data_2W6C
# 
_entry.id   2W6C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2W6C         
WWPDB D_1290038287 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1ZGB unspecified 
'CRYSTAL STRUCTURE OF TORPEDO CALIFORNICAACETYLCHOLINESTERASE IN COMPLEX WITH AN (R)-TACRINE(10)-HUPYRIDONE INHIBITOR.' 
PDB 1AMN unspecified 
'TRANSITION STATE ANALOG: ACETYLCHOLINESTERASE COMPLEXED WITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 1QTI unspecified ACETYLCHOLINESTERASE 
PDB 1E66 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-HUPRINE X AT 2.1A RESOLUTION' 
PDB 2VQ6 unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH 2-PAM' 
PDB 2ACK unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, MONOCHROMATIC DATA' 
PDB 2J3D unspecified 'NATIVE MONOCLINIC FORM OF TORPEDO ACETYLCHOLINESTERASE' 
PDB 1QII unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT F) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2CKM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH ALKYLENE-LINKED BIS-TACRINE DIMER (7 CARBON LINKER)' 
PDB 1DX6 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-GALANTHAMINE AT 2.3A RESOLUTION' 
PDB 1QIJ unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT G) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIE unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT B) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1ACL unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH DECAMETHONIUM' 
PDB 1W4L unspecified 'COMPLEX OF TCACHE WITH BIS-ACTING GALANTHAMINE DERIVATIVE' 
PDB 1ODC unspecified 
;STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH N-4'-QUINOLYL-N'-9 "-(1",2",3",4"-TETRAHYDROACRIDINYL)-1,8- DIAMINOOCTANE AT 2.2A RESOLUTION
;
PDB 2CMF unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH ALKYLENE-LINKED BIS-TACRINE DIMER (5 CARBON LINKER)' 
PDB 2J3Q unspecified 'TORPEDO ACETYLCHOLINESTERASE COMPLEXED WITH FLUOROPHORE THIOFLAVIN T' 
PDB 1GQS unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH NAP' 
PDB 1E3Q unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH BW284C51' 
PDB 2J4F unspecified 'TORPEDO ACETYLCHOLINESTERASE - HG HEAVY-ATOM DERIVATIVE' 
PDB 2DFP unspecified 'X-RAY STRUCTURE OF AGED DI-ISOPROPYL- PHOSPHORO-FLUORIDATE (DFP) BOUND TO ACETYLCHOLINESTERASE' 
PDB 1QIK unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT H) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2C5F unspecified 
'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N-TRIMETHYLAMMONIUM' 
PDB 1EA5 unspecified 'NATIVE ACETYLCHOLINESTERASE (E.C. 3.1.1.7 ) FROM TORPEDO CALIFORNICA AT 1.8A RESOLUTION' 
PDB 2VJC unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET A AT 150K
;
PDB 1QIF unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT C) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1EEA unspecified ACETYLCHOLINESTERASE 
PDB 2VJB unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET D AT 100K
;
PDB 1QIG unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT D) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QID unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT A) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1ZGC unspecified 
'CRYSTAL STRUCTURE OF TORPEDO CALIFORNICAACETYLCHOLINESTERASE IN COMPLEX WITH AN (RS)-TACRINE(10)-HUPYRIDONE INHIBITOR.' 
PDB 1JJB unspecified 
'A NEUTRAL MOLECULE IN CATION-BINDING SITE: SPECIFIC BINDINGOF PEG-SH TO ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 2VJD unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET C AT 150K
;
PDB 1UT6 unspecified 
;STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH N-9-(1',2',3',4 '-TETRAHYDROACRIDINYL)-1,8- DIAMINOOCTANE AT 2.4 ANGSTROMS RESOLUTION.
;
PDB 2VT6 unspecified 'NATIVE TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COLLECTED WITH A CUMULATED DOSE OF 9400000 GY' 
PDB 2VT7 unspecified 'NATIVE TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COLLECTED WITH A CUMULATED DOSE OF 800000 GY' 
PDB 2CEK unspecified 
;CONFORMATIONAL FLEXIBILITY IN THE PERIPHERAL SITE OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE REVEALED BY THE COMPLEX STRUCTURE WITH A BIFUNCTIONAL INHIBITOR
;
PDB 1QIM unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT I) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1GPK unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXE WITH (+)-HUPERZINE A AT 2.1A RESOLUTION' 
PDB 1JGA unspecified 
;THEORETICAL MODEL OF THE DIISOPROPYLPHOSPHORYL- ACETYLCHOLINESTERASE COMPLEXED WITH 1,7- HEPTYLENE-BIS-N,N'-SYN-2-PYRIDINIUMALDOXIME
;
PDB 3ACE unspecified 'THEORETICAL MODEL OF (R)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
PDB 1W6R unspecified 'COMPLEX OF TCACHE WITH GALANTHAMINE DERIVATIVE' 
PDB 1OCE unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH MF268' 
PDB 1SOM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE INHIBITED BY NERVE AGENT GD (SOMAN).' 
PDB 1VXO unspecified 
;METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 2VJA unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET A AT 100K
;
PDB 1CFJ unspecified 
'METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O- ISOPROPYLMETHYLPHOSPHONOFLUORIDATE (GB, SARIN)' 
PDB 2V96 unspecified 
'STRUCTURE OF THE UNPHOTOLYSED COMPLEX OF TCACHE WITH 1-(2-NITROPHENYL)-2,2,2- TRIFLUOROETHYL-ARSENOCHOLINE AT 100K' 
PDB 1U65 unspecified 'ACHE W. CPT-11' 
PDB 1W76 unspecified 
'ORTHORHOMBIC FORM OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE (ACHE) COMPLEXED WITH BIS- ACTING GALANTHAMINE DERIVATIVE' 
PDB 1AX9 unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, LAUE DATA' 
PDB 1H22 unspecified 
'STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH (S,S)-(-)-BIS(10)- HUPERZINE A-LIKE INHIBITOR AT 2.15A RESOLUTION' 
PDB 1EVE unspecified 
'THREE DIMENSIONAL STRUCTURE OF THE ANTI- ALZHEIMER DRUG, E2020 (ARICEPT), COMPLEXED WITH ITS TARGET ACETYLCHOLINESTERASE' 
PDB 2C4H unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 500MM ACETYLTHIOCHOLINE' 
PDB 2ACE unspecified 'NATIVE ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 2VA9 unspecified 
;STRUCTURE OF NATIVE TCACHE AFTER A 9 SECONDS ANNEALING TO ROOM TEMPERATURE DURING THE FIRST 5 SECONDS OF WHICH LASER IRRADIATION AT 266NM TOOK PLACE
;
PDB 1GQR unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH RIVASTIGMINE' 
PDB 1VXR unspecified 
;O-ETHYLMETHYLPHOSPHONYLATED ACETYLCHOLINESTERASE OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 4ACE unspecified 'THEORETICAL MODEL OF (S)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
PDB 2C58 unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 20MM ACETYLTHIOCHOLINE' 
PDB 1HBJ unspecified 
;X-RAY CRYSTAL STRUCTURE OF COMPLEX BETWEEN TORPEDO CALIFORNICA ACHE AND A REVERSIBLE INHIBITOR, 4-AMINO-5-FLUORO-2-METHYL-3-( 3-TRIFLUOROACETYLBENZYLTHIOMETHYL)QUINOLINE
;
PDB 1W75 unspecified 'NATIVE ORTHORHOMBIC FORM OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE (ACHE)' 
PDB 1VOT unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE A' 
PDB 2C5G unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 20MM THIOCHOLINE' 
PDB 1JGB unspecified 
;THEORETICAL MODEL OF THE DIISOPROPYLPHOSPHORYL- ACETYLCHOLINESTERASE COMPLEXED WITH 1,3- PROPYLENE-BIS-N,N'-SYN-4-PYRIDINIUMALDOXIME
;
PDB 2V98 unspecified 
;STRUCTURE OF THE COMPLEX OF TCACHE WITH 1 -(2-NITROPHENYL)-2,2,2-TRIFLUOROETHYL- ARSENOCHOLINE AFTER A 9 SECONDS ANNEALING TO ROOM TEMPERATURE, DURING HTE FIRST 5 SECONDS OF WHICH LASER IRRADIATION AT 266NM TOOK PLACE
;
PDB 1GPN unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE B AT 2.35A RESOLUTION' 
PDB 1QIH unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT E) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1H23 unspecified 
'STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH (S,S)-(-)-BIS(12)- HUPERZINE A-LIKE INHIBITOR AT 2.15A RESOLUTION' 
PDB 1ACJ unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH TACRINE' 
PDB 1FSS unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH FASCICULIN-II' 
PDB 2V97 unspecified 
;STRUCTURE OF THE UNPHOTOLYSED COMPLEX OF TCACHE WITH 1-(2-NITROPHENYL)-2,2,2- TRIFLUOROETHYL-ARSENOCHOLINE AFTER A 9 SECONDS ANNEALING TO ROOM TEMPERATURE
;
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2W6C 
_pdbx_database_status.recvd_initial_deposition_date   2008-12-18 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Paz, A.'          1 
'Xie, Q.'          2 
'Greenblatt, H.M.' 3 
'Fu, W.'           4 
'Tang, Y.'         5 
'Silman, I.'       6 
'Qiu, Z.'          7 
'Sussman, J.L.'    8 
# 
_citation.id                        primary 
_citation.title                     
;The Crystal Structure of a Complex of Acetylcholinesterase with a Bis-(-)-Nor-Meptazinol Derivative Reveals Disruption of the Catalytic Triad.
;
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            52 
_citation.page_first                2543 
_citation.page_last                 ? 
_citation.year                      2009 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19326912 
_citation.pdbx_database_id_DOI      10.1021/JM801657V 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Paz, A.'          1 ? 
primary 'Xie, Q.'          2 ? 
primary 'Greenblatt, H.M.' 3 ? 
primary 'Fu, W.'           4 ? 
primary 'Tang, Y.'         5 ? 
primary 'Silman, I.'       6 ? 
primary 'Qiu, Z.'          7 ? 
primary 'Sussman, J.L.'    8 ? 
# 
_cell.entry_id           2W6C 
_cell.length_a           112.172 
_cell.length_b           112.172 
_cell.length_c           137.568 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2W6C 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat ACETYLCHOLINESTERASE                                                                         65970.711 1   
3.1.1.7 ? ? ? 
2 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose'    424.401   1   ? ? ? 
? 
3 non-polymer syn '3-[(3R)-3-ethyl-1-{9-[(3S)-3-ethyl-3-(3-hydroxyphenyl)azepan-1-yl]nonyl}azepan-3-yl]phenol' 562.869   1   ? ? ? 
? 
4 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                     221.208   2   ? ? ? 
? 
5 water       nat water                                                                                        18.015    115 ? ? ? 
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MNLLVTSSLGVLLHLVVLCQADDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWN
ASTYPNNCQQYVDEQFPGFSGSEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTE
EVVLVSLSYRVGAFGFLALHGSQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLF
RRAILQSGSPNCPWASVSVAEGRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGE
FFPTSLESMLNSGNFKKTQILLGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWM
DDNNGIKNRDGLDDIVGDHNVICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYT
AEEEALSRRIMHYWATFAKTGNPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDG
ELSSSGTSSSKGIIFYVLFSILYLIF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MNLLVTSSLGVLLHLVVLCQADDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWN
ASTYPNNCQQYVDEQFPGFSGSEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTE
EVVLVSLSYRVGAFGFLALHGSQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLF
RRAILQSGSPNCPWASVSVAEGRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGE
FFPTSLESMLNSGNFKKTQILLGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWM
DDNNGIKNRDGLDDIVGDHNVICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYT
AEEEALSRRIMHYWATFAKTGNPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDG
ELSSSGTSSSKGIIFYVLFSILYLIF
;
_entity_poly.pdbx_strand_id                 X 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   LEU n 
1 4   LEU n 
1 5   VAL n 
1 6   THR n 
1 7   SER n 
1 8   SER n 
1 9   LEU n 
1 10  GLY n 
1 11  VAL n 
1 12  LEU n 
1 13  LEU n 
1 14  HIS n 
1 15  LEU n 
1 16  VAL n 
1 17  VAL n 
1 18  LEU n 
1 19  CYS n 
1 20  GLN n 
1 21  ALA n 
1 22  ASP n 
1 23  ASP n 
1 24  HIS n 
1 25  SER n 
1 26  GLU n 
1 27  LEU n 
1 28  LEU n 
1 29  VAL n 
1 30  ASN n 
1 31  THR n 
1 32  LYS n 
1 33  SER n 
1 34  GLY n 
1 35  LYS n 
1 36  VAL n 
1 37  MET n 
1 38  GLY n 
1 39  THR n 
1 40  ARG n 
1 41  VAL n 
1 42  PRO n 
1 43  VAL n 
1 44  LEU n 
1 45  SER n 
1 46  SER n 
1 47  HIS n 
1 48  ILE n 
1 49  SER n 
1 50  ALA n 
1 51  PHE n 
1 52  LEU n 
1 53  GLY n 
1 54  ILE n 
1 55  PRO n 
1 56  PHE n 
1 57  ALA n 
1 58  GLU n 
1 59  PRO n 
1 60  PRO n 
1 61  VAL n 
1 62  GLY n 
1 63  ASN n 
1 64  MET n 
1 65  ARG n 
1 66  PHE n 
1 67  ARG n 
1 68  ARG n 
1 69  PRO n 
1 70  GLU n 
1 71  PRO n 
1 72  LYS n 
1 73  LYS n 
1 74  PRO n 
1 75  TRP n 
1 76  SER n 
1 77  GLY n 
1 78  VAL n 
1 79  TRP n 
1 80  ASN n 
1 81  ALA n 
1 82  SER n 
1 83  THR n 
1 84  TYR n 
1 85  PRO n 
1 86  ASN n 
1 87  ASN n 
1 88  CYS n 
1 89  GLN n 
1 90  GLN n 
1 91  TYR n 
1 92  VAL n 
1 93  ASP n 
1 94  GLU n 
1 95  GLN n 
1 96  PHE n 
1 97  PRO n 
1 98  GLY n 
1 99  PHE n 
1 100 SER n 
1 101 GLY n 
1 102 SER n 
1 103 GLU n 
1 104 MET n 
1 105 TRP n 
1 106 ASN n 
1 107 PRO n 
1 108 ASN n 
1 109 ARG n 
1 110 GLU n 
1 111 MET n 
1 112 SER n 
1 113 GLU n 
1 114 ASP n 
1 115 CYS n 
1 116 LEU n 
1 117 TYR n 
1 118 LEU n 
1 119 ASN n 
1 120 ILE n 
1 121 TRP n 
1 122 VAL n 
1 123 PRO n 
1 124 SER n 
1 125 PRO n 
1 126 ARG n 
1 127 PRO n 
1 128 LYS n 
1 129 SER n 
1 130 THR n 
1 131 THR n 
1 132 VAL n 
1 133 MET n 
1 134 VAL n 
1 135 TRP n 
1 136 ILE n 
1 137 TYR n 
1 138 GLY n 
1 139 GLY n 
1 140 GLY n 
1 141 PHE n 
1 142 TYR n 
1 143 SER n 
1 144 GLY n 
1 145 SER n 
1 146 SER n 
1 147 THR n 
1 148 LEU n 
1 149 ASP n 
1 150 VAL n 
1 151 TYR n 
1 152 ASN n 
1 153 GLY n 
1 154 LYS n 
1 155 TYR n 
1 156 LEU n 
1 157 ALA n 
1 158 TYR n 
1 159 THR n 
1 160 GLU n 
1 161 GLU n 
1 162 VAL n 
1 163 VAL n 
1 164 LEU n 
1 165 VAL n 
1 166 SER n 
1 167 LEU n 
1 168 SER n 
1 169 TYR n 
1 170 ARG n 
1 171 VAL n 
1 172 GLY n 
1 173 ALA n 
1 174 PHE n 
1 175 GLY n 
1 176 PHE n 
1 177 LEU n 
1 178 ALA n 
1 179 LEU n 
1 180 HIS n 
1 181 GLY n 
1 182 SER n 
1 183 GLN n 
1 184 GLU n 
1 185 ALA n 
1 186 PRO n 
1 187 GLY n 
1 188 ASN n 
1 189 VAL n 
1 190 GLY n 
1 191 LEU n 
1 192 LEU n 
1 193 ASP n 
1 194 GLN n 
1 195 ARG n 
1 196 MET n 
1 197 ALA n 
1 198 LEU n 
1 199 GLN n 
1 200 TRP n 
1 201 VAL n 
1 202 HIS n 
1 203 ASP n 
1 204 ASN n 
1 205 ILE n 
1 206 GLN n 
1 207 PHE n 
1 208 PHE n 
1 209 GLY n 
1 210 GLY n 
1 211 ASP n 
1 212 PRO n 
1 213 LYS n 
1 214 THR n 
1 215 VAL n 
1 216 THR n 
1 217 ILE n 
1 218 PHE n 
1 219 GLY n 
1 220 GLU n 
1 221 SER n 
1 222 ALA n 
1 223 GLY n 
1 224 GLY n 
1 225 ALA n 
1 226 SER n 
1 227 VAL n 
1 228 GLY n 
1 229 MET n 
1 230 HIS n 
1 231 ILE n 
1 232 LEU n 
1 233 SER n 
1 234 PRO n 
1 235 GLY n 
1 236 SER n 
1 237 ARG n 
1 238 ASP n 
1 239 LEU n 
1 240 PHE n 
1 241 ARG n 
1 242 ARG n 
1 243 ALA n 
1 244 ILE n 
1 245 LEU n 
1 246 GLN n 
1 247 SER n 
1 248 GLY n 
1 249 SER n 
1 250 PRO n 
1 251 ASN n 
1 252 CYS n 
1 253 PRO n 
1 254 TRP n 
1 255 ALA n 
1 256 SER n 
1 257 VAL n 
1 258 SER n 
1 259 VAL n 
1 260 ALA n 
1 261 GLU n 
1 262 GLY n 
1 263 ARG n 
1 264 ARG n 
1 265 ARG n 
1 266 ALA n 
1 267 VAL n 
1 268 GLU n 
1 269 LEU n 
1 270 GLY n 
1 271 ARG n 
1 272 ASN n 
1 273 LEU n 
1 274 ASN n 
1 275 CYS n 
1 276 ASN n 
1 277 LEU n 
1 278 ASN n 
1 279 SER n 
1 280 ASP n 
1 281 GLU n 
1 282 GLU n 
1 283 LEU n 
1 284 ILE n 
1 285 HIS n 
1 286 CYS n 
1 287 LEU n 
1 288 ARG n 
1 289 GLU n 
1 290 LYS n 
1 291 LYS n 
1 292 PRO n 
1 293 GLN n 
1 294 GLU n 
1 295 LEU n 
1 296 ILE n 
1 297 ASP n 
1 298 VAL n 
1 299 GLU n 
1 300 TRP n 
1 301 ASN n 
1 302 VAL n 
1 303 LEU n 
1 304 PRO n 
1 305 PHE n 
1 306 ASP n 
1 307 SER n 
1 308 ILE n 
1 309 PHE n 
1 310 ARG n 
1 311 PHE n 
1 312 SER n 
1 313 PHE n 
1 314 VAL n 
1 315 PRO n 
1 316 VAL n 
1 317 ILE n 
1 318 ASP n 
1 319 GLY n 
1 320 GLU n 
1 321 PHE n 
1 322 PHE n 
1 323 PRO n 
1 324 THR n 
1 325 SER n 
1 326 LEU n 
1 327 GLU n 
1 328 SER n 
1 329 MET n 
1 330 LEU n 
1 331 ASN n 
1 332 SER n 
1 333 GLY n 
1 334 ASN n 
1 335 PHE n 
1 336 LYS n 
1 337 LYS n 
1 338 THR n 
1 339 GLN n 
1 340 ILE n 
1 341 LEU n 
1 342 LEU n 
1 343 GLY n 
1 344 VAL n 
1 345 ASN n 
1 346 LYS n 
1 347 ASP n 
1 348 GLU n 
1 349 GLY n 
1 350 SER n 
1 351 PHE n 
1 352 PHE n 
1 353 LEU n 
1 354 LEU n 
1 355 TYR n 
1 356 GLY n 
1 357 ALA n 
1 358 PRO n 
1 359 GLY n 
1 360 PHE n 
1 361 SER n 
1 362 LYS n 
1 363 ASP n 
1 364 SER n 
1 365 GLU n 
1 366 SER n 
1 367 LYS n 
1 368 ILE n 
1 369 SER n 
1 370 ARG n 
1 371 GLU n 
1 372 ASP n 
1 373 PHE n 
1 374 MET n 
1 375 SER n 
1 376 GLY n 
1 377 VAL n 
1 378 LYS n 
1 379 LEU n 
1 380 SER n 
1 381 VAL n 
1 382 PRO n 
1 383 HIS n 
1 384 ALA n 
1 385 ASN n 
1 386 ASP n 
1 387 LEU n 
1 388 GLY n 
1 389 LEU n 
1 390 ASP n 
1 391 ALA n 
1 392 VAL n 
1 393 THR n 
1 394 LEU n 
1 395 GLN n 
1 396 TYR n 
1 397 THR n 
1 398 ASP n 
1 399 TRP n 
1 400 MET n 
1 401 ASP n 
1 402 ASP n 
1 403 ASN n 
1 404 ASN n 
1 405 GLY n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 ARG n 
1 410 ASP n 
1 411 GLY n 
1 412 LEU n 
1 413 ASP n 
1 414 ASP n 
1 415 ILE n 
1 416 VAL n 
1 417 GLY n 
1 418 ASP n 
1 419 HIS n 
1 420 ASN n 
1 421 VAL n 
1 422 ILE n 
1 423 CYS n 
1 424 PRO n 
1 425 LEU n 
1 426 MET n 
1 427 HIS n 
1 428 PHE n 
1 429 VAL n 
1 430 ASN n 
1 431 LYS n 
1 432 TYR n 
1 433 THR n 
1 434 LYS n 
1 435 PHE n 
1 436 GLY n 
1 437 ASN n 
1 438 GLY n 
1 439 THR n 
1 440 TYR n 
1 441 LEU n 
1 442 TYR n 
1 443 PHE n 
1 444 PHE n 
1 445 ASN n 
1 446 HIS n 
1 447 ARG n 
1 448 ALA n 
1 449 SER n 
1 450 ASN n 
1 451 LEU n 
1 452 VAL n 
1 453 TRP n 
1 454 PRO n 
1 455 GLU n 
1 456 TRP n 
1 457 MET n 
1 458 GLY n 
1 459 VAL n 
1 460 ILE n 
1 461 HIS n 
1 462 GLY n 
1 463 TYR n 
1 464 GLU n 
1 465 ILE n 
1 466 GLU n 
1 467 PHE n 
1 468 VAL n 
1 469 PHE n 
1 470 GLY n 
1 471 LEU n 
1 472 PRO n 
1 473 LEU n 
1 474 VAL n 
1 475 LYS n 
1 476 GLU n 
1 477 LEU n 
1 478 ASN n 
1 479 TYR n 
1 480 THR n 
1 481 ALA n 
1 482 GLU n 
1 483 GLU n 
1 484 GLU n 
1 485 ALA n 
1 486 LEU n 
1 487 SER n 
1 488 ARG n 
1 489 ARG n 
1 490 ILE n 
1 491 MET n 
1 492 HIS n 
1 493 TYR n 
1 494 TRP n 
1 495 ALA n 
1 496 THR n 
1 497 PHE n 
1 498 ALA n 
1 499 LYS n 
1 500 THR n 
1 501 GLY n 
1 502 ASN n 
1 503 PRO n 
1 504 ASN n 
1 505 GLU n 
1 506 PRO n 
1 507 HIS n 
1 508 SER n 
1 509 GLN n 
1 510 GLU n 
1 511 SER n 
1 512 LYS n 
1 513 TRP n 
1 514 PRO n 
1 515 LEU n 
1 516 PHE n 
1 517 THR n 
1 518 THR n 
1 519 LYS n 
1 520 GLU n 
1 521 GLN n 
1 522 LYS n 
1 523 PHE n 
1 524 ILE n 
1 525 ASP n 
1 526 LEU n 
1 527 ASN n 
1 528 THR n 
1 529 GLU n 
1 530 PRO n 
1 531 MET n 
1 532 LYS n 
1 533 VAL n 
1 534 HIS n 
1 535 GLN n 
1 536 ARG n 
1 537 LEU n 
1 538 ARG n 
1 539 VAL n 
1 540 GLN n 
1 541 MET n 
1 542 CYS n 
1 543 VAL n 
1 544 PHE n 
1 545 TRP n 
1 546 ASN n 
1 547 GLN n 
1 548 PHE n 
1 549 LEU n 
1 550 PRO n 
1 551 LYS n 
1 552 LEU n 
1 553 LEU n 
1 554 ASN n 
1 555 ALA n 
1 556 THR n 
1 557 ALA n 
1 558 CYS n 
1 559 ASP n 
1 560 GLY n 
1 561 GLU n 
1 562 LEU n 
1 563 SER n 
1 564 SER n 
1 565 SER n 
1 566 GLY n 
1 567 THR n 
1 568 SER n 
1 569 SER n 
1 570 SER n 
1 571 LYS n 
1 572 GLY n 
1 573 ILE n 
1 574 ILE n 
1 575 PHE n 
1 576 TYR n 
1 577 VAL n 
1 578 LEU n 
1 579 PHE n 
1 580 SER n 
1 581 ILE n 
1 582 LEU n 
1 583 TYR n 
1 584 LEU n 
1 585 ILE n 
1 586 PHE n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'PACIFIC ELECTRIC RAY' 
_entity_src_nat.pdbx_organism_scientific   'TORPEDO CALIFORNICA' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2W6C 
_struct_ref_seq.pdbx_strand_id                X 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 586 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  586 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       -20 
_struct_ref_seq.pdbx_auth_seq_align_end       565 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                                                                      ? 
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                                                                     ? 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                                                   ? 
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                                              ? 
'C4 H7 N O4'     133.103 
BM4 non-polymer                  . '3-[(3R)-3-ethyl-1-{9-[(3S)-3-ethyl-3-(3-hydroxyphenyl)azepan-1-yl]nonyl}azepan-3-yl]phenol' ? 
'C37 H58 N2 O2'  562.869 
CYS 'L-peptide linking'          y CYSTEINE                                                                                     ? 
'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                                                                    ? 
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                                              ? 
'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                                                                      ? 
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                                                                    ? 
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                                                                        ? 
'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                                                   ? 
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                                                                      ? 
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                                                                       ? 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                                                                                   ? 
'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                                                     ? 
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                                                                                ? 
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                                                                      ? 
'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                                                                       ? 
'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                                                                    ? 
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                                                   ? 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                                                                     ? 
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                                                                       ? 
'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2W6C 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.15 
_exptl_crystal.density_percent_sol   70 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'PROTEIN WAS CRYSTALLIZED FROM 40% PEG 200, 150 MM MES, PH 7.4, AND CRYSTALS WERE SOAKED IN 1 MM OF INHIBITOR SOLUTION' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2007-11-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.934 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-1 
_diffrn_source.pdbx_wavelength             0.934 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2W6C 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             39.68 
_reflns.d_resolution_high            2.69 
_reflns.number_obs                   26745 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.12 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.50 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.4 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.80 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.05 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        6.4 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2W6C 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     26745 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.68 
_refine.ls_d_res_high                            2.69 
_refine.ls_percent_reflns_obs                    99.9 
_refine.ls_R_factor_obs                          0.188 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.185 
_refine.ls_R_factor_R_free                       0.235 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.200 
_refine.ls_number_reflns_R_free                  1456 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.943 
_refine.correlation_coeff_Fo_to_Fc_free          0.910 
_refine.B_iso_mean                               33.37 
_refine.aniso_B[1][1]                            0.03000 
_refine.aniso_B[2][2]                            0.03000 
_refine.aniso_B[3][3]                            -0.05000 
_refine.aniso_B[1][2]                            0.02000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'LOCAL MODEL DERIVED FROM PDB ENTRY 1EA5' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.348 
_refine.pdbx_overall_ESU_R_Free                  0.261 
_refine.overall_SU_ML                            0.167 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             8.060 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4171 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         82 
_refine_hist.number_atoms_solvent             115 
_refine_hist.number_atoms_total               4368 
_refine_hist.d_res_high                       2.69 
_refine_hist.d_res_low                        39.68 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.019  0.022  ? 4382 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          2.112  1.957  ? 5954 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.459  5.000  ? 526  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       32.624 23.959 ? 197  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.162 15.000 ? 686  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       15.689 15.000 ? 21   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.137  0.200  ? 634  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.009  0.021  ? 3343 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.800  1.500  ? 2626 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.548  2.000  ? 4239 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.465  3.000  ? 1756 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.898  4.500  ? 1715 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.69 
_refine_ls_shell.d_res_low                        2.76 
_refine_ls_shell.number_reflns_R_work             1917 
_refine_ls_shell.R_factor_R_work                  0.2590 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3200 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             121 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2W6C 
_struct.title                     'ACHE IN COMPLEX WITH A BIS-(-)-NOR-MEPTAZINOL DERIVATIVE' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2W6C 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;CATALYTIC TRIAD, SERINE HYDROLASE, ALZHEIMER'S DISEASE, CELL MEMBRANE, CHOLINESTERASE, SERINE ESTERASE, NEUROTRANSMITTER DEGRADATION, MEMBRANE, HYDROLASE, ALTERNATIVE SPLICING, GPI-ANCHOR, GLYCOPROTEIN, CELL JUNCTION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 VAL A 61  ? ARG A 65  ? VAL X 40  ARG X 44  5 ? 5  
HELX_P HELX_P2  AA2 PHE A 99  ? MET A 104 ? PHE X 78  MET X 83  1 ? 6  
HELX_P HELX_P3  AA3 LEU A 148 ? ASN A 152 ? LEU X 127 ASN X 131 5 ? 5  
HELX_P HELX_P4  AA4 GLY A 153 ? GLU A 161 ? GLY X 132 GLU X 140 1 ? 9  
HELX_P HELX_P5  AA5 VAL A 171 ? LEU A 177 ? VAL X 150 LEU X 156 1 ? 7  
HELX_P HELX_P6  AA6 ASN A 188 ? ILE A 205 ? ASN X 167 ILE X 184 1 ? 18 
HELX_P HELX_P7  AA7 GLN A 206 ? PHE A 208 ? GLN X 185 PHE X 187 5 ? 3  
HELX_P HELX_P8  AA8 SER A 221 ? SER A 233 ? SER X 200 SER X 212 1 ? 13 
HELX_P HELX_P9  AA9 SER A 236 ? PHE A 240 ? SER X 215 PHE X 219 5 ? 5  
HELX_P HELX_P10 AB1 SER A 258 ? LEU A 273 ? SER X 237 LEU X 252 1 ? 16 
HELX_P HELX_P11 AB2 SER A 279 ? LYS A 290 ? SER X 258 LYS X 269 1 ? 12 
HELX_P HELX_P12 AB3 LYS A 291 ? GLU A 299 ? LYS X 270 GLU X 278 1 ? 9  
HELX_P HELX_P13 AB4 TRP A 300 ? LEU A 303 ? TRP X 279 LEU X 282 5 ? 4  
HELX_P HELX_P14 AB5 SER A 325 ? GLY A 333 ? SER X 304 GLY X 312 1 ? 9  
HELX_P HELX_P15 AB6 GLY A 349 ? ALA A 357 ? GLY X 328 ALA X 336 1 ? 9  
HELX_P HELX_P16 AB7 SER A 369 ? VAL A 381 ? SER X 348 VAL X 360 1 ? 13 
HELX_P HELX_P17 AB8 ASN A 385 ? THR A 397 ? ASN X 364 THR X 376 1 ? 13 
HELX_P HELX_P18 AB9 ASN A 404 ? VAL A 421 ? ASN X 383 VAL X 400 1 ? 18 
HELX_P HELX_P19 AC1 VAL A 421 ? GLY A 436 ? VAL X 400 GLY X 415 1 ? 16 
HELX_P HELX_P20 AC2 PRO A 454 ? GLY A 458 ? PRO X 433 GLY X 437 5 ? 5  
HELX_P HELX_P21 AC3 GLU A 464 ? PHE A 469 ? GLU X 443 PHE X 448 1 ? 6  
HELX_P HELX_P22 AC4 GLY A 470 ? ASN A 478 ? GLY X 449 ASN X 457 5 ? 9  
HELX_P HELX_P23 AC5 THR A 480 ? GLY A 501 ? THR X 459 GLY X 480 1 ? 22 
HELX_P HELX_P24 AC6 ARG A 538 ? GLN A 547 ? ARG X 517 GLN X 526 1 ? 10 
HELX_P HELX_P25 AC7 GLN A 547 ? THR A 556 ? GLN X 526 THR X 535 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 88  SG  ? ? ? 1_555 A CYS 115 SG ? ? X CYS 67  X CYS 94  1_555 ? ? ? ? ? ? ? 2.079 ? ?               
disulf2 disulf ?    ? A CYS 275 SG  ? ? ? 1_555 A CYS 286 SG ? ? X CYS 254 X CYS 265 1_555 ? ? ? ? ? ? ? 2.061 ? ?               
disulf3 disulf ?    ? A CYS 423 SG  ? ? ? 1_555 A CYS 542 SG ? ? X CYS 402 X CYS 521 1_555 ? ? ? ? ? ? ? 2.025 ? ?               
covale1 covale one  ? A ASN 80  ND2 ? ? ? 1_555 D NAG .   C1 ? ? X ASN 59  X NAG 602 1_555 ? ? ? ? ? ? ? 1.446 ? N-Glycosylation 
covale2 covale one  ? A ASN 437 ND2 ? ? ? 1_555 B NAG .   C1 ? ? X ASN 416 A NAG 1   1_555 ? ? ? ? ? ? ? 1.449 ? N-Glycosylation 
covale3 covale one  ? A ASN 478 ND2 ? ? ? 1_555 E NAG .   C1 ? ? X ASN 457 X NAG 605 1_555 ? ? ? ? ? ? ? 1.476 ? N-Glycosylation 
covale4 covale both ? B NAG .   O4  ? ? ? 1_555 B NAG .   C1 ? ? A NAG 1   A NAG 2   1_555 ? ? ? ? ? ? ? 1.468 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           124 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           X 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    125 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    X 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.50 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 28  ? THR A 31  ? LEU X 7   THR X 10  
AA1 2  GLY A 34  ? MET A 37  ? GLY X 13  MET X 16  
AA1 3  VAL A 78  ? ASN A 80  ? VAL X 57  ASN X 59  
AA2 1  THR A 39  ? PRO A 42  ? THR X 18  PRO X 21  
AA2 2  HIS A 47  ? PRO A 55  ? HIS X 26  PRO X 34  
AA2 3  TYR A 117 ? VAL A 122 ? TYR X 96  VAL X 101 
AA2 4  VAL A 163 ? SER A 166 ? VAL X 142 SER X 145 
AA2 5  THR A 130 ? ILE A 136 ? THR X 109 ILE X 115 
AA2 6  GLY A 210 ? GLU A 220 ? GLY X 189 GLU X 199 
AA2 7  ARG A 242 ? GLN A 246 ? ARG X 221 GLN X 225 
AA2 8  GLN A 339 ? ASN A 345 ? GLN X 318 ASN X 324 
AA2 9  GLY A 438 ? PHE A 444 ? GLY X 417 PHE X 423 
AA2 10 LYS A 522 ? LEU A 526 ? LYS X 501 LEU X 505 
AA2 11 VAL A 533 ? GLN A 535 ? VAL X 512 GLN X 514 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 29  ? N VAL X 8   O VAL A 36  ? O VAL X 15  
AA1 2  3  N MET A 37  ? N MET X 16  O TRP A 79  ? O TRP X 58  
AA2 1  2  N VAL A 41  ? N VAL X 20  O ILE A 48  ? O ILE X 27  
AA2 2  3  N ILE A 54  ? N ILE X 33  O LEU A 118 ? O LEU X 97  
AA2 3  4  N TRP A 121 ? N TRP X 100 O LEU A 164 ? O LEU X 143 
AA2 4  5  O VAL A 165 ? O VAL X 144 N MET A 133 ? N MET X 112 
AA2 5  6  N VAL A 134 ? N VAL X 113 O THR A 216 ? O THR X 195 
AA2 6  7  N GLY A 219 ? N GLY X 198 O GLN A 246 ? O GLN X 225 
AA2 7  8  N LEU A 245 ? N LEU X 224 O LEU A 341 ? O LEU X 320 
AA2 8  9  N VAL A 344 ? N VAL X 323 O PHE A 444 ? O PHE X 423 
AA2 9  10 N PHE A 443 ? N PHE X 422 O ILE A 524 ? O ILE X 503 
AA2 10 11 N PHE A 523 ? N PHE X 502 O HIS A 534 ? O HIS X 513 
# 
_database_PDB_matrix.entry_id          2W6C 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2W6C 
_atom_sites.fract_transf_matrix[1][1]   0.008915 
_atom_sites.fract_transf_matrix[1][2]   0.005147 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010294 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007269 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 25  ? -13.141 88.063 34.746 1.00 51.79 ? 4   SER X N   1 
ATOM   2    C CA  . SER A 1 25  ? -12.507 88.402 36.072 1.00 51.84 ? 4   SER X CA  1 
ATOM   3    C C   . SER A 1 25  ? -11.343 87.460 36.433 1.00 51.26 ? 4   SER X C   1 
ATOM   4    O O   . SER A 1 25  ? -11.409 86.239 36.238 1.00 51.07 ? 4   SER X O   1 
ATOM   5    C CB  . SER A 1 25  ? -13.548 88.403 37.219 1.00 52.03 ? 4   SER X CB  1 
ATOM   6    O OG  . SER A 1 25  ? -12.967 88.766 38.478 1.00 52.60 ? 4   SER X OG  1 
ATOM   7    N N   . GLU A 1 26  ? -10.283 88.055 36.973 1.00 50.38 ? 5   GLU X N   1 
ATOM   8    C CA  . GLU A 1 26  ? -9.161  87.318 37.535 1.00 48.96 ? 5   GLU X CA  1 
ATOM   9    C C   . GLU A 1 26  ? -9.588  86.356 38.662 1.00 47.94 ? 5   GLU X C   1 
ATOM   10   O O   . GLU A 1 26  ? -8.961  85.317 38.845 1.00 47.82 ? 5   GLU X O   1 
ATOM   11   C CB  . GLU A 1 26  ? -8.122  88.291 38.071 1.00 48.73 ? 5   GLU X CB  1 
ATOM   12   C CG  . GLU A 1 26  ? -6.740  87.950 37.637 1.00 50.52 ? 5   GLU X CG  1 
ATOM   13   C CD  . GLU A 1 26  ? -5.733  88.668 38.457 1.00 52.30 ? 5   GLU X CD  1 
ATOM   14   O OE1 . GLU A 1 26  ? -6.092  89.081 39.552 1.00 51.59 ? 5   GLU X OE1 1 
ATOM   15   O OE2 . GLU A 1 26  ? -4.576  88.823 38.029 1.00 57.31 ? 5   GLU X OE2 1 
ATOM   16   N N   . LEU A 1 27  ? -10.632 86.688 39.417 1.00 46.15 ? 6   LEU X N   1 
ATOM   17   C CA  . LEU A 1 27  ? -11.105 85.774 40.433 1.00 44.82 ? 6   LEU X CA  1 
ATOM   18   C C   . LEU A 1 27  ? -12.170 84.761 40.001 1.00 44.57 ? 6   LEU X C   1 
ATOM   19   O O   . LEU A 1 27  ? -12.671 83.979 40.814 1.00 44.89 ? 6   LEU X O   1 
ATOM   20   C CB  . LEU A 1 27  ? -11.591 86.549 41.631 1.00 44.55 ? 6   LEU X CB  1 
ATOM   21   C CG  . LEU A 1 27  ? -10.639 87.640 42.091 1.00 43.54 ? 6   LEU X CG  1 
ATOM   22   C CD1 . LEU A 1 27  ? -11.297 88.347 43.271 1.00 40.22 ? 6   LEU X CD1 1 
ATOM   23   C CD2 . LEU A 1 27  ? -9.254  87.078 42.458 1.00 41.49 ? 6   LEU X CD2 1 
ATOM   24   N N   . LEU A 1 28  ? -12.510 84.727 38.731 1.00 43.83 ? 7   LEU X N   1 
ATOM   25   C CA  . LEU A 1 28  ? -13.452 83.727 38.321 1.00 43.55 ? 7   LEU X CA  1 
ATOM   26   C C   . LEU A 1 28  ? -12.691 82.738 37.477 1.00 42.54 ? 7   LEU X C   1 
ATOM   27   O O   . LEU A 1 28  ? -11.894 83.145 36.642 1.00 42.51 ? 7   LEU X O   1 
ATOM   28   C CB  . LEU A 1 28  ? -14.590 84.354 37.537 1.00 44.03 ? 7   LEU X CB  1 
ATOM   29   C CG  . LEU A 1 28  ? -15.652 83.348 37.104 1.00 46.82 ? 7   LEU X CG  1 
ATOM   30   C CD1 . LEU A 1 28  ? -16.177 82.592 38.320 1.00 48.54 ? 7   LEU X CD1 1 
ATOM   31   C CD2 . LEU A 1 28  ? -16.809 84.066 36.372 1.00 49.64 ? 7   LEU X CD2 1 
ATOM   32   N N   . VAL A 1 29  ? -12.906 81.448 37.715 1.00 41.27 ? 8   VAL X N   1 
ATOM   33   C CA  . VAL A 1 29  ? -12.167 80.410 37.004 1.00 40.35 ? 8   VAL X CA  1 
ATOM   34   C C   . VAL A 1 29  ? -13.114 79.274 36.741 1.00 40.58 ? 8   VAL X C   1 
ATOM   35   O O   . VAL A 1 29  ? -13.778 78.743 37.650 1.00 39.94 ? 8   VAL X O   1 
ATOM   36   C CB  . VAL A 1 29  ? -10.922 79.855 37.792 1.00 39.88 ? 8   VAL X CB  1 
ATOM   37   C CG1 . VAL A 1 29  ? -10.332 78.664 37.095 1.00 38.95 ? 8   VAL X CG1 1 
