587 VAL C O   1  
ATOM 4407   C CB  . VAL A 1 583 ? -41.230  25.326  -50.502 1.00 99.99  ? 587 VAL C CB  1  
ATOM 4408   C CG1 . VAL A 1 583 ? -42.442  26.253  -50.466 1.00 99.99  ? 587 VAL C CG1 1  
ATOM 4409   C CG2 . VAL A 1 583 ? -41.487  24.120  -49.606 1.00 99.99  ? 587 VAL C CG2 1  
ATOM 4410   N N   . PRO A 1 584 ? -38.682  24.608  -52.632 1.00 30.00  ? 588 PRO C N   1  
ATOM 4411   C CA  . PRO A 1 584 ? -37.323  24.069  -52.759 1.00 30.00  ? 588 PRO C CA  1  
ATOM 4412   C C   . PRO A 1 584 ? -36.532  24.601  -51.564 1.00 30.00  ? 588 PRO C C   1  
ATOM 4413   O O   . PRO A 1 584 ? -36.196  25.797  -51.476 1.00 30.00  ? 588 PRO C O   1  
ATOM 4414   C CB  . PRO A 1 584 ? -36.965  24.695  -54.060 1.00 99.99  ? 588 PRO C CB  1  
ATOM 4415   C CG  . PRO A 1 584 ? -38.192  25.456  -54.511 1.00 99.99  ? 588 PRO C CG  1  
ATOM 4416   C CD  . PRO A 1 584 ? -39.180  25.354  -53.708 1.00 99.99  ? 588 PRO C CD  1  
ATOM 4417   N N   . TYR A 1 585 ? -36.234  23.710  -50.642 1.00 30.00  ? 589 TYR C N   1  
ATOM 4418   C CA  . TYR A 1 585 ? -35.506  24.069  -49.441 1.00 30.00  ? 589 TYR C CA  1  
ATOM 4419   C C   . TYR A 1 585 ? -34.021  23.778  -49.453 1.00 30.00  ? 589 TYR C C   1  
ATOM 4420   O O   . TYR A 1 585 ? -33.603  22.683  -49.820 1.00 30.00  ? 589 TYR C O   1  
ATOM 4421   C CB  . TYR A 1 585 ? -36.073  23.311  -48.246 1.00 99.99  ? 589 TYR C CB  1  
ATOM 4422   C CG  . TYR A 1 585 ? -37.468  23.809  -47.947 1.00 99.99  ? 589 TYR C CG  1  
ATOM 4423   C CD1 . TYR A 1 585 ? -37.648  24.966  -47.180 1.00 99.99  ? 589 TYR C CD1 1  
ATOM 4424   C CD2 . TYR A 1 585 ? -38.580  23.112  -48.436 1.00 99.99  ? 589 TYR C CD2 1  
ATOM 4425   C CE1 . TYR A 1 585 ? -38.941  25.429  -46.904 1.00 99.99  ? 589 TYR C CE1 1  
ATOM 4426   C CE2 . TYR A 1 585 ? -39.873  23.574  -48.159 1.00 99.99  ? 589 TYR C CE2 1  
ATOM 4427   C CZ  . TYR A 1 585 ? -40.053  24.733  -47.393 1.00 99.99  ? 589 TYR C CZ  1  
ATOM 4428   O OH  . TYR A 1 585 ? -41.309  25.182  -47.124 1.00 99.99  ? 589 TYR C OH  1  
ATOM 4429   N N   . SER A 1 586 ? -33.225  24.757  -49.039 1.00 30.00  ? 590 SER C N   1  
ATOM 4430   C CA  . SER A 1 586 ? -31.778  24.580  -48.963 1.00 30.00  ? 590 SER C CA  1  
ATOM 4431   C C   . SER A 1 586 ? -31.517  24.280  -47.487 1.00 30.00  ? 590 SER C C   1  
ATOM 4432   O O   . SER A 1 586 ? -31.826  25.098  -46.621 1.00 30.00  ? 590 SER C O   1  
ATOM 4433   C CB  . SER A 1 586 ? -31.074  25.857  -49.418 1.00 99.99  ? 590 SER C CB  1  
ATOM 4434   O OG  . SER A 1 586 ? -29.659  25.666  -49.364 1.00 99.99  ? 590 SER C OG  1  
ATOM 4435   N N   . ILE A 1 587 ? -30.955  23.113  -47.193 1.00 30.00  ? 591 ILE C N   1  
ATOM 4436   C CA  . ILE A 1 587 ? -30.688  22.733  -45.805 1.00 30.00  ? 591 ILE C CA  1  
ATOM 4437   C C   . ILE A 1 587 ? -29.303  23.100  -45.267 1.00 30.00  ? 591 ILE C C   1  
ATOM 4438   O O   . ILE A 1 587 ? -28.881  22.545  -44.250 1.00 30.00  ? 591 ILE C O   1  
ATOM 4439   C CB  . ILE A 1 587 ? -30.814  21.222  -45.647 1.00 99.99  ? 591 ILE C CB  1  
ATOM 4440   C CG1 . ILE A 1 587 ? -29.525  20.552  -46.105 1.00 99.99  ? 591 ILE C CG1 1  
ATOM 4441   C CG2 . ILE A 1 587 ? -31.978  20.719  -46.495 1.00 99.99  ? 591 ILE C CG2 1  
ATOM 4442   C CD1 . ILE A 1 587 ? -29.645  20.164  -47.576 1.00 99.99  ? 591 ILE C CD1 1  
ATOM 4443   N N   . THR A 1 588 ? -28.592  24.011  -45.927 1.00 30.00  ? 592 THR C N   1  
ATOM 4444   C CA  . THR A 1 588 ? -27.265  24.369  -45.443 1.00 30.00  ? 592 THR C CA  1  
ATOM 4445   C C   . THR A 1 588 ? -27.328  25.258  -44.191 1.00 30.00  ? 592 THR C C   1  
ATOM 4446   O O   . THR A 1 588 ? -27.965  26.314  -44.190 1.00 30.00  ? 592 THR C O   1  
ATOM 4447   C CB  . THR A 1 588 ? -26.507  25.132  -46.525 1.00 99.99  ? 592 THR C CB  1  
ATOM 4448   O OG1 . THR A 1 588 ? -27.123  26.407  -46.729 1.00 99.99  ? 592 THR C OG1 1  
ATOM 4449   C CG2 . THR A 1 588 ? -26.546  24.338  -47.826 1.00 99.99  ? 592 THR C CG2 1  
ATOM 4450   N N   . GLY A 1 589 ? -26.673  24.796  -43.120 1.00 30.00  ? 593 GLY C N   1  
ATOM 4451   C CA  . GLY A 1 589 ? -26.645  25.530  -41.867 1.00 30.00  ? 593 GLY C CA  1  
ATOM 4452   C C   . GLY A 1 589 ? -27.785  25.236  -40.913 1.00 30.00  ? 593 GLY C C   1  
ATOM 4453   O O   . GLY A 1 589 ? -27.898  25.847  -39.846 1.00 30.00  ? 593 GLY C O   1  
ATOM 4454   N N   . TRP A 1 590 ? -28.629  24.291  -41.290 1.00 30.00  ? 594 TRP C N   1  
ATOM 4455   C CA  . TRP A 1 590 ? -29.792  23.903  -40.491 1.00 30.00  ? 594 TRP C CA  1  
ATOM 4456   C C   . TRP A 1 590 ? -29.466  23.283  -39.146 1.00 30.00  ? 594 TRP C C   1  
ATOM 4457   O O   . TRP A 1 590 ? -30.339  23.210  -38.281 1.00 30.00  ? 594 TRP C O   1  
ATOM 4458   C CB  . TRP A 1 590 ? -30.624  22.877  -41.249 1.00 99.99  ? 594 TRP C CB  1  
ATOM 4459   C CG  . TRP A 1 590 ? -31.929  22.501  -40.589 1.00 99.99  ? 594 TRP C CG  1  
ATOM 4460   C CD1 . TRP A 1 590 ? -32.098  21.682  -39.543 1.00 99.99  ? 594 TRP C CD1 1  
ATOM 4461   C CD2 . TRP A 1 590 ? -33.219  22.934  -40.936 1.00 99.99  ? 594 TRP C CD2 1  
ATOM 4462   N NE1 . TRP A 1 590 ? -33.502  21.631  -39.274 1.00 99.99  ? 594 TRP C NE1 1  
ATOM 4463   C CE2 . TRP A 1 590 ? -34.129  22.394  -40.132 1.00 99.99  ? 594 TRP C CE2 1  
ATOM 4464   C CE3 . TRP A 1 590 ? -33.619  23.799  -41.960 1.00 99.99  ? 594 TRP C CE3 1  
ATOM 4465   C CZ2 . TRP A 1 590 ? -35.506  22.634  -40.231 1.00 99.99  ? 594 TRP C CZ2 1  
ATOM 4466   C CZ3 . TRP A 1 590 ? -35.001  24.055  -42.076 1.00 99.99  ? 594 TRP C CZ3 1  
ATOM 4467   C CH2 . TRP A 1 590 ? -35.905  23.495  -41.246 1.00 99.99  ? 594 TRP C CH2 1  
ATOM 4468   N N   . LEU A 1 591 ? -28.234  22.828  -38.974 1.00 30.00  ? 595 LEU C N   1  
ATOM 4469   C CA  . LEU A 1 591 ? -27.849  22.198  -37.713 1.00 30.00  ? 595 LEU C CA  1  
ATOM 4470   C C   . LEU A 1 591 ? -27.573  23.200  -36.591 1.00 30.00  ? 595 LEU C C   1  
ATOM 4471   O O   . LEU A 1 591 ? -27.895  22.953  -35.419 1.00 30.00  ? 595 LEU C O   1  
ATOM 4472   C CB  . LEU A 1 591 ? -26.580  21.375  -37.910 1.00 99.99  ? 595 LEU C CB  1  
ATOM 4473   C CG  . LEU A 1 591 ? -25.372  22.304  -37.959 1.00 99.99  ? 595 LEU C CG  1  
ATOM 4474   C CD1 . LEU A 1 591 ? -25.767  23.611  -38.643 1.00 99.99  ? 595 LEU C CD1 1  
ATOM 4475   C CD2 . LEU A 1 591 ? -24.897  22.594  -36.540 1.00 99.99  ? 595 LEU C CD2 1  
ATOM 4476   N N   . GLU A 1 592 ? -26.981  24.314  -36.942 1.00 30.00  ? 596 GLU C N   1  
ATOM 4477   C CA  . GLU A 1 592 ? -26.661  25.356  -35.951 1.00 30.00  ? 596 GLU C CA  1  
ATOM 4478   C C   . GLU A 1 592 ? -27.906  26.204  -35.668 1.00 30.00  ? 596 GLU C C   1  
ATOM 4479   O O   . GLU A 1 592 ? -28.100  26.698  -34.551 1.00 30.00  ? 596 GLU C O   1  
ATOM 4480   C CB  . GLU A 1 592 ? -25.556  26.258  -36.486 1.00 99.99  ? 596 GLU C CB  1  
ATOM 4481   C CG  . GLU A 1 592 ? -24.284  25.459  -36.644 1.00 99.99  ? 596 GLU C CG  1  
ATOM 4482   C CD  . GLU A 1 592 ? -23.708  25.143  -35.266 1.00 99.99  ? 596 GLU C CD  1  
ATOM 4483   O OE1 . GLU A 1 592 ? -24.082  24.078  -34.715 1.00 99.99  ? 596 GLU C OE1 1  
ATOM 4484   O OE2 . GLU A 1 592 ? -22.894  25.977  -34.779 1.00 99.99  ? 596 GLU C OE2 1  
ATOM 4485   N N   . LYS A 1 593 ? -28.707  26.331  -36.702 1.00 30.00  ? 597 LYS C N   1  
ATOM 4486   C CA  . LYS A 1 593 ? -29.940  27.124  -36.669 1.00 30.00  ? 597 LYS C CA  1  
ATOM 4487   C C   . LYS A 1 593 ? -30.947  26.545  -35.671 1.00 30.00  ? 597 LYS C C   1  
ATOM 4488   O O   . LYS A 1 593 ? -31.761  27.276  -35.089 1.00 30.00  ? 597 LYS C O   1  
ATOM 4489   C CB  . LYS A 1 593 ? -30.585  27.136  -38.051 1.00 99.99  ? 597 LYS C CB  1  
ATOM 4490   C CG  . LYS A 1 593 ? -31.687  28.189  -38.089 1.00 99.99  ? 597 LYS C CG  1  
ATOM 4491   C CD  . LYS A 1 593 ? -32.264  28.269  -39.499 1.00 99.99  ? 597 LYS C CD  1  
ATOM 4492   C CE  . LYS A 1 593 ? -33.384  29.304  -39.530 1.00 99.99  ? 597 LYS C CE  1  
ATOM 4493   N NZ  . LYS A 1 593 ? -33.958  29.365  -40.883 1.00 99.99  ? 597 LYS C NZ  1  
ATOM 4494   N N   . ASN A 1 594 ? -30.867  25.244  -35.486 1.00 30.00  ? 598 ASN C N   1  
ATOM 4495   C CA  . ASN A 1 594 ? -31.807  24.515  -34.621 1.00 30.00  ? 598 ASN C CA  1  
ATOM 4496   C C   . ASN A 1 594 ? -31.254  24.251  -33.210 1.00 30.00  ? 598 ASN C C   1  
ATOM 4497   O O   . ASN A 1 594 ? -32.004  23.901  -32.286 1.00 30.00  ? 598 ASN C O   1  
ATOM 4498   C CB  . ASN A 1 594 ? -32.137  23.159  -35.241 1.00 99.99  ? 598 ASN C CB  1  
ATOM 4499   C CG  . ASN A 1 594 ? -33.317  22.507  -34.537 1.00 99.99  ? 598 ASN C CG  1  
ATOM 4500   O OD1 . ASN A 1 594 ? -34.416  22.450  -35.087 1.00 99.99  ? 598 ASN C OD1 1  
ATOM 4501   N ND2 . ASN A 1 594 ? -33.091  22.017  -33.318 1.00 99.99  ? 598 ASN C ND2 1  
ATOM 4502   N N   . LYS A 1 595 ? -29.953  24.427  -33.023 1.00 30.00  ? 599 LYS C N   1  
ATOM 4503   C CA  . LYS A 1 595 ? -29.318  24.106  -31.721 1.00 30.00  ? 599 LYS C CA  1  
ATOM 4504   C C   . LYS A 1 595 ? -28.742  25.335  -30.975 1.00 30.00  ? 599 LYS C C   1  
ATOM 4505   O O   . LYS A 1 595 ? -27.971  25.197  -30.010 1.00 30.00  ? 599 LYS C O   1  
ATOM 4506   C CB  . LYS A 1 595 ? -28.163  23.134  -31.932 1.00 99.99  ? 599 LYS C CB  1  
ATOM 4507   C CG  . LYS A 1 595 ? -27.580  22.735  -30.582 1.00 99.99  ? 599 LYS C CG  1  
ATOM 4508   C CD  . LYS A 1 595 ? -26.752  21.463  -30.743 1.00 99.99  ? 599 LYS C CD  1  
ATOM 4509   C CE  . LYS A 1 595 ? -25.880  21.266  -29.508 1.00 99.99  ? 599 LYS C CE  1  
ATOM 4510   N NZ  . LYS A 1 595 ? -26.573  20.390  -28.550 1.00 99.99  ? 599 LYS C NZ  1  
ATOM 4511   N N   . ASP A 1 596 ? -29.113  26.537  -31.399 1.00 30.00  ? 600 ASP C N   1  
ATOM 4512   C CA  . ASP A 1 596 ? -28.625  27.786  -30.752 1.00 30.00  ? 600 ASP C CA  1  
ATOM 4513   C C   . ASP A 1 596 ? -27.223  27.546  -30.153 1.00 30.00  ? 600 ASP C C   1  
ATOM 4514   O O   . ASP A 1 596 ? -26.764  26.403  -30.036 1.00 30.00  ? 600 ASP C O   1  
ATOM 4515   C CB  . ASP A 1 596 ? -29.582  28.203  -29.640 1.00 99.99  ? 600 ASP C CB  1  
ATOM 4516   C CG  . ASP A 1 596 ? -29.218  29.602  -29.148 1.00 99.99  ? 600 ASP C CG  1  
ATOM 4517   O OD1 . ASP A 1 596 ? -28.254  29.697  -28.344 1.00 99.99  ? 600 ASP C OD1 1  
ATOM 4518   O OD2 . ASP A 1 596 ? -29.906  30.562  -29.586 1.00 99.99  ? 600 ASP C OD2 1  
ATOM 4519   N N   . PRO A 1 597 ? -26.534  28.629  -29.774 1.00 30.00  ? 601 PRO C N   1  
ATOM 4520   C CA  . PRO A 1 597 ? -25.175  28.506  -29.193 1.00 30.00  ? 601 PRO C CA  1  
ATOM 4521   C C   . PRO A 1 597 ? -24.512  29.862  -28.886 1.00 30.00  ? 601 PRO C C   1  
ATOM 4522   O O   . PRO A 1 597 ? -23.932  30.510  -29.771 1.00 30.00  ? 601 PRO C O   1  
ATOM 4523   C CB  . PRO A 1 597 ? -24.520  27.805  -30.330 1.00 99.99  ? 601 PRO C CB  1  
ATOM 4524   C CG  . PRO A 1 597 ? -25.317  28.174  -31.560 1.00 99.99  ? 601 PRO C CG  1  
ATOM 4525   C CD  . PRO A 1 597 ? -26.548  28.405  -31.322 1.00 99.99  ? 601 PRO C CD  1  
ATOM 4526   N N   . ILE A 1 598 ? -24.601  30.242  -27.619 1.00 30.00  ? 602 ILE C N   1  
ATOM 4527   C CA  . ILE A 1 598 ? -23.988  31.486  -27.091 1.00 30.00  ? 602 ILE C CA  1  
ATOM 4528   C C   . ILE A 1 598 ? -23.056  31.110  -25.933 1.00 30.00  ? 602 ILE C C   1  
ATOM 4529   O O   . ILE A 1 598 ? -23.414  30.310  -25.058 1.00 30.00  ? 602 ILE C O   1  
ATOM 4530   C CB  . ILE A 1 598 ? -25.076  32.430  -26.596 1.00 99.99  ? 602 ILE C CB  1  
ATOM 4531   C CG1 . ILE A 1 598 ? -25.508  32.019  -25.192 1.00 99.99  ? 602 ILE C CG1 1  
ATOM 4532   C CG2 . ILE A 1 598 ? -26.274  32.363  -27.536 1.00 99.99  ? 602 ILE C CG2 1  
ATOM 4533   C CD1 . ILE A 1 598 ? -26.706  31.077  -25.284 1.00 99.99  ? 602 ILE C CD1 1  
ATOM 4534   N N   . ASN A 1 599 ? -21.875  31.694  -25.950 1.00 30.00  ? 603 ASN C N   1  
ATOM 4535   C CA  . ASN A 1 599 ? -20.857  31.437  -24.920 1.00 30.00  ? 603 ASN C CA  1  
ATOM 4536   C C   . ASN A 1 599 ? -21.504  31.438  -23.532 1.00 30.00  ? 603 ASN C C   1  
ATOM 4537   O O   . ASN A 1 599 ? -21.874  32.496  -23.001 1.00 30.00  ? 603 ASN C O   1  
ATOM 4538   C CB  . ASN A 1 599 ? -19.784  32.517  -24.970 1.00 99.99  ? 603 ASN C CB  1  
ATOM 4539   C CG  . ASN A 1 599 ? -20.370  33.890  -24.677 1.00 99.99  ? 603 ASN C CG  1  
ATOM 4540   O OD1 . ASN A 1 599 ? -19.638  34.846  -24.436 1.00 99.99  ? 603 ASN C OD1 1  
ATOM 4541   N ND2 . ASN A 1 599 ? -21.702  33.986  -24.694 1.00 99.99  ? 603 ASN C ND2 1  
ATOM 4542   N N   . GLU A 1 600 ? -21.627  30.245  -22.980 1.00 30.00  ? 604 GLU C N   1  
ATOM 4543   C CA  . GLU A 1 600 ? -22.201  30.059  -21.641 1.00 30.00  ? 604 GLU C CA  1  
ATOM 4544   C C   . GLU A 1 600 ? -21.466  30.975  -20.666 1.00 30.00  ? 604 GLU C C   1  
ATOM 4545   O O   . GLU A 1 600 ? -21.900  31.165  -19.518 1.00 30.00  ? 604 GLU C O   1  
ATOM 4546   C CB  . GLU A 1 600 ? -22.040  28.606  -21.206 1.00 99.99  ? 604 GLU C CB  1  
ATOM 4547   C CG  . GLU A 1 600 ? -22.816  27.714  -22.141 1.00 99.99  ? 604 GLU C CG  1  
ATOM 4548   C CD  . GLU A 1 600 ? -24.312  27.898  -21.901 1.00 99.99  ? 604 GLU C CD  1  
ATOM 4549   O OE1 . GLU A 1 600 ? -24.896  28.787  -22.575 1.00 99.99  ? 604 GLU C OE1 1  
ATOM 4550   O OE2 . GLU A 1 600 ? -24.855  27.150  -21.045 1.00 99.99  ? 604 GLU C OE2 1  
ATOM 4551   N N   . ASN A 1 601 ? -20.373  31.507  -21.186 1.00 30.00  ? 605 ASN C N   1  
ATOM 4552   C CA  . ASN A 1 601 ? -19.488  32.420  -20.453 1.00 30.00  ? 605 ASN C CA  1  
ATOM 4553   C C   . ASN A 1 601 ? -20.121  33.798  -20.360 1.00 30.00  ? 605 ASN C C   1  
ATOM 4554   O O   . ASN A 1 601 ? -20.319  34.328  -19.267 1.00 30.00  ? 605 ASN C O   1  
ATOM 4555   C CB  . ASN A 1 601 ? -18.150  32.536  -21.177 1.00 99.99  ? 605 ASN C CB  1  
ATOM 4556   C CG  . ASN A 1 601 ? -17.365  31.237  -21.089 1.00 99.99  ? 605 ASN C CG  1  
ATOM 4557   O OD1 . ASN A 1 601 ? -16.852  30.888  -20.026 1.00 99.99  ? 605 ASN C OD1 1  
ATOM 4558   N ND2 . ASN A 1 601 ? -17.270  30.519  -22.210 1.00 99.99  ? 605 ASN C ND2 1  
ATOM 4559   N N   . VAL A 1 602 ? -20.436  34.373  -21.517 1.00 30.00  ? 606 VAL C N   1  
ATOM 4560   C CA  . VAL A 1 602 ? -21.059  35.688  -21.577 1.00 30.00  ? 606 VAL C CA  1  
ATOM 4561   C C   . VAL A 1 602 ? -22.418  35.665  -20.869 1.00 30.00  ? 606 VAL C C   1  
ATOM 4562   O O   . VAL A 1 602 ? -22.872  36.684  -20.347 1.00 30.00  ? 606 VAL C O   1  
ATOM 4563   C CB  . VAL A 1 602 ? -21.268  36.095  -23.031 1.00 99.99  ? 606 VAL C CB  1  
ATOM 4564   C CG1 . VAL A 1 602 ? -22.131  35.051  -23.733 1.00 99.99  ? 606 VAL C CG1 1  
ATOM 4565   C CG2 . VAL A 1 602 ? -21.967  37.449  -23.085 1.00 99.99  ? 606 VAL C CG2 1  
ATOM 4566   N N   . VAL A 1 603 ? -23.063  34.507  -20.847 1.00 30.00  ? 607 VAL C N   1  
ATOM 4567   C CA  . VAL A 1 603 ? -24.352  34.377  -20.186 1.00 30.00  ? 607 VAL C CA  1  
ATOM 4568   C C   . VAL A 1 603 ? -24.147  34.550  -18.679 1.00 30.00  ? 607 VAL C C   1  
ATOM 4569   O O   . VAL A 1 603 ? -25.089  34.832  -17.927 1.00 30.00  ? 607 VAL C O   1  
ATOM 4570   C CB  . VAL A 1 603 ? -24.943  33.002  -20.472 1.00 99.99  ? 607 VAL C CB  1  
ATOM 4571   C CG1 . VAL A 1 603 ? -25.131  32.826  -21.976 1.00 99.99  ? 607 VAL C CG1 1  
ATOM 4572   C CG2 . VAL A 1 603 ? -23.999  31.921  -19.950 1.00 99.99  ? 607 VAL C CG2 1  
ATOM 4573   N N   . ALA A 1 604 ? -22.902  34.377  -18.245 1.00 30.00  ? 608 ALA C N   1  
ATOM 4574   C CA  . ALA A 1 604 ? -22.550  34.530  -16.839 1.00 30.00  ? 608 ALA C CA  1  
ATOM 4575   C C   . ALA A 1 604 ? -22.329  36.027  -16.607 1.00 30.00  ? 608 ALA C C   1  
ATOM 4576   O O   . ALA A 1 604 ? -22.807  36.595  -15.619 1.00 30.00  ? 608 ALA C O   1  
ATOM 4577   C CB  . ALA A 1 604 ? -21.281  33.744  -16.523 1.00 30.00  ? 608 ALA C CB  1  
ATOM 4578   N N   . LEU A 1 605 ? -21.602  36.661  -17.526 1.00 30.00  ? 609 LEU C N   1  
ATOM 4579   C CA  . LEU A 1 605 ? -21.318  38.095  -17.442 1.00 30.00  ? 609 LEU C CA  1  
ATOM 4580   C C   . LEU A 1 605 ? -22.624  38.863  -17.285 1.00 30.00  ? 609 LEU C C   1  
ATOM 4581   O O   . LEU A 1 605 ? -22.815  39.614  -16.322 1.00 30.00  ? 609 LEU C O   1  
ATOM 4582   C CB  . LEU A 1 605 ? -20.608  38.557  -18.711 1.00 99.99  ? 609 LEU C CB  1  
ATOM 4583   C CG  . LEU A 1 605 ? -19.101  38.533  -18.491 1.00 99.99  ? 609 LEU C CG  1  
ATOM 4584   C CD1 . LEU A 1 605 ? -18.410  39.296  -19.618 1.00 99.99  ? 609 LEU C CD1 1  
ATOM 4585   C CD2 . LEU A 1 605 ? -18.770  39.190  -17.155 1.00 99.99  ? 609 LEU C CD2 1  
ATOM 4586   N N   . LEU A 1 606 ? -23.511  38.660  -18.251 1.00 30.00  ? 610 LEU C N   1  
ATOM 4587   C CA  . LEU A 1 606 ? -24.822  39.292  -18.302 1.00 30.00  ? 610 LEU C CA  1  
ATOM 4588   C C   . LEU A 1 606 ? -25.713  38.796  -17.182 1.00 30.00  ? 610 LEU C C   1  
ATOM 4589   O O   . LEU A 1 606 ? -26.649  39.487  -16.776 1.00 30.00  ? 610 LEU C O   1  
ATOM 4590   C CB  . LEU A 1 606 ? -25.498  38.979  -19.630 1.00 99.99  ? 610 LEU C CB  1  
ATOM 4591   C CG  . LEU A 1 606 ? -25.230  40.108  -20.617 1.00 99.99  ? 610 LEU C CG  1  
ATOM 4592   C CD1 . LEU A 1 606 ? -26.161  39.966  -21.817 1.00 99.99  ? 610 LEU C CD1 1  
ATOM 4593   C CD2 . LEU A 1 606 ? -25.478  41.449  -19.934 1.00 99.99  ? 610 LEU C CD2 1  
ATOM 4594   N N   . GLY A 1 607 ? -25.434  37.596  -16.690 1.00 30.00  ? 611 GLY C N   1  
ATOM 4595   C CA  . GLY A 1 607 ? -26.240  37.070  -15.610 1.00 30.00  ? 611 GLY C CA  1  
ATOM 4596   C C   . GLY A 1 607 ? -26.192  38.022  -14.422 1.00 30.00  ? 611 GLY C C   1  
ATOM 4597   O O   . GLY A 1 607 ? -27.171  38.153  -13.679 1.00 30.00  ? 611 GLY C O   1  
ATOM 4598   N N   . ALA A 1 608 ? -25.062  38.700  -14.238 1.00 30.00  ? 612 ALA C N   1  
ATOM 4599   C CA  . ALA A 1 608 ? -24.898  39.636  -13.126 1.00 30.00  ? 612 ALA C CA  1  
ATOM 4600   C C   . ALA A 1 608 ? -24.626  41.069  -13.583 1.00 30.00  ? 612 ALA C C   1  
ATOM 4601   O O   . ALA A 1 608 ? -23.949  41.838  -12.890 1.00 30.00  ? 612 ALA C O   1  
ATOM 4602   C CB  . ALA A 1 608 ? -23.763  39.155  -12.226 1.00 30.00  ? 612 ALA C CB  1  
ATOM 4603   N N   . SER A 1 609 ? -25.157  41.431  -14.746 1.00 30.00  ? 613 SER C N   1  
ATOM 4604   C CA  . SER A 1 609 ? -24.961  42.767  -15.284 1.00 30.00  ? 613 SER C CA  1  
ATOM 4605   C C   . SER A 1 609 ? -25.582  43.839  -14.400 1.00 30.00  ? 613 SER C C   1  
ATOM 4606   O O   . SER A 1 609 ? -26.352  43.538  -13.488 1.00 30.00  ? 613 SER C O   1  
ATOM 4607   C CB  . SER A 1 609 ? -25.605  42.868  -16.665 1.00 99.99  ? 613 SER C CB  1  
ATOM 4608   O OG  . SER A 1 609 ? -27.025  42.789  -16.537 1.00 99.99  ? 613 SER C OG  1  
ATOM 4609   N N   . LYS A 1 610 ? -25.221  45.092  -14.689 1.00 30.00  ? 614 LYS C N   1  
ATOM 4610   C CA  . LYS A 1 610 ? -25.711  46.252  -13.946 1.00 30.00  ? 614 LYS C CA  1  
ATOM 4611   C C   . LYS A 1 610 ? -27.124  46.652  -14.387 1.00 30.00  ? 614 LYS C C   1  
ATOM 4612   O O   . LYS A 1 610 ? -27.975  46.956  -13.547 1.00 30.00  ? 614 LYS C O   1  
ATOM 4613   C CB  . LYS A 1 610 ? -24.787  47.442  -14.171 1.00 99.99  ? 614 LYS C CB  1  
ATOM 4614   C CG  . LYS A 1 610 ? -25.248  48.616  -13.317 1.00 99.99  ? 614 LYS C CG  1  
ATOM 4615   C CD  . LYS A 1 610 ? -24.115  49.628  -13.187 1.00 99.99  ? 614 LYS C CD  1  
ATOM 4616   C CE  . LYS A 1 610 ? -24.669  50.949  -12.665 1.00 99.99  ? 614 LYS C CE  1  
ATOM 4617   N NZ  . LYS A 1 610 ? -24.532  50.993  -11.201 1.00 99.99  ? 614 LYS C NZ  1  
ATOM 4618   N N   . GLU A 1 611 ? -27.367  46.658  -15.698 1.00 30.00  ? 615 GLU C N   1  
ATOM 4619   C CA  . GLU A 1 611 ? -28.685  47.013  -16.206 1.00 30.00  ? 615 GLU C CA  1  
ATOM 4620   C C   . GLU A 1 611 ? -29.684  46.058  -15.549 1.00 30.00  ? 615 GLU C C   1  
ATOM 4621   O O   . GLU A 1 611 ? -29.426  44.860  -15.453 1.00 30.00  ? 615 GLU C O   1  
ATOM 4622   C CB  . GLU A 1 611 ? -28.713  46.862  -17.725 1.00 99.99  ? 615 GLU C CB  1  
ATOM 4623   C CG  . GLU A 1 611 ? -29.790  47.750  -18.299 1.00 99.99  ? 615 GLU C CG  1  
ATOM 4624   C CD  . GLU A 1 611 ? -31.130  47.018  -18.255 1.00 99.99  ? 615 GLU C CD  1  
ATOM 4625   O OE1 . GLU A 1 611 ? -31.832  47.165  -17.221 1.00 99.99  ? 615 GLU C OE1 1  
ATOM 4626   O OE2 . GLU A 1 611 ? -31.439  46.319  -19.258 1.00 99.99  ? 615 GLU C OE2 1  
ATOM 4627   N N   . PRO A 1 612 ? -30.835  46.569  -15.086 1.00 30.00  ? 616 PRO C N   1  
ATOM 4628   C CA  . PRO A 1 612 ? -31.788  45.648  -14.453 1.00 30.00  ? 616 PRO C CA  1  
ATOM 4629   C C   . PRO A 1 612 ? -32.501  44.712  -15.456 1.00 30.00  ? 616 PRO C C   1  
ATOM 4630   O O   . PRO A 1 612 ? -32.838  43.569  -15.114 1.00 30.00  ? 616 PRO C O   1  
ATOM 4631   C CB  . PRO A 1 612 ? -32.715  46.661  -13.880 1.00 99.99  ? 616 PRO C CB  1  
ATOM 4632   C CG  . PRO A 1 612 ? -32.127  48.008  -14.221 1.00 99.99  ? 616 PRO C CG  1  
ATOM 4633   C CD  . PRO A 1 612 ? -31.028  47.939  -14.866 1.00 99.99  ? 616 PRO C CD  1  
ATOM 4634   N N   . LEU A 1 613 ? -32.721  45.191  -16.680 1.00 30.00  ? 617 LEU C N   1  
ATOM 4635   C CA  . LEU A 1 613 ? -33.373  44.364  -17.692 1.00 30.00  ? 617 LEU C CA  1  
ATOM 4636   C C   . LEU A 1 613 ? -32.423  43.230  -18.075 1.00 30.00  ? 617 LEU C C   1  
ATOM 4637   O O   . LEU A 1 613 ? -32.753  42.053  -17.909 1.00 30.00  ? 617 LEU C O   1  
ATOM 4638   C CB  . LEU A 1 613 ? -33.694  45.204  -18.923 1.00 99.99  ? 617 LEU C CB  1  
ATOM 4639   C CG  . LEU A 1 613 ? -35.127  45.717  -18.831 1.00 99.99  ? 617 LEU C CG  1  
ATOM 4640   C CD1 . LEU A 1 613 ? -35.558  46.270  -20.186 1.00 99.99  ? 617 LEU C CD1 1  
ATOM 4641   C CD2 . LEU A 1 613 ? -36.052  44.574  -18.429 1.00 99.99  ? 617 LEU C CD2 1  
ATOM 4642   N N   . VAL A 1 614 ? -31.250  43.590  -18.581 1.00 30.00  ? 618 VAL C N   1  
ATOM 4643   C CA  . VAL A 1 614 ? -30.256  42.599  -18.984 1.00 30.00  ? 618 VAL C CA  1  
ATOM 4644   C C   . VAL A 1 614 ? -30.074  41.501  -17.935 1.00 30.00  ? 618 VAL C C   1  
ATOM 4645   O O   . VAL A 1 614 ? -29.905  40.334  -18.268 1.00 30.00  ? 618 VAL C O   1  
ATOM 4646   C CB  . VAL A 1 614 ? -28.904  43.274  -19.193 1.00 99.99  ? 618 VAL C CB  1  
ATOM 4647   C CG1 . VAL A 1 614 ? -29.031  44.332  -20.286 1.00 99.99  ? 618 VAL C CG1 1  
ATOM 4648   C CG2 . VAL A 1 614 ? -28.458  43.933  -17.895 1.00 99.99  ? 618 VAL C CG2 1  
ATOM 4649   N N   . ALA A 1 615 ? -30.113  41.875  -16.667 1.00 30.00  ? 619 ALA C N   1  
ATOM 4650   C CA  . ALA A 1 615 ? -29.953  40.903  -15.599 1.00 30.00  ? 619 ALA C CA  1  
ATOM 4651   C C   . ALA A 1 615 ? -31.061  39.865  -15.639 1.00 30.00  ? 619 ALA C C   1  
ATOM 4652   O O   . ALA A 1 615 ? -30.806  38.669  -15.470 1.00 30.00  ? 619 ALA C O   1  
ATOM 4653   C CB  . ALA A 1 615 ? -29.962  41.612  -14.264 1.00 30.00  ? 619 ALA C CB  1  
ATOM 4654   N N   . GLU A 1 616 ? -32.294  40.328  -15.857 1.00 30.00  ? 620 GLU C N   1  
ATOM 4655   C CA  . GLU A 1 616 ? -33.472  39.453  -15.914 1.00 30.00  ? 620 GLU C CA  1  
ATOM 4656   C C   . GLU A 1 616 ? -33.499  38.547  -17.129 1.00 30.00  ? 620 GLU C C   1  
ATOM 4657   O O   . GLU A 1 616 ? -33.871  37.378  -17.029 1.00 30.00  ? 620 GLU C O   1  
ATOM 4658   C CB  . GLU A 1 616 ? -34.742  40.301  -15.951 1.00 99.99  ? 620 GLU C CB  1  
ATOM 4659   C CG  . GLU A 1 616 ? -34.874  41.071  -14.661 1.00 99.99  ? 620 GLU C CG  1  
ATOM 4660   C CD  . GLU A 1 616 ? -35.249  40.114  -13.532 1.00 99.99  ? 620 GLU C CD  1  
ATOM 4661   O OE1 . GLU A 1 616 ? -34.306  39.579  -12.893 1.00 99.99  ? 620 GLU C OE1 1  
ATOM 4662   O OE2 . GLU A 1 616 ? -36.478  39.925  -13.321 1.00 99.99  ? 620 GLU C OE2 1  
ATOM 4663   N N   . GLN A 1 639 ? -33.787  21.359  -24.448 1.00 30.00  ? 643 GLN C N   1  
ATOM 4664   C CA  . GLN A 1 639 ? -34.780  21.235  -25.506 1.00 30.00  ? 643 GLN C CA  1  
ATOM 4665   C C   . GLN A 1 639 ? -34.338  21.964  -26.796 1.00 30.00  ? 643 GLN C C   1  
ATOM 4666   O O   . GLN A 1 639 ? -33.766  23.060  -26.760 1.00 30.00  ? 643 GLN C O   1  
ATOM 4667   C CB  . GLN A 1 639 ? -36.104  21.840  -25.048 1.00 99.99  ? 643 GLN C CB  1  
ATOM 4668   C CG  . GLN A 1 639 ? -36.620  22.801  -26.110 1.00 99.99  ? 643 GLN C CG  1  
ATOM 4669   C CD  . GLN A 1 639 ? -35.771  24.064  -26.166 1.00 99.99  ? 643 GLN C CD  1  
ATOM 4670   O OE1 . GLN A 1 639 ? -34.811  24.204  -25.412 1.00 99.99  ? 643 GLN C OE1 1  
ATOM 4671   N NE2 . GLN A 1 639 ? -36.129  24.984  -27.065 1.00 99.99  ? 643 GLN C NE2 1  
ATOM 4672   N N   . THR A 1 640 ? -34.589  21.356  -27.956 1.00 30.00  ? 644 THR C N   1  
ATOM 4673   C CA  . THR A 1 640 ? -34.221  22.021  -29.175 1.00 30.00  ? 644 THR C CA  1  
ATOM 4674   C C   . THR A 1 640 ? -35.334  22.997  -29.571 1.00 30.00  ? 644 THR C C   1  
ATOM 4675   O O   . THR A 1 640 ? -36.455  23.020  -29.034 1.00 30.00  ? 644 THR C O   1  
ATOM 4676   C CB  . THR A 1 640 ? -34.025  20.993  -30.285 1.00 99.99  ? 644 THR C CB  1  
ATOM 4677   O OG1 . THR A 1 640 ? -35.282  20.405  -30.617 1.00 99.99  ? 644 THR C OG1 1  
ATOM 4678   C CG2 . THR A 1 640 ? -33.065  19.908  -29.809 1.00 99.99  ? 644 THR C CG2 1  
ATOM 4679   N N   . ILE A 1 641 ? -34.987  23.801  -30.556 1.00 30.00  ? 645 ILE C N   1  
ATOM 4680   C CA  . ILE A 1 641 ? -35.943  24.770  -31.045 1.00 30.00  ? 645 ILE C CA  1  
ATOM 4681   C C   . ILE A 1 641 ? -37.118  24.043  -31.659 1.00 30.00  ? 645 ILE C C   1  
ATOM 4682   O O   . ILE A 1 641 ? -38.282  24.332  -31.354 1.00 30.00  ? 645 ILE C O   1  
ATOM 4683   C CB  . ILE A 1 641 ? -35.289  25.658  -32.098 1.00 99.99  ? 645 ILE C CB  1  
ATOM 4684   C CG1 . ILE A 1 641 ? -35.394  24.991  -33.465 1.00 99.99  ? 645 ILE C CG1 1  
ATOM 4685   C CG2 . ILE A 1 641 ? -33.818  25.867  -31.745 1.00 99.99  ? 645 ILE C CG2 1  
ATOM 4686   C CD1 . ILE A 1 641 ? -36.632  25.509  -34.189 1.00 99.99  ? 645 ILE C CD1 1  
ATOM 4687   N N   . SER A 1 642 ? -36.794  23.079  -32.509 1.00 30.00  ? 646 SER C N   1  
ATOM 4688   C CA  . SER A 1 642 ? -37.819  22.271  -33.173 1.00 30.00  ? 646 SER C CA  1  
ATOM 4689   C C   . SER A 1 642 ? -38.792  21.659  -32.206 1.00 30.00  ? 646 SER C C   1  
ATOM 4690   O O   . SER A 1 642 ? -40.016  21.763  -32.314 1.00 30.00  ? 646 SER C O   1  
ATOM 4691   C CB  . SER A 1 642 ? -37.161  21.134  -33.952 1.00 99.99  ? 646 SER C CB  1  
ATOM 4692   O OG  . SER A 1 642 ? -36.502  21.664  -35.104 1.00 99.99  ? 646 SER C OG  1  
ATOM 4693   N N   . ALA A 1 643 ? -38.268  20.978  -31.213 1.00 30.00  ? 647 ALA C N   1  
ATOM 4694   C CA  . ALA A 1 643 ? -39.156  20.315  -30.284 1.00 30.00  ? 647 ALA C CA  1  
ATOM 4695   C C   . ALA A 1 643 ? -39.940  21.295  -29.484 1.00 30.00  ? 647 ALA C C   1  
ATOM 4696   O O   . ALA A 1 643 ? -41.076  21.103  -29.026 1.00 30.00  ? 647 ALA C O   1  
ATOM 4697   C CB  . ALA A 1 643 ? -38.315  19.547  -29.270 1.00 30.00  ? 647 ALA C CB  1  
ATOM 4698   N N   . VAL A 1 644 ? -39.243  22.367  -29.246 1.00 30.00  ? 648 VAL C N   1  
ATOM 4699   C CA  . VAL A 1 644 ? -39.935  23.322  -28.427 1.00 30.00  ? 648 VAL C CA  1  
ATOM 4700   C C   . VAL A 1 644 ? -41.115  23.945  -29.169 1.00 30.00  ? 648 VAL C C   1  
ATOM 4701   O O   . VAL A 1 644 ? -42.211  24.102  -28.665 1.00 30.00  ? 648 VAL C O   1  
ATOM 4702   C CB  . VAL A 1 644 ? -38.983  24.442  -28.017 1.00 99.99  ? 648 VAL C CB  1  
ATOM 4703   C CG1 . VAL A 1 644 ? -38.415  25.107  -29.266 1.00 99.99  ? 648 VAL C CG1 1  
ATOM 4704   C CG2 . VAL A 1 644 ? -39.734  25.473  -27.189 1.00 99.99  ? 648 VAL C CG2 1  
ATOM 4705   N N   . HIS A 1 645 ? -40.850  24.335  -30.389 1.00 30.00  ? 649 HIS C N   1  
ATOM 4706   C CA  . HIS A 1 645 ? -41.884  24.964  -31.167 1.00 30.00  ? 649 HIS C CA  1  
ATOM 4707   C C   . HIS A 1 645 ? -42.987  24.000  -31.516 1.00 30.00  ? 649 HIS C C   1  
ATOM 4708   O O   . HIS A 1 645 ? -44.165  24.342  -31.464 1.00 30.00  ? 649 HIS C O   1  
ATOM 4709   C CB  . HIS A 1 645 ? -41.298  25.506  -32.467 1.00 99.99  ? 649 HIS C CB  1  
ATOM 4710   C CG  . HIS A 1 645 ? -40.224  26.553  -32.298 1.00 99.99  ? 649 HIS C CG  1  
ATOM 4711   N ND1 . HIS A 1 645 ? -38.886  26.284  -32.559 1.00 99.99  ? 649 HIS C ND1 1  
ATOM 4712   C CD2 . HIS A 1 645 ? -40.291  27.852  -31.897 1.00 99.99  ? 649 HIS C CD2 1  
ATOM 4713   C CE1 . HIS A 1 645 ? -38.197  27.385  -32.321 1.00 99.99  ? 649 HIS C CE1 1  
ATOM 4714   N NE2 . HIS A 1 645 ? -39.017  28.327  -31.926 1.00 99.99  ? 649 HIS C NE2 1  
ATOM 4715   N N   . ARG A 1 646 ? -42.580  22.780  -31.862 1.00 30.00  ? 650 ARG C N   1  
ATOM 4716   C CA  . ARG A 1 646 ? -43.560  21.777  -32.200 1.00 30.00  ? 650 ARG C CA  1  
ATOM 4717   C C   . ARG A 1 646 ? -44.530  21.672  -31.046 1.00 30.00  ? 650 ARG C C   1  
ATOM 4718   O O   . ARG A 1 646 ? -45.750  21.580  -31.163 1.00 30.00  ? 650 ARG C O   1  
ATOM 4719   C CB  . ARG A 1 646 ? -42.869  20.439  -32.433 1.00 99.99  ? 650 ARG C CB  1  
ATOM 4720   C CG  . ARG A 1 646 ? -43.893  19.413  -32.910 1.00 99.99  ? 650 ARG C CG  1  
ATOM 4721   C CD  . ARG A 1 646 ? -43.230  18.046  -33.024 1.00 99.99  ? 650 ARG C CD  1  
ATOM 4722   N NE  . ARG A 1 646 ? -42.929  17.490  -31.686 1.00 99.99  ? 650 ARG C NE  1  
ATOM 4723   C CZ  . ARG A 1 646 ? -42.420  16.275  -31.503 1.00 99.99  ? 650 ARG C CZ  1  
ATOM 4724   N NH1 . ARG A 1 646 ? -42.143  15.466  -32.524 1.00 99.99  ? 650 ARG C NH1 1  
ATOM 4725   N NH2 . ARG A 1 646 ? -42.187  15.874  -30.257 1.00 99.99  ? 650 ARG C NH2 1  
ATOM 4726   N N   . GLU A 1 647 ? -43.969  21.757  -29.871 1.00 30.00  ? 651 GLU C N   1  
ATOM 4727   C CA  . GLU A 1 647 ? -44.797  21.707  -28.701 1.00 30.00  ? 651 GLU C CA  1  
ATOM 4728   C C   . GLU A 1 647 ? -45.654  22.956  -28.555 1.00 30.00  ? 651 GLU C C   1  
ATOM 4729   O O   . GLU A 1 647 ? -46.818  22.869  -28.196 1.00 30.00  ? 651 GLU C O   1  
ATOM 4730   C CB  . GLU A 1 647 ? -43.927  21.585  -27.454 1.00 99.99  ? 651 GLU C CB  1  
ATOM 4731   C CG  . GLU A 1 647 ? -43.192  20.264  -27.479 1.00 99.99  ? 651 GLU C CG  1  
ATOM 4732   C CD  . GLU A 1 647 ? -44.176  19.130  -27.208 1.00 99.99  ? 651 GLU C CD  1  
ATOM 4733   O OE1 . GLU A 1 647 ? -44.747  18.614  -28.204 1.00 99.99  ? 651 GLU C OE1 1  
ATOM 4734   O OE2 . GLU A 1 647 ? -44.347  18.791  -26.007 1.00 99.99  ? 651 GLU C OE2 1  
ATOM 4735   N N   . SER A 1 648 ? -45.124  24.147  -28.754 1.00 30.00  ? 652 SER C N   1  
ATOM 4736   C CA  . SER A 1 648 ? -45.946  25.344  -28.605 1.00 30.00  ? 652 SER C CA  1  
ATOM 4737   C C   . SER A 1 648 ? -47.174  25.329  -29.533 1.00 30.00  ? 652 SER C C   1  
ATOM 4738   O O   . SER A 1 648 ? -48.314  25.647  -29.200 1.00 30.00  ? 652 SER C O   1  
ATOM 4739   C CB  . SER A 1 648 ? -45.124  26.584  -28.940 1.00 99.99  ? 652 SER C CB  1  
ATOM 4740   O OG  . SER A 1 648 ? -44.812  26.590  -30.334 1.00 99.99  ? 652 SER C OG  1  
ATOM 4741   N N   . LEU A 1 649 ? -46.866  24.914  -30.733 1.00 30.00  ? 653 LEU C N   1  
ATOM 4742   C CA  . LEU A 1 649 ? -47.828  24.777  -31.774 1.00 30.00  ? 653 LEU C CA  1  
ATOM 4743   C C   . LEU A 1 649 ? -48.894  23.749  -31.439 1.00 30.00  ? 653 LEU C C   1  
ATOM 4744   O O   . LEU A 1 649 ? -50.093  23.925  -31.653 1.00 30.00  ? 653 LEU C O   1  
ATOM 4745   C CB  . LEU A 1 649 ? -47.143  24.341  -33.064 1.00 99.99  ? 653 LEU C CB  1  
ATOM 4746   C CG  . LEU A 1 649 ? -46.818  25.565  -33.908 1.00 99.99  ? 653 LEU C CG  1  
ATOM 4747   C CD1 . LEU A 1 649 ? -46.441  25.124  -35.320 1.00 99.99  ? 653 LEU C CD1 1  
ATOM 4748   C CD2 . LEU A 1 649 ? -48.037  26.479  -33.969 1.00 99.99  ? 653 LEU C CD2 1  
ATOM 4749   N N   . ASN A 1 650 ? -48.467  22.614  -30.920 1.00 30.00  ? 654 ASN C N   1  
ATOM 4750   C CA  . ASN A 1 650 ? -49.445  21.596  -30.593 1.00 30.00  ? 654 ASN C CA  1  
ATOM 4751   C C   . ASN A 1 650 ? -50.326  22.126  -29.487 1.00 30.00  ? 654 ASN C C   1  
ATOM 4752   O O   . ASN A 1 650 ? -51.524  21.927  -29.392 1.00 30.00  ? 654 ASN C O   1  
ATOM 4753   C CB  . ASN A 1 650 ? -48.739  20.327  -30.131 1.00 99.99  ? 654 ASN C CB  1  
ATOM 4754   C CG  . ASN A 1 650 ? -48.046  20.540  -28.792 1.00 99.99  ? 654 ASN C CG  1  
ATOM 4755   O OD1 . ASN A 1 650 ? -46.823  20.464  -28.703 1.00 99.99  ? 654 ASN C OD1 1  
ATOM 4756   N ND2 . ASN A 1 650 ? -48.835  20.808  -27.750 1.00 99.99  ? 654 ASN C ND2 1  
ATOM 4757   N N   . LYS A 1 651 ? -49.728  22.877  -28.614 1.00 30.00  ? 655 LYS C N   1  
ATOM 4758   C CA  . LYS A 1 651 ? -50.544  23.404  -27.561 1.00 30.00  ? 655 LYS C CA  1  
ATOM 4759   C C   . LYS A 1 651 ? -51.547  24.448  -28.079 1.00 30.00  ? 655 LYS C C   1  
ATOM 4760   O O   . LYS A 1 651 ? -52.679  24.605  -27.604 1.00 30.00  ? 655 LYS C O   1  
ATOM 4761   C CB  . LYS A 1 651 ? -49.665  24.072  -26.508 1.00 99.99  ? 655 LYS C CB  1  
ATOM 4762   C CG  . LYS A 1 651 ? -49.328  23.067  -25.414 1.00 99.99  ? 655 LYS C CG  1  
ATOM 4763   C CD  . LYS A 1 651 ? -48.261  22.101  -25.920 1.00 99.99  ? 655 LYS C CD  1  
ATOM 4764   C CE  . LYS A 1 651 ? -48.067  20.981  -24.904 1.00 99.99  ? 655 LYS C CE  1  
ATOM 4765   N NZ  . LYS A 1 651 ? -47.129  19.986  -25.445 1.00 99.99  ? 655 LYS C NZ  1  
ATOM 4766   N N   . LEU A 1 652 ? -51.100  25.203  -29.060 1.00 30.00  ? 656 LEU C N   1  
ATOM 4767   C CA  . LEU A 1 652 ? -51.980  26.233  -29.636 1.00 30.00  ? 656 LEU C CA  1  
ATOM 4768   C C   . LEU A 1 652 ? -53.220  25.581  -30.252 1.00 30.00  ? 656 LEU C C   1  
ATOM 4769   O O   . LEU A 1 652 ? -54.358  26.002  -29.990 1.00 30.00  ? 656 LEU C O   1  
ATOM 4770   C CB  . LEU A 1 652 ? -51.233  27.006  -30.719 1.00 99.99  ? 656 LEU C CB  1  
ATOM 4771   C CG  . LEU A 1 652 ? -50.621  28.266  -30.119 1.00 99.99  ? 656 LEU C CG  1  
ATOM 4772   C CD1 . LEU A 1 652 ? -50.165  29.194  -31.239 1.00 99.99  ? 656 LEU C CD1 1  
ATOM 4773   C CD2 . LEU A 1 652 ? -51.661  28.976  -29.260 1.00 99.99  ? 656 LEU C CD2 1  
ATOM 4774   N N   . MET A 1 653 ? -52.946  24.569  -31.054 1.00 30.00  ? 657 MET C N   1  
ATOM 4775   C CA  . MET A 1 653 ? -53.975  23.801  -31.776 1.00 30.00  ? 657 MET C CA  1  
ATOM 4776   C C   . MET A 1 653 ? -55.002  23.211  -30.802 1.00 30.00  ? 657 MET C C   1  
ATOM 4777   O O   . MET A 1 653 ? -56.211  23.212  -31.069 1.00 30.00  ? 657 MET C O   1  
ATOM 4778   C CB  . MET A 1 653 ? -53.324  22.661  -32.549 1.00 99.99  ? 657 MET C CB  1  
ATOM 4779   C CG  . MET A 1 653 ? -54.386  21.916  -33.351 1.00 99.99  ? 657 MET C CG  1  
ATOM 4780   S SD  . MET A 1 653 ? -53.594  20.775  -34.515 1.00 99.99  ? 657 MET C SD  1  
ATOM 4781   C CE  . MET A 1 653 ? -55.039  20.005  -35.220 1.00 99.99  ? 657 MET C CE  1  
ATOM 4782   N N   . LYS A 1 654 ? -54.483  22.716  -29.695 1.00 30.00  ? 658 LYS C N   1  
ATOM 4783   C CA  . LYS A 1 654 ? -55.302  22.095  -28.644 1.00 30.00  ? 658 LYS C CA  1  
ATOM 4784   C C   . LYS A 1 654 ? -56.282  23.120  -28.058 1.00 30.00  ? 658 LYS C C   1  
ATOM 4785   O O   . LYS A 1 654 ? -57.438  22.797  -27.754 1.00 30.00  ? 658 LYS C O   1  
ATOM 4786   C CB  . LYS A 1 654 ? -54.406  21.575  -27.527 1.00 99.99  ? 658 LYS C CB  1  
ATOM 4787   C CG  . LYS A 1 654 ? -55.254  20.847  -26.490 1.00 99.99  ? 658 LYS C CG  1  
ATOM 4788   C CD  . LYS A 1 654 ? -54.358  19.959  -25.631 1.00 99.99  ? 658 LYS C CD  1  
ATOM 4789   C CE  . LYS A 1 654 ? -55.120  19.526  -24.382 1.00 99.99  ? 658 LYS C CE  1  
ATOM 4790   N NZ  . LYS A 1 654 ? -55.752  18.220  -24.621 1.00 99.99  ? 658 LYS C NZ  1  
ATOM 4791   N N   . ASN A 1 655 ? -55.777  24.328  -27.923 1.00 30.00  ? 659 ASN C N   1  
ATOM 4792   C CA  . ASN A 1 655 ? -56.539  25.454  -27.362 1.00 30.00  ? 659 ASN C CA  1  
ATOM 4793   C C   . ASN A 1 655 ? -57.633  25.910  -28.336 1.00 30.00  ? 659 ASN C C   1  
ATOM 4794   O O   . ASN A 1 655 ? -58.693  26.399  -27.920 1.00 30.00  ? 659 ASN C O   1  
ATOM 4795   C CB  . ASN A 1 655 ? -55.605  26.630  -27.096 1.00 99.99  ? 659 ASN C CB  1  
ATOM 4796   C CG  . ASN A 1 655 ? -54.557  26.275  -26.051 1.00 99.99  ? 659 ASN C CG  1  
ATOM 4797   O OD1 . ASN A 1 655 ? -54.895  25.832  -24.956 1.00 99.99  ? 659 ASN C OD1 1  
ATOM 4798   N ND2 . ASN A 1 655 ? -53.281  26.468  -26.395 1.00 99.99  ? 659 ASN C ND2 1  
ATOM 4799   N N   . LEU A 1 656 ? -57.343  25.728  -29.610 1.00 30.00  ? 660 LEU C N   1  
ATOM 4800   C CA  . LEU A 1 656 ? -58.236  26.142  -30.709 1.00 30.00  ? 660 LEU C CA  1  
ATOM 4801   C C   . LEU A 1 656 ? -59.467  25.226  -30.832 1.00 30.00  ? 660 LEU C C   1  
ATOM 4802   O O   . LEU A 1 656 ? -60.609  25.703  -30.917 1.00 30.00  ? 660 LEU C O   1  
ATOM 4803   C CB  . LEU A 1 656 ? -57.482  26.095  -32.035 1.00 99.99  ? 660 LEU C CB  1  
ATOM 4804   C CG  . LEU A 1 656 ? -56.920  27.478  -32.349 1.00 99.99  ? 660 LEU C CG  1  
ATOM 4805   C CD1 . LEU A 1 656 ? -56.462  27.522  -33.804 1.00 99.99  ? 660 LEU C CD1 1  
ATOM 4806   C CD2 . LEU A 1 656 ? -58.001  28.528  -32.126 1.00 99.99  ? 660 LEU C CD2 1  
ATOM 4807   N N   . TYR A 1 657 ? -59.194  23.932  -30.839 1.00 30.00  ? 661 TYR C N   1  
ATOM 4808   C CA  . TYR A 1 657 ? -60.220  22.877  -31.007 1.00 30.00  ? 661 TYR C CA  1  
ATOM 4809   C C   . TYR A 1 657 ? -61.416  23.058  -30.061 1.00 30.00  ? 661 TYR C C   1  
ATOM 4810   O O   . TYR A 1 657 ? -62.550  22.671  -30.373 1.00 30.00  ? 661 TYR C O   1  
ATOM 4811   C CB  . TYR A 1 657 ? -59.607  21.508  -30.726 1.00 99.99  ? 661 TYR C CB  1  
ATOM 4812   C CG  . TYR A 1 657 ? -60.657  20.442  -30.902 1.00 99.99  ? 661 TYR C CG  1  
ATOM 4813   C CD1 . TYR A 1 657 ? -60.941  19.942  -32.180 1.00 99.99  ? 661 TYR C CD1 1  
ATOM 4814   C CD2 . TYR A 1 657 ? -61.347  19.945  -29.788 1.00 99.99  ? 661 TYR C CD2 1  
ATOM 4815   C CE1 . TYR A 1 657 ? -61.917  18.950  -32.343 1.00 99.99  ? 661 TYR C CE1 1  
ATOM 4816   C CE2 . TYR A 1 657 ? -62.322  18.953  -29.953 1.00 99.99  ? 661 TYR C CE2 1  
ATOM 4817   C CZ  . TYR A 1 657 ? -62.604  18.456  -31.230 1.00 99.99  ? 661 TYR C CZ  1  
ATOM 4818   O OH  . TYR A 1 657 ? -63.552  17.491  -31.388 1.00 99.99  ? 661 TYR C OH  1  
ATOM 4819   N N   . SER A 1 658 ? -61.151  23.628  -28.909 1.00 30.00  ? 662 SER C N   1  
ATOM 4820   C CA  . SER A 1 658 ? -62.196  23.870  -27.907 1.00 30.00  ? 662 SER C CA  1  
ATOM 4821   C C   . SER A 1 658 ? -62.987  25.119  -28.279 1.00 30.00  ? 662 SER C C   1  
ATOM 4822   O O   . SER A 1 658 ? -63.411  25.894  -27.414 1.00 30.00  ? 662 SER C O   1  
ATOM 4823   C CB  . SER A 1 658 ? -61.564  24.062  -26.533 1.00 99.99  ? 662 SER C CB  1  
ATOM 4824   O OG  . SER A 1 658 ? -60.831  25.288  -26.513 1.00 99.99  ? 662 SER C OG  1  
ATOM 4825   N N   . THR A 1 659 ? -63.194  25.305  -29.574 1.00 30.00  ? 663 THR C N   1  
ATOM 4826   C CA  . THR A 1 659 ? -63.854  26.527  -30.036 1.00 30.00  ? 663 THR C CA  1  
ATOM 4827   C C   . THR A 1 659 ? -64.830  26.346  -31.199 1.00 30.00  ? 663 THR C C   1  
ATOM 4828   O O   . THR A 1 659 ? -64.781  25.338  -31.928 1.00 30.00  ? 663 THR C O   1  
ATOM 4829   C CB  . THR A 1 659 ? -62.811  27.530  -30.508 1.00 99.99  ? 663 THR C CB  1  
ATOM 4830   O OG1 . THR A 1 659 ? -62.183  27.043  -31.699 1.00 99.99  ? 663 THR C OG1 1  
ATOM 4831   C CG2 . THR A 1 659 ? -61.756  27.718  -29.424 1.00 99.99  ? 663 THR C CG2 1  
ATOM 4832   N N   . HIS A 1 660 ? -65.645  27.389  -31.242 1.00 30.00  ? 664 HIS C N   1  
ATOM 4833   C CA  . HIS A 1 660 ? -66.644  27.665  -32.270 1.00 30.00  ? 664 HIS C CA  1  
ATOM 4834   C C   . HIS A 1 660 ? -66.008  28.701  -33.188 1.00 30.00  ? 664 HIS C C   1  
ATOM 4835   O O   . HIS A 1 660 ? -66.118  29.915  -32.960 1.00 30.00  ? 664 HIS C O   1  
ATOM 4836   C CB  . HIS A 1 660 ? -67.916  28.203  -31.626 1.00 99.99  ? 664 HIS C CB  1  
ATOM 4837   C CG  . HIS A 1 660 ? -68.830  27.153  -31.040 1.00 99.99  ? 664 HIS C CG  1  
ATOM 4838   N ND1 . HIS A 1 660 ? -68.780  26.803  -29.695 1.00 99.99  ? 664 HIS C ND1 1  
ATOM 4839   C CD2 . HIS A 1 660 ? -69.801  26.388  -31.607 1.00 99.99  ? 664 HIS C CD2 1  
ATOM 4840   C CE1 . HIS A 1 660 ? -69.690  25.869  -29.485 1.00 99.99  ? 664 HIS C CE1 1  
ATOM 4841   N NE2 . HIS A 1 660 ? -70.306  25.610  -30.610 1.00 99.99  ? 664 HIS C NE2 1  
ATOM 4842   N N   . PRO A 1 661 ? -65.345  28.159  -34.184 1.00 30.00  ? 665 PRO C N   1  
ATOM 4843   C CA  . PRO A 1 661 ? -64.535  28.933  -35.127 1.00 30.00  ? 665 PRO C CA  1  
ATOM 4844   C C   . PRO A 1 661 ? -65.337  29.585  -36.252 1.00 30.00  ? 665 PRO C C   1  
ATOM 4845   O O   . PRO A 1 661 ? -66.255  28.976  -36.823 1.00 30.00  ? 665 PRO C O   1  
ATOM 4846   C CB  . PRO A 1 661 ? -63.678  27.825  -35.629 1.00 99.99  ? 665 PRO C CB  1  
ATOM 4847   C CG  . PRO A 1 661 ? -64.090  26.592  -34.858 1.00 99.99  ? 665 PRO C CG  1  
ATOM 4848   C CD  . PRO A 1 661 ? -65.010  26.809  -34.001 1.00 99.99  ? 665 PRO C CD  1  
ATOM 4849   N N   . HIS A 1 662 ? -64.900  30.806  -36.486 1.00 30.00  ? 666 HIS C N   1  
ATOM 4850   C CA  . HIS A 1 662 ? -65.339  31.689  -37.568 1.00 30.00  ? 666 HIS C CA  1  
ATOM 4851   C C   . HIS A 1 662 ? -64.077  31.980  -38.367 1.00 30.00  ? 666 HIS C C   1  
ATOM 4852   O O   . HIS A 1 662 ? -63.064  32.440  -37.821 1.00 30.00  ? 666 HIS C O   1  
ATOM 4853   C CB  . HIS A 1 662 ? -65.945  32.959  -36.987 1.00 99.99  ? 666 HIS C CB  1  
ATOM 4854   C CG  . HIS A 1 662 ? -65.590  33.238  -35.546 1.00 99.99  ? 666 HIS C CG  1  
ATOM 4855   N ND1 . HIS A 1 662 ? -65.503  34.531  -35.045 1.00 99.99  ? 666 HIS C ND1 1  
ATOM 4856   C CD2 . HIS A 1 662 ? -65.304  32.400  -34.514 1.00 99.99  ? 666 HIS C CD2 1  
ATOM 4857   C CE1 . HIS A 1 662 ? -65.178  34.453  -33.768 1.00 99.99  ? 666 HIS C CE1 1  
ATOM 4858   N NE2 . HIS A 1 662 ? -65.056  33.192  -33.435 1.00 99.99  ? 666 HIS C NE2 1  
ATOM 4859   N N   . PHE A 1 663 ? -64.124  31.712  -39.650 1.00 30.00  ? 667 PHE C N   1  
ATOM 4860   C CA  . PHE A 1 663 ? -62.919  31.819  -40.472 1.00 30.00  ? 667 PHE C CA  1  
ATOM 4861   C C   . PHE A 1 663 ? -62.899  32.999  -41.424 1.00 30.00  ? 667 PHE C C   1  
ATOM 4862   O O   . PHE A 1 663 ? -63.901  33.332  -42.044 1.00 30.00  ? 667 PHE C O   1  
ATOM 4863   C CB  . PHE A 1 663 ? -62.760  30.568  -41.328 1.00 99.99  ? 667 PHE C CB  1  
ATOM 4864   C CG  . PHE A 1 663 ? -61.514  30.686  -42.170 1.00 99.99  ? 667 PHE C CG  1  
ATOM 4865   C CD1 . PHE A 1 663 ? -60.267  30.355  -41.626 1.00 99.99  ? 667 PHE C CD1 1  
ATOM 4866   C CD2 . PHE A 1 663 ? -61.602  31.129  -43.495 1.00 99.99  ? 667 PHE C CD2 1  
ATOM 4867   C CE1 . PHE A 1 663 ? -59.110  30.466  -42.405 1.00 99.99  ? 667 PHE C CE1 1  
ATOM 4868   C CE2 . PHE A 1 663 ? -60.449  31.241  -44.276 1.00 99.99  ? 667 PHE C CE2 1  
ATOM 4869   C CZ  . PHE A 1 663 ? -59.201  30.908  -43.731 1.00 99.99  ? 667 PHE C CZ  1  
ATOM 4870   N N   . VAL A 1 664 ? -61.734  33.632  -41.521 1.00 30.00  ? 668 VAL C N   1  
ATOM 4871   C CA  . VAL A 1 664 ? -61.532  34.787  -42.408 1.00 30.00  ? 668 VAL C CA  1  
ATOM 4872   C C   . VAL A 1 664 ? -60.474  34.327  -43.399 1.00 30.00  ? 668 VAL C C   1  
ATOM 4873   O O   . VAL A 1 664 ? -59.451  33.768  -42.982 1.00 30.00  ? 668 VAL C O   1  
ATOM 4874   C CB  . VAL A 1 664 ? -61.061  35.989  -41.596 1.00 99.99  ? 668 VAL C CB  1  
ATOM 4875   C CG1 . VAL A 1 664 ? -62.112  36.338  -40.548 1.00 99.99  ? 668 VAL C CG1 1  
ATOM 4876   C CG2 . VAL A 1 664 ? -59.745  35.654  -40.903 1.00 99.99  ? 668 VAL C CG2 1  
ATOM 4877   N N   . ARG A 1 665 ? -60.723  34.550  -44.690 1.00 30.00  ? 669 ARG C N   1  
ATOM 4878   C CA  . ARG A 1 665 ? -59.791  34.137  -45.740 1.00 30.00  ? 669 ARG C CA  1  
ATOM 4879   C C   . ARG A 1 665 ? -59.280  35.310  -46.538 1.00 30.00  ? 669 ARG C C   1  
ATOM 4880   O O   . ARG A 1 665 ? -60.019  35.925  -47.318 1.00 30.00  ? 669 ARG C O   1  
ATOM 4881   C CB  . ARG A 1 665 ? -60.485  33.179  -46.701 1.00 99.99  ? 669 ARG C CB  1  
ATOM 4882   C CG  . ARG A 1 665 ? -59.491  32.714  -47.761 1.00 99.99  ? 669 ARG C CG  1  
ATOM 4883   C CD  . ARG A 1 665 ? -60.197  31.794  -48.751 1.00 99.99  ? 669 ARG C CD  1  
ATOM 4884   N NE  . ARG A 1 665 ? -61.463  32.399  -49.227 1.00 99.99  ? 669 ARG C NE  1  
ATOM 4885   C CZ  . ARG A 1 665 ? -61.510  33.326  -50.176 1.00 99.99  ? 669 ARG C CZ  1  
ATOM 4886   N NH1 . ARG A 1 665 ? -60.410  33.784  -50.771 1.00 99.99  ? 669 ARG C NH1 1  
ATOM 4887   N NH2 . ARG A 1 665 ? -62.704  33.802  -50.526 1.00 99.99  ? 669 ARG C NH2 1  
ATOM 4888   N N   . CYS A 1 666 ? -57.996  35.603  -46.336 1.00 30.00  ? 670 CYS C N   1  
ATOM 4889   C CA  . CYS A 1 666 ? -57.312  36.706  -46.992 1.00 30.00  ? 670 CYS C CA  1  
ATOM 4890   C C   . CYS A 1 666 ? -56.839  36.277  -48.369 1.00 30.00  ? 670 CYS C C   1  
ATOM 4891   O O   . CYS A 1 666 ? -56.521  35.113  -48.577 1.00 30.00  ? 670 CYS C O   1  
ATOM 4892   C CB  . CYS A 1 666 ? -56.106  37.136  -46.162 1.00 99.99  ? 670 CYS C CB  1  
ATOM 4893   S SG  . CYS A 1 666 ? -54.628  36.102  -46.314 1.00 99.99  ? 670 CYS C SG  1  
ATOM 4894   N N   . ILE A 1 667 ? -56.770  37.236  -49.290 1.00 30.00  ? 671 ILE C N   1  
ATOM 4895   C CA  . ILE A 1 667 ? -56.388  36.938  -50.650 1.00 30.00  ? 671 ILE C CA  1  
ATOM 4896   C C   . ILE A 1 667 ? -55.577  38.035  -51.289 1.00 30.00  ? 671 ILE C C   1  
ATOM 4897   O O   . ILE A 1 667 ? -56.036  39.182  -51.403 1.00 30.00  ? 671 ILE C O   1  
ATOM 4898   C CB  . ILE A 1 667 ? -57.633  36.733  -51.507 1.00 99.99  ? 671 ILE C CB  1  
ATOM 4899   C CG1 . ILE A 1 667 ? -58.123  38.081  -52.027 1.00 99.99  ? 671 ILE C CG1 1  
ATOM 4900   C CG2 . ILE A 1 667 ? -58.727  36.086  -50.662 1.00 99.99  ? 671 ILE C CG2 1  
ATOM 4901   C CD1 . ILE A 1 667 ? -57.544  38.330  -53.415 1.00 99.99  ? 671 ILE C CD1 1  
ATOM 4902   N N   . ILE A 1 668 ? -54.376  37.679  -51.731 1.00 30.00  ? 672 ILE C N   1  
ATOM 4903   C CA  . ILE A 1 668 ? -53.504  38.642  -52.373 1.00 30.00  ? 672 ILE C CA  1  
ATOM 4904   C C   . ILE A 1 668 ? -53.917  38.772  -53.841 1.00 30.00  ? 672 ILE C C   1  
ATOM 4905   O O   . ILE A 1 668 ? -53.845  37.823  -54.611 1.00 30.00  ? 672 ILE C O   1  
ATOM 4906   C CB  . ILE A 1 668 ? -52.056  38.169  -52.283 1.00 99.99  ? 672 ILE C CB  1  
ATOM 4907   C CG1 . ILE A 1 668 ? -51.783  37.154  -53.385 1.00 99.99  ? 672 ILE C CG1 1  
ATOM 4908   C CG2 . ILE A 1 668 ? -51.817  37.523  -50.923 1.00 99.99  ? 672 ILE C CG2 1  
ATOM 4909   C CD1 . ILE A 1 668 ? -52.023  35.746  -52.849 1.00 99.99  ? 672 ILE C CD1 1  
ATOM 4910   N N   . PRO A 1 669 ? -54.380  39.960  -54.240 1.00 30.00  ? 673 PRO C N   1  
ATOM 4911   C CA  . PRO A 1 669 ? -54.823  40.275  -55.606 1.00 30.00  ? 673 PRO C CA  1  
ATOM 4912   C C   . PRO A 1 669 ? -53.772  40.176  -56.708 1.00 30.00  ? 673 PRO C C   1  
ATOM 4913   O O   . PRO A 1 669 ? -54.103  39.881  -57.853 1.00 30.00  ? 673 PRO C O   1  
ATOM 4914   C CB  . PRO A 1 669 ? -55.221  41.694  -55.376 1.00 99.99  ? 673 PRO C CB  1  
ATOM 4915   C CG  . PRO A 1 669 ? -54.414  42.165  -54.191 1.00 99.99  ? 673 PRO C CG  1  
ATOM 4916   C CD  . PRO A 1 669 ? -54.124  41.236  -53.366 1.00 99.99  ? 673 PRO C CD  1  
ATOM 4917   N N   . ASN A 1 670 ? -52.518  40.437  -56.380 1.00 30.00  ? 674 ASN C N   1  
ATOM 4918   C CA  . ASN A 1 670 ? -51.454  40.364  -57.370 1.00 30.00  ? 674 ASN C CA  1  
ATOM 4919   C C   . ASN A 1 670 ? -50.072  40.335  -56.744 1.00 30.00  ? 674 ASN C C   1  
ATOM 4920   O O   . ASN A 1 670 ? -49.926  40.480  -55.542 1.00 30.00  ? 674 ASN C O   1  
ATOM 4921   C CB  . ASN A 1 670 ? -51.521  41.580  -58.289 1.00 99.99  ? 674 ASN C CB  1  
ATOM 4922   C CG  . ASN A 1 670 ? -51.383  42.875  -57.501 1.00 99.99  ? 674 ASN C CG  1  
ATOM 4923   O OD1 . ASN A 1 670 ? -50.347  43.530  -57.557 1.00 99.99  ? 674 ASN C OD1 1  
ATOM 4924   N ND2 . ASN A 1 670 ? -52.433  43.236  -56.761 1.00 99.99  ? 674 ASN C ND2 1  
ATOM 4925   N N   . GLU A 1 671 ? -49.063  40.138  -57.584 1.00 30.00  ? 675 GLU C N   1  
ATOM 4926   C CA  . GLU A 1 671 ? -47.664  40.064  -57.159 1.00 30.00  ? 675 GLU C CA  1  
ATOM 4927   C C   . GLU A 1 671 ? -46.969  41.418  -57.257 1.00 30.00  ? 675 GLU C C   1  
ATOM 4928   O O   . GLU A 1 671 ? -45.762  41.522  -57.051 1.00 30.00  ? 675 GLU C O   1  
ATOM 4929   C CB  . GLU A 1 671 ? -46.908  39.079  -58.041 1.00 99.99  ? 675 GLU C CB  1  
ATOM 4930   C CG  . GLU A 1 671 ? -45.642  39.725  -58.553 1.00 99.99  ? 675 GLU C CG  1  
ATOM 4931   C CD  . GLU A 1 671 ? -45.999  40.790  -59.587 1.00 99.99  ? 675 GLU C CD  1  
ATOM 4932   O OE1 . GLU A 1 671 ? -46.199  41.959  -59.167 1.00 99.99  ? 675 GLU C OE1 1  
ATOM 4933   O OE2 . GLU A 1 671 ? -46.068  40.423  -60.792 1.00 99.99  ? 675 GLU C OE2 1  
ATOM 4934   N N   . LEU A 1 672 ? -47.730  42.457  -57.571 1.00 30.00  ? 676 LEU C N   1  
ATOM 4935   C CA  . LEU A 1 672 ? -47.157  43.782  -57.714 1.00 30.00  ? 676 LEU C CA  1  
ATOM 4936   C C   . LEU A 1 672 ? -47.367  44.759  -56.571 1.00 30.00  ? 676 LEU C C   1  
ATOM 4937   O O   . LEU A 1 672 ? -46.898  45.876  -56.644 1.00 30.00  ? 676 LEU C O   1  
ATOM 4938   C CB  . LEU A 1 672 ? -47.742  44.470  -58.941 1.00 99.99  ? 676 LEU C CB  1  
ATOM 4939   C CG  . LEU A 1 672 ? -46.820  44.251  -60.135 1.00 99.99  ? 676 LEU C CG  1  
ATOM 4940   C CD1 . LEU A 1 672 ? -47.216  45.195  -61.265 1.00 99.99  ? 676 LEU C CD1 1  
ATOM 4941   C CD2 . LEU A 1 672 ? -45.378  44.528  -59.723 1.00 99.99  ? 676 LEU C CD2 1  
ATOM 4942   N N   . LYS A 1 673 ? -48.073  44.353  -55.529 1.00 30.00  ? 677 LYS C N   1  
ATOM 4943   C CA  . LYS A 1 673 ? -48.304  45.247  -54.404 1.00 30.00  ? 677 LYS C CA  1  
ATOM 4944   C C   . LYS A 1 673 ? -49.078  46.494  -54.780 1.00 30.00  ? 677 LYS C C   1  
ATOM 4945   O O   . LYS A 1 673 ? -49.191  47.387  -53.948 1.00 30.00  ? 677 LYS C O   1  
ATOM 4946   C CB  . LYS A 1 673 ? -46.971  45.696  -53.814 1.00 99.99  ? 677 LYS C CB  1  
ATOM 4947   C CG  . LYS A 1 673 ? -47.224  46.509  -52.548 1.00 99.99  ? 677 LYS C CG  1  
ATOM 4948   C CD  . LYS A 1 673 ? -45.889  46.917  -51.932 1.00 99.99  ? 677 LYS C CD  1  
ATOM 4949   C CE  . LYS A 1 673 ? -46.128  47.967  -50.851 1.00 99.99  ? 677 LYS C CE  1  
ATOM 4950   N NZ  . LYS A 1 673 ? -44.843  48.361  -50.259 1.00 99.99  ? 677 LYS C NZ  1  
ATOM 4951   N N   . GLN A 1 674 ? -49.601  46.586  -56.004 1.00 30.00  ? 678 GLN C N   1  
ATOM 4952   C CA  . GLN A 1 674 ? -50.374  47.782  -56.365 1.00 30.00  ? 678 GLN C CA  1  
ATOM 4953   C C   . GLN A 1 674 ? -51.855  47.505  -56.132 1.00 30.00  ? 678 GLN C C   1  
ATOM 4954   O O   . GLN A 1 674 ? -52.330  46.389  -56.347 1.00 30.00  ? 678 GLN C O   1  
ATOM 4955   C CB  . GLN A 1 674 ? -50.144  48.123  -57.833 1.00 99.99  ? 678 GLN C CB  1  
ATOM 4956   C CG  . GLN A 1 674 ? -48.686  48.517  -58.042 1.00 99.99  ? 678 GLN C CG  1  
ATOM 4957   C CD  . GLN A 1 674 ? -48.393  49.883  -57.438 1.00 99.99  ? 678 GLN C CD  1  
ATOM 4958   O OE1 . GLN A 1 674 ? -49.278  50.518  -56.875 1.00 99.99  ? 678 GLN C OE1 1  
ATOM 4959   N NE2 . GLN A 1 674 ? -47.141  50.333  -57.560 1.00 99.99  ? 678 GLN C NE2 1  
ATOM 4960   N N   . PRO A 1 675 ? -52.614  48.525  -55.688 1.00 30.00  ? 679 PRO C N   1  
ATOM 4961   C CA  . PRO A 1 675 ? -54.058  48.432  -55.401 1.00 30.00  ? 679 PRO C CA  1  
ATOM 4962   C C   . PRO A 1 675 ? -55.032  48.320  -56.584 1.00 30.00  ? 679 PRO C C   1  
ATOM 4963   O O   . PRO A 1 675 ? -54.736  48.740  -57.707 1.00 30.00  ? 679 PRO C O   1  
ATOM 4964   C CB  . PRO A 1 675 ? -54.227  49.743  -54.721 1.00 99.99  ? 679 PRO C CB  1  
ATOM 4965   C CG  . PRO A 1 675 ? -53.115  50.629  -55.238 1.00 99.99  ? 679 PRO C CG  1  
ATOM 4966   C CD  . PRO A 1 675 ? -52.062  49.987  -55.566 1.00 99.99  ? 679 PRO C CD  1  
ATOM 4967   N N   . GLY A 1 676 ? -56.201  47.739  -56.306 1.00 30.00  ? 680 GLY C N   1  
ATOM 4968   C CA  . GLY A 1 676 ? -57.237  47.570  -57.310 1.00 30.00  ? 680 GLY C CA  1  
ATOM 4969   C C   . GLY A 1 676 ? -56.940  46.792  -58.582 1.00 30.00  ? 680 GLY C C   1  
ATOM 4970   O O   . GLY A 1 676 ? -57.781  46.745  -59.476 1.00 30.00  ? 680 GLY C O   1  
ATOM 4971   N N   . LEU A 1 677 ? -55.757  46.193  -58.669 1.00 30.00  ? 681 LEU C N   1  
ATOM 4972   C CA  . LEU A 1 677 ? -55.363  45.417  -59.840 1.00 30.00  ? 681 LEU C CA  1  
ATOM 4973   C C   . LEU A 1 677 ? -55.485  43.922  -59.526 1.00 30.00  ? 681 LEU C C   1  
ATOM 4974   O O   . LEU A 1 677 ? -55.031  43.457  -58.480 1.00 30.00  ? 681 LEU C O   1  
ATOM 4975   C CB  . LEU A 1 677 ? -53.921  45.739  -60.217 1.00 99.99  ? 681 LEU C CB  1  
ATOM 4976   C CG  . LEU A 1 677 ? -53.904  46.831  -61.281 1.00 99.99  ? 681 LEU C CG  1  
ATOM 4977   C CD1 . LEU A 1 677 ? -52.509  46.922  -61.891 1.00 99.99  ? 681 LEU C CD1 1  
ATOM 4978   C CD2 . LEU A 1 677 ? -54.916  46.491  -62.372 1.00 99.99  ? 681 LEU C CD2 1  
ATOM 4979   N N   . VAL A 1 678 ? -56.089  43.165  -60.437 1.00 30.00  ? 682 VAL C N   1  
ATOM 4980   C CA  . VAL A 1 678 ? -56.256  41.737  -60.203 1.00 30.00  ? 682 VAL C CA  1  
ATOM 4981   C C   . VAL A 1 678 ? -55.464  40.850  -61.149 1.00 30.00  ? 682 VAL C C   1  
ATOM 4982   O O   . VAL A 1 678 ? -55.257  41.186  -62.309 1.00 30.00  ? 682 VAL C O   1  
ATOM 4983   C CB  . VAL A 1 678 ? -57.723  41.355  -60.365 1.00 99.99  ? 682 VAL C CB  1  
ATOM 4984   C CG1 . VAL A 1 678 ? -58.567  42.131  -59.358 1.00 99.99  ? 682 VAL C CG1 1  
ATOM 4985   C CG2 . VAL A 1 678 ? -58.184  41.688  -61.779 1.00 99.99  ? 682 VAL C CG2 1  
ATOM 4986   N N   . ASP A 1 679 ? -55.015  39.718  -60.621 1.00 30.00  ? 683 ASP C N   1  
ATOM 4987   C CA  . ASP A 1 679 ? -54.258  38.709  -61.359 1.00 30.00  ? 683 ASP C CA  1  
ATOM 4988   C C   . ASP A 1 679 ? -55.105  37.454  -61.124 1.00 30.00  ? 683 ASP C C   1  
ATOM 4989   O O   . ASP A 1 679 ? -54.928  36.702  -60.140 1.00 30.00  ? 683 ASP C O   1  
ATOM 4990   C CB  . ASP A 1 679 ? -52.851  38.595  -60.785 1.00 99.99  ? 683 ASP C CB  1  
ATOM 4991   C CG  . ASP A 1 679 ? -51.992  37.732  -61.707 1.00 99.99  ? 683 ASP C CG  1  
ATOM 4992   O OD1 . ASP A 1 679 ? -52.123  36.481  -61.612 1.00 99.99  ? 683 ASP C OD1 1  
ATOM 4993   O OD2 . ASP A 1 679 ? -51.216  38.327  -62.501 1.00 99.99  ? 683 ASP C OD2 1  
ATOM 4994   N N   . ALA A 1 680 ? -56.037  37.258  -62.058 1.00 30.00  ? 684 ALA C N   1  
ATOM 4995   C CA  . ALA A 1 680 ? -56.976  36.146  -62.048 1.00 30.00  ? 684 ALA C CA  1  
ATOM 4996   C C   . ALA A 1 680 ? -56.381  34.782  -61.766 1.00 30.00  ? 684 ALA C C   1  
ATOM 4997   O O   . ALA A 1 680 ? -56.929  33.999  -60.981 1.00 30.00  ? 684 ALA C O   1  
ATOM 4998   C CB  . ALA A 1 680 ? -57.699  36.121  -63.366 1.00 30.00  ? 684 ALA C CB  1  
ATOM 4999   N N   . GLU A 1 681 ? -55.256  34.500  -62.408 1.00 30.00  ? 685 GLU C N   1  
ATOM 5000   C CA  . GLU A 1 681 ? -54.587  33.217  -62.243 1.00 30.00  ? 685 GLU C CA  1  
ATOM 5001   C C   . GLU A 1 681 ? -54.275  32.968  -60.786 1.00 30.00  ? 685 GLU C C   1  
ATOM 5002   O O   . GLU A 1 681 ? -54.616  31.905  -60.229 1.00 30.00  ? 685 GLU C O   1  
ATOM 5003   C CB  . GLU A 1 681 ? -53.284  33.206  -63.036 1.00 99.99  ? 685 GLU C CB  1  
ATOM 5004   C CG  . GLU A 1 681 ? -53.589  33.311  -64.510 1.00 99.99  ? 685 GLU C CG  1  
ATOM 5005   C CD  . GLU A 1 681 ? -54.189  31.997  -65.002 1.00 99.99  ? 685 GLU C CD  1  
ATOM 5006   O OE1 . GLU A 1 681 ? -55.443  31.879  -64.947 1.00 99.99  ? 685 GLU C OE1 1  
ATOM 5007   O OE2 . GLU A 1 681 ? -53.390  31.121  -65.427 1.00 99.99  ? 685 GLU C OE2 1  
ATOM 5008   N N   . LEU A 1 682 ? -53.627  33.965  -60.181 1.00 30.00  ? 686 LEU C N   1  
ATOM 5009   C CA  . LEU A 1 682 ? -53.227  33.931  -58.782 1.00 30.00  ? 686 LEU C CA  1  
ATOM 5010   C C   . LEU A 1 682 ? -54.460  33.823  -57.919 1.00 30.00  ? 686 LEU C C   1  
ATOM 5011   O O   . LEU A 1 682 ? -54.547  32.944  -57.043 1.00 30.00  ? 686 LEU C O   1  
ATOM 5012   C CB  . LEU A 1 682 ? -52.467  35.204  -58.428 1.00 99.99  ? 686 LEU C CB  1  
ATOM 5013   C CG  . LEU A 1 682 ? -50.969  34.961  -58.568 1.00 99.99  ? 686 LEU C CG  1  
ATOM 5014   C CD1 . LEU A 1 682 ? -50.203  36.104  -57.910 1.00 99.99  ? 686 LEU C CD1 1  
ATOM 5015   C CD2 . LEU A 1 682 ? -50.603  33.642  -57.893 1.00 99.99  ? 686 LEU C CD2 1  
ATOM 5016   N N   . VAL A 1 683 ? -55.417  34.710  -58.177 1.00 30.00  ? 687 VAL C N   1  
ATOM 5017   C CA  . VAL A 1 683 ? -56.654  34.699  -57.410 1.00 30.00  ? 687 VAL C CA  1  
ATOM 5018   C C   . VAL A 1 683 ? -57.287  33.312  -57.438 1.00 30.00  ? 687 VAL C C   1  
ATOM 5019   O O   . VAL A 1 683 ? -57.480  32.664  -56.382 1.00 30.00  ? 687 VAL C O   1  
ATOM 5020   C CB  . VAL A 1 683 ? -57.640  35.704  -58.000 1.00 99.99  ? 687 VAL C CB  1  
ATOM 5021   C CG1 . VAL A 1 683 ? -57.031  37.101  -57.953 1.00 99.99  ? 687 VAL C CG1 1  
ATOM 5022   C CG2 . VAL A 1 683 ? -57.942  35.329  -59.445 1.00 99.99  ? 687 VAL C CG2 1  
ATOM 5023   N N   . LEU A 1 684 ? -57.612  32.883  -58.671 1.00 30.00  ? 688 LEU C N   1  
ATOM 5024   C CA  . LEU A 1 684 ? -58.228  31.590  -58.950 1.00 30.00  ? 688 LEU C CA  1  
ATOM 5025   C C   . LEU A 1 684 ? -57.452  30.556  -58.189 1.00 30.00  ? 688 LEU C C   1  
ATOM 5026   O O   . LEU A 1 684 ? -58.023  29.733  -57.484 1.00 30.00  ? 688 LEU C O   1  
ATOM 5027   C CB  . LEU A 1 684 ? -58.177  31.302  -60.446 1.00 99.99  ? 688 LEU C CB  1  
ATOM 5028   C CG  . LEU A 1 684 ? -58.713  29.899  -60.713 1.00 99.99  ? 688 LEU C CG  1  
ATOM 5029   C CD1 . LEU A 1 684 ? -58.594  29.584  -62.201 1.00 99.99  ? 688 LEU C CD1 1  
ATOM 5030   C CD2 . LEU A 1 684 ? -57.905  28.886  -59.912 1.00 99.99  ? 688 LEU C CD2 1  
ATOM 5031   N N   . HIS A 1 685 ? -56.137  30.620  -58.339 1.00 30.00  ? 689 HIS C N   1  
ATOM 5032   C CA  . HIS A 1 685 ? -55.239  29.695  -57.667 1.00 30.00  ? 689 HIS C CA  1  
ATOM 5033   C C   . HIS A 1 685 ? -55.493  29.622  -56.153 1.00 30.00  ? 689 HIS C C   1  
ATOM 5034   O O   . HIS A 1 685 ? -55.367  28.557  -55.540 1.00 30.00  ? 689 HIS C O   1  
ATOM 5035   C CB  . HIS A 1 685 ? -53.793  30.132  -57.876 1.00 99.99  ? 689 HIS C CB  1  
ATOM 5036   C CG  . HIS A 1 685 ? -52.778  29.398  -57.037 1.00 99.99  ? 689 HIS C CG  1  
ATOM 5037   N ND1 . HIS A 1 685 ? -51.664  28.781  -57.600 1.00 99.99  ? 689 HIS C ND1 1  
ATOM 5038   C CD2 . HIS A 1 685 ? -52.700  29.183  -55.695 1.00 99.99  ? 689 HIS C CD2 1  
ATOM 5039   C CE1 . HIS A 1 685 ? -50.968  28.228  -56.625 1.00 99.99  ? 689 HIS C CE1 1  
ATOM 5040   N NE2 . HIS A 1 685 ? -51.571  28.456  -55.485 1.00 99.99  ? 689 HIS C NE2 1  
ATOM 5041   N N   . GLN A 1 686 ? -55.854  30.743  -55.536 1.00 30.00  ? 690 GLN C N   1  
ATOM 5042   C CA  . GLN A 1 686 ? -56.086  30.711  -54.101 1.00 30.00  ? 690 GLN C CA  1  
ATOM 5043   C C   . GLN A 1 686 ? -57.435  30.129  -53.836 1.00 30.00  ? 690 GLN C C   1  
ATOM 5044   O O   . GLN A 1 686 ? -57.597  29.295  -52.938 1.00 30.00  ? 690 GLN C O   1  
ATOM 5045   C CB  . GLN A 1 686 ? -56.023  32.122  -53.533 1.00 99.99  ? 690 GLN C CB  1  
ATOM 5046   C CG  . GLN A 1 686 ? -55.668  32.063  -52.050 1.00 99.99  ? 690 GLN C CG  1  
ATOM 5047   C CD  . GLN A 1 686 ? -56.911  31.847  -51.199 1.00 99.99  ? 690 GLN C CD  1  
ATOM 5048   O OE1 . GLN A 1 686 ? -58.020  31.750  -51.725 1.00 99.99  ? 690 GLN C OE1 1  
ATOM 5049   N NE2 . GLN A 1 686 ? -56.728  31.776  -49.878 1.00 99.99  ? 690 GLN C NE2 1  
ATOM 5050   N N   . LEU A 1 687 ? -58.410  30.562  -54.623 1.00 30.00  ? 691 LEU C N   1  
ATOM 5051   C CA  . LEU A 1 687 ? -59.767  30.060  -54.477 1.00 30.00  ? 691 LEU C CA  1  
ATOM 5052   C C   . LEU A 1 687 ? -59.728  28.539  -54.535 1.00 30.00  ? 691 LEU C C   1  
ATOM 5053   O O   . LEU A 1 687 ? -60.411  27.866  -53.758 1.00 30.00  ? 691 LEU C O   1  
ATOM 5054   C CB  . LEU A 1 687 ? -60.643  30.600  -55.601 1.00 99.99  ? 691 LEU C CB  1  
ATOM 5055   C CG  . LEU A 1 687 ? -61.360  31.862  -55.129 1.00 99.99  ? 691 LEU C CG  1  
ATOM 5056   C CD1 . LEU A 1 687 ? -62.470  32.211  -56.113 1.00 99.99  ? 691 LEU C CD1 1  
ATOM 5057   C CD2 . LEU A 1 687 ? -61.959  31.618  -53.748 1.00 99.99  ? 691 LEU C CD2 1  
ATOM 5058   N N   . GLN A 1 688 ? -58.346  27.848  -54.765 1.00 30.00  ? 692 GLN C N   1  
ATOM 5059   C CA  . GLN A 1 688 ? -58.196  26.416  -54.991 1.00 30.00  ? 692 GLN C CA  1  
ATOM 5060   C C   . GLN A 1 688 ? -57.555  25.708  -53.789 1.00 30.00  ? 692 GLN C C   1  
ATOM 5061   O O   . GLN A 1 688 ? -58.130  24.783  -53.220 1.00 30.00  ? 692 GLN C O   1  
ATOM 5062   C CB  . GLN A 1 688 ? -57.312  26.171  -56.207 1.00 99.99  ? 692 GLN C CB  1  
ATOM 5063   C CG  . GLN A 1 688 ? -57.621  24.799  -56.797 1.00 99.99  ? 692 GLN C CG  1  
ATOM 5064   C CD  . GLN A 1 688 ? -56.830  23.709  -56.087 1.00 99.99  ? 692 GLN C CD  1  
ATOM 5065   O OE1 . GLN A 1 688 ? -56.064  23.991  -55.168 1.00 99.99  ? 692 GLN C OE1 1  
ATOM 5066   N NE2 . GLN A 1 688 ? -57.019  22.458  -56.518 1.00 99.99  ? 692 GLN C NE2 1  
ATOM 5067   N N   . CYS A 1 689 ? -56.366  26.156  -53.405 1.00 30.00  ? 693 CYS C N   1  
ATOM 5068   C CA  . CYS A 1 689 ? -55.632  25.563  -52.288 1.00 30.00  ? 693 CYS C CA  1  
ATOM 5069   C C   . CYS A 1 689 ? -56.228  25.872  -50.913 1.00 30.00  ? 693 CYS C C   1  
ATOM 5070   O O   . CYS A 1 689 ? -55.812  25.287  -49.906 1.00 30.00  ? 693 CYS C O   1  
ATOM 5071   C CB  . CYS A 1 689 ? -54.198  26.083  -52.276 1.00 99.99  ? 693 CYS C CB  1  
ATOM 5072   S SG  . CYS A 1 689 ? -53.108  25.434  -53.568 1.00 99.99  ? 693 CYS C SG  1  
ATOM 5073   N N   . ASN A 1 690 ? -57.208  26.781  -50.874 1.00 30.00  ? 694 ASN C N   1  
ATOM 5074   C CA  . ASN A 1 690 ? -57.857  27.196  -49.627 1.00 30.00  ? 694 ASN C CA  1  
ATOM 5075   C C   . ASN A 1 690 ? -59.147  26.444  -49.348 1.00 30.00  ? 694 ASN C C   1  
ATOM 5076   O O   . ASN A 1 690 ? -59.661  26.454  -48.232 1.00 30.00  ? 694 ASN C O   1  
ATOM 5077   C CB  . ASN A 1 690 ? -58.192  28.681  -49.688 1.00 99.99  ? 694 ASN C CB  1  
ATOM 5078   C CG  . ASN A 1 690 ? -59.174  28.977  -50.814 1.00 99.99  ? 694 ASN C CG  1  
ATOM 5079   O OD1 . ASN A 1 690 ? -59.746  30.064  -50.873 1.00 99.99  ? 694 ASN C OD1 1  
ATOM 5080   N ND2 . ASN A 1 690 ? -59.369  28.004  -51.706 1.00 99.99  ? 694 ASN C ND2 1  
ATOM 5081   N N   . GLY A 1 691 ? -59.663  25.788  -50.382 1.00 30.00  ? 695 GLY C N   1  
ATOM 5082   C CA  . GLY A 1 691 ? -60.879  25.008  -50.244 1.00 30.00  ? 695 GLY C CA  1  
ATOM 5083   C C   . GLY A 1 691 ? -62.173  25.795  -50.231 1.00 30.00  ? 695 GLY C C   1  
ATOM 5084   O O   . GLY A 1 691 ? -63.167  25.349  -49.665 1.00 30.00  ? 695 GLY C O   1  
ATOM 5085   N N   . VAL A 1 692 ? -62.175  26.957  -50.879 1.00 30.00  ? 696 VAL C N   1  
ATOM 5086   C CA  . VAL A 1 692 ? -63.372  27.800  -50.906 1.00 30.00  ? 696 VAL C CA  1  
ATOM 5087   C C   . VAL A 1 692 ? -64.585  27.093  -51.453 1.00 30.00  ? 696 VAL C C   1  
ATOM 5088   O O   . VAL A 1 692 ? -65.541  26.869  -50.732 1.00 30.00  ? 696 VAL C O   1  
ATOM 5089   C CB  . VAL A 1 692 ? -63.124  29.025  -51.780 1.00 99.99  ? 696 VAL C CB  1  
ATOM 5090   C CG1 . VAL A 1 692 ? -61.955  29.827  -51.214 1.00 99.99  ? 696 VAL C CG1 1  
ATOM 5091   C CG2 . VAL A 1 692 ? -62.793  28.576  -53.199 1.00 99.99  ? 696 VAL C CG2 1  
ATOM 5092   N N   . LEU A 1 693 ? -64.553  26.731  -52.722 1.00 30.00  ? 697 LEU C N   1  
ATOM 5093   C CA  . LEU A 1 693 ? -65.693  26.062  -53.314 1.00 30.00  ? 697 LEU C CA  1  
ATOM 5094   C C   . LEU A 1 693 ? -66.290  24.978  -52.425 1.00 30.00  ? 697 LEU C C   1  
ATOM 5095   O O   . LEU A 1 693 ? -67.463  25.053  -52.065 1.00 30.00  ? 697 LEU C O   1  
ATOM 5096   C CB  . LEU A 1 693 ? -65.286  25.400  -54.624 1.00 99.99  ? 697 LEU C CB  1  
ATOM 5097   C CG  . LEU A 1 693 ? -66.458  24.600  -55.177 1.00 99.99  ? 697 LEU C CG  1  
ATOM 5098   C CD1 . LEU A 1 693 ? -66.025  23.877  -56.449 1.00 99.99  ? 697 LEU C CD1 1  
ATOM 5099   C CD2 . LEU A 1 693 ? -66.912  23.577  -54.142 1.00 99.99  ? 697 LEU C CD2 1  
ATOM 5100   N N   . GLU A 1 694 ? -65.482  23.973  -52.091 1.00 30.00  ? 698 GLU C N   1  
ATOM 5101   C CA  . GLU A 1 694 ? -65.922  22.869  -51.249 1.00 30.00  ? 698 GLU C CA  1  
ATOM 5102   C C   . GLU A 1 694 ? -66.471  23.482  -49.993 1.00 30.00  ? 698 GLU C C   1  
ATOM 5103   O O   . GLU A 1 694 ? -67.542  23.117  -49.531 1.00 30.00  ? 698 GLU C O   1  
ATOM 5104   C CB  . GLU A 1 694 ? -64.742  21.954  -50.935 1.00 99.99  ? 698 GLU C CB  1  
ATOM 5105   C CG  . GLU A 1 694 ? -64.247  21.311  -52.207 1.00 99.99  ? 698 GLU C CG  1  
ATOM 5106   C CD  . GLU A 1 694 ? -65.257  20.265  -52.674 1.00 99.99  ? 698 GLU C CD  1  
ATOM 5107   O OE1 . GLU A 1 694 ? -66.170  20.649  -53.450 1.00 99.99  ? 698 GLU C OE1 1  
ATOM 5108   O OE2 . GLU A 1 694 ? -65.104  19.086  -52.248 1.00 99.99  ? 698 GLU C OE2 1  
ATOM 5109   N N   . GLY A 1 695 ? -65.730  24.439  -49.459 1.00 30.00  ? 699 GLY C N   1  
ATOM 5110   C CA  . GLY A 1 695 ? -66.166  25.114  -48.257 1.00 30.00  ? 699 GLY C CA  1  
ATOM 5111   C C   . GLY A 1 695 ? -67.575  25.654  -48.399 1.00 30.00  ? 699 GLY C C   1  
ATOM 5112   O O   . GLY A 1 695 ? -68.241  25.979  -47.413 1.00 30.00  ? 699 GLY C O   1  
ATOM 5113   N N   . ILE A 1 696 ? -68.052  25.741  -49.633 1.00 30.00  ? 700 ILE C N   1  
ATOM 5114   C CA  . ILE A 1 696 ? -69.390  26.255  -49.867 1.00 30.00  ? 700 ILE C CA  1  
ATOM 5115   C C   . ILE A 1 696 ? -70.398  25.143  -50.195 1.00 30.00  ? 700 ILE C C   1  
ATOM 5116   O O   . ILE A 1 696 ? -71.579  25.239  -49.829 1.00 30.00  ? 700 ILE C O   1  
ATOM 5117   C CB  . ILE A 1 696 ? -69.373  27.229  -51.042 1.00 99.99  ? 700 ILE C CB  1  
ATOM 5118   C CG1 . ILE A 1 696 ? -68.238  28.230  -50.854 1.00 99.99  ? 700 ILE C CG1 1  
ATOM 5119   C CG2 . ILE A 1 696 ? -70.701  27.975  -51.102 1.00 99.99  ? 700 ILE C CG2 1  
ATOM 5120   C CD1 . ILE A 1 696 ? -68.589  29.191  -49.721 1.00 99.99  ? 700 ILE C CD1 1  
ATOM 5121   N N   . ARG A 1 697 ? -69.924  24.088  -50.864 1.00 30.00  ? 701 ARG C N   1  
ATOM 5122   C CA  . ARG A 1 697 ? -70.792  22.978  -51.243 1.00 30.00  ? 701 ARG C CA  1  
ATOM 5123   C C   . ARG A 1 697 ? -71.583  22.452  -50.046 1.00 30.00  ? 701 ARG C C   1  
ATOM 5124   O O   . ARG A 1 697 ? -72.805  22.372  -50.104 1.00 30.00  ? 701 ARG C O   1  
ATOM 5125   C CB  . ARG A 1 697 ? -69.958  21.835  -51.807 1.00 99.99  ? 701 ARG C CB  1  
ATOM 5126   C CG  . ARG A 1 697 ? -70.786  21.044  -52.813 1.00 99.99  ? 701 ARG C CG  1  
ATOM 5127   C CD  . ARG A 1 697 ? -69.880  20.098  -53.592 1.00 99.99  ? 701 ARG C CD  1  
ATOM 5128   N NE  . ARG A 1 697 ? -70.541  19.622  -54.826 1.00 99.99  ? 701 ARG C NE  1  
ATOM 5129   C CZ  . ARG A 1 697 ? -69.914  18.911  -55.758 1.00 99.99  ? 701 ARG C CZ  1  
ATOM 5130   N NH1 . ARG A 1 697 ? -68.628  18.577  -55.644 1.00 99.99  ? 701 ARG C NH1 1  
ATOM 5131   N NH2 . ARG A 1 697 ? -70.606  18.533  -56.829 1.00 99.99  ? 701 ARG C NH2 1  
ATOM 5132   N N   . ILE A 1 698 ? -70.880  22.114  -48.961 1.00 30.00  ? 702 ILE C N   1  
ATOM 5133   C CA  . ILE A 1 698 ? -71.531  21.601  -47.757 1.00 30.00  ? 702 ILE C CA  1  
ATOM 5134   C C   . ILE A 1 698 ? -72.534  22.599  -47.163 1.00 30.00  ? 702 ILE C C   1  
ATOM 5135   O O   . ILE A 1 698 ? -73.561  22.186  -46.603 1.00 30.00  ? 702 ILE C O   1  
ATOM 5136   C CB  . ILE A 1 698 ? -70.484  21.302  -46.689 1.00 99.99  ? 702 ILE C CB  1  
ATOM 5137   C CG1 . ILE A 1 698 ? -70.110  22.591  -45.967 1.00 99.99  ? 702 ILE C CG1 1  
ATOM 5138   C CG2 . ILE A 1 698 ? -69.242  20.710  -47.348 1.00 99.99  ? 702 ILE C CG2 1  
ATOM 5139   C CD1 . ILE A 1 698 ? -68.893  23.219  -46.640 1.00 99.99  ? 702 ILE C CD1 1  
ATOM 5140   N N   . CYS A 1 699 ? -72.266  23.904  -47.277 1.00 30.00  ? 703 CYS C N   1  
ATOM 5141   C CA  . CYS A 1 699 ? -73.215  24.893  -46.754 1.00 30.00  ? 703 CYS C CA  1  
ATOM 5142   C C   . CYS A 1 699 ? -74.520  24.791  -47.546 1.00 30.00  ? 703 CYS C C   1  
ATOM 5143   O O   . CYS A 1 699 ? -75.601  25.040  -47.025 1.00 30.00  ? 703 CYS C O   1  
ATOM 5144   C CB  . CYS A 1 699 ? -72.636  26.297  -46.897 1.00 99.99  ? 703 CYS C CB  1  
ATOM 5145   S SG  . CYS A 1 699 ? -72.409  26.893  -48.592 1.00 99.99  ? 703 CYS C SG  1  
ATOM 5146   N N   . ARG A 1 700 ? -74.396  24.420  -48.816 1.00 30.00  ? 704 ARG C N   1  
ATOM 5147   C CA  . ARG A 1 700 ? -75.554  24.255  -49.659 1.00 30.00  ? 704 ARG C CA  1  
ATOM 5148   C C   . ARG A 1 700 ? -76.001  22.797  -49.556 1.00 30.00  ? 704 ARG C C   1  
ATOM 5149   O O   . ARG A 1 700 ? -77.197  22.518  -49.394 1.00 30.00  ? 704 ARG C O   1  
ATOM 5150   C CB  . ARG A 1 700 ? -75.196  24.596  -51.102 1.00 99.99  ? 704 ARG C CB  1  
ATOM 5151   C CG  . ARG A 1 700 ? -76.456  24.566  -51.961 1.00 99.99  ? 704 ARG C CG  1  
ATOM 5152   C CD  . ARG A 1 700 ? -76.147  25.140  -53.338 1.00 99.99  ? 704 ARG C CD  1  
ATOM 5153   N NE  . ARG A 1 700 ? -75.074  24.372  -54.007 1.00 99.99  ? 704 ARG C NE  1  
ATOM 5154   C CZ  . ARG A 1 700 ? -74.191  24.926  -54.831 1.00 99.99  ? 704 ARG C CZ  1  
ATOM 5155   N NH1 . ARG A 1 700 ? -74.211  26.229  -55.113 1.00 99.99  ? 704 ARG C NH1 1  
ATOM 5156   N NH2 . ARG A 1 700 ? -73.266  24.142  -55.378 1.00 99.99  ? 704 ARG C NH2 1  
ATOM 5157   N N   . LYS A 1 701 ? -75.044  21.877  -49.622 1.00 30.00  ? 705 LYS C N   1  
ATOM 5158   C CA  . LYS A 1 701 ? -75.330  20.460  -49.541 1.00 30.00  ? 705 LYS C CA  1  
ATOM 5159   C C   . LYS A 1 701 ? -75.912  19.999  -48.207 1.00 30.00  ? 705 LYS C C   1  
ATOM 5160   O O   . LYS A 1 701 ? -77.041  19.509  -48.150 1.00 30.00  ? 705 LYS C O   1  
ATOM 5161   C CB  . LYS A 1 701 ? -74.052  19.658  -49.758 1.00 99.99  ? 705 LYS C CB  1  
ATOM 5162   C CG  . LYS A 1 701 ? -73.921  19.299  -51.231 1.00 99.99  ? 705 LYS C CG  1  
ATOM 5163   C CD  . LYS A 1 701 ? -73.471  20.527  -52.017 1.00 99.99  ? 705 LYS C CD  1  
ATOM 5164   C CE  . LYS A 1 701 ? -73.530  20.224  -53.511 1.00 99.99  ? 705 LYS C CE  1  
ATOM 5165   N NZ  . LYS A 1 701 ? -73.213  21.443  -54.270 1.00 99.99  ? 705 LYS C NZ  1  
ATOM 5166   N N   . GLY A 1 702 ? -75.507  20.020  -47.239 1.00 30.00  ? 706 GLY C N   1  
ATOM 5167   C CA  . GLY A 1 702 ? -75.563  19.715  -45.817 1.00 30.00  ? 706 GLY C CA  1  
ATOM 5168   C C   . GLY A 1 702 ? -76.524  18.633  -45.379 1.00 30.00  ? 706 GLY C C   1  
ATOM 5169   O O   . GLY A 1 702 ? -76.975  17.851  -46.190 1.00 30.00  ? 706 GLY C O   1  
ATOM 5170   N N   . PHE A 1 703 ? -76.840  18.602  -44.085 1.00 30.00  ? 707 PHE C N   1  
ATOM 5171   C CA  . PHE A 1 703 ? -77.728  17.599  -43.523 1.00 30.00  ? 707 PHE C CA  1  
ATOM 5172   C C   . PHE A 1 703 ? -78.916  18.266  -42.851 1.00 30.00  ? 707 PHE C C   1  
ATOM 5173   O O   . PHE A 1 703 ? -78.940  18.384  -41.638 1.00 30.00  ? 707 PHE C O   1  
ATOM 5174   C CB  . PHE A 1 703 ? -76.978  16.766  -42.489 1.00 99.99  ? 707 PHE C CB  1  
ATOM 5175   C CG  . PHE A 1 703 ? -75.861  16.011  -43.164 1.00 99.99  ? 707 PHE C CG  1  
ATOM 5176   C CD1 . PHE A 1 703 ? -74.597  16.598  -43.296 1.00 99.99  ? 707 PHE C CD1 1  
ATOM 5177   C CD2 . PHE A 1 703 ? -76.087  14.720  -43.661 1.00 99.99  ? 707 PHE C CD2 1  
ATOM 5178   C CE1 . PHE A 1 703 ? -73.559  15.897  -43.924 1.00 99.99  ? 707 PHE C CE1 1  
ATOM 5179   C CE2 . PHE A 1 703 ? -75.051  14.017  -44.289 1.00 99.99  ? 707 PHE C CE2 1  
ATOM 5180   C CZ  . PHE A 1 703 ? -73.789  14.606  -44.419 1.00 99.99  ? 707 PHE C CZ  1  
ATOM 5181   N N   . PRO A 1 704 ? -79.949  18.656  -43.623 1.00 30.00  ? 708 PRO C N   1  
ATOM 5182   C CA  . PRO A 1 704 ? -81.158  19.335  -43.139 1.00 30.00  ? 708 PRO C CA  1  
ATOM 5183   C C   . PRO A 1 704 ? -82.048  18.620  -42.162 1.00 30.00  ? 708 PRO C C   1  
ATOM 5184   O O   . PRO A 1 704 ? -83.090  19.151  -41.770 1.00 30.00  ? 708 PRO C O   1  
ATOM 5185   C CB  . PRO A 1 704 ? -81.854  19.495  -44.444 1.00 99.99  ? 708 PRO C CB  1  
ATOM 5186   C CG  . PRO A 1 704 ? -80.917  18.933  -45.488 1.00 99.99  ? 708 PRO C CG  1  
ATOM 5187   C CD  . PRO A 1 704 ? -79.815  18.503  -45.009 1.00 99.99  ? 708 PRO C CD  1  
ATOM 5188   N N   . SER A 1 705 ? -81.648  17.418  -41.771 1.00 30.00  ? 709 SER C N   1  
ATOM 5189   C CA  . SER A 1 705 ? -82.422  16.640  -40.812 1.00 30.00  ? 709 SER C CA  1  
ATOM 5190   C C   . SER A 1 705 ? -81.529  16.242  -39.672 1.00 30.00  ? 709 SER C C   1  
ATOM 5191   O O   . SER A 1 705 ? -80.400  15.804  -39.884 1.00 30.00  ? 709 SER C O   1  
ATOM 5192   C CB  . SER A 1 705 ? -82.977  15.389  -41.487 1.00 99.99  ? 709 SER C CB  1  
ATOM 5193   O OG  . SER A 1 705 ? -83.802  15.770  -42.588 1.00 99.99  ? 709 SER C OG  1  
ATOM 5194   N N   . ARG A 1 706 ? -83.323  16.578  -39.026 1.00 30.00  ? 710 ARG C N   1  
ATOM 5195   C CA  . ARG A 1 706 ? -82.935  16.618  -37.618 1.00 30.00  ? 710 ARG C CA  1  
ATOM 5196   C C   . ARG A 1 706 ? -84.024  16.025  -36.759 1.00 30.00  ? 710 ARG C C   1  
ATOM 5197   O O   . ARG A 1 706 ? -85.201  16.381  -36.906 1.00 30.00  ? 710 ARG C O   1  
ATOM 5198   C CB  . ARG A 1 706 ? -82.698  18.062  -37.188 1.00 99.99  ? 710 ARG C CB  1  
ATOM 5199   C CG  . ARG A 1 706 ? -81.709  18.724  -38.141 1.00 99.99  ? 710 ARG C CG  1  
ATOM 5200   C CD  . ARG A 1 706 ? -81.416  20.141  -37.671 1.00 99.99  ? 710 ARG C CD  1  
ATOM 5201   N NE  . ARG A 1 706 ? -80.634  20.888  -38.683 1.00 99.99  ? 710 ARG C NE  1  
ATOM 5202   C CZ  . ARG A 1 706 ? -80.329  22.176  -38.557 1.00 99.99  ? 710 ARG C CZ  1  
ATOM 5203   N NH1 . ARG A 1 706 ? -80.713  22.893  -37.505 1.00 99.99  ? 710 ARG C NH1 1  
ATOM 5204   N NH2 . ARG A 1 706 ? -79.619  22.747  -39.528 1.00 99.99  ? 710 ARG C NH2 1  
ATOM 5205   N N   . LEU A 1 707 ? -83.631  15.133  -35.854 1.00 30.00  ? 711 LEU C N   1  
ATOM 5206   C CA  . LEU A 1 707 ? -84.600  14.486  -34.985 1.00 30.00  ? 711 LEU C CA  1  
ATOM 5207   C C   . LEU A 1 707 ? -84.195  14.274  -33.533 1.00 30.00  ? 711 LEU C C   1  
ATOM 5208   O O   . LEU A 1 707 ? -83.093  13.790  -33.246 1.00 30.00  ? 711 LEU C O   1  
ATOM 5209   C CB  . LEU A 1 707 ? -84.926  13.095  -35.521 1.00 99.99  ? 711 LEU C CB  1  
ATOM 5210   C CG  . LEU A 1 707 ? -86.176  13.164  -36.392 1.00 99.99  ? 711 LEU C CG  1  
ATOM 5211   C CD1 . LEU A 1 707 ? -86.694  11.752  -36.654 1.00 99.99  ? 711 LEU C CD1 1  
ATOM 5212   C CD2 . LEU A 1 707 ? -87.252  13.973  -35.677 1.00 99.99  ? 711 LEU C CD2 1  
ATOM 5213   N N   . ILE A 1 708 ? -85.095  14.632  -32.618 1.00 30.00  ? 712 ILE C N   1  
ATOM 5214   C CA  . ILE A 1 708 ? -84.819  14.445  -31.197 1.00 30.00  ? 712 ILE C CA  1  
ATOM 5215   C C   . ILE A 1 708 ? -84.990  12.970  -30.931 1.00 30.00  ? 712 ILE C C   1  
ATOM 5216   O O   . ILE A 1 708 ? -86.052  12.394  -31.209 1.00 30.00  ? 712 ILE C O   1  
ATOM 5217   C CB  . ILE A 1 708 ? -85.798  15.269  -30.367 1.00 99.99  ? 712 ILE C CB  1  
ATOM 5218   C CG1 . ILE A 1 708 ? -87.116  14.513  -30.235 1.00 99.99  ? 712 ILE C CG1 1  
ATOM 5219   C CG2 . ILE A 1 708 ? -86.047  16.608  -31.053 1.00 99.99  ? 712 ILE C CG2 1  
ATOM 5220   C CD1 . ILE A 1 708 ? -88.066  14.949  -31.345 1.00 99.99  ? 712 ILE C CD1 1  
ATOM 5221   N N   . TYR A 1 709 ? -83.946  12.352  -30.398 1.00 30.00  ? 713 TYR C N   1  
ATOM 5222   C CA  . TYR A 1 709 ? -83.968  10.941  -30.080 1.00 30.00  ? 713 TYR C CA  1  
ATOM 5223   C C   . TYR A 1 709 ? -85.295  10.474  -29.452 1.00 30.00  ? 713 TYR C C   1  
ATOM 5224   O O   . TYR A 1 709 ? -85.734  9.352   -29.696 1.00 30.00  ? 713 TYR C O   1  
ATOM 5225   C CB  . TYR A 1 709 ? -82.856  10.616  -29.084 1.00 99.99  ? 713 TYR C CB  1  
ATOM 5226   C CG  . TYR A 1 709 ? -81.514  10.887  -29.719 1.00 99.99  ? 713 TYR C CG  1  
ATOM 5227   C CD1 . TYR A 1 709 ? -80.936  12.157  -29.625 1.00 99.99  ? 713 TYR C CD1 1  
ATOM 5228   C CD2 . TYR A 1 709 ? -80.846  9.863   -30.404 1.00 99.99  ? 713 TYR C CD2 1  
ATOM 5229   C CE1 . TYR A 1 709 ? -79.693  12.408  -30.215 1.00 99.99  ? 713 TYR C CE1 1  
ATOM 5230   C CE2 . TYR A 1 709 ? -79.603  10.113  -30.995 1.00 99.99  ? 713 TYR C CE2 1  
ATOM 5231   C CZ  . TYR A 1 709 ? -79.024  11.384  -30.900 1.00 99.99  ? 713 TYR C CZ  1  
ATOM 5232   O OH  . TYR A 1 709 ? -77.816  11.629  -31.472 1.00 99.99  ? 713 TYR C OH  1  
ATOM 5233   N N   . SER A 1 710 ? -85.932  11.329  -28.657 1.00 30.00  ? 714 SER C N   1  
ATOM 5234   C CA  . SER A 1 710 ? -87.204  10.986  -28.020 1.00 30.00  ? 714 SER C CA  1  
ATOM 5235   C C   . SER A 1 710 ? -88.291  10.694  -29.052 1.00 30.00  ? 714 SER C C   1  
ATOM 5236   O O   . SER A 1 710 ? -89.041  9.728   -28.920 1.00 30.00  ? 714 SER C O   1  
ATOM 5237   C CB  . SER A 1 710 ? -87.677  12.142  -27.147 1.00 99.99  ? 714 SER C CB  1  
ATOM 5238   O OG  . SER A 1 710 ? -88.033  13.250  -27.976 1.00 99.99  ? 714 SER C OG  1  
ATOM 5239   N N   . GLU A 1 711 ? -88.381  11.537  -30.077 1.00 30.00  ? 715 GLU C N   1  
ATOM 5240   C CA  . GLU A 1 711 ? -89.385  11.355  -31.118 1.00 30.00  ? 715 GLU C CA  1  
ATOM 5241   C C   . GLU A 1 711 ? -88.896  10.353  -32.168 1.00 30.00  ? 715 GLU C C   1  
ATOM 5242   O O   . GLU A 1 711 ? -89.692  9.820   -32.930 1.00 30.00  ? 715 GLU C O   1  
ATOM 5243   C CB  . GLU A 1 711 ? -89.667  12.688  -31.806 1.00 99.99  ? 715 GLU C CB  1  
ATOM 5244   C CG  . GLU A 1 711 ? -90.249  13.658  -30.809 1.00 99.99  ? 715 GLU C CG  1  
ATOM 5245   C CD  . GLU A 1 711 ? -91.671  13.233  -30.456 1.00 99.99  ? 715 GLU C CD  1  
ATOM 5246   O OE1 . GLU A 1 711 ? -91.814  12.446  -29.484 1.00 99.99  ? 715 GLU C OE1 1  
ATOM 5247   O OE2 . GLU A 1 711 ? -92.605  13.703  -31.162 1.00 99.99  ? 715 GLU C OE2 1  
ATOM 5248   N N   . PHE A 1 712 ? -87.591  10.101  -32.202 1.00 30.00  ? 716 PHE C N   1  
ATOM 5249   C CA  . PHE A 1 712 ? -87.022  9.157   -33.163 1.00 30.00  ? 716 PHE C CA  1  
ATOM 5250   C C   . PHE A 1 712 ? -87.218  7.724   -32.709 1.00 30.00  ? 716 PHE C C   1  
ATOM 5251   O O   . PHE A 1 712 ? -87.572  6.859   -33.502 1.00 30.00  ? 716 PHE C O   1  
ATOM 5252   C CB  . PHE A 1 712 ? -85.525  9.413   -33.317 1.00 99.99  ? 716 PHE C CB  1  
ATOM 5253   C CG  . PHE A 1 712 ? -84.947  8.437   -34.312 1.00 99.99  ? 716 PHE C CG  1  
ATOM 5254   C CD1 . PHE A 1 712 ? -85.038  8.701   -35.683 1.00 99.99  ? 716 PHE C CD1 1  
ATOM 5255   C CD2 . PHE A 1 712 ? -84.321  7.268   -33.864 1.00 99.99  ? 716 PHE C CD2 1  
ATOM 5256   C CE1 . PHE A 1 712 ? -84.501  7.796   -36.607 1.00 99.99  ? 716 PHE C CE1 1  
ATOM 5257   C CE2 . PHE A 1 712 ? -83.784  6.362   -34.786 1.00 99.99  ? 716 PHE C CE2 1  
ATOM 5258   C CZ  . PHE A 1 712 ? -83.874  6.628   -36.159 1.00 99.99  ? 716 PHE C CZ  1  
ATOM 5259   N N   . LYS A 1 713 ? -86.956  7.483   -31.431 1.00 30.00  ? 717 LYS C N   1  
ATOM 5260   C CA  . LYS A 1 713 ? -87.116  6.150   -30.886 1.00 30.00  ? 717 LYS C CA  1  
ATOM 5261   C C   . LYS A 1 713 ? -88.571  5.743   -31.075 1.00 30.00  ? 717 LYS C C   1  
ATOM 5262   O O   . LYS A 1 713 ? -88.850  4.642   -31.544 1.00 30.00  ? 717 LYS C O   1  
ATOM 5263   C CB  . LYS A 1 713 ? -86.756  6.150   -29.405 1.00 99.99  ? 717 LYS C CB  1  
ATOM 5264   C CG  . LYS A 1 713 ? -86.831  4.727   -28.864 1.00 99.99  ? 717 LYS C CG  1  
ATOM 5265   C CD  . LYS A 1 713 ? -86.064  4.641   -27.548 1.00 99.99  ? 717 LYS C CD  1  
ATOM 5266   C CE  . LYS A 1 713 ? -86.439  3.352   -26.823 1.00 99.99  ? 717 LYS C CE  1  
ATOM 5267   N NZ  . LYS A 1 713 ? -85.469  2.300   -27.164 1.00 99.99  ? 717 LYS C NZ  1  
ATOM 5268   N N   . GLN A 1 714 ? -89.499  6.636   -30.728 1.00 30.00  ? 718 GLN C N   1  
ATOM 5269   C CA  . GLN A 1 714 ? -90.917  6.327   -30.866 1.00 30.00  ? 718 GLN C CA  1  
ATOM 5270   C C   . GLN A 1 714 ? -91.380  5.995   -32.268 1.00 30.00  ? 718 GLN C C   1  
ATOM 5271   O O   . GLN A 1 714 ? -92.320  5.225   -32.466 1.00 30.00  ? 718 GLN C O   1  
ATOM 5272   C CB  . GLN A 1 714 ? -91.756  7.517   -30.411 1.00 99.99  ? 718 GLN C CB  1  
ATOM 5273   C CG  . GLN A 1 714 ? -93.137  7.037   -29.985 1.00 99.99  ? 718 GLN C CG  1  
ATOM 5274   C CD  . GLN A 1 714 ? -94.069  6.925   -31.184 1.00 99.99  ? 718 GLN C CD  1  
ATOM 5275   O OE1 . GLN A 1 714 ? -93.670  7.205   -32.312 1.00 99.99  ? 718 GLN C OE1 1  
ATOM 5276   N NE2 . GLN A 1 714 ? -95.315  6.512   -30.936 1.00 99.99  ? 718 GLN C NE2 1  
ATOM 5277   N N   . ARG A 1 715 ? -90.732  6.578   -33.260 1.00 30.00  ? 719 ARG C N   1  
ATOM 5278   C CA  . ARG A 1 715 ? -91.137  6.324   -34.620 1.00 30.00  ? 719 ARG C CA  1  
ATOM 5279   C C   . ARG A 1 715 ? -90.317  5.263   -35.365 1.00 30.00  ? 719 ARG C C   1  
ATOM 5280   O O   . ARG A 1 715 ? -90.815  4.667   -36.313 1.00 30.00  ? 719 ARG C O   1  
ATOM 5281   C CB  . ARG A 1 715 ? -91.029  7.601   -35.444 1.00 99.99  ? 719 ARG C CB  1  
ATOM 5282   C CG  . ARG A 1 715 ? -91.951  8.666   -34.857 1.00 99.99  ? 719 ARG C CG  1  
ATOM 5283   C CD  . ARG A 1 715 ? -91.749  9.981   -35.603 1.00 99.99  ? 719 ARG C CD  1  
ATOM 5284   N NE  . ARG A 1 715 ? -90.480  10.629  -35.201 1.00 99.99  ? 719 ARG C NE  1  
ATOM 5285   C CZ  . ARG A 1 715 ? -90.032  11.749  -35.759 1.00 99.99  ? 719 ARG C CZ  1  
ATOM 5286   N NH1 . ARG A 1 715 ? -90.699  12.371  -36.728 1.00 99.99  ? 719 ARG C NH1 1  
ATOM 5287   N NH2 . ARG A 1 715 ? -88.877  12.247  -35.322 1.00 99.99  ? 719 ARG C NH2 1  
ATOM 5288   N N   . TYR A 1 716 ? -89.083  5.005   -34.951 1.00 30.00  ? 720 TYR C N   1  
ATOM 5289   C CA  . TYR A 1 716 ? -88.292  4.010   -35.667 1.00 30.00  ? 720 TYR C CA  1  
ATOM 5290   C C   . TYR A 1 716 ? -87.714  2.858   -34.852 1.00 30.00  ? 720 TYR C C   1  
ATOM 5291   O O   . TYR A 1 716 ? -86.640  2.333   -35.170 1.00 30.00  ? 720 TYR C O   1  
ATOM 5292   C CB  . TYR A 1 716 ? -87.089  4.677   -36.325 1.00 99.99  ? 720 TYR C CB  1  
ATOM 5293   C CG  . TYR A 1 716 ? -87.548  5.477   -37.519 1.00 99.99  ? 720 TYR C CG  1  
ATOM 5294   C CD1 . TYR A 1 716 ? -87.857  4.827   -38.719 1.00 99.99  ? 720 TYR C CD1 1  
ATOM 5295   C CD2 . TYR A 1 716 ? -87.663  6.870   -37.426 1.00 99.99  ? 720 TYR C CD2 1  
ATOM 5296   C CE1 . TYR A 1 716 ? -88.283  5.572   -39.826 1.00 99.99  ? 720 TYR C CE1 1  
ATOM 5297   C CE2 . TYR A 1 716 ? -88.088  7.612   -38.536 1.00 99.99  ? 720 TYR C CE2 1  
ATOM 5298   C CZ  . TYR A 1 716 ? -88.400  6.961   -39.734 1.00 99.99  ? 720 TYR C CZ  1  
ATOM 5299   O OH  . TYR A 1 716 ? -88.812  7.683   -40.814 1.00 99.99  ? 720 TYR C OH  1  
ATOM 5300   N N   . SER A 1 717 ? -88.435  2.465   -33.809 1.00 30.00  ? 721 SER C N   1  
ATOM 5301   C CA  . SER A 1 717 ? -88.007  1.364   -32.955 1.00 30.00  ? 721 SER C CA  1  
ATOM 5302   C C   . SER A 1 717 ? -88.383  0.088   -33.714 1.00 30.00  ? 721 SER C C   1  
ATOM 5303   O O   . SER A 1 717 ? -87.621  -0.882  -33.785 1.00 30.00  ? 721 SER C O   1  
ATOM 5304   C CB  . SER A 1 717 ? -88.723  1.441   -31.611 1.00 99.99  ? 721 SER C CB  1  
ATOM 5305   O OG  . SER A 1 717 ? -88.200  2.535   -30.854 1.00 99.99  ? 721 SER C OG  1  
ATOM 5306   N N   . ILE A 1 718 ? -89.577  0.129   -34.291 1.00 30.00  ? 722 ILE C N   1  
ATOM 5307   C CA  . ILE A 1 718 ? -90.151  -0.954  -35.072 1.00 30.00  ? 722 ILE C CA  1  
ATOM 5308   C C   . ILE A 1 718 ? -89.313  -1.307  -36.305 1.00 30.00  ? 722 ILE C C   1  
ATOM 5309   O O   . ILE A 1 718 ? -89.852  -1.766  -37.307 1.00 30.00  ? 722 ILE C O   1  
ATOM 5310   C CB  . ILE A 1 718 ? -91.540  -0.561  -35.557 1.00 99.99  ? 722 ILE C CB  1  
ATOM 5311   C CG1 . ILE A 1 718 ? -91.419  0.307   -36.806 1.00 99.99  ? 722 ILE C CG1 1  
ATOM 5312   C CG2 . ILE A 1 718 ? -92.262  0.222   -34.464 1.00 99.99  ? 722 ILE C CG2 1  
ATOM 5313   C CD1 . ILE A 1 718 ? -91.407  1.778   -36.406 1.00 99.99  ? 722 ILE C CD1 1  
ATOM 5314   N N   . LEU A 1 719 ? -88.003  -1.110  -36.247 1.00 30.00  ? 723 LEU C N   1  
ATOM 5315   C CA  . LEU A 1 719 ? -87.173  -1.424  -37.407 1.00 30.00  ? 723 LEU C CA  1  
ATOM 5316   C C   . LEU A 1 719 ? -85.981  -2.260  -37.013 1.00 30.00  ? 723 LEU C C   1  
ATOM 5317   O O   . LEU A 1 719 ? -85.122  -2.565  -37.848 1.00 30.00  ? 723 LEU C O   1  
ATOM 5318   C CB  . LEU A 1 719 ? -86.669  -0.135  -38.049 1.00 99.99  ? 723 LEU C CB  1  
ATOM 5319   C CG  . LEU A 1 719 ? -87.607  0.270   -39.183 1.00 99.99  ? 723 LEU C CG  1  
ATOM 5320   C CD1 . LEU A 1 719 ? -86.941  1.351   -40.031 1.00 99.99  ? 723 LEU C CD1 1  
ATOM 5321   C CD2 . LEU A 1 719 ? -87.907  -0.947  -40.053 1.00 99.99  ? 723 LEU C CD2 1  
ATOM 5322   N N   . ALA A 1 720 ? -85.937  -2.620  -35.733 1.00 30.00  ? 724 ALA C N   1  
ATOM 5323   C CA  . ALA A 1 720 ? -84.879  -3.446  -35.141 1.00 30.00  ? 724 ALA C CA  1  
ATOM 5324   C C   . ALA A 1 720 ? -85.244  -3.645  -33.664 1.00 30.00  ? 724 ALA C C   1  
ATOM 5325   O O   . ALA A 1 720 ? -84.447  -3.331  -32.782 1.00 30.00  ? 724 ALA C O   1  
ATOM 5326   C CB  . ALA A 1 720 ? -83.507  -2.745  -35.280 1.00 30.00  ? 724 ALA C CB  1  
ATOM 5327   N N   . PRO A 1 721 ? -86.449  -4.188  -33.381 1.00 30.00  ? 725 PRO C N   1  
ATOM 5328   C CA  . PRO A 1 721 ? -86.903  -4.417  -31.992 1.00 30.00  ? 725 PRO C CA  1  
ATOM 5329   C C   . PRO A 1 721 ? -86.218  -5.587  -31.271 1.00 30.00  ? 725 PRO C C   1  
ATOM 5330   O O   . PRO A 1 721 ? -86.361  -5.763  -30.055 1.00 30.00  ? 725 PRO C O   1  
ATOM 5331   C CB  . PRO A 1 721 ? -88.332  -4.717  -32.283 1.00 99.99  ? 725 PRO C CB  1  
ATOM 5332   C CG  . PRO A 1 721 ? -88.498  -4.562  -33.775 1.00 99.99  ? 725 PRO C CG  1  
ATOM 5333   C CD  . PRO A 1 721 ? -87.428  -4.211  -34.376 1.00 99.99  ? 725 PRO C CD  1  
ATOM 5334   N N   . ASN A 1 722 ? -85.480  -6.375  -32.041 1.00 30.00  ? 726 ASN C N   1  
ATOM 5335   C CA  . ASN A 1 722 ? -84.763  -7.517  -31.511 1.00 30.00  ? 726 ASN C CA  1  
ATOM 5336   C C   . ASN A 1 722 ? -83.343  -7.014  -31.279 1.00 30.00  ? 726 ASN C C   1  
ATOM 5337   O O   . ASN A 1 722 ? -82.358  -7.636  -31.685 1.00 30.00  ? 726 ASN C O   1  
ATOM 5338   C CB  . ASN A 1 722 ? -84.794  -8.662  -32.515 1.00 99.99  ? 726 ASN C CB  1  
ATOM 5339   C CG  . ASN A 1 722 ? -84.104  -8.275  -33.815 1.00 99.99  ? 726 ASN C CG  1  
ATOM 5340   O OD1 . ASN A 1 722 ? -83.819  -9.131  -34.649 1.00 99.99  ? 726 ASN C OD1 1  
ATOM 5341   N ND2 . ASN A 1 722 ? -83.834  -6.979  -33.982 1.00 99.99  ? 726 ASN C ND2 1  
ATOM 5342   N N   . ALA A 1 723 ? -83.264  -5.854  -30.624 1.00 30.00  ? 727 ALA C N   1  
ATOM 5343   C CA  . ALA A 1 723 ? -81.996  -5.206  -30.307 1.00 30.00  ? 727 ALA C CA  1  
ATOM 5344   C C   . ALA A 1 723 ? -82.239  -4.039  -29.348 1.00 30.00  ? 727 ALA C C   1  
ATOM 5345   O O   . ALA A 1 723 ? -81.339  -3.242  -29.077 1.00 30.00  ? 727 ALA C O   1  
ATOM 5346   C CB  . ALA A 1 723 ? -81.333  -4.709  -31.592 1.00 30.00  ? 727 ALA C CB  1  
ATOM 5347   N N   . ILE A 1 724 ? -83.461  -3.952  -28.839 1.00 30.00  ? 728 ILE C N   1  
ATOM 5348   C CA  . ILE A 1 724 ? -83.848  -2.889  -27.908 1.00 30.00  ? 728 ILE C CA  1  
ATOM 5349   C C   . ILE A 1 724 ? -84.218  -3.440  -26.532 1.00 30.00  ? 728 ILE C C   1  
ATOM 5350   O O   . ILE A 1 724 ? -85.368  -3.828  -26.307 1.00 30.00  ? 728 ILE C O   1  
ATOM 5351   C CB  . ILE A 1 724 ? -85.053  -2.135  -28.456 1.00 99.99  ? 728 ILE C CB  1  
ATOM 5352   C CG1 . ILE A 1 724 ? -86.335  -2.849  -28.039 1.00 99.99  ? 728 ILE C CG1 1  
ATOM 5353   C CG2 . ILE A 1 724 ? -84.972  -2.084  -29.979 1.00 99.99  ? 728 ILE C CG2 1  
ATOM 5354   C CD1 . ILE A 1 724 ? -86.869  -2.223  -26.755 1.00 99.99  ? 728 ILE C CD1 1  
ATOM 5355   N N   . PRO A 1 725 ? -83.255  -3.480  -25.587 1.00 30.00  ? 729 PRO C N   1  
ATOM 5356   C CA  . PRO A 1 725 ? -83.530  -3.997  -24.230 1.00 30.00  ? 729 PRO C CA  1  
ATOM 5357   C C   . PRO A 1 725 ? -84.634  -3.277  -23.427 1.00 30.00  ? 729 PRO C C   1  
ATOM 5358   O O   . PRO A 1 725 ? -84.332  -2.714  -22.353 1.00 30.00  ? 729 PRO C O   1  
ATOM 5359   C CB  . PRO A 1 725 ? -82.189  -3.746  -23.634 1.00 99.99  ? 729 PRO C CB  1  
ATOM 5360   C CG  . PRO A 1 725 ? -81.335  -3.177  -24.744 1.00 99.99  ? 729 PRO C CG  1  
ATOM 5361   C CD  . PRO A 1 725 ? -81.945  -3.080  -25.860 1.00 99.99  ? 729 PRO C CD  1  
ATOM 5362   N N   . ASP A 1 730 ? -82.784  4.681   -22.434 1.00 30.00  ? 734 ASP C N   1  
ATOM 5363   C CA  . ASP A 1 730 ? -82.240  5.976   -22.941 1.00 30.00  ? 734 ASP C CA  1  
ATOM 5364   C C   . ASP A 1 730 ? -82.508  6.147   -24.436 1.00 30.00  ? 734 ASP C C   1  
ATOM 5365   O O   . ASP A 1 730 ? -82.083  5.327   -25.260 1.00 30.00  ? 734 ASP C O   1  
ATOM 5366   C CB  . ASP A 1 730 ? -80.730  6.031   -22.715 1.00 99.99  ? 734 ASP C CB  1  
ATOM 5367   C CG  . ASP A 1 730 ? -80.221  7.438   -23.004 1.00 99.99  ? 734 ASP C CG  1  
ATOM 5368   O OD1 . ASP A 1 730 ? -80.041  7.751   -24.211 1.00 99.99  ? 734 ASP C OD1 1  
ATOM 5369   O OD2 . ASP A 1 730 ? -80.015  8.191   -22.013 1.00 99.99  ? 734 ASP C OD2 1  
ATOM 5370   N N   . GLY A 1 731 ? -83.216  7.219   -24.776 1.00 30.00  ? 735 GLY C N   1  
ATOM 5371   C CA  . GLY A 1 731 ? -83.532  7.482   -26.167 1.00 30.00  ? 735 GLY C CA  1  
ATOM 5372   C C   . GLY A 1 731 ? -82.340  7.664   -27.090 1.00 30.00  ? 735 GLY C C   1  
ATOM 5373   O O   . GLY A 1 731 ? -82.442  7.346   -28.268 1.00 30.00  ? 735 GLY C O   1  
ATOM 5374   N N   . LYS A 1 732 ? -81.211  8.163   -26.581 1.00 30.00  ? 736 LYS C N   1  
ATOM 5375   C CA  . LYS A 1 732 ? -80.013  8.392   -27.405 1.00 30.00  ? 736 LYS C CA  1  
ATOM 5376   C C   . LYS A 1 732 ? -79.191  7.148   -27.753 1.00 30.00  ? 736 LYS C C   1  
ATOM 5377   O O   . LYS A 1 732 ? -78.387  7.156   -28.692 1.00 30.00  ? 736 LYS C O   1  
ATOM 5378   C CB  . LYS A 1 732 ? -79.057  9.335   -26.683 1.00 99.99  ? 736 LYS C CB  1  
ATOM 5379   C CG  . LYS A 1 732 ? -79.759  10.660  -26.405 1.00 99.99  ? 736 LYS C CG  1  
ATOM 5380   C CD  . LYS A 1 732 ? -78.775  11.635  -25.773 1.00 99.99  ? 736 LYS C CD  1  
ATOM 5381   C CE  . LYS A 1 732 ? -79.474  12.968  -25.520 1.00 99.99  ? 736 LYS C CE  1  
ATOM 5382   N NZ  . LYS A 1 732 ? -78.463  14.028  -25.373 1.00 99.99  ? 736 LYS C NZ  1  
ATOM 5383   N N   . THR A 1 733 ? -79.392  6.078   -26.996 1.00 30.00  ? 737 THR C N   1  
ATOM 5384   C CA  . THR A 1 733 ? -78.657  4.851   -27.231 1.00 30.00  ? 737 THR C CA  1  
ATOM 5385   C C   . THR A 1 733 ? -79.532  3.885   -28.016 1.00 30.00  ? 737 THR C C   1  
ATOM 5386   O O   . THR A 1 733 ? -79.040  3.106   -28.846 1.00 30.00  ? 737 THR C O   1  
ATOM 5387   C CB  . THR A 1 733 ? -78.270  4.215   -25.901 1.00 99.99  ? 737 THR C CB  1  
ATOM 5388   O OG1 . THR A 1 733 ? -79.446  3.753   -25.232 1.00 99.99  ? 737 THR C OG1 1  
ATOM 5389   C CG2 . THR A 1 733 ? -77.565  5.249   -25.031 1.00 99.99  ? 737 THR C CG2 1  
ATOM 5390   N N   . VAL A 1 734 ? -80.833  3.952   -27.747 1.00 30.00  ? 738 VAL C N   1  
ATOM 5391   C CA  . VAL A 1 734 ? -81.819  3.104   -28.414 1.00 30.00  ? 738 VAL C CA  1  
ATOM 5392   C C   . VAL A 1 734 ? -81.659  3.310   -29.920 1.00 30.00  ? 738 VAL C C   1  
ATOM 5393   O O   . VAL A 1 734 ? -81.622  2.354   -30.701 1.00 30.00  ? 738 VAL C O   1  
ATOM 5394   C CB  . VAL A 1 734 ? -83.223  3.498   -27.973 1.00 99.99  ? 738 VAL C CB  1  
ATOM 5395   C CG1 . VAL A 1 734 ? -83.353  3.324   -26.462 1.00 99.99  ? 738 VAL C CG1 1  
ATOM 5396   C CG2 . VAL A 1 734 ? -83.486  4.955   -28.340 1.00 99.99  ? 738 VAL C CG2 1  
ATOM 5397   N N   . SER A 1 735 ? -81.552  4.580   -30.301 1.00 30.00  ? 739 SER C N   1  
ATOM 5398   C CA  . SER A 1 735 ? -81.384  4.980   -31.696 1.00 30.00  ? 739 SER C CA  1  
ATOM 5399   C C   . SER A 1 735 ? -79.987  4.596   -32.163 1.00 30.00  ? 739 SER C C   1  
ATOM 5400   O O   . SER A 1 735 ? -79.759  4.285   -33.337 1.00 30.00  ? 739 SER C O   1  
ATOM 5401   C CB  . SER A 1 735 ? -81.570  6.488   -31.829 1.00 99.99  ? 739 SER C CB  1  
ATOM 5402   O OG  . SER A 1 735 ? -80.488  7.160   -31.179 1.00 99.99  ? 739 SER C OG  1  
ATOM 5403   N N   . GLU A 1 736 ? -79.041  4.643   -31.233 1.00 30.00  ? 740 GLU C N   1  
ATOM 5404   C CA  . GLU A 1 736 ? -77.677  4.291   -31.554 1.00 30.00  ? 740 GLU C CA  1  
ATOM 5405   C C   . GLU A 1 736 ? -77.749  2.853   -32.023 1.00 30.00  ? 740 GLU C C   1  
ATOM 5406   O O   . GLU A 1 736 ? -77.020  2.443   -32.928 1.00 30.00  ? 740 GLU C O   1  
ATOM 5407   C CB  . GLU A 1 736 ? -76.799  4.437   -30.316 1.00 99.99  ? 740 GLU C CB  1  
ATOM 5408   C CG  . GLU A 1 736 ? -76.750  5.888   -29.901 1.00 99.99  ? 740 GLU C CG  1  
ATOM 5409   C CD  . GLU A 1 736 ? -75.906  6.675   -30.899 1.00 99.99  ? 740 GLU C CD  1  
ATOM 5410   O OE1 . GLU A 1 736 ? -76.499  7.179   -31.886 1.00 99.99  ? 740 GLU C OE1 1  
ATOM 5411   O OE2 . GLU A 1 736 ? -74.670  6.764   -30.662 1.00 99.99  ? 740 GLU C OE2 1  
ATOM 5412   N N   . LYS A 1 737 ? -78.654  2.108   -31.387 1.00 30.00  ? 741 LYS C N   1  
ATOM 5413   C CA  . LYS A 1 737 ? -78.891  0.697   -31.678 1.00 30.00  ? 741 LYS C CA  1  
ATOM 5414   C C   . LYS A 1 737 ? -79.677  0.494   -32.989 1.00 30.00  ? 741 LYS C C   1  
ATOM 5415   O O   . LYS A 1 737 ? -79.175  -0.122  -33.933 1.00 30.00  ? 741 LYS C O   1  
ATOM 5416   C CB  . LYS A 1 737 ? -79.697  0.062   -30.549 1.00 99.99  ? 741 LYS C CB  1  
ATOM 5417   C CG  . LYS A 1 737 ? -78.933  0.203   -29.237 1.00 99.99  ? 741 LYS C CG  1  
ATOM 5418   C CD  . LYS A 1 737 ? -79.691  -0.518  -28.127 1.00 99.99  ? 741 LYS C CD  1  
ATOM 5419   C CE  . LYS A 1 737 ? -78.913  -0.397  -26.821 1.00 99.99  ? 741 LYS C CE  1  
ATOM 5420   N NZ  . LYS A 1 737 ? -79.350  -1.447  -25.891 1.00 99.99  ? 741 LYS C NZ  1  
ATOM 5421   N N   . ILE A 1 738 ? -80.898  1.003   -33.043 1.00 30.00  ? 742 ILE C N   1  
ATOM 5422   C CA  . ILE A 1 738 ? -81.730  0.878   -34.241 1.00 30.00  ? 742 ILE C CA  1  
ATOM 5423   C C   . ILE A 1 738 ? -80.964  1.139   -35.531 1.00 30.00  ? 742 ILE C C   1  
ATOM 5424   O O   . ILE A 1 738 ? -80.875  0.280   -36.406 1.00 30.00  ? 742 ILE C O   1  
ATOM 5425   C CB  . ILE A 1 738 ? -82.879  1.880   -34.180 1.00 99.99  ? 742 ILE C CB  1  
ATOM 5426   C CG1 . ILE A 1 738 ? -82.415  3.218   -34.746 1.00 99.99  ? 742 ILE C CG1 1  
ATOM 5427   C CG2 . ILE A 1 738 ? -83.317  2.065   -32.731 1.00 99.99  ? 742 ILE C CG2 1  
ATOM 5428   C CD1 . ILE A 1 738 ? -82.783  3.301   -36.224 1.00 99.99  ? 742 ILE C CD1 1  
ATOM 5429   N N   . LEU A 1 739 ? -80.420  2.339   -35.636 1.00 30.00  ? 743 LEU C N   1  
ATOM 5430   C CA  . LEU A 1 739 ? -79.657  2.751   -36.808 1.00 30.00  ? 743 LEU C CA  1  
ATOM 5431   C C   . LEU A 1 739 ? -78.411  1.899   -36.968 1.00 30.00  ? 743 LEU C C   1  
ATOM 5432   O O   . LEU A 1 739 ? -77.846  1.799   -38.058 1.00 30.00  ? 743 LEU C O   1  
ATOM 5433   C CB  . LEU A 1 739 ? -79.238  4.210   -36.670 1.00 99.99  ? 743 LEU C CB  1  
ATOM 5434   C CG  . LEU A 1 739 ? -80.257  5.103   -37.369 1.00 99.99  ? 743 LEU C CG  1  
ATOM 5435   C CD1 . LEU A 1 739 ? -79.683  6.509   -37.519 1.00 99.99  ? 743 LEU C CD1 1  
ATOM 5436   C CD2 . LEU A 1 739 ? -80.575  4.532   -38.746 1.00 99.99  ? 743 LEU C CD2 1  
ATOM 5437   N N   . ALA A 1 740 ? -77.983  1.289   -35.870 1.00 30.00  ? 744 ALA C N   1  
ATOM 5438   C CA  . ALA A 1 740 ? -76.803  0.436   -35.889 1.00 30.00  ? 744 ALA C CA  1  
ATOM 5439   C C   . ALA A 1 740 ? -77.256  -0.901  -36.461 1.00 30.00  ? 744 ALA C C   1  
ATOM 5440   O O   . ALA A 1 740 ? -76.629  -1.442  -37.381 1.00 30.00  ? 744 ALA C O   1  
ATOM 5441   C CB  . ALA A 1 740 ? -76.263  0.254   -34.473 1.00 30.00  ? 744 ALA C CB  1  
ATOM 5442   N N   . GLY A 1 741 ? -78.351  -1.424  -35.907 1.00 30.00  ? 745 GLY C N   1  
ATOM 5443   C CA  . GLY A 1 741 ? -78.894  -2.685  -36.362 1.00 30.00  ? 745 GLY C CA  1  
ATOM 5444   C C   . GLY A 1 741 ? -79.065  -2.641  -37.862 1.00 30.00  ? 745 GLY C C   1  
ATOM 5445   O O   . GLY A 1 741 ? -78.490  -3.451  -38.583 1.00 30.00  ? 745 GLY C O   1  
ATOM 5446   N N   . LEU A 1 742 ? -79.857  -1.680  -38.330 1.00 30.00  ? 746 LEU C N   1  
ATOM 5447   C CA  . LEU A 1 742 ? -80.120  -1.507  -39.753 1.00 30.00  ? 746 LEU C CA  1  
ATOM 5448   C C   . LEU A 1 742 ? -78.851  -1.450  -40.594 1.00 30.00  ? 746 LEU C C   1  
ATOM 5449   O O   . LEU A 1 742 ? -78.921  -1.315  -41.821 1.00 30.00  ? 746 LEU C O   1  
ATOM 5450   C CB  . LEU A 1 742 ? -80.877  -0.204  -39.985 1.00 99.99  ? 746 LEU C CB  1  
ATOM 5451   C CG  . LEU A 1 742 ? -82.377  -0.488  -40.033 1.00 99.99  ? 746 LEU C CG  1  
ATOM 5452   C CD1 . LEU A 1 742 ? -83.107  0.732   -40.583 1.00 99.99  ? 746 LEU C CD1 1  
ATOM 5453   C CD2 . LEU A 1 742 ? -82.637  -1.688  -40.934 1.00 99.99  ? 746 LEU C CD2 1  
ATOM 5454   N N   . GLN A 1 743 ? -77.699  -1.556  -39.927 1.00 30.00  ? 747 GLN C N   1  
ATOM 5455   C CA  . GLN A 1 743 ? -76.409  -1.508  -40.611 1.00 30.00  ? 747 GLN C CA  1  
ATOM 5456   C C   . GLN A 1 743 ? -76.436  -0.295  -41.527 1.00 30.00  ? 747 GLN C C   1  
ATOM 5457   O O   . GLN A 1 743 ? -76.160  -0.383  -42.726 1.00 30.00  ? 747 GLN C O   1  
ATOM 5458   C CB  . GLN A 1 743 ? -76.203  -2.784  -41.420 1.00 99.99  ? 747 GLN C CB  1  
ATOM 5459   C CG  . GLN A 1 743 ? -76.107  -3.975  -40.478 1.00 99.99  ? 747 GLN C CG  1  
ATOM 5460   C CD  . GLN A 1 743 ? -74.788  -3.972  -39.718 1.00 99.99  ? 747 GLN C CD  1  
ATOM 5461   O OE1 . GLN A 1 743 ? -73.965  -3.078  -39.908 1.00 99.99  ? 747 GLN C OE1 1  
ATOM 5462   N NE2 . GLN A 1 743 ? -74.590  -4.971  -38.858 1.00 99.99  ? 747 GLN C NE2 1  
ATOM 5463   N N   . MET A 1 744 ? -76.786  0.841   -40.927 1.00 30.00  ? 748 MET C N   1  
ATOM 5464   C CA  . MET A 1 744 ? -76.874  2.110   -41.628 1.00 30.00  ? 748 MET C CA  1  
ATOM 5465   C C   . MET A 1 744 ? -75.506  2.747   -41.829 1.00 30.00  ? 748 MET C C   1  
ATOM 5466   O O   . MET A 1 744 ? -74.688  2.796   -40.909 1.00 30.00  ? 748 MET C O   1  
ATOM 5467   C CB  . MET A 1 744 ? -77.736  3.083   -40.829 1.00 99.99  ? 748 MET C CB  1  
ATOM 5468   C CG  . MET A 1 744 ? -79.046  2.407   -40.448 1.00 99.99  ? 748 MET C CG  1  
ATOM 5469   S SD  . MET A 1 744 ? -80.190  2.432   -41.847 1.00 99.99  ? 748 MET C SD  1  
ATOM 5470   C CE  . MET A 1 744 ? -80.713  4.134   -41.792 1.00 99.99  ? 748 MET C CE  1  
ATOM 5471   N N   . ASP A 1 745 ? -75.276  3.227   -43.048 1.00 30.00  ? 749 ASP C N   1  
ATOM 5472   C CA  . ASP A 1 745 ? -74.020  3.867   -43.416 1.00 30.00  ? 749 ASP C CA  1  
ATOM 5473   C C   . ASP A 1 745 ? -73.711  5.103   -42.568 1.00 30.00  ? 749 ASP C C   1  
ATOM 5474   O O   . ASP A 1 745 ? -74.509  6.039   -42.527 1.00 30.00  ? 749 ASP C O   1  
ATOM 5475   C CB  . ASP A 1 745 ? -74.073  4.311   -44.874 1.00 99.99  ? 749 ASP C CB  1  
ATOM 5476   C CG  . ASP A 1 745 ? -72.682  4.751   -45.326 1.00 99.99  ? 749 ASP C CG  1  
ATOM 5477   O OD1 . ASP A 1 745 ? -72.310  5.909   -44.995 1.00 99.99  ? 749 ASP C OD1 1  
ATOM 5478   O OD2 . ASP A 1 745 ? -72.007  3.923   -45.993 1.00 99.99  ? 749 ASP C OD2 1  
ATOM 5479   N N   . PRO A 1 746 ? -72.546  5.124   -41.885 1.00 30.00  ? 750 PRO C N   1  
ATOM 5480   C CA  . PRO A 1 746 ? -72.180  6.282   -41.053 1.00 30.00  ? 750 PRO C CA  1  
ATOM 5481   C C   . PRO A 1 746 ? -72.256  7.596   -41.837 1.00 30.00  ? 750 PRO C C   1  
ATOM 5482   O O   . PRO A 1 746 ? -72.376  8.682   -41.253 1.00 30.00  ? 750 PRO C O   1  
ATOM 5483   C CB  . PRO A 1 746 ? -70.782  5.884   -40.739 1.00 99.99  ? 750 PRO C CB  1  
ATOM 5484   C CG  . PRO A 1 746 ? -70.571  4.538   -41.388 1.00 99.99  ? 750 PRO C CG  1  
ATOM 5485   C CD  . PRO A 1 746 ? -71.603  4.096   -41.995 1.00 99.99  ? 750 PRO C CD  1  
ATOM 5486   N N   . ALA A 1 747 ? -72.193  7.479   -43.164 1.00 30.00  ? 751 ALA C N   1  
ATOM 5487   C CA  . ALA A 1 747 ? -72.257  8.628   -44.058 1.00 30.00  ? 751 ALA C CA  1  
ATOM 5488   C C   . ALA A 1 747 ? -73.630  9.287   -44.007 1.00 30.00  ? 751 ALA C C   1  
ATOM 5489   O O   . ALA A 1 747 ? -73.763  10.447  -43.602 1.00 30.00  ? 751 ALA C O   1  
ATOM 5490   C CB  . ALA A 1 747 ? -71.942  8.193   -45.497 1.00 30.00  ? 751 ALA C CB  1  
ATOM 5491   N N   . GLU A 1 748 ? -74.654  8.534   -44.410 1.00 30.00  ? 752 GLU C N   1  
ATOM 5492   C CA  . GLU A 1 748 ? -76.021  9.036   -44.434 1.00 30.00  ? 752 GLU C CA  1  
ATOM 5493   C C   . GLU A 1 748 ? -76.594  9.543   -43.094 1.00 30.00  ? 752 GLU C C   1  
ATOM 5494   O O   . GLU A 1 748 ? -77.809  9.687   -42.968 1.00 30.00  ? 752 GLU C O   1  
ATOM 5495   C CB  . GLU A 1 748 ? -76.967  7.934   -44.895 1.00 99.99  ? 752 GLU C CB  1  
ATOM 5496   C CG  . GLU A 1 748 ? -76.655  7.567   -46.324 1.00 99.99  ? 752 GLU C CG  1  
ATOM 5497   C CD  . GLU A 1 748 ? -77.111  8.688   -47.252 1.00 99.99  ? 752 GLU C CD  1  
ATOM 5498   O OE1 . GLU A 1 748 ? -76.277  9.598   -47.507 1.00 99.99  ? 752 GLU C OE1 1  
ATOM 5499   O OE2 . GLU A 1 748 ? -78.289  8.627   -47.696 1.00 99.99  ? 752 GLU C OE2 1  
ATOM 5500   N N   . TYR A 1 749 ? -75.744  9.812   -42.099 1.00 30.00  ? 753 TYR C N   1  
ATOM 5501   C CA  . TYR A 1 749 ? -76.237  10.322  -40.818 1.00 30.00  ? 753 TYR C CA  1  
ATOM 5502   C C   . TYR A 1 749 ? -75.171  10.799  -39.830 1.00 30.00  ? 753 TYR C C   1  
ATOM 5503   O O   . TYR A 1 749 ? -73.968  10.588  -40.038 1.00 30.00  ? 753 TYR C O   1  
ATOM 5504   C CB  . TYR A 1 749 ? -77.024  9.236   -40.095 1.00 99.99  ? 753 TYR C CB  1  
ATOM 5505   C CG  . TYR A 1 749 ? -76.096  8.104   -39.723 1.00 99.99  ? 753 TYR C CG  1  
ATOM 5506   C CD1 . TYR A 1 749 ? -75.345  8.173   -38.543 1.00 99.99  ? 753 TYR C CD1 1  
ATOM 5507   C CD2 . TYR A 1 749 ? -75.984  6.986   -40.560 1.00 99.99  ? 753 TYR C CD2 1  
ATOM 5508   C CE1 . TYR A 1 749 ? -74.483  7.125   -38.199 1.00 99.99  ? 753 TYR C CE1 1  
ATOM 5509   C CE2 . TYR A 1 749 ? -75.121  5.939   -40.212 1.00 99.99  ? 753 TYR C CE2 1  
ATOM 5510   C CZ  . TYR A 1 749 ? -74.372  6.008   -39.034 1.00 99.99  ? 753 TYR C CZ  1  
ATOM 5511   O OH  . TYR A 1 749 ? -73.534  4.989   -38.699 1.00 99.99  ? 753 TYR C OH  1  
ATOM 5512   N N   . ARG A 1 750 ? -75.616  11.462  -38.762 1.00 30.00  ? 754 ARG C N   1  
ATOM 5513   C CA  . ARG A 1 750 ? -74.692  11.975  -37.763 1.00 30.00  ? 754 ARG C CA  1  
ATOM 5514   C C   . ARG A 1 750 ? -75.258  12.041  -36.351 1.00 30.00  ? 754 ARG C C   1  
ATOM 5515   O O   . ARG A 1 750 ? -76.463  12.226  -36.128 1.00 30.00  ? 754 ARG C O   1  
ATOM 5516   C CB  . ARG A 1 750 ? -74.271  13.394  -38.131 1.00 99.99  ? 754 ARG C CB  1  
ATOM 5517   C CG  . ARG A 1 750 ? -73.695  13.406  -39.542 1.00 99.99  ? 754 ARG C CG  1  
ATOM 5518   C CD  . ARG A 1 750 ? -72.386  12.620  -39.566 1.00 99.99  ? 754 ARG C CD  1  
ATOM 5519   N NE  . ARG A 1 750 ? -71.401  13.208  -38.626 1.00 99.99  ? 754 ARG C NE  1  
ATOM 5520   C CZ  . ARG A 1 750 ? -70.105  12.926  -38.670 1.00 99.99  ? 754 ARG C CZ  1  
ATOM 5521   N NH1 . ARG A 1 750 ? -69.593  12.085  -39.569 1.00 99.99  ? 754 ARG C NH1 1  
ATOM 5522   N NH2 . ARG A 1 750 ? -69.305  13.508  -37.778 1.00 99.99  ? 754 ARG C NH2 1  
ATOM 5523   N N   . LEU A 1 751 ? -74.323  11.890  -35.410 1.00 30.00  ? 755 LEU C N   1  
ATOM 5524   C CA  . LEU A 1 751 ? -74.481  11.875  -33.952 1.00 30.00  ? 755 LEU C CA  1  
ATOM 5525   C C   . LEU A 1 751 ? -75.474  12.842  -33.341 1.00 30.00  ? 755 LEU C C   1  
ATOM 5526   O O   . LEU A 1 751 ? -76.695  12.674  -33.451 1.00 30.00  ? 755 LEU C O   1  
ATOM 5527   C CB  . LEU A 1 751 ? -73.148  12.205  -33.285 1.00 99.99  ? 755 LEU C CB  1  
ATOM 5528   C CG  . LEU A 1 751 ? -72.423  10.911  -32.936 1.00 99.99  ? 755 LEU C CG  1  
ATOM 5529   C CD1 . LEU A 1 751 ? -71.265  11.221  -31.989 1.00 99.99  ? 755 LEU C CD1 1  
ATOM 5530   C CD2 . LEU A 1 751 ? -73.392  9.948   -32.261 1.00 99.99  ? 755 LEU C CD2 1  
ATOM 5531   N N   . GLY A 1 752 ? -74.923  13.854  -32.693 1.00 30.00  ? 756 GLY C N   1  
ATOM 5532   C CA  . GLY A 1 752 ? -75.746  14.869  -32.067 1.00 30.00  ? 756 GLY C CA  1  
ATOM 5533   C C   . GLY A 1 752 ? -75.807  14.604  -30.595 1.00 30.00  ? 756 GLY C C   1  
ATOM 5534   O O   . GLY A 1 752 ? -75.645  13.471  -30.163 1.00 30.00  ? 756 GLY C O   1  
ATOM 5535   N N   . THR A 1 753 ? -76.028  15.647  -29.814 1.00 30.00  ? 757 THR C N   1  
ATOM 5536   C CA  . THR A 1 753 ? -76.111  15.479  -28.383 1.00 30.00  ? 757 THR C CA  1  
ATOM 5537   C C   . THR A 1 753 ? -77.560  15.125  -28.102 1.00 30.00  ? 757 THR C C   1  
ATOM 5538   O O   . THR A 1 753 ? -77.849  14.076  -27.528 1.00 30.00  ? 757 THR C O   1  
ATOM 5539   C CB  . THR A 1 753 ? -75.714  16.776  -27.683 1.00 99.99  ? 757 THR C CB  1  
ATOM 5540   O OG1 . THR A 1 753 ? -76.699  17.778  -27.940 1.00 99.99  ? 757 THR C OG1 1  
ATOM 5541   C CG2 . THR A 1 753 ? -74.363  17.245  -28.217 1.00 99.99  ? 757 THR C CG2 1  
ATOM 5542   N N   . THR A 1 754 ? -78.470  15.996  -28.523 1.00 30.00  ? 758 THR C N   1  
ATOM 5543   C CA  . THR A 1 754 ? -79.892  15.782  -28.313 1.00 30.00  ? 758 THR C CA  1  
ATOM 5544   C C   . THR A 1 754 ? -80.649  15.320  -29.567 1.00 30.00  ? 758 THR C C   1  
ATOM 5545   O O   . THR A 1 754 ? -81.818  14.930  -29.486 1.00 30.00  ? 758 THR C O   1  
ATOM 5546   C CB  . THR A 1 754 ? -80.551  17.075  -27.852 1.00 99.99  ? 758 THR C CB  1  
ATOM 5547   O OG1 . THR A 1 754 ? -80.533  18.028  -28.920 1.00 99.99  ? 758 THR C OG1 1  
ATOM 5548   C CG2 . THR A 1 754 ? -79.785  17.637  -26.659 1.00 99.99  ? 758 THR C CG2 1  
ATOM 5549   N N   . LYS A 1 755 ? -79.996  15.353  -30.727 1.00 30.00  ? 759 LYS C N   1  
ATOM 5550   C CA  . LYS A 1 755 ? -80.696  14.930  -31.929 1.00 30.00  ? 759 LYS C CA  1  
ATOM 5551   C C   . LYS A 1 755 ? -79.867  14.270  -33.026 1.00 30.00  ? 759 LYS C C   1  
ATOM 5552   O O   . LYS A 1 755 ? -78.651  14.482  -33.132 1.00 30.00  ? 759 LYS C O   1  
ATOM 5553   C CB  . LYS A 1 755 ? -81.357  16.130  -32.595 1.00 99.99  ? 759 LYS C CB  1  
ATOM 5554   C CG  . LYS A 1 755 ? -82.334  16.782  -31.623 1.00 99.99  ? 759 LYS C CG  1  
ATOM 5555   C CD  . LYS A 1 755 ? -83.067  17.923  -32.320 1.00 99.99  ? 759 LYS C CD  1  
ATOM 5556   C CE  . LYS A 1 755 ? -84.063  18.554  -31.354 1.00 99.99  ? 759 LYS C CE  1  
ATOM 5557   N NZ  . LYS A 1 755 ? -85.080  19.296  -32.112 1.00 99.99  ? 759 LYS C NZ  1  
ATOM 5558   N N   . VAL A 1 756 ? -80.566  13.463  -33.834 1.00 30.00  ? 760 VAL C N   1  
ATOM 5559   C CA  . VAL A 1 756 ? -79.982  12.720  -34.954 1.00 30.00  ? 760 VAL C CA  1  
ATOM 5560   C C   . VAL A 1 756 ? -80.063  13.485  -36.250 1.00 30.00  ? 760 VAL C C   1  
ATOM 5561   O O   . VAL A 1 756 ? -81.075  14.139  -36.539 1.00 30.00  ? 760 VAL C O   1  
ATOM 5562   C CB  . VAL A 1 756 ? -80.721  11.399  -35.144 1.00 99.99  ? 760 VAL C CB  1  
ATOM 5563   C CG1 . VAL A 1 756 ? -80.604  10.566  -33.872 1.00 99.99  ? 760 VAL C CG1 1  
ATOM 5564   C CG2 . VAL A 1 756 ? -82.190  11.677  -35.436 1.00 99.99  ? 760 VAL C CG2 1  
ATOM 5565   N N   . PHE A 1 757 ? -79.002  13.373  -37.040 1.00 30.00  ? 761 PHE C N   1  
ATOM 5566   C CA  . PHE A 1 757 ? -78.953  14.059  -38.313 1.00 30.00  ? 761 PHE C CA  1  
ATOM 5567   C C   . PHE A 1 757 ? -78.858  13.087  -39.464 1.00 30.00  ? 761 PHE C C   1  
ATOM 5568   O O   . PHE A 1 757 ? -77.851  12.398  -39.618 1.00 30.00  ? 761 PHE C O   1  
ATOM 5569   C CB  . PHE A 1 757 ? -77.737  14.977  -38.361 1.00 99.99  ? 761 PHE C CB  1  
ATOM 5570   C CG  . PHE A 1 757 ? -77.873  16.051  -37.311 1.00 99.99  ? 761 PHE C CG  1  
ATOM 5571   C CD1 . PHE A 1 757 ? -77.391  15.829  -36.016 1.00 99.99  ? 761 PHE C CD1 1  
ATOM 5572   C CD2 . PHE A 1 757 ? -78.482  17.271  -37.630 1.00 99.99  ? 761 PHE C CD2 1  
ATOM 5573   C CE1 . PHE A 1 757 ? -77.515  16.825  -35.039 1.00 99.99  ? 761 PHE C CE1 1  
ATOM 5574   C CE2 . PHE A 1 757 ? -78.612  18.267  -36.655 1.00 99.99  ? 761 PHE C CE2 1  
ATOM 5575   C CZ  . PHE A 1 757 ? -78.127  18.045  -35.360 1.00 99.99  ? 761 PHE C CZ  1  
ATOM 5576   N N   . PHE A 1 758 ? -79.904  13.027  -40.281 1.00 30.00  ? 762 PHE C N   1  
ATOM 5577   C CA  . PHE A 1 758 ? -79.908  12.128  -41.426 1.00 30.00  ? 762 PHE C CA  1  
ATOM 5578   C C   . PHE A 1 758 ? -79.734  12.904  -42.693 1.00 30.00  ? 762 PHE C C   1  
ATOM 5579   O O   . PHE A 1 758 ? -80.467  13.864  -42.951 1.00 30.00  ? 762 PHE C O   1  
ATOM 5580   C CB  . PHE A 1 758 ? -81.227  11.369  -41.485 1.00 99.99  ? 762 PHE C CB  1  
ATOM 5581   C CG  . PHE A 1 758 ? -81.363  10.495  -40.263 1.00 99.99  ? 762 PHE C CG  1  
ATOM 5582   C CD1 . PHE A 1 758 ? -81.952  11.006  -39.098 1.00 99.99  ? 762 PHE C CD1 1  
ATOM 5583   C CD2 . PHE A 1 758 ? -80.902  9.174   -40.291 1.00 99.99  ? 762 PHE C CD2 1  
ATOM 5584   C CE1 . PHE A 1 758 ? -82.080  10.196  -37.964 1.00 99.99  ? 762 PHE C CE1 1  
ATOM 5585   C CE2 . PHE A 1 758 ? -81.028  8.365   -39.155 1.00 99.99  ? 762 PHE C CE2 1  
ATOM 5586   C CZ  . PHE A 1 758 ? -81.616  8.874   -37.993 1.00 99.99  ? 762 PHE C CZ  1  
ATOM 5587   N N   . LYS A 1 759 ? -78.762  12.488  -43.494 1.00 30.00  ? 763 LYS C N   1  
ATOM 5588   C CA  . LYS A 1 759 ? -78.503  13.133  -44.763 1.00 30.00  ? 763 LYS C CA  1  
ATOM 5589   C C   . LYS A 1 759 ? -79.844  13.267  -45.483 1.00 30.00  ? 763 LYS C C   1  
ATOM 5590   O O   . LYS A 1 759 ? -80.866  12.771  -45.011 1.00 30.00  ? 763 LYS C O   1  
ATOM 5591   C CB  . LYS A 1 759 ? -77.534  12.289  -45.584 1.00 99.99  ? 763 LYS C CB  1  
ATOM 5592   C CG  . LYS A 1 759 ? -77.186  13.023  -46.876 1.00 99.99  ? 763 LYS C CG  1  
ATOM 5593   C CD  . LYS A 1 759 ? -75.919  12.424  -47.475 1.00 99.99  ? 763 LYS C CD  1  
ATOM 5594   C CE  . LYS A 1 759 ? -75.775  12.883  -48.921 1.00 99.99  ? 763 LYS C CE  1  
ATOM 5595   N NZ  . LYS A 1 759 ? -74.929  14.085  -48.974 1.00 99.99  ? 763 LYS C NZ  1  
ATOM 5596   N N   . ALA A 1 760 ? -79.846  13.927  -46.630 1.00 30.00  ? 764 ALA C N   1  
ATOM 5597   C CA  . ALA A 1 760 ? -81.079  14.118  -47.387 1.00 30.00  ? 764 ALA C CA  1  
ATOM 5598   C C   . ALA A 1 760 ? -81.707  12.820  -47.886 1.00 30.00  ? 764 ALA C C   1  
ATOM 5599   O O   . ALA A 1 760 ? -80.999  11.853  -48.168 1.00 30.00  ? 764 ALA C O   1  
ATOM 5600   C CB  . ALA A 1 760 ? -80.802  15.032  -48.560 1.00 30.00  ? 764 ALA C CB  1  
ATOM 5601   N N   . GLY A 1 761 ? -83.036  12.814  -47.992 1.00 30.00  ? 765 GLY C N   1  
ATOM 5602   C CA  . GLY A 1 761 ? -83.779  11.649  -48.473 1.00 30.00  ? 765 GLY C CA  1  
ATOM 5603   C C   . GLY A 1 761 ? -83.925  10.465  -47.534 1.00 30.00  ? 765 GLY C C   1  
ATOM 5604   O O   . GLY A 1 761 ? -84.986  9.837   -47.441 1.00 30.00  ? 765 GLY C O   1  
ATOM 5605   N N   . VAL A 1 762 ? -82.843  10.157  -46.839 1.00 30.00  ? 766 VAL C N   1  
ATOM 5606   C CA  . VAL A 1 762 ? -82.802  9.065   -45.902 1.00 30.00  ? 766 VAL C CA  1  
ATOM 5607   C C   . VAL A 1 762 ? -84.051  8.932   -45.030 1.00 30.00  ? 766 VAL C C   1  
ATOM 5608   O O   . VAL A 1 762 ? -84.599  7.843   -44.913 1.00 30.00  ? 766 VAL C O   1  
ATOM 5609   C CB  . VAL A 1 762 ? -81.619  9.239   -44.955 1.00 99.99  ? 766 VAL C CB  1  
ATOM 5610   C CG1 . VAL A 1 762 ? -80.322  9.262   -45.758 1.00 99.99  ? 766 VAL C CG1 1  
ATOM 5611   C CG2 . VAL A 1 762 ? -81.767  10.550  -44.189 1.00 99.99  ? 766 VAL C CG2 1  
ATOM 5612   N N   . LEU A 1 763 ? -84.515  10.021  -44.425 1.00 30.00  ? 767 LEU C N   1  
ATOM 5613   C CA  . LEU A 1 763 ? -85.701  9.938   -43.576 1.00 30.00  ? 767 LEU C CA  1  
ATOM 5614   C C   . LEU A 1 763 ? -86.942  9.511   -44.358 1.00 30.00  ? 767 LEU C C   1  
ATOM 5615   O O   . LEU A 1 763 ? -87.850  8.870   -43.818 1.00 30.00  ? 767 LEU C O   1  
ATOM 5616   C CB  . LEU A 1 763 ? -85.990  11.300  -42.952 1.00 99.99  ? 767 LEU C CB  1  
ATOM 5617   C CG  . LEU A 1 763 ? -85.354  11.368  -41.567 1.00 99.99  ? 767 LEU C CG  1  
ATOM 5618   C CD1 . LEU A 1 763 ? -85.905  12.576  -40.814 1.00 99.99  ? 767 LEU C CD1 1  
ATOM 5619   C CD2 . LEU A 1 763 ? -85.677  10.093  -40.796 1.00 99.99  ? 767 LEU C CD2 1  
ATOM 5620   N N   . GLY A 1 764 ? -86.987  9.878   -45.634 1.00 30.00  ? 768 GLY C N   1  
ATOM 5621   C CA  . GLY A 1 764 ? -88.130  9.496   -46.435 1.00 30.00  ? 768 GLY C CA  1  
ATOM 5622   C C   . GLY A 1 764 ? -88.109  7.992   -46.584 1.00 30.00  ? 768 GLY C C   1  
ATOM 5623   O O   . GLY A 1 764 ? -89.141  7.334   -46.527 1.00 30.00  ? 768 GLY C O   1  
ATOM 5624   N N   . ASN A 1 765 ? -86.898  7.472   -46.755 1.00 30.00  ? 769 ASN C N   1  
ATOM 5625   C CA  . ASN A 1 765 ? -86.645  6.048   -46.919 1.00 30.00  ? 769 ASN C CA  1  
ATOM 5626   C C   . ASN A 1 765 ? -86.841  5.228   -45.646 1.00 30.00  ? 769 ASN C C   1  
ATOM 5627   O O   . ASN A 1 765 ? -87.067  4.019   -45.701 1.00 30.00  ? 769 ASN C O   1  
ATOM 5628   C CB  . ASN A 1 765 ? -85.209  5.824   -47.374 1.00 99.99  ? 769 ASN C CB  1  
ATOM 5629   C CG  . ASN A 1 765 ? -84.958  6.455   -48.736 1.00 99.99  ? 769 ASN C CG  1  
ATOM 5630   O OD1 . ASN A 1 765 ? -85.680  6.180   -49.693 1.00 99.99  ? 769 ASN C OD1 1  
ATOM 5631   N ND2 . ASN A 1 765 ? -83.933  7.304   -48.824 1.00 99.99  ? 769 ASN C ND2 1  
ATOM 5632   N N   . LEU A 1 766 ? -86.744  5.883   -44.496 1.00 30.00  ? 770 LEU C N   1  
ATOM 5633   C CA  . LEU A 1 766 ? -86.926  5.209   -43.229 1.00 30.00  ? 770 LEU C CA  1  
ATOM 5634   C C   . LEU A 1 766 ? -88.419  5.066   -43.027 1.00 30.00  ? 770 LEU C C   1  
ATOM 5635   O O   . LEU A 1 766 ? -88.877  4.103   -42.420 1.00 30.00  ? 770 LEU C O   1  
ATOM 5636   C CB  . LEU A 1 766 ? -86.305  6.033   -42.107 1.00 99.99  ? 770 LEU C CB  1  
ATOM 5637   C CG  . LEU A 1 766 ? -84.886  5.546   -41.842 1.00 99.99  ? 770 LEU C CG  1  
ATOM 5638   C CD1 . LEU A 1 766 ? -84.385  6.131   -40.524 1.00 99.99  ? 770 LEU C CD1 1  
ATOM 5639   C CD2 . LEU A 1 766 ? -84.880  4.022   -41.758 1.00 99.99  ? 770 LEU C CD2 1  
ATOM 5640   N N   . GLU A 1 767 ? -89.182  6.028   -43.536 1.00 30.00  ? 771 GLU C N   1  
ATOM 5641   C CA  . GLU A 1 767 ? -90.629  5.969   -43.400 1.00 30.00  ? 771 GLU C CA  1  
ATOM 5642   C C   . GLU A 1 767 ? -91.121  4.903   -44.377 1.00 30.00  ? 771 GLU C C   1  
ATOM 5643   O O   . GLU A 1 767 ? -92.259  4.435   -44.291 1.00 30.00  ? 771 GLU C O   1  
ATOM 5644   C CB  . GLU A 1 767 ? -91.236  7.327   -43.731 1.00 99.99  ? 771 GLU C CB  1  
ATOM 5645   C CG  . GLU A 1 767 ? -92.440  7.569   -42.857 1.00 99.99  ? 771 GLU C CG  1  
ATOM 5646   C CD  . GLU A 1 767 ? -93.526  6.551   -43.189 1.00 99.99  ? 771 GLU C CD  1  
ATOM 5647   O OE1 . GLU A 1 767 ? -93.519  5.465   -42.548 1.00 99.99  ? 771 GLU C OE1 1  
ATOM 5648   O OE2 . GLU A 1 767 ? -94.357  6.864   -44.085 1.00 99.99  ? 771 GLU C OE2 1  
ATOM 5649   N N   . GLU A 1 768 ? -90.242  4.529   -45.305 1.00 30.00  ? 772 GLU C N   1  
ATOM 5650   C CA  . GLU A 1 768 ? -90.556  3.506   -46.287 1.00 30.00  ? 772 GLU C CA  1  
ATOM 5651   C C   . GLU A 1 768 ? -90.503  2.234   -45.453 1.00 30.00  ? 772 GLU C C   1  
ATOM 5652   O O   . GLU A 1 768 ? -91.537  1.614   -45.184 1.00 30.00  ? 772 GLU C O   1  
ATOM 5653   C CB  . GLU A 1 768 ? -89.518  3.526   -47.404 1.00 99.99  ? 772 GLU C CB  1  
ATOM 5654   C CG  . GLU A 1 768 ? -90.118  2.937   -48.660 1.00 99.99  ? 772 GLU C CG  1  
ATOM 5655   C CD  . GLU A 1 768 ? -89.978  1.417   -48.627 1.00 99.99  ? 772 GLU C CD  1  
ATOM 5656   O OE1 . GLU A 1 768 ? -90.915  0.763   -48.103 1.00 99.99  ? 772 GLU C OE1 1  
ATOM 5657   O OE2 . GLU A 1 768 ? -88.929  0.925   -49.129 1.00 99.99  ? 772 GLU C OE2 1  
ATOM 5658   N N   . MET A 1 769 ? -89.294  1.858   -45.035 1.00 30.00  ? 773 MET C N   1  
ATOM 5659   C CA  . MET A 1 769 ? -89.083  0.662   -44.223 1.00 30.00  ? 773 MET C CA  1  
ATOM 5660   C C   . MET A 1 769 ? -90.040  0.626   -43.040 1.00 30.00  ? 773 MET C C   1  
ATOM 5661   O O   . MET A 1 769 ? -90.465  -0.434  -42.609 1.00 30.00  ? 773 MET C O   1  
ATOM 5662   C CB  . MET A 1 769 ? -87.656  0.644   -43.687 1.00 99.99  ? 773 MET C CB  1  
ATOM 5663   C CG  . MET A 1 769 ? -86.680  0.887   -44.831 1.00 99.99  ? 773 MET C CG  1  
ATOM 5664   S SD  . MET A 1 769 ? -86.425  -0.643  -45.763 1.00 99.99  ? 773 MET C SD  1  
ATOM 5665   C CE  . MET A 1 769 ? -85.351  -1.515  -44.642 1.00 99.99  ? 773 MET C CE  1  
ATOM 5666   N N   . ARG A 1 770 ? -90.382  1.792   -42.519 1.00 30.00  ? 774 ARG C N   1  
ATOM 5667   C CA  . ARG A 1 770 ? -91.288  1.859   -41.390 1.00 30.00  ? 774 ARG C CA  1  
ATOM 5668   C C   . ARG A 1 770 ? -92.645  1.293   -41.769 1.00 30.00  ? 774 ARG C C   1  
ATOM 5669   O O   . ARG A 1 770 ? -93.269  0.597   -40.983 1.00 30.00  ? 774 ARG C O   1  
ATOM 5670   C CB  . ARG A 1 770 ? -91.463  3.309   -40.952 1.00 99.99  ? 774 ARG C CB  1  
ATOM 5671   C CG  . ARG A 1 770 ? -92.317  3.363   -39.689 1.00 99.99  ? 774 ARG C CG  1  
ATOM 5672   C CD  . ARG A 1 770 ? -92.594  4.816   -39.324 1.00 99.99  ? 774 ARG C CD  1  
ATOM 5673   N NE  . ARG A 1 770 ? -93.534  5.434   -40.284 1.00 99.99  ? 774 ARG C NE  1  
ATOM 5674   C CZ  . ARG A 1 770 ? -94.000  6.674   -40.146 1.00 99.99  ? 774 ARG C CZ  1  
ATOM 5675   N NH1 . ARG A 1 770 ? -93.650  7.448   -39.125 1.00 99.99  ? 774 ARG C NH1 1  
ATOM 5676   N NH2 . ARG A 1 770 ? -94.842  7.133   -41.071 1.00 99.99  ? 774 ARG C NH2 1  
ATOM 5677   N N   . ASP A 1 771 ? -93.105  1.592   -42.975 1.00 30.00  ? 775 ASP C N   1  
ATOM 5678   C CA  . ASP A 1 771 ? -94.409  1.104   -43.424 1.00 30.00  ? 775 ASP C CA  1  
ATOM 5679   C C   . ASP A 1 771 ? -94.409  -0.368  -43.802 1.00 30.00  ? 775 ASP C C   1  
ATOM 5680   O O   . ASP A 1 771 ? -95.360  -1.092  -43.500 1.00 30.00  ? 775 ASP C O   1  
ATOM 5681   C CB  . ASP A 1 771 ? -94.860  1.889   -44.654 1.00 99.99  ? 775 ASP C CB  1  
ATOM 5682   C CG  . ASP A 1 771 ? -95.254  3.304   -44.241 1.00 99.99  ? 775 ASP C CG  1  
ATOM 5683   O OD1 . ASP A 1 771 ? -96.123  3.420   -43.336 1.00 99.99  ? 775 ASP C OD1 1  
ATOM 5684   O OD2 . ASP A 1 771 ? -94.682  4.258   -44.834 1.00 99.99  ? 775 ASP C OD2 1  
ATOM 5685   N N   . GLU A 1 772 ? -93.438  -0.512  -44.545 1.00 30.00  ? 776 GLU C N   1  
ATOM 5686   C CA  . GLU A 1 772 ? -93.360  -1.929  -44.865 1.00 30.00  ? 776 GLU C CA  1  
ATOM 5687   C C   . GLU A 1 772 ? -93.614  -2.793  -43.624 1.00 30.00  ? 776 GLU C C   1  
ATOM 5688   O O   . GLU A 1 772 ? -94.556  -3.582  -43.607 1.00 30.00  ? 776 GLU C O   1  
ATOM 5689   C CB  . GLU A 1 772 ? -91.973  -2.262  -45.407 1.00 99.99  ? 776 GLU C CB  1  
ATOM 5690   C CG  . GLU A 1 772 ? -91.757  -1.547  -46.719 1.00 99.99  ? 776 GLU C CG  1  
ATOM 5691   C CD  . GLU A 1 772 ? -92.612  -2.202  -47.801 1.00 99.99  ? 776 GLU C CD  1  
ATOM 5692   O OE1 . GLU A 1 772 ? -93.777  -1.752  -47.967 1.00 99.99  ? 776 GLU C OE1 1  
ATOM 5693   O OE2 . GLU A 1 772 ? -92.093  -3.146  -48.453 1.00 99.99  ? 776 GLU C OE2 1  
ATOM 5694   N N   . ARG A 1 773 ? -92.786  -2.642  -42.596 1.00 30.00  ? 777 ARG C N   1  
ATOM 5695   C CA  . ARG A 1 773 ? -92.935  -3.412  -41.360 1.00 30.00  ? 777 ARG C CA  1  
ATOM 5696   C C   . ARG A 1 773 ? -94.329  -3.291  -40.790 1.00 30.00  ? 777 ARG C C   1  
ATOM 5697   O O   . ARG A 1 773 ? -94.942  -4.282  -40.411 1.00 30.00  ? 777 ARG C O   1  
ATOM 5698   C CB  . ARG A 1 773 ? -91.947  -2.907  -40.313 1.00 99.99  ? 777 ARG C CB  1  
ATOM 5699   C CG  . ARG A 1 773 ? -90.547  -3.411  -40.642 1.00 99.99  ? 777 ARG C CG  1  
ATOM 5700   C CD  . ARG A 1 773 ? -89.571  -2.947  -39.568 1.00 99.99  ? 777 ARG C CD  1  
ATOM 5701   N NE  . ARG A 1 773 ? -88.184  -3.340  -39.905 1.00 99.99  ? 777 ARG C NE  1  
ATOM 5702   C CZ  . ARG A 1 773 ? -87.645  -4.497  -39.527 1.00 99.99  ? 777 ARG C CZ  1  
ATOM 5703   N NH1 . ARG A 1 773 ? -88.325  -5.388  -38.808 1.00 99.99  ? 777 ARG C NH1 1  
ATOM 5704   N NH2 . ARG A 1 773 ? -86.393  -4.748  -39.886 1.00 99.99  ? 777 ARG C NH2 1  
ATOM 5705   N N   . LEU A 1 774 ? -94.844  -2.077  -40.729 1.00 30.00  ? 778 LEU C N   1  
ATOM 5706   C CA  . LEU A 1 774 ? -96.171  -1.894  -40.193 1.00 30.00  ? 778 LEU C CA  1  
ATOM 5707   C C   . LEU A 1 774 ? -97.216  -2.649  -41.003 1.00 30.00  ? 778 LEU C C   1  
ATOM 5708   O O   . LEU A 1 774 ? -98.261  -3.039  -40.481 1.00 30.00  ? 778 LEU C O   1  
ATOM 5709   C CB  . LEU A 1 774 ? -96.535  -0.412  -40.204 1.00 99.99  ? 778 LEU C CB  1  
ATOM 5710   C CG  . LEU A 1 774 ? -96.205  0.207   -38.849 1.00 99.99  ? 778 LEU C CG  1  
ATOM 5711   C CD1 . LEU A 1 774 ? -96.862  1.579   -38.744 1.00 99.99  ? 778 LEU C CD1 1  
ATOM 5712   C CD2 . LEU A 1 774 ? -96.732  -0.698  -37.738 1.00 99.99  ? 778 LEU C CD2 1  
ATOM 5713   N N   . SER A 1 775 ? -96.954  -2.862  -42.286 1.00 30.00  ? 779 SER C N   1  
ATOM 5714   C CA  . SER A 1 775 ? -97.931  -3.583  -43.091 1.00 30.00  ? 779 SER C CA  1  
ATOM 5715   C C   . SER A 1 775 ? -97.821  -5.061  -42.777 1.00 30.00  ? 779 SER C C   1  
ATOM 5716   O O   . SER A 1 775 ? -98.831  -5.721  -42.538 1.00 30.00  ? 779 SER C O   1  
ATOM 5717   C CB  . SER A 1 775 ? -97.655  -3.350  -44.574 1.00 99.99  ? 779 SER C CB  1  
ATOM 5718   O OG  . SER A 1 775 ? -96.424  -3.980  -44.934 1.00 99.99  ? 779 SER C OG  1  
ATOM 5719   N N   . LYS A 1 776 ? -96.595  -5.573  -42.779 1.00 30.00  ? 780 LYS C N   1  
ATOM 5720   C CA  . LYS A 1 776 ? -96.337  -6.975  -42.478 1.00 30.00  ? 780 LYS C CA  1  
ATOM 5721   C C   . LYS A 1 776 ? -97.027  -7.317  -41.161 1.00 30.00  ? 780 LYS C C   1  
ATOM 5722   O O   . LYS A 1 776 ? -97.977  -8.097  -41.118 1.00 30.00  ? 780 LYS C O   1  
ATOM 5723   C CB  . LYS A 1 776 ? -94.838  -7.212  -42.353 1.00 99.99  ? 780 LYS C CB  1  
ATOM 5724   C CG  . LYS A 1 776 ? -94.572  -8.696  -42.137 1.00 99.99  ? 780 LYS C CG  1  
ATOM 5725   C CD  . LYS A 1 776 ? -93.114  -9.004  -42.454 1.00 99.99  ? 780 LYS C CD  1  
ATOM 5726   C CE  . LYS A 1 776 ? -92.751  -10.376 -41.894 1.00 99.99  ? 780 LYS C CE  1  
ATOM 5727   N NZ  . LYS A 1 776 ? -92.927  -11.394 -42.940 1.00 99.99  ? 780 LYS C NZ  1  
ATOM 5728   N N   . ILE A 1 777 ? -96.532  -6.720  -40.089 1.00 30.00  ? 781 ILE C N   1  
ATOM 5729   C CA  . ILE A 1 777 ? -97.080  -6.944  -38.767 1.00 30.00  ? 781 ILE C CA  1  
ATOM 5730   C C   . ILE A 1 777 ? -98.599  -7.007  -38.789 1.00 30.00  ? 781 ILE C C   1  
ATOM 5731   O O   . ILE A 1 777 ? -99.199  -7.849  -38.118 1.00 30.00  ? 781 ILE C O   1  
ATOM 5732   C CB  . ILE A 1 777 ? -96.668  -5.807  -37.836 1.00 99.99  ? 781 ILE C CB  1  
ATOM 5733   C CG1 . ILE A 1 777 ? -97.664  -4.659  -37.962 1.00 99.99  ? 781 ILE C CG1 1  
ATOM 5734   C CG2 . ILE A 1 777 ? -95.276  -5.319  -38.219 1.00 99.99  ? 781 ILE C CG2 1  
ATOM 5735   C CD1 . ILE A 1 777 ? -98.732  -4.791  -36.883 1.00 99.99  ? 781 ILE C CD1 1  
ATOM 5736   N N   . ILE A 1 778 ? -99.223  -6.134  -39.563 1.00 30.00  ? 782 ILE C N   1  
ATOM 5737   C CA  . ILE A 1 778 ? -100.685 -6.115  -39.648 1.00 30.00  ? 782 ILE C CA  1  
ATOM 5738   C C   . ILE A 1 778 ? -101.182 -7.370  -40.332 1.00 30.00  ? 782 ILE C C   1  
ATOM 5739   O O   . ILE A 1 778 ? -102.264 -7.860  -40.045 1.00 30.00  ? 782 ILE C O   1  
ATOM 5740   C CB  . ILE A 1 778 ? -101.143 -4.898  -40.444 1.00 99.99  ? 782 ILE C CB  1  
ATOM 5741   C CG1 . ILE A 1 778 ? -100.435 -3.652  -39.923 1.00 99.99  ? 782 ILE C CG1 1  
ATOM 5742   C CG2 . ILE A 1 778 ? -102.650 -4.728  -40.290 1.00 99.99  ? 782 ILE C CG2 1  
ATOM 5743   C CD1 . ILE A 1 778 ? -100.990 -3.289  -38.549 1.00 99.99  ? 782 ILE C CD1 1  
ATOM 5744   N N   . SER A 1 779 ? -100.386 -7.873  -41.258 1.00 30.00  ? 783 SER C N   1  
ATOM 5745   C CA  . SER A 1 779 ? -100.733 -9.071  -41.986 1.00 30.00  ? 783 SER C CA  1  
ATOM 5746   C C   . SER A 1 779 ? -100.588 -10.245 -41.024 1.00 30.00  ? 783 SER C C   1  
ATOM 5747   O O   . SER A 1 779 ? -101.470 -11.102 -40.936 1.00 30.00  ? 783 SER C O   1  
ATOM 5748   C CB  . SER A 1 779 ? -99.800  -9.245  -43.179 1.00 99.99  ? 783 SER C CB  1  
ATOM 5749   O OG  . SER A 1 779 ? -98.479  -9.533  -42.716 1.00 99.99  ? 783 SER C OG  1  
ATOM 5750   N N   . MET A 1 780 ? -99.463  -10.259 -40.299 1.00 30.00  ? 784 MET C N   1  
ATOM 5751   C CA  . MET A 1 780 ? -99.149  -11.304 -39.337 1.00 30.00  ? 784 MET C CA  1  
ATOM 5752   C C   . MET A 1 780 ? -100.190 -11.459 -38.261 1.00 30.00  ? 784 MET C C   1  
ATOM 5753   O O   . MET A 1 780 ? -100.360 -12.551 -37.716 1.00 30.00  ? 784 MET C O   1  
ATOM 5754   C CB  . MET A 1 780 ? -97.825  -10.991 -38.649 1.00 99.99  ? 784 MET C CB  1  
ATOM 5755   C CG  . MET A 1 780 ? -97.172  -12.289 -38.189 1.00 99.99  ? 784 MET C CG  1  
ATOM 5756   S SD  . MET A 1 780 ? -96.752  -13.312 -39.622 1.00 99.99  ? 784 MET C SD  1  
ATOM 5757   C CE  . MET A 1 780 ? -95.464  -12.319 -40.347 1.00 99.99  ? 784 MET C CE  1  
ATOM 5758   N N   . PHE A 1 781 ? -100.892 -10.383 -37.947 1.00 30.00  ? 785 PHE C N   1  
ATOM 5759   C CA  . PHE A 1 781 ? -101.932 -10.431 -36.937 1.00 30.00  ? 785 PHE C CA  1  
ATOM 5760   C C   . PHE A 1 781 ? -103.220 -10.860 -37.620 1.00 30.00  ? 785 PHE C C   1  
ATOM 5761   O O   . PHE A 1 781 ? -104.188 -11.278 -36.977 1.00 30.00  ? 785 PHE C O   1  
ATOM 5762   C CB  . PHE A 1 781 ? -102.102 -9.053  -36.303 1.00 99.99  ? 785 PHE C CB  1  
ATOM 5763   C CG  . PHE A 1 781 ? -103.184 -9.114  -35.251 1.00 99.99  ? 785 PHE C CG  1  
ATOM 5764   C CD1 . PHE A 1 781 ? -102.882 -9.565  -33.962 1.00 99.99  ? 785 PHE C CD1 1  
ATOM 5765   C CD2 . PHE A 1 781 ? -104.491 -8.721  -35.568 1.00 99.99  ? 785 PHE C CD2 1  
ATOM 5766   C CE1 . PHE A 1 781 ? -103.885 -9.621  -32.987 1.00 99.99  ? 785 PHE C CE1 1  
ATOM 5767   C CE2 . PHE A 1 781 ? -105.494 -8.778  -34.591 1.00 99.99  ? 785 PHE C CE2 1  
ATOM 5768   C CZ  . PHE A 1 781 ? -105.191 -9.226  -33.302 1.00 99.99  ? 785 PHE C CZ  1  
ATOM 5769   N N   . GLN A 1 782 ? -103.240 -10.740 -38.938 1.00 30.00  ? 786 GLN C N   1  
ATOM 5770   C CA  . GLN A 1 782 ? -104.413 -11.143 -39.685 1.00 30.00  ? 786 GLN C CA  1  
ATOM 5771   C C   . GLN A 1 782 ? -104.224 -12.636 -39.943 1.00 30.00  ? 786 GLN C C   1  
ATOM 5772   O O   . GLN A 1 782 ? -105.191 -13.394 -40.002 1.00 30.00  ? 786 GLN C O   1  
ATOM 5773   C CB  . GLN A 1 782 ? -104.491 -10.353 -40.988 1.00 99.99  ? 786 GLN C CB  1  
ATOM 5774   C CG  . GLN A 1 782 ? -105.937 -10.308 -41.469 1.00 99.99  ? 786 GLN C CG  1  
ATOM 5775   C CD  . GLN A 1 782 ? -106.285 -11.550 -42.277 1.00 99.99  ? 786 GLN C CD  1  
ATOM 5776   O OE1 . GLN A 1 782 ? -105.445 -12.425 -42.467 1.00 99.99  ? 786 GLN C OE1 1  
ATOM 5777   N NE2 . GLN A 1 782 ? -107.529 -11.624 -42.755 1.00 99.99  ? 786 GLN C NE2 1  
ATOM 5778   N N   . ALA A 1 783 ? -102.965 -13.039 -40.080 1.00 30.00  ? 787 ALA C N   1  
ATOM 5779   C CA  . ALA A 1 783 ? -102.602 -14.426 -40.304 1.00 30.00  ? 787 ALA C CA  1  
ATOM 5780   C C   . ALA A 1 783 ? -102.987 -15.144 -39.020 1.00 30.00  ? 787 ALA C C   1  
ATOM 5781   O O   . ALA A 1 783 ? -103.594 -16.219 -39.045 1.00 30.00  ? 787 ALA C O   1  
ATOM 5782   C CB  . ALA A 1 783 ? -101.110 -14.541 -40.529 1.00 30.00  ? 787 ALA C CB  1  
ATOM 5783   N N   . HIS A 1 784 ? -102.625 -14.520 -37.906 1.00 30.00  ? 788 HIS C N   1  
ATOM 5784   C CA  . HIS A 1 784 ? -102.907 -15.034 -36.568 1.00 30.00  ? 788 HIS C CA  1  
ATOM 5785   C C   . HIS A 1 784 ? -104.398 -15.202 -36.373 1.00 30.00  ? 788 HIS C C   1  
ATOM 5786   O O   . HIS A 1 784 ? -104.839 -16.112 -35.677 1.00 30.00  ? 788 HIS C O   1  
ATOM 5787   C CB  . HIS A 1 784 ? -102.377 -14.067 -35.517 1.00 99.99  ? 788 HIS C CB  1  
ATOM 5788   C CG  . HIS A 1 784 ? -102.393 -14.584 -34.100 1.00 99.99  ? 788 HIS C CG  1  
ATOM 5789   N ND1 . HIS A 1 784 ? -103.095 -13.943 -33.087 1.00 99.99  ? 788 HIS C ND1 1  
ATOM 5790   C CD2 . HIS A 1 784 ? -101.801 -15.671 -33.534 1.00 99.99  ? 788 HIS C CD2 1  
ATOM 5791   C CE1 . HIS A 1 784 ? -102.920 -14.630 -31.972 1.00 99.99  ? 788 HIS C CE1 1  
ATOM 5792   N NE2 . HIS A 1 784 ? -102.152 -15.661 -32.221 1.00 99.99  ? 788 HIS C NE2 1  
ATOM 5793   N N   . ILE A 1 785 ? -105.172 -14.305 -36.973 1.00 30.00  ? 789 ILE C N   1  
ATOM 5794   C CA  . ILE A 1 785 ? -106.620 -14.367 -36.860 1.00 30.00  ? 789 ILE C CA  1  
ATOM 5795   C C   . ILE A 1 785 ? -107.151 -15.444 -37.800 1.00 30.00  ? 789 ILE C C   1  
ATOM 5796   O O   . ILE A 1 785 ? -108.184 -16.066 -37.541 1.00 30.00  ? 789 ILE C O   1  
ATOM 5797   C CB  . ILE A 1 785 ? -107.228 -13.021 -37.233 1.00 99.99  ? 789 ILE C CB  1  
ATOM 5798   C CG1 . ILE A 1 785 ? -107.430 -12.957 -38.743 1.00 99.99  ? 789 ILE C CG1 1  
ATOM 5799   C CG2 . ILE A 1 785 ? -106.288 -11.901 -36.801 1.00 99.99  ? 789 ILE C CG2 1  
ATOM 5800   C CD1 . ILE A 1 785 ? -108.857 -13.387 -39.081 1.00 99.99  ? 789 ILE C CD1 1  
ATOM 5801   N N   . ARG A 1 786 ? -106.443 -15.672 -38.898 1.00 30.00  ? 790 ARG C N   1  
ATOM 5802   C CA  . ARG A 1 786 ? -106.864 -16.673 -39.856 1.00 30.00  ? 790 ARG C CA  1  
ATOM 5803   C C   . ARG A 1 786 ? -106.614 -18.045 -39.266 1.00 30.00  ? 790 ARG C C   1  
ATOM 5804   O O   . ARG A 1 786 ? -107.449 -18.934 -39.373 1.00 30.00  ? 790 ARG C O   1  
ATOM 5805   C CB  . ARG A 1 786 ? -106.079 -16.517 -41.153 1.00 99.99  ? 790 ARG C CB  1  
ATOM 5806   C CG  . ARG A 1 786 ? -106.615 -15.321 -41.934 1.00 99.99  ? 790 ARG C CG  1  
ATOM 5807   C CD  . ARG A 1 786 ? -105.862 -15.195 -43.252 1.00 99.99  ? 790 ARG C CD  1  
ATOM 5808   N NE  . ARG A 1 786 ? -106.290 -13.987 -43.994 1.00 99.99  ? 790 ARG C NE  1  
ATOM 5809   C CZ  . ARG A 1 786 ? -107.294 -13.993 -44.868 1.00 99.99  ? 790 ARG C CZ  1  
ATOM 5810   N NH1 . ARG A 1 786 ? -107.987 -15.094 -45.137 1.00 99.99  ? 790 ARG C NH1 1  
ATOM 5811   N NH2 . ARG A 1 786 ? -107.596 -12.852 -45.477 1.00 99.99  ? 790 ARG C NH2 1  
ATOM 5812   N N   . GLY A 1 787 ? -105.448 -18.191 -38.633 1.00 30.00  ? 791 GLY C N   1  
ATOM 5813   C CA  . GLY A 1 787 ? -105.077 -19.447 -38.017 1.00 30.00  ? 791 GLY C CA  1  
ATOM 5814   C C   . GLY A 1 787 ? -105.903 -19.772 -36.784 1.00 30.00  ? 791 GLY C C   1  
ATOM 5815   O O   . GLY A 1 787 ? -106.114 -20.936 -36.476 1.00 30.00  ? 791 GLY C O   1  
ATOM 5816   N N   . TYR A 1 788 ? -106.376 -18.753 -36.075 1.00 30.00  ? 792 TYR C N   1  
ATOM 5817   C CA  . TYR A 1 788 ? -107.177 -18.985 -34.876 1.00 30.00  ? 792 TYR C CA  1  
ATOM 5818   C C   . TYR A 1 788 ? -108.528 -19.537 -35.274 1.00 30.00  ? 792 TYR C C   1  
ATOM 5819   O O   . TYR A 1 788 ? -108.967 -20.544 -34.728 1.00 30.00  ? 792 TYR C O   1  
ATOM 5820   C CB  . TYR A 1 788 ? -107.368 -17.675 -34.121 1.00 99.99  ? 792 TYR C CB  1  
ATOM 5821   C CG  . TYR A 1 788 ? -108.812 -17.243 -34.215 1.00 99.99  ? 792 TYR C CG  1  
ATOM 5822   C CD1 . TYR A 1 788 ? -109.590 -17.644 -35.307 1.00 99.99  ? 792 TYR C CD1 1  
ATOM 5823   C CD2 . TYR A 1 788 ? -109.371 -16.442 -33.213 1.00 99.99  ? 792 TYR C CD2 1  
ATOM 5824   C CE1 . TYR A 1 788 ? -110.930 -17.246 -35.397 1.00 99.99  ? 792 TYR C CE1 1  
ATOM 5825   C CE2 . TYR A 1 788 ? -110.708 -16.041 -33.303 1.00 99.99  ? 792 TYR C CE2 1  
ATOM 5826   C CZ  . TYR A 1 788 ? -111.489 -16.444 -34.394 1.00 99.99  ? 792 TYR C CZ  1  
ATOM 5827   O OH  . TYR A 1 788 ? -112.791 -16.055 -34.480 1.00 99.99  ? 792 TYR C OH  1  
ATOM 5828   N N   . LEU A 1 789 ? -109.185 -18.872 -36.222 1.00 30.00  ? 793 LEU C N   1  
ATOM 5829   C CA  . LEU A 1 789 ? -110.501 -19.292 -36.700 1.00 30.00  ? 793 LEU C CA  1  
ATOM 5830   C C   . LEU A 1 789 ? -110.476 -20.704 -37.299 1.00 30.00  ? 793 LEU C C   1  
ATOM 5831   O O   . LEU A 1 789 ? -111.419 -21.490 -37.108 1.00 30.00  ? 793 LEU C O   1  
ATOM 5832   C CB  . LEU A 1 789 ? -110.990 -18.334 -37.780 1.00 99.99  ? 793 LEU C CB  1  
ATOM 5833   C CG  . LEU A 1 789 ? -112.304 -18.847 -38.358 1.00 99.99  ? 793 LEU C CG  1  
ATOM 5834   C CD1 . LEU A 1 789 ? -112.755 -17.925 -39.488 1.00 99.99  ? 793 LEU C CD1 1  
ATOM 5835   C CD2 . LEU A 1 789 ? -112.106 -20.257 -38.901 1.00 99.99  ? 793 LEU C CD2 1  
ATOM 5836   N N   . ILE A 1 790 ? -109.408 -21.029 -38.029 1.00 30.00  ? 794 ILE C N   1  
ATOM 5837   C CA  . ILE A 1 790 ? -109.276 -22.354 -38.629 1.00 30.00  ? 794 ILE C CA  1  
ATOM 5838   C C   . ILE A 1 790 ? -109.253 -23.368 -37.477 1.00 30.00  ? 794 ILE C C   1  
ATOM 5839   O O   . ILE A 1 790 ? -110.185 -24.154 -37.323 1.00 30.00  ? 794 ILE C O   1  
ATOM 5840   C CB  . ILE A 1 790 ? -107.982 -22.429 -39.434 1.00 99.99  ? 794 ILE C CB  1  
ATOM 5841   C CG1 . ILE A 1 790 ? -106.831 -22.821 -38.511 1.00 99.99  ? 794 ILE C CG1 1  
ATOM 5842   C CG2 . ILE A 1 790 ? -107.691 -21.066 -40.056 1.00 99.99  ? 794 ILE C CG2 1  
ATOM 5843   C CD1 . ILE A 1 790 ? -106.632 -24.333 -38.567 1.00 99.99  ? 794 ILE C CD1 1  
ATOM 5844   N N   . ARG A 1 791 ? -108.199 -23.334 -36.666 1.00 30.00  ? 795 ARG C N   1  
ATOM 5845   C CA  . ARG A 1 791 ? -108.034 -24.243 -35.526 1.00 30.00  ? 795 ARG C CA  1  
ATOM 5846   C C   . ARG A 1 791 ? -109.249 -24.319 -34.590 1.00 30.00  ? 795 ARG C C   1  
ATOM 5847   O O   . ARG A 1 791 ? -109.487 -25.337 -33.935 1.00 30.00  ? 795 ARG C O   1  
ATOM 5848   C CB  . ARG A 1 791 ? -106.851 -23.794 -34.673 1.00 99.99  ? 795 ARG C CB  1  
ATOM 5849   C CG  . ARG A 1 791 ? -105.552 -24.064 -35.422 1.00 99.99  ? 795 ARG C CG  1  
ATOM 5850   C CD  . ARG A 1 791 ? -104.384 -24.049 -34.440 1.00 99.99  ? 795 ARG C CD  1  
ATOM 5851   N NE  . ARG A 1 791 ? -104.145 -22.681 -33.928 1.00 99.99  ? 795 ARG C NE  1  
ATOM 5852   C CZ  . ARG A 1 791 ? -103.445 -21.771 -34.597 1.00 99.99  ? 795 ARG C CZ  1  
ATOM 5853   N NH1 . ARG A 1 791 ? -102.906 -22.028 -35.785 1.00 99.99  ? 795 ARG C NH1 1  
ATOM 5854   N NH2 . ARG A 1 791 ? -103.289 -20.569 -34.044 1.00 99.99  ? 795 ARG C NH2 1  
ATOM 5855   N N   . LYS A 1 792 ? -110.019 -23.244 -34.524 1.00 30.00  ? 796 LYS C N   1  
ATOM 5856   C CA  . LYS A 1 792 ? -111.192 -23.225 -33.674 1.00 30.00  ? 796 LYS C CA  1  
ATOM 5857   C C   . LYS A 1 792 ? -112.186 -24.243 -34.212 1.00 30.00  ? 796 LYS C C   1  
ATOM 5858   O O   . LYS A 1 792 ? -112.838 -24.961 -33.462 1.00 30.00  ? 796 LYS C O   1  
ATOM 5859   C CB  . LYS A 1 792 ? -111.815 -21.834 -33.684 1.00 99.99  ? 796 LYS C CB  1  
ATOM 5860   C CG  . LYS A 1 792 ? -112.988 -21.795 -32.712 1.00 99.99  ? 796 LYS C CG  1  
ATOM 5861   C CD  . LYS A 1 792 ? -113.326 -20.345 -32.380 1.00 99.99  ? 796 LYS C CD  1  
ATOM 5862   C CE  . LYS A 1 792 ? -114.703 -20.280 -31.724 1.00 99.99  ? 796 LYS C CE  1  
ATOM 5863   N NZ  . LYS A 1 792 ? -114.548 -20.311 -30.261 1.00 99.99  ? 796 LYS C NZ  1  
ATOM 5864   N N   . ALA A 1 793 ? -112.306 -24.286 -35.526 1.00 30.00  ? 797 ALA C N   1  
ATOM 5865   C CA  . ALA A 1 793 ? -113.215 -25.226 -36.142 1.00 30.00  ? 797 ALA C CA  1  
ATOM 5866   C C   . ALA A 1 793 ? -112.368 -26.420 -36.572 1.00 30.00  ? 797 ALA C C   1  
ATOM 5867   O O   . ALA A 1 793 ? -112.059 -26.588 -37.747 1.00 30.00  ? 797 ALA C O   1  
ATOM 5868   C CB  . ALA A 1 793 ? -113.892 -24.585 -37.344 1.00 30.00  ? 797 ALA C CB  1  
ATOM 5869   N N   . TYR A 1 794 ? -111.972 -27.240 -35.610 1.00 30.00  ? 798 TYR C N   1  
ATOM 5870   C CA  . TYR A 1 794 ? -111.172 -28.420 -35.921 1.00 30.00  ? 798 TYR C CA  1  
ATOM 5871   C C   . TYR A 1 794 ? -111.878 -29.614 -35.334 1.00 30.00  ? 798 TYR C C   1  
ATOM 5872   O O   . TYR A 1 794 ? -111.802 -30.718 -35.872 1.00 30.00  ? 798 TYR C O   1  
ATOM 5873   C CB  . TYR A 1 794 ? -109.780 -28.275 -35.314 1.00 99.99  ? 798 TYR C CB  1  
ATOM 5874   C CG  . TYR A 1 794 ? -108.958 -29.497 -35.642 1.00 99.99  ? 798 TYR C CG  1  
ATOM 5875   C CD1 . TYR A 1 794 ? -108.304 -29.593 -36.875 1.00 99.99  ? 798 TYR C CD1 1  
ATOM 5876   C CD2 . TYR A 1 794 ? -108.847 -30.537 -34.710 1.00 99.99  ? 798 TYR C CD2 1  
ATOM 5877   C CE1 . TYR A 1 794 ? -107.540 -30.726 -37.180 1.00 99.99  ? 798 TYR C CE1 1  
ATOM 5878   C CE2 . TYR A 1 794 ? -108.082 -31.670 -35.013 1.00 99.99  ? 798 TYR C CE2 1  
ATOM 5879   C CZ  . TYR A 1 794 ? -107.430 -31.763 -36.248 1.00 99.99  ? 798 TYR C CZ  1  
ATOM 5880   O OH  . TYR A 1 794 ? -106.687 -32.866 -36.543 1.00 99.99  ? 798 TYR C OH  1  
ATOM 5881   N N   . LYS A 1 795 ? -112.549 -29.387 -34.213 1.00 30.00  ? 799 LYS C N   1  
ATOM 5882   C CA  . LYS A 1 795 ? -113.288 -30.447 -33.561 1.00 30.00  ? 799 LYS C CA  1  
ATOM 5883   C C   . LYS A 1 795 ? -114.424 -30.696 -34.535 1.00 30.00  ? 799 LYS C C   1  
ATOM 5884   O O   . LYS A 1 795 ? -114.636 -31.814 -34.999 1.00 30.00  ? 799 LYS C O   1  
ATOM 5885   C CB  . LYS A 1 795 ? -113.773 -29.973 -32.194 1.00 99.99  ? 799 LYS C CB  1  
ATOM 5886   C CG  . LYS A 1 795 ? -114.466 -31.126 -31.473 1.00 99.99  ? 799 LYS C CG  1  
ATOM 5887   C CD  . LYS A 1 795 ? -114.550 -30.813 -29.983 1.00 99.99  ? 799 LYS C CD  1  
ATOM 5888   C CE  . LYS A 1 795 ? -115.548 -31.759 -29.323 1.00 99.99  ? 799 LYS C CE  1  
ATOM 5889   N NZ  . LYS A 1 795 ? -114.835 -32.923 -28.779 1.00 99.99  ? 799 LYS C NZ  1  
ATOM 5890   N N   . LYS A 1 796 ? -115.146 -29.625 -34.852 1.00 30.00  ? 800 LYS C N   1  
ATOM 5891   C CA  . LYS A 1 796 ? -116.269 -29.705 -35.770 1.00 30.00  ? 800 LYS C CA  1  
ATOM 5892   C C   . LYS A 1 796 ? -115.910 -30.445 -37.057 1.00 30.00  ? 800 LYS C C   1  
ATOM 5893   O O   . LYS A 1 796 ? -116.786 -30.922 -37.757 1.00 30.00  ? 800 LYS C O   1  
ATOM 5894   C CB  . LYS A 1 796 ? -116.733 -28.303 -36.151 1.00 99.99  ? 800 LYS C CB  1  
ATOM 5895   C CG  . LYS A 1 796 ? -117.969 -28.398 -37.035 1.00 99.99  ? 800 LYS C CG  1  
ATOM 5896   C CD  . LYS A 1 796 ? -118.689 -27.052 -37.049 1.00 99.99  ? 800 LYS C CD  1  
ATOM 5897   C CE  . LYS A 1 796 ? -119.690 -27.024 -38.198 1.00 99.99  ? 800 LYS C CE  1  
ATOM 5898   N NZ  . LYS A 1 796 ? -121.013 -27.436 -37.705 1.00 99.99  ? 800 LYS C NZ  1  
ATOM 5899   N N   . LEU A 1 797 ? -113.714 -30.463 -37.431 1.00 30.00  ? 801 LEU C N   1  
ATOM 5900   C CA  . LEU A 1 797 ? -114.192 -31.227 -38.577 1.00 30.00  ? 801 LEU C CA  1  
ATOM 5901   C C   . LEU A 1 797 ? -114.966 -32.497 -38.243 1.00 30.00  ? 801 LEU C C   1  
ATOM 5902   O O   . LEU A 1 797 ? -115.433 -33.198 -39.141 1.00 30.00  ? 801 LEU C O   1  
ATOM 5903   C CB  . LEU A 1 797 ? -113.011 -31.666 -39.436 1.00 99.99  ? 801 LEU C CB  1  
ATOM 5904   C CG  . LEU A 1 797 ? -112.797 -30.656 -40.557 1.00 99.99  ? 801 LEU C CG  1  
ATOM 5905   C CD1 . LEU A 1 797 ? -111.849 -31.246 -41.599 1.00 99.99  ? 801 LEU C CD1 1  
ATOM 5906   C CD2 . LEU A 1 797 ? -114.133 -30.329 -41.213 1.00 99.99  ? 801 LEU C CD2 1  
ATOM 5907   N N   . GLN A 1 798 ? -115.094 -32.811 -36.965 1.00 30.00  ? 802 GLN C N   1  
ATOM 5908   C CA  . GLN A 1 798 ? -115.830 -34.003 -36.569 1.00 30.00  ? 802 GLN C CA  1  
ATOM 5909   C C   . GLN A 1 798 ? -117.170 -33.487 -36.097 1.00 30.00  ? 802 GLN C C   1  
ATOM 5910   O O   . GLN A 1 798 ? -118.218 -34.045 -36.421 1.00 30.00  ? 802 GLN C O   1  
ATOM 5911   C CB  . GLN A 1 798 ? -115.085 -34.728 -35.455 1.00 99.99  ? 802 GLN C CB  1  
ATOM 5912   C CG  . GLN A 1 798 ? -113.799 -35.331 -36.009 1.00 99.99  ? 802 GLN C CG  1  
ATOM 5913   C CD  . GLN A 1 798 ? -114.095 -36.525 -36.906 1.00 99.99  ? 802 GLN C CD  1  
ATOM 5914   O OE1 . GLN A 1 798 ? -115.252 -36.888 -37.099 1.00 99.99  ? 802 GLN C OE1 1  
ATOM 5915   N NE2 . GLN A 1 798 ? -113.044 -37.138 -37.453 1.00 99.99  ? 802 GLN C NE2 1  
ATOM 5916   N N   . ASP A 1 799 ? -117.139 -32.479 -35.662 1.00 30.00  ? 803 ASP C N   1  
ATOM 5917   C CA  . ASP A 1 799 ? -118.341 -31.927 -35.058 1.00 30.00  ? 803 ASP C CA  1  
ATOM 5918   C C   . ASP A 1 799 ? -119.299 -31.506 -36.153 1.00 30.00  ? 803 ASP C C   1  
ATOM 5919   O O   . ASP A 1 799 ? -120.510 -31.731 -36.074 1.00 30.00  ? 803 ASP C O   1  
ATOM 5920   C CB  . ASP A 1 799 ? -117.982 -30.714 -34.205 1.00 99.99  ? 803 ASP C CB  1  
ATOM 5921   C CG  . ASP A 1 799 ? -117.393 -29.622 -35.093 1.00 99.99  ? 803 ASP C CG  1  
ATOM 5922   O OD1 . ASP A 1 799 ? -116.179 -29.725 -35.407 1.00 99.99  ? 803 ASP C OD1 1  
ATOM 5923   O OD2 . ASP A 1 799 ? -118.166 -28.691 -35.451 1.00 99.99  ? 803 ASP C OD2 1  
ATOM 5924   N N   . GLN A 1 800 ? -118.754 -30.884 -37.180 1.00 30.00  ? 804 GLN C N   1  
ATOM 5925   C CA  . GLN A 1 800 ? -119.592 -30.444 -38.260 1.00 30.00  ? 804 GLN C CA  1  
ATOM 5926   C C   . GLN A 1 800 ? -120.045 -31.657 -39.053 1.00 30.00  ? 804 GLN C C   1  
ATOM 5927   O O   . GLN A 1 800 ? -121.111 -31.622 -39.655 1.00 30.00  ? 804 GLN C O   1  
ATOM 5928   C CB  . GLN A 1 800 ? -118.812 -29.499 -39.170 1.00 99.99  ? 804 GLN C CB  1  
ATOM 5929   C CG  . GLN A 1 800 ? -119.787 -28.595 -39.919 1.00 99.99  ? 804 GLN C CG  1  
ATOM 5930   C CD  . GLN A 1 800 ? -120.305 -29.271 -41.178 1.00 99.99  ? 804 GLN C CD  1  
ATOM 5931   O OE1 . GLN A 1 800 ? -119.932 -30.404 -41.475 1.00 99.99  ? 804 GLN C OE1 1  
ATOM 5932   N NE2 . GLN A 1 800 ? -121.169 -28.573 -41.919 1.00 99.99  ? 804 GLN C NE2 1  
ATOM 5933   N N   . ARG A 1 801 ? -119.265 -32.737 -39.047 1.00 30.00  ? 805 ARG C N   1  
ATOM 5934   C CA  . ARG A 1 801 ? -119.683 -33.923 -39.801 1.00 30.00  ? 805 ARG C CA  1  
ATOM 5935   C C   . ARG A 1 801 ? -120.932 -34.565 -39.187 1.00 30.00  ? 805 ARG C C   1  
ATOM 5936   O O   . ARG A 1 801 ? -121.729 -35.215 -39.871 1.00 30.00  ? 805 ARG C O   1  
ATOM 5937   C CB  . ARG A 1 801 ? -118.560 -34.958 -39.803 1.00 99.99  ? 805 ARG C CB  1  
ATOM 5938   C CG  . ARG A 1 801 ? -118.983 -36.166 -40.630 1.00 99.99  ? 805 ARG C CG  1  
ATOM 5939   C CD  . ARG A 1 801 ? -117.881 -37.220 -40.590 1.00 99.99  ? 805 ARG C CD  1  
ATOM 5940   N NE  . ARG A 1 801 ? -117.439 -37.471 -39.201 1.00 99.99  ? 805 ARG C NE  1  
ATOM 5941   C CZ  . ARG A 1 801 ? -118.109 -38.252 -38.356 1.00 99.99  ? 805 ARG C CZ  1  
ATOM 5942   N NH1 . ARG A 1 801 ? -119.234 -38.866 -38.707 1.00 99.99  ? 805 ARG C NH1 1  
ATOM 5943   N NH2 . ARG A 1 801 ? -117.619 -38.408 -37.130 1.00 99.99  ? 805 ARG C NH2 1  
ATOM 5944   N N   . ILE A 1 802 ? -121.067 -34.375 -37.880 1.00 30.00  ? 806 ILE C N   1  
ATOM 5945   C CA  . ILE A 1 802 ? -122.186 -34.893 -37.114 1.00 30.00  ? 806 ILE C CA  1  
ATOM 5946   C C   . ILE A 1 802 ? -123.300 -33.864 -37.260 1.00 30.00  ? 806 ILE C C   1  
ATOM 5947   O O   . ILE A 1 802 ? -124.388 -34.183 -37.730 1.00 30.00  ? 806 ILE C O   1  
ATOM 5948   C CB  . ILE A 1 802 ? -121.781 -35.062 -35.654 1.00 99.99  ? 806 ILE C CB  1  
ATOM 5949   C CG1 . ILE A 1 802 ? -121.991 -33.748 -34.911 1.00 99.99  ? 806 ILE C CG1 1  
ATOM 5950   C CG2 . ILE A 1 802 ? -120.310 -35.459 -35.577 1.00 99.99  ? 806 ILE C CG2 1  
ATOM 5951   C CD1 . ILE A 1 802 ? -123.363 -33.753 -34.246 1.00 99.99  ? 806 ILE C CD1 1  
ATOM 5952   N N   . GLY A 1 803 ? -123.005 -32.627 -36.865 1.00 30.00  ? 807 GLY C N   1  
ATOM 5953   C CA  . GLY A 1 803 ? -123.972 -31.550 -36.952 1.00 30.00  ? 807 GLY C CA  1  
ATOM 5954   C C   . GLY A 1 803 ? -124.644 -31.417 -38.313 1.00 30.00  ? 807 GLY C C   1  
ATOM 5955   O O   . GLY A 1 803 ? -125.666 -30.748 -38.423 1.00 30.00  ? 807 GLY C O   1  
ATOM 5956   N N   . LEU A 1 804 ? -124.069 -32.035 -39.343 1.00 30.00  ? 808 LEU C N   1  
ATOM 5957   C CA  . LEU A 1 804 ? -124.641 -31.980 -40.697 1.00 30.00  ? 808 LEU C CA  1  
ATOM 5958   C C   . LEU A 1 804 ? -125.514 -33.202 -40.911 1.00 30.00  ? 808 LEU C C   1  
ATOM 5959   O O   . LEU A 1 804 ? -126.540 -33.137 -41.581 1.00 30.00  ? 808 LEU C O   1  
ATOM 5960   C CB  . LEU A 1 804 ? -123.522 -31.960 -41.730 1.00 99.99  ? 808 LEU C CB  1  
ATOM 5961   C CG  . LEU A 1 804 ? -123.203 -30.520 -42.112 1.00 99.99  ? 808 LEU C CG  1  
ATOM 5962   C CD1 . LEU A 1 804 ? -122.334 -30.505 -43.366 1.00 99.99  ? 808 LEU C CD1 1  
ATOM 5963   C CD2 . LEU A 1 804 ? -124.501 -29.765 -42.383 1.00 99.99  ? 808 LEU C CD2 1  
ATOM 5964   N N   . SER A 1 805 ? -125.086 -34.323 -40.350 1.00 30.00  ? 809 SER C N   1  
ATOM 5965   C CA  . SER A 1 805 ? -125.838 -35.556 -40.477 1.00 30.00  ? 809 SER C CA  1  
ATOM 5966   C C   . SER A 1 805 ? -127.159 -35.408 -39.706 1.00 30.00  ? 809 SER C C   1  
ATOM 5967   O O   . SER A 1 805 ? -128.172 -36.003 -40.074 1.00 30.00  ? 809 SER C O   1  
ATOM 5968   C CB  . SER A 1 805 ? -125.035 -36.715 -39.904 1.00 99.99  ? 809 SER C CB  1  
ATOM 5969   O OG  . SER A 1 805 ? -124.921 -36.564 -38.487 1.00 99.99  ? 809 SER C OG  1  
ATOM 5970   N N   . VAL A 1 806 ? -127.144 -34.616 -38.636 1.00 30.00  ? 810 VAL C N   1  
ATOM 5971   C CA  . VAL A 1 806 ? -128.348 -34.377 -37.858 1.00 30.00  ? 810 VAL C CA  1  
ATOM 5972   C C   . VAL A 1 806 ? -129.285 -33.761 -38.891 1.00 30.00  ? 810 VAL C C   1  
ATOM 5973   O O   . VAL A 1 806 ? -130.214 -34.412 -39.372 1.00 30.00  ? 810 VAL C O   1  
ATOM 5974   C CB  . VAL A 1 806 ? -128.040 -33.433 -36.702 1.00 99.99  ? 810 VAL C CB  1  
ATOM 5975   C CG1 . VAL A 1 806 ? -126.975 -34.058 -35.804 1.00 99.99  ? 810 VAL C CG1 1  
ATOM 5976   C CG2 . VAL A 1 806 ? -127.525 -32.108 -37.251 1.00 99.99  ? 810 VAL C CG2 1  
ATOM 5977   N N   . ILE A 1 807 ? -129.007 -32.505 -39.241 1.00 30.00  ? 811 ILE C N   1  
ATOM 5978   C CA  . ILE A 1 807 ? -129.777 -31.721 -40.210 1.00 30.00  ? 811 ILE C CA  1  
ATOM 5979   C C   . ILE A 1 807 ? -130.166 -32.446 -41.497 1.00 30.00  ? 811 ILE C C   1  
ATOM 5980   O O   . ILE A 1 807 ? -131.288 -32.309 -41.970 1.00 30.00  ? 811 ILE C O   1  
ATOM 5981   C CB  . ILE A 1 807 ? -128.973 -30.499 -40.643 1.00 99.99  ? 811 ILE C CB  1  
ATOM 5982   C CG1 . ILE A 1 807 ? -128.057 -30.877 -41.801 1.00 99.99  ? 811 ILE C CG1 1  
ATOM 5983   C CG2 . ILE A 1 807 ? -128.132 -30.002 -39.471 1.00 99.99  ? 811 ILE C CG2 1  
ATOM 5984   C CD1 . ILE A 1 807 ? -128.748 -30.550 -43.122 1.00 99.99  ? 811 ILE C CD1 1  
ATOM 5985   N N   . GLN A 1 808 ? -129.246 -33.216 -42.064 1.00 30.00  ? 812 GLN C N   1  
ATOM 5986   C CA  . GLN A 1 808 ? -129.541 -33.934 -43.299 1.00 30.00  ? 812 GLN C CA  1  
ATOM 5987   C C   . GLN A 1 808 ? -130.546 -35.055 -43.089 1.00 30.00  ? 812 GLN C C   1  
ATOM 5988   O O   . GLN A 1 808 ? -131.457 -35.228 -43.893 1.00 30.00  ? 812 GLN C O   1  
ATOM 5989   C CB  . GLN A 1 808 ? -128.262 -34.550 -43.857 1.00 99.99  ? 812 GLN C CB  1  
ATOM 5990   C CG  . GLN A 1 808 ? -128.414 -34.763 -45.360 1.00 99.99  ? 812 GLN C CG  1  
ATOM 5991   C CD  . GLN A 1 808 ? -129.104 -36.089 -45.658 1.00 99.99  ? 812 GLN C CD  1  
ATOM 5992   O OE1 . GLN A 1 808 ? -129.459 -36.826 -44.742 1.00 99.99  ? 812 GLN C OE1 1  
ATOM 5993   N NE2 . GLN A 1 808 ? -129.292 -36.386 -46.946 1.00 99.99  ? 812 GLN C NE2 1  
ATOM 5994   N N   . ARG A 1 809 ? -130.384 -35.814 -42.006 1.00 30.00  ? 813 ARG C N   1  
ATOM 5995   C CA  . ARG A 1 809 ? -131.298 -36.922 -41.705 1.00 30.00  ? 813 ARG C CA  1  
ATOM 5996   C C   . ARG A 1 809 ? -132.612 -36.432 -41.076 1.00 30.00  ? 813 ARG C C   1  
ATOM 5997   O O   . ARG A 1 809 ? -133.672 -37.038 -41.260 1.00 30.00  ? 813 ARG C O   1  
ATOM 5998   C CB  . ARG A 1 809 ? -130.638 -37.887 -40.729 1.00 99.99  ? 813 ARG C CB  1  
ATOM 5999   C CG  . ARG A 1 809 ? -129.374 -38.463 -41.355 1.00 99.99  ? 813 ARG C CG  1  
ATOM 6000   C CD  . ARG A 1 809 ? -128.648 -39.332 -40.333 1.00 99.99  ? 813 ARG C CD  1  
ATOM 6001   N NE  . ARG A 1 809 ? -127.959 -38.499 -39.323 1.00 99.99  ? 813 ARG C NE  1  
ATOM 6002   C CZ  . ARG A 1 809 ? -127.318 -39.014 -38.276 1.00 99.99  ? 813 ARG C CZ  1  
ATOM 6003   N NH1 . ARG A 1 809 ? -127.252 -40.323 -38.065 1.00 99.99  ? 813 ARG C NH1 1  
ATOM 6004   N NH2 . ARG A 1 809 ? -126.733 -38.170 -37.427 1.00 99.99  ? 813 ARG C NH2 1  
ATOM 6005   N N   . ASN A 1 810 ? -132.528 -35.336 -40.335 1.00 30.00  ? 814 ASN C N   1  
ATOM 6006   C CA  . ASN A 1 810 ? -133.689 -34.770 -39.671 1.00 30.00  ? 814 ASN C CA  1  
ATOM 6007   C C   . ASN A 1 810 ? -134.515 -33.790 -40.487 1.00 30.00  ? 814 ASN C C   1  
ATOM 6008   O O   . ASN A 1 810 ? -135.430 -33.162 -39.956 1.00 30.00  ? 814 ASN C O   1  
ATOM 6009   C CB  . ASN A 1 810 ? -133.253 -34.009 -38.425 1.00 99.99  ? 814 ASN C CB  1  
ATOM 6010   C CG  . ASN A 1 810 ? -132.459 -32.761 -38.792 1.00 99.99  ? 814 ASN C CG  1  
ATOM 6011   O OD1 . ASN A 1 810 ? -131.280 -32.654 -38.464 1.00 99.99  ? 814 ASN C OD1 1  
ATOM 6012   N ND2 . ASN A 1 810 ? -133.115 -31.816 -39.472 1.00 99.99  ? 814 ASN C ND2 1  
ATOM 6013   N N   . ILE A 1 811 ? -134.199 -33.621 -41.759 1.00 30.00  ? 815 ILE C N   1  
ATOM 6014   C CA  . ILE A 1 811 ? -134.975 -32.706 -42.579 1.00 30.00  ? 815 ILE C CA  1  
ATOM 6015   C C   . ILE A 1 811 ? -135.650 -33.674 -43.536 1.00 30.00  ? 815 ILE C C   1  
ATOM 6016   O O   . ILE A 1 811 ? -136.786 -33.461 -43.961 1.00 30.00  ? 815 ILE C O   1  
ATOM 6017   C CB  . ILE A 1 811 ? -134.048 -31.715 -43.272 1.00 99.99  ? 815 ILE C CB  1  
ATOM 6018   C CG1 . ILE A 1 811 ? -134.835 -30.907 -44.296 1.00 99.99  ? 815 ILE C CG1 1  
ATOM 6019   C CG2 . ILE A 1 811 ? -132.926 -32.475 -43.976 1.00 99.99  ? 815 ILE C CG2 1  
ATOM 6020   C CD1 . ILE A 1 811 ? -136.176 -30.497 -43.697 1.00 99.99  ? 815 ILE C CD1 1  
ATOM 6021   N N   . ARG A 1 812 ? -134.934 -34.756 -43.850 1.00 30.00  ? 816 ARG C N   1  
ATOM 6022   C CA  . ARG A 1 812 ? -135.434 -35.791 -44.737 1.00 30.00  ? 816 ARG C CA  1  
ATOM 6023   C C   . ARG A 1 812 ? -136.616 -36.464 -44.044 1.00 30.00  ? 816 ARG C C   1  
ATOM 6024   O O   . ARG A 1 812 ? -137.480 -37.054 -44.694 1.00 30.00  ? 816 ARG C O   1  
ATOM 6025   C CB  . ARG A 1 812 ? -134.334 -36.812 -45.012 1.00 99.99  ? 816 ARG C CB  1  
ATOM 6026   C CG  . ARG A 1 812 ? -134.817 -37.810 -46.057 1.00 99.99  ? 816 ARG C CG  1  
ATOM 6027   C CD  . ARG A 1 812 ? -133.645 -38.674 -46.515 1.00 99.99  ? 816 ARG C CD  1  
ATOM 6028   N NE  . ARG A 1 812 ? -133.048 -39.403 -45.377 1.00 99.99  ? 816 ARG C NE  1  
ATOM 6029   C CZ  . ARG A 1 812 ? -131.751 -39.689 -45.297 1.00 99.99  ? 816 ARG C CZ  1  
ATOM 6030   N NH1 . ARG A 1 812 ? -130.893 -39.332 -46.249 1.00 99.99  ? 816 ARG C NH1 1  
ATOM 6031   N NH2 . ARG A 1 812 ? -131.319 -40.348 -44.227 1.00 99.99  ? 816 ARG C NH2 1  
ATOM 6032   N N   . LYS A 1 813 ? -136.639 -36.376 -42.715 1.00 30.00  ? 817 LYS C N   1  
ATOM 6033   C CA  . LYS A 1 813 ? -137.707 -36.955 -41.922 1.00 30.00  ? 817 LYS C CA  1  
ATOM 6034   C C   . LYS A 1 813 ? -138.918 -36.043 -42.079 1.00 30.00  ? 817 LYS C C   1  
ATOM 6035   O O   . LYS A 1 813 ? -139.950 -36.459 -42.610 1.00 30.00  ? 817 LYS C O   1  
ATOM 6036   C CB  . LYS A 1 813 ? -137.281 -37.042 -40.460 1.00 99.99  ? 817 LYS C CB  1  
ATOM 6037   C CG  . LYS A 1 813 ? -138.370 -37.744 -39.653 1.00 99.99  ? 817 LYS C CG  1  
ATOM 6038   C CD  . LYS A 1 813 ? -137.788 -38.227 -38.330 1.00 99.99  ? 817 LYS C CD  1  
ATOM 6039   C CE  . LYS A 1 813 ? -138.926 -38.586 -37.377 1.00 99.99  ? 817 LYS C CE  1  
ATOM 6040   N NZ  . LYS A 1 813 ? -139.215 -40.024 -37.482 1.00 99.99  ? 817 LYS C NZ  1  
ATOM 6041   N N   . TRP A 1 814 ? -138.783 -34.803 -41.626 1.00 30.00  ? 818 TRP C N   1  
ATOM 6042   C CA  . TRP A 1 814 ? -139.854 -33.807 -41.716 1.00 30.00  ? 818 TRP C CA  1  
ATOM 6043   C C   . TRP A 1 814 ? -140.340 -33.653 -43.153 1.00 30.00  ? 818 TRP C C   1  
ATOM 6044   O O   . TRP A 1 814 ? -141.424 -33.133 -43.405 1.00 30.00  ? 818 TRP C O   1  
ATOM 6045   C CB  . TRP A 1 814 ? -139.343 -32.454 -41.229 1.00 99.99  ? 818 TRP C CB  1  
ATOM 6046   C CG  . TRP A 1 814 ? -140.352 -31.330 -41.295 1.00 99.99  ? 818 TRP C CG  1  
ATOM 6047   C CD1 . TRP A 1 814 ? -141.574 -31.311 -40.744 1.00 99.99  ? 818 TRP C CD1 1  
ATOM 6048   C CD2 . TRP A 1 814 ? -140.213 -30.095 -41.937 1.00 99.99  ? 818 TRP C CD2 1  
ATOM 6049   N NE1 . TRP A 1 814 ? -142.159 -30.049 -41.069 1.00 99.99  ? 818 TRP C NE1 1  
ATOM 6050   C CE2 . TRP A 1 814 ? -141.306 -29.355 -41.784 1.00 99.99  ? 818 TRP C CE2 1  
ATOM 6051   C CE3 . TRP A 1 814 ? -139.131 -29.589 -42.667 1.00 99.99  ? 818 TRP C CE3 1  
ATOM 6052   C CZ2 . TRP A 1 814 ? -141.470 -28.069 -42.312 1.00 99.99  ? 818 TRP C CZ2 1  
ATOM 6053   C CZ3 . TRP A 1 814 ? -139.273 -28.295 -43.210 1.00 99.99  ? 818 TRP C CZ3 1  
ATOM 6054   C CH2 . TRP A 1 814 ? -140.393 -27.567 -43.037 1.00 99.99  ? 818 TRP C CH2 1  
ATOM 6055   N N   . LEU A 1 815 ? -139.530 -34.120 -44.093 1.00 30.00  ? 819 LEU C N   1  
ATOM 6056   C CA  . LEU A 1 815 ? -139.858 -34.046 -45.512 1.00 30.00  ? 819 LEU C CA  1  
ATOM 6057   C C   . LEU A 1 815 ? -140.778 -35.200 -45.890 1.00 30.00  ? 819 LEU C C   1  
ATOM 6058   O O   . LEU A 1 815 ? -141.778 -35.013 -46.586 1.00 30.00  ? 819 LEU C O   1  
ATOM 6059   C CB  . LEU A 1 815 ? -138.583 -34.129 -46.343 1.00 99.99  ? 819 LEU C CB  1  
ATOM 6060   C CG  . LEU A 1 815 ? -138.099 -32.720 -46.673 1.00 99.99  ? 819 LEU C CG  1  
ATOM 6061   C CD1 . LEU A 1 815 ? -137.035 -32.793 -47.763 1.00 99.99  ? 819 LEU C CD1 1  
ATOM 6062   C CD2 . LEU A 1 815 ? -139.272 -31.878 -47.163 1.00 99.99  ? 819 LEU C CD2 1  
ATOM 6063   N N   . VAL A 1 816 ? -140.424 -36.392 -45.426 1.00 30.00  ? 820 VAL C N   1  
ATOM 6064   C CA  . VAL A 1 816 ? -141.190 -37.596 -45.703 1.00 30.00  ? 820 VAL C CA  1  
ATOM 6065   C C   . VAL A 1 816 ? -142.476 -37.680 -44.848 1.00 30.00  ? 820 VAL C C   1  
ATOM 6066   O O   . VAL A 1 816 ? -143.429 -38.361 -45.222 1.00 30.00  ? 820 VAL C O   1  