ATOM   38   C CG2 . VAL A 1 29  ? -9.867  80.892 37.935 1.00 38.88 ? 8   VAL X CG2 1 
ATOM   39   N N   . ASN A 1 30  ? -13.155 78.883 35.480 1.00 41.10 ? 9   ASN X N   1 
ATOM   40   C CA  . ASN A 1 30  ? -14.042 77.823 35.042 1.00 41.86 ? 9   ASN X CA  1 
ATOM   41   C C   . ASN A 1 30  ? -13.243 76.525 35.003 1.00 40.95 ? 9   ASN X C   1 
ATOM   42   O O   . ASN A 1 30  ? -12.149 76.497 34.444 1.00 41.71 ? 9   ASN X O   1 
ATOM   43   C CB  . ASN A 1 30  ? -14.583 78.196 33.663 1.00 42.27 ? 9   ASN X CB  1 
ATOM   44   C CG  . ASN A 1 30  ? -15.602 77.201 33.140 1.00 46.73 ? 9   ASN X CG  1 
ATOM   45   O OD1 . ASN A 1 30  ? -16.431 76.600 33.901 1.00 48.10 ? 9   ASN X OD1 1 
ATOM   46   N ND2 . ASN A 1 30  ? -15.560 77.009 31.814 1.00 49.88 ? 9   ASN X ND2 1 
ATOM   47   N N   . THR A 1 31  ? -13.731 75.462 35.623 1.00 39.59 ? 10  THR X N   1 
ATOM   48   C CA  . THR A 1 31  ? -12.924 74.264 35.633 1.00 39.07 ? 10  THR X CA  1 
ATOM   49   C C   . THR A 1 31  ? -13.748 73.098 35.187 1.00 38.74 ? 10  THR X C   1 
ATOM   50   O O   . THR A 1 31  ? -14.941 73.227 35.023 1.00 38.72 ? 10  THR X O   1 
ATOM   51   C CB  . THR A 1 31  ? -12.405 73.918 37.049 1.00 39.24 ? 10  THR X CB  1 
ATOM   52   O OG1 . THR A 1 31  ? -13.450 73.265 37.780 1.00 40.18 ? 10  THR X OG1 1 
ATOM   53   C CG2 . THR A 1 31  ? -11.929 75.173 37.790 1.00 37.48 ? 10  THR X CG2 1 
ATOM   54   N N   . LYS A 1 32  ? -13.125 71.932 35.051 1.00 38.56 ? 11  LYS X N   1 
ATOM   55   C CA  . LYS A 1 32  ? -13.877 70.759 34.639 1.00 38.04 ? 11  LYS X CA  1 
ATOM   56   C C   . LYS A 1 32  ? -14.989 70.383 35.644 1.00 38.76 ? 11  LYS X C   1 
ATOM   57   O O   . LYS A 1 32  ? -15.939 69.735 35.281 1.00 38.49 ? 11  LYS X O   1 
ATOM   58   C CB  . LYS A 1 32  ? -12.938 69.596 34.301 1.00 37.39 ? 11  LYS X CB  1 
ATOM   59   C CG  . LYS A 1 32  ? -12.074 69.836 33.032 1.00 35.55 ? 11  LYS X CG  1 
ATOM   60   C CD  . LYS A 1 32  ? -10.894 68.878 32.968 1.00 32.55 ? 11  LYS X CD  1 
ATOM   61   C CE  . LYS A 1 32  ? -10.044 69.125 31.751 1.00 32.01 ? 11  LYS X CE  1 
ATOM   62   N NZ  . LYS A 1 32  ? -8.602  68.778 31.902 1.00 29.20 ? 11  LYS X NZ  1 
ATOM   63   N N   . SER A 1 33  ? -14.918 70.822 36.892 1.00 39.87 ? 12  SER X N   1 
ATOM   64   C CA  . SER A 1 33  ? -15.979 70.460 37.829 1.00 41.49 ? 12  SER X CA  1 
ATOM   65   C C   . SER A 1 33  ? -17.049 71.543 37.957 1.00 42.33 ? 12  SER X C   1 
ATOM   66   O O   . SER A 1 33  ? -18.076 71.358 38.661 1.00 42.68 ? 12  SER X O   1 
ATOM   67   C CB  . SER A 1 33  ? -15.397 70.203 39.213 1.00 41.66 ? 12  SER X CB  1 
ATOM   68   O OG  . SER A 1 33  ? -14.454 69.160 39.169 1.00 43.03 ? 12  SER X OG  1 
ATOM   69   N N   . GLY A 1 34  ? -16.807 72.680 37.305 1.00 42.69 ? 13  GLY X N   1 
ATOM   70   C CA  . GLY A 1 34  ? -17.696 73.836 37.459 1.00 43.03 ? 13  GLY X CA  1 
ATOM   71   C C   . GLY A 1 34  ? -16.886 75.102 37.700 1.00 43.14 ? 13  GLY X C   1 
ATOM   72   O O   . GLY A 1 34  ? -15.635 75.028 37.806 1.00 43.02 ? 13  GLY X O   1 
ATOM   73   N N   . LYS A 1 35  ? -17.587 76.251 37.769 1.00 42.64 ? 14  LYS X N   1 
ATOM   74   C CA  . LYS A 1 35  ? -16.933 77.567 37.937 1.00 42.46 ? 14  LYS X CA  1 
ATOM   75   C C   . LYS A 1 35  ? -16.607 77.778 39.422 1.00 41.08 ? 14  LYS X C   1 
ATOM   76   O O   . LYS A 1 35  ? -17.276 77.247 40.300 1.00 41.04 ? 14  LYS X O   1 
ATOM   77   C CB  . LYS A 1 35  ? -17.754 78.736 37.346 1.00 42.44 ? 14  LYS X CB  1 
ATOM   78   C CG  . LYS A 1 35  ? -18.476 78.455 35.994 1.00 46.88 ? 14  LYS X CG  1 
ATOM   79   C CD  . LYS A 1 35  ? -18.785 79.763 35.141 1.00 52.81 ? 14  LYS X CD  1 
ATOM   80   C CE  . LYS A 1 35  ? -20.193 79.761 34.409 1.00 55.72 ? 14  LYS X CE  1 
ATOM   81   N NZ  . LYS A 1 35  ? -21.393 80.263 35.257 1.00 57.67 ? 14  LYS X NZ  1 
ATOM   82   N N   . VAL A 1 36  ? -15.554 78.527 39.701 1.00 39.91 ? 15  VAL X N   1 
ATOM   83   C CA  . VAL A 1 36  ? -15.069 78.671 41.056 1.00 38.53 ? 15  VAL X CA  1 
ATOM   84   C C   . VAL A 1 36  ? -14.781 80.137 41.227 1.00 37.92 ? 15  VAL X C   1 
ATOM   85   O O   . VAL A 1 36  ? -14.223 80.746 40.306 1.00 36.76 ? 15  VAL X O   1 
ATOM   86   C CB  . VAL A 1 36  ? -13.733 77.881 41.217 1.00 38.37 ? 15  VAL X CB  1 
ATOM   87   C CG1 . VAL A 1 36  ? -12.671 78.717 41.874 1.00 39.07 ? 15  VAL X CG1 1 
ATOM   88   C CG2 . VAL A 1 36  ? -13.930 76.588 41.950 1.00 36.62 ? 15  VAL X CG2 1 
ATOM   89   N N   . MET A 1 37  ? -15.118 80.704 42.389 1.00 37.82 ? 16  MET X N   1 
ATOM   90   C CA  . MET A 1 37  ? -14.713 82.105 42.669 1.00 38.61 ? 16  MET X CA  1 
ATOM   91   C C   . MET A 1 37  ? -13.871 82.367 43.917 1.00 38.18 ? 16  MET X C   1 
ATOM   92   O O   . MET A 1 37  ? -14.271 82.063 45.041 1.00 37.64 ? 16  MET X O   1 
ATOM   93   C CB  . MET A 1 37  ? -15.919 83.061 42.695 1.00 39.15 ? 16  MET X CB  1 
ATOM   94   C CG  . MET A 1 37  ? -15.541 84.506 43.098 1.00 41.24 ? 16  MET X CG  1 
ATOM   95   S SD  . MET A 1 37  ? -16.597 85.778 42.324 1.00 51.21 ? 16  MET X SD  1 
ATOM   96   C CE  . MET A 1 37  ? -16.132 85.749 40.563 1.00 45.14 ? 16  MET X CE  1 
ATOM   97   N N   . GLY A 1 38  ? -12.746 83.021 43.713 1.00 38.07 ? 17  GLY X N   1 
ATOM   98   C CA  . GLY A 1 38  ? -11.851 83.300 44.813 1.00 39.33 ? 17  GLY X CA  1 
ATOM   99   C C   . GLY A 1 38  ? -11.997 84.693 45.381 1.00 39.76 ? 17  GLY X C   1 
ATOM   100  O O   . GLY A 1 38  ? -13.058 85.287 45.278 1.00 39.78 ? 17  GLY X O   1 
ATOM   101  N N   . THR A 1 39  ? -10.894 85.199 45.941 1.00 40.39 ? 18  THR X N   1 
ATOM   102  C CA  . THR A 1 39  ? -10.813 86.452 46.681 1.00 41.10 ? 18  THR X CA  1 
ATOM   103  C C   . THR A 1 39  ? -9.392  86.974 46.597 1.00 41.55 ? 18  THR X C   1 
ATOM   104  O O   . THR A 1 39  ? -8.482  86.171 46.613 1.00 42.09 ? 18  THR X O   1 
ATOM   105  C CB  . THR A 1 39  ? -11.113 86.222 48.182 1.00 41.18 ? 18  THR X CB  1 
ATOM   106  O OG1 . THR A 1 39  ? -10.938 87.450 48.869 1.00 41.91 ? 18  THR X OG1 1 
ATOM   107  C CG2 . THR A 1 39  ? -10.115 85.250 48.804 1.00 41.66 ? 18  THR X CG2 1 
ATOM   108  N N   . ARG A 1 40  ? -9.178  88.295 46.509 1.00 42.68 ? 19  ARG X N   1 
ATOM   109  C CA  . ARG A 1 40  ? -7.805  88.865 46.550 1.00 43.60 ? 19  ARG X CA  1 
ATOM   110  C C   . ARG A 1 40  ? -7.314  88.856 47.984 1.00 43.31 ? 19  ARG X C   1 
ATOM   111  O O   . ARG A 1 40  ? -8.093  89.128 48.906 1.00 43.20 ? 19  ARG X O   1 
ATOM   112  C CB  . ARG A 1 40  ? -7.730  90.330 46.110 1.00 44.04 ? 19  ARG X CB  1 
ATOM   113  C CG  . ARG A 1 40  ? -8.038  90.662 44.662 1.00 49.51 ? 19  ARG X CG  1 
ATOM   114  C CD  . ARG A 1 40  ? -7.404  92.043 44.307 1.00 55.87 ? 19  ARG X CD  1 
ATOM   115  N NE  . ARG A 1 40  ? -6.049  91.864 43.771 1.00 61.98 ? 19  ARG X NE  1 
ATOM   116  C CZ  . ARG A 1 40  ? -5.188  92.841 43.462 1.00 64.56 ? 19  ARG X CZ  1 
ATOM   117  N NH1 . ARG A 1 40  ? -5.525  94.132 43.644 1.00 65.32 ? 19  ARG X NH1 1 
ATOM   118  N NH2 . ARG A 1 40  ? -3.974  92.518 42.983 1.00 63.33 ? 19  ARG X NH2 1 
ATOM   119  N N   . VAL A 1 41  ? -6.025  88.583 48.185 1.00 42.73 ? 20  VAL X N   1 
ATOM   120  C CA  . VAL A 1 41  ? -5.466  88.707 49.518 1.00 42.23 ? 20  VAL X CA  1 
ATOM   121  C C   . VAL A 1 41  ? -4.194  89.525 49.484 1.00 41.70 ? 20  VAL X C   1 
ATOM   122  O O   . VAL A 1 41  ? -3.407  89.423 48.548 1.00 40.95 ? 20  VAL X O   1 
ATOM   123  C CB  . VAL A 1 41  ? -5.221  87.313 50.228 1.00 42.53 ? 20  VAL X CB  1 
ATOM   124  C CG1 . VAL A 1 41  ? -6.410  86.395 50.049 1.00 41.18 ? 20  VAL X CG1 1 
ATOM   125  C CG2 . VAL A 1 41  ? -3.959  86.648 49.714 1.00 42.83 ? 20  VAL X CG2 1 
ATOM   126  N N   . PRO A 1 42  ? -3.988  90.344 50.522 1.00 41.69 ? 21  PRO X N   1 
ATOM   127  C CA  . PRO A 1 42  ? -2.770  91.145 50.542 1.00 41.98 ? 21  PRO X CA  1 
ATOM   128  C C   . PRO A 1 42  ? -1.535  90.283 50.944 1.00 42.43 ? 21  PRO X C   1 
ATOM   129  O O   . PRO A 1 42  ? -1.665  89.279 51.705 1.00 42.59 ? 21  PRO X O   1 
ATOM   130  C CB  . PRO A 1 42  ? -3.086  92.223 51.588 1.00 41.23 ? 21  PRO X CB  1 
ATOM   131  C CG  . PRO A 1 42  ? -4.064  91.588 52.512 1.00 41.62 ? 21  PRO X CG  1 
ATOM   132  C CD  . PRO A 1 42  ? -4.708  90.393 51.809 1.00 41.63 ? 21  PRO X CD  1 
ATOM   133  N N   . VAL A 1 43  ? -0.355  90.655 50.442 1.00 41.71 ? 22  VAL X N   1 
ATOM   134  C CA  . VAL A 1 43  ? 0.829   89.861 50.678 1.00 41.63 ? 22  VAL X CA  1 
ATOM   135  C C   . VAL A 1 43  ? 1.970   90.799 50.602 1.00 42.40 ? 22  VAL X C   1 
ATOM   136  O O   . VAL A 1 43  ? 2.200   91.340 49.523 1.00 41.92 ? 22  VAL X O   1 
ATOM   137  C CB  . VAL A 1 43  ? 1.135   88.887 49.507 1.00 41.58 ? 22  VAL X CB  1 
ATOM   138  C CG1 . VAL A 1 43  ? 1.885   87.693 50.015 1.00 39.71 ? 22  VAL X CG1 1 
ATOM   139  C CG2 . VAL A 1 43  ? -0.120  88.503 48.737 1.00 40.94 ? 22  VAL X CG2 1 
ATOM   140  N N   . LEU A 1 44  ? 2.714   90.974 51.698 1.00 43.24 ? 23  LEU X N   1 
ATOM   141  C CA  . LEU A 1 44  ? 3.914   91.804 51.660 1.00 43.67 ? 23  LEU X CA  1 
ATOM   142  C C   . LEU A 1 44  ? 3.666   93.106 50.863 1.00 44.42 ? 23  LEU X C   1 
ATOM   143  O O   . LEU A 1 44  ? 4.405   93.414 49.871 1.00 44.27 ? 23  LEU X O   1 
ATOM   144  C CB  . LEU A 1 44  ? 5.034   91.005 50.991 1.00 43.72 ? 23  LEU X CB  1 
ATOM   145  C CG  . LEU A 1 44  ? 5.733   89.920 51.816 1.00 43.79 ? 23  LEU X CG  1 
ATOM   146  C CD1 . LEU A 1 44  ? 6.932   89.291 51.071 1.00 39.20 ? 23  LEU X CD1 1 
ATOM   147  C CD2 . LEU A 1 44  ? 6.169   90.541 53.182 1.00 42.53 ? 23  LEU X CD2 1 
ATOM   148  N N   . SER A 1 45  ? 2.624   93.859 51.252 1.00 44.45 ? 24  SER X N   1 
ATOM   149  C CA  . SER A 1 45  ? 2.308   95.131 50.545 1.00 44.99 ? 24  SER X CA  1 
ATOM   150  C C   . SER A 1 45  ? 2.028   94.918 49.034 1.00 44.98 ? 24  SER X C   1 
ATOM   151  O O   . SER A 1 45  ? 2.464   95.697 48.178 1.00 45.27 ? 24  SER X O   1 
ATOM   152  C CB  . SER A 1 45  ? 3.483   96.108 50.689 1.00 45.43 ? 24  SER X CB  1 
ATOM   153  O OG  . SER A 1 45  ? 4.503   95.751 49.745 1.00 45.71 ? 24  SER X OG  1 
ATOM   154  N N   . SER A 1 46  ? 1.339   93.829 48.705 1.00 44.36 ? 25  SER X N   1 
ATOM   155  C CA  . SER A 1 46  ? 0.813   93.620 47.358 1.00 42.74 ? 25  SER X CA  1 
ATOM   156  C C   . SER A 1 46  ? -0.436  92.739 47.435 1.00 41.71 ? 25  SER X C   1 
ATOM   157  O O   . SER A 1 46  ? -1.077  92.649 48.496 1.00 40.60 ? 25  SER X O   1 
ATOM   158  C CB  . SER A 1 46  ? 1.880   93.087 46.408 1.00 42.43 ? 25  SER X CB  1 
ATOM   159  O OG  . SER A 1 46  ? 1.276   92.694 45.195 1.00 43.31 ? 25  SER X OG  1 
ATOM   160  N N   . HIS A 1 47  ? -0.815  92.117 46.332 1.00 41.19 ? 26  HIS X N   1 
ATOM   161  C CA  . HIS A 1 47  ? -2.033  91.305 46.367 1.00 42.65 ? 26  HIS X CA  1 
ATOM   162  C C   . HIS A 1 47  ? -1.833  90.034 45.463 1.00 41.36 ? 26  HIS X C   1 
ATOM   163  O O   . HIS A 1 47  ? -1.004  90.071 44.552 1.00 41.68 ? 26  HIS X O   1 
ATOM   164  C CB  . HIS A 1 47  ? -3.307  92.163 46.020 1.00 43.01 ? 26  HIS X CB  1 
ATOM   165  C CG  . HIS A 1 47  ? -3.516  93.393 46.905 1.00 50.04 ? 26  HIS X CG  1 
ATOM   166  N ND1 . HIS A 1 47  ? -4.273  93.379 48.075 1.00 55.24 ? 26  HIS X ND1 1 
ATOM   167  C CD2 . HIS A 1 47  ? -3.099  94.688 46.764 1.00 53.09 ? 26  HIS X CD2 1 
ATOM   168  C CE1 . HIS A 1 47  ? -4.286  94.590 48.624 1.00 53.07 ? 26  HIS X CE1 1 
ATOM   169  N NE2 . HIS A 1 47  ? -3.583  95.402 47.849 1.00 53.53 ? 26  HIS X NE2 1 
ATOM   170  N N   . ILE A 1 48  ? -2.521  88.918 45.755 1.00 39.58 ? 27  ILE X N   1 
ATOM   171  C CA  . ILE A 1 48  ? -2.645  87.771 44.824 1.00 37.93 ? 27  ILE X CA  1 
ATOM   172  C C   . ILE A 1 48  ? -3.998  87.083 44.968 1.00 36.65 ? 27  ILE X C   1 
ATOM   173  O O   . ILE A 1 48  ? -4.780  87.437 45.826 1.00 36.95 ? 27  ILE X O   1 
ATOM   174  C CB  . ILE A 1 48  ? -1.577  86.682 45.006 1.00 38.26 ? 27  ILE X CB  1 
ATOM   175  C CG1 . ILE A 1 48  ? -1.715  86.039 46.359 1.00 38.82 ? 27  ILE X CG1 1 
ATOM   176  C CG2 . ILE A 1 48  ? -0.164  87.219 44.860 1.00 37.75 ? 27  ILE X CG2 1 
ATOM   177  C CD1 . ILE A 1 48  ? -0.646  85.063 46.522 1.00 44.38 ? 27  ILE X CD1 1 
ATOM   178  N N   . SER A 1 49  ? -4.303  86.092 44.151 1.00 35.22 ? 28  SER X N   1 
ATOM   179  C CA  . SER A 1 49  ? -5.622  85.529 44.297 1.00 35.47 ? 28  SER X CA  1 
ATOM   180  C C   . SER A 1 49  ? -5.522  84.261 45.108 1.00 35.32 ? 28  SER X C   1 
ATOM   181  O O   . SER A 1 49  ? -4.481  83.605 45.099 1.00 35.84 ? 28  SER X O   1 
ATOM   182  C CB  . SER A 1 49  ? -6.279  85.240 42.940 1.00 35.72 ? 28  SER X CB  1 
ATOM   183  O OG  . SER A 1 49  ? -5.741  86.057 41.910 1.00 36.76 ? 28  SER X OG  1 
ATOM   184  N N   . ALA A 1 50  ? -6.600  83.927 45.805 1.00 34.57 ? 29  ALA X N   1 
ATOM   185  C CA  . ALA A 1 50  ? -6.709  82.691 46.567 1.00 34.32 ? 29  ALA X CA  1 
ATOM   186  C C   . ALA A 1 50  ? -8.060  82.055 46.271 1.00 34.48 ? 29  ALA X C   1 
ATOM   187  O O   . ALA A 1 50  ? -9.106  82.742 46.263 1.00 34.86 ? 29  ALA X O   1 
ATOM   188  C CB  . ALA A 1 50  ? -6.570  82.959 48.082 1.00 33.78 ? 29  ALA X CB  1 
ATOM   189  N N   . PHE A 1 51  ? -8.038  80.758 45.999 1.00 33.97 ? 30  PHE X N   1 
ATOM   190  C CA  . PHE A 1 51  ? -9.260  79.997 45.802 1.00 33.73 ? 30  PHE X CA  1 
ATOM   191  C C   . PHE A 1 51  ? -9.232  78.982 46.893 1.00 33.79 ? 30  PHE X C   1 
ATOM   192  O O   . PHE A 1 51  ? -8.469  78.029 46.804 1.00 34.66 ? 30  PHE X O   1 
ATOM   193  C CB  . PHE A 1 51  ? -9.246  79.314 44.433 1.00 33.58 ? 30  PHE X CB  1 
ATOM   194  C CG  . PHE A 1 51  ? -9.214  80.301 43.276 1.00 32.78 ? 30  PHE X CG  1 
ATOM   195  C CD1 . PHE A 1 51  ? -8.016  80.903 42.901 1.00 31.23 ? 30  PHE X CD1 1 
ATOM   196  C CD2 . PHE A 1 51  ? -10.394 80.628 42.579 1.00 29.30 ? 30  PHE X CD2 1 
ATOM   197  C CE1 . PHE A 1 51  ? -7.977  81.827 41.854 1.00 32.00 ? 30  PHE X CE1 1 
ATOM   198  C CE2 . PHE A 1 51  ? -10.374 81.521 41.546 1.00 29.18 ? 30  PHE X CE2 1 
ATOM   199  C CZ  . PHE A 1 51  ? -9.170  82.145 41.185 1.00 30.82 ? 30  PHE X CZ  1 
ATOM   200  N N   . LEU A 1 52  ? -10.031 79.187 47.937 1.00 33.08 ? 31  LEU X N   1 
ATOM   201  C CA  . LEU A 1 52  ? -9.893  78.411 49.153 1.00 32.44 ? 31  LEU X CA  1 
ATOM   202  C C   . LEU A 1 52  ? -11.049 77.460 49.304 1.00 32.70 ? 31  LEU X C   1 
ATOM   203  O O   . LEU A 1 52  ? -12.183 77.805 49.009 1.00 33.65 ? 31  LEU X O   1 
ATOM   204  C CB  . LEU A 1 52  ? -9.821  79.349 50.358 1.00 32.06 ? 31  LEU X CB  1 
ATOM   205  C CG  . LEU A 1 52  ? -8.678  80.390 50.230 1.00 32.24 ? 31  LEU X CG  1 
ATOM   206  C CD1 . LEU A 1 52  ? -8.707  81.437 51.350 1.00 28.15 ? 31  LEU X CD1 1 
ATOM   207  C CD2 . LEU A 1 52  ? -7.300  79.713 50.121 1.00 29.45 ? 31  LEU X CD2 1 
ATOM   208  N N   . GLY A 1 53  ? -10.777 76.247 49.762 1.00 32.79 ? 32  GLY X N   1 
ATOM   209  C CA  . GLY A 1 53  ? -11.850 75.320 50.104 1.00 32.06 ? 32  GLY X CA  1 
ATOM   210  C C   . GLY A 1 53  ? -12.601 74.823 48.890 1.00 32.55 ? 32  GLY X C   1 
ATOM   211  O O   . GLY A 1 53  ? -13.814 74.734 48.935 1.00 33.56 ? 32  GLY X O   1 
ATOM   212  N N   . ILE A 1 54  ? -11.888 74.502 47.809 1.00 31.86 ? 33  ILE X N   1 
ATOM   213  C CA  . ILE A 1 54  ? -12.488 73.916 46.638 1.00 31.49 ? 33  ILE X CA  1 
ATOM   214  C C   . ILE A 1 54  ? -12.580 72.422 46.874 1.00 32.19 ? 33  ILE X C   1 
ATOM   215  O O   . ILE A 1 54  ? -11.560 71.820 47.247 1.00 32.86 ? 33  ILE X O   1 
ATOM   216  C CB  . ILE A 1 54  ? -11.544 74.066 45.478 1.00 31.29 ? 33  ILE X CB  1 
ATOM   217  C CG1 . ILE A 1 54  ? -11.383 75.520 45.103 1.00 29.45 ? 33  ILE X CG1 1 
ATOM   218  C CG2 . ILE A 1 54  ? -12.008 73.248 44.308 1.00 30.49 ? 33  ILE X CG2 1 
ATOM   219  C CD1 . ILE A 1 54  ? -10.389 75.729 43.995 1.00 29.69 ? 33  ILE X CD1 1 
ATOM   220  N N   . PRO A 1 55  ? -13.776 71.801 46.650 1.00 32.07 ? 34  PRO X N   1 
ATOM   221  C CA  . PRO A 1 55  ? -13.949 70.332 46.922 1.00 31.07 ? 34  PRO X CA  1 
ATOM   222  C C   . PRO A 1 55  ? -13.250 69.522 45.849 1.00 31.08 ? 34  PRO X C   1 
ATOM   223  O O   . PRO A 1 55  ? -13.225 69.958 44.710 1.00 31.58 ? 34  PRO X O   1 
ATOM   224  C CB  . PRO A 1 55  ? -15.473 70.116 46.777 1.00 30.62 ? 34  PRO X CB  1 
ATOM   225  C CG  . PRO A 1 55  ? -15.917 71.247 45.834 1.00 30.78 ? 34  PRO X CG  1 
ATOM   226  C CD  . PRO A 1 55  ? -15.034 72.440 46.185 1.00 31.13 ? 34  PRO X CD  1 
ATOM   227  N N   . PHE A 1 56  ? -12.716 68.341 46.160 1.00 30.49 ? 35  PHE X N   1 
ATOM   228  C CA  . PHE A 1 56  ? -12.157 67.506 45.097 1.00 28.99 ? 35  PHE X CA  1 
ATOM   229  C C   . PHE A 1 56  ? -12.642 66.084 45.263 1.00 28.74 ? 35  PHE X C   1 
ATOM   230  O O   . PHE A 1 56  ? -12.221 65.206 44.530 1.00 28.85 ? 35  PHE X O   1 
ATOM   231  C CB  . PHE A 1 56  ? -10.618 67.565 45.076 1.00 29.23 ? 35  PHE X CB  1 
ATOM   232  C CG  . PHE A 1 56  ? -9.999  67.074 46.342 1.00 30.22 ? 35  PHE X CG  1 
ATOM   233  C CD1 . PHE A 1 56  ? -9.981  65.711 46.625 1.00 29.34 ? 35  PHE X CD1 1 
ATOM   234  C CD2 . PHE A 1 56  ? -9.518  67.980 47.307 1.00 30.01 ? 35  PHE X CD2 1 
ATOM   235  C CE1 . PHE A 1 56  ? -9.454  65.245 47.841 1.00 31.40 ? 35  PHE X CE1 1 
ATOM   236  C CE2 . PHE A 1 56  ? -8.993  67.532 48.535 1.00 28.31 ? 35  PHE X CE2 1 
ATOM   237  C CZ  . PHE A 1 56  ? -8.946  66.167 48.804 1.00 30.55 ? 35  PHE X CZ  1 
ATOM   238  N N   . ALA A 1 57  ? -13.565 65.850 46.196 1.00 29.06 ? 36  ALA X N   1 
ATOM   239  C CA  . ALA A 1 57  ? -14.153 64.507 46.399 1.00 29.14 ? 36  ALA X CA  1 
ATOM   240  C C   . ALA A 1 57  ? -15.550 64.673 46.958 1.00 30.55 ? 36  ALA X C   1 
ATOM   241  O O   . ALA A 1 57  ? -15.856 65.720 47.545 1.00 31.43 ? 36  ALA X O   1 
ATOM   242  C CB  . ALA A 1 57  ? -13.329 63.721 47.398 1.00 28.45 ? 36  ALA X CB  1 
ATOM   243  N N   . GLU A 1 58  ? -16.381 63.634 46.846 1.00 31.21 ? 37  GLU X N   1 
ATOM   244  C CA  . GLU A 1 58  ? -17.602 63.565 47.610 1.00 31.96 ? 37  GLU X CA  1 
ATOM   245  C C   . GLU A 1 58  ? -17.295 63.539 49.119 1.00 32.80 ? 37  GLU X C   1 
ATOM   246  O O   . GLU A 1 58  ? -16.349 62.866 49.548 1.00 32.20 ? 37  GLU X O   1 
ATOM   247  C CB  . GLU A 1 58  ? -18.356 62.303 47.227 1.00 32.36 ? 37  GLU X CB  1 
ATOM   248  C CG  . GLU A 1 58  ? -19.267 62.433 45.972 1.00 36.56 ? 37  GLU X CG  1 
ATOM   249  C CD  . GLU A 1 58  ? -20.156 63.724 45.950 1.00 38.94 ? 37  GLU X CD  1 
ATOM   250  O OE1 . GLU A 1 58  ? -21.087 63.841 46.789 1.00 35.91 ? 37  GLU X OE1 1 
ATOM   251  O OE2 . GLU A 1 58  ? -19.899 64.620 45.089 1.00 41.18 ? 37  GLU X OE2 1 
ATOM   252  N N   . PRO A 1 59  ? -18.096 64.258 49.949 1.00 33.72 ? 38  PRO X N   1 
ATOM   253  C CA  . PRO A 1 59  ? -17.925 64.103 51.399 1.00 34.36 ? 38  PRO X CA  1 
ATOM   254  C C   . PRO A 1 59  ? -17.909 62.663 51.874 1.00 35.37 ? 38  PRO X C   1 
ATOM   255  O O   . PRO A 1 59  ? -18.891 61.955 51.691 1.00 36.83 ? 38  PRO X O   1 
ATOM   256  C CB  . PRO A 1 59  ? -19.161 64.804 51.944 1.00 33.74 ? 38  PRO X CB  1 
ATOM   257  C CG  . PRO A 1 59  ? -19.294 65.966 51.041 1.00 32.24 ? 38  PRO X CG  1 
ATOM   258  C CD  . PRO A 1 59  ? -19.006 65.382 49.662 1.00 32.82 ? 38  PRO X CD  1 
ATOM   259  N N   . PRO A 1 60  ? -16.813 62.226 52.508 1.00 35.84 ? 39  PRO X N   1 
ATOM   260  C CA  . PRO A 1 60  ? -16.834 60.823 52.918 1.00 36.17 ? 39  PRO X CA  1 
ATOM   261  C C   . PRO A 1 60  ? -17.640 60.573 54.186 1.00 36.88 ? 39  PRO X C   1 
ATOM   262  O O   . PRO A 1 60  ? -17.122 60.019 55.144 1.00 37.13 ? 39  PRO X O   1 
ATOM   263  C CB  . PRO A 1 60  ? -15.338 60.493 53.158 1.00 35.72 ? 39  PRO X CB  1 
ATOM   264  C CG  . PRO A 1 60  ? -14.630 61.807 53.306 1.00 35.70 ? 39  PRO X CG  1 
ATOM   265  C CD  . PRO A 1 60  ? -15.600 62.936 52.964 1.00 35.74 ? 39  PRO X CD  1 
ATOM   266  N N   . VAL A 1 61  ? -18.909 60.940 54.206 1.00 37.87 ? 40  VAL X N   1 
ATOM   267  C CA  . VAL A 1 61  ? -19.699 60.771 55.444 1.00 38.16 ? 40  VAL X CA  1 
ATOM   268  C C   . VAL A 1 61  ? -20.613 59.560 55.406 1.00 38.22 ? 40  VAL X C   1 
ATOM   269  O O   . VAL A 1 61  ? -20.727 58.900 54.391 1.00 37.76 ? 40  VAL X O   1 
ATOM   270  C CB  . VAL A 1 61  ? -20.558 61.995 55.722 1.00 38.20 ? 40  VAL X CB  1 
ATOM   271  C CG1 . VAL A 1 61  ? -19.648 63.236 55.953 1.00 38.10 ? 40  VAL X CG1 1 
ATOM   272  C CG2 . VAL A 1 61  ? -21.533 62.195 54.552 1.00 36.99 ? 40  VAL X CG2 1 
ATOM   273  N N   . GLY A 1 62  ? -21.248 59.277 56.542 1.00 39.04 ? 41  GLY X N   1 
ATOM   274  C CA  . GLY A 1 62  ? -22.223 58.192 56.669 1.00 39.35 ? 41  GLY X CA  1 
ATOM   275  C C   . GLY A 1 62  ? -21.705 56.834 56.280 1.00 40.00 ? 41  GLY X C   1 
ATOM   276  O O   . GLY A 1 62  ? -20.634 56.435 56.710 1.00 41.00 ? 41  GLY X O   1 
ATOM   277  N N   . ASN A 1 63  ? -22.474 56.107 55.481 1.00 40.31 ? 42  ASN X N   1 
ATOM   278  C CA  . ASN A 1 63  ? -22.042 54.795 55.009 1.00 40.78 ? 42  ASN X CA  1 
ATOM   279  C C   . ASN A 1 63  ? -20.734 54.917 54.172 1.00 40.14 ? 42  ASN X C   1 
ATOM   280  O O   . ASN A 1 63  ? -20.206 53.931 53.669 1.00 40.41 ? 42  ASN X O   1 
ATOM   281  C CB  . ASN A 1 63  ? -23.186 54.046 54.248 1.00 40.68 ? 42  ASN X CB  1 
ATOM   282  N N   . MET A 1 64  ? -20.202 56.115 54.020 1.00 39.06 ? 43  MET X N   1 
ATOM   283  C CA  . MET A 1 64  ? -18.963 56.224 53.245 1.00 39.22 ? 43  MET X CA  1 
ATOM   284  C C   . MET A 1 64  ? -17.670 56.321 54.109 1.00 38.53 ? 43  MET X C   1 
ATOM   285  O O   . MET A 1 64  ? -16.555 56.301 53.579 1.00 38.05 ? 43  MET X O   1 
ATOM   286  C CB  . MET A 1 64  ? -19.026 57.385 52.232 1.00 39.72 ? 43  MET X CB  1 
ATOM   287  C CG  . MET A 1 64  ? -19.737 57.106 50.896 1.00 41.97 ? 43  MET X CG  1 
ATOM   288  S SD  . MET A 1 64  ? -19.487 58.562 49.814 1.00 47.69 ? 43  MET X SD  1 
ATOM   289  C CE  . MET A 1 64  ? -20.664 59.738 50.563 1.00 52.39 ? 43  MET X CE  1 
ATOM   290  N N   . ARG A 1 65  ? -17.820 56.432 55.431 1.00 37.78 ? 44  ARG X N   1 
ATOM   291  C CA  . ARG A 1 65  ? -16.677 56.454 56.340 1.00 36.70 ? 44  ARG X CA  1 
ATOM   292  C C   . ARG A 1 65  ? -15.838 55.198 56.151 1.00 36.54 ? 44  ARG X C   1 
ATOM   293  O O   . ARG A 1 65  ? -16.381 54.152 55.893 1.00 36.25 ? 44  ARG X O   1 
ATOM   294  C CB  . ARG A 1 65  ? -17.137 56.576 57.788 1.00 36.57 ? 44  ARG X CB  1 
ATOM   295  C CG  . ARG A 1 65  ? -15.987 56.557 58.765 1.00 35.80 ? 44  ARG X CG  1 
ATOM   296  C CD  . ARG A 1 65  ? -16.451 56.498 60.214 1.00 33.76 ? 44  ARG X CD  1 
ATOM   297  N NE  . ARG A 1 65  ? -17.048 57.748 60.675 1.00 29.42 ? 44  ARG X NE  1 
ATOM   298  C CZ  . ARG A 1 65  ? -17.792 57.840 61.775 1.00 27.73 ? 44  ARG X CZ  1 
ATOM   299  N NH1 . ARG A 1 65  ? -18.049 56.762 62.529 1.00 25.91 ? 44  ARG X NH1 1 
ATOM   300  N NH2 . ARG A 1 65  ? -18.278 59.005 62.125 1.00 25.27 ? 44  ARG X NH2 1 
ATOM   301  N N   . PHE A 1 66  ? -14.513 55.327 56.265 1.00 36.55 ? 45  PHE X N   1 
ATOM   302  C CA  . PHE A 1 66  ? -13.529 54.267 55.943 1.00 36.09 ? 45  PHE X CA  1 
ATOM   303  C C   . PHE A 1 66  ? -13.466 53.886 54.470 1.00 36.48 ? 45  PHE X C   1 
ATOM   304  O O   . PHE A 1 66  ? -12.533 53.161 54.053 1.00 35.97 ? 45  PHE X O   1 
ATOM   305  C CB  . PHE A 1 66  ? -13.648 53.017 56.827 1.00 35.16 ? 45  PHE X CB  1 
ATOM   306  C CG  . PHE A 1 66  ? -13.947 53.324 58.277 1.00 36.93 ? 45  PHE X CG  1 
ATOM   307  C CD1 . PHE A 1 66  ? -13.078 54.094 59.030 1.00 35.56 ? 45  PHE X CD1 1 
ATOM   308  C CD2 . PHE A 1 66  ? -15.120 52.838 58.886 1.00 37.57 ? 45  PHE X CD2 1 
ATOM   309  C CE1 . PHE A 1 66  ? -13.369 54.400 60.340 1.00 38.09 ? 45  PHE X CE1 1 
ATOM   310  C CE2 . PHE A 1 66  ? -15.409 53.119 60.204 1.00 38.11 ? 45  PHE X CE2 1 
ATOM   311  C CZ  . PHE A 1 66  ? -14.541 53.915 60.937 1.00 38.86 ? 45  PHE X CZ  1 
ATOM   312  N N   . ARG A 1 67  ? -14.414 54.386 53.671 1.00 36.96 ? 46  ARG X N   1 
ATOM   313  C CA  . ARG A 1 67  ? -14.389 54.094 52.214 1.00 38.05 ? 46  ARG X CA  1 
ATOM   314  C C   . ARG A 1 67  ? -13.376 54.864 51.336 1.00 37.31 ? 46  ARG X C   1 
ATOM   315  O O   . ARG A 1 67  ? -12.942 55.982 51.664 1.00 36.14 ? 46  ARG X O   1 
ATOM   316  C CB  . ARG A 1 67  ? -15.774 54.237 51.593 1.00 38.76 ? 46  ARG X CB  1 
ATOM   317  C CG  . ARG A 1 67  ? -16.652 53.031 51.759 1.00 41.23 ? 46  ARG X CG  1 
ATOM   318  C CD  . ARG A 1 67  ? -17.029 52.582 50.359 1.00 46.37 ? 46  ARG X CD  1 
ATOM   319  N NE  . ARG A 1 67  ? -18.448 52.253 50.229 1.00 49.80 ? 46  ARG X NE  1 
ATOM   320  N N   . ARG A 1 68  ? -13.004 54.238 50.222 1.00 37.27 ? 47  ARG X N   1 
ATOM   321  C CA  . ARG A 1 68  ? -12.243 54.935 49.206 1.00 37.68 ? 47  ARG X CA  1 
ATOM   322  C C   . ARG A 1 68  ? -13.024 56.165 48.793 1.00 37.23 ? 47  ARG X C   1 
ATOM   323  O O   . ARG A 1 68  ? -14.255 56.120 48.695 1.00 37.01 ? 47  ARG X O   1 
ATOM   324  C CB  . ARG A 1 68  ? -12.022 54.065 47.975 1.00 37.91 ? 47  ARG X CB  1 
ATOM   325  C CG  . ARG A 1 68  ? -11.277 52.793 48.235 1.00 41.93 ? 47  ARG X CG  1 
ATOM   326  C CD  . ARG A 1 68  ? -11.001 52.056 46.877 1.00 49.95 ? 47  ARG X CD  1 
ATOM   327  N NE  . ARG A 1 68  ? -9.904  51.086 47.019 1.00 52.33 ? 47  ARG X NE  1 
ATOM   328  C CZ  . ARG A 1 68  ? -10.065 49.845 47.506 1.00 55.18 ? 47  ARG X CZ  1 
ATOM   329  N NH1 . ARG A 1 68  ? -11.304 49.417 47.870 1.00 51.79 ? 47  ARG X NH1 1 
ATOM   330  N NH2 . ARG A 1 68  ? -8.994  49.025 47.608 1.00 52.46 ? 47  ARG X NH2 1 
ATOM   331  N N   . PRO A 1 69  ? -12.311 57.264 48.504 1.00 37.10 ? 48  PRO X N   1 
ATOM   332  C CA  . PRO A 1 69  ? -13.023 58.448 48.141 1.00 37.32 ? 48  PRO X CA  1 
ATOM   333  C C   . PRO A 1 69  ? -13.525 58.359 46.707 1.00 38.41 ? 48  PRO X C   1 
ATOM   334  O O   . PRO A 1 69  ? -12.958 57.658 45.879 1.00 37.09 ? 48  PRO X O   1 
ATOM   335  C CB  . PRO A 1 69  ? -11.958 59.519 48.255 1.00 36.77 ? 48  PRO X CB  1 
ATOM   336  C CG  . PRO A 1 69  ? -10.683 58.805 47.883 1.00 35.22 ? 48  PRO X CG  1 
ATOM   337  C CD  . PRO A 1 69  ? -10.848 57.423 48.355 1.00 37.02 ? 48  PRO X CD  1 
ATOM   338  N N   . GLU A 1 70  ? -14.590 59.108 46.465 1.00 40.37 ? 49  GLU X N   1 
ATOM   339  C CA  . GLU A 1 70  ? -15.315 59.187 45.216 1.00 42.36 ? 49  GLU X CA  1 
ATOM   340  C C   . GLU A 1 70  ? -15.097 60.612 44.712 1.00 41.96 ? 49  GLU X C   1 
ATOM   341  O O   . GLU A 1 70  ? -15.012 61.551 45.523 1.00 41.44 ? 49  GLU X O   1 
ATOM   342  C CB  . GLU A 1 70  ? -16.811 59.005 45.521 1.00 43.24 ? 49  GLU X CB  1 
ATOM   343  C CG  . GLU A 1 70  ? -17.473 57.880 44.733 1.00 49.88 ? 49  GLU X CG  1 
ATOM   344  C CD  . GLU A 1 70  ? -17.168 56.485 45.293 1.00 57.44 ? 49  GLU X CD  1 
ATOM   345  O OE1 . GLU A 1 70  ? -16.260 55.770 44.750 1.00 57.50 ? 49  GLU X OE1 1 
ATOM   346  O OE2 . GLU A 1 70  ? -17.847 56.125 46.295 1.00 61.56 ? 49  GLU X OE2 1 
ATOM   347  N N   . PRO A 1 71  ? -15.023 60.776 43.379 1.00 42.03 ? 50  PRO X N   1 
ATOM   348  C CA  . PRO A 1 71  ? -14.902 62.075 42.672 1.00 42.29 ? 50  PRO X CA  1 
ATOM   349  C C   . PRO A 1 71  ? -16.093 62.974 43.009 1.00 43.38 ? 50  PRO X C   1 
ATOM   350  O O   . PRO A 1 71  ? -17.215 62.475 43.118 1.00 43.00 ? 50  PRO X O   1 
ATOM   351  C CB  . PRO A 1 71  ? -14.952 61.700 41.186 1.00 41.76 ? 50  PRO X CB  1 
ATOM   352  C CG  . PRO A 1 71  ? -15.086 60.203 41.113 1.00 41.55 ? 50  PRO X CG  1 
ATOM   353  C CD  . PRO A 1 71  ? -15.241 59.623 42.482 1.00 41.74 ? 50  PRO X CD  1 
ATOM   354  N N   . LYS A 1 72  ? -15.866 64.273 43.202 1.00 44.91 ? 51  LYS X N   1 
ATOM   355  C CA  . LYS A 1 72  ? -16.952 65.178 43.595 1.00 46.49 ? 51  LYS X CA  1 
ATOM   356  C C   . LYS A 1 72  ? -17.912 65.367 42.422 1.00 48.33 ? 51  LYS X C   1 
ATOM   357  O O   . LYS A 1 72  ? -17.479 65.761 41.341 1.00 48.66 ? 51  LYS X O   1 
ATOM   358  C CB  . LYS A 1 72  ? -16.364 66.531 43.978 1.00 45.82 ? 51  LYS X CB  1 
ATOM   359  C CG  . LYS A 1 72  ? -17.340 67.692 44.029 1.00 45.20 ? 51  LYS X CG  1 
ATOM   360  C CD  . LYS A 1 72  ? -18.320 67.573 45.194 1.00 44.30 ? 51  LYS X CD  1 
ATOM   361  C CE  . LYS A 1 72  ? -18.937 68.915 45.565 1.00 43.21 ? 51  LYS X CE  1 
ATOM   362  N NZ  . LYS A 1 72  ? -19.827 68.736 46.770 1.00 43.20 ? 51  LYS X NZ  1 
ATOM   363  N N   . LYS A 1 73  ? -19.205 65.113 42.620 1.00 49.97 ? 52  LYS X N   1 
ATOM   364  C CA  . LYS A 1 73  ? -20.190 65.437 41.589 1.00 52.01 ? 52  LYS X CA  1 
ATOM   365  C C   . LYS A 1 73  ? -20.105 66.924 41.214 1.00 52.95 ? 52  LYS X C   1 
ATOM   366  O O   . LYS A 1 73  ? -20.178 67.804 42.090 1.00 52.92 ? 52  LYS X O   1 
ATOM   367  C CB  . LYS A 1 73  ? -21.597 65.097 42.068 1.00 52.15 ? 52  LYS X CB  1 
ATOM   368  C CG  . LYS A 1 73  ? -21.633 63.763 42.789 1.00 55.48 ? 52  LYS X CG  1 
ATOM   369  C CD  . LYS A 1 73  ? -23.051 63.169 42.981 1.00 59.80 ? 52  LYS X CD  1 
ATOM   370  C CE  . LYS A 1 73  ? -22.993 61.608 42.905 1.00 61.24 ? 52  LYS X CE  1 
ATOM   371  N NZ  . LYS A 1 73  ? -23.768 60.916 44.006 1.00 61.45 ? 52  LYS X NZ  1 
ATOM   372  N N   . PRO A 1 74  ? -19.975 67.222 39.905 1.00 53.99 ? 53  PRO X N   1 
ATOM   373  C CA  . PRO A 1 74  ? -19.904 68.655 39.590 1.00 54.59 ? 53  PRO X CA  1 
ATOM   374  C C   . PRO A 1 74  ? -21.129 69.435 40.077 1.00 54.74 ? 53  PRO X C   1 
ATOM   375  O O   . PRO A 1 74  ? -22.165 68.874 40.446 1.00 53.75 ? 53  PRO X O   1 
ATOM   376  C CB  . PRO A 1 74  ? -19.781 68.680 38.050 1.00 54.40 ? 53  PRO X CB  1 
ATOM   377  C CG  . PRO A 1 74  ? -19.244 67.282 37.705 1.00 54.18 ? 53  PRO X CG  1 
ATOM   378  C CD  . PRO A 1 74  ? -19.990 66.402 38.677 1.00 53.81 ? 53  PRO X CD  1 
ATOM   379  N N   . TRP A 1 75  ? -20.987 70.741 40.113 1.00 55.43 ? 54  TRP X N   1 
ATOM   380  C CA  . TRP A 1 75  ? -22.082 71.550 40.585 1.00 56.18 ? 54  TRP X CA  1 
ATOM   381  C C   . TRP A 1 75  ? -22.315 72.605 39.506 1.00 56.46 ? 54  TRP X C   1 
ATOM   382  O O   . TRP A 1 75  ? -21.439 72.866 38.668 1.00 56.32 ? 54  TRP X O   1 
ATOM   383  C CB  . TRP A 1 75  ? -21.668 72.214 41.889 1.00 56.08 ? 54  TRP X CB  1 
ATOM   384  C CG  . TRP A 1 75  ? -20.422 72.969 41.676 1.00 55.51 ? 54  TRP X CG  1 
ATOM   385  C CD1 . TRP A 1 75  ? -20.315 74.272 41.258 1.00 55.53 ? 54  TRP X CD1 1 
ATOM   386  C CD2 . TRP A 1 75  ? -19.086 72.461 41.777 1.00 54.74 ? 54  TRP X CD2 1 
ATOM   387  N NE1 . TRP A 1 75  ? -18.990 74.610 41.127 1.00 56.31 ? 54  TRP X NE1 1 
ATOM   388  C CE2 . TRP A 1 75  ? -18.214 73.517 41.443 1.00 55.38 ? 54  TRP X CE2 1 
ATOM   389  C CE3 . TRP A 1 75  ? -18.538 71.223 42.135 1.00 53.98 ? 54  TRP X CE3 1 
ATOM   390  C CZ2 . TRP A 1 75  ? -16.821 73.371 41.465 1.00 53.61 ? 54  TRP X CZ2 1 
ATOM   391  C CZ3 . TRP A 1 75  ? -17.150 71.083 42.159 1.00 52.74 ? 54  TRP X CZ3 1 
ATOM   392  C CH2 . TRP A 1 75  ? -16.313 72.149 41.829 1.00 53.30 ? 54  TRP X CH2 1 
ATOM   393  N N   . SER A 1 76  ? -23.496 73.204 39.490 1.00 56.90 ? 55  SER X N   1 
ATOM   394  C CA  . SER A 1 76  ? -23.586 74.468 38.751 1.00 57.22 ? 55  SER X CA  1 
ATOM   395  C C   . SER A 1 76  ? -23.788 75.654 39.676 1.00 56.40 ? 55  SER X C   1 
ATOM   396  O O   . SER A 1 76  ? -23.982 75.519 40.914 1.00 56.52 ? 55  SER X O   1 
ATOM   397  C CB  . SER A 1 76  ? -24.553 74.473 37.539 1.00 57.52 ? 55  SER X CB  1 
ATOM   398  O OG  . SER A 1 76  ? -25.669 73.622 37.745 1.00 58.54 ? 55  SER X OG  1 
ATOM   399  N N   . GLY A 1 77  ? -23.695 76.819 39.049 1.00 55.01 ? 56  GLY X N   1 
ATOM   400  C CA  . GLY A 1 77  ? -23.497 78.030 39.792 1.00 52.69 ? 56  GLY X CA  1 
ATOM   401  C C   . GLY A 1 77  ? -22.007 78.119 40.025 1.00 51.05 ? 56  GLY X C   1 
ATOM   402  O O   . GLY A 1 77  ? -21.226 77.323 39.485 1.00 50.71 ? 56  GLY X O   1 
ATOM   403  N N   . VAL A 1 78  ? -21.652 79.076 40.869 1.00 48.99 ? 57  VAL X N   1 
ATOM   404  C CA  . VAL A 1 78  ? -20.315 79.517 41.106 1.00 47.07 ? 57  VAL X CA  1 
ATOM   405  C C   . VAL A 1 78  ? -19.953 79.082 42.515 1.00 46.13 ? 57  VAL X C   1 
ATOM   406  O O   . VAL A 1 78  ? -20.658 79.464 43.453 1.00 45.67 ? 57  VAL X O   1 
ATOM   407  C CB  . VAL A 1 78  ? -20.308 81.046 41.074 1.00 47.11 ? 57  VAL X CB  1 
ATOM   408  C CG1 . VAL A 1 78  ? -19.065 81.578 41.696 1.00 46.69 ? 57  VAL X CG1 1 
ATOM   409  C CG2 . VAL A 1 78  ? -20.483 81.550 39.640 1.00 47.40 ? 57  VAL X CG2 1 
ATOM   410  N N   . TRP A 1 79  ? -18.865 78.295 42.671 1.00 44.83 ? 58  TRP X N   1 
ATOM   411  C CA  . TRP A 1 79  ? -18.412 77.834 44.001 1.00 42.43 ? 58  TRP X CA  1 
ATOM   412  C C   . TRP A 1 79  ? -17.741 78.982 44.752 1.00 41.67 ? 58  TRP X C   1 
ATOM   413  O O   . TRP A 1 79  ? -16.880 79.672 44.213 1.00 40.89 ? 58  TRP X O   1 
ATOM   414  C CB  . TRP A 1 79  ? -17.504 76.571 43.935 1.00 42.26 ? 58  TRP X CB  1 
ATOM   415  C CG  . TRP A 1 79  ? -17.203 76.064 45.308 1.00 39.16 ? 58  TRP X CG  1 
ATOM   416  C CD1 . TRP A 1 79  ? -16.259 76.550 46.164 1.00 36.46 ? 58  TRP X CD1 1 
ATOM   417  C CD2 . TRP A 1 79  ? -17.905 75.049 46.020 1.00 37.79 ? 58  TRP X CD2 1 
ATOM   418  N NE1 . TRP A 1 79  ? -16.332 75.911 47.367 1.00 36.83 ? 58  TRP X NE1 1 
ATOM   419  C CE2 . TRP A 1 79  ? -17.329 74.974 47.312 1.00 38.16 ? 58  TRP X CE2 1 
ATOM   420  C CE3 . TRP A 1 79  ? -18.945 74.178 45.691 1.00 38.80 ? 58  TRP X CE3 1 
ATOM   421  C CZ2 . TRP A 1 79  ? -17.765 74.065 48.284 1.00 37.46 ? 58  TRP X CZ2 1 
ATOM   422  C CZ3 . TRP A 1 79  ? -19.392 73.264 46.665 1.00 39.59 ? 58  TRP X CZ3 1 
ATOM   423  C CH2 . TRP A 1 79  ? -18.797 73.225 47.948 1.00 39.42 ? 58  TRP X CH2 1 
ATOM   424  N N   . ASN A 1 80  ? -18.169 79.204 45.988 1.00 41.55 ? 59  ASN X N   1 
ATOM   425  C CA  . ASN A 1 80  ? -17.610 80.277 46.800 1.00 42.37 ? 59  ASN X CA  1 
ATOM   426  C C   . ASN A 1 80  ? -16.295 79.768 47.409 1.00 41.45 ? 59  ASN X C   1 
ATOM   427  O O   . ASN A 1 80  ? -16.309 79.055 48.410 1.00 41.65 ? 59  ASN X O   1 
ATOM   428  C CB  . ASN A 1 80  ? -18.635 80.682 47.878 1.00 42.89 ? 59  ASN X CB  1 
ATOM   429  C CG  . ASN A 1 80  ? -18.259 81.986 48.637 1.00 47.94 ? 59  ASN X CG  1 
ATOM   430  O OD1 . ASN A 1 80  ? -17.127 82.480 48.511 1.00 49.96 ? 59  ASN X OD1 1 
ATOM   431  N ND2 . ASN A 1 80  ? -19.243 82.526 49.470 1.00 52.28 ? 59  ASN X ND2 1 
ATOM   432  N N   . ALA A 1 81  ? -15.159 80.092 46.789 1.00 40.28 ? 60  ALA X N   1 
ATOM   433  C CA  . ALA A 1 81  ? -13.852 79.686 47.336 1.00 38.91 ? 60  ALA X CA  1 
ATOM   434  C C   . ALA A 1 81  ? -13.189 80.875 47.957 1.00 38.87 ? 60  ALA X C   1 
ATOM   435  O O   . ALA A 1 81  ? -12.030 81.195 47.632 1.00 38.06 ? 60  ALA X O   1 
ATOM   436  C CB  . ALA A 1 81  ? -12.944 79.096 46.278 1.00 38.57 ? 60  ALA X CB  1 
ATOM   437  N N   . SER A 1 82  ? -13.931 81.552 48.837 1.00 38.82 ? 61  SER X N   1 
ATOM   438  C CA  . SER A 1 82  ? -13.397 82.753 49.463 1.00 39.12 ? 61  SER X CA  1 
ATOM   439  C C   . SER A 1 82  ? -12.915 82.510 50.904 1.00 38.79 ? 61  SER X C   1 
ATOM   440  O O   . SER A 1 82  ? -12.125 83.323 51.425 1.00 39.01 ? 61  SER X O   1 
ATOM   441  C CB  . SER A 1 82  ? -14.402 83.901 49.390 1.00 39.05 ? 61  SER X CB  1 
ATOM   442  O OG  . SER A 1 82  ? -15.552 83.584 50.159 1.00 40.86 ? 61  SER X OG  1 
ATOM   443  N N   . THR A 1 83  ? -13.364 81.403 51.528 1.00 37.64 ? 62  THR X N   1 
ATOM   444  C CA  . THR A 1 83  ? -12.834 81.028 52.837 1.00 37.37 ? 62  THR X CA  1 
ATOM   445  C C   . THR A 1 83  ? -12.339 79.584 53.017 1.00 36.68 ? 62  THR X C   1 