ATOM 6067   C CB  . VAL A 1 816 ? -140.347 -38.829 -45.407 1.00 99.99  ? 820 VAL C CB  1  
ATOM 6068   C CG1 . VAL A 1 816 ? -139.102 -38.819 -46.285 1.00 99.99  ? 820 VAL C CG1 1  
ATOM 6069   C CG2 . VAL A 1 816 ? -139.935 -38.821 -43.938 1.00 99.99  ? 820 VAL C CG2 1  
ATOM 6070   N N   . LEU A 1 817 ? -142.495 -36.986 -43.709 1.00 30.00  ? 821 LEU C N   1  
ATOM 6071   C CA  . LEU A 1 817 ? -143.659 -36.964 -42.817 1.00 30.00  ? 821 LEU C CA  1  
ATOM 6072   C C   . LEU A 1 817 ? -144.776 -36.109 -43.427 1.00 30.00  ? 821 LEU C C   1  
ATOM 6073   O O   . LEU A 1 817 ? -145.955 -36.310 -43.131 1.00 30.00  ? 821 LEU C O   1  
ATOM 6074   C CB  . LEU A 1 817 ? -143.266 -36.379 -41.466 1.00 99.99  ? 821 LEU C CB  1  
ATOM 6075   C CG  . LEU A 1 817 ? -142.907 -37.507 -40.506 1.00 99.99  ? 821 LEU C CG  1  
ATOM 6076   C CD1 . LEU A 1 817 ? -142.838 -36.959 -39.083 1.00 99.99  ? 821 LEU C CD1 1  
ATOM 6077   C CD2 . LEU A 1 817 ? -143.973 -38.597 -40.582 1.00 99.99  ? 821 LEU C CD2 1  
ATOM 6078   N N   . ARG A 1 818 ? -144.404 -35.150 -44.268 1.00 30.00  ? 822 ARG C N   1  
ATOM 6079   C CA  . ARG A 1 818 ? -145.376 -34.266 -44.914 1.00 30.00  ? 822 ARG C CA  1  
ATOM 6080   C C   . ARG A 1 818 ? -145.923 -34.955 -46.159 1.00 30.00  ? 822 ARG C C   1  
ATOM 6081   O O   . ARG A 1 818 ? -146.913 -34.516 -46.743 1.00 30.00  ? 822 ARG C O   1  
ATOM 6082   C CB  . ARG A 1 818 ? -144.703 -32.956 -45.313 1.00 99.99  ? 822 ARG C CB  1  
ATOM 6083   C CG  . ARG A 1 818 ? -144.506 -32.088 -44.073 1.00 99.99  ? 822 ARG C CG  1  
ATOM 6084   C CD  . ARG A 1 818 ? -143.878 -30.760 -44.479 1.00 99.99  ? 822 ARG C CD  1  
ATOM 6085   N NE  . ARG A 1 818 ? -143.586 -29.929 -43.291 1.00 99.99  ? 822 ARG C NE  1  
ATOM 6086   C CZ  . ARG A 1 818 ? -144.459 -29.064 -42.779 1.00 99.99  ? 822 ARG C CZ  1  
ATOM 6087   N NH1 . ARG A 1 818 ? -145.666 -28.885 -43.307 1.00 99.99  ? 822 ARG C NH1 1  
ATOM 6088   N NH2 . ARG A 1 818 ? -144.091 -28.367 -41.707 1.00 99.99  ? 822 ARG C NH2 1  
ATOM 6089   N N   . ASN A 1 819 ? -145.268 -36.039 -46.563 1.00 30.00  ? 823 ASN C N   1  
ATOM 6090   C CA  . ASN A 1 819 ? -145.682 -36.811 -47.724 1.00 30.00  ? 823 ASN C CA  1  
ATOM 6091   C C   . ASN A 1 819 ? -146.337 -38.095 -47.202 1.00 30.00  ? 823 ASN C C   1  
ATOM 6092   O O   . ASN A 1 819 ? -146.219 -39.163 -47.806 1.00 30.00  ? 823 ASN C O   1  
ATOM 6093   C CB  . ASN A 1 819 ? -144.472 -37.142 -48.587 1.00 99.99  ? 823 ASN C CB  1  
ATOM 6094   C CG  . ASN A 1 819 ? -143.824 -35.878 -49.134 1.00 99.99  ? 823 ASN C CG  1  
ATOM 6095   O OD1 . ASN A 1 819 ? -144.493 -35.057 -49.759 1.00 99.99  ? 823 ASN C OD1 1  
ATOM 6096   N ND2 . ASN A 1 819 ? -142.522 -35.724 -48.899 1.00 99.99  ? 823 ASN C ND2 1  
ATOM 6097   N N   . TRP A 1 820 ? -147.016 -37.961 -46.066 1.00 30.00  ? 824 TRP C N   1  
ATOM 6098   C CA  . TRP A 1 820 ? -147.722 -39.062 -45.397 1.00 30.00  ? 824 TRP C CA  1  
ATOM 6099   C C   . TRP A 1 820 ? -149.208 -38.742 -45.376 1.00 30.00  ? 824 TRP C C   1  
ATOM 6100   O O   . TRP A 1 820 ? -149.615 -37.740 -44.764 1.00 30.00  ? 824 TRP C O   1  
ATOM 6101   C CB  . TRP A 1 820 ? -147.205 -39.219 -43.970 1.00 99.99  ? 824 TRP C CB  1  
ATOM 6102   C CG  . TRP A 1 820 ? -147.752 -40.411 -43.221 1.00 99.99  ? 824 TRP C CG  1  
ATOM 6103   C CD1 . TRP A 1 820 ? -148.964 -40.527 -42.664 1.00 99.99  ? 824 TRP C CD1 1  
ATOM 6104   C CD2 . TRP A 1 820 ? -147.104 -41.625 -42.960 1.00 99.99  ? 824 TRP C CD2 1  
ATOM 6105   N NE1 . TRP A 1 820 ? -149.029 -41.824 -42.068 1.00 99.99  ? 824 TRP C NE1 1  
ATOM 6106   C CE2 . TRP A 1 820 ? -147.893 -42.445 -42.273 1.00 99.99  ? 824 TRP C CE2 1  
ATOM 6107   C CE3 . TRP A 1 820 ? -145.815 -42.039 -43.318 1.00 99.99  ? 824 TRP C CE3 1  
ATOM 6108   C CZ2 . TRP A 1 820 ? -147.524 -43.731 -41.864 1.00 99.99  ? 824 TRP C CZ2 1  
ATOM 6109   C CZ3 . TRP A 1 820 ? -145.422 -43.335 -42.914 1.00 99.99  ? 824 TRP C CZ3 1  
ATOM 6110   C CH2 . TRP A 1 820 ? -146.247 -44.145 -42.216 1.00 99.99  ? 824 TRP C CH2 1  
ATOM 6111   N N   . GLN A 1 821 ? -150.247 -39.007 -46.217 1.00 30.00  ? 825 GLN C N   1  
ATOM 6112   C CA  . GLN A 1 821 ? -151.686 -38.772 -46.341 1.00 30.00  ? 825 GLN C CA  1  
ATOM 6113   C C   . GLN A 1 821 ? -152.266 -38.415 -44.992 1.00 30.00  ? 825 GLN C C   1  
ATOM 6114   O O   . GLN A 1 821 ? -152.916 -37.374 -44.825 1.00 30.00  ? 825 GLN C O   1  
ATOM 6115   C CB  . GLN A 1 821 ? -152.373 -40.030 -46.862 1.00 99.99  ? 825 GLN C CB  1  
ATOM 6116   C CG  . GLN A 1 821 ? -153.684 -39.652 -47.543 1.00 99.99  ? 825 GLN C CG  1  
ATOM 6117   C CD  . GLN A 1 821 ? -154.813 -39.536 -46.529 1.00 99.99  ? 825 GLN C CD  1  
ATOM 6118   O OE1 . GLN A 1 821 ? -154.603 -39.739 -45.334 1.00 99.99  ? 825 GLN C OE1 1  
ATOM 6119   N NE2 . GLN A 1 821 ? -156.014 -39.206 -47.009 1.00 99.99  ? 825 GLN C NE2 1  
ATOM 6120   N N   . TRP A 1 822 ? -152.007 -39.294 -44.033 1.00 30.00  ? 826 TRP C N   1  
ATOM 6121   C CA  . TRP A 1 822 ? -152.481 -39.117 -42.670 1.00 30.00  ? 826 TRP C CA  1  
ATOM 6122   C C   . TRP A 1 822 ? -152.099 -37.750 -42.129 1.00 30.00  ? 826 TRP C C   1  
ATOM 6123   O O   . TRP A 1 822 ? -152.962 -36.983 -41.695 1.00 30.00  ? 826 TRP C O   1  
ATOM 6124   C CB  . TRP A 1 822 ? -151.871 -40.178 -41.764 1.00 99.99  ? 826 TRP C CB  1  
ATOM 6125   C CG  . TRP A 1 822 ? -152.396 -40.190 -40.348 1.00 99.99  ? 826 TRP C CG  1  
ATOM 6126   C CD1 . TRP A 1 822 ? -152.075 -39.342 -39.362 1.00 99.99  ? 826 TRP C CD1 1  
ATOM 6127   C CD2 . TRP A 1 822 ? -153.318 -41.081 -39.786 1.00 99.99  ? 826 TRP C CD2 1  
ATOM 6128   N NE1 . TRP A 1 822 ? -152.816 -39.741 -38.207 1.00 99.99  ? 826 TRP C NE1 1  
ATOM 6129   C CE2 . TRP A 1 822 ? -153.546 -40.785 -38.509 1.00 99.99  ? 826 TRP C CE2 1  
ATOM 6130   C CE3 . TRP A 1 822 ? -153.977 -42.169 -40.374 1.00 99.99  ? 826 TRP C CE3 1  
ATOM 6131   C CZ2 . TRP A 1 822 ? -154.422 -41.495 -37.679 1.00 99.99  ? 826 TRP C CZ2 1  
ATOM 6132   C CZ3 . TRP A 1 822 ? -154.863 -42.899 -39.555 1.00 99.99  ? 826 TRP C CZ3 1  
ATOM 6133   C CH2 . TRP A 1 822 ? -155.075 -42.574 -38.262 1.00 99.99  ? 826 TRP C CH2 1  
ATOM 6134   N N   . TRP A 1 823 ? -150.798 -37.450 -42.169 1.00 30.00  ? 827 TRP C N   1  
ATOM 6135   C CA  . TRP A 1 823 ? -150.286 -36.172 -41.688 1.00 30.00  ? 827 TRP C CA  1  
ATOM 6136   C C   . TRP A 1 823 ? -150.891 -35.018 -42.490 1.00 30.00  ? 827 TRP C C   1  
ATOM 6137   O O   . TRP A 1 823 ? -151.292 -33.993 -41.927 1.00 30.00  ? 827 TRP C O   1  
ATOM 6138   C CB  . TRP A 1 823 ? -148.768 -36.134 -41.835 1.00 99.99  ? 827 TRP C CB  1  
ATOM 6139   C CG  . TRP A 1 823 ? -148.098 -34.916 -41.243 1.00 99.99  ? 827 TRP C CG  1  
ATOM 6140   C CD1 . TRP A 1 823 ? -148.060 -33.685 -41.762 1.00 99.99  ? 827 TRP C CD1 1  
ATOM 6141   C CD2 . TRP A 1 823 ? -147.394 -34.834 -40.036 1.00 99.99  ? 827 TRP C CD2 1  
ATOM 6142   N NE1 . TRP A 1 823 ? -147.319 -32.868 -40.853 1.00 99.99  ? 827 TRP C NE1 1  
ATOM 6143   C CE2 . TRP A 1 823 ? -146.941 -33.600 -39.834 1.00 99.99  ? 827 TRP C CE2 1  
ATOM 6144   C CE3 . TRP A 1 823 ? -147.132 -35.833 -39.089 1.00 99.99  ? 827 TRP C CE3 1  
ATOM 6145   C CZ2 . TRP A 1 823 ? -146.201 -33.204 -38.716 1.00 99.99  ? 827 TRP C CZ2 1  
ATOM 6146   C CZ3 . TRP A 1 823 ? -146.383 -35.456 -37.953 1.00 99.99  ? 827 TRP C CZ3 1  
ATOM 6147   C CH2 . TRP A 1 823 ? -145.938 -34.194 -37.776 1.00 99.99  ? 827 TRP C CH2 1  
ATOM 6148   N N   . LYS A 1 824 ? -150.948 -35.188 -43.807 1.00 30.00  ? 828 LYS C N   1  
ATOM 6149   C CA  . LYS A 1 824 ? -151.507 -34.174 -44.688 1.00 30.00  ? 828 LYS C CA  1  
ATOM 6150   C C   . LYS A 1 824 ? -152.891 -33.820 -44.157 1.00 30.00  ? 828 LYS C C   1  
ATOM 6151   O O   . LYS A 1 824 ? -153.145 -32.693 -43.723 1.00 30.00  ? 828 LYS C O   1  
ATOM 6152   C CB  . LYS A 1 824 ? -151.604 -34.714 -46.109 1.00 99.99  ? 828 LYS C CB  1  
ATOM 6153   C CG  . LYS A 1 824 ? -152.093 -33.615 -47.043 1.00 99.99  ? 828 LYS C CG  1  
ATOM 6154   C CD  . LYS A 1 824 ? -151.777 -33.994 -48.486 1.00 99.99  ? 828 LYS C CD  1  
ATOM 6155   C CE  . LYS A 1 824 ? -152.576 -33.103 -49.433 1.00 99.99  ? 828 LYS C CE  1  
ATOM 6156   N NZ  . LYS A 1 824 ? -151.759 -31.945 -49.826 1.00 99.99  ? 828 LYS C NZ  1  
ATOM 6157   N N   . LEU A 1 825 ? -153.773 -34.812 -44.194 1.00 30.00  ? 829 LEU C N   1  
ATOM 6158   C CA  . LEU A 1 825 ? -155.143 -34.649 -43.729 1.00 30.00  ? 829 LEU C CA  1  
ATOM 6159   C C   . LEU A 1 825 ? -155.155 -34.121 -42.299 1.00 30.00  ? 829 LEU C C   1  
ATOM 6160   O O   . LEU A 1 825 ? -155.990 -33.287 -41.944 1.00 30.00  ? 829 LEU C O   1  
ATOM 6161   C CB  . LEU A 1 825 ? -155.865 -35.991 -43.769 1.00 99.99  ? 829 LEU C CB  1  
ATOM 6162   C CG  . LEU A 1 825 ? -156.627 -36.121 -45.084 1.00 99.99  ? 829 LEU C CG  1  
ATOM 6163   C CD1 . LEU A 1 825 ? -157.602 -37.292 -44.993 1.00 99.99  ? 829 LEU C CD1 1  
ATOM 6164   C CD2 . LEU A 1 825 ? -157.398 -34.835 -45.356 1.00 99.99  ? 829 LEU C CD2 1  
ATOM 6165   N N   . TYR A 1 826 ? -154.225 -34.607 -41.484 1.00 30.00  ? 830 TYR C N   1  
ATOM 6166   C CA  . TYR A 1 826 ? -154.157 -34.149 -40.106 1.00 30.00  ? 830 TYR C CA  1  
ATOM 6167   C C   . TYR A 1 826 ? -153.943 -32.646 -40.103 1.00 30.00  ? 830 TYR C C   1  
ATOM 6168   O O   . TYR A 1 826 ? -154.771 -31.873 -39.618 1.00 30.00  ? 830 TYR C O   1  
ATOM 6169   C CB  . TYR A 1 826 ? -153.003 -34.836 -39.388 1.00 99.99  ? 830 TYR C CB  1  
ATOM 6170   C CG  . TYR A 1 826 ? -152.942 -34.355 -37.958 1.00 99.99  ? 830 TYR C CG  1  
ATOM 6171   C CD1 . TYR A 1 826 ? -153.764 -34.939 -36.987 1.00 99.99  ? 830 TYR C CD1 1  
ATOM 6172   C CD2 . TYR A 1 826 ? -152.061 -33.328 -37.601 1.00 99.99  ? 830 TYR C CD2 1  
ATOM 6173   C CE1 . TYR A 1 826 ? -153.707 -34.495 -35.661 1.00 99.99  ? 830 TYR C CE1 1  
ATOM 6174   C CE2 . TYR A 1 826 ? -152.005 -32.882 -36.275 1.00 99.99  ? 830 TYR C CE2 1  
ATOM 6175   C CZ  . TYR A 1 826 ? -152.829 -33.467 -35.304 1.00 99.99  ? 830 TYR C CZ  1  
ATOM 6176   O OH  . TYR A 1 826 ? -152.774 -33.032 -34.017 1.00 99.99  ? 830 TYR C OH  1  
ATOM 6177   N N   . SER A 1 827 ? -152.802 -32.241 -40.647 1.00 30.00  ? 831 SER C N   1  
ATOM 6178   C CA  . SER A 1 827 ? -152.437 -30.840 -40.718 1.00 30.00  ? 831 SER C CA  1  
ATOM 6179   C C   . SER A 1 827 ? -153.627 -30.027 -41.174 1.00 30.00  ? 831 SER C C   1  
ATOM 6180   O O   . SER A 1 827 ? -153.875 -28.929 -40.666 1.00 30.00  ? 831 SER C O   1  
ATOM 6181   C CB  . SER A 1 827 ? -151.291 -30.651 -41.707 1.00 99.99  ? 831 SER C CB  1  
ATOM 6182   O OG  . SER A 1 827 ? -151.754 -30.923 -43.030 1.00 99.99  ? 831 SER C OG  1  
ATOM 6183   N N   . LYS A 1 828 ? -154.371 -30.579 -42.133 1.00 30.00  ? 832 LYS C N   1  
ATOM 6184   C CA  . LYS A 1 828 ? -155.550 -29.906 -42.667 1.00 30.00  ? 832 LYS C CA  1  
ATOM 6185   C C   . LYS A 1 828 ? -156.570 -29.606 -41.556 1.00 30.00  ? 832 LYS C C   1  
ATOM 6186   O O   . LYS A 1 828 ? -156.941 -28.448 -41.347 1.00 30.00  ? 832 LYS C O   1  
ATOM 6187   C CB  . LYS A 1 828 ? -156.225 -30.793 -43.710 1.00 99.99  ? 832 LYS C CB  1  
ATOM 6188   C CG  . LYS A 1 828 ? -157.397 -30.046 -44.334 1.00 99.99  ? 832 LYS C CG  1  
ATOM 6189   C CD  . LYS A 1 828 ? -157.785 -30.713 -45.649 1.00 99.99  ? 832 LYS C CD  1  
ATOM 6190   C CE  . LYS A 1 828 ? -159.161 -30.217 -46.086 1.00 99.99  ? 832 LYS C CE  1  
ATOM 6191   N NZ  . LYS A 1 828 ? -159.004 -29.080 -47.004 1.00 99.99  ? 832 LYS C NZ  1  
ATOM 6192   N N   . VAL A 1 829 ? -157.011 -30.641 -40.844 1.00 30.00  ? 833 VAL C N   1  
ATOM 6193   C CA  . VAL A 1 829 ? -157.982 -30.459 -39.770 1.00 30.00  ? 833 VAL C CA  1  
ATOM 6194   C C   . VAL A 1 829 ? -157.501 -29.415 -38.763 1.00 30.00  ? 833 VAL C C   1  
ATOM 6195   O O   . VAL A 1 829 ? -158.256 -28.510 -38.400 1.00 30.00  ? 833 VAL C O   1  
ATOM 6196   C CB  . VAL A 1 829 ? -158.196 -31.779 -39.036 1.00 99.99  ? 833 VAL C CB  1  
ATOM 6197   C CG1 . VAL A 1 829 ? -158.717 -32.828 -40.014 1.00 99.99  ? 833 VAL C CG1 1  
ATOM 6198   C CG2 . VAL A 1 829 ? -156.873 -32.251 -38.443 1.00 99.99  ? 833 VAL C CG2 1  
ATOM 6199   N N   . LYS A 1 830 ? -156.248 -29.549 -38.324 1.00 30.00  ? 834 LYS C N   1  
ATOM 6200   C CA  . LYS A 1 830 ? -155.626 -28.643 -37.353 1.00 30.00  ? 834 LYS C CA  1  
ATOM 6201   C C   . LYS A 1 830 ? -156.543 -27.533 -36.813 1.00 30.00  ? 834 LYS C C   1  
ATOM 6202   O O   . LYS A 1 830 ? -156.963 -27.589 -35.661 1.00 30.00  ? 834 LYS C O   1  
ATOM 6203   C CB  . LYS A 1 830 ? -154.434 -27.941 -37.990 1.00 99.99  ? 834 LYS C CB  1  
ATOM 6204   C CG  . LYS A 1 830 ? -153.733 -27.075 -36.949 1.00 99.99  ? 834 LYS C CG  1  
ATOM 6205   C CD  . LYS A 1 830 ? -152.327 -26.737 -37.428 1.00 99.99  ? 834 LYS C CD  1  
ATOM 6206   C CE  . LYS A 1 830 ? -151.764 -25.589 -36.592 1.00 99.99  ? 834 LYS C CE  1  
ATOM 6207   N NZ  . LYS A 1 830 ? -150.978 -26.138 -35.479 1.00 99.99  ? 834 LYS C NZ  1  
ATOM 6208   N N   . PRO A 1 831 ? -156.867 -26.512 -37.628 1.00 30.00  ? 835 PRO C N   1  
ATOM 6209   C CA  . PRO A 1 831 ? -157.744 -25.473 -37.069 1.00 30.00  ? 835 PRO C CA  1  
ATOM 6210   C C   . PRO A 1 831 ? -159.137 -25.998 -36.678 1.00 30.00  ? 835 PRO C C   1  
ATOM 6211   O O   . PRO A 1 831 ? -159.355 -26.289 -35.477 1.00 30.00  ? 835 PRO C O   1  
ATOM 6212   C CB  . PRO A 1 831 ? -157.797 -24.576 -38.253 1.00 99.99  ? 835 PRO C CB  1  
ATOM 6213   C CG  . PRO A 1 831 ? -156.900 -25.201 -39.295 1.00 99.99  ? 835 PRO C CG  1  
ATOM 6214   C CD  . PRO A 1 831 ? -156.338 -26.277 -38.904 1.00 99.99  ? 835 PRO C CD  1  
ATOM 6215   O OXT . PRO A 1 831 ? -159.993 -26.110 -37.587 1.00 30.00  ? 835 PRO C OXT 1  
ATOM 6216   N N   . LYS B 2 1   ? -150.373 -32.546 -24.707 1.00 30.00  ? 15  LYS Y N   1  
ATOM 6217   C CA  . LYS B 2 1   ? -151.068 -31.529 -25.485 1.00 30.00  ? 15  LYS Y CA  1  
ATOM 6218   C C   . LYS B 2 1   ? -151.033 -31.994 -26.937 1.00 30.00  ? 15  LYS Y C   1  
ATOM 6219   O O   . LYS B 2 1   ? -151.771 -31.489 -27.790 1.00 30.00  ? 15  LYS Y O   1  
ATOM 6220   C CB  . LYS B 2 1   ? -150.362 -30.186 -25.330 1.00 99.99  ? 15  LYS Y CB  1  
ATOM 6221   C CG  . LYS B 2 1   ? -151.148 -29.109 -26.067 1.00 99.99  ? 15  LYS Y CG  1  
ATOM 6222   C CD  . LYS B 2 1   ? -150.725 -27.733 -25.564 1.00 99.99  ? 15  LYS Y CD  1  
ATOM 6223   C CE  . LYS B 2 1   ? -151.220 -26.663 -26.531 1.00 99.99  ? 15  LYS Y CE  1  
ATOM 6224   N NZ  . LYS B 2 1   ? -152.516 -26.149 -26.071 1.00 99.99  ? 15  LYS Y NZ  1  
ATOM 6225   N N   . GLN B 2 2   ? -150.161 -32.958 -27.211 1.00 30.00  ? 16  GLN Y N   1  
ATOM 6226   C CA  . GLN B 2 2   ? -150.046 -33.499 -28.557 1.00 30.00  ? 16  GLN Y CA  1  
ATOM 6227   C C   . GLN B 2 2   ? -151.235 -34.438 -28.682 1.00 30.00  ? 16  GLN Y C   1  
ATOM 6228   O O   . GLN B 2 2   ? -151.791 -34.620 -29.764 1.00 30.00  ? 16  GLN Y O   1  
ATOM 6229   C CB  . GLN B 2 2   ? -148.721 -34.239 -28.704 1.00 99.99  ? 16  GLN Y CB  1  
ATOM 6230   C CG  . GLN B 2 2   ? -148.624 -35.333 -27.651 1.00 99.99  ? 16  GLN Y CG  1  
ATOM 6231   C CD  . GLN B 2 2   ? -148.256 -34.752 -26.291 1.00 99.99  ? 16  GLN Y CD  1  
ATOM 6232   O OE1 . GLN B 2 2   ? -148.080 -33.544 -26.157 1.00 99.99  ? 16  GLN Y OE1 1  
ATOM 6233   N NE2 . GLN B 2 2   ? -148.142 -35.618 -25.282 1.00 99.99  ? 16  GLN Y NE2 1  
ATOM 6234   N N   . ILE B 2 3   ? -151.610 -35.018 -27.543 1.00 30.00  ? 17  ILE Y N   1  
ATOM 6235   C CA  . ILE B 2 3   ? -152.732 -35.943 -27.452 1.00 30.00  ? 17  ILE Y CA  1  
ATOM 6236   C C   . ILE B 2 3   ? -154.056 -35.194 -27.515 1.00 30.00  ? 17  ILE Y C   1  
ATOM 6237   O O   . ILE B 2 3   ? -154.926 -35.519 -28.326 1.00 30.00  ? 17  ILE Y O   1  
ATOM 6238   C CB  . ILE B 2 3   ? -152.666 -36.707 -26.132 1.00 99.99  ? 17  ILE Y CB  1  
ATOM 6239   C CG1 . ILE B 2 3   ? -153.253 -35.851 -25.019 1.00 99.99  ? 17  ILE Y CG1 1  
ATOM 6240   C CG2 . ILE B 2 3   ? -151.213 -37.040 -25.811 1.00 99.99  ? 17  ILE Y CG2 1  
ATOM 6241   C CD1 . ILE B 2 3   ? -152.134 -35.065 -24.339 1.00 99.99  ? 17  ILE Y CD1 1  
ATOM 6242   N N   . GLN B 2 4   ? -154.202 -34.193 -26.654 1.00 30.00  ? 18  GLN Y N   1  
ATOM 6243   C CA  . GLN B 2 4   ? -155.414 -33.377 -26.606 1.00 30.00  ? 18  GLN Y CA  1  
ATOM 6244   C C   . GLN B 2 4   ? -155.873 -33.030 -28.023 1.00 30.00  ? 18  GLN Y C   1  
ATOM 6245   O O   . GLN B 2 4   ? -157.068 -33.059 -28.320 1.00 30.00  ? 18  GLN Y O   1  
ATOM 6246   C CB  . GLN B 2 4   ? -155.138 -32.086 -25.843 1.00 99.99  ? 18  GLN Y CB  1  
ATOM 6247   C CG  . GLN B 2 4   ? -156.446 -31.537 -25.279 1.00 99.99  ? 18  GLN Y CG  1  
ATOM 6248   C CD  . GLN B 2 4   ? -157.178 -30.695 -26.314 1.00 99.99  ? 18  GLN Y CD  1  
ATOM 6249   O OE1 . GLN B 2 4   ? -156.700 -30.530 -27.434 1.00 99.99  ? 18  GLN Y OE1 1  
ATOM 6250   N NE2 . GLN B 2 4   ? -158.340 -30.160 -25.934 1.00 99.99  ? 18  GLN Y NE2 1  
ATOM 6251   N N   . GLU B 2 5   ? -154.928 -32.699 -28.901 1.00 30.00  ? 19  GLU Y N   1  
ATOM 6252   C CA  . GLU B 2 5   ? -155.242 -32.353 -30.286 1.00 30.00  ? 19  GLU Y CA  1  
ATOM 6253   C C   . GLU B 2 5   ? -155.671 -33.612 -31.029 1.00 30.00  ? 19  GLU Y C   1  
ATOM 6254   O O   . GLU B 2 5   ? -156.724 -33.645 -31.661 1.00 30.00  ? 19  GLU Y O   1  
ATOM 6255   C CB  . GLU B 2 5   ? -154.016 -31.753 -30.961 1.00 99.99  ? 19  GLU Y CB  1  
ATOM 6256   C CG  . GLU B 2 5   ? -153.658 -30.447 -30.292 1.00 99.99  ? 19  GLU Y CG  1  
ATOM 6257   C CD  . GLU B 2 5   ? -154.693 -29.386 -30.666 1.00 99.99  ? 19  GLU Y CD  1  
ATOM 6258   O OE1 . GLU B 2 5   ? -155.698 -29.272 -29.918 1.00 99.99  ? 19  GLU Y OE1 1  
ATOM 6259   O OE2 . GLU B 2 5   ? -154.465 -28.698 -31.697 1.00 99.99  ? 19  GLU Y OE2 1  
ATOM 6260   N N   . MET B 2 6   ? -154.837 -34.644 -30.955 1.00 30.00  ? 20  MET Y N   1  
ATOM 6261   C CA  . MET B 2 6   ? -155.110 -35.911 -31.612 1.00 30.00  ? 20  MET Y CA  1  
ATOM 6262   C C   . MET B 2 6   ? -156.573 -36.311 -31.464 1.00 30.00  ? 20  MET Y C   1  
ATOM 6263   O O   . MET B 2 6   ? -157.246 -36.610 -32.452 1.00 30.00  ? 20  MET Y O   1  
ATOM 6264   C CB  . MET B 2 6   ? -154.250 -37.012 -30.998 1.00 99.99  ? 20  MET Y CB  1  
ATOM 6265   C CG  . MET B 2 6   ? -152.799 -36.554 -30.949 1.00 99.99  ? 20  MET Y CG  1  
ATOM 6266   S SD  . MET B 2 6   ? -152.028 -36.760 -32.574 1.00 99.99  ? 20  MET Y SD  1  
ATOM 6267   C CE  . MET B 2 6   ? -151.777 -38.523 -32.577 1.00 99.99  ? 20  MET Y CE  1  
ATOM 6268   N N   . LYS B 2 7   ? -157.049 -36.316 -30.224 1.00 30.00  ? 21  LYS Y N   1  
ATOM 6269   C CA  . LYS B 2 7   ? -158.431 -36.674 -29.920 1.00 30.00  ? 21  LYS Y CA  1  
ATOM 6270   C C   . LYS B 2 7   ? -159.386 -35.745 -30.647 1.00 30.00  ? 21  LYS Y C   1  
ATOM 6271   O O   . LYS B 2 7   ? -160.086 -36.163 -31.575 1.00 30.00  ? 21  LYS Y O   1  
ATOM 6272   C CB  . LYS B 2 7   ? -158.677 -36.561 -28.418 1.00 99.99  ? 21  LYS Y CB  1  
ATOM 6273   C CG  . LYS B 2 7   ? -160.094 -37.030 -28.098 1.00 99.99  ? 21  LYS Y CG  1  
ATOM 6274   C CD  . LYS B 2 7   ? -160.197 -37.344 -26.611 1.00 99.99  ? 21  LYS Y CD  1  
ATOM 6275   C CE  . LYS B 2 7   ? -161.668 -37.450 -26.217 1.00 99.99  ? 21  LYS Y CE  1  
ATOM 6276   N NZ  . LYS B 2 7   ? -162.094 -38.856 -26.284 1.00 99.99  ? 21  LYS Y NZ  1  
ATOM 6277   N N   . GLU B 2 8   ? -159.412 -34.485 -30.220 1.00 30.00  ? 22  GLU Y N   1  
ATOM 6278   C CA  . GLU B 2 8   ? -160.276 -33.480 -30.829 1.00 30.00  ? 22  GLU Y CA  1  
ATOM 6279   C C   . GLU B 2 8   ? -160.245 -33.635 -32.354 1.00 30.00  ? 22  GLU Y C   1  
ATOM 6280   O O   . GLU B 2 8   ? -161.237 -33.360 -33.038 1.00 30.00  ? 22  GLU Y O   1  
ATOM 6281   C CB  . GLU B 2 8   ? -159.790 -32.083 -30.457 1.00 99.99  ? 22  GLU Y CB  1  
ATOM 6282   C CG  . GLU B 2 8   ? -159.932 -31.880 -28.969 1.00 99.99  ? 22  GLU Y CG  1  
ATOM 6283   C CD  . GLU B 2 8   ? -161.411 -31.733 -28.613 1.00 99.99  ? 22  GLU Y CD  1  
ATOM 6284   O OE1 . GLU B 2 8   ? -162.045 -32.784 -28.338 1.00 99.99  ? 22  GLU Y OE1 1  
ATOM 6285   O OE2 . GLU B 2 8   ? -161.892 -30.567 -28.624 1.00 99.99  ? 22  GLU Y OE2 1  
ATOM 6286   N N   . ALA B 2 9   ? -159.097 -34.071 -32.873 1.00 30.00  ? 23  ALA Y N   1  
ATOM 6287   C CA  . ALA B 2 9   ? -158.908 -34.284 -34.305 1.00 30.00  ? 23  ALA Y CA  1  
ATOM 6288   C C   . ALA B 2 9   ? -159.728 -35.513 -34.695 1.00 30.00  ? 23  ALA Y C   1  
ATOM 6289   O O   . ALA B 2 9   ? -160.672 -35.429 -35.480 1.00 30.00  ? 23  ALA Y O   1  
ATOM 6290   C CB  . ALA B 2 9   ? -157.430 -34.519 -34.609 1.00 30.00  ? 23  ALA Y CB  1  
ATOM 6291   N N   . PHE B 2 10  ? -159.344 -36.649 -34.129 1.00 30.00  ? 24  PHE Y N   1  
ATOM 6292   C CA  . PHE B 2 10  ? -160.019 -37.915 -34.374 1.00 30.00  ? 24  PHE Y CA  1  
ATOM 6293   C C   . PHE B 2 10  ? -161.527 -37.668 -34.350 1.00 30.00  ? 24  PHE Y C   1  
ATOM 6294   O O   . PHE B 2 10  ? -162.289 -38.319 -35.067 1.00 30.00  ? 24  PHE Y O   1  
ATOM 6295   C CB  . PHE B 2 10  ? -159.638 -38.921 -33.292 1.00 99.99  ? 24  PHE Y CB  1  
ATOM 6296   C CG  . PHE B 2 10  ? -160.340 -40.231 -33.556 1.00 99.99  ? 24  PHE Y CG  1  
ATOM 6297   C CD1 . PHE B 2 10  ? -159.796 -41.148 -34.465 1.00 99.99  ? 24  PHE Y CD1 1  
ATOM 6298   C CD2 . PHE B 2 10  ? -161.534 -40.533 -32.890 1.00 99.99  ? 24  PHE Y CD2 1  
ATOM 6299   C CE1 . PHE B 2 10  ? -160.448 -42.364 -34.707 1.00 99.99  ? 24  PHE Y CE1 1  
ATOM 6300   C CE2 . PHE B 2 10  ? -162.185 -41.746 -33.134 1.00 99.99  ? 24  PHE Y CE2 1  
ATOM 6301   C CZ  . PHE B 2 10  ? -161.641 -42.663 -34.041 1.00 99.99  ? 24  PHE Y CZ  1  
ATOM 6302   N N   . SER B 2 11  ? -161.958 -36.717 -33.523 1.00 30.00  ? 25  SER Y N   1  
ATOM 6303   C CA  . SER B 2 11  ? -163.376 -36.378 -33.413 1.00 30.00  ? 25  SER Y CA  1  
ATOM 6304   C C   . SER B 2 11  ? -163.902 -35.783 -34.722 1.00 30.00  ? 25  SER Y C   1  
ATOM 6305   O O   . SER B 2 11  ? -164.886 -36.272 -35.275 1.00 30.00  ? 25  SER Y O   1  
ATOM 6306   C CB  . SER B 2 11  ? -163.580 -35.357 -32.299 1.00 99.99  ? 25  SER Y CB  1  
ATOM 6307   O OG  . SER B 2 11  ? -163.108 -35.900 -31.065 1.00 99.99  ? 25  SER Y OG  1  
ATOM 6308   N N   . MET B 2 12  ? -163.236 -34.732 -35.209 1.00 30.00  ? 26  MET Y N   1  
ATOM 6309   C CA  . MET B 2 12  ? -163.633 -34.069 -36.451 1.00 30.00  ? 26  MET Y CA  1  
ATOM 6310   C C   . MET B 2 12  ? -163.488 -35.010 -37.638 1.00 30.00  ? 26  MET Y C   1  
ATOM 6311   O O   . MET B 2 12  ? -164.244 -34.907 -38.602 1.00 30.00  ? 26  MET Y O   1  
ATOM 6312   C CB  . MET B 2 12  ? -162.751 -32.847 -36.691 1.00 99.99  ? 26  MET Y CB  1  
ATOM 6313   C CG  . MET B 2 12  ? -162.712 -31.992 -35.430 1.00 99.99  ? 26  MET Y CG  1  
ATOM 6314   S SD  . MET B 2 12  ? -164.206 -30.980 -35.319 1.00 99.99  ? 26  MET Y SD  1  
ATOM 6315   C CE  . MET B 2 12  ? -163.824 -29.731 -36.529 1.00 99.99  ? 26  MET Y CE  1  
ATOM 6316   N N   . ILE B 2 13  ? -162.525 -35.928 -37.581 1.00 30.00  ? 27  ILE Y N   1  
ATOM 6317   C CA  . ILE B 2 13  ? -162.331 -36.867 -38.686 1.00 30.00  ? 27  ILE Y CA  1  
ATOM 6318   C C   . ILE B 2 13  ? -163.418 -37.938 -38.631 1.00 30.00  ? 27  ILE Y C   1  
ATOM 6319   O O   . ILE B 2 13  ? -164.020 -38.267 -39.659 1.00 30.00  ? 27  ILE Y O   1  
ATOM 6320   C CB  . ILE B 2 13  ? -160.963 -37.525 -38.575 1.00 99.99  ? 27  ILE Y CB  1  
ATOM 6321   C CG1 . ILE B 2 13  ? -161.057 -38.747 -37.667 1.00 99.99  ? 27  ILE Y CG1 1  
ATOM 6322   C CG2 . ILE B 2 13  ? -159.967 -36.528 -37.989 1.00 99.99  ? 27  ILE Y CG2 1  
ATOM 6323   C CD1 . ILE B 2 13  ? -161.286 -39.995 -38.513 1.00 99.99  ? 27  ILE Y CD1 1  
ATOM 6324   N N   . ASP B 2 14  ? -163.661 -38.482 -37.436 1.00 30.00  ? 28  ASP Y N   1  
ATOM 6325   C CA  . ASP B 2 14  ? -164.680 -39.515 -37.222 1.00 30.00  ? 28  ASP Y CA  1  
ATOM 6326   C C   . ASP B 2 14  ? -166.043 -38.836 -37.322 1.00 30.00  ? 28  ASP Y C   1  
ATOM 6327   O O   . ASP B 2 14  ? -166.695 -38.563 -36.312 1.00 30.00  ? 28  ASP Y O   1  
ATOM 6328   C CB  . ASP B 2 14  ? -164.496 -40.142 -35.843 1.00 99.99  ? 28  ASP Y CB  1  
ATOM 6329   C CG  . ASP B 2 14  ? -163.212 -40.963 -35.822 1.00 99.99  ? 28  ASP Y CG  1  
ATOM 6330   O OD1 . ASP B 2 14  ? -163.146 -41.953 -36.599 1.00 99.99  ? 28  ASP Y OD1 1  
ATOM 6331   O OD2 . ASP B 2 14  ? -162.303 -40.594 -35.028 1.00 99.99  ? 28  ASP Y OD2 1  
ATOM 6332   N N   . VAL B 2 15  ? -166.456 -38.567 -38.561 1.00 30.00  ? 29  VAL Y N   1  
ATOM 6333   C CA  . VAL B 2 15  ? -167.720 -37.903 -38.852 1.00 30.00  ? 29  VAL Y CA  1  
ATOM 6334   C C   . VAL B 2 15  ? -168.950 -38.622 -38.327 1.00 30.00  ? 29  VAL Y C   1  
ATOM 6335   O O   . VAL B 2 15  ? -169.691 -38.067 -37.511 1.00 30.00  ? 29  VAL Y O   1  
ATOM 6336   C CB  . VAL B 2 15  ? -167.904 -37.774 -40.359 1.00 99.99  ? 29  VAL Y CB  1  
ATOM 6337   C CG1 . VAL B 2 15  ? -166.757 -36.947 -40.941 1.00 99.99  ? 29  VAL Y CG1 1  
ATOM 6338   C CG2 . VAL B 2 15  ? -167.906 -39.159 -40.995 1.00 99.99  ? 29  VAL Y CG2 1  
ATOM 6339   N N   . ASP B 2 16  ? -169.176 -39.855 -38.782 1.00 30.00  ? 30  ASP Y N   1  
ATOM 6340   C CA  . ASP B 2 16  ? -170.331 -40.615 -38.327 1.00 30.00  ? 30  ASP Y CA  1  
ATOM 6341   C C   . ASP B 2 16  ? -170.233 -40.874 -36.825 1.00 30.00  ? 30  ASP Y C   1  
ATOM 6342   O O   . ASP B 2 16  ? -170.779 -41.852 -36.319 1.00 30.00  ? 30  ASP Y O   1  
ATOM 6343   C CB  . ASP B 2 16  ? -170.392 -41.953 -39.055 1.00 99.99  ? 30  ASP Y CB  1  
ATOM 6344   C CG  . ASP B 2 16  ? -169.018 -42.619 -39.019 1.00 99.99  ? 30  ASP Y CG  1  
ATOM 6345   O OD1 . ASP B 2 16  ? -168.046 -41.958 -39.476 1.00 99.99  ? 30  ASP Y OD1 1  
ATOM 6346   O OD2 . ASP B 2 16  ? -168.950 -43.780 -38.534 1.00 99.99  ? 30  ASP Y OD2 1  
ATOM 6347   N N   . ARG B 2 17  ? -169.532 -39.974 -36.132 1.00 30.00  ? 31  ARG Y N   1  
ATOM 6348   C CA  . ARG B 2 17  ? -169.305 -40.006 -34.690 1.00 30.00  ? 31  ARG Y CA  1  
ATOM 6349   C C   . ARG B 2 17  ? -169.446 -41.383 -34.023 1.00 30.00  ? 31  ARG Y C   1  
ATOM 6350   O O   . ARG B 2 17  ? -169.967 -41.482 -32.914 1.00 30.00  ? 31  ARG Y O   1  
ATOM 6351   C CB  . ARG B 2 17  ? -170.302 -39.090 -33.986 1.00 99.99  ? 31  ARG Y CB  1  
ATOM 6352   C CG  . ARG B 2 17  ? -170.214 -37.691 -34.578 1.00 99.99  ? 31  ARG Y CG  1  
ATOM 6353   C CD  . ARG B 2 17  ? -168.860 -37.078 -34.234 1.00 99.99  ? 31  ARG Y CD  1  
ATOM 6354   N NE  . ARG B 2 17  ? -168.665 -37.008 -32.768 1.00 99.99  ? 31  ARG Y NE  1  
ATOM 6355   C CZ  . ARG B 2 17  ? -167.732 -36.251 -32.198 1.00 99.99  ? 31  ARG Y CZ  1  
ATOM 6356   N NH1 . ARG B 2 17  ? -166.899 -35.497 -32.912 1.00 99.99  ? 31  ARG Y NH1 1  
ATOM 6357   N NH2 . ARG B 2 17  ? -167.643 -36.262 -30.871 1.00 99.99  ? 31  ARG Y NH2 1  
ATOM 6358   N N   . ASP B 2 18  ? -168.975 -42.440 -34.687 1.00 30.00  ? 32  ASP Y N   1  
ATOM 6359   C CA  . ASP B 2 18  ? -169.057 -43.803 -34.158 1.00 30.00  ? 32  ASP Y CA  1  
ATOM 6360   C C   . ASP B 2 18  ? -167.787 -44.310 -33.462 1.00 30.00  ? 32  ASP Y C   1  
ATOM 6361   O O   . ASP B 2 18  ? -167.622 -45.519 -33.257 1.00 30.00  ? 32  ASP Y O   1  
ATOM 6362   C CB  . ASP B 2 18  ? -169.347 -44.782 -35.290 1.00 99.99  ? 32  ASP Y CB  1  
ATOM 6363   C CG  . ASP B 2 18  ? -170.759 -44.545 -35.822 1.00 99.99  ? 32  ASP Y CG  1  
ATOM 6364   O OD1 . ASP B 2 18  ? -171.717 -44.899 -35.085 1.00 99.99  ? 32  ASP Y OD1 1  
ATOM 6365   O OD2 . ASP B 2 18  ? -170.865 -44.011 -36.958 1.00 99.99  ? 32  ASP Y OD2 1  
ATOM 6366   N N   . GLY B 2 19  ? -166.895 -43.384 -33.105 1.00 30.00  ? 33  GLY Y N   1  
ATOM 6367   C CA  . GLY B 2 19  ? -165.652 -43.755 -32.435 1.00 30.00  ? 33  GLY Y CA  1  
ATOM 6368   C C   . GLY B 2 19  ? -164.695 -44.597 -33.267 1.00 30.00  ? 33  GLY Y C   1  
ATOM 6369   O O   . GLY B 2 19  ? -163.781 -45.233 -32.729 1.00 30.00  ? 33  GLY Y O   1  
ATOM 6370   N N   . PHE B 2 20  ? -164.902 -44.608 -34.581 1.00 30.00  ? 34  PHE Y N   1  
ATOM 6371   C CA  . PHE B 2 20  ? -164.056 -45.363 -35.504 1.00 30.00  ? 34  PHE Y CA  1  
ATOM 6372   C C   . PHE B 2 20  ? -163.862 -44.579 -36.785 1.00 30.00  ? 34  PHE Y C   1  
ATOM 6373   O O   . PHE B 2 20  ? -164.694 -43.744 -37.137 1.00 30.00  ? 34  PHE Y O   1  
ATOM 6374   C CB  . PHE B 2 20  ? -164.709 -46.700 -35.831 1.00 99.99  ? 34  PHE Y CB  1  
ATOM 6375   C CG  . PHE B 2 20  ? -165.947 -46.469 -36.663 1.00 99.99  ? 34  PHE Y CG  1  
ATOM 6376   C CD1 . PHE B 2 20  ? -167.183 -46.280 -36.036 1.00 99.99  ? 34  PHE Y CD1 1  
ATOM 6377   C CD2 . PHE B 2 20  ? -165.856 -46.436 -38.060 1.00 99.99  ? 34  PHE Y CD2 1  
ATOM 6378   C CE1 . PHE B 2 20  ? -168.334 -46.063 -36.810 1.00 99.99  ? 34  PHE Y CE1 1  
ATOM 6379   C CE2 . PHE B 2 20  ? -167.005 -46.222 -38.832 1.00 99.99  ? 34  PHE Y CE2 1  
ATOM 6380   C CZ  . PHE B 2 20  ? -168.244 -46.035 -38.207 1.00 99.99  ? 34  PHE Y CZ  1  
ATOM 6381   N N   . VAL B 2 21  ? -162.761 -44.840 -37.479 1.00 30.00  ? 35  VAL Y N   1  
ATOM 6382   C CA  . VAL B 2 21  ? -162.481 -44.138 -38.722 1.00 30.00  ? 35  VAL Y CA  1  
ATOM 6383   C C   . VAL B 2 21  ? -162.592 -45.137 -39.861 1.00 30.00  ? 35  VAL Y C   1  
ATOM 6384   O O   . VAL B 2 21  ? -161.869 -46.138 -39.917 1.00 30.00  ? 35  VAL Y O   1  
ATOM 6385   C CB  . VAL B 2 21  ? -161.076 -43.551 -38.678 1.00 99.99  ? 35  VAL Y CB  1  
ATOM 6386   C CG1 . VAL B 2 21  ? -160.970 -42.571 -37.514 1.00 99.99  ? 35  VAL Y CG1 1  
ATOM 6387   C CG2 . VAL B 2 21  ? -160.059 -44.672 -38.494 1.00 99.99  ? 35  VAL Y CG2 1  
ATOM 6388   N N   . SER B 2 22  ? -163.517 -44.843 -40.770 1.00 30.00  ? 36  SER Y N   1  
ATOM 6389   C CA  . SER B 2 22  ? -163.782 -45.685 -41.931 1.00 30.00  ? 36  SER Y CA  1  
ATOM 6390   C C   . SER B 2 22  ? -163.471 -44.954 -43.222 1.00 30.00  ? 36  SER Y C   1  
ATOM 6391   O O   . SER B 2 22  ? -163.414 -43.721 -43.241 1.00 30.00  ? 36  SER Y O   1  
ATOM 6392   C CB  . SER B 2 22  ? -165.254 -46.092 -41.949 1.00 99.99  ? 36  SER Y CB  1  
ATOM 6393   O OG  . SER B 2 22  ? -166.064 -44.941 -42.206 1.00 99.99  ? 36  SER Y OG  1  
ATOM 6394   N N   . LYS B 2 23  ? -163.277 -45.716 -44.303 1.00 30.00  ? 37  LYS Y N   1  
ATOM 6395   C CA  . LYS B 2 23  ? -162.983 -45.138 -45.618 1.00 30.00  ? 37  LYS Y CA  1  
ATOM 6396   C C   . LYS B 2 23  ? -163.906 -43.941 -45.907 1.00 30.00  ? 37  LYS Y C   1  
ATOM 6397   O O   . LYS B 2 23  ? -163.502 -42.970 -46.545 1.00 30.00  ? 37  LYS Y O   1  
ATOM 6398   C CB  . LYS B 2 23  ? -163.192 -46.188 -46.705 1.00 99.99  ? 37  LYS Y CB  1  
ATOM 6399   C CG  . LYS B 2 23  ? -162.791 -45.610 -48.057 1.00 99.99  ? 37  LYS Y CG  1  
ATOM 6400   C CD  . LYS B 2 23  ? -162.570 -46.743 -49.050 1.00 99.99  ? 37  LYS Y CD  1  
ATOM 6401   C CE  . LYS B 2 23  ? -162.536 -46.179 -50.467 1.00 99.99  ? 37  LYS Y CE  1  
ATOM 6402   N NZ  . LYS B 2 23  ? -161.145 -45.909 -50.856 1.00 99.99  ? 37  LYS Y NZ  1  
ATOM 6403   N N   . GLU B 2 24  ? -165.143 -44.022 -45.423 1.00 30.00  ? 38  GLU Y N   1  
ATOM 6404   C CA  . GLU B 2 24  ? -166.133 -42.973 -45.618 1.00 30.00  ? 38  GLU Y CA  1  
ATOM 6405   C C   . GLU B 2 24  ? -165.886 -41.829 -44.658 1.00 30.00  ? 38  GLU Y C   1  
ATOM 6406   O O   . GLU B 2 24  ? -166.220 -40.688 -44.935 1.00 30.00  ? 38  GLU Y O   1  
ATOM 6407   C CB  . GLU B 2 24  ? -167.532 -43.527 -45.374 1.00 99.99  ? 38  GLU Y CB  1  
ATOM 6408   C CG  . GLU B 2 24  ? -167.851 -44.572 -46.417 1.00 99.99  ? 38  GLU Y CG  1  
ATOM 6409   C CD  . GLU B 2 24  ? -168.084 -43.894 -47.763 1.00 99.99  ? 38  GLU Y CD  1  
ATOM 6410   O OE1 . GLU B 2 24  ? -167.082 -43.732 -48.509 1.00 99.99  ? 38  GLU Y OE1 1  
ATOM 6411   O OE2 . GLU B 2 24  ? -169.264 -43.543 -48.035 1.00 99.99  ? 38  GLU Y OE2 1  
ATOM 6412   N N   . ASP B 2 25  ? -165.296 -42.143 -43.518 1.00 30.00  ? 39  ASP Y N   1  
ATOM 6413   C CA  . ASP B 2 25  ? -165.007 -41.113 -42.536 1.00 30.00  ? 39  ASP Y CA  1  
ATOM 6414   C C   . ASP B 2 25  ? -163.980 -40.149 -43.131 1.00 30.00  ? 39  ASP Y C   1  
ATOM 6415   O O   . ASP B 2 25  ? -164.188 -38.929 -43.143 1.00 30.00  ? 39  ASP Y O   1  
ATOM 6416   C CB  . ASP B 2 25  ? -164.446 -41.750 -41.268 1.00 99.99  ? 39  ASP Y CB  1  
ATOM 6417   C CG  . ASP B 2 25  ? -165.559 -42.490 -40.531 1.00 99.99  ? 39  ASP Y CG  1  
ATOM 6418   O OD1 . ASP B 2 25  ? -166.593 -41.827 -40.239 1.00 99.99  ? 39  ASP Y OD1 1  
ATOM 6419   O OD2 . ASP B 2 25  ? -165.370 -43.707 -40.265 1.00 99.99  ? 39  ASP Y OD2 1  
ATOM 6420   N N   . ILE B 2 26  ? -162.876 -40.717 -43.624 1.00 30.00  ? 40  ILE Y N   1  
ATOM 6421   C CA  . ILE B 2 26  ? -161.773 -39.958 -44.230 1.00 30.00  ? 40  ILE Y CA  1  
ATOM 6422   C C   . ILE B 2 26  ? -162.264 -39.167 -45.433 1.00 30.00  ? 40  ILE Y C   1  
ATOM 6423   O O   . ILE B 2 26  ? -162.177 -37.931 -45.459 1.00 30.00  ? 40  ILE Y O   1  
ATOM 6424   C CB  . ILE B 2 26  ? -160.675 -40.912 -44.686 1.00 99.99  ? 40  ILE Y CB  1  
ATOM 6425   C CG1 . ILE B 2 26  ? -160.989 -41.416 -46.089 1.00 99.99  ? 40  ILE Y CG1 1  
ATOM 6426   C CG2 . ILE B 2 26  ? -160.599 -42.096 -43.724 1.00 99.99  ? 40  ILE Y CG2 1  
ATOM 6427   C CD1 . ILE B 2 26  ? -160.275 -40.542 -47.114 1.00 99.99  ? 40  ILE Y CD1 1  
ATOM 6428   N N   . LYS B 2 27  ? -162.767 -39.897 -46.428 1.00 30.00  ? 41  LYS Y N   1  
ATOM 6429   C CA  . LYS B 2 27  ? -163.295 -39.318 -47.659 1.00 30.00  ? 41  LYS Y CA  1  
ATOM 6430   C C   . LYS B 2 27  ? -164.241 -38.177 -47.306 1.00 30.00  ? 41  LYS Y C   1  
ATOM 6431   O O   . LYS B 2 27  ? -164.166 -37.085 -47.862 1.00 30.00  ? 41  LYS Y O   1  
ATOM 6432   C CB  . LYS B 2 27  ? -164.048 -40.380 -48.452 1.00 99.99  ? 41  LYS Y CB  1  
ATOM 6433   C CG  . LYS B 2 27  ? -164.511 -39.796 -49.781 1.00 99.99  ? 41  LYS Y CG  1  
ATOM 6434   C CD  . LYS B 2 27  ? -164.854 -40.928 -50.744 1.00 99.99  ? 41  LYS Y CD  1  
ATOM 6435   C CE  . LYS B 2 27  ? -165.656 -40.368 -51.917 1.00 99.99  ? 41  LYS Y CE  1  
ATOM 6436   N NZ  . LYS B 2 27  ? -164.743 -40.046 -53.024 1.00 99.99  ? 41  LYS Y NZ  1  
ATOM 6437   N N   . ALA B 2 28  ? -165.134 -38.447 -46.367 1.00 30.00  ? 42  ALA Y N   1  
ATOM 6438   C CA  . ALA B 2 28  ? -166.108 -37.470 -45.917 1.00 30.00  ? 42  ALA Y CA  1  
ATOM 6439   C C   . ALA B 2 28  ? -165.486 -36.114 -45.615 1.00 30.00  ? 42  ALA Y C   1  
ATOM 6440   O O   . ALA B 2 28  ? -165.629 -35.169 -46.386 1.00 30.00  ? 42  ALA Y O   1  
ATOM 6441   C CB  . ALA B 2 28  ? -166.817 -37.992 -44.676 1.00 30.00  ? 42  ALA Y CB  1  
ATOM 6442   N N   . ILE B 2 29  ? -164.792 -36.030 -44.487 1.00 30.00  ? 43  ILE Y N   1  
ATOM 6443   C CA  . ILE B 2 29  ? -164.152 -34.792 -44.042 1.00 30.00  ? 43  ILE Y CA  1  
ATOM 6444   C C   . ILE B 2 29  ? -163.158 -34.143 -45.010 1.00 30.00  ? 43  ILE Y C   1  
ATOM 6445   O O   . ILE B 2 29  ? -163.089 -32.912 -45.097 1.00 30.00  ? 43  ILE Y O   1  
ATOM 6446   C CB  . ILE B 2 29  ? -163.365 -35.047 -42.759 1.00 99.99  ? 43  ILE Y CB  1  
ATOM 6447   C CG1 . ILE B 2 29  ? -162.010 -35.652 -43.104 1.00 99.99  ? 43  ILE Y CG1 1  
ATOM 6448   C CG2 . ILE B 2 29  ? -164.144 -36.013 -41.870 1.00 99.99  ? 43  ILE Y CG2 1  
ATOM 6449   C CD1 . ILE B 2 29  ? -162.107 -37.174 -43.061 1.00 99.99  ? 43  ILE Y CD1 1  
ATOM 6450   N N   . SER B 2 30  ? -162.380 -34.956 -45.721 1.00 30.00  ? 44  SER Y N   1  
ATOM 6451   C CA  . SER B 2 30  ? -161.413 -34.420 -46.674 1.00 30.00  ? 44  SER Y CA  1  
ATOM 6452   C C   . SER B 2 30  ? -162.171 -33.455 -47.584 1.00 30.00  ? 44  SER Y C   1  
ATOM 6453   O O   . SER B 2 30  ? -161.904 -32.254 -47.593 1.00 30.00  ? 44  SER Y O   1  
ATOM 6454   C CB  . SER B 2 30  ? -160.801 -35.556 -47.486 1.00 99.99  ? 44  SER Y CB  1  
ATOM 6455   O OG  . SER B 2 30  ? -161.796 -36.124 -48.340 1.00 99.99  ? 44  SER Y OG  1  
ATOM 6456   N N   . GLU B 2 31  ? -163.124 -34.010 -48.340 1.00 30.00  ? 45  GLU Y N   1  
ATOM 6457   C CA  . GLU B 2 31  ? -163.952 -33.251 -49.275 1.00 30.00  ? 45  GLU Y CA  1  
ATOM 6458   C C   . GLU B 2 31  ? -164.600 -32.010 -48.661 1.00 30.00  ? 45  GLU Y C   1  
ATOM 6459   O O   . GLU B 2 31  ? -164.754 -30.997 -49.337 1.00 30.00  ? 45  GLU Y O   1  
ATOM 6460   C CB  . GLU B 2 31  ? -165.081 -34.131 -49.801 1.00 99.99  ? 45  GLU Y CB  1  
ATOM 6461   C CG  . GLU B 2 31  ? -164.499 -35.264 -50.612 1.00 99.99  ? 45  GLU Y CG  1  
ATOM 6462   C CD  . GLU B 2 31  ? -163.970 -34.724 -51.937 1.00 99.99  ? 45  GLU Y CD  1  
ATOM 6463   O OE1 . GLU B 2 31  ? -162.769 -34.344 -51.965 1.00 99.99  ? 45  GLU Y OE1 1  
ATOM 6464   O OE2 . GLU B 2 31  ? -164.770 -34.695 -52.909 1.00 99.99  ? 45  GLU Y OE2 1  
ATOM 6465   N N   . GLN B 2 32  ? -164.983 -32.077 -47.393 1.00 30.00  ? 46  GLN Y N   1  
ATOM 6466   C CA  . GLN B 2 32  ? -165.606 -30.924 -46.751 1.00 30.00  ? 46  GLN Y CA  1  
ATOM 6467   C C   . GLN B 2 32  ? -164.593 -29.786 -46.666 1.00 30.00  ? 46  GLN Y C   1  
ATOM 6468   O O   . GLN B 2 32  ? -164.944 -28.645 -46.355 1.00 30.00  ? 46  GLN Y O   1  
ATOM 6469   C CB  . GLN B 2 32  ? -166.068 -31.297 -45.347 1.00 99.99  ? 46  GLN Y CB  1  
ATOM 6470   C CG  . GLN B 2 32  ? -167.169 -32.347 -45.434 1.00 99.99  ? 46  GLN Y CG  1  
ATOM 6471   C CD  . GLN B 2 32  ? -168.466 -31.739 -45.949 1.00 99.99  ? 46  GLN Y CD  1  
ATOM 6472   O OE1 . GLN B 2 32  ? -168.526 -30.546 -46.231 1.00 99.99  ? 46  GLN Y OE1 1  
ATOM 6473   N NE2 . GLN B 2 32  ? -169.508 -32.563 -46.068 1.00 99.99  ? 46  GLN Y NE2 1  
ATOM 6474   N N   . LEU B 2 33  ? -163.335 -30.107 -46.956 1.00 30.00  ? 47  LEU Y N   1  
ATOM 6475   C CA  . LEU B 2 33  ? -162.256 -29.127 -46.912 1.00 30.00  ? 47  LEU Y CA  1  
ATOM 6476   C C   . LEU B 2 33  ? -161.504 -28.985 -48.248 1.00 30.00  ? 47  LEU Y C   1  
ATOM 6477   O O   . LEU B 2 33  ? -161.817 -28.101 -49.058 1.00 30.00  ? 47  LEU Y O   1  
ATOM 6478   C CB  . LEU B 2 33  ? -161.229 -29.533 -45.860 1.00 99.99  ? 47  LEU Y CB  1  
ATOM 6479   C CG  . LEU B 2 33  ? -161.542 -28.826 -44.545 1.00 99.99  ? 47  LEU Y CG  1  
ATOM 6480   C CD1 . LEU B 2 33  ? -160.353 -28.965 -43.598 1.00 99.99  ? 47  LEU Y CD1 1  
ATOM 6481   C CD2 . LEU B 2 33  ? -161.810 -27.349 -44.814 1.00 99.99  ? 47  LEU Y CD2 1  
ATOM 6482   N N   . GLY B 2 34  ? -160.518 -29.849 -48.477 1.00 30.00  ? 48  GLY Y N   1  
ATOM 6483   C CA  . GLY B 2 34  ? -159.758 -29.787 -49.712 1.00 30.00  ? 48  GLY Y CA  1  
ATOM 6484   C C   . GLY B 2 34  ? -159.928 -31.073 -50.496 1.00 30.00  ? 48  GLY Y C   1  
ATOM 6485   O O   . GLY B 2 34  ? -160.555 -32.007 -50.010 1.00 30.00  ? 48  GLY Y O   1  
ATOM 6486   N N   . ARG B 2 35  ? -159.378 -31.129 -51.702 1.00 30.00  ? 49  ARG Y N   1  
ATOM 6487   C CA  . ARG B 2 35  ? -159.502 -32.339 -52.507 1.00 30.00  ? 49  ARG Y CA  1  
ATOM 6488   C C   . ARG B 2 35  ? -159.204 -33.543 -51.612 1.00 30.00  ? 49  ARG Y C   1  
ATOM 6489   O O   . ARG B 2 35  ? -158.393 -33.456 -50.686 1.00 30.00  ? 49  ARG Y O   1  
ATOM 6490   C CB  . ARG B 2 35  ? -158.513 -32.292 -53.668 1.00 99.99  ? 49  ARG Y CB  1  
ATOM 6491   C CG  . ARG B 2 35  ? -158.682 -33.537 -54.532 1.00 99.99  ? 49  ARG Y CG  1  
ATOM 6492   C CD  . ARG B 2 35  ? -157.762 -33.443 -55.744 1.00 99.99  ? 49  ARG Y CD  1  
ATOM 6493   N NE  . ARG B 2 35  ? -156.426 -34.000 -55.439 1.00 99.99  ? 49  ARG Y NE  1  
ATOM 6494   C CZ  . ARG B 2 35  ? -156.167 -35.305 -55.440 1.00 99.99  ? 49  ARG Y CZ  1  
ATOM 6495   N NH1 . ARG B 2 35  ? -157.100 -36.208 -55.720 1.00 99.99  ? 49  ARG Y NH1 1  
ATOM 6496   N NH2 . ARG B 2 35  ? -154.928 -35.697 -55.151 1.00 99.99  ? 49  ARG Y NH2 1  
ATOM 6497   N N   . ALA B 2 36  ? -159.864 -34.664 -51.887 1.00 30.00  ? 50  ALA Y N   1  
ATOM 6498   C CA  . ALA B 2 36  ? -159.673 -35.872 -51.102 1.00 30.00  ? 50  ALA Y CA  1  
ATOM 6499   C C   . ALA B 2 36  ? -158.984 -36.962 -51.925 1.00 30.00  ? 50  ALA Y C   1  
ATOM 6500   O O   . ALA B 2 36  ? -158.946 -36.891 -53.152 1.00 30.00  ? 50  ALA Y O   1  
ATOM 6501   C CB  . ALA B 2 36  ? -161.025 -36.362 -50.605 1.00 30.00  ? 50  ALA Y CB  1  
ATOM 6502   N N   . PRO B 2 37  ? -158.422 -37.981 -51.251 1.00 30.00  ? 51  PRO Y N   1  
ATOM 6503   C CA  . PRO B 2 37  ? -157.724 -39.107 -51.901 1.00 30.00  ? 51  PRO Y CA  1  
ATOM 6504   C C   . PRO B 2 37  ? -158.645 -40.057 -52.666 1.00 30.00  ? 51  PRO Y C   1  
ATOM 6505   O O   . PRO B 2 37  ? -159.833 -40.155 -52.370 1.00 30.00  ? 51  PRO Y O   1  
ATOM 6506   C CB  . PRO B 2 37  ? -157.164 -39.742 -50.680 1.00 99.99  ? 51  PRO Y CB  1  
ATOM 6507   C CG  . PRO B 2 37  ? -157.572 -38.864 -49.520 1.00 99.99  ? 51  PRO Y CG  1  
ATOM 6508   C CD  . PRO B 2 37  ? -158.247 -37.838 -49.871 1.00 99.99  ? 51  PRO Y CD  1  
ATOM 6509   N N   . ASP B 2 38  ? -158.082 -40.756 -53.648 1.00 30.00  ? 52  ASP Y N   1  
ATOM 6510   C CA  . ASP B 2 38  ? -158.846 -41.701 -54.455 1.00 30.00  ? 52  ASP Y CA  1  
ATOM 6511   C C   . ASP B 2 38  ? -158.982 -42.999 -53.664 1.00 30.00  ? 52  ASP Y C   1  
ATOM 6512   O O   . ASP B 2 38  ? -158.221 -43.236 -52.729 1.00 30.00  ? 52  ASP Y O   1  
ATOM 6513   C CB  . ASP B 2 38  ? -158.118 -41.967 -55.769 1.00 99.99  ? 52  ASP Y CB  1  
ATOM 6514   C CG  . ASP B 2 38  ? -156.769 -42.620 -55.483 1.00 99.99  ? 52  ASP Y CG  1  
ATOM 6515   O OD1 . ASP B 2 38  ? -155.823 -41.862 -55.144 1.00 99.99  ? 52  ASP Y OD1 1  
ATOM 6516   O OD2 . ASP B 2 38  ? -156.696 -43.872 -55.606 1.00 99.99  ? 52  ASP Y OD2 1  
ATOM 6517   N N   . ASP B 2 39  ? -159.947 -43.831 -54.043 1.00 30.00  ? 53  ASP Y N   1  
ATOM 6518   C CA  . ASP B 2 39  ? -160.169 -45.096 -53.353 1.00 30.00  ? 53  ASP Y CA  1  
ATOM 6519   C C   . ASP B 2 39  ? -158.863 -45.773 -52.955 1.00 30.00  ? 53  ASP Y C   1  
ATOM 6520   O O   . ASP B 2 39  ? -158.678 -46.108 -51.782 1.00 30.00  ? 53  ASP Y O   1  
ATOM 6521   C CB  . ASP B 2 39  ? -160.936 -46.052 -54.257 1.00 99.99  ? 53  ASP Y CB  1  
ATOM 6522   C CG  . ASP B 2 39  ? -160.288 -46.079 -55.641 1.00 99.99  ? 53  ASP Y CG  1  
ATOM 6523   O OD1 . ASP B 2 39  ? -160.165 -44.975 -56.238 1.00 99.99  ? 53  ASP Y OD1 1  
ATOM 6524   O OD2 . ASP B 2 39  ? -159.922 -47.197 -56.085 1.00 99.99  ? 53  ASP Y OD2 1  
ATOM 6525   N N   . LYS B 2 40  ? -157.962 -45.965 -53.917 1.00 30.00  ? 54  LYS Y N   1  
ATOM 6526   C CA  . LYS B 2 40  ? -156.673 -46.614 -53.656 1.00 30.00  ? 54  LYS Y CA  1  
ATOM 6527   C C   . LYS B 2 40  ? -155.894 -45.941 -52.525 1.00 30.00  ? 54  LYS Y C   1  
ATOM 6528   O O   . LYS B 2 40  ? -155.254 -46.611 -51.705 1.00 30.00  ? 54  LYS Y O   1  
ATOM 6529   C CB  . LYS B 2 40  ? -155.807 -46.570 -54.909 1.00 99.99  ? 54  LYS Y CB  1  
ATOM 6530   C CG  . LYS B 2 40  ? -156.011 -47.847 -55.714 1.00 99.99  ? 54  LYS Y CG  1  
ATOM 6531   C CD  . LYS B 2 40  ? -157.346 -47.782 -56.446 1.00 99.99  ? 54  LYS Y CD  1  
ATOM 6532   C CE  . LYS B 2 40  ? -157.642 -49.132 -57.088 1.00 99.99  ? 54  LYS Y CE  1  
ATOM 6533   N NZ  . LYS B 2 40  ? -158.983 -49.106 -57.689 1.00 99.99  ? 54  LYS Y NZ  1  
ATOM 6534   N N   . GLU B 2 41  ? -155.949 -44.612 -52.489 1.00 30.00  ? 55  GLU Y N   1  
ATOM 6535   C CA  . GLU B 2 41  ? -155.258 -43.841 -51.460 1.00 30.00  ? 55  GLU Y CA  1  
ATOM 6536   C C   . GLU B 2 41  ? -155.892 -44.146 -50.111 1.00 30.00  ? 55  GLU Y C   1  
ATOM 6537   O O   . GLU B 2 41  ? -155.197 -44.423 -49.137 1.00 30.00  ? 55  GLU Y O   1  
ATOM 6538   C CB  . GLU B 2 41  ? -155.382 -42.351 -51.760 1.00 99.99  ? 55  GLU Y CB  1  
ATOM 6539   C CG  . GLU B 2 41  ? -154.661 -42.034 -53.049 1.00 99.99  ? 55  GLU Y CG  1  
ATOM 6540   C CD  . GLU B 2 41  ? -153.151 -42.119 -52.821 1.00 99.99  ? 55  GLU Y CD  1  
ATOM 6541   O OE1 . GLU B 2 41  ? -152.600 -43.234 -53.010 1.00 99.99  ? 55  GLU Y OE1 1  
ATOM 6542   O OE2 . GLU B 2 41  ? -152.566 -41.063 -52.458 1.00 99.99  ? 55  GLU Y OE2 1  
ATOM 6543   N N   . LEU B 2 42  ? -157.224 -44.080 -50.075 1.00 30.00  ? 56  LEU Y N   1  
ATOM 6544   C CA  . LEU B 2 42  ? -158.009 -44.338 -48.870 1.00 30.00  ? 56  LEU Y CA  1  
ATOM 6545   C C   . LEU B 2 42  ? -157.840 -45.777 -48.384 1.00 30.00  ? 56  LEU Y C   1  
ATOM 6546   O O   . LEU B 2 42  ? -157.765 -46.043 -47.181 1.00 30.00  ? 56  LEU Y O   1  
ATOM 6547   C CB  . LEU B 2 42  ? -159.489 -44.101 -49.151 1.00 99.99  ? 56  LEU Y CB  1  
ATOM 6548   C CG  . LEU B 2 42  ? -160.303 -44.428 -47.904 1.00 99.99  ? 56  LEU Y CG  1  
ATOM 6549   C CD1 . LEU B 2 42  ? -159.925 -45.816 -47.401 1.00 99.99  ? 56  LEU Y CD1 1  
ATOM 6550   C CD2 . LEU B 2 42  ? -160.012 -43.395 -46.821 1.00 99.99  ? 56  LEU Y CD2 1  
ATOM 6551   N N   . THR B 2 43  ? -157.782 -46.702 -49.331 1.00 30.00  ? 57  THR Y N   1  
ATOM 6552   C CA  . THR B 2 43  ? -157.616 -48.106 -49.014 1.00 30.00  ? 57  THR Y CA  1  
ATOM 6553   C C   . THR B 2 43  ? -156.311 -48.371 -48.278 1.00 30.00  ? 57  THR Y C   1  
ATOM 6554   O O   . THR B 2 43  ? -156.324 -48.758 -47.108 1.00 30.00  ? 57  THR Y O   1  
ATOM 6555   C CB  . THR B 2 43  ? -157.613 -48.929 -50.298 1.00 99.99  ? 57  THR Y CB  1  
ATOM 6556   O OG1 . THR B 2 43  ? -156.431 -48.636 -51.048 1.00 99.99  ? 57  THR Y OG1 1  
ATOM 6557   C CG2 . THR B 2 43  ? -158.842 -48.581 -51.128 1.00 99.99  ? 57  THR Y CG2 1  
ATOM 6558   N N   . ALA B 2 44  ? -155.184 -48.165 -48.962 1.00 30.00  ? 58  ALA Y N   1  
ATOM 6559   C CA  . ALA B 2 44  ? -153.877 -48.400 -48.345 1.00 30.00  ? 58  ALA Y CA  1  
ATOM 6560   C C   . ALA B 2 44  ? -153.619 -47.475 -47.154 1.00 30.00  ? 58  ALA Y C   1  
ATOM 6561   O O   . ALA B 2 44  ? -152.743 -47.736 -46.319 1.00 30.00  ? 58  ALA Y O   1  
ATOM 6562   C CB  . ALA B 2 44  ? -152.777 -48.224 -49.385 1.00 30.00  ? 58  ALA Y CB  1  
ATOM 6563   N N   . MET B 2 45  ? -154.394 -46.397 -47.080 1.00 30.00  ? 59  MET Y N   1  
ATOM 6564   C CA  . MET B 2 45  ? -154.285 -45.413 -46.008 1.00 30.00  ? 59  MET Y CA  1  
ATOM 6565   C C   . MET B 2 45  ? -154.817 -46.004 -44.705 1.00 30.00  ? 59  MET Y C   1  
ATOM 6566   O O   . MET B 2 45  ? -154.417 -45.594 -43.613 1.00 30.00  ? 59  MET Y O   1  
ATOM 6567   C CB  . MET B 2 45  ? -155.098 -44.170 -46.362 1.00 99.99  ? 59  MET Y CB  1  
ATOM 6568   C CG  . MET B 2 45  ? -155.313 -43.326 -45.109 1.00 99.99  ? 59  MET Y CG  1  
ATOM 6569   S SD  . MET B 2 45  ? -156.328 -41.879 -45.499 1.00 99.99  ? 59  MET Y SD  1  
ATOM 6570   C CE  . MET B 2 45  ? -156.905 -41.458 -43.870 1.00 99.99  ? 59  MET Y CE  1  
ATOM 6571   N N   . LEU B 2 46  ? -155.723 -46.969 -44.840 1.00 30.00  ? 60  LEU Y N   1  
ATOM 6572   C CA  . LEU B 2 46  ? -156.326 -47.648 -43.699 1.00 30.00  ? 60  LEU Y CA  1  
ATOM 6573   C C   . LEU B 2 46  ? -155.564 -48.930 -43.427 1.00 30.00  ? 60  LEU Y C   1  
ATOM 6574   O O   . LEU B 2 46  ? -155.286 -49.256 -42.274 1.00 30.00  ? 60  LEU Y O   1  
ATOM 6575   C CB  . LEU B 2 46  ? -157.783 -47.974 -43.999 1.00 99.99  ? 60  LEU Y CB  1  
ATOM 6576   C CG  . LEU B 2 46  ? -158.678 -46.867 -43.452 1.00 99.99  ? 60  LEU Y CG  1  
ATOM 6577   C CD1 . LEU B 2 46  ? -160.127 -47.337 -43.452 1.00 99.99  ? 60  LEU Y CD1 1  
ATOM 6578   C CD2 . LEU B 2 46  ? -158.253 -46.530 -42.028 1.00 99.99  ? 60  LEU Y CD2 1  
ATOM 6579   N N   . LYS B 2 47  ? -155.222 -49.650 -44.495 1.00 30.00  ? 61  LYS Y N   1  
ATOM 6580   C CA  . LYS B 2 47  ? -154.472 -50.900 -44.365 1.00 30.00  ? 61  LYS Y CA  1  
ATOM 6581   C C   . LYS B 2 47  ? -153.229 -50.670 -43.500 1.00 30.00  ? 61  LYS Y C   1  
ATOM 6582   O O   . LYS B 2 47  ? -152.569 -51.617 -43.067 1.00 30.00  ? 61  LYS Y O   1  
ATOM 6583   C CB  . LYS B 2 47  ? -154.043 -51.389 -45.745 1.00 99.99  ? 61  LYS Y CB  1  
ATOM 6584   C CG  . LYS B 2 47  ? -153.351 -52.741 -45.611 1.00 99.99  ? 61  LYS Y CG  1  
ATOM 6585   C CD  . LYS B 2 47  ? -153.321 -53.432 -46.971 1.00 99.99  ? 61  LYS Y CD  1  
ATOM 6586   C CE  . LYS B 2 47  ? -152.323 -54.586 -46.932 1.00 99.99  ? 61  LYS Y CE  1  
ATOM 6587   N NZ  . LYS B 2 47  ? -153.028 -55.831 -46.598 1.00 99.99  ? 61  LYS Y NZ  1  
ATOM 6588   N N   . GLU B 2 48  ? -152.923 -49.403 -43.254 1.00 30.00  ? 62  GLU Y N   1  
ATOM 6589   C CA  . GLU B 2 48  ? -151.780 -49.012 -42.443 1.00 30.00  ? 62  GLU Y CA  1  
ATOM 6590   C C   . GLU B 2 48  ? -152.062 -49.297 -40.968 1.00 30.00  ? 62  GLU Y C   1  
ATOM 6591   O O   . GLU B 2 48  ? -151.176 -49.182 -40.123 1.00 30.00  ? 62  GLU Y O   1  
ATOM 6592   C CB  . GLU B 2 48  ? -151.504 -47.523 -42.617 1.00 99.99  ? 62  GLU Y CB  1  
ATOM 6593   C CG  . GLU B 2 48  ? -151.089 -47.251 -44.044 1.00 99.99  ? 62  GLU Y CG  1  
ATOM 6594   C CD  . GLU B 2 48  ? -149.683 -47.794 -44.281 1.00 99.99  ? 62  GLU Y CD  1  
ATOM 6595   O OE1 . GLU B 2 48  ? -149.585 -48.983 -44.683 1.00 99.99  ? 62  GLU Y OE1 1  
ATOM 6596   O OE2 . GLU B 2 48  ? -148.720 -47.013 -44.057 1.00 99.99  ? 62  GLU Y OE2 1  
ATOM 6597   N N   . ALA B 2 49  ? -153.300 -49.674 -40.665 1.00 30.00  ? 63  ALA Y N   1  
ATOM 6598   C CA  . ALA B 2 49  ? -153.713 -49.985 -39.294 1.00 30.00  ? 63  ALA Y CA  1  
ATOM 6599   C C   . ALA B 2 49  ? -154.328 -51.402 -39.224 1.00 30.00  ? 63  ALA Y C   1  
ATOM 6600   O O   . ALA B 2 49  ? -155.454 -51.621 -39.675 1.00 30.00  ? 63  ALA Y O   1  
ATOM 6601   C CB  . ALA B 2 49  ? -154.729 -48.940 -38.804 1.00 30.00  ? 63  ALA Y CB  1  
ATOM 6602   N N   . PRO B 2 50  ? -153.589 -52.373 -38.658 1.00 30.00  ? 64  PRO Y N   1  
ATOM 6603   C CA  . PRO B 2 50  ? -154.010 -53.775 -38.504 1.00 30.00  ? 64  PRO Y CA  1  
ATOM 6604   C C   . PRO B 2 50  ? -155.518 -54.003 -38.392 1.00 30.00  ? 64  PRO Y C   1  
ATOM 6605   O O   . PRO B 2 50  ? -156.123 -54.655 -39.245 1.00 30.00  ? 64  PRO Y O   1  
ATOM 6606   C CB  . PRO B 2 50  ? -153.323 -54.063 -37.216 1.00 99.99  ? 64  PRO Y CB  1  
ATOM 6607   C CG  . PRO B 2 50  ? -152.567 -52.807 -36.853 1.00 99.99  ? 64  PRO Y CG  1  
ATOM 6608   C CD  . PRO B 2 50  ? -152.690 -51.870 -37.711 1.00 99.99  ? 64  PRO Y CD  1  
ATOM 6609   N N   . GLY B 2 51  ? -156.114 -53.469 -37.332 1.00 30.00  ? 65  GLY Y N   1  
ATOM 6610   C CA  . GLY B 2 51  ? -157.539 -53.624 -37.128 1.00 30.00  ? 65  GLY Y CA  1  
ATOM 6611   C C   . GLY B 2 51  ? -158.241 -52.285 -37.003 1.00 30.00  ? 65  GLY Y C   1  
ATOM 6612   O O   . GLY B 2 51  ? -157.597 -51.239 -37.084 1.00 30.00  ? 65  GLY Y O   1  
ATOM 6613   N N   . PRO B 2 52  ? -159.568 -52.289 -36.801 1.00 30.00  ? 66  PRO Y N   1  
ATOM 6614   C CA  . PRO B 2 52  ? -160.389 -51.083 -36.663 1.00 30.00  ? 66  PRO Y CA  1  
ATOM 6615   C C   . PRO B 2 52  ? -159.644 -49.863 -36.110 1.00 30.00  ? 66  PRO Y C   1  
ATOM 6616   O O   . PRO B 2 52  ? -158.722 -49.975 -35.301 1.00 30.00  ? 66  PRO Y O   1  
ATOM 6617   C CB  . PRO B 2 52  ? -161.379 -51.609 -35.683 1.00 99.99  ? 66  PRO Y CB  1  
ATOM 6618   C CG  . PRO B 2 52  ? -161.009 -53.057 -35.451 1.00 99.99  ? 66  PRO Y CG  1  
ATOM 6619   C CD  . PRO B 2 52  ? -160.002 -53.444 -36.134 1.00 99.99  ? 66  PRO Y CD  1  
ATOM 6620   N N   . LEU B 2 53  ? -160.056 -48.686 -36.558 1.00 30.00  ? 67  LEU Y N   1  
ATOM 6621   C CA  . LEU B 2 53  ? -159.405 -47.481 -36.121 1.00 30.00  ? 67  LEU Y CA  1  
ATOM 6622   C C   . LEU B 2 53  ? -160.026 -46.750 -34.960 1.00 30.00  ? 67  LEU Y C   1  
ATOM 6623   O O   . LEU B 2 53  ? -160.677 -45.728 -35.141 1.00 30.00  ? 67  LEU Y O   1  
ATOM 6624   C CB  . LEU B 2 53  ? -159.367 -46.471 -37.261 1.00 99.99  ? 67  LEU Y CB  1  
ATOM 6625   C CG  . LEU B 2 53  ? -158.038 -46.584 -38.000 1.00 99.99  ? 67  LEU Y CG  1  
ATOM 6626   C CD1 . LEU B 2 53  ? -157.858 -45.375 -38.911 1.00 99.99  ? 67  LEU Y CD1 1  
ATOM 6627   C CD2 . LEU B 2 53  ? -156.897 -46.632 -36.988 1.00 99.99  ? 67  LEU Y CD2 1  
ATOM 6628   N N   . ASN B 2 54  ? -159.815 -47.286 -33.765 1.00 30.00  ? 68  ASN Y N   1  
ATOM 6629   C CA  . ASN B 2 54  ? -160.333 -46.674 -32.539 1.00 30.00  ? 68  ASN Y CA  1  
ATOM 6630   C C   . ASN B 2 54  ? -159.337 -45.561 -32.267 1.00 30.00  ? 68  ASN Y C   1  
ATOM 6631   O O   . ASN B 2 54  ? -158.307 -45.490 -32.932 1.00 30.00  ? 68  ASN Y O   1  
ATOM 6632   C CB  . ASN B 2 54  ? -160.371 -47.710 -31.422 1.00 99.99  ? 68  ASN Y CB  1  
ATOM 6633   C CG  . ASN B 2 54  ? -161.428 -47.361 -30.386 1.00 99.99  ? 68  ASN Y CG  1  
ATOM 6634   O OD1 . ASN B 2 54  ? -161.330 -47.768 -29.229 1.00 99.99  ? 68  ASN Y OD1 1  
ATOM 6635   N ND2 . ASN B 2 54  ? -162.448 -46.610 -30.802 1.00 99.99  ? 68  ASN Y ND2 1  
ATOM 6636   N N   . PHE B 2 55  ? -159.613 -44.695 -31.305 1.00 30.00  ? 69  PHE Y N   1  
ATOM 6637   C CA  . PHE B 2 55  ? -158.648 -43.644 -31.048 1.00 30.00  ? 69  PHE Y CA  1  
ATOM 6638   C C   . PHE B 2 55  ? -157.320 -44.230 -30.599 1.00 30.00  ? 69  PHE Y C   1  
ATOM 6639   O O   . PHE B 2 55  ? -156.376 -43.498 -30.338 1.00 30.00  ? 69  PHE Y O   1  
ATOM 6640   C CB  . PHE B 2 55  ? -159.172 -42.717 -29.955 1.00 99.99  ? 69  PHE Y CB  1  
ATOM 6641   C CG  . PHE B 2 55  ? -158.164 -41.622 -29.697 1.00 99.99  ? 69  PHE Y CG  1  
ATOM 6642   C CD1 . PHE B 2 55  ? -158.139 -40.485 -30.513 1.00 99.99  ? 69  PHE Y CD1 1  
ATOM 6643   C CD2 . PHE B 2 55  ? -157.254 -41.744 -28.639 1.00 99.99  ? 69  PHE Y CD2 1  
ATOM 6644   C CE1 . PHE B 2 55  ? -157.203 -39.472 -30.271 1.00 99.99  ? 69  PHE Y CE1 1  
ATOM 6645   C CE2 . PHE B 2 55  ? -156.321 -40.728 -28.398 1.00 99.99  ? 69  PHE Y CE2 1  
ATOM 6646   C CZ  . PHE B 2 55  ? -156.296 -39.593 -29.215 1.00 99.99  ? 69  PHE Y CZ  1  
ATOM 6647   N N   . THR B 2 56  ? -157.247 -45.555 -30.507 1.00 30.00  ? 70  THR Y N   1  
ATOM 6648   C CA  . THR B 2 56  ? -156.016 -46.198 -30.078 1.00 30.00  ? 70  THR Y CA  1  
ATOM 6649   C C   . THR B 2 56  ? -155.094 -46.553 -31.243 1.00 30.00  ? 70  THR Y C   1  
ATOM 6650   O O   . THR B 2 56  ? -153.977 -46.052 -31.296 1.00 30.00  ? 70  THR Y O   1  
ATOM 6651   C CB  . THR B 2 56  ? -156.336 -47.491 -29.337 1.00 99.99  ? 70  THR Y CB  1  
ATOM 6652   O OG1 . THR B 2 56  ? -156.887 -48.442 -30.252 1.00 99.99  ? 70  THR Y OG1 1  
ATOM 6653   C CG2 . THR B 2 56  ? -157.350 -47.205 -28.236 1.00 99.99  ? 70  THR Y CG2 1  
ATOM 6654   N N   . MET B 2 57  ? -155.531 -47.397 -32.170 1.00 30.00  ? 71  MET Y N   1  
ATOM 6655   C CA  . MET B 2 57  ? -154.660 -47.746 -33.290 1.00 30.00  ? 71  MET Y CA  1  
ATOM 6656   C C   . MET B 2 57  ? -154.299 -46.470 -34.052 1.00 30.00  ? 71  MET Y C   1  
ATOM 6657   O O   . MET B 2 57  ? -153.388 -46.457 -34.879 1.00 30.00  ? 71  MET Y O   1  
ATOM 6658   C CB  . MET B 2 57  ? -155.376 -48.715 -34.224 1.00 99.99  ? 71  MET Y CB  1  
ATOM 6659   C CG  . MET B 2 57  ? -155.094 -50.149 -33.786 1.00 99.99  ? 71  MET Y CG  1  
ATOM 6660   S SD  . MET B 2 57  ? -155.818 -51.311 -34.969 1.00 99.99  ? 71  MET Y SD  1  
ATOM 6661   C CE  . MET B 2 57  ? -155.065 -52.827 -34.410 1.00 99.99  ? 71  MET Y CE  1  
ATOM 6662   N N   . PHE B 2 58  ? -155.037 -45.401 -33.759 1.00 30.00  ? 72  PHE Y N   1  
ATOM 6663   C CA  . PHE B 2 58  ? -154.829 -44.090 -34.378 1.00 30.00  ? 72  PHE Y CA  1  
ATOM 6664   C C   . PHE B 2 58  ? -153.528 -43.559 -33.797 1.00 30.00  ? 72  PHE Y C   1  
ATOM 6665   O O   . PHE B 2 58  ? -152.496 -43.510 -34.475 1.00 30.00  ? 72  PHE Y O   1  
ATOM 6666   C CB  . PHE B 2 58  ? -155.997 -43.166 -34.043 1.00 99.99  ? 72  PHE Y CB  1  
ATOM 6667   C CG  . PHE B 2 58  ? -155.776 -41.819 -34.685 1.00 99.99  ? 72  PHE Y CG  1  
ATOM 6668   C CD1 . PHE B 2 58  ? -156.124 -41.616 -36.025 1.00 99.99  ? 72  PHE Y CD1 1  
ATOM 6669   C CD2 . PHE B 2 58  ? -155.221 -40.772 -33.941 1.00 99.99  ? 72  PHE Y CD2 1  
ATOM 6670   C CE1 . PHE B 2 58  ? -155.919 -40.368 -36.621 1.00 99.99  ? 72  PHE Y CE1 1  
ATOM 6671   C CE2 . PHE B 2 58  ? -155.015 -39.522 -34.538 1.00 99.99  ? 72  PHE Y CE2 1  
ATOM 6672   C CZ  . PHE B 2 58  ? -155.367 -39.319 -35.878 1.00 99.99  ? 72  PHE Y CZ  1  
ATOM 6673   N N   . LEU B 2 59  ? -153.598 -43.172 -32.527 1.00 30.00  ? 73  LEU Y N   1  
ATOM 6674   C CA  . LEU B 2 59  ? -152.445 -42.650 -31.816 1.00 30.00  ? 73  LEU Y CA  1  
ATOM 6675   C C   . LEU B 2 59  ? -151.256 -43.584 -31.974 1.00 30.00  ? 73  LEU Y C   1  
ATOM 6676   O O   . LEU B 2 59  ? -150.115 -43.157 -31.858 1.00 30.00  ? 73  LEU Y O   1  
ATOM 6677   C CB  . LEU B 2 59  ? -152.771 -42.513 -30.332 1.00 99.99  ? 73  LEU Y CB  1  
ATOM 6678   C CG  . LEU B 2 59  ? -153.241 -41.091 -30.042 1.00 99.99  ? 73  LEU Y CG  1  
ATOM 6679   C CD1 . LEU B 2 59  ? -153.247 -40.855 -28.535 1.00 99.99  ? 73  LEU Y CD1 1  
ATOM 6680   C CD2 . LEU B 2 59  ? -152.295 -40.096 -30.708 1.00 99.99  ? 73  LEU Y CD2 1  
ATOM 6681   N N   . SER B 2 60  ? -151.510 -44.857 -32.250 1.00 30.00  ? 74  SER Y N   1  
ATOM 6682   C CA  . SER B 2 60  ? -150.436 -45.827 -32.428 1.00 30.00  ? 74  SER Y CA  1  
ATOM 6683   C C   . SER B 2 60  ? -149.623 -45.556 -33.697 1.00 30.00  ? 74  SER Y C   1  
ATOM 6684   O O   . SER B 2 60  ? -148.407 -45.380 -33.630 1.00 30.00  ? 74  SER Y O   1  
ATOM 6685   C CB  . SER B 2 60  ? -151.018 -47.234 -32.530 1.00 99.99  ? 74  SER Y CB  1  
ATOM 6686   O OG  . SER B 2 60  ? -151.757 -47.531 -31.343 1.00 99.99  ? 74  SER Y OG  1  
ATOM 6687   N N   . ILE B 2 61  ? -150.282 -45.523 -34.857 1.00 30.00  ? 75  ILE Y N   1  
ATOM 6688   C CA  . ILE B 2 61  ? -149.565 -45.277 -36.108 1.00 30.00  ? 75  ILE Y CA  1  
ATOM 6689   C C   . ILE B 2 61  ? -148.974 -43.869 -36.181 1.00 30.00  ? 75  ILE Y C   1  
ATOM 6690   O O   . ILE B 2 61  ? -147.916 -43.672 -36.779 1.00 30.00  ? 75  ILE Y O   1  
ATOM 6691   C CB  . ILE B 2 61  ? -150.515 -45.445 -37.290 1.00 99.99  ? 75  ILE Y CB  1  
ATOM 6692   C CG1 . ILE B 2 61  ? -151.324 -44.166 -37.475 1.00 99.99  ? 75  ILE Y CG1 1  
ATOM 6693   C CG2 . ILE B 2 61  ? -151.461 -46.612 -37.020 1.00 99.99  ? 75  ILE Y CG2 1  
ATOM 6694   C CD1 . ILE B 2 61  ? -152.640 -44.281 -36.712 1.00 99.99  ? 75  ILE Y CD1 1  
ATOM 6695   N N   . PHE B 2 62  ? -149.651 -42.893 -35.578 1.00 30.00  ? 76  PHE Y N   1  
ATOM 6696   C CA  . PHE B 2 62  ? -149.150 -41.521 -35.587 1.00 30.00  ? 76  PHE Y CA  1  
ATOM 6697   C C   . PHE B 2 62  ? -147.879 -41.419 -34.747 1.00 30.00  ? 76  PHE Y C   1  
ATOM 6698   O O   . PHE B 2 62  ? -146.917 -40.752 -35.130 1.00 30.00  ? 76  PHE Y O   1  
ATOM 6699   C CB  . PHE B 2 62  ? -150.203 -40.582 -35.008 1.00 99.99  ? 76  PHE Y CB  1  
ATOM 6700   C CG  . PHE B 2 62  ? -149.679 -39.167 -35.024 1.00 99.99  ? 76  PHE Y CG  1  
ATOM 6701   C CD1 . PHE B 2 62  ? -149.770 -38.398 -36.190 1.00 99.99  ? 76  PHE Y CD1 1  
ATOM 6702   C CD2 . PHE B 2 62  ? -149.100 -38.623 -33.869 1.00 99.99  ? 76  PHE Y CD2 1  
ATOM 6703   C CE1 . PHE B 2 62  ? -149.284 -37.085 -36.203 1.00 99.99  ? 76  PHE Y CE1 1  
ATOM 6704   C CE2 . PHE B 2 62  ? -148.613 -37.311 -33.885 1.00 99.99  ? 76  PHE Y CE2 1  
ATOM 6705   C CZ  . PHE B 2 62  ? -148.704 -36.542 -35.052 1.00 99.99  ? 76  PHE Y CZ  1  
ATOM 6706   N N   . SER B 2 63  ? -147.876 -42.077 -33.597 1.00 30.00  ? 77  SER Y N   1  
ATOM 6707   C CA  . SER B 2 63  ? -146.716 -42.047 -32.725 1.00 30.00  ? 77  SER Y CA  1  
ATOM 6708   C C   . SER B 2 63  ? -145.546 -42.807 -33.326 1.00 30.00  ? 77  SER Y C   1  
ATOM 6709   O O   . SER B 2 63  ? -144.398 -42.433 -33.118 1.00 30.00  ? 77  SER Y O   1  
ATOM 6710   C CB  . SER B 2 63  ? -147.060 -42.683 -31.382 1.00 99.99  ? 77  SER Y CB  1  
ATOM 6711   O OG  . SER B 2 63  ? -147.279 -44.085 -31.559 1.00 99.99  ? 77  SER Y OG  1  
ATOM 6712   N N   . ASP B 2 64  ? -145.833 -43.864 -34.075 1.00 30.00  ? 78  ASP Y N   1  
ATOM 6713   C CA  . ASP B 2 64  ? -144.774 -44.656 -34.691 1.00 30.00  ? 78  ASP Y CA  1  
ATOM 6714   C C   . ASP B 2 64  ? -144.188 -43.983 -35.931 1.00 30.00  ? 78  ASP Y C   1  
ATOM 6715   O O   . ASP B 2 64  ? -143.283 -44.518 -36.579 1.00 30.00  ? 78  ASP Y O   1  
ATOM 6716   C CB  . ASP B 2 64  ? -145.323 -46.014 -35.117 1.00 99.99  ? 78  ASP Y CB  1  
ATOM 6717   C CG  . ASP B 2 64  ? -145.671 -46.835 -33.876 1.00 99.99  ? 78  ASP Y CG  1  
ATOM 6718   O OD1 . ASP B 2 64  ? -144.710 -47.282 -33.194 1.00 99.99  ? 78  ASP Y OD1 1  
ATOM 6719   O OD2 . ASP B 2 64  ? -146.892 -47.004 -33.621 1.00 99.99  ? 78  ASP Y OD2 1  
ATOM 6720   N N   . LYS B 2 65  ? -144.724 -42.811 -36.247 1.00 30.00  ? 79  LYS Y N   1  
ATOM 6721   C CA  . LYS B 2 65  ? -144.268 -42.033 -37.383 1.00 30.00  ? 79  LYS Y CA  1  
ATOM 6722   C C   . LYS B 2 65  ? -143.233 -41.104 -36.790 1.00 30.00  ? 79  LYS Y C   1  
ATOM 6723   O O   . LYS B 2 65  ? -142.040 -41.209 -37.084 1.00 30.00  ? 79  LYS Y O   1  
ATOM 6724   C CB  . LYS B 2 65  ? -145.441 -41.270 -37.991 1.00 99.99  ? 79  LYS Y CB  1  
ATOM 6725   C CG  . LYS B 2 65  ? -146.147 -42.155 -39.013 1.00 99.99  ? 79  LYS Y CG  1  
ATOM 6726   C CD  . LYS B 2 65  ? -147.028 -41.292 -39.911 1.00 99.99  ? 79  LYS Y CD  1  
ATOM 6727   C CE  . LYS B 2 65  ? -148.262 -40.846 -39.137 1.00 99.99  ? 79  LYS Y CE  1  
ATOM 6728   N NZ  . LYS B 2 65  ? -149.261 -40.310 -40.073 1.00 99.99  ? 79  LYS Y NZ  1  
ATOM 6729   N N   . LEU B 2 66  ? -143.720 -40.206 -35.943 1.00 30.00  ? 80  LEU Y N   1  
ATOM 6730   C CA  . LEU B 2 66  ? -142.906 -39.209 -35.257 1.00 30.00  ? 80  LEU Y CA  1  
ATOM 6731   C C   . LEU B 2 66  ? -141.832 -39.798 -34.322 1.00 30.00  ? 80  LEU Y C   1  
ATOM 6732   O O   . LEU B 2 66  ? -141.269 -39.087 -33.483 1.00 30.00  ? 80  LEU Y O   1  
ATOM 6733   C CB  . LEU B 2 66  ? -143.794 -38.315 -34.399 1.00 99.99  ? 80  LEU Y CB  1  
ATOM 6734   C CG  . LEU B 2 66  ? -144.164 -37.063 -35.182 1.00 99.99  ? 80  LEU Y CG  1  
ATOM 6735   C CD1 . LEU B 2 66  ? -144.764 -36.027 -34.233 1.00 99.99  ? 80  LEU Y CD1 1  
ATOM 6736   C CD2 . LEU B 2 66  ? -142.914 -36.485 -35.838 1.00 99.99  ? 80  LEU Y CD2 1  
ATOM 6737   N N   . SER B 2 67  ? -141.551 -41.089 -34.471 1.00 30.00  ? 81  SER Y N   1  
ATOM 6738   C CA  . SER B 2 67  ? -140.554 -41.751 -33.635 1.00 30.00  ? 81  SER Y CA  1  
ATOM 6739   C C   . SER B 2 67  ? -139.275 -41.972 -34.430 1.00 30.00  ? 81  SER Y C   1  
ATOM 6740   O O   . SER B 2 67  ? -139.318 -42.408 -35.587 1.00 30.00  ? 81  SER Y O   1  
ATOM 6741   C CB  . SER B 2 67  ? -141.087 -43.099 -33.162 1.00 99.99  ? 81  SER Y CB  1  
ATOM 6742   O OG  . SER B 2 67  ? -141.201 -43.985 -34.277 1.00 99.99  ? 81  SER Y OG  1  
ATOM 6743   N N   . GLY B 2 68  ? -138.143 -41.673 -33.802 1.00 30.00  ? 82  GLY Y N   1  
ATOM 6744   C CA  . GLY B 2 68  ? -136.869 -41.839 -34.471 1.00 30.00  ? 82  GLY Y CA  1  
ATOM 6745   C C   . GLY B 2 68  ? -136.366 -40.481 -34.905 1.00 30.00  ? 82  GLY Y C   1  
ATOM 6746   O O   . GLY B 2 68  ? -135.846 -40.318 -36.014 1.00 30.00  ? 82  GLY Y O   1  
ATOM 6747   N N   . THR B 2 69  ? -136.535 -39.496 -34.022 1.00 30.00  ? 83  THR Y N   1  
ATOM 6748   C CA  . THR B 2 69  ? -136.101 -38.128 -34.274 1.00 30.00  ? 83  THR Y CA  1  
ATOM 6749   C C   . THR B 2 69  ? -135.540 -37.506 -32.992 1.00 30.00  ? 83  THR Y C   1  
ATOM 6750   O O   . THR B 2 69  ? -135.820 -37.990 -31.892 1.00 30.00  ? 83  THR Y O   1  
ATOM 6751   C CB  . THR B 2 69  ? -137.283 -37.290 -34.753 1.00 99.99  ? 83  THR Y CB  1  
ATOM 6752   O OG1 . THR B 2 69  ? -136.842 -35.954 -35.018 1.00 99.99  ? 83  THR Y OG1 1  
ATOM 6753   C CG2 . THR B 2 69  ? -138.359 -37.264 -33.674 1.00 99.99  ? 83  THR Y CG2 1  
ATOM 6754   N N   . ASP B 2 70  ? -134.766 -36.436 -33.141 1.00 30.00  ? 84  ASP Y N   1  
ATOM 6755   C CA  . ASP B 2 70  ? -134.131 -35.758 -32.004 1.00 30.00  ? 84  ASP Y CA  1  
ATOM 6756   C C   . ASP B 2 70  ? -134.795 -34.503 -31.479 1.00 30.00  ? 84  ASP Y C   1  
ATOM 6757   O O   . ASP B 2 70  ? -135.774 -34.028 -32.034 1.00 30.00  ? 84  ASP Y O   1  
ATOM 6758   C CB  . ASP B 2 70  ? -132.716 -35.334 -32.375 1.00 99.99  ? 84  ASP Y CB  1  
ATOM 6759   C CG  . ASP B 2 70  ? -132.771 -34.319 -33.519 1.00 99.99  ? 84  ASP Y CG  1  
ATOM 6760   O OD1 . ASP B 2 70  ? -132.912 -34.772 -34.684 1.00 99.99  ? 84  ASP Y OD1 1  
ATOM 6761   O OD2 . ASP B 2 70  ? -132.673 -33.100 -33.211 1.00 99.99  ? 84  ASP Y OD2 1  
ATOM 6762   N N   . SER B 2 71  ? -133.861 -33.530 -30.704 1.00 30.00  ? 85  SER Y N   1  
ATOM 6763   C CA  . SER B 2 71  ? -134.407 -32.348 -30.042 1.00 30.00  ? 85  SER Y CA  1  
ATOM 6764   C C   . SER B 2 71  ? -134.352 -31.070 -30.858 1.00 30.00  ? 85  SER Y C   1  
ATOM 6765   O O   . SER B 2 71  ? -133.668 -30.997 -31.872 1.00 30.00  ? 85  SER Y O   1  
ATOM 6766   C CB  . SER B 2 71  ? -133.637 -32.067 -28.757 1.00 99.99  ? 85  SER Y CB  1  
ATOM 6767   O OG  . SER B 2 71  ? -132.304 -31.659 -29.075 1.00 99.99  ? 85  SER Y OG  1  
ATOM 6768   N N   . GLU B 2 72  ? -135.093 -30.073 -30.391 1.00 30.00  ? 86  GLU Y N   1  
ATOM 6769   C CA  . GLU B 2 72  ? -135.160 -28.772 -31.036 1.00 30.00  ? 86  GLU Y CA  1  
ATOM 6770   C C   . GLU B 2 72  ? -133.908 -28.044 -30.604 1.00 30.00  ? 86  GLU Y C   1  
ATOM 6771   O O   . GLU B 2 72  ? -133.495 -27.061 -31.216 1.00 30.00  ? 86  GLU Y O   1  
ATOM 6772   C CB  . GLU B 2 72  ? -136.415 -28.031 -30.585 1.00 99.99  ? 86  GLU Y CB  1  
ATOM 6773   C CG  . GLU B 2 72  ? -136.414 -27.908 -29.082 1.00 99.99  ? 86  GLU Y CG  1  
ATOM 6774   C CD  . GLU B 2 72  ? -136.840 -29.238 -28.462 1.00 99.99  ? 86  GLU Y CD  1  
ATOM 6775   O OE1 . GLU B 2 72  ? -135.934 -30.070 -28.201 1.00 99.99  ? 86  GLU Y OE1 1  
ATOM 6776   O OE2 . GLU B 2 72  ? -138.073 -29.406 -28.253 1.00 99.99  ? 86  GLU Y OE2 1  
ATOM 6777   N N   . GLU B 2 73  ? -133.312 -28.548 -29.527 1.00 30.00  ? 87  GLU Y N   1  
ATOM 6778   C CA  . GLU B 2 73  ? -132.092 -27.972 -28.994 1.00 30.00  ? 87  GLU Y CA  1  
ATOM 6779   C C   . GLU B 2 73  ? -130.948 -28.695 -29.705 1.00 30.00  ? 87  GLU Y C   1  
ATOM 6780   O O   . GLU B 2 73  ? -129.987 -28.073 -30.134 1.00 30.00  ? 87  GLU Y O   1  
ATOM 6781   C CB  . GLU B 2 73  ? -132.030 -28.194 -27.487 1.00 99.99  ? 87  GLU Y CB  1  
ATOM 6782   C CG  . GLU B 2 73  ? -133.150 -27.436 -26.819 1.00 99.99  ? 87  GLU Y CG  1  
ATOM 6783   C CD  . GLU B 2 73  ? -132.850 -25.940 -26.862 1.00 99.99  ? 87  GLU Y CD  1  
ATOM 6784   O OE1 . GLU B 2 73  ? -133.267 -25.298 -27.859 1.00 99.99  ? 87  GLU Y OE1 1  
ATOM 6785   O OE2 . GLU B 2 73  ? -132.205 -25.453 -25.894 1.00 99.99  ? 87  GLU Y OE2 1  
ATOM 6786   N N   . THR B 2 74  ? -131.071 -30.007 -29.843 1.00 30.00  ? 88  THR Y N   1  
ATOM 6787   C CA  . THR B 2 74  ? -130.046 -30.794 -30.501 1.00 30.00  ? 88  THR Y CA  1  
ATOM 6788   C C   . THR B 2 74  ? -129.846 -30.374 -31.952 1.00 30.00  ? 88  THR Y C   1  
ATOM 6789   O O   . THR B 2 74  ? -128.730 -30.427 -32.478 1.00 30.00  ? 88  THR Y O   1  
ATOM 6790   C CB  . THR B 2 74  ? -130.429 -32.267 -30.484 1.00 99.99  ? 88  THR Y CB  1  
ATOM 6791   O OG1 . THR B 2 74  ? -131.566 -32.473 -31.326 1.00 99.99  ? 88  THR Y OG1 1  
ATOM 6792   C CG2 . THR B 2 74  ? -130.773 -32.689 -29.060 1.00 99.99  ? 88  THR Y CG2 1  
ATOM 6793   N N   . ILE B 2 75  ? -130.932 -29.960 -32.605 1.00 30.00  ? 89  ILE Y N   1  
ATOM 6794   C CA  . ILE B 2 75  ? -130.858 -29.541 -34.000 1.00 30.00  ? 89  ILE Y CA  1  
ATOM 6795   C C   . ILE B 2 75  ? -130.413 -28.086 -34.085 1.00 30.00  ? 89  ILE Y C   1  
ATOM 6796   O O   . ILE B 2 75  ? -129.584 -27.744 -34.921 1.00 30.00  ? 89  ILE Y O   1  
ATOM 6797   C CB  . ILE B 2 75  ? -132.226 -29.681 -34.656 1.00 99.99  ? 89  ILE Y CB  1  
ATOM 6798   C CG1 . ILE B 2 75  ? -133.083 -28.470 -34.312 1.00 99.99  ? 89  ILE Y CG1 1  
ATOM 6799   C CG2 . ILE B 2 75  ? -132.906 -30.947 -34.145 1.00 99.99  ? 89  ILE Y CG2 1  
ATOM 6800   C CD1 . ILE B 2 75  ? -133.916 -28.771 -33.070 1.00 99.99  ? 89  ILE Y CD1 1  
ATOM 6801   N N   . ARG B 2 76  ? -130.946 -27.235 -33.222 1.00 30.00  ? 90  ARG Y N   1  
ATOM 6802   C CA  . ARG B 2 76  ? -130.555 -25.838 -33.253 1.00 30.00  ? 90  ARG Y CA  1  
ATOM 6803   C C   . ARG B 2 76  ? -129.051 -25.682 -33.045 1.00 30.00  ? 90  ARG Y C   1  
ATOM 6804   O O   . ARG B 2 76  ? -128.475 -24.645 -33.364 1.00 30.00  ? 90  ARG Y O   1  
ATOM 6805   C CB  . ARG B 2 76  ? -131.275 -25.072 -32.150 1.00 99.99  ? 90  ARG Y CB  1  
ATOM 6806   C CG  . ARG B 2 76  ? -130.895 -23.597 -32.218 1.00 99.99  ? 90  ARG Y CG  1  
ATOM 6807   C CD  . ARG B 2 76  ? -131.579 -22.842 -31.086 1.00 99.99  ? 90  ARG Y CD  1  
ATOM 6808   N NE  . ARG B 2 76  ? -131.378 -23.533 -29.790 1.00 99.99  ? 90  ARG Y NE  1  
ATOM 6809   C CZ  . ARG B 2 76  ? -130.256 -23.428 -29.080 1.00 99.99  ? 90  ARG Y CZ  1  
ATOM 6810   N NH1 . ARG B 2 76  ? -129.231 -22.692 -29.487 1.00 99.99  ? 90  ARG Y NH1 1  
ATOM 6811   N NH2 . ARG B 2 76  ? -130.185 -24.095 -27.930 1.00 99.99  ? 90  ARG Y NH2 1  
ATOM 6812   N N   . ASN B 2 77  ? -128.409 -26.707 -32.501 1.00 30.00  ? 91  ASN Y N   1  
ATOM 6813   C CA  . ASN B 2 77  ? -126.968 -26.651 -32.257 1.00 30.00  ? 91  ASN Y CA  1  
ATOM 6814   C C   . ASN B 2 77  ? -126.198 -27.180 -33.451 1.00 30.00  ? 91  ASN Y C   1  
ATOM 6815   O O   . ASN B 2 77  ? -125.197 -26.594 -33.849 1.00 30.00  ? 91  ASN Y O   1  
ATOM 6816   C CB  . ASN B 2 77  ? -126.617 -27.496 -31.036 1.00 99.99  ? 91  ASN Y CB  1  
ATOM 6817   C CG  . ASN B 2 77  ? -127.277 -26.948 -29.778 1.00 99.99  ? 91  ASN Y CG  1  
ATOM 6818   O OD1 . ASN B 2 77  ? -127.120 -25.771 -29.455 1.00 99.99  ? 91  ASN Y OD1 1  
ATOM 6819   N ND2 . ASN B 2 77  ? -128.015 -27.804 -29.071 1.00 99.99  ? 91  ASN Y ND2 1  
ATOM 6820   N N   . ALA B 2 78  ? -126.667 -28.289 -34.023 1.00 30.00  ? 92  ALA Y N   1  
ATOM 6821   C CA  . ALA B 2 78  ? -126.011 -28.866 -35.188 1.00 30.00  ? 92  ALA Y CA  1  
ATOM 6822   C C   . ALA B 2 78  ? -125.963 -27.763 -36.248 1.00 30.00  ? 92  ALA Y C   1  
ATOM 6823   O O   . ALA B 2 78  ? -125.221 -27.842 -37.227 1.00 30.00  ? 92  ALA Y O   1  
ATOM 6824   C CB  . ALA B 2 78  ? -126.804 -30.066 -35.713 1.00 30.00  ? 92  ALA Y CB  1  
ATOM 6825   N N   . PHE B 2 79  ? -126.775 -26.725 -36.030 1.00 30.00  ? 93  PHE Y N   1  
ATOM 6826   C CA  . PHE B 2 79  ? -126.860 -25.589 -36.933 1.00 30.00  ? 93  PHE Y CA  1  
ATOM 6827   C C   . PHE B 2 79  ? -125.864 -24.520 -36.514 1.00 30.00  ? 93  PHE Y C   1  
ATOM 6828   O O   . PHE B 2 79  ? -125.048 -24.083 -37.326 1.00 30.00  ? 93  PHE Y O   1  
ATOM 6829   C CB  . PHE B 2 79  ? -128.267 -25.002 -36.897 1.00 99.99  ? 93  PHE Y CB  1  
ATOM 6830   C CG  . PHE B 2 79  ? -128.347 -23.827 -37.837 1.00 99.99  ? 93  PHE Y CG  1  
ATOM 6831   C CD1 . PHE B 2 79  ? -128.571 -24.035 -39.202 1.00 99.99  ? 93  PHE Y CD1 1  
ATOM 6832   C CD2 . PHE B 2 79  ? -128.194 -22.524 -37.345 1.00 99.99  ? 93  PHE Y CD2 1  
ATOM 6833   C CE1 . PHE B 2 79  ? -128.645 -22.944 -40.076 1.00 99.99  ? 93  PHE Y CE1 1  
ATOM 6834   C CE2 . PHE B 2 79  ? -128.268 -21.433 -38.218 1.00 99.99  ? 93  PHE Y CE2 1  
ATOM 6835   C CZ  . PHE B 2 79  ? -128.494 -21.643 -39.584 1.00 99.99  ? 93  PHE Y CZ  1  
ATOM 6836   N N   . ALA B 2 80  ? -125.938 -24.096 -35.253 1.00 30.00  ? 94  ALA Y N   1  
ATOM 6837   C CA  . ALA B 2 80  ? -125.034 -23.069 -34.739 1.00 30.00  ? 94  ALA Y CA  1  
ATOM 6838   C C   . ALA B 2 80  ? -123.582 -23.546 -34.864 1.00 30.00  ? 94  ALA Y C   1  
ATOM 6839   O O   . ALA B 2 80  ? -122.642 -22.805 -34.565 1.00 30.00  ? 94  ALA Y O   1  
ATOM 6840   C CB  . ALA B 2 80  ? -125.375 -22.758 -33.281 1.00 30.00  ? 94  ALA Y CB  1  
ATOM 6841   N N   . MET B 2 81  ? -123.423 -24.794 -35.308 1.00 30.00  ? 95  MET Y N   1  
ATOM 6842   C CA  . MET B 2 81  ? -122.113 -25.413 -35.500 1.00 30.00  ? 95  MET Y CA  1  
ATOM 6843   C C   . MET B 2 81  ? -121.478 -24.874 -36.793 1.00 30.00  ? 95  MET Y C   1  
ATOM 6844   O O   . MET B 2 81  ? -120.343 -25.232 -37.143 1.00 30.00  ? 95  MET Y O   1  
ATOM 6845   C CB  . MET B 2 81  ? -122.270 -26.928 -35.608 1.00 99.99  ? 95  MET Y CB  1  
ATOM 6846   C CG  . MET B 2 81  ? -120.908 -27.592 -35.437 1.00 99.99  ? 95  MET Y CG  1  
ATOM 6847   S SD  . MET B 2 81  ? -121.096 -29.392 -35.418 1.00 99.99  ? 95  MET Y SD  1  
ATOM 6848   C CE  . MET B 2 81  ? -122.214 -29.603 -36.789 1.00 99.99  ? 95  MET Y CE  1  
ATOM 6849   N N   . PHE B 2 82  ? -122.226 -24.026 -37.497 1.00 30.00  ? 96  PHE Y N   1  
ATOM 6850   C CA  . PHE B 2 82  ? -121.768 -23.415 -38.736 1.00 30.00  ? 96  PHE Y CA  1  
ATOM 6851   C C   . PHE B 2 82  ? -122.054 -21.937 -38.609 1.00 30.00  ? 96  PHE Y C   1  
ATOM 6852   O O   . PHE B 2 82  ? -121.932 -21.186 -39.579 1.00 30.00  ? 96  PHE Y O   1  
ATOM 6853   C CB  . PHE B 2 82  ? -122.514 -24.015 -39.922 1.00 99.99  ? 96  PHE Y CB  1  
ATOM 6854   C CG  . PHE B 2 82  ? -122.030 -23.378 -41.199 1.00 99.99  ? 96  PHE Y CG  1  
ATOM 6855   C CD1 . PHE B 2 82  ? -120.869 -23.848 -41.820 1.00 99.99  ? 96  PHE Y CD1 1  
ATOM 6856   C CD2 . PHE B 2 82  ? -122.747 -22.316 -41.766 1.00 99.99  ? 96  PHE Y CD2 1  
ATOM 6857   C CE1 . PHE B 2 82  ? -120.418 -23.256 -43.006 1.00 99.99  ? 96  PHE Y CE1 1  
ATOM 6858   C CE2 . PHE B 2 82  ? -122.297 -21.724 -42.952 1.00 99.99  ? 96  PHE Y CE2 1  
ATOM 6859   C CZ  . PHE B 2 82  ? -121.133 -22.194 -43.571 1.00 99.99  ? 96  PHE Y CZ  1  
ATOM 6860   N N   . ASP B 2 83  ? -122.438 -21.537 -37.404 1.00 30.00  ? 97  ASP Y N   1  
ATOM 6861   C CA  . ASP B 2 83  ? -122.749 -20.145 -37.125 1.00 30.00  ? 97  ASP Y CA  1  
ATOM 6862   C C   . ASP B 2 83  ? -121.658 -19.571 -36.222 1.00 30.00  ? 97  ASP Y C   1  
ATOM 6863   O O   . ASP B 2 83  ? -121.950 -19.016 -35.159 1.00 30.00  ? 97  ASP Y O   1  
ATOM 6864   C CB  . ASP B 2 83  ? -124.098 -20.046 -36.427 1.00 99.99  ? 97  ASP Y CB  1  
ATOM 6865   C CG  . ASP B 2 83  ? -124.530 -18.583 -36.360 1.00 99.99  ? 97  ASP Y CG  1  
ATOM 6866   O OD1 . ASP B 2 83  ? -124.018 -17.871 -35.454 1.00 99.99  ? 97  ASP Y OD1 1  
ATOM 6867   O OD2 . ASP B 2 83  ? -125.367 -18.187 -37.215 1.00 99.99  ? 97  ASP Y OD2 1  
ATOM 6868   N N   . GLU B 2 84  ? -120.404 -19.713 -36.659 1.00 30.00  ? 98  GLU Y N   1  
ATOM 6869   C CA  . GLU B 2 84  ? -119.225 -19.232 -35.923 1.00 30.00  ? 98  GLU Y CA  1  
ATOM 6870   C C   . GLU B 2 84  ? -119.479 -17.979 -35.084 1.00 30.00  ? 98  GLU Y C   1  
ATOM 6871   O O   . GLU B 2 84  ? -119.391 -18.017 -33.853 1.00 30.00  ? 98  GLU Y O   1  
ATOM 6872   C CB  . GLU B 2 84  ? -118.106 -18.890 -36.904 1.00 99.99  ? 98  GLU Y CB  1  
ATOM 6873   C CG  . GLU B 2 84  ? -118.600 -17.868 -37.896 1.00 99.99  ? 98  GLU Y CG  1  
ATOM 6874   C CD  . GLU B 2 84  ? -119.464 -18.557 -38.951 1.00 99.99  ? 98  GLU Y CD  1  
ATOM 6875   O OE1 . GLU B 2 84  ? -120.698 -18.642 -38.717 1.00 99.99  ? 98  GLU Y OE1 1  
ATOM 6876   O OE2 . GLU B 2 84  ? -118.881 -18.989 -39.980 1.00 99.99  ? 98  GLU Y OE2 1  
ATOM 6877   N N   . GLN B 2 85  ? -119.787 -16.871 -35.751 1.00 30.00  ? 99  GLN Y N   1  
ATOM 6878   C CA  . GLN B 2 85  ? -120.037 -15.612 -35.055 1.00 30.00  ? 99  GLN Y CA  1  
ATOM 6879   C C   . GLN B 2 85  ? -121.202 -15.628 -34.070 1.00 30.00  ? 99  GLN Y C   1  
ATOM 6880   O O   . GLN B 2 85  ? -121.372 -14.682 -33.299 1.00 30.00  ? 99  GLN Y O   1  
ATOM 6881   C CB  . GLN B 2 85  ? -120.342 -14.512 -36.066 1.00 99.99  ? 99  GLN Y CB  1  
ATOM 6882   C CG  . GLN B 2 85  ? -119.116 -14.253 -36.928 1.00 99.99  ? 99  GLN Y CG  1  
ATOM 6883   C CD  . GLN B 2 85  ? -118.031 -13.536 -36.134 1.00 99.99  ? 99  GLN Y CD  1  
ATOM 6884   O OE1 . GLN B 2 85  ? -118.210 -13.247 -34.954 1.00 99.99  ? 99  GLN Y OE1 1  
ATOM 6885   N NE2 . GLN B 2 85  ? -116.900 -13.255 -36.787 1.00 99.99  ? 99  GLN Y NE2 1  
ATOM 6886   N N   . GLU B 2 86  ? -122.000 -16.689 -34.095 1.00 30.00  ? 100 GLU Y N   1  
ATOM 6887   C CA  . GLU B 2 86  ? -123.152 -16.793 -33.196 1.00 30.00  ? 100 GLU Y CA  1  
ATOM 6888   C C   . GLU B 2 86  ? -124.119 -15.646 -33.476 1.00 30.00  ? 100 GLU Y C   1  
ATOM 6889   O O   . GLU B 2 86  ? -124.393 -14.822 -32.602 1.00 30.00  ? 100 GLU Y O   1  
ATOM 6890   C CB  . GLU B 2 86  ? -122.685 -16.719 -31.747 1.00 99.99  ? 100 GLU Y CB  1  
ATOM 6891   C CG  . GLU B 2 86  ? -123.504 -15.692 -31.006 1.00 99.99  ? 100 GLU Y CG  1  
ATOM 6892   C CD  . GLU B 2 86  ? -123.117 -14.292 -31.481 1.00 99.99  ? 100 GLU Y CD  1  
ATOM 6893   O OE1 . GLU B 2 86  ? -123.760 -13.819 -32.455 1.00 99.99  ? 100 GLU Y OE1 1  
ATOM 6894   O OE2 . GLU B 2 86  ? -122.185 -13.712 -30.865 1.00 99.99  ? 100 GLU Y OE2 1  
ATOM 6895   N N   . THR B 2 87  ? -124.633 -15.605 -34.702 1.00 30.00  ? 101 THR Y N   1  
ATOM 6896   C CA  . THR B 2 87  ? -125.573 -14.567 -35.130 1.00 30.00  ? 101 THR Y CA  1  
ATOM 6897   C C   . THR B 2 87  ? -127.005 -15.079 -35.209 1.00 30.00  ? 101 THR Y C   1  
ATOM 6898   O O   . THR B 2 87  ? -127.959 -14.298 -35.331 1.00 30.00  ? 101 THR Y O   1  
ATOM 6899   C CB  . THR B 2 87  ? -125.179 -14.051 -36.510 1.00 99.99  ? 101 THR Y CB  1  
ATOM 6900   O OG1 . THR B 2 87  ? -125.391 -15.080 -37.480 1.00 99.99  ? 101 THR Y OG1 1  
ATOM 6901   C CG2 . THR B 2 87  ? -123.710 -13.651 -36.507 1.00 99.99  ? 101 THR Y CG2 1  
ATOM 6902   N N   . LYS B 2 88  ? -127.139 -16.400 -35.143 1.00 30.00  ? 102 LYS Y N   1  
ATOM 6903   C CA  . LYS B 2 88  ? -128.437 -17.047 -35.205 1.00 30.00  ? 102 LYS Y CA  1  
ATOM 6904   C C   . LYS B 2 88  ? -129.040 -16.856 -36.595 1.00 30.00  ? 102 LYS Y C   1  
ATOM 6905   O O   . LYS B 2 88  ? -130.182 -16.420 -36.747 1.00 30.00  ? 102 LYS Y O   1  
ATOM 6906   C CB  . LYS B 2 88  ? -129.371 -16.439 -34.164 1.00 99.99  ? 102 LYS Y CB  1  
ATOM 6907   C CG  . LYS B 2 88  ? -128.792 -16.653 -32.773 1.00 99.99  ? 102 LYS Y CG  1  
ATOM 6908   C CD  . LYS B 2 88  ? -129.049 -18.090 -32.328 1.00 99.99  ? 102 LYS Y CD  1  
ATOM 6909   C CE  . LYS B 2 88  ? -128.629 -18.257 -30.873 1.00 99.99  ? 102 LYS Y CE  1  
ATOM 6910   N NZ  . LYS B 2 88  ? -128.630 -19.686 -30.525 1.00 99.99  ? 102 LYS Y NZ  1  
ATOM 6911   N N   . LYS B 2 89  ? -128.240 -17.192 -37.603 1.00 30.00  ? 103 LYS Y N   1  
ATOM 6912   C CA  . LYS B 2 89  ? -128.626 -17.097 -39.005 1.00 30.00  ? 103 LYS Y CA  1  
ATOM 6913   C C   . LYS B 2 89  ? -127.497 -17.680 -39.827 1.00 30.00  ? 103 LYS Y C   1  
ATOM 6914   O O   . LYS B 2 89  ? -126.331 -17.598 -39.443 1.00 30.00  ? 103 LYS Y O   1  
ATOM 6915   C CB  . LYS B 2 89  ? -128.859 -15.637 -39.380 1.00 99.99  ? 103 LYS Y CB  1  
ATOM 6916   C CG  . LYS B 2 89  ? -129.954 -15.050 -38.498 1.00 99.99  ? 103 LYS Y CG  1  
ATOM 6917   C CD  . LYS B 2 89  ? -130.254 -13.622 -38.939 1.00 99.99  ? 103 LYS Y CD  1  
ATOM 6918   C CE  . LYS B 2 89  ? -131.367 -13.045 -38.070 1.00 99.99  ? 103 LYS Y CE  1  
ATOM 6919   N NZ  . LYS B 2 89  ? -131.984 -11.904 -38.760 1.00 99.99  ? 103 LYS Y NZ  1  
ATOM 6920   N N   . LEU B 2 90  ? -127.839 -18.282 -40.955 1.00 30.00  ? 104 LEU Y N   1  
ATOM 6921   C CA  . LEU B 2 90  ? -126.838 -18.871 -41.831 1.00 30.00  ? 104 LEU Y CA  1  
ATOM 6922   C C   . LEU B 2 90  ? -126.978 -18.173 -43.182 1.00 30.00  ? 104 LEU Y C   1  
ATOM 6923   O O   . LEU B 2 90  ? -128.093 -17.849 -43.592 1.00 30.00  ? 104 LEU Y O   1  
ATOM 6924   C CB  . LEU B 2 90  ? -127.086 -20.368 -41.971 1.00 99.99  ? 104 LEU Y CB  1  
ATOM 6925   C CG  . LEU B 2 90  ? -126.230 -21.121 -40.958 1.00 99.99  ? 104 LEU Y CG  1  
ATOM 6926   C CD1 . LEU B 2 90  ? -126.219 -22.606 -41.305 1.00 99.99  ? 104 LEU Y CD1 1  
ATOM 6927   C CD2 . LEU B 2 90  ? -124.804 -20.579 -40.991 1.00 99.99  ? 104 LEU Y CD2 1  
ATOM 6928   N N   . ASN B 2 91  ? -125.870 -17.928 -43.875 1.00 30.00  ? 105 ASN Y N   1  
ATOM 6929   C CA  . ASN B 2 91  ? -126.005 -17.271 -45.158 1.00 30.00  ? 105 ASN Y CA  1  
ATOM 6930   C C   . ASN B 2 91  ? -126.466 -18.315 -46.148 1.00 30.00  ? 105 ASN Y C   1  
ATOM 6931   O O   . ASN B 2 91  ? -125.804 -19.332 -46.378 1.00 30.00  ? 105 ASN Y O   1  
ATOM 6932   C CB  . ASN B 2 91  ? -124.664 -16.683 -45.586 1.00 99.99  ? 105 ASN Y CB  1  
ATOM 6933   C CG  . ASN B 2 91  ? -124.856 -15.503 -46.524 1.00 99.99  ? 105 ASN Y CG  1  
ATOM 6934   O OD1 . ASN B 2 91  ? -123.974 -15.185 -47.320 1.00 99.99  ? 105 ASN Y OD1 1  
ATOM 6935   N ND2 . ASN B 2 91  ? -126.017 -14.846 -46.428 1.00 99.99  ? 105 ASN Y ND2 1  
ATOM 6936   N N   . ILE B 2 92  ? -127.634 -18.025 -46.708 1.00 30.00  ? 106 ILE Y N   1  
ATOM 6937   C CA  . ILE B 2 92  ? -128.320 -18.855 -47.669 1.00 30.00  ? 106 ILE Y CA  1  
ATOM 6938   C C   . ILE B 2 92  ? -127.511 -19.639 -48.682 1.00 30.00  ? 106 ILE Y C   1  
ATOM 6939   O O   . ILE B 2 92  ? -127.798 -20.812 -48.936 1.00 30.00  ? 106 ILE Y O   1  
ATOM 6940   C CB  . ILE B 2 92  ? -129.253 -17.998 -48.518 1.00 99.99  ? 106 ILE Y CB  1  
ATOM 6941   C CG1 . ILE B 2 92  ? -129.803 -18.832 -49.669 1.00 99.99  ? 106 ILE Y CG1 1  
ATOM 6942   C CG2 . ILE B 2 92  ? -128.482 -16.805 -49.076 1.00 99.99  ? 106 ILE Y CG2 1  
ATOM 6943   C CD1 . ILE B 2 92  ? -130.196 -20.215 -49.156 1.00 99.99  ? 106 ILE Y CD1 1  
ATOM 6944   N N   . GLU B 2 93  ? -126.511 -19.002 -49.281 1.00 30.00  ? 107 GLU Y N   1  
ATOM 6945   C CA  . GLU B 2 93  ? -125.694 -19.686 -50.279 1.00 30.00  ? 107 GLU Y CA  1  
ATOM 6946   C C   . GLU B 2 93  ? -124.921 -20.812 -49.602 1.00 30.00  ? 107 GLU Y C   1  
ATOM 6947   O O   . GLU B 2 93  ? -124.710 -21.891 -50.180 1.00 30.00  ? 107 GLU Y O   1  
ATOM 6948   C CB  . GLU B 2 93  ? -124.717 -18.702 -50.912 1.00 99.99  ? 107 GLU Y CB  1  
ATOM 6949   C CG  . GLU B 2 93  ? -123.868 -18.072 -49.834 1.00 99.99  ? 107 GLU Y CG  1  
ATOM 6950   C CD  . GLU B 2 93  ? -124.671 -16.986 -49.121 1.00 99.99  ? 107 GLU Y CD  1  
ATOM 6951   O OE1 . GLU B 2 93  ? -125.346 -17.334 -48.118 1.00 99.99  ? 107 GLU Y OE1 1  
ATOM 6952   O OE2 . GLU B 2 93  ? -124.602 -15.817 -49.591 1.00 99.99  ? 107 GLU Y OE2 1  
ATOM 6953   N N   . TYR B 2 94  ? -124.523 -20.540 -48.353 1.00 30.00  ? 108 TYR Y N   1  
ATOM 6954   C CA  . TYR B 2 94  ? -123.767 -21.480 -47.516 1.00 30.00  ? 108 TYR Y CA  1  
ATOM 6955   C C   . TYR B 2 94  ? -124.562 -22.763 -47.230 1.00 30.00  ? 108 TYR Y C   1  
ATOM 6956   O O   . TYR B 2 94  ? -124.195 -23.874 -47.678 1.00 30.00  ? 108 TYR Y O   1  
ATOM 6957   C CB  . TYR B 2 94  ? -123.426 -20.828 -46.181 1.00 99.99  ? 108 TYR Y CB  1  
ATOM 6958   C CG  . TYR B 2 94  ? -122.516 -19.646 -46.414 1.00 99.99  ? 108 TYR Y CG  1  
ATOM 6959   C CD1 . TYR B 2 94  ? -123.061 -18.378 -46.656 1.00 99.99  ? 108 TYR Y CD1 1  
ATOM 6960   C CD2 . TYR B 2 94  ? -121.128 -19.816 -46.393 1.00 99.99  ? 108 TYR Y CD2 1  
ATOM 6961   C CE1 . TYR B 2 94  ? -122.217 -17.283 -46.873 1.00 99.99  ? 108 TYR Y CE1 1  
ATOM 6962   C CE2 . TYR B 2 94  ? -120.284 -18.719 -46.611 1.00 99.99  ? 108 TYR Y CE2 1  
ATOM 6963   C CZ  . TYR B 2 94  ? -120.828 -17.453 -46.849 1.00 99.99  ? 108 TYR Y CZ  1  
ATOM 6964   O OH  . TYR B 2 94  ? -120.007 -16.388 -47.060 1.00 99.99  ? 108 TYR Y OH  1  
ATOM 6965   N N   . ILE B 2 95  ? -125.651 -22.602 -46.478 1.00 30.00  ? 109 ILE Y N   1  
ATOM 6966   C CA  . ILE B 2 95  ? -126.504 -23.732 -46.118 1.00 30.00  ? 109 ILE Y CA  1  
ATOM 6967   C C   . ILE B 2 95  ? -126.876 -24.541 -47.362 1.00 30.00  ? 109 ILE Y C   1  
ATOM 6968   O O   . ILE B 2 95  ? -126.665 -25.762 -47.418 1.00 30.00  ? 109 ILE Y O   1  
ATOM 6969   C CB  . ILE B 2 95  ? -127.784 -23.229 -45.458 1.00 99.99  ? 109 ILE Y CB  1  
ATOM 6970   C CG1 . ILE B 2 95  ? -128.772 -22.793 -46.535 1.00 99.99  ? 109 ILE Y CG1 1  
ATOM 6971   C CG2 . ILE B 2 95  ? -127.457 -22.040 -44.560 1.00 99.99  ? 109 ILE Y CG2 1  
ATOM 6972   C CD1 . ILE B 2 95  ? -128.608 -21.301 -46.804 1.00 99.99  ? 109 ILE Y CD1 1  
ATOM 6973   N N   . LYS B 2 96  ? -127.414 -23.852 -48.363 1.00 30.00  ? 110 LYS Y N   1  
ATOM 6974   C CA  . LYS B 2 96  ? -127.795 -24.513 -49.603 1.00 30.00  ? 110 LYS Y CA  1  
ATOM 6975   C C   . LYS B 2 96  ? -126.636 -25.366 -50.118 1.00 30.00  ? 110 LYS Y C   1  
ATOM 6976   O O   . LYS B 2 96  ? -126.818 -26.491 -50.587 1.00 30.00  ? 110 LYS Y O   1  
ATOM 6977   C CB  . LYS B 2 96  ? -128.156 -23.470 -50.655 1.00 99.99  ? 110 LYS Y CB  1  
ATOM 6978   C CG  . LYS B 2 96  ? -128.649 -24.170 -51.919 1.00 99.99  ? 110 LYS Y CG  1  
ATOM 6979   C CD  . LYS B 2 96  ? -129.414 -23.175 -52.785 1.00 99.99  ? 110 LYS Y CD  1  
ATOM 6980   C CE  . LYS B 2 96  ? -129.583 -23.751 -54.187 1.00 99.99  ? 110 LYS Y CE  1  
ATOM 6981   N NZ  . LYS B 2 96  ? -130.878 -24.440 -54.283 1.00 99.99  ? 110 LYS Y NZ  1  
ATOM 6982   N N   . ASP B 2 97  ? -125.429 -24.812 -50.023 1.00 30.00  ? 111 ASP Y N   1  
ATOM 6983   C CA  . ASP B 2 97  ? -124.227 -25.494 -50.482 1.00 30.00  ? 111 ASP Y CA  1  
ATOM 6984   C C   . ASP B 2 97  ? -123.944 -26.752 -49.669 1.00 30.00  ? 111 ASP Y C   1  
ATOM 6985   O O   . ASP B 2 97  ? -123.632 -27.821 -50.231 1.00 30.00  ? 111 ASP Y O   1  
ATOM 6986   C CB  . ASP B 2 97  ? -123.024 -24.563 -50.356 1.00 99.99  ? 111 ASP Y CB  1  
ATOM 6987   C CG  . ASP B 2 97  ? -121.821 -25.185 -51.061 1.00 99.99  ? 111 ASP Y CG  1  
ATOM 6988   O OD1 . ASP B 2 97  ? -121.187 -26.080 -50.442 1.00 99.99  ? 111 ASP Y OD1 1  
ATOM 6989   O OD2 . ASP B 2 97  ? -121.550 -24.759 -52.219 1.00 99.99  ? 111 ASP Y OD2 1  
ATOM 6990   N N   . LEU B 2 98  ? -124.061 -26.616 -48.345 1.00 30.00  ? 112 LEU Y N   1  
ATOM 6991   C CA  . LEU B 2 98  ? -123.823 -27.737 -47.424 1.00 30.00  ? 112 LEU Y CA  1  
ATOM 6992   C C   . LEU B 2 98  ? -124.703 -28.928 -47.756 1.00 30.00  ? 112 LEU Y C   1  
ATOM 6993   O O   . LEU B 2 98  ? -124.196 -30.013 -48.087 1.00 30.00  ? 112 LEU Y O   1  
ATOM 6994   C CB  . LEU B 2 98  ? -124.125 -27.306 -45.992 1.00 99.99  ? 112 LEU Y CB  1  
ATOM 6995   C CG  . LEU B 2 98  ? -122.836 -26.848 -45.317 1.00 99.99  ? 112 LEU Y CG  1  
ATOM 6996   C CD1 . LEU B 2 98  ? -123.065 -26.734 -43.813 1.00 99.99  ? 112 LEU Y CD1 1  
ATOM 6997   C CD2 . LEU B 2 98  ? -121.733 -27.865 -45.589 1.00 99.99  ? 112 LEU Y CD2 1  
ATOM 6998   N N   . LEU B 2 99  ? -126.022 -28.708 -47.669 1.00 30.00  ? 113 LEU Y N   1  
ATOM 6999   C CA  . LEU B 2 99  ? -127.044 -29.723 -47.948 1.00 30.00  ? 113 LEU Y CA  1  
ATOM 7000   C C   . LEU B 2 99  ? -126.942 -30.316 -49.350 1.00 30.00  ? 113 LEU Y C   1  
ATOM 7001   O O   . LEU B 2 99  ? -126.991 -31.539 -49.535 1.00 30.00  ? 113 LEU Y O   1  
ATOM 7002   C CB  . LEU B 2 99  ? -128.433 -29.109 -47.812 1.00 99.99  ? 113 LEU Y CB  1  
ATOM 7003   C CG  . LEU B 2 99  ? -128.969 -29.364 -46.407 1.00 99.99  ? 113 LEU Y CG  1  
ATOM 7004   C CD1 . LEU B 2 99  ? -130.460 -29.050 -46.367 1.00 99.99  ? 113 LEU Y CD1 1  
ATOM 7005   C CD2 . LEU B 2 99  ? -128.742 -30.824 -46.034 1.00 99.99  ? 113 LEU Y CD2 1  
ATOM 7006   N N   . GLU B 2 100 ? -126.798 -29.425 -50.331 1.00 30.00  ? 114 GLU Y N   1  
ATOM 7007   C CA  . GLU B 2 100 ? -126.705 -29.808 -51.728 1.00 30.00  ? 114 GLU Y CA  1  
ATOM 7008   C C   . GLU B 2 100 ? -125.628 -30.796 -52.154 1.00 30.00  ? 114 GLU Y C   1  
ATOM 7009   O O   . GLU B 2 100 ? -125.943 -31.825 -52.754 1.00 30.00  ? 114 GLU Y O   1  
ATOM 7010   C CB  . GLU B 2 100 ? -126.446 -28.574 -52.587 1.00 99.99  ? 114 GLU Y CB  1  
ATOM 7011   C CG  . GLU B 2 100 ? -127.632 -27.645 -52.506 1.00 99.99  ? 114 GLU Y CG  1  
ATOM 7012   C CD  . GLU B 2 100 ? -128.803 -28.243 -53.278 1.00 99.99  ? 114 GLU Y CD  1  
ATOM 7013   O OE1 . GLU B 2 100 ? -129.591 -28.992 -52.642 1.00 99.99  ? 114 GLU Y OE1 1  
ATOM 7014   O OE2 . GLU B 2 100 ? -128.898 -27.948 -54.500 1.00 99.99  ? 114 GLU Y OE2 1  
ATOM 7015   N N   . ASN B 2 101 ? -124.361 -30.498 -51.856 1.00 30.00  ? 115 ASN Y N   1  
ATOM 7016   C CA  . ASN B 2 101 ? -123.285 -31.403 -52.261 1.00 30.00  ? 115 ASN Y CA  1  
ATOM 7017   C C   . ASN B 2 101 ? -122.288 -31.775 -51.179 1.00 30.00  ? 115 ASN Y C   1  
ATOM 7018   O O   . ASN B 2 101 ? -121.097 -31.931 -51.454 1.00 30.00  ? 115 ASN Y O   1  
ATOM 7019   C CB  . ASN B 2 101 ? -122.469 -30.768 -53.383 1.00 99.99  ? 115 ASN Y CB  1  
ATOM 7020   C CG  . ASN B 2 101 ? -121.809 -29.477 -52.921 1.00 99.99  ? 115 ASN Y CG  1  
ATOM 7021   O OD1 . ASN B 2 101 ? -120.927 -28.951 -53.596 1.00 99.99  ? 115 ASN Y OD1 1  
ATOM 7022   N ND2 . ASN B 2 101 ? -122.238 -28.970 -51.763 1.00 99.99  ? 115 ASN Y ND2 1  
ATOM 7023   N N   . MET B 2 102 ? -122.762 -31.930 -49.953 1.00 30.00  ? 116 MET Y N   1  
ATOM 7024   C CA  . MET B 2 102 ? -121.872 -32.290 -48.870 1.00 30.00  ? 116 MET Y CA  1  
ATOM 7025   C C   . MET B 2 102 ? -122.474 -33.267 -47.881 1.00 30.00  ? 116 MET Y C   1  
ATOM 7026   O O   . MET B 2 102 ? -123.594 -33.084 -47.401 1.00 30.00  ? 116 MET Y O   1  
ATOM 7027   C CB  . MET B 2 102 ? -121.477 -31.044 -48.086 1.00 99.99  ? 116 MET Y CB  1  
ATOM 7028   C CG  . MET B 2 102 ? -120.997 -29.966 -49.050 1.00 99.99  ? 116 MET Y CG  1  
ATOM 7029   S SD  . MET B 2 102 ? -119.285 -30.287 -49.542 1.00 99.99  ? 116 MET Y SD  1  
ATOM 7030   C CE  . MET B 2 102 ? -118.436 -29.760 -48.068 1.00 99.99  ? 116 MET Y CE  1  
ATOM 7031   N N   . GLY B 2 103 ? -121.710 -34.304 -47.571 1.00 30.00  ? 117 GLY Y N   1  
ATOM 7032   C CA  . GLY B 2 103 ? -122.181 -35.313 -46.652 1.00 30.00  ? 117 GLY Y CA  1  
ATOM 7033   C C   . GLY B 2 103 ? -123.041 -36.256 -47.458 1.00 30.00  ? 117 GLY Y C   1  
ATOM 7034   O O   . GLY B 2 103 ? -122.559 -36.955 -48.349 1.00 30.00  ? 117 GLY Y O   1  
ATOM 7035   N N   . ASP B 2 104 ? -124.329 -36.276 -47.137 1.00 30.00  ? 118 ASP Y N   1  
ATOM 7036   C CA  . ASP B 2 104 ? -125.279 -37.127 -47.841 1.00 30.00  ? 118 ASP Y CA  1  
ATOM 7037   C C   . ASP B 2 104 ? -126.037 -36.168 -48.734 1.00 30.00  ? 118 ASP Y C   1  
ATOM 7038   O O   . ASP B 2 104 ? -127.149 -35.738 -48.421 1.00 30.00  ? 118 ASP Y O   1  
ATOM 7039   C CB  . ASP B 2 104 ? -126.195 -37.823 -46.838 1.00 99.99  ? 118 ASP Y CB  1  
ATOM 7040   C CG  . ASP B 2 104 ? -126.961 -38.943 -47.538 1.00 99.99  ? 118 ASP Y CG  1  
ATOM 7041   O OD1 . ASP B 2 104 ? -126.319 -39.988 -47.827 1.00 99.99  ? 118 ASP Y OD1 1  
ATOM 7042   O OD2 . ASP B 2 104 ? -128.183 -38.740 -47.782 1.00 99.99  ? 118 ASP Y OD2 1  
ATOM 7043   N N   . ASN B 2 105 ? -125.407 -35.820 -49.849 1.00 30.00  ? 119 ASN Y N   1  
ATOM 7044   C CA  . ASN B 2 105 ? -125.978 -34.896 -50.815 1.00 30.00  ? 119 ASN Y CA  1  
ATOM 7045   C C   . ASN B 2 105 ? -127.489 -34.996 -50.963 1.00 30.00  ? 119 ASN Y C   1  
ATOM 7046   O O   . ASN B 2 105 ? -128.056 -36.088 -51.058 1.00 30.00  ? 119 ASN Y O   1  
ATOM 7047   C CB  . ASN B 2 105 ? -125.383 -35.155 -52.195 1.00 99.99  ? 119 ASN Y CB  1  
ATOM 7048   C CG  . ASN B 2 105 ? -125.830 -36.502 -52.744 1.00 99.99  ? 119 ASN Y CG  1  
ATOM 7049   O OD1 . ASN B 2 105 ? -125.015 -37.394 -52.952 1.00 99.99  ? 119 ASN Y OD1 1  
ATOM 7050   N ND2 . ASN B 2 105 ? -127.139 -36.641 -52.980 1.00 99.99  ? 119 ASN Y ND2 1  
ATOM 7051   N N   . PHE B 2 106 ? -128.132 -33.840 -50.980 1.00 30.00  ? 120 PHE Y N   1  
ATOM 7052   C CA  . PHE B 2 106 ? -129.568 -33.787 -51.158 1.00 30.00  ? 120 PHE Y CA  1  
ATOM 7053   C C   . PHE B 2 106 ? -129.742 -33.843 -52.650 1.00 30.00  ? 120 PHE Y C   1  
ATOM 7054   O O   . PHE B 2 106 ? -128.803 -34.112 -53.399 1.00 30.00  ? 120 PHE Y O   1  
ATOM 7055   C CB  . PHE B 2 106 ? -130.118 -32.499 -50.561 1.00 99.99  ? 120 PHE Y CB  1  
ATOM 7056   C CG  . PHE B 2 106 ? -130.096 -32.589 -49.055 1.00 99.99  ? 120 PHE Y CG  1  
ATOM 7057   C CD1 . PHE B 2 106 ? -131.077 -33.332 -48.384 1.00 99.99  ? 120 PHE Y CD1 1  
ATOM 7058   C CD2 . PHE B 2 106 ? -129.097 -31.932 -48.329 1.00 99.99  ? 120 PHE Y CD2 1  
ATOM 7059   C CE1 . PHE B 2 106 ? -131.056 -33.417 -46.987 1.00 99.99  ? 120 PHE Y CE1 1  
ATOM 7060   C CE2 . PHE B 2 106 ? -129.077 -32.019 -46.929 1.00 99.99  ? 120 PHE Y CE2 1  
ATOM 7061   C CZ  . PHE B 2 106 ? -130.056 -32.759 -46.260 1.00 99.99  ? 120 PHE Y CZ  1  
ATOM 7062   N N   . ASN B 2 107 ? -130.957 -33.585 -53.090 1.00 30.00  ? 121 ASN Y N   1  
ATOM 7063   C CA  . ASN B 2 107 ? -131.238 -33.596 -54.507 1.00 30.00  ? 121 ASN Y CA  1  
ATOM 7064   C C   . ASN B 2 107 ? -131.992 -32.299 -54.738 1.00 30.00  ? 121 ASN Y C   1  
ATOM 7065   O O   . ASN B 2 107 ? -132.400 -31.645 -53.776 1.00 30.00  ? 121 ASN Y O   1  
ATOM 7066   C CB  . ASN B 2 107 ? -132.079 -34.820 -54.858 1.00 99.99  ? 121 ASN Y CB  1  
ATOM 7067   C CG  . ASN B 2 107 ? -133.390 -34.824 -54.088 1.00 99.99  ? 121 ASN Y CG  1  
ATOM 7068   O OD1 . ASN B 2 107 ? -134.449 -34.569 -54.658 1.00 99.99  ? 121 ASN Y OD1 1  
ATOM 7069   N ND2 . ASN B 2 107 ? -133.318 -35.108 -52.786 1.00 99.99  ? 121 ASN Y ND2 1  
ATOM 7070   N N   . LYS B 2 108 ? -132.162 -31.925 -56.000 1.00 30.00  ? 122 LYS Y N   1  
ATOM 7071   C CA  . LYS B 2 108 ? -132.864 -30.693 -56.338 1.00 30.00  ? 122 LYS Y CA  1  
ATOM 7072   C C   . LYS B 2 108 ? -134.256 -30.629 -55.689 1.00 30.00  ? 122 LYS Y C   1  
ATOM 7073   O O   . LYS B 2 108 ? -134.667 -29.597 -55.141 1.00 30.00  ? 122 LYS Y O   1  
ATOM 7074   C CB  . LYS B 2 108 ? -133.041 -30.597 -57.850 1.00 99.99  ? 122 LYS Y CB  1  
ATOM 7075   C CG  . LYS B 2 108 ? -133.686 -29.259 -58.204 1.00 99.99  ? 122 LYS Y CG  1  
ATOM 7076   C CD  . LYS B 2 108 ? -133.463 -28.961 -59.683 1.00 99.99  ? 122 LYS Y CD  1  
ATOM 7077   C CE  . LYS B 2 108 ? -134.404 -27.843 -60.122 1.00 99.99  ? 122 LYS Y CE  1  
ATOM 7078   N NZ  . LYS B 2 108 ? -133.708 -26.551 -60.020 1.00 99.99  ? 122 LYS Y NZ  1  
ATOM 7079   N N   . ASP B 2 109 ? -134.977 -31.742 -55.751 1.00 30.00  ? 123 ASP Y N   1  
ATOM 7080   C CA  . ASP B 2 109 ? -136.313 -31.806 -55.176 1.00 30.00  ? 123 ASP Y CA  1  
ATOM 7081   C C   . ASP B 2 109 ? -136.235 -31.662 -53.661 1.00 30.00  ? 123 ASP Y C   1  
ATOM 7082   O O   . ASP B 2 109 ? -136.973 -30.855 -53.065 1.00 30.00  ? 123 ASP Y O   1  
ATOM 7083   C CB  . ASP B 2 109 ? -136.960 -33.145 -55.513 1.00 99.99  ? 123 ASP Y CB  1  
ATOM 7084   C CG  . ASP B 2 109 ? -138.433 -33.113 -55.124 1.00 99.99  ? 123 ASP Y CG  1  
ATOM 7085   O OD1 . ASP B 2 109 ? -138.716 -33.292 -53.911 1.00 99.99  ? 123 ASP Y OD1 1  
ATOM 7086   O OD2 . ASP B 2 109 ? -139.268 -32.906 -56.048 1.00 99.99  ? 123 ASP Y OD2 1  
ATOM 7087   N N   . GLU B 2 110 ? -135.343 -32.439 -53.043 1.00 30.00  ? 124 GLU Y N   1  
ATOM 7088   C CA  . GLU B 2 110 ? -135.157 -32.381 -51.601 1.00 30.00  ? 124 GLU Y CA  1  
ATOM 7089   C C   . GLU B 2 110 ? -134.832 -30.915 -51.336 1.00 30.00  ? 124 GLU Y C   1  
ATOM 7090   O O   . GLU B 2 110 ? -135.302 -30.315 -50.373 1.00 30.00  ? 124 GLU Y O   1  
ATOM 7091   C CB  . GLU B 2 110 ? -134.012 -33.305 -51.191 1.00 99.99  ? 124 GLU Y CB  1  
ATOM 7092   C CG  . GLU B 2 110 ? -134.388 -34.737 -51.488 1.00 99.99  ? 124 GLU Y CG  1  
ATOM 7093   C CD  . GLU B 2 110 ? -135.451 -35.200 -50.494 1.00 99.99  ? 124 GLU Y CD  1  
ATOM 7094   O OE1 . GLU B 2 110 ? -136.656 -35.019 -50.813 1.00 99.99  ? 124 GLU Y OE1 1  
ATOM 7095   O OE2 . GLU B 2 110 ? -135.046 -35.732 -49.424 1.00 99.99  ? 124 GLU Y OE2 1  
ATOM 7096   N N   . MET B 2 111 ? -134.037 -30.341 -52.240 1.00 30.00  ? 125 MET Y N   1  
ATOM 7097   C CA  . MET B 2 111 ? -133.606 -28.945 -52.176 1.00 30.00  ? 125 MET Y CA  1  
ATOM 7098   C C   . MET B 2 111 ? -134.748 -27.950 -52.318 1.00 30.00  ? 125 MET Y C   1  
ATOM 7099   O O   . MET B 2 111 ? -134.806 -26.959 -51.578 1.00 30.00  ? 125 MET Y O   1  
ATOM 7100   C CB  . MET B 2 111 ? -132.615 -28.655 -53.298 1.00 99.99  ? 125 MET Y CB  1  
ATOM 7101   C CG  . MET B 2 111 ? -132.476 -27.148 -53.480 1.00 99.99  ? 125 MET Y CG  1  
ATOM 7102   S SD  . MET B 2 111 ? -131.345 -26.790 -54.847 1.00 99.99  ? 125 MET Y SD  1  
ATOM 7103   C CE  . MET B 2 111 ? -131.827 -25.118 -55.218 1.00 99.99  ? 125 MET Y CE  1  
ATOM 7104   N N   . ARG B 2 112 ? -135.645 -28.206 -53.266 1.00 30.00  ? 126 ARG Y N   1  
ATOM 7105   C CA  . ARG B 2 112 ? -136.778 -27.306 -53.466 1.00 30.00  ? 126 ARG Y CA  1  
ATOM 7106   C C   . ARG B 2 112 ? -137.812 -27.475 -52.366 1.00 30.00  ? 126 ARG Y C   1  
ATOM 7107   O O   . ARG B 2 112 ? -138.318 -26.482 -51.806 1.00 30.00  ? 126 ARG Y O   1  
ATOM 7108   C CB  . ARG B 2 112 ? -137.445 -27.602 -54.806 1.00 99.99  ? 126 ARG Y CB  1  
ATOM 7109   C CG  . ARG B 2 112 ? -136.444 -27.378 -55.935 1.00 99.99  ? 126 ARG Y CG  1  
ATOM 7110   C CD  . ARG B 2 112 ? -137.072 -27.792 -57.262 1.00 99.99  ? 126 ARG Y CD  1  
ATOM 7111   N NE  . ARG B 2 112 ? -137.123 -29.267 -57.385 1.00 99.99  ? 126 ARG Y NE  1  
ATOM 7112   C CZ  . ARG B 2 112 ? -137.693 -29.886 -58.414 1.00 99.99  ? 126 ARG Y CZ  1  
ATOM 7113   N NH1 . ARG B 2 112 ? -138.264 -29.219 -59.412 1.00 99.99  ? 126 ARG Y NH1 1  
ATOM 7114   N NH2 . ARG B 2 112 ? -137.683 -31.217 -58.424 1.00 99.99  ? 126 ARG Y NH2 1  
ATOM 7115   N N   . MET B 2 113 ? -138.136 -28.735 -52.074 1.00 30.00  ? 127 MET Y N   1  
ATOM 7116   C CA  . MET B 2 113 ? -139.121 -29.044 -51.056 1.00 30.00  ? 127 MET Y CA  1  
ATOM 7117   C C   . MET B 2 113 ? -138.707 -28.357 -49.772 1.00 30.00  ? 127 MET Y C   1  
ATOM 7118   O O   . MET B 2 113 ? -139.547 -27.781 -49.059 1.00 30.00  ? 127 MET Y O   1  
ATOM 7119   C CB  . MET B 2 113 ? -139.187 -30.552 -50.840 1.00 99.99  ? 127 MET Y CB  1  
ATOM 7120   C CG  . MET B 2 113 ? -139.337 -31.253 -52.185 1.00 99.99  ? 127 MET Y CG  1  
ATOM 7121   S SD  . MET B 2 113 ? -141.059 -31.182 -52.735 1.00 99.99  ? 127 MET Y SD  1  
ATOM 7122   C CE  . MET B 2 113 ? -141.771 -32.424 -51.679 1.00 99.99  ? 127 MET Y CE  1  
ATOM 7123   N N   . THR B 2 114 ? -137.400 -28.402 -49.492 1.00 30.00  ? 128 THR Y N   1  
ATOM 7124   C CA  . THR B 2 114 ? -136.853 -27.796 -48.279 1.00 30.00  ? 128 THR Y CA  1  
ATOM 7125   C C   . THR B 2 114 ? -136.890 -26.289 -48.202 1.00 30.00  ? 128 THR Y C   1  
ATOM 7126   O O   . THR B 2 114 ? -137.232 -25.720 -47.159 1.00 30.00  ? 128 THR Y O   1  
ATOM 7127   C CB  . THR B 2 114 ? -135.387 -28.180 -48.126 1.00 99.99  ? 128 THR Y CB  1  
ATOM 7128   O OG1 . THR B 2 114 ? -134.619 -27.558 -49.161 1.00 99.99  ? 128 THR Y OG1 1  
ATOM 7129   C CG2 . THR B 2 114 ? -135.244 -29.695 -48.230 1.00 99.99  ? 128 THR Y CG2 1  
ATOM 7130   N N   . PHE B 2 115 ? -136.528 -25.630 -49.295 1.00 30.00  ? 129 PHE Y N   1  
ATOM 7131   C CA  . PHE B 2 115 ? -136.516 -24.183 -49.271 1.00 30.00  ? 129 PHE Y CA  1  
ATOM 7132   C C   . PHE B 2 115 ? -137.808 -23.496 -49.631 1.00 30.00  ? 129 PHE Y C   1  
ATOM 7133   O O   . PHE B 2 115 ? -137.921 -22.275 -49.504 1.00 30.00  ? 129 PHE Y O   1  
ATOM 7134   C CB  . PHE B 2 115 ? -135.477 -23.657 -50.255 1.00 99.99  ? 129 PHE Y CB  1  
ATOM 7135   C CG  . PHE B 2 115 ? -135.468 -22.147 -50.222 1.00 99.99  ? 129 PHE Y CG  1  
ATOM 7136   C CD1 . PHE B 2 115 ? -134.737 -21.472 -49.237 1.00 99.99  ? 129 PHE Y CD1 1  
ATOM 7137   C CD2 . PHE B 2 115 ? -136.194 -21.425 -51.176 1.00 99.99  ? 129 PHE Y CD2 1  
ATOM 7138   C CE1 . PHE B 2 115 ? -134.731 -20.072 -49.207 1.00 99.99  ? 129 PHE Y CE1 1  
ATOM 7139   C CE2 . PHE B 2 115 ? -136.188 -20.022 -51.145 1.00 99.99  ? 129 PHE Y CE2 1  
ATOM 7140   C CZ  . PHE B 2 115 ? -135.455 -19.349 -50.160 1.00 99.99  ? 129 PHE Y CZ  1  
ATOM 7141   N N   . LYS B 2 116 ? -138.790 -24.278 -50.068 1.00 30.00  ? 130 LYS Y N   1  
ATOM 7142   C CA  . LYS B 2 116 ? -140.085 -23.722 -50.431 1.00 30.00  ? 130 LYS Y CA  1  
ATOM 7143   C C   . LYS B 2 116 ? -140.696 -23.102 -49.171 1.00 30.00  ? 130 LYS Y C   1  
ATOM 7144   O O   . LYS B 2 116 ? -141.497 -22.169 -49.235 1.00 30.00  ? 130 LYS Y O   1  
ATOM 7145   C CB  . LYS B 2 116 ? -140.991 -24.823 -50.970 1.00 99.99  ? 130 LYS Y CB  1  
ATOM 7146   C CG  . LYS B 2 116 ? -140.542 -25.211 -52.375 1.00 99.99  ? 130 LYS Y CG  1  
ATOM 7147   C CD  . LYS B 2 116 ? -141.505 -26.241 -52.950 1.00 99.99  ? 130 LYS Y CD  1  
ATOM 7148   C CE  . LYS B 2 116 ? -140.961 -27.643 -52.699 1.00 99.99  ? 130 LYS Y CE  1  
ATOM 7149   N NZ  . LYS B 2 116 ? -141.695 -28.612 -53.530 1.00 99.99  ? 130 LYS Y NZ  1  
ATOM 7150   N N   . GLU B 2 117 ? -140.289 -23.628 -48.021 1.00 30.00  ? 131 GLU Y N   1  
ATOM 7151   C CA  . GLU B 2 117 ? -140.775 -23.161 -46.726 1.00 30.00  ? 131 GLU Y CA  1  
ATOM 7152   C C   . GLU B 2 117 ? -139.786 -22.230 -46.018 1.00 30.00  ? 131 GLU Y C   1  
ATOM 7153   O O   . GLU B 2 117 ? -140.175 -21.197 -45.460 1.00 30.00  ? 131 GLU Y O   1  
ATOM 7154   C CB  . GLU B 2 117 ? -141.031 -24.351 -45.807 1.00 99.99  ? 131 GLU Y CB  1  
ATOM 7155   C CG  . GLU B 2 117 ? -142.147 -25.198 -46.372 1.00 99.99  ? 131 GLU Y CG  1  
ATOM 7156   C CD  . GLU B 2 117 ? -143.477 -24.464 -46.204 1.00 99.99  ? 131 GLU Y CD  1  
ATOM 7157   O OE1 . GLU B 2 117 ? -143.838 -23.702 -47.140 1.00 99.99  ? 131 GLU Y OE1 1  
ATOM 7158   O OE2 . GLU B 2 117 ? -144.117 -24.672 -45.139 1.00 99.99  ? 131 GLU Y OE2 1  
ATOM 7159   N N   . ALA B 2 118 ? -138.515 -22.628 -46.051 1.00 30.00  ? 132 ALA Y N   1  
ATOM 7160   C CA  . ALA B 2 118 ? -137.420 -21.893 -45.427 1.00 30.00  ? 132 ALA Y CA  1  
ATOM 7161   C C   . ALA B 2 118 ? -137.639 -20.391 -45.286 1.00 30.00  ? 132 ALA Y C   1  
ATOM 7162   O O   . ALA B 2 118 ? -138.090 -19.730 -46.223 1.00 30.00  ? 132 ALA Y O   1  
ATOM 7163   C CB  . ALA B 2 118 ? -136.155 -22.156 -46.203 1.00 30.00  ? 132 ALA Y CB  1  
ATOM 7164   N N   . PRO B 2 119 ? -137.324 -19.832 -44.102 1.00 30.00  ? 133 PRO Y N   1  
ATOM 7165   C CA  . PRO B 2 119 ? -137.440 -18.409 -43.741 1.00 30.00  ? 133 PRO Y CA  1  
ATOM 7166   C C   . PRO B 2 119 ? -136.210 -17.519 -44.041 1.00 30.00  ? 133 PRO Y C   1  
ATOM 7167   O O   . PRO B 2 119 ? -135.550 -17.034 -43.114 1.00 30.00  ? 133 PRO Y O   1  
ATOM 7168   C CB  . PRO B 2 119 ? -137.634 -18.579 -42.276 1.00 99.99  ? 133 PRO Y CB  1  
ATOM 7169   C CG  . PRO B 2 119 ? -137.652 -20.068 -42.024 1.00 99.99  ? 133 PRO Y CG  1  
ATOM 7170   C CD  . PRO B 2 119 ? -137.524 -20.767 -43.084 1.00 99.99  ? 133 PRO Y CD  1  
ATOM 7171   N N   . VAL B 2 120 ? -135.909 -17.293 -45.320 1.00 30.00  ? 134 VAL Y N   1  
ATOM 7172   C CA  . VAL B 2 120 ? -134.760 -16.473 -45.733 1.00 30.00  ? 134 VAL Y CA  1  
ATOM 7173   C C   . VAL B 2 120 ? -135.086 -15.033 -46.143 1.00 30.00  ? 134 VAL Y C   1  
ATOM 7174   O O   . VAL B 2 120 ? -135.770 -14.819 -47.145 1.00 30.00  ? 134 VAL Y O   1  
ATOM 7175   C CB  . VAL B 2 120 ? -134.075 -17.111 -46.935 1.00 99.99  ? 134 VAL Y CB  1  
ATOM 7176   C CG1 . VAL B 2 120 ? -133.589 -18.511 -46.559 1.00 99.99  ? 134 VAL Y CG1 1  
ATOM 7177   C CG2 . VAL B 2 120 ? -135.060 -17.212 -48.092 1.00 99.99  ? 134 VAL Y CG2 1  
ATOM 7178   N N   . GLU B 2 121 ? -134.604 -14.043 -45.391 1.00 30.00  ? 135 GLU Y N   1  
ATOM 7179   C CA  . GLU B 2 121 ? -134.873 -12.653 -45.756 1.00 30.00  ? 135 GLU Y CA  1  
ATOM 7180   C C   . GLU B 2 121 ? -133.756 -11.672 -45.408 1.00 30.00  ? 135 GLU Y C   1  
ATOM 7181   O O   . GLU B 2 121 ? -133.626 -11.225 -44.262 1.00 30.00  ? 135 GLU Y O   1  
ATOM 7182   C CB  . GLU B 2 121 ? -136.125 -12.163 -45.033 1.00 99.99  ? 135 GLU Y CB  1  
ATOM 7183   C CG  . GLU B 2 121 ? -135.944 -12.325 -43.544 1.00 99.99  ? 135 GLU Y CG  1  
ATOM 7184   C CD  . GLU B 2 121 ? -136.162 -13.786 -43.160 1.00 99.99  ? 135 GLU Y CD  1  
ATOM 7185   O OE1 . GLU B 2 121 ? -135.152 -14.542 -43.169 1.00 99.99  ? 135 GLU Y OE1 1  
ATOM 7186   O OE2 . GLU B 2 121 ? -137.335 -14.135 -42.859 1.00 99.99  ? 135 GLU Y OE2 1  
ATOM 7187   N N   . GLY B 2 122 ? -132.970 -11.332 -46.428 1.00 30.00  ? 136 GLY Y N   1  
ATOM 7188   C CA  . GLY B 2 122 ? -131.858 -10.417 -46.277 1.00 30.00  ? 136 GLY Y CA  1  
ATOM 7189   C C   . GLY B 2 122 ? -130.607 -11.220 -46.568 1.00 30.00  ? 136 GLY Y C   1  
ATOM 7190   O O   . GLY B 2 122 ? -129.511 -10.849 -46.165 1.00 30.00  ? 136 GLY Y O   1  
ATOM 7191   N N   . GLY B 2 123 ? -130.787 -12.334 -47.274 1.00 30.00  ? 137 GLY Y N   1  
ATOM 7192   C CA  . GLY B 2 123 ? -129.672 -13.191 -47.610 1.00 30.00  ? 137 GLY Y CA  1  
ATOM 7193   C C   . GLY B 2 123 ? -129.448 -14.276 -46.569 1.00 30.00  ? 137 GLY Y C   1  
ATOM 7194   O O   . GLY B 2 123 ? -128.987 -15.381 -46.895 1.00 30.00  ? 137 GLY Y O   1  
ATOM 7195   N N   . LYS B 2 124 ? -129.778 -13.955 -45.312 1.00 30.00  ? 138 LYS Y N   1  
ATOM 7196   C CA  . LYS B 2 124 ? -129.619 -14.893 -44.187 1.00 30.00  ? 138 LYS Y CA  1  
ATOM 7197   C C   . LYS B 2 124 ? -130.840 -15.797 -43.851 1.00 30.00  ? 138 LYS Y C   1  
ATOM 7198   O O   . LYS B 2 124 ? -131.960 -15.323 -43.622 1.00 30.00  ? 138 LYS Y O   1  
ATOM 7199   C CB  . LYS B 2 124 ? -129.321 -14.118 -42.907 1.00 99.99  ? 138 LYS Y CB  1  
ATOM 7200   C CG  . LYS B 2 124 ? -128.048 -13.302 -43.089 1.00 99.99  ? 138 LYS Y CG  1  
ATOM 7201   C CD  . LYS B 2 124 ? -127.694 -12.607 -41.778 1.00 99.99  ? 138 LYS Y CD  1  
ATOM 7202   C CE  . LYS B 2 124 ? -126.407 -11.811 -41.956 1.00 99.99  ? 138 LYS Y CE  1  
ATOM 7203   N NZ  . LYS B 2 124 ? -125.808 -11.543 -40.639 1.00 99.99  ? 138 LYS Y NZ  1  
ATOM 7204   N N   . PHE B 2 125 ? -130.584 -17.105 -43.817 1.00 30.00  ? 139 PHE Y N   1  
ATOM 7205   C CA  . PHE B 2 125 ? -131.606 -18.112 -43.516 1.00 30.00  ? 139 PHE Y CA  1  
ATOM 7206   C C   . PHE B 2 125 ? -131.653 -18.450 -42.023 1.00 30.00  ? 139 PHE Y C   1  
ATOM 7207   O O   . PHE B 2 125 ? -130.837 -19.228 -41.533 1.00 30.00  ? 139 PHE Y O   1  
ATOM 7208   C CB  . PHE B 2 125 ? -131.308 -19.397 -44.284 1.00 99.99  ? 139 PHE Y CB  1  
ATOM 7209   C CG  . PHE B 2 125 ? -132.367 -20.426 -43.972 1.00 99.99  ? 139 PHE Y CG  1  
ATOM 7210   C CD1 . PHE B 2 125 ? -133.586 -20.410 -44.659 1.00 99.99  ? 139 PHE Y CD1 1  
ATOM 7211   C CD2 . PHE B 2 125 ? -132.128 -21.398 -42.994 1.00 99.99  ? 139 PHE Y CD2 1  
ATOM 7212   C CE1 . PHE B 2 125 ? -134.567 -21.365 -44.369 1.00 99.99  ? 139 PHE Y CE1 1  
ATOM 7213   C CE2 . PHE B 2 125 ? -133.110 -22.353 -42.704 1.00 99.99  ? 139 PHE Y CE2 1  
ATOM 7214   C CZ  . PHE B 2 125 ? -134.328 -22.336 -43.391 1.00 99.99  ? 139 PHE Y CZ  1  
ATOM 7215   N N   . ASP B 2 126 ? -132.618 -17.863 -41.312 1.00 30.00  ? 140 ASP Y N   1  
ATOM 7216   C CA  . ASP B 2 126 ? -132.797 -18.083 -39.866 1.00 30.00  ? 140 ASP Y CA  1  
ATOM 7217   C C   . ASP B 2 126 ? -133.096 -19.536 -39.478 1.00 30.00  ? 140 ASP Y C   1  
ATOM 7218   O O   . ASP B 2 126 ? -134.235 -19.980 -39.592 1.00 30.00  ? 140 ASP Y O   1  
ATOM 7219   C CB  . ASP B 2 126 ? -133.963 -17.245 -39.355 1.00 99.99  ? 140 ASP Y CB  1  
ATOM 7220   C CG  . ASP B 2 126 ? -133.930 -17.198 -37.828 1.00 99.99  ? 140 ASP Y CG  1  
ATOM 7221   O OD1 . ASP B 2 126 ? -134.407 -18.191 -37.216 1.00 99.99  ? 140 ASP Y OD1 1  
ATOM 7222   O OD2 . ASP B 2 126 ? -133.427 -16.178 -37.291 1.00 99.99  ? 140 ASP Y OD2 1  
ATOM 7223   N N   . TYR B 2 127 ? -132.078 -20.255 -39.002 1.00 30.00  ? 141 TYR Y N   1  
ATOM 7224   C CA  . TYR B 2 127 ? -132.216 -21.658 -38.619 1.00 30.00  ? 141 TYR Y CA  1  
ATOM 7225   C C   . TYR B 2 127 ? -132.916 -21.895 -37.296 1.00 30.00  ? 141 TYR Y C   1  
ATOM 7226   O O   . TYR B 2 127 ? -133.206 -23.032 -36.929 1.00 30.00  ? 141 TYR Y O   1  
ATOM 7227   C CB  . TYR B 2 127 ? -130.839 -22.302 -38.501 1.00 99.99  ? 141 TYR Y CB  1  
ATOM 7228   C CG  . TYR B 2 127 ? -130.990 -23.750 -38.106 1.00 99.99  ? 141 TYR Y CG  1  
ATOM 7229   C CD1 . TYR B 2 127 ? -131.250 -24.717 -39.085 1.00 99.99  ? 141 TYR Y CD1 1  
ATOM 7230   C CD2 . TYR B 2 127 ? -130.868 -24.126 -36.763 1.00 99.99  ? 141 TYR Y CD2 1  
ATOM 7231   C CE1 . TYR B 2 127 ? -131.391 -26.062 -38.718 1.00 99.99  ? 141 TYR Y CE1 1  
ATOM 7232   C CE2 . TYR B 2 127 ? -131.011 -25.472 -36.399 1.00 99.99  ? 141 TYR Y CE2 1  
ATOM 7233   C CZ  . TYR B 2 127 ? -131.271 -26.437 -37.378 1.00 99.99  ? 141 TYR Y CZ  1  
ATOM 7234   O OH  . TYR B 2 127 ? -131.409 -27.744 -37.020 1.00 99.99  ? 141 TYR Y OH  1  
ATOM 7235   N N   . VAL B 2 128 ? -133.179 -20.824 -36.566 1.00 30.00  ? 142 VAL Y N   1  
ATOM 7236   C CA  . VAL B 2 128 ? -133.875 -20.954 -35.296 1.00 30.00  ? 142 VAL Y CA  1  
ATOM 7237   C C   . VAL B 2 128 ? -135.343 -21.149 -35.706 1.00 30.00  ? 142 VAL Y C   1  
ATOM 7238   O O   . VAL B 2 128 ? -135.909 -22.244 -35.576 1.00 30.00  ? 142 VAL Y O   1  
ATOM 7239   C CB  . VAL B 2 128 ? -133.671 -19.694 -34.463 1.00 99.99  ? 142 VAL Y CB  1  
ATOM 7240   C CG1 . VAL B 2 128 ? -134.447 -19.819 -33.154 1.00 99.99  ? 142 VAL Y CG1 1  
ATOM 7241   C CG2 . VAL B 2 128 ? -132.189 -19.514 -34.159 1.00 99.99  ? 142 VAL Y CG2 1  
ATOM 7242   N N   . LYS B 2 129 ? -135.940 -20.073 -36.215 1.00 30.00  ? 143 LYS Y N   1  
ATOM 7243   C CA  . LYS B 2 129 ? -137.319 -20.082 -36.667 1.00 30.00  ? 143 LYS Y CA  1  
ATOM 7244   C C   . LYS B 2 129 ? -137.610 -21.315 -37.504 1.00 30.00  ? 143 LYS Y C   1  
ATOM 7245   O O   . LYS B 2 129 ? -138.700 -21.867 -37.429 1.00 30.00  ? 143 LYS Y O   1  
ATOM 7246   C CB  . LYS B 2 129 ? -137.590 -18.843 -37.517 1.00 99.99  ? 143 LYS Y CB  1  
ATOM 7247   C CG  . LYS B 2 129 ? -139.065 -18.807 -37.906 1.00 99.99  ? 143 LYS Y CG  1  
ATOM 7248   C CD  . LYS B 2 129 ? -139.436 -17.396 -38.352 1.00 99.99  ? 143 LYS Y CD  1  
ATOM 7249   C CE  . LYS B 2 129 ? -140.776 -17.432 -39.084 1.00 99.99  ? 143 LYS Y CE  1  
ATOM 7250   N NZ  . LYS B 2 129 ? -141.861 -17.146 -38.133 1.00 99.99  ? 143 LYS Y NZ  1  
ATOM 7251   N N   . PHE B 2 130 ? -136.639 -21.748 -38.296 1.00 30.00  ? 144 PHE Y N   1  
ATOM 7252   C CA  . PHE B 2 130 ? -136.831 -22.907 -39.146 1.00 30.00  ? 144 PHE Y CA  1  
ATOM 7253   C C   . PHE B 2 130 ? -136.693 -24.190 -38.398 1.00 30.00  ? 144 PHE Y C   1  
ATOM 7254   O O   . PHE B 2 130 ? -137.195 -25.212 -38.847 1.00 30.00  ? 144 PHE Y O   1  
ATOM 7255   C CB  . PHE B 2 130 ? -135.797 -22.905 -40.265 1.00 99.99  ? 144 PHE Y CB  1  
ATOM 7256   C CG  . PHE B 2 130 ? -136.004 -24.112 -41.147 1.00 99.99  ? 144 PHE Y CG  1  
ATOM 7257   C CD1 . PHE B 2 130 ? -136.964 -24.079 -42.165 1.00 99.99  ? 144 PHE Y CD1 1  
ATOM 7258   C CD2 . PHE B 2 130 ? -135.234 -25.266 -40.946 1.00 99.99  ? 144 PHE Y CD2 1  
ATOM 7259   C CE1 . PHE B 2 130 ? -137.157 -25.201 -42.981 1.00 99.99  ? 144 PHE Y CE1 1  
ATOM 7260   C CE2 . PHE B 2 130 ? -135.429 -26.387 -41.762 1.00 99.99  ? 144 PHE Y CE2 1  
ATOM 7261   C CZ  . PHE B 2 130 ? -136.390 -26.353 -42.782 1.00 99.99  ? 144 PHE Y CZ  1  
ATOM 7262   N N   . THR B 2 131 ? -136.004 -24.160 -37.259 1.00 30.00  ? 145 THR Y N   1  
ATOM 7263   C CA  . THR B 2 131 ? -135.842 -25.387 -36.479 1.00 30.00  ? 145 THR Y CA  1  
ATOM 7264   C C   . THR B 2 131 ? -137.147 -25.607 -35.738 1.00 30.00  ? 145 THR Y C   1  
ATOM 7265   O O   . THR B 2 131 ? -137.568 -26.735 -35.514 1.00 30.00  ? 145 THR Y O   1  
ATOM 7266   C CB  . THR B 2 131 ? -134.685 -25.226 -35.498 1.00 99.99  ? 145 THR Y CB  1  
ATOM 7267   O OG1 . THR B 2 131 ? -133.446 -25.246 -36.212 1.00 99.99  ? 145 THR Y OG1 1  
ATOM 7268   C CG2 . THR B 2 131 ? -134.708 -26.375 -34.494 1.00 99.99  ? 145 THR Y CG2 1  
ATOM 7269   N N   . ALA B 2 132 ? -137.778 -24.504 -35.357 1.00 30.00  ? 146 ALA Y N   1  
ATOM 7270   C CA  . ALA B 2 132 ? -139.045 -24.573 -34.665 1.00 30.00  ? 146 ALA Y CA  1  
ATOM 7271   C C   . ALA B 2 132 ? -140.037 -25.136 -35.697 1.00 30.00  ? 146 ALA Y C   1  
ATOM 7272   O O   . ALA B 2 132 ? -140.589 -26.215 -35.515 1.00 30.00  ? 146 ALA Y O   1  
ATOM 7273   C CB  . ALA B 2 132 ? -139.467 -23.180 -34.211 1.00 30.00  ? 146 ALA Y CB  1  
ATOM 7274   N N   . MET B 2 133 ? -140.241 -24.404 -36.789 1.00 30.00  ? 147 MET Y N   1  
ATOM 7275   C CA  . MET B 2 133 ? -141.156 -24.826 -37.849 1.00 30.00  ? 147 MET Y CA  1  
ATOM 7276   C C   . MET B 2 133 ? -141.044 -26.318 -38.166 1.00 30.00  ? 147 MET Y C   1  
ATOM 7277   O O   . MET B 2 133 ? -142.056 -27.011 -38.303 1.00 30.00  ? 147 MET Y O   1  
ATOM 7278   C CB  . MET B 2 133 ? -140.858 -24.057 -39.130 1.00 99.99  ? 147 MET Y CB  1  
ATOM 7279   C CG  . MET B 2 133 ? -140.791 -22.565 -38.824 1.00 99.99  ? 147 MET Y CG  1  
ATOM 7280   S SD  . MET B 2 133 ? -142.462 -21.877 -38.717 1.00 99.99  ? 147 MET Y SD  1  
ATOM 7281   C CE  . MET B 2 133 ? -142.875 -21.804 -40.446 1.00 99.99  ? 147 MET Y CE  1  
ATOM 7282   N N   . ILE B 2 134 ? -139.829 -26.809 -38.288 1.00 30.00  ? 148 ILE Y N   1  
ATOM 7283   C CA  . ILE B 2 134 ? -139.600 -28.208 -38.585 1.00 30.00  ? 148 ILE Y CA  1  
ATOM 7284   C C   . ILE B 2 134 ? -139.875 -29.111 -37.376 1.00 30.00  ? 148 ILE Y C   1  
ATOM 7285   O O   . ILE B 2 134 ? -140.102 -30.305 -37.531 1.00 30.00  ? 148 ILE Y O   1  
ATOM 7286   C CB  . ILE B 2 134 ? -138.152 -28.418 -39.009 1.00 99.99  ? 148 ILE Y CB  1  
ATOM 7287   C CG1 . ILE B 2 134 ? -137.285 -28.626 -37.772 1.00 99.99  ? 148 ILE Y CG1 1  
ATOM 7288   C CG2 . ILE B 2 134 ? -137.661 -27.193 -39.774 1.00 99.99  ? 148 ILE Y CG2 1  
ATOM 7289   C CD1 . ILE B 2 134 ? -137.135 -30.119 -37.498 1.00 99.99  ? 148 ILE Y CD1 1  
ATOM 7290   N N   . LYS B 2 135 ? -139.865 -28.513 -36.178 1.00 30.00  ? 149 LYS Y N   1  
ATOM 7291   C CA  . LYS B 2 135 ? -140.110 -29.262 -34.911 1.00 30.00  ? 149 LYS Y CA  1  
ATOM 7292   C C   . LYS B 2 135 ? -141.506 -28.861 -34.323 1.00 30.00  ? 149 LYS Y C   1  
ATOM 7293   O O   . LYS B 2 135 ? -142.475 -28.973 -35.058 1.00 30.00  ? 149 LYS Y O   1  
ATOM 7294   C CB  . LYS B 2 135 ? -139.024 -28.930 -33.894 1.00 99.99  ? 149 LYS Y CB  1  
ATOM 7295   C CG  . LYS B 2 135 ? -139.225 -29.772 -32.639 1.00 99.99  ? 149 LYS Y CG  1  
ATOM 7296   C CD  . LYS B 2 135 ? -137.937 -29.787 -31.823 1.00 99.99  ? 149 LYS Y CD  1  
ATOM 7297   C CE  . LYS B 2 135 ? -138.232 -30.301 -30.417 1.00 99.99  ? 149 LYS Y CE  1  
ATOM 7298   N NZ  . LYS B 2 135 ? -137.981 -31.747 -30.360 1.00 99.99  ? 149 LYS Y NZ  1  
ATOM 7299   N N   . GLY B 2 136 ? -141.525 -28.439 -33.048 1.00 30.00  ? 150 GLY Y N   1  
ATOM 7300   C CA  . GLY B 2 136 ? -142.694 -27.991 -32.306 1.00 30.00  ? 150 GLY Y CA  1  
ATOM 7301   C C   . GLY B 2 136 ? -143.276 -26.704 -32.897 1.00 30.00  ? 150 GLY Y C   1  
ATOM 7302   O O   . GLY B 2 136 ? -142.820 -25.582 -32.517 1.00 30.00  ? 150 GLY Y O   1  
ATOM 7303   O OXT . GLY B 2 136 ? -144.195 -26.799 -33.720 1.00 30.00  ? 150 GLY Y OXT 1  
ATOM 7304   N N   . SER C 3 1   ? -89.325  -33.854 -36.634 1.00 30.00  ? 4   SER Z N   1  
ATOM 7305   C CA  . SER C 3 1   ? -89.140  -35.080 -35.876 1.00 30.00  ? 4   SER Z CA  1  
ATOM 7306   C C   . SER C 3 1   ? -90.257  -36.039 -36.276 1.00 30.00  ? 4   SER Z C   1  
ATOM 7307   O O   . SER C 3 1   ? -91.170  -35.659 -37.015 1.00 30.00  ? 4   SER Z O   1  
ATOM 7308   C CB  . SER C 3 1   ? -89.209  -34.782 -34.383 1.00 99.99  ? 4   SER Z CB  1  
ATOM 7309   O OG  . SER C 3 1   ? -90.539  -34.393 -34.032 1.00 99.99  ? 4   SER Z OG  1  
ATOM 7310   N N   . GLN C 3 2   ? -90.197  -37.274 -35.786 1.00 30.00  ? 5   GLN Z N   1  
ATOM 7311   C CA  . GLN C 3 2   ? -91.226  -38.248 -36.124 1.00 30.00  ? 5   GLN Z CA  1  
ATOM 7312   C C   . GLN C 3 2   ? -92.584  -37.882 -35.541 1.00 30.00  ? 5   GLN Z C   1  
ATOM 7313   O O   . GLN C 3 2   ? -93.546  -37.686 -36.289 1.00 30.00  ? 5   GLN Z O   1  
ATOM 7314   C CB  . GLN C 3 2   ? -90.839  -39.621 -35.585 1.00 99.99  ? 5   GLN Z CB  1  
ATOM 7315   C CG  . GLN C 3 2   ? -91.537  -40.707 -36.396 1.00 99.99  ? 5   GLN Z CG  1  
ATOM 7316   C CD  . GLN C 3 2   ? -92.940  -40.969 -35.870 1.00 99.99  ? 5   GLN Z CD  1  
ATOM 7317   O OE1 . GLN C 3 2   ? -93.373  -40.339 -34.906 1.00 99.99  ? 5   GLN Z OE1 1  
ATOM 7318   N NE2 . GLN C 3 2   ? -93.652  -41.903 -36.505 1.00 99.99  ? 5   GLN Z NE2 1  
ATOM 7319   N N   . ASP C 3 3   ? -92.674  -37.782 -34.217 1.00 30.00  ? 6   ASP Z N   1  
ATOM 7320   C CA  . ASP C 3 3   ? -93.946  -37.430 -33.591 1.00 30.00  ? 6   ASP Z CA  1  
ATOM 7321   C C   . ASP C 3 3   ? -94.518  -36.204 -34.313 1.00 30.00  ? 6   ASP Z C   1  
ATOM 7322   O O   . ASP C 3 3   ? -95.731  -35.967 -34.316 1.00 30.00  ? 6   ASP Z O   1  
ATOM 7323   C CB  . ASP C 3 3   ? -93.728  -37.106 -32.118 1.00 99.99  ? 6   ASP Z CB  1  
ATOM 7324   C CG  . ASP C 3 3   ? -92.550  -36.144 -31.974 1.00 99.99  ? 6   ASP Z CG  1  
ATOM 7325   O OD1 . ASP C 3 3   ? -91.449  -36.504 -32.472 1.00 99.99  ? 6   ASP Z OD1 1  
ATOM 7326   O OD2 . ASP C 3 3   ? -92.762  -35.060 -31.372 1.00 99.99  ? 6   ASP Z OD2 1  
ATOM 7327   N N   . GLU C 3 4   ? -93.626  -35.432 -34.938 1.00 30.00  ? 7   GLU Z N   1  
ATOM 7328   C CA  . GLU C 3 4   ? -93.990  -34.227 -35.687 1.00 30.00  ? 7   GLU Z CA  1  
ATOM 7329   C C   . GLU C 3 4   ? -94.576  -34.606 -37.038 1.00 30.00  ? 7   GLU Z C   1  
ATOM 7330   O O   . GLU C 3 4   ? -95.739  -34.308 -37.322 1.00 30.00  ? 7   GLU Z O   1  
ATOM 7331   C CB  . GLU C 3 4   ? -92.756  -33.363 -35.910 1.00 99.99  ? 7   GLU Z CB  1  
ATOM 7332   C CG  . GLU C 3 4   ? -92.243  -32.863 -34.581 1.00 99.99  ? 7   GLU Z CG  1  
ATOM 7333   C CD  . GLU C 3 4   ? -93.195  -31.803 -34.033 1.00 99.99  ? 7   GLU Z CD  1  
ATOM 7334   O OE1 . GLU C 3 4   ? -94.140  -32.200 -33.302 1.00 99.99  ? 7   GLU Z OE1 1  
ATOM 7335   O OE2 . GLU C 3 4   ? -92.968  -30.605 -34.352 1.00 99.99  ? 7   GLU Z OE2 1  
ATOM 7336   N N   . ILE C 3 5   ? -93.769  -35.258 -37.869 1.00 30.00  ? 8   ILE Z N   1  
ATOM 7337   C CA  . ILE C 3 5   ? -94.219  -35.679 -39.188 1.00 30.00  ? 8   ILE Z CA  1  
ATOM 7338   C C   . ILE C 3 5   ? -95.500  -36.506 -39.072 1.00 30.00  ? 8   ILE Z C   1  
ATOM 7339   O O   . ILE C 3 5   ? -96.333  -36.517 -39.978 1.00 30.00  ? 8   ILE Z O   1  
ATOM 7340   C CB  . ILE C 3 5   ? -93.142  -36.529 -39.856 1.00 99.99  ? 8   ILE Z CB  1  
ATOM 7341   C CG1 . ILE C 3 5   ? -93.236  -37.961 -39.341 1.00 99.99  ? 8   ILE Z CG1 1  
ATOM 7342   C CG2 . ILE C 3 5   ? -91.768  -35.959 -39.527 1.00 99.99  ? 8   ILE Z CG2 1  
ATOM 7343   C CD1 . ILE C 3 5   ? -92.295  -38.136 -38.151 1.00 99.99  ? 8   ILE Z CD1 1  
ATOM 7344   N N   . ASP C 3 6   ? -95.644  -37.196 -37.947 1.00 30.00  ? 9   ASP Z N   1  
ATOM 7345   C CA  . ASP C 3 6   ? -96.821  -38.014 -37.694 1.00 30.00  ? 9   ASP Z CA  1  
ATOM 7346   C C   . ASP C 3 6   ? -98.010  -37.080 -37.588 1.00 30.00  ? 9   ASP Z C   1  
ATOM 7347   O O   . ASP C 3 6   ? -99.110  -37.383 -38.043 1.00 30.00  ? 9   ASP Z O   1  
ATOM 7348   C CB  . ASP C 3 6   ? -96.644  -38.794 -36.399 1.00 99.99  ? 9   ASP Z CB  1  
ATOM 7349   C CG  . ASP C 3 6   ? -97.758  -39.828 -36.266 1.00 99.99  ? 9   ASP Z CG  1  
ATOM 7350   O OD1 . ASP C 3 6   ? -98.878  -39.419 -35.857 1.00 99.99  ? 9   ASP Z OD1 1  
ATOM 7351   O OD2 . ASP C 3 6   ? -97.480  -41.018 -36.579 1.00 99.99  ? 9   ASP Z OD2 1  
ATOM 7352   N N   . ASP C 3 7   ? -97.771  -35.934 -36.976 1.00 30.00  ? 10  ASP Z N   1  
ATOM 7353   C CA  . ASP C 3 7   ? -98.810  -34.944 -36.801 1.00 30.00  ? 10  ASP Z CA  1  
ATOM 7354   C C   . ASP C 3 7   ? -99.268  -34.384 -38.135 1.00 30.00  ? 10  ASP Z C   1  
ATOM 7355   O O   . ASP C 3 7   ? -100.452 -34.124 -38.337 1.00 30.00  ? 10  ASP Z O   1  
ATOM 7356   C CB  . ASP C 3 7   ? -98.294  -33.790 -35.947 1.00 99.99  ? 10  ASP Z CB  1  
ATOM 7357   C CG  . ASP C 3 7   ? -98.150  -34.254 -34.498 1.00 99.99  ? 10  ASP Z CG  1  
ATOM 7358   O OD1 . ASP C 3 7   ? -99.171  -34.750 -33.951 1.00 99.99  ? 10  ASP Z OD1 1  
ATOM 7359   O OD2 . ASP C 3 7   ? -97.023  -34.106 -33.954 1.00 99.99  ? 10  ASP Z OD2 1  
ATOM 7360   N N   . LEU C 3 8   ? -98.321  -34.184 -39.048 1.00 30.00  ? 11  LEU Z N   1  
ATOM 7361   C CA  . LEU C 3 8   ? -98.652  -33.674 -40.369 1.00 30.00  ? 11  LEU Z CA  1  
ATOM 7362   C C   . LEU C 3 8   ? -99.583  -34.735 -40.956 1.00 30.00  ? 11  LEU Z C   1  
ATOM 7363   O O   . LEU C 3 8   ? -100.650 -34.419 -41.493 1.00 30.00  ? 11  LEU Z O   1  
ATOM 7364   C CB  . LEU C 3 8   ? -97.380  -33.513 -41.197 1.00 99.99  ? 11  LEU Z CB  1  
ATOM 7365   C CG  . LEU C 3 8   ? -96.874  -32.078 -41.081 1.00 99.99  ? 11  LEU Z CG  1  
ATOM 7366   C CD1 . LEU C 3 8   ? -95.816  -31.825 -42.146 1.00 99.99  ? 11  LEU Z CD1 1  
ATOM 7367   C CD2 . LEU C 3 8   ? -98.039  -31.113 -41.279 1.00 99.99  ? 11  LEU Z CD2 1  
ATOM 7368   N N   . LYS C 3 9   ? -99.160  -35.997 -40.834 1.00 30.00  ? 12  LYS Z N   1  
ATOM 7369   C CA  . LYS C 3 9   ? -99.926  -37.146 -41.311 1.00 30.00  ? 12  LYS Z CA  1  
ATOM 7370   C C   . LYS C 3 9   ? -101.348 -37.041 -40.754 1.00 30.00  ? 12  LYS Z C   1  
ATOM 7371   O O   . LYS C 3 9   ? -102.310 -36.869 -41.497 1.00 30.00  ? 12  LYS Z O   1  
ATOM 7372   C CB  . LYS C 3 9   ? -99.273  -38.438 -40.833 1.00 99.99  ? 12  LYS Z CB  1  
ATOM 7373   C CG  . LYS C 3 9   ? -100.020 -39.634 -41.417 1.00 99.99  ? 12  LYS Z CG  1  
ATOM 7374   C CD  . LYS C 3 9   ? -99.140  -40.877 -41.324 1.00 99.99  ? 12  LYS Z CD  1  
ATOM 7375   C CE  . LYS C 3 9   ? -99.995  -42.119 -41.553 1.00 99.99  ? 12  LYS Z CE  1  
ATOM 7376   N NZ  . LYS C 3 9   ? -99.941  -42.499 -42.972 1.00 99.99  ? 12  LYS Z NZ  1  
ATOM 7377   N N   . ASP C 3 10  ? -101.475 -37.138 -39.441 1.00 30.00  ? 13  ASP Z N   1  
ATOM 7378   C CA  . ASP C 3 10  ? -102.779 -37.051 -38.810 1.00 30.00  ? 13  ASP Z CA  1  
ATOM 7379   C C   . ASP C 3 10  ? -103.686 -36.057 -39.530 1.00 30.00  ? 13  ASP Z C   1  
ATOM 7380   O O   . ASP C 3 10  ? -104.688 -36.440 -40.121 1.00 30.00  ? 13  ASP Z O   1  
ATOM 7381   C CB  . ASP C 3 10  ? -102.626 -36.599 -37.362 1.00 99.99  ? 13  ASP Z CB  1  
ATOM 7382   C CG  . ASP C 3 10  ? -101.940 -37.696 -36.553 1.00 99.99  ? 13  ASP Z CG  1  
ATOM 7383   O OD1 . ASP C 3 10  ? -102.613 -38.733 -36.301 1.00 99.99  ? 13  ASP Z OD1 1  
ATOM 7384   O OD2 . ASP C 3 10  ? -100.749 -37.489 -36.197 1.00 99.99  ? 13  ASP Z OD2 1  
ATOM 7385   N N   . VAL C 3 11  ? -103.330 -34.777 -39.487 1.00 30.00  ? 14  VAL Z N   1  
ATOM 7386   C CA  . VAL C 3 11  ? -104.120 -33.727 -40.126 1.00 30.00  ? 14  VAL Z CA  1  
ATOM 7387   C C   . VAL C 3 11  ? -104.327 -33.877 -41.629 1.00 30.00  ? 14  VAL Z C   1  
ATOM 7388   O O   . VAL C 3 11  ? -105.429 -33.651 -42.117 1.00 30.00  ? 14  VAL Z O   1  
ATOM 7389   C CB  . VAL C 3 11  ? -103.447 -32.372 -39.926 1.00 99.99  ? 14  VAL Z CB  1  
ATOM 7390   C CG1 . VAL C 3 11  ? -103.334 -32.076 -38.433 1.00 99.99  ? 14  VAL Z CG1 1  
ATOM 7391   C CG2 . VAL C 3 11  ? -102.053 -32.398 -40.545 1.00 99.99  ? 14  VAL Z CG2 1  
ATOM 7392   N N   . PHE C 3 12  ? -103.273 -34.249 -42.361 1.00 30.00  ? 15  PHE Z N   1  
ATOM 7393   C CA  . PHE C 3 12  ? -103.391 -34.427 -43.814 1.00 30.00  ? 15  PHE Z CA  1  
ATOM 7394   C C   . PHE C 3 12  ? -104.612 -35.278 -44.140 1.00 30.00  ? 15  PHE Z C   1  
ATOM 7395   O O   . PHE C 3 12  ? -105.331 -35.014 -45.102 1.00 30.00  ? 15  PHE Z O   1  
ATOM 7396   C CB  . PHE C 3 12  ? -102.144 -35.119 -44.355 1.00 99.99  ? 15  PHE Z CB  1  
ATOM 7397   C CG  . PHE C 3 12  ? -102.271 -35.298 -45.847 1.00 99.99  ? 15  PHE Z CG  1  
ATOM 7398   C CD1 . PHE C 3 12  ? -101.939 -34.245 -46.707 1.00 99.99  ? 15  PHE Z CD1 1  
ATOM 7399   C CD2 . PHE C 3 12  ? -102.719 -36.516 -46.373 1.00 99.99  ? 15  PHE Z CD2 1  
ATOM 7400   C CE1 . PHE C 3 12  ? -102.057 -34.410 -48.092 1.00 99.99  ? 15  PHE Z CE1 1  
ATOM 7401   C CE2 . PHE C 3 12  ? -102.836 -36.681 -47.757 1.00 99.99  ? 15  PHE Z CE2 1  
ATOM 7402   C CZ  . PHE C 3 12  ? -102.506 -35.628 -48.618 1.00 99.99  ? 15  PHE Z CZ  1  
ATOM 7403   N N   . GLU C 3 13  ? -104.847 -36.304 -43.338 1.00 30.00  ? 16  GLU Z N   1  
ATOM 7404   C CA  . GLU C 3 13  ? -105.985 -37.178 -43.560 1.00 30.00  ? 16  GLU Z CA  1  
ATOM 7405   C C   . GLU C 3 13  ? -107.300 -36.418 -43.430 1.00 30.00  ? 16  GLU Z C   1  
ATOM 7406   O O   . GLU C 3 13  ? -108.043 -36.308 -44.401 1.00 30.00  ? 16  GLU Z O   1  
ATOM 7407   C CB  . GLU C 3 13  ? -105.979 -38.310 -42.537 1.00 99.99  ? 16  GLU Z CB  1  
ATOM 7408   C CG  . GLU C 3 13  ? -104.762 -39.176 -42.752 1.00 99.99  ? 16  GLU Z CG  1  
ATOM 7409   C CD  . GLU C 3 13  ? -104.939 -39.995 -44.028 1.00 99.99  ? 16  GLU Z CD  1  
ATOM 7410   O OE1 . GLU C 3 13  ? -104.528 -39.486 -45.102 1.00 99.99  ? 16  GLU Z OE1 1  
ATOM 7411   O OE2 . GLU C 3 13  ? -105.488 -41.126 -43.916 1.00 99.99  ? 16  GLU Z OE2 1  
ATOM 7412   N N   . LEU C 3 14  ? -107.588 -35.888 -42.238 1.00 30.00  ? 17  LEU Z N   1  
ATOM 7413   C CA  . LEU C 3 14  ? -108.839 -35.165 -42.034 1.00 30.00  ? 17  LEU Z CA  1  
ATOM 7414   C C   . LEU C 3 14  ? -109.192 -34.300 -43.223 1.00 30.00  ? 17  LEU Z C   1  
ATOM 7415   O O   . LEU C 3 14  ? -110.372 -34.161 -43.583 1.00 30.00  ? 17  LEU Z O   1  
ATOM 7416   C CB  . LEU C 3 14  ? -108.723 -34.264 -40.811 1.00 99.99  ? 17  LEU Z CB  1  
ATOM 7417   C CG  . LEU C 3 14  ? -109.988 -33.424 -40.677 1.00 99.99  ? 17  LEU Z CG  1  
ATOM 7418   C CD1 . LEU C 3 14  ? -109.839 -32.468 -39.494 1.00 99.99  ? 17  LEU Z CD1 1  
ATOM 7419   C CD2 . LEU C 3 14  ? -110.205 -32.622 -41.954 1.00 99.99  ? 17  LEU Z CD2 1  
ATOM 7420   N N   . PHE C 3 15  ? -108.171 -33.719 -43.841 1.00 30.00  ? 18  PHE Z N   1  
ATOM 7421   C CA  . PHE C 3 15  ? -108.378 -32.851 -44.993 1.00 30.00  ? 18  PHE Z CA  1  
ATOM 7422   C C   . PHE C 3 15  ? -108.573 -33.637 -46.283 1.00 30.00  ? 18  PHE Z C   1  
ATOM 7423   O O   . PHE C 3 15  ? -109.655 -33.594 -46.877 1.00 30.00  ? 18  PHE Z O   1  
ATOM 7424   C CB  . PHE C 3 15  ? -107.171 -31.941 -45.175 1.00 99.99  ? 18  PHE Z CB  1  
ATOM 7425   C CG  . PHE C 3 15  ? -107.392 -31.044 -46.368 1.00 99.99  ? 18  PHE Z CG  1  
ATOM 7426   C CD1 . PHE C 3 15  ? -108.138 -29.867 -46.228 1.00 99.99  ? 18  PHE Z CD1 1  
ATOM 7427   C CD2 . PHE C 3 15  ? -106.854 -31.389 -47.614 1.00 99.99  ? 18  PHE Z CD2 1  
ATOM 7428   C CE1 . PHE C 3 15  ? -108.344 -29.033 -47.334 1.00 99.99  ? 18  PHE Z CE1 1  
ATOM 7429   C CE2 . PHE C 3 15  ? -107.060 -30.554 -48.720 1.00 99.99  ? 18  PHE Z CE2 1  
ATOM 7430   C CZ  . PHE C 3 15  ? -107.806 -29.376 -48.579 1.00 99.99  ? 18  PHE Z CZ  1  
ATOM 7431   N N   . ASP C 3 16  ? -107.532 -34.353 -46.703 1.00 30.00  ? 19  ASP Z N   1  
ATOM 7432   C CA  . ASP C 3 16  ? -107.589 -35.149 -47.923 1.00 30.00  ? 19  ASP Z CA  1  
ATOM 7433   C C   . ASP C 3 16  ? -108.877 -35.962 -48.005 1.00 30.00  ? 19  ASP Z C   1  
ATOM 7434   O O   . ASP C 3 16  ? -109.295 -36.370 -49.080 1.00 30.00  ? 19  ASP Z O   1  
ATOM 7435   C CB  . ASP C 3 16  ? -106.413 -36.118 -47.965 1.00 99.99  ? 19  ASP Z CB  1  
ATOM 7436   C CG  . ASP C 3 16  ? -106.296 -36.841 -46.625 1.00 99.99  ? 19  ASP Z CG  1  
ATOM 7437   O OD1 . ASP C 3 16  ? -106.188 -36.126 -45.593 1.00 99.99  ? 19  ASP Z OD1 1  
ATOM 7438   O OD2 . ASP C 3 16  ? -106.321 -38.100 -46.645 1.00 99.99  ? 19  ASP Z OD2 1  
ATOM 7439   N N   . PHE C 3 17  ? -109.509 -36.189 -46.863 1.00 30.00  ? 20  PHE Z N   1  
ATOM 7440   C CA  . PHE C 3 17  ? -110.738 -36.946 -46.840 1.00 30.00  ? 20  PHE Z CA  1  
ATOM 7441   C C   . PHE C 3 17  ? -111.882 -36.049 -47.244 1.00 30.00  ? 20  PHE Z C   1  
ATOM 7442   O O   . PHE C 3 17  ? -112.656 -36.387 -48.138 1.00 30.00  ? 20  PHE Z O   1  
ATOM 7443   C CB  . PHE C 3 17  ? -110.986 -37.488 -45.436 1.00 99.99  ? 20  PHE Z CB  1  
ATOM 7444   C CG  . PHE C 3 17  ? -112.270 -38.278 -45.421 1.00 99.99  ? 20  PHE Z CG  1  
ATOM 7445   C CD1 . PHE C 3 17  ? -112.277 -39.616 -45.834 1.00 99.99  ? 20  PHE Z CD1 1  
ATOM 7446   C CD2 . PHE C 3 17  ? -113.461 -37.674 -44.994 1.00 99.99  ? 20  PHE Z CD2 1  
ATOM 7447   C CE1 . PHE C 3 17  ? -113.468 -40.351 -45.819 1.00 99.99  ? 20  PHE Z CE1 1  
ATOM 7448   C CE2 . PHE C 3 17  ? -114.653 -38.408 -44.983 1.00 99.99  ? 20  PHE Z CE2 1  
ATOM 7449   C CZ  . PHE C 3 17  ? -114.657 -39.746 -45.395 1.00 99.99  ? 20  PHE Z CZ  1  
ATOM 7450   N N   . TRP C 3 18  ? -111.985 -34.899 -46.591 1.00 30.00  ? 21  TRP Z N   1  
ATOM 7451   C CA  . TRP C 3 18  ? -113.064 -33.961 -46.865 1.00 30.00  ? 21  TRP Z CA  1  
ATOM 7452   C C   . TRP C 3 18  ? -113.195 -33.374 -48.261 1.00 30.00  ? 21  TRP Z C   1  
ATOM 7453   O O   . TRP C 3 18  ? -114.270 -32.900 -48.638 1.00 30.00  ? 21  TRP Z O   1  
ATOM 7454   C CB  . TRP C 3 18  ? -112.940 -32.745 -45.955 1.00 99.99  ? 21  TRP Z CB  1  
ATOM 7455   C CG  . TRP C 3 18  ? -114.085 -31.763 -46.042 1.00 99.99  ? 21  TRP Z CG  1  
ATOM 7456   C CD1 . TRP C 3 18  ? -114.301 -30.862 -47.009 1.00 99.99  ? 21  TRP Z CD1 1  
ATOM 7457   C CD2 . TRP C 3 18  ? -115.140 -31.598 -45.137 1.00 99.99  ? 21  TRP Z CD2 1  
ATOM 7458   N NE1 . TRP C 3 18  ? -115.498 -30.159 -46.668 1.00 99.99  ? 21  TRP Z NE1 1  
ATOM 7459   C CE2 . TRP C 3 18  ? -115.962 -30.636 -45.539 1.00 99.99  ? 21  TRP Z CE2 1  
ATOM 7460   C CE3 . TRP C 3 18  ? -115.403 -32.283 -43.943 1.00 99.99  ? 21  TRP Z CE3 1  
ATOM 7461   C CZ2 . TRP C 3 18  ? -117.112 -30.237 -44.842 1.00 99.99  ? 21  TRP Z CZ2 1  
ATOM 7462   C CZ3 . TRP C 3 18  ? -116.554 -31.897 -43.227 1.00 99.99  ? 21  TRP Z CZ3 1  
ATOM 7463   C CH2 . TRP C 3 18  ? -117.373 -30.916 -43.658 1.00 99.99  ? 21  TRP Z CH2 1  
ATOM 7464   N N   . ASP C 3 19  ? -112.117 -33.385 -49.033 1.00 30.00  ? 22  ASP Z N   1  
ATOM 7465   C CA  . ASP C 3 19  ? -112.193 -32.859 -50.389 1.00 30.00  ? 22  ASP Z CA  1  
ATOM 7466   C C   . ASP C 3 19  ? -112.126 -34.108 -51.263 1.00 30.00  ? 22  ASP Z C   1  
ATOM 7467   O O   . ASP C 3 19  ? -111.495 -34.128 -52.324 1.00 30.00  ? 22  ASP Z O   1  
ATOM 7468   C CB  . ASP C 3 19  ? -111.022 -31.917 -50.644 1.00 99.99  ? 22  ASP Z CB  1  
ATOM 7469   C CG  . ASP C 3 19  ? -109.723 -32.574 -50.186 1.00 99.99  ? 22  ASP Z CG  1  
ATOM 7470   O OD1 . ASP C 3 19  ? -109.668 -32.965 -48.989 1.00 99.99  ? 22  ASP Z OD1 1  
ATOM 7471   O OD2 . ASP C 3 19  ? -108.801 -32.684 -51.037 1.00 99.99  ? 22  ASP Z OD2 1  
ATOM 7472   N N   . GLY C 3 20  ? -112.804 -35.148 -50.775 1.00 30.00  ? 23  GLY Z N   1  
ATOM 7473   C CA  . GLY C 3 20  ? -112.863 -36.435 -51.451 1.00 30.00  ? 23  GLY Z CA  1  
ATOM 7474   C C   . GLY C 3 20  ? -111.653 -37.286 -51.115 1.00 30.00  ? 23  GLY Z C   1  
ATOM 7475   O O   . GLY C 3 20  ? -110.582 -37.066 -51.663 1.00 30.00  ? 23  GLY Z O   1  
ATOM 7476   N N   . ARG C 3 21  ? -111.817 -38.260 -50.225 1.00 30.00  ? 24  ARG Z N   1  
ATOM 7477   C CA  . ARG C 3 21  ? -110.700 -39.126 -49.839 1.00 30.00  ? 24  ARG Z CA  1  
ATOM 7478   C C   . ARG C 3 21  ? -110.054 -39.842 -51.027 1.00 30.00  ? 24  ARG Z C   1  
ATOM 7479   O O   . ARG C 3 21  ? -110.720 -40.573 -51.764 1.00 30.00  ? 24  ARG Z O   1  
ATOM 7480   C CB  . ARG C 3 21  ? -111.188 -40.199 -48.869 1.00 99.99  ? 24  ARG Z CB  1  
ATOM 7481   C CG  . ARG C 3 21  ? -110.001 -41.018 -48.377 1.00 99.99  ? 24  ARG Z CG  1  
ATOM 7482   C CD  . ARG C 3 21  ? -110.499 -42.167 -47.507 1.00 99.99  ? 24  ARG Z CD  1  
ATOM 7483   N NE  . ARG C 3 21  ? -111.183 -43.192 -48.324 1.00 99.99  ? 24  ARG Z NE  1  
ATOM 7484   C CZ  . ARG C 3 21  ? -111.645 -44.332 -47.819 1.00 99.99  ? 24  ARG Z CZ  1  
ATOM 7485   N NH1 . ARG C 3 21  ? -111.518 -44.634 -46.530 1.00 99.99  ? 24  ARG Z NH1 1  
ATOM 7486   N NH2 . ARG C 3 21  ? -112.246 -45.185 -48.645 1.00 99.99  ? 24  ARG Z NH2 1  
ATOM 7487   N N   . ASP C 3 22  ? -108.755 -39.632 -51.197 1.00 30.00  ? 25  ASP Z N   1  
ATOM 7488   C CA  . ASP C 3 22  ? -108.033 -40.243 -52.301 1.00 30.00  ? 25  ASP Z CA  1  
ATOM 7489   C C   . ASP C 3 22  ? -106.529 -40.067 -52.159 1.00 30.00  ? 25  ASP Z C   1  
ATOM 7490   O O   . ASP C 3 22  ? -105.783 -40.259 -53.123 1.00 30.00  ? 25  ASP Z O   1  
ATOM 7491   C CB  . ASP C 3 22  ? -108.462 -39.608 -53.618 1.00 99.99  ? 25  ASP Z CB  1  
ATOM 7492   C CG  . ASP C 3 22  ? -109.909 -39.984 -53.920 1.00 99.99  ? 25  ASP Z CG  1  
ATOM 7493   O OD1 . ASP C 3 22  ? -110.134 -41.177 -54.264 1.00 99.99  ? 25  ASP Z OD1 1  
ATOM 7494   O OD2 . ASP C 3 22  ? -110.778 -39.080 -53.800 1.00 99.99  ? 25  ASP Z OD2 1  
ATOM 7495   N N   . GLY C 3 23  ? -106.081 -39.689 -50.959 1.00 30.00  ? 26  GLY Z N   1  
ATOM 7496   C CA  . GLY C 3 23  ? -104.659 -39.499 -50.724 1.00 30.00  ? 26  GLY Z CA  1  
ATOM 7497   C C   . GLY C 3 23  ? -104.057 -38.278 -51.404 1.00 30.00  ? 26  GLY Z C   1  
ATOM 7498   O O   . GLY C 3 23  ? -102.874 -38.276 -51.761 1.00 30.00  ? 26  GLY Z O   1  
ATOM 7499   N N   . ALA C 3 24  ? -104.871 -37.238 -51.583 1.00 30.00  ? 27  ALA Z N   1  
ATOM 7500   C CA  . ALA C 3 24  ? -104.422 -35.998 -52.218 1.00 30.00  ? 27  ALA Z CA  1  
ATOM 7501   C C   . ALA C 3 24  ? -105.225 -34.836 -51.645 1.00 30.00  ? 27  ALA Z C   1  
ATOM 7502   O O   . ALA C 3 24  ? -106.402 -34.987 -51.354 1.00 30.00  ? 27  ALA Z O   1  
ATOM 7503   C CB  . ALA C 3 24  ? -104.626 -36.067 -53.729 1.00 30.00  ? 27  ALA Z CB  1  
ATOM 7504   N N   . VAL C 3 25  ? -104.583 -33.677 -51.476 1.00 30.00  ? 28  VAL Z N   1  
ATOM 7505   C CA  . VAL C 3 25  ? -105.264 -32.498 -50.932 1.00 30.00  ? 28  VAL Z CA  1  
ATOM 7506   C C   . VAL C 3 25  ? -105.192 -31.324 -51.894 1.00 30.00  ? 28  VAL Z C   1  
ATOM 7507   O O   . VAL C 3 25  ? -104.168 -31.119 -52.559 1.00 30.00  ? 28  VAL Z O   1  
ATOM 7508   C CB  . VAL C 3 25  ? -104.612 -32.081 -49.620 1.00 99.99  ? 28  VAL Z CB  1  
ATOM 7509   C CG1 . VAL C 3 25  ? -104.714 -33.226 -48.616 1.00 99.99  ? 28  VAL Z CG1 1  
ATOM 7510   C CG2 . VAL C 3 25  ? -103.141 -31.749 -49.862 1.00 99.99  ? 28  VAL Z CG2 1  
ATOM 7511   N N   . ASP C 3 26  ? -106.281 -30.555 -51.964 1.00 30.00  ? 29  ASP Z N   1  
ATOM 7512   C CA  . ASP C 3 26  ? -106.334 -29.389 -52.840 1.00 30.00  ? 29  ASP Z CA  1  
ATOM 7513   C C   . ASP C 3 26  ? -105.324 -28.356 -52.349 1.00 30.00  ? 29  ASP Z C   1  
ATOM 7514   O O   . ASP C 3 26  ? -105.415 -27.870 -51.215 1.00 30.00  ? 29  ASP Z O   1  
ATOM 7515   C CB  . ASP C 3 26  ? -107.733 -28.783 -52.816 1.00 99.99  ? 29  ASP Z CB  1  
ATOM 7516   C CG  . ASP C 3 26  ? -107.853 -27.725 -53.909 1.00 99.99  ? 29  ASP Z CG  1  
ATOM 7517   O OD1 . ASP C 3 26  ? -107.367 -26.590 -53.666 1.00 99.99  ? 29  ASP Z OD1 1  
ATOM 7518   O OD2 . ASP C 3 26  ? -108.426 -28.066 -54.980 1.00 99.99  ? 29  ASP Z OD2 1  
ATOM 7519   N N   . ALA C 3 27  ? -104.356 -28.030 -53.208 1.00 30.00  ? 30  ALA Z N   1  
ATOM 7520   C CA  . ALA C 3 27  ? -103.304 -27.067 -52.889 1.00 30.00  ? 30  ALA Z CA  1  
ATOM 7521   C C   . ALA C 3 27  ? -103.873 -25.757 -52.313 1.00 30.00  ? 30  ALA Z C   1  
ATOM 7522   O O   . ALA C 3 27  ? -103.157 -24.965 -51.699 1.00 30.00  ? 30  ALA Z O   1  
ATOM 7523   C CB  . ALA C 3 27  ? -102.473 -26.789 -54.153 1.00 30.00  ? 30  ALA Z CB  1  
ATOM 7524   N N   . PHE C 3 28  ? -105.167 -25.543 -52.506 1.00 30.00  ? 31  PHE Z N   1  
ATOM 7525   C CA  . PHE C 3 28  ? -105.827 -24.347 -52.012 1.00 30.00  ? 31  PHE Z CA  1  
ATOM 7526   C C   . PHE C 3 28  ? -106.110 -24.473 -50.511 1.00 30.00  ? 31  PHE Z C   1  
ATOM 7527   O O   . PHE C 3 28  ? -106.585 -23.529 -49.871 1.00 30.00  ? 31  PHE Z O   1  
ATOM 7528   C CB  . PHE C 3 28  ? -107.147 -24.141 -52.745 1.00 99.99  ? 31  PHE Z CB  1  
ATOM 7529   C CG  . PHE C 3 28  ? -107.822 -22.897 -52.226 1.00 99.99  ? 31  PHE Z CG  1  
ATOM 7530   C CD1 . PHE C 3 28  ? -107.459 -21.642 -52.727 1.00 99.99  ? 31  PHE Z CD1 1  
ATOM 7531   C CD2 . PHE C 3 28  ? -108.817 -22.998 -51.245 1.00 99.99  ? 31  PHE Z CD2 1  
ATOM 7532   C CE1 . PHE C 3 28  ? -108.088 -20.486 -52.244 1.00 99.99  ? 31  PHE Z CE1 1  
ATOM 7533   C CE2 . PHE C 3 28  ? -109.442 -21.843 -50.760 1.00 99.99  ? 31  PHE Z CE2 1  
ATOM 7534   C CZ  . PHE C 3 28  ? -109.079 -20.589 -51.262 1.00 99.99  ? 31  PHE Z CZ  1  
ATOM 7535   N N   . LYS C 3 29  ? -105.814 -25.636 -49.943 1.00 30.00  ? 32  LYS Z N   1  
ATOM 7536   C CA  . LYS C 3 29  ? -106.057 -25.840 -48.522 1.00 30.00  ? 32  LYS Z CA  1  
ATOM 7537   C C   . LYS C 3 29  ? -104.767 -25.952 -47.730 1.00 30.00  ? 32  LYS Z C   1  
ATOM 7538   O O   . LYS C 3 29  ? -104.789 -25.886 -46.499 1.00 30.00  ? 32  LYS Z O   1  
ATOM 7539   C CB  . LYS C 3 29  ? -106.853 -27.125 -48.313 1.00 99.99  ? 32  LYS Z CB  1  
ATOM 7540   C CG  . LYS C 3 29  ? -108.340 -26.804 -48.271 1.00 99.99  ? 32  LYS Z CG  1  
ATOM 7541   C CD  . LYS C 3 29  ? -108.846 -26.539 -49.687 1.00 99.99  ? 32  LYS Z CD  1  
ATOM 7542   C CE  . LYS C 3 29  ? -110.279 -26.026 -49.628 1.00 99.99  ? 32  LYS Z CE  1  
ATOM 7543   N NZ  . LYS C 3 29  ? -110.723 -25.657 -50.980 1.00 99.99  ? 32  LYS Z NZ  1  
ATOM 7544   N N   . LEU C 3 30  ? -103.651 -26.108 -48.443 1.00 30.00  ? 33  LEU Z N   1  
ATOM 7545   C CA  . LEU C 3 30  ? -102.326 -26.222 -47.821 1.00 30.00  ? 33  LEU Z CA  1  
ATOM 7546   C C   . LEU C 3 30  ? -102.156 -25.185 -46.710 1.00 30.00  ? 33  LEU Z C   1  
ATOM 7547   O O   . LEU C 3 30  ? -101.385 -25.373 -45.766 1.00 30.00  ? 33  LEU Z O   1  
ATOM 7548   C CB  . LEU C 3 30  ? -101.240 -25.999 -48.867 1.00 99.99  ? 33  LEU Z CB  1  
ATOM 7549   C CG  . LEU C 3 30  ? -100.781 -27.343 -49.422 1.00 99.99  ? 33  LEU Z CG  1  
ATOM 7550   C CD1 . LEU C 3 30  ? -99.490  -27.153 -50.210 1.00 99.99  ? 33  LEU Z CD1 1  
ATOM 7551   C CD2 . LEU C 3 30  ? -100.537 -28.311 -48.269 1.00 99.99  ? 33  LEU Z CD2 1  
ATOM 7552   N N   . GLY C 3 31  ? -102.873 -24.081 -46.827 1.00 30.00  ? 34  GLY Z N   1  
ATOM 7553   C CA  . GLY C 3 31  ? -102.766 -23.081 -45.798 1.00 30.00  ? 34  GLY Z CA  1  
ATOM 7554   C C   . GLY C 3 31  ? -103.392 -23.675 -44.552 1.00 30.00  ? 34  GLY Z C   1  
ATOM 7555   O O   . GLY C 3 31  ? -102.692 -24.079 -43.625 1.00 30.00  ? 34  GLY Z O   1  
ATOM 7556   N N   . ASP C 3 32  ? -104.717 -23.739 -44.550 1.00 30.00  ? 35  ASP Z N   1  
ATOM 7557   C CA  . ASP C 3 32  ? -105.458 -24.270 -43.427 1.00 30.00  ? 35  ASP Z CA  1  
ATOM 7558   C C   . ASP C 3 32  ? -104.861 -25.527 -42.798 1.00 30.00  ? 35  ASP Z C   1  
ATOM 7559   O O   . ASP C 3 32  ? -105.002 -25.750 -41.600 1.00 30.00  ? 35  ASP Z O   1  
ATOM 7560   C CB  . ASP C 3 32  ? -106.872 -24.632 -43.862 1.00 99.99  ? 35  ASP Z CB  1  
ATOM 7561   C CG  . ASP C 3 32  ? -107.720 -24.954 -42.634 1.00 99.99  ? 35  ASP Z CG  1  
ATOM 7562   O OD1 . ASP C 3 32  ? -107.593 -26.101 -42.130 1.00 99.99  ? 35  ASP Z OD1 1  
ATOM 7563   O OD2 . ASP C 3 32  ? -108.487 -24.048 -42.210 1.00 99.99  ? 35  ASP Z OD2 1  
ATOM 7564   N N   . VAL C 3 33  ? -104.200 -26.353 -43.601 1.00 30.00  ? 36  VAL Z N   1  
ATOM 7565   C CA  . VAL C 3 33  ? -103.601 -27.568 -43.073 1.00 30.00  ? 36  VAL Z CA  1  
ATOM 7566   C C   . VAL C 3 33  ? -102.618 -27.156 -41.980 1.00 30.00  ? 36  VAL Z C   1  
ATOM 7567   O O   . VAL C 3 33  ? -102.804 -27.487 -40.806 1.00 30.00  ? 36  VAL Z O   1  
ATOM 7568   C CB  . VAL C 3 33  ? -102.871 -28.314 -44.185 1.00 99.99  ? 36  VAL Z CB  1  
ATOM 7569   C CG1 . VAL C 3 33  ? -103.863 -28.680 -45.286 1.00 99.99  ? 36  VAL Z CG1 1  
ATOM 7570   C CG2 . VAL C 3 33  ? -101.777 -27.424 -44.763 1.00 99.99  ? 36  VAL Z CG2 1  
ATOM 7571   N N   . CYS C 3 34  ? -101.590 -26.416 -42.387 1.00 30.00  ? 37  CYS Z N   1  
ATOM 7572   C CA  . CYS C 3 34  ? -100.552 -25.936 -41.486 1.00 30.00  ? 37  CYS Z CA  1  
ATOM 7573   C C   . CYS C 3 34  ? -101.098 -25.039 -40.376 1.00 30.00  ? 37  CYS Z C   1  
ATOM 7574   O O   . CYS C 3 34  ? -100.543 -25.000 -39.277 1.00 30.00  ? 37  CYS Z O   1  
ATOM 7575   C CB  . CYS C 3 34  ? -99.524  -25.125 -42.269 1.00 99.99  ? 37  CYS Z CB  1  
ATOM 7576   S SG  . CYS C 3 34  ? -100.113 -23.573 -42.987 1.00 99.99  ? 37  CYS Z SG  1  
ATOM 7577   N N   . ARG C 3 35  ? -102.186 -24.328 -40.665 1.00 30.00  ? 38  ARG Z N   1  
ATOM 7578   C CA  . ARG C 3 35  ? -102.795 -23.454 -39.669 1.00 30.00  ? 38  ARG Z CA  1  
ATOM 7579   C C   . ARG C 3 35  ? -103.314 -24.308 -38.511 1.00 30.00  ? 38  ARG Z C   1  
ATOM 7580   O O   . ARG C 3 35  ? -103.536 -23.807 -37.413 1.00 30.00  ? 38  ARG Z O   1  
ATOM 7581   C CB  . ARG C 3 35  ? -103.952 -22.685 -40.298 1.00 99.99  ? 38  ARG Z CB  1  
ATOM 7582   C CG  . ARG C 3 35  ? -103.405 -21.565 -41.174 1.00 99.99  ? 38  ARG Z CG  1  
ATOM 7583   C CD  . ARG C 3 35  ? -104.560 -20.765 -41.762 1.00 99.99  ? 38  ARG Z CD  1  
ATOM 7584   N NE  . ARG C 3 35  ? -104.068 -19.723 -42.694 1.00 99.99  ? 38  ARG Z NE  1  
ATOM 7585   C CZ  . ARG C 3 35  ? -103.756 -18.491 -42.303 1.00 99.99  ? 38  ARG Z CZ  1  
ATOM 7586   N NH1 . ARG C 3 35  ? -103.868 -18.103 -41.035 1.00 99.99  ? 38  ARG Z NH1 1  
ATOM 7587   N NH2 . ARG C 3 35  ? -103.322 -17.637 -43.224 1.00 99.99  ? 38  ARG Z NH2 1  
ATOM 7588   N N   . CYS C 3 36  ? -103.500 -25.602 -38.775 1.00 30.00  ? 39  CYS Z N   1  
ATOM 7589   C CA  . CYS C 3 36  ? -104.004 -26.562 -37.782 1.00 30.00  ? 39  CYS Z CA  1  
ATOM 7590   C C   . CYS C 3 36  ? -102.911 -27.113 -36.883 1.00 30.00  ? 39  CYS Z C   1  
ATOM 7591   O O   . CYS C 3 36  ? -103.171 -27.478 -35.739 1.00 30.00  ? 39  CYS Z O   1  
ATOM 7592   C CB  . CYS C 3 36  ? -104.658 -27.745 -38.488 1.00 99.99  ? 39  CYS Z CB  1  
ATOM 7593   S SG  . CYS C 3 36  ? -106.150 -27.375 -39.441 1.00 99.99  ? 39  CYS Z SG  1  
ATOM 7594   N N   . LEU C 3 37  ? -101.698 -27.167 -37.420 1.00 30.00  ? 40  LEU Z N   1  
ATOM 7595   C CA  . LEU C 3 37  ? -100.537 -27.660 -36.698 1.00 30.00  ? 40  LEU Z CA  1  
ATOM 7596   C C   . LEU C 3 37  ? -99.908  -26.534 -35.876 1.00 30.00  ? 40  LEU Z C   1  
ATOM 7597   O O   . LEU C 3 37  ? -98.714  -26.564 -35.553 1.00 30.00  ? 40  LEU Z O   1  
ATOM 7598   C CB  . LEU C 3 37  ? -99.501  -28.189 -37.683 1.00 99.99  ? 40  LEU Z CB  1  
ATOM 7599   C CG  . LEU C 3 37  ? -99.682  -29.694 -37.856 1.00 99.99  ? 40  LEU Z CG  1  
ATOM 7600   C CD1 . LEU C 3 37  ? -98.462  -30.276 -38.565 1.00 99.99  ? 40  LEU Z CD1 1  
ATOM 7601   C CD2 . LEU C 3 37  ? -99.831  -30.347 -36.485 1.00 99.99  ? 40  LEU Z CD2 1  
ATOM 7602   N N   . GLY C 3 38  ? -100.725 -25.540 -35.541 1.00 30.00  ? 41  GLY Z N   1  
ATOM 7603   C CA  . GLY C 3 38  ? -100.239 -24.408 -34.766 1.00 30.00  ? 41  GLY Z CA  1  
ATOM 7604   C C   . GLY C 3 38  ? -99.986  -23.178 -35.624 1.00 30.00  ? 41  GLY Z C   1  
ATOM 7605   O O   . GLY C 3 38  ? -100.728 -22.207 -35.542 1.00 30.00  ? 41  GLY Z O   1  
ATOM 7606   N N   . ILE C 3 39  ? -98.936  -23.229 -36.442 1.00 30.00  ? 42  ILE Z N   1  
ATOM 7607   C CA  . ILE C 3 39  ? -98.544  -22.139 -37.347 1.00 30.00  ? 42  ILE Z CA  1  
ATOM 7608   C C   . ILE C 3 39  ? -99.656  -21.255 -37.965 1.00 30.00  ? 42  ILE Z C   1  
ATOM 7609   O O   . ILE C 3 39  ? -100.796 -21.693 -38.096 1.00 30.00  ? 42  ILE Z O   1  
ATOM 7610   C CB  . ILE C 3 39  ? -97.792  -22.708 -38.546 1.00 99.99  ? 42  ILE Z CB  1  
ATOM 7611   C CG1 . ILE C 3 39  ? -98.792  -23.125 -39.621 1.00 99.99  ? 42  ILE Z CG1 1  
ATOM 7612   C CG2 . ILE C 3 39  ? -96.977  -23.921 -38.109 1.00 99.99  ? 42  ILE Z CG2 1  
ATOM 7613   C CD1 . ILE C 3 39  ? -98.972  -21.986 -40.618 1.00 99.99  ? 42  ILE Z CD1 1  
ATOM 7614   N N   . ASN C 3 40  ? -99.305  -20.014 -38.329 1.00 30.00  ? 43  ASN Z N   1  
ATOM 7615   C CA  . ASN C 3 40  ? -100.244 -19.077 -38.982 1.00 30.00  ? 43  ASN Z CA  1  
ATOM 7616   C C   . ASN C 3 40  ? -99.455  -18.356 -40.050 1.00 30.00  ? 43  ASN Z C   1  
ATOM 7617   O O   . ASN C 3 40  ? -99.007  -17.225 -39.842 1.00 30.00  ? 43  ASN Z O   1  
ATOM 7618   C CB  . ASN C 3 40  ? -100.791 -18.092 -37.955 1.00 99.99  ? 43  ASN Z CB  1  
ATOM 7619   C CG  . ASN C 3 40  ? -101.716 -18.788 -36.965 1.00 99.99  ? 43  ASN Z CG  1  
ATOM 7620   O OD1 . ASN C 3 40  ? -102.831 -19.168 -37.314 1.00 99.99  ? 43  ASN Z OD1 1  
ATOM 7621   N ND2 . ASN C 3 40  ? -101.248 -18.953 -35.727 1.00 99.99  ? 43  ASN Z ND2 1  
ATOM 7622   N N   . PRO C 3 41  ? -99.278  -18.983 -41.216 1.00 30.00  ? 44  PRO Z N   1  
ATOM 7623   C CA  . PRO C 3 41  ? -98.513  -18.256 -42.230 1.00 30.00  ? 44  PRO Z CA  1  
ATOM 7624   C C   . PRO C 3 41  ? -99.378  -17.180 -42.838 1.00 30.00  ? 44  PRO Z C   1  
ATOM 7625   O O   . PRO C 3 41  ? -100.581 -17.103 -42.563 1.00 30.00  ? 44  PRO Z O   1  
ATOM 7626   C CB  . PRO C 3 41  ? -98.250  -19.395 -43.151 1.00 99.99  ? 44  PRO Z CB  1  
ATOM 7627   C CG  . PRO C 3 41  ? -98.855  -20.613 -42.499 1.00 99.99  ? 44  PRO Z CG  1  
ATOM 7628   C CD  . PRO C 3 41  ? -99.396  -20.373 -41.369 1.00 99.99  ? 44  PRO Z CD  1  
ATOM 7629   N N   . ARG C 3 42  ? -98.762  -16.347 -43.668 1.00 30.00  ? 45  ARG Z N   1  
ATOM 7630   C CA  . ARG C 3 42  ? -99.480  -15.268 -44.335 1.00 30.00  ? 45  ARG Z CA  1  
ATOM 7631   C C   . ARG C 3 42  ? -99.806  -15.765 -45.746 1.00 30.00  ? 45  ARG Z C   1  
ATOM 7632   O O   . ARG C 3 42  ? -99.059  -16.561 -46.314 1.00 30.00  ? 45  ARG Z O   1  
ATOM 7633   C CB  . ARG C 3 42  ? -98.609  -14.018 -44.388 1.00 99.99  ? 45  ARG Z CB  1  
ATOM 7634   C CG  . ARG C 3 42  ? -99.416  -12.856 -44.954 1.00 99.99  ? 45  ARG Z CG  1  
ATOM 7635   C CD  . ARG C 3 42  ? -98.634  -11.562 -44.780 1.00 99.99  ? 45  ARG Z CD  1  
ATOM 7636   N NE  . ARG C 3 42  ? -97.328  -11.633 -45.471 1.00 99.99  ? 45  ARG Z NE  1  
ATOM 7637   C CZ  . ARG C 3 42  ? -96.236  -11.020 -45.023 1.00 99.99  ? 45  ARG Z CZ  1  
ATOM 7638   N NH1 . ARG C 3 42  ? -96.244  -10.290 -43.910 1.00 99.99  ? 45  ARG Z NH1 1  
ATOM 7639   N NH2 . ARG C 3 42  ? -95.113  -11.152 -45.720 1.00 99.99  ? 45  ARG Z NH2 1  
ATOM 7640   N N   . ASN C 3 43  ? -100.913 -15.313 -46.316 1.00 30.00  ? 46  ASN Z N   1  
ATOM 7641   C CA  . ASN C 3 43  ? -101.255 -15.752 -47.656 1.00 30.00  ? 46  ASN Z CA  1  
ATOM 7642   C C   . ASN C 3 43  ? -100.025 -15.571 -48.550 1.00 30.00  ? 46  ASN Z C   1  
ATOM 7643   O O   . ASN C 3 43  ? -99.667  -16.468 -49.302 1.00 30.00  ? 46  ASN Z O   1  
ATOM 7644   C CB  . ASN C 3 43  ? -102.415 -14.923 -48.196 1.00 99.99  ? 46  ASN Z CB  1  
ATOM 7645   C CG  . ASN C 3 43  ? -102.038 -13.453 -48.298 1.00 99.99  ? 46  ASN Z CG  1  
ATOM 7646   O OD1 . ASN C 3 43  ? -102.747 -12.669 -48.927 1.00 99.99  ? 46  ASN Z OD1 1  
ATOM 7647   N ND2 . ASN C 3 43  ? -100.916 -13.081 -47.679 1.00 99.99  ? 46  ASN Z ND2 1  
ATOM 7648   N N   . GLU C 3 44  ? -99.361  -14.420 -48.465 1.00 30.00  ? 47  GLU Z N   1  
ATOM 7649   C CA  . GLU C 3 44  ? -98.169  -14.215 -49.284 1.00 30.00  ? 47  GLU Z CA  1  
ATOM 7650   C C   . GLU C 3 44  ? -97.255  -15.427 -49.072 1.00 30.00  ? 47  GLU Z C   1  
ATOM 7651   O O   . GLU C 3 44  ? -96.690  -15.972 -50.023 1.00 30.00  ? 47  GLU Z O   1  
ATOM 7652   C CB  . GLU C 3 44  ? -97.464  -12.934 -48.855 1.00 99.99  ? 47  GLU Z CB  1  
ATOM 7653   C CG  . GLU C 3 44  ? -98.355  -11.746 -49.137 1.00 99.99  ? 47  GLU Z CG  1  
ATOM 7654   C CD  . GLU C 3 44  ? -98.415  -11.504 -50.642 1.00 99.99  ? 47  GLU Z CD  1  
ATOM 7655   O OE1 . GLU C 3 44  ? -99.323  -12.093 -51.283 1.00 99.99  ? 47  GLU Z OE1 1  
ATOM 7656   O OE2 . GLU C 3 44  ? -97.553  -10.729 -51.137 1.00 99.99  ? 47  GLU Z OE2 1  
ATOM 7657   N N   . ASP C 3 45  ? -97.139  -15.834 -47.807 1.00 30.00  ? 48  ASP Z N   1  
ATOM 7658   C CA  . ASP C 3 45  ? -96.316  -16.966 -47.356 1.00 30.00  ? 48  ASP Z CA  1  
ATOM 7659   C C   . ASP C 3 45  ? -96.696  -18.283 -48.045 1.00 30.00  ? 48  ASP Z C   1  
ATOM 7660   O O   . ASP C 3 45  ? -95.864  -18.915 -48.701 1.00 30.00  ? 48  ASP Z O   1  
ATOM 7661   C CB  . ASP C 3 45  ? -96.486  -17.165 -45.852 1.00 99.99  ? 48  ASP Z CB  1  
ATOM 7662   C CG  . ASP C 3 45  ? -95.452  -18.171 -45.351 1.00 99.99  ? 48  ASP Z CG  1  
ATOM 7663   O OD1 . ASP C 3 45  ? -95.701  -19.394 -45.531 1.00 99.99  ? 48  ASP Z OD1 1  
ATOM 7664   O OD2 . ASP C 3 45  ? -94.423  -17.707 -44.792 1.00 99.99  ? 48  ASP Z OD2 1  
ATOM 7665   N N   . VAL C 3 46  ? -97.951  -18.688 -47.878 1.00 30.00  ? 49  VAL Z N   1  
ATOM 7666   C CA  . VAL C 3 46  ? -98.456  -19.935 -48.452 1.00 30.00  ? 49  VAL Z CA  1  
ATOM 7667   C C   . VAL C 3 46  ? -98.255  -20.114 -49.953 1.00 30.00  ? 49  VAL Z C   1  
ATOM 7668   O O   . VAL C 3 46  ? -97.718  -21.141 -50.378 1.00 30.00  ? 49  VAL Z O   1  
ATOM 7669   C CB  . VAL C 3 46  ? -99.959  -20.042 -48.221 1.00 99.99  ? 49  VAL Z CB  1  
ATOM 7670   C CG1 . VAL C 3 46  ? -100.243 -20.029 -46.721 1.00 99.99  ? 49  VAL Z CG1 1  
ATOM 7671   C CG2 . VAL C 3 46  ? -100.665 -18.865 -48.883 1.00 99.99  ? 49  VAL Z CG2 1  
ATOM 7672   N N   . PHE C 3 47  ? -98.670  -19.128 -50.747 1.00 30.00  ? 50  PHE Z N   1  
ATOM 7673   C CA  . PHE C 3 47  ? -98.519  -19.209 -52.196 1.00 30.00  ? 50  PHE Z CA  1  
ATOM 7674   C C   . PHE C 3 47  ? -97.053  -19.459 -52.529 1.00 30.00  ? 50  PHE Z C   1  
ATOM 7675   O O   . PHE C 3 47  ? -96.729  -20.194 -53.451 1.00 30.00  ? 50  PHE Z O   1  
ATOM 7676   C CB  . PHE C 3 47  ? -98.974  -17.902 -52.838 1.00 99.99  ? 50  PHE Z CB  1  
ATOM 7677   C CG  . PHE C 3 47  ? -98.818  -17.996 -54.336 1.00 99.99  ? 50  PHE Z CG  1  
ATOM 7678   C CD1 . PHE C 3 47  ? -99.812  -18.607 -55.108 1.00 99.99  ? 50  PHE Z CD1 1  
ATOM 7679   C CD2 . PHE C 3 47  ? -97.680  -17.468 -54.956 1.00 99.99  ? 50  PHE Z CD2 1  
ATOM 7680   C CE1 . PHE C 3 47  ? -99.667  -18.695 -56.498 1.00 99.99  ? 50  PHE Z CE1 1  
ATOM 7681   C CE2 . PHE C 3 47  ? -97.536  -17.554 -56.346 1.00 99.99  ? 50  PHE Z CE2 1  
ATOM 7682   C CZ  . PHE C 3 47  ? -98.530  -18.166 -57.115 1.00 99.99  ? 50  PHE Z CZ  1  
ATOM 7683   N N   . ALA C 3 48  ? -96.167  -18.847 -51.762 1.00 30.00  ? 51  ALA Z N   1  
ATOM 7684   C CA  . ALA C 3 48  ? -94.736  -19.006 -51.983 1.00 30.00  ? 51  ALA Z CA  1  
ATOM 7685   C C   . ALA C 3 48  ? -94.293  -20.465 -52.024 1.00 30.00  ? 51  ALA Z C   1  
ATOM 7686   O O   . ALA C 3 48  ? -93.386  -20.826 -52.770 1.00 30.00  ? 51  ALA Z O   1  
ATOM 7687   C CB  . ALA C 3 48  ? -93.970  -18.275 -50.896 1.00 30.00  ? 51  ALA Z CB  1  
ATOM 7688   N N   . VAL C 3 49  ? -94.937  -21.309 -51.220 1.00 30.00  ? 52  VAL Z N   1  
ATOM 7689   C CA  . VAL C 3 49  ? -94.561  -22.723 -51.185 1.00 30.00  ? 52  VAL Z CA  1  
ATOM 7690   C C   . VAL C 3 49  ? -95.347  -23.629 -52.138 1.00 30.00  ? 52  VAL Z C   1  
ATOM 7691   O O   . VAL C 3 49  ? -94.853  -24.697 -52.517 1.00 30.00  ? 52  VAL Z O   1  
ATOM 7692   C CB  . VAL C 3 49  ? -94.781  -23.282 -49.784 1.00 99.99  ? 52  VAL Z CB  1  
ATOM 7693   C CG1 . VAL C 3 49  ? -93.919  -22.509 -48.787 1.00 99.99  ? 52  VAL Z CG1 1  
ATOM 7694   C CG2 . VAL C 3 49  ? -96.249  -23.141 -49.402 1.00 99.99  ? 52  VAL Z CG2 1  
ATOM 7695   N N   . GLY C 3 50  ? -96.549  -23.217 -52.532 1.00 30.00  ? 53  GLY Z N   1  
ATOM 7696   C CA  . GLY C 3 50  ? -97.329  -24.034 -53.443 1.00 30.00  ? 53  GLY Z CA  1  
ATOM 7697   C C   . GLY C 3 50  ? -98.824  -23.798 -53.419 1.00 30.00  ? 53  GLY Z C   1  
ATOM 7698   O O   . GLY C 3 50  ? -99.530  -24.263 -54.312 1.00 30.00  ? 53  GLY Z O   1  
ATOM 7699   N N   . GLY C 3 51  ? -99.316  -23.077 -52.413 1.00 30.00  ? 54  GLY Z N   1  
ATOM 7700   C CA  . GLY C 3 51  ? -100.743 -22.808 -52.316 1.00 30.00  ? 54  GLY Z CA  1  
ATOM 7701   C C   . GLY C 3 51  ? -101.355 -22.248 -53.587 1.00 30.00  ? 54  GLY Z C   1  
ATOM 7702   O O   . GLY C 3 51  ? -100.637 -21.784 -54.479 1.00 30.00  ? 54  GLY Z O   1  
ATOM 7703   N N   . THR C 3 52  ? -102.680 -22.292 -53.684 1.00 30.00  ? 55  THR Z N   1  
ATOM 7704   C CA  . THR C 3 52  ? -103.365 -21.773 -54.859 1.00 30.00  ? 55  THR Z CA  1  
ATOM 7705   C C   . THR C 3 52  ? -104.539 -20.905 -54.436 1.00 30.00  ? 55  THR Z C   1  
ATOM 7706   O O   . THR C 3 52  ? -105.052 -21.033 -53.319 1.00 30.00  ? 55  THR Z O   1  
ATOM 7707   C CB  . THR C 3 52  ? -103.878 -22.929 -55.709 1.00 99.99  ? 55  THR Z CB  1  
ATOM 7708   O OG1 . THR C 3 52  ? -104.927 -23.608 -55.011 1.00 99.99  ? 55  THR Z OG1 1  
ATOM 7709   C CG2 . THR C 3 52  ? -102.741 -23.904 -55.985 1.00 99.99  ? 55  THR Z CG2 1  
ATOM 7710   N N   . HIS C 3 53  ? -104.952 -20.018 -55.338 1.00 30.00  ? 56  HIS Z N   1  
ATOM 7711   C CA  . HIS C 3 53  ? -106.063 -19.102 -55.091 1.00 30.00  ? 56  HIS Z CA  1  
ATOM 7712   C C   . HIS C 3 53  ? -107.424 -19.789 -55.112 1.00 30.00  ? 56  HIS Z C   1  
ATOM 7713   O O   . HIS C 3 53  ? -108.350 -19.348 -54.428 1.00 30.00  ? 56  HIS Z O   1  
ATOM 7714   C CB  . HIS C 3 53  ? -106.081 -18.013 -56.157 1.00 99.99  ? 56  HIS Z CB  1  
ATOM 7715   C CG  . HIS C 3 53  ? -107.314 -17.140 -56.154 1.00 99.99  ? 56  HIS Z CG  1  
ATOM 7716   N ND1 . HIS C 3 53  ? -107.233 -15.754 -56.104 1.00 99.99  ? 56  HIS Z ND1 1  
ATOM 7717   C CD2 . HIS C 3 53  ? -108.638 -17.453 -56.198 1.00 99.99  ? 56  HIS Z CD2 1  
ATOM 7718   C CE1 . HIS C 3 53  ? -108.466 -15.273 -56.117 1.00 99.99  ? 56  HIS Z CE1 1  
ATOM 7719   N NE2 . HIS C 3 53  ? -109.310 -16.269 -56.172 1.00 99.99  ? 56  HIS Z NE2 1  
ATOM 7720   N N   . LYS C 3 54  ? -107.550 -20.859 -55.897 1.00 30.00  ? 57  LYS Z N   1  
ATOM 7721   C CA  . LYS C 3 54  ? -108.823 -21.577 -56.002 1.00 30.00  ? 57  LYS Z CA  1  
ATOM 7722   C C   . LYS C 3 54  ? -108.731 -23.088 -55.862 1.00 30.00  ? 57  LYS Z C   1  
ATOM 7723   O O   . LYS C 3 54  ? -107.653 -23.693 -55.981 1.00 30.00  ? 57  LYS Z O   1  
ATOM 7724   C CB  . LYS C 3 54  ? -109.455 -21.311 -57.365 1.00 99.99  ? 57  LYS Z CB  1  
ATOM 7725   C CG  . LYS C 3 54  ? -110.821 -21.982 -57.429 1.00 99.99  ? 57  LYS Z CG  1  
ATOM 7726   C CD  . LYS C 3 54  ? -111.635 -21.370 -58.567 1.00 99.99  ? 57  LYS Z CD  1  