ATOM   446  O O   . THR A 1 83  ? -12.788 78.664 52.341 1.00 36.34 ? 62  THR X O   1 
ATOM   447  C CB  . THR A 1 83  ? -13.838 81.333 53.937 1.00 38.38 ? 62  THR X CB  1 
ATOM   448  O OG1 . THR A 1 83  ? -15.064 80.630 53.665 1.00 36.77 ? 62  THR X OG1 1 
ATOM   449  C CG2 . THR A 1 83  ? -14.055 82.911 54.078 1.00 39.09 ? 62  THR X CG2 1 
ATOM   450  N N   . TYR A 1 84  ? -11.423 79.413 53.970 1.00 35.46 ? 63  TYR X N   1 
ATOM   451  C CA  . TYR A 1 84  ? -10.836 78.115 54.285 1.00 33.94 ? 63  TYR X CA  1 
ATOM   452  C C   . TYR A 1 84  ? -11.907 77.129 54.625 1.00 33.61 ? 63  TYR X C   1 
ATOM   453  O O   . TYR A 1 84  ? -12.869 77.493 55.235 1.00 34.66 ? 63  TYR X O   1 
ATOM   454  C CB  . TYR A 1 84  ? -9.961  78.224 55.506 1.00 32.83 ? 63  TYR X CB  1 
ATOM   455  C CG  . TYR A 1 84  ? -8.555  78.554 55.197 1.00 32.23 ? 63  TYR X CG  1 
ATOM   456  C CD1 . TYR A 1 84  ? -7.951  78.058 54.046 1.00 32.97 ? 63  TYR X CD1 1 
ATOM   457  C CD2 . TYR A 1 84  ? -7.788  79.339 56.076 1.00 31.06 ? 63  TYR X CD2 1 
ATOM   458  C CE1 . TYR A 1 84  ? -6.593  78.342 53.757 1.00 32.50 ? 63  TYR X CE1 1 
ATOM   459  C CE2 . TYR A 1 84  ? -6.442  79.636 55.810 1.00 30.92 ? 63  TYR X CE2 1 
ATOM   460  C CZ  . TYR A 1 84  ? -5.852  79.126 54.651 1.00 33.51 ? 63  TYR X CZ  1 
ATOM   461  O OH  . TYR A 1 84  ? -4.535  79.400 54.380 1.00 34.85 ? 63  TYR X OH  1 
ATOM   462  N N   . PRO A 1 85  ? -11.697 75.852 54.279 1.00 33.02 ? 64  PRO X N   1 
ATOM   463  C CA  . PRO A 1 85  ? -12.585 74.737 54.501 1.00 31.87 ? 64  PRO X CA  1 
ATOM   464  C C   . PRO A 1 85  ? -12.473 74.232 55.932 1.00 31.76 ? 64  PRO X C   1 
ATOM   465  O O   . PRO A 1 85  ? -11.587 74.647 56.654 1.00 30.95 ? 64  PRO X O   1 
ATOM   466  C CB  . PRO A 1 85  ? -11.993 73.680 53.578 1.00 31.64 ? 64  PRO X CB  1 
ATOM   467  C CG  . PRO A 1 85  ? -10.516 73.959 53.641 1.00 31.46 ? 64  PRO X CG  1 
ATOM   468  C CD  . PRO A 1 85  ? -10.416 75.427 53.657 1.00 32.66 ? 64  PRO X CD  1 
ATOM   469  N N   . ASN A 1 86  ? -13.353 73.319 56.337 1.00 32.06 ? 65  ASN X N   1 
ATOM   470  C CA  . ASN A 1 86  ? -13.135 72.592 57.575 1.00 32.79 ? 65  ASN X CA  1 
ATOM   471  C C   . ASN A 1 86  ? -11.837 71.748 57.594 1.00 32.30 ? 65  ASN X C   1 
ATOM   472  O O   . ASN A 1 86  ? -11.248 71.402 56.552 1.00 31.99 ? 65  ASN X O   1 
ATOM   473  C CB  . ASN A 1 86  ? -14.284 71.641 57.860 1.00 34.14 ? 65  ASN X CB  1 
ATOM   474  C CG  . ASN A 1 86  ? -15.678 72.300 57.761 1.00 36.68 ? 65  ASN X CG  1 
ATOM   475  O OD1 . ASN A 1 86  ? -15.995 73.295 58.440 1.00 37.08 ? 65  ASN X OD1 1 
ATOM   476  N ND2 . ASN A 1 86  ? -16.537 71.680 56.955 1.00 37.60 ? 65  ASN X ND2 1 
ATOM   477  N N   . ASN A 1 87  ? -11.397 71.412 58.800 1.00 31.21 ? 66  ASN X N   1 
ATOM   478  C CA  . ASN A 1 87  ? -10.275 70.526 58.965 1.00 30.00 ? 66  ASN X CA  1 
ATOM   479  C C   . ASN A 1 87  ? -10.856 69.124 59.228 1.00 30.08 ? 66  ASN X C   1 
ATOM   480  O O   . ASN A 1 87  ? -11.948 69.014 59.829 1.00 28.80 ? 66  ASN X O   1 
ATOM   481  C CB  . ASN A 1 87  ? -9.436  70.970 60.148 1.00 29.60 ? 66  ASN X CB  1 
ATOM   482  C CG  . ASN A 1 87  ? -8.944  72.430 60.035 1.00 31.13 ? 66  ASN X CG  1 
ATOM   483  O OD1 . ASN A 1 87  ? -8.806  73.137 61.064 1.00 32.53 ? 66  ASN X OD1 1 
ATOM   484  N ND2 . ASN A 1 87  ? -8.636  72.872 58.816 1.00 30.45 ? 66  ASN X ND2 1 
ATOM   485  N N   . CYS A 1 88  ? -10.162 68.059 58.779 1.00 29.65 ? 67  CYS X N   1 
ATOM   486  C CA  . CYS A 1 88  ? -10.631 66.729 59.109 1.00 30.38 ? 67  CYS X CA  1 
ATOM   487  C C   . CYS A 1 88  ? -10.644 66.455 60.601 1.00 30.57 ? 67  CYS X C   1 
ATOM   488  O O   . CYS A 1 88  ? -9.789  66.950 61.330 1.00 30.65 ? 67  CYS X O   1 
ATOM   489  C CB  . CYS A 1 88  ? -9.810  65.669 58.415 1.00 30.54 ? 67  CYS X CB  1 
ATOM   490  S SG  . CYS A 1 88  ? -9.819  65.853 56.640 1.00 33.21 ? 67  CYS X SG  1 
ATOM   491  N N   . GLN A 1 89  ? -11.604 65.638 61.039 1.00 30.78 ? 68  GLN X N   1 
ATOM   492  C CA  . GLN A 1 89  ? -11.673 65.158 62.419 1.00 31.33 ? 68  GLN X CA  1 
ATOM   493  C C   . GLN A 1 89  ? -10.350 64.600 62.897 1.00 30.96 ? 68  GLN X C   1 
ATOM   494  O O   . GLN A 1 89  ? -9.795  63.716 62.251 1.00 30.97 ? 68  GLN X O   1 
ATOM   495  C CB  . GLN A 1 89  ? -12.700 64.038 62.520 1.00 31.47 ? 68  GLN X CB  1 
ATOM   496  C CG  . GLN A 1 89  ? -14.093 64.533 62.293 1.00 33.94 ? 68  GLN X CG  1 
ATOM   497  C CD  . GLN A 1 89  ? -14.700 65.244 63.491 1.00 36.29 ? 68  GLN X CD  1 
ATOM   498  O OE1 . GLN A 1 89  ? -15.918 65.359 63.576 1.00 41.75 ? 68  GLN X OE1 1 
ATOM   499  N NE2 . GLN A 1 89  ? -13.877 65.716 64.410 1.00 35.72 ? 68  GLN X NE2 1 
ATOM   500  N N   . GLN A 1 90  ? -9.849  65.095 64.024 1.00 30.48 ? 69  GLN X N   1 
ATOM   501  C CA  . GLN A 1 90  ? -8.550  64.630 64.514 1.00 29.79 ? 69  GLN X CA  1 
ATOM   502  C C   . GLN A 1 90  ? -8.350  64.789 66.033 1.00 29.87 ? 69  GLN X C   1 
ATOM   503  O O   . GLN A 1 90  ? -9.056  65.541 66.694 1.00 29.36 ? 69  GLN X O   1 
ATOM   504  C CB  . GLN A 1 90  ? -7.431  65.348 63.771 1.00 29.17 ? 69  GLN X CB  1 
ATOM   505  C CG  . GLN A 1 90  ? -7.434  66.862 63.940 1.00 28.23 ? 69  GLN X CG  1 
ATOM   506  C CD  . GLN A 1 90  ? -6.468  67.549 62.971 1.00 28.98 ? 69  GLN X CD  1 
ATOM   507  O OE1 . GLN A 1 90  ? -5.295  67.824 63.303 1.00 30.25 ? 69  GLN X OE1 1 
ATOM   508  N NE2 . GLN A 1 90  ? -6.946  67.796 61.752 1.00 24.95 ? 69  GLN X NE2 1 
ATOM   509  N N   . TYR A 1 91  ? -7.363  64.080 66.569 1.00 29.76 ? 70  TYR X N   1 
ATOM   510  C CA  . TYR A 1 91  ? -6.977  64.252 67.947 1.00 29.65 ? 70  TYR X CA  1 
ATOM   511  C C   . TYR A 1 91  ? -6.384  65.634 68.143 1.00 29.97 ? 70  TYR X C   1 
ATOM   512  O O   . TYR A 1 91  ? -5.654  66.101 67.280 1.00 30.96 ? 70  TYR X O   1 
ATOM   513  C CB  . TYR A 1 91  ? -5.986  63.190 68.309 1.00 29.41 ? 70  TYR X CB  1 
ATOM   514  C CG  . TYR A 1 91  ? -5.374  63.411 69.640 1.00 32.52 ? 70  TYR X CG  1 
ATOM   515  C CD1 . TYR A 1 91  ? -5.956  62.869 70.799 1.00 31.94 ? 70  TYR X CD1 1 
ATOM   516  C CD2 . TYR A 1 91  ? -4.193  64.176 69.761 1.00 32.90 ? 70  TYR X CD2 1 
ATOM   517  C CE1 . TYR A 1 91  ? -5.388  63.082 72.023 1.00 32.13 ? 70  TYR X CE1 1 
ATOM   518  C CE2 . TYR A 1 91  ? -3.619  64.392 70.988 1.00 32.73 ? 70  TYR X CE2 1 
ATOM   519  C CZ  . TYR A 1 91  ? -4.217  63.843 72.107 1.00 34.45 ? 70  TYR X CZ  1 
ATOM   520  O OH  . TYR A 1 91  ? -3.625  64.067 73.319 1.00 39.28 ? 70  TYR X OH  1 
ATOM   521  N N   . VAL A 1 92  ? -6.719  66.319 69.242 1.00 29.27 ? 71  VAL X N   1 
ATOM   522  C CA  . VAL A 1 92  ? -6.313  67.734 69.416 1.00 28.06 ? 71  VAL X CA  1 
ATOM   523  C C   . VAL A 1 92  ? -5.307  67.796 70.576 1.00 29.38 ? 71  VAL X C   1 
ATOM   524  O O   . VAL A 1 92  ? -5.592  67.264 71.676 1.00 30.18 ? 71  VAL X O   1 
ATOM   525  C CB  . VAL A 1 92  ? -7.574  68.651 69.705 1.00 27.53 ? 71  VAL X CB  1 
ATOM   526  C CG1 . VAL A 1 92  ? -7.200  70.034 70.165 1.00 24.46 ? 71  VAL X CG1 1 
ATOM   527  C CG2 . VAL A 1 92  ? -8.529  68.681 68.526 1.00 24.00 ? 71  VAL X CG2 1 
ATOM   528  N N   . ASP A 1 93  ? -4.127  68.392 70.342 1.00 30.05 ? 72  ASP X N   1 
ATOM   529  C CA  . ASP A 1 93  ? -3.072  68.501 71.369 1.00 30.39 ? 72  ASP X CA  1 
ATOM   530  C C   . ASP A 1 93  ? -3.506  69.488 72.445 1.00 31.13 ? 72  ASP X C   1 
ATOM   531  O O   . ASP A 1 93  ? -3.795  70.625 72.152 1.00 30.06 ? 72  ASP X O   1 
ATOM   532  C CB  . ASP A 1 93  ? -1.790  69.014 70.738 1.00 30.54 ? 72  ASP X CB  1 
ATOM   533  C CG  . ASP A 1 93  ? -0.621  69.114 71.726 1.00 31.38 ? 72  ASP X CG  1 
ATOM   534  O OD1 . ASP A 1 93  ? -0.718  68.706 72.874 1.00 33.98 ? 72  ASP X OD1 1 
ATOM   535  O OD2 . ASP A 1 93  ? 0.446   69.608 71.362 1.00 34.10 ? 72  ASP X OD2 1 
ATOM   536  N N   . GLU A 1 94  ? -3.554  69.035 73.692 1.00 33.00 ? 73  GLU X N   1 
ATOM   537  C CA  . GLU A 1 94  ? -3.901  69.887 74.831 1.00 34.50 ? 73  GLU X CA  1 
ATOM   538  C C   . GLU A 1 94  ? -2.846  69.762 75.915 1.00 34.82 ? 73  GLU X C   1 
ATOM   539  O O   . GLU A 1 94  ? -3.056  70.151 77.053 1.00 35.20 ? 73  GLU X O   1 
ATOM   540  C CB  . GLU A 1 94  ? -5.275  69.512 75.386 1.00 34.27 ? 73  GLU X CB  1 
ATOM   541  C CG  . GLU A 1 94  ? -6.426  70.019 74.543 1.00 38.15 ? 73  GLU X CG  1 
ATOM   542  C CD  . GLU A 1 94  ? -7.780  69.523 75.053 1.00 44.90 ? 73  GLU X CD  1 
ATOM   543  O OE1 . GLU A 1 94  ? -8.518  68.877 74.275 1.00 47.31 ? 73  GLU X OE1 1 
ATOM   544  O OE2 . GLU A 1 94  ? -8.110  69.768 76.238 1.00 47.68 ? 73  GLU X OE2 1 
ATOM   545  N N   . GLN A 1 95  ? -1.702  69.195 75.580 1.00 35.84 ? 74  GLN X N   1 
ATOM   546  C CA  . GLN A 1 95  ? -0.597  69.240 76.525 1.00 37.00 ? 74  GLN X CA  1 
ATOM   547  C C   . GLN A 1 95  ? -0.265  70.637 77.132 1.00 37.01 ? 74  GLN X C   1 
ATOM   548  O O   . GLN A 1 95  ? 0.079   70.710 78.301 1.00 36.60 ? 74  GLN X O   1 
ATOM   549  C CB  . GLN A 1 95  ? 0.649   68.595 75.922 1.00 37.06 ? 74  GLN X CB  1 
ATOM   550  C CG  . GLN A 1 95  ? 0.929   67.226 76.517 1.00 39.86 ? 74  GLN X CG  1 
ATOM   551  C CD  . GLN A 1 95  ? 1.254   67.318 77.997 1.00 42.98 ? 74  GLN X CD  1 
ATOM   552  O OE1 . GLN A 1 95  ? 2.177   66.681 78.468 1.00 44.23 ? 74  GLN X OE1 1 
ATOM   553  N NE2 . GLN A 1 95  ? 0.508   68.146 78.731 1.00 44.70 ? 74  GLN X NE2 1 
ATOM   554  N N   . PHE A 1 96  ? -0.351  71.722 76.345 1.00 37.05 ? 75  PHE X N   1 
ATOM   555  C CA  . PHE A 1 96  ? 0.022   73.059 76.821 1.00 37.49 ? 75  PHE X CA  1 
ATOM   556  C C   . PHE A 1 96  ? -1.008  74.157 76.488 1.00 38.03 ? 75  PHE X C   1 
ATOM   557  O O   . PHE A 1 96  ? -0.719  75.095 75.697 1.00 36.86 ? 75  PHE X O   1 
ATOM   558  C CB  . PHE A 1 96  ? 1.416   73.451 76.301 1.00 37.55 ? 75  PHE X CB  1 
ATOM   559  C CG  . PHE A 1 96  ? 2.470   72.429 76.601 1.00 37.43 ? 75  PHE X CG  1 
ATOM   560  C CD1 . PHE A 1 96  ? 2.954   72.274 77.901 1.00 35.30 ? 75  PHE X CD1 1 
ATOM   561  C CD2 . PHE A 1 96  ? 2.957   71.581 75.590 1.00 36.33 ? 75  PHE X CD2 1 
ATOM   562  C CE1 . PHE A 1 96  ? 3.915   71.303 78.195 1.00 33.07 ? 75  PHE X CE1 1 
ATOM   563  C CE2 . PHE A 1 96  ? 3.926   70.610 75.887 1.00 34.45 ? 75  PHE X CE2 1 
ATOM   564  C CZ  . PHE A 1 96  ? 4.400   70.479 77.194 1.00 32.24 ? 75  PHE X CZ  1 
ATOM   565  N N   . PRO A 1 97  ? -2.206  74.063 77.119 1.00 38.60 ? 76  PRO X N   1 
ATOM   566  C CA  . PRO A 1 97  ? -3.333  74.937 76.741 1.00 38.30 ? 76  PRO X CA  1 
ATOM   567  C C   . PRO A 1 97  ? -2.865  76.375 76.742 1.00 38.52 ? 76  PRO X C   1 
ATOM   568  O O   . PRO A 1 97  ? -2.073  76.773 77.606 1.00 38.01 ? 76  PRO X O   1 
ATOM   569  C CB  . PRO A 1 97  ? -4.366  74.676 77.843 1.00 37.94 ? 76  PRO X CB  1 
ATOM   570  C CG  . PRO A 1 97  ? -4.120  73.243 78.246 1.00 37.58 ? 76  PRO X CG  1 
ATOM   571  C CD  . PRO A 1 97  ? -2.579  73.134 78.213 1.00 38.56 ? 76  PRO X CD  1 
ATOM   572  N N   . GLY A 1 98  ? -3.311  77.134 75.745 1.00 38.64 ? 77  GLY X N   1 
ATOM   573  C CA  . GLY A 1 98  ? -2.878  78.521 75.599 1.00 38.77 ? 77  GLY X CA  1 
ATOM   574  C C   . GLY A 1 98  ? -1.413  78.739 75.193 1.00 39.07 ? 77  GLY X C   1 
ATOM   575  O O   . GLY A 1 98  ? -0.943  79.873 75.164 1.00 40.58 ? 77  GLY X O   1 
ATOM   576  N N   . PHE A 1 99  ? -0.654  77.689 74.895 1.00 38.01 ? 78  PHE X N   1 
ATOM   577  C CA  . PHE A 1 99  ? 0.762   77.889 74.544 1.00 36.19 ? 78  PHE X CA  1 
ATOM   578  C C   . PHE A 1 99  ? 0.866   77.877 73.021 1.00 35.57 ? 78  PHE X C   1 
ATOM   579  O O   . PHE A 1 99  ? 0.352   76.981 72.365 1.00 36.34 ? 78  PHE X O   1 
ATOM   580  C CB  . PHE A 1 99  ? 1.612   76.795 75.187 1.00 35.54 ? 78  PHE X CB  1 
ATOM   581  C CG  . PHE A 1 99  ? 3.039   76.825 74.767 1.00 33.68 ? 78  PHE X CG  1 
ATOM   582  C CD1 . PHE A 1 99  ? 3.807   77.948 74.996 1.00 32.03 ? 78  PHE X CD1 1 
ATOM   583  C CD2 . PHE A 1 99  ? 3.612   75.724 74.139 1.00 29.88 ? 78  PHE X CD2 1 
ATOM   584  C CE1 . PHE A 1 99  ? 5.135   77.975 74.603 1.00 32.26 ? 78  PHE X CE1 1 
ATOM   585  C CE2 . PHE A 1 99  ? 4.921   75.718 73.764 1.00 27.41 ? 78  PHE X CE2 1 
ATOM   586  C CZ  . PHE A 1 99  ? 5.696   76.841 73.988 1.00 31.37 ? 78  PHE X CZ  1 
ATOM   587  N N   . SER A 1 100 ? 1.474   78.868 72.410 1.00 34.70 ? 79  SER X N   1 
ATOM   588  C CA  . SER A 1 100 ? 1.291   78.931 70.947 1.00 33.57 ? 79  SER X CA  1 
ATOM   589  C C   . SER A 1 100 ? 2.154   77.872 70.190 1.00 33.30 ? 79  SER X C   1 
ATOM   590  O O   . SER A 1 100 ? 1.738   77.323 69.130 1.00 32.27 ? 79  SER X O   1 
ATOM   591  C CB  . SER A 1 100 ? 1.505   80.351 70.415 1.00 33.15 ? 79  SER X CB  1 
ATOM   592  O OG  . SER A 1 100 ? 2.841   80.758 70.651 1.00 32.33 ? 79  SER X OG  1 
ATOM   593  N N   . GLY A 1 101 ? 3.328   77.562 70.756 1.00 32.33 ? 80  GLY X N   1 
ATOM   594  C CA  . GLY A 1 101 ? 4.201   76.554 70.160 1.00 31.91 ? 80  GLY X CA  1 
ATOM   595  C C   . GLY A 1 101 ? 3.448   75.276 69.795 1.00 32.18 ? 80  GLY X C   1 
ATOM   596  O O   . GLY A 1 101 ? 3.717   74.677 68.774 1.00 32.14 ? 80  GLY X O   1 
ATOM   597  N N   . SER A 1 102 ? 2.504   74.844 70.633 1.00 32.12 ? 81  SER X N   1 
ATOM   598  C CA  . SER A 1 102 ? 1.764   73.628 70.345 1.00 31.94 ? 81  SER X CA  1 
ATOM   599  C C   . SER A 1 102 ? 0.426   73.917 69.656 1.00 31.70 ? 81  SER X C   1 
ATOM   600  O O   . SER A 1 102 ? -0.044  73.142 68.805 1.00 29.87 ? 81  SER X O   1 
ATOM   601  C CB  . SER A 1 102 ? 1.534   72.816 71.633 1.00 31.90 ? 81  SER X CB  1 
ATOM   602  O OG  . SER A 1 102 ? 0.655   73.491 72.502 1.00 31.94 ? 81  SER X OG  1 
ATOM   603  N N   . GLU A 1 103 ? -0.167  75.047 70.039 1.00 32.24 ? 82  GLU X N   1 
ATOM   604  C CA  . GLU A 1 103 ? -1.555  75.342 69.691 1.00 33.23 ? 82  GLU X CA  1 
ATOM   605  C C   . GLU A 1 103 ? -1.665  75.726 68.195 1.00 32.00 ? 82  GLU X C   1 
ATOM   606  O O   . GLU A 1 103 ? -2.610  75.364 67.505 1.00 31.17 ? 82  GLU X O   1 
ATOM   607  C CB  . GLU A 1 103 ? -2.161  76.363 70.696 1.00 33.72 ? 82  GLU X CB  1 
ATOM   608  C CG  . GLU A 1 103 ? -3.558  75.978 71.176 1.00 38.36 ? 82  GLU X CG  1 
ATOM   609  C CD  . GLU A 1 103 ? -3.795  76.149 72.692 1.00 43.78 ? 82  GLU X CD  1 
ATOM   610  O OE1 . GLU A 1 103 ? -3.825  77.295 73.184 1.00 45.02 ? 82  GLU X OE1 1 
ATOM   611  O OE2 . GLU A 1 103 ? -3.991  75.131 73.410 1.00 48.00 ? 82  GLU X OE2 1 
ATOM   612  N N   . MET A 1 104 ? -0.628  76.353 67.669 1.00 31.89 ? 83  MET X N   1 
ATOM   613  C CA  . MET A 1 104 ? -0.599  76.680 66.244 1.00 31.88 ? 83  MET X CA  1 
ATOM   614  C C   . MET A 1 104 ? -0.619  75.472 65.295 1.00 31.87 ? 83  MET X C   1 
ATOM   615  O O   . MET A 1 104 ? -0.753  75.652 64.080 1.00 32.21 ? 83  MET X O   1 
ATOM   616  C CB  . MET A 1 104 ? 0.645   77.498 65.932 1.00 32.21 ? 83  MET X CB  1 
ATOM   617  C CG  . MET A 1 104 ? 1.945   76.720 66.009 1.00 31.91 ? 83  MET X CG  1 
ATOM   618  S SD  . MET A 1 104 ? 3.193   77.756 65.204 1.00 33.99 ? 83  MET X SD  1 
ATOM   619  C CE  . MET A 1 104 ? 4.382   76.536 64.651 1.00 34.83 ? 83  MET X CE  1 
ATOM   620  N N   . TRP A 1 105 ? -0.423  74.259 65.823 1.00 31.09 ? 84  TRP X N   1 
ATOM   621  C CA  . TRP A 1 105 ? -0.530  73.037 65.015 1.00 29.43 ? 84  TRP X CA  1 
ATOM   622  C C   . TRP A 1 105 ? -1.930  72.447 65.021 1.00 29.12 ? 84  TRP X C   1 
ATOM   623  O O   . TRP A 1 105 ? -2.258  71.611 64.170 1.00 27.89 ? 84  TRP X O   1 
ATOM   624  C CB  . TRP A 1 105 ? 0.496   71.979 65.451 1.00 28.36 ? 84  TRP X CB  1 
ATOM   625  C CG  . TRP A 1 105 ? 1.875   72.504 65.385 1.00 26.62 ? 84  TRP X CG  1 
ATOM   626  C CD1 . TRP A 1 105 ? 2.640   72.919 66.438 1.00 25.00 ? 84  TRP X CD1 1 
ATOM   627  C CD2 . TRP A 1 105 ? 2.680   72.696 64.209 1.00 24.40 ? 84  TRP X CD2 1 
ATOM   628  N NE1 . TRP A 1 105 ? 3.874   73.338 65.997 1.00 21.47 ? 84  TRP X NE1 1 
ATOM   629  C CE2 . TRP A 1 105 ? 3.924   73.224 64.634 1.00 23.31 ? 84  TRP X CE2 1 
ATOM   630  C CE3 . TRP A 1 105 ? 2.479   72.471 62.841 1.00 22.18 ? 84  TRP X CE3 1 
ATOM   631  C CZ2 . TRP A 1 105 ? 4.963   73.541 63.733 1.00 20.92 ? 84  TRP X CZ2 1 
ATOM   632  C CZ3 . TRP A 1 105 ? 3.523   72.776 61.951 1.00 19.31 ? 84  TRP X CZ3 1 
ATOM   633  C CH2 . TRP A 1 105 ? 4.747   73.312 62.416 1.00 18.01 ? 84  TRP X CH2 1 
ATOM   634  N N   . ASN A 1 106 ? -2.737  72.845 66.002 1.00 29.23 ? 85  ASN X N   1 
ATOM   635  C CA  . ASN A 1 106 ? -4.083  72.294 66.117 1.00 29.35 ? 85  ASN X CA  1 
ATOM   636  C C   . ASN A 1 106 ? -5.001  72.869 65.049 1.00 29.09 ? 85  ASN X C   1 
ATOM   637  O O   . ASN A 1 106 ? -4.706  73.892 64.457 1.00 27.84 ? 85  ASN X O   1 
ATOM   638  C CB  . ASN A 1 106 ? -4.655  72.578 67.498 1.00 29.69 ? 85  ASN X CB  1 
ATOM   639  C CG  . ASN A 1 106 ? -4.141  71.618 68.552 1.00 29.87 ? 85  ASN X CG  1 
ATOM   640  O OD1 . ASN A 1 106 ? -3.828  70.484 68.274 1.00 30.93 ? 85  ASN X OD1 1 
ATOM   641  N ND2 . ASN A 1 106 ? -4.060  72.082 69.766 1.00 30.60 ? 85  ASN X ND2 1 
ATOM   642  N N   . PRO A 1 107 ? -6.115  72.192 64.784 1.00 30.06 ? 86  PRO X N   1 
ATOM   643  C CA  . PRO A 1 107 ? -7.086  72.720 63.842 1.00 30.88 ? 86  PRO X CA  1 
ATOM   644  C C   . PRO A 1 107 ? -7.517  74.135 64.259 1.00 31.87 ? 86  PRO X C   1 
ATOM   645  O O   . PRO A 1 107 ? -7.862  74.336 65.419 1.00 31.17 ? 86  PRO X O   1 
ATOM   646  C CB  . PRO A 1 107 ? -8.266  71.760 63.998 1.00 30.31 ? 86  PRO X CB  1 
ATOM   647  C CG  . PRO A 1 107 ? -7.672  70.506 64.411 1.00 29.98 ? 86  PRO X CG  1 
ATOM   648  C CD  . PRO A 1 107 ? -6.534  70.886 65.318 1.00 30.37 ? 86  PRO X CD  1 
ATOM   649  N N   . ASN A 1 108 ? -7.477  75.090 63.327 1.00 32.36 ? 87  ASN X N   1 
ATOM   650  C CA  . ASN A 1 108 ? -8.029  76.410 63.542 1.00 33.44 ? 87  ASN X CA  1 
ATOM   651  C C   . ASN A 1 108 ? -9.356  76.573 62.772 1.00 34.68 ? 87  ASN X C   1 
ATOM   652  O O   . ASN A 1 108 ? -9.727  77.673 62.423 1.00 35.36 ? 87  ASN X O   1 
ATOM   653  C CB  . ASN A 1 108 ? -7.062  77.423 62.993 1.00 33.01 ? 87  ASN X CB  1 
ATOM   654  C CG  . ASN A 1 108 ? -6.730  77.121 61.546 1.00 34.97 ? 87  ASN X CG  1 
ATOM   655  O OD1 . ASN A 1 108 ? -7.275  76.155 60.961 1.00 38.47 ? 87  ASN X OD1 1 
ATOM   656  N ND2 . ASN A 1 108 ? -5.853  77.900 60.963 1.00 29.82 ? 87  ASN X ND2 1 
ATOM   657  N N   . ARG A 1 109 ? -10.082 75.497 62.508 1.00 35.52 ? 88  ARG X N   1 
ATOM   658  C CA  . ARG A 1 109 ? -11.392 75.630 61.889 1.00 36.26 ? 88  ARG X CA  1 
ATOM   659  C C   . ARG A 1 109 ? -12.249 74.544 62.441 1.00 36.61 ? 88  ARG X C   1 
ATOM   660  O O   . ARG A 1 109 ? -11.728 73.594 62.971 1.00 36.97 ? 88  ARG X O   1 
ATOM   661  C CB  . ARG A 1 109 ? -11.270 75.359 60.412 1.00 37.11 ? 88  ARG X CB  1 
ATOM   662  C CG  . ARG A 1 109 ? -10.466 76.357 59.715 1.00 38.09 ? 88  ARG X CG  1 
ATOM   663  C CD  . ARG A 1 109 ? -11.399 77.450 59.398 1.00 42.41 ? 88  ARG X CD  1 
ATOM   664  N NE  . ARG A 1 109 ? -10.663 78.683 59.504 1.00 46.88 ? 88  ARG X NE  1 
ATOM   665  C CZ  . ARG A 1 109 ? -11.048 79.792 58.920 1.00 47.69 ? 88  ARG X CZ  1 
ATOM   666  N NH1 . ARG A 1 109 ? -12.180 79.769 58.198 1.00 46.52 ? 88  ARG X NH1 1 
ATOM   667  N NH2 . ARG A 1 109 ? -10.282 80.877 59.036 1.00 45.76 ? 88  ARG X NH2 1 
ATOM   668  N N   . GLU A 1 110 ? -13.556 74.648 62.291 1.00 37.27 ? 89  GLU X N   1 
ATOM   669  C CA  . GLU A 1 110 ? -14.421 73.548 62.667 1.00 38.80 ? 89  GLU X CA  1 
ATOM   670  C C   . GLU A 1 110 ? -13.858 72.230 62.094 1.00 37.79 ? 89  GLU X C   1 
ATOM   671  O O   . GLU A 1 110 ? -13.373 72.167 60.961 1.00 37.92 ? 89  GLU X O   1 
ATOM   672  C CB  . GLU A 1 110 ? -15.840 73.772 62.124 1.00 40.24 ? 89  GLU X CB  1 
ATOM   673  C CG  . GLU A 1 110 ? -16.965 74.084 63.185 1.00 47.26 ? 89  GLU X CG  1 
ATOM   674  C CD  . GLU A 1 110 ? -18.236 73.150 62.998 1.00 55.41 ? 89  GLU X CD  1 
ATOM   675  O OE1 . GLU A 1 110 ? -18.581 72.439 63.990 1.00 57.53 ? 89  GLU X OE1 1 
ATOM   676  O OE2 . GLU A 1 110 ? -18.853 73.088 61.875 1.00 54.47 ? 89  GLU X OE2 1 
ATOM   677  N N   . MET A 1 111 ? -13.924 71.171 62.874 1.00 36.44 ? 90  MET X N   1 
ATOM   678  C CA  . MET A 1 111 ? -13.549 69.880 62.379 1.00 35.34 ? 90  MET X CA  1 
ATOM   679  C C   . MET A 1 111 ? -14.794 69.278 61.805 1.00 34.90 ? 90  MET X C   1 
ATOM   680  O O   . MET A 1 111 ? -15.868 69.461 62.384 1.00 35.29 ? 90  MET X O   1 
ATOM   681  C CB  . MET A 1 111 ? -13.083 68.999 63.544 1.00 35.67 ? 90  MET X CB  1 
ATOM   682  C CG  . MET A 1 111 ? -11.779 69.444 64.165 1.00 35.67 ? 90  MET X CG  1 
ATOM   683  S SD  . MET A 1 111 ? -11.054 68.114 65.090 1.00 37.88 ? 90  MET X SD  1 
ATOM   684  C CE  . MET A 1 111 ? -11.912 68.260 66.657 1.00 33.26 ? 90  MET X CE  1 
ATOM   685  N N   . SER A 1 112 ? -14.696 68.565 60.683 1.00 33.88 ? 91  SER X N   1 
ATOM   686  C CA  . SER A 1 112 ? -15.818 67.673 60.319 1.00 33.54 ? 91  SER X CA  1 
ATOM   687  C C   . SER A 1 112 ? -15.371 66.547 59.362 1.00 33.31 ? 91  SER X C   1 
ATOM   688  O O   . SER A 1 112 ? -14.299 66.673 58.730 1.00 33.02 ? 91  SER X O   1 
ATOM   689  C CB  . SER A 1 112 ? -17.040 68.476 59.793 1.00 33.08 ? 91  SER X CB  1 
ATOM   690  O OG  . SER A 1 112 ? -17.301 68.261 58.425 1.00 31.62 ? 91  SER X OG  1 
ATOM   691  N N   . GLU A 1 113 ? -16.159 65.470 59.248 1.00 32.42 ? 92  GLU X N   1 
ATOM   692  C CA  . GLU A 1 113 ? -15.824 64.439 58.271 1.00 32.27 ? 92  GLU X CA  1 
ATOM   693  C C   . GLU A 1 113 ? -15.884 64.946 56.845 1.00 32.95 ? 92  GLU X C   1 
ATOM   694  O O   . GLU A 1 113 ? -15.309 64.348 55.925 1.00 32.23 ? 92  GLU X O   1 
ATOM   695  C CB  . GLU A 1 113 ? -16.704 63.237 58.434 1.00 31.99 ? 92  GLU X CB  1 
ATOM   696  C CG  . GLU A 1 113 ? -16.322 62.434 59.664 1.00 32.99 ? 92  GLU X CG  1 
ATOM   697  C CD  . GLU A 1 113 ? -17.106 61.144 59.790 1.00 34.98 ? 92  GLU X CD  1 
ATOM   698  O OE1 . GLU A 1 113 ? -18.129 61.141 60.523 1.00 35.05 ? 92  GLU X OE1 1 
ATOM   699  O OE2 . GLU A 1 113 ? -16.700 60.143 59.148 1.00 36.72 ? 92  GLU X OE2 1 
ATOM   700  N N   . ASP A 1 114 ? -16.585 66.068 56.660 1.00 34.15 ? 93  ASP X N   1 
ATOM   701  C CA  . ASP A 1 114 ? -16.695 66.716 55.346 1.00 33.98 ? 93  ASP X CA  1 
ATOM   702  C C   . ASP A 1 114 ? -15.529 67.630 55.244 1.00 33.04 ? 93  ASP X C   1 
ATOM   703  O O   . ASP A 1 114 ? -15.621 68.793 55.630 1.00 33.68 ? 93  ASP X O   1 
ATOM   704  C CB  . ASP A 1 114 ? -18.012 67.513 55.231 1.00 34.10 ? 93  ASP X CB  1 
ATOM   705  C CG  . ASP A 1 114 ? -18.144 68.293 53.887 1.00 37.10 ? 93  ASP X CG  1 
ATOM   706  O OD1 . ASP A 1 114 ? -17.166 68.372 53.105 1.00 36.62 ? 93  ASP X OD1 1 
ATOM   707  O OD2 . ASP A 1 114 ? -19.247 68.848 53.614 1.00 39.20 ? 93  ASP X OD2 1 
ATOM   708  N N   . CYS A 1 115 ? -14.421 67.109 54.737 1.00 32.25 ? 94  CYS X N   1 
ATOM   709  C CA  . CYS A 1 115 ? -13.183 67.897 54.714 1.00 31.41 ? 94  CYS X CA  1 
ATOM   710  C C   . CYS A 1 115 ? -12.302 67.670 53.517 1.00 30.92 ? 94  CYS X C   1 
ATOM   711  O O   . CYS A 1 115 ? -11.203 68.206 53.470 1.00 30.87 ? 94  CYS X O   1 
ATOM   712  C CB  . CYS A 1 115 ? -12.326 67.608 55.948 1.00 31.12 ? 94  CYS X CB  1 
ATOM   713  S SG  . CYS A 1 115 ? -11.803 65.893 56.019 1.00 29.94 ? 94  CYS X SG  1 
ATOM   714  N N   . LEU A 1 116 ? -12.735 66.885 52.551 1.00 30.17 ? 95  LEU X N   1 
ATOM   715  C CA  . LEU A 1 116 ? -11.899 66.759 51.383 1.00 30.47 ? 95  LEU X CA  1 
ATOM   716  C C   . LEU A 1 116 ? -11.864 68.037 50.501 1.00 30.66 ? 95  LEU X C   1 
ATOM   717  O O   . LEU A 1 116 ? -12.528 68.101 49.474 1.00 31.94 ? 95  LEU X O   1 
ATOM   718  C CB  . LEU A 1 116 ? -12.293 65.510 50.607 1.00 30.10 ? 95  LEU X CB  1 
ATOM   719  C CG  . LEU A 1 116 ? -12.087 64.367 51.602 1.00 31.67 ? 95  LEU X CG  1 
ATOM   720  C CD1 . LEU A 1 116 ? -12.312 62.969 51.022 1.00 29.37 ? 95  LEU X CD1 1 
ATOM   721  C CD2 . LEU A 1 116 ? -10.639 64.532 52.196 1.00 31.91 ? 95  LEU X CD2 1 
ATOM   722  N N   . TYR A 1 117 ? -11.067 69.032 50.880 1.00 30.12 ? 96  TYR X N   1 
ATOM   723  C CA  . TYR A 1 117 ? -10.941 70.272 50.097 1.00 30.22 ? 96  TYR X CA  1 
ATOM   724  C C   . TYR A 1 117 ? -9.490  70.627 49.734 1.00 29.91 ? 96  TYR X C   1 
ATOM   725  O O   . TYR A 1 117 ? -8.584  70.100 50.353 1.00 30.76 ? 96  TYR X O   1 
ATOM   726  C CB  . TYR A 1 117 ? -11.576 71.423 50.884 1.00 30.69 ? 96  TYR X CB  1 
ATOM   727  C CG  . TYR A 1 117 ? -13.022 71.155 51.080 1.00 30.70 ? 96  TYR X CG  1 
ATOM   728  C CD1 . TYR A 1 117 ? -13.456 70.384 52.172 1.00 30.45 ? 96  TYR X CD1 1 
ATOM   729  C CD2 . TYR A 1 117 ? -13.957 71.611 50.133 1.00 28.63 ? 96  TYR X CD2 1 
ATOM   730  C CE1 . TYR A 1 117 ? -14.790 70.093 52.338 1.00 32.46 ? 96  TYR X CE1 1 
ATOM   731  C CE2 . TYR A 1 117 ? -15.290 71.332 50.281 1.00 30.07 ? 96  TYR X CE2 1 
ATOM   732  C CZ  . TYR A 1 117 ? -15.716 70.576 51.369 1.00 32.67 ? 96  TYR X CZ  1 
ATOM   733  O OH  . TYR A 1 117 ? -17.060 70.287 51.497 1.00 32.48 ? 96  TYR X OH  1 
ATOM   734  N N   . LEU A 1 118 ? -9.260  71.505 48.756 1.00 28.69 ? 97  LEU X N   1 
ATOM   735  C CA  . LEU A 1 118 ? -7.895  71.947 48.467 1.00 28.03 ? 97  LEU X CA  1 
ATOM   736  C C   . LEU A 1 118 ? -7.815  73.493 48.323 1.00 28.23 ? 97  LEU X C   1 
ATOM   737  O O   . LEU A 1 118 ? -8.835  74.139 48.242 1.00 28.91 ? 97  LEU X O   1 
ATOM   738  C CB  . LEU A 1 118 ? -7.327  71.186 47.271 1.00 27.42 ? 97  LEU X CB  1 
ATOM   739  C CG  . LEU A 1 118 ? -8.044  71.265 45.914 1.00 27.56 ? 97  LEU X CG  1 
ATOM   740  C CD1 . LEU A 1 118 ? -7.629  72.513 45.232 1.00 25.99 ? 97  LEU X CD1 1 
ATOM   741  C CD2 . LEU A 1 118 ? -7.814  70.070 44.975 1.00 24.52 ? 97  LEU X CD2 1 
ATOM   742  N N   . ASN A 1 119 ? -6.625  74.095 48.355 1.00 28.01 ? 98  ASN X N   1 
ATOM   743  C CA  . ASN A 1 119 ? -6.517  75.546 48.362 1.00 28.14 ? 98  ASN X CA  1 
ATOM   744  C C   . ASN A 1 119 ? -5.499  75.936 47.338 1.00 28.97 ? 98  ASN X C   1 
ATOM   745  O O   . ASN A 1 119 ? -4.482  75.279 47.243 1.00 30.85 ? 98  ASN X O   1 
ATOM   746  C CB  . ASN A 1 119 ? -6.037  76.082 49.733 1.00 28.44 ? 98  ASN X CB  1 
ATOM   747  C CG  . ASN A 1 119 ? -6.893  75.568 50.927 1.00 29.30 ? 98  ASN X CG  1 
ATOM   748  O OD1 . ASN A 1 119 ? -8.127  75.753 50.985 1.00 28.33 ? 98  ASN X OD1 1 
ATOM   749  N ND2 . ASN A 1 119 ? -6.225  74.902 51.874 1.00 28.21 ? 98  ASN X ND2 1 
ATOM   750  N N   . ILE A 1 120 ? -5.731  77.011 46.583 1.00 29.55 ? 99  ILE X N   1 
ATOM   751  C CA  . ILE A 1 120 ? -4.794  77.465 45.534 1.00 29.22 ? 99  ILE X CA  1 
ATOM   752  C C   . ILE A 1 120 ? -4.401  78.932 45.677 1.00 30.06 ? 99  ILE X C   1 
ATOM   753  O O   . ILE A 1 120 ? -5.259  79.783 45.816 1.00 30.72 ? 99  ILE X O   1 
ATOM   754  C CB  . ILE A 1 120 ? -5.423  77.319 44.145 1.00 28.21 ? 99  ILE X CB  1 
ATOM   755  C CG1 . ILE A 1 120 ? -6.165  75.982 44.060 1.00 26.44 ? 99  ILE X CG1 1 
ATOM   756  C CG2 . ILE A 1 120 ? -4.357  77.415 43.113 1.00 26.23 ? 99  ILE X CG2 1 
ATOM   757  C CD1 . ILE A 1 120 ? -6.661  75.675 42.692 1.00 23.92 ? 99  ILE X CD1 1 
ATOM   758  N N   . TRP A 1 121 ? -3.125  79.248 45.612 1.00 30.09 ? 100 TRP X N   1 
ATOM   759  C CA  . TRP A 1 121 ? -2.773  80.636 45.625 1.00 30.88 ? 100 TRP X CA  1 
ATOM   760  C C   . TRP A 1 121 ? -2.212  80.975 44.255 1.00 32.10 ? 100 TRP X C   1 
ATOM   761  O O   . TRP A 1 121 ? -1.187  80.410 43.880 1.00 32.86 ? 100 TRP X O   1 
ATOM   762  C CB  . TRP A 1 121 ? -1.704  80.886 46.678 1.00 30.47 ? 100 TRP X CB  1 
ATOM   763  C CG  . TRP A 1 121 ? -2.286  81.034 48.042 1.00 30.57 ? 100 TRP X CG  1 
ATOM   764  C CD1 . TRP A 1 121 ? -2.725  82.183 48.613 1.00 29.39 ? 100 TRP X CD1 1 
ATOM   765  C CD2 . TRP A 1 121 ? -2.490  79.999 49.019 1.00 30.70 ? 100 TRP X CD2 1 
ATOM   766  N NE1 . TRP A 1 121 ? -3.189  81.944 49.873 1.00 28.79 ? 100 TRP X NE1 1 
ATOM   767  C CE2 . TRP A 1 121 ? -3.068  80.612 50.154 1.00 29.27 ? 100 TRP X CE2 1 
ATOM   768  C CE3 . TRP A 1 121 ? -2.255  78.618 49.037 1.00 29.68 ? 100 TRP X CE3 1 
ATOM   769  C CZ2 . TRP A 1 121 ? -3.411  79.902 51.307 1.00 28.25 ? 100 TRP X CZ2 1 
ATOM   770  C CZ3 . TRP A 1 121 ? -2.600  77.903 50.180 1.00 32.09 ? 100 TRP X CZ3 1 
ATOM   771  C CH2 . TRP A 1 121 ? -3.160  78.565 51.318 1.00 32.03 ? 100 TRP X CH2 1 
ATOM   772  N N   . VAL A 1 122 ? -2.838  81.891 43.510 1.00 32.54 ? 101 VAL X N   1 
ATOM   773  C CA  . VAL A 1 122 ? -2.369  82.199 42.142 1.00 33.13 ? 101 VAL X CA  1 
ATOM   774  C C   . VAL A 1 122 ? -1.740  83.576 42.025 1.00 33.56 ? 101 VAL X C   1 
ATOM   775  O O   . VAL A 1 122 ? -2.351  84.559 42.415 1.00 34.02 ? 101 VAL X O   1 
ATOM   776  C CB  . VAL A 1 122 ? -3.534  82.138 41.120 1.00 33.64 ? 101 VAL X CB  1 
ATOM   777  C CG1 . VAL A 1 122 ? -3.041  82.482 39.733 1.00 33.32 ? 101 VAL X CG1 1 
ATOM   778  C CG2 . VAL A 1 122 ? -4.220  80.762 41.135 1.00 32.06 ? 101 VAL X CG2 1 
ATOM   779  N N   . PRO A 1 123 ? -0.519  83.666 41.477 1.00 33.90 ? 102 PRO X N   1 
ATOM   780  C CA  . PRO A 1 123 ? 0.023   85.020 41.313 1.00 34.85 ? 102 PRO X CA  1 
ATOM   781  C C   . PRO A 1 123 ? -0.873  85.979 40.513 1.00 36.21 ? 102 PRO X C   1 
ATOM   782  O O   . PRO A 1 123 ? -1.764  85.564 39.773 1.00 35.90 ? 102 PRO X O   1 
ATOM   783  C CB  . PRO A 1 123 ? 1.345   84.797 40.567 1.00 34.25 ? 102 PRO X CB  1 
ATOM   784  C CG  . PRO A 1 123 ? 1.743   83.415 40.883 1.00 33.57 ? 102 PRO X CG  1 
ATOM   785  C CD  . PRO A 1 123 ? 0.480   82.626 41.185 1.00 33.60 ? 102 PRO X CD  1 
ATOM   786  N N   . SER A 1 124 ? -0.618  87.281 40.657 1.00 38.31 ? 103 SER X N   1 
ATOM   787  C CA  . SER A 1 124 ? -1.419  88.300 39.947 1.00 38.54 ? 103 SER X CA  1 
ATOM   788  C C   . SER A 1 124 ? -0.525  89.277 39.251 1.00 37.68 ? 103 SER X C   1 
ATOM   789  O O   . SER A 1 124 ? 0.381   89.793 39.835 1.00 37.04 ? 103 SER X O   1 
ATOM   790  C CB  . SER A 1 124 ? -2.336  89.044 40.906 1.00 38.79 ? 103 SER X CB  1 
ATOM   791  O OG  . SER A 1 124 ? -3.263  89.762 40.128 1.00 41.18 ? 103 SER X OG  1 
ATOM   792  N N   . PRO A 1 125 ? -0.751  89.500 37.963 1.00 38.49 ? 104 PRO X N   1 
ATOM   793  C CA  . PRO A 1 125 ? -1.819  88.844 37.158 1.00 38.41 ? 104 PRO X CA  1 
ATOM   794  C C   . PRO A 1 125 ? -1.598  87.311 36.940 1.00 38.01 ? 104 PRO X C   1 
ATOM   795  O O   . PRO A 1 125 ? -0.451  86.850 36.889 1.00 37.45 ? 104 PRO X O   1 
ATOM   796  C CB  . PRO A 1 125 ? -1.733  89.597 35.806 1.00 38.05 ? 104 PRO X CB  1 
ATOM   797  C CG  . PRO A 1 125 ? -0.229  90.029 35.716 1.00 37.49 ? 104 PRO X CG  1 
ATOM   798  C CD  . PRO A 1 125 ? 0.215   90.276 37.136 1.00 37.78 ? 104 PRO X CD  1 
ATOM   799  N N   . ARG A 1 126 ? -2.703  86.567 36.809 1.00 38.19 ? 105 ARG X N   1 
ATOM   800  C CA  . ARG A 1 126 ? -2.738  85.120 36.466 1.00 38.30 ? 105 ARG X CA  1 
ATOM   801  C C   . ARG A 1 126 ? -1.633  84.723 35.487 1.00 38.81 ? 105 ARG X C   1 
ATOM   802  O O   . ARG A 1 126 ? -1.509  85.310 34.400 1.00 39.55 ? 105 ARG X O   1 
ATOM   803  C CB  . ARG A 1 126 ? -4.127  84.715 35.918 1.00 37.66 ? 105 ARG X CB  1 
ATOM   804  C CG  . ARG A 1 126 ? -4.458  83.208 35.948 1.00 36.77 ? 105 ARG X CG  1 
ATOM   805  C CD  . ARG A 1 126 ? -5.806  82.854 35.304 1.00 33.50 ? 105 ARG X CD  1 
ATOM   806  N NE  . ARG A 1 126 ? -6.916  83.346 36.113 1.00 38.10 ? 105 ARG X NE  1 
ATOM   807  C CZ  . ARG A 1 126 ? -8.213  83.289 35.769 1.00 39.60 ? 105 ARG X CZ  1 
ATOM   808  N NH1 . ARG A 1 126 ? -8.596  82.767 34.622 1.00 39.75 ? 105 ARG X NH1 1 
ATOM   809  N NH2 . ARG A 1 126 ? -9.147  83.775 36.569 1.00 38.93 ? 105 ARG X NH2 1 
ATOM   810  N N   . PRO A 1 127 ? -0.800  83.744 35.879 1.00 39.08 ? 106 PRO X N   1 
ATOM   811  C CA  . PRO A 1 127 ? 0.197   83.220 34.920 1.00 38.55 ? 106 PRO X CA  1 
ATOM   812  C C   . PRO A 1 127 ? -0.528  82.484 33.792 1.00 37.90 ? 106 PRO X C   1 
ATOM   813  O O   . PRO A 1 127 ? -1.765  82.303 33.840 1.00 37.70 ? 106 PRO X O   1 
ATOM   814  C CB  . PRO A 1 127 ? 1.040   82.236 35.765 1.00 38.12 ? 106 PRO X CB  1 
ATOM   815  C CG  . PRO A 1 127 ? 0.753   82.617 37.191 1.00 39.61 ? 106 PRO X CG  1 
ATOM   816  C CD  . PRO A 1 127 ? -0.692  83.105 37.203 1.00 38.82 ? 106 PRO X CD  1 
ATOM   817  N N   . LYS A 1 128 ? 0.221   82.078 32.780 1.00 37.64 ? 107 LYS X N   1 
ATOM   818  C CA  . LYS A 1 128 ? -0.336  81.235 31.732 1.00 38.02 ? 107 LYS X CA  1 
ATOM   819  C C   . LYS A 1 128 ? 0.070   79.779 31.955 1.00 37.65 ? 107 LYS X C   1 
ATOM   820  O O   . LYS A 1 128 ? -0.728  78.852 31.760 1.00 37.76 ? 107 LYS X O   1 
ATOM   821  C CB  . LYS A 1 128 ? 0.153   81.703 30.364 1.00 38.36 ? 107 LYS X CB  1 
ATOM   822  C CG  . LYS A 1 128 ? -0.045  83.189 30.147 1.00 40.76 ? 107 LYS X CG  1 
ATOM   823  C CD  . LYS A 1 128 ? -1.534  83.481 30.285 1.00 45.50 ? 107 LYS X CD  1 
ATOM   824  C CE  . LYS A 1 128 ? -1.881  84.956 30.216 1.00 45.40 ? 107 LYS X CE  1 
ATOM   825  N NZ  . LYS A 1 128 ? -3.357  84.990 30.264 1.00 47.51 ? 107 LYS X NZ  1 
ATOM   826  N N   . SER A 1 129 ? 1.322   79.569 32.347 1.00 37.12 ? 108 SER X N   1 
ATOM   827  C CA  . SER A 1 129 ? 1.804   78.208 32.476 1.00 37.05 ? 108 SER X CA  1 
ATOM   828  C C   . SER A 1 129 ? 2.991   78.109 33.369 1.00 36.21 ? 108 SER X C   1 
ATOM   829  O O   . SER A 1 129 ? 4.031   77.620 32.940 1.00 36.69 ? 108 SER X O   1 
ATOM   830  C CB  . SER A 1 129 ? 2.194   77.612 31.121 1.00 37.13 ? 108 SER X CB  1 
ATOM   831  O OG  . SER A 1 129 ? 2.022   76.215 31.157 1.00 37.68 ? 108 SER X OG  1 
ATOM   832  N N   . THR A 1 130 ? 2.817   78.505 34.619 1.00 35.17 ? 109 THR X N   1 
ATOM   833  C CA  . THR A 1 130 ? 3.915   78.511 35.561 1.00 34.76 ? 109 THR X CA  1 
ATOM   834  C C   . THR A 1 130 ? 4.014   77.208 36.414 1.00 34.16 ? 109 THR X C   1 
ATOM   835  O O   . THR A 1 130 ? 3.042   76.440 36.523 1.00 34.10 ? 109 THR X O   1 
ATOM   836  C CB  . THR A 1 130 ? 3.799   79.759 36.451 1.00 34.74 ? 109 THR X CB  1 
ATOM   837  O OG1 . THR A 1 130 ? 5.037   79.993 37.110 1.00 35.68 ? 109 THR X OG1 1 
ATOM   838  C CG2 . THR A 1 130 ? 2.705   79.573 37.488 1.00 35.35 ? 109 THR X CG2 1 
ATOM   839  N N   . THR A 1 131 ? 5.188   76.978 37.010 1.00 33.34 ? 110 THR X N   1 
ATOM   840  C CA  . THR A 1 131 ? 5.411   75.903 38.002 1.00 32.79 ? 110 THR X CA  1 
ATOM   841  C C   . THR A 1 131 ? 4.379   75.803 39.153 1.00 32.32 ? 110 THR X C   1 
ATOM   842  O O   . THR A 1 131 ? 4.052   76.816 39.774 1.00 32.33 ? 110 THR X O   1 
ATOM   843  C CB  . THR A 1 131 ? 6.763   76.049 38.693 1.00 32.48 ? 110 THR X CB  1 
ATOM   844  O OG1 . THR A 1 131 ? 7.809   76.100 37.724 1.00 33.73 ? 110 THR X OG1 1 
ATOM   845  C CG2 . THR A 1 131 ? 7.006   74.879 39.611 1.00 32.58 ? 110 THR X CG2 1 
ATOM   846  N N   . VAL A 1 132 ? 3.916   74.573 39.443 1.00 31.04 ? 111 VAL X N   1 
ATOM   847  C CA  . VAL A 1 132 ? 2.951   74.311 40.495 1.00 29.64 ? 111 VAL X CA  1 
ATOM   848  C C   . VAL A 1 132 ? 3.592   73.497 41.621 1.00 29.40 ? 111 VAL X C   1 
ATOM   849  O O   . VAL A 1 132 ? 4.282   72.503 41.350 1.00 29.05 ? 111 VAL X O   1 
ATOM   850  C CB  . VAL A 1 132 ? 1.808   73.429 39.945 1.00 30.38 ? 111 VAL X CB  1 
ATOM   851  C CG1 . VAL A 1 132 ? 0.785   73.067 41.060 1.00 25.59 ? 111 VAL X CG1 1 
ATOM   852  C CG2 . VAL A 1 132 ? 1.153   74.089 38.729 1.00 29.03 ? 111 VAL X CG2 1 
ATOM   853  N N   . MET A 1 133 ? 3.317   73.874 42.871 1.00 27.93 ? 112 MET X N   1 
ATOM   854  C CA  . MET A 1 133 ? 3.764   73.123 44.029 1.00 26.96 ? 112 MET X CA  1 