ATOM 7727   C CE  . LYS C 3 54  ? -112.830 -22.266 -58.873 1.00 99.99  ? 57  LYS Z CE  1  
ATOM 7728   N NZ  . LYS C 3 54  ? -114.004 -21.795 -58.125 1.00 99.99  ? 57  LYS Z NZ  1  
ATOM 7729   N N   . MET C 3 55  ? -109.894 -23.689 -55.614 1.00 30.00  ? 58  MET Z N   1  
ATOM 7730   C CA  . MET C 3 55  ? -110.006 -25.128 -55.479 1.00 30.00  ? 58  MET Z CA  1  
ATOM 7731   C C   . MET C 3 55  ? -109.773 -25.654 -56.895 1.00 30.00  ? 58  MET Z C   1  
ATOM 7732   O O   . MET C 3 55  ? -109.484 -24.877 -57.802 1.00 30.00  ? 58  MET Z O   1  
ATOM 7733   C CB  . MET C 3 55  ? -111.393 -25.494 -54.957 1.00 99.99  ? 58  MET Z CB  1  
ATOM 7734   C CG  . MET C 3 55  ? -111.478 -27.002 -54.749 1.00 99.99  ? 58  MET Z CG  1  
ATOM 7735   S SD  . MET C 3 55  ? -112.983 -27.417 -53.835 1.00 99.99  ? 58  MET Z SD  1  
ATOM 7736   C CE  . MET C 3 55  ? -112.858 -29.192 -53.824 1.00 99.99  ? 58  MET Z CE  1  
ATOM 7737   N N   . GLY C 3 56  ? -109.890 -26.960 -57.090 1.00 30.00  ? 59  GLY Z N   1  
ATOM 7738   C CA  . GLY C 3 56  ? -109.692 -27.522 -58.413 1.00 30.00  ? 59  GLY Z CA  1  
ATOM 7739   C C   . GLY C 3 56  ? -108.349 -27.266 -59.069 1.00 30.00  ? 59  GLY Z C   1  
ATOM 7740   O O   . GLY C 3 56  ? -107.776 -28.163 -59.681 1.00 30.00  ? 59  GLY Z O   1  
ATOM 7741   N N   . GLU C 3 57  ? -107.845 -26.049 -58.946 1.00 30.00  ? 60  GLU Z N   1  
ATOM 7742   C CA  . GLU C 3 57  ? -106.561 -25.674 -59.527 1.00 30.00  ? 60  GLU Z CA  1  
ATOM 7743   C C   . GLU C 3 57  ? -105.566 -26.820 -59.516 1.00 30.00  ? 60  GLU Z C   1  
ATOM 7744   O O   . GLU C 3 57  ? -104.897 -27.073 -60.515 1.00 30.00  ? 60  GLU Z O   1  
ATOM 7745   C CB  . GLU C 3 57  ? -105.953 -24.517 -58.743 1.00 99.99  ? 60  GLU Z CB  1  
ATOM 7746   C CG  . GLU C 3 57  ? -106.828 -23.294 -58.886 1.00 99.99  ? 60  GLU Z CG  1  
ATOM 7747   C CD  . GLU C 3 57  ? -106.691 -22.735 -60.300 1.00 99.99  ? 60  GLU Z CD  1  
ATOM 7748   O OE1 . GLU C 3 57  ? -107.489 -23.171 -61.170 1.00 99.99  ? 60  GLU Z OE1 1  
ATOM 7749   O OE2 . GLU C 3 57  ? -105.791 -21.875 -60.492 1.00 99.99  ? 60  GLU Z OE2 1  
ATOM 7750   N N   . LYS C 3 58  ? -105.466 -27.508 -58.386 1.00 30.00  ? 61  LYS Z N   1  
ATOM 7751   C CA  . LYS C 3 58  ? -104.541 -28.634 -58.268 1.00 30.00  ? 61  LYS Z CA  1  
ATOM 7752   C C   . LYS C 3 58  ? -104.572 -29.309 -56.894 1.00 30.00  ? 61  LYS Z C   1  
ATOM 7753   O O   . LYS C 3 58  ? -104.903 -28.676 -55.883 1.00 30.00  ? 61  LYS Z O   1  
ATOM 7754   C CB  . LYS C 3 58  ? -103.112 -28.155 -58.504 1.00 99.99  ? 61  LYS Z CB  1  
ATOM 7755   C CG  . LYS C 3 58  ? -102.163 -29.348 -58.479 1.00 99.99  ? 61  LYS Z CG  1  
ATOM 7756   C CD  . LYS C 3 58  ? -100.844 -28.966 -59.139 1.00 99.99  ? 61  LYS Z CD  1  
ATOM 7757   C CE  . LYS C 3 58  ? -99.782  -30.003 -58.791 1.00 99.99  ? 61  LYS Z CE  1  
ATOM 7758   N NZ  . LYS C 3 58  ? -99.724  -31.022 -59.851 1.00 99.99  ? 61  LYS Z NZ  1  
ATOM 7759   N N   . SER C 3 59  ? -104.228 -30.600 -56.873 1.00 30.00  ? 62  SER Z N   1  
ATOM 7760   C CA  . SER C 3 59  ? -104.200 -31.402 -55.647 1.00 30.00  ? 62  SER Z CA  1  
ATOM 7761   C C   . SER C 3 59  ? -102.766 -31.840 -55.365 1.00 30.00  ? 62  SER Z C   1  
ATOM 7762   O O   . SER C 3 59  ? -101.929 -31.880 -56.274 1.00 30.00  ? 62  SER Z O   1  
ATOM 7763   C CB  . SER C 3 59  ? -105.085 -32.635 -55.816 1.00 99.99  ? 62  SER Z CB  1  
ATOM 7764   O OG  . SER C 3 59  ? -105.071 -33.398 -54.609 1.00 99.99  ? 62  SER Z OG  1  
ATOM 7765   N N   . LEU C 3 60  ? -102.490 -32.176 -54.108 1.00 30.00  ? 63  LEU Z N   1  
ATOM 7766   C CA  . LEU C 3 60  ? -101.144 -32.588 -53.730 1.00 30.00  ? 63  LEU Z CA  1  
ATOM 7767   C C   . LEU C 3 60  ? -101.042 -33.793 -52.796 1.00 30.00  ? 63  LEU Z C   1  
ATOM 7768   O O   . LEU C 3 60  ? -101.912 -34.015 -51.953 1.00 30.00  ? 63  LEU Z O   1  
ATOM 7769   C CB  . LEU C 3 60  ? -100.435 -31.445 -53.009 1.00 99.99  ? 63  LEU Z CB  1  
ATOM 7770   C CG  . LEU C 3 60  ? -99.603  -30.651 -54.010 1.00 99.99  ? 63  LEU Z CG  1  
ATOM 7771   C CD1 . LEU C 3 60  ? -98.650  -29.728 -53.258 1.00 99.99  ? 63  LEU Z CD1 1  
ATOM 7772   C CD2 . LEU C 3 60  ? -98.803  -31.608 -54.883 1.00 99.99  ? 63  LEU Z CD2 1  
ATOM 7773   N N   . PRO C 3 61  ? -99.966  -34.593 -52.945 1.00 30.00  ? 64  PRO Z N   1  
ATOM 7774   C CA  . PRO C 3 61  ? -99.741  -35.782 -52.116 1.00 30.00  ? 64  PRO Z CA  1  
ATOM 7775   C C   . PRO C 3 61  ? -99.121  -35.383 -50.786 1.00 30.00  ? 64  PRO Z C   1  
ATOM 7776   O O   . PRO C 3 61  ? -98.998  -34.200 -50.482 1.00 30.00  ? 64  PRO Z O   1  
ATOM 7777   C CB  . PRO C 3 61  ? -98.789  -36.489 -53.016 1.00 99.99  ? 64  PRO Z CB  1  
ATOM 7778   C CG  . PRO C 3 61  ? -98.657  -35.629 -54.249 1.00 99.99  ? 64  PRO Z CG  1  
ATOM 7779   C CD  . PRO C 3 61  ? -99.374  -34.573 -54.215 1.00 99.99  ? 64  PRO Z CD  1  
ATOM 7780   N N   . PHE C 3 62  ? -98.727  -36.368 -49.993 1.00 30.00  ? 65  PHE Z N   1  
ATOM 7781   C CA  . PHE C 3 62  ? -98.116  -36.095 -48.709 1.00 30.00  ? 65  PHE Z CA  1  
ATOM 7782   C C   . PHE C 3 62  ? -96.627  -35.962 -48.983 1.00 30.00  ? 65  PHE Z C   1  
ATOM 7783   O O   . PHE C 3 62  ? -95.887  -35.377 -48.200 1.00 30.00  ? 65  PHE Z O   1  
ATOM 7784   C CB  . PHE C 3 62  ? -98.400  -37.243 -47.744 1.00 99.99  ? 65  PHE Z CB  1  
ATOM 7785   C CG  . PHE C 3 62  ? -97.762  -36.949 -46.409 1.00 99.99  ? 65  PHE Z CG  1  
ATOM 7786   C CD1 . PHE C 3 62  ? -98.419  -36.133 -45.480 1.00 99.99  ? 65  PHE Z CD1 1  
ATOM 7787   C CD2 . PHE C 3 62  ? -96.509  -37.491 -46.097 1.00 99.99  ? 65  PHE Z CD2 1  
ATOM 7788   C CE1 . PHE C 3 62  ? -97.829  -35.862 -44.243 1.00 99.99  ? 65  PHE Z CE1 1  
ATOM 7789   C CE2 . PHE C 3 62  ? -95.917  -37.218 -44.859 1.00 99.99  ? 65  PHE Z CE2 1  
ATOM 7790   C CZ  . PHE C 3 62  ? -96.576  -36.403 -43.932 1.00 99.99  ? 65  PHE Z CZ  1  
ATOM 7791   N N   . GLU C 3 63  ? -96.184  -36.498 -50.110 1.00 30.00  ? 66  GLU Z N   1  
ATOM 7792   C CA  . GLU C 3 63  ? -94.775  -36.429 -50.468 1.00 30.00  ? 66  GLU Z CA  1  
ATOM 7793   C C   . GLU C 3 63  ? -94.324  -34.984 -50.721 1.00 30.00  ? 66  GLU Z C   1  
ATOM 7794   O O   . GLU C 3 63  ? -93.257  -34.565 -50.262 1.00 30.00  ? 66  GLU Z O   1  
ATOM 7795   C CB  . GLU C 3 63  ? -94.524  -37.236 -51.738 1.00 99.99  ? 66  GLU Z CB  1  
ATOM 7796   C CG  . GLU C 3 63  ? -94.796  -38.697 -51.471 1.00 99.99  ? 66  GLU Z CG  1  
ATOM 7797   C CD  . GLU C 3 63  ? -93.689  -39.270 -50.592 1.00 99.99  ? 66  GLU Z CD  1  
ATOM 7798   O OE1 . GLU C 3 63  ? -93.854  -39.210 -49.345 1.00 99.99  ? 66  GLU Z OE1 1  
ATOM 7799   O OE2 . GLU C 3 63  ? -92.683  -39.761 -51.175 1.00 99.99  ? 66  GLU Z OE2 1  
ATOM 7800   N N   . GLU C 3 64  ? -95.144  -34.227 -51.447 1.00 30.00  ? 67  GLU Z N   1  
ATOM 7801   C CA  . GLU C 3 64  ? -94.835  -32.837 -51.768 1.00 30.00  ? 67  GLU Z CA  1  
ATOM 7802   C C   . GLU C 3 64  ? -95.201  -31.922 -50.605 1.00 30.00  ? 67  GLU Z C   1  
ATOM 7803   O O   . GLU C 3 64  ? -94.684  -30.814 -50.467 1.00 30.00  ? 67  GLU Z O   1  
ATOM 7804   C CB  . GLU C 3 64  ? -95.621  -32.400 -52.998 1.00 99.99  ? 67  GLU Z CB  1  
ATOM 7805   C CG  . GLU C 3 64  ? -95.163  -33.195 -54.197 1.00 99.99  ? 67  GLU Z CG  1  
ATOM 7806   C CD  . GLU C 3 64  ? -93.771  -32.730 -54.615 1.00 99.99  ? 67  GLU Z CD  1  
ATOM 7807   O OE1 . GLU C 3 64  ? -92.787  -33.318 -54.092 1.00 99.99  ? 67  GLU Z OE1 1  
ATOM 7808   O OE2 . GLU C 3 64  ? -93.705  -31.793 -55.454 1.00 99.99  ? 67  GLU Z OE2 1  
ATOM 7809   N N   . PHE C 3 65  ? -96.101  -32.397 -49.761 1.00 30.00  ? 68  PHE Z N   1  
ATOM 7810   C CA  . PHE C 3 65  ? -96.560  -31.651 -48.601 1.00 30.00  ? 68  PHE Z CA  1  
ATOM 7811   C C   . PHE C 3 65  ? -95.519  -31.412 -47.509 1.00 30.00  ? 68  PHE Z C   1  
ATOM 7812   O O   . PHE C 3 65  ? -95.484  -30.353 -46.894 1.00 30.00  ? 68  PHE Z O   1  
ATOM 7813   C CB  . PHE C 3 65  ? -97.711  -32.393 -47.931 1.00 99.99  ? 68  PHE Z CB  1  
ATOM 7814   C CG  . PHE C 3 65  ? -98.186  -31.611 -46.728 1.00 99.99  ? 68  PHE Z CG  1  
ATOM 7815   C CD1 . PHE C 3 65  ? -99.089  -30.555 -46.892 1.00 99.99  ? 68  PHE Z CD1 1  
ATOM 7816   C CD2 . PHE C 3 65  ? -97.722  -31.943 -45.451 1.00 99.99  ? 68  PHE Z CD2 1  
ATOM 7817   C CE1 . PHE C 3 65  ? -99.528  -29.829 -45.778 1.00 99.99  ? 68  PHE Z CE1 1  
ATOM 7818   C CE2 . PHE C 3 65  ? -98.160  -31.219 -44.336 1.00 99.99  ? 68  PHE Z CE2 1  
ATOM 7819   C CZ  . PHE C 3 65  ? -99.063  -30.161 -44.500 1.00 99.99  ? 68  PHE Z CZ  1  
ATOM 7820   N N   . LEU C 3 66  ? -94.683  -32.407 -47.262 1.00 30.00  ? 69  LEU Z N   1  
ATOM 7821   C CA  . LEU C 3 66  ? -93.647  -32.315 -46.235 1.00 30.00  ? 69  LEU Z CA  1  
ATOM 7822   C C   . LEU C 3 66  ? -92.816  -31.032 -46.291 1.00 30.00  ? 69  LEU Z C   1  
ATOM 7823   O O   . LEU C 3 66  ? -92.606  -30.379 -45.266 1.00 30.00  ? 69  LEU Z O   1  
ATOM 7824   C CB  . LEU C 3 66  ? -92.674  -33.478 -46.376 1.00 99.99  ? 69  LEU Z CB  1  
ATOM 7825   C CG  . LEU C 3 66  ? -93.095  -34.610 -45.448 1.00 99.99  ? 69  LEU Z CG  1  
ATOM 7826   C CD1 . LEU C 3 66  ? -91.961  -35.626 -45.334 1.00 99.99  ? 69  LEU Z CD1 1  
ATOM 7827   C CD2 . LEU C 3 66  ? -93.409  -34.046 -44.065 1.00 99.99  ? 69  LEU Z CD2 1  
ATOM 7828   N N   . PRO C 3 67  ? -92.324  -30.655 -47.485 1.00 30.00  ? 70  PRO Z N   1  
ATOM 7829   C CA  . PRO C 3 67  ? -91.513  -29.443 -47.644 1.00 30.00  ? 70  PRO Z CA  1  
ATOM 7830   C C   . PRO C 3 67  ? -92.282  -28.117 -47.574 1.00 30.00  ? 70  PRO Z C   1  
ATOM 7831   O O   . PRO C 3 67  ? -91.703  -27.060 -47.299 1.00 30.00  ? 70  PRO Z O   1  
ATOM 7832   C CB  . PRO C 3 67  ? -91.004  -29.703 -49.018 1.00 99.99  ? 70  PRO Z CB  1  
ATOM 7833   C CG  . PRO C 3 67  ? -91.558  -31.050 -49.421 1.00 99.99  ? 70  PRO Z CG  1  
ATOM 7834   C CD  . PRO C 3 67  ? -92.268  -31.603 -48.516 1.00 99.99  ? 70  PRO Z CD  1  
ATOM 7835   N N   . ALA C 3 68  ? -93.590  -28.165 -47.829 1.00 30.00  ? 71  ALA Z N   1  
ATOM 7836   C CA  . ALA C 3 68  ? -94.395  -26.954 -47.766 1.00 30.00  ? 71  ALA Z CA  1  
ATOM 7837   C C   . ALA C 3 68  ? -94.436  -26.570 -46.296 1.00 30.00  ? 71  ALA Z C   1  
ATOM 7838   O O   . ALA C 3 68  ? -94.419  -25.387 -45.949 1.00 30.00  ? 71  ALA Z O   1  
ATOM 7839   C CB  . ALA C 3 68  ? -95.802  -27.228 -48.278 1.00 30.00  ? 71  ALA Z CB  1  
ATOM 7840   N N   . TYR C 3 69  ? -94.485  -27.585 -45.438 1.00 30.00  ? 72  TYR Z N   1  
ATOM 7841   C CA  . TYR C 3 69  ? -94.517  -27.377 -43.999 1.00 30.00  ? 72  TYR Z CA  1  
ATOM 7842   C C   . TYR C 3 69  ? -93.111  -27.121 -43.473 1.00 30.00  ? 72  TYR Z C   1  
ATOM 7843   O O   . TYR C 3 69  ? -92.939  -26.513 -42.427 1.00 30.00  ? 72  TYR Z O   1  
ATOM 7844   C CB  . TYR C 3 69  ? -95.082  -28.613 -43.307 1.00 99.99  ? 72  TYR Z CB  1  
ATOM 7845   C CG  . TYR C 3 69  ? -95.111  -28.389 -41.817 1.00 99.99  ? 72  TYR Z CG  1  
ATOM 7846   C CD1 . TYR C 3 69  ? -96.177  -27.693 -41.233 1.00 99.99  ? 72  TYR Z CD1 1  
ATOM 7847   C CD2 . TYR C 3 69  ? -94.071  -28.878 -41.014 1.00 99.99  ? 72  TYR Z CD2 1  
ATOM 7848   C CE1 . TYR C 3 69  ? -96.203  -27.485 -39.850 1.00 99.99  ? 72  TYR Z CE1 1  
ATOM 7849   C CE2 . TYR C 3 69  ? -94.098  -28.670 -39.630 1.00 99.99  ? 72  TYR Z CE2 1  
ATOM 7850   C CZ  . TYR C 3 69  ? -95.165  -27.975 -39.048 1.00 99.99  ? 72  TYR Z CZ  1  
ATOM 7851   O OH  . TYR C 3 69  ? -95.189  -27.770 -37.702 1.00 99.99  ? 72  TYR Z OH  1  
ATOM 7852   N N   . GLU C 3 70  ? -92.107  -27.606 -44.191 1.00 30.00  ? 73  GLU Z N   1  
ATOM 7853   C CA  . GLU C 3 70  ? -90.737  -27.379 -43.768 1.00 30.00  ? 73  GLU Z CA  1  
ATOM 7854   C C   . GLU C 3 70  ? -90.573  -25.896 -44.047 1.00 30.00  ? 73  GLU Z C   1  
ATOM 7855   O O   . GLU C 3 70  ? -89.977  -25.157 -43.263 1.00 30.00  ? 73  GLU Z O   1  
ATOM 7856   C CB  . GLU C 3 70  ? -89.791  -28.253 -44.584 1.00 99.99  ? 73  GLU Z CB  1  
ATOM 7857   C CG  . GLU C 3 70  ? -90.065  -29.708 -44.289 1.00 99.99  ? 73  GLU Z CG  1  
ATOM 7858   C CD  . GLU C 3 70  ? -89.565  -30.046 -42.887 1.00 99.99  ? 73  GLU Z CD  1  
ATOM 7859   O OE1 . GLU C 3 70  ? -90.375  -29.898 -41.935 1.00 99.99  ? 73  GLU Z OE1 1  
ATOM 7860   O OE2 . GLU C 3 70  ? -88.376  -30.450 -42.780 1.00 99.99  ? 73  GLU Z OE2 1  
ATOM 7861   N N   . GLY C 3 71  ? -91.130  -25.480 -45.182 1.00 30.00  ? 74  GLY Z N   1  
ATOM 7862   C CA  . GLY C 3 71  ? -91.071  -24.088 -45.587 1.00 30.00  ? 74  GLY Z CA  1  
ATOM 7863   C C   . GLY C 3 71  ? -91.784  -23.165 -44.614 1.00 30.00  ? 74  GLY Z C   1  
ATOM 7864   O O   . GLY C 3 71  ? -91.134  -22.355 -43.949 1.00 30.00  ? 74  GLY Z O   1  
ATOM 7865   N N   . LEU C 3 72  ? -93.108  -23.286 -44.521 1.00 30.00  ? 75  LEU Z N   1  
ATOM 7866   C CA  . LEU C 3 72  ? -93.913  -22.447 -43.626 1.00 30.00  ? 75  LEU Z CA  1  
ATOM 7867   C C   . LEU C 3 72  ? -93.542  -22.493 -42.148 1.00 30.00  ? 75  LEU Z C   1  
ATOM 7868   O O   . LEU C 3 72  ? -94.304  -22.028 -41.300 1.00 30.00  ? 75  LEU Z O   1  
ATOM 7869   C CB  . LEU C 3 72  ? -95.378  -22.870 -43.703 1.00 99.99  ? 75  LEU Z CB  1  
ATOM 7870   C CG  . LEU C 3 72  ? -96.189  -22.078 -42.682 1.00 99.99  ? 75  LEU Z CG  1  
ATOM 7871   C CD1 . LEU C 3 72  ? -97.641  -22.551 -42.709 1.00 99.99  ? 75  LEU Z CD1 1  
ATOM 7872   C CD2 . LEU C 3 72  ? -95.606  -22.293 -41.291 1.00 99.99  ? 75  LEU Z CD2 1  
ATOM 7873   N N   . MET C 3 73  ? -92.383  -23.059 -41.839 1.00 30.00  ? 76  MET Z N   1  
ATOM 7874   C CA  . MET C 3 73  ? -91.925  -23.145 -40.463 1.00 30.00  ? 76  MET Z CA  1  
ATOM 7875   C C   . MET C 3 73  ? -90.900  -22.042 -40.247 1.00 30.00  ? 76  MET Z C   1  
ATOM 7876   O O   . MET C 3 73  ? -90.976  -21.279 -39.282 1.00 30.00  ? 76  MET Z O   1  
ATOM 7877   C CB  . MET C 3 73  ? -91.292  -24.509 -40.214 1.00 99.99  ? 76  MET Z CB  1  
ATOM 7878   C CG  . MET C 3 73  ? -90.881  -24.618 -38.749 1.00 99.99  ? 76  MET Z CG  1  
ATOM 7879   S SD  . MET C 3 73  ? -90.429  -26.326 -38.358 1.00 99.99  ? 76  MET Z SD  1  
ATOM 7880   C CE  . MET C 3 73  ? -89.923  -26.133 -36.662 1.00 99.99  ? 76  MET Z CE  1  
ATOM 7881   N N   . ASP C 3 74  ? -89.952  -21.961 -41.169 1.00 30.00  ? 77  ASP Z N   1  
ATOM 7882   C CA  . ASP C 3 74  ? -88.898  -20.966 -41.111 1.00 30.00  ? 77  ASP Z CA  1  
ATOM 7883   C C   . ASP C 3 74  ? -89.403  -19.537 -41.319 1.00 30.00  ? 77  ASP Z C   1  
ATOM 7884   O O   . ASP C 3 74  ? -88.614  -18.590 -41.253 1.00 30.00  ? 77  ASP Z O   1  
ATOM 7885   C CB  . ASP C 3 74  ? -87.861  -21.243 -42.194 1.00 99.99  ? 77  ASP Z CB  1  
ATOM 7886   C CG  . ASP C 3 74  ? -87.117  -22.538 -41.868 1.00 99.99  ? 77  ASP Z CG  1  
ATOM 7887   O OD1 . ASP C 3 74  ? -86.304  -22.506 -40.908 1.00 99.99  ? 77  ASP Z OD1 1  
ATOM 7888   O OD2 . ASP C 3 74  ? -87.372  -23.544 -42.584 1.00 99.99  ? 77  ASP Z OD2 1  
ATOM 7889   N N   . CYS C 3 75  ? -90.707  -19.365 -41.562 1.00 30.00  ? 78  CYS Z N   1  
ATOM 7890   C CA  . CYS C 3 75  ? -91.269  -18.032 -41.779 1.00 30.00  ? 78  CYS Z CA  1  
ATOM 7891   C C   . CYS C 3 75  ? -91.698  -17.329 -40.481 1.00 30.00  ? 78  CYS Z C   1  
ATOM 7892   O O   . CYS C 3 75  ? -92.257  -17.936 -39.565 1.00 30.00  ? 78  CYS Z O   1  
ATOM 7893   C CB  . CYS C 3 75  ? -92.505  -18.127 -42.667 1.00 99.99  ? 78  CYS Z CB  1  
ATOM 7894   S SG  . CYS C 3 75  ? -93.926  -18.999 -41.965 1.00 99.99  ? 78  CYS Z SG  1  
ATOM 7895   N N   . GLU C 3 76  ? -91.415  -16.030 -40.427 1.00 30.00  ? 79  GLU Z N   1  
ATOM 7896   C CA  . GLU C 3 76  ? -91.706  -15.175 -39.280 1.00 30.00  ? 79  GLU Z CA  1  
ATOM 7897   C C   . GLU C 3 76  ? -93.108  -15.170 -38.703 1.00 30.00  ? 79  GLU Z C   1  
ATOM 7898   O O   . GLU C 3 76  ? -94.093  -15.082 -39.441 1.00 30.00  ? 79  GLU Z O   1  
ATOM 7899   C CB  . GLU C 3 76  ? -91.440  -13.718 -39.643 1.00 99.99  ? 79  GLU Z CB  1  
ATOM 7900   C CG  . GLU C 3 76  ? -92.268  -13.338 -40.846 1.00 99.99  ? 79  GLU Z CG  1  
ATOM 7901   C CD  . GLU C 3 76  ? -91.609  -13.888 -42.111 1.00 99.99  ? 79  GLU Z CD  1  
ATOM 7902   O OE1 . GLU C 3 76  ? -91.947  -15.041 -42.482 1.00 99.99  ? 79  GLU Z OE1 1  
ATOM 7903   O OE2 . GLU C 3 76  ? -90.771  -13.145 -42.692 1.00 99.99  ? 79  GLU Z OE2 1  
ATOM 7904   N N   . GLN C 3 77  ? -93.173  -15.247 -37.367 1.00 30.00  ? 80  GLN Z N   1  
ATOM 7905   C CA  . GLN C 3 77  ? -94.436  -15.223 -36.616 1.00 30.00  ? 80  GLN Z CA  1  
ATOM 7906   C C   . GLN C 3 77  ? -94.460  -13.912 -35.804 1.00 30.00  ? 80  GLN Z C   1  
ATOM 7907   O O   . GLN C 3 77  ? -93.435  -13.465 -35.287 1.00 30.00  ? 80  GLN Z O   1  
ATOM 7908   C CB  . GLN C 3 77  ? -94.510  -16.428 -35.685 1.00 99.99  ? 80  GLN Z CB  1  
ATOM 7909   C CG  . GLN C 3 77  ? -95.967  -16.742 -35.373 1.00 99.99  ? 80  GLN Z CG  1  
ATOM 7910   C CD  . GLN C 3 77  ? -96.477  -15.899 -34.215 1.00 99.99  ? 80  GLN Z CD  1  
ATOM 7911   O OE1 . GLN C 3 77  ? -95.733  -15.091 -33.658 1.00 99.99  ? 80  GLN Z OE1 1  
ATOM 7912   N NE2 . GLN C 3 77  ? -97.747  -16.087 -33.849 1.00 99.99  ? 80  GLN Z NE2 1  
ATOM 7913   N N   . GLY C 3 78  ? -95.622  -13.288 -35.685 1.00 30.00  ? 81  GLY Z N   1  
ATOM 7914   C CA  . GLY C 3 78  ? -95.684  -12.039 -34.947 1.00 30.00  ? 81  GLY Z CA  1  
ATOM 7915   C C   . GLY C 3 78  ? -95.743  -12.114 -33.437 1.00 30.00  ? 81  GLY Z C   1  
ATOM 7916   O O   . GLY C 3 78  ? -96.629  -12.756 -32.886 1.00 30.00  ? 81  GLY Z O   1  
ATOM 7917   N N   . THR C 3 79  ? -94.807  -11.456 -32.758 1.00 30.00  ? 82  THR Z N   1  
ATOM 7918   C CA  . THR C 3 79  ? -94.787  -11.456 -31.298 1.00 30.00  ? 82  THR Z CA  1  
ATOM 7919   C C   . THR C 3 79  ? -95.837  -10.502 -30.736 1.00 30.00  ? 82  THR Z C   1  
ATOM 7920   O O   . THR C 3 79  ? -96.540  -9.837  -31.488 1.00 30.00  ? 82  THR Z O   1  
ATOM 7921   C CB  . THR C 3 79  ? -93.416  -11.014 -30.797 1.00 99.99  ? 82  THR Z CB  1  
ATOM 7922   O OG1 . THR C 3 79  ? -93.215  -9.633  -31.115 1.00 99.99  ? 82  THR Z OG1 1  
ATOM 7923   C CG2 . THR C 3 79  ? -92.335  -11.854 -31.470 1.00 99.99  ? 82  THR Z CG2 1  
ATOM 7924   N N   . PHE C 3 80  ? -95.953  -10.437 -29.412 1.00 30.00  ? 83  PHE Z N   1  
ATOM 7925   C CA  . PHE C 3 80  ? -96.926  -9.552  -28.762 1.00 30.00  ? 83  PHE Z CA  1  
ATOM 7926   C C   . PHE C 3 80  ? -96.445  -8.108  -28.942 1.00 30.00  ? 83  PHE Z C   1  
ATOM 7927   O O   . PHE C 3 80  ? -97.240  -7.180  -29.113 1.00 30.00  ? 83  PHE Z O   1  
ATOM 7928   C CB  . PHE C 3 80  ? -97.023  -9.889  -27.276 1.00 99.99  ? 83  PHE Z CB  1  
ATOM 7929   C CG  . PHE C 3 80  ? -98.025  -8.975  -26.617 1.00 99.99  ? 83  PHE Z CG  1  
ATOM 7930   C CD1 . PHE C 3 80  ? -99.389  -9.276  -26.676 1.00 99.99  ? 83  PHE Z CD1 1  
ATOM 7931   C CD2 . PHE C 3 80  ? -97.589  -7.826  -25.945 1.00 99.99  ? 83  PHE Z CD2 1  
ATOM 7932   C CE1 . PHE C 3 80  ? -100.322 -8.427  -26.065 1.00 99.99  ? 83  PHE Z CE1 1  
ATOM 7933   C CE2 . PHE C 3 80  ? -98.520  -6.978  -25.333 1.00 99.99  ? 83  PHE Z CE2 1  
ATOM 7934   C CZ  . PHE C 3 80  ? -99.887  -7.278  -25.392 1.00 99.99  ? 83  PHE Z CZ  1  
ATOM 7935   N N   . ALA C 3 81  ? -95.125  -7.947  -28.886 1.00 30.00  ? 84  ALA Z N   1  
ATOM 7936   C CA  . ALA C 3 81  ? -94.480  -6.649  -29.048 1.00 30.00  ? 84  ALA Z CA  1  
ATOM 7937   C C   . ALA C 3 81  ? -94.965  -6.033  -30.353 1.00 30.00  ? 84  ALA Z C   1  
ATOM 7938   O O   . ALA C 3 81  ? -95.531  -4.933  -30.361 1.00 30.00  ? 84  ALA Z O   1  
ATOM 7939   C CB  . ALA C 3 81  ? -92.960  -6.818  -29.087 1.00 30.00  ? 84  ALA Z CB  1  
ATOM 7940   N N   . ASP C 3 82  ? -94.735  -6.763  -31.442 1.00 30.00  ? 85  ASP Z N   1  
ATOM 7941   C CA  . ASP C 3 82  ? -95.120  -6.331  -32.764 1.00 30.00  ? 85  ASP Z CA  1  
ATOM 7942   C C   . ASP C 3 82  ? -96.598  -5.971  -32.866 1.00 30.00  ? 85  ASP Z C   1  
ATOM 7943   O O   . ASP C 3 82  ? -96.937  -4.913  -33.383 1.00 30.00  ? 85  ASP Z O   1  
ATOM 7944   C CB  . ASP C 3 82  ? -94.849  -7.443  -33.773 1.00 99.99  ? 85  ASP Z CB  1  
ATOM 7945   C CG  . ASP C 3 82  ? -93.341  -7.647  -33.914 1.00 99.99  ? 85  ASP Z CG  1  
ATOM 7946   O OD1 . ASP C 3 82  ? -92.696  -6.752  -34.523 1.00 99.99  ? 85  ASP Z OD1 1  
ATOM 7947   O OD2 . ASP C 3 82  ? -92.851  -8.693  -33.413 1.00 99.99  ? 85  ASP Z OD2 1  
ATOM 7948   N N   . TYR C 3 83  ? -97.493  -6.825  -32.380 1.00 30.00  ? 86  TYR Z N   1  
ATOM 7949   C CA  . TYR C 3 83  ? -98.902  -6.479  -32.497 1.00 30.00  ? 86  TYR Z CA  1  
ATOM 7950   C C   . TYR C 3 83  ? -99.248  -5.272  -31.662 1.00 30.00  ? 86  TYR Z C   1  
ATOM 7951   O O   . TYR C 3 83  ? -100.158 -4.529  -32.006 1.00 30.00  ? 86  TYR Z O   1  
ATOM 7952   C CB  . TYR C 3 83  ? -99.761  -7.645  -32.030 1.00 99.99  ? 86  TYR Z CB  1  
ATOM 7953   C CG  . TYR C 3 83  ? -99.542  -8.830  -32.938 1.00 99.99  ? 86  TYR Z CG  1  
ATOM 7954   C CD1 . TYR C 3 83  ? -98.521  -9.745  -32.661 1.00 99.99  ? 86  TYR Z CD1 1  
ATOM 7955   C CD2 . TYR C 3 83  ? -100.360 -9.015  -34.062 1.00 99.99  ? 86  TYR Z CD2 1  
ATOM 7956   C CE1 . TYR C 3 83  ? -98.316  -10.847 -33.503 1.00 99.99  ? 86  TYR Z CE1 1  
ATOM 7957   C CE2 . TYR C 3 83  ? -100.156 -10.115 -34.904 1.00 99.99  ? 86  TYR Z CE2 1  
ATOM 7958   C CZ  . TYR C 3 83  ? -99.134  -11.029 -34.625 1.00 99.99  ? 86  TYR Z CZ  1  
ATOM 7959   O OH  . TYR C 3 83  ? -98.936  -12.096 -35.445 1.00 99.99  ? 86  TYR Z OH  1  
ATOM 7960   N N   . MET C 3 84  ? -98.528  -5.076  -30.564 1.00 30.00  ? 87  MET Z N   1  
ATOM 7961   C CA  . MET C 3 84  ? -98.775  -3.939  -29.679 1.00 30.00  ? 87  MET Z CA  1  
ATOM 7962   C C   . MET C 3 84  ? -98.264  -2.647  -30.346 1.00 30.00  ? 87  MET Z C   1  
ATOM 7963   O O   . MET C 3 84  ? -98.936  -1.605  -30.329 1.00 30.00  ? 87  MET Z O   1  
ATOM 7964   C CB  . MET C 3 84  ? -98.047  -4.146  -28.356 1.00 99.99  ? 87  MET Z CB  1  
ATOM 7965   C CG  . MET C 3 84  ? -98.364  -5.532  -27.810 1.00 99.99  ? 87  MET Z CG  1  
ATOM 7966   S SD  . MET C 3 84  ? -99.981  -5.525  -27.000 1.00 99.99  ? 87  MET Z SD  1  
ATOM 7967   C CE  . MET C 3 84  ? -99.563  -4.700  -25.479 1.00 99.99  ? 87  MET Z CE  1  
ATOM 7968   N N   . GLU C 3 85  ? -97.074  -2.742  -30.933 1.00 30.00  ? 88  GLU Z N   1  
ATOM 7969   C CA  . GLU C 3 85  ? -96.437  -1.625  -31.625 1.00 30.00  ? 88  GLU Z CA  1  
ATOM 7970   C C   . GLU C 3 85  ? -97.370  -1.039  -32.686 1.00 30.00  ? 88  GLU Z C   1  
ATOM 7971   O O   . GLU C 3 85  ? -97.831  0.107   -32.584 1.00 30.00  ? 88  GLU Z O   1  
ATOM 7972   C CB  . GLU C 3 85  ? -95.160  -2.098  -32.309 1.00 99.99  ? 88  GLU Z CB  1  
ATOM 7973   C CG  . GLU C 3 85  ? -94.164  -2.539  -31.264 1.00 99.99  ? 88  GLU Z CG  1  
ATOM 7974   C CD  . GLU C 3 85  ? -93.616  -1.318  -30.535 1.00 99.99  ? 88  GLU Z CD  1  
ATOM 7975   O OE1 . GLU C 3 85  ? -94.236  -0.933  -29.505 1.00 99.99  ? 88  GLU Z OE1 1  
ATOM 7976   O OE2 . GLU C 3 85  ? -92.582  -0.772  -31.013 1.00 99.99  ? 88  GLU Z OE2 1  
ATOM 7977   N N   . ALA C 3 86  ? -97.642  -1.848  -33.701 1.00 30.00  ? 89  ALA Z N   1  
ATOM 7978   C CA  . ALA C 3 86  ? -98.509  -1.473  -34.803 1.00 30.00  ? 89  ALA Z CA  1  
ATOM 7979   C C   . ALA C 3 86  ? -99.839  -0.884  -34.370 1.00 30.00  ? 89  ALA Z C   1  
ATOM 7980   O O   . ALA C 3 86  ? -100.305 0.100   -34.945 1.00 30.00  ? 89  ALA Z O   1  
ATOM 7981   C CB  . ALA C 3 86  ? -98.757  -2.673  -35.679 1.00 30.00  ? 89  ALA Z CB  1  
ATOM 7982   N N   . PHE C 3 87  ? -100.459 -1.473  -33.367 1.00 30.00  ? 90  PHE Z N   1  
ATOM 7983   C CA  . PHE C 3 87  ? -101.741 -0.979  -32.907 1.00 30.00  ? 90  PHE Z CA  1  
ATOM 7984   C C   . PHE C 3 87  ? -101.618 0.369   -32.232 1.00 30.00  ? 90  PHE Z C   1  
ATOM 7985   O O   . PHE C 3 87  ? -102.577 1.137   -32.178 1.00 30.00  ? 90  PHE Z O   1  
ATOM 7986   C CB  . PHE C 3 87  ? -102.341 -1.956  -31.903 1.00 99.99  ? 90  PHE Z CB  1  
ATOM 7987   C CG  . PHE C 3 87  ? -103.677 -1.438  -31.432 1.00 99.99  ? 90  PHE Z CG  1  
ATOM 7988   C CD1 . PHE C 3 87  ? -104.828 -1.662  -32.197 1.00 99.99  ? 90  PHE Z CD1 1  
ATOM 7989   C CD2 . PHE C 3 87  ? -103.768 -0.726  -30.226 1.00 99.99  ? 90  PHE Z CD2 1  
ATOM 7990   C CE1 . PHE C 3 87  ? -106.066 -1.182  -31.759 1.00 99.99  ? 90  PHE Z CE1 1  
ATOM 7991   C CE2 . PHE C 3 87  ? -105.006 -0.244  -29.791 1.00 99.99  ? 90  PHE Z CE2 1  
ATOM 7992   C CZ  . PHE C 3 87  ? -106.155 -0.470  -30.556 1.00 99.99  ? 90  PHE Z CZ  1  
ATOM 7993   N N   . LYS C 3 88  ? -100.439 0.672   -31.710 1.00 30.00  ? 91  LYS Z N   1  
ATOM 7994   C CA  . LYS C 3 88  ? -100.255 1.951   -31.046 1.00 30.00  ? 91  LYS Z CA  1  
ATOM 7995   C C   . LYS C 3 88  ? -100.370 3.113   -32.041 1.00 30.00  ? 91  LYS Z C   1  
ATOM 7996   O O   . LYS C 3 88  ? -100.933 4.171   -31.714 1.00 30.00  ? 91  LYS Z O   1  
ATOM 7997   C CB  . LYS C 3 88  ? -98.878  2.004   -30.393 1.00 99.99  ? 91  LYS Z CB  1  
ATOM 7998   C CG  . LYS C 3 88  ? -98.731  3.307   -29.616 1.00 99.99  ? 91  LYS Z CG  1  
ATOM 7999   C CD  . LYS C 3 88  ? -97.580  3.181   -28.624 1.00 99.99  ? 91  LYS Z CD  1  
ATOM 8000   C CE  . LYS C 3 88  ? -97.192  4.565   -28.117 1.00 99.99  ? 91  LYS Z CE  1  
ATOM 8001   N NZ  . LYS C 3 88  ? -97.906  4.849   -26.863 1.00 99.99  ? 91  LYS Z NZ  1  
ATOM 8002   N N   . THR C 3 89  ? -99.852  2.900   -33.253 1.00 30.00  ? 92  THR Z N   1  
ATOM 8003   C CA  . THR C 3 89  ? -99.877  3.912   -34.305 1.00 30.00  ? 92  THR Z CA  1  
ATOM 8004   C C   . THR C 3 89  ? -101.278 4.369   -34.742 1.00 30.00  ? 92  THR Z C   1  
ATOM 8005   O O   . THR C 3 89  ? -101.407 5.213   -35.635 1.00 30.00  ? 92  THR Z O   1  
ATOM 8006   C CB  . THR C 3 89  ? -99.194  3.375   -35.557 1.00 99.99  ? 92  THR Z CB  1  
ATOM 8007   O OG1 . THR C 3 89  ? -99.983  2.321   -36.117 1.00 99.99  ? 92  THR Z OG1 1  
ATOM 8008   C CG2 . THR C 3 89  ? -97.814  2.838   -35.195 1.00 99.99  ? 92  THR Z CG2 1  
ATOM 8009   N N   . PHE C 3 90  ? -102.320 3.837   -34.124 1.00 30.00  ? 93  PHE Z N   1  
ATOM 8010   C CA  . PHE C 3 90  ? -103.690 4.234   -34.475 1.00 30.00  ? 93  PHE Z CA  1  
ATOM 8011   C C   . PHE C 3 90  ? -104.341 4.887   -33.257 1.00 30.00  ? 93  PHE Z C   1  
ATOM 8012   O O   . PHE C 3 90  ? -105.484 5.364   -33.322 1.00 30.00  ? 93  PHE Z O   1  
ATOM 8013   C CB  . PHE C 3 90  ? -104.495 3.009   -34.893 1.00 99.99  ? 93  PHE Z CB  1  
ATOM 8014   C CG  . PHE C 3 90  ? -105.898 3.426   -35.254 1.00 99.99  ? 93  PHE Z CG  1  
ATOM 8015   C CD1 . PHE C 3 90  ? -106.173 3.923   -36.533 1.00 99.99  ? 93  PHE Z CD1 1  
ATOM 8016   C CD2 . PHE C 3 90  ? -106.925 3.314   -34.309 1.00 99.99  ? 93  PHE Z CD2 1  
ATOM 8017   C CE1 . PHE C 3 90  ? -107.478 4.311   -36.868 1.00 99.99  ? 93  PHE Z CE1 1  
ATOM 8018   C CE2 . PHE C 3 90  ? -108.230 3.703   -34.646 1.00 99.99  ? 93  PHE Z CE2 1  
ATOM 8019   C CZ  . PHE C 3 90  ? -108.505 4.200   -35.923 1.00 99.99  ? 93  PHE Z CZ  1  
ATOM 8020   N N   . ASP C 3 91  ? -103.596 4.905   -32.149 1.00 30.00  ? 94  ASP Z N   1  
ATOM 8021   C CA  . ASP C 3 91  ? -104.064 5.494   -30.897 1.00 30.00  ? 94  ASP Z CA  1  
ATOM 8022   C C   . ASP C 3 91  ? -103.544 6.916   -30.689 1.00 30.00  ? 94  ASP Z C   1  
ATOM 8023   O O   . ASP C 3 91  ? -102.385 7.104   -30.317 1.00 30.00  ? 94  ASP Z O   1  
ATOM 8024   C CB  . ASP C 3 91  ? -103.595 4.645   -29.721 1.00 99.99  ? 94  ASP Z CB  1  
ATOM 8025   C CG  . ASP C 3 91  ? -104.307 3.295   -29.744 1.00 99.99  ? 94  ASP Z CG  1  
ATOM 8026   O OD1 . ASP C 3 91  ? -105.530 3.286   -29.439 1.00 99.99  ? 94  ASP Z OD1 1  
ATOM 8027   O OD2 . ASP C 3 91  ? -103.627 2.287   -30.072 1.00 99.99  ? 94  ASP Z OD2 1  
ATOM 8028   N N   . ARG C 3 92  ? -104.401 7.909   -30.927 1.00 30.00  ? 95  ARG Z N   1  
ATOM 8029   C CA  . ARG C 3 92  ? -104.022 9.308   -30.755 1.00 30.00  ? 95  ARG Z CA  1  
ATOM 8030   C C   . ARG C 3 92  ? -103.991 9.612   -29.263 1.00 30.00  ? 95  ARG Z C   1  
ATOM 8031   O O   . ARG C 3 92  ? -103.131 10.358  -28.792 1.00 30.00  ? 95  ARG Z O   1  
ATOM 8032   C CB  . ARG C 3 92  ? -105.039 10.209  -31.446 1.00 99.99  ? 95  ARG Z CB  1  
ATOM 8033   C CG  . ARG C 3 92  ? -104.570 11.659  -31.368 1.00 99.99  ? 95  ARG Z CG  1  
ATOM 8034   C CD  . ARG C 3 92  ? -105.644 12.572  -31.948 1.00 99.99  ? 95  ARG Z CD  1  
ATOM 8035   N NE  . ARG C 3 92  ? -106.821 12.642  -31.055 1.00 99.99  ? 95  ARG Z NE  1  
ATOM 8036   C CZ  . ARG C 3 92  ? -107.864 13.433  -31.293 1.00 99.99  ? 95  ARG Z CZ  1  
ATOM 8037   N NH1 . ARG C 3 92  ? -107.923 14.222  -32.362 1.00 99.99  ? 95  ARG Z NH1 1  
ATOM 8038   N NH2 . ARG C 3 92  ? -108.872 13.418  -30.423 1.00 99.99  ? 95  ARG Z NH2 1  
ATOM 8039   N N   . GLU C 3 93  ? -104.930 9.025   -28.525 1.00 30.00  ? 96  GLU Z N   1  
ATOM 8040   C CA  . GLU C 3 93  ? -105.016 9.218   -27.079 1.00 30.00  ? 96  GLU Z CA  1  
ATOM 8041   C C   . GLU C 3 93  ? -103.808 8.623   -26.344 1.00 30.00  ? 96  GLU Z C   1  
ATOM 8042   O O   . GLU C 3 93  ? -103.312 9.207   -25.375 1.00 30.00  ? 96  GLU Z O   1  
ATOM 8043   C CB  . GLU C 3 93  ? -106.271 8.541   -26.539 1.00 99.99  ? 96  GLU Z CB  1  
ATOM 8044   C CG  . GLU C 3 93  ? -106.254 7.077   -26.904 1.00 99.99  ? 96  GLU Z CG  1  
ATOM 8045   C CD  . GLU C 3 93  ? -106.659 6.915   -28.369 1.00 99.99  ? 96  GLU Z CD  1  
ATOM 8046   O OE1 . GLU C 3 93  ? -105.744 6.945   -29.228 1.00 99.99  ? 96  GLU Z OE1 1  
ATOM 8047   O OE2 . GLU C 3 93  ? -107.890 6.762   -28.611 1.00 99.99  ? 96  GLU Z OE2 1  
ATOM 8048   N N   . GLY C 3 94  ? -103.351 7.465   -26.813 1.00 30.00  ? 97  GLY Z N   1  
ATOM 8049   C CA  . GLY C 3 94  ? -102.213 6.782   -26.215 1.00 30.00  ? 97  GLY Z CA  1  
ATOM 8050   C C   . GLY C 3 94  ? -102.590 5.862   -25.061 1.00 30.00  ? 97  GLY Z C   1  
ATOM 8051   O O   . GLY C 3 94  ? -101.741 5.181   -24.484 1.00 30.00  ? 97  GLY Z O   1  
ATOM 8052   N N   . GLN C 3 95  ? -103.877 5.829   -24.728 1.00 30.00  ? 98  GLN Z N   1  
ATOM 8053   C CA  . GLN C 3 95  ? -104.358 5.009   -23.627 1.00 30.00  ? 98  GLN Z CA  1  
ATOM 8054   C C   . GLN C 3 95  ? -104.917 3.625   -23.950 1.00 30.00  ? 98  GLN Z C   1  
ATOM 8055   O O   . GLN C 3 95  ? -105.908 3.199   -23.349 1.00 30.00  ? 98  GLN Z O   1  
ATOM 8056   C CB  . GLN C 3 95  ? -105.491 5.726   -22.902 1.00 99.99  ? 98  GLN Z CB  1  
ATOM 8057   C CG  . GLN C 3 95  ? -106.676 4.782   -22.748 1.00 99.99  ? 98  GLN Z CG  1  
ATOM 8058   C CD  . GLN C 3 95  ? -107.354 4.528   -24.086 1.00 99.99  ? 98  GLN Z CD  1  
ATOM 8059   O OE1 . GLN C 3 95  ? -106.930 5.061   -25.109 1.00 99.99  ? 98  GLN Z OE1 1  
ATOM 8060   N NE2 . GLN C 3 95  ? -108.409 3.713   -24.078 1.00 99.99  ? 98  GLN Z NE2 1  
ATOM 8061   N N   . GLY C 3 96  ? -104.281 2.931   -24.892 1.00 30.00  ? 99  GLY Z N   1  
ATOM 8062   C CA  . GLY C 3 96  ? -104.722 1.597   -25.270 1.00 30.00  ? 99  GLY Z CA  1  
ATOM 8063   C C   . GLY C 3 96  ? -106.136 1.424   -25.806 1.00 30.00  ? 99  GLY Z C   1  
ATOM 8064   O O   . GLY C 3 96  ? -106.741 0.373   -25.628 1.00 30.00  ? 99  GLY Z O   1  
ATOM 8065   N N   . PHE C 3 97  ? -106.670 2.442   -26.463 1.00 30.00  ? 100 PHE Z N   1  
ATOM 8066   C CA  . PHE C 3 97  ? -108.013 2.338   -27.010 1.00 30.00  ? 100 PHE Z CA  1  
ATOM 8067   C C   . PHE C 3 97  ? -108.053 2.409   -28.515 1.00 30.00  ? 100 PHE Z C   1  
ATOM 8068   O O   . PHE C 3 97  ? -107.036 2.538   -29.186 1.00 30.00  ? 100 PHE Z O   1  
ATOM 8069   C CB  . PHE C 3 97  ? -108.879 3.475   -26.479 1.00 99.99  ? 100 PHE Z CB  1  
ATOM 8070   C CG  . PHE C 3 97  ? -109.195 4.433   -27.599 1.00 99.99  ? 100 PHE Z CG  1  
ATOM 8071   C CD1 . PHE C 3 97  ? -108.323 4.552   -28.690 1.00 99.99  ? 100 PHE Z CD1 1  
ATOM 8072   C CD2 . PHE C 3 97  ? -110.362 5.207   -27.551 1.00 99.99  ? 100 PHE Z CD2 1  
ATOM 8073   C CE1 . PHE C 3 97  ? -108.619 5.443   -29.728 1.00 99.99  ? 100 PHE Z CE1 1  
ATOM 8074   C CE2 . PHE C 3 97  ? -110.655 6.099   -28.589 1.00 99.99  ? 100 PHE Z CE2 1  
ATOM 8075   C CZ  . PHE C 3 97  ? -109.783 6.216   -29.679 1.00 99.99  ? 100 PHE Z CZ  1  
ATOM 8076   N N   . ILE C 3 98  ? -109.263 2.327   -29.037 1.00 30.00  ? 101 ILE Z N   1  
ATOM 8077   C CA  . ILE C 3 98  ? -109.495 2.373   -30.467 1.00 30.00  ? 101 ILE Z CA  1  
ATOM 8078   C C   . ILE C 3 98  ? -110.995 2.229   -30.511 1.00 30.00  ? 101 ILE Z C   1  
ATOM 8079   O O   . ILE C 3 98  ? -111.611 1.888   -29.504 1.00 30.00  ? 101 ILE Z O   1  
ATOM 8080   C CB  . ILE C 3 98  ? -108.753 1.229   -31.149 1.00 99.99  ? 101 ILE Z CB  1  
ATOM 8081   C CG1 . ILE C 3 98  ? -108.873 1.373   -32.663 1.00 99.99  ? 101 ILE Z CG1 1  
ATOM 8082   C CG2 . ILE C 3 98  ? -109.361 -0.101  -30.715 1.00 99.99  ? 101 ILE Z CG2 1  
ATOM 8083   C CD1 . ILE C 3 98  ? -107.796 0.533   -33.340 1.00 99.99  ? 101 ILE Z CD1 1  
ATOM 8084   N N   . SER C 3 99  ? -111.598 2.518   -31.648 1.00 30.00  ? 102 SER Z N   1  
ATOM 8085   C CA  . SER C 3 99  ? -113.036 2.392   -31.736 1.00 30.00  ? 102 SER Z CA  1  
ATOM 8086   C C   . SER C 3 99  ? -113.293 1.101   -32.489 1.00 30.00  ? 102 SER Z C   1  
ATOM 8087   O O   . SER C 3 99  ? -112.388 0.552   -33.137 1.00 30.00  ? 102 SER Z O   1  
ATOM 8088   C CB  . SER C 3 99  ? -113.616 3.589   -32.481 1.00 99.99  ? 102 SER Z CB  1  
ATOM 8089   O OG  . SER C 3 99  ? -113.215 3.538   -33.853 1.00 99.99  ? 102 SER Z OG  1  
ATOM 8090   N N   . GLY C 3 100 ? -114.526 0.614   -32.397 1.00 30.00  ? 103 GLY Z N   1  
ATOM 8091   C CA  . GLY C 3 100 ? -114.859 -0.605  -33.094 1.00 30.00  ? 103 GLY Z CA  1  
ATOM 8092   C C   . GLY C 3 100 ? -114.618 -0.316  -34.556 1.00 30.00  ? 103 GLY Z C   1  
ATOM 8093   O O   . GLY C 3 100 ? -113.752 -0.933  -35.190 1.00 30.00  ? 103 GLY Z O   1  
ATOM 8094   N N   . ALA C 3 101 ? -115.386 0.647   -35.063 1.00 30.00  ? 104 ALA Z N   1  
ATOM 8095   C CA  . ALA C 3 101 ? -115.322 1.087   -36.460 1.00 30.00  ? 104 ALA Z CA  1  
ATOM 8096   C C   . ALA C 3 101 ? -113.922 1.135   -37.066 1.00 30.00  ? 104 ALA Z C   1  
ATOM 8097   O O   . ALA C 3 101 ? -113.712 0.659   -38.191 1.00 30.00  ? 104 ALA Z O   1  
ATOM 8098   C CB  . ALA C 3 101 ? -115.977 2.451   -36.577 1.00 30.00  ? 104 ALA Z CB  1  
ATOM 8099   N N   . GLU C 3 102 ? -112.970 1.712   -36.337 1.00 30.00  ? 105 GLU Z N   1  
ATOM 8100   C CA  . GLU C 3 102 ? -111.604 1.805   -36.841 1.00 30.00  ? 105 GLU Z CA  1  
ATOM 8101   C C   . GLU C 3 102 ? -110.933 0.438   -36.852 1.00 30.00  ? 105 GLU Z C   1  
ATOM 8102   O O   . GLU C 3 102 ? -110.323 0.050   -37.853 1.00 30.00  ? 105 GLU Z O   1  
ATOM 8103   C CB  . GLU C 3 102 ? -110.787 2.739   -35.954 1.00 99.99  ? 105 GLU Z CB  1  
ATOM 8104   C CG  . GLU C 3 102 ? -111.344 4.139   -36.048 1.00 99.99  ? 105 GLU Z CG  1  
ATOM 8105   C CD  . GLU C 3 102 ? -111.004 4.732   -37.414 1.00 99.99  ? 105 GLU Z CD  1  
ATOM 8106   O OE1 . GLU C 3 102 ? -111.831 4.548   -38.344 1.00 99.99  ? 105 GLU Z OE1 1  
ATOM 8107   O OE2 . GLU C 3 102 ? -109.918 5.362   -37.513 1.00 99.99  ? 105 GLU Z OE2 1  
ATOM 8108   N N   . LEU C 3 103 ? -111.045 -0.286  -35.745 1.00 30.00  ? 106 LEU Z N   1  
ATOM 8109   C CA  . LEU C 3 103 ? -110.451 -1.612  -35.646 1.00 30.00  ? 106 LEU Z CA  1  
ATOM 8110   C C   . LEU C 3 103 ? -110.907 -2.417  -36.857 1.00 30.00  ? 106 LEU Z C   1  
ATOM 8111   O O   . LEU C 3 103 ? -110.113 -3.095  -37.521 1.00 30.00  ? 106 LEU Z O   1  
ATOM 8112   C CB  . LEU C 3 103 ? -110.907 -2.289  -34.360 1.00 99.99  ? 106 LEU Z CB  1  
ATOM 8113   C CG  . LEU C 3 103 ? -109.873 -2.055  -33.266 1.00 99.99  ? 106 LEU Z CG  1  
ATOM 8114   C CD1 . LEU C 3 103 ? -110.154 -2.992  -32.093 1.00 99.99  ? 106 LEU Z CD1 1  
ATOM 8115   C CD2 . LEU C 3 103 ? -108.478 -2.330  -33.815 1.00 99.99  ? 106 LEU Z CD2 1  
ATOM 8116   N N   . ARG C 3 104 ? -112.204 -2.328  -37.130 1.00 30.00  ? 107 ARG Z N   1  
ATOM 8117   C CA  . ARG C 3 104 ? -112.811 -3.014  -38.256 1.00 30.00  ? 107 ARG Z CA  1  
ATOM 8118   C C   . ARG C 3 104 ? -112.043 -2.619  -39.529 1.00 30.00  ? 107 ARG Z C   1  
ATOM 8119   O O   . ARG C 3 104 ? -111.640 -3.469  -40.328 1.00 30.00  ? 107 ARG Z O   1  
ATOM 8120   C CB  . ARG C 3 104 ? -114.274 -2.606  -38.383 1.00 99.99  ? 107 ARG Z CB  1  
ATOM 8121   C CG  . ARG C 3 104 ? -114.917 -3.370  -39.535 1.00 99.99  ? 107 ARG Z CG  1  
ATOM 8122   C CD  . ARG C 3 104 ? -116.368 -2.925  -39.694 1.00 99.99  ? 107 ARG Z CD  1  
ATOM 8123   N NE  . ARG C 3 104 ? -116.470 -1.449  -39.717 1.00 99.99  ? 107 ARG Z NE  1  
ATOM 8124   C CZ  . ARG C 3 104 ? -116.213 -0.722  -40.800 1.00 99.99  ? 107 ARG Z CZ  1  
ATOM 8125   N NH1 . ARG C 3 104 ? -115.838 -1.275  -41.948 1.00 99.99  ? 107 ARG Z NH1 1  
ATOM 8126   N NH2 . ARG C 3 104 ? -116.336 0.601   -40.709 1.00 99.99  ? 107 ARG Z NH2 1  
ATOM 8127   N N   . HIS C 3 105 ? -111.837 -1.314  -39.699 1.00 30.00  ? 108 HIS Z N   1  
ATOM 8128   C CA  . HIS C 3 105 ? -111.116 -0.769  -40.848 1.00 30.00  ? 108 HIS Z CA  1  
ATOM 8129   C C   . HIS C 3 105 ? -109.705 -1.361  -41.005 1.00 30.00  ? 108 HIS Z C   1  
ATOM 8130   O O   . HIS C 3 105 ? -109.272 -1.694  -42.111 1.00 30.00  ? 108 HIS Z O   1  
ATOM 8131   C CB  . HIS C 3 105 ? -110.969 0.741   -40.698 1.00 99.99  ? 108 HIS Z CB  1  
ATOM 8132   C CG  . HIS C 3 105 ? -110.042 1.395   -41.695 1.00 99.99  ? 108 HIS Z CG  1  
ATOM 8133   N ND1 . HIS C 3 105 ? -110.440 2.474   -42.474 1.00 99.99  ? 108 HIS Z ND1 1  
ATOM 8134   C CD2 . HIS C 3 105 ? -108.750 1.126   -42.035 1.00 99.99  ? 108 HIS Z CD2 1  
ATOM 8135   C CE1 . HIS C 3 105 ? -109.422 2.824   -43.240 1.00 99.99  ? 108 HIS Z CE1 1  
ATOM 8136   N NE2 . HIS C 3 105 ? -108.411 2.030   -42.992 1.00 99.99  ? 108 HIS Z NE2 1  
ATOM 8137   N N   . VAL C 3 106 ? -108.984 -1.477  -39.892 1.00 30.00  ? 109 VAL Z N   1  
ATOM 8138   C CA  . VAL C 3 106 ? -107.620 -2.010  -39.893 1.00 30.00  ? 109 VAL Z CA  1  
ATOM 8139   C C   . VAL C 3 106 ? -107.560 -3.441  -40.402 1.00 30.00  ? 109 VAL Z C   1  
ATOM 8140   O O   . VAL C 3 106 ? -106.694 -3.824  -41.197 1.00 30.00  ? 109 VAL Z O   1  
ATOM 8141   C CB  . VAL C 3 106 ? -107.055 -1.994  -38.477 1.00 99.99  ? 109 VAL Z CB  1  
ATOM 8142   C CG1 . VAL C 3 106 ? -107.036 -0.560  -37.955 1.00 99.99  ? 109 VAL Z CG1 1  
ATOM 8143   C CG2 . VAL C 3 106 ? -107.929 -2.852  -37.569 1.00 99.99  ? 109 VAL Z CG2 1  
ATOM 8144   N N   . LEU C 3 107 ? -108.502 -4.227  -39.908 1.00 30.00  ? 110 LEU Z N   1  
ATOM 8145   C CA  . LEU C 3 107 ? -108.592 -5.631  -40.258 1.00 30.00  ? 110 LEU Z CA  1  
ATOM 8146   C C   . LEU C 3 107 ? -109.048 -5.844  -41.691 1.00 30.00  ? 110 LEU Z C   1  
ATOM 8147   O O   . LEU C 3 107 ? -108.374 -6.527  -42.469 1.00 30.00  ? 110 LEU Z O   1  
ATOM 8148   C CB  . LEU C 3 107 ? -109.590 -6.332  -39.342 1.00 99.99  ? 110 LEU Z CB  1  
ATOM 8149   C CG  . LEU C 3 107 ? -108.847 -6.964  -38.170 1.00 99.99  ? 110 LEU Z CG  1  
ATOM 8150   C CD1 . LEU C 3 107 ? -109.777 -7.930  -37.442 1.00 99.99  ? 110 LEU Z CD1 1  
ATOM 8151   C CD2 . LEU C 3 107 ? -107.630 -7.719  -38.686 1.00 99.99  ? 110 LEU Z CD2 1  
ATOM 8152   N N   . THR C 3 108 ? -110.186 -5.250  -42.034 1.00 30.00  ? 111 THR Z N   1  
ATOM 8153   C CA  . THR C 3 108 ? -110.744 -5.380  -43.373 1.00 30.00  ? 111 THR Z CA  1  
ATOM 8154   C C   . THR C 3 108 ? -110.032 -4.588  -44.474 1.00 30.00  ? 111 THR Z C   1  
ATOM 8155   O O   . THR C 3 108 ? -109.848 -5.090  -45.587 1.00 30.00  ? 111 THR Z O   1  
ATOM 8156   C CB  . THR C 3 108 ? -112.192 -4.900  -43.381 1.00 99.99  ? 111 THR Z CB  1  
ATOM 8157   O OG1 . THR C 3 108 ? -112.227 -3.487  -43.162 1.00 99.99  ? 111 THR Z OG1 1  
ATOM 8158   C CG2 . THR C 3 108 ? -112.965 -5.603  -42.270 1.00 99.99  ? 111 THR Z CG2 1  
ATOM 8159   N N   . ALA C 3 109 ? -109.616 -3.362  -44.162 1.00 30.00  ? 112 ALA Z N   1  
ATOM 8160   C CA  . ALA C 3 109 ? -108.953 -2.507  -45.140 1.00 30.00  ? 112 ALA Z CA  1  
ATOM 8161   C C   . ALA C 3 109 ? -107.442 -2.542  -45.293 1.00 30.00  ? 112 ALA Z C   1  
ATOM 8162   O O   . ALA C 3 109 ? -106.962 -2.481  -46.416 1.00 30.00  ? 112 ALA Z O   1  
ATOM 8163   C CB  . ALA C 3 109 ? -109.388 -1.068  -44.905 1.00 30.00  ? 112 ALA Z CB  1  
ATOM 8164   N N   . LEU C 3 110 ? -106.683 -2.643  -44.209 1.00 30.00  ? 113 LEU Z N   1  
ATOM 8165   C CA  . LEU C 3 110 ? -105.220 -2.659  -44.358 1.00 30.00  ? 113 LEU Z CA  1  
ATOM 8166   C C   . LEU C 3 110 ? -104.563 -4.041  -44.375 1.00 30.00  ? 113 LEU Z C   1  
ATOM 8167   O O   . LEU C 3 110 ? -105.155 -5.023  -43.925 1.00 30.00  ? 113 LEU Z O   1  
ATOM 8168   C CB  . LEU C 3 110 ? -104.573 -1.901  -43.205 1.00 99.99  ? 113 LEU Z CB  1  
ATOM 8169   C CG  . LEU C 3 110 ? -104.313 -0.458  -43.624 1.00 99.99  ? 113 LEU Z CG  1  
ATOM 8170   C CD1 . LEU C 3 110 ? -103.382 0.205   -42.616 1.00 99.99  ? 113 LEU Z CD1 1  
ATOM 8171   C CD2 . LEU C 3 110 ? -103.668 -0.437  -45.006 1.00 99.99  ? 113 LEU Z CD2 1  
ATOM 8172   N N   . GLY C 3 111 ? -103.334 -4.102  -44.895 1.00 30.00  ? 114 GLY Z N   1  
ATOM 8173   C CA  . GLY C 3 111 ? -102.599 -5.360  -44.973 1.00 30.00  ? 114 GLY Z CA  1  
ATOM 8174   C C   . GLY C 3 111 ? -103.398 -6.424  -45.707 1.00 30.00  ? 114 GLY Z C   1  
ATOM 8175   O O   . GLY C 3 111 ? -104.431 -6.102  -46.292 1.00 30.00  ? 114 GLY Z O   1  
ATOM 8176   N N   . GLU C 3 112 ? -102.934 -7.678  -45.689 1.00 30.00  ? 115 GLU Z N   1  
ATOM 8177   C CA  . GLU C 3 112 ? -103.655 -8.774  -46.357 1.00 30.00  ? 115 GLU Z CA  1  
ATOM 8178   C C   . GLU C 3 112 ? -105.072 -8.769  -45.788 1.00 30.00  ? 115 GLU Z C   1  
ATOM 8179   O O   . GLU C 3 112 ? -105.348 -9.472  -44.819 1.00 30.00  ? 115 GLU Z O   1  
ATOM 8180   C CB  . GLU C 3 112 ? -102.960 -10.100 -46.070 1.00 99.99  ? 115 GLU Z CB  1  
ATOM 8181   C CG  . GLU C 3 112 ? -103.289 -11.087 -47.163 1.00 99.99  ? 115 GLU Z CG  1  
ATOM 8182   C CD  . GLU C 3 112 ? -104.614 -11.776 -46.850 1.00 99.99  ? 115 GLU Z CD  1  
ATOM 8183   O OE1 . GLU C 3 112 ? -105.662 -11.235 -47.289 1.00 99.99  ? 115 GLU Z OE1 1  
ATOM 8184   O OE2 . GLU C 3 112 ? -104.567 -12.838 -46.171 1.00 99.99  ? 115 GLU Z OE2 1  
ATOM 8185   N N   . ARG C 3 113 ? -105.975 -7.996  -46.386 1.00 30.00  ? 116 ARG Z N   1  
ATOM 8186   C CA  . ARG C 3 113 ? -107.345 -7.901  -45.892 1.00 30.00  ? 116 ARG Z CA  1  
ATOM 8187   C C   . ARG C 3 113 ? -107.976 -9.159  -45.300 1.00 30.00  ? 116 ARG Z C   1  
ATOM 8188   O O   . ARG C 3 113 ? -107.509 -10.274 -45.500 1.00 30.00  ? 116 ARG Z O   1  
ATOM 8189   C CB  . ARG C 3 113 ? -108.279 -7.486  -47.025 1.00 99.99  ? 116 ARG Z CB  1  
ATOM 8190   C CG  . ARG C 3 113 ? -107.819 -6.156  -47.603 1.00 99.99  ? 116 ARG Z CG  1  
ATOM 8191   C CD  . ARG C 3 113 ? -108.517 -5.910  -48.936 1.00 99.99  ? 116 ARG Z CD  1  
ATOM 8192   N NE  . ARG C 3 113 ? -109.985 -5.822  -48.757 1.00 99.99  ? 116 ARG Z NE  1  
ATOM 8193   C CZ  . ARG C 3 113 ? -110.617 -4.678  -48.511 1.00 99.99  ? 116 ARG Z CZ  1  
ATOM 8194   N NH1 . ARG C 3 113 ? -109.967 -3.522  -48.408 1.00 99.99  ? 116 ARG Z NH1 1  
ATOM 8195   N NH2 . ARG C 3 113 ? -111.938 -4.712  -48.368 1.00 99.99  ? 116 ARG Z NH2 1  
ATOM 8196   N N   . LEU C 3 114 ? -109.053 -8.947  -44.557 1.00 30.00  ? 117 LEU Z N   1  
ATOM 8197   C CA  . LEU C 3 114 ? -109.794 -10.021 -43.907 1.00 30.00  ? 117 LEU Z CA  1  
ATOM 8198   C C   . LEU C 3 114 ? -111.259 -9.782  -44.222 1.00 30.00  ? 117 LEU Z C   1  
ATOM 8199   O O   . LEU C 3 114 ? -111.784 -8.720  -43.915 1.00 30.00  ? 117 LEU Z O   1  
ATOM 8200   C CB  . LEU C 3 114 ? -109.551 -9.980  -42.401 1.00 99.99  ? 117 LEU Z CB  1  
ATOM 8201   C CG  . LEU C 3 114 ? -110.375 -8.860  -41.780 1.00 99.99  ? 117 LEU Z CG  1  
ATOM 8202   C CD1 . LEU C 3 114 ? -110.454 -7.689  -42.755 1.00 99.99  ? 117 LEU Z CD1 1  
ATOM 8203   C CD2 . LEU C 3 114 ? -111.781 -9.370  -41.481 1.00 99.99  ? 117 LEU Z CD2 1  
ATOM 8204   N N   . SER C 3 115 ? -111.918 -10.766 -44.824 1.00 30.00  ? 118 SER Z N   1  
ATOM 8205   C CA  . SER C 3 115 ? -113.336 -10.632 -45.159 1.00 30.00  ? 118 SER Z CA  1  
ATOM 8206   C C   . SER C 3 115 ? -114.133 -10.020 -44.007 1.00 30.00  ? 118 SER Z C   1  
ATOM 8207   O O   . SER C 3 115 ? -113.726 -10.048 -42.853 1.00 30.00  ? 118 SER Z O   1  
ATOM 8208   C CB  . SER C 3 115 ? -113.926 -12.001 -45.474 1.00 99.99  ? 118 SER Z CB  1  
ATOM 8209   O OG  . SER C 3 115 ? -113.961 -12.791 -44.283 1.00 99.99  ? 118 SER Z OG  1  
ATOM 8210   N N   . ASP C 3 116 ? -115.284 -9.464  -44.327 1.00 30.00  ? 119 ASP Z N   1  
ATOM 8211   C CA  . ASP C 3 116 ? -116.099 -8.847  -43.304 1.00 30.00  ? 119 ASP Z CA  1  
ATOM 8212   C C   . ASP C 3 116 ? -116.684 -9.873  -42.360 1.00 30.00  ? 119 ASP Z C   1  
ATOM 8213   O O   . ASP C 3 116 ? -117.087 -9.545  -41.248 1.00 30.00  ? 119 ASP Z O   1  
ATOM 8214   C CB  . ASP C 3 116 ? -117.248 -8.079  -43.946 1.00 99.99  ? 119 ASP Z CB  1  
ATOM 8215   C CG  . ASP C 3 116 ? -117.931 -8.961  -44.989 1.00 99.99  ? 119 ASP Z CG  1  
ATOM 8216   O OD1 . ASP C 3 116 ? -117.204 -9.435  -45.904 1.00 99.99  ? 119 ASP Z OD1 1  
ATOM 8217   O OD2 . ASP C 3 116 ? -119.167 -9.152  -44.860 1.00 99.99  ? 119 ASP Z OD2 1  
ATOM 8218   N N   . GLU C 3 117 ? -116.727 -11.122 -42.815 1.00 30.00  ? 120 GLU Z N   1  
ATOM 8219   C CA  . GLU C 3 117 ? -117.281 -12.233 -42.039 1.00 30.00  ? 120 GLU Z CA  1  
ATOM 8220   C C   . GLU C 3 117 ? -116.346 -12.739 -40.957 1.00 30.00  ? 120 GLU Z C   1  
ATOM 8221   O O   . GLU C 3 117 ? -116.771 -12.944 -39.816 1.00 30.00  ? 120 GLU Z O   1  
ATOM 8222   C CB  . GLU C 3 117 ? -117.583 -13.409 -42.960 1.00 99.99  ? 120 GLU Z CB  1  
ATOM 8223   C CG  . GLU C 3 117 ? -118.671 -13.022 -43.934 1.00 99.99  ? 120 GLU Z CG  1  
ATOM 8224   C CD  . GLU C 3 117 ? -120.004 -12.934 -43.194 1.00 99.99  ? 120 GLU Z CD  1  
ATOM 8225   O OE1 . GLU C 3 117 ? -120.316 -11.820 -42.698 1.00 99.99  ? 120 GLU Z OE1 1  
ATOM 8226   O OE2 . GLU C 3 117 ? -120.699 -13.983 -43.131 1.00 99.99  ? 120 GLU Z OE2 1  
ATOM 8227   N N   . ASP C 3 118 ? -115.081 -12.944 -41.324 1.00 30.00  ? 121 ASP Z N   1  
ATOM 8228   C CA  . ASP C 3 118 ? -114.058 -13.422 -40.396 1.00 30.00  ? 121 ASP Z CA  1  
ATOM 8229   C C   . ASP C 3 118 ? -113.956 -12.440 -39.253 1.00 30.00  ? 121 ASP Z C   1  
ATOM 8230   O O   . ASP C 3 118 ? -113.611 -12.799 -38.130 1.00 30.00  ? 121 ASP Z O   1  
ATOM 8231   C CB  . ASP C 3 118 ? -112.717 -13.525 -41.113 1.00 99.99  ? 121 ASP Z CB  1  
ATOM 8232   C CG  . ASP C 3 118 ? -112.768 -14.659 -42.131 1.00 99.99  ? 121 ASP Z CG  1  
ATOM 8233   O OD1 . ASP C 3 118 ? -112.951 -15.827 -41.687 1.00 99.99  ? 121 ASP Z OD1 1  
ATOM 8234   O OD2 . ASP C 3 118 ? -112.628 -14.353 -43.346 1.00 99.99  ? 121 ASP Z OD2 1  
ATOM 8235   N N   . VAL C 3 119 ? -114.259 -11.189 -39.560 1.00 30.00  ? 122 VAL Z N   1  
ATOM 8236   C CA  . VAL C 3 119 ? -114.199 -10.149 -38.569 1.00 30.00  ? 122 VAL Z CA  1  
ATOM 8237   C C   . VAL C 3 119 ? -115.332 -10.280 -37.550 1.00 30.00  ? 122 VAL Z C   1  
ATOM 8238   O O   . VAL C 3 119 ? -115.063 -10.470 -36.367 1.00 30.00  ? 122 VAL Z O   1  
ATOM 8239   C CB  . VAL C 3 119 ? -114.310 -8.786  -39.241 1.00 99.99  ? 122 VAL Z CB  1  
ATOM 8240   C CG1 . VAL C 3 119 ? -115.024 -8.935  -40.580 1.00 99.99  ? 122 VAL Z CG1 1  
ATOM 8241   C CG2 . VAL C 3 119 ? -115.104 -7.840  -38.345 1.00 99.99  ? 122 VAL Z CG2 1  
ATOM 8242   N N   . ASP C 3 120 ? -116.585 -10.189 -37.993 1.00 30.00  ? 123 ASP Z N   1  
ATOM 8243   C CA  . ASP C 3 120 ? -117.725 -10.306 -37.069 1.00 30.00  ? 123 ASP Z CA  1  
ATOM 8244   C C   . ASP C 3 120 ? -117.568 -11.613 -36.312 1.00 30.00  ? 123 ASP Z C   1  
ATOM 8245   O O   . ASP C 3 120 ? -118.065 -11.773 -35.188 1.00 30.00  ? 123 ASP Z O   1  
ATOM 8246   C CB  . ASP C 3 120 ? -119.031 -10.303 -37.852 1.00 99.99  ? 123 ASP Z CB  1  
ATOM 8247   C CG  . ASP C 3 120 ? -119.079 -11.524 -38.769 1.00 99.99  ? 123 ASP Z CG  1  
ATOM 8248   O OD1 . ASP C 3 120 ? -118.454 -11.448 -39.861 1.00 99.99  ? 123 ASP Z OD1 1  
ATOM 8249   O OD2 . ASP C 3 120 ? -119.738 -12.519 -38.369 1.00 99.99  ? 123 ASP Z OD2 1  
ATOM 8250   N N   . GLU C 3 121 ? -116.876 -12.539 -36.965 1.00 30.00  ? 124 GLU Z N   1  
ATOM 8251   C CA  . GLU C 3 121 ? -116.593 -13.858 -36.433 1.00 30.00  ? 124 GLU Z CA  1  
ATOM 8252   C C   . GLU C 3 121 ? -115.786 -13.710 -35.163 1.00 30.00  ? 124 GLU Z C   1  
ATOM 8253   O O   . GLU C 3 121 ? -116.331 -13.736 -34.057 1.00 30.00  ? 124 GLU Z O   1  
ATOM 8254   C CB  . GLU C 3 121 ? -115.802 -14.672 -37.451 1.00 99.99  ? 124 GLU Z CB  1  
ATOM 8255   C CG  . GLU C 3 121 ? -116.651 -14.909 -38.678 1.00 99.99  ? 124 GLU Z CG  1  
ATOM 8256   C CD  . GLU C 3 121 ? -117.748 -15.919 -38.350 1.00 99.99  ? 124 GLU Z CD  1  
ATOM 8257   O OE1 . GLU C 3 121 ? -118.838 -15.466 -37.918 1.00 99.99  ? 124 GLU Z OE1 1  
ATOM 8258   O OE2 . GLU C 3 121 ? -117.481 -17.138 -38.536 1.00 99.99  ? 124 GLU Z OE2 1  
ATOM 8259   N N   . ILE C 3 122 ? -114.477 -13.552 -35.348 1.00 30.00  ? 125 ILE Z N   1  
ATOM 8260   C CA  . ILE C 3 122 ? -113.524 -13.395 -34.253 1.00 30.00  ? 125 ILE Z CA  1  
ATOM 8261   C C   . ILE C 3 122 ? -113.949 -12.388 -33.198 1.00 30.00  ? 125 ILE Z C   1  
ATOM 8262   O O   . ILE C 3 122 ? -113.537 -12.487 -32.042 1.00 30.00  ? 125 ILE Z O   1  
ATOM 8263   C CB  . ILE C 3 122 ? -112.180 -12.923 -34.801 1.00 99.99  ? 125 ILE Z CB  1  
ATOM 8264   C CG1 . ILE C 3 122 ? -112.216 -11.417 -35.012 1.00 99.99  ? 125 ILE Z CG1 1  
ATOM 8265   C CG2 . ILE C 3 122 ? -111.900 -13.620 -36.128 1.00 99.99  ? 125 ILE Z CG2 1  
ATOM 8266   C CD1 . ILE C 3 122 ? -112.635 -11.113 -36.448 1.00 99.99  ? 125 ILE Z CD1 1  
ATOM 8267   N N   . ILE C 3 123 ? -114.762 -11.417 -33.589 1.00 30.00  ? 126 ILE Z N   1  
ATOM 8268   C CA  . ILE C 3 123 ? -115.238 -10.433 -32.633 1.00 30.00  ? 126 ILE Z CA  1  
ATOM 8269   C C   . ILE C 3 123 ? -116.070 -11.253 -31.655 1.00 30.00  ? 126 ILE Z C   1  
ATOM 8270   O O   . ILE C 3 123 ? -115.754 -11.322 -30.469 1.00 30.00  ? 126 ILE Z O   1  
ATOM 8271   C CB  . ILE C 3 123 ? -116.068 -9.373  -33.349 1.00 99.99  ? 126 ILE Z CB  1  
ATOM 8272   C CG1 . ILE C 3 123 ? -117.364 -9.995  -33.848 1.00 99.99  ? 126 ILE Z CG1 1  
ATOM 8273   C CG2 . ILE C 3 123 ? -115.275 -8.825  -34.534 1.00 99.99  ? 126 ILE Z CG2 1  
ATOM 8274   C CD1 . ILE C 3 123 ? -118.172 -8.947  -34.609 1.00 99.99  ? 126 ILE Z CD1 1  
ATOM 8275   N N   . LYS C 3 124 ? -117.122 -11.877 -32.191 1.00 30.00  ? 127 LYS Z N   1  
ATOM 8276   C CA  . LYS C 3 124 ? -118.049 -12.715 -31.427 1.00 30.00  ? 127 LYS Z CA  1  
ATOM 8277   C C   . LYS C 3 124 ? -117.341 -13.843 -30.672 1.00 30.00  ? 127 LYS Z C   1  
ATOM 8278   O O   . LYS C 3 124 ? -117.682 -14.130 -29.522 1.00 30.00  ? 127 LYS Z O   1  
ATOM 8279   C CB  . LYS C 3 124 ? -119.061 -13.356 -32.367 1.00 99.99  ? 127 LYS Z CB  1  
ATOM 8280   C CG  . LYS C 3 124 ? -120.083 -14.147 -31.557 1.00 99.99  ? 127 LYS Z CG  1  
ATOM 8281   C CD  . LYS C 3 124 ? -121.320 -14.408 -32.408 1.00 99.99  ? 127 LYS Z CD  1  
ATOM 8282   C CE  . LYS C 3 124 ? -122.168 -15.492 -31.751 1.00 99.99  ? 127 LYS Z CE  1  
ATOM 8283   N NZ  . LYS C 3 124 ? -123.197 -14.868 -30.904 1.00 99.99  ? 127 LYS Z NZ  1  
ATOM 8284   N N   . LEU C 3 125 ? -116.366 -14.485 -31.318 1.00 30.00  ? 128 LEU Z N   1  
ATOM 8285   C CA  . LEU C 3 125 ? -115.622 -15.567 -30.678 1.00 30.00  ? 128 LEU Z CA  1  
ATOM 8286   C C   . LEU C 3 125 ? -115.009 -15.008 -29.406 1.00 30.00  ? 128 LEU Z C   1  
ATOM 8287   O O   . LEU C 3 125 ? -115.489 -15.293 -28.304 1.00 30.00  ? 128 LEU Z O   1  
ATOM 8288   C CB  . LEU C 3 125 ? -114.530 -16.071 -31.614 1.00 99.99  ? 128 LEU Z CB  1  
ATOM 8289   C CG  . LEU C 3 125 ? -115.047 -17.273 -32.398 1.00 99.99  ? 128 LEU Z CG  1  
ATOM 8290   C CD1 . LEU C 3 125 ? -113.876 -17.974 -33.081 1.00 99.99  ? 128 LEU Z CD1 1  
ATOM 8291   C CD2 . LEU C 3 125 ? -115.738 -18.241 -31.447 1.00 99.99  ? 128 LEU Z CD2 1  
ATOM 8292   N N   . THR C 3 126 ? -113.951 -14.207 -29.572 1.00 30.00  ? 129 THR Z N   1  
ATOM 8293   C CA  . THR C 3 126 ? -113.236 -13.573 -28.464 1.00 30.00  ? 129 THR Z CA  1  
ATOM 8294   C C   . THR C 3 126 ? -114.175 -12.740 -27.592 1.00 30.00  ? 129 THR Z C   1  
ATOM 8295   O O   . THR C 3 126 ? -113.768 -12.213 -26.565 1.00 30.00  ? 129 THR Z O   1  
ATOM 8296   C CB  . THR C 3 126 ? -112.146 -12.654 -29.009 1.00 99.99  ? 129 THR Z CB  1  
ATOM 8297   O OG1 . THR C 3 126 ? -112.753 -11.539 -29.669 1.00 99.99  ? 129 THR Z OG1 1  
ATOM 8298   C CG2 . THR C 3 126 ? -111.282 -13.424 -30.002 1.00 99.99  ? 129 THR Z CG2 1  
ATOM 8299   N N   . ASP C 3 127 ? -115.424 -12.621 -28.012 1.00 30.00  ? 130 ASP Z N   1  
ATOM 8300   C CA  . ASP C 3 127 ? -116.411 -11.860 -27.264 1.00 30.00  ? 130 ASP Z CA  1  
ATOM 8301   C C   . ASP C 3 127 ? -115.911 -10.477 -26.892 1.00 30.00  ? 130 ASP Z C   1  
ATOM 8302   O O   . ASP C 3 127 ? -116.023 -10.062 -25.735 1.00 30.00  ? 130 ASP Z O   1  
ATOM 8303   C CB  . ASP C 3 127 ? -116.764 -12.594 -25.976 1.00 99.99  ? 130 ASP Z CB  1  
ATOM 8304   C CG  . ASP C 3 127 ? -117.539 -13.866 -26.308 1.00 99.99  ? 130 ASP Z CG  1  
ATOM 8305   O OD1 . ASP C 3 127 ? -118.655 -13.730 -26.875 1.00 99.99  ? 130 ASP Z OD1 1  
ATOM 8306   O OD2 . ASP C 3 127 ? -117.006 -14.964 -25.991 1.00 99.99  ? 130 ASP Z OD2 1  
ATOM 8307   N N   . LEU C 3 128 ? -115.357 -9.765  -27.870 1.00 30.00  ? 131 LEU Z N   1  
ATOM 8308   C CA  . LEU C 3 128 ? -114.839 -8.412  -27.670 1.00 30.00  ? 131 LEU Z CA  1  
ATOM 8309   C C   . LEU C 3 128 ? -116.019 -7.443  -27.490 1.00 30.00  ? 131 LEU Z C   1  
ATOM 8310   O O   . LEU C 3 128 ? -116.999 -7.504  -28.230 1.00 30.00  ? 131 LEU Z O   1  
ATOM 8311   C CB  . LEU C 3 128 ? -114.013 -7.988  -28.877 1.00 99.99  ? 131 LEU Z CB  1  
ATOM 8312   C CG  . LEU C 3 128 ? -112.540 -8.284  -28.618 1.00 99.99  ? 131 LEU Z CG  1  
ATOM 8313   C CD1 . LEU C 3 128 ? -111.687 -7.571  -29.663 1.00 99.99  ? 131 LEU Z CD1 1  
ATOM 8314   C CD2 . LEU C 3 128 ? -112.161 -7.791  -27.227 1.00 99.99  ? 131 LEU Z CD2 1  
ATOM 8315   N N   . GLN C 3 129 ? -115.932 -6.549  -26.507 1.00 30.00  ? 132 GLN Z N   1  
ATOM 8316   C CA  . GLN C 3 129 ? -117.025 -5.605  -26.276 1.00 30.00  ? 132 GLN Z CA  1  
ATOM 8317   C C   . GLN C 3 129 ? -116.599 -4.138  -26.183 1.00 30.00  ? 132 GLN Z C   1  
ATOM 8318   O O   . GLN C 3 129 ? -115.537 -3.817  -25.653 1.00 30.00  ? 132 GLN Z O   1  
ATOM 8319   C CB  . GLN C 3 129 ? -117.725 -5.936  -24.963 1.00 99.99  ? 132 GLN Z CB  1  
ATOM 8320   C CG  . GLN C 3 129 ? -117.848 -4.677  -24.116 1.00 99.99  ? 132 GLN Z CG  1  
ATOM 8321   C CD  . GLN C 3 129 ? -116.495 -4.242  -23.576 1.00 99.99  ? 132 GLN Z CD  1  
ATOM 8322   O OE1 . GLN C 3 129 ? -115.481 -4.887  -23.841 1.00 99.99  ? 132 GLN Z OE1 1  
ATOM 8323   N NE2 . GLN C 3 129 ? -116.476 -3.142  -22.818 1.00 99.99  ? 132 GLN Z NE2 1  
ATOM 8324   N N   . GLU C 3 130 ? -117.448 -3.255  -26.702 1.00 30.00  ? 133 GLU Z N   1  
ATOM 8325   C CA  . GLU C 3 130 ? -117.187 -1.819  -26.689 1.00 30.00  ? 133 GLU Z CA  1  
ATOM 8326   C C   . GLU C 3 130 ? -117.907 -1.181  -25.513 1.00 30.00  ? 133 GLU Z C   1  
ATOM 8327   O O   . GLU C 3 130 ? -118.859 -1.753  -24.980 1.00 30.00  ? 133 GLU Z O   1  
ATOM 8328   C CB  . GLU C 3 130 ? -117.684 -1.188  -27.983 1.00 99.99  ? 133 GLU Z CB  1  
ATOM 8329   C CG  . GLU C 3 130 ? -119.151 -1.484  -28.158 1.00 99.99  ? 133 GLU Z CG  1  
ATOM 8330   C CD  . GLU C 3 130 ? -119.327 -2.916  -28.661 1.00 99.99  ? 133 GLU Z CD  1  
ATOM 8331   O OE1 . GLU C 3 130 ? -119.445 -3.820  -27.793 1.00 99.99  ? 133 GLU Z OE1 1  
ATOM 8332   O OE2 . GLU C 3 130 ? -119.342 -3.091  -29.909 1.00 99.99  ? 133 GLU Z OE2 1  
ATOM 8333   N N   . ASP C 3 131 ? -117.455 0.006   -25.114 1.00 30.00  ? 134 ASP Z N   1  
ATOM 8334   C CA  . ASP C 3 131 ? -118.072 0.718   -24.004 1.00 30.00  ? 134 ASP Z CA  1  
ATOM 8335   C C   . ASP C 3 131 ? -119.146 1.641   -24.552 1.00 30.00  ? 134 ASP Z C   1  
ATOM 8336   O O   . ASP C 3 131 ? -119.607 1.470   -25.685 1.00 30.00  ? 134 ASP Z O   1  
ATOM 8337   C CB  . ASP C 3 131 ? -117.020 1.536   -23.266 1.00 99.99  ? 134 ASP Z CB  1  
ATOM 8338   C CG  . ASP C 3 131 ? -116.187 2.328   -24.270 1.00 99.99  ? 134 ASP Z CG  1  
ATOM 8339   O OD1 . ASP C 3 131 ? -115.615 1.677   -25.183 1.00 99.99  ? 134 ASP Z OD1 1  
ATOM 8340   O OD2 . ASP C 3 131 ? -116.133 3.577   -24.115 1.00 99.99  ? 134 ASP Z OD2 1  
ATOM 8341   N N   . LEU C 3 132 ? -119.542 2.620   -23.746 1.00 30.00  ? 135 LEU Z N   1  
ATOM 8342   C CA  . LEU C 3 132 ? -120.574 3.586   -24.134 1.00 30.00  ? 135 LEU Z CA  1  
ATOM 8343   C C   . LEU C 3 132 ? -120.156 4.463   -25.318 1.00 30.00  ? 135 LEU Z C   1  
ATOM 8344   O O   . LEU C 3 132 ? -120.983 4.825   -26.162 1.00 30.00  ? 135 LEU Z O   1  
ATOM 8345   C CB  . LEU C 3 132 ? -120.887 4.509   -22.963 1.00 99.99  ? 135 LEU Z CB  1  
ATOM 8346   C CG  . LEU C 3 132 ? -122.085 3.965   -22.193 1.00 99.99  ? 135 LEU Z CG  1  
ATOM 8347   C CD1 . LEU C 3 132 ? -122.602 5.038   -21.237 1.00 99.99  ? 135 LEU Z CD1 1  
ATOM 8348   C CD2 . LEU C 3 132 ? -123.189 3.578   -23.173 1.00 99.99  ? 135 LEU Z CD2 1  
ATOM 8349   N N   . GLU C 3 133 ? -118.872 4.805   -25.369 1.00 30.00  ? 136 GLU Z N   1  
ATOM 8350   C CA  . GLU C 3 133 ? -118.334 5.635   -26.436 1.00 30.00  ? 136 GLU Z CA  1  
ATOM 8351   C C   . GLU C 3 133 ? -118.048 4.810   -27.687 1.00 30.00  ? 136 GLU Z C   1  
ATOM 8352   O O   . GLU C 3 133 ? -117.699 5.355   -28.735 1.00 30.00  ? 136 GLU Z O   1  
ATOM 8353   C CB  . GLU C 3 133 ? -117.033 6.286   -25.980 1.00 99.99  ? 136 GLU Z CB  1  
ATOM 8354   C CG  . GLU C 3 133 ? -117.315 7.235   -24.843 1.00 99.99  ? 136 GLU Z CG  1  
ATOM 8355   C CD  . GLU C 3 133 ? -118.038 8.472   -25.376 1.00 99.99  ? 136 GLU Z CD  1  
ATOM 8356   O OE1 . GLU C 3 133 ? -119.295 8.435   -25.405 1.00 99.99  ? 136 GLU Z OE1 1  
ATOM 8357   O OE2 . GLU C 3 133 ? -117.321 9.440   -25.751 1.00 99.99  ? 136 GLU Z OE2 1  
ATOM 8358   N N   . GLY C 3 134 ? -118.196 3.494   -27.563 1.00 30.00  ? 137 GLY Z N   1  
ATOM 8359   C CA  . GLY C 3 134 ? -117.956 2.595   -28.676 1.00 30.00  ? 137 GLY Z CA  1  
ATOM 8360   C C   . GLY C 3 134 ? -116.482 2.305   -28.921 1.00 30.00  ? 137 GLY Z C   1  
ATOM 8361   O O   . GLY C 3 134 ? -116.065 2.132   -30.072 1.00 30.00  ? 137 GLY Z O   1  
ATOM 8362   N N   . ASN C 3 135 ? -115.690 2.241   -27.848 1.00 30.00  ? 138 ASN Z N   1  
ATOM 8363   C CA  . ASN C 3 135 ? -114.256 1.973   -27.953 1.00 30.00  ? 138 ASN Z CA  1  
ATOM 8364   C C   . ASN C 3 135 ? -113.888 0.646   -27.326 1.00 30.00  ? 138 ASN Z C   1  
ATOM 8365   O O   . ASN C 3 135 ? -114.627 0.105   -26.511 1.00 30.00  ? 138 ASN Z O   1  
ATOM 8366   C CB  . ASN C 3 135 ? -113.470 3.070   -27.245 1.00 99.99  ? 138 ASN Z CB  1  
ATOM 8367   C CG  . ASN C 3 135 ? -113.689 3.018   -25.740 1.00 99.99  ? 138 ASN Z CG  1  
ATOM 8368   O OD1 . ASN C 3 135 ? -114.235 3.948   -25.156 1.00 99.99  ? 138 ASN Z OD1 1  
ATOM 8369   N ND2 . ASN C 3 135 ? -113.254 1.922   -25.111 1.00 99.99  ? 138 ASN Z ND2 1  
ATOM 8370   N N   . VAL C 3 136 ? -112.731 0.130   -27.708 1.00 30.00  ? 139 VAL Z N   1  
ATOM 8371   C CA  . VAL C 3 136 ? -112.267 -1.141  -27.189 1.00 30.00  ? 139 VAL Z CA  1  
ATOM 8372   C C   . VAL C 3 136 ? -110.782 -1.146  -26.880 1.00 30.00  ? 139 VAL Z C   1  
ATOM 8373   O O   . VAL C 3 136 ? -109.983 -0.519  -27.579 1.00 30.00  ? 139 VAL Z O   1  
ATOM 8374   C CB  . VAL C 3 136 ? -112.527 -2.244  -28.213 1.00 99.99  ? 139 VAL Z CB  1  
ATOM 8375   C CG1 . VAL C 3 136 ? -114.024 -2.330  -28.498 1.00 99.99  ? 139 VAL Z CG1 1  
ATOM 8376   C CG2 . VAL C 3 136 ? -111.782 -1.925  -29.504 1.00 99.99  ? 139 VAL Z CG2 1  
ATOM 8377   N N   . LYS C 3 137 ? -110.409 -1.855  -25.819 1.00 30.00  ? 140 LYS Z N   1  
ATOM 8378   C CA  . LYS C 3 137 ? -109.012 -1.945  -25.432 1.00 30.00  ? 140 LYS Z CA  1  
ATOM 8379   C C   . LYS C 3 137 ? -108.344 -2.932  -26.378 1.00 30.00  ? 140 LYS Z C   1  
ATOM 8380   O O   . LYS C 3 137 ? -108.512 -4.143  -26.260 1.00 30.00  ? 140 LYS Z O   1  
ATOM 8381   C CB  . LYS C 3 137 ? -108.902 -2.432  -23.991 1.00 99.99  ? 140 LYS Z CB  1  
ATOM 8382   C CG  . LYS C 3 137 ? -109.595 -1.439  -23.063 1.00 99.99  ? 140 LYS Z CG  1  
ATOM 8383   C CD  . LYS C 3 137 ? -108.690 -0.232  -22.844 1.00 99.99  ? 140 LYS Z CD  1  
ATOM 8384   C CE  . LYS C 3 137 ? -109.304 0.676   -21.785 1.00 99.99  ? 140 LYS Z CE  1  
ATOM 8385   N NZ  . LYS C 3 137 ? -108.581 1.955   -21.757 1.00 99.99  ? 140 LYS Z NZ  1  
ATOM 8386   N N   . TYR C 3 138 ? -107.590 -2.420  -27.335 1.00 30.00  ? 141 TYR Z N   1  
ATOM 8387   C CA  . TYR C 3 138 ? -106.943 -3.307  -28.270 1.00 30.00  ? 141 TYR Z CA  1  
ATOM 8388   C C   . TYR C 3 138 ? -105.946 -4.206  -27.581 1.00 30.00  ? 141 TYR Z C   1  
ATOM 8389   O O   . TYR C 3 138 ? -105.506 -5.198  -28.166 1.00 30.00  ? 141 TYR Z O   1  
ATOM 8390   C CB  . TYR C 3 138 ? -106.202 -2.498  -29.327 1.00 99.99  ? 141 TYR Z CB  1  
ATOM 8391   C CG  . TYR C 3 138 ? -105.527 -3.436  -30.299 1.00 99.99  ? 141 TYR Z CG  1  
ATOM 8392   C CD1 . TYR C 3 138 ? -106.257 -3.981  -31.364 1.00 99.99  ? 141 TYR Z CD1 1  
ATOM 8393   C CD2 . TYR C 3 138 ? -104.176 -3.759  -30.139 1.00 99.99  ? 141 TYR Z CD2 1  
ATOM 8394   C CE1 . TYR C 3 138 ? -105.633 -4.850  -32.267 1.00 99.99  ? 141 TYR Z CE1 1  
ATOM 8395   C CE2 . TYR C 3 138 ? -103.552 -4.629  -31.040 1.00 99.99  ? 141 TYR Z CE2 1  
ATOM 8396   C CZ  . TYR C 3 138 ? -104.281 -5.175  -32.106 1.00 99.99  ? 141 TYR Z CZ  1  
ATOM 8397   O OH  . TYR C 3 138 ? -103.674 -6.022  -32.982 1.00 99.99  ? 141 TYR Z OH  1  
ATOM 8398   N N   . GLU C 3 139 ? -105.581 -3.886  -26.349 1.00 30.00  ? 142 GLU Z N   1  
ATOM 8399   C CA  . GLU C 3 139 ? -104.618 -4.745  -25.679 1.00 30.00  ? 142 GLU Z CA  1  
ATOM 8400   C C   . GLU C 3 139 ? -105.240 -6.101  -25.360 1.00 30.00  ? 142 GLU Z C   1  
ATOM 8401   O O   . GLU C 3 139 ? -104.620 -7.144  -25.583 1.00 30.00  ? 142 GLU Z O   1  
ATOM 8402   C CB  . GLU C 3 139 ? -104.161 -4.096  -24.376 1.00 99.99  ? 142 GLU Z CB  1  
ATOM 8403   C CG  . GLU C 3 139 ? -103.410 -2.821  -24.682 1.00 99.99  ? 142 GLU Z CG  1  
ATOM 8404   C CD  . GLU C 3 139 ? -102.047 -3.165  -25.281 1.00 99.99  ? 142 GLU Z CD  1  
ATOM 8405   O OE1 . GLU C 3 139 ? -101.982 -3.279  -26.533 1.00 99.99  ? 142 GLU Z OE1 1  
ATOM 8406   O OE2 . GLU C 3 139 ? -101.087 -3.309  -24.478 1.00 99.99  ? 142 GLU Z OE2 1  
ATOM 8407   N N   . ASP C 3 140 ? -106.464 -6.068  -24.836 1.00 30.00  ? 143 ASP Z N   1  
ATOM 8408   C CA  . ASP C 3 140 ? -107.209 -7.272  -24.480 1.00 30.00  ? 143 ASP Z CA  1  
ATOM 8409   C C   . ASP C 3 140 ? -107.365 -8.151  -25.718 1.00 30.00  ? 143 ASP Z C   1  
ATOM 8410   O O   . ASP C 3 140 ? -106.927 -9.308  -25.748 1.00 30.00  ? 143 ASP Z O   1  
ATOM 8411   C CB  . ASP C 3 140 ? -108.587 -6.891  -23.953 1.00 99.99  ? 143 ASP Z CB  1  
ATOM 8412   C CG  . ASP C 3 140 ? -109.264 -8.121  -23.354 1.00 99.99  ? 143 ASP Z CG  1  
ATOM 8413   O OD1 . ASP C 3 140 ? -109.802 -8.931  -24.157 1.00 99.99  ? 143 ASP Z OD1 1  
ATOM 8414   O OD2 . ASP C 3 140 ? -109.233 -8.246  -22.101 1.00 99.99  ? 143 ASP Z OD2 1  
ATOM 8415   N N   . PHE C 3 141 ? -107.996 -7.590  -26.742 1.00 30.00  ? 144 PHE Z N   1  
ATOM 8416   C CA  . PHE C 3 141 ? -108.211 -8.295  -27.998 1.00 30.00  ? 144 PHE Z CA  1  
ATOM 8417   C C   . PHE C 3 141 ? -106.959 -9.047  -28.459 1.00 30.00  ? 144 PHE Z C   1  
ATOM 8418   O O   . PHE C 3 141 ? -106.982 -10.256 -28.596 1.00 30.00  ? 144 PHE Z O   1  
ATOM 8419   C CB  . PHE C 3 141 ? -108.592 -7.300  -29.090 1.00 99.99  ? 144 PHE Z CB  1  
ATOM 8420   C CG  . PHE C 3 141 ? -108.814 -8.038  -30.387 1.00 99.99  ? 144 PHE Z CG  1  
ATOM 8421   C CD1 . PHE C 3 141 ? -109.996 -8.759  -30.589 1.00 99.99  ? 144 PHE Z CD1 1  
ATOM 8422   C CD2 . PHE C 3 141 ? -107.837 -8.003  -31.388 1.00 99.99  ? 144 PHE Z CD2 1  
ATOM 8423   C CE1 . PHE C 3 141 ? -110.205 -9.443  -31.791 1.00 99.99  ? 144 PHE Z CE1 1  
ATOM 8424   C CE2 . PHE C 3 141 ? -108.045 -8.689  -32.592 1.00 99.99  ? 144 PHE Z CE2 1  
ATOM 8425   C CZ  . PHE C 3 141 ? -109.228 -9.408  -32.793 1.00 99.99  ? 144 PHE Z CZ  1  
ATOM 8426   N N   . VAL C 3 142 ? -105.867 -8.338  -28.697 1.00 30.00  ? 145 VAL Z N   1  
ATOM 8427   C CA  . VAL C 3 142 ? -104.626 -8.982  -29.149 1.00 30.00  ? 145 VAL Z CA  1  
ATOM 8428   C C   . VAL C 3 142 ? -104.269 -10.186 -28.306 1.00 30.00  ? 145 VAL Z C   1  
ATOM 8429   O O   . VAL C 3 142 ? -103.784 -11.193 -28.824 1.00 30.00  ? 145 VAL Z O   1  
ATOM 8430   C CB  . VAL C 3 142 ? -103.470 -7.995  -29.070 1.00 99.99  ? 145 VAL Z CB  1  
ATOM 8431   C CG1 . VAL C 3 142 ? -103.763 -6.794  -29.964 1.00 99.99  ? 145 VAL Z CG1 1  
ATOM 8432   C CG2 . VAL C 3 142 ? -103.294 -7.526  -27.630 1.00 99.99  ? 145 VAL Z CG2 1  
ATOM 8433   N N   . LYS C 3 143 ? -104.504 -10.071 -27.001 1.00 30.00  ? 146 LYS Z N   1  
ATOM 8434   C CA  . LYS C 3 143 ? -104.188 -11.146 -26.066 1.00 30.00  ? 146 LYS Z CA  1  
ATOM 8435   C C   . LYS C 3 143 ? -105.024 -12.425 -26.282 1.00 30.00  ? 146 LYS Z C   1  
ATOM 8436   O O   . LYS C 3 143 ? -104.508 -13.543 -26.165 1.00 30.00  ? 146 LYS Z O   1  
ATOM 8437   C CB  . LYS C 3 143 ? -104.443 -10.683 -24.636 1.00 99.99  ? 146 LYS Z CB  1  
ATOM 8438   C CG  . LYS C 3 143 ? -104.019 -11.777 -23.663 1.00 99.99  ? 146 LYS Z CG  1  
ATOM 8439   C CD  . LYS C 3 143 ? -103.844 -11.178 -22.269 1.00 99.99  ? 146 LYS Z CD  1  
ATOM 8440   C CE  . LYS C 3 143 ? -103.787 -12.302 -21.239 1.00 99.99  ? 146 LYS Z CE  1  
ATOM 8441   N NZ  . LYS C 3 143 ? -102.386 -12.661 -20.980 1.00 99.99  ? 146 LYS Z NZ  1  
ATOM 8442   N N   . LYS C 3 144 ? -106.310 -12.247 -26.602 1.00 30.00  ? 147 LYS Z N   1  
ATOM 8443   C CA  . LYS C 3 144 ? -107.204 -13.366 -26.849 1.00 30.00  ? 147 LYS Z CA  1  
ATOM 8444   C C   . LYS C 3 144 ? -106.774 -14.047 -28.139 1.00 30.00  ? 147 LYS Z C   1  
ATOM 8445   O O   . LYS C 3 144 ? -106.432 -15.224 -28.135 1.00 30.00  ? 147 LYS Z O   1  
ATOM 8446   C CB  . LYS C 3 144 ? -108.637 -12.863 -26.982 1.00 99.99  ? 147 LYS Z CB  1  
ATOM 8447   C CG  . LYS C 3 144 ? -109.045 -12.141 -25.703 1.00 99.99  ? 147 LYS Z CG  1  
ATOM 8448   C CD  . LYS C 3 144 ? -110.509 -11.723 -25.798 1.00 99.99  ? 147 LYS Z CD  1  
ATOM 8449   C CE  . LYS C 3 144 ? -110.922 -11.025 -24.508 1.00 99.99  ? 147 LYS Z CE  1  
ATOM 8450   N NZ  . LYS C 3 144 ? -112.388 -11.048 -24.385 1.00 99.99  ? 147 LYS Z NZ  1  
ATOM 8451   N N   . VAL C 3 145 ? -106.797 -13.300 -29.241 1.00 30.00  ? 148 VAL Z N   1  
ATOM 8452   C CA  . VAL C 3 145 ? -106.398 -13.828 -30.547 1.00 30.00  ? 148 VAL Z CA  1  
ATOM 8453   C C   . VAL C 3 145 ? -105.112 -14.631 -30.395 1.00 30.00  ? 148 VAL Z C   1  
ATOM 8454   O O   . VAL C 3 145 ? -104.939 -15.693 -31.002 1.00 30.00  ? 148 VAL Z O   1  
ATOM 8455   C CB  . VAL C 3 145 ? -106.163 -12.678 -31.520 1.00 99.99  ? 148 VAL Z CB  1  
ATOM 8456   C CG1 . VAL C 3 145 ? -107.450 -11.872 -31.674 1.00 99.99  ? 148 VAL Z CG1 1  
ATOM 8457   C CG2 . VAL C 3 145 ? -105.057 -11.774 -30.985 1.00 99.99  ? 148 VAL Z CG2 1  
ATOM 8458   N N   . MET C 3 146 ? -104.216 -14.107 -29.578 1.00 30.00  ? 149 MET Z N   1  
ATOM 8459   C CA  . MET C 3 146 ? -102.938 -14.748 -29.329 1.00 30.00  ? 149 MET Z CA  1  
ATOM 8460   C C   . MET C 3 146 ? -103.156 -16.006 -28.492 1.00 30.00  ? 149 MET Z C   1  
ATOM 8461   O O   . MET C 3 146 ? -102.485 -17.020 -28.692 1.00 30.00  ? 149 MET Z O   1  
ATOM 8462   C CB  . MET C 3 146 ? -102.013 -13.794 -28.578 1.00 99.99  ? 149 MET Z CB  1  
ATOM 8463   C CG  . MET C 3 146 ? -101.651 -12.622 -29.479 1.00 99.99  ? 149 MET Z CG  1  
ATOM 8464   S SD  . MET C 3 146 ? -100.678 -13.203 -30.891 1.00 99.99  ? 149 MET Z SD  1  
ATOM 8465   C CE  . MET C 3 146 ? -99.171  -13.658 -30.060 1.00 99.99  ? 149 MET Z CE  1  
ATOM 8466   N N   . ALA C 3 147 ? -104.105 -15.915 -27.559 1.00 30.00  ? 150 ALA Z N   1  
ATOM 8467   C CA  . ALA C 3 147 ? -104.468 -17.003 -26.648 1.00 30.00  ? 150 ALA Z CA  1  
ATOM 8468   C C   . ALA C 3 147 ? -104.755 -18.313 -27.369 1.00 30.00  ? 150 ALA Z C   1  
ATOM 8469   O O   . ALA C 3 147 ? -104.072 -19.323 -27.159 1.00 30.00  ? 150 ALA Z O   1  
ATOM 8470   C CB  . ALA C 3 147 ? -105.701 -16.595 -25.814 1.00 30.00  ? 150 ALA Z CB  1  
ATOM 8471   N N   . GLY C 3 148 ? -105.776 -18.286 -28.217 1.00 30.00  ? 151 GLY Z N   1  
ATOM 8472   C CA  . GLY C 3 148 ? -106.155 -19.469 -28.957 1.00 30.00  ? 151 GLY Z CA  1  
ATOM 8473   C C   . GLY C 3 148 ? -107.648 -19.603 -28.778 1.00 30.00  ? 151 GLY Z C   1  
ATOM 8474   O O   . GLY C 3 148 ? -108.238 -18.862 -27.982 1.00 30.00  ? 151 GLY Z O   1  
ATOM 8475   N N   . PRO C 3 149 ? -108.295 -20.540 -29.507 1.00 30.00  ? 152 PRO Z N   1  
ATOM 8476   C CA  . PRO C 3 149 ? -109.749 -20.734 -29.396 1.00 30.00  ? 152 PRO Z CA  1  
ATOM 8477   C C   . PRO C 3 149 ? -110.092 -21.443 -28.086 1.00 30.00  ? 152 PRO Z C   1  
ATOM 8478   O O   . PRO C 3 149 ? -111.183 -21.286 -27.520 1.00 30.00  ? 152 PRO Z O   1  
ATOM 8479   C CB  . PRO C 3 149 ? -109.940 -21.595 -30.593 1.00 99.99  ? 152 PRO Z CB  1  
ATOM 8480   C CG  . PRO C 3 149 ? -108.581 -21.722 -31.241 1.00 99.99  ? 152 PRO Z CG  1  
ATOM 8481   C CD  . PRO C 3 149 ? -107.664 -21.072 -30.639 1.00 99.99  ? 152 PRO Z CD  1  
ATOM 8482   N N   . TYR C 3 150 ? -109.126 -22.224 -27.613 1.00 30.00  ? 153 TYR Z N   1  
ATOM 8483   C CA  . TYR C 3 150 ? -109.263 -22.971 -26.372 1.00 30.00  ? 153 TYR Z CA  1  
ATOM 8484   C C   . TYR C 3 150 ? -108.052 -22.628 -25.498 1.00 30.00  ? 153 TYR Z C   1  
ATOM 8485   O O   . TYR C 3 150 ? -106.931 -23.087 -25.747 1.00 30.00  ? 153 TYR Z O   1  
ATOM 8486   C CB  . TYR C 3 150 ? -109.300 -24.466 -26.666 1.00 99.99  ? 153 TYR Z CB  1  
ATOM 8487   C CG  . TYR C 3 150 ? -109.443 -25.232 -25.373 1.00 99.99  ? 153 TYR Z CG  1  
ATOM 8488   C CD1 . TYR C 3 150 ? -110.709 -25.409 -24.801 1.00 99.99  ? 153 TYR Z CD1 1  
ATOM 8489   C CD2 . TYR C 3 150 ? -108.310 -25.760 -24.742 1.00 99.99  ? 153 TYR Z CD2 1  
ATOM 8490   C CE1 . TYR C 3 150 ? -110.843 -26.120 -23.603 1.00 99.99  ? 153 TYR Z CE1 1  
ATOM 8491   C CE2 . TYR C 3 150 ? -108.445 -26.471 -23.545 1.00 99.99  ? 153 TYR Z CE2 1  
ATOM 8492   C CZ  . TYR C 3 150 ? -109.710 -26.648 -22.976 1.00 99.99  ? 153 TYR Z CZ  1  
ATOM 8493   O OH  . TYR C 3 150 ? -109.838 -27.339 -21.806 1.00 99.99  ? 153 TYR Z OH  1  
ATOM 8494   N N   . PRO C 3 151 ? -108.262 -21.780 -24.474 1.00 30.00  ? 154 PRO Z N   1  
ATOM 8495   C CA  . PRO C 3 151 ? -107.228 -21.341 -23.535 1.00 30.00  ? 154 PRO Z CA  1  
ATOM 8496   C C   . PRO C 3 151 ? -107.206 -22.101 -22.194 1.00 30.00  ? 154 PRO Z C   1  
ATOM 8497   O O   . PRO C 3 151 ? -108.210 -22.030 -21.443 1.00 30.00  ? 154 PRO Z O   1  
ATOM 8498   C CB  . PRO C 3 151 ? -107.683 -19.934 -23.361 1.00 99.99  ? 154 PRO Z CB  1  
ATOM 8499   C CG  . PRO C 3 151 ? -108.878 -19.761 -24.268 1.00 99.99  ? 154 PRO Z CG  1  
ATOM 8500   C CD  . PRO C 3 151 ? -109.167 -20.811 -24.935 1.00 99.99  ? 154 PRO Z CD  1  
ATOM 8501   O OXT . PRO C 3 151 ? -106.179 -22.757 -21.897 1.00 30.00  ? 154 PRO Z OXT 1  
ATOM 8502   N N   . PHE A 1 1   ? -79.697  52.179  -48.043 1.00 30.00  ? 5   PHE C N   2  
ATOM 8503   C CA  . PHE A 1 1   ? -80.698  52.809  -47.126 1.00 30.00  ? 5   PHE C CA  2  
ATOM 8504   C C   . PHE A 1 1   ? -80.528  54.323  -47.233 1.00 30.00  ? 5   PHE C C   2  
ATOM 8505   O O   . PHE A 1 1   ? -81.205  55.091  -46.534 1.00 30.00  ? 5   PHE C O   2  
ATOM 8506   C CB  . PHE A 1 1   ? -80.454  52.348  -45.694 1.00 99.99  ? 5   PHE C CB  2  
ATOM 8507   C CG  . PHE A 1 1   ? -81.467  52.987  -44.777 1.00 99.99  ? 5   PHE C CG  2  
ATOM 8508   C CD1 . PHE A 1 1   ? -82.742  52.420  -44.638 1.00 99.99  ? 5   PHE C CD1 2  
ATOM 8509   C CD2 . PHE A 1 1   ? -81.134  54.146  -44.063 1.00 99.99  ? 5   PHE C CD2 2  
ATOM 8510   C CE1 . PHE A 1 1   ? -83.682  53.013  -43.788 1.00 99.99  ? 5   PHE C CE1 2  
ATOM 8511   C CE2 . PHE A 1 1   ? -82.077  54.735  -43.214 1.00 99.99  ? 5   PHE C CE2 2  
ATOM 8512   C CZ  . PHE A 1 1   ? -83.349  54.172  -43.076 1.00 99.99  ? 5   PHE C CZ  2  
ATOM 8513   N N   . SER A 1 2   ? -79.597  54.674  -48.105 1.00 30.00  ? 6   SER C N   2  
ATOM 8514   C CA  . SER A 1 2   ? -79.239  56.067  -48.398 1.00 30.00  ? 6   SER C CA  2  
ATOM 8515   C C   . SER A 1 2   ? -78.119  56.541  -47.462 1.00 30.00  ? 6   SER C C   2  
ATOM 8516   O O   . SER A 1 2   ? -77.706  57.708  -47.502 1.00 30.00  ? 6   SER C O   2  
ATOM 8517   C CB  . SER A 1 2   ? -80.454  56.967  -48.206 1.00 99.99  ? 6   SER C CB  2  
ATOM 8518   O OG  . SER A 1 2   ? -81.508  56.540  -49.074 1.00 99.99  ? 6   SER C OG  2  
ATOM 8519   N N   . ASP A 1 3   ? -77.658  55.613  -46.647 1.00 30.00  ? 7   ASP C N   2  
ATOM 8520   C CA  . ASP A 1 3   ? -76.608  55.880  -45.645 1.00 30.00  ? 7   ASP C CA  2  
ATOM 8521   C C   . ASP A 1 3   ? -75.227  55.983  -46.298 1.00 30.00  ? 7   ASP C C   2  
ATOM 8522   O O   . ASP A 1 3   ? -74.688  54.993  -46.815 1.00 30.00  ? 7   ASP C O   2  
ATOM 8523   C CB  . ASP A 1 3   ? -76.574  54.754  -44.618 1.00 99.99  ? 7   ASP C CB  2  
ATOM 8524   C CG  . ASP A 1 3   ? -76.570  53.407  -45.338 1.00 99.99  ? 7   ASP C CG  2  
ATOM 8525   O OD1 . ASP A 1 3   ? -77.514  53.184  -46.145 1.00 99.99  ? 7   ASP C OD1 2  
ATOM 8526   O OD2 . ASP A 1 3   ? -75.625  52.616  -45.077 1.00 99.99  ? 7   ASP C OD2 2  
ATOM 8527   N N   . PRO A 1 4   ? -74.702  57.188  -46.239 1.00 30.00  ? 8   PRO C N   2  
ATOM 8528   C CA  . PRO A 1 4   ? -73.382  57.509  -46.785 1.00 30.00  ? 8   PRO C CA  2  
ATOM 8529   C C   . PRO A 1 4   ? -72.352  56.459  -46.336 1.00 30.00  ? 8   PRO C C   2  
ATOM 8530   O O   . PRO A 1 4   ? -71.426  56.106  -47.069 1.00 30.00  ? 8   PRO C O   2  
ATOM 8531   C CB  . PRO A 1 4   ? -73.192  58.831  -46.130 1.00 99.99  ? 8   PRO C CB  2  
ATOM 8532   C CG  . PRO A 1 4   ? -74.458  59.095  -45.347 1.00 99.99  ? 8   PRO C CG  2  
ATOM 8533   C CD  . PRO A 1 4   ? -75.329  58.172  -45.461 1.00 99.99  ? 8   PRO C CD  2  
ATOM 8534   N N   . ASP A 1 5   ? -72.540  55.958  -45.133 1.00 30.00  ? 9   ASP C N   2  
ATOM 8535   C CA  . ASP A 1 5   ? -71.612  54.988  -44.521 1.00 30.00  ? 9   ASP C CA  2  
ATOM 8536   C C   . ASP A 1 5   ? -71.478  53.676  -45.333 1.00 30.00  ? 9   ASP C C   2  
ATOM 8537   O O   . ASP A 1 5   ? -70.721  52.770  -44.962 1.00 30.00  ? 9   ASP C O   2  
ATOM 8538   C CB  . ASP A 1 5   ? -72.102  54.611  -43.126 1.00 99.99  ? 9   ASP C CB  2  
ATOM 8539   C CG  . ASP A 1 5   ? -73.590  54.270  -43.181 1.00 99.99  ? 9   ASP C CG  2  
ATOM 8540   O OD1 . ASP A 1 5   ? -74.362  55.145  -43.654 1.00 99.99  ? 9   ASP C OD1 2  
ATOM 8541   O OD2 . ASP A 1 5   ? -73.935  53.138  -42.754 1.00 99.99  ? 9   ASP C OD2 2  
ATOM 8542   N N   . PHE A 1 6   ? -72.188  53.565  -46.449 1.00 30.00  ? 10  PHE C N   2  
ATOM 8543   C CA  . PHE A 1 6   ? -72.181  52.306  -47.240 1.00 30.00  ? 10  PHE C CA  2  
ATOM 8544   C C   . PHE A 1 6   ? -71.581  52.462  -48.647 1.00 30.00  ? 10  PHE C C   2  
ATOM 8545   O O   . PHE A 1 6   ? -71.842  51.661  -49.551 1.00 30.00  ? 10  PHE C O   2  
ATOM 8546   C CB  . PHE A 1 6   ? -73.607  51.797  -47.418 1.00 99.99  ? 10  PHE C CB  2  
ATOM 8547   C CG  . PHE A 1 6   ? -74.022  51.941  -48.862 1.00 99.99  ? 10  PHE C CG  2  
ATOM 8548   C CD1 . PHE A 1 6   ? -73.430  52.926  -49.662 1.00 99.99  ? 10  PHE C CD1 2  
ATOM 8549   C CD2 . PHE A 1 6   ? -74.995  51.092  -49.401 1.00 99.99  ? 10  PHE C CD2 2  
ATOM 8550   C CE1 . PHE A 1 6   ? -73.812  53.062  -51.002 1.00 99.99  ? 10  PHE C CE1 2  
ATOM 8551   C CE2 . PHE A 1 6   ? -75.378  51.228  -50.742 1.00 99.99  ? 10  PHE C CE2 2  
ATOM 8552   C CZ  . PHE A 1 6   ? -74.784  52.213  -51.542 1.00 99.99  ? 10  PHE C CZ  2  
ATOM 8553   N N   . GLN A 1 7   ? -70.764  53.469  -48.826 1.00 30.00  ? 11  GLN C N   2  
ATOM 8554   C CA  . GLN A 1 7   ? -70.157  53.756  -50.135 1.00 30.00  ? 11  GLN C CA  2  
ATOM 8555   C C   . GLN A 1 7   ? -69.380  52.563  -50.694 1.00 30.00  ? 11  GLN C C   2  
ATOM 8556   O O   . GLN A 1 7   ? -69.661  52.100  -51.805 1.00 30.00  ? 11  GLN C O   2  
ATOM 8557   C CB  . GLN A 1 7   ? -69.185  54.926  -50.012 1.00 99.99  ? 11  GLN C CB  2  
ATOM 8558   C CG  . GLN A 1 7   ? -69.020  55.596  -51.372 1.00 99.99  ? 11  GLN C CG  2  
ATOM 8559   C CD  . GLN A 1 7   ? -67.961  54.889  -52.207 1.00 99.99  ? 11  GLN C CD  2  
ATOM 8560   O OE1 . GLN A 1 7   ? -67.366  53.912  -51.760 1.00 99.99  ? 11  GLN C OE1 2  
ATOM 8561   N NE2 . GLN A 1 7   ? -67.729  55.389  -53.424 1.00 99.99  ? 11  GLN C NE2 2  
ATOM 8562   N N   . TYR A 1 8   ? -68.415  52.057  -49.937 1.00 30.00  ? 12  TYR C N   2  
ATOM 8563   C CA  . TYR A 1 8   ? -67.630  50.920  -50.403 1.00 30.00  ? 12  TYR C CA  2  
ATOM 8564   C C   . TYR A 1 8   ? -68.071  49.689  -49.662 1.00 30.00  ? 12  TYR C C   2  
ATOM 8565   O O   . TYR A 1 8   ? -67.251  48.819  -49.352 1.00 30.00  ? 12  TYR C O   2  
ATOM 8566   C CB  . TYR A 1 8   ? -66.148  51.173  -50.141 1.00 99.99  ? 12  TYR C CB  2  
ATOM 8567   C CG  . TYR A 1 8   ? -65.661  50.241  -49.061 1.00 99.99  ? 12  TYR C CG  2  
ATOM 8568   C CD1 . TYR A 1 8   ? -66.557  49.749  -48.105 1.00 99.99  ? 12  TYR C CD1 2  
ATOM 8569   C CD2 . TYR A 1 8   ? -64.314  49.867  -49.014 1.00 99.99  ? 12  TYR C CD2 2  
ATOM 8570   C CE1 . TYR A 1 8   ? -66.105  48.884  -47.101 1.00 99.99  ? 12  TYR C CE1 2  
ATOM 8571   C CE2 . TYR A 1 8   ? -63.861  49.003  -48.010 1.00 99.99  ? 12  TYR C CE2 2  
ATOM 8572   C CZ  . TYR A 1 8   ? -64.756  48.511  -47.053 1.00 99.99  ? 12  TYR C CZ  2  
ATOM 8573   O OH  . TYR A 1 8   ? -64.317  47.669  -46.077 1.00 99.99  ? 12  TYR C OH  2  
ATOM 8574   N N   . LEU A 1 9   ? -69.357  49.597  -49.364 1.00 30.00  ? 13  LEU C N   2  
ATOM 8575   C CA  . LEU A 1 9   ? -69.835  48.437  -48.630 1.00 30.00  ? 13  LEU C CA  2  
ATOM 8576   C C   . LEU A 1 9   ? -71.069  47.751  -49.200 1.00 30.00  ? 13  LEU C C   2  
ATOM 8577   O O   . LEU A 1 9   ? -71.229  46.544  -49.027 1.00 30.00  ? 13  LEU C O   2  
ATOM 8578   C CB  . LEU A 1 9   ? -70.195  48.837  -47.203 1.00 99.99  ? 13  LEU C CB  2  
ATOM 8579   C CG  . LEU A 1 9   ? -69.008  48.579  -46.284 1.00 99.99  ? 13  LEU C CG  2  
ATOM 8580   C CD1 . LEU A 1 9   ? -69.462  48.663  -44.831 1.00 99.99  ? 13  LEU C CD1 2  
ATOM 8581   C CD2 . LEU A 1 9   ? -68.442  47.191  -46.563 1.00 99.99  ? 13  LEU C CD2 2  
ATOM 8582   N N   . ALA A 1 10  ? -71.933  48.507  -49.873 1.00 30.00  ? 14  ALA C N   2  
ATOM 8583   C CA  . ALA A 1 10  ? -73.161  47.947  -50.447 1.00 30.00  ? 14  ALA C CA  2  
ATOM 8584   C C   . ALA A 1 10  ? -73.131  47.815  -51.965 1.00 30.00  ? 14  ALA C C   2  
ATOM 8585   O O   . ALA A 1 10  ? -72.721  48.748  -52.661 1.00 30.00  ? 14  ALA C O   2  
ATOM 8586   C CB  . ALA A 1 10  ? -74.343  48.799  -50.045 1.00 30.00  ? 14  ALA C CB  2  
ATOM 8587   N N   . VAL A 1 11  ? -73.572  46.657  -52.464 1.00 30.00  ? 15  VAL C N   2  
ATOM 8588   C CA  . VAL A 1 11  ? -73.604  46.391  -53.908 1.00 30.00  ? 15  VAL C CA  2  
ATOM 8589   C C   . VAL A 1 11  ? -74.494  47.416  -54.594 1.00 30.00  ? 15  VAL C C   2  
ATOM 8590   O O   . VAL A 1 11  ? -75.647  47.624  -54.200 1.00 30.00  ? 15  VAL C O   2  
ATOM 8591   C CB  . VAL A 1 11  ? -74.156  44.994  -54.164 1.00 99.99  ? 15  VAL C CB  2  
ATOM 8592   C CG1 . VAL A 1 11  ? -73.263  43.961  -53.484 1.00 99.99  ? 15  VAL C CG1 2  
ATOM 8593   C CG2 . VAL A 1 11  ? -75.571  44.891  -53.603 1.00 99.99  ? 15  VAL C CG2 2  
ATOM 8594   N N   . ASP A 1 12  ? -73.952  48.053  -55.621 1.00 30.00  ? 16  ASP C N   2  
ATOM 8595   C CA  . ASP A 1 12  ? -74.634  49.082  -56.400 1.00 30.00  ? 16  ASP C CA  2  
ATOM 8596   C C   . ASP A 1 12  ? -76.043  48.724  -56.907 1.00 30.00  ? 16  ASP C C   2  
ATOM 8597   O O   . ASP A 1 12  ? -76.434  47.541  -56.833 1.00 30.00  ? 16  ASP C O   2  
ATOM 8598   C CB  . ASP A 1 12  ? -73.817  49.420  -57.645 1.00 99.99  ? 16  ASP C CB  2  
ATOM 8599   C CG  . ASP A 1 12  ? -73.398  48.128  -58.345 1.00 99.99  ? 16  ASP C CG  2  
ATOM 8600   O OD1 . ASP A 1 12  ? -72.755  47.287  -57.661 1.00 99.99  ? 16  ASP C OD1 2  
ATOM 8601   O OD2 . ASP A 1 12  ? -73.724  47.997  -59.553 1.00 99.99  ? 16  ASP C OD2 2  
ATOM 8602   N N   . GLN A 1 20  ? -78.830  44.658  -63.971 1.00 30.00  ? 24  GLN C N   2  
ATOM 8603   C CA  . GLN A 1 20  ? -78.316  43.272  -64.081 1.00 30.00  ? 24  GLN C CA  2  
ATOM 8604   C C   . GLN A 1 20  ? -79.270  42.415  -64.954 1.00 30.00  ? 24  GLN C C   2  
ATOM 8605   O O   . GLN A 1 20  ? -79.931  41.492  -64.467 1.00 30.00  ? 24  GLN C O   2  
ATOM 8606   C CB  . GLN A 1 20  ? -78.216  42.644  -62.694 1.00 99.99  ? 24  GLN C CB  2  
ATOM 8607   C CG  . GLN A 1 20  ? -78.895  41.280  -62.704 1.00 99.99  ? 24  GLN C CG  2  
ATOM 8608   C CD  . GLN A 1 20  ? -80.406  41.416  -62.809 1.00 99.99  ? 24  GLN C CD  2  
ATOM 8609   O OE1 . GLN A 1 20  ? -80.928  42.530  -62.876 1.00 99.99  ? 24  GLN C OE1 2  
ATOM 8610   N NE2 . GLN A 1 20  ? -81.109  40.282  -62.828 1.00 99.99  ? 24  GLN C NE2 2  
ATOM 8611   N N   . THR A 1 21  ? -79.346  42.698  -66.269 1.00 30.00  ? 25  THR C N   2  
ATOM 8612   C CA  . THR A 1 21  ? -80.295  41.946  -67.139 1.00 30.00  ? 25  THR C CA  2  
ATOM 8613   C C   . THR A 1 21  ? -79.939  41.900  -68.643 1.00 30.00  ? 25  THR C C   2  
ATOM 8614   O O   . THR A 1 21  ? -79.079  42.658  -69.126 1.00 30.00  ? 25  THR C O   2  
ATOM 8615   C CB  . THR A 1 21  ? -81.685  42.567  -67.050 1.00 99.99  ? 25  THR C CB  2  
ATOM 8616   O OG1 . THR A 1 21  ? -82.183  42.439  -65.715 1.00 99.99  ? 25  THR C OG1 2  
ATOM 8617   C CG2 . THR A 1 21  ? -82.625  41.852  -68.014 1.00 99.99  ? 25  THR C CG2 2  
ATOM 8618   N N   . ALA A 1 22  ? -80.664  40.968  -69.287 1.00 30.00  ? 26  ALA C N   2  
ATOM 8619   C CA  . ALA A 1 22  ? -80.649  40.704  -70.747 1.00 30.00  ? 26  ALA C CA  2  
ATOM 8620   C C   . ALA A 1 22  ? -79.610  39.645  -71.168 1.00 30.00  ? 26  ALA C C   2  
ATOM 8621   O O   . ALA A 1 22  ? -79.257  38.748  -70.382 1.00 30.00  ? 26  ALA C O   2  
ATOM 8622   C CB  . ALA A 1 22  ? -80.331  41.979  -71.520 1.00 30.00  ? 26  ALA C CB  2  
ATOM 8623   N N   . ALA A 1 23  ? -79.205  39.834  -72.418 1.00 30.00  ? 27  ALA C N   2  
ATOM 8624   C CA  . ALA A 1 23  ? -78.221  39.013  -73.152 1.00 30.00  ? 27  ALA C CA  2  
ATOM 8625   C C   . ALA A 1 23  ? -77.608  37.925  -72.272 1.00 30.00  ? 27  ALA C C   2  
ATOM 8626   O O   . ALA A 1 23  ? -76.479  38.067  -71.778 1.00 30.00  ? 27  ALA C O   2  
ATOM 8627   C CB  . ALA A 1 23  ? -77.081  39.897  -73.666 1.00 30.00  ? 27  ALA C CB  2  
ATOM 8628   N N   . PHE A 1 24  ? -78.366  36.858  -72.115 1.00 30.00  ? 28  PHE C N   2  
ATOM 8629   C CA  . PHE A 1 24  ? -77.940  35.707  -71.308 1.00 30.00  ? 28  PHE C CA  2  
ATOM 8630   C C   . PHE A 1 24  ? -78.787  34.473  -71.623 1.00 30.00  ? 28  PHE C C   2  
ATOM 8631   O O   . PHE A 1 24  ? -79.955  34.378  -71.212 1.00 30.00  ? 28  PHE C O   2  
ATOM 8632   C CB  . PHE A 1 24  ? -78.086  36.030  -69.825 1.00 99.99  ? 28  PHE C CB  2  
ATOM 8633   C CG  . PHE A 1 24  ? -77.646  34.844  -69.003 1.00 99.99  ? 28  PHE C CG  2  
ATOM 8634   C CD1 . PHE A 1 24  ? -76.288  34.648  -68.727 1.00 99.99  ? 28  PHE C CD1 2  
ATOM 8635   C CD2 . PHE A 1 24  ? -78.595  33.937  -68.516 1.00 99.99  ? 28  PHE C CD2 2  
ATOM 8636   C CE1 . PHE A 1 24  ? -75.877  33.548  -67.964 1.00 99.99  ? 28  PHE C CE1 2  
ATOM 8637   C CE2 . PHE A 1 24  ? -78.187  32.836  -67.754 1.00 99.99  ? 28  PHE C CE2 2  
ATOM 8638   C CZ  . PHE A 1 24  ? -76.828  32.643  -67.478 1.00 99.99  ? 28  PHE C CZ  2  
ATOM 8639   N N   . ASP A 1 25  ? -78.155  33.567  -72.348 1.00 30.00  ? 29  ASP C N   2  
ATOM 8640   C CA  . ASP A 1 25  ? -78.742  32.273  -72.733 1.00 30.00  ? 29  ASP C CA  2  
ATOM 8641   C C   . ASP A 1 25  ? -78.063  31.181  -71.906 1.00 30.00  ? 29  ASP C C   2  
ATOM 8642   O O   . ASP A 1 25  ? -76.866  30.909  -72.064 1.00 30.00  ? 29  ASP C O   2  
ATOM 8643   C CB  . ASP A 1 25  ? -78.515  32.021  -74.219 1.00 99.99  ? 29  ASP C CB  2  
ATOM 8644   C CG  . ASP A 1 25  ? -79.330  30.813  -74.664 1.00 99.99  ? 29  ASP C CG  2  
ATOM 8645   O OD1 . ASP A 1 25  ? -78.860  29.670  -74.406 1.00 99.99  ? 29  ASP C OD1 2  
ATOM 8646   O OD2 . ASP A 1 25  ? -80.420  31.036  -75.256 1.00 99.99  ? 29  ASP C OD2 2  
ATOM 8647   N N   . GLY A 1 26  ? -78.857  30.587  -71.037 1.00 30.00  ? 30  GLY C N   2  
ATOM 8648   C CA  . GLY A 1 26  ? -78.390  29.563  -70.085 1.00 30.00  ? 30  GLY C CA  2  
ATOM 8649   C C   . GLY A 1 26  ? -77.846  28.301  -70.776 1.00 30.00  ? 30  GLY C C   2  
ATOM 8650   O O   . GLY A 1 26  ? -77.431  27.338  -70.114 1.00 30.00  ? 30  GLY C O   2  
ATOM 8651   N N   . LYS A 1 27  ? -77.831  28.295  -72.097 1.00 30.00  ? 31  LYS C N   2  
ATOM 8652   C CA  . LYS A 1 27  ? -77.365  27.113  -72.850 1.00 30.00  ? 31  LYS C CA  2  
ATOM 8653   C C   . LYS A 1 27  ? -76.252  27.457  -73.843 1.00 30.00  ? 31  LYS C C   2  
ATOM 8654   O O   . LYS A 1 27  ? -75.587  26.568  -74.396 1.00 30.00  ? 31  LYS C O   2  
ATOM 8655   C CB  . LYS A 1 27  ? -78.522  26.506  -73.634 1.00 99.99  ? 31  LYS C CB  2  
ATOM 8656   C CG  . LYS A 1 27  ? -78.056  25.228  -74.326 1.00 99.99  ? 31  LYS C CG  2  
ATOM 8657   C CD  . LYS A 1 27  ? -79.268  24.396  -74.729 1.00 99.99  ? 31  LYS C CD  2  
ATOM 8658   C CE  . LYS A 1 27  ? -78.842  23.327  -75.730 1.00 99.99  ? 31  LYS C CE  2  
ATOM 8659   N NZ  . LYS A 1 27  ? -78.539  22.079  -75.014 1.00 99.99  ? 31  LYS C NZ  2  
ATOM 8660   N N   . LYS A 1 28  ? -76.068  28.738  -74.062 1.00 30.00  ? 32  LYS C N   2  
ATOM 8661   C CA  . LYS A 1 28  ? -75.048  29.227  -74.993 1.00 30.00  ? 32  LYS C CA  2  
ATOM 8662   C C   . LYS A 1 28  ? -73.827  29.735  -74.225 1.00 30.00  ? 32  LYS C C   2  
ATOM 8663   O O   . LYS A 1 28  ? -72.676  29.449  -74.597 1.00 30.00  ? 32  LYS C O   2  
ATOM 8664   C CB  . LYS A 1 28  ? -75.614  30.369  -75.831 1.00 99.99  ? 32  LYS C CB  2  
ATOM 8665   C CG  . LYS A 1 28  ? -74.579  30.804  -76.863 1.00 99.99  ? 32  LYS C CG  2  
ATOM 8666   C CD  . LYS A 1 28  ? -75.267  31.605  -77.964 1.00 99.99  ? 32  LYS C CD  2  
ATOM 8667   C CE  . LYS A 1 28  ? -74.217  32.348  -78.785 1.00 99.99  ? 32  LYS C CE  2  
ATOM 8668   N NZ  . LYS A 1 28  ? -73.845  31.539  -79.954 1.00 99.99  ? 32  LYS C NZ  2  
ATOM 8669   N N   . ASN A 1 29  ? -74.131  30.461  -73.168 1.00 30.00  ? 33  ASN C N   2  
ATOM 8670   C CA  . ASN A 1 29  ? -73.120  31.109  -72.320 1.00 30.00  ? 33  ASN C CA  2  
ATOM 8671   C C   . ASN A 1 29  ? -72.517  30.155  -71.281 1.00 30.00  ? 33  ASN C C   2  
ATOM 8672   O O   . ASN A 1 29  ? -73.230  29.435  -70.580 1.00 30.00  ? 33  ASN C O   2  
ATOM 8673   C CB  . ASN A 1 29  ? -73.751  32.274  -71.562 1.00 99.99  ? 33  ASN C CB  2  
ATOM 8674   C CG  . ASN A 1 29  ? -72.707  33.322  -71.203 1.00 99.99  ? 33  ASN C CG  2  
ATOM 8675   O OD1 . ASN A 1 29  ? -72.882  34.072  -70.245 1.00 99.99  ? 33  ASN C OD1 2  
ATOM 8676   N ND2 . ASN A 1 29  ? -71.620  33.372  -71.974 1.00 99.99  ? 33  ASN C ND2 2  
ATOM 8677   N N   . CYS A 1 30  ? -71.193  30.156  -71.174 1.00 30.00  ? 34  CYS C N   2  
ATOM 8678   C CA  . CYS A 1 30  ? -70.521  29.275  -70.230 1.00 30.00  ? 34  CYS C CA  2  
ATOM 8679   C C   . CYS A 1 30  ? -69.092  29.761  -69.903 1.00 30.00  ? 34  CYS C C   2  
ATOM 8680   O O   . CYS A 1 30  ? -68.601  30.764  -70.447 1.00 30.00  ? 34  CYS C O   2  
ATOM 8681   C CB  . CYS A 1 30  ? -70.422  27.870  -70.812 1.00 99.99  ? 34  CYS C CB  2  
ATOM 8682   S SG  . CYS A 1 30  ? -69.713  26.607  -69.728 1.00 99.99  ? 34  CYS C SG  2  
ATOM 8683   N N   . TRP A 1 31  ? -68.435  29.028  -69.010 1.00 30.00  ? 35  TRP C N   2  
ATOM 8684   C CA  . TRP A 1 31  ? -67.083  29.352  -68.595 1.00 30.00  ? 35  TRP C CA  2  
ATOM 8685   C C   . TRP A 1 31  ? -66.099  28.402  -69.252 1.00 30.00  ? 35  TRP C C   2  
ATOM 8686   O O   . TRP A 1 31  ? -66.194  27.177  -69.071 1.00 30.00  ? 35  TRP C O   2  
ATOM 8687   C CB  . TRP A 1 31  ? -66.963  29.224  -67.078 1.00 99.99  ? 35  TRP C CB  2  
ATOM 8688   C CG  . TRP A 1 31  ? -67.714  30.266  -66.287 1.00 99.99  ? 35  TRP C CG  2  
ATOM 8689   C CD1 . TRP A 1 31  ? -69.014  30.247  -65.961 1.00 99.99  ? 35  TRP C CD1 2  
ATOM 8690   C CD2 . TRP A 1 31  ? -67.210  31.453  -65.741 1.00 99.99  ? 35  TRP C CD2 2  
ATOM 8691   N NE1 . TRP A 1 31  ? -69.275  31.437  -65.213 1.00 99.99  ? 35  TRP C NE1 2  
ATOM 8692   C CE2 . TRP A 1 31  ? -68.165  32.126  -65.106 1.00 99.99  ? 35  TRP C CE2 2  
ATOM 8693   C CE3 . TRP A 1 31  ? -65.910  31.971  -65.784 1.00 99.99  ? 35  TRP C CE3 2  
ATOM 8694   C CZ2 . TRP A 1 31  ? -67.971  33.350  -64.458 1.00 99.99  ? 35  TRP C CZ2 2  
ATOM 8695   C CZ3 . TRP A 1 31  ? -65.690  33.204  -65.138 1.00 99.99  ? 35  TRP C CZ3 2  
ATOM 8696   C CH2 . TRP A 1 31  ? -66.680  33.866  -64.501 1.00 99.99  ? 35  TRP C CH2 2  
ATOM 8697   N N   . VAL A 1 32  ? -65.152  28.955  -70.009 1.00 30.00  ? 36  VAL C N   2  
ATOM 8698   C CA  . VAL A 1 32  ? -64.129  28.136  -70.663 1.00 30.00  ? 36  VAL C CA  2  
ATOM 8699   C C   . VAL A 1 32  ? -62.751  28.510  -70.132 1.00 30.00  ? 36  VAL C C   2  
ATOM 8700   O O   . VAL A 1 32  ? -62.434  29.689  -69.993 1.00 30.00  ? 36  VAL C O   2  
ATOM 8701   C CB  . VAL A 1 32  ? -64.167  28.364  -72.170 1.00 99.99  ? 36  VAL C CB  2  
ATOM 8702   C CG1 . VAL A 1 32  ? -65.541  27.979  -72.709 1.00 99.99  ? 36  VAL C CG1 2  
ATOM 8703   C CG2 . VAL A 1 32  ? -63.897  29.834  -72.469 1.00 99.99  ? 36  VAL C CG2 2  
ATOM 8704   N N   . PRO A 1 33  ? -61.925  27.509  -69.805 1.00 30.00  ? 37  PRO C N   2  
ATOM 8705   C CA  . PRO A 1 33  ? -60.571  27.763  -69.290 1.00 30.00  ? 37  PRO C CA  2  
ATOM 8706   C C   . PRO A 1 33  ? -59.770  28.813  -70.059 1.00 30.00  ? 37  PRO C C   2  
ATOM 8707   O O   . PRO A 1 33  ? -59.894  28.947  -71.286 1.00 30.00  ? 37  PRO C O   2  
ATOM 8708   C CB  . PRO A 1 33  ? -60.011  26.399  -69.485 1.00 99.99  ? 37  PRO C CB  2  
ATOM 8709   C CG  . PRO A 1 33  ? -61.137  25.555  -70.029 1.00 99.99  ? 37  PRO C CG  2  
ATOM 8710   C CD  . PRO A 1 33  ? -62.236  26.190  -70.160 1.00 99.99  ? 37  PRO C CD  2  
ATOM 8711   N N   . ASP A 1 34  ? -58.950  29.561  -69.327 1.00 30.00  ? 38  ASP C N   2  
ATOM 8712   C CA  . ASP A 1 34  ? -58.111  30.593  -69.922 1.00 30.00  ? 38  ASP C CA  2  
ATOM 8713   C C   . ASP A 1 34  ? -56.736  30.559  -69.252 1.00 30.00  ? 38  ASP C C   2  
ATOM 8714   O O   . ASP A 1 34  ? -56.604  30.036  -68.146 1.00 30.00  ? 38  ASP C O   2  
ATOM 8715   C CB  . ASP A 1 34  ? -58.750  31.964  -69.711 1.00 99.99  ? 38  ASP C CB  2  
ATOM 8716   C CG  . ASP A 1 34  ? -58.007  33.005  -70.542 1.00 99.99  ? 38  ASP C CG  2  
ATOM 8717   O OD1 . ASP A 1 34  ? -56.924  33.448  -70.078 1.00 99.99  ? 38  ASP C OD1 2  
ATOM 8718   O OD2 . ASP A 1 34  ? -58.530  33.350  -71.638 1.00 99.99  ? 38  ASP C OD2 2  
ATOM 8719   N N   . GLU A 1 35  ? -55.714  31.101  -69.919 1.00 30.00  ? 39  GLU C N   2  
ATOM 8720   C CA  . GLU A 1 35  ? -54.352  31.117  -69.352 1.00 30.00  ? 39  GLU C CA  2  
ATOM 8721   C C   . GLU A 1 35  ? -54.055  32.434  -68.613 1.00 30.00  ? 39  GLU C C   2  
ATOM 8722   O O   . GLU A 1 35  ? -53.292  32.456  -67.647 1.00 30.00  ? 39  GLU C O   2  
ATOM 8723   C CB  . GLU A 1 35  ? -53.326  30.955  -70.467 1.00 99.99  ? 39  GLU C CB  2  
ATOM 8724   C CG  . GLU A 1 35  ? -53.513  32.047  -71.489 1.00 99.99  ? 39  GLU C CG  2  
ATOM 8725   C CD  . GLU A 1 35  ? -54.704  31.704  -72.386 1.00 99.99  ? 39  GLU C CD  2  
ATOM 8726   O OE1 . GLU A 1 35  ? -55.835  32.115  -72.021 1.00 99.99  ? 39  GLU C OE1 2  
ATOM 8727   O OE2 . GLU A 1 35  ? -54.467  31.037  -73.428 1.00 99.99  ? 39  GLU C OE2 2  
ATOM 8728   N N   . LYS A 1 36  ? -54.665  33.518  -69.085 1.00 30.00  ? 40  LYS C N   2  
ATOM 8729   C CA  . LYS A 1 36  ? -54.495  34.844  -68.496 1.00 30.00  ? 40  LYS C CA  2  
ATOM 8730   C C   . LYS A 1 36  ? -55.532  35.093  -67.398 1.00 30.00  ? 40  LYS C C   2  
ATOM 8731   O O   . LYS A 1 36  ? -55.183  35.468  -66.282 1.00 30.00  ? 40  LYS C O   2  
ATOM 8732   C CB  . LYS A 1 36  ? -54.658  35.913  -69.570 1.00 99.99  ? 40  LYS C CB  2  
ATOM 8733   C CG  . LYS A 1 36  ? -54.382  37.287  -68.969 1.00 99.99  ? 40  LYS C CG  2  
ATOM 8734   C CD  . LYS A 1 36  ? -54.104  38.286  -70.087 1.00 99.99  ? 40  LYS C CD  2  
ATOM 8735   C CE  . LYS A 1 36  ? -54.197  39.705  -69.535 1.00 99.99  ? 40  LYS C CE  2  
ATOM 8736   N NZ  . LYS A 1 36  ? -52.857  40.166  -69.139 1.00 99.99  ? 40  LYS C NZ  2  
ATOM 8737   N N   . GLU A 1 37  ? -56.800  34.873  -67.734 1.00 30.00  ? 41  GLU C N   2  
ATOM 8738   C CA  . GLU A 1 37  ? -57.915  35.085  -66.811 1.00 30.00  ? 41  GLU C CA  2  
ATOM 8739   C C   . GLU A 1 37  ? -58.408  33.887  -66.017 1.00 30.00  ? 41  GLU C C   2  
ATOM 8740   O O   . GLU A 1 37  ? -59.348  34.020  -65.227 1.00 30.00  ? 41  GLU C O   2  
ATOM 8741   C CB  . GLU A 1 37  ? -59.133  35.587  -67.576 1.00 99.99  ? 41  GLU C CB  2  
ATOM 8742   C CG  . GLU A 1 37  ? -59.903  36.562  -66.719 1.00 99.99  ? 41  GLU C CG  2  
ATOM 8743   C CD  . GLU A 1 37  ? -60.464  35.831  -65.499 1.00 99.99  ? 41  GLU C CD  2  
ATOM 8744   O OE1 . GLU A 1 37  ? -59.742  35.791  -64.469 1.00 99.99  ? 41  GLU C OE1 2  
ATOM 8745   O OE2 . GLU A 1 37  ? -61.612  35.321  -65.613 1.00 99.99  ? 41  GLU C OE2 2  
ATOM 8746   N N   . GLY A 1 38  ? -57.801  32.721  -66.216 1.00 30.00  ? 42  GLY C N   2  
ATOM 8747   C CA  . GLY A 1 38  ? -58.248  31.540  -65.481 1.00 30.00  ? 42  GLY C CA  2  
ATOM 8748   C C   . GLY A 1 38  ? -59.487  30.909  -66.111 1.00 30.00  ? 42  GLY C C   2  
ATOM 8749   O O   . GLY A 1 38  ? -59.565  29.680  -66.257 1.00 30.00  ? 42  GLY C O   2  
ATOM 8750   N N   . PHE A 1 39  ? -60.451  31.757  -66.477 1.00 30.00  ? 43  PHE C N   2  
ATOM 8751   C CA  . PHE A 1 39  ? -61.700  31.331  -67.101 1.00 30.00  ? 43  PHE C CA  2  
ATOM 8752   C C   . PHE A 1 39  ? -62.201  32.460  -67.986 1.00 30.00  ? 43  PHE C C   2  
ATOM 8753   O O   . PHE A 1 39  ? -62.059  33.631  -67.640 1.00 30.00  ? 43  PHE C O   2  
ATOM 8754   C CB  . PHE A 1 39  ? -62.732  31.014  -66.026 1.00 99.99  ? 43  PHE C CB  2  
ATOM 8755   C CG  . PHE A 1 39  ? -62.258  29.849  -65.197 1.00 99.99  ? 43  PHE C CG  2  
ATOM 8756   C CD1 . PHE A 1 39  ? -61.463  30.069  -64.067 1.00 99.99  ? 43  PHE C CD1 2  
ATOM 8757   C CD2 . PHE A 1 39  ? -62.612  28.540  -65.557 1.00 99.99  ? 43  PHE C CD2 2  
ATOM 8758   C CE1 . PHE A 1 39  ? -61.022  28.987  -63.294 1.00 99.99  ? 43  PHE C CE1 2  
ATOM 8759   C CE2 . PHE A 1 39  ? -62.170  27.458  -64.787 1.00 99.99  ? 43  PHE C CE2 2  
ATOM 8760   C CZ  . PHE A 1 39  ? -61.377  27.681  -63.657 1.00 99.99  ? 43  PHE C CZ  2  
ATOM 8761   N N   . ALA A 1 40  ? -62.786  32.114  -69.127 1.00 30.00  ? 44  ALA C N   2  
ATOM 8762   C CA  . ALA A 1 40  ? -63.289  33.130  -70.034 1.00 30.00  ? 44  ALA C CA  2  
ATOM 8763   C C   . ALA A 1 40  ? -64.753  32.953  -70.324 1.00 30.00  ? 44  ALA C C   2  
ATOM 8764   O O   . ALA A 1 40  ? -65.261  31.828  -70.358 1.00 30.00  ? 44  ALA C O   2  
ATOM 8765   C CB  . ALA A 1 40  ? -62.512  33.087  -71.328 1.00 30.00  ? 44  ALA C CB  2  
ATOM 8766   N N   . SER A 1 41  ? -65.431  34.079  -70.528 1.00 30.00  ? 45  SER C N   2  
ATOM 8767   C CA  . SER A 1 41  ? -66.853  34.095  -70.828 1.00 30.00  ? 45  SER C CA  2  
ATOM 8768   C C   . SER A 1 41  ? -66.992  33.642  -72.264 1.00 30.00  ? 45  SER C C   2  
ATOM 8769   O O   . SER A 1 41  ? -66.536  34.324  -73.187 1.00 30.00  ? 45  SER C O   2  
ATOM 8770   C CB  . SER A 1 41  ? -67.407  35.504  -70.647 1.00 99.99  ? 45  SER C CB  2  
ATOM 8771   O OG  . SER A 1 41  ? -66.865  36.362  -71.655 1.00 99.99  ? 45  SER C OG  2  
ATOM 8772   N N   . ALA A 1 42  ? -67.621  32.489  -72.451 1.00 30.00  ? 46  ALA C N   2  
ATOM 8773   C CA  . ALA A 1 42  ? -67.795  31.962  -73.788 1.00 30.00  ? 46  ALA C CA  2  
ATOM 8774   C C   . ALA A 1 42  ? -69.244  31.720  -74.149 1.00 30.00  ? 46  ALA C C   2  
ATOM 8775   O O   . ALA A 1 42  ? -70.109  31.582  -73.277 1.00 30.00  ? 46  ALA C O   2  
ATOM 8776   C CB  . ALA A 1 42  ? -67.017  30.672  -73.922 1.00 30.00  ? 46  ALA C CB  2  
ATOM 8777   N N   . GLU A 1 43  ? -69.487  31.688  -75.454 1.00 30.00  ? 47  GLU C N   2  
ATOM 8778   C CA  . GLU A 1 43  ? -70.804  31.444  -76.028 1.00 30.00  ? 47  GLU C CA  2  
ATOM 8779   C C   . GLU A 1 43  ? -70.602  30.334  -77.055 1.00 30.00  ? 47  GLU C C   2  
ATOM 8780   O O   . GLU A 1 43  ? -69.926  30.543  -78.070 1.00 30.00  ? 47  GLU C O   2  
ATOM 8781   C CB  . GLU A 1 43  ? -71.333  32.717  -76.681 1.00 99.99  ? 47  GLU C CB  2  
ATOM 8782   C CG  . GLU A 1 43  ? -71.799  32.410  -78.082 1.00 99.99  ? 47  GLU C CG  2  
ATOM 8783   C CD  . GLU A 1 43  ? -70.593  32.128  -78.974 1.00 99.99  ? 47  GLU C CD  2  
ATOM 8784   O OE1 . GLU A 1 43  ? -70.195  30.937  -79.049 1.00 99.99  ? 47  GLU C OE1 2  
ATOM 8785   O OE2 . GLU A 1 43  ? -70.077  33.112  -79.570 1.00 99.99  ? 47  GLU C OE2 2  
ATOM 8786   N N   . ILE A 1 44  ? -71.179  29.163  -76.786 1.00 30.00  ? 48  ILE C N   2  
ATOM 8787   C CA  . ILE A 1 44  ? -71.055  28.011  -77.684 1.00 30.00  ? 48  ILE C CA  2  
ATOM 8788   C C   . ILE A 1 44  ? -71.565  28.252  -79.100 1.00 30.00  ? 48  ILE C C   2  
ATOM 8789   O O   . ILE A 1 44  ? -72.562  28.940  -79.323 1.00 30.00  ? 48  ILE C O   2  
ATOM 8790   C CB  . ILE A 1 44  ? -71.849  26.834  -77.130 1.00 99.99  ? 48  ILE C CB  2  
ATOM 8791   C CG1 . ILE A 1 44  ? -73.322  26.994  -77.498 1.00 99.99  ? 48  ILE C CG1 2  
ATOM 8792   C CG2 . ILE A 1 44  ? -71.710  26.793  -75.612 1.00 99.99  ? 48  ILE C CG2 2  
ATOM 8793   C CD1 . ILE A 1 44  ? -74.054  27.709  -76.369 1.00 99.99  ? 48  ILE C CD1 2  
ATOM 8794   N N   . GLN A 1 45  ? -70.866  27.662  -80.057 1.00 30.00  ? 49  GLN C N   2  
ATOM 8795   C CA  . GLN A 1 45  ? -71.223  27.805  -81.456 1.00 30.00  ? 49  GLN C CA  2  
ATOM 8796   C C   . GLN A 1 45  ? -71.622  26.479  -82.083 1.00 30.00  ? 49  GLN C C   2  
ATOM 8797   O O   . GLN A 1 45  ? -72.644  26.394  -82.771 1.00 30.00  ? 49  GLN C O   2  
ATOM 8798   C CB  . GLN A 1 45  ? -70.035  28.357  -82.239 1.00 99.99  ? 49  GLN C CB  2  
ATOM 8799   C CG  . GLN A 1 45  ? -69.724  29.770  -81.762 1.00 99.99  ? 49  GLN C CG  2  
ATOM 8800   C CD  . GLN A 1 45  ? -70.784  30.753  -82.230 1.00 99.99  ? 49  GLN C CD  2  
ATOM 8801   O OE1 . GLN A 1 45  ? -71.741  30.369  -82.903 1.00 99.99  ? 49  GLN C OE1 2  
ATOM 8802   N NE2 . GLN A 1 45  ? -70.621  32.028  -81.873 1.00 99.99  ? 49  GLN C NE2 2  
ATOM 8803   N N   . SER A 1 46  ? -70.817  25.449  -81.836 1.00 30.00  ? 50  SER C N   2  
ATOM 8804   C CA  . SER A 1 46  ? -71.077  24.142  -82.407 1.00 30.00  ? 50  SER C CA  2  
ATOM 8805   C C   . SER A 1 46  ? -70.461  22.970  -81.664 1.00 30.00  ? 50  SER C C   2  
ATOM 8806   O O   . SER A 1 46  ? -69.279  22.988  -81.334 1.00 30.00  ? 50  SER C O   2  
ATOM 8807   C CB  . SER A 1 46  ? -70.529  24.078  -83.828 1.00 99.99  ? 50  SER C CB  2  
ATOM 8808   O OG  . SER A 1 46  ? -70.809  22.795  -84.392 1.00 99.99  ? 50  SER C OG  2  
ATOM 8809   N N   . SER A 1 47  ? -71.272  21.946  -81.419 1.00 30.00  ? 51  SER C N   2  
ATOM 8810   C CA  . SER A 1 47  ? -70.804  20.747  -80.738 1.00 30.00  ? 51  SER C CA  2  
ATOM 8811   C C   . SER A 1 47  ? -70.236  19.826  -81.820 1.00 30.00  ? 51  SER C C   2  
ATOM 8812   O O   . SER A 1 47  ? -70.408  20.073  -83.012 1.00 30.00  ? 51  SER C O   2  
ATOM 8813   C CB  . SER A 1 47  ? -71.966  20.077  -80.011 1.00 99.99  ? 51  SER C CB  2  
ATOM 8814   O OG  . SER A 1 47  ? -72.889  19.550  -80.968 1.00 99.99  ? 51  SER C OG  2  
ATOM 8815   N N   . LYS A 1 48  ? -69.566  18.765  -81.397 1.00 30.00  ? 52  LYS C N   2  
ATOM 8816   C CA  . LYS A 1 48  ? -68.977  17.822  -82.320 1.00 30.00  ? 52  LYS C CA  2  
ATOM 8817   C C   . LYS A 1 48  ? -68.382  16.696  -81.500 1.00 30.00  ? 52  LYS C C   2  
ATOM 8818   O O   . LYS A 1 48  ? -67.172  16.505  -81.470 1.00 30.00  ? 52  LYS C O   2  
ATOM 8819   C CB  . LYS A 1 48  ? -67.892  18.511  -83.143 1.00 99.99  ? 52  LYS C CB  2  
ATOM 8820   C CG  . LYS A 1 48  ? -67.347  17.536  -84.183 1.00 99.99  ? 52  LYS C CG  2  
ATOM 8821   C CD  . LYS A 1 48  ? -66.612  18.311  -85.271 1.00 99.99  ? 52  LYS C CD  2  
ATOM 8822   C CE  . LYS A 1 48  ? -65.761  17.352  -86.093 1.00 99.99  ? 52  LYS C CE  2  
ATOM 8823   N NZ  . LYS A 1 48  ? -66.520  16.909  -87.275 1.00 99.99  ? 52  LYS C NZ  2  
ATOM 8824   N N   . GLY A 1 49  ? -69.252  15.949  -80.832 1.00 30.00  ? 53  GLY C N   2  
ATOM 8825   C CA  . GLY A 1 49  ? -68.812  14.842  -80.007 1.00 30.00  ? 53  GLY C CA  2  
ATOM 8826   C C   . GLY A 1 49  ? -68.369  15.371  -78.655 1.00 30.00  ? 53  GLY C C   2  
ATOM 8827   O O   . GLY A 1 49  ? -69.141  15.409  -77.692 1.00 30.00  ? 53  GLY C O   2  
ATOM 8828   N N   . ASP A 1 50  ? -67.106  15.781  -78.597 1.00 30.00  ? 54  ASP C N   2  
ATOM 8829   C CA  . ASP A 1 50  ? -66.503  16.324  -77.391 1.00 30.00  ? 54  ASP C CA  2  
ATOM 8830   C C   . ASP A 1 50  ? -65.903  17.679  -77.717 1.00 30.00  ? 54  ASP C C   2  
ATOM 8831   O O   . ASP A 1 50  ? -65.700  18.512  -76.842 1.00 30.00  ? 54  ASP C O   2  
ATOM 8832   C CB  . ASP A 1 50  ? -65.410  15.384  -76.888 1.00 99.99  ? 54  ASP C CB  2  
ATOM 8833   C CG  . ASP A 1 50  ? -64.957  15.827  -75.503 1.00 99.99  ? 54  ASP C CG  2  
ATOM 8834   O OD1 . ASP A 1 50  ? -64.143  16.789  -75.441 1.00 99.99  ? 54  ASP C OD1 2  
ATOM 8835   O OD2 . ASP A 1 50  ? -65.424  15.202  -74.513 1.00 99.99  ? 54  ASP C OD2 2  
ATOM 8836   N N   . GLU A 1 51  ? -65.624  17.899  -78.988 1.00 30.00  ? 55  GLU C N   2  
ATOM 8837   C CA  . GLU A 1 51  ? -65.036  19.141  -79.420 1.00 30.00  ? 55  GLU C CA  2  
ATOM 8838   C C   . GLU A 1 51  ? -66.045  20.242  -79.589 1.00 30.00  ? 55  GLU C C   2  
ATOM 8839   O O   . GLU A 1 51  ? -66.651  20.371  -80.651 1.00 30.00  ? 55  GLU C O   2  
ATOM 8840   C CB  . GLU A 1 51  ? -64.343  18.946  -80.764 1.00 99.99  ? 55  GLU C CB  2  
ATOM 8841   C CG  . GLU A 1 51  ? -63.109  19.813  -80.824 1.00 99.99  ? 55  GLU C CG  2  
ATOM 8842   C CD  . GLU A 1 51  ? -63.520  21.283  -80.793 1.00 99.99  ? 55  GLU C CD  2  
ATOM 8843   O OE1 . GLU A 1 51  ? -63.618  21.834  -79.664 1.00 99.99  ? 55  GLU C OE1 2  
ATOM 8844   O OE2 . GLU A 1 51  ? -63.733  21.846  -81.902 1.00 99.99  ? 55  GLU C OE2 2  
ATOM 8845   N N   . ILE A 1 52  ? -66.220  21.041  -78.545 1.00 30.00  ? 56  ILE C N   2  
ATOM 8846   C CA  . ILE A 1 52  ? -67.160  22.148  -78.598 1.00 30.00  ? 56  ILE C CA  2  
ATOM 8847   C C   . ILE A 1 52  ? -66.390  23.326  -79.161 1.00 30.00  ? 56  ILE C C   2  
ATOM 8848   O O   . ILE A 1 52  ? -65.200  23.456  -78.910 1.00 30.00  ? 56  ILE C O   2  
ATOM 8849   C CB  . ILE A 1 52  ? -67.683  22.454  -77.200 1.00 99.99  ? 56  ILE C CB  2  
ATOM 8850   C CG1 . ILE A 1 52  ? -66.726  23.409  -76.496 1.00 99.99  ? 56  ILE C CG1 2  
ATOM 8851   C CG2 . ILE A 1 52  ? -67.785  21.156  -76.401 1.00 99.99  ? 56  ILE C CG2 2  
ATOM 8852   C CD1 . ILE A 1 52  ? -67.209  24.845  -76.693 1.00 99.99  ? 56  ILE C CD1 2  
ATOM 8853   N N   . THR A 1 53  ? -67.066  24.170  -79.925 1.00 30.00  ? 57  THR C N   2  
ATOM 8854   C CA  . THR A 1 53  ? -66.452  25.349  -80.525 1.00 30.00  ? 57  THR C CA  2  
ATOM 8855   C C   . THR A 1 53  ? -67.230  26.541  -79.991 1.00 30.00  ? 57  THR C C   2  
ATOM 8856   O O   . THR A 1 53  ? -68.413  26.722  -80.301 1.00 30.00  ? 57  THR C O   2  
ATOM 8857   C CB  . THR A 1 53  ? -66.547  25.265  -82.045 1.00 99.99  ? 57  THR C CB  2  
ATOM 8858   O OG1 . THR A 1 53  ? -67.914  25.391  -82.445 1.00 99.99  ? 57  THR C OG1 2  
ATOM 8859   C CG2 . THR A 1 53  ? -66.001  23.922  -82.516 1.00 99.99  ? 57  THR C CG2 2  
ATOM 8860   N N   . VAL A 1 54  ? -66.544  27.350  -79.184 1.00 30.00  ? 58  VAL C N   2  
ATOM 8861   C CA  . VAL A 1 54  ? -67.131  28.532  -78.560 1.00 30.00  ? 58  VAL C CA  2  
ATOM 8862   C C   . VAL A 1 54  ? -66.547  29.820  -79.091 1.00 30.00  ? 58  VAL C C   2  
ATOM 8863   O O   . VAL A 1 54  ? -65.539  29.814  -79.800 1.00 30.00  ? 58  VAL C O   2  
ATOM 8864   C CB  . VAL A 1 54  ? -66.891  28.499  -77.055 1.00 99.99  ? 58  VAL C CB  2  
ATOM 8865   C CG1 . VAL A 1 54  ? -67.534  27.247  -76.466 1.00 99.99  ? 58  VAL C CG1 2  
ATOM 8866   C CG2 . VAL A 1 54  ? -65.392  28.480  -76.777 1.00 99.99  ? 58  VAL C CG2 2  
ATOM 8867   N N   . LYS A 1 55  ? -67.184  30.929  -78.747 1.00 30.00  ? 59  LYS C N   2  
ATOM 8868   C CA  . LYS A 1 55  ? -66.709  32.231  -79.166 1.00 30.00  ? 59  LYS C CA  2  
ATOM 8869   C C   . LYS A 1 55  ? -66.452  33.005  -77.882 1.00 30.00  ? 59  LYS C C   2  
ATOM 8870   O O   . LYS A 1 55  ? -67.291  32.996  -76.970 1.00 30.00  ? 59  LYS C O   2  
ATOM 8871   C CB  . LYS A 1 55  ? -67.768  32.918  -80.019 1.00 99.99  ? 59  LYS C CB  2  
ATOM 8872   C CG  . LYS A 1 55  ? -67.225  34.245  -80.538 1.00 99.99  ? 59  LYS C CG  2  
ATOM 8873   C CD  . LYS A 1 55  ? -68.068  34.715  -81.718 1.00 99.99  ? 59  LYS C CD  2  
ATOM 8874   C CE  . LYS A 1 55  ? -67.775  36.186  -82.001 1.00 99.99  ? 59  LYS C CE  2  
ATOM 8875   N NZ  . LYS A 1 55  ? -66.731  36.291  -83.031 1.00 99.99  ? 59  LYS C NZ  2  
ATOM 8876   N N   . ILE A 1 56  ? -65.294  33.655  -77.804 1.00 30.00  ? 60  ILE C N   2  
ATOM 8877   C CA  . ILE A 1 56  ? -64.935  34.441  -76.622 1.00 30.00  ? 60  ILE C CA  2  
ATOM 8878   C C   . ILE A 1 56  ? -65.642  35.797  -76.742 1.00 30.00  ? 60  ILE C C   2  
ATOM 8879   O O   . ILE A 1 56  ? -65.402  36.549  -77.696 1.00 30.00  ? 60  ILE C O   2  
ATOM 8880   C CB  . ILE A 1 56  ? -63.423  34.633  -76.566 1.00 99.99  ? 60  ILE C CB  2  
ATOM 8881   C CG1 . ILE A 1 56  ? -63.036  35.854  -77.392 1.00 99.99  ? 60  ILE C CG1 2  
ATOM 8882   C CG2 . ILE A 1 56  ? -62.733  33.396  -77.133 1.00 99.99  ? 60  ILE C CG2 2  
ATOM 8883   C CD1 . ILE A 1 56  ? -62.948  37.075  -76.484 1.00 99.99  ? 60  ILE C CD1 2  
ATOM 8884   N N   . VAL A 1 57  ? -66.516  36.097  -75.783 1.00 30.00  ? 61  VAL C N   2  
ATOM 8885   C CA  . VAL A 1 57  ? -67.268  37.357  -75.785 1.00 30.00  ? 61  VAL C CA  2  
ATOM 8886   C C   . VAL A 1 57  ? -66.403  38.617  -75.801 1.00 30.00  ? 61  VAL C C   2  
ATOM 8887   O O   . VAL A 1 57  ? -66.766  39.621  -76.423 1.00 30.00  ? 61  VAL C O   2  
ATOM 8888   C CB  . VAL A 1 57  ? -68.140  37.442  -74.536 1.00 99.99  ? 61  VAL C CB  2  
ATOM 8889   C CG1 . VAL A 1 57  ? -68.880  38.778  -74.523 1.00 99.99  ? 61  VAL C CG1 2  
ATOM 8890   C CG2 . VAL A 1 57  ? -69.152  36.302  -74.542 1.00 99.99  ? 61  VAL C CG2 2  
ATOM 8891   N N   . ALA A 1 58  ? -65.268  38.547  -75.116 1.00 30.00  ? 62  ALA C N   2  
ATOM 8892   C CA  . ALA A 1 58  ? -64.327  39.656  -75.027 1.00 30.00  ? 62  ALA C CA  2  
ATOM 8893   C C   . ALA A 1 58  ? -63.764  40.097  -76.383 1.00 30.00  ? 62  ALA C C   2  
ATOM 8894   O O   . ALA A 1 58  ? -64.275  41.028  -77.009 1.00 30.00  ? 62  ALA C O   2  
ATOM 8895   C CB  . ALA A 1 58  ? -63.180  39.271  -74.086 1.00 30.00  ? 62  ALA C CB  2  
ATOM 8896   N N   . ASP A 1 59  ? -62.707  39.426  -76.832 1.00 30.00  ? 63  ASP C N   2  
ATOM 8897   C CA  . ASP A 1 59  ? -62.064  39.750  -78.102 1.00 30.00  ? 63  ASP C CA  2  
ATOM 8898   C C   . ASP A 1 59  ? -62.850  39.291  -79.324 1.00 30.00  ? 63  ASP C C   2  
ATOM 8899   O O   . ASP A 1 59  ? -62.612  39.759  -80.440 1.00 30.00  ? 63  ASP C O   2  
ATOM 8900   C CB  . ASP A 1 59  ? -60.691  39.089  -78.175 1.00 99.99  ? 63  ASP C CB  2  
ATOM 8901   C CG  . ASP A 1 59  ? -59.929  39.630  -79.383 1.00 99.99  ? 63  ASP C CG  2  
ATOM 8902   O OD1 . ASP A 1 59  ? -60.216  39.141  -80.511 1.00 99.99  ? 63  ASP C OD1 2  
ATOM 8903   O OD2 . ASP A 1 59  ? -59.067  40.523  -79.169 1.00 99.99  ? 63  ASP C OD2 2  
ATOM 8904   N N   . SER A 1 60  ? -63.787  38.370  -79.102 1.00 30.00  ? 64  SER C N   2  
ATOM 8905   C CA  . SER A 1 60  ? -64.619  37.823  -80.166 1.00 30.00  ? 64  SER C CA  2  
ATOM 8906   C C   . SER A 1 60  ? -63.847  36.810  -81.024 1.00 30.00  ? 64  SER C C   2  
ATOM 8907   O O   . SER A 1 60  ? -64.165  36.592  -82.192 1.00 30.00  ? 64  SER C O   2  
ATOM 8908   C CB  . SER A 1 60  ? -65.104  38.944  -81.076 1.00 99.99  ? 64  SER C CB  2  
ATOM 8909   O OG  . SER A 1 60  ? -65.938  38.403  -82.101 1.00 99.99  ? 64  SER C OG  2  
ATOM 8910   N N   . SER A 1 61  ? -62.829  36.197  -80.428 1.00 30.00  ? 65  SER C N   2  
ATOM 8911   C CA  . SER A 1 61  ? -62.029  35.204  -81.121 1.00 30.00  ? 65  SER C CA  2  
ATOM 8912   C C   . SER A 1 61  ? -62.786  33.876  -81.008 1.00 30.00  ? 65  SER C C   2  
ATOM 8913   O O   . SER A 1 61  ? -63.860  33.826  -80.398 1.00 30.00  ? 65  SER C O   2  
ATOM 8914   C CB  . SER A 1 61  ? -60.654  35.101  -80.472 1.00 99.99  ? 65  SER C CB  2  
ATOM 8915   O OG  . SER A 1 61  ? -60.007  36.374  -80.523 1.00 99.99  ? 65  SER C OG  2  
ATOM 8916   N N   . THR A 1 62  ? -62.240  32.805  -81.584 1.00 30.00  ? 66  THR C N   2  
ATOM 8917   C CA  . THR A 1 62  ? -62.895  31.491  -81.537 1.00 30.00  ? 66  THR C CA  2  
ATOM 8918   C C   . THR A 1 62  ? -61.942  30.372  -81.190 1.00 30.00  ? 66  THR C C   2  
ATOM 8919   O O   . THR A 1 62  ? -60.749  30.452  -81.463 1.00 30.00  ? 66  THR C O   2  
ATOM 8920   C CB  . THR A 1 62  ? -63.511  31.170  -82.894 1.00 99.99  ? 66  THR C CB  2  
ATOM 8921   O OG1 . THR A 1 62  ? -64.165  29.900  -82.830 1.00 99.99  ? 66  THR C OG1 2  
ATOM 8922   C CG2 . THR A 1 62  ? -62.412  31.122  -83.951 1.00 99.99  ? 66  THR C CG2 2  
ATOM 8923   N N   . ARG A 1 63  ? -62.493  29.317  -80.595 1.00 30.00  ? 67  ARG C N   2  
ATOM 8924   C CA  . ARG A 1 63  ? -61.687  28.164  -80.226 1.00 30.00  ? 67  ARG C CA  2  
ATOM 8925   C C   . ARG A 1 63  ? -62.536  26.969  -79.822 1.00 30.00  ? 67  ARG C C   2  
ATOM 8926   O O   . ARG A 1 63  ? -63.747  27.076  -79.653 1.00 30.00  ? 67  ARG C O   2  
ATOM 8927   C CB  . ARG A 1 63  ? -60.786  28.517  -79.045 1.00 99.99  ? 67  ARG C CB  2  
ATOM 8928   C CG  . ARG A 1 63  ? -61.640  28.738  -77.801 1.00 99.99  ? 67  ARG C CG  2  
ATOM 8929   C CD  . ARG A 1 63  ? -60.739  28.821  -76.574 1.00 99.99  ? 67  ARG C CD  2  
ATOM 8930   N NE  . ARG A 1 63  ? -61.523  29.154  -75.364 1.00 99.99  ? 67  ARG C NE  2  
ATOM 8931   C CZ  . ARG A 1 63  ? -60.963  29.383  -74.177 1.00 99.99  ? 67  ARG C CZ  2  
ATOM 8932   N NH1 . ARG A 1 63  ? -59.646  29.320  -73.998 1.00 99.99  ? 67  ARG C NH1 2  
ATOM 8933   N NH2 . ARG A 1 63  ? -61.762  29.675  -73.156 1.00 99.99  ? 67  ARG C NH2 2  
ATOM 8934   N N   . THR A 1 64  ? -61.867  25.835  -79.678 1.00 30.00  ? 68  THR C N   2  
ATOM 8935   C CA  . THR A 1 64  ? -62.519  24.593  -79.307 1.00 30.00  ? 68  THR C CA  2  
ATOM 8936   C C   . THR A 1 64  ? -62.155  24.269  -77.866 1.00 30.00  ? 68  THR C C   2  
ATOM 8937   O O   . THR A 1 64  ? -61.161  24.777  -77.368 1.00 30.00  ? 68  THR C O   2  
ATOM 8938   C CB  . THR A 1 64  ? -62.050  23.467  -80.222 1.00 99.99  ? 68  THR C CB  2  
ATOM 8939   O OG1 . THR A 1 64  ? -60.671  23.186  -79.966 1.00 99.99  ? 68  THR C OG1 2  
ATOM 8940   C CG2 . THR A 1 64  ? -62.217  23.894  -81.677 1.00 99.99  ? 68  THR C CG2 2  
ATOM 8941   N N   . VAL A 1 65  ? -62.945  23.430  -77.201 1.00 30.00  ? 69  VAL C N   2  
ATOM 8942   C CA  . VAL A 1 65  ? -62.680  23.079  -75.809 1.00 30.00  ? 69  VAL C CA  2  
ATOM 8943   C C   . VAL A 1 65  ? -63.353  21.777  -75.442 1.00 30.00  ? 69  VAL C C   2  
ATOM 8944   O O   . VAL A 1 65  ? -64.523  21.606  -75.745 1.00 30.00  ? 69  VAL C O   2  
ATOM 8945   C CB  . VAL A 1 65  ? -63.204  24.173  -74.887 1.00 99.99  ? 69  VAL C CB  2  
ATOM 8946   C CG1 . VAL A 1 65  ? -62.506  25.491  -75.215 1.00 99.99  ? 69  VAL C CG1 2  
ATOM 8947   C CG2 . VAL A 1 65  ? -64.707  24.330  -75.087 1.00 99.99  ? 69  VAL C CG2 2  
ATOM 8948   N N   . LYS A 1 66  ? -62.648  20.859  -74.799 1.00 30.00  ? 70  LYS C N   2  
ATOM 8949   C CA  . LYS A 1 66  ? -63.277  19.599  -74.413 1.00 30.00  ? 70  LYS C CA  2  
ATOM 8950   C C   . LYS A 1 66  ? -64.620  19.941  -73.773 1.00 30.00  ? 70  LYS C C   2  
ATOM 8951   O O   . LYS A 1 66  ? -64.762  20.955  -73.098 1.00 30.00  ? 70  LYS C O   2  
ATOM 8952   C CB  . LYS A 1 66  ? -62.388  18.858  -73.420 1.00 99.99  ? 70  LYS C CB  2  
ATOM 8953   C CG  . LYS A 1 66  ? -63.027  17.522  -73.061 1.00 99.99  ? 70  LYS C CG  2  
ATOM 8954   C CD  . LYS A 1 66  ? -62.200  16.838  -71.978 1.00 99.99  ? 70  LYS C CD  2  
ATOM 8955   C CE  . LYS A 1 66  ? -63.032  15.741  -71.321 1.00 99.99  ? 70  LYS C CE  2  
ATOM 8956   N NZ  . LYS A 1 66  ? -63.642  14.901  -72.363 1.00 99.99  ? 70  LYS C NZ  2  
ATOM 8957   N N   . LYS A 1 67  ? -65.614  19.095  -73.995 1.00 30.00  ? 71  LYS C N   2  
ATOM 8958   C CA  . LYS A 1 67  ? -66.939  19.333  -73.453 1.00 30.00  ? 71  LYS C CA  2  
ATOM 8959   C C   . LYS A 1 67  ? -66.938  19.275  -71.941 1.00 30.00  ? 71  LYS C C   2  
ATOM 8960   O O   . LYS A 1 67  ? -67.665  20.015  -71.281 1.00 30.00  ? 71  LYS C O   2  
ATOM 8961   C CB  . LYS A 1 67  ? -67.911  18.278  -73.971 1.00 99.99  ? 71  LYS C CB  2  
ATOM 8962   C CG  . LYS A 1 67  ? -69.317  18.593  -73.477 1.00 99.99  ? 71  LYS C CG  2  
ATOM 8963   C CD  . LYS A 1 67  ? -70.336  17.839  -74.327 1.00 99.99  ? 71  LYS C CD  2  
ATOM 8964   C CE  . LYS A 1 67  ? -71.689  17.847  -73.624 1.00 99.99  ? 71  LYS C CE  2  
ATOM 8965   N NZ  . LYS A 1 67  ? -72.492  18.974  -74.118 1.00 99.99  ? 71  LYS C NZ  2  
ATOM 8966   N N   . ASP A 1 68  ? -66.118  18.396  -71.383 1.00 30.00  ? 72  ASP C N   2  
ATOM 8967   C CA  . ASP A 1 68  ? -66.054  18.255  -69.941 1.00 30.00  ? 72  ASP C CA  2  
ATOM 8968   C C   . ASP A 1 68  ? -65.162  19.287  -69.262 1.00 30.00  ? 72  ASP C C   2  
ATOM 8969   O O   . ASP A 1 68  ? -64.790  19.106  -68.110 1.00 30.00  ? 72  ASP C O   2  
ATOM 8970   C CB  . ASP A 1 68  ? -65.501  16.880  -69.578 1.00 99.99  ? 72  ASP C CB  2  
ATOM 8971   C CG  . ASP A 1 68  ? -65.666  16.641  -68.079 1.00 99.99  ? 72  ASP C CG  2  
ATOM 8972   O OD1 . ASP A 1 68  ? -64.818  17.175  -67.314 1.00 99.99  ? 72  ASP C OD1 2  
ATOM 8973   O OD2 . ASP A 1 68  ? -66.639  15.931  -67.711 1.00 99.99  ? 72  ASP C OD2 2  
ATOM 8974   N N   . ASP A 1 69  ? -64.824  20.362  -69.973 1.00 30.00  ? 73  ASP C N   2  
ATOM 8975   C CA  . ASP A 1 69  ? -63.968  21.430  -69.440 1.00 30.00  ? 73  ASP C CA  2  
ATOM 8976   C C   . ASP A 1 69  ? -64.752  22.737  -69.406 1.00 30.00  ? 73  ASP C C   2  
ATOM 8977   O O   . ASP A 1 69  ? -64.233  23.788  -69.030 1.00 30.00  ? 73  ASP C O   2  
ATOM 8978   C CB  . ASP A 1 69  ? -62.739  21.599  -70.326 1.00 99.99  ? 73  ASP C CB  2  
ATOM 8979   C CG  . ASP A 1 69  ? -61.846  20.369  -70.201 1.00 99.99  ? 73  ASP C CG  2  
ATOM 8980   O OD1 . ASP A 1 69  ? -61.216  20.219  -69.121 1.00 99.99  ? 73  ASP C OD1 2  
ATOM 8981   O OD2 . ASP A 1 69  ? -61.807  19.584  -71.188 1.00 99.99  ? 73  ASP C OD2 2  
ATOM 8982   N N   . ILE A 1 70  ? -66.003  22.672  -69.826 1.00 30.00  ? 74  ILE C N   2  
ATOM 8983   C CA  . ILE A 1 70  ? -66.853  23.844  -69.826 1.00 30.00  ? 74  ILE C CA  2  
ATOM 8984   C C   . ILE A 1 70  ? -67.390  23.879  -68.399 1.00 30.00  ? 74  ILE C C   2  
ATOM 8985   O O   . ILE A 1 70  ? -67.596  22.825  -67.772 1.00 30.00  ? 74  ILE C O   2  
ATOM 8986   C CB  . ILE A 1 70  ? -67.961  23.682  -70.863 1.00 99.99  ? 74  ILE C CB  2  
ATOM 8987   C CG1 . ILE A 1 70  ? -69.135  22.934  -70.242 1.00 99.99  ? 74  ILE C CG1 2  
ATOM 8988   C CG2 . ILE A 1 70  ? -67.427  22.893  -72.055 1.00 99.99  ? 74  ILE C CG2 2  
ATOM 8989   C CD1 . ILE A 1 70  ? -70.153  23.938  -69.711 1.00 99.99  ? 74  ILE C CD1 2  
ATOM 8990   N N   . GLN A 1 71  ? -67.603  25.084  -67.886 1.00 30.00  ? 75  GLN C N   2  
ATOM 8991   C CA  . GLN A 1 71  ? -68.113  25.251  -66.534 1.00 30.00  ? 75  GLN C CA  2  
ATOM 8992   C C   . GLN A 1 71  ? -69.427  25.989  -66.661 1.00 30.00  ? 75  GLN C C   2  
ATOM 8993   O O   . GLN A 1 71  ? -69.548  26.910  -67.483 1.00 30.00  ? 75  GLN C O   2  
ATOM 8994   C CB  . GLN A 1 71  ? -67.120  26.051  -65.699 1.00 99.99  ? 75  GLN C CB  2  
ATOM 8995   C CG  . GLN A 1 71  ? -65.830  25.255  -65.541 1.00 99.99  ? 75  GLN C CG  2  
ATOM 8996   C CD  . GLN A 1 71  ? -66.022  24.075  -64.600 1.00 99.99  ? 75  GLN C CD  2  
ATOM 8997   O OE1 . GLN A 1 71  ? -67.116  23.864  -64.078 1.00 99.99  ? 75  GLN C OE1 2  
ATOM 8998   N NE2 . GLN A 1 71  ? -64.957  23.302  -64.382 1.00 99.99  ? 75  GLN C NE2 2  
ATOM 8999   N N   . SER A 1 72  ? -70.408  25.600  -65.858 1.00 30.00  ? 76  SER C N   2  
ATOM 9000   C CA  . SER A 1 72  ? -71.708  26.260  -65.910 1.00 30.00  ? 76  SER C CA  2  
ATOM 9001   C C   . SER A 1 72  ? -71.641  27.704  -65.385 1.00 30.00  ? 76  SER C C   2  
ATOM 9002   O O   . SER A 1 72  ? -71.095  27.955  -64.311 1.00 30.00  ? 76  SER C O   2  
ATOM 9003   C CB  . SER A 1 72  ? -72.713  25.493  -65.057 1.00 99.99  ? 76  SER C CB  2  
ATOM 9004   O OG  . SER A 1 72  ? -72.358  25.612  -63.677 1.00 99.99  ? 76  SER C OG  2  
ATOM 9005   N N   . MET A 1 73  ? -71.688  28.742  -65.957 1.00 30.00  ? 77  MET C N   2  
ATOM 9006   C CA  . MET A 1 73  ? -71.820  30.170  -65.627 1.00 30.00  ? 77  MET C CA  2  
ATOM 9007   C C   . MET A 1 73  ? -73.082  30.381  -64.791 1.00 30.00  ? 77  MET C C   2  
ATOM 9008   O O   . MET A 1 73  ? -74.001  29.571  -64.843 1.00 30.00  ? 77  MET C O   2  
ATOM 9009   C CB  . MET A 1 73  ? -71.917  30.990  -66.907 1.00 99.99  ? 77  MET C CB  2  
ATOM 9010   C CG  . MET A 1 73  ? -71.977  32.475  -66.556 1.00 99.99  ? 77  MET C CG  2  
ATOM 9011   S SD  . MET A 1 73  ? -71.765  33.474  -68.051 1.00 99.99  ? 77  MET C SD  2  
ATOM 9012   C CE  . MET A 1 73  ? -71.968  35.103  -67.365 1.00 99.99  ? 77  MET C CE  2  
ATOM 9013   N N   . ASN A 1 74  ? -73.133  31.464  -64.016 1.00 30.00  ? 78  ASN C N   2  
ATOM 9014   C CA  . ASN A 1 74  ? -74.321  31.739  -63.204 1.00 30.00  ? 78  ASN C CA  2  
ATOM 9015   C C   . ASN A 1 74  ? -75.079  32.860  -63.933 1.00 30.00  ? 78  ASN C C   2  
ATOM 9016   O O   . ASN A 1 74  ? -74.469  33.676  -64.645 1.00 30.00  ? 78  ASN C O   2  
ATOM 9017   C CB  . ASN A 1 74  ? -73.903  32.180  -61.806 1.00 99.99  ? 78  ASN C CB  2  
ATOM 9018   C CG  . ASN A 1 74  ? -73.152  31.072  -61.082 1.00 99.99  ? 78  ASN C CG  2  
ATOM 9019   O OD1 . ASN A 1 74  ? -73.647  29.953  -60.969 1.00 99.99  ? 78  ASN C OD1 2  
ATOM 9020   N ND2 . ASN A 1 74  ? -71.951  31.385  -60.593 1.00 99.99  ? 78  ASN C ND2 2  
ATOM 9021   N N   . PRO A 1 75  ? -76.412  32.899  -63.784 1.00 30.00  ? 79  PRO C N   2  
ATOM 9022   C CA  . PRO A 1 75  ? -77.250  33.926  -64.430 1.00 30.00  ? 79  PRO C CA  2  
ATOM 9023   C C   . PRO A 1 75  ? -77.040  35.305  -63.802 1.00 30.00  ? 79  PRO C C   2  
ATOM 9024   O O   . PRO A 1 75  ? -76.688  35.402  -62.622 1.00 30.00  ? 79  PRO C O   2  
ATOM 9025   C CB  . PRO A 1 75  ? -78.584  33.345  -64.105 1.00 99.99  ? 79  PRO C CB  2  
ATOM 9026   C CG  . PRO A 1 75  ? -78.311  32.052  -63.375 1.00 99.99  ? 79  PRO C CG  2  
ATOM 9027   C CD  . PRO A 1 75  ? -77.069  31.788  -63.245 1.00 99.99  ? 79  PRO C CD  2  
ATOM 9028   N N   . PRO A 1 76  ? -77.258  36.385  -64.570 1.00 30.00  ? 80  PRO C N   2  
ATOM 9029   C CA  . PRO A 1 76  ? -77.073  37.731  -64.017 1.00 30.00  ? 80  PRO C CA  2  
ATOM 9030   C C   . PRO A 1 76  ? -77.804  37.966  -62.682 1.00 30.00  ? 80  PRO C C   2  
ATOM 9031   O O   . PRO A 1 76  ? -77.611  38.978  -62.016 1.00 30.00  ? 80  PRO C O   2  
ATOM 9032   C CB  . PRO A 1 76  ? -77.687  38.507  -65.128 1.00 99.99  ? 80  PRO C CB  2  
ATOM 9033   C CG  . PRO A 1 76  ? -78.083  37.493  -66.178 1.00 99.99  ? 80  PRO C CG  2  
ATOM 9034   C CD  . PRO A 1 76  ? -77.788  36.292  -65.866 1.00 99.99  ? 80  PRO C CD  2  
ATOM 9035   N N   . LYS A 1 77  ? -78.639  37.008  -62.307 1.00 30.00  ? 81  LYS C N   2  
ATOM 9036   C CA  . LYS A 1 77  ? -79.407  37.052  -61.061 1.00 30.00  ? 81  LYS C CA  2  
ATOM 9037   C C   . LYS A 1 77  ? -78.440  37.165  -59.868 1.00 30.00  ? 81  LYS C C   2  
ATOM 9038   O O   . LYS A 1 77  ? -78.746  37.813  -58.869 1.00 30.00  ? 81  LYS C O   2  
ATOM 9039   C CB  . LYS A 1 77  ? -80.239  35.781  -60.918 1.00 99.99  ? 81  LYS C CB  2  
ATOM 9040   C CG  . LYS A 1 77  ? -81.108  35.879  -59.669 1.00 99.99  ? 81  LYS C CG  2  
ATOM 9041   C CD  . LYS A 1 77  ? -82.234  34.856  -59.752 1.00 99.99  ? 81  LYS C CD  2  
ATOM 9042   C CE  . LYS A 1 77  ? -82.875  34.690  -58.377 1.00 99.99  ? 81  LYS C CE  2  
ATOM 9043   N NZ  . LYS A 1 77  ? -84.036  35.584  -58.264 1.00 99.99  ? 81  LYS C NZ  2  
ATOM 9044   N N   . PHE A 1 78  ? -77.270  36.538  -59.977 1.00 30.00  ? 82  PHE C N   2  
ATOM 9045   C CA  . PHE A 1 78  ? -76.279  36.577  -58.902 1.00 30.00  ? 82  PHE C CA  2  
ATOM 9046   C C   . PHE A 1 78  ? -75.049  37.442  -59.181 1.00 30.00  ? 82  PHE C C   2  
ATOM 9047   O O   . PHE A 1 78  ? -73.926  37.005  -58.978 1.00 30.00  ? 82  PHE C O   2  
ATOM 9048   C CB  . PHE A 1 78  ? -75.763  35.170  -58.621 1.00 99.99  ? 82  PHE C CB  2  
ATOM 9049   C CG  . PHE A 1 78  ? -76.894  34.305  -58.124 1.00 99.99  ? 82  PHE C CG  2  
ATOM 9050   C CD1 . PHE A 1 78  ? -77.693  33.603  -59.035 1.00 99.99  ? 82  PHE C CD1 2  
ATOM 9051   C CD2 . PHE A 1 78  ? -77.147  34.204  -56.749 1.00 99.99  ? 82  PHE C CD2 2  
ATOM 9052   C CE1 . PHE A 1 78  ? -78.743  32.800  -58.572 1.00 99.99  ? 82  PHE C CE1 2  
ATOM 9053   C CE2 . PHE A 1 78  ? -78.198  33.404  -56.287 1.00 99.99  ? 82  PHE C CE2 2  
ATOM 9054   C CZ  . PHE A 1 78  ? -78.994  32.701  -57.197 1.00 99.99  ? 82  PHE C CZ  2  
ATOM 9055   N N   . GLU A 1 79  ? -75.263  38.666  -59.649 1.00 30.00  ? 83  GLU C N   2  
ATOM 9056   C CA  . GLU A 1 79  ? -74.158  39.575  -59.924 1.00 30.00  ? 83  GLU C CA  2  
ATOM 9057   C C   . GLU A 1 79  ? -73.646  40.099  -58.580 1.00 30.00  ? 83  GLU C C   2  
ATOM 9058   O O   . GLU A 1 79  ? -74.449  40.427  -57.707 1.00 30.00  ? 83  GLU C O   2  
ATOM 9059   C CB  . GLU A 1 79  ? -74.644  40.734  -60.790 1.00 99.99  ? 83  GLU C CB  2  
ATOM 9060   C CG  . GLU A 1 79  ? -73.477  41.316  -61.551 1.00 99.99  ? 83  GLU C CG  2  
ATOM 9061   C CD  . GLU A 1 79  ? -72.763  42.342  -60.676 1.00 99.99  ? 83  GLU C CD  2  
ATOM 9062   O OE1 . GLU A 1 79  ? -71.827  41.925  -59.945 1.00 99.99  ? 83  GLU C OE1 2  
ATOM 9063   O OE2 . GLU A 1 79  ? -73.157  43.538  -60.748 1.00 99.99  ? 83  GLU C OE2 2  
ATOM 9064   N N   . LYS A 1 80  ? -72.326  40.170  -58.408 1.00 30.00  ? 84  LYS C N   2  
ATOM 9065   C CA  . LYS A 1 80  ? -71.736  40.656  -57.154 1.00 30.00  ? 84  LYS C CA  2  
ATOM 9066   C C   . LYS A 1 80  ? -72.458  40.145  -55.899 1.00 30.00  ? 84  LYS C C   2  
ATOM 9067   O O   . LYS A 1 80  ? -72.591  40.871  -54.915 1.00 30.00  ? 84  LYS C O   2  
ATOM 9068   C CB  . LYS A 1 80  ? -71.781  42.180  -57.115 1.00 99.99  ? 84  LYS C CB  2  
ATOM 9069   C CG  . LYS A 1 80  ? -70.731  42.748  -58.062 1.00 99.99  ? 84  LYS C CG  2  
ATOM 9070   C CD  . LYS A 1 80  ? -70.708  44.266  -57.949 1.00 99.99  ? 84  LYS C CD  2  
ATOM 9071   C CE  . LYS A 1 80  ? -71.597  44.871  -59.031 1.00 99.99  ? 84  LYS C CE  2  
ATOM 9072   N NZ  . LYS A 1 80  ? -71.322  46.309  -59.144 1.00 99.99  ? 84  LYS C NZ  2  
ATOM 9073   N N   . LEU A 1 81  ? -72.926  38.905  -55.930 1.00 30.00  ? 85  LEU C N   2  
ATOM 9074   C CA  . LEU A 1 81  ? -73.635  38.342  -54.788 1.00 30.00  ? 85  LEU C CA  2  
ATOM 9075   C C   . LEU A 1 81  ? -72.872  38.450  -53.451 1.00 30.00  ? 85  LEU C C   2  
ATOM 9076   O O   . LEU A 1 81  ? -71.665  38.202  -53.393 1.00 30.00  ? 85  LEU C O   2  
ATOM 9077   C CB  . LEU A 1 81  ? -73.903  36.860  -55.024 1.00 99.99  ? 85  LEU C CB  2  
ATOM 9078   C CG  . LEU A 1 81  ? -72.623  36.064  -54.786 1.00 99.99  ? 85  LEU C CG  2  
ATOM 9079   C CD1 . LEU A 1 81  ? -71.424  36.890  -55.239 1.00 99.99  ? 85  LEU C CD1 2  
ATOM 9080   C CD2 . LEU A 1 81  ? -72.493  35.746  -53.301 1.00 99.99  ? 85  LEU C CD2 2  
ATOM 9081   N N   . GLU A 1 82  ? -73.588  38.804  -52.381 1.00 30.00  ? 86  GLU C N   2  
ATOM 9082   C CA  . GLU A 1 82  ? -72.984  38.946  -51.062 1.00 30.00  ? 86  GLU C CA  2  
ATOM 9083   C C   . GLU A 1 82  ? -72.669  37.602  -50.445 1.00 30.00  ? 86  GLU C C   2  
ATOM 9084   O O   . GLU A 1 82  ? -71.654  37.465  -49.753 1.00 30.00  ? 86  GLU C O   2  
ATOM 9085   C CB  . GLU A 1 82  ? -73.938  39.688  -50.132 1.00 99.99  ? 86  GLU C CB  2  
ATOM 9086   C CG  . GLU A 1 82  ? -74.138  41.099  -50.633 1.00 99.99  ? 86  GLU C CG  2  
ATOM 9087   C CD  . GLU A 1 82  ? -72.871  41.911  -50.388 1.00 99.99  ? 86  GLU C CD  2  
ATOM 9088   O OE1 . GLU A 1 82  ? -72.002  41.915  -51.300 1.00 99.99  ? 86  GLU C OE1 2  
ATOM 9089   O OE2 . GLU A 1 82  ? -72.780  42.522  -49.288 1.00 99.99  ? 86  GLU C OE2 2  
ATOM 9090   N N   . ASP A 1 83  ? -73.514  36.598  -50.671 1.00 30.00  ? 87  ASP C N   2  
ATOM 9091   C CA  . ASP A 1 83  ? -73.229  35.251  -50.143 1.00 30.00  ? 87  ASP C CA  2  
ATOM 9092   C C   . ASP A 1 83  ? -73.209  34.257  -51.310 1.00 30.00  ? 87  ASP C C   2  
ATOM 9093   O O   . ASP A 1 83  ? -74.225  33.995  -51.950 1.00 30.00  ? 87  ASP C O   2  
ATOM 9094   C CB  . ASP A 1 83  ? -74.308  34.846  -49.144 1.00 99.99  ? 87  ASP C CB  2  
ATOM 9095   C CG  . ASP A 1 83  ? -73.883  33.571  -48.420 1.00 99.99  ? 87  ASP C CG  2  
ATOM 9096   O OD1 . ASP A 1 83  ? -74.046  32.480  -49.028 1.00 99.99  ? 87  ASP C OD1 2  
ATOM 9097   O OD2 . ASP A 1 83  ? -73.392  33.698  -47.267 1.00 99.99  ? 87  ASP C OD2 2  
ATOM 9098   N N   . MET A 1 84  ? -72.030  33.707  -51.577 1.00 30.00  ? 88  MET C N   2  
ATOM 9099   C CA  . MET A 1 84  ? -71.850  32.773  -52.670 1.00 30.00  ? 88  MET C CA  2  
ATOM 9100   C C   . MET A 1 84  ? -72.486  31.405  -52.531 1.00 30.00  ? 88  MET C C   2  
ATOM 9101   O O   . MET A 1 84  ? -72.665  30.709  -53.520 1.00 30.00  ? 88  MET C O   2  
ATOM 9102   C CB  . MET A 1 84  ? -70.366  32.504  -52.882 1.00 99.99  ? 88  MET C CB  2  
ATOM 9103   C CG  . MET A 1 84  ? -69.613  33.824  -52.969 1.00 99.99  ? 88  MET C CG  2  
ATOM 9104   S SD  . MET A 1 84  ? -69.793  34.534  -54.624 1.00 99.99  ? 88  MET C SD  2  
ATOM 9105   C CE  . MET A 1 84  ? -68.667  33.499  -55.530 1.00 99.99  ? 88  MET C CE  2  
ATOM 9106   N N   . ALA A 1 85  ? -72.822  31.009  -51.313 1.00 30.00  ? 89  ALA C N   2  
ATOM 9107   C CA  . ALA A 1 85  ? -73.443  29.717  -51.108 1.00 30.00  ? 89  ALA C CA  2  
ATOM 9108   C C   . ALA A 1 85  ? -74.832  29.741  -51.774 1.00 30.00  ? 89  ALA C C   2  
ATOM 9109   O O   . ALA A 1 85  ? -75.414  28.694  -52.071 1.00 30.00  ? 89  ALA C O   2  
ATOM 9110   C CB  . ALA A 1 85  ? -73.567  29.439  -49.623 1.00 30.00  ? 89  ALA C CB  2  
ATOM 9111   N N   . ASN A 1 86  ? -75.344  30.943  -52.018 1.00 30.00  ? 90  ASN C N   2  
ATOM 9112   C CA  . ASN A 1 86  ? -76.653  31.138  -52.647 1.00 30.00  ? 90  ASN C CA  2  
ATOM 9113   C C   . ASN A 1 86  ? -76.628  31.135  -54.180 1.00 30.00  ? 90  ASN C C   2  
ATOM 9114   O O   . ASN A 1 86  ? -77.654  31.350  -54.822 1.00 30.00  ? 90  ASN C O   2  
ATOM 9115   C CB  . ASN A 1 86  ? -77.240  32.478  -52.219 1.00 99.99  ? 90  ASN C CB  2  
ATOM 9116   C CG  . ASN A 1 86  ? -77.486  32.518  -50.719 1.00 99.99  ? 90  ASN C CG  2  
ATOM 9117   O OD1 . ASN A 1 86  ? -78.161  31.648  -50.175 1.00 99.99  ? 90  ASN C OD1 2  
ATOM 9118   N ND2 . ASN A 1 86  ? -76.938  33.535  -50.050 1.00 99.99  ? 90  ASN C ND2 2  
ATOM 9119   N N   . MET A 1 87  ? -75.457  30.909  -54.760 1.00 30.00  ? 91  MET C N   2  
ATOM 9120   C CA  . MET A 1 87  ? -75.309  30.876  -56.213 1.00 30.00  ? 91  MET C CA  2  
ATOM 9121   C C   . MET A 1 87  ? -75.681  29.492  -56.718 1.00 30.00  ? 91  MET C C   2  
ATOM 9122   O O   . MET A 1 87  ? -75.587  28.509  -55.974 1.00 30.00  ? 91  MET C O   2  
ATOM 9123   C CB  . MET A 1 87  ? -73.865  31.187  -56.593 1.00 99.99  ? 91  MET C CB  2  
ATOM 9124   C CG  . MET A 1 87  ? -73.411  32.453  -55.878 1.00 99.99  ? 91  MET C CG  2  
ATOM 9125   S SD  . MET A 1 87  ? -74.029  33.914  -56.747 1.00 99.99  ? 91  MET C SD  2  
ATOM 9126   C CE  . MET A 1 87  ? -72.913  33.946  -58.133 1.00 99.99  ? 91  MET C CE  2  
ATOM 9127   N N   . THR A 1 88  ? -76.098  29.422  -57.984 1.00 30.00  ? 92  THR C N   2  
ATOM 9128   C CA  . THR A 1 88  ? -76.468  28.131  -58.574 1.00 30.00  ? 92  THR C CA  2  
ATOM 9129   C C   . THR A 1 88  ? -75.184  27.323  -58.703 1.00 30.00  ? 92  THR C C   2  
ATOM 9130   O O   . THR A 1 88  ? -75.118  26.173  -58.252 1.00 30.00  ? 92  THR C O   2  
ATOM 9131   C CB  . THR A 1 88  ? -77.107  28.350  -59.941 1.00 99.99  ? 92  THR C CB  2  
ATOM 9132   O OG1 . THR A 1 88  ? -76.122  28.840  -60.854 1.00 99.99  ? 92  THR C OG1 2  
ATOM 9133   C CG2 . THR A 1 88  ? -78.233  29.369  -59.818 1.00 99.99  ? 92  THR C CG2 2  
ATOM 9134   N N   . TYR A 1 89  ? -74.164  27.939  -59.314 1.00 30.00  ? 93  TYR C N   2  
ATOM 9135   C CA  . TYR A 1 89  ? -72.872  27.285  -59.512 1.00 30.00  ? 93  TYR C CA  2  
ATOM 9136   C C   . TYR A 1 89  ? -71.705  27.839  -58.693 1.00 30.00  ? 93  TYR C C   2  
ATOM 9137   O O   . TYR A 1 89  ? -71.363  29.028  -58.751 1.00 30.00  ? 93  TYR C O   2  
ATOM 9138   C CB  . TYR A 1 89  ? -72.449  27.406  -60.973 1.00 99.99  ? 93  TYR C CB  2  
ATOM 9139   C CG  . TYR A 1 89  ? -73.369  26.573  -61.834 1.00 99.99  ? 93  TYR C CG  2  
ATOM 9140   C CD1 . TYR A 1 89  ? -73.145  25.200  -61.976 1.00 99.99  ? 93  TYR C CD1 2  
ATOM 9141   C CD2 . TYR A 1 89  ? -74.449  27.177  -62.490 1.00 99.99  ? 93  TYR C CD2 2  
ATOM 9142   C CE1 . TYR A 1 89  ? -73.999  24.429  -62.774 1.00 99.99  ? 93  TYR C CE1 2  
ATOM 9143   C CE2 . TYR A 1 89  ? -75.301  26.410  -63.289 1.00 99.99  ? 93  TYR C CE2 2  
ATOM 9144   C CZ  . TYR A 1 89  ? -75.075  25.034  -63.430 1.00 99.99  ? 93  TYR C CZ  2  
ATOM 9145   O OH  . TYR A 1 89  ? -75.906  24.283  -64.206 1.00 99.99  ? 93  TYR C OH  2  
ATOM 9146   N N   . LEU A 1 90  ? -71.085  26.947  -57.939 1.00 30.00  ? 94  LEU C N   2  
ATOM 9147   C CA  . LEU A 1 90  ? -69.956  27.297  -57.105 1.00 30.00  ? 94  LEU C CA  2  
ATOM 9148   C C   . LEU A 1 90  ? -68.674  26.633  -57.634 1.00 30.00  ? 94  LEU C C   2  
ATOM 9149   O O   . LEU A 1 90  ? -68.080  25.775  -56.973 1.00 30.00  ? 94  LEU C O   2  
ATOM 9150   C CB  . LEU A 1 90  ? -70.198  26.827  -55.676 1.00 99.99  ? 94  LEU C CB  2  
ATOM 9151   C CG  . LEU A 1 90  ? -70.791  27.970  -54.858 1.00 99.99  ? 94  LEU C CG  2  
ATOM 9152   C CD1 . LEU A 1 90  ? -70.730  27.617  -53.374 1.00 99.99  ? 94  LEU C CD1 2  
ATOM 9153   C CD2 . LEU A 1 90  ? -69.996  29.245  -55.112 1.00 99.99  ? 94  LEU C CD2 2  
ATOM 9154   N N   . ASN A 1 91  ? -68.249  27.022  -58.828 1.00 30.00  ? 95  ASN C N   2  
ATOM 9155   C CA  . ASN A 1 91  ? -67.044  26.424  -59.388 1.00 30.00  ? 95  ASN C CA  2  
ATOM 9156   C C   . ASN A 1 91  ? -65.961  27.485  -59.502 1.00 30.00  ? 95  ASN C C   2  
ATOM 9157   O O   . ASN A 1 91  ? -66.261  28.679  -59.598 1.00 30.00  ? 95  ASN C O   2  
ATOM 9158   C CB  . ASN A 1 91  ? -67.345  25.857  -60.772 1.00 99.99  ? 95  ASN C CB  2  
ATOM 9159   C CG  . ASN A 1 91  ? -67.851  26.940  -61.713 1.00 99.99  ? 95  ASN C CG  2  
ATOM 9160   O OD1 . ASN A 1 91  ? -67.131  27.373  -62.610 1.00 99.99  ? 95  ASN C OD1 2  
ATOM 9161   N ND2 . ASN A 1 91  ? -69.092  27.380  -61.501 1.00 99.99  ? 95  ASN C ND2 2  
ATOM 9162   N N   . GLU A 1 92  ? -64.705  27.040  -59.489 1.00 30.00  ? 96  GLU C N   2  
ATOM 9163   C CA  . GLU A 1 92  ? -63.580  27.957  -59.569 1.00 30.00  ? 96  GLU C CA  2  
ATOM 9164   C C   . GLU A 1 92  ? -63.762  29.137  -60.498 1.00 30.00  ? 96  GLU C C   2  
ATOM 9165   O O   . GLU A 1 92  ? -63.078  30.143  -60.358 1.00 30.00  ? 96  GLU C O   2  
ATOM 9166   C CB  . GLU A 1 92  ? -62.340  27.217  -60.063 1.00 99.99  ? 96  GLU C CB  2  
ATOM 9167   C CG  . GLU A 1 92  ? -61.871  26.257  -58.999 1.00 99.99  ? 96  GLU C CG  2  
ATOM 9168   C CD  . GLU A 1 92  ? -61.246  27.038  -57.846 1.00 99.99  ? 96  GLU C CD  2  
ATOM 9169   O OE1 . GLU A 1 92  ? -62.008  27.396  -56.912 1.00 99.99  ? 96  GLU C OE1 2  
ATOM 9170   O OE2 . GLU A 1 92  ? -60.007  27.267  -57.912 1.00 99.99  ? 96  GLU C OE2 2  
ATOM 9171   N N   . ALA A 1 93  ? -64.682  29.051  -61.443 1.00 30.00  ? 97  ALA C N   2  
ATOM 9172   C CA  . ALA A 1 93  ? -64.849  30.176  -62.349 1.00 30.00  ? 97  ALA C CA  2  
ATOM 9173   C C   . ALA A 1 93  ? -65.994  31.095  -61.956 1.00 30.00  ? 97  ALA C C   2  
ATOM 9174   O O   . ALA A 1 93  ? -66.001  32.263  -62.331 1.00 30.00  ? 97  ALA C O   2  
ATOM 9175   C CB  . ALA A 1 93  ? -65.065  29.658  -63.773 1.00 30.00  ? 97  ALA C CB  2  
ATOM 9176   N N   . SER A 1 94  ? -66.964  30.566  -61.211 1.00 30.00  ? 98  SER C N   2  
ATOM 9177   C CA  . SER A 1 94  ? -68.115  31.361  -60.768 1.00 30.00  ? 98  SER C CA  2  
ATOM 9178   C C   . SER A 1 94  ? -67.677  32.170  -59.566 1.00 30.00  ? 98  SER C C   2  
ATOM 9179   O O   . SER A 1 94  ? -68.047  33.332  -59.418 1.00 30.00  ? 98  SER C O   2  
ATOM 9180   C CB  . SER A 1 94  ? -69.267  30.435  -60.390 1.00 99.99  ? 98  SER C CB  2  
ATOM 9181   O OG  . SER A 1 94  ? -68.923  29.699  -59.214 1.00 99.99  ? 98  SER C OG  2  
ATOM 9182   N N   . VAL A 1 95  ? -66.895  31.524  -58.708 1.00 30.00  ? 99  VAL C N   2  
ATOM 9183   C CA  . VAL A 1 95  ? -66.370  32.151  -57.509 1.00 30.00  ? 99  VAL C CA  2  
ATOM 9184   C C   . VAL A 1 95  ? -65.411  33.285  -57.919 1.00 30.00  ? 99  VAL C C   2  
ATOM 9185   O O   . VAL A 1 95  ? -65.633  34.449  -57.590 1.00 30.00  ? 99  VAL C O   2  
ATOM 9186   C CB  . VAL A 1 95  ? -65.617  31.119  -56.674 1.00 99.99  ? 99  VAL C CB  2  
ATOM 9187   C CG1 . VAL A 1 95  ? -66.566  29.992  -56.279 1.00 99.99  ? 99  VAL C CG1 2  
ATOM 9188   C CG2 . VAL A 1 95  ? -64.462  30.549  -57.490 1.00 99.99  ? 99  VAL C CG2 2  
ATOM 9189   N N   . LEU A 1 96  ? -64.352  32.951  -58.646 1.00 30.00  ? 100 LEU C N   2  
ATOM 9190   C CA  . LEU A 1 96  ? -63.408  33.964  -59.093 1.00 30.00  ? 100 LEU C CA  2  
ATOM 9191   C C   . LEU A 1 96  ? -64.125  35.128  -59.789 1.00 30.00  ? 100 LEU C C   2  
ATOM 9192   O O   . LEU A 1 96  ? -63.717  36.275  -59.682 1.00 30.00  ? 100 LEU C O   2  
ATOM 9193   C CB  . LEU A 1 96  ? -62.416  33.350  -60.078 1.00 99.99  ? 100 LEU C CB  2  
ATOM 9194   C CG  . LEU A 1 96  ? -61.160  32.913  -59.332 1.00 99.99  ? 100 LEU C CG  2  
ATOM 9195   C CD1 . LEU A 1 96  ? -60.053  32.611  -60.336 1.00 99.99  ? 100 LEU C CD1 2  
ATOM 9196   C CD2 . LEU A 1 96  ? -60.710  34.032  -58.397 1.00 99.99  ? 100 LEU C CD2 2  
ATOM 9197   N N   . TYR A 1 97  ? -65.194  34.848  -60.515 1.00 30.00  ? 101 TYR C N   2  
ATOM 9198   C CA  . TYR A 1 97  ? -65.891  35.925  -61.199 1.00 30.00  ? 101 TYR C CA  2  
ATOM 9199   C C   . TYR A 1 97  ? -66.622  36.840  -60.234 1.00 30.00  ? 101 TYR C C   2  
ATOM 9200   O O   . TYR A 1 97  ? -66.577  38.061  -60.377 1.00 30.00  ? 101 TYR C O   2  
ATOM 9201   C CB  . TYR A 1 97  ? -66.919  35.346  -62.167 1.00 99.99  ? 101 TYR C CB  2  
ATOM 9202   C CG  . TYR A 1 97  ? -67.634  36.471  -62.874 1.00 99.99  ? 101 TYR C CG  2  
ATOM 9203   C CD1 . TYR A 1 97  ? -67.057  37.075  -63.998 1.00 99.99  ? 101 TYR C CD1 2  
ATOM 9204   C CD2 . TYR A 1 97  ? -68.877  36.915  -62.405 1.00 99.99  ? 101 TYR C CD2 2  
ATOM 9205   C CE1 . TYR A 1 97  ? -67.720  38.116  -64.653 1.00 99.99  ? 101 TYR C CE1 2  
ATOM 9206   C CE2 . TYR A 1 97  ? -69.543  37.958  -63.060 1.00 99.99  ? 101 TYR C CE2 2  
ATOM 9207   C CZ  . TYR A 1 97  ? -68.962  38.560  -64.184 1.00 99.99  ? 101 TYR C CZ  2  
ATOM 9208   O OH  . TYR A 1 97  ? -69.610  39.572  -64.821 1.00 99.99  ? 101 TYR C OH  2  
ATOM 9209   N N   . ASN A 1 98  ? -67.304  36.244  -59.257 1.00 30.00  ? 102 ASN C N   2  
ATOM 9210   C CA  . ASN A 1 98  ? -68.055  37.004  -58.269 1.00 30.00  ? 102 ASN C CA  2  
ATOM 9211   C C   . ASN A 1 98  ? -67.148  37.934  -57.467 1.00 30.00  ? 102 ASN C C   2  
ATOM 9212   O O   . ASN A 1 98  ? -67.413  39.133  -57.342 1.00 30.00  ? 102 ASN C O   2  
ATOM 9213   C CB  . ASN A 1 98  ? -68.743  36.053  -57.295 1.00 99.99  ? 102 ASN C CB  2  
ATOM 9214   C CG  . ASN A 1 98  ? -69.952  35.388  -57.935 1.00 99.99  ? 102 ASN C CG  2  
ATOM 9215   O OD1 . ASN A 1 98  ? -70.195  34.202  -57.732 1.00 99.99  ? 102 ASN C OD1 2  
ATOM 9216   N ND2 . ASN A 1 98  ? -70.713  36.159  -58.715 1.00 99.99  ? 102 ASN C ND2 2  
ATOM 9217   N N   . LEU A 1 99  ? -66.073  37.372  -56.923 1.00 30.00  ? 103 LEU C N   2  
ATOM 9218   C CA  . LEU A 1 99  ? -65.111  38.141  -56.147 1.00 30.00  ? 103 LEU C CA  2  
ATOM 9219   C C   . LEU A 1 99  ? -64.638  39.299  -57.008 1.00 30.00  ? 103 LEU C C   2  
ATOM 9220   O O   . LEU A 1 99  ? -65.015  40.447  -56.781 1.00 30.00  ? 103 LEU C O   2  
ATOM 9221   C CB  . LEU A 1 99  ? -63.929  37.254  -55.767 1.00 99.99  ? 103 LEU C CB  2  
ATOM 9222   C CG  . LEU A 1 99  ? -64.159  36.672  -54.375 1.00 99.99  ? 103 LEU C CG  2  
ATOM 9223   C CD1 . LEU A 1 99  ? -62.855  36.065  -53.858 1.00 99.99  ? 103 LEU C CD1 2  
ATOM 9224   C CD2 . LEU A 1 99  ? -64.614  37.777  -53.430 1.00 99.99  ? 103 LEU C CD2 2  
ATOM 9225   N N   . ARG A 1 100 ? -63.818  38.987  -57.999 1.00 30.00  ? 104 ARG C N   2  
ATOM 9226   C CA  . ARG A 1 100 ? -63.280  39.964  -58.935 1.00 30.00  ? 104 ARG C CA  2  
ATOM 9227   C C   . ARG A 1 100 ? -64.328  41.009  -59.379 1.00 30.00  ? 104 ARG C C   2  
ATOM 9228   O O   . ARG A 1 100 ? -63.992  42.143  -59.691 1.00 30.00  ? 104 ARG C O   2  
ATOM 9229   C CB  . ARG A 1 100 ? -62.770  39.262  -60.188 1.00 99.99  ? 104 ARG C CB  2  
ATOM 9230   C CG  . ARG A 1 100 ? -61.632  40.068  -60.798 1.00 99.99  ? 104 ARG C CG  2  
ATOM 9231   C CD  . ARG A 1 100 ? -60.929  39.233  -61.863 1.00 99.99  ? 104 ARG C CD  2  
ATOM 9232   N NE  . ARG A 1 100 ? -59.600  39.797  -62.188 1.00 99.99  ? 104 ARG C NE  2  
ATOM 9233   C CZ  . ARG A 1 100 ? -58.721  39.175  -62.968 1.00 99.99  ? 104 ARG C CZ  2  
ATOM 9234   N NH1 . ARG A 1 100 ? -58.977  37.990  -63.516 1.00 99.99  ? 104 ARG C NH1 2  
ATOM 9235   N NH2 . ARG A 1 100 ? -57.555  39.773  -63.195 1.00 99.99  ? 104 ARG C NH2 2  
ATOM 9236   N N   . SER A 1 101 ? -65.598  40.621  -59.411 1.00 30.00  ? 105 SER C N   2  
ATOM 9237   C CA  . SER A 1 101 ? -66.653  41.551  -59.818 1.00 30.00  ? 105 SER C CA  2  
ATOM 9238   C C   . SER A 1 101 ? -66.788  42.598  -58.729 1.00 30.00  ? 105 SER C C   2  
ATOM 9239   O O   . SER A 1 101 ? -66.705  43.795  -58.994 1.00 30.00  ? 105 SER C O   2  
ATOM 9240   C CB  . SER A 1 101 ? -67.969  40.800  -59.993 1.00 99.99  ? 105 SER C CB  2  
ATOM 9241   O OG  . SER A 1 101 ? -67.808  39.779  -60.981 1.00 99.99  ? 105 SER C OG  2  
ATOM 9242   N N   . ARG A 1 102 ? -67.000  42.121  -57.506 1.00 30.00  ? 106 ARG C N   2  
ATOM 9243   C CA  . ARG A 1 102 ? -67.146  42.960  -56.329 1.00 30.00  ? 106 ARG C CA  2  
ATOM 9244   C C   . ARG A 1 102 ? -65.882  43.806  -56.148 1.00 30.00  ? 106 ARG C C   2  
ATOM 9245   O O   . ARG A 1 102 ? -65.943  45.040  -56.199 1.00 30.00  ? 106 ARG C O   2  
ATOM 9246   C CB  . ARG A 1 102 ? -67.352  42.089  -55.095 1.00 99.99  ? 106 ARG C CB  2  
ATOM 9247   C CG  . ARG A 1 102 ? -68.582  41.210  -55.291 1.00 99.99  ? 106 ARG C CG  2  
ATOM 9248   C CD  . ARG A 1 102 ? -68.595  40.110  -54.234 1.00 99.99  ? 106 ARG C CD  2  
ATOM 9249   N NE  . ARG A 1 102 ? -68.682  40.684  -52.871 1.00 99.99  ? 106 ARG C NE  2  
ATOM 9250   C CZ  . ARG A 1 102 ? -69.837  40.921  -52.260 1.00 99.99  ? 106 ARG C CZ  2  
ATOM 9251   N NH1 . ARG A 1 102 ? -71.007  40.666  -52.837 1.00 99.99  ? 106 ARG C NH1 2  
ATOM 9252   N NH2 . ARG A 1 102 ? -69.801  41.440  -51.034 1.00 99.99  ? 106 ARG C NH2 2  
ATOM 9253   N N   . TYR A 1 103 ? -64.746  43.138  -55.950 1.00 30.00  ? 107 TYR C N   2  
ATOM 9254   C CA  . TYR A 1 103 ? -63.462  43.815  -55.773 1.00 30.00  ? 107 TYR C CA  2  
ATOM 9255   C C   . TYR A 1 103 ? -63.257  45.070  -56.639 1.00 30.00  ? 107 TYR C C   2  
ATOM 9256   O O   . TYR A 1 103 ? -62.992  46.147  -56.104 1.00 30.00  ? 107 TYR C O   2  
ATOM 9257   C CB  . TYR A 1 103 ? -62.320  42.864  -56.119 1.00 99.99  ? 107 TYR C CB  2  
ATOM 9258   C CG  . TYR A 1 103 ? -61.001  43.568  -55.932 1.00 99.99  ? 107 TYR C CG  2  
ATOM 9259   C CD1 . TYR A 1 103 ? -60.422  43.646  -54.660 1.00 99.99  ? 107 TYR C CD1 2  
ATOM 9260   C CD2 . TYR A 1 103 ? -60.354  44.149  -57.033 1.00 99.99  ? 107 TYR C CD2 2  
ATOM 9261   C CE1 . TYR A 1 103 ? -59.196  44.302  -54.489 1.00 99.99  ? 107 TYR C CE1 2  
ATOM 9262   C CE2 . TYR A 1 103 ? -59.129  44.804  -56.859 1.00 99.99  ? 107 TYR C CE2 2  
ATOM 9263   C CZ  . TYR A 1 103 ? -58.551  44.880  -55.586 1.00 99.99  ? 107 TYR C CZ  2  
ATOM 9264   O OH  . TYR A 1 103 ? -57.359  45.519  -55.418 1.00 99.99  ? 107 TYR C OH  2  
ATOM 9265   N N   . THR A 1 104 ? -63.374  44.945  -57.959 1.00 30.00  ? 108 THR C N   2  
ATOM 9266   C CA  . THR A 1 104 ? -63.184  46.101  -58.839 1.00 30.00  ? 108 THR C CA  2  
ATOM 9267   C C   . THR A 1 104 ? -64.263  47.159  -58.646 1.00 30.00  ? 108 THR C C   2  
ATOM 9268   O O   . THR A 1 104 ? -64.419  48.064  -59.463 1.00 30.00  ? 108 THR C O   2  
ATOM 9269   C CB  . THR A 1 104 ? -63.225  45.655  -60.297 1.00 99.99  ? 108 THR C CB  2  
ATOM 9270   O OG1 . THR A 1 104 ? -64.549  45.225  -60.627 1.00 99.99  ? 108 THR C OG1 2  
ATOM 9271   C CG2 . THR A 1 104 ? -62.248  44.503  -60.502 1.00 99.99  ? 108 THR C CG2 2  
ATOM 9272   N N   . SER A 1 105 ? -65.008  47.051  -57.562 1.00 30.00  ? 109 SER C N   2  
ATOM 9273   C CA  . SER A 1 105 ? -66.056  48.009  -57.289 1.00 30.00  ? 109 SER C CA  2  
ATOM 9274   C C   . SER A 1 105 ? -65.967  48.516  -55.855 1.00 30.00  ? 109 SER C C   2  
ATOM 9275   O O   . SER A 1 105 ? -66.856  49.220  -55.377 1.00 30.00  ? 109 SER C O   2  
ATOM 9276   C CB  . SER A 1 105 ? -67.419  47.361  -57.493 1.00 99.99  ? 109 SER C CB  2  
ATOM 9277   O OG  . SER A 1 105 ? -67.526  46.889  -58.838 1.00 99.99  ? 109 SER C OG  2  
ATOM 9278   N N   . GLY A 1 106 ? -64.889  48.146  -55.165 1.00 30.00  ? 110 GLY C N   2  
ATOM 9279   C CA  . GLY A 1 106 ? -64.697  48.583  -53.795 1.00 30.00  ? 110 GLY C CA  2  
ATOM 9280   C C   . GLY A 1 106 ? -65.056  47.561  -52.734 1.00 30.00  ? 110 GLY C C   2  
ATOM 9281   O O   . GLY A 1 106 ? -64.506  47.590  -51.626 1.00 30.00  ? 110 GLY C O   2  
ATOM 9282   N N   . LEU A 1 107 ? -65.974  46.659  -53.068 1.00 30.00  ? 111 LEU C N   2  
ATOM 9283   C CA  . LEU A 1 107 ? -66.400  45.627  -52.136 1.00 30.00  ? 111 LEU C CA  2  
ATOM 9284   C C   . LEU A 1 107 ? -65.321  44.553  -52.041 1.00 30.00  ? 111 LEU C C   2  
ATOM 9285   O O   . LEU A 1 107 ? -65.046  43.846  -53.014 1.00 30.00  ? 111 LEU C O   2  
ATOM 9286   C CB  . LEU A 1 107 ? -67.699  44.996  -52.621 1.00 99.99  ? 111 LEU C CB  2  
ATOM 9287   C CG  . LEU A 1 107 ? -68.883  45.685  -51.952 1.00 99.99  ? 111 LEU C CG  2  
ATOM 9288   C CD1 . LEU A 1 107 ? -70.145  44.859  -52.169 1.00 99.99  ? 111 LEU C CD1 2  
ATOM 9289   C CD2 . LEU A 1 107 ? -68.614  45.822  -50.457 1.00 99.99  ? 111 LEU C CD2 2  
ATOM 9290   N N   . ILE A 1 108 ? -64.719  44.438  -50.860 1.00 30.00  ? 112 ILE C N   2  
ATOM 9291   C CA  . ILE A 1 108 ? -63.650  43.477  -50.626 1.00 30.00  ? 112 ILE C CA  2  
ATOM 9292   C C   . ILE A 1 108 ? -64.038  42.357  -49.672 1.00 30.00  ? 112 ILE C C   2  
ATOM 9293   O O   . ILE A 1 108 ? -63.226  41.459  -49.393 1.00 30.00  ? 112 ILE C O   2  
ATOM 9294   C CB  . ILE A 1 108 ? -62.440  44.181  -50.027 1.00 99.99  ? 112 ILE C CB  2  
ATOM 9295   C CG1 . ILE A 1 108 ? -62.643  44.357  -48.527 1.00 99.99  ? 112 ILE C CG1 2  
ATOM 9296   C CG2 . ILE A 1 108 ? -62.276  45.551  -50.680 1.00 99.99  ? 112 ILE C CG2 2  
ATOM 9297   C CD1 . ILE A 1 108 ? -63.271  45.719  -48.251 1.00 99.99  ? 112 ILE C CD1 2  
ATOM 9298   N N   . TYR A 1 109 ? -65.264  42.403  -49.159 1.00 30.00  ? 113 TYR C N   2  
ATOM 9299   C CA  . TYR A 1 109 ? -65.737  41.372  -48.232 1.00 30.00  ? 113 TYR C CA  2  
ATOM 9300   C C   . TYR A 1 109 ? -66.887  40.575  -48.867 1.00 30.00  ? 113 TYR C C   2  
ATOM 9301   O O   . TYR A 1 109 ? -67.808  41.158  -49.460 1.00 30.00  ? 113 TYR C O   2  
ATOM 9302   C CB  . TYR A 1 109 ? -66.235  42.020  -46.945 1.00 99.99  ? 113 TYR C CB  2  
ATOM 9303   C CG  . TYR A 1 109 ? -66.715  40.951  -45.995 1.00 99.99  ? 113 TYR C CG  2  
ATOM 9304   C CD1 . TYR A 1 109 ? -65.801  40.268  -45.184 1.00 99.99  ? 113 TYR C CD1 2  
ATOM 9305   C CD2 . TYR A 1 109 ? -68.079  40.640  -45.924 1.00 99.99  ? 113 TYR C CD2 2  
ATOM 9306   C CE1 . TYR A 1 109 ? -66.247  39.276  -44.305 1.00 99.99  ? 113 TYR C CE1 2  
ATOM 9307   C CE2 . TYR A 1 109 ? -68.527  39.648  -45.043 1.00 99.99  ? 113 TYR C CE2 2  
ATOM 9308   C CZ  . TYR A 1 109 ? -67.610  38.966  -44.235 1.00 99.99  ? 113 TYR C CZ  2  
ATOM 9309   O OH  . TYR A 1 109 ? -68.046  38.002  -43.379 1.00 99.99  ? 113 TYR C OH  2  
ATOM 9310   N N   . THR A 1 110 ? -66.838  39.245  -48.756 1.00 30.00  ? 114 THR C N   2  
ATOM 9311   C CA  . THR A 1 110 ? -67.884  38.384  -49.336 1.00 30.00  ? 114 THR C CA  2  
ATOM 9312   C C   . THR A 1 110 ? -68.007  37.083  -48.566 1.00 30.00  ? 114 THR C C   2  
ATOM 9313   O O   . THR A 1 110 ? -66.997  36.462  -48.217 1.00 30.00  ? 114 THR C O   2  
ATOM 9314   C CB  . THR A 1 110 ? -67.543  38.059  -50.786 1.00 99.99  ? 114 THR C CB  2  
ATOM 9315   O OG1 . THR A 1 110 ? -67.435  39.275  -51.533 1.00 99.99  ? 114 THR C OG1 2  
ATOM 9316   C CG2 . THR A 1 110 ? -68.644  37.189  -51.384 1.00 99.99  ? 114 THR C CG2 2  
ATOM 9317   N N   . TYR A 1 111 ? -69.234  36.652  -48.296 1.00 30.00  ? 115 TYR C N   2  
ATOM 9318   C CA  . TYR A 1 111 ? -69.399  35.398  -47.570 1.00 30.00  ? 115 TYR C CA  2  
ATOM 9319   C C   . TYR A 1 111 ? -69.554  34.260  -48.584 1.00 30.00  ? 115 TYR C C   2  
ATOM 9320   O O   . TYR A 1 111 ? -69.804  34.484  -49.780 1.00 30.00  ? 115 TYR C O   2  
ATOM 9321   C CB  . TYR A 1 111 ? -70.640  35.470  -46.686 1.00 99.99  ? 115 TYR C CB  2  
ATOM 9322   C CG  . TYR A 1 111 ? -70.450  36.540  -45.640 1.00 99.99  ? 115 TYR C CG  2  
ATOM 9323   C CD1 . TYR A 1 111 ? -70.829  37.860  -45.910 1.00 99.99  ? 115 TYR C CD1 2  
ATOM 9324   C CD2 . TYR A 1 111 ? -69.900  36.212  -44.395 1.00 99.99  ? 115 TYR C CD2 2  
ATOM 9325   C CE1 . TYR A 1 111 ? -70.654  38.853  -44.940 1.00 99.99  ? 115 TYR C CE1 2  
ATOM 9326   C CE2 . TYR A 1 111 ? -69.725  37.205  -43.424 1.00 99.99  ? 115 TYR C CE2 2  
ATOM 9327   C CZ  . TYR A 1 111 ? -70.102  38.525  -43.695 1.00 99.99  ? 115 TYR C CZ  2  
ATOM 9328   O OH  . TYR A 1 111 ? -69.934  39.488  -42.749 1.00 99.99  ? 115 TYR C OH  2  
ATOM 9329   N N   . SER A 1 112 ? -68.814  33.257  -47.865 1.00 30.00  ? 116 SER C N   2  
ATOM 9330   C CA  . SER A 1 112 ? -68.673  32.063  -48.649 1.00 30.00  ? 116 SER C CA  2  
ATOM 9331   C C   . SER A 1 112 ? -69.350  31.065  -47.802 1.00 30.00  ? 116 SER C C   2  
ATOM 9332   O O   . SER A 1 112 ? -68.755  30.198  -47.207 1.00 30.00  ? 116 SER C O   2  
ATOM 9333   C CB  . SER A 1 112 ? -67.196  31.757  -48.869 1.00 99.99  ? 116 SER C CB  2  
ATOM 9334   O OG  . SER A 1 112 ? -66.595  31.386  -47.626 1.00 99.99  ? 116 SER C OG  2  
ATOM 9335   N N   . GLY A 1 113 ? -70.619  31.244  -47.688 1.00 30.00  ? 117 GLY C N   2  
ATOM 9336   C CA  . GLY A 1 113 ? -71.210  30.289  -46.831 1.00 30.00  ? 117 GLY C CA  2  
ATOM 9337   C C   . GLY A 1 113 ? -70.957  30.793  -45.439 1.00 30.00  ? 117 GLY C C   2  
ATOM 9338   O O   . GLY A 1 113 ? -71.172  31.970  -45.161 1.00 30.00  ? 117 GLY C O   2  
ATOM 9339   N N   . LEU A 1 114 ? -70.513  29.880  -44.569 1.00 30.00  ? 118 LEU C N   2  
ATOM 9340   C CA  . LEU A 1 114 ? -70.279  30.212  -43.168 1.00 30.00  ? 118 LEU C CA  2  
ATOM 9341   C C   . LEU A 1 114 ? -69.063  31.059  -42.761 1.00 30.00  ? 118 LEU C C   2  
ATOM 9342   O O   . LEU A 1 114 ? -68.992  31.577  -41.651 1.00 30.00  ? 118 LEU C O   2  
ATOM 9343   C CB  . LEU A 1 114 ? -70.111  28.934  -42.355 1.00 99.99  ? 118 LEU C CB  2  
ATOM 9344   C CG  . LEU A 1 114 ? -71.452  28.539  -41.744 1.00 99.99  ? 118 LEU C CG  2  
ATOM 9345   C CD1 . LEU A 1 114 ? -71.228  27.471  -40.677 1.00 99.99  ? 118 LEU C CD1 2  
ATOM 9346   C CD2 . LEU A 1 114 ? -72.100  29.764  -41.108 1.00 99.99  ? 118 LEU C CD2 2  
ATOM 9347   N N   . PHE A 1 115 ? -68.102  31.227  -43.653 1.00 30.00  ? 119 PHE C N   2  
ATOM 9348   C CA  . PHE A 1 115 ? -66.911  32.007  -43.365 1.00 30.00  ? 119 PHE C CA  2  
ATOM 9349   C C   . PHE A 1 115 ? -66.793  33.196  -44.295 1.00 30.00  ? 119 PHE C C   2  
ATOM 9350   O O   . PHE A 1 115 ? -67.448  33.257  -45.336 1.00 30.00  ? 119 PHE C O   2  
ATOM 9351   C CB  . PHE A 1 115 ? -65.670  31.137  -43.536 1.00 99.99  ? 119 PHE C CB  2  
ATOM 9352   C CG  . PHE A 1 115 ? -65.694  30.016  -42.526 1.00 99.99  ? 119 PHE C CG  2  
ATOM 9353   C CD1 . PHE A 1 115 ? -66.326  28.807  -42.840 1.00 99.99  ? 119 PHE C CD1 2  
ATOM 9354   C CD2 . PHE A 1 115 ? -65.087  30.185  -41.276 1.00 99.99  ? 119 PHE C CD2 2  
ATOM 9355   C CE1 . PHE A 1 115 ? -66.349  27.765  -41.905 1.00 99.99  ? 119 PHE C CE1 2  
ATOM 9356   C CE2 . PHE A 1 115 ? -65.111  29.146  -40.340 1.00 99.99  ? 119 PHE C CE2 2  
ATOM 9357   C CZ  . PHE A 1 115 ? -65.742  27.935  -40.653 1.00 99.99  ? 119 PHE C CZ  2  
ATOM 9358   N N   . CYS A 1 116 ? -65.927  34.108  -43.896 1.00 30.00  ? 120 CYS C N   2  
ATOM 9359   C CA  . CYS A 1 116 ? -65.715  35.296  -44.670 1.00 30.00  ? 120 CYS C CA  2  
ATOM 9360   C C   . CYS A 1 116 ? -64.493  35.242  -45.547 1.00 30.00  ? 120 CYS C C   2  
ATOM 9361   O O   . CYS A 1 116 ? -63.491  34.669  -45.170 1.00 30.00  ? 120 CYS C O   2  
ATOM 9362   C CB  . CYS A 1 116 ? -65.545  36.496  -43.741 1.00 99.99  ? 120 CYS C CB  2  
ATOM 9363   S SG  . CYS A 1 116 ? -64.066  36.485  -42.696 1.00 99.99  ? 120 CYS C SG  2  
ATOM 9364   N N   . ILE A 1 117 ? -64.631  36.175  -46.835 1.00 30.00  ? 121 ILE C N   2  
ATOM 9365   C CA  . ILE A 1 117 ? -63.495  36.374  -47.742 1.00 30.00  ? 121 ILE C CA  2  
ATOM 9366   C C   . ILE A 1 117 ? -63.090  37.825  -47.874 1.00 30.00  ? 121 ILE C C   2  
ATOM 9367   O O   . ILE A 1 117 ? -63.901  38.684  -48.256 1.00 30.00  ? 121 ILE C O   2  
ATOM 9368   C CB  . ILE A 1 117 ? -63.850  35.869  -49.137 1.00 99.99  ? 121 ILE C CB  2  
ATOM 9369   C CG1 . ILE A 1 117 ? -64.557  36.977  -49.915 1.00 99.99  ? 121 ILE C CG1 2  
ATOM 9370   C CG2 . ILE A 1 117 ? -64.773  34.661  -49.019 1.00 99.99  ? 121 ILE C CG2 2  
ATOM 9371   C CD1 . ILE A 1 117 ? -63.536  37.739  -50.750 1.00 99.99  ? 121 ILE C CD1 2  
ATOM 9372   N N   . ALA A 1 118 ? -61.827  38.090  -47.568 1.00 30.00  ? 122 ALA C N   2  
ATOM 9373   C CA  . ALA A 1 118 ? -61.298  39.431  -47.641 1.00 30.00  ? 122 ALA C CA  2  
ATOM 9374   C C   . ALA A 1 118 ? -60.242  39.514  -48.725 1.00 30.00  ? 122 ALA C C   2  
ATOM 9375   O O   . ALA A 1 118 ? -59.256  38.770  -48.701 1.00 30.00  ? 122 ALA C O   2  
ATOM 9376   C CB  . ALA A 1 118 ? -60.688  39.801  -46.297 1.00 30.00  ? 122 ALA C CB  2  
ATOM 9377   N N   . VAL A 1 119 ? -60.447  40.408  -49.681 1.00 30.00  ? 123 VAL C N   2  
ATOM 9378   C CA  . VAL A 1 119 ? -59.476  40.572  -50.756 1.00 30.00  ? 123 VAL C CA  2  
ATOM 9379   C C   . VAL A 1 119 ? -58.715  41.878  -50.506 1.00 30.00  ? 123 VAL C C   2  
ATOM 9380   O O   . VAL A 1 119 ? -59.302  42.959  -50.520 1.00 30.00  ? 123 VAL C O   2  
ATOM 9381   C CB  . VAL A 1 119 ? -60.196  40.636  -52.098 1.00 99.99  ? 123 VAL C CB  2  
ATOM 9382   C CG1 . VAL A 1 119 ? -60.975  39.341  -52.318 1.00 99.99  ? 123 VAL C CG1 2  
ATOM 9383   C CG2 . VAL A 1 119 ? -61.160  41.817  -52.107 1.00 99.99  ? 123 VAL C CG2 2  
ATOM 9384   N N   . ASN A 1 120 ? -57.388  41.868  -50.209 1.00 30.00  ? 124 ASN C N   2  
ATOM 9385   C CA  . ASN A 1 120 ? -56.563  43.040  -49.942 1.00 30.00  ? 124 ASN C CA  2  
ATOM 9386   C C   . ASN A 1 120 ? -56.811  44.248  -50.871 1.00 30.00  ? 124 ASN C C   2  