ATOM   855  C C   . MET A 1 133 ? 2.572   72.687 44.844 1.00 27.36 ? 112 MET X C   1 
ATOM   856  O O   . MET A 1 133 ? 1.708   73.514 45.172 1.00 28.95 ? 112 MET X O   1 
ATOM   857  C CB  . MET A 1 133 ? 4.668   73.982 44.869 1.00 26.46 ? 112 MET X CB  1 
ATOM   858  C CG  . MET A 1 133 ? 5.924   74.305 44.120 1.00 27.44 ? 112 MET X CG  1 
ATOM   859  S SD  . MET A 1 133 ? 7.094   75.358 45.002 1.00 31.63 ? 112 MET X SD  1 
ATOM   860  C CE  . MET A 1 133 ? 7.886   74.202 46.118 1.00 32.03 ? 112 MET X CE  1 
ATOM   861  N N   . VAL A 1 134 ? 2.481   71.396 45.163 1.00 26.73 ? 113 VAL X N   1 
ATOM   862  C CA  . VAL A 1 134 ? 1.352   70.908 45.955 1.00 25.43 ? 113 VAL X CA  1 
ATOM   863  C C   . VAL A 1 134 ? 1.862   70.449 47.319 1.00 26.07 ? 113 VAL X C   1 
ATOM   864  O O   . VAL A 1 134 ? 2.710   69.536 47.407 1.00 26.56 ? 113 VAL X O   1 
ATOM   865  C CB  . VAL A 1 134 ? 0.636   69.739 45.229 1.00 25.51 ? 113 VAL X CB  1 
ATOM   866  C CG1 . VAL A 1 134 ? -0.455  69.090 46.120 1.00 23.37 ? 113 VAL X CG1 1 
ATOM   867  C CG2 . VAL A 1 134 ? 0.063   70.216 43.905 1.00 21.96 ? 113 VAL X CG2 1 
ATOM   868  N N   . TRP A 1 135 ? 1.350   71.067 48.377 1.00 25.41 ? 114 TRP X N   1 
ATOM   869  C CA  . TRP A 1 135 ? 1.795   70.773 49.736 1.00 24.87 ? 114 TRP X CA  1 
ATOM   870  C C   . TRP A 1 135 ? 0.920   69.721 50.368 1.00 24.69 ? 114 TRP X C   1 
ATOM   871  O O   . TRP A 1 135 ? -0.312  69.823 50.327 1.00 24.25 ? 114 TRP X O   1 
ATOM   872  C CB  . TRP A 1 135 ? 1.790   72.039 50.594 1.00 24.87 ? 114 TRP X CB  1 
ATOM   873  C CG  . TRP A 1 135 ? 2.037   71.842 52.081 1.00 25.54 ? 114 TRP X CG  1 
ATOM   874  C CD1 . TRP A 1 135 ? 1.113   71.940 53.103 1.00 27.59 ? 114 TRP X CD1 1 
ATOM   875  C CD2 . TRP A 1 135 ? 3.286   71.586 52.716 1.00 25.68 ? 114 TRP X CD2 1 
ATOM   876  N NE1 . TRP A 1 135 ? 1.710   71.717 54.325 1.00 25.00 ? 114 TRP X NE1 1 
ATOM   877  C CE2 . TRP A 1 135 ? 3.044   71.510 54.116 1.00 26.03 ? 114 TRP X CE2 1 
ATOM   878  C CE3 . TRP A 1 135 ? 4.587   71.401 52.247 1.00 24.01 ? 114 TRP X CE3 1 
ATOM   879  C CZ2 . TRP A 1 135 ? 4.052   71.248 55.026 1.00 25.49 ? 114 TRP X CZ2 1 
ATOM   880  C CZ3 . TRP A 1 135 ? 5.587   71.179 53.159 1.00 23.61 ? 114 TRP X CZ3 1 
ATOM   881  C CH2 . TRP A 1 135 ? 5.320   71.081 54.521 1.00 24.83 ? 114 TRP X CH2 1 
ATOM   882  N N   . ILE A 1 136 ? 1.578   68.700 50.944 1.00 25.06 ? 115 ILE X N   1 
ATOM   883  C CA  . ILE A 1 136 ? 0.923   67.652 51.749 1.00 24.41 ? 115 ILE X CA  1 
ATOM   884  C C   . ILE A 1 136 ? 1.346   67.730 53.239 1.00 24.85 ? 115 ILE X C   1 
ATOM   885  O O   . ILE A 1 136 ? 2.494   67.417 53.569 1.00 25.61 ? 115 ILE X O   1 
ATOM   886  C CB  . ILE A 1 136 ? 1.265   66.277 51.208 1.00 24.15 ? 115 ILE X CB  1 
ATOM   887  C CG1 . ILE A 1 136 ? 1.318   66.331 49.670 1.00 24.25 ? 115 ILE X CG1 1 
ATOM   888  C CG2 . ILE A 1 136 ? 0.301   65.243 51.750 1.00 23.67 ? 115 ILE X CG2 1 
ATOM   889  C CD1 . ILE A 1 136 ? 1.285   64.986 48.927 1.00 18.89 ? 115 ILE X CD1 1 
ATOM   890  N N   . TYR A 1 137 ? 0.436   68.147 54.128 1.00 24.33 ? 116 TYR X N   1 
ATOM   891  C CA  . TYR A 1 137 ? 0.756   68.314 55.538 1.00 23.54 ? 116 TYR X CA  1 
ATOM   892  C C   . TYR A 1 137 ? 1.111   67.014 56.215 1.00 23.85 ? 116 TYR X C   1 
ATOM   893  O O   . TYR A 1 137 ? 0.574   65.944 55.860 1.00 24.38 ? 116 TYR X O   1 
ATOM   894  C CB  . TYR A 1 137 ? -0.411  68.981 56.297 1.00 23.93 ? 116 TYR X CB  1 
ATOM   895  C CG  . TYR A 1 137 ? -1.787  68.294 56.275 1.00 23.40 ? 116 TYR X CG  1 
ATOM   896  C CD1 . TYR A 1 137 ? -2.012  67.065 56.890 1.00 25.70 ? 116 TYR X CD1 1 
ATOM   897  C CD2 . TYR A 1 137 ? -2.874  68.916 55.713 1.00 23.30 ? 116 TYR X CD2 1 
ATOM   898  C CE1 . TYR A 1 137 ? -3.292  66.481 56.915 1.00 24.29 ? 116 TYR X CE1 1 
ATOM   899  C CE2 . TYR A 1 137 ? -4.154  68.330 55.722 1.00 21.68 ? 116 TYR X CE2 1 
ATOM   900  C CZ  . TYR A 1 137 ? -4.363  67.126 56.303 1.00 23.81 ? 116 TYR X CZ  1 
ATOM   901  O OH  . TYR A 1 137 ? -5.640  66.556 56.255 1.00 22.23 ? 116 TYR X OH  1 
ATOM   902  N N   . GLY A 1 138 ? 1.999   67.107 57.204 1.00 23.51 ? 117 GLY X N   1 
ATOM   903  C CA  . GLY A 1 138 ? 2.343   65.967 58.093 1.00 23.95 ? 117 GLY X CA  1 
ATOM   904  C C   . GLY A 1 138 ? 1.457   65.951 59.329 1.00 23.70 ? 117 GLY X C   1 
ATOM   905  O O   . GLY A 1 138 ? 0.350   66.517 59.284 1.00 23.20 ? 117 GLY X O   1 
ATOM   906  N N   . GLY A 1 139 ? 1.923   65.321 60.419 1.00 23.68 ? 118 GLY X N   1 
ATOM   907  C CA  . GLY A 1 139 ? 1.060   65.065 61.621 1.00 23.22 ? 118 GLY X CA  1 
ATOM   908  C C   . GLY A 1 139 ? 0.949   63.592 62.052 1.00 23.65 ? 118 GLY X C   1 
ATOM   909  O O   . GLY A 1 139 ? -0.066  63.152 62.654 1.00 23.73 ? 118 GLY X O   1 
ATOM   910  N N   . GLY A 1 140 ? 1.992   62.809 61.742 1.00 22.91 ? 119 GLY X N   1 
ATOM   911  C CA  . GLY A 1 140 ? 1.985   61.376 62.016 1.00 22.32 ? 119 GLY X CA  1 
ATOM   912  C C   . GLY A 1 140 ? 0.784   60.567 61.537 1.00 22.60 ? 119 GLY X C   1 
ATOM   913  O O   . GLY A 1 140 ? 0.521   59.463 62.077 1.00 23.65 ? 119 GLY X O   1 
ATOM   914  N N   . PHE A 1 141 ? 0.069   61.076 60.524 1.00 22.02 ? 120 PHE X N   1 
ATOM   915  C CA  . PHE A 1 141 ? -1.148  60.430 59.946 1.00 21.80 ? 120 PHE X CA  1 
ATOM   916  C C   . PHE A 1 141 ? -2.348  60.444 60.930 1.00 22.61 ? 120 PHE X C   1 
ATOM   917  O O   . PHE A 1 141 ? -3.453  59.955 60.617 1.00 22.53 ? 120 PHE X O   1 
ATOM   918  C CB  . PHE A 1 141 ? -0.903  58.988 59.452 1.00 20.61 ? 120 PHE X CB  1 
ATOM   919  C CG  . PHE A 1 141 ? 0.070   58.878 58.314 1.00 20.02 ? 120 PHE X CG  1 
ATOM   920  C CD1 . PHE A 1 141 ? -0.276  59.260 57.024 1.00 17.64 ? 120 PHE X CD1 1 
ATOM   921  C CD2 . PHE A 1 141 ? 1.345   58.362 58.519 1.00 19.01 ? 120 PHE X CD2 1 
ATOM   922  C CE1 . PHE A 1 141 ? 0.634   59.123 55.950 1.00 15.15 ? 120 PHE X CE1 1 
ATOM   923  C CE2 . PHE A 1 141 ? 2.251   58.241 57.466 1.00 14.40 ? 120 PHE X CE2 1 
ATOM   924  C CZ  . PHE A 1 141 ? 1.885   58.631 56.168 1.00 14.20 ? 120 PHE X CZ  1 
ATOM   925  N N   . TYR A 1 142 ? -2.150  61.017 62.110 1.00 22.96 ? 121 TYR X N   1 
ATOM   926  C CA  . TYR A 1 142 ? -3.256  61.073 63.066 1.00 23.25 ? 121 TYR X CA  1 
ATOM   927  C C   . TYR A 1 142 ? -3.823  62.492 63.135 1.00 23.32 ? 121 TYR X C   1 
ATOM   928  O O   . TYR A 1 142 ? -4.839  62.707 63.781 1.00 23.77 ? 121 TYR X O   1 
ATOM   929  C CB  . TYR A 1 142 ? -2.828  60.558 64.479 1.00 22.84 ? 121 TYR X CB  1 
ATOM   930  C CG  . TYR A 1 142 ? -1.969  61.521 65.278 1.00 20.96 ? 121 TYR X CG  1 
ATOM   931  C CD1 . TYR A 1 142 ? -2.542  62.606 65.942 1.00 24.13 ? 121 TYR X CD1 1 
ATOM   932  C CD2 . TYR A 1 142 ? -0.585  61.379 65.329 1.00 20.47 ? 121 TYR X CD2 1 
ATOM   933  C CE1 . TYR A 1 142 ? -1.750  63.541 66.700 1.00 25.27 ? 121 TYR X CE1 1 
ATOM   934  C CE2 . TYR A 1 142 ? 0.209   62.250 66.068 1.00 24.04 ? 121 TYR X CE2 1 
ATOM   935  C CZ  . TYR A 1 142 ? -0.381  63.339 66.776 1.00 27.10 ? 121 TYR X CZ  1 
ATOM   936  O OH  . TYR A 1 142 ? 0.403   64.231 67.515 1.00 28.95 ? 121 TYR X OH  1 
ATOM   937  N N   . SER A 1 143 ? -3.188  63.444 62.454 1.00 23.43 ? 122 SER X N   1 
ATOM   938  C CA  . SER A 1 143 ? -3.511  64.839 62.654 1.00 24.08 ? 122 SER X CA  1 
ATOM   939  C C   . SER A 1 143 ? -2.998  65.720 61.528 1.00 24.83 ? 122 SER X C   1 
ATOM   940  O O   . SER A 1 143 ? -2.183  65.275 60.743 1.00 24.34 ? 122 SER X O   1 
ATOM   941  C CB  . SER A 1 143 ? -2.907  65.314 63.974 1.00 24.37 ? 122 SER X CB  1 
ATOM   942  O OG  . SER A 1 143 ? -1.497  65.466 63.904 1.00 23.89 ? 122 SER X OG  1 
ATOM   943  N N   . GLY A 1 144 ? -3.470  66.977 61.470 1.00 25.80 ? 123 GLY X N   1 
ATOM   944  C CA  . GLY A 1 144 ? -3.017  67.949 60.442 1.00 26.45 ? 123 GLY X CA  1 
ATOM   945  C C   . GLY A 1 144 ? -4.086  68.800 59.763 1.00 26.94 ? 123 GLY X C   1 
ATOM   946  O O   . GLY A 1 144 ? -5.247  68.426 59.700 1.00 27.23 ? 123 GLY X O   1 
ATOM   947  N N   . SER A 1 145 ? -3.715  69.966 59.261 1.00 26.99 ? 124 SER X N   1 
ATOM   948  C CA  . SER A 1 145 ? -4.673  70.772 58.538 1.00 27.50 ? 124 SER X CA  1 
ATOM   949  C C   . SER A 1 145 ? -3.994  71.542 57.438 1.00 29.60 ? 124 SER X C   1 
ATOM   950  O O   . SER A 1 145 ? -2.794  71.797 57.500 1.00 30.36 ? 124 SER X O   1 
ATOM   951  C CB  . SER A 1 145 ? -5.305  71.768 59.458 1.00 26.94 ? 124 SER X CB  1 
ATOM   952  O OG  . SER A 1 145 ? -5.959  71.123 60.508 1.00 25.24 ? 124 SER X OG  1 
ATOM   953  N N   . SER A 1 146 ? -4.751  71.930 56.417 1.00 31.58 ? 125 SER X N   1 
ATOM   954  C CA  . SER A 1 146 ? -4.152  72.598 55.265 1.00 32.37 ? 125 SER X CA  1 
ATOM   955  C C   . SER A 1 146 ? -4.198  74.066 55.565 1.00 33.10 ? 125 SER X C   1 
ATOM   956  O O   . SER A 1 146 ? -3.620  74.854 54.835 1.00 34.37 ? 125 SER X O   1 
ATOM   957  C CB  . SER A 1 146 ? -4.924  72.312 53.970 1.00 32.41 ? 125 SER X CB  1 
ATOM   958  O OG  . SER A 1 146 ? -6.326  72.614 54.069 1.00 34.19 ? 125 SER X OG  1 
ATOM   959  N N   . THR A 1 147 ? -4.845  74.426 56.673 1.00 33.20 ? 126 THR X N   1 
ATOM   960  C CA  . THR A 1 147 ? -5.283  75.797 56.890 1.00 33.00 ? 126 THR X CA  1 
ATOM   961  C C   . THR A 1 147 ? -4.483  76.517 57.948 1.00 33.55 ? 126 THR X C   1 
ATOM   962  O O   . THR A 1 147 ? -4.928  77.507 58.486 1.00 34.41 ? 126 THR X O   1 
ATOM   963  C CB  . THR A 1 147 ? -6.766  75.801 57.332 1.00 32.81 ? 126 THR X CB  1 
ATOM   964  O OG1 . THR A 1 147 ? -6.927  74.987 58.493 1.00 31.14 ? 126 THR X OG1 1 
ATOM   965  C CG2 . THR A 1 147 ? -7.655  75.207 56.243 1.00 32.58 ? 126 THR X CG2 1 
ATOM   966  N N   . LEU A 1 148 ? -3.317  76.022 58.294 1.00 33.49 ? 127 LEU X N   1 
ATOM   967  C CA  . LEU A 1 148 ? -2.660  76.572 59.442 1.00 33.95 ? 127 LEU X CA  1 
ATOM   968  C C   . LEU A 1 148 ? -1.861  77.804 59.100 1.00 34.79 ? 127 LEU X C   1 
ATOM   969  O O   . LEU A 1 148 ? -1.309  77.929 58.017 1.00 35.44 ? 127 LEU X O   1 
ATOM   970  C CB  . LEU A 1 148 ? -1.674  75.567 60.027 1.00 33.72 ? 127 LEU X CB  1 
ATOM   971  C CG  . LEU A 1 148 ? -2.059  74.180 60.517 1.00 34.45 ? 127 LEU X CG  1 
ATOM   972  C CD1 . LEU A 1 148 ? -0.753  73.447 60.917 1.00 34.27 ? 127 LEU X CD1 1 
ATOM   973  C CD2 . LEU A 1 148 ? -3.018  74.214 61.660 1.00 33.12 ? 127 LEU X CD2 1 
ATOM   974  N N   . ASP A 1 149 ? -1.672  78.676 60.069 1.00 35.58 ? 128 ASP X N   1 
ATOM   975  C CA  . ASP A 1 149 ? -0.807  79.807 59.803 1.00 36.42 ? 128 ASP X CA  1 
ATOM   976  C C   . ASP A 1 149 ? 0.530   79.465 59.105 1.00 35.80 ? 128 ASP X C   1 
ATOM   977  O O   . ASP A 1 149 ? 0.870   80.135 58.122 1.00 36.08 ? 128 ASP X O   1 
ATOM   978  C CB  . ASP A 1 149 ? -0.679  80.747 61.028 1.00 37.10 ? 128 ASP X CB  1 
ATOM   979  C CG  . ASP A 1 149 ? -2.017  81.423 61.380 1.00 39.06 ? 128 ASP X CG  1 
ATOM   980  O OD1 . ASP A 1 149 ? -2.870  81.568 60.445 1.00 37.80 ? 128 ASP X OD1 1 
ATOM   981  O OD2 . ASP A 1 149 ? -2.211  81.773 62.585 1.00 41.20 ? 128 ASP X OD2 1 
ATOM   982  N N   . VAL A 1 150 ? 1.273   78.451 59.560 1.00 34.81 ? 129 VAL X N   1 
ATOM   983  C CA  . VAL A 1 150 ? 2.570   78.195 58.923 1.00 33.89 ? 129 VAL X CA  1 
ATOM   984  C C   . VAL A 1 150 ? 2.414   77.614 57.523 1.00 34.26 ? 129 VAL X C   1 
ATOM   985  O O   . VAL A 1 150 ? 3.420   77.444 56.818 1.00 34.67 ? 129 VAL X O   1 
ATOM   986  C CB  . VAL A 1 150 ? 3.426   77.179 59.663 1.00 33.12 ? 129 VAL X CB  1 
ATOM   987  C CG1 . VAL A 1 150 ? 4.257   77.840 60.726 1.00 32.92 ? 129 VAL X CG1 1 
ATOM   988  C CG2 . VAL A 1 150 ? 2.530   76.095 60.212 1.00 32.88 ? 129 VAL X CG2 1 
ATOM   989  N N   . TYR A 1 151 ? 1.205   77.239 57.107 1.00 33.55 ? 130 TYR X N   1 
ATOM   990  C CA  . TYR A 1 151 ? 1.105   76.705 55.730 1.00 33.56 ? 130 TYR X CA  1 
ATOM   991  C C   . TYR A 1 151 ? 0.493   77.708 54.759 1.00 33.89 ? 130 TYR X C   1 
ATOM   992  O O   . TYR A 1 151 ? 0.006   77.316 53.719 1.00 33.86 ? 130 TYR X O   1 
ATOM   993  C CB  . TYR A 1 151 ? 0.304   75.403 55.645 1.00 32.65 ? 130 TYR X CB  1 
ATOM   994  C CG  . TYR A 1 151 ? 0.761   74.284 56.548 1.00 31.19 ? 130 TYR X CG  1 
ATOM   995  C CD1 . TYR A 1 151 ? 2.128   74.104 56.877 1.00 27.41 ? 130 TYR X CD1 1 
ATOM   996  C CD2 . TYR A 1 151 ? -0.169  73.371 57.051 1.00 27.49 ? 130 TYR X CD2 1 
ATOM   997  C CE1 . TYR A 1 151 ? 2.533   73.057 57.681 1.00 23.07 ? 130 TYR X CE1 1 
ATOM   998  C CE2 . TYR A 1 151 ? 0.228   72.310 57.858 1.00 25.45 ? 130 TYR X CE2 1 
ATOM   999  C CZ  . TYR A 1 151 ? 1.578   72.145 58.179 1.00 25.76 ? 130 TYR X CZ  1 
ATOM   1000 O OH  . TYR A 1 151 ? 1.930   71.071 59.031 1.00 24.14 ? 130 TYR X OH  1 
ATOM   1001 N N   . ASN A 1 152 ? 0.492   78.992 55.100 1.00 34.40 ? 131 ASN X N   1 
ATOM   1002 C CA  . ASN A 1 152 ? -0.064  79.980 54.194 1.00 35.15 ? 131 ASN X CA  1 
ATOM   1003 C C   . ASN A 1 152 ? 0.722   80.085 52.899 1.00 35.46 ? 131 ASN X C   1 
ATOM   1004 O O   . ASN A 1 152 ? 1.911   80.443 52.908 1.00 35.21 ? 131 ASN X O   1 
ATOM   1005 C CB  . ASN A 1 152 ? -0.109  81.347 54.848 1.00 35.35 ? 131 ASN X CB  1 
ATOM   1006 C CG  . ASN A 1 152 ? -1.138  82.270 54.198 1.00 36.18 ? 131 ASN X CG  1 
ATOM   1007 O OD1 . ASN A 1 152 ? -1.363  82.270 52.971 1.00 36.25 ? 131 ASN X OD1 1 
ATOM   1008 N ND2 . ASN A 1 152 ? -1.752  83.082 55.027 1.00 36.93 ? 131 ASN X ND2 1 
ATOM   1009 N N   . GLY A 1 153 ? 0.057   79.800 51.782 1.00 35.42 ? 132 GLY X N   1 
ATOM   1010 C CA  . GLY A 1 153 ? 0.770   79.754 50.508 1.00 36.32 ? 132 GLY X CA  1 
ATOM   1011 C C   . GLY A 1 153 ? 1.099   81.088 49.853 1.00 36.89 ? 132 GLY X C   1 
ATOM   1012 O O   . GLY A 1 153 ? 1.868   81.141 48.880 1.00 36.86 ? 132 GLY X O   1 
ATOM   1013 N N   . LYS A 1 154 ? 0.534   82.178 50.371 1.00 36.97 ? 133 LYS X N   1 
ATOM   1014 C CA  . LYS A 1 154 ? 0.684   83.458 49.689 1.00 36.47 ? 133 LYS X CA  1 
ATOM   1015 C C   . LYS A 1 154 ? 2.130   83.929 49.595 1.00 35.72 ? 133 LYS X C   1 
ATOM   1016 O O   . LYS A 1 154 ? 2.514   84.468 48.568 1.00 36.11 ? 133 LYS X O   1 
ATOM   1017 C CB  . LYS A 1 154 ? -0.216  84.525 50.308 1.00 36.88 ? 133 LYS X CB  1 
ATOM   1018 C CG  . LYS A 1 154 ? 0.339   85.160 51.576 1.00 37.26 ? 133 LYS X CG  1 
ATOM   1019 C CD  . LYS A 1 154 ? -0.807  85.692 52.402 1.00 36.81 ? 133 LYS X CD  1 
ATOM   1020 C CE  . LYS A 1 154 ? -0.408  86.827 53.300 1.00 36.57 ? 133 LYS X CE  1 
ATOM   1021 N NZ  . LYS A 1 154 ? -1.682  87.346 53.858 1.00 35.91 ? 133 LYS X NZ  1 
ATOM   1022 N N   . TYR A 1 155 ? 2.937   83.731 50.626 1.00 34.63 ? 134 TYR X N   1 
ATOM   1023 C CA  . TYR A 1 155 ? 4.334   84.203 50.571 1.00 34.27 ? 134 TYR X CA  1 
ATOM   1024 C C   . TYR A 1 155 ? 5.120   83.458 49.528 1.00 34.37 ? 134 TYR X C   1 
ATOM   1025 O O   . TYR A 1 155 ? 5.884   84.037 48.775 1.00 35.13 ? 134 TYR X O   1 
ATOM   1026 C CB  . TYR A 1 155 ? 5.031   84.026 51.916 1.00 34.04 ? 134 TYR X CB  1 
ATOM   1027 C CG  . TYR A 1 155 ? 4.260   84.654 53.029 1.00 34.05 ? 134 TYR X CG  1 
ATOM   1028 C CD1 . TYR A 1 155 ? 3.601   83.886 53.969 1.00 33.42 ? 134 TYR X CD1 1 
ATOM   1029 C CD2 . TYR A 1 155 ? 4.121   86.028 53.091 1.00 36.28 ? 134 TYR X CD2 1 
ATOM   1030 C CE1 . TYR A 1 155 ? 2.840   84.473 54.976 1.00 34.24 ? 134 TYR X CE1 1 
ATOM   1031 C CE2 . TYR A 1 155 ? 3.376   86.635 54.098 1.00 37.51 ? 134 TYR X CE2 1 
ATOM   1032 C CZ  . TYR A 1 155 ? 2.740   85.862 55.046 1.00 37.03 ? 134 TYR X CZ  1 
ATOM   1033 O OH  . TYR A 1 155 ? 2.014   86.504 56.058 1.00 36.45 ? 134 TYR X OH  1 
ATOM   1034 N N   . LEU A 1 156 ? 4.958   82.150 49.487 1.00 34.56 ? 135 LEU X N   1 
ATOM   1035 C CA  . LEU A 1 156 ? 5.667   81.364 48.492 1.00 34.39 ? 135 LEU X CA  1 
ATOM   1036 C C   . LEU A 1 156 ? 5.141   81.721 47.111 1.00 34.70 ? 135 LEU X C   1 
ATOM   1037 O O   . LEU A 1 156 ? 5.918   82.033 46.197 1.00 34.75 ? 135 LEU X O   1 
ATOM   1038 C CB  . LEU A 1 156 ? 5.485   79.872 48.752 1.00 33.91 ? 135 LEU X CB  1 
ATOM   1039 C CG  . LEU A 1 156 ? 6.578   79.010 48.149 1.00 33.18 ? 135 LEU X CG  1 
ATOM   1040 C CD1 . LEU A 1 156 ? 7.993   79.668 48.197 1.00 30.37 ? 135 LEU X CD1 1 
ATOM   1041 C CD2 . LEU A 1 156 ? 6.534   77.714 48.886 1.00 31.58 ? 135 LEU X CD2 1 
ATOM   1042 N N   . ALA A 1 157 ? 3.821   81.701 46.945 1.00 35.02 ? 136 ALA X N   1 
ATOM   1043 C CA  . ALA A 1 157 ? 3.286   81.930 45.607 1.00 35.89 ? 136 ALA X CA  1 
ATOM   1044 C C   . ALA A 1 157 ? 3.864   83.255 45.067 1.00 37.02 ? 136 ALA X C   1 
ATOM   1045 O O   . ALA A 1 157 ? 4.489   83.312 43.974 1.00 37.15 ? 136 ALA X O   1 
ATOM   1046 C CB  . ALA A 1 157 ? 1.795   81.942 45.624 1.00 35.32 ? 136 ALA X CB  1 
ATOM   1047 N N   . TYR A 1 158 ? 3.694   84.297 45.882 1.00 37.39 ? 137 TYR X N   1 
ATOM   1048 C CA  . TYR A 1 158 ? 4.070   85.642 45.537 1.00 37.21 ? 137 TYR X CA  1 
ATOM   1049 C C   . TYR A 1 158 ? 5.564   85.794 45.290 1.00 37.28 ? 137 TYR X C   1 
ATOM   1050 O O   . TYR A 1 158 ? 5.976   86.333 44.266 1.00 37.01 ? 137 TYR X O   1 
ATOM   1051 C CB  . TYR A 1 158 ? 3.643   86.581 46.645 1.00 37.14 ? 137 TYR X CB  1 
ATOM   1052 C CG  . TYR A 1 158 ? 4.094   87.981 46.382 1.00 39.19 ? 137 TYR X CG  1 
ATOM   1053 C CD1 . TYR A 1 158 ? 5.161   88.541 47.094 1.00 40.15 ? 137 TYR X CD1 1 
ATOM   1054 C CD2 . TYR A 1 158 ? 3.472   88.752 45.384 1.00 41.49 ? 137 TYR X CD2 1 
ATOM   1055 C CE1 . TYR A 1 158 ? 5.591   89.833 46.833 1.00 41.99 ? 137 TYR X CE1 1 
ATOM   1056 C CE2 . TYR A 1 158 ? 3.884   90.040 45.118 1.00 43.02 ? 137 TYR X CE2 1 
ATOM   1057 C CZ  . TYR A 1 158 ? 4.940   90.576 45.850 1.00 44.46 ? 137 TYR X CZ  1 
ATOM   1058 O OH  . TYR A 1 158 ? 5.335   91.850 45.579 1.00 46.53 ? 137 TYR X OH  1 
ATOM   1059 N N   . THR A 1 159 ? 6.399   85.331 46.213 1.00 37.08 ? 138 THR X N   1 
ATOM   1060 C CA  . THR A 1 159 ? 7.835   85.582 46.039 1.00 36.36 ? 138 THR X CA  1 
ATOM   1061 C C   . THR A 1 159 ? 8.438   84.831 44.882 1.00 36.37 ? 138 THR X C   1 
ATOM   1062 O O   . THR A 1 159 ? 9.257   85.380 44.177 1.00 35.94 ? 138 THR X O   1 
ATOM   1063 C CB  . THR A 1 159 ? 8.634   85.194 47.259 1.00 35.74 ? 138 THR X CB  1 
ATOM   1064 O OG1 . THR A 1 159 ? 8.158   85.951 48.352 1.00 35.92 ? 138 THR X OG1 1 
ATOM   1065 C CG2 . THR A 1 159 ? 10.069  85.541 47.056 1.00 34.55 ? 138 THR X CG2 1 
ATOM   1066 N N   . GLU A 1 160 ? 8.092   83.554 44.732 1.00 36.56 ? 139 GLU X N   1 
ATOM   1067 C CA  . GLU A 1 160 ? 8.759   82.710 43.724 1.00 37.33 ? 139 GLU X CA  1 
ATOM   1068 C C   . GLU A 1 160 ? 7.892   82.565 42.470 1.00 38.12 ? 139 GLU X C   1 
ATOM   1069 O O   . GLU A 1 160 ? 8.308   81.941 41.492 1.00 37.91 ? 139 GLU X O   1 
ATOM   1070 C CB  . GLU A 1 160 ? 9.133   81.320 44.260 1.00 36.79 ? 139 GLU X CB  1 
ATOM   1071 C CG  . GLU A 1 160 ? 10.281  81.244 45.280 1.00 35.95 ? 139 GLU X CG  1 
ATOM   1072 C CD  . GLU A 1 160 ? 11.551  81.910 44.806 1.00 36.38 ? 139 GLU X CD  1 
ATOM   1073 O OE1 . GLU A 1 160 ? 11.968  81.687 43.642 1.00 36.02 ? 139 GLU X OE1 1 
ATOM   1074 O OE2 . GLU A 1 160 ? 12.139  82.668 45.609 1.00 35.92 ? 139 GLU X OE2 1 
ATOM   1075 N N   . GLU A 1 161 ? 6.675   83.122 42.508 1.00 38.43 ? 140 GLU X N   1 
ATOM   1076 C CA  . GLU A 1 161 ? 5.875   83.166 41.305 1.00 38.34 ? 140 GLU X CA  1 
ATOM   1077 C C   . GLU A 1 161 ? 5.420   81.780 40.861 1.00 36.69 ? 140 GLU X C   1 
ATOM   1078 O O   . GLU A 1 161 ? 5.447   81.471 39.679 1.00 35.99 ? 140 GLU X O   1 
ATOM   1079 C CB  . GLU A 1 161 ? 6.763   83.726 40.229 1.00 39.18 ? 140 GLU X CB  1 
ATOM   1080 C CG  . GLU A 1 161 ? 6.072   84.691 39.307 1.00 45.56 ? 140 GLU X CG  1 
ATOM   1081 C CD  . GLU A 1 161 ? 6.972   85.915 38.985 1.00 51.94 ? 140 GLU X CD  1 
ATOM   1082 O OE1 . GLU A 1 161 ? 8.208   85.772 38.697 1.00 52.45 ? 140 GLU X OE1 1 
ATOM   1083 O OE2 . GLU A 1 161 ? 6.409   87.028 39.037 1.00 53.80 ? 140 GLU X OE2 1 
ATOM   1084 N N   . VAL A 1 162 ? 5.003   80.953 41.816 1.00 35.21 ? 141 VAL X N   1 
ATOM   1085 C CA  . VAL A 1 162 ? 4.556   79.584 41.551 1.00 32.95 ? 141 VAL X CA  1 
ATOM   1086 C C   . VAL A 1 162 ? 3.096   79.595 41.941 1.00 32.53 ? 141 VAL X C   1 
ATOM   1087 O O   . VAL A 1 162 ? 2.668   80.474 42.685 1.00 31.95 ? 141 VAL X O   1 
ATOM   1088 C CB  . VAL A 1 162 ? 5.331   78.525 42.411 1.00 33.06 ? 141 VAL X CB  1 
ATOM   1089 C CG1 . VAL A 1 162 ? 6.851   78.538 42.109 1.00 29.64 ? 141 VAL X CG1 1 
ATOM   1090 C CG2 . VAL A 1 162 ? 5.093   78.770 43.899 1.00 32.00 ? 141 VAL X CG2 1 
ATOM   1091 N N   . VAL A 1 163 ? 2.327   78.670 41.384 1.00 32.07 ? 142 VAL X N   1 
ATOM   1092 C CA  . VAL A 1 163 ? 0.962   78.417 41.812 1.00 31.60 ? 142 VAL X CA  1 
ATOM   1093 C C   . VAL A 1 163 ? 1.060   77.394 42.955 1.00 31.80 ? 142 VAL X C   1 
ATOM   1094 O O   . VAL A 1 163 ? 1.584   76.289 42.758 1.00 32.86 ? 142 VAL X O   1 
ATOM   1095 C CB  . VAL A 1 163 ? 0.120   77.859 40.624 1.00 31.33 ? 142 VAL X CB  1 
ATOM   1096 C CG1 . VAL A 1 163 ? -1.196  77.304 41.080 1.00 30.24 ? 142 VAL X CG1 1 
ATOM   1097 C CG2 . VAL A 1 163 ? -0.142  78.939 39.651 1.00 29.79 ? 142 VAL X CG2 1 
ATOM   1098 N N   . LEU A 1 164 ? 0.587   77.770 44.139 1.00 31.03 ? 143 LEU X N   1 
ATOM   1099 C CA  . LEU A 1 164 ? 0.737   76.953 45.342 1.00 30.14 ? 143 LEU X CA  1 
ATOM   1100 C C   . LEU A 1 164 ? -0.572  76.270 45.738 1.00 29.84 ? 143 LEU X C   1 
ATOM   1101 O O   . LEU A 1 164 ? -1.563  76.956 46.093 1.00 30.10 ? 143 LEU X O   1 
ATOM   1102 C CB  . LEU A 1 164 ? 1.236   77.796 46.517 1.00 29.35 ? 143 LEU X CB  1 
ATOM   1103 C CG  . LEU A 1 164 ? 1.656   76.687 47.483 1.00 30.86 ? 143 LEU X CG  1 
ATOM   1104 C CD1 . LEU A 1 164 ? 3.125   76.581 47.660 1.00 28.88 ? 143 LEU X CD1 1 
ATOM   1105 C CD2 . LEU A 1 164 ? 0.907   76.622 48.837 1.00 30.46 ? 143 LEU X CD2 1 
ATOM   1106 N N   . VAL A 1 165 ? -0.596  74.939 45.676 1.00 28.47 ? 144 VAL X N   1 
ATOM   1107 C CA  . VAL A 1 165 ? -1.793  74.192 46.111 1.00 27.69 ? 144 VAL X CA  1 
ATOM   1108 C C   . VAL A 1 165 ? -1.504  73.549 47.461 1.00 27.35 ? 144 VAL X C   1 
ATOM   1109 O O   . VAL A 1 165 ? -0.396  73.037 47.655 1.00 27.50 ? 144 VAL X O   1 
ATOM   1110 C CB  . VAL A 1 165 ? -2.117  72.999 45.156 1.00 27.29 ? 144 VAL X CB  1 
ATOM   1111 C CG1 . VAL A 1 165 ? -3.382  72.328 45.579 1.00 26.98 ? 144 VAL X CG1 1 
ATOM   1112 C CG2 . VAL A 1 165 ? -2.236  73.441 43.742 1.00 27.37 ? 144 VAL X CG2 1 
ATOM   1113 N N   . SER A 1 166 ? -2.462  73.527 48.382 1.00 26.20 ? 145 SER X N   1 
ATOM   1114 C CA  . SER A 1 166 ? -2.327  72.580 49.484 1.00 26.53 ? 145 SER X CA  1 
ATOM   1115 C C   . SER A 1 166 ? -3.548  71.668 49.576 1.00 25.94 ? 145 SER X C   1 
ATOM   1116 O O   . SER A 1 166 ? -4.687  72.159 49.632 1.00 26.61 ? 145 SER X O   1 
ATOM   1117 C CB  . SER A 1 166 ? -2.048  73.265 50.832 1.00 27.08 ? 145 SER X CB  1 
ATOM   1118 O OG  . SER A 1 166 ? -3.044  74.227 51.180 1.00 29.68 ? 145 SER X OG  1 
ATOM   1119 N N   . LEU A 1 167 ? -3.340  70.352 49.585 1.00 23.92 ? 146 LEU X N   1 
ATOM   1120 C CA  . LEU A 1 167 ? -4.493  69.469 49.653 1.00 23.31 ? 146 LEU X CA  1 
ATOM   1121 C C   . LEU A 1 167 ? -4.850  69.097 51.124 1.00 23.24 ? 146 LEU X C   1 
ATOM   1122 O O   . LEU A 1 167 ? -4.405  69.719 52.061 1.00 22.57 ? 146 LEU X O   1 
ATOM   1123 C CB  . LEU A 1 167 ? -4.306  68.236 48.742 1.00 22.66 ? 146 LEU X CB  1 
ATOM   1124 C CG  . LEU A 1 167 ? -2.959  67.516 48.972 1.00 22.65 ? 146 LEU X CG  1 
ATOM   1125 C CD1 . LEU A 1 167 ? -2.980  66.647 50.273 1.00 21.34 ? 146 LEU X CD1 1 
ATOM   1126 C CD2 . LEU A 1 167 ? -2.478  66.727 47.749 1.00 17.70 ? 146 LEU X CD2 1 
ATOM   1127 N N   . SER A 1 168 ? -5.671  68.085 51.318 1.00 23.43 ? 147 SER X N   1 
ATOM   1128 C CA  . SER A 1 168 ? -6.012  67.679 52.659 1.00 24.12 ? 147 SER X CA  1 
ATOM   1129 C C   . SER A 1 168 ? -6.423  66.234 52.519 1.00 24.17 ? 147 SER X C   1 
ATOM   1130 O O   . SER A 1 168 ? -6.616  65.740 51.414 1.00 24.05 ? 147 SER X O   1 
ATOM   1131 C CB  . SER A 1 168 ? -7.178  68.483 53.194 1.00 23.76 ? 147 SER X CB  1 
ATOM   1132 O OG  . SER A 1 168 ? -8.338  68.037 52.523 1.00 23.97 ? 147 SER X OG  1 
ATOM   1133 N N   . TYR A 1 169 ? -6.536  65.537 53.625 1.00 24.36 ? 148 TYR X N   1 
ATOM   1134 C CA  . TYR A 1 169 ? -6.743  64.109 53.499 1.00 24.84 ? 148 TYR X CA  1 
ATOM   1135 C C   . TYR A 1 169 ? -7.094  63.604 54.879 1.00 24.81 ? 148 TYR X C   1 
ATOM   1136 O O   . TYR A 1 169 ? -6.693  64.222 55.894 1.00 25.63 ? 148 TYR X O   1 
ATOM   1137 C CB  . TYR A 1 169 ? -5.489  63.426 52.904 1.00 24.86 ? 148 TYR X CB  1 
ATOM   1138 C CG  . TYR A 1 169 ? -4.255  63.484 53.790 1.00 24.85 ? 148 TYR X CG  1 
ATOM   1139 C CD1 . TYR A 1 169 ? -3.339  64.556 53.705 1.00 22.48 ? 148 TYR X CD1 1 
ATOM   1140 C CD2 . TYR A 1 169 ? -4.007  62.477 54.726 1.00 24.26 ? 148 TYR X CD2 1 
ATOM   1141 C CE1 . TYR A 1 169 ? -2.221  64.622 54.532 1.00 21.45 ? 148 TYR X CE1 1 
ATOM   1142 C CE2 . TYR A 1 169 ? -2.871  62.540 55.563 1.00 23.55 ? 148 TYR X CE2 1 
ATOM   1143 C CZ  . TYR A 1 169 ? -1.990  63.610 55.459 1.00 21.92 ? 148 TYR X CZ  1 
ATOM   1144 O OH  . TYR A 1 169 ? -0.877  63.643 56.287 1.00 19.50 ? 148 TYR X OH  1 
ATOM   1145 N N   . ARG A 1 170 ? -7.908  62.557 54.919 1.00 24.49 ? 149 ARG X N   1 
ATOM   1146 C CA  . ARG A 1 170 ? -8.396  62.008 56.183 1.00 24.63 ? 149 ARG X CA  1 
ATOM   1147 C C   . ARG A 1 170 ? -7.226  61.425 56.996 1.00 25.23 ? 149 ARG X C   1 
ATOM   1148 O O   . ARG A 1 170 ? -6.336  60.727 56.449 1.00 26.02 ? 149 ARG X O   1 
ATOM   1149 C CB  . ARG A 1 170 ? -9.455  60.925 55.939 1.00 23.95 ? 149 ARG X CB  1 
ATOM   1150 C CG  . ARG A 1 170 ? -10.780 61.438 55.478 1.00 23.01 ? 149 ARG X CG  1 
ATOM   1151 C CD  . ARG A 1 170 ? -11.689 60.298 55.028 1.00 21.92 ? 149 ARG X CD  1 
ATOM   1152 N NE  . ARG A 1 170 ? -11.373 59.894 53.669 1.00 20.39 ? 149 ARG X NE  1 
ATOM   1153 C CZ  . ARG A 1 170 ? -11.909 58.835 53.049 1.00 20.62 ? 149 ARG X CZ  1 
ATOM   1154 N NH1 . ARG A 1 170 ? -12.802 58.080 53.680 1.00 17.74 ? 149 ARG X NH1 1 
ATOM   1155 N NH2 . ARG A 1 170 ? -11.567 58.545 51.775 1.00 16.90 ? 149 ARG X NH2 1 
ATOM   1156 N N   . VAL A 1 171 ? -7.237  61.715 58.294 1.00 24.82 ? 150 VAL X N   1 
ATOM   1157 C CA  . VAL A 1 171 ? -6.258  61.168 59.210 1.00 24.00 ? 150 VAL X CA  1 
ATOM   1158 C C   . VAL A 1 171 ? -6.935  60.285 60.246 1.00 25.65 ? 150 VAL X C   1 
ATOM   1159 O O   . VAL A 1 171 ? -8.141  60.002 60.167 1.00 25.09 ? 150 VAL X O   1 
ATOM   1160 C CB  . VAL A 1 171 ? -5.519  62.281 59.950 1.00 23.91 ? 150 VAL X CB  1 
ATOM   1161 C CG1 . VAL A 1 171 ? -4.630  63.056 58.966 1.00 21.42 ? 150 VAL X CG1 1 
ATOM   1162 C CG2 . VAL A 1 171 ? -6.513  63.186 60.747 1.00 18.54 ? 150 VAL X CG2 1 
ATOM   1163 N N   . GLY A 1 172 ? -6.131  59.862 61.222 1.00 26.95 ? 151 GLY X N   1 
ATOM   1164 C CA  . GLY A 1 172 ? -6.543  58.906 62.242 1.00 27.92 ? 151 GLY X CA  1 
ATOM   1165 C C   . GLY A 1 172 ? -7.251  57.731 61.613 1.00 29.36 ? 151 GLY X C   1 
ATOM   1166 O O   . GLY A 1 172 ? -6.927  57.322 60.503 1.00 30.54 ? 151 GLY X O   1 
ATOM   1167 N N   . ALA A 1 173 ? -8.253  57.207 62.298 1.00 30.19 ? 152 ALA X N   1 
ATOM   1168 C CA  . ALA A 1 173 ? -8.875  55.979 61.867 1.00 31.23 ? 152 ALA X CA  1 
ATOM   1169 C C   . ALA A 1 173 ? -9.746  56.224 60.635 1.00 31.90 ? 152 ALA X C   1 
ATOM   1170 O O   . ALA A 1 173 ? -9.993  55.290 59.864 1.00 31.96 ? 152 ALA X O   1 
ATOM   1171 C CB  . ALA A 1 173 ? -9.717  55.354 63.026 1.00 31.65 ? 152 ALA X CB  1 
ATOM   1172 N N   . PHE A 1 174 ? -10.227 57.463 60.477 1.00 31.70 ? 153 PHE X N   1 
ATOM   1173 C CA  . PHE A 1 174 ? -11.045 57.851 59.313 1.00 31.10 ? 153 PHE X CA  1 
ATOM   1174 C C   . PHE A 1 174 ? -10.261 57.669 58.045 1.00 31.36 ? 153 PHE X C   1 
ATOM   1175 O O   . PHE A 1 174 ? -10.827 57.256 57.009 1.00 32.49 ? 153 PHE X O   1 
ATOM   1176 C CB  . PHE A 1 174 ? -11.445 59.315 59.452 1.00 30.90 ? 153 PHE X CB  1 
ATOM   1177 C CG  . PHE A 1 174 ? -12.089 59.606 60.761 1.00 30.97 ? 153 PHE X CG  1 
ATOM   1178 C CD1 . PHE A 1 174 ? -13.455 59.374 60.949 1.00 31.39 ? 153 PHE X CD1 1 
ATOM   1179 C CD2 . PHE A 1 174 ? -11.341 60.000 61.831 1.00 30.29 ? 153 PHE X CD2 1 
ATOM   1180 C CE1 . PHE A 1 174 ? -14.052 59.581 62.182 1.00 29.71 ? 153 PHE X CE1 1 
ATOM   1181 C CE2 . PHE A 1 174 ? -11.937 60.223 63.072 1.00 29.12 ? 153 PHE X CE2 1 
ATOM   1182 C CZ  . PHE A 1 174 ? -13.278 60.019 63.243 1.00 28.50 ? 153 PHE X CZ  1 
ATOM   1183 N N   . GLY A 1 175 ? -8.951  57.965 58.118 1.00 30.41 ? 154 GLY X N   1 
ATOM   1184 C CA  . GLY A 1 175 ? -8.095  57.861 56.953 1.00 28.77 ? 154 GLY X CA  1 
ATOM   1185 C C   . GLY A 1 175 ? -7.402  56.497 56.817 1.00 28.57 ? 154 GLY X C   1 
ATOM   1186 O O   . GLY A 1 175 ? -6.971  56.133 55.713 1.00 28.90 ? 154 GLY X O   1 
ATOM   1187 N N   . PHE A 1 176 ? -7.256  55.721 57.896 1.00 26.66 ? 155 PHE X N   1 
ATOM   1188 C CA  . PHE A 1 176 ? -6.329  54.622 57.782 1.00 25.60 ? 155 PHE X CA  1 
ATOM   1189 C C   . PHE A 1 176 ? -6.745  53.317 58.461 1.00 26.79 ? 155 PHE X C   1 
ATOM   1190 O O   . PHE A 1 176 ? -5.918  52.390 58.625 1.00 26.72 ? 155 PHE X O   1 
ATOM   1191 C CB  . PHE A 1 176 ? -4.940  55.096 58.219 1.00 24.22 ? 155 PHE X CB  1 
ATOM   1192 C CG  . PHE A 1 176 ? -4.351  56.110 57.289 1.00 23.01 ? 155 PHE X CG  1 
ATOM   1193 C CD1 . PHE A 1 176 ? -3.756  55.722 56.094 1.00 23.62 ? 155 PHE X CD1 1 
ATOM   1194 C CD2 . PHE A 1 176 ? -4.439  57.467 57.562 1.00 22.34 ? 155 PHE X CD2 1 
ATOM   1195 C CE1 . PHE A 1 176 ? -3.225  56.656 55.208 1.00 20.25 ? 155 PHE X CE1 1 
ATOM   1196 C CE2 . PHE A 1 176 ? -3.939  58.406 56.693 1.00 21.47 ? 155 PHE X CE2 1 
ATOM   1197 C CZ  . PHE A 1 176 ? -3.319  57.994 55.500 1.00 22.64 ? 155 PHE X CZ  1 
ATOM   1198 N N   . LEU A 1 177 ? -8.019  53.211 58.845 1.00 27.60 ? 156 LEU X N   1 
ATOM   1199 C CA  . LEU A 1 177 ? -8.457  52.019 59.547 1.00 28.59 ? 156 LEU X CA  1 
ATOM   1200 C C   . LEU A 1 177 ? -8.390  50.977 58.479 1.00 29.10 ? 156 LEU X C   1 
ATOM   1201 O O   . LEU A 1 177 ? -8.806  51.253 57.368 1.00 29.43 ? 156 LEU X O   1 
ATOM   1202 C CB  . LEU A 1 177 ? -9.868  52.170 60.020 1.00 28.90 ? 156 LEU X CB  1 
ATOM   1203 C CG  . LEU A 1 177 ? -10.324 50.916 60.743 1.00 29.97 ? 156 LEU X CG  1 
ATOM   1204 C CD1 . LEU A 1 177 ? -10.537 51.212 62.259 1.00 30.73 ? 156 LEU X CD1 1 
ATOM   1205 C CD2 . LEU A 1 177 ? -11.648 50.580 60.102 1.00 28.38 ? 156 LEU X CD2 1 
ATOM   1206 N N   . ALA A 1 178 ? -7.807  49.822 58.765 1.00 29.31 ? 157 ALA X N   1 
ATOM   1207 C CA  . ALA A 1 178 ? -7.527  48.859 57.725 1.00 30.80 ? 157 ALA X CA  1 
ATOM   1208 C C   . ALA A 1 178 ? -8.003  47.412 58.038 1.00 32.26 ? 157 ALA X C   1 
ATOM   1209 O O   . ALA A 1 178 ? -7.429  46.722 58.884 1.00 32.45 ? 157 ALA X O   1 
ATOM   1210 C CB  . ALA A 1 178 ? -6.006  48.879 57.378 1.00 29.94 ? 157 ALA X CB  1 
ATOM   1211 N N   . LEU A 1 179 ? -9.046  46.946 57.358 1.00 34.10 ? 158 LEU X N   1 
ATOM   1212 C CA  . LEU A 1 179 ? -9.402  45.517 57.406 1.00 35.09 ? 158 LEU X CA  1 
ATOM   1213 C C   . LEU A 1 179 ? -9.151  44.901 56.048 1.00 36.29 ? 158 LEU X C   1 
ATOM   1214 O O   . LEU A 1 179 ? -10.057 44.780 55.259 1.00 37.22 ? 158 LEU X O   1 
ATOM   1215 C CB  . LEU A 1 179 ? -10.856 45.362 57.802 1.00 34.29 ? 158 LEU X CB  1 
ATOM   1216 C CG  . LEU A 1 179 ? -11.011 45.836 59.256 1.00 34.82 ? 158 LEU X CG  1 
ATOM   1217 C CD1 . LEU A 1 179 ? -12.425 46.301 59.557 1.00 33.44 ? 158 LEU X CD1 1 
ATOM   1218 C CD2 . LEU A 1 179 ? -10.542 44.765 60.256 1.00 32.35 ? 158 LEU X CD2 1 
ATOM   1219 N N   . HIS A 1 180 ? -7.909  44.556 55.743 1.00 37.92 ? 159 HIS X N   1 
ATOM   1220 C CA  . HIS A 1 180 ? -7.599  43.987 54.437 1.00 39.83 ? 159 HIS X CA  1 
ATOM   1221 C C   . HIS A 1 180 ? -8.568  42.875 54.063 1.00 41.15 ? 159 HIS X C   1 
ATOM   1222 O O   . HIS A 1 180 ? -8.877  42.017 54.901 1.00 41.73 ? 159 HIS X O   1 
ATOM   1223 C CB  . HIS A 1 180 ? -6.199  43.415 54.421 1.00 39.67 ? 159 HIS X CB  1 
ATOM   1224 C CG  . HIS A 1 180 ? -5.757  42.953 53.065 1.00 42.60 ? 159 HIS X CG  1 
ATOM   1225 N ND1 . HIS A 1 180 ? -5.561  43.825 52.007 1.00 43.42 ? 159 HIS X ND1 1 
ATOM   1226 C CD2 . HIS A 1 180 ? -5.437  41.717 52.602 1.00 43.42 ? 159 HIS X CD2 1 
ATOM   1227 C CE1 . HIS A 1 180 ? -5.148  43.143 50.950 1.00 44.26 ? 159 HIS X CE1 1 
ATOM   1228 N NE2 . HIS A 1 180 ? -5.061  41.863 51.285 1.00 45.28 ? 159 HIS X NE2 1 
ATOM   1229 N N   . GLY A 1 181 ? -9.020  42.862 52.803 1.00 42.19 ? 160 GLY X N   1 
ATOM   1230 C CA  . GLY A 1 181 ? -10.026 41.892 52.347 1.00 42.53 ? 160 GLY X CA  1 
ATOM   1231 C C   . GLY A 1 181 ? -11.383 42.561 52.210 1.00 42.99 ? 160 GLY X C   1 
ATOM   1232 O O   . GLY A 1 181 ? -12.143 42.279 51.282 1.00 42.99 ? 160 GLY X O   1 
ATOM   1233 N N   . SER A 1 182 ? -11.698 43.473 53.122 1.00 43.26 ? 161 SER X N   1 
ATOM   1234 C CA  . SER A 1 182 ? -12.965 44.182 53.024 1.00 43.87 ? 161 SER X CA  1 
ATOM   1235 C C   . SER A 1 182 ? -12.882 45.227 51.910 1.00 44.29 ? 161 SER X C   1 
ATOM   1236 O O   . SER A 1 182 ? -11.780 45.627 51.504 1.00 45.25 ? 161 SER X O   1 
ATOM   1237 C CB  . SER A 1 182 ? -13.274 44.858 54.334 1.00 43.45 ? 161 SER X CB  1 
ATOM   1238 O OG  . SER A 1 182 ? -13.995 46.054 54.094 1.00 46.33 ? 161 SER X OG  1 
ATOM   1239 N N   . GLN A 1 183 ? -14.011 45.684 51.391 1.00 43.80 ? 162 GLN X N   1 
ATOM   1240 C CA  . GLN A 1 183 ? -13.919 46.789 50.441 1.00 43.77 ? 162 GLN X CA  1 
ATOM   1241 C C   . GLN A 1 183 ? -14.546 47.977 51.105 1.00 43.05 ? 162 GLN X C   1 
ATOM   1242 O O   . GLN A 1 183 ? -14.532 49.094 50.584 1.00 42.71 ? 162 GLN X O   1 
ATOM   1243 C CB  . GLN A 1 183 ? -14.584 46.467 49.098 1.00 44.22 ? 162 GLN X CB  1 
ATOM   1244 C CG  . GLN A 1 183 ? -13.840 45.356 48.272 1.00 47.24 ? 162 GLN X CG  1 
ATOM   1245 C CD  . GLN A 1 183 ? -12.381 45.732 47.871 1.00 51.59 ? 162 GLN X CD  1 
ATOM   1246 O OE1 . GLN A 1 183 ? -12.050 46.918 47.648 1.00 53.42 ? 162 GLN X OE1 1 
ATOM   1247 N NE2 . GLN A 1 183 ? -11.513 44.720 47.790 1.00 50.97 ? 162 GLN X NE2 1 
ATOM   1248 N N   . GLU A 1 184 ? -15.088 47.723 52.288 1.00 41.95 ? 163 GLU X N   1 
ATOM   1249 C CA  . GLU A 1 184 ? -15.713 48.779 53.057 1.00 41.22 ? 163 GLU X CA  1 
ATOM   1250 C C   . GLU A 1 184 ? -14.677 49.653 53.835 1.00 40.39 ? 163 GLU X C   1 
ATOM   1251 O O   . GLU A 1 184 ? -14.919 50.850 54.063 1.00 39.84 ? 163 GLU X O   1 
ATOM   1252 C CB  . GLU A 1 184 ? -16.766 48.186 54.006 1.00 41.97 ? 163 GLU X CB  1 
ATOM   1253 C CG  . GLU A 1 184 ? -18.110 47.760 53.383 1.00 42.87 ? 163 GLU X CG  1 
ATOM   1254 C CD  . GLU A 1 184 ? -18.624 48.723 52.301 1.00 46.73 ? 163 GLU X CD  1 
ATOM   1255 O OE1 . GLU A 1 184 ? -18.939 48.177 51.195 1.00 47.56 ? 163 GLU X OE1 1 
ATOM   1256 O OE2 . GLU A 1 184 ? -18.704 49.984 52.534 1.00 43.21 ? 163 GLU X OE2 1 
ATOM   1257 N N   . ALA A 1 185 ? -13.557 49.028 54.248 1.00 38.80 ? 164 ALA X N   1 
ATOM   1258 C CA  . ALA A 1 185 ? -12.422 49.672 54.953 1.00 36.78 ? 164 ALA X CA  1 
ATOM   1259 C C   . ALA A 1 185 ? -11.128 48.969 54.537 1.00 35.40 ? 164 ALA X C   1 
ATOM   1260 O O   . ALA A 1 185 ? -10.582 48.139 55.285 1.00 35.93 ? 164 ALA X O   1 
ATOM   1261 C CB  . ALA A 1 185 ? -12.593 49.629 56.485 1.00 35.74 ? 164 ALA X CB  1 
ATOM   1262 N N   . PRO A 1 186 ? -10.640 49.291 53.331 1.00 33.71 ? 165 PRO X N   1 
ATOM   1263 C CA  . PRO A 1 186 ? -9.529  48.544 52.738 1.00 32.65 ? 165 PRO X CA  1 
ATOM   1264 C C   . PRO A 1 186 ? -8.188  48.984 53.287 1.00 31.80 ? 165 PRO X C   1 
ATOM   1265 O O   . PRO A 1 186 ? -7.200  48.260 53.133 1.00 31.08 ? 165 PRO X O   1 
ATOM   1266 C CB  . PRO A 1 186 ? -9.624  48.880 51.252 1.00 31.96 ? 165 PRO X CB  1 
ATOM   1267 C CG  . PRO A 1 186 ? -10.352 50.203 51.209 1.00 32.23 ? 165 PRO X CG  1 
ATOM   1268 C CD  . PRO A 1 186 ? -11.207 50.304 52.425 1.00 33.17 ? 165 PRO X CD  1 
ATOM   1269 N N   . GLY A 1 187 ? -8.173  50.146 53.948 1.00 30.91 ? 166 GLY X N   1 
ATOM   1270 C CA  . GLY A 1 187 ? -6.925  50.809 54.327 1.00 29.81 ? 166 GLY X CA  1 
ATOM   1271 C C   . GLY A 1 187 ? -6.481  51.826 53.265 1.00 28.95 ? 166 GLY X C   1 
ATOM   1272 O O   . GLY A 1 187 ? -7.021  51.826 52.165 1.00 28.52 ? 166 GLY X O   1 
ATOM   1273 N N   . ASN A 1 188 ? -5.543  52.704 53.631 1.00 27.80 ? 167 ASN X N   1 
ATOM   1274 C CA  . ASN A 1 188 ? -4.864  53.591 52.723 1.00 26.84 ? 167 ASN X CA  1 
ATOM   1275 C C   . ASN A 1 188 ? -5.740  54.721 52.183 1.00 26.88 ? 167 ASN X C   1 
ATOM   1276 O O   . ASN A 1 188 ? -5.307  55.586 51.399 1.00 27.09 ? 167 ASN X O   1 
ATOM   1277 C CB  . ASN A 1 188 ? -4.183  52.776 51.625 1.00 26.19 ? 167 ASN X CB  1 
ATOM   1278 C CG  . ASN A 1 188 ? -2.990  51.984 52.167 1.00 27.35 ? 167 ASN X CG  1 
ATOM   1279 O OD1 . ASN A 1 188 ? -2.421  52.335 53.194 1.00 27.41 ? 167 ASN X OD1 1 
ATOM   1280 N ND2 . ASN A 1 188 ? -2.614  50.926 51.490 1.00 26.58 ? 167 ASN X ND2 1 
ATOM   1281 N N   . VAL A 1 189 ? -6.978  54.779 52.630 1.00 26.57 ? 168 VAL X N   1 
ATOM   1282 C CA  . VAL A 1 189 ? -7.878  55.696 51.920 1.00 26.17 ? 168 VAL X CA  1 
ATOM   1283 C C   . VAL A 1 189 ? -7.457  57.186 52.006 1.00 26.18 ? 168 VAL X C   1 
ATOM   1284 O O   . VAL A 1 189 ? -7.676  57.984 51.041 1.00 26.40 ? 168 VAL X O   1 
ATOM   1285 C CB  . VAL A 1 189 ? -9.384  55.433 52.243 1.00 25.88 ? 168 VAL X CB  1 
ATOM   1286 C CG1 . VAL A 1 189 ? -9.670  53.920 52.150 1.00 23.65 ? 168 VAL X CG1 1 
ATOM   1287 C CG2 . VAL A 1 189 ? -9.798  56.084 53.594 1.00 24.93 ? 168 VAL X CG2 1 
ATOM   1288 N N   . GLY A 1 190 ? -6.861  57.546 53.145 1.00 25.60 ? 169 GLY X N   1 
ATOM   1289 C CA  . GLY A 1 190 ? -6.142  58.823 53.295 1.00 24.70 ? 169 GLY X CA  1 
ATOM   1290 C C   . GLY A 1 190 ? -5.161  59.022 52.149 1.00 24.35 ? 169 GLY X C   1 
ATOM   1291 O O   . GLY A 1 190 ? -5.084  60.108 51.574 1.00 23.25 ? 169 GLY X O   1 
ATOM   1292 N N   . LEU A 1 191 ? -4.401  57.974 51.816 1.00 24.10 ? 170 LEU X N   1 
ATOM   1293 C CA  . LEU A 1 191 ? -3.459  58.094 50.718 1.00 24.50 ? 170 LEU X CA  1 
ATOM   1294 C C   . LEU A 1 191 ? -4.239  58.283 49.407 1.00 25.27 ? 170 LEU X C   1 
ATOM   1295 O O   . LEU A 1 191 ? -3.821  59.067 48.531 1.00 26.03 ? 170 LEU X O   1 
ATOM   1296 C CB  . LEU A 1 191 ? -2.545  56.877 50.637 1.00 23.92 ? 170 LEU X CB  1 
ATOM   1297 C CG  . LEU A 1 191 ? -1.387  56.832 51.621 1.00 23.37 ? 170 LEU X CG  1 
ATOM   1298 C CD1 . LEU A 1 191 ? -0.707  55.481 51.631 1.00 23.73 ? 170 LEU X CD1 1 
ATOM   1299 C CD2 . LEU A 1 191 ? -0.377  57.920 51.339 1.00 21.19 ? 170 LEU X CD2 1 
ATOM   1300 N N   . LEU A 1 192 ? -5.367  57.579 49.271 1.00 24.95 ? 171 LEU X N   1 
ATOM   1301 C CA  . LEU A 1 192 ? -6.266  57.816 48.140 1.00 24.89 ? 171 LEU X CA  1 
ATOM   1302 C C   . LEU A 1 192 ? -6.897  59.221 48.128 1.00 25.37 ? 171 LEU X C   1 
ATOM   1303 O O   . LEU A 1 192 ? -7.143  59.756 47.061 1.00 26.20 ? 171 LEU X O   1 
ATOM   1304 C CB  . LEU A 1 192 ? -7.340  56.721 48.030 1.00 24.62 ? 171 LEU X CB  1 
ATOM   1305 C CG  . LEU A 1 192 ? -6.705  55.336 47.774 1.00 23.82 ? 171 LEU X CG  1 
ATOM   1306 C CD1 . LEU A 1 192 ? -7.725  54.214 47.861 1.00 22.72 ? 171 LEU X CD1 1 
ATOM   1307 C CD2 . LEU A 1 192 ? -5.861  55.239 46.485 1.00 16.23 ? 171 LEU X CD2 1 
ATOM   1308 N N   . ASP A 1 193 ? -7.174  59.827 49.279 1.00 25.61 ? 172 ASP X N   1 
ATOM   1309 C CA  . ASP A 1 193 ? -7.623  61.219 49.261 1.00 25.84 ? 172 ASP X CA  1 
ATOM   1310 C C   . ASP A 1 193 ? -6.538  62.053 48.549 1.00 25.74 ? 172 ASP X C   1 
ATOM   1311 O O   . ASP A 1 193 ? -6.804  62.895 47.686 1.00 25.34 ? 172 ASP X O   1 
ATOM   1312 C CB  . ASP A 1 193 ? -7.863  61.761 50.684 1.00 26.01 ? 172 ASP X CB  1 
ATOM   1313 C CG  . ASP A 1 193 ? -9.027  61.082 51.400 1.00 28.85 ? 172 ASP X CG  1 
ATOM   1314 O OD1 . ASP A 1 193 ? -9.807  60.394 50.746 1.00 30.94 ? 172 ASP X OD1 1 
ATOM   1315 O OD2 . ASP A 1 193 ? -9.195  61.231 52.645 1.00 34.86 ? 172 ASP X OD2 1 
ATOM   1316 N N   . GLN A 1 194 ? -5.286  61.812 48.903 1.00 26.17 ? 173 GLN X N   1 
ATOM   1317 C CA  . GLN A 1 194 ? -4.238  62.690 48.418 1.00 25.92 ? 173 GLN X CA  1 
ATOM   1318 C C   . GLN A 1 194 ? -4.214  62.539 46.931 1.00 26.07 ? 173 GLN X C   1 
ATOM   1319 O O   . GLN A 1 194 ? -4.070  63.506 46.205 1.00 26.59 ? 173 GLN X O   1 
ATOM   1320 C CB  . GLN A 1 194 ? -2.896  62.337 49.032 1.00 25.33 ? 173 GLN X CB  1 
ATOM   1321 C CG  . GLN A 1 194 ? -2.812  62.664 50.498 1.00 25.17 ? 173 GLN X CG  1 
ATOM   1322 C CD  . GLN A 1 194 ? -1.530  62.117 51.136 1.00 27.01 ? 173 GLN X CD  1 
ATOM   1323 O OE1 . GLN A 1 194 ? -0.601  61.682 50.428 1.00 22.58 ? 173 GLN X OE1 1 
ATOM   1324 N NE2 . GLN A 1 194 ? -1.471  62.149 52.490 1.00 23.67 ? 173 GLN X NE2 1 
ATOM   1325 N N   . ARG A 1 195 ? -4.359  61.308 46.469 1.00 26.25 ? 174 ARG X N   1 
ATOM   1326 C CA  . ARG A 1 195 ? -4.165  61.034 45.054 1.00 26.21 ? 174 ARG X CA  1 
ATOM   1327 C C   . ARG A 1 195 ? -5.268  61.697 44.263 1.00 26.71 ? 174 ARG X C   1 
ATOM   1328 O O   . ARG A 1 195 ? -5.059  62.177 43.146 1.00 26.55 ? 174 ARG X O   1 
ATOM   1329 C CB  . ARG A 1 195 ? -4.107  59.529 44.801 1.00 25.86 ? 174 ARG X CB  1 
ATOM   1330 C CG  . ARG A 1 195 ? -3.954  59.126 43.378 1.00 23.53 ? 174 ARG X CG  1 
ATOM   1331 C CD  . ARG A 1 195 ? -4.319  57.625 43.252 1.00 23.92 ? 174 ARG X CD  1 
ATOM   1332 N NE  . ARG A 1 195 ? -3.131  56.811 43.512 1.00 25.54 ? 174 ARG X NE  1 
ATOM   1333 C CZ  . ARG A 1 195 ? -3.119  55.483 43.638 1.00 24.48 ? 174 ARG X CZ  1 
ATOM   1334 N NH1 . ARG A 1 195 ? -4.217  54.792 43.569 1.00 23.65 ? 174 ARG X NH1 1 
ATOM   1335 N NH2 . ARG A 1 195 ? -1.998  54.846 43.851 1.00 24.45 ? 174 ARG X NH2 1 
ATOM   1336 N N   . MET A 1 196 ? -6.456  61.752 44.845 1.00 27.15 ? 175 MET X N   1 
ATOM   1337 C CA  . MET A 1 196 ? -7.508  62.391 44.118 1.00 27.73 ? 175 MET X CA  1 
ATOM   1338 C C   . MET A 1 196 ? -7.300  63.883 43.983 1.00 27.58 ? 175 MET X C   1 
ATOM   1339 O O   . MET A 1 196 ? -7.515  64.453 42.928 1.00 28.02 ? 175 MET X O   1 
ATOM   1340 C CB  . MET A 1 196 ? -8.857  62.115 44.713 1.00 27.86 ? 175 MET X CB  1 
ATOM   1341 C CG  . MET A 1 196 ? -9.857  62.203 43.560 1.00 33.12 ? 175 MET X CG  1 
ATOM   1342 S SD  . MET A 1 196 ? -11.280 61.228 43.871 1.00 38.99 ? 175 MET X SD  1 
ATOM   1343 C CE  . MET A 1 196 ? -12.089 62.579 44.718 1.00 40.98 ? 175 MET X CE  1 
ATOM   1344 N N   . ALA A 1 197 ? -6.911  64.532 45.064 1.00 27.77 ? 176 ALA X N   1 
ATOM   1345 C CA  . ALA A 1 197 ? -6.583  65.931 44.980 1.00 27.33 ? 176 ALA X CA  1 
ATOM   1346 C C   . ALA A 1 197 ? -5.533  66.067 43.894 1.00 27.33 ? 176 ALA X C   1 
ATOM   1347 O O   . ALA A 1 197 ? -5.496  67.060 43.176 1.00 28.12 ? 176 ALA X O   1 
ATOM   1348 C CB  . ALA A 1 197 ? -6.074  66.445 46.304 1.00 26.83 ? 176 ALA X CB  1 
ATOM   1349 N N   . LEU A 1 198 ? -4.675  65.075 43.728 1.00 27.01 ? 177 LEU X N   1 
ATOM   1350 C CA  . LEU A 1 198 ? -3.630  65.277 42.731 1.00 27.15 ? 177 LEU X CA  1 
ATOM   1351 C C   . LEU A 1 198 ? -4.161  65.042 41.320 1.00 27.11 ? 177 LEU X C   1 
ATOM   1352 O O   . LEU A 1 198 ? -3.637  65.582 40.352 1.00 26.43 ? 177 LEU X O   1 
ATOM   1353 C CB  . LEU A 1 198 ? -2.415  64.383 42.971 1.00 26.87 ? 177 LEU X CB  1 
ATOM   1354 C CG  . LEU A 1 198 ? -1.455  64.524 44.146 1.00 26.35 ? 177 LEU X CG  1 
ATOM   1355 C CD1 . LEU A 1 198 ? -0.549  63.263 44.175 1.00 22.53 ? 177 LEU X CD1 1 
ATOM   1356 C CD2 . LEU A 1 198 ? -0.655  65.832 44.108 1.00 21.49 ? 177 LEU X CD2 1 
ATOM   1357 N N   . GLN A 1 199 ? -5.147  64.150 41.216 1.00 28.10 ? 178 GLN X N   1 
ATOM   1358 C CA  . GLN A 1 199 ? -5.880  63.927 39.968 1.00 27.87 ? 178 GLN X CA  1 
ATOM   1359 C C   . GLN A 1 199 ? -6.483  65.264 39.591 1.00 27.66 ? 178 GLN X C   1 
ATOM   1360 O O   . GLN A 1 199 ? -6.396  65.710 38.454 1.00 28.19 ? 178 GLN X O   1 
ATOM   1361 C CB  . GLN A 1 199 ? -6.990  62.913 40.170 1.00 27.21 ? 178 GLN X CB  1 
ATOM   1362 C CG  . GLN A 1 199 ? -7.633  62.343 38.884 1.00 28.58 ? 178 GLN X CG  1 
ATOM   1363 C CD  . GLN A 1 199 ? -6.613  61.870 37.853 1.00 32.70 ? 178 GLN X CD  1 
ATOM   1364 O OE1 . GLN A 1 199 ? -6.092  60.759 37.944 1.00 33.75 ? 178 GLN X OE1 1 
ATOM   1365 N NE2 . GLN A 1 199 ? -6.334  62.714 36.859 1.00 32.34 ? 178 GLN X NE2 1 
ATOM   1366 N N   . TRP A 1 200 ? -7.034  65.944 40.569 1.00 27.17 ? 179 TRP X N   1 
ATOM   1367 C CA  . TRP A 1 200 ? -7.785  67.115 40.251 1.00 27.33 ? 179 TRP X CA  1 
ATOM   1368 C C   . TRP A 1 200 ? -6.861  68.221 39.803 1.00 28.63 ? 179 TRP X C   1 
ATOM   1369 O O   . TRP A 1 200 ? -7.165  68.922 38.862 1.00 29.18 ? 179 TRP X O   1 
ATOM   1370 C CB  . TRP A 1 200 ? -8.601  67.500 41.439 1.00 26.05 ? 179 TRP X CB  1 
ATOM   1371 C CG  . TRP A 1 200 ? -9.613  68.453 41.156 1.00 26.18 ? 179 TRP X CG  1 
ATOM   1372 C CD1 . TRP A 1 200 ? -10.956 68.214 40.897 1.00 23.11 ? 179 TRP X CD1 1 
ATOM   1373 C CD2 . TRP A 1 200 ? -9.437  69.882 41.153 1.00 25.66 ? 179 TRP X CD2 1 
ATOM   1374 N NE1 . TRP A 1 200 ? -11.598 69.430 40.699 1.00 24.41 ? 179 TRP X NE1 1 
ATOM   1375 C CE2 . TRP A 1 200 ? -10.695 70.460 40.875 1.00 23.19 ? 179 TRP X CE2 1 
ATOM   1376 C CE3 . TRP A 1 200 ? -8.332  70.723 41.343 1.00 25.45 ? 179 TRP X CE3 1 
ATOM   1377 C CZ2 . TRP A 1 200 ? -10.873 71.847 40.788 1.00 22.55 ? 179 TRP X CZ2 1 
ATOM   1378 C CZ3 . TRP A 1 200 ? -8.523  72.137 41.237 1.00 25.16 ? 179 TRP X CZ3 1 
ATOM   1379 C CH2 . TRP A 1 200 ? -9.778  72.664 40.966 1.00 22.58 ? 179 TRP X CH2 1 
ATOM   1380 N N   . VAL A 1 201 ? -5.701  68.350 40.432 1.00 30.08 ? 180 VAL X N   1 
ATOM   1381 C CA  . VAL A 1 201 ? -4.722  69.318 39.979 1.00 30.63 ? 180 VAL X CA  1 
ATOM   1382 C C   . VAL A 1 201 ? -4.250  68.998 38.544 1.00 31.78 ? 180 VAL X C   1 
ATOM   1383 O O   . VAL A 1 201 ? -4.207  69.877 37.671 1.00 32.76 ? 180 VAL X O   1 
ATOM   1384 C CB  . VAL A 1 201 ? -3.533  69.326 40.930 1.00 30.49 ? 180 VAL X CB  1 
ATOM   1385 C CG1 . VAL A 1 201 ? -2.362  70.133 40.375 1.00 28.31 ? 180 VAL X CG1 1 
ATOM   1386 C CG2 . VAL A 1 201 ? -3.970  69.859 42.223 1.00 30.26 ? 180 VAL X CG2 1 
ATOM   1387 N N   . HIS A 1 202 ? -3.880  67.753 38.302 1.00 32.46 ? 181 HIS X N   1 
ATOM   1388 C CA  . HIS A 1 202 ? -3.445  67.335 36.976 1.00 33.23 ? 181 HIS X CA  1 
ATOM   1389 C C   . HIS A 1 202 ? -4.507  67.787 35.985 1.00 32.65 ? 181 HIS X C   1 
ATOM   1390 O O   . HIS A 1 202 ? -4.202  68.283 34.934 1.00 30.97 ? 181 HIS X O   1 
ATOM   1391 C CB  . HIS A 1 202 ? -3.270  65.792 36.928 1.00 33.83 ? 181 HIS X CB  1 
ATOM   1392 C CG  . HIS A 1 202 ? -3.130  65.228 35.534 1.00 37.14 ? 181 HIS X CG  1 
ATOM   1393 N ND1 . HIS A 1 202 ? -4.226  64.916 34.732 1.00 38.36 ? 181 HIS X ND1 1 
ATOM   1394 C CD2 . HIS A 1 202 ? -2.028  64.931 34.798 1.00 35.75 ? 181 HIS X CD2 1 
ATOM   1395 C CE1 . HIS A 1 202 ? -3.798  64.459 33.567 1.00 37.07 ? 181 HIS X CE1 1 
ATOM   1396 N NE2 . HIS A 1 202 ? -2.472  64.450 33.585 1.00 36.70 ? 181 HIS X NE2 1 
ATOM   1397 N N   . ASP A 1 203 ? -5.762  67.645 36.365 1.00 32.50 ? 182 ASP X N   1 
ATOM   1398 C CA  . ASP A 1 203 ? -6.822  67.929 35.452 1.00 33.27 ? 182 ASP X CA  1 
ATOM   1399 C C   . ASP A 1 203 ? -7.181  69.398 35.297 1.00 34.38 ? 182 ASP X C   1 
ATOM   1400 O O   . ASP A 1 203 ? -7.580  69.801 34.202 1.00 36.41 ? 182 ASP X O   1 
ATOM   1401 C CB  . ASP A 1 203 ? -8.080  67.113 35.784 1.00 32.36 ? 182 ASP X CB  1 
ATOM   1402 C CG  . ASP A 1 203 ? -7.862  65.621 35.587 1.00 33.68 ? 182 ASP X CG  1 
ATOM   1403 O OD1 . ASP A 1 203 ? -6.915  65.236 34.836 1.00 34.32 ? 182 ASP X OD1 1 
ATOM   1404 O OD2 . ASP A 1 203 ? -8.604  64.834 36.211 1.00 32.74 ? 182 ASP X OD2 1 
ATOM   1405 N N   . ASN A 1 204 ? -7.089  70.207 36.348 1.00 33.67 ? 183 ASN X N   1 
ATOM   1406 C CA  . ASN A 1 204 ? -7.709  71.502 36.297 1.00 32.45 ? 183 ASN X CA  1 
ATOM   1407 C C   . ASN A 1 204 ? -6.747  72.614 36.585 1.00 32.44 ? 183 ASN X C   1 
ATOM   1408 O O   . ASN A 1 204 ? -7.097  73.800 36.537 1.00 33.48 ? 183 ASN X O   1 
ATOM   1409 C CB  . ASN A 1 204 ? -8.760  71.549 37.343 1.00 32.84 ? 183 ASN X CB  1 
ATOM   1410 C CG  . ASN A 1 204 ? -9.946  70.663 37.014 1.00 35.97 ? 183 ASN X CG  1 
ATOM   1411 O OD1 . ASN A 1 204 ? -10.808 71.034 36.190 1.00 39.36 ? 183 ASN X OD1 1 
ATOM   1412 N ND2 . ASN A 1 204 ? -10.050 69.520 37.705 1.00 33.36 ? 183 ASN X ND2 1 
ATOM   1413 N N   . ILE A 1 205 ? -5.517  72.284 36.915 1.00 31.51 ? 184 ILE X N   1 
ATOM   1414 C CA  . ILE A 1 205 ? -4.687  73.381 37.360 1.00 30.55 ? 184 ILE X CA  1 
ATOM   1415 C C   . ILE A 1 205 ? -4.374  74.337 36.180 1.00 31.50 ? 184 ILE X C   1 
ATOM   1416 O O   . ILE A 1 205 ? -3.955  75.499 36.393 1.00 31.18 ? 184 ILE X O   1 
ATOM   1417 C CB  . ILE A 1 205 ? -3.441  72.903 38.167 1.00 29.64 ? 184 ILE X CB  1 
ATOM   1418 C CG1 . ILE A 1 205 ? -2.873  74.074 38.978 1.00 28.75 ? 184 ILE X CG1 1 
ATOM   1419 C CG2 . ILE A 1 205 ? -2.401  72.295 37.273 1.00 25.75 ? 184 ILE X CG2 1 
ATOM   1420 C CD1 . ILE A 1 205 ? -3.722  74.502 40.213 1.00 23.15 ? 184 ILE X CD1 1 
ATOM   1421 N N   . GLN A 1 206 ? -4.602  73.861 34.945 1.00 31.61 ? 185 GLN X N   1 
ATOM   1422 C CA  . GLN A 1 206 ? -4.233  74.650 33.774 1.00 32.04 ? 185 GLN X CA  1 
ATOM   1423 C C   . GLN A 1 206 ? -5.068  75.911 33.795 1.00 32.33 ? 185 GLN X C   1 
ATOM   1424 O O   . GLN A 1 206 ? -4.576  76.989 33.456 1.00 32.20 ? 185 GLN X O   1 
ATOM   1425 C CB  . GLN A 1 206 ? -4.400  73.884 32.458 1.00 31.61 ? 185 GLN X CB  1 
ATOM   1426 C CG  . GLN A 1 206 ? -5.828  73.484 32.130 1.00 33.73 ? 185 GLN X CG  1 
ATOM   1427 C CD  . GLN A 1 206 ? -5.912  72.298 31.140 1.00 36.89 ? 185 GLN X CD  1 
ATOM   1428 O OE1 . GLN A 1 206 ? -5.535  71.177 31.486 1.00 36.83 ? 185 GLN X OE1 1 
ATOM   1429 N NE2 . GLN A 1 206 ? -6.422  72.547 29.912 1.00 35.39 ? 185 GLN X NE2 1 
ATOM   1430 N N   . PHE A 1 207 ? -6.316  75.800 34.245 1.00 32.46 ? 186 PHE X N   1 
ATOM   1431 C CA  . PHE A 1 207 ? -7.194  76.967 34.161 1.00 32.97 ? 186 PHE X CA  1 
ATOM   1432 C C   . PHE A 1 207 ? -6.817  78.039 35.147 1.00 33.81 ? 186 PHE X C   1 
ATOM   1433 O O   . PHE A 1 207 ? -7.452  79.089 35.148 1.00 35.43 ? 186 PHE X O   1 
ATOM   1434 C CB  . PHE A 1 207 ? -8.667  76.598 34.327 1.00 32.57 ? 186 PHE X CB  1 
ATOM   1435 C CG  . PHE A 1 207 ? -9.059  75.454 33.464 1.00 31.76 ? 186 PHE X CG  1 
ATOM   1436 C CD1 . PHE A 1 207 ? -9.148  75.625 32.087 1.00 29.02 ? 186 PHE X CD1 1 
ATOM   1437 C CD2 . PHE A 1 207 ? -9.232  74.188 34.011 1.00 29.00 ? 186 PHE X CD2 1 
ATOM   1438 C CE1 . PHE A 1 207 ? -9.455  74.555 31.248 1.00 31.01 ? 186 PHE X CE1 1 
ATOM   1439 C CE2 . PHE A 1 207 ? -9.527  73.109 33.196 1.00 32.66 ? 186 PHE X CE2 1 
ATOM   1440 C CZ  . PHE A 1 207 ? -9.645  73.285 31.790 1.00 32.16 ? 186 PHE X CZ  1 
ATOM   1441 N N   . PHE A 1 208 ? -5.805  77.805 35.983 1.00 32.95 ? 187 PHE X N   1 
ATOM   1442 C CA  . PHE A 1 208 ? -5.487  78.775 37.008 1.00 31.45 ? 187 PHE X CA  1 
ATOM   1443 C C   . PHE A 1 208 ? -4.136  79.322 36.694 1.00 31.62 ? 187 PHE X C   1 
ATOM   1444 O O   . PHE A 1 208 ? -3.523  79.947 37.554 1.00 30.80 ? 187 PHE X O   1 
ATOM   1445 C CB  . PHE A 1 208 ? -5.403  78.130 38.383 1.00 30.29 ? 187 PHE X CB  1 
ATOM   1446 C CG  . PHE A 1 208 ? -6.719  77.682 38.937 1.00 28.47 ? 187 PHE X CG  1 
ATOM   1447 C CD1 . PHE A 1 208 ? -7.206  76.414 38.660 1.00 26.48 ? 187 PHE X CD1 1 
ATOM   1448 C CD2 . PHE A 1 208 ? -7.452  78.511 39.802 1.00 26.70 ? 187 PHE X CD2 1 
ATOM   1449 C CE1 . PHE A 1 208 ? -8.417  75.977 39.226 1.00 25.50 ? 187 PHE X CE1 1 
ATOM   1450 C CE2 . PHE A 1 208 ? -8.663  78.085 40.369 1.00 23.38 ? 187 PHE X CE2 1 
ATOM   1451 C CZ  . PHE A 1 208 ? -9.159  76.829 40.065 1.00 23.32 ? 187 PHE X CZ  1 
ATOM   1452 N N   . GLY A 1 209 ? -3.659  79.039 35.480 1.00 31.39 ? 188 GLY X N   1 
ATOM   1453 C CA  . GLY A 1 209 ? -2.284  79.384 35.080 1.00 31.56 ? 188 GLY X CA  1 
ATOM   1454 C C   . GLY A 1 209 ? -1.169  78.376 35.436 1.00 32.13 ? 188 GLY X C   1 
ATOM   1455 O O   . GLY A 1 209 ? 0.006   78.537 35.026 1.00 32.24 ? 188 GLY X O   1 
ATOM   1456 N N   . GLY A 1 210 ? -1.503  77.349 36.222 1.00 31.86 ? 189 GLY X N   1 
ATOM   1457 C CA  . GLY A 1 210 ? -0.539  76.310 36.546 1.00 31.52 ? 189 GLY X CA  1 
ATOM   1458 C C   . GLY A 1 210 ? -0.236  75.446 35.336 1.00 31.52 ? 189 GLY X C   1 
ATOM   1459 O O   . GLY A 1 210 ? -1.068  75.349 34.439 1.00 31.39 ? 189 GLY X O   1 
ATOM   1460 N N   . ASP A 1 211 ? 0.950   74.827 35.327 1.00 31.17 ? 190 ASP X N   1 
ATOM   1461 C CA  . ASP A 1 211 ? 1.388   73.897 34.291 1.00 31.51 ? 190 ASP X CA  1 
ATOM   1462 C C   . ASP A 1 211 ? 1.245   72.423 34.754 1.00 31.53 ? 190 ASP X C   1 
ATOM   1463 O O   . ASP A 1 211 ? 2.097   71.902 35.431 1.00 32.00 ? 190 ASP X O   1 
ATOM   1464 C CB  . ASP A 1 211 ? 2.849   74.230 33.943 1.00 31.16 ? 190 ASP X CB  1 
ATOM   1465 C CG  . ASP A 1 211 ? 3.468   73.292 32.897 1.00 32.29 ? 190 ASP X CG  1 
ATOM   1466 O OD1 . ASP A 1 211 ? 2.734   72.461 32.318 1.00 31.25 ? 190 ASP X OD1 1 
ATOM   1467 O OD2 . ASP A 1 211 ? 4.710   73.394 32.647 1.00 32.94 ? 190 ASP X OD2 1 
ATOM   1468 N N   . PRO A 1 212 ? 0.206   71.708 34.332 1.00 31.67 ? 191 PRO X N   1 
ATOM   1469 C CA  . PRO A 1 212 ? 0.172   70.425 35.017 1.00 31.68 ? 191 PRO X CA  1 
ATOM   1470 C C   . PRO A 1 212 ? 1.346   69.496 34.706 1.00 31.77 ? 191 PRO X C   1 
ATOM   1471 O O   . PRO A 1 212 ? 1.429   68.415 35.244 1.00 31.33 ? 191 PRO X O   1 
ATOM   1472 C CB  . PRO A 1 212 ? -1.127  69.786 34.513 1.00 30.89 ? 191 PRO X CB  1 
ATOM   1473 C CG  . PRO A 1 212 ? -1.386  70.432 33.172 1.00 31.47 ? 191 PRO X CG  1 
ATOM   1474 C CD  . PRO A 1 212 ? -0.412  71.602 33.006 1.00 32.10 ? 191 PRO X CD  1 
ATOM   1475 N N   . LYS A 1 213 ? 2.273   69.862 33.857 1.00 32.50 ? 192 LYS X N   1 
ATOM   1476 C CA  . LYS A 1 213 ? 3.348   68.887 33.672 1.00 33.19 ? 192 LYS X CA  1 
ATOM   1477 C C   . LYS A 1 213 ? 4.628   69.326 34.394 1.00 31.93 ? 192 LYS X C   1 
ATOM   1478 O O   . LYS A 1 213 ? 5.736   68.848 34.130 1.00 31.90 ? 192 LYS X O   1 
ATOM   1479 C CB  . LYS A 1 213 ? 3.563   68.616 32.195 1.00 33.75 ? 192 LYS X CB  1 
ATOM   1480 C CG  . LYS A 1 213 ? 4.021   69.850 31.464 1.00 38.76 ? 192 LYS X CG  1 
ATOM   1481 C CD  . LYS A 1 213 ? 3.791   69.693 29.909 1.00 47.03 ? 192 LYS X CD  1 
ATOM   1482 C CE  . LYS A 1 213 ? 3.748   71.067 29.174 1.00 47.87 ? 192 LYS X CE  1 
ATOM   1483 N NZ  . LYS A 1 213 ? 2.417   71.750 29.408 1.00 49.50 ? 192 LYS X NZ  1 
ATOM   1484 N N   . THR A 1 214 ? 4.438   70.217 35.357 1.00 30.77 ? 193 THR X N   1 
ATOM   1485 C CA  . THR A 1 214 ? 5.523   70.662 36.219 1.00 29.21 ? 193 THR X CA  1 
ATOM   1486 C C   . THR A 1 214 ? 5.007   70.775 37.647 1.00 28.61 ? 193 THR X C   1 
ATOM   1487 O O   . THR A 1 214 ? 5.263   71.766 38.325 1.00 29.33 ? 193 THR X O   1 
ATOM   1488 C CB  . THR A 1 214 ? 6.123   71.974 35.687 1.00 28.12 ? 193 THR X CB  1 
ATOM   1489 O OG1 . THR A 1 214 ? 6.491   71.739 34.339 1.00 30.16 ? 193 THR X OG1 1 
ATOM   1490 C CG2 . THR A 1 214 ? 7.372   72.359 36.371 1.00 26.78 ? 193 THR X CG2 1 
ATOM   1491 N N   . VAL A 1 215 ? 4.281   69.758 38.109 1.00 27.55 ? 194 VAL X N   1 
ATOM   1492 C CA  . VAL A 1 215 ? 3.912   69.765 39.516 1.00 27.27 ? 194 VAL X CA  1 
ATOM   1493 C C   . VAL A 1 215 ? 4.899   69.054 40.412 1.00 27.65 ? 194 VAL X C   1 
ATOM   1494 O O   . VAL A 1 215 ? 5.276   67.901 40.150 1.00 28.14 ? 194 VAL X O   1 
ATOM   1495 C CB  . VAL A 1 215 ? 2.428   69.418 39.806 1.00 26.97 ? 194 VAL X CB  1 
ATOM   1496 C CG1 . VAL A 1 215 ? 1.702   69.073 38.553 1.00 27.00 ? 194 VAL X CG1 1 
ATOM   1497 C CG2 . VAL A 1 215 ? 2.290   68.398 40.859 1.00 24.90 ? 194 VAL X CG2 1 
ATOM   1498 N N   . THR A 1 216 ? 5.365   69.783 41.431 1.00 27.21 ? 195 THR X N   1 
ATOM   1499 C CA  . THR A 1 216 ? 6.222   69.222 42.480 1.00 26.29 ? 195 THR X CA  1 
ATOM   1500 C C   . THR A 1 216 ? 5.358   68.932 43.670 1.00 26.46 ? 195 THR X C   1 
ATOM   1501 O O   . THR A 1 216 ? 4.715   69.881 44.212 1.00 26.46 ? 195 THR X O   1 
ATOM   1502 C CB  . THR A 1 216 ? 7.275   70.228 42.970 1.00 25.18 ? 195 THR X CB  1 
ATOM   1503 O OG1 . THR A 1 216 ? 8.242   70.407 41.955 1.00 27.36 ? 195 THR X OG1 1 
ATOM   1504 C CG2 . THR A 1 216 ? 8.031   69.686 44.129 1.00 24.67 ? 195 THR X CG2 1 
ATOM   1505 N N   . ILE A 1 217 ? 5.325   67.671 44.120 1.00 25.18 ? 196 ILE X N   1 
ATOM   1506 C CA  . ILE A 1 217 ? 4.715   67.485 45.428 1.00 25.04 ? 196 ILE X CA  1 
ATOM   1507 C C   . ILE A 1 217 ? 5.754   67.606 46.538 1.00 24.99 ? 196 ILE X C   1 
ATOM   1508 O O   . ILE A 1 217 ? 6.901   67.180 46.368 1.00 24.85 ? 196 ILE X O   1 
ATOM   1509 C CB  . ILE A 1 217 ? 3.967   66.190 45.529 1.00 25.22 ? 196 ILE X CB  1 
ATOM   1510 C CG1 . ILE A 1 217 ? 4.892   65.015 45.219 1.00 24.19 ? 196 ILE X CG1 1 
ATOM   1511 C CG2 . ILE A 1 217 ? 2.770   66.214 44.575 1.00 26.09 ? 196 ILE X CG2 1 
ATOM   1512 C CD1 . ILE A 1 217 ? 4.224   63.682 45.360 1.00 19.91 ? 196 ILE X CD1 1 
ATOM   1513 N N   . PHE A 1 218 ? 5.355   68.227 47.655 1.00 24.78 ? 197 PHE X N   1 
ATOM   1514 C CA  . PHE A 1 218 ? 6.215   68.370 48.844 1.00 24.14 ? 197 PHE X CA  1 
ATOM   1515 C C   . PHE A 1 218 ? 5.483   68.315 50.185 1.00 24.48 ? 197 PHE X C   1 
ATOM   1516 O O   . PHE A 1 218 ? 4.323   68.738 50.300 1.00 25.84 ? 197 PHE X O   1 
ATOM   1517 C CB  . PHE A 1 218 ? 7.113   69.621 48.728 1.00 24.06 ? 197 PHE X CB  1 
ATOM   1518 C CG  . PHE A 1 218 ? 6.429   70.958 48.984 1.00 22.60 ? 197 PHE X CG  1 
ATOM   1519 C CD1 . PHE A 1 218 ? 5.328   71.363 48.257 1.00 23.93 ? 197 PHE X CD1 1 
ATOM   1520 C CD2 . PHE A 1 218 ? 7.001   71.881 49.870 1.00 21.22 ? 197 PHE X CD2 1 
ATOM   1521 C CE1 . PHE A 1 218 ? 4.731   72.643 48.478 1.00 24.35 ? 197 PHE X CE1 1 
ATOM   1522 C CE2 . PHE A 1 218 ? 6.432   73.173 50.087 1.00 21.34 ? 197 PHE X CE2 1 
ATOM   1523 C CZ  . PHE A 1 218 ? 5.288   73.552 49.404 1.00 21.06 ? 197 PHE X CZ  1 
ATOM   1524 N N   . GLY A 1 219 ? 6.135   67.785 51.215 1.00 23.77 ? 198 GLY X N   1 
ATOM   1525 C CA  . GLY A 1 219 ? 5.486   67.688 52.523 1.00 22.64 ? 198 GLY X CA  1 
ATOM   1526 C C   . GLY A 1 219 ? 6.482   67.358 53.616 1.00 22.60 ? 198 GLY X C   1 
ATOM   1527 O O   . GLY A 1 219 ? 7.642   67.054 53.339 1.00 21.90 ? 198 GLY X O   1 
ATOM   1528 N N   . GLU A 1 220 ? 6.030   67.442 54.869 1.00 22.19 ? 199 GLU X N   1 
ATOM   1529 C CA  . GLU A 1 220 ? 6.917   67.317 56.004 1.00 21.51 ? 199 GLU X CA  1 
ATOM   1530 C C   . GLU A 1 220 ? 6.403   66.205 56.907 1.00 21.29 ? 199 GLU X C   1 
ATOM   1531 O O   . GLU A 1 220 ? 5.206   66.089 57.064 1.00 20.73 ? 199 GLU X O   1 
ATOM   1532 C CB  . GLU A 1 220 ? 6.973   68.628 56.764 1.00 20.96 ? 199 GLU X CB  1 
ATOM   1533 C CG  . GLU A 1 220 ? 7.934   68.608 57.939 1.00 22.30 ? 199 GLU X CG  1 
ATOM   1534 C CD  . GLU A 1 220 ? 7.303   68.121 59.244 1.00 23.59 ? 199 GLU X CD  1 
ATOM   1535 O OE1 . GLU A 1 220 ? 6.076   67.958 59.304 1.00 26.85 ? 199 GLU X OE1 1 
ATOM   1536 O OE2 . GLU A 1 220 ? 8.029   67.907 60.232 1.00 23.44 ? 199 GLU X OE2 1 
ATOM   1537 N N   . SER A 1 221 ? 7.316   65.391 57.465 1.00 21.07 ? 200 SER X N   1 
ATOM   1538 C CA  . SER A 1 221 ? 6.983   64.296 58.389 1.00 20.83 ? 200 SER X CA  1 
ATOM   1539 C C   . SER A 1 221 ? 5.987   63.375 57.657 1.00 21.16 ? 200 SER X C   1 
ATOM   1540 O O   . SER A 1 221 ? 6.346   62.986 56.558 1.00 22.49 ? 200 SER X O   1 
ATOM   1541 C CB  . SER A 1 221 ? 6.569   64.810 59.773 1.00 19.85 ? 200 SER X CB  1 
ATOM   1542 O OG  . SER A 1 221 ? 5.238   65.282 59.795 1.00 20.11 ? 200 SER X OG  1 
ATOM   1543 N N   . ALA A 1 222 ? 4.785   63.045 58.156 1.00 20.45 ? 201 ALA X N   1 
ATOM   1544 C CA  . ALA A 1 222 ? 3.902   62.133 57.381 1.00 20.83 ? 201 ALA X CA  1 
ATOM   1545 C C   . ALA A 1 222 ? 3.631   62.608 55.944 1.00 22.02 ? 201 ALA X C   1 
ATOM   1546 O O   . ALA A 1 222 ? 3.348   61.805 55.044 1.00 22.68 ? 201 ALA X O   1 
ATOM   1547 C CB  . ALA A 1 222 ? 2.536   61.786 58.123 1.00 19.48 ? 201 ALA X CB  1 
ATOM   1548 N N   . GLY A 1 223 ? 3.708   63.917 55.723 1.00 22.89 ? 202 GLY X N   1 
ATOM   1549 C CA  . GLY A 1 223 ? 3.586   64.456 54.372 1.00 23.21 ? 202 GLY X CA  1 
ATOM   1550 C C   . GLY A 1 223 ? 4.816   64.111 53.560 1.00 23.51 ? 202 GLY X C   1 
ATOM   1551 O O   . GLY A 1 223 ? 4.709   63.769 52.386 1.00 24.71 ? 202 GLY X O   1 
ATOM   1552 N N   . GLY A 1 224 ? 5.994   64.200 54.168 1.00 23.35 ? 203 GLY X N   1 
ATOM   1553 C CA  . GLY A 1 224 ? 7.221   63.734 53.502 1.00 22.93 ? 203 GLY X CA  1 
ATOM   1554 C C   . GLY A 1 224 ? 7.130   62.241 53.194 1.00 22.94 ? 203 GLY X C   1 
ATOM   1555 O O   . GLY A 1 224 ? 7.421   61.798 52.086 1.00 22.14 ? 203 GLY X O   1 
ATOM   1556 N N   . ALA A 1 225 ? 6.705   61.452 54.171 1.00 22.86 ? 204 ALA X N   1 
ATOM   1557 C CA  . ALA A 1 225 ? 6.488   60.023 53.908 1.00 23.61 ? 204 ALA X CA  1 
ATOM   1558 C C   . ALA A 1 225 ? 5.457   59.746 52.781 1.00 23.42 ? 204 ALA X C   1 
ATOM   1559 O O   . ALA A 1 225 ? 5.706   58.912 51.881 1.00 23.87 ? 204 ALA X O   1 
ATOM   1560 C CB  . ALA A 1 225 ? 6.107   59.264 55.212 1.00 23.40 ? 204 ALA X CB  1 
ATOM   1561 N N   . SER A 1 226 ? 4.305   60.414 52.859 1.00 22.86 ? 205 SER X N   1 
ATOM   1562 C CA  . SER A 1 226 ? 3.308   60.393 51.778 1.00 22.61 ? 205 SER X CA  1 
ATOM   1563 C C   . SER A 1 226 ? 3.960   60.606 50.381 1.00 22.47 ? 205 SER X C   1 
ATOM   1564 O O   . SER A 1 226 ? 3.723   59.820 49.455 1.00 22.09 ? 205 SER X O   1 
ATOM   1565 C CB  . SER A 1 226 ? 2.196   61.458 52.024 1.00 22.73 ? 205 SER X CB  1 
ATOM   1566 O OG  . SER A 1 226 ? 1.337   61.141 53.137 1.00 20.91 ? 205 SER X OG  1 
ATOM   1567 N N   . VAL A 1 227 ? 4.794   61.646 50.245 1.00 21.82 ? 206 VAL X N   1 
ATOM   1568 C CA  . VAL A 1 227 ? 5.405   61.973 48.948 1.00 21.40 ? 206 VAL X CA  1 
ATOM   1569 C C   . VAL A 1 227 ? 6.209   60.754 48.492 1.00 22.09 ? 206 VAL X C   1 
ATOM   1570 O O   . VAL A 1 227 ? 6.022   60.248 47.383 1.00 23.17 ? 206 VAL X O   1 
ATOM   1571 C CB  . VAL A 1 227 ? 6.295   63.256 49.031 1.00 21.31 ? 206 VAL X CB  1 
ATOM   1572 C CG1 . VAL A 1 227 ? 7.201   63.401 47.794 1.00 19.74 ? 206 VAL X CG1 1 
ATOM   1573 C CG2 . VAL A 1 227 ? 5.452   64.526 49.315 1.00 19.27 ? 206 VAL X CG2 1 
ATOM   1574 N N   . GLY A 1 228 ? 7.074   60.241 49.347 1.00 21.69 ? 207 GLY X N   1 
ATOM   1575 C CA  . GLY A 1 228 ? 7.746   58.984 49.023 1.00 22.68 ? 207 GLY X CA  1 
ATOM   1576 C C   . GLY A 1 228 ? 6.777   57.873 48.644 1.00 23.58 ? 207 GLY X C   1 
ATOM   1577 O O   . GLY A 1 228 ? 7.072   57.019 47.790 1.00 23.14 ? 207 GLY X O   1 
ATOM   1578 N N   . MET A 1 229 ? 5.599   57.866 49.256 1.00 23.93 ? 208 MET X N   1 
ATOM   1579 C CA  . MET A 1 229 ? 4.731   56.743 48.979 1.00 24.59 ? 208 MET X CA  1 
ATOM   1580 C C   . MET A 1 229 ? 4.121   56.937 47.605 1.00 25.32 ? 208 MET X C   1 
ATOM   1581 O O   . MET A 1 229 ? 3.810   55.971 46.912 1.00 26.68 ? 208 MET X O   1 
ATOM   1582 C CB  . MET A 1 229 ? 3.687   56.556 50.081 1.00 24.27 ? 208 MET X CB  1 
ATOM   1583 C CG  . MET A 1 229 ? 4.303   56.202 51.441 1.00 25.65 ? 208 MET X CG  1 
ATOM   1584 S SD  . MET A 1 229 ? 3.177   56.118 52.851 1.00 25.86 ? 208 MET X SD  1 
ATOM   1585 C CE  . MET A 1 229 ? 4.124   55.132 53.984 1.00 26.29 ? 208 MET X CE  1 
ATOM   1586 N N   . HIS A 1 230 ? 3.968   58.178 47.165 1.00 24.82 ? 209 HIS X N   1 
ATOM   1587 C CA  . HIS A 1 230 ? 3.359   58.374 45.865 1.00 24.59 ? 209 HIS X CA  1 
ATOM   1588 C C   . HIS A 1 230 ? 4.356   58.117 44.773 1.00 25.05 ? 209 HIS X C   1 
ATOM   1589 O O   . HIS A 1 230 ? 3.984   57.882 43.626 1.00 23.77 ? 209 HIS X O   1 
ATOM   1590 C CB  . HIS A 1 230 ? 2.831   59.786 45.738 1.00 24.77 ? 209 HIS X CB  1 
ATOM   1591 C CG  . HIS A 1 230 ? 1.546   59.991 46.462 1.00 25.44 ? 209 HIS X CG  1 
ATOM   1592 N ND1 . HIS A 1 230 ? 0.426   59.210 46.217 1.00 25.10 ? 209 HIS X ND1 1 
ATOM   1593 C CD2 . HIS A 1 230 ? 1.200   60.866 47.432 1.00 22.67 ? 209 HIS X CD2 1 
ATOM   1594 C CE1 . HIS A 1 230 ? -0.555  59.605 47.003 1.00 23.94 ? 209 HIS X CE1 1 
ATOM   1595 N NE2 . HIS A 1 230 ? -0.109  60.602 47.754 1.00 26.10 ? 209 HIS X NE2 1 
ATOM   1596 N N   . ILE A 1 231 ? 5.631   58.251 45.142 1.00 25.61 ? 210 ILE X N   1 
ATOM   1597 C CA  . ILE A 1 231 ? 6.725   57.946 44.269 1.00 26.04 ? 210 ILE X CA  1 
ATOM   1598 C C   . ILE A 1 231 ? 6.785   56.439 44.066 1.00 27.29 ? 210 ILE X C   1 
ATOM   1599 O O   . ILE A 1 231 ? 7.229   55.995 42.995 1.00 28.52 ? 210 ILE X O   1 
ATOM   1600 C CB  . ILE A 1 231 ? 8.035   58.390 44.898 1.00 26.15 ? 210 ILE X CB  1 
ATOM   1601 C CG1 . ILE A 1 231 ? 8.318   59.847 44.580 1.00 25.65 ? 210 ILE X CG1 1 
ATOM   1602 C CG2 . ILE A 1 231 ? 9.203   57.568 44.401 1.00 25.53 ? 210 ILE X CG2 1 
ATOM   1603 C CD1 . ILE A 1 231 ? 9.594   60.322 45.225 1.00 17.63 ? 210 ILE X CD1 1 
ATOM   1604 N N   . LEU A 1 232 ? 6.373   55.657 45.073 1.00 27.31 ? 211 LEU X N   1 
ATOM   1605 C CA  . LEU A 1 232 ? 6.445   54.197 44.989 1.00 28.38 ? 211 LEU X CA  1 
ATOM   1606 C C   . LEU A 1 232 ? 5.163   53.584 44.382 1.00 30.41 ? 211 LEU X C   1 
ATOM   1607 O O   . LEU A 1 232 ? 5.234   52.676 43.521 1.00 31.43 ? 211 LEU X O   1 
ATOM   1608 C CB  . LEU A 1 232 ? 6.709   53.563 46.359 1.00 27.85 ? 211 LEU X CB  1 
ATOM   1609 C CG  . LEU A 1 232 ? 8.065   53.665 47.071 1.00 27.93 ? 211 LEU X CG  1 
ATOM   1610 C CD1 . LEU A 1 232 ? 7.877   53.460 48.558 1.00 25.48 ? 211 LEU X CD1 1 
ATOM   1611 C CD2 . LEU A 1 232 ? 8.983   52.603 46.536 1.00 30.44 ? 211 LEU X CD2 1 
ATOM   1612 N N   . SER A 1 233 ? 3.990   54.053 44.825 1.00 30.76 ? 212 SER X N   1 
ATOM   1613 C CA  . SER A 1 233 ? 2.731   53.542 44.293 1.00 31.45 ? 212 SER X CA  1 
ATOM   1614 C C   . SER A 1 233 ? 2.589   53.714 42.775 1.00 32.36 ? 212 SER X C   1 
ATOM   1615 O O   . SER A 1 233 ? 2.581   54.861 42.258 1.00 32.84 ? 212 SER X O   1 
ATOM   1616 C CB  . SER A 1 233 ? 1.567   54.287 44.912 1.00 31.57 ? 212 SER X CB  1 
ATOM   1617 O OG  . SER A 1 233 ? 0.405   53.484 44.879 1.00 30.36 ? 212 SER X OG  1 
ATOM   1618 N N   . PRO A 1 234 ? 2.422   52.594 42.052 1.00 32.23 ? 213 PRO X N   1 
ATOM   1619 C CA  . PRO A 1 234 ? 2.224   52.756 40.588 1.00 32.04 ? 213 PRO X CA  1 
ATOM   1620 C C   . PRO A 1 234 ? 1.045   53.684 40.220 1.00 31.36 ? 213 PRO X C   1 
ATOM   1621 O O   . PRO A 1 234 ? 1.125   54.439 39.251 1.00 31.63 ? 213 PRO X O   1 
ATOM   1622 C CB  . PRO A 1 234 ? 1.995   51.314 40.092 1.00 32.20 ? 213 PRO X CB  1 
ATOM   1623 C CG  . PRO A 1 234 ? 2.714   50.455 41.138 1.00 32.46 ? 213 PRO X CG  1 
ATOM   1624 C CD  . PRO A 1 234 ? 2.595   51.189 42.464 1.00 31.58 ? 213 PRO X CD  1 
ATOM   1625 N N   . GLY A 1 235 ? -0.046  53.636 40.970 1.00 31.14 ? 214 GLY X N   1 
ATOM   1626 C CA  . GLY A 1 235 ? -1.190  54.478 40.640 1.00 30.06 ? 214 GLY X CA  1 
ATOM   1627 C C   . GLY A 1 235 ? -1.007  55.959 40.929 1.00 30.71 ? 214 GLY X C   1 
ATOM   1628 O O   . GLY A 1 235 ? -1.902  56.745 40.645 1.00 31.56 ? 214 GLY X O   1 
ATOM   1629 N N   . SER A 1 236 ? 0.113   56.391 41.505 1.00 30.24 ? 215 SER X N   1 
ATOM   1630 C CA  . SER A 1 236 ? 0.252   57.825 41.750 1.00 29.95 ? 215 SER X CA  1 
ATOM   1631 C C   . SER A 1 236 ? 1.307   58.455 40.849 1.00 30.38 ? 215 SER X C   1 
ATOM   1632 O O   . SER A 1 236 ? 1.381   59.681 40.686 1.00 31.31 ? 215 SER X O   1 
ATOM   1633 C CB  . SER A 1 236 ? 0.586   58.083 43.223 1.00 29.69 ? 215 SER X CB  1 
ATOM   1634 O OG  . SER A 1 236 ? -0.383  57.461 44.048 1.00 29.15 ? 215 SER X OG  1 
ATOM   1635 N N   . ARG A 1 237 ? 2.143   57.615 40.270 1.00 30.15 ? 216 ARG X N   1 
ATOM   1636 C CA  . ARG A 1 237 ? 3.380   58.099 39.688 1.00 29.81 ? 216 ARG X CA  1 
ATOM   1637 C C   . ARG A 1 237 ? 3.111   59.066 38.574 1.00 29.82 ? 216 ARG X C   1 
ATOM   1638 O O   . ARG A 1 237 ? 3.866   60.020 38.404 1.00 30.20 ? 216 ARG X O   1 
ATOM   1639 C CB  . ARG A 1 237 ? 4.241   56.943 39.154 1.00 29.40 ? 216 ARG X CB  1 
ATOM   1640 C CG  . ARG A 1 237 ? 4.554   55.826 40.125 1.00 29.10 ? 216 ARG X CG  1 
ATOM   1641 C CD  . ARG A 1 237 ? 5.509   54.756 39.491 1.00 30.97 ? 216 ARG X CD  1 
ATOM   1642 N NE  . ARG A 1 237 ? 5.808   53.662 40.424 1.00 32.23 ? 216 ARG X NE  1 
ATOM   1643 C CZ  . ARG A 1 237 ? 6.356   52.485 40.106 1.00 33.74 ? 216 ARG X CZ  1 
ATOM   1644 N NH1 . ARG A 1 237 ? 6.578   51.569 41.071 1.00 30.59 ? 216 ARG X NH1 1 
ATOM   1645 N NH2 . ARG A 1 237 ? 6.680   52.205 38.833 1.00 33.93 ? 216 ARG X NH2 1 
ATOM   1646 N N   . ASP A 1 238 ? 2.051   58.845 37.795 1.00 29.89 ? 217 ASP X N   1 
ATOM   1647 C CA  . ASP A 1 238 ? 1.934   59.654 36.562 1.00 29.56 ? 217 ASP X CA  1 
ATOM   1648 C C   . ASP A 1 238 ? 1.355   61.012 36.848 1.00 28.95 ? 217 ASP X C   1 
ATOM   1649 O O   . ASP A 1 238 ? 1.314   61.849 35.948 1.00 28.88 ? 217 ASP X O   1 
ATOM   1650 C CB  . ASP A 1 238 ? 1.103   58.981 35.476 1.00 29.59 ? 217 ASP X CB  1 
ATOM   1651 C CG  . ASP A 1 238 ? 1.589   57.562 35.143 1.00 30.04 ? 217 ASP X CG  1 
ATOM   1652 O OD1 . ASP A 1 238 ? 2.770   57.208 35.442 1.00 30.38 ? 217 ASP X OD1 1 
ATOM   1653 O OD2 . ASP A 1 238 ? 0.770   56.821 34.560 1.00 28.24 ? 217 ASP X OD2 1 
ATOM   1654 N N   . LEU A 1 239 ? 0.898   61.213 38.092 1.00 27.47 ? 218 LEU X N   1 
ATOM   1655 C CA  . LEU A 1 239 ? 0.239   62.469 38.498 1.00 26.15 ? 218 LEU X CA  1 
ATOM   1656 C C   . LEU A 1 239 ? 1.138   63.618 39.034 1.00 25.32 ? 218 LEU X C   1 
ATOM   1657 O O   . LEU A 1 239 ? 0.601   64.575 39.556 1.00 24.56 ? 218 LEU X O   1 
ATOM   1658 C CB  . LEU A 1 239 ? -0.843  62.200 39.534 1.00 25.66 ? 218 LEU X CB  1 
ATOM   1659 C CG  . LEU A 1 239 ? -1.845  61.041 39.326 1.00 27.17 ? 218 LEU X CG  1 
ATOM   1660 C CD1 . LEU A 1 239 ? -2.848  60.795 40.519 1.00 23.58 ? 218 LEU X CD1 1 
ATOM   1661 C CD2 . LEU A 1 239 ? -2.612  61.235 38.042 1.00 25.55 ? 218 LEU X CD2 1 
ATOM   1662 N N   . PHE A 1 240 ? 2.470   63.559 38.900 1.00 24.12 ? 219 PHE X N   1 
ATOM   1663 C CA  . PHE A 1 240 ? 3.314   64.700 39.338 1.00 23.26 ? 219 PHE X CA  1 
ATOM   1664 C C   . PHE A 1 240 ? 4.735   64.512 38.741 1.00 23.40 ? 219 PHE X C   1 
ATOM   1665 O O   . PHE A 1 240 ? 5.108   63.417 38.328 1.00 23.63 ? 219 PHE X O   1 
ATOM   1666 C CB  . PHE A 1 240 ? 3.366   64.774 40.882 1.00 22.93 ? 219 PHE X CB  1 
ATOM   1667 C CG  . PHE A 1 240 ? 3.986   63.546 41.502 1.00 21.99 ? 219 PHE X CG  1 
ATOM   1668 C CD1 . PHE A 1 240 ? 3.205   62.401 41.749 1.00 21.59 ? 219 PHE X CD1 1 
ATOM   1669 C CD2 . PHE A 1 240 ? 5.364   63.484 41.739 1.00 19.40 ? 219 PHE X CD2 1 
ATOM   1670 C CE1 . PHE A 1 240 ? 3.805   61.237 42.297 1.00 22.69 ? 219 PHE X CE1 1 
ATOM   1671 C CE2 . PHE A 1 240 ? 5.969   62.319 42.245 1.00 20.55 ? 219 PHE X CE2 1 