ATOM 9387   O O   . ASN A 1 120 ? -56.616  44.169  -52.088 1.00 30.00  ? 124 ASN C O   2  
ATOM 9388   C CB  . ASN A 1 120 ? -55.089  42.681  -50.092 1.00 99.99  ? 124 ASN C CB  2  
ATOM 9389   C CG  . ASN A 1 120 ? -54.772  42.235  -51.512 1.00 99.99  ? 124 ASN C CG  2  
ATOM 9390   O OD1 . ASN A 1 120 ? -53.607  42.136  -51.891 1.00 99.99  ? 124 ASN C OD1 2  
ATOM 9391   N ND2 . ASN A 1 120 ? -55.818  41.968  -52.298 1.00 99.99  ? 124 ASN C ND2 2  
ATOM 9392   N N   . PRO A 1 121 ? -57.216  45.401  -50.297 1.00 30.00  ? 125 PRO C N   2  
ATOM 9393   C CA  . PRO A 1 121 ? -57.500  46.629  -51.055 1.00 30.00  ? 125 PRO C CA  2  
ATOM 9394   C C   . PRO A 1 121 ? -56.324  47.452  -51.538 1.00 30.00  ? 125 PRO C C   2  
ATOM 9395   O O   . PRO A 1 121 ? -56.439  48.161  -52.552 1.00 30.00  ? 125 PRO C O   2  
ATOM 9396   C CB  . PRO A 1 121 ? -58.250  47.363  -50.000 1.00 99.99  ? 125 PRO C CB  2  
ATOM 9397   C CG  . PRO A 1 121 ? -58.334  46.430  -48.817 1.00 99.99  ? 125 PRO C CG  2  
ATOM 9398   C CD  . PRO A 1 121 ? -57.783  45.295  -49.019 1.00 99.99  ? 125 PRO C CD  2  
ATOM 9399   N N   . TYR A 1 122 ? -55.206  47.347  -50.817 1.00 30.00  ? 126 TYR C N   2  
ATOM 9400   C CA  . TYR A 1 122 ? -53.982  48.096  -51.126 1.00 30.00  ? 126 TYR C CA  2  
ATOM 9401   C C   . TYR A 1 122 ? -54.325  49.588  -51.234 1.00 30.00  ? 126 TYR C C   2  
ATOM 9402   O O   . TYR A 1 122 ? -53.851  50.299  -52.119 1.00 30.00  ? 126 TYR C O   2  
ATOM 9403   C CB  . TYR A 1 122 ? -53.395  47.609  -52.447 1.00 99.99  ? 126 TYR C CB  2  
ATOM 9404   C CG  . TYR A 1 122 ? -52.138  48.383  -52.756 1.00 99.99  ? 126 TYR C CG  2  
ATOM 9405   C CD1 . TYR A 1 122 ? -50.946  48.086  -52.082 1.00 99.99  ? 126 TYR C CD1 2  
ATOM 9406   C CD2 . TYR A 1 122 ? -52.159  49.402  -53.716 1.00 99.99  ? 126 TYR C CD2 2  
ATOM 9407   C CE1 . TYR A 1 122 ? -49.779  48.802  -52.369 1.00 99.99  ? 126 TYR C CE1 2  
ATOM 9408   C CE2 . TYR A 1 122 ? -50.992  50.123  -54.002 1.00 99.99  ? 126 TYR C CE2 2  
ATOM 9409   C CZ  . TYR A 1 122 ? -49.803  49.819  -53.327 1.00 99.99  ? 126 TYR C CZ  2  
ATOM 9410   O OH  . TYR A 1 122 ? -48.668  50.521  -53.608 1.00 99.99  ? 126 TYR C OH  2  
ATOM 9411   N N   . ARG A 1 123 ? -55.163  50.050  -50.311 1.00 30.00  ? 127 ARG C N   2  
ATOM 9412   C CA  . ARG A 1 123 ? -55.595  51.435  -50.268 1.00 30.00  ? 127 ARG C CA  2  
ATOM 9413   C C   . ARG A 1 123 ? -56.513  51.594  -49.049 1.00 30.00  ? 127 ARG C C   2  
ATOM 9414   O O   . ARG A 1 123 ? -57.150  50.642  -48.607 1.00 30.00  ? 127 ARG C O   2  
ATOM 9415   C CB  . ARG A 1 123 ? -56.350  51.781  -51.546 1.00 99.99  ? 127 ARG C CB  2  
ATOM 9416   C CG  . ARG A 1 123 ? -56.755  53.251  -51.514 1.00 99.99  ? 127 ARG C CG  2  
ATOM 9417   C CD  . ARG A 1 123 ? -57.552  53.588  -52.769 1.00 99.99  ? 127 ARG C CD  2  
ATOM 9418   N NE  . ARG A 1 123 ? -58.622  52.591  -52.999 1.00 99.99  ? 127 ARG C NE  2  
ATOM 9419   C CZ  . ARG A 1 123 ? -59.785  52.616  -52.351 1.00 99.99  ? 127 ARG C CZ  2  
ATOM 9420   N NH1 . ARG A 1 123 ? -60.067  53.546  -51.442 1.00 99.99  ? 127 ARG C NH1 2  
ATOM 9421   N NH2 . ARG A 1 123 ? -60.680  51.674  -52.636 1.00 99.99  ? 127 ARG C NH2 2  
ATOM 9422   N N   . ARG A 1 124 ? -56.577  52.795  -48.492 1.00 30.00  ? 128 ARG C N   2  
ATOM 9423   C CA  . ARG A 1 124 ? -57.410  53.009  -47.321 1.00 30.00  ? 128 ARG C CA  2  
ATOM 9424   C C   . ARG A 1 124 ? -58.873  53.187  -47.687 1.00 30.00  ? 128 ARG C C   2  
ATOM 9425   O O   . ARG A 1 124 ? -59.205  53.910  -48.629 1.00 30.00  ? 128 ARG C O   2  
ATOM 9426   C CB  . ARG A 1 124 ? -56.953  54.265  -46.579 1.00 99.99  ? 128 ARG C CB  2  
ATOM 9427   C CG  . ARG A 1 124 ? -57.800  54.452  -45.325 1.00 99.99  ? 128 ARG C CG  2  
ATOM 9428   C CD  . ARG A 1 124 ? -57.374  55.731  -44.613 1.00 99.99  ? 128 ARG C CD  2  
ATOM 9429   N NE  . ARG A 1 124 ? -57.306  56.866  -45.560 1.00 99.99  ? 128 ARG C NE  2  
ATOM 9430   C CZ  . ARG A 1 124 ? -58.376  57.541  -45.963 1.00 99.99  ? 128 ARG C CZ  2  
ATOM 9431   N NH1 . ARG A 1 124 ? -59.600  57.238  -45.541 1.00 99.99  ? 128 ARG C NH1 2  
ATOM 9432   N NH2 . ARG A 1 124 ? -58.197  58.545  -46.816 1.00 99.99  ? 128 ARG C NH2 2  
ATOM 9433   N N   . LEU A 1 125 ? -59.740  52.521  -46.931 1.00 30.00  ? 129 LEU C N   2  
ATOM 9434   C CA  . LEU A 1 125 ? -61.178  52.579  -47.162 1.00 30.00  ? 129 LEU C CA  2  
ATOM 9435   C C   . LEU A 1 125 ? -61.952  53.085  -45.959 1.00 30.00  ? 129 LEU C C   2  
ATOM 9436   O O   . LEU A 1 125 ? -61.709  52.662  -44.836 1.00 30.00  ? 129 LEU C O   2  
ATOM 9437   C CB  . LEU A 1 125 ? -61.705  51.188  -47.496 1.00 99.99  ? 129 LEU C CB  2  
ATOM 9438   C CG  . LEU A 1 125 ? -61.815  50.363  -46.218 1.00 99.99  ? 129 LEU C CG  2  
ATOM 9439   C CD1 . LEU A 1 125 ? -60.677  50.740  -45.272 1.00 99.99  ? 129 LEU C CD1 2  
ATOM 9440   C CD2 . LEU A 1 125 ? -63.152  50.646  -45.544 1.00 99.99  ? 129 LEU C CD2 2  
ATOM 9441   N N   . PRO A 1 126 ? -62.914  53.994  -46.189 1.00 30.00  ? 130 PRO C N   2  
ATOM 9442   C CA  . PRO A 1 126 ? -63.753  54.583  -45.133 1.00 30.00  ? 130 PRO C CA  2  
ATOM 9443   C C   . PRO A 1 126 ? -64.840  53.650  -44.622 1.00 30.00  ? 130 PRO C C   2  
ATOM 9444   O O   . PRO A 1 126 ? -65.948  54.088  -44.320 1.00 30.00  ? 130 PRO C O   2  
ATOM 9445   C CB  . PRO A 1 126 ? -64.316  55.715  -45.916 1.00 99.99  ? 130 PRO C CB  2  
ATOM 9446   C CG  . PRO A 1 126 ? -63.677  55.642  -47.280 1.00 99.99  ? 130 PRO C CG  2  
ATOM 9447   C CD  . PRO A 1 126 ? -62.843  54.684  -47.405 1.00 99.99  ? 130 PRO C CD  2  
ATOM 9448   N N   . ILE A 1 127 ? -64.517  52.370  -44.511 1.00 30.00  ? 131 ILE C N   2  
ATOM 9449   C CA  . ILE A 1 127 ? -65.482  51.373  -44.063 1.00 30.00  ? 131 ILE C CA  2  
ATOM 9450   C C   . ILE A 1 127 ? -65.299  50.909  -42.622 1.00 30.00  ? 131 ILE C C   2  
ATOM 9451   O O   . ILE A 1 127 ? -66.102  50.128  -42.112 1.00 30.00  ? 131 ILE C O   2  
ATOM 9452   C CB  . ILE A 1 127 ? -65.385  50.126  -44.935 1.00 99.99  ? 131 ILE C CB  2  
ATOM 9453   C CG1 . ILE A 1 127 ? -66.230  49.013  -44.327 1.00 99.99  ? 131 ILE C CG1 2  
ATOM 9454   C CG2 . ILE A 1 127 ? -63.931  49.675  -45.016 1.00 99.99  ? 131 ILE C CG2 2  
ATOM 9455   C CD1 . ILE A 1 127 ? -67.563  49.581  -43.857 1.00 99.99  ? 131 ILE C CD1 2  
ATOM 9456   N N   . TYR A 1 128 ? -64.250  51.398  -41.968 1.00 30.00  ? 132 TYR C N   2  
ATOM 9457   C CA  . TYR A 1 128 ? -63.957  51.024  -40.585 1.00 30.00  ? 132 TYR C CA  2  
ATOM 9458   C C   . TYR A 1 128 ? -64.275  52.097  -39.537 1.00 30.00  ? 132 TYR C C   2  
ATOM 9459   O O   . TYR A 1 128 ? -64.066  51.888  -38.338 1.00 30.00  ? 132 TYR C O   2  
ATOM 9460   C CB  . TYR A 1 128 ? -62.473  50.705  -40.437 1.00 99.99  ? 132 TYR C CB  2  
ATOM 9461   C CG  . TYR A 1 128 ? -61.667  51.973  -40.594 1.00 99.99  ? 132 TYR C CG  2  
ATOM 9462   C CD1 . TYR A 1 128 ? -61.217  52.361  -41.861 1.00 99.99  ? 132 TYR C CD1 2  
ATOM 9463   C CD2 . TYR A 1 128 ? -61.369  52.756  -39.474 1.00 99.99  ? 132 TYR C CD2 2  
ATOM 9464   C CE1 . TYR A 1 128 ? -60.468  53.536  -42.008 1.00 99.99  ? 132 TYR C CE1 2  
ATOM 9465   C CE2 . TYR A 1 128 ? -60.621  53.929  -39.620 1.00 99.99  ? 132 TYR C CE2 2  
ATOM 9466   C CZ  . TYR A 1 128 ? -60.172  54.319  -40.888 1.00 99.99  ? 132 TYR C CZ  2  
ATOM 9467   O OH  . TYR A 1 128 ? -59.444  55.460  -41.030 1.00 99.99  ? 132 TYR C OH  2  
ATOM 9468   N N   . THR A 1 129 ? -64.781  53.240  -39.993 1.00 30.00  ? 133 THR C N   2  
ATOM 9469   C CA  . THR A 1 129 ? -65.125  54.342  -39.111 1.00 30.00  ? 133 THR C CA  2  
ATOM 9470   C C   . THR A 1 129 ? -66.056  53.943  -37.967 1.00 30.00  ? 133 THR C C   2  
ATOM 9471   O O   . THR A 1 129 ? -66.600  52.835  -37.927 1.00 30.00  ? 133 THR C O   2  
ATOM 9472   C CB  . THR A 1 129 ? -65.833  55.438  -39.902 1.00 99.99  ? 133 THR C CB  2  
ATOM 9473   O OG1 . THR A 1 129 ? -67.110  54.968  -40.333 1.00 99.99  ? 133 THR C OG1 2  
ATOM 9474   C CG2 . THR A 1 129 ? -64.990  55.807  -41.118 1.00 99.99  ? 133 THR C CG2 2  
ATOM 9475   N N   . ASP A 1 130 ? -66.221  54.867  -37.035 1.00 30.00  ? 134 ASP C N   2  
ATOM 9476   C CA  . ASP A 1 130 ? -67.079  54.653  -35.881 1.00 30.00  ? 134 ASP C CA  2  
ATOM 9477   C C   . ASP A 1 130 ? -68.521  54.794  -36.354 1.00 30.00  ? 134 ASP C C   2  
ATOM 9478   O O   . ASP A 1 130 ? -69.460  54.279  -35.743 1.00 30.00  ? 134 ASP C O   2  
ATOM 9479   C CB  . ASP A 1 130 ? -66.768  55.685  -34.803 1.00 99.99  ? 134 ASP C CB  2  
ATOM 9480   C CG  . ASP A 1 130 ? -66.722  57.077  -35.431 1.00 99.99  ? 134 ASP C CG  2  
ATOM 9481   O OD1 . ASP A 1 130 ? -65.921  57.248  -36.391 1.00 99.99  ? 134 ASP C OD1 2  
ATOM 9482   O OD2 . ASP A 1 130 ? -67.482  57.955  -34.946 1.00 99.99  ? 134 ASP C OD2 2  
ATOM 9483   N N   . SER A 1 131 ? -68.685  55.518  -37.454 1.00 30.00  ? 135 SER C N   2  
ATOM 9484   C CA  . SER A 1 131 ? -70.002  55.722  -38.030 1.00 30.00  ? 135 SER C CA  2  
ATOM 9485   C C   . SER A 1 131 ? -70.496  54.332  -38.431 1.00 30.00  ? 135 SER C C   2  
ATOM 9486   O O   . SER A 1 131 ? -71.582  53.888  -38.044 1.00 30.00  ? 135 SER C O   2  
ATOM 9487   C CB  . SER A 1 131 ? -69.899  56.645  -39.240 1.00 99.99  ? 135 SER C CB  2  
ATOM 9488   O OG  . SER A 1 131 ? -69.199  55.978  -40.291 1.00 99.99  ? 135 SER C OG  2  
ATOM 9489   N N   . VAL A 1 132 ? -69.667  53.645  -39.205 1.00 30.00  ? 136 VAL C N   2  
ATOM 9490   C CA  . VAL A 1 132 ? -69.967  52.311  -39.689 1.00 30.00  ? 136 VAL C CA  2  
ATOM 9491   C C   . VAL A 1 132 ? -70.093  51.267  -38.591 1.00 30.00  ? 136 VAL C C   2  
ATOM 9492   O O   . VAL A 1 132 ? -70.933  50.370  -38.687 1.00 30.00  ? 136 VAL C O   2  
ATOM 9493   C CB  . VAL A 1 132 ? -68.863  51.838  -40.630 1.00 99.99  ? 136 VAL C CB  2  
ATOM 9494   C CG1 . VAL A 1 132 ? -68.760  52.793  -41.817 1.00 99.99  ? 136 VAL C CG1 2  
ATOM 9495   C CG2 . VAL A 1 132 ? -67.535  51.814  -39.883 1.00 99.99  ? 136 VAL C CG2 2  
ATOM 9496   N N   . ILE A 1 133 ? -69.270  51.369  -37.554 1.00 30.00  ? 137 ILE C N   2  
ATOM 9497   C CA  . ILE A 1 133 ? -69.338  50.391  -36.470 1.00 30.00  ? 137 ILE C CA  2  
ATOM 9498   C C   . ILE A 1 133 ? -70.682  50.422  -35.769 1.00 30.00  ? 137 ILE C C   2  
ATOM 9499   O O   . ILE A 1 133 ? -71.187  49.390  -35.311 1.00 30.00  ? 137 ILE C O   2  
ATOM 9500   C CB  . ILE A 1 133 ? -68.255  50.686  -35.437 1.00 99.99  ? 137 ILE C CB  2  
ATOM 9501   C CG1 . ILE A 1 133 ? -68.775  51.709  -34.434 1.00 99.99  ? 137 ILE C CG1 2  
ATOM 9502   C CG2 . ILE A 1 133 ? -67.021  51.245  -36.139 1.00 99.99  ? 137 ILE C CG2 2  
ATOM 9503   C CD1 . ILE A 1 133 ? -69.351  50.984  -33.220 1.00 99.99  ? 137 ILE C CD1 2  
ATOM 9504   N N   . ALA A 1 134 ? -71.258  51.620  -35.690 1.00 30.00  ? 138 ALA C N   2  
ATOM 9505   C CA  . ALA A 1 134 ? -72.554  51.839  -35.050 1.00 30.00  ? 138 ALA C CA  2  
ATOM 9506   C C   . ALA A 1 134 ? -73.641  51.000  -35.716 1.00 30.00  ? 138 ALA C C   2  
ATOM 9507   O O   . ALA A 1 134 ? -74.467  50.374  -35.047 1.00 30.00  ? 138 ALA C O   2  
ATOM 9508   C CB  . ALA A 1 134 ? -72.926  53.317  -35.136 1.00 30.00  ? 138 ALA C CB  2  
ATOM 9509   N N   . LYS A 1 135 ? -73.621  50.995  -37.042 1.00 30.00  ? 139 LYS C N   2  
ATOM 9510   C CA  . LYS A 1 135 ? -74.578  50.259  -37.848 1.00 30.00  ? 139 LYS C CA  2  
ATOM 9511   C C   . LYS A 1 135 ? -74.434  48.736  -37.827 1.00 30.00  ? 139 LYS C C   2  
ATOM 9512   O O   . LYS A 1 135 ? -75.414  48.027  -38.013 1.00 30.00  ? 139 LYS C O   2  
ATOM 9513   C CB  . LYS A 1 135 ? -74.452  50.672  -39.311 1.00 99.99  ? 139 LYS C CB  2  
ATOM 9514   C CG  . LYS A 1 135 ? -75.639  50.130  -40.098 1.00 99.99  ? 139 LYS C CG  2  
ATOM 9515   C CD  . LYS A 1 135 ? -75.565  50.629  -41.538 1.00 99.99  ? 139 LYS C CD  2  
ATOM 9516   C CE  . LYS A 1 135 ? -76.741  50.065  -42.330 1.00 99.99  ? 139 LYS C CE  2  
ATOM 9517   N NZ  . LYS A 1 135 ? -76.656  50.526  -43.723 1.00 99.99  ? 139 LYS C NZ  2  
ATOM 9518   N N   . TYR A 1 136 ? -73.228  48.225  -37.597 1.00 30.00  ? 140 TYR C N   2  
ATOM 9519   C CA  . TYR A 1 136 ? -73.033  46.781  -37.574 1.00 30.00  ? 140 TYR C CA  2  
ATOM 9520   C C   . TYR A 1 136 ? -73.319  46.147  -36.237 1.00 30.00  ? 140 TYR C C   2  
ATOM 9521   O O   . TYR A 1 136 ? -73.462  44.923  -36.142 1.00 30.00  ? 140 TYR C O   2  
ATOM 9522   C CB  . TYR A 1 136 ? -71.589  46.449  -37.926 1.00 99.99  ? 140 TYR C CB  2  
ATOM 9523   C CG  . TYR A 1 136 ? -70.882  45.911  -36.704 1.00 99.99  ? 140 TYR C CG  2  
ATOM 9524   C CD1 . TYR A 1 136 ? -71.318  46.283  -35.427 1.00 99.99  ? 140 TYR C CD1 2  
ATOM 9525   C CD2 . TYR A 1 136 ? -69.793  45.044  -36.849 1.00 99.99  ? 140 TYR C CD2 2  
ATOM 9526   C CE1 . TYR A 1 136 ? -70.663  45.786  -34.293 1.00 99.99  ? 140 TYR C CE1 2  
ATOM 9527   C CE2 . TYR A 1 136 ? -69.138  44.547  -35.716 1.00 99.99  ? 140 TYR C CE2 2  
ATOM 9528   C CZ  . TYR A 1 136 ? -69.574  44.919  -34.438 1.00 99.99  ? 140 TYR C CZ  2  
ATOM 9529   O OH  . TYR A 1 136 ? -68.935  44.435  -33.336 1.00 99.99  ? 140 TYR C OH  2  
ATOM 9530   N N   . ARG A 1 137 ? -73.408  46.969  -35.201 1.00 30.00  ? 141 ARG C N   2  
ATOM 9531   C CA  . ARG A 1 137 ? -73.669  46.465  -33.862 1.00 30.00  ? 141 ARG C CA  2  
ATOM 9532   C C   . ARG A 1 137 ? -74.973  45.650  -33.776 1.00 30.00  ? 141 ARG C C   2  
ATOM 9533   O O   . ARG A 1 137 ? -76.053  46.131  -34.149 1.00 30.00  ? 141 ARG C O   2  
ATOM 9534   C CB  . ARG A 1 137 ? -73.787  47.631  -32.884 1.00 99.99  ? 141 ARG C CB  2  
ATOM 9535   C CG  . ARG A 1 137 ? -73.348  47.175  -31.496 1.00 99.99  ? 141 ARG C CG  2  
ATOM 9536   C CD  . ARG A 1 137 ? -73.181  48.394  -30.593 1.00 99.99  ? 141 ARG C CD  2  
ATOM 9537   N NE  . ARG A 1 137 ? -72.381  48.056  -29.394 1.00 99.99  ? 141 ARG C NE  2  
ATOM 9538   C CZ  . ARG A 1 137 ? -71.958  48.970  -28.524 1.00 99.99  ? 141 ARG C CZ  2  
ATOM 9539   N NH1 . ARG A 1 137 ? -72.227  50.266  -28.676 1.00 99.99  ? 141 ARG C NH1 2  
ATOM 9540   N NH2 . ARG A 1 137 ? -71.246  48.558  -27.480 1.00 99.99  ? 141 ARG C NH2 2  
ATOM 9541   N N   . GLY A 1 138 ? -74.787  44.433  -33.278 1.00 30.00  ? 142 GLY C N   2  
ATOM 9542   C CA  . GLY A 1 138 ? -75.865  43.458  -32.995 1.00 30.00  ? 142 GLY C CA  2  
ATOM 9543   C C   . GLY A 1 138 ? -76.634  43.013  -34.253 1.00 30.00  ? 142 GLY C C   2  
ATOM 9544   O O   . GLY A 1 138 ? -77.715  42.417  -34.166 1.00 30.00  ? 142 GLY C O   2  
ATOM 9545   N N   . LYS A 1 139 ? -76.073  43.288  -35.411 1.00 30.00  ? 143 LYS C N   2  
ATOM 9546   C CA  . LYS A 1 139 ? -76.724  42.909  -36.680 1.00 30.00  ? 143 LYS C CA  2  
ATOM 9547   C C   . LYS A 1 139 ? -76.379  41.463  -37.052 1.00 30.00  ? 143 LYS C C   2  
ATOM 9548   O O   . LYS A 1 139 ? -75.235  41.019  -36.882 1.00 30.00  ? 143 LYS C O   2  
ATOM 9549   C CB  . LYS A 1 139 ? -76.249  43.831  -37.799 1.00 99.99  ? 143 LYS C CB  2  
ATOM 9550   C CG  . LYS A 1 139 ? -77.214  45.002  -37.939 1.00 99.99  ? 143 LYS C CG  2  
ATOM 9551   C CD  . LYS A 1 139 ? -76.974  45.996  -36.807 1.00 99.99  ? 143 LYS C CD  2  
ATOM 9552   C CE  . LYS A 1 139 ? -78.062  47.063  -36.827 1.00 99.99  ? 143 LYS C CE  2  
ATOM 9553   N NZ  . LYS A 1 139 ? -77.902  47.949  -35.666 1.00 99.99  ? 143 LYS C NZ  2  
ATOM 9554   N N   . ARG A 1 140 ? -77.400  40.793  -37.543 1.00 30.00  ? 144 ARG C N   2  
ATOM 9555   C CA  . ARG A 1 140 ? -77.324  39.398  -38.005 1.00 30.00  ? 144 ARG C CA  2  
ATOM 9556   C C   . ARG A 1 140 ? -76.848  39.416  -39.480 1.00 30.00  ? 144 ARG C C   2  
ATOM 9557   O O   . ARG A 1 140 ? -77.436  40.099  -40.324 1.00 30.00  ? 144 ARG C O   2  
ATOM 9558   C CB  . ARG A 1 140 ? -78.697  38.742  -37.901 1.00 99.99  ? 144 ARG C CB  2  
ATOM 9559   C CG  . ARG A 1 140 ? -79.642  39.376  -38.916 1.00 99.99  ? 144 ARG C CG  2  
ATOM 9560   C CD  . ARG A 1 140 ? -80.921  38.551  -39.006 1.00 99.99  ? 144 ARG C CD  2  
ATOM 9561   N NE  . ARG A 1 140 ? -81.910  39.202  -39.892 1.00 99.99  ? 144 ARG C NE  2  
ATOM 9562   C CZ  . ARG A 1 140 ? -83.144  38.735  -40.063 1.00 99.99  ? 144 ARG C CZ  2  
ATOM 9563   N NH1 . ARG A 1 140 ? -83.578  37.639  -39.446 1.00 99.99  ? 144 ARG C NH1 2  
ATOM 9564   N NH2 . ARG A 1 140 ? -83.955  39.400  -40.882 1.00 99.99  ? 144 ARG C NH2 2  
ATOM 9565   N N   . LYS A 1 141 ? -75.790  38.652  -39.722 1.00 30.00  ? 145 LYS C N   2  
ATOM 9566   C CA  . LYS A 1 141 ? -75.054  38.565  -41.026 1.00 30.00  ? 145 LYS C CA  2  
ATOM 9567   C C   . LYS A 1 141 ? -75.899  38.846  -42.306 1.00 30.00  ? 145 LYS C C   2  
ATOM 9568   O O   . LYS A 1 141 ? -75.421  39.467  -43.268 1.00 30.00  ? 145 LYS C O   2  
ATOM 9569   C CB  . LYS A 1 141 ? -74.479  37.164  -41.204 1.00 99.99  ? 145 LYS C CB  2  
ATOM 9570   C CG  . LYS A 1 141 ? -73.534  36.851  -40.050 1.00 99.99  ? 145 LYS C CG  2  
ATOM 9571   C CD  . LYS A 1 141 ? -72.882  35.492  -40.279 1.00 99.99  ? 145 LYS C CD  2  
ATOM 9572   C CE  . LYS A 1 141 ? -71.917  35.193  -39.135 1.00 99.99  ? 145 LYS C CE  2  
ATOM 9573   N NZ  . LYS A 1 141 ? -70.958  34.163  -39.563 1.00 99.99  ? 145 LYS C NZ  2  
ATOM 9574   N N   . THR A 1 142 ? -77.143  38.395  -42.347 1.00 30.00  ? 146 THR C N   2  
ATOM 9575   C CA  . THR A 1 142 ? -77.997  38.573  -43.558 1.00 30.00  ? 146 THR C CA  2  
ATOM 9576   C C   . THR A 1 142 ? -78.653  39.961  -43.601 1.00 30.00  ? 146 THR C C   2  
ATOM 9577   O O   . THR A 1 142 ? -79.065  40.443  -44.670 1.00 30.00  ? 146 THR C O   2  
ATOM 9578   C CB  . THR A 1 142 ? -79.109  37.528  -43.568 1.00 99.99  ? 146 THR C CB  2  
ATOM 9579   O OG1 . THR A 1 142 ? -80.021  37.793  -42.499 1.00 99.99  ? 146 THR C OG1 2  
ATOM 9580   C CG2 . THR A 1 142 ? -78.504  36.140  -43.387 1.00 99.99  ? 146 THR C CG2 2  
ATOM 9581   N N   . GLU A 1 143 ? -78.717  40.556  -42.436 1.00 30.00  ? 147 GLU C N   2  
ATOM 9582   C CA  . GLU A 1 143 ? -79.367  41.857  -42.218 1.00 30.00  ? 147 GLU C CA  2  
ATOM 9583   C C   . GLU A 1 143 ? -78.595  43.020  -42.848 1.00 30.00  ? 147 GLU C C   2  
ATOM 9584   O O   . GLU A 1 143 ? -79.188  44.005  -43.310 1.00 30.00  ? 147 GLU C O   2  
ATOM 9585   C CB  . GLU A 1 143 ? -79.483  42.134  -40.724 1.00 99.99  ? 147 GLU C CB  2  
ATOM 9586   C CG  . GLU A 1 143 ? -80.402  41.118  -40.090 1.00 99.99  ? 147 GLU C CG  2  
ATOM 9587   C CD  . GLU A 1 143 ? -81.843  41.403  -40.510 1.00 99.99  ? 147 GLU C CD  2  
ATOM 9588   O OE1 . GLU A 1 143 ? -82.260  40.844  -41.558 1.00 99.99  ? 147 GLU C OE1 2  
ATOM 9589   O OE2 . GLU A 1 143 ? -82.515  42.179  -39.777 1.00 99.99  ? 147 GLU C OE2 2  
ATOM 9590   N N   . ILE A 1 144 ? -77.280  42.912  -42.862 1.00 30.00  ? 148 ILE C N   2  
ATOM 9591   C CA  . ILE A 1 144 ? -76.445  44.013  -43.359 1.00 30.00  ? 148 ILE C CA  2  
ATOM 9592   C C   . ILE A 1 144 ? -75.294  43.520  -44.264 1.00 30.00  ? 148 ILE C C   2  
ATOM 9593   O O   . ILE A 1 144 ? -74.830  42.385  -44.109 1.00 30.00  ? 148 ILE C O   2  
ATOM 9594   C CB  . ILE A 1 144 ? -75.825  44.762  -42.184 1.00 99.99  ? 148 ILE C CB  2  
ATOM 9595   C CG1 . ILE A 1 144 ? -74.589  44.013  -41.696 1.00 99.99  ? 148 ILE C CG1 2  
ATOM 9596   C CG2 . ILE A 1 144 ? -76.842  44.858  -41.049 1.00 99.99  ? 148 ILE C CG2 2  
ATOM 9597   C CD1 . ILE A 1 144 ? -74.981  43.061  -40.572 1.00 99.99  ? 148 ILE C CD1 2  
ATOM 9598   N N   . PRO A 1 145 ? -74.839  44.361  -45.226 1.00 30.00  ? 149 PRO C N   2  
ATOM 9599   C CA  . PRO A 1 145 ? -73.750  44.000  -46.138 1.00 30.00  ? 149 PRO C CA  2  
ATOM 9600   C C   . PRO A 1 145 ? -72.643  43.171  -45.526 1.00 30.00  ? 149 PRO C C   2  
ATOM 9601   O O   . PRO A 1 145 ? -72.473  43.132  -44.305 1.00 30.00  ? 149 PRO C O   2  
ATOM 9602   C CB  . PRO A 1 145 ? -73.281  45.373  -46.467 1.00 99.99  ? 149 PRO C CB  2  
ATOM 9603   C CG  . PRO A 1 145 ? -74.208  46.319  -45.737 1.00 99.99  ? 149 PRO C CG  2  
ATOM 9604   C CD  . PRO A 1 145 ? -75.122  45.725  -45.073 1.00 99.99  ? 149 PRO C CD  2  
ATOM 9605   N N   . PRO A 1 146 ? -71.863  42.481  -46.370 1.00 30.00  ? 150 PRO C N   2  
ATOM 9606   C CA  . PRO A 1 146 ? -70.795  41.676  -45.786 1.00 30.00  ? 150 PRO C CA  2  
ATOM 9607   C C   . PRO A 1 146 ? -69.676  42.571  -45.235 1.00 30.00  ? 150 PRO C C   2  
ATOM 9608   O O   . PRO A 1 146 ? -69.246  43.548  -45.870 1.00 30.00  ? 150 PRO C O   2  
ATOM 9609   C CB  . PRO A 1 146 ? -70.394  40.935  -47.013 1.00 99.99  ? 150 PRO C CB  2  
ATOM 9610   C CG  . PRO A 1 146 ? -71.603  40.942  -47.921 1.00 99.99  ? 150 PRO C CG  2  
ATOM 9611   C CD  . PRO A 1 146 ? -72.332  41.979  -47.788 1.00 99.99  ? 150 PRO C CD  2  
ATOM 9612   N N   . HIS A 1 147 ? -69.212  42.232  -44.045 1.00 30.00  ? 151 HIS C N   2  
ATOM 9613   C CA  . HIS A 1 147 ? -68.158  42.995  -43.422 1.00 30.00  ? 151 HIS C CA  2  
ATOM 9614   C C   . HIS A 1 147 ? -67.519  42.167  -42.341 1.00 30.00  ? 151 HIS C C   2  
ATOM 9615   O O   . HIS A 1 147 ? -68.131  41.240  -41.792 1.00 30.00  ? 151 HIS C O   2  
ATOM 9616   C CB  . HIS A 1 147 ? -68.731  44.269  -42.814 1.00 99.99  ? 151 HIS C CB  2  
ATOM 9617   C CG  . HIS A 1 147 ? -67.710  45.311  -42.425 1.00 99.99  ? 151 HIS C CG  2  
ATOM 9618   N ND1 . HIS A 1 147 ? -67.134  45.341  -41.162 1.00 99.99  ? 151 HIS C ND1 2  
ATOM 9619   C CD2 . HIS A 1 147 ? -67.169  46.342  -43.126 1.00 99.99  ? 151 HIS C CD2 2  
ATOM 9620   C CE1 . HIS A 1 147 ? -66.288  46.354  -41.123 1.00 99.99  ? 151 HIS C CE1 2  
ATOM 9621   N NE2 . HIS A 1 147 ? -66.296  46.961  -42.284 1.00 99.99  ? 151 HIS C NE2 2  
ATOM 9622   N N   . LEU A 1 148 ? -66.276  42.524  -42.042 1.00 30.00  ? 152 LEU C N   2  
ATOM 9623   C CA  . LEU A 1 148 ? -65.502  41.853  -41.020 1.00 30.00  ? 152 LEU C CA  2  
ATOM 9624   C C   . LEU A 1 148 ? -66.144  42.147  -39.652 1.00 30.00  ? 152 LEU C C   2  
ATOM 9625   O O   . LEU A 1 148 ? -66.100  41.314  -38.738 1.00 30.00  ? 152 LEU C O   2  
ATOM 9626   C CB  . LEU A 1 148 ? -64.064  42.366  -41.038 1.00 99.99  ? 152 LEU C CB  2  
ATOM 9627   C CG  . LEU A 1 148 ? -63.208  41.443  -41.894 1.00 99.99  ? 152 LEU C CG  2  
ATOM 9628   C CD1 . LEU A 1 148 ? -61.733  41.750  -41.653 1.00 99.99  ? 152 LEU C CD1 2  
ATOM 9629   C CD2 . LEU A 1 148 ? -63.492  39.991  -41.521 1.00 99.99  ? 152 LEU C CD2 2  
ATOM 9630   N N   . PHE A 1 149 ? -66.760  43.328  -39.516 1.00 30.00  ? 153 PHE C N   2  
ATOM 9631   C CA  . PHE A 1 149 ? -67.393  43.678  -38.242 1.00 30.00  ? 153 PHE C CA  2  
ATOM 9632   C C   . PHE A 1 149 ? -68.451  42.652  -37.935 1.00 30.00  ? 153 PHE C C   2  
ATOM 9633   O O   . PHE A 1 149 ? -68.560  42.185  -36.800 1.00 30.00  ? 153 PHE C O   2  
ATOM 9634   C CB  . PHE A 1 149 ? -68.029  45.061  -38.343 1.00 99.99  ? 153 PHE C CB  2  
ATOM 9635   C CG  . PHE A 1 149 ? -66.947  46.115  -38.338 1.00 99.99  ? 153 PHE C CG  2  
ATOM 9636   C CD1 . PHE A 1 149 ? -66.328  46.474  -37.134 1.00 99.99  ? 153 PHE C CD1 2  
ATOM 9637   C CD2 . PHE A 1 149 ? -66.564  46.732  -39.536 1.00 99.99  ? 153 PHE C CD2 2  
ATOM 9638   C CE1 . PHE A 1 149 ? -65.325  47.454  -37.131 1.00 99.99  ? 153 PHE C CE1 2  
ATOM 9639   C CE2 . PHE A 1 149 ? -65.562  47.710  -39.528 1.00 99.99  ? 153 PHE C CE2 2  
ATOM 9640   C CZ  . PHE A 1 149 ? -64.944  48.068  -38.326 1.00 99.99  ? 153 PHE C CZ  2  
ATOM 9641   N N   . SER A 1 150 ? -69.223  42.299  -38.962 1.00 30.00  ? 154 SER C N   2  
ATOM 9642   C CA  . SER A 1 150 ? -70.294  41.313  -38.857 1.00 30.00  ? 154 SER C CA  2  
ATOM 9643   C C   . SER A 1 150 ? -69.780  39.985  -38.322 1.00 30.00  ? 154 SER C C   2  
ATOM 9644   O O   . SER A 1 150 ? -70.408  39.354  -37.469 1.00 30.00  ? 154 SER C O   2  
ATOM 9645   C CB  . SER A 1 150 ? -70.913  41.072  -40.229 1.00 99.99  ? 154 SER C CB  2  
ATOM 9646   O OG  . SER A 1 150 ? -71.426  42.301  -40.746 1.00 99.99  ? 154 SER C OG  2  
ATOM 9647   N N   . VAL A 1 151 ? -68.628  39.557  -38.826 1.00 30.00  ? 155 VAL C N   2  
ATOM 9648   C CA  . VAL A 1 151 ? -68.042  38.300  -38.375 1.00 30.00  ? 155 VAL C CA  2  
ATOM 9649   C C   . VAL A 1 151 ? -67.730  38.405  -36.882 1.00 30.00  ? 155 VAL C C   2  
ATOM 9650   O O   . VAL A 1 151 ? -68.029  37.484  -36.112 1.00 30.00  ? 155 VAL C O   2  
ATOM 9651   C CB  . VAL A 1 151 ? -66.755  38.020  -39.145 1.00 99.99  ? 155 VAL C CB  2  
ATOM 9652   C CG1 . VAL A 1 151 ? -66.122  36.731  -38.631 1.00 99.99  ? 155 VAL C CG1 2  
ATOM 9653   C CG2 . VAL A 1 151 ? -67.071  37.875  -40.628 1.00 99.99  ? 155 VAL C CG2 2  
ATOM 9654   N N   . ALA A 1 152 ? -67.122  39.539  -36.497 1.00 30.00  ? 156 ALA C N   2  
ATOM 9655   C CA  . ALA A 1 152 ? -66.743  39.828  -35.098 1.00 30.00  ? 156 ALA C CA  2  
ATOM 9656   C C   . ALA A 1 152 ? -68.004  40.001  -34.251 1.00 30.00  ? 156 ALA C C   2  
ATOM 9657   O O   . ALA A 1 152 ? -68.173  39.347  -33.206 1.00 30.00  ? 156 ALA C O   2  
ATOM 9658   C CB  . ALA A 1 152 ? -65.913  41.088  -35.048 1.00 30.00  ? 156 ALA C CB  2  
ATOM 9659   N N   . ASP A 1 153 ? -68.887  40.885  -34.709 1.00 30.00  ? 157 ASP C N   2  
ATOM 9660   C CA  . ASP A 1 153 ? -70.130  41.105  -33.994 1.00 30.00  ? 157 ASP C CA  2  
ATOM 9661   C C   . ASP A 1 153 ? -70.857  39.776  -33.759 1.00 30.00  ? 157 ASP C C   2  
ATOM 9662   O O   . ASP A 1 153 ? -71.398  39.534  -32.679 1.00 30.00  ? 157 ASP C O   2  
ATOM 9663   C CB  . ASP A 1 153 ? -71.037  42.026  -34.802 1.00 99.99  ? 157 ASP C CB  2  
ATOM 9664   C CG  . ASP A 1 153 ? -72.227  42.451  -33.946 1.00 99.99  ? 157 ASP C CG  2  
ATOM 9665   O OD1 . ASP A 1 153 ? -73.175  41.631  -33.829 1.00 99.99  ? 157 ASP C OD1 2  
ATOM 9666   O OD2 . ASP A 1 153 ? -72.175  43.591  -33.412 1.00 99.99  ? 157 ASP C OD2 2  
ATOM 9667   N N   . ASN A 1 154 ? -70.881  38.899  -34.756 1.00 30.00  ? 158 ASN C N   2  
ATOM 9668   C CA  . ASN A 1 154 ? -71.574  37.642  -34.558 1.00 30.00  ? 158 ASN C CA  2  
ATOM 9669   C C   . ASN A 1 154 ? -70.887  36.726  -33.562 1.00 30.00  ? 158 ASN C C   2  
ATOM 9670   O O   . ASN A 1 154 ? -71.556  36.113  -32.745 1.00 30.00  ? 158 ASN C O   2  
ATOM 9671   C CB  . ASN A 1 154 ? -71.665  36.887  -35.879 1.00 99.99  ? 158 ASN C CB  2  
ATOM 9672   C CG  . ASN A 1 154 ? -72.811  37.407  -36.732 1.00 99.99  ? 158 ASN C CG  2  
ATOM 9673   O OD1 . ASN A 1 154 ? -73.970  37.347  -36.323 1.00 99.99  ? 158 ASN C OD1 2  
ATOM 9674   N ND2 . ASN A 1 154 ? -72.486  37.924  -37.920 1.00 99.99  ? 158 ASN C ND2 2  
ATOM 9675   N N   . ALA A 1 155 ? -69.568  36.619  -33.616 1.00 30.00  ? 159 ALA C N   2  
ATOM 9676   C CA  . ALA A 1 155 ? -68.885  35.754  -32.666 1.00 30.00  ? 159 ALA C CA  2  
ATOM 9677   C C   . ALA A 1 155 ? -69.223  36.230  -31.252 1.00 30.00  ? 159 ALA C C   2  
ATOM 9678   O O   . ALA A 1 155 ? -69.335  35.427  -30.326 1.00 30.00  ? 159 ALA C O   2  
ATOM 9679   C CB  . ALA A 1 155 ? -67.379  35.803  -32.893 1.00 30.00  ? 159 ALA C CB  2  
ATOM 9680   N N   . TYR A 1 156 ? -69.394  37.539  -31.082 1.00 30.00  ? 160 TYR C N   2  
ATOM 9681   C CA  . TYR A 1 156 ? -69.720  38.080  -29.768 1.00 30.00  ? 160 TYR C CA  2  
ATOM 9682   C C   . TYR A 1 156 ? -71.067  37.541  -29.303 1.00 30.00  ? 160 TYR C C   2  
ATOM 9683   O O   . TYR A 1 156 ? -71.169  36.947  -28.223 1.00 30.00  ? 160 TYR C O   2  
ATOM 9684   C CB  . TYR A 1 156 ? -69.788  39.602  -29.834 1.00 99.99  ? 160 TYR C CB  2  
ATOM 9685   C CG  . TYR A 1 156 ? -70.126  40.153  -28.471 1.00 99.99  ? 160 TYR C CG  2  
ATOM 9686   C CD1 . TYR A 1 156 ? -69.115  40.334  -27.519 1.00 99.99  ? 160 TYR C CD1 2  
ATOM 9687   C CD2 . TYR A 1 156 ? -71.452  40.480  -28.156 1.00 99.99  ? 160 TYR C CD2 2  
ATOM 9688   C CE1 . TYR A 1 156 ? -69.429  40.847  -26.254 1.00 99.99  ? 160 TYR C CE1 2  
ATOM 9689   C CE2 . TYR A 1 156 ? -71.764  40.991  -26.890 1.00 99.99  ? 160 TYR C CE2 2  
ATOM 9690   C CZ  . TYR A 1 156 ? -70.752  41.174  -25.939 1.00 99.99  ? 160 TYR C CZ  2  
ATOM 9691   O OH  . TYR A 1 156 ? -71.058  41.670  -24.710 1.00 99.99  ? 160 TYR C OH  2  
ATOM 9692   N N   . GLN A 1 157 ? -72.096  37.752  -30.129 1.00 30.00  ? 161 GLN C N   2  
ATOM 9693   C CA  . GLN A 1 157 ? -73.446  37.292  -29.818 1.00 30.00  ? 161 GLN C CA  2  
ATOM 9694   C C   . GLN A 1 157 ? -73.468  35.804  -29.438 1.00 30.00  ? 161 GLN C C   2  
ATOM 9695   O O   . GLN A 1 157 ? -74.139  35.415  -28.476 1.00 30.00  ? 161 GLN C O   2  
ATOM 9696   C CB  . GLN A 1 157 ? -74.352  37.488  -31.028 1.00 99.99  ? 161 GLN C CB  2  
ATOM 9697   C CG  . GLN A 1 157 ? -75.803  37.588  -30.566 1.00 99.99  ? 161 GLN C CG  2  
ATOM 9698   C CD  . GLN A 1 157 ? -76.423  36.208  -30.406 1.00 99.99  ? 161 GLN C CD  2  
ATOM 9699   O OE1 . GLN A 1 157 ? -75.766  35.195  -30.641 1.00 99.99  ? 161 GLN C OE1 2  
ATOM 9700   N NE2 . GLN A 1 157 ? -77.699  36.166  -30.004 1.00 99.99  ? 161 GLN C NE2 2  
ATOM 9701   N N   . ASN A 1 158 ? -72.732  34.977  -30.187 1.00 30.00  ? 162 ASN C N   2  
ATOM 9702   C CA  . ASN A 1 158 ? -72.673  33.530  -29.924 1.00 30.00  ? 162 ASN C CA  2  
ATOM 9703   C C   . ASN A 1 158 ? -72.072  33.221  -28.566 1.00 30.00  ? 162 ASN C C   2  
ATOM 9704   O O   . ASN A 1 158 ? -72.617  32.434  -27.801 1.00 30.00  ? 162 ASN C O   2  
ATOM 9705   C CB  . ASN A 1 158 ? -71.818  32.845  -30.984 1.00 99.99  ? 162 ASN C CB  2  
ATOM 9706   C CG  . ASN A 1 158 ? -72.434  32.993  -32.369 1.00 99.99  ? 162 ASN C CG  2  
ATOM 9707   O OD1 . ASN A 1 158 ? -73.596  32.651  -32.574 1.00 99.99  ? 162 ASN C OD1 2  
ATOM 9708   N ND2 . ASN A 1 158 ? -71.651  33.506  -33.319 1.00 99.99  ? 162 ASN C ND2 2  
ATOM 9709   N N   . MET A 1 159 ? -70.931  33.835  -28.272 1.00 30.00  ? 163 MET C N   2  
ATOM 9710   C CA  . MET A 1 159 ? -70.282  33.599  -26.997 1.00 30.00  ? 163 MET C CA  2  
ATOM 9711   C C   . MET A 1 159 ? -71.251  33.943  -25.881 1.00 30.00  ? 163 MET C C   2  
ATOM 9712   O O   . MET A 1 159 ? -71.370  33.210  -24.888 1.00 30.00  ? 163 MET C O   2  
ATOM 9713   C CB  . MET A 1 159 ? -69.035  34.468  -26.880 1.00 99.99  ? 163 MET C CB  2  
ATOM 9714   C CG  . MET A 1 159 ? -68.067  34.126  -28.007 1.00 99.99  ? 163 MET C CG  2  
ATOM 9715   S SD  . MET A 1 159 ? -66.380  34.572  -27.532 1.00 99.99  ? 163 MET C SD  2  
ATOM 9716   C CE  . MET A 1 159 ? -66.568  36.329  -27.328 1.00 99.99  ? 163 MET C CE  2  
ATOM 9717   N N   . VAL A 1 160 ? -71.942  35.070  -26.062 1.00 30.00  ? 164 VAL C N   2  
ATOM 9718   C CA  . VAL A 1 160 ? -72.922  35.562  -25.098 1.00 30.00  ? 164 VAL C CA  2  
ATOM 9719   C C   . VAL A 1 160 ? -74.105  34.595  -24.954 1.00 30.00  ? 164 VAL C C   2  
ATOM 9720   O O   . VAL A 1 160 ? -74.232  33.894  -23.939 1.00 30.00  ? 164 VAL C O   2  
ATOM 9721   C CB  . VAL A 1 160 ? -73.458  36.917  -25.549 1.00 99.99  ? 164 VAL C CB  2  
ATOM 9722   C CG1 . VAL A 1 160 ? -74.517  37.397  -24.560 1.00 99.99  ? 164 VAL C CG1 2  
ATOM 9723   C CG2 . VAL A 1 160 ? -72.317  37.926  -25.602 1.00 99.99  ? 164 VAL C CG2 2  
ATOM 9724   N N   . THR A 1 161 ? -74.962  34.539  -25.977 1.00 30.00  ? 165 THR C N   2  
ATOM 9725   C CA  . THR A 1 161 ? -76.122  33.659  -25.939 1.00 30.00  ? 165 THR C CA  2  
ATOM 9726   C C   . THR A 1 161 ? -75.776  32.175  -25.775 1.00 30.00  ? 165 THR C C   2  
ATOM 9727   O O   . THR A 1 161 ? -76.367  31.505  -24.930 1.00 30.00  ? 165 THR C O   2  
ATOM 9728   C CB  . THR A 1 161 ? -76.918  33.793  -27.234 1.00 99.99  ? 165 THR C CB  2  
ATOM 9729   O OG1 . THR A 1 161 ? -76.151  33.257  -28.317 1.00 99.99  ? 165 THR C OG1 2  
ATOM 9730   C CG2 . THR A 1 161 ? -77.211  35.262  -27.501 1.00 99.99  ? 165 THR C CG2 2  
ATOM 9731   N N   . ASP A 1 162 ? -74.824  31.669  -26.558 1.00 30.00  ? 166 ASP C N   2  
ATOM 9732   C CA  . ASP A 1 162 ? -74.428  30.250  -26.479 1.00 30.00  ? 166 ASP C CA  2  
ATOM 9733   C C   . ASP A 1 162 ? -73.560  29.924  -25.270 1.00 30.00  ? 166 ASP C C   2  
ATOM 9734   O O   . ASP A 1 162 ? -73.386  28.754  -24.929 1.00 30.00  ? 166 ASP C O   2  
ATOM 9735   C CB  . ASP A 1 162 ? -73.637  29.862  -27.722 1.00 99.99  ? 166 ASP C CB  2  
ATOM 9736   C CG  . ASP A 1 162 ? -74.552  29.884  -28.941 1.00 99.99  ? 166 ASP C CG  2  
ATOM 9737   O OD1 . ASP A 1 162 ? -75.411  28.965  -29.035 1.00 99.99  ? 166 ASP C OD1 2  
ATOM 9738   O OD2 . ASP A 1 162 ? -74.391  30.823  -29.769 1.00 99.99  ? 166 ASP C OD2 2  
ATOM 9739   N N   . ARG A 1 163 ? -73.008  30.946  -24.628 1.00 30.00  ? 167 ARG C N   2  
ATOM 9740   C CA  . ARG A 1 163 ? -72.143  30.774  -23.452 1.00 30.00  ? 167 ARG C CA  2  
ATOM 9741   C C   . ARG A 1 163 ? -71.030  29.769  -23.761 1.00 30.00  ? 167 ARG C C   2  
ATOM 9742   O O   . ARG A 1 163 ? -71.033  28.642  -23.255 1.00 30.00  ? 167 ARG C O   2  
ATOM 9743   C CB  . ARG A 1 163 ? -72.966  30.258  -22.275 1.00 99.99  ? 167 ARG C CB  2  
ATOM 9744   C CG  . ARG A 1 163 ? -73.971  31.323  -21.851 1.00 99.99  ? 167 ARG C CG  2  
ATOM 9745   C CD  . ARG A 1 163 ? -75.027  30.695  -20.947 1.00 99.99  ? 167 ARG C CD  2  
ATOM 9746   N NE  . ARG A 1 163 ? -76.086  31.672  -20.612 1.00 99.99  ? 167 ARG C NE  2  
ATOM 9747   C CZ  . ARG A 1 163 ? -77.064  31.998  -21.453 1.00 99.99  ? 167 ARG C CZ  2  
ATOM 9748   N NH1 . ARG A 1 163 ? -77.155  31.463  -22.670 1.00 99.99  ? 167 ARG C NH1 2  
ATOM 9749   N NH2 . ARG A 1 163 ? -77.966  32.888  -21.051 1.00 99.99  ? 167 ARG C NH2 2  
ATOM 9750   N N   . GLU A 1 164 ? -70.055  30.188  -24.579 1.00 30.00  ? 168 GLU C N   2  
ATOM 9751   C CA  . GLU A 1 164 ? -68.898  29.370  -24.978 1.00 30.00  ? 168 GLU C CA  2  
ATOM 9752   C C   . GLU A 1 164 ? -67.818  30.288  -25.590 1.00 30.00  ? 168 GLU C C   2  
ATOM 9753   O O   . GLU A 1 164 ? -68.122  31.421  -25.979 1.00 30.00  ? 168 GLU C O   2  
ATOM 9754   C CB  . GLU A 1 164 ? -69.328  28.331  -26.009 1.00 99.99  ? 168 GLU C CB  2  
ATOM 9755   C CG  . GLU A 1 164 ? -68.397  28.381  -27.195 1.00 99.99  ? 168 GLU C CG  2  
ATOM 9756   C CD  . GLU A 1 164 ? -68.647  29.662  -27.986 1.00 99.99  ? 168 GLU C CD  2  
ATOM 9757   O OE1 . GLU A 1 164 ? -67.982  30.679  -27.662 1.00 99.99  ? 168 GLU C OE1 2  
ATOM 9758   O OE2 . GLU A 1 164 ? -69.506  29.609  -28.908 1.00 99.99  ? 168 GLU C OE2 2  
ATOM 9759   N N   . ASN A 1 165 ? -66.577  29.810  -25.675 1.00 30.00  ? 169 ASN C N   2  
ATOM 9760   C CA  . ASN A 1 165 ? -65.501  30.621  -26.255 1.00 30.00  ? 169 ASN C CA  2  
ATOM 9761   C C   . ASN A 1 165 ? -65.585  30.655  -27.779 1.00 30.00  ? 169 ASN C C   2  
ATOM 9762   O O   . ASN A 1 165 ? -65.923  29.648  -28.418 1.00 30.00  ? 169 ASN C O   2  
ATOM 9763   C CB  . ASN A 1 165 ? -64.146  30.039  -25.863 1.00 99.99  ? 169 ASN C CB  2  
ATOM 9764   C CG  . ASN A 1 165 ? -63.941  30.088  -24.357 1.00 99.99  ? 169 ASN C CG  2  
ATOM 9765   O OD1 . ASN A 1 165 ? -64.065  31.148  -23.744 1.00 99.99  ? 169 ASN C OD1 2  
ATOM 9766   N ND2 . ASN A 1 165 ? -63.628  28.937  -23.759 1.00 99.99  ? 169 ASN C ND2 2  
ATOM 9767   N N   . GLN A 1 166 ? -65.282  31.813  -28.354 1.00 30.00  ? 170 GLN C N   2  
ATOM 9768   C CA  . GLN A 1 166 ? -65.307  31.969  -29.803 1.00 30.00  ? 170 GLN C CA  2  
ATOM 9769   C C   . GLN A 1 166 ? -63.872  32.040  -30.287 1.00 30.00  ? 170 GLN C C   2  
ATOM 9770   O O   . GLN A 1 166 ? -62.933  31.988  -29.484 1.00 30.00  ? 170 GLN C O   2  
ATOM 9771   C CB  . GLN A 1 166 ? -66.054  33.243  -30.175 1.00 99.99  ? 170 GLN C CB  2  
ATOM 9772   C CG  . GLN A 1 166 ? -67.516  33.118  -29.762 1.00 99.99  ? 170 GLN C CG  2  
ATOM 9773   C CD  . GLN A 1 166 ? -68.260  32.145  -30.666 1.00 99.99  ? 170 GLN C CD  2  
ATOM 9774   O OE1 . GLN A 1 166 ? -67.677  31.578  -31.587 1.00 99.99  ? 170 GLN C OE1 2  
ATOM 9775   N NE2 . GLN A 1 166 ? -69.554  31.952  -30.401 1.00 99.99  ? 170 GLN C NE2 2  
ATOM 9776   N N   . SER A 1 167 ? -63.690  32.154  -31.596 1.00 30.00  ? 171 SER C N   2  
ATOM 9777   C CA  . SER A 1 167 ? -62.347  32.225  -32.153 1.00 30.00  ? 171 SER C CA  2  
ATOM 9778   C C   . SER A 1 167 ? -62.350  32.429  -33.665 1.00 30.00  ? 171 SER C C   2  
ATOM 9779   O O   . SER A 1 167 ? -63.152  31.827  -34.383 1.00 30.00  ? 171 SER C O   2  
ATOM 9780   C CB  . SER A 1 167 ? -61.593  30.931  -31.863 1.00 99.99  ? 171 SER C CB  2  
ATOM 9781   O OG  . SER A 1 167 ? -61.262  30.874  -30.473 1.00 99.99  ? 171 SER C OG  2  
ATOM 9782   N N   . CYS A 1 168 ? -61.456  33.302  -34.134 1.00 30.00  ? 172 CYS C N   2  
ATOM 9783   C CA  . CYS A 1 168 ? -61.319  33.612  -35.548 1.00 30.00  ? 172 CYS C CA  2  
ATOM 9784   C C   . CYS A 1 168 ? -59.953  33.271  -36.027 1.00 30.00  ? 172 CYS C C   2  
ATOM 9785   O O   . CYS A 1 168 ? -58.953  33.768  -35.507 1.00 30.00  ? 172 CYS C O   2  
ATOM 9786   C CB  . CYS A 1 168 ? -61.563  35.097  -35.777 1.00 99.99  ? 172 CYS C CB  2  
ATOM 9787   S SG  . CYS A 1 168 ? -60.348  36.226  -35.050 1.00 99.99  ? 172 CYS C SG  2  
ATOM 9788   N N   . LEU A 1 169 ? -59.913  32.415  -37.034 1.00 30.00  ? 173 LEU C N   2  
ATOM 9789   C CA  . LEU A 1 169 ? -58.654  32.035  -37.601 1.00 30.00  ? 173 LEU C CA  2  
ATOM 9790   C C   . LEU A 1 169 ? -58.695  32.854  -38.897 1.00 30.00  ? 173 LEU C C   2  
ATOM 9791   O O   . LEU A 1 169 ? -59.520  32.599  -39.794 1.00 30.00  ? 173 LEU C O   2  
ATOM 9792   C CB  . LEU A 1 169 ? -58.618  30.528  -37.823 1.00 99.99  ? 173 LEU C CB  2  
ATOM 9793   C CG  . LEU A 1 169 ? -57.961  29.851  -36.624 1.00 99.99  ? 173 LEU C CG  2  
ATOM 9794   C CD1 . LEU A 1 169 ? -57.624  28.406  -36.978 1.00 99.99  ? 173 LEU C CD1 2  
ATOM 9795   C CD2 . LEU A 1 169 ? -56.681  30.597  -36.261 1.00 99.99  ? 173 LEU C CD2 2  
ATOM 9796   N N   . ILE A 1 170 ? -57.826  33.868  -38.978 1.00 30.00  ? 174 ILE C N   2  
ATOM 9797   C CA  . ILE A 1 170 ? -57.760  34.714  -40.156 1.00 30.00  ? 174 ILE C CA  2  
ATOM 9798   C C   . ILE A 1 170 ? -56.583  34.189  -40.938 1.00 30.00  ? 174 ILE C C   2  
ATOM 9799   O O   . ILE A 1 170 ? -55.432  34.382  -40.539 1.00 30.00  ? 174 ILE C O   2  
ATOM 9800   C CB  . ILE A 1 170 ? -57.559  36.167  -39.741 1.00 99.99  ? 174 ILE C CB  2  
ATOM 9801   C CG1 . ILE A 1 170 ? -56.070  36.443  -39.561 1.00 99.99  ? 174 ILE C CG1 2  
ATOM 9802   C CG2 . ILE A 1 170 ? -58.286  36.423  -38.424 1.00 99.99  ? 174 ILE C CG2 2  
ATOM 9803   C CD1 . ILE A 1 170 ? -55.503  37.020  -40.855 1.00 99.99  ? 174 ILE C CD1 2  
ATOM 9804   N N   . THR A 1 171 ? -56.867  33.518  -42.054 1.00 30.00  ? 175 THR C N   2  
ATOM 9805   C CA  . THR A 1 171 ? -55.802  32.962  -42.874 1.00 30.00  ? 175 THR C CA  2  
ATOM 9806   C C   . THR A 1 171 ? -55.659  33.607  -44.240 1.00 30.00  ? 175 THR C C   2  
ATOM 9807   O O   . THR A 1 171 ? -56.505  34.387  -44.686 1.00 30.00  ? 175 THR C O   2  
ATOM 9808   C CB  . THR A 1 171 ? -56.052  31.476  -43.113 1.00 99.99  ? 175 THR C CB  2  
ATOM 9809   O OG1 . THR A 1 171 ? -57.204  31.316  -43.944 1.00 99.99  ? 175 THR C OG1 2  
ATOM 9810   C CG2 . THR A 1 171 ? -56.291  30.781  -41.778 1.00 99.99  ? 175 THR C CG2 2  
ATOM 9811   N N   . GLY A 1 172 ? -54.562  33.260  -44.900 1.00 30.00  ? 176 GLY C N   2  
ATOM 9812   C CA  . GLY A 1 172 ? -54.287  33.815  -46.202 1.00 30.00  ? 176 GLY C CA  2  
ATOM 9813   C C   . GLY A 1 172 ? -52.795  33.761  -46.422 1.00 30.00  ? 176 GLY C C   2  
ATOM 9814   O O   . GLY A 1 172 ? -52.041  33.334  -45.540 1.00 30.00  ? 176 GLY C O   2  
ATOM 9815   N N   . GLU A 1 173 ? -52.369  34.195  -47.608 1.00 30.00  ? 177 GLU C N   2  
ATOM 9816   C CA  . GLU A 1 173 ? -50.957  34.204  -47.982 1.00 30.00  ? 177 GLU C CA  2  
ATOM 9817   C C   . GLU A 1 173 ? -50.295  35.417  -47.356 1.00 30.00  ? 177 GLU C C   2  
ATOM 9818   O O   . GLU A 1 173 ? -50.951  36.229  -46.715 1.00 30.00  ? 177 GLU C O   2  
ATOM 9819   C CB  . GLU A 1 173 ? -50.823  34.274  -49.498 1.00 99.99  ? 177 GLU C CB  2  
ATOM 9820   C CG  . GLU A 1 173 ? -51.546  35.494  -50.014 1.00 99.99  ? 177 GLU C CG  2  
ATOM 9821   C CD  . GLU A 1 173 ? -53.048  35.223  -50.048 1.00 99.99  ? 177 GLU C CD  2  
ATOM 9822   O OE1 . GLU A 1 173 ? -53.709  35.505  -49.016 1.00 99.99  ? 177 GLU C OE1 2  
ATOM 9823   O OE2 . GLU A 1 173 ? -53.520  34.733  -51.111 1.00 99.99  ? 177 GLU C OE2 2  
ATOM 9824   N N   . SER A 1 174 ? -48.990  35.539  -47.554 1.00 30.00  ? 178 SER C N   2  
ATOM 9825   C CA  . SER A 1 174 ? -48.270  36.654  -46.986 1.00 30.00  ? 178 SER C CA  2  
ATOM 9826   C C   . SER A 1 174 ? -48.483  37.930  -47.782 1.00 30.00  ? 178 SER C C   2  
ATOM 9827   O O   . SER A 1 174 ? -48.157  37.991  -48.958 1.00 30.00  ? 178 SER C O   2  
ATOM 9828   C CB  . SER A 1 174 ? -46.774  36.354  -46.970 1.00 99.99  ? 178 SER C CB  2  
ATOM 9829   O OG  . SER A 1 174 ? -46.537  35.172  -46.201 1.00 99.99  ? 178 SER C OG  2  
ATOM 9830   N N   . GLY A 1 175 ? -49.035  38.939  -47.114 1.00 30.00  ? 179 GLY C N   2  
ATOM 9831   C CA  . GLY A 1 175 ? -49.285  40.214  -47.765 1.00 30.00  ? 179 GLY C CA  2  
ATOM 9832   C C   . GLY A 1 175 ? -50.745  40.315  -48.118 1.00 30.00  ? 179 GLY C C   2  
ATOM 9833   O O   . GLY A 1 175 ? -51.146  41.260  -48.802 1.00 30.00  ? 179 GLY C O   2  
ATOM 9834   N N   . ALA A 1 176 ? -51.533  39.345  -47.639 1.00 30.00  ? 180 ALA C N   2  
ATOM 9835   C CA  . ALA A 1 176 ? -52.982  39.278  -47.915 1.00 30.00  ? 180 ALA C CA  2  
ATOM 9836   C C   . ALA A 1 176 ? -53.861  40.232  -47.133 1.00 30.00  ? 180 ALA C C   2  
ATOM 9837   O O   . ALA A 1 176 ? -54.643  40.987  -47.733 1.00 30.00  ? 180 ALA C O   2  
ATOM 9838   C CB  . ALA A 1 176 ? -53.482  37.872  -47.685 1.00 30.00  ? 180 ALA C CB  2  
ATOM 9839   N N   . GLY A 1 177 ? -53.743  40.182  -45.802 1.00 30.00  ? 181 GLY C N   2  
ATOM 9840   C CA  . GLY A 1 177 ? -54.542  41.046  -44.958 1.00 30.00  ? 181 GLY C CA  2  
ATOM 9841   C C   . GLY A 1 177 ? -54.733  40.420  -43.587 1.00 30.00  ? 181 GLY C C   2  
ATOM 9842   O O   . GLY A 1 177 ? -55.506  40.932  -42.765 1.00 30.00  ? 181 GLY C O   2  
ATOM 9843   N N   . LYS A 1 178 ? -54.037  39.319  -43.322 1.00 30.00  ? 182 LYS C N   2  
ATOM 9844   C CA  . LYS A 1 178 ? -54.180  38.660  -42.016 1.00 30.00  ? 182 LYS C CA  2  
ATOM 9845   C C   . LYS A 1 178 ? -54.082  39.643  -40.834 1.00 30.00  ? 182 LYS C C   2  
ATOM 9846   O O   . LYS A 1 178 ? -54.993  39.724  -40.015 1.00 30.00  ? 182 LYS C O   2  
ATOM 9847   C CB  . LYS A 1 178 ? -53.083  37.615  -41.838 1.00 99.99  ? 182 LYS C CB  2  
ATOM 9848   C CG  . LYS A 1 178 ? -53.539  36.291  -42.442 1.00 99.99  ? 182 LYS C CG  2  
ATOM 9849   C CD  . LYS A 1 178 ? -52.661  35.163  -41.910 1.00 99.99  ? 182 LYS C CD  2  
ATOM 9850   C CE  . LYS A 1 178 ? -51.289  35.228  -42.573 1.00 99.99  ? 182 LYS C CE  2  
ATOM 9851   N NZ  . LYS A 1 178 ? -50.565  33.973  -42.329 1.00 99.99  ? 182 LYS C NZ  2  
ATOM 9852   N N   . THR A 1 179 ? -52.968  40.379  -40.758 1.00 30.00  ? 183 THR C N   2  
ATOM 9853   C CA  . THR A 1 179 ? -52.713  41.342  -39.685 1.00 30.00  ? 183 THR C CA  2  
ATOM 9854   C C   . THR A 1 179 ? -53.687  42.517  -39.656 1.00 30.00  ? 183 THR C C   2  
ATOM 9855   O O   . THR A 1 179 ? -54.324  42.765  -38.628 1.00 30.00  ? 183 THR C O   2  
ATOM 9856   C CB  . THR A 1 179 ? -51.314  41.927  -39.838 1.00 99.99  ? 183 THR C CB  2  
ATOM 9857   O OG1 . THR A 1 179 ? -51.265  42.746  -41.010 1.00 99.99  ? 183 THR C OG1 2  
ATOM 9858   C CG2 . THR A 1 179 ? -50.301  40.798  -39.966 1.00 99.99  ? 183 THR C CG2 2  
ATOM 9859   N N   . GLU A 1 180 ? -53.803  43.235  -40.765 1.00 30.00  ? 184 GLU C N   2  
ATOM 9860   C CA  . GLU A 1 180 ? -54.729  44.358  -40.838 1.00 30.00  ? 184 GLU C CA  2  
ATOM 9861   C C   . GLU A 1 180 ? -56.124  44.007  -40.327 1.00 30.00  ? 184 GLU C C   2  
ATOM 9862   O O   . GLU A 1 180 ? -56.747  44.769  -39.581 1.00 30.00  ? 184 GLU C O   2  
ATOM 9863   C CB  . GLU A 1 180 ? -54.867  44.823  -42.283 1.00 99.99  ? 184 GLU C CB  2  
ATOM 9864   C CG  . GLU A 1 180 ? -53.544  45.364  -42.769 1.00 99.99  ? 184 GLU C CG  2  
ATOM 9865   C CD  . GLU A 1 180 ? -53.269  46.708  -42.102 1.00 99.99  ? 184 GLU C CD  2  
ATOM 9866   O OE1 . GLU A 1 180 ? -52.640  46.692  -41.010 1.00 99.99  ? 184 GLU C OE1 2  
ATOM 9867   O OE2 . GLU A 1 180 ? -53.687  47.742  -42.691 1.00 99.99  ? 184 GLU C OE2 2  
ATOM 9868   N N   . ASN A 1 181 ? -56.610  42.845  -40.740 1.00 30.00  ? 185 ASN C N   2  
ATOM 9869   C CA  . ASN A 1 181 ? -57.926  42.376  -40.346 1.00 30.00  ? 185 ASN C CA  2  
ATOM 9870   C C   . ASN A 1 181 ? -57.971  41.916  -38.894 1.00 30.00  ? 185 ASN C C   2  
ATOM 9871   O O   . ASN A 1 181 ? -59.008  42.034  -38.238 1.00 30.00  ? 185 ASN C O   2  
ATOM 9872   C CB  . ASN A 1 181 ? -58.341  41.197  -41.219 1.00 99.99  ? 185 ASN C CB  2  
ATOM 9873   C CG  . ASN A 1 181 ? -58.462  41.611  -42.679 1.00 99.99  ? 185 ASN C CG  2  
ATOM 9874   O OD1 . ASN A 1 181 ? -59.176  42.560  -42.999 1.00 99.99  ? 185 ASN C OD1 2  
ATOM 9875   N ND2 . ASN A 1 181 ? -57.764  40.895  -43.562 1.00 99.99  ? 185 ASN C ND2 2  
ATOM 9876   N N   . THR A 1 182 ? -56.867  41.383  -38.387 1.00 30.00  ? 186 THR C N   2  
ATOM 9877   C CA  . THR A 1 182 ? -56.863  40.949  -37.006 1.00 30.00  ? 186 THR C CA  2  
ATOM 9878   C C   . THR A 1 182 ? -57.002  42.200  -36.147 1.00 30.00  ? 186 THR C C   2  
ATOM 9879   O O   . THR A 1 182 ? -57.761  42.241  -35.179 1.00 30.00  ? 186 THR C O   2  
ATOM 9880   C CB  . THR A 1 182 ? -55.556  40.227  -36.696 1.00 99.99  ? 186 THR C CB  2  
ATOM 9881   O OG1 . THR A 1 182 ? -54.474  41.161  -36.734 1.00 99.99  ? 186 THR C OG1 2  
ATOM 9882   C CG2 . THR A 1 182 ? -55.320  39.136  -37.735 1.00 99.99  ? 186 THR C CG2 2  
ATOM 9883   N N   . LYS A 1 183 ? -56.264  43.235  -36.515 1.00 30.00  ? 187 LYS C N   2  
ATOM 9884   C CA  . LYS A 1 183 ? -56.322  44.456  -35.756 1.00 30.00  ? 187 LYS C CA  2  
ATOM 9885   C C   . LYS A 1 183 ? -57.727  45.074  -35.819 1.00 30.00  ? 187 LYS C C   2  
ATOM 9886   O O   . LYS A 1 183 ? -58.278  45.465  -34.790 1.00 30.00  ? 187 LYS C O   2  
ATOM 9887   C CB  . LYS A 1 183 ? -55.324  45.464  -36.317 1.00 99.99  ? 187 LYS C CB  2  
ATOM 9888   C CG  . LYS A 1 183 ? -55.321  46.717  -35.451 1.00 99.99  ? 187 LYS C CG  2  
ATOM 9889   C CD  . LYS A 1 183 ? -54.053  47.520  -35.717 1.00 99.99  ? 187 LYS C CD  2  
ATOM 9890   C CE  . LYS A 1 183 ? -54.213  48.928  -35.150 1.00 99.99  ? 187 LYS C CE  2  
ATOM 9891   N NZ  . LYS A 1 183 ? -53.653  48.975  -33.793 1.00 99.99  ? 187 LYS C NZ  2  
ATOM 9892   N N   . LYS A 1 184 ? -58.325  45.149  -36.998 1.00 30.00  ? 188 LYS C N   2  
ATOM 9893   C CA  . LYS A 1 184 ? -59.662  45.728  -37.099 1.00 30.00  ? 188 LYS C CA  2  
ATOM 9894   C C   . LYS A 1 184 ? -60.695  44.984  -36.256 1.00 30.00  ? 188 LYS C C   2  
ATOM 9895   O O   . LYS A 1 184 ? -61.689  45.565  -35.829 1.00 30.00  ? 188 LYS C O   2  
ATOM 9896   C CB  . LYS A 1 184 ? -60.136  45.692  -38.548 1.00 99.99  ? 188 LYS C CB  2  
ATOM 9897   C CG  . LYS A 1 184 ? -61.385  46.555  -38.698 1.00 99.99  ? 188 LYS C CG  2  
ATOM 9898   C CD  . LYS A 1 184 ? -61.799  46.597  -40.164 1.00 99.99  ? 188 LYS C CD  2  
ATOM 9899   C CE  . LYS A 1 184 ? -63.063  47.438  -40.311 1.00 99.99  ? 188 LYS C CE  2  
ATOM 9900   N NZ  . LYS A 1 184 ? -63.476  47.461  -41.722 1.00 99.99  ? 188 LYS C NZ  2  
ATOM 9901   N N   . VAL A 1 185 ? -60.474  43.696  -36.017 1.00 30.00  ? 189 VAL C N   2  
ATOM 9902   C CA  . VAL A 1 185 ? -61.413  42.891  -35.231 1.00 30.00  ? 189 VAL C CA  2  
ATOM 9903   C C   . VAL A 1 185 ? -61.333  43.304  -33.785 1.00 30.00  ? 189 VAL C C   2  
ATOM 9904   O O   . VAL A 1 185 ? -62.351  43.492  -33.136 1.00 30.00  ? 189 VAL C O   2  
ATOM 9905   C CB  . VAL A 1 185 ? -61.060  41.412  -35.358 1.00 99.99  ? 189 VAL C CB  2  
ATOM 9906   C CG1 . VAL A 1 185 ? -62.010  40.587  -34.500 1.00 99.99  ? 189 VAL C CG1 2  
ATOM 9907   C CG2 . VAL A 1 185 ? -61.186  40.981  -36.813 1.00 99.99  ? 189 VAL C CG2 2  
ATOM 9908   N N   . ILE A 1 186 ? -60.107  43.426  -33.287 1.00 30.00  ? 190 ILE C N   2  
ATOM 9909   C CA  . ILE A 1 186 ? -59.855  43.840  -31.918 1.00 30.00  ? 190 ILE C CA  2  
ATOM 9910   C C   . ILE A 1 186 ? -60.357  45.294  -31.784 1.00 30.00  ? 190 ILE C C   2  
ATOM 9911   O O   . ILE A 1 186 ? -61.102  45.640  -30.876 1.00 30.00  ? 190 ILE C O   2  
ATOM 9912   C CB  . ILE A 1 186 ? -58.365  43.756  -31.614 1.00 99.99  ? 190 ILE C CB  2  
ATOM 9913   C CG1 . ILE A 1 186 ? -57.683  45.052  -32.040 1.00 99.99  ? 190 ILE C CG1 2  
ATOM 9914   C CG2 . ILE A 1 186 ? -57.755  42.588  -32.382 1.00 99.99  ? 190 ILE C CG2 2  
ATOM 9915   C CD1 . ILE A 1 186 ? -57.597  45.997  -30.846 1.00 99.99  ? 190 ILE C CD1 2  
ATOM 9916   N N   . MET A 1 187 ? -59.942  46.152  -32.704 1.00 30.00  ? 191 MET C N   2  
ATOM 9917   C CA  . MET A 1 187 ? -60.371  47.532  -32.651 1.00 30.00  ? 191 MET C CA  2  
ATOM 9918   C C   . MET A 1 187 ? -61.884  47.575  -32.579 1.00 30.00  ? 191 MET C C   2  
ATOM 9919   O O   . MET A 1 187 ? -62.448  48.428  -31.905 1.00 30.00  ? 191 MET C O   2  
ATOM 9920   C CB  . MET A 1 187 ? -59.896  48.273  -33.898 1.00 99.99  ? 191 MET C CB  2  
ATOM 9921   C CG  . MET A 1 187 ? -58.410  48.017  -34.108 1.00 99.99  ? 191 MET C CG  2  
ATOM 9922   S SD  . MET A 1 187 ? -57.436  49.082  -33.019 1.00 99.99  ? 191 MET C SD  2  
ATOM 9923   C CE  . MET A 1 187 ? -57.591  50.630  -33.884 1.00 99.99  ? 191 MET C CE  2  
ATOM 9924   N N   . TYR A 1 188 ? -62.540  46.643  -33.276 1.00 30.00  ? 192 TYR C N   2  
ATOM 9925   C CA  . TYR A 1 188 ? -64.007  46.578  -33.295 1.00 30.00  ? 192 TYR C CA  2  
ATOM 9926   C C   . TYR A 1 188 ? -64.544  46.152  -31.933 1.00 30.00  ? 192 TYR C C   2  
ATOM 9927   O O   . TYR A 1 188 ? -65.294  46.880  -31.296 1.00 30.00  ? 192 TYR C O   2  
ATOM 9928   C CB  . TYR A 1 188 ? -64.467  45.563  -34.338 1.00 99.99  ? 192 TYR C CB  2  
ATOM 9929   C CG  . TYR A 1 188 ? -65.068  44.364  -33.646 1.00 99.99  ? 192 TYR C CG  2  
ATOM 9930   C CD1 . TYR A 1 188 ? -64.664  44.030  -32.349 1.00 99.99  ? 192 TYR C CD1 2  
ATOM 9931   C CD2 . TYR A 1 188 ? -66.028  43.585  -34.303 1.00 99.99  ? 192 TYR C CD2 2  
ATOM 9932   C CE1 . TYR A 1 188 ? -65.220  42.918  -31.708 1.00 99.99  ? 192 TYR C CE1 2  
ATOM 9933   C CE2 . TYR A 1 188 ? -66.583  42.472  -33.664 1.00 99.99  ? 192 TYR C CE2 2  
ATOM 9934   C CZ  . TYR A 1 188 ? -66.180  42.136  -32.364 1.00 99.99  ? 192 TYR C CZ  2  
ATOM 9935   O OH  . TYR A 1 188 ? -66.721  41.056  -31.741 1.00 99.99  ? 192 TYR C OH  2  
ATOM 9936   N N   . LEU A 1 189 ? -64.153  44.962  -31.505 1.00 30.00  ? 193 LEU C N   2  
ATOM 9937   C CA  . LEU A 1 189 ? -64.562  44.423  -30.214 1.00 30.00  ? 193 LEU C CA  2  
ATOM 9938   C C   . LEU A 1 189 ? -64.226  45.383  -29.068 1.00 30.00  ? 193 LEU C C   2  
ATOM 9939   O O   . LEU A 1 189 ? -64.871  45.384  -28.031 1.00 30.00  ? 193 LEU C O   2  
ATOM 9940   C CB  . LEU A 1 189 ? -63.846  43.100  -29.954 1.00 99.99  ? 193 LEU C CB  2  
ATOM 9941   C CG  . LEU A 1 189 ? -64.186  42.603  -28.554 1.00 99.99  ? 193 LEU C CG  2  
ATOM 9942   C CD1 . LEU A 1 189 ? -63.413  41.322  -28.268 1.00 99.99  ? 193 LEU C CD1 2  
ATOM 9943   C CD2 . LEU A 1 189 ? -63.803  43.667  -27.530 1.00 99.99  ? 193 LEU C CD2 2  
ATOM 9944   N N   . ALA A 1 190 ? -63.193  46.193  -29.251 1.00 30.00  ? 194 ALA C N   2  
ATOM 9945   C CA  . ALA A 1 190 ? -62.788  47.141  -28.223 1.00 30.00  ? 194 ALA C CA  2  
ATOM 9946   C C   . ALA A 1 190 ? -63.771  48.307  -28.190 1.00 30.00  ? 194 ALA C C   2  
ATOM 9947   O O   . ALA A 1 190 ? -64.082  48.835  -27.124 1.00 30.00  ? 194 ALA C O   2  
ATOM 9948   C CB  . ALA A 1 190 ? -61.377  47.658  -28.514 1.00 30.00  ? 194 ALA C CB  2  
ATOM 9949   N N   . LYS A 1 191 ? -64.253  48.696  -29.363 1.00 30.00  ? 195 LYS C N   2  
ATOM 9950   C CA  . LYS A 1 191 ? -65.191  49.806  -29.475 1.00 30.00  ? 195 LYS C CA  2  
ATOM 9951   C C   . LYS A 1 191 ? -66.658  49.503  -29.086 1.00 30.00  ? 195 LYS C C   2  
ATOM 9952   O O   . LYS A 1 191 ? -67.470  50.421  -28.978 1.00 30.00  ? 195 LYS C O   2  
ATOM 9953   C CB  . LYS A 1 191 ? -65.240  50.298  -30.920 1.00 99.99  ? 195 LYS C CB  2  
ATOM 9954   C CG  . LYS A 1 191 ? -66.148  51.518  -31.012 1.00 99.99  ? 195 LYS C CG  2  
ATOM 9955   C CD  . LYS A 1 191 ? -65.862  52.269  -32.305 1.00 99.99  ? 195 LYS C CD  2  
ATOM 9956   C CE  . LYS A 1 191 ? -66.995  53.254  -32.583 1.00 99.99  ? 195 LYS C CE  2  
ATOM 9957   N NZ  . LYS A 1 191 ? -66.642  54.573  -32.039 1.00 99.99  ? 195 LYS C NZ  2  
ATOM 9958   N N   . VAL A 1 192 ? -67.010  48.240  -28.854 1.00 30.00  ? 196 VAL C N   2  
ATOM 9959   C CA  . VAL A 1 192 ? -68.394  47.915  -28.509 1.00 30.00  ? 196 VAL C CA  2  
ATOM 9960   C C   . VAL A 1 192 ? -68.600  47.080  -27.239 1.00 30.00  ? 196 VAL C C   2  
ATOM 9961   O O   . VAL A 1 192 ? -69.729  46.879  -26.792 1.00 30.00  ? 196 VAL C O   2  
ATOM 9962   C CB  . VAL A 1 192 ? -69.036  47.117  -29.638 1.00 99.99  ? 196 VAL C CB  2  
ATOM 9963   C CG1 . VAL A 1 192 ? -69.018  47.946  -30.921 1.00 99.99  ? 196 VAL C CG1 2  
ATOM 9964   C CG2 . VAL A 1 192 ? -68.257  45.826  -29.859 1.00 99.99  ? 196 VAL C CG2 2  
ATOM 9965   N N   . GLU A 1 212 ? -58.856  49.440  -22.890 1.00 30.00  ? 216 GLU C N   2  
ATOM 9966   C CA  . GLU A 1 212 ? -59.123  49.443  -24.315 1.00 30.00  ? 216 GLU C CA  2  
ATOM 9967   C C   . GLU A 1 212 ? -57.988  50.146  -25.042 1.00 30.00  ? 216 GLU C C   2  
ATOM 9968   O O   . GLU A 1 212 ? -57.444  49.641  -26.014 1.00 30.00  ? 216 GLU C O   2  
ATOM 9969   C CB  . GLU A 1 212 ? -60.430  50.174  -24.598 1.00 99.99  ? 216 GLU C CB  2  
ATOM 9970   C CG  . GLU A 1 212 ? -60.356  51.574  -24.041 1.00 99.99  ? 216 GLU C CG  2  
ATOM 9971   C CD  . GLU A 1 212 ? -60.577  51.532  -22.529 1.00 99.99  ? 216 GLU C CD  2  
ATOM 9972   O OE1 . GLU A 1 212 ? -59.557  51.398  -21.802 1.00 99.99  ? 216 GLU C OE1 2  
ATOM 9973   O OE2 . GLU A 1 212 ? -61.764  51.641  -22.117 1.00 99.99  ? 216 GLU C OE2 2  
ATOM 9974   N N   . ASP A 1 213 ? -57.634  51.321  -24.551 1.00 30.00  ? 217 ASP C N   2  
ATOM 9975   C CA  . ASP A 1 213 ? -56.568  52.123  -25.136 1.00 30.00  ? 217 ASP C CA  2  
ATOM 9976   C C   . ASP A 1 213 ? -55.187  51.460  -25.171 1.00 30.00  ? 217 ASP C C   2  
ATOM 9977   O O   . ASP A 1 213 ? -54.428  51.651  -26.127 1.00 30.00  ? 217 ASP C O   2  
ATOM 9978   C CB  . ASP A 1 213 ? -56.398  53.415  -24.345 1.00 99.99  ? 217 ASP C CB  2  
ATOM 9979   C CG  . ASP A 1 213 ? -56.339  53.098  -22.853 1.00 99.99  ? 217 ASP C CG  2  
ATOM 9980   O OD1 . ASP A 1 213 ? -57.308  52.455  -22.364 1.00 99.99  ? 217 ASP C OD1 2  
ATOM 9981   O OD2 . ASP A 1 213 ? -55.329  53.499  -22.217 1.00 99.99  ? 217 ASP C OD2 2  
ATOM 9982   N N   . GLN A 1 214 ? -54.857  50.698  -24.132 1.00 30.00  ? 218 GLN C N   2  
ATOM 9983   C CA  . GLN A 1 214 ? -53.568  50.018  -24.042 1.00 30.00  ? 218 GLN C CA  2  
ATOM 9984   C C   . GLN A 1 214 ? -53.494  48.860  -25.011 1.00 30.00  ? 218 GLN C C   2  
ATOM 9985   O O   . GLN A 1 214 ? -52.457  48.623  -25.647 1.00 30.00  ? 218 GLN C O   2  
ATOM 9986   C CB  . GLN A 1 214 ? -53.365  49.478  -22.628 1.00 99.99  ? 218 GLN C CB  2  
ATOM 9987   C CG  . GLN A 1 214 ? -54.519  48.550  -22.266 1.00 99.99  ? 218 GLN C CG  2  
ATOM 9988   C CD  . GLN A 1 214 ? -55.762  49.342  -21.888 1.00 99.99  ? 218 GLN C CD  2  
ATOM 9989   O OE1 . GLN A 1 214 ? -55.746  50.570  -21.901 1.00 99.99  ? 218 GLN C OE1 2  
ATOM 9990   N NE2 . GLN A 1 214 ? -56.842  48.632  -21.549 1.00 99.99  ? 218 GLN C NE2 2  
ATOM 9991   N N   . ILE A 1 215 ? -54.611  48.135  -25.099 1.00 30.00  ? 219 ILE C N   2  
ATOM 9992   C CA  . ILE A 1 215 ? -54.751  46.993  -25.975 1.00 30.00  ? 219 ILE C CA  2  
ATOM 9993   C C   . ILE A 1 215 ? -54.352  47.454  -27.374 1.00 30.00  ? 219 ILE C C   2  
ATOM 9994   O O   . ILE A 1 215 ? -53.342  47.024  -27.946 1.00 30.00  ? 219 ILE C O   2  
ATOM 9995   C CB  . ILE A 1 215 ? -56.197  46.507  -25.967 1.00 99.99  ? 219 ILE C CB  2  
ATOM 9996   C CG1 . ILE A 1 215 ? -57.004  47.290  -26.995 1.00 99.99  ? 219 ILE C CG1 2  
ATOM 9997   C CG2 . ILE A 1 215 ? -56.794  46.720  -24.579 1.00 99.99  ? 219 ILE C CG2 2  
ATOM 9998   C CD1 . ILE A 1 215 ? -57.042  46.518  -28.308 1.00 99.99  ? 219 ILE C CD1 2  
ATOM 9999   N N   . ILE A 1 216 ? -55.144  48.353  -27.925 1.00 30.00  ? 220 ILE C N   2  
ATOM 10000  C CA  . ILE A 1 216 ? -54.863  48.881  -29.238 1.00 30.00  ? 220 ILE C CA  2  
ATOM 10001  C C   . ILE A 1 216 ? -53.408  49.315  -29.352 1.00 30.00  ? 220 ILE C C   2  
ATOM 10002  O O   . ILE A 1 216 ? -52.774  49.184  -30.392 1.00 30.00  ? 220 ILE C O   2  
ATOM 10003  C CB  . ILE A 1 216 ? -55.751  50.090  -29.510 1.00 99.99  ? 220 ILE C CB  2  
ATOM 10004  C CG1 . ILE A 1 216 ? -55.089  51.345  -28.953 1.00 99.99  ? 220 ILE C CG1 2  
ATOM 10005  C CG2 . ILE A 1 216 ? -57.103  49.887  -28.835 1.00 99.99  ? 220 ILE C CG2 2  
ATOM 10006  C CD1 . ILE A 1 216 ? -54.288  52.027  -30.057 1.00 99.99  ? 220 ILE C CD1 2  
ATOM 10007  N N   . GLN A 1 217 ? -52.885  49.844  -28.258 1.00 30.00  ? 221 GLN C N   2  
ATOM 10008  C CA  . GLN A 1 217 ? -51.521  50.341  -28.213 1.00 30.00  ? 221 GLN C CA  2  
ATOM 10009  C C   . GLN A 1 217 ? -50.404  49.336  -28.090 1.00 30.00  ? 221 GLN C C   2  
ATOM 10010  O O   . GLN A 1 217 ? -49.235  49.704  -28.141 1.00 30.00  ? 221 GLN C O   2  
ATOM 10011  C CB  . GLN A 1 217 ? -51.344  51.268  -27.015 1.00 99.99  ? 221 GLN C CB  2  
ATOM 10012  C CG  . GLN A 1 217 ? -52.213  52.507  -27.199 1.00 99.99  ? 221 GLN C CG  2  
ATOM 10013  C CD  . GLN A 1 217 ? -51.648  53.417  -28.278 1.00 99.99  ? 221 GLN C CD  2  
ATOM 10014  O OE1 . GLN A 1 217 ? -50.618  53.112  -28.875 1.00 99.99  ? 221 GLN C OE1 2  
ATOM 10015  N NE2 . GLN A 1 217 ? -52.326  54.539  -28.530 1.00 99.99  ? 221 GLN C NE2 2  
ATOM 10016  N N   . ALA A 1 218 ? -50.758  48.070  -27.925 1.00 30.00  ? 222 ALA C N   2  
ATOM 10017  C CA  . ALA A 1 218 ? -49.737  47.041  -27.809 1.00 30.00  ? 222 ALA C CA  2  
ATOM 10018  C C   . ALA A 1 218 ? -49.216  46.647  -29.183 1.00 30.00  ? 222 ALA C C   2  
ATOM 10019  O O   . ALA A 1 218 ? -48.128  46.107  -29.305 1.00 30.00  ? 222 ALA C O   2  
ATOM 10020  C CB  . ALA A 1 218 ? -50.311  45.820  -27.112 1.00 30.00  ? 222 ALA C CB  2  
ATOM 10021  N N   . ASN A 1 219 ? -49.990  46.930  -30.222 1.00 30.00  ? 223 ASN C N   2  
ATOM 10022  C CA  . ASN A 1 219 ? -49.577  46.578  -31.574 1.00 30.00  ? 223 ASN C CA  2  
ATOM 10023  C C   . ASN A 1 219 ? -48.397  47.393  -32.041 1.00 30.00  ? 223 ASN C C   2  
ATOM 10024  O O   . ASN A 1 219 ? -47.414  46.831  -32.537 1.00 30.00  ? 223 ASN C O   2  
ATOM 10025  C CB  . ASN A 1 219 ? -50.728  46.818  -32.546 1.00 99.99  ? 223 ASN C CB  2  
ATOM 10026  C CG  . ASN A 1 219 ? -51.915  45.922  -32.223 1.00 99.99  ? 223 ASN C CG  2  
ATOM 10027  O OD1 . ASN A 1 219 ? -51.775  44.707  -32.136 1.00 99.99  ? 223 ASN C OD1 2  
ATOM 10028  N ND2 . ASN A 1 219 ? -53.091  46.532  -32.045 1.00 99.99  ? 223 ASN C ND2 2  
ATOM 10029  N N   . PRO A 1 220 ? -48.469  48.724  -31.876 1.00 30.00  ? 224 PRO C N   2  
ATOM 10030  C CA  . PRO A 1 220 ? -47.356  49.571  -32.314 1.00 30.00  ? 224 PRO C CA  2  
ATOM 10031  C C   . PRO A 1 220 ? -46.004  49.165  -31.758 1.00 30.00  ? 224 PRO C C   2  
ATOM 10032  O O   . PRO A 1 220 ? -44.996  49.271  -32.455 1.00 30.00  ? 224 PRO C O   2  
ATOM 10033  C CB  . PRO A 1 220 ? -47.825  50.857  -31.731 1.00 99.99  ? 224 PRO C CB  2  
ATOM 10034  C CG  . PRO A 1 220 ? -49.164  50.564  -31.096 1.00 99.99  ? 224 PRO C CG  2  
ATOM 10035  C CD  . PRO A 1 220 ? -49.542  49.355  -31.231 1.00 99.99  ? 224 PRO C CD  2  
ATOM 10036  N N   . VAL A 1 221 ? -45.959  48.694  -30.513 1.00 30.00  ? 225 VAL C N   2  
ATOM 10037  C CA  . VAL A 1 221 ? -44.661  48.301  -29.977 1.00 30.00  ? 225 VAL C CA  2  
ATOM 10038  C C   . VAL A 1 221 ? -44.263  46.902  -30.433 1.00 30.00  ? 225 VAL C C   2  
ATOM 10039  O O   . VAL A 1 221 ? -43.104  46.679  -30.793 1.00 30.00  ? 225 VAL C O   2  
ATOM 10040  C CB  . VAL A 1 221 ? -44.702  48.308  -28.452 1.00 99.99  ? 225 VAL C CB  2  
ATOM 10041  C CG1 . VAL A 1 221 ? -45.047  49.714  -27.961 1.00 99.99  ? 225 VAL C CG1 2  
ATOM 10042  C CG2 . VAL A 1 221 ? -45.764  47.328  -27.967 1.00 99.99  ? 225 VAL C CG2 2  
ATOM 10043  N N   . LEU A 1 222 ? -45.204  45.962  -30.436 1.00 30.00  ? 226 LEU C N   2  
ATOM 10044  C CA  . LEU A 1 222 ? -44.886  44.597  -30.867 1.00 30.00  ? 226 LEU C CA  2  
ATOM 10045  C C   . LEU A 1 222 ? -44.533  44.553  -32.354 1.00 30.00  ? 226 LEU C C   2  
ATOM 10046  O O   . LEU A 1 222 ? -43.691  43.762  -32.779 1.00 30.00  ? 226 LEU C O   2  
ATOM 10047  C CB  . LEU A 1 222 ? -46.084  43.687  -30.628 1.00 99.99  ? 226 LEU C CB  2  
ATOM 10048  C CG  . LEU A 1 222 ? -45.937  42.992  -29.279 1.00 99.99  ? 226 LEU C CG  2  
ATOM 10049  C CD1 . LEU A 1 222 ? -46.941  41.850  -29.181 1.00 99.99  ? 226 LEU C CD1 2  
ATOM 10050  C CD2 . LEU A 1 222 ? -44.520  42.439  -29.143 1.00 99.99  ? 226 LEU C CD2 2  
ATOM 10051  N N   . GLU A 1 223 ? -45.170  45.411  -33.142 1.00 30.00  ? 227 GLU C N   2  
ATOM 10052  C CA  . GLU A 1 223 ? -44.896  45.447  -34.566 1.00 30.00  ? 227 GLU C CA  2  
ATOM 10053  C C   . GLU A 1 223 ? -43.540  46.076  -34.855 1.00 30.00  ? 227 GLU C C   2  
ATOM 10054  O O   . GLU A 1 223 ? -42.891  45.752  -35.846 1.00 30.00  ? 227 GLU C O   2  
ATOM 10055  C CB  . GLU A 1 223 ? -45.968  46.264  -35.281 1.00 99.99  ? 227 GLU C CB  2  
ATOM 10056  C CG  . GLU A 1 223 ? -47.301  45.569  -35.150 1.00 99.99  ? 227 GLU C CG  2  
ATOM 10057  C CD  . GLU A 1 223 ? -47.314  44.319  -36.027 1.00 99.99  ? 227 GLU C CD  2  
ATOM 10058  O OE1 . GLU A 1 223 ? -46.919  43.244  -35.504 1.00 99.99  ? 227 GLU C OE1 2  
ATOM 10059  O OE2 . GLU A 1 223 ? -47.719  44.454  -37.213 1.00 99.99  ? 227 GLU C OE2 2  
ATOM 10060  N N   . ALA A 1 224 ? -43.112  46.989  -33.994 1.00 30.00  ? 228 ALA C N   2  
ATOM 10061  C CA  . ALA A 1 224 ? -41.835  47.653  -34.194 1.00 30.00  ? 228 ALA C CA  2  
ATOM 10062  C C   . ALA A 1 224 ? -40.714  46.649  -33.973 1.00 30.00  ? 228 ALA C C   2  
ATOM 10063  O O   . ALA A 1 224 ? -39.720  46.626  -34.699 1.00 30.00  ? 228 ALA C O   2  
ATOM 10064  C CB  . ALA A 1 224 ? -41.710  48.816  -33.224 1.00 30.00  ? 228 ALA C CB  2  
ATOM 10065  N N   . TYR A 1 225 ? -40.898  45.804  -32.969 1.00 30.00  ? 229 TYR C N   2  
ATOM 10066  C CA  . TYR A 1 225 ? -39.926  44.790  -32.623 1.00 30.00  ? 229 TYR C CA  2  
ATOM 10067  C C   . TYR A 1 225 ? -40.065  43.433  -33.338 1.00 30.00  ? 229 TYR C C   2  
ATOM 10068  O O   . TYR A 1 225 ? -39.122  42.648  -33.368 1.00 30.00  ? 229 TYR C O   2  
ATOM 10069  C CB  . TYR A 1 225 ? -40.009  44.481  -31.132 1.00 99.99  ? 229 TYR C CB  2  
ATOM 10070  C CG  . TYR A 1 225 ? -39.634  45.711  -30.340 1.00 99.99  ? 229 TYR C CG  2  
ATOM 10071  C CD1 . TYR A 1 225 ? -40.620  46.641  -29.987 1.00 99.99  ? 229 TYR C CD1 2  
ATOM 10072  C CD2 . TYR A 1 225 ? -38.303  45.920  -29.960 1.00 99.99  ? 229 TYR C CD2 2  
ATOM 10073  C CE1 . TYR A 1 225 ? -40.274  47.780  -29.252 1.00 99.99  ? 229 TYR C CE1 2  
ATOM 10074  C CE2 . TYR A 1 225 ? -37.959  47.060  -29.226 1.00 99.99  ? 229 TYR C CE2 2  
ATOM 10075  C CZ  . TYR A 1 225 ? -38.943  47.991  -28.872 1.00 99.99  ? 229 TYR C CZ  2  
ATOM 10076  O OH  . TYR A 1 225 ? -38.606  49.100  -28.158 1.00 99.99  ? 229 TYR C OH  2  
ATOM 10077  N N   . GLY A 1 226 ? -41.238  43.159  -33.909 1.00 30.00  ? 230 GLY C N   2  
ATOM 10078  C CA  . GLY A 1 226 ? -41.447  41.893  -34.589 1.00 30.00  ? 230 GLY C CA  2  
ATOM 10079  C C   . GLY A 1 226 ? -42.022  41.952  -35.995 1.00 30.00  ? 230 GLY C C   2  
ATOM 10080  O O   . GLY A 1 226 ? -42.737  41.060  -36.396 1.00 30.00  ? 230 GLY C O   2  
ATOM 10081  N N   . ASN A 1 227 ? -41.527  43.025  -36.787 1.00 30.00  ? 231 ASN C N   2  
ATOM 10082  C CA  . ASN A 1 227 ? -42.005  43.180  -38.151 1.00 30.00  ? 231 ASN C CA  2  
ATOM 10083  C C   . ASN A 1 227 ? -40.815  43.710  -38.928 1.00 30.00  ? 231 ASN C C   2  
ATOM 10084  O O   . ASN A 1 227 ? -39.858  44.191  -38.346 1.00 30.00  ? 231 ASN C O   2  
ATOM 10085  C CB  . ASN A 1 227 ? -43.175  44.157  -38.186 1.00 99.99  ? 231 ASN C CB  2  
ATOM 10086  C CG  . ASN A 1 227 ? -44.443  43.512  -37.646 1.00 99.99  ? 231 ASN C CG  2  
ATOM 10087  O OD1 . ASN A 1 227 ? -45.211  44.149  -36.929 1.00 99.99  ? 231 ASN C OD1 2  
ATOM 10088  N ND2 . ASN A 1 227 ? -44.663  42.244  -37.994 1.00 99.99  ? 231 ASN C ND2 2  
ATOM 10089  N N   . ALA A 1 228 ? -40.869  43.622  -40.244 1.00 30.00  ? 232 ALA C N   2  
ATOM 10090  C CA  . ALA A 1 228 ? -39.765  44.085  -41.045 1.00 30.00  ? 232 ALA C CA  2  
ATOM 10091  C C   . ALA A 1 228 ? -40.171  44.093  -42.498 1.00 30.00  ? 232 ALA C C   2  
ATOM 10092  O O   . ALA A 1 228 ? -41.078  43.380  -42.904 1.00 30.00  ? 232 ALA C O   2  
ATOM 10093  C CB  . ALA A 1 228 ? -38.582  43.162  -40.845 1.00 30.00  ? 232 ALA C CB  2  
ATOM 10094  N N   . LYS A 1 229 ? -39.491  44.907  -43.283 1.00 30.00  ? 233 LYS C N   2  
ATOM 10095  C CA  . LYS A 1 229 ? -39.783  44.971  -44.689 1.00 30.00  ? 233 LYS C CA  2  
ATOM 10096  C C   . LYS A 1 229 ? -39.285  43.677  -45.296 1.00 30.00  ? 233 LYS C C   2  
ATOM 10097  O O   . LYS A 1 229 ? -38.214  43.170  -44.942 1.00 30.00  ? 233 LYS C O   2  
ATOM 10098  C CB  . LYS A 1 229 ? -39.070  46.168  -45.312 1.00 99.99  ? 233 LYS C CB  2  
ATOM 10099  C CG  . LYS A 1 229 ? -39.465  46.287  -46.781 1.00 99.99  ? 233 LYS C CG  2  
ATOM 10100  C CD  . LYS A 1 229 ? -39.131  47.688  -47.283 1.00 99.99  ? 233 LYS C CD  2  
ATOM 10101  C CE  . LYS A 1 229 ? -39.171  47.702  -48.809 1.00 99.99  ? 233 LYS C CE  2  
ATOM 10102  N NZ  . LYS A 1 229 ? -40.503  48.131  -49.260 1.00 99.99  ? 233 LYS C NZ  2  
ATOM 10103  N N   . THR A 1 230 ? -39.815  43.207  -46.121 1.00 30.00  ? 234 THR C N   2  
ATOM 10104  C CA  . THR A 1 230 ? -39.564  41.974  -46.853 1.00 30.00  ? 234 THR C CA  2  
ATOM 10105  C C   . THR A 1 230 ? -39.986  42.300  -48.298 1.00 30.00  ? 234 THR C C   2  
ATOM 10106  O O   . THR A 1 230 ? -40.631  43.339  -48.557 1.00 30.00  ? 234 THR C O   2  
ATOM 10107  C CB  . THR A 1 230 ? -40.394  40.841  -46.261 1.00 99.99  ? 234 THR C CB  2  
ATOM 10108  O OG1 . THR A 1 230 ? -41.781  41.080  -46.518 1.00 99.99  ? 234 THR C OG1 2  
ATOM 10109  C CG2 . THR A 1 230 ? -40.161  40.773  -44.756 1.00 99.99  ? 234 THR C CG2 2  
ATOM 10110  N N   . THR A 1 231 ? -39.615  41.452  -49.245 1.00 30.00  ? 235 THR C N   2  
ATOM 10111  C CA  . THR A 1 231 ? -39.981  41.705  -50.641 1.00 30.00  ? 235 THR C CA  2  
ATOM 10112  C C   . THR A 1 231 ? -41.496  41.644  -50.742 1.00 30.00  ? 235 THR C C   2  
ATOM 10113  O O   . THR A 1 231 ? -42.127  42.476  -51.399 1.00 30.00  ? 235 THR C O   2  
ATOM 10114  C CB  . THR A 1 231 ? -39.351  40.647  -51.542 1.00 99.99  ? 235 THR C CB  2  
ATOM 10115  O OG1 . THR A 1 231 ? -39.959  39.380  -51.284 1.00 99.99  ? 235 THR C OG1 2  
ATOM 10116  C CG2 . THR A 1 231 ? -37.856  40.560  -51.254 1.00 99.99  ? 235 THR C CG2 2  
ATOM 10117  N N   . ARG A 1 232 ? -42.051  40.773  -50.197 1.00 30.00  ? 236 ARG C N   2  
ATOM 10118  C CA  . ARG A 1 232 ? -43.480  40.520  -50.182 1.00 30.00  ? 236 ARG C CA  2  
ATOM 10119  C C   . ARG A 1 232 ? -44.244  41.591  -49.389 1.00 30.00  ? 236 ARG C C   2  
ATOM 10120  O O   . ARG A 1 232 ? -45.178  42.220  -49.903 1.00 30.00  ? 236 ARG C O   2  
ATOM 10121  C CB  . ARG A 1 232 ? -43.762  39.166  -49.543 1.00 99.99  ? 236 ARG C CB  2  
ATOM 10122  C CG  . ARG A 1 232 ? -45.040  38.577  -50.132 1.00 99.99  ? 236 ARG C CG  2  
ATOM 10123  C CD  . ARG A 1 232 ? -45.163  37.113  -49.724 1.00 99.99  ? 236 ARG C CD  2  
ATOM 10124  N NE  . ARG A 1 232 ? -46.138  36.403  -50.579 1.00 99.99  ? 236 ARG C NE  2  
ATOM 10125  C CZ  . ARG A 1 232 ? -46.318  35.089  -50.537 1.00 99.99  ? 236 ARG C CZ  2  
ATOM 10126  N NH1 . ARG A 1 232 ? -45.624  34.307  -49.711 1.00 99.99  ? 236 ARG C NH1 2  
ATOM 10127  N NH2 . ARG A 1 232 ? -47.222  34.552  -51.351 1.00 99.99  ? 236 ARG C NH2 2  
ATOM 10128  N N   . ASN A 1 233 ? -43.841  41.795  -48.134 1.00 30.00  ? 237 ASN C N   2  
ATOM 10129  C CA  . ASN A 1 233 ? -44.493  42.782  -47.264 1.00 30.00  ? 237 ASN C CA  2  
ATOM 10130  C C   . ASN A 1 233 ? -43.580  43.860  -46.677 1.00 30.00  ? 237 ASN C C   2  
ATOM 10131  O O   . ASN A 1 233 ? -42.567  43.546  -46.046 1.00 30.00  ? 237 ASN C O   2  
ATOM 10132  C CB  . ASN A 1 233 ? -45.132  42.077  -46.072 1.00 99.99  ? 237 ASN C CB  2  
ATOM 10133  C CG  . ASN A 1 233 ? -46.409  41.357  -46.481 1.00 99.99  ? 237 ASN C CG  2  
ATOM 10134  O OD1 . ASN A 1 233 ? -46.675  40.248  -46.025 1.00 99.99  ? 237 ASN C OD1 2  
ATOM 10135  N ND2 . ASN A 1 233 ? -47.202  41.994  -47.347 1.00 99.99  ? 237 ASN C ND2 2  
ATOM 10136  N N   . ASN A 1 234 ? -43.936  45.129  -46.869 1.00 30.00  ? 238 ASN C N   2  
ATOM 10137  C CA  . ASN A 1 234 ? -43.114  46.198  -46.306 1.00 30.00  ? 238 ASN C CA  2  
ATOM 10138  C C   . ASN A 1 234 ? -43.192  46.160  -44.772 1.00 30.00  ? 238 ASN C C   2  
ATOM 10139  O O   . ASN A 1 234 ? -42.311  46.684  -44.083 1.00 30.00  ? 238 ASN C O   2  
ATOM 10140  C CB  . ASN A 1 234 ? -43.615  47.553  -46.799 1.00 99.99  ? 238 ASN C CB  2  
ATOM 10141  C CG  . ASN A 1 234 ? -42.747  48.686  -46.270 1.00 99.99  ? 238 ASN C CG  2  
ATOM 10142  O OD1 . ASN A 1 234 ? -41.538  48.527  -46.123 1.00 99.99  ? 238 ASN C OD1 2  
ATOM 10143  N ND2 . ASN A 1 234 ? -43.370  49.831  -45.983 1.00 99.99  ? 238 ASN C ND2 2  
ATOM 10144  N N   . ASN A 1 235 ? -44.243  45.519  -44.243 1.00 30.00  ? 239 ASN C N   2  
ATOM 10145  C CA  . ASN A 1 235 ? -44.438  45.377  -42.807 1.00 30.00  ? 239 ASN C CA  2  
ATOM 10146  C C   . ASN A 1 235 ? -44.750  43.905  -42.452 1.00 30.00  ? 239 ASN C C   2  
ATOM 10147  O O   . ASN A 1 235 ? -45.778  43.554  -41.826 1.00 30.00  ? 239 ASN C O   2  
ATOM 10148  C CB  . ASN A 1 235 ? -45.600  46.254  -42.353 1.00 99.99  ? 239 ASN C CB  2  
ATOM 10149  C CG  . ASN A 1 235 ? -45.201  47.722  -42.315 1.00 99.99  ? 239 ASN C CG  2  
ATOM 10150  O OD1 . ASN A 1 235 ? -45.981  48.590  -42.696 1.00 99.99  ? 239 ASN C OD1 2  
ATOM 10151  N ND2 . ASN A 1 235 ? -43.980  47.993  -41.854 1.00 99.99  ? 239 ASN C ND2 2  
ATOM 10152  N N   . SER A 1 236 ? -43.832  43.033  -42.847 1.00 30.00  ? 240 SER C N   2  
ATOM 10153  C CA  . SER A 1 236 ? -43.994  41.613  -42.596 1.00 30.00  ? 240 SER C CA  2  
ATOM 10154  C C   . SER A 1 236 ? -43.900  41.205  -41.121 1.00 30.00  ? 240 SER C C   2  
ATOM 10155  O O   . SER A 1 236 ? -42.930  41.495  -40.454 1.00 30.00  ? 240 SER C O   2  
ATOM 10156  C CB  . SER A 1 236 ? -42.916  40.830  -43.334 1.00 99.99  ? 240 SER C CB  2  
ATOM 10157  O OG  . SER A 1 236 ? -43.081  41.000  -44.745 1.00 99.99  ? 240 SER C OG  2  
ATOM 10158  N N   . SER A 1 237 ? -44.914  40.514  -40.622 1.00 30.00  ? 241 SER C N   2  
ATOM 10159  C CA  . SER A 1 237 ? -44.907  40.046  -39.244 1.00 30.00  ? 241 SER C CA  2  
ATOM 10160  C C   . SER A 1 237 ? -43.960  38.851  -39.181 1.00 30.00  ? 241 SER C C   2  
ATOM 10161  O O   . SER A 1 237 ? -44.152  37.877  -39.905 1.00 30.00  ? 241 SER C O   2  
ATOM 10162  C CB  . SER A 1 237 ? -46.316  39.635  -38.828 1.00 99.99  ? 241 SER C CB  2  
ATOM 10163  O OG  . SER A 1 237 ? -46.303  39.201  -37.467 1.00 99.99  ? 241 SER C OG  2  
ATOM 10164  N N   . ARG A 1 238 ? -43.100  38.867  -38.254 1.00 30.00  ? 242 ARG C N   2  
ATOM 10165  C CA  . ARG A 1 238 ? -42.115  37.789  -38.131 1.00 30.00  ? 242 ARG C CA  2  
ATOM 10166  C C   . ARG A 1 238 ? -42.226  36.954  -36.898 1.00 30.00  ? 242 ARG C C   2  
ATOM 10167  O O   . ARG A 1 238 ? -41.218  36.401  -36.393 1.00 30.00  ? 242 ARG C O   2  
ATOM 10168  C CB  . ARG A 1 238 ? -40.705  38.375  -38.120 1.00 99.99  ? 242 ARG C CB  2  
ATOM 10169  C CG  . ARG A 1 238 ? -40.450  39.114  -39.430 1.00 99.99  ? 242 ARG C CG  2  
ATOM 10170  C CD  . ARG A 1 238 ? -39.091  39.801  -39.369 1.00 99.99  ? 242 ARG C CD  2  
ATOM 10171  N NE  . ARG A 1 238 ? -39.147  41.009  -38.514 1.00 99.99  ? 242 ARG C NE  2  
ATOM 10172  C CZ  . ARG A 1 238 ? -38.074  41.745  -38.233 1.00 99.99  ? 242 ARG C CZ  2  
ATOM 10173  N NH1 . ARG A 1 238 ? -36.869  41.446  -38.708 1.00 99.99  ? 242 ARG C NH1 2  
ATOM 10174  N NH2 . ARG A 1 238 ? -38.236  42.809  -37.451 1.00 99.99  ? 242 ARG C NH2 2  
ATOM 10175  N N   . PHE A 1 239 ? -43.455  36.854  -36.407 1.00 30.00  ? 243 PHE C N   2  
ATOM 10176  C CA  . PHE A 1 239 ? -43.729  36.036  -35.209 1.00 30.00  ? 243 PHE C CA  2  
ATOM 10177  C C   . PHE A 1 239 ? -45.221  35.671  -35.289 1.00 30.00  ? 243 PHE C C   2  
ATOM 10178  O O   . PHE A 1 239 ? -46.015  36.353  -35.959 1.00 30.00  ? 243 PHE C O   2  
ATOM 10179  C CB  . PHE A 1 239 ? -43.424  36.842  -33.952 1.00 99.99  ? 243 PHE C CB  2  
ATOM 10180  C CG  . PHE A 1 239 ? -44.435  37.954  -33.807 1.00 99.99  ? 243 PHE C CG  2  
ATOM 10181  C CD1 . PHE A 1 239 ? -44.186  39.204  -34.387 1.00 99.99  ? 243 PHE C CD1 2  
ATOM 10182  C CD2 . PHE A 1 239 ? -45.618  37.735  -33.097 1.00 99.99  ? 243 PHE C CD2 2  
ATOM 10183  C CE1 . PHE A 1 239 ? -45.122  40.237  -34.253 1.00 99.99  ? 243 PHE C CE1 2  
ATOM 10184  C CE2 . PHE A 1 239 ? -46.555  38.768  -32.962 1.00 99.99  ? 243 PHE C CE2 2  
ATOM 10185  C CZ  . PHE A 1 239 ? -46.307  40.019  -33.541 1.00 99.99  ? 243 PHE C CZ  2  
ATOM 10186  N N   . GLY A 1 240 ? -45.609  34.599  -34.613 1.00 30.00  ? 244 GLY C N   2  
ATOM 10187  C CA  . GLY A 1 240 ? -46.999  34.198  -34.652 1.00 30.00  ? 244 GLY C CA  2  
ATOM 10188  C C   . GLY A 1 240 ? -47.724  34.858  -33.513 1.00 30.00  ? 244 GLY C C   2  
ATOM 10189  O O   . GLY A 1 240 ? -47.184  34.934  -32.417 1.00 30.00  ? 244 GLY C O   2  
ATOM 10190  N N   . LYS A 1 241 ? -48.945  35.309  -33.757 1.00 30.00  ? 245 LYS C N   2  
ATOM 10191  C CA  . LYS A 1 241 ? -49.713  35.987  -32.727 1.00 30.00  ? 245 LYS C CA  2  
ATOM 10192  C C   . LYS A 1 241 ? -51.097  35.451  -32.408 1.00 30.00  ? 245 LYS C C   2  
ATOM 10193  O O   . LYS A 1 241 ? -51.965  35.384  -33.272 1.00 30.00  ? 245 LYS C O   2  
ATOM 10194  C CB  . LYS A 1 241 ? -49.932  37.444  -33.117 1.00 99.99  ? 245 LYS C CB  2  
ATOM 10195  C CG  . LYS A 1 241 ? -48.751  38.284  -32.645 1.00 99.99  ? 245 LYS C CG  2  
ATOM 10196  C CD  . LYS A 1 241 ? -49.141  39.759  -32.648 1.00 99.99  ? 245 LYS C CD  2  
ATOM 10197  C CE  . LYS A 1 241 ? -49.192  40.268  -34.083 1.00 99.99  ? 245 LYS C CE  2  
ATOM 10198  N NZ  . LYS A 1 241 ? -49.232  41.739  -34.079 1.00 99.99  ? 245 LYS C NZ  2  
ATOM 10199  N N   . PHE A 1 242 ? -51.311  35.074  -31.158 1.00 30.00  ? 246 PHE C N   2  
ATOM 10200  C CA  . PHE A 1 242 ? -52.613  34.592  -30.743 1.00 30.00  ? 246 PHE C CA  2  
ATOM 10201  C C   . PHE A 1 242 ? -53.014  35.505  -29.590 1.00 30.00  ? 246 PHE C C   2  
ATOM 10202  O O   . PHE A 1 242 ? -52.399  35.460  -28.526 1.00 30.00  ? 246 PHE C O   2  
ATOM 10203  C CB  . PHE A 1 242 ? -52.511  33.136  -30.303 1.00 99.99  ? 246 PHE C CB  2  
ATOM 10204  C CG  . PHE A 1 242 ? -53.871  32.641  -29.876 1.00 99.99  ? 246 PHE C CG  2  
ATOM 10205  C CD1 . PHE A 1 242 ? -54.783  32.186  -30.835 1.00 99.99  ? 246 PHE C CD1 2  
ATOM 10206  C CD2 . PHE A 1 242 ? -54.220  32.638  -28.520 1.00 99.99  ? 246 PHE C CD2 2  
ATOM 10207  C CE1 . PHE A 1 242 ? -56.046  31.726  -30.438 1.00 99.99  ? 246 PHE C CE1 2  
ATOM 10208  C CE2 . PHE A 1 242 ? -55.484  32.181  -28.124 1.00 99.99  ? 246 PHE C CE2 2  
ATOM 10209  C CZ  . PHE A 1 242 ? -56.396  31.725  -29.084 1.00 99.99  ? 246 PHE C CZ  2  
ATOM 10210  N N   . ILE A 1 243 ? -54.040  36.327  -29.782 1.00 30.00  ? 247 ILE C N   2  
ATOM 10211  C CA  . ILE A 1 243 ? -54.478  37.222  -28.721 1.00 30.00  ? 247 ILE C CA  2  
ATOM 10212  C C   . ILE A 1 243 ? -55.906  36.926  -28.275 1.00 30.00  ? 247 ILE C C   2  
ATOM 10213  O O   . ILE A 1 243 ? -56.821  36.976  -29.078 1.00 30.00  ? 247 ILE C O   2  
ATOM 10214  C CB  . ILE A 1 243 ? -54.428  38.668  -29.207 1.00 99.99  ? 247 ILE C CB  2  
ATOM 10215  C CG1 . ILE A 1 243 ? -55.681  38.978  -30.017 1.00 99.99  ? 247 ILE C CG1 2  
ATOM 10216  C CG2 . ILE A 1 243 ? -53.194  38.866  -30.082 1.00 99.99  ? 247 ILE C CG2 2  