ATOM   1672 C CZ  . PHE A 1 240 ? 5.187   61.206 42.546 1.00 20.52 ? 219 PHE X CZ  1 
ATOM   1673 N N   . ARG A 1 241 ? 5.538   65.560 38.741 1.00 23.20 ? 220 ARG X N   1 
ATOM   1674 C CA  . ARG A 1 241 ? 6.763   65.568 38.003 1.00 23.37 ? 220 ARG X CA  1 
ATOM   1675 C C   . ARG A 1 241 ? 7.966   65.280 38.886 1.00 23.52 ? 220 ARG X C   1 
ATOM   1676 O O   . ARG A 1 241 ? 8.811   64.454 38.514 1.00 23.50 ? 220 ARG X O   1 
ATOM   1677 C CB  . ARG A 1 241 ? 6.895   66.950 37.382 1.00 23.92 ? 220 ARG X CB  1 
ATOM   1678 C CG  . ARG A 1 241 ? 8.162   67.245 36.589 1.00 26.07 ? 220 ARG X CG  1 
ATOM   1679 C CD  . ARG A 1 241 ? 8.328   66.338 35.437 1.00 26.85 ? 220 ARG X CD  1 
ATOM   1680 N NE  . ARG A 1 241 ? 9.439   66.776 34.579 1.00 32.67 ? 220 ARG X NE  1 
ATOM   1681 C CZ  . ARG A 1 241 ? 9.349   67.674 33.580 1.00 34.75 ? 220 ARG X CZ  1 
ATOM   1682 N NH1 . ARG A 1 241 ? 8.192   68.317 33.300 1.00 32.06 ? 220 ARG X NH1 1 
ATOM   1683 N NH2 . ARG A 1 241 ? 10.440  67.931 32.844 1.00 31.95 ? 220 ARG X NH2 1 
ATOM   1684 N N   . ARG A 1 242 ? 8.055   65.977 40.027 1.00 23.12 ? 221 ARG X N   1 
ATOM   1685 C CA  . ARG A 1 242 ? 9.179   65.862 40.973 1.00 22.75 ? 221 ARG X CA  1 
ATOM   1686 C C   . ARG A 1 242 ? 8.643   65.889 42.372 1.00 22.74 ? 221 ARG X C   1 
ATOM   1687 O O   . ARG A 1 242 ? 7.457   66.201 42.586 1.00 22.27 ? 221 ARG X O   1 
ATOM   1688 C CB  . ARG A 1 242 ? 10.066  67.092 40.947 1.00 22.96 ? 221 ARG X CB  1 
ATOM   1689 C CG  . ARG A 1 242 ? 10.597  67.471 39.655 1.00 25.35 ? 221 ARG X CG  1 
ATOM   1690 C CD  . ARG A 1 242 ? 11.558  68.597 39.822 1.00 28.31 ? 221 ARG X CD  1 
ATOM   1691 N NE  . ARG A 1 242 ? 11.186  69.579 38.839 1.00 33.15 ? 221 ARG X NE  1 
ATOM   1692 C CZ  . ARG A 1 242 ? 11.494  69.495 37.556 1.00 32.15 ? 221 ARG X CZ  1 
ATOM   1693 N NH1 . ARG A 1 242 ? 12.251  68.512 37.125 1.00 24.12 ? 221 ARG X NH1 1 
ATOM   1694 N NH2 . ARG A 1 242 ? 11.040  70.434 36.729 1.00 37.35 ? 221 ARG X NH2 1 
ATOM   1695 N N   . ALA A 1 243 ? 9.560   65.697 43.337 1.00 22.60 ? 222 ALA X N   1 
ATOM   1696 C CA  . ALA A 1 243 ? 9.204   65.517 44.742 1.00 21.82 ? 222 ALA X CA  1 
ATOM   1697 C C   . ALA A 1 243 ? 10.206  66.130 45.692 1.00 22.07 ? 222 ALA X C   1 
ATOM   1698 O O   . ALA A 1 243 ? 11.408  66.092 45.428 1.00 23.00 ? 222 ALA X O   1 
ATOM   1699 C CB  . ALA A 1 243 ? 9.011   64.052 45.051 1.00 21.23 ? 222 ALA X CB  1 
ATOM   1700 N N   . ILE A 1 244 ? 9.690   66.691 46.795 1.00 21.36 ? 223 ILE X N   1 
ATOM   1701 C CA  . ILE A 1 244 ? 10.491  67.170 47.898 1.00 20.72 ? 223 ILE X CA  1 
ATOM   1702 C C   . ILE A 1 244 ? 10.008  66.521 49.196 1.00 20.60 ? 223 ILE X C   1 
ATOM   1703 O O   . ILE A 1 244 ? 8.818   66.559 49.480 1.00 20.53 ? 223 ILE X O   1 
ATOM   1704 C CB  . ILE A 1 244 ? 10.291  68.669 48.080 1.00 20.95 ? 223 ILE X CB  1 
ATOM   1705 C CG1 . ILE A 1 244 ? 10.945  69.422 46.923 1.00 20.68 ? 223 ILE X CG1 1 
ATOM   1706 C CG2 . ILE A 1 244 ? 10.834  69.121 49.467 1.00 19.65 ? 223 ILE X CG2 1 
ATOM   1707 C CD1 . ILE A 1 244 ? 10.749  70.952 47.019 1.00 19.16 ? 223 ILE X CD1 1 
ATOM   1708 N N   . LEU A 1 245 ? 10.925  66.001 50.000 1.00 19.81 ? 224 LEU X N   1 
ATOM   1709 C CA  . LEU A 1 245 ? 10.602  65.303 51.252 1.00 20.33 ? 224 LEU X CA  1 
ATOM   1710 C C   . LEU A 1 245 ? 11.250  65.982 52.441 1.00 20.94 ? 224 LEU X C   1 
ATOM   1711 O O   . LEU A 1 245 ? 12.469  65.979 52.559 1.00 22.36 ? 224 LEU X O   1 
ATOM   1712 C CB  . LEU A 1 245 ? 11.157  63.877 51.206 1.00 19.11 ? 224 LEU X CB  1 
ATOM   1713 C CG  . LEU A 1 245 ? 10.383  62.965 50.230 1.00 19.81 ? 224 LEU X CG  1 
ATOM   1714 C CD1 . LEU A 1 245 ? 10.835  63.137 48.753 1.00 17.11 ? 224 LEU X CD1 1 
ATOM   1715 C CD2 . LEU A 1 245 ? 10.424  61.469 50.645 1.00 15.98 ? 224 LEU X CD2 1 
ATOM   1716 N N   . GLN A 1 246 ? 10.477  66.570 53.335 1.00 21.52 ? 225 GLN X N   1 
ATOM   1717 C CA  . GLN A 1 246 ? 11.069  67.159 54.544 1.00 21.13 ? 225 GLN X CA  1 
ATOM   1718 C C   . GLN A 1 246 ? 10.879  66.279 55.811 1.00 21.40 ? 225 GLN X C   1 
ATOM   1719 O O   . GLN A 1 246 ? 9.745   65.977 56.268 1.00 21.04 ? 225 GLN X O   1 
ATOM   1720 C CB  . GLN A 1 246 ? 10.509  68.569 54.739 1.00 21.81 ? 225 GLN X CB  1 
ATOM   1721 C CG  . GLN A 1 246 ? 10.709  69.516 53.508 1.00 21.86 ? 225 GLN X CG  1 
ATOM   1722 C CD  . GLN A 1 246 ? 9.774   70.756 53.547 1.00 24.33 ? 225 GLN X CD  1 
ATOM   1723 O OE1 . GLN A 1 246 ? 9.447   71.345 52.521 1.00 23.40 ? 225 GLN X OE1 1 
ATOM   1724 N NE2 . GLN A 1 246 ? 9.340   71.129 54.739 1.00 24.99 ? 225 GLN X NE2 1 
ATOM   1725 N N   . SER A 1 247 ? 11.994  65.832 56.371 1.00 21.23 ? 226 SER X N   1 
ATOM   1726 C CA  . SER A 1 247 ? 11.948  65.060 57.633 1.00 21.33 ? 226 SER X CA  1 
ATOM   1727 C C   . SER A 1 247 ? 10.944  63.935 57.572 1.00 21.44 ? 226 SER X C   1 
ATOM   1728 O O   . SER A 1 247 ? 10.182  63.782 58.527 1.00 21.67 ? 226 SER X O   1 
ATOM   1729 C CB  . SER A 1 247 ? 11.536  65.924 58.860 1.00 21.03 ? 226 SER X CB  1 
ATOM   1730 O OG  . SER A 1 247 ? 12.219  67.164 58.985 1.00 21.49 ? 226 SER X OG  1 
ATOM   1731 N N   . GLY A 1 248 ? 10.923  63.128 56.510 1.00 21.24 ? 227 GLY X N   1 
ATOM   1732 C CA  . GLY A 1 248 ? 9.983   62.003 56.504 1.00 20.84 ? 227 GLY X CA  1 
ATOM   1733 C C   . GLY A 1 248 ? 10.295  61.142 55.308 1.00 22.00 ? 227 GLY X C   1 
ATOM   1734 O O   . GLY A 1 248 ? 10.722  61.649 54.259 1.00 21.04 ? 227 GLY X O   1 
ATOM   1735 N N   . SER A 1 249 ? 10.146  59.821 55.445 1.00 22.33 ? 228 SER X N   1 
ATOM   1736 C CA  . SER A 1 249 ? 10.358  59.020 54.262 1.00 22.40 ? 228 SER X CA  1 
ATOM   1737 C C   . SER A 1 249 ? 9.500   57.762 54.246 1.00 22.73 ? 228 SER X C   1 
ATOM   1738 O O   . SER A 1 249 ? 8.978   57.351 55.272 1.00 23.02 ? 228 SER X O   1 
ATOM   1739 C CB  . SER A 1 249 ? 11.838  58.862 53.936 1.00 21.36 ? 228 SER X CB  1 
ATOM   1740 O OG  . SER A 1 249 ? 12.373  57.677 54.408 1.00 21.67 ? 228 SER X OG  1 
ATOM   1741 N N   . PRO A 1 250 ? 9.262   57.214 53.059 1.00 22.26 ? 229 PRO X N   1 
ATOM   1742 C CA  . PRO A 1 250 ? 8.185   56.265 53.058 1.00 22.40 ? 229 PRO X CA  1 
ATOM   1743 C C   . PRO A 1 250 ? 8.461   55.077 53.967 1.00 22.33 ? 229 PRO X C   1 
ATOM   1744 O O   . PRO A 1 250 ? 7.517   54.469 54.477 1.00 22.54 ? 229 PRO X O   1 
ATOM   1745 C CB  . PRO A 1 250 ? 8.087   55.845 51.568 1.00 23.32 ? 229 PRO X CB  1 
ATOM   1746 C CG  . PRO A 1 250 ? 9.468   56.224 50.955 1.00 22.09 ? 229 PRO X CG  1 
ATOM   1747 C CD  . PRO A 1 250 ? 9.776   57.504 51.710 1.00 22.10 ? 229 PRO X CD  1 
ATOM   1748 N N   . ASN A 1 251 ? 9.731   54.731 54.146 1.00 22.11 ? 230 ASN X N   1 
ATOM   1749 C CA  . ASN A 1 251 ? 10.110  53.520 54.901 1.00 21.72 ? 230 ASN X CA  1 
ATOM   1750 C C   . ASN A 1 251 ? 10.286  53.835 56.377 1.00 22.24 ? 230 ASN X C   1 
ATOM   1751 O O   . ASN A 1 251 ? 10.930  53.053 57.087 1.00 22.33 ? 230 ASN X O   1 
ATOM   1752 C CB  . ASN A 1 251 ? 11.463  52.993 54.441 1.00 20.65 ? 230 ASN X CB  1 
ATOM   1753 C CG  . ASN A 1 251 ? 12.488  54.104 54.320 1.00 21.39 ? 230 ASN X CG  1 
ATOM   1754 O OD1 . ASN A 1 251 ? 12.165  55.219 53.923 1.00 21.17 ? 230 ASN X OD1 1 
ATOM   1755 N ND2 . ASN A 1 251 ? 13.719  53.820 54.685 1.00 24.71 ? 230 ASN X ND2 1 
ATOM   1756 N N   . CYS A 1 252 ? 9.806   54.981 56.853 1.00 21.70 ? 231 CYS X N   1 
ATOM   1757 C CA  . CYS A 1 252 ? 10.007  55.247 58.271 1.00 22.36 ? 231 CYS X CA  1 
ATOM   1758 C C   . CYS A 1 252 ? 9.346   54.171 59.160 1.00 22.68 ? 231 CYS X C   1 
ATOM   1759 O O   . CYS A 1 252 ? 8.297   53.596 58.827 1.00 23.33 ? 231 CYS X O   1 
ATOM   1760 C CB  . CYS A 1 252 ? 9.527   56.645 58.682 1.00 22.37 ? 231 CYS X CB  1 
ATOM   1761 S SG  . CYS A 1 252 ? 10.597  57.961 58.148 1.00 22.31 ? 231 CYS X SG  1 
ATOM   1762 N N   . PRO A 1 253 ? 9.933   53.906 60.318 1.00 22.15 ? 232 PRO X N   1 
ATOM   1763 C CA  . PRO A 1 253 ? 9.360   52.738 60.990 1.00 20.87 ? 232 PRO X CA  1 
ATOM   1764 C C   . PRO A 1 253 ? 7.960   53.000 61.515 1.00 20.87 ? 232 PRO X C   1 
ATOM   1765 O O   . PRO A 1 253 ? 7.288   52.048 61.878 1.00 19.09 ? 232 PRO X O   1 
ATOM   1766 C CB  . PRO A 1 253 ? 10.325  52.498 62.155 1.00 21.18 ? 232 PRO X CB  1 
ATOM   1767 C CG  . PRO A 1 253 ? 10.940  53.904 62.433 1.00 22.27 ? 232 PRO X CG  1 
ATOM   1768 C CD  . PRO A 1 253 ? 11.102  54.481 61.012 1.00 21.88 ? 232 PRO X CD  1 
ATOM   1769 N N   . TRP A 1 254 ? 7.535   54.271 61.591 1.00 21.60 ? 233 TRP X N   1 
ATOM   1770 C CA  . TRP A 1 254 ? 6.195   54.649 62.119 1.00 22.25 ? 233 TRP X CA  1 
ATOM   1771 C C   . TRP A 1 254 ? 5.206   54.904 60.961 1.00 24.09 ? 233 TRP X C   1 
ATOM   1772 O O   . TRP A 1 254 ? 4.017   55.178 61.193 1.00 25.37 ? 233 TRP X O   1 
ATOM   1773 C CB  . TRP A 1 254 ? 6.260   55.933 62.979 1.00 21.90 ? 233 TRP X CB  1 
ATOM   1774 C CG  . TRP A 1 254 ? 7.062   57.042 62.271 1.00 21.82 ? 233 TRP X CG  1 
ATOM   1775 C CD1 . TRP A 1 254 ? 8.396   57.308 62.434 1.00 22.36 ? 233 TRP X CD1 1 
ATOM   1776 C CD2 . TRP A 1 254 ? 6.601   57.949 61.260 1.00 20.41 ? 233 TRP X CD2 1 
ATOM   1777 N NE1 . TRP A 1 254 ? 8.797   58.318 61.605 1.00 22.30 ? 233 TRP X NE1 1 
ATOM   1778 C CE2 . TRP A 1 254 ? 7.731   58.743 60.865 1.00 20.06 ? 233 TRP X CE2 1 
ATOM   1779 C CE3 . TRP A 1 254 ? 5.355   58.178 60.654 1.00 19.96 ? 233 TRP X CE3 1 
ATOM   1780 C CZ2 . TRP A 1 254 ? 7.666   59.750 59.888 1.00 16.50 ? 233 TRP X CZ2 1 
ATOM   1781 C CZ3 . TRP A 1 254 ? 5.262   59.209 59.693 1.00 22.20 ? 233 TRP X CZ3 1 
ATOM   1782 C CH2 . TRP A 1 254 ? 6.440   59.983 59.308 1.00 22.23 ? 233 TRP X CH2 1 
ATOM   1783 N N   . ALA A 1 255 ? 5.672   54.857 59.715 1.00 23.99 ? 234 ALA X N   1 
ATOM   1784 C CA  . ALA A 1 255 ? 4.816   55.299 58.628 1.00 23.71 ? 234 ALA X CA  1 
ATOM   1785 C C   . ALA A 1 255 ? 3.982   54.207 57.987 1.00 24.34 ? 234 ALA X C   1 
ATOM   1786 O O   . ALA A 1 255 ? 3.168   54.521 57.142 1.00 23.37 ? 234 ALA X O   1 
ATOM   1787 C CB  . ALA A 1 255 ? 5.636   55.943 57.581 1.00 23.68 ? 234 ALA X CB  1 
ATOM   1788 N N   . SER A 1 256 ? 4.200   52.919 58.311 1.00 25.26 ? 235 SER X N   1 
ATOM   1789 C CA  . SER A 1 256 ? 3.323   51.892 57.725 1.00 25.67 ? 235 SER X CA  1 
ATOM   1790 C C   . SER A 1 256 ? 3.297   50.645 58.592 1.00 26.55 ? 235 SER X C   1 
ATOM   1791 O O   . SER A 1 256 ? 4.102   50.524 59.456 1.00 27.03 ? 235 SER X O   1 
ATOM   1792 C CB  . SER A 1 256 ? 3.776   51.525 56.330 1.00 24.83 ? 235 SER X CB  1 
ATOM   1793 O OG  . SER A 1 256 ? 5.011   50.881 56.454 1.00 22.42 ? 235 SER X OG  1 
ATOM   1794 N N   . VAL A 1 257 ? 2.363   49.728 58.354 1.00 27.49 ? 236 VAL X N   1 
ATOM   1795 C CA  . VAL A 1 257 ? 2.245   48.523 59.162 1.00 28.22 ? 236 VAL X CA  1 
ATOM   1796 C C   . VAL A 1 257 ? 1.762   47.367 58.277 1.00 29.62 ? 236 VAL X C   1 
ATOM   1797 O O   . VAL A 1 257 ? 1.246   47.611 57.181 1.00 31.30 ? 236 VAL X O   1 
ATOM   1798 C CB  . VAL A 1 257 ? 1.234   48.716 60.329 1.00 28.15 ? 236 VAL X CB  1 
ATOM   1799 C CG1 . VAL A 1 257 ? 1.777   49.694 61.345 1.00 25.97 ? 236 VAL X CG1 1 
ATOM   1800 C CG2 . VAL A 1 257 ? -0.159  49.120 59.807 1.00 24.68 ? 236 VAL X CG2 1 
ATOM   1801 N N   . SER A 1 258 ? 1.918   46.128 58.711 1.00 29.40 ? 237 SER X N   1 
ATOM   1802 C CA  . SER A 1 258 ? 1.470   45.026 57.857 1.00 30.97 ? 237 SER X CA  1 
ATOM   1803 C C   . SER A 1 258 ? -0.062  44.930 57.918 1.00 31.03 ? 237 SER X C   1 
ATOM   1804 O O   . SER A 1 258 ? -0.693  45.549 58.798 1.00 30.73 ? 237 SER X O   1 
ATOM   1805 C CB  . SER A 1 258 ? 2.042   43.698 58.360 1.00 30.70 ? 237 SER X CB  1 
ATOM   1806 O OG  . SER A 1 258 ? 1.530   43.469 59.691 1.00 33.52 ? 237 SER X OG  1 
ATOM   1807 N N   . VAL A 1 259 ? -0.651  44.104 57.050 1.00 30.67 ? 238 VAL X N   1 
ATOM   1808 C CA  . VAL A 1 259 ? -2.109  43.981 57.056 1.00 30.55 ? 238 VAL X CA  1 
ATOM   1809 C C   . VAL A 1 259 ? -2.551  43.297 58.341 1.00 30.61 ? 238 VAL X C   1 
ATOM   1810 O O   . VAL A 1 259 ? -3.614  43.614 58.887 1.00 31.54 ? 238 VAL X O   1 
ATOM   1811 C CB  . VAL A 1 259 ? -2.678  43.230 55.813 1.00 30.49 ? 238 VAL X CB  1 
ATOM   1812 C CG1 . VAL A 1 259 ? -2.007  43.676 54.543 1.00 28.72 ? 238 VAL X CG1 1 
ATOM   1813 C CG2 . VAL A 1 259 ? -2.485  41.784 55.959 1.00 28.73 ? 238 VAL X CG2 1 
ATOM   1814 N N   . ALA A 1 260 ? -1.748  42.363 58.838 1.00 30.31 ? 239 ALA X N   1 
ATOM   1815 C CA  . ALA A 1 260 ? -2.068  41.723 60.134 1.00 30.20 ? 239 ALA X CA  1 
ATOM   1816 C C   . ALA A 1 260 ? -2.128  42.777 61.248 1.00 30.38 ? 239 ALA X C   1 
ATOM   1817 O O   . ALA A 1 260 ? -3.114  42.887 61.974 1.00 30.32 ? 239 ALA X O   1 
ATOM   1818 C CB  . ALA A 1 260 ? -1.080  40.626 60.473 1.00 28.43 ? 239 ALA X CB  1 
ATOM   1819 N N   . GLU A 1 261 ? -1.093  43.603 61.347 1.00 30.81 ? 240 GLU X N   1 
ATOM   1820 C CA  . GLU A 1 261 ? -1.084  44.603 62.416 1.00 30.62 ? 240 GLU X CA  1 
ATOM   1821 C C   . GLU A 1 261 ? -2.230  45.646 62.275 1.00 29.97 ? 240 GLU X C   1 
ATOM   1822 O O   . GLU A 1 261 ? -2.848  46.067 63.261 1.00 29.91 ? 240 GLU X O   1 
ATOM   1823 C CB  . GLU A 1 261 ? 0.313   45.216 62.555 1.00 29.93 ? 240 GLU X CB  1 
ATOM   1824 C CG  . GLU A 1 261 ? 0.403   46.321 63.571 1.00 32.46 ? 240 GLU X CG  1 
ATOM   1825 C CD  . GLU A 1 261 ? 0.103   45.892 65.015 1.00 34.34 ? 240 GLU X CD  1 
ATOM   1826 O OE1 . GLU A 1 261 ? -0.191  44.696 65.236 1.00 36.11 ? 240 GLU X OE1 1 
ATOM   1827 O OE2 . GLU A 1 261 ? 0.133   46.771 65.916 1.00 34.50 ? 240 GLU X OE2 1 
ATOM   1828 N N   . GLY A 1 262 ? -2.562  46.022 61.053 1.00 29.58 ? 241 GLY X N   1 
ATOM   1829 C CA  . GLY A 1 262 ? -3.693  46.929 60.866 1.00 30.17 ? 241 GLY X CA  1 
ATOM   1830 C C   . GLY A 1 262 ? -5.025  46.288 61.249 1.00 30.26 ? 241 GLY X C   1 
ATOM   1831 O O   . GLY A 1 262 ? -5.899  46.911 61.881 1.00 29.22 ? 241 GLY X O   1 
ATOM   1832 N N   . ARG A 1 263 ? -5.175  45.032 60.843 1.00 30.45 ? 242 ARG X N   1 
ATOM   1833 C CA  . ARG A 1 263 ? -6.344  44.275 61.183 1.00 31.10 ? 242 ARG X CA  1 
ATOM   1834 C C   . ARG A 1 263 ? -6.455  44.196 62.726 1.00 31.34 ? 242 ARG X C   1 
ATOM   1835 O O   . ARG A 1 263 ? -7.464  44.603 63.322 1.00 31.41 ? 242 ARG X O   1 
ATOM   1836 C CB  . ARG A 1 263 ? -6.295  42.913 60.470 1.00 31.20 ? 242 ARG X CB  1 
ATOM   1837 C CG  . ARG A 1 263 ? -7.261  41.806 61.041 1.00 32.12 ? 242 ARG X CG  1 
ATOM   1838 C CD  . ARG A 1 263 ? -7.504  40.599 60.053 1.00 31.69 ? 242 ARG X CD  1 
ATOM   1839 N NE  . ARG A 1 263 ? -8.082  41.031 58.757 1.00 33.66 ? 242 ARG X NE  1 
ATOM   1840 C CZ  . ARG A 1 263 ? -9.373  41.324 58.550 1.00 32.04 ? 242 ARG X CZ  1 
ATOM   1841 N NH1 . ARG A 1 263 ? -9.789  41.728 57.344 1.00 32.74 ? 242 ARG X NH1 1 
ATOM   1842 N NH2 . ARG A 1 263 ? -10.252 41.235 59.541 1.00 28.84 ? 242 ARG X NH2 1 
ATOM   1843 N N   . ARG A 1 264 ? -5.383  43.743 63.365 1.00 31.20 ? 243 ARG X N   1 
ATOM   1844 C CA  . ARG A 1 264 ? -5.310  43.655 64.818 1.00 31.92 ? 243 ARG X CA  1 
ATOM   1845 C C   . ARG A 1 264 ? -5.725  44.995 65.512 1.00 32.20 ? 243 ARG X C   1 
ATOM   1846 O O   . ARG A 1 264 ? -6.515  45.005 66.452 1.00 32.29 ? 243 ARG X O   1 
ATOM   1847 C CB  . ARG A 1 264 ? -3.888  43.221 65.152 1.00 32.16 ? 243 ARG X CB  1 
ATOM   1848 C CG  . ARG A 1 264 ? -3.587  42.662 66.519 1.00 32.69 ? 243 ARG X CG  1 
ATOM   1849 C CD  . ARG A 1 264 ? -2.281  43.360 67.097 1.00 34.30 ? 243 ARG X CD  1 
ATOM   1850 N NE  . ARG A 1 264 ? -2.704  44.151 68.254 1.00 36.18 ? 243 ARG X NE  1 
ATOM   1851 C CZ  . ARG A 1 264 ? -2.462  45.433 68.522 1.00 34.93 ? 243 ARG X CZ  1 
ATOM   1852 N NH1 . ARG A 1 264 ? -1.694  46.206 67.749 1.00 35.26 ? 243 ARG X NH1 1 
ATOM   1853 N NH2 . ARG A 1 264 ? -2.984  45.919 69.641 1.00 33.70 ? 243 ARG X NH2 1 
ATOM   1854 N N   . ARG A 1 265 ? -5.228  46.130 65.017 1.00 32.19 ? 244 ARG X N   1 
ATOM   1855 C CA  . ARG A 1 265 ? -5.567  47.432 65.632 1.00 31.46 ? 244 ARG X CA  1 
ATOM   1856 C C   . ARG A 1 265 ? -6.998  47.886 65.359 1.00 31.72 ? 244 ARG X C   1 
ATOM   1857 O O   . ARG A 1 265 ? -7.590  48.558 66.203 1.00 31.63 ? 244 ARG X O   1 
ATOM   1858 C CB  . ARG A 1 265 ? -4.572  48.555 65.245 1.00 30.33 ? 244 ARG X CB  1 
ATOM   1859 C CG  . ARG A 1 265 ? -3.101  48.237 65.482 1.00 27.31 ? 244 ARG X CG  1 
ATOM   1860 C CD  . ARG A 1 265 ? -2.300  49.441 65.056 1.00 24.78 ? 244 ARG X CD  1 
ATOM   1861 N NE  . ARG A 1 265 ? -0.860  49.283 65.184 1.00 22.07 ? 244 ARG X NE  1 
ATOM   1862 C CZ  . ARG A 1 265 ? 0.028   50.274 65.022 1.00 24.74 ? 244 ARG X CZ  1 
ATOM   1863 N NH1 . ARG A 1 265 ? -0.329  51.560 64.692 1.00 21.27 ? 244 ARG X NH1 1 
ATOM   1864 N NH2 . ARG A 1 265 ? 1.307   49.972 65.180 1.00 21.49 ? 244 ARG X NH2 1 
ATOM   1865 N N   . ALA A 1 266 ? -7.534  47.559 64.181 1.00 31.90 ? 245 ALA X N   1 
ATOM   1866 C CA  . ALA A 1 266 ? -8.941  47.830 63.868 1.00 32.05 ? 245 ALA X CA  1 
ATOM   1867 C C   . ALA A 1 266 ? -9.865  47.111 64.853 1.00 32.75 ? 245 ALA X C   1 
ATOM   1868 O O   . ALA A 1 266 ? -10.722 47.726 65.484 1.00 33.10 ? 245 ALA X O   1 
ATOM   1869 C CB  . ALA A 1 266 ? -9.228  47.337 62.516 1.00 32.73 ? 245 ALA X CB  1 
ATOM   1870 N N   . VAL A 1 267 ? -9.682  45.795 64.973 1.00 32.69 ? 246 VAL X N   1 
ATOM   1871 C CA  . VAL A 1 267 ? -10.389 45.000 65.960 1.00 32.72 ? 246 VAL X CA  1 
ATOM   1872 C C   . VAL A 1 267 ? -10.255 45.548 67.402 1.00 33.23 ? 246 VAL X C   1 
ATOM   1873 O O   . VAL A 1 267 ? -11.250 45.797 68.090 1.00 34.08 ? 246 VAL X O   1 
ATOM   1874 C CB  . VAL A 1 267 ? -9.915  43.525 65.947 1.00 33.16 ? 246 VAL X CB  1 
ATOM   1875 C CG1 . VAL A 1 267 ? -10.539 42.781 67.114 1.00 31.32 ? 246 VAL X CG1 1 
ATOM   1876 C CG2 . VAL A 1 267 ? -10.197 42.819 64.569 1.00 30.72 ? 246 VAL X CG2 1 
ATOM   1877 N N   . GLU A 1 268 ? -9.032  45.737 67.867 1.00 32.69 ? 247 GLU X N   1 
ATOM   1878 C CA  . GLU A 1 268 ? -8.844  46.363 69.154 1.00 32.48 ? 247 GLU X CA  1 
ATOM   1879 C C   . GLU A 1 268 ? -9.591  47.701 69.276 1.00 32.26 ? 247 GLU X C   1 
ATOM   1880 O O   . GLU A 1 268 ? -10.159 48.005 70.342 1.00 32.49 ? 247 GLU X O   1 
ATOM   1881 C CB  . GLU A 1 268 ? -7.361  46.531 69.437 1.00 32.30 ? 247 GLU X CB  1 
ATOM   1882 C CG  . GLU A 1 268 ? -7.105  47.016 70.830 1.00 36.27 ? 247 GLU X CG  1 
ATOM   1883 C CD  . GLU A 1 268 ? -7.398  45.961 71.920 1.00 40.64 ? 247 GLU X CD  1 
ATOM   1884 O OE1 . GLU A 1 268 ? -7.318  46.330 73.113 1.00 42.02 ? 247 GLU X OE1 1 
ATOM   1885 O OE2 . GLU A 1 268 ? -7.691  44.785 71.594 1.00 39.84 ? 247 GLU X OE2 1 
ATOM   1886 N N   . LEU A 1 269 ? -9.616  48.502 68.203 1.00 31.85 ? 248 LEU X N   1 
ATOM   1887 C CA  . LEU A 1 269 ? -10.375 49.759 68.224 1.00 31.67 ? 248 LEU X CA  1 
ATOM   1888 C C   . LEU A 1 269 ? -11.779 49.418 68.596 1.00 32.00 ? 248 LEU X C   1 
ATOM   1889 O O   . LEU A 1 269 ? -12.298 49.894 69.585 1.00 31.73 ? 248 LEU X O   1 
ATOM   1890 C CB  . LEU A 1 269 ? -10.441 50.421 66.854 1.00 31.68 ? 248 LEU X CB  1 
ATOM   1891 C CG  . LEU A 1 269 ? -11.144 51.784 66.899 1.00 30.05 ? 248 LEU X CG  1 
ATOM   1892 C CD1 . LEU A 1 269 ? -10.469 52.654 67.933 1.00 29.17 ? 248 LEU X CD1 1 
ATOM   1893 C CD2 . LEU A 1 269 ? -11.178 52.502 65.570 1.00 28.24 ? 248 LEU X CD2 1 
ATOM   1894 N N   . GLY A 1 270 ? -12.383 48.560 67.783 1.00 32.43 ? 249 GLY X N   1 
ATOM   1895 C CA  . GLY A 1 270 ? -13.733 48.021 68.051 1.00 33.03 ? 249 GLY X CA  1 
ATOM   1896 C C   . GLY A 1 270 ? -13.955 47.509 69.460 1.00 33.02 ? 249 GLY X C   1 
ATOM   1897 O O   . GLY A 1 270 ? -14.915 47.892 70.130 1.00 32.90 ? 249 GLY X O   1 
ATOM   1898 N N   . ARG A 1 271 ? -13.061 46.655 69.916 1.00 33.06 ? 250 ARG X N   1 
ATOM   1899 C CA  . ARG A 1 271 ? -13.111 46.187 71.283 1.00 34.48 ? 250 ARG X CA  1 
ATOM   1900 C C   . ARG A 1 271 ? -13.179 47.355 72.316 1.00 35.24 ? 250 ARG X C   1 
ATOM   1901 O O   . ARG A 1 271 ? -13.795 47.220 73.353 1.00 35.33 ? 250 ARG X O   1 
ATOM   1902 C CB  . ARG A 1 271 ? -11.923 45.243 71.524 1.00 34.74 ? 250 ARG X CB  1 
ATOM   1903 C CG  . ARG A 1 271 ? -11.969 44.389 72.787 1.00 34.75 ? 250 ARG X CG  1 
ATOM   1904 C CD  . ARG A 1 271 ? -10.713 43.498 72.904 1.00 35.56 ? 250 ARG X CD  1 
ATOM   1905 N NE  . ARG A 1 271 ? -10.676 42.406 71.909 1.00 37.26 ? 250 ARG X NE  1 
ATOM   1906 N N   . ASN A 1 272 ? -12.591 48.512 72.020 1.00 36.00 ? 251 ASN X N   1 
ATOM   1907 C CA  . ASN A 1 272 ? -12.665 49.647 72.945 1.00 36.20 ? 251 ASN X CA  1 
ATOM   1908 C C   . ASN A 1 272 ? -14.028 50.316 72.963 1.00 37.73 ? 251 ASN X C   1 
ATOM   1909 O O   . ASN A 1 272 ? -14.361 51.020 73.930 1.00 37.99 ? 251 ASN X O   1 
ATOM   1910 C CB  . ASN A 1 272 ? -11.595 50.717 72.627 1.00 36.11 ? 251 ASN X CB  1 
ATOM   1911 C CG  . ASN A 1 272 ? -10.198 50.380 73.182 1.00 34.50 ? 251 ASN X CG  1 
ATOM   1912 O OD1 . ASN A 1 272 ? -9.749  51.002 74.124 1.00 32.78 ? 251 ASN X OD1 1 
ATOM   1913 N ND2 . ASN A 1 272 ? -9.511  49.414 72.577 1.00 34.75 ? 251 ASN X ND2 1 
ATOM   1914 N N   . LEU A 1 273 ? -14.805 50.147 71.890 1.00 39.38 ? 252 LEU X N   1 
ATOM   1915 C CA  . LEU A 1 273 ? -16.178 50.712 71.824 1.00 40.67 ? 252 LEU X CA  1 
ATOM   1916 C C   . LEU A 1 273 ? -17.303 49.684 71.998 1.00 41.95 ? 252 LEU X C   1 
ATOM   1917 O O   . LEU A 1 273 ? -18.458 49.945 71.668 1.00 41.68 ? 252 LEU X O   1 
ATOM   1918 C CB  . LEU A 1 273 ? -16.374 51.500 70.544 1.00 39.71 ? 252 LEU X CB  1 
ATOM   1919 C CG  . LEU A 1 273 ? -15.214 52.485 70.435 1.00 39.79 ? 252 LEU X CG  1 
ATOM   1920 C CD1 . LEU A 1 273 ? -14.972 52.829 68.982 1.00 39.85 ? 252 LEU X CD1 1 
ATOM   1921 C CD2 . LEU A 1 273 ? -15.416 53.762 71.269 1.00 37.96 ? 252 LEU X CD2 1 
ATOM   1922 N N   . ASN A 1 274 ? -16.948 48.521 72.531 1.00 44.00 ? 253 ASN X N   1 
ATOM   1923 C CA  . ASN A 1 274 ? -17.914 47.454 72.776 1.00 45.99 ? 253 ASN X CA  1 
ATOM   1924 C C   . ASN A 1 274 ? -18.604 47.067 71.485 1.00 46.11 ? 253 ASN X C   1 
ATOM   1925 O O   . ASN A 1 274 ? -19.806 46.893 71.446 1.00 46.74 ? 253 ASN X O   1 
ATOM   1926 C CB  . ASN A 1 274 ? -18.916 47.891 73.865 1.00 46.27 ? 253 ASN X CB  1 
ATOM   1927 C CG  . ASN A 1 274 ? -18.197 48.475 75.111 1.00 49.96 ? 253 ASN X CG  1 
ATOM   1928 O OD1 . ASN A 1 274 ? -17.479 47.754 75.838 1.00 52.26 ? 253 ASN X OD1 1 
ATOM   1929 N ND2 . ASN A 1 274 ? -18.352 49.796 75.332 1.00 52.27 ? 253 ASN X ND2 1 
ATOM   1930 N N   . CYS A 1 275 ? -17.849 46.944 70.408 1.00 46.19 ? 254 CYS X N   1 
ATOM   1931 C CA  . CYS A 1 275 ? -18.472 46.576 69.169 1.00 46.41 ? 254 CYS X CA  1 
ATOM   1932 C C   . CYS A 1 275 ? -18.644 45.100 69.099 1.00 46.74 ? 254 CYS X C   1 
ATOM   1933 O O   . CYS A 1 275 ? -17.876 44.332 69.688 1.00 46.17 ? 254 CYS X O   1 
ATOM   1934 C CB  . CYS A 1 275 ? -17.615 46.950 67.983 1.00 46.28 ? 254 CYS X CB  1 
ATOM   1935 S SG  . CYS A 1 275 ? -17.503 48.682 67.677 1.00 48.80 ? 254 CYS X SG  1 
ATOM   1936 N N   . ASN A 1 276 ? -19.639 44.705 68.313 1.00 47.47 ? 255 ASN X N   1 
ATOM   1937 C CA  . ASN A 1 276 ? -19.767 43.328 67.879 1.00 47.69 ? 255 ASN X CA  1 
ATOM   1938 C C   . ASN A 1 276 ? -18.544 42.987 67.028 1.00 47.35 ? 255 ASN X C   1 
ATOM   1939 O O   . ASN A 1 276 ? -18.371 43.579 65.959 1.00 46.81 ? 255 ASN X O   1 
ATOM   1940 C CB  . ASN A 1 276 ? -21.044 43.204 67.038 1.00 48.57 ? 255 ASN X CB  1 
ATOM   1941 C CG  . ASN A 1 276 ? -21.425 41.738 66.721 1.00 49.05 ? 255 ASN X CG  1 
ATOM   1942 O OD1 . ASN A 1 276 ? -20.574 40.834 66.562 1.00 47.62 ? 255 ASN X OD1 1 
ATOM   1943 N ND2 . ASN A 1 276 ? -22.720 41.517 66.619 1.00 49.46 ? 255 ASN X ND2 1 
ATOM   1944 N N   . LEU A 1 277 ? -17.700 42.062 67.484 1.00 46.77 ? 256 LEU X N   1 
ATOM   1945 C CA  . LEU A 1 277 ? -16.533 41.694 66.688 1.00 46.82 ? 256 LEU X CA  1 
ATOM   1946 C C   . LEU A 1 277 ? -16.687 40.369 65.974 1.00 46.82 ? 256 LEU X C   1 
ATOM   1947 O O   . LEU A 1 277 ? -15.683 39.696 65.771 1.00 46.46 ? 256 LEU X O   1 
ATOM   1948 C CB  . LEU A 1 277 ? -15.281 41.554 67.554 1.00 46.72 ? 256 LEU X CB  1 
ATOM   1949 C CG  . LEU A 1 277 ? -15.026 42.572 68.663 1.00 47.50 ? 256 LEU X CG  1 
ATOM   1950 C CD1 . LEU A 1 277 ? -13.732 42.271 69.423 1.00 45.70 ? 256 LEU X CD1 1 
ATOM   1951 C CD2 . LEU A 1 277 ? -15.014 43.981 68.087 1.00 47.73 ? 256 LEU X CD2 1 
ATOM   1952 N N   . ASN A 1 278 ? -17.890 39.935 65.606 1.00 46.57 ? 257 ASN X N   1 
ATOM   1953 C CA  . ASN A 1 278 ? -17.925 38.566 65.044 1.00 46.81 ? 257 ASN X CA  1 
ATOM   1954 C C   . ASN A 1 278 ? -17.621 38.472 63.503 1.00 46.44 ? 257 ASN X C   1 
ATOM   1955 O O   . ASN A 1 278 ? -17.334 37.386 62.988 1.00 46.04 ? 257 ASN X O   1 
ATOM   1956 C CB  . ASN A 1 278 ? -19.164 37.754 65.536 1.00 46.75 ? 257 ASN X CB  1 
ATOM   1957 N N   . SER A 1 279 ? -17.642 39.619 62.803 1.00 45.82 ? 258 SER X N   1 
ATOM   1958 C CA  . SER A 1 279 ? -17.336 39.716 61.358 1.00 45.00 ? 258 SER X CA  1 
ATOM   1959 C C   . SER A 1 279 ? -16.842 41.137 60.998 1.00 45.19 ? 258 SER X C   1 
ATOM   1960 O O   . SER A 1 279 ? -17.226 42.116 61.670 1.00 45.16 ? 258 SER X O   1 
ATOM   1961 C CB  . SER A 1 279 ? -18.590 39.451 60.533 1.00 44.53 ? 258 SER X CB  1 
ATOM   1962 O OG  . SER A 1 279 ? -19.498 40.547 60.670 1.00 43.80 ? 258 SER X OG  1 
ATOM   1963 N N   . ASP A 1 280 ? -16.045 41.261 59.923 1.00 44.40 ? 259 ASP X N   1 
ATOM   1964 C CA  . ASP A 1 280 ? -15.668 42.574 59.407 1.00 43.77 ? 259 ASP X CA  1 
ATOM   1965 C C   . ASP A 1 280 ? -16.878 43.466 59.211 1.00 44.08 ? 259 ASP X C   1 
ATOM   1966 O O   . ASP A 1 280 ? -16.855 44.651 59.522 1.00 44.28 ? 259 ASP X O   1 
ATOM   1967 C CB  . ASP A 1 280 ? -14.902 42.477 58.090 1.00 43.46 ? 259 ASP X CB  1 
ATOM   1968 C CG  . ASP A 1 280 ? -13.452 41.960 58.280 1.00 44.71 ? 259 ASP X CG  1 
ATOM   1969 O OD1 . ASP A 1 280 ? -13.122 41.515 59.404 1.00 43.81 ? 259 ASP X OD1 1 
ATOM   1970 O OD2 . ASP A 1 280 ? -12.641 41.988 57.314 1.00 44.12 ? 259 ASP X OD2 1 
ATOM   1971 N N   . GLU A 1 281 ? -17.955 42.912 58.693 1.00 44.26 ? 260 GLU X N   1 
ATOM   1972 C CA  . GLU A 1 281 ? -19.105 43.740 58.374 1.00 44.08 ? 260 GLU X CA  1 
ATOM   1973 C C   . GLU A 1 281 ? -19.750 44.222 59.669 1.00 43.24 ? 260 GLU X C   1 
ATOM   1974 O O   . GLU A 1 281 ? -20.137 45.391 59.809 1.00 42.27 ? 260 GLU X O   1 
ATOM   1975 C CB  . GLU A 1 281 ? -20.049 42.971 57.425 1.00 44.78 ? 260 GLU X CB  1 
ATOM   1976 C CG  . GLU A 1 281 ? -19.246 42.212 56.205 1.00 46.84 ? 260 GLU X CG  1 
ATOM   1977 C CD  . GLU A 1 281 ? -18.323 40.996 56.650 1.00 43.70 ? 260 GLU X CD  1 
ATOM   1978 N N   . GLU A 1 282 ? -19.801 43.343 60.654 1.00 42.91 ? 261 GLU X N   1 
ATOM   1979 C CA  . GLU A 1 282 ? -20.401 43.724 61.928 1.00 43.11 ? 261 GLU X CA  1 
ATOM   1980 C C   . GLU A 1 282 ? -19.602 44.873 62.565 1.00 42.58 ? 261 GLU X C   1 
ATOM   1981 O O   . GLU A 1 282 ? -20.174 45.861 63.101 1.00 42.27 ? 261 GLU X O   1 
ATOM   1982 C CB  . GLU A 1 282 ? -20.456 42.510 62.887 1.00 44.55 ? 261 GLU X CB  1 
ATOM   1983 C CG  . GLU A 1 282 ? -21.512 41.384 62.572 1.00 47.96 ? 261 GLU X CG  1 
ATOM   1984 C CD  . GLU A 1 282 ? -22.880 41.633 63.284 1.00 54.12 ? 261 GLU X CD  1 
ATOM   1985 O OE1 . GLU A 1 282 ? -23.143 42.757 63.815 1.00 53.06 ? 261 GLU X OE1 1 
ATOM   1986 O OE2 . GLU A 1 282 ? -23.701 40.683 63.322 1.00 56.48 ? 261 GLU X OE2 1 
ATOM   1987 N N   . LEU A 1 283 ? -18.268 44.737 62.505 1.00 41.51 ? 262 LEU X N   1 
ATOM   1988 C CA  . LEU A 1 283 ? -17.346 45.668 63.145 1.00 39.85 ? 262 LEU X CA  1 
ATOM   1989 C C   . LEU A 1 283 ? -17.397 47.040 62.494 1.00 39.72 ? 262 LEU X C   1 
ATOM   1990 O O   . LEU A 1 283 ? -17.502 48.060 63.181 1.00 39.95 ? 262 LEU X O   1 
ATOM   1991 C CB  . LEU A 1 283 ? -15.934 45.087 63.111 1.00 39.73 ? 262 LEU X CB  1 
ATOM   1992 C CG  . LEU A 1 283 ? -14.707 45.931 63.504 1.00 38.76 ? 262 LEU X CG  1 
ATOM   1993 C CD1 . LEU A 1 283 ? -14.895 46.790 64.742 1.00 36.50 ? 262 LEU X CD1 1 
ATOM   1994 C CD2 . LEU A 1 283 ? -13.514 45.012 63.683 1.00 39.98 ? 262 LEU X CD2 1 
ATOM   1995 N N   . ILE A 1 284 ? -17.338 47.064 61.167 1.00 39.51 ? 263 ILE X N   1 
ATOM   1996 C CA  . ILE A 1 284 ? -17.393 48.308 60.411 1.00 39.84 ? 263 ILE X CA  1 
ATOM   1997 C C   . ILE A 1 284 ? -18.705 49.015 60.659 1.00 40.89 ? 263 ILE X C   1 
ATOM   1998 O O   . ILE A 1 284 ? -18.735 50.225 60.892 1.00 40.42 ? 263 ILE X O   1 
ATOM   1999 C CB  . ILE A 1 284 ? -17.208 48.070 58.902 1.00 39.74 ? 263 ILE X CB  1 
ATOM   2000 C CG1 . ILE A 1 284 ? -15.765 47.616 58.626 1.00 40.21 ? 263 ILE X CG1 1 
ATOM   2001 C CG2 . ILE A 1 284 ? -17.557 49.312 58.128 1.00 38.12 ? 263 ILE X CG2 1 
ATOM   2002 C CD1 . ILE A 1 284 ? -15.568 46.883 57.351 1.00 39.64 ? 263 ILE X CD1 1 
ATOM   2003 N N   . HIS A 1 285 ? -19.795 48.254 60.628 1.00 42.33 ? 264 HIS X N   1 
ATOM   2004 C CA  . HIS A 1 285 ? -21.091 48.826 60.951 1.00 43.85 ? 264 HIS X CA  1 
ATOM   2005 C C   . HIS A 1 285 ? -21.086 49.582 62.300 1.00 43.60 ? 264 HIS X C   1 
ATOM   2006 O O   . HIS A 1 285 ? -21.530 50.762 62.382 1.00 43.89 ? 264 HIS X O   1 
ATOM   2007 C CB  . HIS A 1 285 ? -22.221 47.770 60.899 1.00 44.96 ? 264 HIS X CB  1 
ATOM   2008 C CG  . HIS A 1 285 ? -23.590 48.373 61.063 1.00 49.23 ? 264 HIS X CG  1 
ATOM   2009 N ND1 . HIS A 1 285 ? -24.228 48.465 62.291 1.00 50.66 ? 264 HIS X ND1 1 
ATOM   2010 C CD2 . HIS A 1 285 ? -24.396 49.005 60.171 1.00 50.95 ? 264 HIS X CD2 1 
ATOM   2011 C CE1 . HIS A 1 285 ? -25.379 49.101 62.141 1.00 51.59 ? 264 HIS X CE1 1 
ATOM   2012 N NE2 . HIS A 1 285 ? -25.506 49.436 60.866 1.00 53.41 ? 264 HIS X NE2 1 
ATOM   2013 N N   . CYS A 1 286 ? -20.596 48.913 63.350 1.00 43.18 ? 265 CYS X N   1 
ATOM   2014 C CA  . CYS A 1 286 ? -20.499 49.537 64.678 1.00 42.98 ? 265 CYS X CA  1 
ATOM   2015 C C   . CYS A 1 286 ? -19.621 50.811 64.610 1.00 42.17 ? 265 CYS X C   1 
ATOM   2016 O O   . CYS A 1 286 ? -20.029 51.867 65.094 1.00 41.72 ? 265 CYS X O   1 
ATOM   2017 C CB  . CYS A 1 286 ? -19.981 48.537 65.725 1.00 43.02 ? 265 CYS X CB  1 
ATOM   2018 S SG  . CYS A 1 286 ? -19.427 49.316 67.300 1.00 48.36 ? 265 CYS X SG  1 
ATOM   2019 N N   . LEU A 1 287 ? -18.435 50.730 63.988 1.00 40.85 ? 266 LEU X N   1 
ATOM   2020 C CA  . LEU A 1 287 ? -17.596 51.939 63.872 1.00 39.88 ? 266 LEU X CA  1 
ATOM   2021 C C   . LEU A 1 287 ? -18.325 53.061 63.127 1.00 39.97 ? 266 LEU X C   1 
ATOM   2022 O O   . LEU A 1 287 ? -18.151 54.247 63.429 1.00 40.01 ? 266 LEU X O   1 
ATOM   2023 C CB  . LEU A 1 287 ? -16.240 51.644 63.216 1.00 38.77 ? 266 LEU X CB  1 
ATOM   2024 C CG  . LEU A 1 287 ? -15.490 50.574 63.993 1.00 36.43 ? 266 LEU X CG  1 
ATOM   2025 C CD1 . LEU A 1 287 ? -14.288 50.077 63.270 1.00 33.41 ? 266 LEU X CD1 1 
ATOM   2026 C CD2 . LEU A 1 287 ? -15.120 51.088 65.358 1.00 34.97 ? 266 LEU X CD2 1 
ATOM   2027 N N   . ARG A 1 288 ? -19.150 52.701 62.153 1.00 39.84 ? 267 ARG X N   1 
ATOM   2028 C CA  . ARG A 1 288 ? -19.804 53.737 61.395 1.00 39.84 ? 267 ARG X CA  1 
ATOM   2029 C C   . ARG A 1 288 ? -20.947 54.390 62.172 1.00 40.30 ? 267 ARG X C   1 
ATOM   2030 O O   . ARG A 1 288 ? -21.316 55.524 61.861 1.00 39.11 ? 267 ARG X O   1 
ATOM   2031 C CB  . ARG A 1 288 ? -20.252 53.225 60.038 1.00 39.73 ? 267 ARG X CB  1 
ATOM   2032 C CG  . ARG A 1 288 ? -19.108 52.948 59.106 1.00 39.70 ? 267 ARG X CG  1 
ATOM   2033 C CD  . ARG A 1 288 ? -19.628 52.591 57.770 1.00 39.98 ? 267 ARG X CD  1 
ATOM   2034 N NE  . ARG A 1 288 ? -18.575 52.379 56.789 1.00 42.07 ? 267 ARG X NE  1 
ATOM   2035 C CZ  . ARG A 1 288 ? -18.756 51.683 55.673 1.00 41.45 ? 267 ARG X CZ  1 
ATOM   2036 N NH1 . ARG A 1 288 ? -19.946 51.159 55.464 1.00 41.68 ? 267 ARG X NH1 1 
ATOM   2037 N NH2 . ARG A 1 288 ? -17.772 51.494 54.784 1.00 40.67 ? 267 ARG X NH2 1 
ATOM   2038 N N   . GLU A 1 289 ? -21.498 53.707 63.190 1.00 40.95 ? 268 GLU X N   1 
ATOM   2039 C CA  . GLU A 1 289 ? -22.555 54.381 64.016 1.00 42.16 ? 268 GLU X CA  1 
ATOM   2040 C C   . GLU A 1 289 ? -22.002 55.336 65.106 1.00 41.59 ? 268 GLU X C   1 
ATOM   2041 O O   . GLU A 1 289 ? -22.747 56.146 65.651 1.00 41.31 ? 268 GLU X O   1 
ATOM   2042 C CB  . GLU A 1 289 ? -23.655 53.409 64.579 1.00 42.24 ? 268 GLU X CB  1 
ATOM   2043 C CG  . GLU A 1 289 ? -24.754 52.910 63.509 1.00 45.72 ? 268 GLU X CG  1 
ATOM   2044 C CD  . GLU A 1 289 ? -25.378 54.060 62.625 1.00 44.69 ? 268 GLU X CD  1 
ATOM   2045 N N   . LYS A 1 290 ? -20.697 55.243 65.387 1.00 40.75 ? 269 LYS X N   1 
ATOM   2046 C CA  . LYS A 1 290 ? -20.065 56.026 66.435 1.00 39.78 ? 269 LYS X CA  1 
ATOM   2047 C C   . LYS A 1 290 ? -19.802 57.491 66.041 1.00 39.25 ? 269 LYS X C   1 
ATOM   2048 O O   . LYS A 1 290 ? -19.459 57.805 64.899 1.00 38.74 ? 269 LYS X O   1 
ATOM   2049 C CB  . LYS A 1 290 ? -18.776 55.335 66.861 1.00 39.86 ? 269 LYS X CB  1 
ATOM   2050 C CG  . LYS A 1 290 ? -18.983 53.927 67.346 1.00 39.91 ? 269 LYS X CG  1 
ATOM   2051 C CD  . LYS A 1 290 ? -19.659 53.847 68.737 1.00 40.83 ? 269 LYS X CD  1 
ATOM   2052 C CE  . LYS A 1 290 ? -19.780 52.374 69.185 1.00 41.25 ? 269 LYS X CE  1 
ATOM   2053 N NZ  . LYS A 1 290 ? -19.565 52.144 70.661 1.00 44.68 ? 269 LYS X NZ  1 
ATOM   2054 N N   . LYS A 1 291 ? -19.986 58.394 66.995 1.00 39.15 ? 270 LYS X N   1 
ATOM   2055 C CA  . LYS A 1 291 ? -19.710 59.806 66.755 1.00 39.23 ? 270 LYS X CA  1 
ATOM   2056 C C   . LYS A 1 291 ? -18.201 59.886 66.487 1.00 38.99 ? 270 LYS X C   1 
ATOM   2057 O O   . LYS A 1 291 ? -17.427 59.083 67.040 1.00 39.77 ? 270 LYS X O   1 
ATOM   2058 C CB  . LYS A 1 291 ? -20.112 60.672 67.971 1.00 39.41 ? 270 LYS X CB  1 
ATOM   2059 C CG  . LYS A 1 291 ? -21.595 61.070 68.061 1.00 39.46 ? 270 LYS X CG  1 
ATOM   2060 N N   . PRO A 1 292 ? -17.773 60.815 65.622 1.00 37.84 ? 271 PRO X N   1 
ATOM   2061 C CA  . PRO A 1 292 ? -16.340 60.971 65.379 1.00 37.20 ? 271 PRO X CA  1 
ATOM   2062 C C   . PRO A 1 292 ? -15.477 60.980 66.656 1.00 36.25 ? 271 PRO X C   1 
ATOM   2063 O O   . PRO A 1 292 ? -14.476 60.267 66.752 1.00 35.19 ? 271 PRO X O   1 
ATOM   2064 C CB  . PRO A 1 292 ? -16.256 62.353 64.685 1.00 37.22 ? 271 PRO X CB  1 
ATOM   2065 C CG  . PRO A 1 292 ? -17.572 62.515 64.006 1.00 36.97 ? 271 PRO X CG  1 
ATOM   2066 C CD  . PRO A 1 292 ? -18.584 61.762 64.832 1.00 37.78 ? 271 PRO X CD  1 
ATOM   2067 N N   . GLN A 1 293 ? -15.846 61.816 67.615 1.00 35.85 ? 272 GLN X N   1 
ATOM   2068 C CA  . GLN A 1 293 ? -15.041 61.956 68.831 1.00 35.87 ? 272 GLN X CA  1 
ATOM   2069 C C   . GLN A 1 293 ? -14.938 60.645 69.671 1.00 35.32 ? 272 GLN X C   1 
ATOM   2070 O O   . GLN A 1 293 ? -14.046 60.478 70.503 1.00 34.82 ? 272 GLN X O   1 
ATOM   2071 C CB  . GLN A 1 293 ? -15.555 63.145 69.642 1.00 35.94 ? 272 GLN X CB  1 
ATOM   2072 C CG  . GLN A 1 293 ? -14.619 63.709 70.715 1.00 38.06 ? 272 GLN X CG  1 
ATOM   2073 C CD  . GLN A 1 293 ? -13.256 64.056 70.173 1.00 39.85 ? 272 GLN X CD  1 
ATOM   2074 O OE1 . GLN A 1 293 ? -13.145 64.696 69.113 1.00 40.97 ? 272 GLN X OE1 1 
ATOM   2075 N NE2 . GLN A 1 293 ? -12.199 63.609 70.883 1.00 35.98 ? 272 GLN X NE2 1 
ATOM   2076 N N   . GLU A 1 294 ? -15.820 59.685 69.429 1.00 34.82 ? 273 GLU X N   1 
ATOM   2077 C CA  . GLU A 1 294 ? -15.689 58.435 70.143 1.00 34.62 ? 273 GLU X CA  1 
ATOM   2078 C C   . GLU A 1 294 ? -14.515 57.676 69.643 1.00 33.94 ? 273 GLU X C   1 
ATOM   2079 O O   . GLU A 1 294 ? -13.827 57.035 70.419 1.00 34.99 ? 273 GLU X O   1 
ATOM   2080 C CB  . GLU A 1 294 ? -16.937 57.609 69.993 1.00 34.80 ? 273 GLU X CB  1 
ATOM   2081 C CG  . GLU A 1 294 ? -18.120 58.431 70.451 1.00 39.98 ? 273 GLU X CG  1 
ATOM   2082 C CD  . GLU A 1 294 ? -19.370 57.619 70.633 1.00 42.33 ? 273 GLU X CD  1 
ATOM   2083 O OE1 . GLU A 1 294 ? -19.356 56.770 71.554 1.00 43.18 ? 273 GLU X OE1 1 
ATOM   2084 O OE2 . GLU A 1 294 ? -20.331 57.842 69.852 1.00 40.82 ? 273 GLU X OE2 1 
ATOM   2085 N N   . LEU A 1 295 ? -14.284 57.727 68.338 1.00 32.58 ? 274 LEU X N   1 
ATOM   2086 C CA  . LEU A 1 295 ? -13.169 57.018 67.766 1.00 31.05 ? 274 LEU X CA  1 
ATOM   2087 C C   . LEU A 1 295 ? -11.895 57.707 68.236 1.00 29.87 ? 274 LEU X C   1 
ATOM   2088 O O   . LEU A 1 295 ? -10.926 57.082 68.615 1.00 28.93 ? 274 LEU X O   1 
ATOM   2089 C CB  . LEU A 1 295 ? -13.291 56.968 66.242 1.00 30.84 ? 274 LEU X CB  1 
ATOM   2090 C CG  . LEU A 1 295 ? -14.232 55.841 65.787 1.00 31.83 ? 274 LEU X CG  1 
ATOM   2091 C CD1 . LEU A 1 295 ? -15.634 56.055 66.328 1.00 34.09 ? 274 LEU X CD1 1 
ATOM   2092 C CD2 . LEU A 1 295 ? -14.326 55.828 64.318 1.00 32.61 ? 274 LEU X CD2 1 
ATOM   2093 N N   . ILE A 1 296 ? -11.923 59.015 68.261 1.00 29.09 ? 275 ILE X N   1 
ATOM   2094 C CA  . ILE A 1 296 ? -10.750 59.721 68.677 1.00 29.18 ? 275 ILE X CA  1 
ATOM   2095 C C   . ILE A 1 296 ? -10.452 59.516 70.175 1.00 29.05 ? 275 ILE X C   1 
ATOM   2096 O O   . ILE A 1 296 ? -9.307  59.340 70.582 1.00 27.89 ? 275 ILE X O   1 
ATOM   2097 C CB  . ILE A 1 296 ? -10.892 61.186 68.340 1.00 29.47 ? 275 ILE X CB  1 
ATOM   2098 C CG1 . ILE A 1 296 ? -10.840 61.332 66.814 1.00 28.45 ? 275 ILE X CG1 1 
ATOM   2099 C CG2 . ILE A 1 296 ? -9.836  62.006 69.060 1.00 28.43 ? 275 ILE X CG2 1 
ATOM   2100 C CD1 . ILE A 1 296 ? -11.459 62.654 66.277 1.00 27.92 ? 275 ILE X CD1 1 
ATOM   2101 N N   . ASP A 1 297 ? -11.477 59.487 71.001 1.00 28.74 ? 276 ASP X N   1 
ATOM   2102 C CA  . ASP A 1 297 ? -11.209 59.288 72.434 1.00 28.61 ? 276 ASP X CA  1 
ATOM   2103 C C   . ASP A 1 297 ? -10.451 58.028 72.791 1.00 28.32 ? 276 ASP X C   1 
ATOM   2104 O O   . ASP A 1 297 ? -9.841  57.997 73.854 1.00 28.34 ? 276 ASP X O   1 
ATOM   2105 C CB  . ASP A 1 297 ? -12.497 59.344 73.252 1.00 28.84 ? 276 ASP X CB  1 
ATOM   2106 C CG  . ASP A 1 297 ? -12.956 60.778 73.503 1.00 31.37 ? 276 ASP X CG  1 
ATOM   2107 O OD1 . ASP A 1 297 ? -12.122 61.740 73.374 1.00 30.10 ? 276 ASP X OD1 1 
ATOM   2108 O OD2 . ASP A 1 297 ? -14.161 60.926 73.788 1.00 31.65 ? 276 ASP X OD2 1 
ATOM   2109 N N   . VAL A 1 298 ? -10.495 56.990 71.948 1.00 27.78 ? 277 VAL X N   1 
ATOM   2110 C CA  . VAL A 1 298 ? -9.806  55.732 72.280 1.00 28.16 ? 277 VAL X CA  1 
ATOM   2111 C C   . VAL A 1 298 ? -8.665  55.295 71.293 1.00 28.52 ? 277 VAL X C   1 
ATOM   2112 O O   . VAL A 1 298 ? -8.062  54.231 71.474 1.00 27.93 ? 277 VAL X O   1 
ATOM   2113 C CB  . VAL A 1 298 ? -10.802 54.526 72.505 1.00 28.51 ? 277 VAL X CB  1 
ATOM   2114 C CG1 . VAL A 1 298 ? -11.807 54.842 73.589 1.00 27.25 ? 277 VAL X CG1 1 
ATOM   2115 C CG2 . VAL A 1 298 ? -11.494 54.107 71.179 1.00 27.25 ? 277 VAL X CG2 1 
ATOM   2116 N N   . GLU A 1 299 ? -8.383  56.129 70.288 1.00 28.46 ? 278 GLU X N   1 
ATOM   2117 C CA  . GLU A 1 299 ? -7.459  55.841 69.195 1.00 28.63 ? 278 GLU X CA  1 
ATOM   2118 C C   . GLU A 1 299 ? -6.089  55.373 69.696 1.00 29.09 ? 278 GLU X C   1 
ATOM   2119 O O   . GLU A 1 299 ? -5.464  54.451 69.163 1.00 28.76 ? 278 GLU X O   1 
ATOM   2120 C CB  . GLU A 1 299 ? -7.296  57.143 68.414 1.00 28.83 ? 278 GLU X CB  1 
ATOM   2121 C CG  . GLU A 1 299 ? -6.252  57.153 67.295 1.00 30.69 ? 278 GLU X CG  1 
ATOM   2122 C CD  . GLU A 1 299 ? -6.094  58.538 66.634 1.00 30.97 ? 278 GLU X CD  1 
ATOM   2123 O OE1 . GLU A 1 299 ? -7.050  59.312 66.641 1.00 32.67 ? 278 GLU X OE1 1 
ATOM   2124 O OE2 . GLU A 1 299 ? -5.013  58.868 66.097 1.00 34.98 ? 278 GLU X OE2 1 
ATOM   2125 N N   . TRP A 1 300 ? -5.622  56.005 70.760 1.00 29.55 ? 279 TRP X N   1 
ATOM   2126 C CA  . TRP A 1 300 ? -4.293  55.712 71.253 1.00 29.14 ? 279 TRP X CA  1 
ATOM   2127 C C   . TRP A 1 300 ? -4.195  54.405 71.991 1.00 29.20 ? 279 TRP X C   1 
ATOM   2128 O O   . TRP A 1 300 ? -3.075  53.935 72.207 1.00 30.35 ? 279 TRP X O   1 
ATOM   2129 C CB  . TRP A 1 300 ? -3.769  56.860 72.127 1.00 28.51 ? 279 TRP X CB  1 
ATOM   2130 C CG  . TRP A 1 300 ? -3.485  58.090 71.329 1.00 29.59 ? 279 TRP X CG  1 
ATOM   2131 C CD1 . TRP A 1 300 ? -4.328  59.167 71.148 1.00 29.78 ? 279 TRP X CD1 1 
ATOM   2132 C CD2 . TRP A 1 300 ? -2.294  58.384 70.571 1.00 29.90 ? 279 TRP X CD2 1 
ATOM   2133 N NE1 . TRP A 1 300 ? -3.715  60.113 70.364 1.00 30.90 ? 279 TRP X NE1 1 
ATOM   2134 C CE2 . TRP A 1 300 ? -2.484  59.654 69.970 1.00 30.05 ? 279 TRP X CE2 1 
ATOM   2135 C CE3 . TRP A 1 300 ? -1.100  57.698 70.333 1.00 30.55 ? 279 TRP X CE3 1 
ATOM   2136 C CZ2 . TRP A 1 300 ? -1.517  60.257 69.153 1.00 29.60 ? 279 TRP X CZ2 1 
ATOM   2137 C CZ3 . TRP A 1 300 ? -0.123  58.303 69.518 1.00 32.82 ? 279 TRP X CZ3 1 
ATOM   2138 C CH2 . TRP A 1 300 ? -0.341  59.574 68.943 1.00 29.94 ? 279 TRP X CH2 1 
ATOM   2139 N N   . ASN A 1 301 ? -5.331  53.821 72.380 1.00 28.75 ? 280 ASN X N   1 
ATOM   2140 C CA  . ASN A 1 301 ? -5.335  52.583 73.159 1.00 28.90 ? 280 ASN X CA  1 
ATOM   2141 C C   . ASN A 1 301 ? -4.912  51.316 72.421 1.00 29.24 ? 280 ASN X C   1 
ATOM   2142 O O   . ASN A 1 301 ? -4.869  50.243 73.019 1.00 29.99 ? 280 ASN X O   1 
ATOM   2143 C CB  . ASN A 1 301 ? -6.715  52.333 73.754 1.00 29.02 ? 280 ASN X CB  1 
ATOM   2144 C CG  . ASN A 1 301 ? -7.157  53.436 74.724 1.00 30.49 ? 280 ASN X CG  1 
ATOM   2145 O OD1 . ASN A 1 301 ? -6.339  54.286 75.155 1.00 31.84 ? 280 ASN X OD1 1 
ATOM   2146 N ND2 . ASN A 1 301 ? -8.459  53.437 75.067 1.00 25.33 ? 280 ASN X ND2 1 
ATOM   2147 N N   . VAL A 1 302 ? -4.593  51.422 71.143 1.00 29.42 ? 281 VAL X N   1 
ATOM   2148 C CA  . VAL A 1 302 ? -4.400  50.240 70.290 1.00 29.95 ? 281 VAL X CA  1 
ATOM   2149 C C   . VAL A 1 302 ? -2.961  50.000 69.878 1.00 30.26 ? 281 VAL X C   1 
ATOM   2150 O O   . VAL A 1 302 ? -2.672  48.980 69.244 1.00 30.34 ? 281 VAL X O   1 
ATOM   2151 C CB  . VAL A 1 302 ? -5.263  50.329 68.960 1.00 30.47 ? 281 VAL X CB  1 
ATOM   2152 C CG1 . VAL A 1 302 ? -6.729  50.495 69.308 1.00 30.91 ? 281 VAL X CG1 1 
ATOM   2153 C CG2 . VAL A 1 302 ? -4.793  51.504 68.003 1.00 28.19 ? 281 VAL X CG2 1 
ATOM   2154 N N   . LEU A 1 303 ? -2.076  50.961 70.164 1.00 29.72 ? 282 LEU X N   1 
ATOM   2155 C CA  . LEU A 1 303 ? -0.650  50.757 69.930 1.00 29.48 ? 282 LEU X CA  1 
ATOM   2156 C C   . LEU A 1 303 ? -0.276  49.420 70.544 1.00 30.06 ? 282 LEU X C   1 
ATOM   2157 O O   . LEU A 1 303 ? -0.743  49.107 71.599 1.00 30.54 ? 282 LEU X O   1 
ATOM   2158 C CB  . LEU A 1 303 ? 0.141   51.871 70.599 1.00 28.46 ? 282 LEU X CB  1 
ATOM   2159 C CG  . LEU A 1 303 ? -0.010  53.121 69.751 1.00 26.84 ? 282 LEU X CG  1 
ATOM   2160 C CD1 . LEU A 1 303 ? 0.726   54.237 70.362 1.00 25.73 ? 282 LEU X CD1 1 
ATOM   2161 C CD2 . LEU A 1 303 ? 0.465   52.853 68.328 1.00 21.94 ? 282 LEU X CD2 1 
ATOM   2162 N N   . PRO A 1 304 ? 0.538   48.594 69.876 1.00 31.19 ? 283 PRO X N   1 
ATOM   2163 C CA  . PRO A 1 304 ? 0.753   47.321 70.603 1.00 31.08 ? 283 PRO X CA  1 
ATOM   2164 C C   . PRO A 1 304 ? 1.817   47.421 71.703 1.00 31.50 ? 283 PRO X C   1 
ATOM   2165 O O   . PRO A 1 304 ? 1.961   46.489 72.475 1.00 31.03 ? 283 PRO X O   1 
ATOM   2166 C CB  . PRO A 1 304 ? 1.278   46.389 69.505 1.00 30.70 ? 283 PRO X CB  1 
ATOM   2167 C CG  . PRO A 1 304 ? 2.061   47.336 68.605 1.00 30.35 ? 283 PRO X CG  1 
ATOM   2168 C CD  . PRO A 1 304 ? 1.205   48.601 68.550 1.00 30.83 ? 283 PRO X CD  1 
ATOM   2169 N N   . PHE A 1 305 ? 2.592   48.512 71.732 1.00 32.50 ? 284 PHE X N   1 
ATOM   2170 C CA  . PHE A 1 305 ? 3.681   48.682 72.713 1.00 32.59 ? 284 PHE X CA  1 
ATOM   2171 C C   . PHE A 1 305 ? 3.576   50.025 73.406 1.00 32.24 ? 284 PHE X C   1 
ATOM   2172 O O   . PHE A 1 305 ? 2.799   50.886 73.031 1.00 32.62 ? 284 PHE X O   1 
ATOM   2173 C CB  . PHE A 1 305 ? 5.077   48.618 72.081 1.00 32.66 ? 284 PHE X CB  1 
ATOM   2174 C CG  . PHE A 1 305 ? 5.327   47.402 71.250 1.00 34.16 ? 284 PHE X CG  1 
ATOM   2175 C CD1 . PHE A 1 305 ? 5.327   46.118 71.847 1.00 36.53 ? 284 PHE X CD1 1 
ATOM   2176 C CD2 . PHE A 1 305 ? 5.605   47.533 69.865 1.00 34.01 ? 284 PHE X CD2 1 
ATOM   2177 C CE1 . PHE A 1 305 ? 5.562   44.949 71.062 1.00 38.87 ? 284 PHE X CE1 1 
ATOM   2178 C CE2 . PHE A 1 305 ? 5.828   46.402 69.052 1.00 35.41 ? 284 PHE X CE2 1 
ATOM   2179 C CZ  . PHE A 1 305 ? 5.801   45.089 69.647 1.00 38.37 ? 284 PHE X CZ  1 
ATOM   2180 N N   . ASP A 1 306 ? 4.393   50.197 74.428 1.00 31.88 ? 285 ASP X N   1 
ATOM   2181 C CA  . ASP A 1 306 ? 4.503   51.462 75.117 1.00 30.83 ? 285 ASP X CA  1 
ATOM   2182 C C   . ASP A 1 306 ? 5.638   52.148 74.357 1.00 30.01 ? 285 ASP X C   1 
ATOM   2183 O O   . ASP A 1 306 ? 6.767   51.644 74.317 1.00 29.97 ? 285 ASP X O   1 
ATOM   2184 C CB  . ASP A 1 306 ? 4.843   51.200 76.576 1.00 29.88 ? 285 ASP X CB  1 
ATOM   2185 C CG  . ASP A 1 306 ? 4.950   52.463 77.396 1.00 32.58 ? 285 ASP X CG  1 
ATOM   2186 O OD1 . ASP A 1 306 ? 4.464   53.539 76.944 1.00 33.56 ? 285 ASP X OD1 1 
ATOM   2187 O OD2 . ASP A 1 306 ? 5.518   52.372 78.519 1.00 34.73 ? 285 ASP X OD2 1 
ATOM   2188 N N   . SER A 1 307 ? 5.362   53.293 73.751 1.00 28.82 ? 286 SER X N   1 
ATOM   2189 C CA  . SER A 1 307 ? 6.266   53.741 72.726 1.00 27.74 ? 286 SER X CA  1 
ATOM   2190 C C   . SER A 1 307 ? 6.129   55.206 72.390 1.00 27.05 ? 286 SER X C   1 
ATOM   2191 O O   . SER A 1 307 ? 5.090   55.769 72.549 1.00 26.13 ? 286 SER X O   1 
ATOM   2192 C CB  . SER A 1 307 ? 5.931   52.966 71.480 1.00 27.53 ? 286 SER X CB  1 
ATOM   2193 O OG  . SER A 1 307 ? 4.692   53.465 70.999 1.00 28.08 ? 286 SER X OG  1 
ATOM   2194 N N   . ILE A 1 308 ? 7.188   55.792 71.842 1.00 27.30 ? 287 ILE X N   1 
ATOM   2195 C CA  . ILE A 1 308 ? 7.203   57.196 71.518 1.00 25.86 ? 287 ILE X CA  1 
ATOM   2196 C C   . ILE A 1 308 ? 7.407   57.205 70.005 1.00 25.40 ? 287 ILE X C   1 
ATOM   2197 O O   . ILE A 1 308 ? 7.922   56.231 69.474 1.00 25.32 ? 287 ILE X O   1 
ATOM   2198 C CB  . ILE A 1 308 ? 8.225   57.878 72.489 1.00 26.44 ? 287 ILE X CB  1 
ATOM   2199 C CG1 . ILE A 1 308 ? 7.581   59.035 73.161 1.00 29.25 ? 287 ILE X CG1 1 
ATOM   2200 C CG2 . ILE A 1 308 ? 9.765   58.021 72.081 1.00 25.07 ? 287 ILE X CG2 1 
ATOM   2201 C CD1 . ILE A 1 308 ? 7.227   58.594 74.543 1.00 35.03 ? 287 ILE X CD1 1 
ATOM   2202 N N   . PHE A 1 309 ? 6.907   58.214 69.294 1.00 25.01 ? 288 PHE X N   1 
ATOM   2203 C CA  . PHE A 1 309 ? 6.957   58.260 67.801 1.00 23.49 ? 288 PHE X CA  1 
ATOM   2204 C C   . PHE A 1 309 ? 6.275   57.026 67.115 1.00 23.64 ? 288 PHE X C   1 
ATOM   2205 O O   . PHE A 1 309 ? 6.818   56.418 66.148 1.00 23.63 ? 288 PHE X O   1 
ATOM   2206 C CB  . PHE A 1 309 ? 8.400   58.427 67.348 1.00 23.18 ? 288 PHE X CB  1 
ATOM   2207 C CG  . PHE A 1 309 ? 8.598   59.374 66.149 1.00 24.56 ? 288 PHE X CG  1 
ATOM   2208 C CD1 . PHE A 1 309 ? 7.776   59.315 65.017 1.00 25.17 ? 288 PHE X CD1 1 
ATOM   2209 C CD2 . PHE A 1 309 ? 9.634   60.319 66.154 1.00 22.14 ? 288 PHE X CD2 1 
ATOM   2210 C CE1 . PHE A 1 309 ? 7.983   60.170 63.929 1.00 23.85 ? 288 PHE X CE1 1 
ATOM   2211 C CE2 . PHE A 1 309 ? 9.826   61.166 65.083 1.00 20.79 ? 288 PHE X CE2 1 
ATOM   2212 C CZ  . PHE A 1 309 ? 8.993   61.084 63.960 1.00 21.41 ? 288 PHE X CZ  1 
ATOM   2213 N N   . ARG A 1 310 ? 5.102   56.624 67.634 1.00 22.69 ? 289 ARG X N   1 
ATOM   2214 C CA  . ARG A 1 310 ? 4.274   55.570 66.993 1.00 21.78 ? 289 ARG X CA  1 
ATOM   2215 C C   . ARG A 1 310 ? 2.819   56.043 67.009 1.00 21.83 ? 289 ARG X C   1 
ATOM   2216 O O   . ARG A 1 310 ? 2.398   56.726 67.976 1.00 19.71 ? 289 ARG X O   1 
ATOM   2217 C CB  . ARG A 1 310 ? 4.410   54.186 67.649 1.00 20.33 ? 289 ARG X CB  1 
ATOM   2218 C CG  . ARG A 1 310 ? 5.810   53.629 67.663 1.00 19.93 ? 289 ARG X CG  1 
ATOM   2219 C CD  . ARG A 1 310 ? 6.320   53.369 66.267 1.00 21.30 ? 289 ARG X CD  1 
ATOM   2220 N NE  . ARG A 1 310 ? 7.583   52.615 66.227 1.00 19.51 ? 289 ARG X NE  1 
ATOM   2221 C CZ  . ARG A 1 310 ? 8.792   53.141 66.024 1.00 19.32 ? 289 ARG X CZ  1 
ATOM   2222 N NH1 . ARG A 1 310 ? 8.925   54.457 65.863 1.00 21.71 ? 289 ARG X NH1 1 
ATOM   2223 N NH2 . ARG A 1 310 ? 9.870   52.348 65.976 1.00 15.08 ? 289 ARG X NH2 1 
ATOM   2224 N N   . PHE A 1 311 ? 2.084   55.698 65.932 1.00 21.86 ? 290 PHE X N   1 
ATOM   2225 C CA  . PHE A 1 311 ? 0.733   56.211 65.705 1.00 22.48 ? 290 PHE X CA  1 
ATOM   2226 C C   . PHE A 1 311 ? -0.160  55.070 65.279 1.00 23.97 ? 290 PHE X C   1 
ATOM   2227 O O   . PHE A 1 311 ? 0.288   54.072 64.685 1.00 25.95 ? 290 PHE X O   1 
ATOM   2228 C CB  . PHE A 1 311 ? 0.729   57.360 64.694 1.00 21.81 ? 290 PHE X CB  1 
ATOM   2229 C CG  . PHE A 1 311 ? 1.902   58.300 64.831 1.00 20.43 ? 290 PHE X CG  1 
ATOM   2230 C CD1 . PHE A 1 311 ? 2.102   59.047 66.008 1.00 20.26 ? 290 PHE X CD1 1 
ATOM   2231 C CD2 . PHE A 1 311 ? 2.833   58.428 63.796 1.00 18.98 ? 290 PHE X CD2 1 
ATOM   2232 C CE1 . PHE A 1 311 ? 3.188   59.924 66.135 1.00 16.82 ? 290 PHE X CE1 1 
ATOM   2233 C CE2 . PHE A 1 311 ? 3.936   59.303 63.894 1.00 15.82 ? 290 PHE X CE2 1 
ATOM   2234 C CZ  . PHE A 1 311 ? 4.129   60.038 65.057 1.00 19.16 ? 290 PHE X CZ  1 
ATOM   2235 N N   . SER A 1 312 ? -1.424  55.165 65.644 1.00 24.85 ? 291 SER X N   1 
ATOM   2236 C CA  . SER A 1 312 ? -2.299  54.019 65.592 1.00 25.33 ? 291 SER X CA  1 
ATOM   2237 C C   . SER A 1 312 ? -2.677  53.604 64.152 1.00 25.98 ? 291 SER X C   1 
ATOM   2238 O O   . SER A 1 312 ? -2.525  52.439 63.770 1.00 25.97 ? 291 SER X O   1 
ATOM   2239 C CB  . SER A 1 312 ? -3.566  54.356 66.366 1.00 25.99 ? 291 SER X CB  1 
ATOM   2240 O OG  . SER A 1 312 ? -3.290  54.569 67.737 1.00 27.60 ? 291 SER X OG  1 
ATOM   2241 N N   . PHE A 1 313 ? -3.184  54.553 63.356 1.00 25.40 ? 292 PHE X N   1 
ATOM   2242 C CA  . PHE A 1 313 ? -3.648  54.216 62.020 1.00 24.40 ? 292 PHE X CA  1 
ATOM   2243 C C   . PHE A 1 313 ? -2.825  54.887 60.957 1.00 24.29 ? 292 PHE X C   1 
ATOM   2244 O O   . PHE A 1 313 ? -2.880  56.128 60.784 1.00 24.78 ? 292 PHE X O   1 
ATOM   2245 C CB  . PHE A 1 313 ? -5.095  54.631 61.901 1.00 24.26 ? 292 PHE X CB  1 
ATOM   2246 C CG  . PHE A 1 313 ? -5.922  54.000 62.933 1.00 25.75 ? 292 PHE X CG  1 
ATOM   2247 C CD1 . PHE A 1 313 ? -6.297  52.663 62.807 1.00 27.35 ? 292 PHE X CD1 1 
ATOM   2248 C CD2 . PHE A 1 313 ? -6.238  54.679 64.087 1.00 26.92 ? 292 PHE X CD2 1 
ATOM   2249 C CE1 . PHE A 1 313 ? -7.029  52.038 63.802 1.00 27.11 ? 292 PHE X CE1 1 
ATOM   2250 C CE2 . PHE A 1 313 ? -6.956  54.072 65.086 1.00 26.15 ? 292 PHE X CE2 1 
ATOM   2251 C CZ  . PHE A 1 313 ? -7.358  52.744 64.951 1.00 27.24 ? 292 PHE X CZ  1 
ATOM   2252 N N   . VAL A 1 314 ? -2.058  54.084 60.241 1.00 23.20 ? 293 VAL X N   1 
ATOM   2253 C CA  . VAL A 1 314 ? -1.122  54.623 59.278 1.00 23.06 ? 293 VAL X CA  1 
ATOM   2254 C C   . VAL A 1 314 ? -1.255  53.693 58.087 1.00 23.65 ? 293 VAL X C   1 
ATOM   2255 O O   . VAL A 1 314 ? -1.912  52.667 58.210 1.00 24.52 ? 293 VAL X O   1 
ATOM   2256 C CB  . VAL A 1 314 ? 0.292   54.564 59.861 1.00 22.88 ? 293 VAL X CB  1 
ATOM   2257 C CG1 . VAL A 1 314 ? 0.454   55.494 61.056 1.00 20.61 ? 293 VAL X CG1 1 
ATOM   2258 C CG2 . VAL A 1 314 ? 0.643   53.113 60.280 1.00 23.43 ? 293 VAL X CG2 1 
ATOM   2259 N N   . PRO A 1 315 ? -0.652  54.031 56.943 1.00 23.65 ? 294 PRO X N   1 
ATOM   2260 C CA  . PRO A 1 315 ? -0.735  53.188 55.768 1.00 24.60 ? 294 PRO X CA  1 
ATOM   2261 C C   . PRO A 1 315 ? -0.423  51.687 56.016 1.00 26.48 ? 294 PRO X C   1 
ATOM   2262 O O   . PRO A 1 315 ? 0.326   51.347 56.964 1.00 27.61 ? 294 PRO X O   1 
ATOM   2263 C CB  . PRO A 1 315 ? 0.326   53.793 54.842 1.00 24.07 ? 294 PRO X CB  1 
ATOM   2264 C CG  . PRO A 1 315 ? 0.303   55.247 55.154 1.00 23.67 ? 294 PRO X CG  1 
ATOM   2265 C CD  . PRO A 1 315 ? -0.065  55.348 56.633 1.00 23.99 ? 294 PRO X CD  1 
ATOM   2266 N N   . VAL A 1 316 ? -0.982  50.806 55.172 1.00 26.74 ? 295 VAL X N   1 
ATOM   2267 C CA  . VAL A 1 316 ? -0.726  49.367 55.254 1.00 27.19 ? 295 VAL X CA  1 
ATOM   2268 C C   . VAL A 1 316 ? -0.138  48.896 53.995 1.00 27.10 ? 295 VAL X C   1 
ATOM   2269 O O   . VAL A 1 316 ? -0.501  49.384 52.918 1.00 27.84 ? 295 VAL X O   1 
ATOM   2270 C CB  . VAL A 1 316 ? -1.989  48.497 55.280 1.00 26.96 ? 295 VAL X CB  1 
ATOM   2271 C CG1 . VAL A 1 316 ? -2.321  48.134 56.649 1.00 29.53 ? 295 VAL X CG1 1 
ATOM   2272 C CG2 . VAL A 1 316 ? -3.167  49.169 54.616 1.00 27.04 ? 295 VAL X CG2 1 
ATOM   2273 N N   . ILE A 1 317 ? 0.717   47.900 54.119 1.00 26.53 ? 296 ILE X N   1 
ATOM   2274 C CA  . ILE A 1 317 ? 1.369   47.328 52.962 1.00 26.58 ? 296 ILE X CA  1 
ATOM   2275 C C   . ILE A 1 317 ? 0.385   46.301 52.408 1.00 28.55 ? 296 ILE X C   1 
ATOM   2276 O O   . ILE A 1 317 ? 0.298   45.178 52.876 1.00 28.14 ? 296 ILE X O   1 
ATOM   2277 C CB  . ILE A 1 317 ? 2.740   46.662 53.377 1.00 26.23 ? 296 ILE X CB  1 
ATOM   2278 C CG1 . ILE A 1 317 ? 3.565   47.658 54.208 1.00 21.57 ? 296 ILE X CG1 1 
ATOM   2279 C CG2 . ILE A 1 317 ? 3.515   46.111 52.140 1.00 21.77 ? 296 ILE X CG2 1 
ATOM   2280 C CD1 . ILE A 1 317 ? 3.791   49.023 53.464 1.00 18.18 ? 296 ILE X CD1 1 
ATOM   2281 N N   . ASP A 1 318 ? -0.395  46.701 51.423 1.00 30.49 ? 297 ASP X N   1 
ATOM   2282 C CA  . ASP A 1 318 ? -1.587  45.925 51.098 1.00 31.92 ? 297 ASP X CA  1 
ATOM   2283 C C   . ASP A 1 318 ? -1.437  45.091 49.845 1.00 32.64 ? 297 ASP X C   1 
ATOM   2284 O O   . ASP A 1 318 ? -2.319  44.336 49.530 1.00 32.90 ? 297 ASP X O   1 
ATOM   2285 C CB  . ASP A 1 318 ? -2.779  46.868 50.902 1.00 31.39 ? 297 ASP X CB  1 
ATOM   2286 C CG  . ASP A 1 318 ? -2.513  47.913 49.816 1.00 33.63 ? 297 ASP X CG  1 
ATOM   2287 O OD1 . ASP A 1 318 ? -1.356  47.944 49.256 1.00 32.88 ? 297 ASP X OD1 1 
ATOM   2288 O OD2 . ASP A 1 318 ? -3.464  48.702 49.525 1.00 32.97 ? 297 ASP X OD2 1 
ATOM   2289 N N   . GLY A 1 319 ? -0.351  45.236 49.103 1.00 33.54 ? 298 GLY X N   1 
ATOM   2290 C CA  . GLY A 1 319 ? -0.298  44.558 47.812 1.00 34.38 ? 298 GLY X CA  1 
ATOM   2291 C C   . GLY A 1 319 ? -1.128  45.256 46.722 1.00 35.73 ? 298 GLY X C   1 
ATOM   2292 O O   . GLY A 1 319 ? -1.228  44.728 45.620 1.00 36.67 ? 298 GLY X O   1 
ATOM   2293 N N   . GLU A 1 320 ? -1.715  46.432 46.992 1.00 35.40 ? 299 GLU X N   1 
ATOM   2294 C CA  . GLU A 1 320 ? -2.518  47.170 45.989 1.00 35.06 ? 299 GLU X CA  1 
ATOM   2295 C C   . GLU A 1 320 ? -1.864  48.533 45.777 1.00 33.26 ? 299 GLU X C   1 
ATOM   2296 O O   . GLU A 1 320 ? -1.097  48.728 44.853 1.00 33.55 ? 299 GLU X O   1 
ATOM   2297 C CB  . GLU A 1 320 ? -3.939  47.352 46.508 1.00 35.96 ? 299 GLU X CB  1 
ATOM   2298 C CG  . GLU A 1 320 ? -5.041  47.600 45.450 1.00 44.00 ? 299 GLU X CG  1 
ATOM   2299 C CD  . GLU A 1 320 ? -5.053  46.529 44.300 1.00 54.70 ? 299 GLU X CD  1 
ATOM   2300 O OE1 . GLU A 1 320 ? -5.405  45.325 44.576 1.00 57.28 ? 299 GLU X OE1 1 
ATOM   2301 O OE2 . GLU A 1 320 ? -4.708  46.902 43.126 1.00 55.02 ? 299 GLU X OE2 1 
ATOM   2302 N N   . PHE A 1 321 ? -2.126  49.472 46.671 1.00 31.57 ? 300 PHE X N   1 
ATOM   2303 C CA  . PHE A 1 321 ? -1.357  50.717 46.712 1.00 29.69 ? 300 PHE X CA  1 
ATOM   2304 C C   . PHE A 1 321 ? 0.161   50.485 46.679 1.00 30.38 ? 300 PHE X C   1 
ATOM   2305 O O   . PHE A 1 321 ? 0.880   51.084 45.863 1.00 29.20 ? 300 PHE X O   1 
ATOM   2306 C CB  . PHE A 1 321 ? -1.730  51.507 47.949 1.00 28.35 ? 300 PHE X CB  1 
ATOM   2307 C CG  . PHE A 1 321 ? -1.441  52.968 47.837 1.00 25.59 ? 300 PHE X CG  1 
ATOM   2308 C CD1 . PHE A 1 321 ? -0.130  53.466 48.074 1.00 24.82 ? 300 PHE X CD1 1 
ATOM   2309 C CD2 . PHE A 1 321 ? -2.460  53.857 47.508 1.00 22.27 ? 300 PHE X CD2 1 
ATOM   2310 C CE1 . PHE A 1 321 ? 0.180   54.822 47.974 1.00 21.13 ? 300 PHE X CE1 1 
ATOM   2311 C CE2 . PHE A 1 321 ? -2.197  55.228 47.417 1.00 23.55 ? 300 PHE X CE2 1 
ATOM   2312 C CZ  . PHE A 1 321 ? -0.858  55.723 47.644 1.00 24.34 ? 300 PHE X CZ  1 
ATOM   2313 N N   . PHE A 1 322 ? 0.646   49.632 47.595 1.00 30.90 ? 301 PHE X N   1 
ATOM   2314 C CA  . PHE A 1 322 ? 2.035   49.132 47.559 1.00 31.11 ? 301 PHE X CA  1 
ATOM   2315 C C   . PHE A 1 322 ? 2.021   47.689 47.031 1.00 31.82 ? 301 PHE X C   1 
ATOM   2316 O O   . PHE A 1 322 ? 1.475   46.814 47.677 1.00 32.97 ? 301 PHE X O   1 
ATOM   2317 C CB  . PHE A 1 322 ? 2.650   49.198 48.962 1.00 30.18 ? 301 PHE X CB  1 
ATOM   2318 C CG  . PHE A 1 322 ? 2.560   50.581 49.611 1.00 29.58 ? 301 PHE X CG  1 
ATOM   2319 C CD1 . PHE A 1 322 ? 3.462   51.600 49.264 1.00 28.48 ? 301 PHE X CD1 1 
ATOM   2320 C CD2 . PHE A 1 322 ? 1.583   50.856 50.579 1.00 27.34 ? 301 PHE X CD2 1 
ATOM   2321 C CE1 . PHE A 1 322 ? 3.389   52.881 49.865 1.00 29.40 ? 301 PHE X CE1 1 
ATOM   2322 C CE2 . PHE A 1 322 ? 1.497   52.111 51.200 1.00 26.11 ? 301 PHE X CE2 1 
ATOM   2323 C CZ  . PHE A 1 322 ? 2.411   53.136 50.845 1.00 29.61 ? 301 PHE X CZ  1 
ATOM   2324 N N   . PRO A 1 323 ? 2.567   47.440 45.828 1.00 32.27 ? 302 PRO X N   1 
ATOM   2325 C CA  . PRO A 1 323 ? 2.410   46.082 45.264 1.00 32.07 ? 302 PRO X CA  1 
ATOM   2326 C C   . PRO A 1 323 ? 3.174   45.020 46.036 1.00 32.36 ? 302 PRO X C   1 
ATOM   2327 O O   . PRO A 1 323 ? 2.704   43.884 46.124 1.00 32.55 ? 302 PRO X O   1 
ATOM   2328 C CB  . PRO A 1 323 ? 3.018   46.202 43.843 1.00 31.84 ? 302 PRO X CB  1 
ATOM   2329 C CG  . PRO A 1 323 ? 3.007   47.659 43.529 1.00 31.64 ? 302 PRO X CG  1 
ATOM   2330 C CD  . PRO A 1 323 ? 3.202   48.368 44.863 1.00 32.29 ? 302 PRO X CD  1 
ATOM   2331 N N   . THR A 1 324 ? 4.364   45.355 46.538 1.00 32.07 ? 303 THR X N   1 
ATOM   2332 C CA  . THR A 1 324 ? 5.086   44.440 47.434 1.00 32.75 ? 303 THR X CA  1 
ATOM   2333 C C   . THR A 1 324 ? 5.666   45.257 48.573 1.00 32.34 ? 303 THR X C   1 
ATOM   2334 O O   . THR A 1 324 ? 5.327   46.429 48.741 1.00 33.14 ? 303 THR X O   1 
ATOM   2335 C CB  . THR A 1 324 ? 6.294   43.766 46.757 1.00 33.17 ? 303 THR X CB  1 
ATOM   2336 O OG1 . THR A 1 324 ? 7.290   44.752 46.503 1.00 34.43 ? 303 THR X OG1 1 
ATOM   2337 C CG2 . THR A 1 324 ? 5.916   43.104 45.429 1.00 33.68 ? 303 THR X CG2 1 
ATOM   2338 N N   . SER A 1 325 ? 6.603   44.676 49.309 1.00 31.31 ? 304 SER X N   1 
ATOM   2339 C CA  . SER A 1 325 ? 7.202   45.382 50.449 1.00 30.52 ? 304 SER X CA  1 
ATOM   2340 C C   . SER A 1 325 ? 8.026   46.617 50.021 1.00 30.13 ? 304 SER X C   1 
ATOM   2341 O O   . SER A 1 325 ? 8.667   46.613 48.961 1.00 30.61 ? 304 SER X O   1 
ATOM   2342 C CB  . SER A 1 325 ? 8.083   44.440 51.276 1.00 29.89 ? 304 SER X CB  1 
ATOM   2343 O OG  . SER A 1 325 ? 9.348   44.314 50.645 1.00 28.97 ? 304 SER X OG  1 
ATOM   2344 N N   . LEU A 1 326 ? 8.030   47.660 50.851 1.00 29.51 ? 305 LEU X N   1 
ATOM   2345 C CA  . LEU A 1 326 ? 8.749   48.865 50.497 1.00 29.27 ? 305 LEU X CA  1 
ATOM   2346 C C   . LEU A 1 326 ? 10.210  48.538 50.179 1.00 30.84 ? 305 LEU X C   1 
ATOM   2347 O O   . LEU A 1 326 ? 10.777  49.054 49.206 1.00 31.89 ? 305 LEU X O   1 
ATOM   2348 C CB  . LEU A 1 326 ? 8.656   49.906 51.588 1.00 27.73 ? 305 LEU X CB  1 
ATOM   2349 C CG  . LEU A 1 326 ? 7.275   50.390 52.029 1.00 26.87 ? 305 LEU X CG  1 
ATOM   2350 C CD1 . LEU A 1 326 ? 7.458   51.454 53.148 1.00 24.07 ? 305 LEU X CD1 1 
ATOM   2351 C CD2 . LEU A 1 326 ? 6.412   50.946 50.873 1.00 22.79 ? 305 LEU X CD2 1 
ATOM   2352 N N   . GLU A 1 327 ? 10.815  47.654 50.965 1.00 31.76 ? 306 GLU X N   1 
ATOM   2353 C CA  . GLU A 1 327 ? 12.241  47.406 50.847 1.00 32.57 ? 306 GLU X CA  1 
ATOM   2354 C C   . GLU A 1 327 ? 12.536  46.717 49.519 1.00 32.17 ? 306 GLU X C   1 
ATOM   2355 O O   . GLU A 1 327 ? 13.528  47.039 48.842 1.00 31.55 ? 306 GLU X O   1 
ATOM   2356 C CB  . GLU A 1 327 ? 12.739  46.579 52.045 1.00 33.43 ? 306 GLU X CB  1 
ATOM   2357 C CG  . GLU A 1 327 ? 14.190  46.137 51.962 1.00 37.61 ? 306 GLU X CG  1 
ATOM   2358 C CD  . GLU A 1 327 ? 15.188  47.324 51.964 1.00 45.17 ? 306 GLU X CD  1 
ATOM   2359 O OE1 . GLU A 1 327 ? 14.795  48.465 52.352 1.00 46.20 ? 306 GLU X OE1 1 
ATOM   2360 O OE2 . GLU A 1 327 ? 16.368  47.106 51.571 1.00 47.38 ? 306 GLU X OE2 1 
ATOM   2361 N N   . SER A 1 328 ? 11.685  45.774 49.121 1.00 31.80 ? 307 SER X N   1 
ATOM   2362 C CA  . SER A 1 328 ? 11.962  45.105 47.827 1.00 32.39 ? 307 SER X CA  1 
ATOM   2363 C C   . SER A 1 328 ? 11.662  46.024 46.666 1.00 32.20 ? 307 SER X C   1 
ATOM   2364 O O   . SER A 1 328 ? 12.320  45.937 45.632 1.00 32.40 ? 307 SER X O   1 
ATOM   2365 C CB  . SER A 1 328 ? 11.230  43.770 47.643 1.00 31.41 ? 307 SER X CB  1 
ATOM   2366 O OG  . SER A 1 328 ? 9.854   43.940 47.843 1.00 33.04 ? 307 SER X OG  1 
ATOM   2367 N N   . MET A 1 329 ? 10.668  46.901 46.835 1.00 32.64 ? 308 MET X N   1 
ATOM   2368 C CA  . MET A 1 329 ? 10.426  47.946 45.846 1.00 32.29 ? 308 MET X CA  1 
ATOM   2369 C C   . MET A 1 329 ? 11.670  48.836 45.711 1.00 31.60 ? 308 MET X C   1 
ATOM   2370 O O   . MET A 1 329 ? 12.154  49.100 44.628 1.00 31.32 ? 308 MET X O   1 
ATOM   2371 C CB  . MET A 1 329 ? 9.183   48.744 46.214 1.00 32.36 ? 308 MET X CB  1 
ATOM   2372 C CG  . MET A 1 329 ? 7.910   47.958 46.038 1.00 32.24 ? 308 MET X CG  1 
ATOM   2373 S SD  . MET A 1 329 ? 6.420   49.010 46.191 1.00 34.70 ? 308 MET X SD  1 
ATOM   2374 C CE  . MET A 1 329 ? 6.504   49.981 44.698 1.00 32.04 ? 308 MET X CE  1 
ATOM   2375 N N   . LEU A 1 330 ? 12.215  49.266 46.826 1.00 31.59 ? 309 LEU X N   1 
ATOM   2376 C CA  . LEU A 1 330 ? 13.396  50.077 46.771 1.00 32.24 ? 309 LEU X CA  1 
ATOM   2377 C C   . LEU A 1 330 ? 14.632  49.381 46.146 1.00 33.31 ? 309 LEU X C   1 
ATOM   2378 O O   . LEU A 1 330 ? 15.370  50.032 45.380 1.00 33.96 ? 309 LEU X O   1 
ATOM   2379 C CB  . LEU A 1 330 ? 13.699  50.649 48.159 1.00 31.88 ? 309 LEU X CB  1 
ATOM   2380 C CG  . LEU A 1 330 ? 12.753  51.775 48.613 1.00 32.87 ? 309 LEU X CG  1 
ATOM   2381 C CD1 . LEU A 1 330 ? 13.053  52.168 50.059 1.00 32.47 ? 309 LEU X CD1 1 
ATOM   2382 C CD2 . LEU A 1 330 ? 12.807  53.027 47.694 1.00 29.18 ? 309 LEU X CD2 1 
ATOM   2383 N N   . ASN A 1 331 ? 14.866  48.096 46.448 1.00 33.61 ? 310 ASN X N   1 
ATOM   2384 C CA  . ASN A 1 331 ? 16.046  47.404 45.932 1.00 34.45 ? 310 ASN X CA  1 
ATOM   2385 C C   . ASN A 1 331 ? 15.979  47.166 44.459 1.00 34.22 ? 310 ASN X C   1 
ATOM   2386 O O   . ASN A 1 331 ? 17.015  47.152 43.798 1.00 34.48 ? 310 ASN X O   1 
ATOM   2387 C CB  . ASN A 1 331 ? 16.295  46.058 46.623 1.00 35.52 ? 310 ASN X CB  1 
ATOM   2388 C CG  . ASN A 1 331 ? 16.990  46.234 47.958 1.00 40.14 ? 310 ASN X CG  1 
ATOM   2389 O OD1 . ASN A 1 331 ? 17.875  47.093 48.083 1.00 45.54 ? 310 ASN X OD1 1 
ATOM   2390 N ND2 . ASN A 1 331 ? 16.574  45.474 48.976 1.00 42.19 ? 310 ASN X ND2 1 
ATOM   2391 N N   . SER A 1 332 ? 14.766  46.965 43.943 1.00 33.51 ? 311 SER X N   1 
ATOM   2392 C CA  . SER A 1 332 ? 14.587  46.572 42.551 1.00 32.48 ? 311 SER X CA  1 
ATOM   2393 C C   . SER A 1 332 ? 14.316  47.739 41.618 1.00 32.25 ? 311 SER X C   1 
ATOM   2394 O O   . SER A 1 332 ? 14.079  47.521 40.437 1.00 31.71 ? 311 SER X O   1 
ATOM   2395 C CB  . SER A 1 332 ? 13.459  45.544 42.411 1.00 32.68 ? 311 SER X CB  1 
ATOM   2396 O OG  . SER A 1 332 ? 12.181  46.137 42.586 1.00 33.48 ? 311 SER X OG  1 
ATOM   2397 N N   . GLY A 1 333 ? 14.324  48.972 42.134 1.00 31.81 ? 312 GLY X N   1 
ATOM   2398 C CA  . GLY A 1 333 ? 14.037  50.142 41.290 1.00 30.88 ? 312 GLY X CA  1 
ATOM   2399 C C   . GLY A 1 333 ? 12.568  50.242 40.886 1.00 30.61 ? 312 GLY X C   1 
ATOM   2400 O O   . GLY A 1 333 ? 12.198  50.902 39.906 1.00 30.55 ? 312 GLY X O   1 
ATOM   2401 N N   . ASN A 1 334 ? 11.698  49.573 41.622 1.00 30.12 ? 313 ASN X N   1 
ATOM   2402 C CA  . ASN A 1 334 ? 10.305  49.679 41.288 1.00 29.62 ? 313 ASN X CA  1 
ATOM   2403 C C   . ASN A 1 334 ? 9.727   50.997 41.827 1.00 29.58 ? 313 ASN X C   1 
ATOM   2404 O O   . ASN A 1 334 ? 9.117   51.050 42.909 1.00 29.59 ? 313 ASN X O   1 
ATOM   2405 C CB  . ASN A 1 334 ? 9.569   48.467 41.833 1.00 30.00 ? 313 ASN X CB  1 
ATOM   2406 C CG  . ASN A 1 334 ? 8.115   48.447 41.419 1.00 30.09 ? 313 ASN X CG  1 
ATOM   2407 O OD1 . ASN A 1 334 ? 7.672   49.334 40.688 1.00 32.96 ? 313 ASN X OD1 1 
ATOM   2408 N ND2 . ASN A 1 334 ? 7.357   47.465 41.907 1.00 24.85 ? 313 ASN X ND2 1 
ATOM   2409 N N   . PHE A 1 335 ? 9.952   52.084 41.100 1.00 29.19 ? 314 PHE X N   1 
ATOM   2410 C CA  . PHE A 1 335 ? 9.433   53.365 41.552 1.00 28.93 ? 314 PHE X CA  1 
ATOM   2411 C C   . PHE A 1 335 ? 9.669   54.484 40.551 1.00 29.47 ? 314 PHE X C   1 
ATOM   2412 O O   . PHE A 1 335 ? 10.502  54.374 39.652 1.00 29.29 ? 314 PHE X O   1 
ATOM   2413 C CB  . PHE A 1 335 ? 10.002  53.741 42.941 1.00 28.51 ? 314 PHE X CB  1 
ATOM   2414 C CG  . PHE A 1 335 ? 11.524  53.780 42.998 1.00 27.04 ? 314 PHE X CG  1 
ATOM   2415 C CD1 . PHE A 1 335 ? 12.241  54.800 42.362 1.00 24.51 ? 314 PHE X CD1 1 
ATOM   2416 C CD2 . PHE A 1 335 ? 12.235  52.793 43.692 1.00 24.16 ? 314 PHE X CD2 1 
ATOM   2417 C CE1 . PHE A 1 335 ? 13.660  54.831 42.432 1.00 24.53 ? 314 PHE X CE1 1 
ATOM   2418 C CE2 . PHE A 1 335 ? 13.645  52.816 43.766 1.00 23.28 ? 314 PHE X CE2 1 
ATOM   2419 C CZ  . PHE A 1 335 ? 14.361  53.823 43.115 1.00 22.18 ? 314 PHE X CZ  1 
ATOM   2420 N N   . LYS A 1 336 ? 8.946   55.592 40.727 1.00 29.92 ? 315 LYS X N   1 
ATOM   2421 C CA  . LYS A 1 336 ? 9.057   56.683 39.766 1.00 29.41 ? 315 LYS X CA  1 
ATOM   2422 C C   . LYS A 1 336 ? 10.496  57.179 39.720 1.00 29.72 ? 315 LYS X C   1 
ATOM   2423 O O   . LYS A 1 336 ? 11.080  57.507 40.763 1.00 29.78 ? 315 LYS X O   1 
ATOM   2424 C CB  . LYS A 1 336 ? 8.096   57.814 40.121 1.00 28.88 ? 315 LYS X CB  1 
ATOM   2425 C CG  . LYS A 1 336 ? 7.888   58.847 39.034 1.00 26.58 ? 315 LYS X CG  1 
ATOM   2426 C CD  . LYS A 1 336 ? 7.286   60.097 39.643 1.00 25.41 ? 315 LYS X CD  1 
ATOM   2427 C CE  . LYS A 1 336 ? 7.204   61.236 38.665 1.00 23.68 ? 315 LYS X CE  1 
ATOM   2428 N NZ  . LYS A 1 336 ? 6.226   60.861 37.664 1.00 21.59 ? 315 LYS X NZ  1 
ATOM   2429 N N   . LYS A 1 337 ? 11.070  57.229 38.520 1.00 29.33 ? 316 LYS X N   1 
ATOM   2430 C CA  . LYS A 1 337 ? 12.404  57.798 38.361 1.00 29.18 ? 316 LYS X CA  1 
ATOM   2431 C C   . LYS A 1 337 ? 12.414  59.286 38.002 1.00 28.54 ? 316 LYS X C   1 
ATOM   2432 O O   . LYS A 1 337 ? 12.088  59.653 36.890 1.00 30.48 ? 316 LYS X O   1 
ATOM   2433 C CB  . LYS A 1 337 ? 13.163  57.040 37.294 1.00 28.92 ? 316 LYS X CB  1 
ATOM   2434 C CG  . LYS A 1 337 ? 13.753  55.743 37.788 1.00 31.65 ? 316 LYS X CG  1 
ATOM   2435 C CD  . LYS A 1 337 ? 12.818  54.614 37.535 1.00 36.27 ? 316 LYS X CD  1 
ATOM   2436 C CE  . LYS A 1 337 ? 13.486  53.333 37.863 1.00 37.76 ? 316 LYS X CE  1 
ATOM   2437 N NZ  . LYS A 1 337 ? 12.823  52.317 37.008 1.00 42.44 ? 316 LYS X NZ  1 
ATOM   2438 N N   . THR A 1 338 ? 12.853  60.146 38.901 1.00 27.21 ? 317 THR X N   1 
ATOM   2439 C CA  . THR A 1 338 ? 12.771  61.570 38.652 1.00 25.66 ? 317 THR X CA  1 
ATOM   2440 C C   . THR A 1 338 ? 13.800  62.316 39.542 1.00 26.52 ? 317 THR X C   1 
ATOM   2441 O O   . THR A 1 338 ? 14.732  61.685 40.031 1.00 26.02 ? 317 THR X O   1 
ATOM   2442 C CB  . THR A 1 338 ? 11.340  62.099 38.881 1.00 25.16 ? 317 THR X CB  1 
ATOM   2443 O OG1 . THR A 1 338 ? 11.339  63.487 38.579 1.00 26.07 ? 317 THR X OG1 1 
ATOM   2444 C CG2 . THR A 1 338 ? 10.887  61.907 40.354 1.00 21.74 ? 317 THR X CG2 1 
ATOM   2445 N N   . GLN A 1 339 ? 13.670  63.638 39.732 1.00 26.62 ? 318 GLN X N   1 
ATOM   2446 C CA  . GLN A 1 339 ? 14.576  64.317 40.669 1.00 27.12 ? 318 GLN X CA  1 
ATOM   2447 C C   . GLN A 1 339 ? 13.875  64.410 42.001 1.00 27.03 ? 318 GLN X C   1 
ATOM   2448 O O   . GLN A 1 339 ? 12.682  64.555 42.021 1.00 28.18 ? 318 GLN X O   1 
ATOM   2449 C CB  . GLN A 1 339 ? 14.946  65.740 40.231 1.00 26.70 ? 318 GLN X CB  1 
ATOM   2450 C CG  . GLN A 1 339 ? 15.620  65.867 38.875 1.00 28.26 ? 318 GLN X CG  1 
ATOM   2451 C CD  . GLN A 1 339 ? 14.597  65.872 37.721 1.00 30.06 ? 318 GLN X CD  1 
ATOM   2452 O OE1 . GLN A 1 339 ? 13.461  66.318 37.890 1.00 32.56 ? 318 GLN X OE1 1 
ATOM   2453 N NE2 . GLN A 1 339 ? 14.995  65.356 36.566 1.00 28.94 ? 318 GLN X NE2 1 
ATOM   2454 N N   . ILE A 1 340 ? 14.611  64.364 43.103 1.00 26.65 ? 319 ILE X N   1 
ATOM   2455 C CA  . ILE A 1 340 ? 14.049  64.633 44.415 1.00 25.78 ? 319 ILE X CA  1 
ATOM   2456 C C   . ILE A 1 340 ? 15.034  65.465 45.223 1.00 26.07 ? 319 ILE X C   1 
ATOM   2457 O O   . ILE A 1 340 ? 16.269  65.356 45.059 1.00 25.89 ? 319 ILE X O   1 
ATOM   2458 C CB  . ILE A 1 340 ? 13.890  63.358 45.227 1.00 26.37 ? 319 ILE X CB  1 
ATOM   2459 C CG1 . ILE A 1 340 ? 15.270  62.678 45.426 1.00 24.86 ? 319 ILE X CG1 1 
ATOM   2460 C CG2 . ILE A 1 340 ? 12.816  62.402 44.618 1.00 25.32 ? 319 ILE X CG2 1 
ATOM   2461 C CD1 . ILE A 1 340 ? 15.200  61.382 46.287 1.00 21.36 ? 319 ILE X CD1 1 
ATOM   2462 N N   . LEU A 1 341 ? 14.472  66.265 46.121 1.00 25.42 ? 320 LEU X N   1 
ATOM   2463 C CA  . LEU A 1 341 ? 15.212  67.076 47.044 1.00 24.82 ? 320 LEU X CA  1 
ATOM   2464 C C   . LEU A 1 341 ? 14.627  66.811 48.438 1.00 25.19 ? 320 LEU X C   1 
ATOM   2465 O O   . LEU A 1 341 ? 13.409  66.791 48.616 1.00 26.79 ? 320 LEU X O   1 
ATOM   2466 C CB  . LEU A 1 341 ? 15.011  68.500 46.644 1.00 24.43 ? 320 LEU X CB  1 
ATOM   2467 C CG  . LEU A 1 341 ? 15.627  69.615 47.475 1.00 25.72 ? 320 LEU X CG  1 
ATOM   2468 C CD1 . LEU A 1 341 ? 15.694  70.904 46.584 1.00 23.71 ? 320 LEU X CD1 1 
ATOM   2469 C CD2 . LEU A 1 341 ? 14.794  69.824 48.730 1.00 22.21 ? 320 LEU X CD2 1 
ATOM   2470 N N   . LEU A 1 342 ? 15.467  66.589 49.436 1.00 24.43 ? 321 LEU X N   1 
ATOM   2471 C CA  . LEU A 1 342 ? 14.951  66.185 50.739 1.00 23.69 ? 321 LEU X CA  1 
ATOM   2472 C C   . LEU A 1 342 ? 16.033  66.384 51.801 1.00 24.45 ? 321 LEU X C   1 
ATOM   2473 O O   . LEU A 1 342 ? 17.228  66.700 51.504 1.00 23.71 ? 321 LEU X O   1 
ATOM   2474 C CB  . LEU A 1 342 ? 14.495  64.722 50.727 1.00 23.32 ? 321 LEU X CB  1 
ATOM   2475 C CG  . LEU A 1 342 ? 15.651  63.701 50.538 1.00 23.24 ? 321 LEU X CG  1 
ATOM   2476 C CD1 . LEU A 1 342 ? 15.219  62.214 50.543 1.00 20.13 ? 321 LEU X CD1 1 
ATOM   2477 C CD2 . LEU A 1 342 ? 16.443  63.996 49.246 1.00 19.57 ? 321 LEU X CD2 1 
ATOM   2478 N N   . GLY A 1 343 ? 15.622  66.216 53.055 1.00 23.97 ? 322 GLY X N   1 
ATOM   2479 C CA  . GLY A 1 343 ? 16.516  66.599 54.127 1.00 23.99 ? 322 GLY X CA  1 
ATOM   2480 C C   . GLY A 1 343 ? 15.893  66.467 55.479 1.00 24.26 ? 322 GLY X C   1 
ATOM   2481 O O   . GLY A 1 343 ? 14.726  66.081 55.573 1.00 23.94 ? 322 GLY X O   1 
ATOM   2482 N N   . VAL A 1 344 ? 16.679  66.784 56.517 1.00 24.63 ? 323 VAL X N   1 
ATOM   2483 C CA  . VAL A 1 344 ? 16.238  66.624 57.917 1.00 25.05 ? 323 VAL X CA  1 
ATOM   2484 C C   . VAL A 1 344 ? 16.690  67.798 58.800 1.00 25.54 ? 323 VAL X C   1 
ATOM   2485 O O   . VAL A 1 344 ? 17.581  68.543 58.429 1.00 25.44 ? 323 VAL X O   1 
ATOM   2486 C CB  . VAL A 1 344 ? 16.855  65.372 58.484 1.00 24.31 ? 323 VAL X CB  1 
ATOM   2487 C CG1 . VAL A 1 344 ? 16.479  64.203 57.617 1.00 24.45 ? 323 VAL X CG1 1 