ATOM 10217  C CD1 . ILE A 1 243 ? -55.406  38.724  -31.497 1.00 99.99  ? 247 ILE C CD1 2  
ATOM 10218  N N   . ARG A 1 244 ? -56.082  36.614  -26.989 1.00 30.00  ? 248 ARG C N   2  
ATOM 10219  C CA  . ARG A 1 244 ? -57.403  36.329  -26.426 1.00 30.00  ? 248 ARG C CA  2  
ATOM 10220  C C   . ARG A 1 244 ? -57.952  37.579  -25.766 1.00 30.00  ? 248 ARG C C   2  
ATOM 10221  O O   . ARG A 1 244 ? -57.232  38.287  -25.079 1.00 30.00  ? 248 ARG C O   2  
ATOM 10222  C CB  . ARG A 1 244 ? -57.293  35.216  -25.387 1.00 99.99  ? 248 ARG C CB  2  
ATOM 10223  C CG  . ARG A 1 244 ? -56.631  33.995  -26.015 1.00 99.99  ? 248 ARG C CG  2  
ATOM 10224  C CD  . ARG A 1 244 ? -57.552  33.404  -27.076 1.00 99.99  ? 248 ARG C CD  2  
ATOM 10225  N NE  . ARG A 1 244 ? -58.855  33.014  -26.489 1.00 99.99  ? 248 ARG C NE  2  
ATOM 10226  C CZ  . ARG A 1 244 ? -59.714  32.206  -27.105 1.00 99.99  ? 248 ARG C CZ  2  
ATOM 10227  N NH1 . ARG A 1 244 ? -59.457  31.689  -28.305 1.00 99.99  ? 248 ARG C NH1 2  
ATOM 10228  N NH2 . ARG A 1 244 ? -60.855  31.919  -26.488 1.00 99.99  ? 248 ARG C NH2 2  
ATOM 10229  N N   . ILE A 1 245 ? -59.234  37.851  -25.977 1.00 30.00  ? 249 ILE C N   2  
ATOM 10230  C CA  . ILE A 1 245 ? -59.883  39.017  -25.395 1.00 30.00  ? 249 ILE C CA  2  
ATOM 10231  C C   . ILE A 1 245 ? -61.009  38.574  -24.468 1.00 30.00  ? 249 ILE C C   2  
ATOM 10232  O O   . ILE A 1 245 ? -62.068  38.167  -24.927 1.00 30.00  ? 249 ILE C O   2  
ATOM 10233  C CB  . ILE A 1 245 ? -60.459  39.895  -26.499 1.00 99.99  ? 249 ILE C CB  2  
ATOM 10234  C CG1 . ILE A 1 245 ? -61.858  39.405  -26.863 1.00 99.99  ? 249 ILE C CG1 2  
ATOM 10235  C CG2 . ILE A 1 245 ? -59.559  39.822  -27.730 1.00 99.99  ? 249 ILE C CG2 2  
ATOM 10236  C CD1 . ILE A 1 245 ? -62.894  40.191  -26.071 1.00 99.99  ? 249 ILE C CD1 2  
ATOM 10237  N N   . HIS A 1 246 ? -60.771  38.660  -23.162 1.00 30.00  ? 250 HIS C N   2  
ATOM 10238  C CA  . HIS A 1 246 ? -61.749  38.265  -22.155 1.00 30.00  ? 250 HIS C CA  2  
ATOM 10239  C C   . HIS A 1 246 ? -62.935  39.214  -21.938 1.00 30.00  ? 250 HIS C C   2  
ATOM 10240  O O   . HIS A 1 246 ? -62.825  40.436  -22.113 1.00 30.00  ? 250 HIS C O   2  
ATOM 10241  C CB  . HIS A 1 246 ? -61.070  38.139  -20.795 1.00 99.99  ? 250 HIS C CB  2  
ATOM 10242  C CG  . HIS A 1 246 ? -59.894  37.195  -20.752 1.00 99.99  ? 250 HIS C CG  2  
ATOM 10243  N ND1 . HIS A 1 246 ? -60.043  35.845  -20.452 1.00 99.99  ? 250 HIS C ND1 2  
ATOM 10244  C CD2 . HIS A 1 246 ? -58.566  37.400  -20.969 1.00 99.99  ? 250 HIS C CD2 2  
ATOM 10245  C CE1 . HIS A 1 246 ? -58.849  35.286  -20.492 1.00 99.99  ? 250 HIS C CE1 2  
ATOM 10246  N NE2 . HIS A 1 246 ? -57.959  36.193  -20.799 1.00 99.99  ? 250 HIS C NE2 2  
ATOM 10247  N N   . PHE A 1 247 ? -64.071  38.630  -21.559 1.00 30.00  ? 251 PHE C N   2  
ATOM 10248  C CA  . PHE A 1 247 ? -65.302  39.383  -21.326 1.00 30.00  ? 251 PHE C CA  2  
ATOM 10249  C C   . PHE A 1 247 ? -65.938  39.092  -19.966 1.00 30.00  ? 251 PHE C C   2  
ATOM 10250  O O   . PHE A 1 247 ? -65.912  37.950  -19.490 1.00 30.00  ? 251 PHE C O   2  
ATOM 10251  C CB  . PHE A 1 247 ? -66.334  39.036  -22.396 1.00 99.99  ? 251 PHE C CB  2  
ATOM 10252  C CG  . PHE A 1 247 ? -65.939  39.681  -23.703 1.00 99.99  ? 251 PHE C CG  2  
ATOM 10253  C CD1 . PHE A 1 247 ? -66.168  41.045  -23.908 1.00 99.99  ? 251 PHE C CD1 2  
ATOM 10254  C CD2 . PHE A 1 247 ? -65.343  38.911  -24.711 1.00 99.99  ? 251 PHE C CD2 2  
ATOM 10255  C CE1 . PHE A 1 247 ? -65.803  41.642  -25.121 1.00 99.99  ? 251 PHE C CE1 2  
ATOM 10256  C CE2 . PHE A 1 247 ? -64.977  39.509  -25.924 1.00 99.99  ? 251 PHE C CE2 2  
ATOM 10257  C CZ  . PHE A 1 247 ? -65.208  40.873  -26.127 1.00 99.99  ? 251 PHE C CZ  2  
ATOM 10258  N N   . GLY A 1 248 ? -66.521  40.135  -19.358 1.00 30.00  ? 252 GLY C N   2  
ATOM 10259  C CA  . GLY A 1 248 ? -67.160  39.990  -18.059 1.00 30.00  ? 252 GLY C CA  2  
ATOM 10260  C C   . GLY A 1 248 ? -68.657  39.689  -18.067 1.00 30.00  ? 252 GLY C C   2  
ATOM 10261  O O   . GLY A 1 248 ? -69.258  39.572  -19.139 1.00 30.00  ? 252 GLY C O   2  
ATOM 10262  N N   . PRO A 1 249 ? -69.286  39.554  -16.873 1.00 30.00  ? 253 PRO C N   2  
ATOM 10263  C CA  . PRO A 1 249 ? -70.710  39.268  -16.637 1.00 30.00  ? 253 PRO C CA  2  
ATOM 10264  C C   . PRO A 1 249 ? -71.743  40.235  -17.211 1.00 30.00  ? 253 PRO C C   2  
ATOM 10265  O O   . PRO A 1 249 ? -72.945  40.009  -17.097 1.00 30.00  ? 253 PRO C O   2  
ATOM 10266  C CB  . PRO A 1 249 ? -70.699  39.341  -15.150 1.00 99.99  ? 253 PRO C CB  2  
ATOM 10267  C CG  . PRO A 1 249 ? -69.265  39.604  -14.754 1.00 99.99  ? 253 PRO C CG  2  
ATOM 10268  C CD  . PRO A 1 249 ? -68.464  39.675  -15.745 1.00 99.99  ? 253 PRO C CD  2  
ATOM 10269  N N   . THR A 1 250 ? -71.281  41.314  -17.826 1.00 30.00  ? 254 THR C N   2  
ATOM 10270  C CA  . THR A 1 250 ? -72.188  42.287  -18.432 1.00 30.00  ? 254 THR C CA  2  
ATOM 10271  C C   . THR A 1 250 ? -71.837  42.321  -19.918 1.00 30.00  ? 254 THR C C   2  
ATOM 10272  O O   . THR A 1 250 ? -72.298  43.201  -20.654 1.00 30.00  ? 254 THR C O   2  
ATOM 10273  C CB  . THR A 1 250 ? -71.983  43.655  -17.790 1.00 99.99  ? 254 THR C CB  2  
ATOM 10274  O OG1 . THR A 1 250 ? -70.694  44.160  -18.147 1.00 99.99  ? 254 THR C OG1 2  
ATOM 10275  C CG2 . THR A 1 250 ? -72.073  43.525  -16.275 1.00 99.99  ? 254 THR C CG2 2  
ATOM 10276  N N   . GLY A 1 251 ? -71.012  41.355  -20.340 1.00 30.00  ? 255 GLY C N   2  
ATOM 10277  C CA  . GLY A 1 251 ? -70.579  41.243  -21.729 1.00 30.00  ? 255 GLY C CA  2  
ATOM 10278  C C   . GLY A 1 251 ? -69.634  42.346  -22.198 1.00 30.00  ? 255 GLY C C   2  
ATOM 10279  O O   . GLY A 1 251 ? -69.677  42.746  -23.369 1.00 30.00  ? 255 GLY C O   2  
ATOM 10280  N N   . LYS A 1 252 ? -68.779  42.837  -21.301 1.00 30.00  ? 256 LYS C N   2  
ATOM 10281  C CA  . LYS A 1 252 ? -67.838  43.899  -21.648 1.00 30.00  ? 256 LYS C CA  2  
ATOM 10282  C C   . LYS A 1 252 ? -66.394  43.438  -21.476 1.00 30.00  ? 256 LYS C C   2  
ATOM 10283  O O   . LYS A 1 252 ? -66.124  42.511  -20.700 1.00 30.00  ? 256 LYS C O   2  
ATOM 10284  C CB  . LYS A 1 252 ? -68.070  45.111  -20.751 1.00 99.99  ? 256 LYS C CB  2  
ATOM 10285  C CG  . LYS A 1 252 ? -67.153  46.249  -21.186 1.00 99.99  ? 256 LYS C CG  2  
ATOM 10286  C CD  . LYS A 1 252 ? -67.673  47.565  -20.618 1.00 99.99  ? 256 LYS C CD  2  
ATOM 10287  C CE  . LYS A 1 252 ? -66.582  48.630  -20.726 1.00 99.99  ? 256 LYS C CE  2  
ATOM 10288  N NZ  . LYS A 1 252 ? -66.765  49.390  -21.972 1.00 99.99  ? 256 LYS C NZ  2  
ATOM 10289  N N   . ILE A 1 253 ? -65.465  44.074  -22.191 1.00 30.00  ? 257 ILE C N   2  
ATOM 10290  C CA  . ILE A 1 253 ? -64.061  43.682  -22.104 1.00 30.00  ? 257 ILE C CA  2  
ATOM 10291  C C   . ILE A 1 253 ? -63.513  43.834  -20.686 1.00 30.00  ? 257 ILE C C   2  
ATOM 10292  O O   . ILE A 1 253 ? -63.500  44.919  -20.115 1.00 30.00  ? 257 ILE C O   2  
ATOM 10293  C CB  . ILE A 1 253 ? -63.223  44.557  -23.031 1.00 99.99  ? 257 ILE C CB  2  
ATOM 10294  C CG1 . ILE A 1 253 ? -62.920  45.882  -22.344 1.00 99.99  ? 257 ILE C CG1 2  
ATOM 10295  C CG2 . ILE A 1 253 ? -63.994  44.816  -24.320 1.00 99.99  ? 257 ILE C CG2 2  
ATOM 10296  C CD1 . ILE A 1 253 ? -63.979  46.909  -22.731 1.00 99.99  ? 257 ILE C CD1 2  
ATOM 10297  N N   . ALA A 1 254 ? -63.061  42.710  -20.137 1.00 30.00  ? 258 ALA C N   2  
ATOM 10298  C CA  . ALA A 1 254 ? -62.517  42.638  -18.786 1.00 30.00  ? 258 ALA C CA  2  
ATOM 10299  C C   . ALA A 1 254 ? -61.099  42.063  -18.699 1.00 30.00  ? 258 ALA C C   2  
ATOM 10300  O O   . ALA A 1 254 ? -60.765  41.396  -17.707 1.00 30.00  ? 258 ALA C O   2  
ATOM 10301  C CB  . ALA A 1 254 ? -63.444  41.785  -17.942 1.00 30.00  ? 258 ALA C CB  2  
ATOM 10302  N N   . GLY A 1 255 ? -60.276  42.313  -19.716 1.00 30.00  ? 259 GLY C N   2  
ATOM 10303  C CA  . GLY A 1 255 ? -58.913  41.790  -19.711 1.00 30.00  ? 259 GLY C CA  2  
ATOM 10304  C C   . GLY A 1 255 ? -58.478  41.289  -21.076 1.00 30.00  ? 259 GLY C C   2  
ATOM 10305  O O   . GLY A 1 255 ? -59.266  41.328  -22.024 1.00 30.00  ? 259 GLY C O   2  
ATOM 10306  N N   . ALA A 1 256 ? -57.236  40.808  -21.182 1.00 30.00  ? 260 ALA C N   2  
ATOM 10307  C CA  . ALA A 1 256 ? -56.704  40.307  -22.454 1.00 30.00  ? 260 ALA C CA  2  
ATOM 10308  C C   . ALA A 1 256 ? -55.248  39.854  -22.373 1.00 30.00  ? 260 ALA C C   2  
ATOM 10309  O O   . ALA A 1 256 ? -54.454  40.438  -21.649 1.00 30.00  ? 260 ALA C O   2  
ATOM 10310  C CB  . ALA A 1 256 ? -56.824  41.384  -23.514 1.00 30.00  ? 260 ALA C CB  2  
ATOM 10311  N N   . ASP A 1 257 ? -54.892  38.814  -23.117 1.00 30.00  ? 261 ASP C N   2  
ATOM 10312  C CA  . ASP A 1 257 ? -53.513  38.327  -23.114 1.00 30.00  ? 261 ASP C CA  2  
ATOM 10313  C C   . ASP A 1 257 ? -53.015  38.033  -24.521 1.00 30.00  ? 261 ASP C C   2  
ATOM 10314  O O   . ASP A 1 257 ? -53.796  37.804  -25.453 1.00 30.00  ? 261 ASP C O   2  
ATOM 10315  C CB  . ASP A 1 257 ? -53.418  37.042  -22.298 1.00 99.99  ? 261 ASP C CB  2  
ATOM 10316  C CG  . ASP A 1 257 ? -51.950  36.676  -22.091 1.00 99.99  ? 261 ASP C CG  2  
ATOM 10317  O OD1 . ASP A 1 257 ? -51.358  36.103  -23.047 1.00 99.99  ? 261 ASP C OD1 2  
ATOM 10318  O OD2 . ASP A 1 257 ? -51.432  36.972  -20.980 1.00 99.99  ? 261 ASP C OD2 2  
ATOM 10319  N N   . ILE A 1 258 ? -51.700  38.032  -24.662 1.00 30.00  ? 262 ILE C N   2  
ATOM 10320  C CA  . ILE A 1 258 ? -51.066  37.795  -25.940 1.00 30.00  ? 262 ILE C CA  2  
ATOM 10321  C C   . ILE A 1 258 ? -50.069  36.662  -25.872 1.00 30.00  ? 262 ILE C C   2  
ATOM 10322  O O   . ILE A 1 258 ? -49.384  36.483  -24.867 1.00 30.00  ? 262 ILE C O   2  
ATOM 10323  C CB  . ILE A 1 258 ? -50.330  39.049  -26.393 1.00 99.99  ? 262 ILE C CB  2  
ATOM 10324  C CG1 . ILE A 1 258 ? -48.969  39.118  -25.707 1.00 99.99  ? 262 ILE C CG1 2  
ATOM 10325  C CG2 . ILE A 1 258 ? -51.148  40.282  -26.023 1.00 99.99  ? 262 ILE C CG2 2  
ATOM 10326  C CD1 . ILE A 1 258 ? -49.087  39.940  -24.428 1.00 99.99  ? 262 ILE C CD1 2  
ATOM 10327  N N   . GLU A 1 259 ? -50.007  35.893  -26.954 1.00 30.00  ? 263 GLU C N   2  
ATOM 10328  C CA  . GLU A 1 259 ? -49.086  34.769  -27.078 1.00 30.00  ? 263 GLU C CA  2  
ATOM 10329  C C   . GLU A 1 259 ? -48.422  35.000  -28.424 1.00 30.00  ? 263 GLU C C   2  
ATOM 10330  O O   . GLU A 1 259 ? -49.072  35.454  -29.379 1.00 30.00  ? 263 GLU C O   2  
ATOM 10331  C CB  . GLU A 1 259 ? -49.861  33.455  -27.035 1.00 99.99  ? 263 GLU C CB  2  
ATOM 10332  C CG  . GLU A 1 259 ? -50.542  33.315  -25.697 1.00 99.99  ? 263 GLU C CG  2  
ATOM 10333  C CD  . GLU A 1 259 ? -49.496  33.040  -24.618 1.00 99.99  ? 263 GLU C CD  2  
ATOM 10334  O OE1 . GLU A 1 259 ? -48.990  34.041  -24.042 1.00 99.99  ? 263 GLU C OE1 2  
ATOM 10335  O OE2 . GLU A 1 259 ? -49.213  31.836  -24.383 1.00 99.99  ? 263 GLU C OE2 2  
ATOM 10336  N N   . THR A 1 260 ? -47.129  34.719  -28.490 1.00 30.00  ? 264 THR C N   2  
ATOM 10337  C CA  . THR A 1 260 ? -46.390  34.905  -29.721 1.00 30.00  ? 264 THR C CA  2  
ATOM 10338  C C   . THR A 1 260 ? -45.650  33.620  -30.025 1.00 30.00  ? 264 THR C C   2  
ATOM 10339  O O   . THR A 1 260 ? -45.346  32.827  -29.127 1.00 30.00  ? 264 THR C O   2  
ATOM 10340  C CB  . THR A 1 260 ? -45.398  36.051  -29.562 1.00 99.99  ? 264 THR C CB  2  
ATOM 10341  O OG1 . THR A 1 260 ? -44.375  35.673  -28.635 1.00 99.99  ? 264 THR C OG1 2  
ATOM 10342  C CG2 . THR A 1 260 ? -46.126  37.284  -29.035 1.00 99.99  ? 264 THR C CG2 2  
ATOM 10343  N N   . TYR A 1 261 ? -45.356  33.422  -31.309 1.00 30.00  ? 265 TYR C N   2  
ATOM 10344  C CA  . TYR A 1 261 ? -44.675  32.225  -31.741 1.00 30.00  ? 265 TYR C CA  2  
ATOM 10345  C C   . TYR A 1 261 ? -43.594  32.431  -32.795 1.00 30.00  ? 265 TYR C C   2  
ATOM 10346  O O   . TYR A 1 261 ? -43.768  33.203  -33.747 1.00 30.00  ? 265 TYR C O   2  
ATOM 10347  C CB  . TYR A 1 261 ? -45.677  31.247  -32.347 1.00 99.99  ? 265 TYR C CB  2  
ATOM 10348  C CG  . TYR A 1 261 ? -44.958  29.999  -32.795 1.00 99.99  ? 265 TYR C CG  2  
ATOM 10349  C CD1 . TYR A 1 261 ? -44.673  28.985  -31.871 1.00 99.99  ? 265 TYR C CD1 2  
ATOM 10350  C CD2 . TYR A 1 261 ? -44.575  29.852  -34.134 1.00 99.99  ? 265 TYR C CD2 2  
ATOM 10351  C CE1 . TYR A 1 261 ? -44.006  27.828  -32.287 1.00 99.99  ? 265 TYR C CE1 2  
ATOM 10352  C CE2 . TYR A 1 261 ? -43.907  28.697  -34.547 1.00 99.99  ? 265 TYR C CE2 2  
ATOM 10353  C CZ  . TYR A 1 261 ? -43.624  27.683  -33.624 1.00 99.99  ? 265 TYR C CZ  2  
ATOM 10354  O OH  . TYR A 1 261 ? -42.973  26.556  -34.028 1.00 99.99  ? 265 TYR C OH  2  
ATOM 10355  N N   . LEU A 1 262 ? -42.480  31.724  -32.601 1.00 30.00  ? 266 LEU C N   2  
ATOM 10356  C CA  . LEU A 1 262 ? -41.338  31.733  -33.511 1.00 30.00  ? 266 LEU C CA  2  
ATOM 10357  C C   . LEU A 1 262 ? -40.926  33.041  -34.157 1.00 30.00  ? 266 LEU C C   2  
ATOM 10358  O O   . LEU A 1 262 ? -41.199  33.271  -35.347 1.00 30.00  ? 266 LEU C O   2  
ATOM 10359  C CB  . LEU A 1 262 ? -41.605  30.801  -34.689 1.00 99.99  ? 266 LEU C CB  2  
ATOM 10360  C CG  . LEU A 1 262 ? -41.003  29.430  -34.401 1.00 99.99  ? 266 LEU C CG  2  
ATOM 10361  C CD1 . LEU A 1 262 ? -40.975  28.606  -35.683 1.00 99.99  ? 266 LEU C CD1 2  
ATOM 10362  C CD2 . LEU A 1 262 ? -39.582  29.603  -33.873 1.00 99.99  ? 266 LEU C CD2 2  
ATOM 10363  N N   . LEU A 1 263 ? -40.261  33.895  -33.392 1.00 30.00  ? 267 LEU C N   2  
ATOM 10364  C CA  . LEU A 1 263 ? -39.810  35.173  -33.926 1.00 30.00  ? 267 LEU C CA  2  
ATOM 10365  C C   . LEU A 1 263 ? -38.533  34.911  -34.736 1.00 30.00  ? 267 LEU C C   2  
ATOM 10366  O O   . LEU A 1 263 ? -37.670  34.130  -34.319 1.00 30.00  ? 267 LEU C O   2  
ATOM 10367  C CB  . LEU A 1 263 ? -39.521  36.142  -32.784 1.00 99.99  ? 267 LEU C CB  2  
ATOM 10368  C CG  . LEU A 1 263 ? -40.750  37.004  -32.523 1.00 99.99  ? 267 LEU C CG  2  
ATOM 10369  C CD1 . LEU A 1 263 ? -40.368  38.177  -31.625 1.00 99.99  ? 267 LEU C CD1 2  
ATOM 10370  C CD2 . LEU A 1 263 ? -41.290  37.534  -33.847 1.00 99.99  ? 267 LEU C CD2 2  
ATOM 10371  N N   . GLU A 1 264 ? -38.414  35.561  -35.886 1.00 30.00  ? 268 GLU C N   2  
ATOM 10372  C CA  . GLU A 1 264 ? -37.244  35.365  -36.723 1.00 30.00  ? 268 GLU C CA  2  
ATOM 10373  C C   . GLU A 1 264 ? -35.909  35.884  -36.162 1.00 30.00  ? 268 GLU C C   2  
ATOM 10374  O O   . GLU A 1 264 ? -35.432  36.956  -36.558 1.00 30.00  ? 268 GLU C O   2  
ATOM 10375  C CB  . GLU A 1 264 ? -37.437  36.073  -38.059 1.00 99.99  ? 268 GLU C CB  2  
ATOM 10376  C CG  . GLU A 1 264 ? -36.230  36.930  -38.355 1.00 99.99  ? 268 GLU C CG  2  
ATOM 10377  C CD  . GLU A 1 264 ? -36.219  38.135  -37.413 1.00 99.99  ? 268 GLU C CD  2  
ATOM 10378  O OE1 . GLU A 1 264 ? -35.615  38.000  -36.316 1.00 99.99  ? 268 GLU C OE1 2  
ATOM 10379  O OE2 . GLU A 1 264 ? -36.814  39.176  -37.804 1.00 99.99  ? 268 GLU C OE2 2  
ATOM 10380  N N   . LYS A 1 265 ? -35.512  34.963  -35.241 1.00 30.00  ? 269 LYS C N   2  
ATOM 10381  C CA  . LYS A 1 265 ? -34.214  35.317  -34.661 1.00 30.00  ? 269 LYS C CA  2  
ATOM 10382  C C   . LYS A 1 265 ? -33.188  35.729  -35.714 1.00 30.00  ? 269 LYS C C   2  
ATOM 10383  O O   . LYS A 1 265 ? -32.383  36.625  -35.497 1.00 30.00  ? 269 LYS C O   2  
ATOM 10384  C CB  . LYS A 1 265 ? -33.645  34.120  -33.906 1.00 99.99  ? 269 LYS C CB  2  
ATOM 10385  C CG  . LYS A 1 265 ? -34.613  33.705  -32.804 1.00 99.99  ? 269 LYS C CG  2  
ATOM 10386  C CD  . LYS A 1 265 ? -33.999  32.575  -31.987 1.00 99.99  ? 269 LYS C CD  2  
ATOM 10387  C CE  . LYS A 1 265 ? -34.958  32.176  -30.870 1.00 99.99  ? 269 LYS C CE  2  
ATOM 10388  N NZ  . LYS A 1 265 ? -34.217  31.462  -29.819 1.00 99.99  ? 269 LYS C NZ  2  
ATOM 10389  N N   . SER A 1 266 ? -33.216  35.076  -36.863 1.00 30.00  ? 270 SER C N   2  
ATOM 10390  C CA  . SER A 1 266 ? -32.258  35.366  -37.932 1.00 30.00  ? 270 SER C CA  2  
ATOM 10391  C C   . SER A 1 266 ? -32.213  36.736  -38.586 1.00 30.00  ? 270 SER C C   2  
ATOM 10392  O O   . SER A 1 266 ? -31.158  37.142  -39.075 1.00 30.00  ? 270 SER C O   2  
ATOM 10393  C CB  . SER A 1 266 ? -32.492  34.422  -39.106 1.00 99.99  ? 270 SER C CB  2  
ATOM 10394  O OG  . SER A 1 266 ? -33.746  34.726  -39.722 1.00 99.99  ? 270 SER C OG  2  
ATOM 10395  N N   . ARG A 1 267 ? -33.334  37.450  -38.622 1.00 30.00  ? 271 ARG C N   2  
ATOM 10396  C CA  . ARG A 1 267 ? -33.339  38.768  -39.272 1.00 30.00  ? 271 ARG C CA  2  
ATOM 10397  C C   . ARG A 1 267 ? -32.464  39.799  -38.572 1.00 30.00  ? 271 ARG C C   2  
ATOM 10398  O O   . ARG A 1 267 ? -31.981  40.745  -39.199 1.00 30.00  ? 271 ARG C O   2  
ATOM 10399  C CB  . ARG A 1 267 ? -34.758  39.324  -39.301 1.00 99.99  ? 271 ARG C CB  2  
ATOM 10400  C CG  . ARG A 1 267 ? -34.924  40.239  -40.509 1.00 99.99  ? 271 ARG C CG  2  
ATOM 10401  C CD  . ARG A 1 267 ? -36.306  40.031  -41.117 1.00 99.99  ? 271 ARG C CD  2  
ATOM 10402  N NE  . ARG A 1 267 ? -36.352  40.529  -42.510 1.00 99.99  ? 271 ARG C NE  2  
ATOM 10403  C CZ  . ARG A 1 267 ? -37.357  40.266  -43.340 1.00 99.99  ? 271 ARG C CZ  2  
ATOM 10404  N NH1 . ARG A 1 267 ? -38.402  39.529  -42.973 1.00 99.99  ? 271 ARG C NH1 2  
ATOM 10405  N NH2 . ARG A 1 267 ? -37.298  40.765  -44.572 1.00 99.99  ? 271 ARG C NH2 2  
ATOM 10406  N N   . VAL A 1 268 ? -32.275  39.607  -37.270 1.00 30.00  ? 272 VAL C N   2  
ATOM 10407  C CA  . VAL A 1 268 ? -31.473  40.490  -36.433 1.00 30.00  ? 272 VAL C CA  2  
ATOM 10408  C C   . VAL A 1 268 ? -30.106  40.853  -37.031 1.00 30.00  ? 272 VAL C C   2  
ATOM 10409  O O   . VAL A 1 268 ? -29.768  42.032  -37.173 1.00 30.00  ? 272 VAL C O   2  
ATOM 10410  C CB  . VAL A 1 268 ? -31.205  39.829  -35.088 1.00 99.99  ? 272 VAL C CB  2  
ATOM 10411  C CG1 . VAL A 1 268 ? -32.532  39.543  -34.388 1.00 99.99  ? 272 VAL C CG1 2  
ATOM 10412  C CG2 . VAL A 1 268 ? -30.451  38.523  -35.301 1.00 99.99  ? 272 VAL C CG2 2  
ATOM 10413  N N   . THR A 1 269 ? -29.333  39.827  -37.388 1.00 30.00  ? 273 THR C N   2  
ATOM 10414  C CA  . THR A 1 269 ? -27.999  40.015  -37.971 1.00 30.00  ? 273 THR C CA  2  
ATOM 10415  C C   . THR A 1 269 ? -27.932  39.879  -39.496 1.00 30.00  ? 273 THR C C   2  
ATOM 10416  O O   . THR A 1 269 ? -26.993  40.365  -40.122 1.00 30.00  ? 273 THR C O   2  
ATOM 10417  C CB  . THR A 1 269 ? -27.035  38.978  -37.400 1.00 99.99  ? 273 THR C CB  2  
ATOM 10418  O OG1 . THR A 1 269 ? -27.403  37.678  -37.870 1.00 99.99  ? 273 THR C OG1 2  
ATOM 10419  C CG2 . THR A 1 269 ? -27.102  39.006  -35.879 1.00 99.99  ? 273 THR C CG2 2  
ATOM 10420  N N   . TYR A 1 270 ? -28.925  39.220  -40.089 1.00 30.00  ? 274 TYR C N   2  
ATOM 10421  C CA  . TYR A 1 270 ? -28.948  39.028  -41.541 1.00 30.00  ? 274 TYR C CA  2  
ATOM 10422  C C   . TYR A 1 270 ? -30.240  39.444  -42.215 1.00 30.00  ? 274 TYR C C   2  
ATOM 10423  O O   . TYR A 1 270 ? -31.322  39.292  -41.644 1.00 30.00  ? 274 TYR C O   2  
ATOM 10424  C CB  . TYR A 1 270 ? -28.738  37.553  -41.872 1.00 99.99  ? 274 TYR C CB  2  
ATOM 10425  C CG  . TYR A 1 270 ? -28.761  37.362  -43.369 1.00 99.99  ? 274 TYR C CG  2  
ATOM 10426  C CD1 . TYR A 1 270 ? -27.603  37.599  -44.121 1.00 99.99  ? 274 TYR C CD1 2  
ATOM 10427  C CD2 . TYR A 1 270 ? -29.939  36.953  -44.006 1.00 99.99  ? 274 TYR C CD2 2  
ATOM 10428  C CE1 . TYR A 1 270 ? -27.623  37.423  -45.510 1.00 99.99  ? 274 TYR C CE1 2  
ATOM 10429  C CE2 . TYR A 1 270 ? -29.957  36.778  -45.395 1.00 99.99  ? 274 TYR C CE2 2  
ATOM 10430  C CZ  . TYR A 1 270 ? -28.801  37.012  -46.147 1.00 99.99  ? 274 TYR C CZ  2  
ATOM 10431  O OH  . TYR A 1 270 ? -28.824  36.841  -47.496 1.00 99.99  ? 274 TYR C OH  2  
ATOM 10432  N N   . GLN A 1 271 ? -30.118  39.962  -43.435 1.00 30.00  ? 275 GLN C N   2  
ATOM 10433  C CA  . GLN A 1 271 ? -31.293  40.373  -44.189 1.00 30.00  ? 275 GLN C CA  2  
ATOM 10434  C C   . GLN A 1 271 ? -31.062  40.310  -45.691 1.00 30.00  ? 275 GLN C C   2  
ATOM 10435  O O   . GLN A 1 271 ? -30.320  41.121  -46.237 1.00 30.00  ? 275 GLN C O   2  
ATOM 10436  C CB  . GLN A 1 271 ? -31.665  41.807  -43.832 1.00 99.99  ? 275 GLN C CB  2  
ATOM 10437  C CG  . GLN A 1 271 ? -32.088  41.874  -42.367 1.00 99.99  ? 275 GLN C CG  2  
ATOM 10438  C CD  . GLN A 1 271 ? -33.448  41.226  -42.159 1.00 99.99  ? 275 GLN C CD  2  
ATOM 10439  O OE1 . GLN A 1 271 ? -34.056  40.737  -43.109 1.00 99.99  ? 275 GLN C OE1 2  
ATOM 10440  N NE2 . GLN A 1 271 ? -33.925  41.224  -40.912 1.00 99.99  ? 275 GLN C NE2 2  
ATOM 10441  N N   . GLN A 1 272 ? -31.708  39.343  -46.347 1.00 30.00  ? 276 GLN C N   2  
ATOM 10442  C CA  . GLN A 1 272 ? -31.602  39.154  -47.799 1.00 30.00  ? 276 GLN C CA  2  
ATOM 10443  C C   . GLN A 1 272 ? -31.812  40.485  -48.514 1.00 30.00  ? 276 GLN C C   2  
ATOM 10444  O O   . GLN A 1 272 ? -32.451  41.386  -47.979 1.00 30.00  ? 276 GLN C O   2  
ATOM 10445  C CB  . GLN A 1 272 ? -32.659  38.163  -48.271 1.00 99.99  ? 276 GLN C CB  2  
ATOM 10446  C CG  . GLN A 1 272 ? -34.043  38.662  -47.869 1.00 99.99  ? 276 GLN C CG  2  
ATOM 10447  C CD  . GLN A 1 272 ? -34.315  38.394  -46.394 1.00 99.99  ? 276 GLN C CD  2  
ATOM 10448  O OE1 . GLN A 1 272 ? -33.468  37.843  -45.696 1.00 99.99  ? 276 GLN C OE1 2  
ATOM 10449  N NE2 . GLN A 1 272 ? -35.499  38.789  -45.924 1.00 99.99  ? 276 GLN C NE2 2  
ATOM 10450  N N   . SER A 1 273 ? -31.281  40.621  -49.722 1.00 30.00  ? 277 SER C N   2  
ATOM 10451  C CA  . SER A 1 273 ? -31.436  41.874  -50.442 1.00 30.00  ? 277 SER C CA  2  
ATOM 10452  C C   . SER A 1 273 ? -32.891  42.305  -50.512 1.00 30.00  ? 277 SER C C   2  
ATOM 10453  O O   . SER A 1 273 ? -33.795  41.472  -50.397 1.00 30.00  ? 277 SER C O   2  
ATOM 10454  C CB  . SER A 1 273 ? -30.915  41.722  -51.865 1.00 99.99  ? 277 SER C CB  2  
ATOM 10455  O OG  . SER A 1 273 ? -31.769  40.836  -52.595 1.00 99.99  ? 277 SER C OG  2  
ATOM 10456  N N   . ALA A 1 274 ? -33.109  43.611  -50.695 1.00 30.00  ? 278 ALA C N   2  
ATOM 10457  C CA  . ALA A 1 274 ? -34.459  44.187  -50.791 1.00 30.00  ? 278 ALA C CA  2  
ATOM 10458  C C   . ALA A 1 274 ? -35.327  43.988  -49.536 1.00 30.00  ? 278 ALA C C   2  
ATOM 10459  O O   . ALA A 1 274 ? -36.551  44.166  -49.572 1.00 30.00  ? 278 ALA C O   2  
ATOM 10460  C CB  . ALA A 1 274 ? -35.174  43.598  -51.997 1.00 30.00  ? 278 ALA C CB  2  
ATOM 10461  N N   . GLU A 1 275 ? -34.686  43.619  -48.432 1.00 30.00  ? 279 GLU C N   2  
ATOM 10462  C CA  . GLU A 1 275 ? -35.381  43.397  -47.168 1.00 30.00  ? 279 GLU C CA  2  
ATOM 10463  C C   . GLU A 1 275 ? -34.706  44.197  -46.062 1.00 30.00  ? 279 GLU C C   2  
ATOM 10464  O O   . GLU A 1 275 ? -33.518  44.513  -46.147 1.00 30.00  ? 279 GLU C O   2  
ATOM 10465  C CB  . GLU A 1 275 ? -35.347  41.916  -46.810 1.00 99.99  ? 279 GLU C CB  2  
ATOM 10466  C CG  . GLU A 1 275 ? -34.866  41.754  -45.388 1.00 99.99  ? 279 GLU C CG  2  
ATOM 10467  C CD  . GLU A 1 275 ? -33.372  42.081  -45.315 1.00 99.99  ? 279 GLU C CD  2  
ATOM 10468  O OE1 . GLU A 1 275 ? -33.058  43.277  -45.083 1.00 99.99  ? 279 GLU C OE1 2  
ATOM 10469  O OE2 . GLU A 1 275 ? -32.568  41.129  -45.493 1.00 99.99  ? 279 GLU C OE2 2  
ATOM 10470  N N   . ARG A 1 276 ? -35.465  44.512  -45.022 1.00 30.00  ? 280 ARG C N   2  
ATOM 10471  C CA  . ARG A 1 276 ? -34.936  45.262  -43.901 1.00 30.00  ? 280 ARG C CA  2  
ATOM 10472  C C   . ARG A 1 276 ? -34.939  44.424  -42.644 1.00 30.00  ? 280 ARG C C   2  
ATOM 10473  O O   . ARG A 1 276 ? -35.515  43.327  -42.606 1.00 30.00  ? 280 ARG C O   2  
ATOM 10474  C CB  . ARG A 1 276 ? -35.787  46.505  -43.661 1.00 99.99  ? 280 ARG C CB  2  
ATOM 10475  C CG  . ARG A 1 276 ? -35.153  47.351  -42.562 1.00 99.99  ? 280 ARG C CG  2  
ATOM 10476  C CD  . ARG A 1 276 ? -36.067  48.528  -42.236 1.00 99.99  ? 280 ARG C CD  2  
ATOM 10477  N NE  . ARG A 1 276 ? -37.284  48.074  -41.528 1.00 99.99  ? 280 ARG C NE  2  
ATOM 10478  C CZ  . ARG A 1 276 ? -38.206  48.911  -41.062 1.00 99.99  ? 280 ARG C CZ  2  
ATOM 10479  N NH1 . ARG A 1 276 ? -38.097  50.230  -41.202 1.00 99.99  ? 280 ARG C NH1 2  
ATOM 10480  N NH2 . ARG A 1 276 ? -39.263  48.395  -40.441 1.00 99.99  ? 280 ARG C NH2 2  
ATOM 10481  N N   . ASN A 1 277 ? -34.287  44.947  -41.608 1.00 30.00  ? 281 ASN C N   2  
ATOM 10482  C CA  . ASN A 1 277 ? -34.232  44.269  -40.318 1.00 30.00  ? 281 ASN C CA  2  
ATOM 10483  C C   . ASN A 1 277 ? -35.515  44.769  -39.665 1.00 30.00  ? 281 ASN C C   2  
ATOM 10484  O O   . ASN A 1 277 ? -36.303  45.505  -40.301 1.00 30.00  ? 281 ASN C O   2  
ATOM 10485  C CB  . ASN A 1 277 ? -32.970  44.684  -39.568 1.00 99.99  ? 281 ASN C CB  2  
ATOM 10486  C CG  . ASN A 1 277 ? -32.968  46.177  -39.278 1.00 99.99  ? 281 ASN C CG  2  
ATOM 10487  O OD1 . ASN A 1 277 ? -32.163  46.658  -38.485 1.00 99.99  ? 281 ASN C OD1 2  
ATOM 10488  N ND2 . ASN A 1 277 ? -33.876  46.911  -39.927 1.00 99.99  ? 281 ASN C ND2 2  
ATOM 10489  N N   . TYR A 1 278 ? -35.742  44.378  -38.418 1.00 30.00  ? 282 TYR C N   2  
ATOM 10490  C CA  . TYR A 1 278 ? -36.934  44.828  -37.727 1.00 30.00  ? 282 TYR C CA  2  
ATOM 10491  C C   . TYR A 1 278 ? -37.122  46.345  -37.800 1.00 30.00  ? 282 TYR C C   2  
ATOM 10492  O O   . TYR A 1 278 ? -36.159  47.090  -37.938 1.00 30.00  ? 282 TYR C O   2  
ATOM 10493  C CB  . TYR A 1 278 ? -36.858  44.441  -36.253 1.00 99.99  ? 282 TYR C CB  2  
ATOM 10494  C CG  . TYR A 1 278 ? -35.781  45.251  -35.573 1.00 99.99  ? 282 TYR C CG  2  
ATOM 10495  C CD1 . TYR A 1 278 ? -34.468  44.767  -35.529 1.00 99.99  ? 282 TYR C CD1 2  
ATOM 10496  C CD2 . TYR A 1 278 ? -36.094  46.482  -34.990 1.00 99.99  ? 282 TYR C CD2 2  
ATOM 10497  C CE1 . TYR A 1 278 ? -33.467  45.519  -34.897 1.00 99.99  ? 282 TYR C CE1 2  
ATOM 10498  C CE2 . TYR A 1 278 ? -35.097  47.234  -34.358 1.00 99.99  ? 282 TYR C CE2 2  
ATOM 10499  C CZ  . TYR A 1 278 ? -33.783  46.752  -34.313 1.00 99.99  ? 282 TYR C CZ  2  
ATOM 10500  O OH  . TYR A 1 278 ? -32.810  47.481  -33.701 1.00 99.99  ? 282 TYR C OH  2  
ATOM 10501  N N   . HIS A 1 279 ? -38.369  46.793  -37.729 1.00 30.00  ? 283 HIS C N   2  
ATOM 10502  C CA  . HIS A 1 279 ? -38.670  48.222  -37.820 1.00 30.00  ? 283 HIS C CA  2  
ATOM 10503  C C   . HIS A 1 279 ? -37.944  49.159  -36.842 1.00 30.00  ? 283 HIS C C   2  
ATOM 10504  O O   . HIS A 1 279 ? -37.475  50.222  -37.273 1.00 30.00  ? 283 HIS C O   2  
ATOM 10505  C CB  . HIS A 1 279 ? -40.157  48.454  -37.572 1.00 99.99  ? 283 HIS C CB  2  
ATOM 10506  C CG  . HIS A 1 279 ? -41.083  47.685  -38.481 1.00 99.99  ? 283 HIS C CG  2  
ATOM 10507  N ND1 . HIS A 1 279 ? -41.526  48.204  -39.692 1.00 99.99  ? 283 HIS C ND1 2  
ATOM 10508  C CD2 . HIS A 1 279 ? -41.648  46.454  -38.358 1.00 99.99  ? 283 HIS C CD2 2  
ATOM 10509  C CE1 . HIS A 1 279 ? -42.317  47.310  -40.256 1.00 99.99  ? 283 HIS C CE1 2  
ATOM 10510  N NE2 . HIS A 1 279 ? -42.400  46.261  -39.476 1.00 99.99  ? 283 HIS C NE2 2  
ATOM 10511  N N   . ILE A 1 280 ? -37.858  48.784  -35.554 1.00 30.00  ? 284 ILE C N   2  
ATOM 10512  C CA  . ILE A 1 280 ? -37.192  49.614  -34.546 1.00 30.00  ? 284 ILE C CA  2  
ATOM 10513  C C   . ILE A 1 280 ? -35.861  50.192  -35.001 1.00 30.00  ? 284 ILE C C   2  
ATOM 10514  O O   . ILE A 1 280 ? -35.702  51.416  -35.130 1.00 30.00  ? 284 ILE C O   2  
ATOM 10515  C CB  . ILE A 1 280 ? -36.914  48.789  -33.294 1.00 99.99  ? 284 ILE C CB  2  
ATOM 10516  C CG1 . ILE A 1 280 ? -38.168  48.743  -32.430 1.00 99.99  ? 284 ILE C CG1 2  
ATOM 10517  C CG2 . ILE A 1 280 ? -35.779  49.430  -32.504 1.00 99.99  ? 284 ILE C CG2 2  
ATOM 10518  C CD1 . ILE A 1 280 ? -38.917  47.439  -32.688 1.00 99.99  ? 284 ILE C CD1 2  
ATOM 10519  N N   . PHE A 1 281 ? -34.901  49.302  -35.229 1.00 30.00  ? 285 PHE C N   2  
ATOM 10520  C CA  . PHE A 1 281 ? -33.567  49.699  -35.661 1.00 30.00  ? 285 PHE C CA  2  
ATOM 10521  C C   . PHE A 1 281 ? -33.564  50.916  -36.586 1.00 30.00  ? 285 PHE C C   2  
ATOM 10522  O O   . PHE A 1 281 ? -32.698  51.778  -36.481 1.00 30.00  ? 285 PHE C O   2  
ATOM 10523  C CB  . PHE A 1 281 ? -32.905  48.555  -36.419 1.00 99.99  ? 285 PHE C CB  2  
ATOM 10524  C CG  . PHE A 1 281 ? -31.523  48.974  -36.860 1.00 99.99  ? 285 PHE C CG  2  
ATOM 10525  C CD1 . PHE A 1 281 ? -30.445  48.882  -35.972 1.00 99.99  ? 285 PHE C CD1 2  
ATOM 10526  C CD2 . PHE A 1 281 ? -31.322  49.453  -38.161 1.00 99.99  ? 285 PHE C CD2 2  
ATOM 10527  C CE1 . PHE A 1 281 ? -29.166  49.270  -36.384 1.00 99.99  ? 285 PHE C CE1 2  
ATOM 10528  C CE2 . PHE A 1 281 ? -30.040  49.844  -38.570 1.00 99.99  ? 285 PHE C CE2 2  
ATOM 10529  C CZ  . PHE A 1 281 ? -28.963  49.751  -37.682 1.00 99.99  ? 285 PHE C CZ  2  
ATOM 10530  N N   . TYR A 1 282 ? -34.528  51.012  -37.486 1.00 30.00  ? 286 TYR C N   2  
ATOM 10531  C CA  . TYR A 1 282 ? -34.552  52.140  -38.402 1.00 30.00  ? 286 TYR C CA  2  
ATOM 10532  C C   . TYR A 1 282 ? -35.209  53.342  -37.776 1.00 30.00  ? 286 TYR C C   2  
ATOM 10533  O O   . TYR A 1 282 ? -34.917  54.480  -38.147 1.00 30.00  ? 286 TYR C O   2  
ATOM 10534  C CB  . TYR A 1 282 ? -35.328  51.770  -39.662 1.00 99.99  ? 286 TYR C CB  2  
ATOM 10535  C CG  . TYR A 1 282 ? -34.616  50.655  -40.384 1.00 99.99  ? 286 TYR C CG  2  
ATOM 10536  C CD1 . TYR A 1 282 ? -34.903  49.321  -40.072 1.00 99.99  ? 286 TYR C CD1 2  
ATOM 10537  C CD2 . TYR A 1 282 ? -33.667  50.953  -41.370 1.00 99.99  ? 286 TYR C CD2 2  
ATOM 10538  C CE1 . TYR A 1 282 ? -34.242  48.286  -40.741 1.00 99.99  ? 286 TYR C CE1 2  
ATOM 10539  C CE2 . TYR A 1 282 ? -33.005  49.918  -42.040 1.00 99.99  ? 286 TYR C CE2 2  
ATOM 10540  C CZ  . TYR A 1 282 ? -33.293  48.584  -41.728 1.00 99.99  ? 286 TYR C CZ  2  
ATOM 10541  O OH  . TYR A 1 282 ? -32.648  47.579  -42.381 1.00 99.99  ? 286 TYR C OH  2  
ATOM 10542  N N   . GLN A 1 283 ? -36.099  53.090  -36.823 1.00 30.00  ? 287 GLN C N   2  
ATOM 10543  C CA  . GLN A 1 283 ? -36.800  54.156  -36.121 1.00 30.00  ? 287 GLN C CA  2  
ATOM 10544  C C   . GLN A 1 283 ? -35.716  54.880  -35.297 1.00 30.00  ? 287 GLN C C   2  
ATOM 10545  O O   . GLN A 1 283 ? -35.547  56.109  -35.366 1.00 30.00  ? 287 GLN C O   2  
ATOM 10546  C CB  . GLN A 1 283 ? -37.880  53.565  -35.220 1.00 99.99  ? 287 GLN C CB  2  
ATOM 10547  C CG  . GLN A 1 283 ? -38.944  52.889  -36.078 1.00 99.99  ? 287 GLN C CG  2  
ATOM 10548  C CD  . GLN A 1 283 ? -39.792  53.918  -36.810 1.00 99.99  ? 287 GLN C CD  2  
ATOM 10549  O OE1 . GLN A 1 283 ? -39.578  55.119  -36.668 1.00 99.99  ? 287 GLN C OE1 2  
ATOM 10550  N NE2 . GLN A 1 283 ? -40.763  53.442  -37.595 1.00 99.99  ? 287 GLN C NE2 2  
ATOM 10551  N N   . ILE A 1 284 ? -34.983  54.081  -34.531 1.00 30.00  ? 288 ILE C N   2  
ATOM 10552  C CA  . ILE A 1 284 ? -33.891  54.531  -33.677 1.00 30.00  ? 288 ILE C CA  2  
ATOM 10553  C C   . ILE A 1 284 ? -32.814  55.439  -34.338 1.00 30.00  ? 288 ILE C C   2  
ATOM 10554  O O   . ILE A 1 284 ? -32.140  56.198  -33.646 1.00 30.00  ? 288 ILE C O   2  
ATOM 10555  C CB  . ILE A 1 284 ? -33.130  53.333  -33.127 1.00 99.99  ? 288 ILE C CB  2  
ATOM 10556  C CG1 . ILE A 1 284 ? -32.060  52.905  -34.126 1.00 99.99  ? 288 ILE C CG1 2  
ATOM 10557  C CG2 . ILE A 1 284 ? -34.099  52.179  -32.897 1.00 99.99  ? 288 ILE C CG2 2  
ATOM 10558  C CD1 . ILE A 1 284 ? -30.735  53.566  -33.765 1.00 99.99  ? 288 ILE C CD1 2  
ATOM 10559  N N   . CYS A 1 285 ? -32.641  55.368  -35.651 1.00 30.00  ? 289 CYS C N   2  
ATOM 10560  C CA  . CYS A 1 285 ? -31.636  56.189  -36.326 1.00 30.00  ? 289 CYS C CA  2  
ATOM 10561  C C   . CYS A 1 285 ? -32.237  57.246  -37.217 1.00 30.00  ? 289 CYS C C   2  
ATOM 10562  O O   . CYS A 1 285 ? -31.648  57.583  -38.253 1.00 30.00  ? 289 CYS C O   2  
ATOM 10563  C CB  . CYS A 1 285 ? -30.747  55.304  -37.195 1.00 99.99  ? 289 CYS C CB  2  
ATOM 10564  S SG  . CYS A 1 285 ? -31.555  54.509  -38.606 1.00 99.99  ? 289 CYS C SG  2  
ATOM 10565  N N   . SER A 1 286 ? -33.396  57.787  -36.840 1.00 30.00  ? 290 SER C N   2  
ATOM 10566  C CA  . SER A 1 286 ? -34.044  58.808  -37.674 1.00 30.00  ? 290 SER C CA  2  
ATOM 10567  C C   . SER A 1 286 ? -34.024  60.233  -37.157 1.00 30.00  ? 290 SER C C   2  
ATOM 10568  O O   . SER A 1 286 ? -34.072  61.167  -37.953 1.00 30.00  ? 290 SER C O   2  
ATOM 10569  C CB  . SER A 1 286 ? -35.516  58.464  -37.863 1.00 99.99  ? 290 SER C CB  2  
ATOM 10570  O OG  . SER A 1 286 ? -36.202  58.601  -36.616 1.00 99.99  ? 290 SER C OG  2  
ATOM 10571  N N   . ASN A 1 287 ? -33.977  60.375  -35.831 1.00 30.00  ? 291 ASN C N   2  
ATOM 10572  C CA  . ASN A 1 287 ? -33.954  61.664  -35.135 1.00 30.00  ? 291 ASN C CA  2  
ATOM 10573  C C   . ASN A 1 287 ? -35.348  62.165  -34.786 1.00 30.00  ? 291 ASN C C   2  
ATOM 10574  O O   . ASN A 1 287 ? -35.613  63.375  -34.797 1.00 30.00  ? 291 ASN C O   2  
ATOM 10575  C CB  . ASN A 1 287 ? -33.289  62.718  -36.014 1.00 99.99  ? 291 ASN C CB  2  
ATOM 10576  C CG  . ASN A 1 287 ? -32.677  63.830  -35.175 1.00 99.99  ? 291 ASN C CG  2  
ATOM 10577  O OD1 . ASN A 1 287 ? -32.510  64.951  -35.648 1.00 99.99  ? 291 ASN C OD1 2  
ATOM 10578  N ND2 . ASN A 1 287 ? -32.340  63.514  -33.921 1.00 99.99  ? 291 ASN C ND2 2  
ATOM 10579  N N   . ALA A 1 288 ? -36.232  61.227  -34.478 1.00 30.00  ? 292 ALA C N   2  
ATOM 10580  C CA  . ALA A 1 288 ? -37.596  61.562  -34.112 1.00 30.00  ? 292 ALA C CA  2  
ATOM 10581  C C   . ALA A 1 288 ? -37.519  62.187  -32.724 1.00 30.00  ? 292 ALA C C   2  
ATOM 10582  O O   . ALA A 1 288 ? -38.319  63.034  -32.349 1.00 30.00  ? 292 ALA C O   2  
ATOM 10583  C CB  . ALA A 1 288 ? -38.446  60.301  -34.077 1.00 30.00  ? 292 ALA C CB  2  
ATOM 10584  N N   . ILE A 1 289 ? -36.526  61.747  -31.965 1.00 30.00  ? 293 ILE C N   2  
ATOM 10585  C CA  . ILE A 1 289 ? -36.313  62.246  -30.621 1.00 30.00  ? 293 ILE C CA  2  
ATOM 10586  C C   . ILE A 1 289 ? -34.810  62.398  -30.454 1.00 30.00  ? 293 ILE C C   2  
ATOM 10587  O O   . ILE A 1 289 ? -34.139  61.496  -29.938 1.00 30.00  ? 293 ILE C O   2  
ATOM 10588  C CB  . ILE A 1 289 ? -36.874  61.258  -29.605 1.00 99.99  ? 293 ILE C CB  2  
ATOM 10589  C CG1 . ILE A 1 289 ? -35.869  60.137  -29.375 1.00 99.99  ? 293 ILE C CG1 2  
ATOM 10590  C CG2 . ILE A 1 289 ? -38.178  60.668  -30.136 1.00 99.99  ? 293 ILE C CG2 2  
ATOM 10591  C CD1 . ILE A 1 289 ? -36.175  58.974  -30.315 1.00 99.99  ? 293 ILE C CD1 2  
ATOM 10592  N N   . PRO A 1 290 ? -34.265  63.536  -30.905 1.00 30.00  ? 294 PRO C N   2  
ATOM 10593  C CA  . PRO A 1 290 ? -32.831  63.840  -30.819 1.00 30.00  ? 294 PRO C CA  2  
ATOM 10594  C C   . PRO A 1 290 ? -32.308  63.639  -29.404 1.00 30.00  ? 294 PRO C C   2  
ATOM 10595  O O   . PRO A 1 290 ? -31.202  63.149  -29.205 1.00 30.00  ? 294 PRO C O   2  
ATOM 10596  C CB  . PRO A 1 290 ? -32.893  65.274  -31.211 1.00 99.99  ? 294 PRO C CB  2  
ATOM 10597  C CG  . PRO A 1 290 ? -34.345  65.564  -31.516 1.00 99.99  ? 294 PRO C CG  2  
ATOM 10598  C CD  . PRO A 1 290 ? -35.108  64.549  -31.385 1.00 99.99  ? 294 PRO C CD  2  
ATOM 10599  N N   . GLU A 1 291 ? -33.115  64.015  -28.416 1.00 30.00  ? 295 GLU C N   2  
ATOM 10600  C CA  . GLU A 1 291 ? -32.742  63.870  -27.020 1.00 30.00  ? 295 GLU C CA  2  
ATOM 10601  C C   . GLU A 1 291 ? -32.178  62.475  -26.726 1.00 30.00  ? 295 GLU C C   2  
ATOM 10602  O O   . GLU A 1 291 ? -31.236  62.321  -25.950 1.00 30.00  ? 295 GLU C O   2  
ATOM 10603  C CB  . GLU A 1 291 ? -33.964  64.085  -26.133 1.00 99.99  ? 295 GLU C CB  2  
ATOM 10604  C CG  . GLU A 1 291 ? -34.442  65.512  -26.272 1.00 99.99  ? 295 GLU C CG  2  
ATOM 10605  C CD  . GLU A 1 291 ? -33.460  66.448  -25.573 1.00 99.99  ? 295 GLU C CD  2  
ATOM 10606  O OE1 . GLU A 1 291 ? -32.508  66.903  -26.262 1.00 99.99  ? 295 GLU C OE1 2  
ATOM 10607  O OE2 . GLU A 1 291 ? -33.670  66.700  -24.357 1.00 99.99  ? 295 GLU C OE2 2  
ATOM 10608  N N   . LEU A 1 292 ? -32.750  61.460  -27.360 1.00 30.00  ? 296 LEU C N   2  
ATOM 10609  C CA  . LEU A 1 292 ? -32.323  60.069  -27.168 1.00 30.00  ? 296 LEU C CA  2  
ATOM 10610  C C   . LEU A 1 292 ? -31.010  59.635  -27.827 1.00 30.00  ? 296 LEU C C   2  
ATOM 10611  O O   . LEU A 1 292 ? -30.395  58.641  -27.411 1.00 30.00  ? 296 LEU C O   2  
ATOM 10612  C CB  . LEU A 1 292 ? -33.381  59.121  -27.725 1.00 99.99  ? 296 LEU C CB  2  
ATOM 10613  C CG  . LEU A 1 292 ? -34.321  58.689  -26.604 1.00 99.99  ? 296 LEU C CG  2  
ATOM 10614  C CD1 . LEU A 1 292 ? -35.160  57.506  -27.073 1.00 99.99  ? 296 LEU C CD1 2  
ATOM 10615  C CD2 . LEU A 1 292 ? -33.502  58.283  -25.383 1.00 99.99  ? 296 LEU C CD2 2  
ATOM 10616  N N   . ASN A 1 293 ? -30.581  60.366  -28.852 1.00 30.00  ? 297 ASN C N   2  
ATOM 10617  C CA  . ASN A 1 293 ? -29.346  60.028  -29.545 1.00 30.00  ? 297 ASN C CA  2  
ATOM 10618  C C   . ASN A 1 293 ? -28.190  59.736  -28.597 1.00 30.00  ? 297 ASN C C   2  
ATOM 10619  O O   . ASN A 1 293 ? -27.478  58.738  -28.759 1.00 30.00  ? 297 ASN C O   2  
ATOM 10620  C CB  . ASN A 1 293 ? -28.921  61.185  -30.441 1.00 99.99  ? 297 ASN C CB  2  
ATOM 10621  C CG  . ASN A 1 293 ? -28.638  62.438  -29.625 1.00 99.99  ? 297 ASN C CG  2  
ATOM 10622  O OD1 . ASN A 1 293 ? -28.060  63.397  -30.132 1.00 99.99  ? 297 ASN C OD1 2  
ATOM 10623  N ND2 . ASN A 1 293 ? -29.050  62.427  -28.355 1.00 99.99  ? 297 ASN C ND2 2  
ATOM 10624  N N   . ASP A 1 294 ? -28.001  60.591  -27.598 1.00 30.00  ? 298 ASP C N   2  
ATOM 10625  C CA  . ASP A 1 294 ? -26.917  60.393  -26.646 1.00 30.00  ? 298 ASP C CA  2  
ATOM 10626  C C   . ASP A 1 294 ? -27.196  59.307  -25.611 1.00 30.00  ? 298 ASP C C   2  
ATOM 10627  O O   . ASP A 1 294 ? -26.272  58.784  -24.990 1.00 30.00  ? 298 ASP C O   2  
ATOM 10628  C CB  . ASP A 1 294 ? -26.658  61.685  -25.880 1.00 99.99  ? 298 ASP C CB  2  
ATOM 10629  C CG  . ASP A 1 294 ? -27.895  62.055  -25.067 1.00 99.99  ? 298 ASP C CG  2  
ATOM 10630  O OD1 . ASP A 1 294 ? -28.833  62.636  -25.678 1.00 99.99  ? 298 ASP C OD1 2  
ATOM 10631  O OD2 . ASP A 1 294 ? -27.899  61.751  -23.844 1.00 99.99  ? 298 ASP C OD2 2  
ATOM 10632  N N   . VAL A 1 295 ? -28.468  58.963  -25.431 1.00 30.00  ? 299 VAL C N   2  
ATOM 10633  C CA  . VAL A 1 295 ? -28.837  57.924  -24.474 1.00 30.00  ? 299 VAL C CA  2  
ATOM 10634  C C   . VAL A 1 295 ? -28.499  56.555  -25.036 1.00 30.00  ? 299 VAL C C   2  
ATOM 10635  O O   . VAL A 1 295 ? -28.134  55.631  -24.303 1.00 30.00  ? 299 VAL C O   2  
ATOM 10636  C CB  . VAL A 1 295 ? -30.336  57.988  -24.192 1.00 99.99  ? 299 VAL C CB  2  
ATOM 10637  C CG1 . VAL A 1 295 ? -30.685  59.355  -23.612 1.00 99.99  ? 299 VAL C CG1 2  
ATOM 10638  C CG2 . VAL A 1 295 ? -31.107  57.775  -25.491 1.00 99.99  ? 299 VAL C CG2 2  
ATOM 10639  N N   . MET A 1 296 ? -28.621  56.437  -26.351 1.00 30.00  ? 300 MET C N   2  
ATOM 10640  C CA  . MET A 1 296 ? -28.337  55.190  -27.037 1.00 30.00  ? 300 MET C CA  2  
ATOM 10641  C C   . MET A 1 296 ? -26.928  55.183  -27.630 1.00 30.00  ? 300 MET C C   2  
ATOM 10642  O O   . MET A 1 296 ? -26.373  54.116  -27.928 1.00 30.00  ? 300 MET C O   2  
ATOM 10643  C CB  . MET A 1 296 ? -29.333  54.986  -28.174 1.00 99.99  ? 300 MET C CB  2  
ATOM 10644  C CG  . MET A 1 296 ? -30.749  54.939  -27.610 1.00 99.99  ? 300 MET C CG  2  
ATOM 10645  S SD  . MET A 1 296 ? -31.836  54.027  -28.736 1.00 99.99  ? 300 MET C SD  2  
ATOM 10646  C CE  . MET A 1 296 ? -31.727  55.070  -30.176 1.00 99.99  ? 300 MET C CE  2  
ATOM 10647  N N   . LEU A 1 297 ? -26.350  56.372  -27.793 1.00 30.00  ? 301 LEU C N   2  
ATOM 10648  C CA  . LEU A 1 297 ? -25.006  56.518  -28.347 1.00 30.00  ? 301 LEU C CA  2  
ATOM 10649  C C   . LEU A 1 297 ? -25.029  56.215  -29.835 1.00 30.00  ? 301 LEU C C   2  
ATOM 10650  O O   . LEU A 1 297 ? -24.093  55.631  -30.382 1.00 30.00  ? 301 LEU C O   2  
ATOM 10651  C CB  . LEU A 1 297 ? -24.053  55.551  -27.652 1.00 99.99  ? 301 LEU C CB  2  
ATOM 10652  C CG  . LEU A 1 297 ? -23.350  56.265  -26.504 1.00 99.99  ? 301 LEU C CG  2  
ATOM 10653  C CD1 . LEU A 1 297 ? -22.174  55.420  -26.024 1.00 99.99  ? 301 LEU C CD1 2  
ATOM 10654  C CD2 . LEU A 1 297 ? -22.843  57.622  -26.981 1.00 99.99  ? 301 LEU C CD2 2  
ATOM 10655  N N   . VAL A 1 298 ? -26.101  56.628  -30.500 1.00 30.00  ? 302 VAL C N   2  
ATOM 10656  C CA  . VAL A 1 298 ? -26.213  56.375  -31.921 1.00 30.00  ? 302 VAL C CA  2  
ATOM 10657  C C   . VAL A 1 298 ? -26.134  57.608  -32.782 1.00 30.00  ? 302 VAL C C   2  
ATOM 10658  O O   . VAL A 1 298 ? -26.588  58.681  -32.401 1.00 30.00  ? 302 VAL C O   2  
ATOM 10659  C CB  . VAL A 1 298 ? -27.551  55.711  -32.226 1.00 99.99  ? 302 VAL C CB  2  
ATOM 10660  C CG1 . VAL A 1 298 ? -27.649  54.390  -31.469 1.00 99.99  ? 302 VAL C CG1 2  
ATOM 10661  C CG2 . VAL A 1 298 ? -28.686  56.632  -31.787 1.00 99.99  ? 302 VAL C CG2 2  
ATOM 10662  N N   . THR A 1 299 ? -25.537  57.437  -33.952 1.00 30.00  ? 303 THR C N   2  
ATOM 10663  C CA  . THR A 1 299 ? -25.411  58.509  -34.920 1.00 30.00  ? 303 THR C CA  2  
ATOM 10664  C C   . THR A 1 299 ? -26.627  58.230  -35.798 1.00 30.00  ? 303 THR C C   2  
ATOM 10665  O O   . THR A 1 299 ? -26.779  57.130  -36.326 1.00 30.00  ? 303 THR C O   2  
ATOM 10666  C CB  . THR A 1 299 ? -24.080  58.389  -35.655 1.00 99.99  ? 303 THR C CB  2  
ATOM 10667  O OG1 . THR A 1 299 ? -24.098  57.221  -36.482 1.00 99.99  ? 303 THR C OG1 2  
ATOM 10668  C CG2 . THR A 1 299 ? -22.947  58.274  -34.642 1.00 99.99  ? 303 THR C CG2 2  
ATOM 10669  N N   . PRO A 1 300 ? -27.523  59.217  -35.949 1.00 30.00  ? 304 PRO C N   2  
ATOM 10670  C CA  . PRO A 1 300 ? -28.727  59.028  -36.773 1.00 30.00  ? 304 PRO C CA  2  
ATOM 10671  C C   . PRO A 1 300 ? -28.539  58.656  -38.245 1.00 30.00  ? 304 PRO C C   2  
ATOM 10672  O O   . PRO A 1 300 ? -29.029  59.357  -39.133 1.00 30.00  ? 304 PRO C O   2  
ATOM 10673  C CB  . PRO A 1 300 ? -29.289  60.398  -36.650 1.00 99.99  ? 304 PRO C CB  2  
ATOM 10674  C CG  . PRO A 1 300 ? -28.358  61.154  -35.733 1.00 99.99  ? 304 PRO C CG  2  
ATOM 10675  C CD  . PRO A 1 300 ? -27.381  60.451  -35.302 1.00 99.99  ? 304 PRO C CD  2  
ATOM 10676  N N   . ASP A 1 301 ? -27.838  57.548  -38.486 1.00 30.00  ? 305 ASP C N   2  
ATOM 10677  C CA  . ASP A 1 301 ? -27.575  57.031  -39.836 1.00 30.00  ? 305 ASP C CA  2  
ATOM 10678  C C   . ASP A 1 301 ? -27.717  55.513  -39.756 1.00 30.00  ? 305 ASP C C   2  
ATOM 10679  O O   . ASP A 1 301 ? -26.930  54.857  -39.071 1.00 30.00  ? 305 ASP C O   2  
ATOM 10680  C CB  . ASP A 1 301 ? -26.169  57.421  -40.277 1.00 99.99  ? 305 ASP C CB  2  
ATOM 10681  C CG  . ASP A 1 301 ? -25.989  57.104  -41.759 1.00 99.99  ? 305 ASP C CG  2  
ATOM 10682  O OD1 . ASP A 1 301 ? -25.747  55.905  -42.066 1.00 99.99  ? 305 ASP C OD1 2  
ATOM 10683  O OD2 . ASP A 1 301 ? -26.103  58.061  -42.572 1.00 99.99  ? 305 ASP C OD2 2  
ATOM 10684  N N   . SER A 1 302 ? -28.715  54.955  -40.436 1.00 30.00  ? 306 SER C N   2  
ATOM 10685  C CA  . SER A 1 302 ? -28.891  53.506  -40.391 1.00 30.00  ? 306 SER C CA  2  
ATOM 10686  C C   . SER A 1 302 ? -27.862  52.800  -41.285 1.00 30.00  ? 306 SER C C   2  
ATOM 10687  O O   . SER A 1 302 ? -27.321  51.750  -40.912 1.00 30.00  ? 306 SER C O   2  
ATOM 10688  C CB  . SER A 1 302 ? -30.291  53.141  -40.877 1.00 99.99  ? 306 SER C CB  2  
ATOM 10689  O OG  . SER A 1 302 ? -30.400  53.429  -42.272 1.00 99.99  ? 306 SER C OG  2  
ATOM 10690  N N   . GLY A 1 303 ? -27.587  53.399  -42.449 1.00 30.00  ? 307 GLY C N   2  
ATOM 10691  C CA  . GLY A 1 303 ? -26.631  52.833  -43.393 1.00 30.00  ? 307 GLY C CA  2  
ATOM 10692  C C   . GLY A 1 303 ? -25.206  52.829  -42.883 1.00 30.00  ? 307 GLY C C   2  
ATOM 10693  O O   . GLY A 1 303 ? -24.244  52.648  -43.630 1.00 30.00  ? 307 GLY C O   2  
ATOM 10694  N N   . LEU A 1 304 ? -25.099  53.020  -41.579 1.00 30.00  ? 308 LEU C N   2  
ATOM 10695  C CA  . LEU A 1 304 ? -23.835  53.069  -40.875 1.00 30.00  ? 308 LEU C CA  2  
ATOM 10696  C C   . LEU A 1 304 ? -23.587  51.772  -40.130 1.00 30.00  ? 308 LEU C C   2  
ATOM 10697  O O   . LEU A 1 304 ? -22.441  51.393  -39.891 1.00 30.00  ? 308 LEU C O   2  
ATOM 10698  C CB  . LEU A 1 304 ? -23.845  54.216  -39.871 1.00 99.99  ? 308 LEU C CB  2  
ATOM 10699  C CG  . LEU A 1 304 ? -23.216  55.452  -40.506 1.00 99.99  ? 308 LEU C CG  2  
ATOM 10700  C CD1 . LEU A 1 304 ? -22.926  56.486  -39.420 1.00 99.99  ? 308 LEU C CD1 2  
ATOM 10701  C CD2 . LEU A 1 304 ? -21.919  55.063  -41.201 1.00 99.99  ? 308 LEU C CD2 2  
ATOM 10702  N N   . TYR A 1 305 ? -24.669  51.093  -39.765 1.00 30.00  ? 309 TYR C N   2  
ATOM 10703  C CA  . TYR A 1 305 ? -24.561  49.848  -39.026 1.00 30.00  ? 309 TYR C CA  2  
ATOM 10704  C C   . TYR A 1 305 ? -24.778  48.632  -39.889 1.00 30.00  ? 309 TYR C C   2  
ATOM 10705  O O   . TYR A 1 305 ? -25.842  48.450  -40.471 1.00 30.00  ? 309 TYR C O   2  
ATOM 10706  C CB  . TYR A 1 305 ? -25.606  49.812  -37.914 1.00 99.99  ? 309 TYR C CB  2  
ATOM 10707  C CG  . TYR A 1 305 ? -25.326  50.917  -36.924 1.00 99.99  ? 309 TYR C CG  2  
ATOM 10708  C CD1 . TYR A 1 305 ? -25.880  52.189  -37.116 1.00 99.99  ? 309 TYR C CD1 2  
ATOM 10709  C CD2 . TYR A 1 305 ? -24.510  50.669  -35.813 1.00 99.99  ? 309 TYR C CD2 2  
ATOM 10710  C CE1 . TYR A 1 305 ? -25.618  53.212  -36.198 1.00 99.99  ? 309 TYR C CE1 2  
ATOM 10711  C CE2 . TYR A 1 305 ? -24.249  51.692  -34.895 1.00 99.99  ? 309 TYR C CE2 2  
ATOM 10712  C CZ  . TYR A 1 305 ? -24.805  52.963  -35.085 1.00 99.99  ? 309 TYR C CZ  2  
ATOM 10713  O OH  . TYR A 1 305 ? -24.550  53.959  -34.193 1.00 99.99  ? 309 TYR C OH  2  
ATOM 10714  N N   . SER A 1 306 ? -23.741  47.802  -39.962 1.00 30.00  ? 310 SER C N   2  
ATOM 10715  C CA  . SER A 1 306 ? -23.765  46.580  -40.758 1.00 30.00  ? 310 SER C CA  2  
ATOM 10716  C C   . SER A 1 306 ? -25.011  45.750  -40.487 1.00 30.00  ? 310 SER C C   2  
ATOM 10717  O O   . SER A 1 306 ? -25.767  45.458  -41.411 1.00 30.00  ? 310 SER C O   2  
ATOM 10718  C CB  . SER A 1 306 ? -22.546  45.726  -40.429 1.00 99.99  ? 310 SER C CB  2  
ATOM 10719  O OG  . SER A 1 306 ? -22.657  45.230  -39.093 1.00 99.99  ? 310 SER C OG  2  
ATOM 10720  N N   . PHE A 1 307 ? -25.228  45.379  -39.229 1.00 30.00  ? 311 PHE C N   2  
ATOM 10721  C CA  . PHE A 1 307 ? -26.399  44.583  -38.847 1.00 30.00  ? 311 PHE C CA  2  
ATOM 10722  C C   . PHE A 1 307 ? -27.757  45.048  -39.370 1.00 30.00  ? 311 PHE C C   2  
ATOM 10723  O O   . PHE A 1 307 ? -28.730  44.308  -39.228 1.00 30.00  ? 311 PHE C O   2  
ATOM 10724  C CB  . PHE A 1 307 ? -26.536  44.557  -37.328 1.00 99.99  ? 311 PHE C CB  2  
ATOM 10725  C CG  . PHE A 1 307 ? -27.752  45.354  -36.920 1.00 99.99  ? 311 PHE C CG  2  
ATOM 10726  C CD1 . PHE A 1 307 ? -28.217  46.390  -37.739 1.00 99.99  ? 311 PHE C CD1 2  
ATOM 10727  C CD2 . PHE A 1 307 ? -28.413  45.058  -35.724 1.00 99.99  ? 311 PHE C CD2 2  
ATOM 10728  C CE1 . PHE A 1 307 ? -29.344  47.129  -37.362 1.00 99.99  ? 311 PHE C CE1 2  
ATOM 10729  C CE2 . PHE A 1 307 ? -29.540  45.794  -35.345 1.00 99.99  ? 311 PHE C CE2 2  
ATOM 10730  C CZ  . PHE A 1 307 ? -30.005  46.832  -36.164 1.00 99.99  ? 311 PHE C CZ  2  
ATOM 10731  N N   . ILE A 1 308 ? -27.850  46.240  -39.955 1.00 30.00  ? 312 ILE C N   2  
ATOM 10732  C CA  . ILE A 1 308 ? -29.131  46.727  -40.461 1.00 30.00  ? 312 ILE C CA  2  
ATOM 10733  C C   . ILE A 1 308 ? -29.090  47.449  -41.805 1.00 30.00  ? 312 ILE C C   2  
ATOM 10734  O O   . ILE A 1 308 ? -30.058  48.113  -42.196 1.00 30.00  ? 312 ILE C O   2  
ATOM 10735  C CB  . ILE A 1 308 ? -29.735  47.718  -39.472 1.00 99.99  ? 312 ILE C CB  2  
ATOM 10736  C CG1 . ILE A 1 308 ? -30.952  48.387  -40.103 1.00 99.99  ? 312 ILE C CG1 2  
ATOM 10737  C CG2 . ILE A 1 308 ? -28.697  48.780  -39.118 1.00 99.99  ? 312 ILE C CG2 2  
ATOM 10738  C CD1 . ILE A 1 308 ? -31.788  47.341  -40.833 1.00 99.99  ? 312 ILE C CD1 2  
ATOM 10739  N N   . ASN A 1 309 ? -27.976  47.347  -42.528 1.00 30.00  ? 313 ASN C N   2  
ATOM 10740  C CA  . ASN A 1 309 ? -27.923  48.010  -43.827 1.00 30.00  ? 313 ASN C CA  2  
ATOM 10741  C C   . ASN A 1 309 ? -27.594  47.017  -44.939 1.00 30.00  ? 313 ASN C C   2  
ATOM 10742  O O   . ASN A 1 309 ? -27.305  47.425  -46.066 1.00 30.00  ? 313 ASN C O   2  
ATOM 10743  C CB  . ASN A 1 309 ? -26.847  49.091  -43.812 1.00 99.99  ? 313 ASN C CB  2  
ATOM 10744  C CG  . ASN A 1 309 ? -25.472  48.495  -43.562 1.00 99.99  ? 313 ASN C CG  2  
ATOM 10745  O OD1 . ASN A 1 309 ? -24.458  49.166  -43.752 1.00 99.99  ? 313 ASN C OD1 2  
ATOM 10746  N ND2 . ASN A 1 309 ? -25.437  47.230  -43.140 1.00 99.99  ? 313 ASN C ND2 2  
ATOM 10747  N N   . GLN A 1 310 ? -27.653  45.719  -44.614 1.00 30.00  ? 314 GLN C N   2  
ATOM 10748  C CA  . GLN A 1 310 ? -27.388  44.629  -45.564 1.00 30.00  ? 314 GLN C CA  2  
ATOM 10749  C C   . GLN A 1 310 ? -28.334  44.755  -46.758 1.00 30.00  ? 314 GLN C C   2  
ATOM 10750  O O   . GLN A 1 310 ? -27.921  44.945  -47.905 1.00 30.00  ? 314 GLN C O   2  
ATOM 10751  C CB  . GLN A 1 310 ? -27.606  43.281  -44.885 1.00 99.99  ? 314 GLN C CB  2  
ATOM 10752  C CG  . GLN A 1 310 ? -29.028  43.212  -44.336 1.00 99.99  ? 314 GLN C CG  2  
ATOM 10753  C CD  . GLN A 1 310 ? -29.150  43.998  -43.035 1.00 99.99  ? 314 GLN C CD  2  
ATOM 10754  O OE1 . GLN A 1 310 ? -28.176  44.580  -42.565 1.00 99.99  ? 314 GLN C OE1 2  
ATOM 10755  N NE2 . GLN A 1 310 ? -30.354  44.011  -42.458 1.00 99.99  ? 314 GLN C NE2 2  
ATOM 10756  N N   . GLY A 1 311 ? -29.622  44.645  -46.478 1.00 30.00  ? 315 GLY C N   2  
ATOM 10757  C CA  . GLY A 1 311 ? -30.598  44.755  -47.536 1.00 30.00  ? 315 GLY C CA  2  
ATOM 10758  C C   . GLY A 1 311 ? -31.017  46.194  -47.760 1.00 30.00  ? 315 GLY C C   2  
ATOM 10759  O O   . GLY A 1 311 ? -30.261  47.009  -48.244 1.00 30.00  ? 315 GLY C O   2  
ATOM 10760  N N   . CYS A 1 312 ? -32.254  46.491  -47.389 1.00 30.00  ? 316 CYS C N   2  
ATOM 10761  C CA  . CYS A 1 312 ? -32.833  47.818  -47.540 1.00 30.00  ? 316 CYS C CA  2  
ATOM 10762  C C   . CYS A 1 312 ? -32.618  48.774  -46.347 1.00 30.00  ? 316 CYS C C   2  
ATOM 10763  O O   . CYS A 1 312 ? -32.253  48.360  -45.237 1.00 30.00  ? 316 CYS C O   2  
ATOM 10764  C CB  . CYS A 1 312 ? -34.343  47.709  -47.730 1.00 99.99  ? 316 CYS C CB  2  
ATOM 10765  S SG  . CYS A 1 312 ? -35.221  49.258  -48.046 1.00 99.99  ? 316 CYS C SG  2  
ATOM 10766  N N   . LEU A 1 313 ? -32.864  50.052  -46.596 1.00 30.00  ? 317 LEU C N   2  
ATOM 10767  C CA  . LEU A 1 313 ? -32.706  51.075  -45.581 1.00 30.00  ? 317 LEU C CA  2  
ATOM 10768  C C   . LEU A 1 313 ? -34.020  51.804  -45.333 1.00 30.00  ? 317 LEU C C   2  
ATOM 10769  O O   . LEU A 1 313 ? -34.511  51.836  -44.206 1.00 30.00  ? 317 LEU C O   2  
ATOM 10770  C CB  . LEU A 1 313 ? -31.665  52.095  -46.031 1.00 99.99  ? 317 LEU C CB  2  
ATOM 10771  C CG  . LEU A 1 313 ? -30.302  51.719  -45.459 1.00 99.99  ? 317 LEU C CG  2  
ATOM 10772  C CD1 . LEU A 1 313 ? -29.339  52.891  -45.625 1.00 99.99  ? 317 LEU C CD1 2  
ATOM 10773  C CD2 . LEU A 1 313 ? -30.447  51.380  -43.978 1.00 99.99  ? 317 LEU C CD2 2  
ATOM 10774  N N   . THR A 1 314 ? -34.576  52.382  -46.389 1.00 30.00  ? 318 THR C N   2  
ATOM 10775  C CA  . THR A 1 314 ? -35.847  53.106  -46.298 1.00 30.00  ? 318 THR C CA  2  
ATOM 10776  C C   . THR A 1 314 ? -37.022  52.176  -46.682 1.00 30.00  ? 318 THR C C   2  
ATOM 10777  O O   . THR A 1 314 ? -36.805  51.021  -47.044 1.00 30.00  ? 318 THR C O   2  
ATOM 10778  C CB  . THR A 1 314 ? -35.832  54.302  -47.248 1.00 99.99  ? 318 THR C CB  2  
ATOM 10779  O OG1 . THR A 1 314 ? -35.832  53.836  -48.599 1.00 99.99  ? 318 THR C OG1 2  
ATOM 10780  C CG2 . THR A 1 314 ? -34.579  55.132  -46.996 1.00 99.99  ? 318 THR C CG2 2  
ATOM 10781  N N   . VAL A 1 315 ? -38.256  52.662  -46.600 1.00 30.00  ? 319 VAL C N   2  
ATOM 10782  C CA  . VAL A 1 315 ? -39.410  51.822  -46.950 1.00 30.00  ? 319 VAL C CA  2  
ATOM 10783  C C   . VAL A 1 315 ? -40.614  52.589  -47.487 1.00 30.00  ? 319 VAL C C   2  
ATOM 10784  O O   . VAL A 1 315 ? -41.421  53.101  -46.723 1.00 30.00  ? 319 VAL C O   2  
ATOM 10785  C CB  . VAL A 1 315 ? -39.890  51.058  -45.720 1.00 99.99  ? 319 VAL C CB  2  
ATOM 10786  C CG1 . VAL A 1 315 ? -38.765  50.171  -45.201 1.00 99.99  ? 319 VAL C CG1 2  
ATOM 10787  C CG2 . VAL A 1 315 ? -40.301  52.047  -44.637 1.00 99.99  ? 319 VAL C CG2 2  
ATOM 10788  N N   . ASP A 1 316 ? -40.738  52.657  -48.806 1.00 30.00  ? 320 ASP C N   2  
ATOM 10789  C CA  . ASP A 1 316 ? -41.853  53.359  -49.425 1.00 30.00  ? 320 ASP C CA  2  
ATOM 10790  C C   . ASP A 1 316 ? -43.096  53.249  -48.537 1.00 30.00  ? 320 ASP C C   2  
ATOM 10791  O O   . ASP A 1 316 ? -43.612  52.160  -48.309 1.00 30.00  ? 320 ASP C O   2  
ATOM 10792  C CB  . ASP A 1 316 ? -42.159  52.745  -50.786 1.00 99.99  ? 320 ASP C CB  2  
ATOM 10793  C CG  . ASP A 1 316 ? -42.231  51.227  -50.658 1.00 99.99  ? 320 ASP C CG  2  
ATOM 10794  O OD1 . ASP A 1 316 ? -41.225  50.643  -50.175 1.00 99.99  ? 320 ASP C OD1 2  
ATOM 10795  O OD2 . ASP A 1 316 ? -43.290  50.664  -51.044 1.00 99.99  ? 320 ASP C OD2 2  
ATOM 10796  N N   . ASN A 1 317 ? -43.540  54.386  -48.017 1.00 30.00  ? 321 ASN C N   2  
ATOM 10797  C CA  . ASN A 1 317 ? -44.722  54.454  -47.161 1.00 30.00  ? 321 ASN C CA  2  
ATOM 10798  C C   . ASN A 1 317 ? -44.627  54.075  -45.685 1.00 30.00  ? 321 ASN C C   2  
ATOM 10799  O O   . ASN A 1 317 ? -45.597  53.615  -45.090 1.00 30.00  ? 321 ASN C O   2  
ATOM 10800  C CB  . ASN A 1 317 ? -45.806  53.526  -47.699 1.00 99.99  ? 321 ASN C CB  2  
ATOM 10801  C CG  . ASN A 1 317 ? -47.190  53.999  -47.283 1.00 99.99  ? 321 ASN C CG  2  
ATOM 10802  O OD1 . ASN A 1 317 ? -48.126  53.206  -47.206 1.00 99.99  ? 321 ASN C OD1 2  
ATOM 10803  N ND2 . ASN A 1 317 ? -47.322  55.300  -47.013 1.00 99.99  ? 321 ASN C ND2 2  
ATOM 10804  N N   . ILE A 1 318 ? -43.455  54.281  -45.106 1.00 30.00  ? 322 ILE C N   2  
ATOM 10805  C CA  . ILE A 1 318 ? -43.217  54.006  -43.697 1.00 30.00  ? 322 ILE C CA  2  
ATOM 10806  C C   . ILE A 1 318 ? -42.302  55.141  -43.286 1.00 30.00  ? 322 ILE C C   2  
ATOM 10807  O O   . ILE A 1 318 ? -41.164  55.210  -43.744 1.00 30.00  ? 322 ILE C O   2  
ATOM 10808  C CB  . ILE A 1 318 ? -42.562  52.638  -43.540 1.00 99.99  ? 322 ILE C CB  2  
ATOM 10809  C CG1 . ILE A 1 318 ? -43.335  51.608  -44.354 1.00 99.99  ? 322 ILE C CG1 2  
ATOM 10810  C CG2 . ILE A 1 318 ? -42.573  52.239  -42.068 1.00 99.99  ? 322 ILE C CG2 2  
ATOM 10811  C CD1 . ILE A 1 318 ? -44.678  51.333  -43.684 1.00 99.99  ? 322 ILE C CD1 2  
ATOM 10812  N N   . ASP A 1 319 ? -42.810  56.036  -42.445 1.00 30.00  ? 323 ASP C N   2  
ATOM 10813  C CA  . ASP A 1 319 ? -42.027  57.167  -41.970 1.00 30.00  ? 323 ASP C CA  2  
ATOM 10814  C C   . ASP A 1 319 ? -41.423  56.740  -40.633 1.00 30.00  ? 323 ASP C C   2  
ATOM 10815  O O   . ASP A 1 319 ? -42.108  56.765  -39.611 1.00 30.00  ? 323 ASP C O   2  
ATOM 10816  C CB  . ASP A 1 319 ? -42.928  58.387  -41.794 1.00 99.99  ? 323 ASP C CB  2  
ATOM 10817  C CG  . ASP A 1 319 ? -42.073  59.623  -41.539 1.00 99.99  ? 323 ASP C CG  2  
ATOM 10818  O OD1 . ASP A 1 319 ? -41.636  59.787  -40.368 1.00 99.99  ? 323 ASP C OD1 2  
ATOM 10819  O OD2 . ASP A 1 319 ? -41.862  60.391  -42.516 1.00 99.99  ? 323 ASP C OD2 2  
ATOM 10820  N N   . ASP A 1 320 ? -40.150  56.350  -40.646 1.00 30.00  ? 324 ASP C N   2  
ATOM 10821  C CA  . ASP A 1 320 ? -39.475  55.912  -39.431 1.00 30.00  ? 324 ASP C CA  2  
ATOM 10822  C C   . ASP A 1 320 ? -39.433  56.970  -38.316 1.00 30.00  ? 324 ASP C C   2  
ATOM 10823  O O   . ASP A 1 320 ? -39.375  56.637  -37.122 1.00 30.00  ? 324 ASP C O   2  
ATOM 10824  C CB  . ASP A 1 320 ? -38.027  55.546  -39.748 1.00 99.99  ? 324 ASP C CB  2  
ATOM 10825  C CG  . ASP A 1 320 ? -37.995  54.291  -40.616 1.00 99.99  ? 324 ASP C CG  2  
ATOM 10826  O OD1 . ASP A 1 320 ? -38.296  53.199  -40.062 1.00 99.99  ? 324 ASP C OD1 2  
ATOM 10827  O OD2 . ASP A 1 320 ? -37.677  54.435  -41.827 1.00 99.99  ? 324 ASP C OD2 2  
ATOM 10828  N N   . VAL A 1 321 ? -39.464  58.240  -38.717 1.00 30.00  ? 325 VAL C N   2  
ATOM 10829  C CA  . VAL A 1 321 ? -39.448  59.378  -37.802 1.00 30.00  ? 325 VAL C CA  2  
ATOM 10830  C C   . VAL A 1 321 ? -40.714  59.307  -36.938 1.00 30.00  ? 325 VAL C C   2  
ATOM 10831  O O   . VAL A 1 321 ? -40.665  59.129  -35.711 1.00 30.00  ? 325 VAL C O   2  
ATOM 10832  C CB  . VAL A 1 321 ? -39.426  60.681  -38.593 1.00 99.99  ? 325 VAL C CB  2  
ATOM 10833  C CG1 . VAL A 1 321 ? -39.460  61.864  -37.629 1.00 99.99  ? 325 VAL C CG1 2  
ATOM 10834  C CG2 . VAL A 1 321 ? -38.155  60.747  -39.433 1.00 99.99  ? 325 VAL C CG2 2  
ATOM 10835  N N   . GLU A 1 322 ? -41.854  59.447  -37.610 1.00 30.00  ? 326 GLU C N   2  
ATOM 10836  C CA  . GLU A 1 322 ? -43.160  59.401  -36.966 1.00 30.00  ? 326 GLU C CA  2  
ATOM 10837  C C   . GLU A 1 322 ? -43.493  58.066  -36.312 1.00 30.00  ? 326 GLU C C   2  
ATOM 10838  O O   . GLU A 1 322 ? -44.199  58.013  -35.307 1.00 30.00  ? 326 GLU C O   2  
ATOM 10839  C CB  . GLU A 1 322 ? -44.256  59.676  -37.992 1.00 99.99  ? 326 GLU C CB  2  
ATOM 10840  C CG  . GLU A 1 322 ? -44.115  61.084  -38.514 1.00 99.99  ? 326 GLU C CG  2  
ATOM 10841  C CD  . GLU A 1 322 ? -44.538  62.073  -37.428 1.00 99.99  ? 326 GLU C CD  2  
ATOM 10842  O OE1 . GLU A 1 322 ? -43.644  62.481  -36.640 1.00 99.99  ? 326 GLU C OE1 2  
ATOM 10843  O OE2 . GLU A 1 322 ? -45.752  62.410  -37.396 1.00 99.99  ? 326 GLU C OE2 2  
ATOM 10844  N N   . GLU A 1 323 ? -43.006  56.978  -36.879 1.00 30.00  ? 327 GLU C N   2  
ATOM 10845  C CA  . GLU A 1 323 ? -43.311  55.696  -36.283 1.00 30.00  ? 327 GLU C CA  2  
ATOM 10846  C C   . GLU A 1 323 ? -42.554  55.620  -34.969 1.00 30.00  ? 327 GLU C C   2  
ATOM 10847  O O   . GLU A 1 323 ? -43.061  55.065  -33.991 1.00 30.00  ? 327 GLU C O   2  
ATOM 10848  C CB  . GLU A 1 323 ? -42.869  54.573  -37.218 1.00 99.99  ? 327 GLU C CB  2  
ATOM 10849  C CG  . GLU A 1 323 ? -43.675  53.329  -36.926 1.00 99.99  ? 327 GLU C CG  2  
ATOM 10850  C CD  . GLU A 1 323 ? -43.024  52.558  -35.781 1.00 99.99  ? 327 GLU C CD  2  
ATOM 10851  O OE1 . GLU A 1 323 ? -43.397  52.840  -34.613 1.00 99.99  ? 327 GLU C OE1 2  
ATOM 10852  O OE2 . GLU A 1 323 ? -42.157  51.692  -36.086 1.00 99.99  ? 327 GLU C OE2 2  
ATOM 10853  N N   . PHE A 1 324 ? -41.344  56.182  -34.937 1.00 30.00  ? 328 PHE C N   2  
ATOM 10854  C CA  . PHE A 1 324 ? -40.554  56.160  -33.702 1.00 30.00  ? 328 PHE C CA  2  
ATOM 10855  C C   . PHE A 1 324 ? -41.311  56.925  -32.613 1.00 30.00  ? 328 PHE C C   2  
ATOM 10856  O O   . PHE A 1 324 ? -41.487  56.419  -31.488 1.00 30.00  ? 328 PHE C O   2  
ATOM 10857  C CB  . PHE A 1 324 ? -39.199  56.814  -33.941 1.00 99.99  ? 328 PHE C CB  2  
ATOM 10858  C CG  . PHE A 1 324 ? -38.394  56.784  -32.667 1.00 99.99  ? 328 PHE C CG  2  
ATOM 10859  C CD1 . PHE A 1 324 ? -37.667  55.635  -32.324 1.00 99.99  ? 328 PHE C CD1 2  
ATOM 10860  C CD2 . PHE A 1 324 ? -38.368  57.903  -31.826 1.00 99.99  ? 328 PHE C CD2 2  
ATOM 10861  C CE1 . PHE A 1 324 ? -36.920  55.605  -31.141 1.00 99.99  ? 328 PHE C CE1 2  
ATOM 10862  C CE2 . PHE A 1 324 ? -37.620  57.874  -30.643 1.00 99.99  ? 328 PHE C CE2 2  
ATOM 10863  C CZ  . PHE A 1 324 ? -36.895  56.724  -30.301 1.00 99.99  ? 328 PHE C CZ  2  
ATOM 10864  N N   . LYS A 1 325 ? -41.762  58.131  -32.957 1.00 30.00  ? 329 LYS C N   2  
ATOM 10865  C CA  . LYS A 1 325 ? -42.508  58.972  -32.034 1.00 30.00  ? 329 LYS C CA  2  
ATOM 10866  C C   . LYS A 1 325 ? -43.701  58.195  -31.486 1.00 30.00  ? 329 LYS C C   2  
ATOM 10867  O O   . LYS A 1 325 ? -43.839  58.030  -30.271 1.00 30.00  ? 329 LYS C O   2  
ATOM 10868  C CB  . LYS A 1 325 ? -43.009  60.220  -32.756 1.00 99.99  ? 329 LYS C CB  2  
ATOM 10869  C CG  . LYS A 1 325 ? -43.703  61.141  -31.759 1.00 99.99  ? 329 LYS C CG  2  
ATOM 10870  C CD  . LYS A 1 325 ? -43.804  62.544  -32.349 1.00 99.99  ? 329 LYS C CD  2  
ATOM 10871  C CE  . LYS A 1 325 ? -44.807  63.363  -31.542 1.00 99.99  ? 329 LYS C CE  2  
ATOM 10872  N NZ  . LYS A 1 325 ? -44.094  64.125  -30.505 1.00 99.99  ? 329 LYS C NZ  2  
ATOM 10873  N N   . LEU A 1 326 ? -44.558  57.713  -32.380 1.00 30.00  ? 330 LEU C N   2  
ATOM 10874  C CA  . LEU A 1 326 ? -45.733  56.948  -31.967 1.00 30.00  ? 330 LEU C CA  2  
ATOM 10875  C C   . LEU A 1 326 ? -45.370  55.724  -31.124 1.00 30.00  ? 330 LEU C C   2  
ATOM 10876  O O   . LEU A 1 326 ? -46.137  55.325  -30.219 1.00 30.00  ? 330 LEU C O   2  
ATOM 10877  C CB  . LEU A 1 326 ? -46.491  56.457  -33.197 1.00 99.99  ? 330 LEU C CB  2  
ATOM 10878  C CG  . LEU A 1 326 ? -47.605  57.443  -33.536 1.00 99.99  ? 330 LEU C CG  2  
ATOM 10879  C CD1 . LEU A 1 326 ? -48.559  56.803  -34.541 1.00 99.99  ? 330 LEU C CD1 2  
ATOM 10880  C CD2 . LEU A 1 326 ? -48.369  57.804  -32.267 1.00 99.99  ? 330 LEU C CD2 2  
ATOM 10881  N N   . CYS A 1 327 ? -44.215  55.119  -31.412 1.00 30.00  ? 331 CYS C N   2  
ATOM 10882  C CA  . CYS A 1 327 ? -43.774  53.936  -30.675 1.00 30.00  ? 331 CYS C CA  2  
ATOM 10883  C C   . CYS A 1 327 ? -43.383  54.352  -29.271 1.00 30.00  ? 331 CYS C C   2  
ATOM 10884  O O   . CYS A 1 327 ? -43.608  53.632  -28.287 1.00 30.00  ? 331 CYS C O   2  
ATOM 10885  C CB  . CYS A 1 327 ? -42.575  53.305  -31.376 1.00 99.99  ? 331 CYS C CB  2  
ATOM 10886  S SG  . CYS A 1 327 ? -40.976  54.103  -31.090 1.00 99.99  ? 331 CYS C SG  2  
ATOM 10887  N N   . ASP A 1 328 ? -42.788  55.537  -29.186 1.00 30.00  ? 332 ASP C N   2  
ATOM 10888  C CA  . ASP A 1 328 ? -42.366  56.100  -27.916 1.00 30.00  ? 332 ASP C CA  2  
ATOM 10889  C C   . ASP A 1 328 ? -43.673  56.430  -27.156 1.00 30.00  ? 332 ASP C C   2  
ATOM 10890  O O   . ASP A 1 328 ? -43.874  56.033  -25.999 1.00 30.00  ? 332 ASP C O   2  
ATOM 10891  C CB  . ASP A 1 328 ? -41.533  57.354  -28.154 1.00 99.99  ? 332 ASP C CB  2  
ATOM 10892  C CG  . ASP A 1 328 ? -40.207  56.968  -28.804 1.00 99.99  ? 332 ASP C CG  2  
ATOM 10893  O OD1 . ASP A 1 328 ? -39.361  56.380  -28.079 1.00 99.99  ? 332 ASP C OD1 2  
ATOM 10894  O OD2 . ASP A 1 328 ? -40.050  57.264  -30.018 1.00 99.99  ? 332 ASP C OD2 2  
ATOM 10895  N N   . GLU A 1 329 ? -44.554  57.148  -27.844 1.00 30.00  ? 333 GLU C N   2  
ATOM 10896  C CA  . GLU A 1 329 ? -45.848  57.555  -27.313 1.00 30.00  ? 333 GLU C CA  2  
ATOM 10897  C C   . GLU A 1 329 ? -46.608  56.348  -26.752 1.00 30.00  ? 333 GLU C C   2  
ATOM 10898  O O   . GLU A 1 329 ? -47.270  56.448  -25.716 1.00 30.00  ? 333 GLU C O   2  
ATOM 10899  C CB  . GLU A 1 329 ? -46.685  58.188  -28.419 1.00 99.99  ? 333 GLU C CB  2  
ATOM 10900  C CG  . GLU A 1 329 ? -46.025  59.464  -28.883 1.00 99.99  ? 333 GLU C CG  2  
ATOM 10901  C CD  . GLU A 1 329 ? -46.181  60.539  -27.810 1.00 99.99  ? 333 GLU C CD  2  
ATOM 10902  O OE1 . GLU A 1 329 ? -45.278  60.616  -26.938 1.00 99.99  ? 333 GLU C OE1 2  
ATOM 10903  O OE2 . GLU A 1 329 ? -47.203  61.272  -27.872 1.00 99.99  ? 333 GLU C OE2 2  
ATOM 10904  N N   . ALA A 1 330 ? -46.508  55.211  -27.449 1.00 30.00  ? 334 ALA C N   2  
ATOM 10905  C CA  . ALA A 1 330 ? -47.196  53.979  -27.057 1.00 30.00  ? 334 ALA C CA  2  
ATOM 10906  C C   . ALA A 1 330 ? -46.623  53.285  -25.836 1.00 30.00  ? 334 ALA C C   2  
ATOM 10907  O O   . ALA A 1 330 ? -47.314  52.523  -25.154 1.00 30.00  ? 334 ALA C O   2  
ATOM 10908  C CB  . ALA A 1 330 ? -47.196  53.011  -28.234 1.00 30.00  ? 334 ALA C CB  2  
ATOM 10909  N N   . PHE A 1 331 ? -45.349  53.543  -25.563 1.00 30.00  ? 335 PHE C N   2  
ATOM 10910  C CA  . PHE A 1 331 ? -44.686  52.946  -24.409 1.00 30.00  ? 335 PHE C CA  2  
ATOM 10911  C C   . PHE A 1 331 ? -45.217  53.611  -23.160 1.00 30.00  ? 335 PHE C C   2  
ATOM 10912  O O   . PHE A 1 331 ? -45.333  52.986  -22.107 1.00 30.00  ? 335 PHE C O   2  
ATOM 10913  C CB  . PHE A 1 331 ? -43.178  53.159  -24.511 1.00 99.99  ? 335 PHE C CB  2  
ATOM 10914  C CG  . PHE A 1 331 ? -42.496  52.488  -23.342 1.00 99.99  ? 335 PHE C CG  2  
ATOM 10915  C CD1 . PHE A 1 331 ? -42.352  51.096  -23.320 1.00 99.99  ? 335 PHE C CD1 2  
ATOM 10916  C CD2 . PHE A 1 331 ? -42.008  53.260  -22.281 1.00 99.99  ? 335 PHE C CD2 2  
ATOM 10917  C CE1 . PHE A 1 331 ? -41.716  50.476  -22.238 1.00 99.99  ? 335 PHE C CE1 2  
ATOM 10918  C CE2 . PHE A 1 331 ? -41.372  52.639  -21.198 1.00 99.99  ? 335 PHE C CE2 2  
ATOM 10919  C CZ  . PHE A 1 331 ? -41.229  51.248  -21.176 1.00 99.99  ? 335 PHE C CZ  2  
ATOM 10920  N N   . ASP A 1 332 ? -45.531  54.895  -23.298 1.00 30.00  ? 336 ASP C N   2  
ATOM 10921  C CA  . ASP A 1 332 ? -46.069  55.688  -22.202 1.00 30.00  ? 336 ASP C CA  2  
ATOM 10922  C C   . ASP A 1 332 ? -47.461  55.158  -21.832 1.00 30.00  ? 336 ASP C C   2  
ATOM 10923  O O   . ASP A 1 332 ? -47.692  54.752  -20.687 1.00 30.00  ? 336 ASP C O   2  
ATOM 10924  C CB  . ASP A 1 332 ? -46.176  57.151  -22.624 1.00 99.99  ? 336 ASP C CB  2  
ATOM 10925  C CG  . ASP A 1 332 ? -44.777  57.734  -22.804 1.00 99.99  ? 336 ASP C CG  2  
ATOM 10926  O OD1 . ASP A 1 332 ? -44.101  57.944  -21.760 1.00 99.99  ? 336 ASP C OD1 2  
ATOM 10927  O OD2 . ASP A 1 332 ? -44.396  57.963  -23.982 1.00 99.99  ? 336 ASP C OD2 2  
ATOM 10928  N N   . ILE A 1 333 ? -48.369  55.158  -22.811 1.00 30.00  ? 337 ILE C N   2  
ATOM 10929  C CA  . ILE A 1 333 ? -49.747  54.675  -22.622 1.00 30.00  ? 337 ILE C CA  2  
ATOM 10930  C C   . ILE A 1 333 ? -49.822  53.254  -22.069 1.00 30.00  ? 337 ILE C C   2  
ATOM 10931  O O   . ILE A 1 333 ? -50.757  52.878  -21.357 1.00 30.00  ? 337 ILE C O   2  
ATOM 10932  C CB  . ILE A 1 333 ? -50.486  54.680  -23.955 1.00 99.99  ? 337 ILE C CB  2  
ATOM 10933  C CG1 . ILE A 1 333 ? -50.219  53.373  -24.691 1.00 99.99  ? 337 ILE C CG1 2  
ATOM 10934  C CG2 . ILE A 1 333 ? -49.997  55.853  -24.801 1.00 99.99  ? 337 ILE C CG2 2  
ATOM 10935  C CD1 . ILE A 1 333 ? -51.336  52.381  -24.388 1.00 99.99  ? 337 ILE C CD1 2  
ATOM 10936  N N   . LEU A 1 334 ? -48.818  52.457  -22.404 1.00 30.00  ? 338 LEU C N   2  
ATOM 10937  C CA  . LEU A 1 334 ? -48.761  51.084  -21.954 1.00 30.00  ? 338 LEU C CA  2  
ATOM 10938  C C   . LEU A 1 334 ? -48.403  51.075  -20.481 1.00 30.00  ? 338 LEU C C   2  
ATOM 10939  O O   . LEU A 1 334 ? -48.528  50.054  -19.795 1.00 30.00  ? 338 LEU C O   2  
ATOM 10940  C CB  . LEU A 1 334 ? -47.703  50.321  -22.744 1.00 99.99  ? 338 LEU C CB  2  
ATOM 10941  C CG  . LEU A 1 334 ? -48.362  49.612  -23.920 1.00 99.99  ? 338 LEU C CG  2  
ATOM 10942  C CD1 . LEU A 1 334 ? -47.388  48.598  -24.513 1.00 99.99  ? 338 LEU C CD1 2  
ATOM 10943  C CD2 . LEU A 1 334 ? -49.618  48.892  -23.441 1.00 99.99  ? 338 LEU C CD2 2  
ATOM 10944  N N   . GLY A 1 335 ? -47.946  52.228  -19.994 1.00 30.00  ? 339 GLY C N   2  
ATOM 10945  C CA  . GLY A 1 335 ? -47.559  52.347  -18.607 1.00 30.00  ? 339 GLY C CA  2  
ATOM 10946  C C   . GLY A 1 335 ? -46.153  51.812  -18.402 1.00 30.00  ? 339 GLY C C   2  
ATOM 10947  O O   . GLY A 1 335 ? -45.925  50.920  -17.587 1.00 30.00  ? 339 GLY C O   2  
ATOM 10948  N N   . PHE A 1 336 ? -45.202  52.358  -19.146 1.00 30.00  ? 340 PHE C N   2  
ATOM 10949  C CA  . PHE A 1 336 ? -43.813  51.926  -19.041 1.00 30.00  ? 340 PHE C CA  2  
ATOM 10950  C C   . PHE A 1 336 ? -43.022  53.021  -18.352 1.00 30.00  ? 340 PHE C C   2  
ATOM 10951  O O   . PHE A 1 336 ? -42.991  54.158  -18.835 1.00 30.00  ? 340 PHE C O   2  
ATOM 10952  C CB  . PHE A 1 336 ? -43.242  51.675  -20.432 1.00 99.99  ? 340 PHE C CB  2  
ATOM 10953  C CG  . PHE A 1 336 ? -43.912  50.468  -21.040 1.00 99.99  ? 340 PHE C CG  2  
ATOM 10954  C CD1 . PHE A 1 336 ? -43.462  49.180  -20.723 1.00 99.99  ? 340 PHE C CD1 2  
ATOM 10955  C CD2 . PHE A 1 336 ? -44.987  50.634  -21.923 1.00 99.99  ? 340 PHE C CD2 2  
ATOM 10956  C CE1 . PHE A 1 336 ? -44.082  48.061  -21.289 1.00 99.99  ? 340 PHE C CE1 2  
ATOM 10957  C CE2 . PHE A 1 336 ? -45.609  49.516  -22.490 1.00 99.99  ? 340 PHE C CE2 2  
ATOM 10958  C CZ  . PHE A 1 336 ? -45.157  48.229  -22.172 1.00 99.99  ? 340 PHE C CZ  2  
ATOM 10959  N N   . THR A 1 337 ? -42.379  52.712  -17.230 1.00 30.00  ? 341 THR C N   2  
ATOM 10960  C CA  . THR A 1 337 ? -41.615  53.770  -16.575 1.00 30.00  ? 341 THR C CA  2  
ATOM 10961  C C   . THR A 1 337 ? -40.577  54.254  -17.583 1.00 30.00  ? 341 THR C C   2  
ATOM 10962  O O   . THR A 1 337 ? -40.218  53.518  -18.504 1.00 30.00  ? 341 THR C O   2  
ATOM 10963  C CB  . THR A 1 337 ? -40.935  53.221  -15.326 1.00 99.99  ? 341 THR C CB  2  
ATOM 10964  O OG1 . THR A 1 337 ? -39.917  52.289  -15.709 1.00 99.99  ? 341 THR C OG1 2  
ATOM 10965  C CG2 . THR A 1 337 ? -41.966  52.513  -14.455 1.00 99.99  ? 341 THR C CG2 2  
ATOM 10966  N N   . LYS A 1 338 ? -40.112  55.486  -17.425 1.00 30.00  ? 342 LYS C N   2  
ATOM 10967  C CA  . LYS A 1 338 ? -39.130  56.063  -18.338 1.00 30.00  ? 342 LYS C CA  2  
ATOM 10968  C C   . LYS A 1 338 ? -37.833  55.257  -18.382 1.00 30.00  ? 342 LYS C C   2  
ATOM 10969  O O   . LYS A 1 338 ? -37.140  55.233  -19.400 1.00 30.00  ? 342 LYS C O   2  
ATOM 10970  C CB  . LYS A 1 338 ? -38.783  57.481  -17.898 1.00 99.99  ? 342 LYS C CB  2  
ATOM 10971  C CG  . LYS A 1 338 ? -40.034  58.347  -17.934 1.00 99.99  ? 342 LYS C CG  2  
ATOM 10972  C CD  . LYS A 1 338 ? -40.338  58.747  -19.373 1.00 99.99  ? 342 LYS C CD  2  
ATOM 10973  C CE  . LYS A 1 338 ? -41.486  59.752  -19.393 1.00 99.99  ? 342 LYS C CE  2  
ATOM 10974  N NZ  . LYS A 1 338 ? -41.953  59.936  -20.773 1.00 99.99  ? 342 LYS C NZ  2  
ATOM 10975  N N   . GLU A 1 339 ? -37.500  54.601  -17.285 1.00 30.00  ? 343 GLU C N   2  
ATOM 10976  C CA  . GLU A 1 339 ? -36.278  53.820  -17.259 1.00 30.00  ? 343 GLU C CA  2  
ATOM 10977  C C   . GLU A 1 339 ? -36.538  52.589  -18.111 1.00 30.00  ? 343 GLU C C   2  
ATOM 10978  O O   . GLU A 1 339 ? -35.769  52.281  -19.018 1.00 30.00  ? 343 GLU C O   2  
ATOM 10979  C CB  . GLU A 1 339 ? -35.945  53.424  -15.823 1.00 99.99  ? 343 GLU C CB  2  
ATOM 10980  C CG  . GLU A 1 339 ? -35.642  54.665  -15.017 1.00 99.99  ? 343 GLU C CG  2  
ATOM 10981  C CD  . GLU A 1 339 ? -34.289  55.229  -15.439 1.00 99.99  ? 343 GLU C CD  2  
ATOM 10982  O OE1 . GLU A 1 339 ? -34.281  56.070  -16.377 1.00 99.99  ? 343 GLU C OE1 2  
ATOM 10983  O OE2 . GLU A 1 339 ? -33.273  54.813  -14.820 1.00 99.99  ? 343 GLU C OE2 2  
ATOM 10984  N N   . GLU A 1 340 ? -37.632  51.900  -17.808 1.00 30.00  ? 344 GLU C N   2  
ATOM 10985  C CA  . GLU A 1 340 ? -38.044  50.696  -18.527 1.00 30.00  ? 344 GLU C CA  2  
ATOM 10986  C C   . GLU A 1 340 ? -37.945  50.858  -20.044 1.00 30.00  ? 344 GLU C C   2  
ATOM 10987  O O   . GLU A 1 340 ? -37.303  50.071  -20.740 1.00 30.00  ? 344 GLU C O   2  
ATOM 10988  C CB  . GLU A 1 340 ? -39.493  50.360  -18.188 1.00 99.99  ? 344 GLU C CB  2  
ATOM 10989  C CG  . GLU A 1 340 ? -39.600  50.006  -16.725 1.00 99.99  ? 344 GLU C CG  2  
ATOM 10990  C CD  . GLU A 1 340 ? -38.963  48.638  -16.485 1.00 99.99  ? 344 GLU C CD  2  
ATOM 10991  O OE1 . GLU A 1 340 ? -37.736  48.613  -16.204 1.00 99.99  ? 344 GLU C OE1 2  
ATOM 10992  O OE2 . GLU A 1 340 ? -39.714  47.629  -16.586 1.00 99.99  ? 344 GLU C OE2 2  
ATOM 10993  N N   . LYS A 1 341 ? -38.594  51.901  -20.547 1.00 30.00  ? 345 LYS C N   2  
ATOM 10994  C CA  . LYS A 1 341 ? -38.610  52.174  -21.960 1.00 30.00  ? 345 LYS C CA  2  
ATOM 10995  C C   . LYS A 1 341 ? -37.330  52.733  -22.518 1.00 30.00  ? 345 LYS C C   2  
ATOM 10996  O O   . LYS A 1 341 ? -37.221  52.970  -23.719 1.00 30.00  ? 345 LYS C O   2  
ATOM 10997  C CB  . LYS A 1 341 ? -39.699  53.193  -22.280 1.00 99.99  ? 345 LYS C CB  2  
ATOM 10998  C CG  . LYS A 1 341 ? -39.777  53.403  -23.788 1.00 99.99  ? 345 LYS C CG  2  
ATOM 10999  C CD  . LYS A 1 341 ? -41.111  54.048  -24.144 1.00 99.99  ? 345 LYS C CD  2  
ATOM 11000  C CE  . LYS A 1 341 ? -41.048  54.592  -25.568 1.00 99.99  ? 345 LYS C CE  2  
ATOM 11001  N NZ  . LYS A 1 341 ? -41.574  53.588  -26.503 1.00 99.99  ? 345 LYS C NZ  2  
ATOM 11002  N N   . GLN A 1 342 ? -36.354  52.962  -21.653 1.00 30.00  ? 346 GLN C N   2  
ATOM 11003  C CA  . GLN A 1 342 ? -35.077  53.485  -22.100 1.00 30.00  ? 346 GLN C CA  2  
ATOM 11004  C C   . GLN A 1 342 ? -34.113  52.307  -22.037 1.00 30.00  ? 346 GLN C C   2  
ATOM 11005  O O   . GLN A 1 342 ? -33.050  52.323  -22.644 1.00 30.00  ? 346 GLN C O   2  
ATOM 11006  C CB  . GLN A 1 342 ? -34.631  54.618  -21.181 1.00 99.99  ? 346 GLN C CB  2  
ATOM 11007  C CG  . GLN A 1 342 ? -35.605  55.786  -21.302 1.00 99.99  ? 346 GLN C CG  2  
ATOM 11008  C CD  . GLN A 1 342 ? -35.444  56.499  -22.638 1.00 99.99  ? 346 GLN C CD  2  
ATOM 11009  O OE1 . GLN A 1 342 ? -34.613  56.112  -23.455 1.00 99.99  ? 346 GLN C OE1 2  
ATOM 11010  N NE2 . GLN A 1 342 ? -36.247  57.540  -22.857 1.00 99.99  ? 346 GLN C NE2 2  
ATOM 11011  N N   . SER A 1 343 ? -34.513  51.288  -21.274 1.00 30.00  ? 347 SER C N   2  
ATOM 11012  C CA  . SER A 1 343 ? -33.756  50.056  -21.100 1.00 30.00  ? 347 SER C CA  2  
ATOM 11013  C C   . SER A 1 343 ? -33.920  49.333  -22.441 1.00 30.00  ? 347 SER C C   2  
ATOM 11014  O O   . SER A 1 343 ? -32.959  48.794  -23.003 1.00 30.00  ? 347 SER C O   2  
ATOM 11015  C CB  . SER A 1 343 ? -34.331  49.253  -19.940 1.00 99.99  ? 347 SER C CB  2  
ATOM 11016  O OG  . SER A 1 343 ? -34.275  50.033  -18.745 1.00 99.99  ? 347 SER C OG  2  
ATOM 11017  N N   . MET A 1 344 ? -35.161  49.328  -22.930 1.00 30.00  ? 348 MET C N   2  
ATOM 11018  C CA  . MET A 1 344 ? -35.500  48.707  -24.204 1.00 30.00  ? 348 MET C CA  2  
ATOM 11019  C C   . MET A 1 344 ? -34.608  49.351  -25.251 1.00 30.00  ? 348 MET C C   2  
ATOM 11020  O O   . MET A 1 344 ? -33.680  48.733  -25.759 1.00 30.00  ? 348 MET C O   2  
ATOM 11021  C CB  . MET A 1 344 ? -36.968  48.952  -24.527 1.00 99.99  ? 348 MET C CB  2  
ATOM 11022  C CG  . MET A 1 344 ? -37.824  48.573  -23.323 1.00 99.99  ? 348 MET C CG  2  
ATOM 11023  S SD  . MET A 1 344 ? -38.061  46.782  -23.268 1.00 99.99  ? 348 MET C SD  2  
ATOM 11024  C CE  . MET A 1 344 ? -39.271  46.588  -24.559 1.00 99.99  ? 348 MET C CE  2  
ATOM 11025  N N   . PHE A 1 345 ? -34.901  50.604  -25.558 1.00 30.00  ? 349 PHE C N   2  
ATOM 11026  C CA  . PHE A 1 345 ? -34.171  51.381  -26.546 1.00 30.00  ? 349 PHE C CA  2  
ATOM 11027  C C   . PHE A 1 345 ? -32.653  51.268  -26.523 1.00 30.00  ? 349 PHE C C   2  
ATOM 11028  O O   . PHE A 1 345 ? -31.994  51.381  -27.555 1.00 30.00  ? 349 PHE C O   2  
ATOM 11029  C CB  . PHE A 1 345 ? -34.473  52.865  -26.365 1.00 99.99  ? 349 PHE C CB  2  
ATOM 11030  C CG  . PHE A 1 345 ? -35.870  53.158  -26.856 1.00 99.99  ? 349 PHE C CG  2  
ATOM 11031  C CD1 . PHE A 1 345 ? -36.118  53.263  -28.230 1.00 99.99  ? 349 PHE C CD1 2  
ATOM 11032  C CD2 . PHE A 1 345 ? -36.914  53.328  -25.939 1.00 99.99  ? 349 PHE C CD2 2  
ATOM 11033  C CE1 . PHE A 1 345 ? -37.416  53.536  -28.686 1.00 99.99  ? 349 PHE C CE1 2  
ATOM 11034  C CE2 . PHE A 1 345 ? -38.208  53.602  -26.397 1.00 99.99  ? 349 PHE C CE2 2  
ATOM 11035  C CZ  . PHE A 1 345 ? -38.459  53.706  -27.770 1.00 99.99  ? 349 PHE C CZ  2  
ATOM 11036  N N   . LYS A 1 346 ? -32.090  51.058  -25.344 1.00 30.00  ? 350 LYS C N   2  
ATOM 11037  C CA  . LYS A 1 346 ? -30.648  50.964  -25.229 1.00 30.00  ? 350 LYS C CA  2  
ATOM 11038  C C   . LYS A 1 346 ? -30.156  49.584  -25.602 1.00 30.00  ? 350 LYS C C   2  
ATOM 11039  O O   . LYS A 1 346 ? -29.187  49.449  -26.350 1.00 30.00  ? 350 LYS C O   2  
ATOM 11040  C CB  . LYS A 1 346 ? -30.222  51.257  -23.795 1.00 99.99  ? 350 LYS C CB  2  
ATOM 11041  C CG  . LYS A 1 346 ? -28.701  51.253  -23.704 1.00 99.99  ? 350 LYS C CG  2  
ATOM 11042  C CD  . LYS A 1 346 ? -28.264  51.962  -22.428 1.00 99.99  ? 350 LYS C CD  2  
ATOM 11043  C CE  . LYS A 1 346 ? -26.800  51.644  -22.143 1.00 99.99  ? 350 LYS C CE  2  
ATOM 11044  N NZ  . LYS A 1 346 ? -25.947  52.696  -22.718 1.00 99.99  ? 350 LYS C NZ  2  
ATOM 11045  N N   . CYS A 1 347 ? -30.820  48.556  -25.083 1.00 30.00  ? 351 CYS C N   2  
ATOM 11046  C CA  . CYS A 1 347 ? -30.434  47.192  -25.398 1.00 30.00  ? 351 CYS C CA  2  
ATOM 11047  C C   . CYS A 1 347