ATOM   2488 C CG2 . VAL A 1 344 ? 18.329  65.539 58.458 1.00 24.57 ? 323 VAL X CG2 1 
ATOM   2489 N N   . ASN A 1 345 ? 16.086  67.957 59.972 1.00 26.07 ? 324 ASN X N   1 
ATOM   2490 C CA  . ASN A 1 345 ? 16.564  68.980 60.921 1.00 26.82 ? 324 ASN X CA  1 
ATOM   2491 C C   . ASN A 1 345 ? 17.587  68.409 61.919 1.00 27.56 ? 324 ASN X C   1 
ATOM   2492 O O   . ASN A 1 345 ? 17.687  67.188 62.084 1.00 28.76 ? 324 ASN X O   1 
ATOM   2493 C CB  . ASN A 1 345 ? 15.396  69.656 61.648 1.00 26.18 ? 324 ASN X CB  1 
ATOM   2494 C CG  . ASN A 1 345 ? 14.358  70.240 60.685 1.00 26.83 ? 324 ASN X CG  1 
ATOM   2495 O OD1 . ASN A 1 345 ? 14.592  70.320 59.476 1.00 25.53 ? 324 ASN X OD1 1 
ATOM   2496 N ND2 . ASN A 1 345 ? 13.192  70.655 61.231 1.00 28.50 ? 324 ASN X ND2 1 
ATOM   2497 N N   . LYS A 1 346 ? 18.362  69.256 62.582 1.00 27.75 ? 325 LYS X N   1 
ATOM   2498 C CA  . LYS A 1 346 ? 19.387  68.710 63.470 1.00 28.52 ? 325 LYS X CA  1 
ATOM   2499 C C   . LYS A 1 346 ? 18.826  67.966 64.685 1.00 27.73 ? 325 LYS X C   1 
ATOM   2500 O O   . LYS A 1 346 ? 19.391  66.999 65.106 1.00 27.44 ? 325 LYS X O   1 
ATOM   2501 C CB  . LYS A 1 346 ? 20.574  69.695 63.794 1.00 28.38 ? 325 LYS X CB  1 
ATOM   2502 C CG  . LYS A 1 346 ? 21.103  69.760 65.227 1.00 28.45 ? 325 LYS X CG  1 
ATOM   2503 C CD  . LYS A 1 346 ? 22.620  70.008 65.407 1.00 32.40 ? 325 LYS X CD  1 
ATOM   2504 C CE  . LYS A 1 346 ? 23.017  69.999 66.910 1.00 37.03 ? 325 LYS X CE  1 
ATOM   2505 N NZ  . LYS A 1 346 ? 21.999  69.184 67.833 1.00 43.35 ? 325 LYS X NZ  1 
ATOM   2506 N N   . ASP A 1 347 ? 17.673  68.344 65.193 1.00 27.37 ? 326 ASP X N   1 
ATOM   2507 C CA  . ASP A 1 347 ? 17.202  67.648 66.375 1.00 27.32 ? 326 ASP X CA  1 
ATOM   2508 C C   . ASP A 1 347 ? 15.787  67.093 66.251 1.00 27.83 ? 326 ASP X C   1 
ATOM   2509 O O   . ASP A 1 347 ? 14.902  67.531 66.975 1.00 28.61 ? 326 ASP X O   1 
ATOM   2510 C CB  . ASP A 1 347 ? 17.314  68.563 67.602 1.00 27.42 ? 326 ASP X CB  1 
ATOM   2511 C CG  . ASP A 1 347 ? 18.742  69.074 67.815 1.00 26.39 ? 326 ASP X CG  1 
ATOM   2512 O OD1 . ASP A 1 347 ? 19.659  68.269 68.082 1.00 25.60 ? 326 ASP X OD1 1 
ATOM   2513 O OD2 . ASP A 1 347 ? 18.957  70.287 67.671 1.00 24.58 ? 326 ASP X OD2 1 
ATOM   2514 N N   . GLU A 1 348 ? 15.583  66.116 65.355 1.00 27.84 ? 327 GLU X N   1 
ATOM   2515 C CA  . GLU A 1 348 ? 14.241  65.576 65.069 1.00 27.15 ? 327 GLU X CA  1 
ATOM   2516 C C   . GLU A 1 348 ? 13.516  64.936 66.310 1.00 27.48 ? 327 GLU X C   1 
ATOM   2517 O O   . GLU A 1 348 ? 12.270  64.950 66.379 1.00 28.68 ? 327 GLU X O   1 
ATOM   2518 C CB  . GLU A 1 348 ? 14.278  64.584 63.877 1.00 26.77 ? 327 GLU X CB  1 
ATOM   2519 C CG  . GLU A 1 348 ? 14.811  65.113 62.517 1.00 26.79 ? 327 GLU X CG  1 
ATOM   2520 C CD  . GLU A 1 348 ? 13.763  65.898 61.730 1.00 27.64 ? 327 GLU X CD  1 
ATOM   2521 O OE1 . GLU A 1 348 ? 12.686  66.182 62.301 1.00 29.45 ? 327 GLU X OE1 1 
ATOM   2522 O OE2 . GLU A 1 348 ? 14.000  66.264 60.552 1.00 28.65 ? 327 GLU X OE2 1 
ATOM   2523 N N   . GLY A 1 349 ? 14.256  64.401 67.287 1.00 26.35 ? 328 GLY X N   1 
ATOM   2524 C CA  . GLY A 1 349 ? 13.628  63.594 68.326 1.00 25.21 ? 328 GLY X CA  1 
ATOM   2525 C C   . GLY A 1 349 ? 13.022  64.357 69.494 1.00 25.56 ? 328 GLY X C   1 
ATOM   2526 O O   . GLY A 1 349 ? 12.044  63.908 70.106 1.00 25.56 ? 328 GLY X O   1 
ATOM   2527 N N   . SER A 1 350 ? 13.552  65.525 69.830 1.00 25.40 ? 329 SER X N   1 
ATOM   2528 C CA  . SER A 1 350 ? 13.072  66.153 71.048 1.00 25.54 ? 329 SER X CA  1 
ATOM   2529 C C   . SER A 1 350 ? 11.540  66.270 71.306 1.00 26.79 ? 329 SER X C   1 
ATOM   2530 O O   . SER A 1 350 ? 11.110  66.042 72.451 1.00 27.85 ? 329 SER X O   1 
ATOM   2531 C CB  . SER A 1 350 ? 13.774  67.456 71.301 1.00 24.94 ? 329 SER X CB  1 
ATOM   2532 O OG  . SER A 1 350 ? 13.749  68.247 70.162 1.00 24.21 ? 329 SER X OG  1 
ATOM   2533 N N   . PHE A 1 351 ? 10.710  66.619 70.314 1.00 27.25 ? 330 PHE X N   1 
ATOM   2534 C CA  . PHE A 1 351 ? 9.255   66.664 70.561 1.00 27.58 ? 330 PHE X CA  1 
ATOM   2535 C C   . PHE A 1 351 ? 8.742   65.372 71.231 1.00 27.67 ? 330 PHE X C   1 
ATOM   2536 O O   . PHE A 1 351 ? 7.967   65.409 72.197 1.00 28.49 ? 330 PHE X O   1 
ATOM   2537 C CB  . PHE A 1 351 ? 8.451   66.955 69.282 1.00 27.50 ? 330 PHE X CB  1 
ATOM   2538 C CG  . PHE A 1 351 ? 7.973   68.373 69.200 1.00 31.61 ? 330 PHE X CG  1 
ATOM   2539 C CD1 . PHE A 1 351 ? 6.846   68.787 69.924 1.00 33.27 ? 330 PHE X CD1 1 
ATOM   2540 C CD2 . PHE A 1 351 ? 8.656   69.319 68.417 1.00 34.11 ? 330 PHE X CD2 1 
ATOM   2541 C CE1 . PHE A 1 351 ? 6.415   70.118 69.902 1.00 33.08 ? 330 PHE X CE1 1 
ATOM   2542 C CE2 . PHE A 1 351 ? 8.219   70.654 68.378 1.00 35.10 ? 330 PHE X CE2 1 
ATOM   2543 C CZ  . PHE A 1 351 ? 7.098   71.051 69.138 1.00 34.88 ? 330 PHE X CZ  1 
ATOM   2544 N N   . PHE A 1 352 ? 9.177   64.226 70.728 1.00 26.51 ? 331 PHE X N   1 
ATOM   2545 C CA  . PHE A 1 352 ? 8.510   63.023 71.104 1.00 25.73 ? 331 PHE X CA  1 
ATOM   2546 C C   . PHE A 1 352 ? 8.955   62.674 72.466 1.00 26.36 ? 331 PHE X C   1 
ATOM   2547 O O   . PHE A 1 352 ? 8.194   62.054 73.185 1.00 28.36 ? 331 PHE X O   1 
ATOM   2548 C CB  . PHE A 1 352 ? 8.728   61.927 70.066 1.00 24.96 ? 331 PHE X CB  1 
ATOM   2549 C CG  . PHE A 1 352 ? 8.347   62.395 68.717 1.00 23.33 ? 331 PHE X CG  1 
ATOM   2550 C CD1 . PHE A 1 352 ? 9.223   63.244 68.008 1.00 23.33 ? 331 PHE X CD1 1 
ATOM   2551 C CD2 . PHE A 1 352 ? 7.066   62.168 68.227 1.00 18.29 ? 331 PHE X CD2 1 
ATOM   2552 C CE1 . PHE A 1 352 ? 8.861   63.796 66.777 1.00 22.68 ? 331 PHE X CE1 1 
ATOM   2553 C CE2 . PHE A 1 352 ? 6.685   62.689 67.010 1.00 19.33 ? 331 PHE X CE2 1 
ATOM   2554 C CZ  . PHE A 1 352 ? 7.587   63.507 66.257 1.00 21.09 ? 331 PHE X CZ  1 
ATOM   2555 N N   . LEU A 1 353 ? 10.150  63.108 72.859 1.00 25.53 ? 332 LEU X N   1 
ATOM   2556 C CA  . LEU A 1 353 ? 10.635  62.810 74.210 1.00 25.38 ? 332 LEU X CA  1 
ATOM   2557 C C   . LEU A 1 353 ? 9.906   63.726 75.246 1.00 26.50 ? 332 LEU X C   1 
ATOM   2558 O O   . LEU A 1 353 ? 9.491   63.276 76.334 1.00 26.30 ? 332 LEU X O   1 
ATOM   2559 C CB  . LEU A 1 353 ? 12.161  62.979 74.310 1.00 24.47 ? 332 LEU X CB  1 
ATOM   2560 C CG  . LEU A 1 353 ? 13.076  62.005 73.605 1.00 22.17 ? 332 LEU X CG  1 
ATOM   2561 C CD1 . LEU A 1 353 ? 14.448  62.633 73.330 1.00 20.45 ? 332 LEU X CD1 1 
ATOM   2562 C CD2 . LEU A 1 353 ? 13.207  60.738 74.428 1.00 20.08 ? 332 LEU X CD2 1 
ATOM   2563 N N   . LEU A 1 354 ? 9.746   64.996 74.878 1.00 26.52 ? 333 LEU X N   1 
ATOM   2564 C CA  . LEU A 1 354 ? 8.981   65.937 75.662 1.00 27.17 ? 333 LEU X CA  1 
ATOM   2565 C C   . LEU A 1 354 ? 7.571   65.399 75.915 1.00 27.75 ? 333 LEU X C   1 
ATOM   2566 O O   . LEU A 1 354 ? 7.084   65.362 77.057 1.00 27.16 ? 333 LEU X O   1 
ATOM   2567 C CB  . LEU A 1 354 ? 8.902   67.268 74.914 1.00 26.65 ? 333 LEU X CB  1 
ATOM   2568 C CG  . LEU A 1 354 ? 7.996   68.292 75.595 1.00 27.41 ? 333 LEU X CG  1 
ATOM   2569 C CD1 . LEU A 1 354 ? 8.468   68.521 77.044 1.00 25.08 ? 333 LEU X CD1 1 
ATOM   2570 C CD2 . LEU A 1 354 ? 7.928   69.608 74.794 1.00 26.25 ? 333 LEU X CD2 1 
ATOM   2571 N N   . TYR A 1 355 ? 6.902   64.966 74.857 1.00 28.54 ? 334 TYR X N   1 
ATOM   2572 C CA  . TYR A 1 355 ? 5.545   64.505 75.058 1.00 29.27 ? 334 TYR X CA  1 
ATOM   2573 C C   . TYR A 1 355 ? 5.486   63.165 75.788 1.00 30.42 ? 334 TYR X C   1 
ATOM   2574 O O   . TYR A 1 355 ? 4.480   62.860 76.365 1.00 31.40 ? 334 TYR X O   1 
ATOM   2575 C CB  . TYR A 1 355 ? 4.740   64.491 73.759 1.00 28.31 ? 334 TYR X CB  1 
ATOM   2576 C CG  . TYR A 1 355 ? 4.186   65.849 73.402 1.00 27.47 ? 334 TYR X CG  1 
ATOM   2577 C CD1 . TYR A 1 355 ? 5.033   66.919 73.209 1.00 28.78 ? 334 TYR X CD1 1 
ATOM   2578 C CD2 . TYR A 1 355 ? 2.805   66.073 73.283 1.00 25.88 ? 334 TYR X CD2 1 
ATOM   2579 C CE1 . TYR A 1 355 ? 4.533   68.198 72.907 1.00 29.56 ? 334 TYR X CE1 1 
ATOM   2580 C CE2 . TYR A 1 355 ? 2.285   67.349 72.976 1.00 25.25 ? 334 TYR X CE2 1 
ATOM   2581 C CZ  . TYR A 1 355 ? 3.157   68.418 72.789 1.00 26.30 ? 334 TYR X CZ  1 
ATOM   2582 O OH  . TYR A 1 355 ? 2.710   69.699 72.456 1.00 22.40 ? 334 TYR X OH  1 
ATOM   2583 N N   . GLY A 1 356 ? 6.532   62.360 75.847 1.00 31.32 ? 335 GLY X N   1 
ATOM   2584 C CA  . GLY A 1 356 ? 6.267   61.058 76.485 1.00 32.96 ? 335 GLY X CA  1 
ATOM   2585 C C   . GLY A 1 356 ? 7.311   60.364 77.359 1.00 33.94 ? 335 GLY X C   1 
ATOM   2586 O O   . GLY A 1 356 ? 6.992   59.459 78.138 1.00 34.42 ? 335 GLY X O   1 
ATOM   2587 N N   . ALA A 1 357 ? 8.566   60.757 77.242 1.00 33.50 ? 336 ALA X N   1 
ATOM   2588 C CA  . ALA A 1 357 ? 9.566   60.058 78.001 1.00 33.20 ? 336 ALA X CA  1 
ATOM   2589 C C   . ALA A 1 357 ? 9.713   60.693 79.403 1.00 33.49 ? 336 ALA X C   1 
ATOM   2590 O O   . ALA A 1 357 ? 9.750   61.913 79.548 1.00 32.77 ? 336 ALA X O   1 
ATOM   2591 C CB  . ALA A 1 357 ? 10.903  60.053 77.214 1.00 32.15 ? 336 ALA X CB  1 
ATOM   2592 N N   . PRO A 1 358 ? 9.825   59.861 80.442 1.00 34.38 ? 337 PRO X N   1 
ATOM   2593 C CA  . PRO A 1 358 ? 10.000  60.410 81.805 1.00 34.55 ? 337 PRO X CA  1 
ATOM   2594 C C   . PRO A 1 358 ? 11.315  61.183 81.945 1.00 34.47 ? 337 PRO X C   1 
ATOM   2595 O O   . PRO A 1 358 ? 12.357  60.764 81.389 1.00 34.58 ? 337 PRO X O   1 
ATOM   2596 C CB  . PRO A 1 358 ? 10.036  59.160 82.686 1.00 34.81 ? 337 PRO X CB  1 
ATOM   2597 C CG  . PRO A 1 358 ? 10.608  58.060 81.773 1.00 34.92 ? 337 PRO X CG  1 
ATOM   2598 C CD  . PRO A 1 358 ? 10.060  58.397 80.382 1.00 34.99 ? 337 PRO X CD  1 
ATOM   2599 N N   . GLY A 1 359 ? 11.263  62.317 82.652 1.00 33.47 ? 338 GLY X N   1 
ATOM   2600 C CA  . GLY A 1 359 ? 12.465  63.106 82.871 1.00 31.84 ? 338 GLY X CA  1 
ATOM   2601 C C   . GLY A 1 359 ? 12.473  64.420 82.128 1.00 31.66 ? 338 GLY X C   1 
ATOM   2602 O O   . GLY A 1 359 ? 13.207  65.358 82.504 1.00 32.29 ? 338 GLY X O   1 
ATOM   2603 N N   . PHE A 1 360 ? 11.656  64.494 81.075 1.00 30.89 ? 339 PHE X N   1 
ATOM   2604 C CA  . PHE A 1 360 ? 11.653  65.608 80.130 1.00 29.93 ? 339 PHE X CA  1 
ATOM   2605 C C   . PHE A 1 360 ? 10.487  66.498 80.404 1.00 30.82 ? 339 PHE X C   1 
ATOM   2606 O O   . PHE A 1 360 ? 9.378   65.991 80.669 1.00 30.78 ? 339 PHE X O   1 
ATOM   2607 C CB  . PHE A 1 360 ? 11.463  65.112 78.704 1.00 29.10 ? 339 PHE X CB  1 
ATOM   2608 C CG  . PHE A 1 360 ? 12.634  64.401 78.160 1.00 26.54 ? 339 PHE X CG  1 
ATOM   2609 C CD1 . PHE A 1 360 ? 13.626  65.101 77.487 1.00 24.18 ? 339 PHE X CD1 1 
ATOM   2610 C CD2 . PHE A 1 360 ? 12.757  63.009 78.313 1.00 22.37 ? 339 PHE X CD2 1 
ATOM   2611 C CE1 . PHE A 1 360 ? 14.751  64.419 76.958 1.00 23.51 ? 339 PHE X CE1 1 
ATOM   2612 C CE2 . PHE A 1 360 ? 13.864  62.341 77.801 1.00 21.42 ? 339 PHE X CE2 1 
ATOM   2613 C CZ  . PHE A 1 360 ? 14.859  63.032 77.122 1.00 21.12 ? 339 PHE X CZ  1 
ATOM   2614 N N   . SER A 1 361 ? 10.698  67.816 80.300 1.00 30.97 ? 340 SER X N   1 
ATOM   2615 C CA  . SER A 1 361 ? 9.563   68.711 80.403 1.00 31.27 ? 340 SER X CA  1 
ATOM   2616 C C   . SER A 1 361 ? 9.782   70.093 79.795 1.00 31.67 ? 340 SER X C   1 
ATOM   2617 O O   . SER A 1 361 ? 10.902  70.510 79.528 1.00 32.83 ? 340 SER X O   1 
ATOM   2618 C CB  . SER A 1 361 ? 8.994   68.753 81.839 1.00 31.86 ? 340 SER X CB  1 
ATOM   2619 O OG  . SER A 1 361 ? 9.990   68.851 82.839 1.00 31.04 ? 340 SER X OG  1 
ATOM   2620 N N   . LYS A 1 362 ? 8.701   70.803 79.536 1.00 31.18 ? 341 LYS X N   1 
ATOM   2621 C CA  . LYS A 1 362 ? 8.846   71.991 78.762 1.00 30.93 ? 341 LYS X CA  1 
ATOM   2622 C C   . LYS A 1 362 ? 9.680   73.049 79.448 1.00 29.98 ? 341 LYS X C   1 
ATOM   2623 O O   . LYS A 1 362 ? 10.355  73.801 78.765 1.00 29.63 ? 341 LYS X O   1 
ATOM   2624 C CB  . LYS A 1 362 ? 7.492   72.548 78.312 1.00 30.91 ? 341 LYS X CB  1 
ATOM   2625 C CG  . LYS A 1 362 ? 7.608   73.677 77.291 1.00 32.36 ? 341 LYS X CG  1 
ATOM   2626 C CD  . LYS A 1 362 ? 6.209   74.113 76.787 1.00 34.94 ? 341 LYS X CD  1 
ATOM   2627 C CE  . LYS A 1 362 ? 5.441   74.873 77.890 1.00 36.22 ? 341 LYS X CE  1 
ATOM   2628 N NZ  . LYS A 1 362 ? 6.131   76.142 78.318 1.00 37.30 ? 341 LYS X NZ  1 
ATOM   2629 N N   . ASP A 1 363 ? 9.637   73.122 80.777 1.00 29.47 ? 342 ASP X N   1 
ATOM   2630 C CA  . ASP A 1 363 ? 10.225  74.273 81.449 1.00 28.98 ? 342 ASP X CA  1 
ATOM   2631 C C   . ASP A 1 363 ? 11.499  73.974 82.242 1.00 29.67 ? 342 ASP X C   1 
ATOM   2632 O O   . ASP A 1 363 ? 11.902  74.751 83.100 1.00 29.03 ? 342 ASP X O   1 
ATOM   2633 C CB  . ASP A 1 363 ? 9.198   74.911 82.374 1.00 28.65 ? 342 ASP X CB  1 
ATOM   2634 C CG  . ASP A 1 363 ? 7.917   75.365 81.659 1.00 29.36 ? 342 ASP X CG  1 
ATOM   2635 O OD1 . ASP A 1 363 ? 7.872   75.425 80.396 1.00 28.56 ? 342 ASP X OD1 1 
ATOM   2636 O OD2 . ASP A 1 363 ? 6.930   75.682 82.382 1.00 29.24 ? 342 ASP X OD2 1 
ATOM   2637 N N   . SER A 1 364 ? 12.131  72.839 81.997 1.00 30.88 ? 343 SER X N   1 
ATOM   2638 C CA  . SER A 1 364 ? 13.376  72.547 82.691 1.00 31.81 ? 343 SER X CA  1 
ATOM   2639 C C   . SER A 1 364 ? 14.398  72.207 81.654 1.00 32.52 ? 343 SER X C   1 
ATOM   2640 O O   . SER A 1 364 ? 14.032  71.945 80.496 1.00 31.72 ? 343 SER X O   1 
ATOM   2641 C CB  . SER A 1 364 ? 13.228  71.423 83.726 1.00 32.48 ? 343 SER X CB  1 
ATOM   2642 O OG  . SER A 1 364 ? 13.136  70.113 83.158 1.00 33.31 ? 343 SER X OG  1 
ATOM   2643 N N   . GLU A 1 365 ? 15.675  72.279 82.041 1.00 33.54 ? 344 GLU X N   1 
ATOM   2644 C CA  . GLU A 1 365 ? 16.750  71.890 81.129 1.00 35.14 ? 344 GLU X CA  1 
ATOM   2645 C C   . GLU A 1 365 ? 16.614  70.368 80.771 1.00 35.23 ? 344 GLU X C   1 
ATOM   2646 O O   . GLU A 1 365 ? 17.316  69.862 79.895 1.00 35.24 ? 344 GLU X O   1 
ATOM   2647 C CB  . GLU A 1 365 ? 18.136  72.192 81.731 1.00 35.39 ? 344 GLU X CB  1 
ATOM   2648 C CG  . GLU A 1 365 ? 18.648  73.670 81.677 1.00 38.77 ? 344 GLU X CG  1 
ATOM   2649 C CD  . GLU A 1 365 ? 20.087  73.818 82.245 1.00 41.18 ? 344 GLU X CD  1 
ATOM   2650 N N   . SER A 1 366 ? 15.717  69.649 81.455 1.00 35.10 ? 345 SER X N   1 
ATOM   2651 C CA  . SER A 1 366 ? 15.476  68.239 81.178 1.00 35.42 ? 345 SER X CA  1 
ATOM   2652 C C   . SER A 1 366 ? 16.758  67.372 81.196 1.00 35.84 ? 345 SER X C   1 
ATOM   2653 O O   . SER A 1 366 ? 17.051  66.646 80.238 1.00 35.87 ? 345 SER X O   1 
ATOM   2654 C CB  . SER A 1 366 ? 14.752  68.092 79.842 1.00 35.22 ? 345 SER X CB  1 
ATOM   2655 O OG  . SER A 1 366 ? 13.426  68.588 79.927 1.00 36.37 ? 345 SER X OG  1 
ATOM   2656 N N   . LYS A 1 367 ? 17.525  67.453 82.276 1.00 36.17 ? 346 LYS X N   1 
ATOM   2657 C CA  . LYS A 1 367 ? 18.702  66.633 82.390 1.00 37.18 ? 346 LYS X CA  1 
ATOM   2658 C C   . LYS A 1 367 ? 18.254  65.244 82.828 1.00 37.73 ? 346 LYS X C   1 
ATOM   2659 O O   . LYS A 1 367 ? 17.430  65.098 83.688 1.00 38.39 ? 346 LYS X O   1 
ATOM   2660 C CB  . LYS A 1 367 ? 19.663  67.226 83.397 1.00 37.26 ? 346 LYS X CB  1 
ATOM   2661 C CG  . LYS A 1 367 ? 20.394  68.479 82.990 1.00 38.29 ? 346 LYS X CG  1 
ATOM   2662 C CD  . LYS A 1 367 ? 20.959  69.058 84.301 1.00 43.50 ? 346 LYS X CD  1 
ATOM   2663 C CE  . LYS A 1 367 ? 21.929  70.240 84.101 1.00 46.71 ? 346 LYS X CE  1 
ATOM   2664 N NZ  . LYS A 1 367 ? 22.105  71.027 85.393 1.00 46.30 ? 346 LYS X NZ  1 
ATOM   2665 N N   . ILE A 1 368 ? 18.780  64.211 82.227 1.00 38.72 ? 347 ILE X N   1 
ATOM   2666 C CA  . ILE A 1 368 ? 18.148  62.921 82.344 1.00 39.95 ? 347 ILE X CA  1 
ATOM   2667 C C   . ILE A 1 368 ? 19.042  61.960 83.163 1.00 41.22 ? 347 ILE X C   1 
ATOM   2668 O O   . ILE A 1 368 ? 20.244  61.800 82.889 1.00 41.20 ? 347 ILE X O   1 
ATOM   2669 C CB  . ILE A 1 368 ? 17.899  62.371 80.893 1.00 40.26 ? 347 ILE X CB  1 
ATOM   2670 C CG1 . ILE A 1 368 ? 16.867  63.241 80.195 1.00 38.70 ? 347 ILE X CG1 1 
ATOM   2671 C CG2 . ILE A 1 368 ? 17.487  60.914 80.883 1.00 39.77 ? 347 ILE X CG2 1 
ATOM   2672 C CD1 . ILE A 1 368 ? 15.751  63.554 81.068 1.00 37.00 ? 347 ILE X CD1 1 
ATOM   2673 N N   . SER A 1 369 ? 18.465  61.319 84.167 1.00 41.96 ? 348 SER X N   1 
ATOM   2674 C CA  . SER A 1 369 ? 19.232  60.355 84.932 1.00 42.57 ? 348 SER X CA  1 
ATOM   2675 C C   . SER A 1 369 ? 19.471  59.045 84.149 1.00 43.84 ? 348 SER X C   1 
ATOM   2676 O O   . SER A 1 369 ? 18.660  58.651 83.312 1.00 43.50 ? 348 SER X O   1 
ATOM   2677 C CB  . SER A 1 369 ? 18.484  60.064 86.231 1.00 41.95 ? 348 SER X CB  1 
ATOM   2678 O OG  . SER A 1 369 ? 17.318  59.327 85.975 1.00 40.52 ? 348 SER X OG  1 
ATOM   2679 N N   . ARG A 1 370 ? 20.576  58.364 84.432 1.00 45.54 ? 349 ARG X N   1 
ATOM   2680 C CA  . ARG A 1 370 ? 20.779  56.987 83.949 1.00 47.44 ? 349 ARG X CA  1 
ATOM   2681 C C   . ARG A 1 370 ? 19.493  56.136 83.927 1.00 47.93 ? 349 ARG X C   1 
ATOM   2682 O O   . ARG A 1 370 ? 19.268  55.413 82.966 1.00 48.00 ? 349 ARG X O   1 
ATOM   2683 C CB  . ARG A 1 370 ? 21.815  56.254 84.810 1.00 48.22 ? 349 ARG X CB  1 
ATOM   2684 C CG  . ARG A 1 370 ? 22.699  55.298 84.029 1.00 50.12 ? 349 ARG X CG  1 
ATOM   2685 C CD  . ARG A 1 370 ? 23.443  56.068 82.954 1.00 53.11 ? 349 ARG X CD  1 
ATOM   2686 N NE  . ARG A 1 370 ? 23.759  55.198 81.831 1.00 55.11 ? 349 ARG X NE  1 
ATOM   2687 C CZ  . ARG A 1 370 ? 23.823  55.579 80.552 1.00 56.45 ? 349 ARG X CZ  1 
ATOM   2688 N NH1 . ARG A 1 370 ? 23.592  56.835 80.175 1.00 56.69 ? 349 ARG X NH1 1 
ATOM   2689 N NH2 . ARG A 1 370 ? 24.109  54.679 79.629 1.00 57.56 ? 349 ARG X NH2 1 
ATOM   2690 N N   . GLU A 1 371 ? 18.666  56.198 84.978 1.00 48.27 ? 350 GLU X N   1 
ATOM   2691 C CA  . GLU A 1 371 ? 17.453  55.368 85.032 1.00 48.73 ? 350 GLU X CA  1 
ATOM   2692 C C   . GLU A 1 371 ? 16.481  55.835 83.965 1.00 47.99 ? 350 GLU X C   1 
ATOM   2693 O O   . GLU A 1 371 ? 15.991  55.038 83.185 1.00 48.58 ? 350 GLU X O   1 
ATOM   2694 C CB  . GLU A 1 371 ? 16.752  55.390 86.408 1.00 49.58 ? 350 GLU X CB  1 
ATOM   2695 C CG  . GLU A 1 371 ? 17.546  54.784 87.573 1.00 53.31 ? 350 GLU X CG  1 
ATOM   2696 C CD  . GLU A 1 371 ? 18.765  55.649 87.992 1.00 57.85 ? 350 GLU X CD  1 
ATOM   2697 O OE1 . GLU A 1 371 ? 19.921  55.139 87.908 1.00 60.11 ? 350 GLU X OE1 1 
ATOM   2698 O OE2 . GLU A 1 371 ? 18.568  56.834 88.391 1.00 57.74 ? 350 GLU X OE2 1 
ATOM   2699 N N   . ASP A 1 372 ? 16.217  57.137 83.915 1.00 47.15 ? 351 ASP X N   1 
ATOM   2700 C CA  . ASP A 1 372 ? 15.357  57.708 82.866 1.00 45.27 ? 351 ASP X CA  1 
ATOM   2701 C C   . ASP A 1 372 ? 15.893  57.498 81.424 1.00 44.10 ? 351 ASP X C   1 
ATOM   2702 O O   . ASP A 1 372 ? 15.124  57.306 80.492 1.00 43.84 ? 351 ASP X O   1 
ATOM   2703 C CB  . ASP A 1 372 ? 15.075  59.181 83.166 1.00 45.55 ? 351 ASP X CB  1 
ATOM   2704 C CG  . ASP A 1 372 ? 13.967  59.361 84.210 1.00 45.33 ? 351 ASP X CG  1 
ATOM   2705 O OD1 . ASP A 1 372 ? 13.286  58.365 84.534 1.00 46.29 ? 351 ASP X OD1 1 
ATOM   2706 O OD2 . ASP A 1 372 ? 13.765  60.497 84.688 1.00 44.11 ? 351 ASP X OD2 1 
ATOM   2707 N N   . PHE A 1 373 ? 17.203  57.522 81.250 1.00 42.32 ? 352 PHE X N   1 
ATOM   2708 C CA  . PHE A 1 373 ? 17.763  57.201 79.983 1.00 41.29 ? 352 PHE X CA  1 
ATOM   2709 C C   . PHE A 1 373 ? 17.357  55.805 79.602 1.00 42.89 ? 352 PHE X C   1 
ATOM   2710 O O   . PHE A 1 373 ? 16.894  55.542 78.495 1.00 43.18 ? 352 PHE X O   1 
ATOM   2711 C CB  . PHE A 1 373 ? 19.252  57.181 80.088 1.00 40.05 ? 352 PHE X CB  1 
ATOM   2712 C CG  . PHE A 1 373 ? 19.921  57.016 78.790 1.00 36.23 ? 352 PHE X CG  1 
ATOM   2713 C CD1 . PHE A 1 373 ? 20.050  58.092 77.924 1.00 32.31 ? 352 PHE X CD1 1 
ATOM   2714 C CD2 . PHE A 1 373 ? 20.412  55.791 78.406 1.00 34.77 ? 352 PHE X CD2 1 
ATOM   2715 C CE1 . PHE A 1 373 ? 20.672  57.953 76.707 1.00 28.80 ? 352 PHE X CE1 1 
ATOM   2716 C CE2 . PHE A 1 373 ? 21.064  55.642 77.192 1.00 31.30 ? 352 PHE X CE2 1 
ATOM   2717 C CZ  . PHE A 1 373 ? 21.189  56.736 76.342 1.00 29.47 ? 352 PHE X CZ  1 
ATOM   2718 N N   . MET A 1 374 ? 17.560  54.873 80.516 1.00 44.32 ? 353 MET X N   1 
ATOM   2719 C CA  . MET A 1 374 ? 17.287  53.476 80.175 1.00 44.60 ? 353 MET X CA  1 
ATOM   2720 C C   . MET A 1 374 ? 15.845  53.338 79.772 1.00 43.42 ? 353 MET X C   1 
ATOM   2721 O O   . MET A 1 374 ? 15.544  52.636 78.813 1.00 43.53 ? 353 MET X O   1 
ATOM   2722 C CB  . MET A 1 374 ? 17.621  52.519 81.319 1.00 45.54 ? 353 MET X CB  1 
ATOM   2723 C CG  . MET A 1 374 ? 19.111  51.996 81.353 1.00 48.47 ? 353 MET X CG  1 
ATOM   2724 S SD  . MET A 1 374 ? 19.409  51.461 83.081 1.00 53.96 ? 353 MET X SD  1 
ATOM   2725 C CE  . MET A 1 374 ? 17.909  50.521 83.505 1.00 51.12 ? 353 MET X CE  1 
ATOM   2726 N N   . SER A 1 375 ? 14.928  54.004 80.461 1.00 41.82 ? 354 SER X N   1 
ATOM   2727 C CA  . SER A 1 375 ? 13.541  53.848 79.999 1.00 41.01 ? 354 SER X CA  1 
ATOM   2728 C C   . SER A 1 375 ? 13.176  54.612 78.710 1.00 39.43 ? 354 SER X C   1 
ATOM   2729 O O   . SER A 1 375 ? 12.184  54.266 78.059 1.00 39.41 ? 354 SER X O   1 
ATOM   2730 C CB  . SER A 1 375 ? 12.535  54.120 81.099 1.00 40.84 ? 354 SER X CB  1 
ATOM   2731 O OG  . SER A 1 375 ? 13.186  54.777 82.137 1.00 43.76 ? 354 SER X OG  1 
ATOM   2732 N N   . GLY A 1 376 ? 13.973  55.631 78.361 1.00 37.43 ? 355 GLY X N   1 
ATOM   2733 C CA  . GLY A 1 376 ? 13.795  56.391 77.142 1.00 34.45 ? 355 GLY X CA  1 
ATOM   2734 C C   . GLY A 1 376 ? 14.106  55.458 76.006 1.00 33.40 ? 355 GLY X C   1 
ATOM   2735 O O   . GLY A 1 376 ? 13.337  55.350 75.013 1.00 33.01 ? 355 GLY X O   1 
ATOM   2736 N N   . VAL A 1 377 ? 15.193  54.716 76.165 1.00 31.62 ? 356 VAL X N   1 
ATOM   2737 C CA  . VAL A 1 377 ? 15.584  53.858 75.082 1.00 30.39 ? 356 VAL X CA  1 
ATOM   2738 C C   . VAL A 1 377 ? 14.557  52.816 74.806 1.00 30.28 ? 356 VAL X C   1 
ATOM   2739 O O   . VAL A 1 377 ? 14.273  52.525 73.636 1.00 29.90 ? 356 VAL X O   1 
ATOM   2740 C CB  . VAL A 1 377 ? 17.067  53.343 75.107 1.00 29.70 ? 356 VAL X CB  1 
ATOM   2741 C CG1 . VAL A 1 377 ? 17.711  53.632 76.354 1.00 29.82 ? 356 VAL X CG1 1 
ATOM   2742 C CG2 . VAL A 1 377 ? 17.143  51.897 74.779 1.00 28.89 ? 356 VAL X CG2 1 
ATOM   2743 N N   . LYS A 1 378 ? 13.977  52.270 75.862 1.00 30.80 ? 357 LYS X N   1 
ATOM   2744 C CA  . LYS A 1 378 ? 12.975  51.194 75.727 1.00 31.64 ? 357 LYS X CA  1 
ATOM   2745 C C   . LYS A 1 378 ? 11.721  51.769 75.052 1.00 31.07 ? 357 LYS X C   1 
ATOM   2746 O O   . LYS A 1 378 ? 11.095  51.132 74.194 1.00 31.98 ? 357 LYS X O   1 
ATOM   2747 C CB  . LYS A 1 378 ? 12.713  50.576 77.120 1.00 32.30 ? 357 LYS X CB  1 
ATOM   2748 C CG  . LYS A 1 378 ? 11.452  49.742 77.333 1.00 36.58 ? 357 LYS X CG  1 
ATOM   2749 C CD  . LYS A 1 378 ? 11.628  48.201 77.093 1.00 41.43 ? 357 LYS X CD  1 
ATOM   2750 C CE  . LYS A 1 378 ? 10.323  47.388 77.410 1.00 40.47 ? 357 LYS X CE  1 
ATOM   2751 N N   . LEU A 1 379 ? 11.375  53.000 75.384 1.00 29.79 ? 358 LEU X N   1 
ATOM   2752 C CA  . LEU A 1 379 ? 10.261  53.623 74.721 1.00 29.35 ? 358 LEU X CA  1 
ATOM   2753 C C   . LEU A 1 379 ? 10.538  53.970 73.247 1.00 29.90 ? 358 LEU X C   1 
ATOM   2754 O O   . LEU A 1 379 ? 9.590   54.019 72.428 1.00 30.63 ? 358 LEU X O   1 
ATOM   2755 C CB  . LEU A 1 379 ? 9.880   54.877 75.479 1.00 29.17 ? 358 LEU X CB  1 
ATOM   2756 C CG  . LEU A 1 379 ? 8.619   55.082 76.323 1.00 29.13 ? 358 LEU X CG  1 
ATOM   2757 C CD1 . LEU A 1 379 ? 7.824   53.860 76.863 1.00 23.84 ? 358 LEU X CD1 1 
ATOM   2758 C CD2 . LEU A 1 379 ? 9.017   56.004 77.451 1.00 28.53 ? 358 LEU X CD2 1 
ATOM   2759 N N   . SER A 1 380 ? 11.807  54.274 72.905 1.00 29.47 ? 359 SER X N   1 
ATOM   2760 C CA  . SER A 1 380 ? 12.163  54.705 71.534 1.00 27.83 ? 359 SER X CA  1 
ATOM   2761 C C   . SER A 1 380 ? 12.330  53.589 70.567 1.00 28.66 ? 359 SER X C   1 
ATOM   2762 O O   . SER A 1 380 ? 12.186  53.819 69.384 1.00 29.32 ? 359 SER X O   1 
ATOM   2763 C CB  . SER A 1 380 ? 13.442  55.517 71.469 1.00 27.01 ? 359 SER X CB  1 
ATOM   2764 O OG  . SER A 1 380 ? 13.490  56.446 72.498 1.00 23.30 ? 359 SER X OG  1 
ATOM   2765 N N   . VAL A 1 381 ? 12.674  52.399 71.036 1.00 29.37 ? 360 VAL X N   1 
ATOM   2766 C CA  . VAL A 1 381 ? 12.845  51.267 70.138 1.00 30.49 ? 360 VAL X CA  1 
ATOM   2767 C C   . VAL A 1 381 ? 12.009  50.143 70.669 1.00 32.22 ? 360 VAL X C   1 
ATOM   2768 O O   . VAL A 1 381 ? 12.531  49.089 71.040 1.00 33.15 ? 360 VAL X O   1 
ATOM   2769 C CB  . VAL A 1 381 ? 14.292  50.774 70.126 1.00 30.13 ? 360 VAL X CB  1 
ATOM   2770 C CG1 . VAL A 1 381 ? 14.549  49.909 68.911 1.00 29.70 ? 360 VAL X CG1 1 
ATOM   2771 C CG2 . VAL A 1 381 ? 15.225  51.949 70.130 1.00 30.64 ? 360 VAL X CG2 1 
ATOM   2772 N N   . PRO A 1 382 ? 10.693  50.348 70.697 1.00 33.59 ? 361 PRO X N   1 
ATOM   2773 C CA  . PRO A 1 382 ? 9.681   49.493 71.350 1.00 34.16 ? 361 PRO X CA  1 
ATOM   2774 C C   . PRO A 1 382 ? 9.691   48.033 70.917 1.00 35.16 ? 361 PRO X C   1 
ATOM   2775 O O   . PRO A 1 382 ? 9.237   47.171 71.652 1.00 35.16 ? 361 PRO X O   1 
ATOM   2776 C CB  . PRO A 1 382 ? 8.366   50.141 70.933 1.00 34.26 ? 361 PRO X CB  1 
ATOM   2777 C CG  . PRO A 1 382 ? 8.705   50.924 69.704 1.00 34.36 ? 361 PRO X CG  1 
ATOM   2778 C CD  . PRO A 1 382 ? 10.095  51.434 69.909 1.00 33.06 ? 361 PRO X CD  1 
ATOM   2779 N N   . HIS A 1 383 ? 10.178  47.763 69.718 1.00 37.23 ? 362 HIS X N   1 
ATOM   2780 C CA  . HIS A 1 383 ? 10.218  46.394 69.154 1.00 39.53 ? 362 HIS X CA  1 
ATOM   2781 C C   . HIS A 1 383 ? 11.561  45.623 69.456 1.00 39.94 ? 362 HIS X C   1 
ATOM   2782 O O   . HIS A 1 383 ? 11.832  44.566 68.872 1.00 39.99 ? 362 HIS X O   1 
ATOM   2783 C CB  . HIS A 1 383 ? 10.014  46.501 67.627 1.00 39.94 ? 362 HIS X CB  1 
ATOM   2784 C CG  . HIS A 1 383 ? 11.011  47.419 66.962 1.00 43.40 ? 362 HIS X CG  1 
ATOM   2785 N ND1 . HIS A 1 383 ? 10.981  48.792 67.123 1.00 45.04 ? 362 HIS X ND1 1 
ATOM   2786 C CD2 . HIS A 1 383 ? 12.091  47.157 66.180 1.00 43.94 ? 362 HIS X CD2 1 
ATOM   2787 C CE1 . HIS A 1 383 ? 11.984  49.336 66.451 1.00 44.44 ? 362 HIS X CE1 1 
ATOM   2788 N NE2 . HIS A 1 383 ? 12.668  48.370 65.866 1.00 43.37 ? 362 HIS X NE2 1 
ATOM   2789 N N   . ALA A 1 384 ? 12.406  46.163 70.338 1.00 39.61 ? 363 ALA X N   1 
ATOM   2790 C CA  . ALA A 1 384 ? 13.712  45.580 70.550 1.00 39.08 ? 363 ALA X CA  1 
ATOM   2791 C C   . ALA A 1 384 ? 13.713  44.631 71.749 1.00 38.93 ? 363 ALA X C   1 
ATOM   2792 O O   . ALA A 1 384 ? 13.040  44.893 72.767 1.00 39.07 ? 363 ALA X O   1 
ATOM   2793 C CB  . ALA A 1 384 ? 14.733  46.680 70.744 1.00 39.17 ? 363 ALA X CB  1 
ATOM   2794 N N   . ASN A 1 385 ? 14.459  43.527 71.636 1.00 37.69 ? 364 ASN X N   1 
ATOM   2795 C CA  . ASN A 1 385 ? 14.650  42.632 72.772 1.00 35.98 ? 364 ASN X CA  1 
ATOM   2796 C C   . ASN A 1 385 ? 15.739  43.239 73.653 1.00 35.48 ? 364 ASN X C   1 
ATOM   2797 O O   . ASN A 1 385 ? 16.385  44.216 73.240 1.00 35.63 ? 364 ASN X O   1 
ATOM   2798 C CB  . ASN A 1 385 ? 15.059  41.253 72.282 1.00 35.96 ? 364 ASN X CB  1 
ATOM   2799 C CG  . ASN A 1 385 ? 16.326  41.284 71.470 1.00 35.80 ? 364 ASN X CG  1 
ATOM   2800 O OD1 . ASN A 1 385 ? 17.006  42.313 71.393 1.00 40.65 ? 364 ASN X OD1 1 
ATOM   2801 N ND2 . ASN A 1 385 ? 16.660  40.172 70.860 1.00 31.63 ? 364 ASN X ND2 1 
ATOM   2802 N N   . ASP A 1 386 ? 15.953  42.684 74.847 1.00 34.22 ? 365 ASP X N   1 
ATOM   2803 C CA  . ASP A 1 386 ? 16.937  43.250 75.743 1.00 33.68 ? 365 ASP X CA  1 
ATOM   2804 C C   . ASP A 1 386 ? 18.322  43.387 75.044 1.00 33.24 ? 365 ASP X C   1 
ATOM   2805 O O   . ASP A 1 386 ? 19.023  44.409 75.155 1.00 32.93 ? 365 ASP X O   1 
ATOM   2806 C CB  . ASP A 1 386 ? 16.987  42.478 77.081 1.00 34.25 ? 365 ASP X CB  1 
ATOM   2807 C CG  . ASP A 1 386 ? 15.728  42.705 77.950 1.00 34.85 ? 365 ASP X CG  1 
ATOM   2808 N N   . LEU A 1 387 ? 18.720  42.389 74.274 1.00 32.54 ? 366 LEU X N   1 
ATOM   2809 C CA  . LEU A 1 387 ? 19.985  42.526 73.574 1.00 31.79 ? 366 LEU X CA  1 
ATOM   2810 C C   . LEU A 1 387 ? 20.042  43.760 72.644 1.00 31.49 ? 366 LEU X C   1 
ATOM   2811 O O   . LEU A 1 387 ? 21.073  44.435 72.578 1.00 31.35 ? 366 LEU X O   1 
ATOM   2812 C CB  . LEU A 1 387 ? 20.319  41.267 72.805 1.00 31.45 ? 366 LEU X CB  1 
ATOM   2813 C CG  . LEU A 1 387 ? 21.684  41.423 72.151 1.00 32.84 ? 366 LEU X CG  1 
ATOM   2814 C CD1 . LEU A 1 387 ? 22.792  41.322 73.174 1.00 33.37 ? 366 LEU X CD1 1 
ATOM   2815 C CD2 . LEU A 1 387 ? 21.897  40.403 71.042 1.00 33.93 ? 366 LEU X CD2 1 
ATOM   2816 N N   . GLY A 1 388 ? 18.962  44.048 71.913 1.00 30.28 ? 367 GLY X N   1 
ATOM   2817 C CA  . GLY A 1 388 ? 18.920  45.266 71.094 1.00 29.23 ? 367 GLY X CA  1 
ATOM   2818 C C   . GLY A 1 388 ? 18.987  46.569 71.903 1.00 28.63 ? 367 GLY X C   1 
ATOM   2819 O O   . GLY A 1 388 ? 19.761  47.480 71.572 1.00 27.94 ? 367 GLY X O   1 
ATOM   2820 N N   . LEU A 1 389 ? 18.188  46.661 72.970 1.00 27.69 ? 368 LEU X N   1 
ATOM   2821 C CA  . LEU A 1 389 ? 18.342  47.762 73.902 1.00 27.77 ? 368 LEU X CA  1 
ATOM   2822 C C   . LEU A 1 389 ? 19.788  47.938 74.410 1.00 28.77 ? 368 LEU X C   1 
ATOM   2823 O O   . LEU A 1 389 ? 20.282  49.079 74.497 1.00 28.57 ? 368 LEU X O   1 
ATOM   2824 C CB  . LEU A 1 389 ? 17.367  47.644 75.064 1.00 27.11 ? 368 LEU X CB  1 
ATOM   2825 C CG  . LEU A 1 389 ? 15.875  47.536 74.682 1.00 26.56 ? 368 LEU X CG  1 
ATOM   2826 C CD1 . LEU A 1 389 ? 15.103  47.310 75.993 1.00 22.05 ? 368 LEU X CD1 1 
ATOM   2827 C CD2 . LEU A 1 389 ? 15.335  48.775 73.885 1.00 18.30 ? 368 LEU X CD2 1 
ATOM   2828 N N   . ASP A 1 390 ? 20.478  46.834 74.714 1.00 29.14 ? 369 ASP X N   1 
ATOM   2829 C CA  . ASP A 1 390 ? 21.867  46.956 75.119 1.00 30.28 ? 369 ASP X CA  1 
ATOM   2830 C C   . ASP A 1 390 ? 22.699  47.614 74.020 1.00 30.17 ? 369 ASP X C   1 
ATOM   2831 O O   . ASP A 1 390 ? 23.576  48.479 74.309 1.00 30.04 ? 369 ASP X O   1 
ATOM   2832 C CB  . ASP A 1 390 ? 22.485  45.614 75.481 1.00 31.19 ? 369 ASP X CB  1 
ATOM   2833 C CG  . ASP A 1 390 ? 22.122  45.137 76.892 1.00 34.32 ? 369 ASP X CG  1 
ATOM   2834 O OD1 . ASP A 1 390 ? 21.435  45.873 77.634 1.00 35.55 ? 369 ASP X OD1 1 
ATOM   2835 O OD2 . ASP A 1 390 ? 22.525  43.988 77.243 1.00 38.96 ? 369 ASP X OD2 1 
ATOM   2836 N N   . ALA A 1 391 ? 22.427  47.232 72.773 1.00 29.56 ? 370 ALA X N   1 
ATOM   2837 C CA  . ALA A 1 391 ? 23.240  47.742 71.678 1.00 29.92 ? 370 ALA X CA  1 
ATOM   2838 C C   . ALA A 1 391 ? 22.921  49.209 71.409 1.00 30.25 ? 370 ALA X C   1 
ATOM   2839 O O   . ALA A 1 391 ? 23.841  50.002 71.244 1.00 31.19 ? 370 ALA X O   1 
ATOM   2840 C CB  . ALA A 1 391 ? 23.114  46.923 70.440 1.00 28.98 ? 370 ALA X CB  1 
ATOM   2841 N N   . VAL A 1 392 ? 21.653  49.601 71.409 1.00 29.79 ? 371 VAL X N   1 
ATOM   2842 C CA  . VAL A 1 392 ? 21.371  51.020 71.248 1.00 28.83 ? 371 VAL X CA  1 
ATOM   2843 C C   . VAL A 1 392 ? 22.128  51.783 72.328 1.00 29.45 ? 371 VAL X C   1 
ATOM   2844 O O   . VAL A 1 392 ? 22.844  52.763 72.043 1.00 29.68 ? 371 VAL X O   1 
ATOM   2845 C CB  . VAL A 1 392 ? 19.865  51.359 71.340 1.00 29.34 ? 371 VAL X CB  1 
ATOM   2846 C CG1 . VAL A 1 392 ? 19.651  52.875 71.487 1.00 25.48 ? 371 VAL X CG1 1 
ATOM   2847 C CG2 . VAL A 1 392 ? 19.069  50.760 70.137 1.00 27.63 ? 371 VAL X CG2 1 
ATOM   2848 N N   . THR A 1 393 ? 22.002  51.327 73.569 1.00 29.64 ? 372 THR X N   1 
ATOM   2849 C CA  . THR A 1 393 ? 22.652  52.001 74.701 1.00 29.86 ? 372 THR X CA  1 
ATOM   2850 C C   . THR A 1 393 ? 24.160  52.114 74.602 1.00 30.37 ? 372 THR X C   1 
ATOM   2851 O O   . THR A 1 393 ? 24.750  53.166 74.846 1.00 30.42 ? 372 THR X O   1 
ATOM   2852 C CB  . THR A 1 393 ? 22.357  51.255 75.981 1.00 30.11 ? 372 THR X CB  1 
ATOM   2853 O OG1 . THR A 1 393 ? 20.930  51.177 76.129 1.00 31.79 ? 372 THR X OG1 1 
ATOM   2854 C CG2 . THR A 1 393 ? 22.962  51.984 77.176 1.00 28.19 ? 372 THR X CG2 1 
ATOM   2855 N N   . LEU A 1 394 ? 24.804  51.013 74.258 1.00 30.90 ? 373 LEU X N   1 
ATOM   2856 C CA  . LEU A 1 394 ? 26.239  51.045 74.117 1.00 31.13 ? 373 LEU X CA  1 
ATOM   2857 C C   . LEU A 1 394 ? 26.608  52.067 73.069 1.00 31.55 ? 373 LEU X C   1 
ATOM   2858 O O   . LEU A 1 394 ? 27.616  52.772 73.195 1.00 32.57 ? 373 LEU X O   1 
ATOM   2859 C CB  . LEU A 1 394 ? 26.748  49.660 73.722 1.00 31.39 ? 373 LEU X CB  1 
ATOM   2860 C CG  . LEU A 1 394 ? 28.165  49.587 73.178 1.00 32.62 ? 373 LEU X CG  1 
ATOM   2861 C CD1 . LEU A 1 394 ? 29.090  49.565 74.348 1.00 33.52 ? 373 LEU X CD1 1 
ATOM   2862 C CD2 . LEU A 1 394 ? 28.379  48.364 72.277 1.00 33.90 ? 373 LEU X CD2 1 
ATOM   2863 N N   . GLN A 1 395 ? 25.787  52.156 72.022 1.00 31.64 ? 374 GLN X N   1 
ATOM   2864 C CA  . GLN A 1 395 ? 26.092  53.011 70.875 1.00 31.27 ? 374 GLN X CA  1 
ATOM   2865 C C   . GLN A 1 395 ? 25.962  54.501 71.148 1.00 31.04 ? 374 GLN X C   1 
ATOM   2866 O O   . GLN A 1 395 ? 26.482  55.315 70.399 1.00 30.99 ? 374 GLN X O   1 
ATOM   2867 C CB  . GLN A 1 395 ? 25.198  52.651 69.689 1.00 31.27 ? 374 GLN X CB  1 
ATOM   2868 C CG  . GLN A 1 395 ? 25.744  53.175 68.403 1.00 32.52 ? 374 GLN X CG  1 
ATOM   2869 C CD  . GLN A 1 395 ? 26.967  52.362 67.927 1.00 36.22 ? 374 GLN X CD  1 
ATOM   2870 O OE1 . GLN A 1 395 ? 27.676  52.771 66.960 1.00 36.52 ? 374 GLN X OE1 1 
ATOM   2871 N NE2 . GLN A 1 395 ? 27.224  51.206 68.594 1.00 31.52 ? 374 GLN X NE2 1 
ATOM   2872 N N   . TYR A 1 396 ? 25.235  54.867 72.185 1.00 30.49 ? 375 TYR X N   1 
ATOM   2873 C CA  . TYR A 1 396 ? 24.873  56.258 72.335 1.00 31.60 ? 375 TYR X CA  1 
ATOM   2874 C C   . TYR A 1 396 ? 25.386  56.855 73.648 1.00 33.24 ? 375 TYR X C   1 
ATOM   2875 O O   . TYR A 1 396 ? 25.220  58.049 73.898 1.00 33.90 ? 375 TYR X O   1 
ATOM   2876 C CB  . TYR A 1 396 ? 23.340  56.422 72.173 1.00 30.49 ? 375 TYR X CB  1 
ATOM   2877 C CG  . TYR A 1 396 ? 22.957  56.543 70.704 1.00 28.62 ? 375 TYR X CG  1 
ATOM   2878 C CD1 . TYR A 1 396 ? 22.936  57.795 70.073 1.00 23.34 ? 375 TYR X CD1 1 
ATOM   2879 C CD2 . TYR A 1 396 ? 22.693  55.389 69.919 1.00 25.72 ? 375 TYR X CD2 1 
ATOM   2880 C CE1 . TYR A 1 396 ? 22.620  57.926 68.740 1.00 20.48 ? 375 TYR X CE1 1 
ATOM   2881 C CE2 . TYR A 1 396 ? 22.393  55.499 68.587 1.00 24.08 ? 375 TYR X CE2 1 
ATOM   2882 C CZ  . TYR A 1 396 ? 22.348  56.791 67.993 1.00 23.58 ? 375 TYR X CZ  1 
ATOM   2883 O OH  . TYR A 1 396 ? 22.015  56.924 66.655 1.00 22.16 ? 375 TYR X OH  1 
ATOM   2884 N N   . THR A 1 397 ? 26.041  56.016 74.453 1.00 34.56 ? 376 THR X N   1 
ATOM   2885 C CA  . THR A 1 397 ? 26.578  56.374 75.758 1.00 35.52 ? 376 THR X CA  1 
ATOM   2886 C C   . THR A 1 397 ? 28.047  56.701 75.766 1.00 36.38 ? 376 THR X C   1 
ATOM   2887 O O   . THR A 1 397 ? 28.843  55.875 75.445 1.00 36.03 ? 376 THR X O   1 
ATOM   2888 C CB  . THR A 1 397 ? 26.469  55.171 76.670 1.00 35.53 ? 376 THR X CB  1 
ATOM   2889 O OG1 . THR A 1 397 ? 25.081  54.889 76.911 1.00 36.77 ? 376 THR X OG1 1 
ATOM   2890 C CG2 . THR A 1 397 ? 27.147  55.432 77.961 1.00 34.15 ? 376 THR X CG2 1 
ATOM   2891 N N   . ASP A 1 398 ? 28.416  57.901 76.177 1.00 38.74 ? 377 ASP X N   1 
ATOM   2892 C CA  . ASP A 1 398 ? 29.816  58.178 76.474 1.00 40.63 ? 377 ASP X CA  1 
ATOM   2893 C C   . ASP A 1 398 ? 30.172  57.473 77.778 1.00 41.92 ? 377 ASP X C   1 
ATOM   2894 O O   . ASP A 1 398 ? 29.854  57.996 78.848 1.00 41.19 ? 377 ASP X O   1 
ATOM   2895 C CB  . ASP A 1 398 ? 30.012  59.669 76.686 1.00 40.54 ? 377 ASP X CB  1 
ATOM   2896 C CG  . ASP A 1 398 ? 31.457  60.030 76.963 1.00 43.13 ? 377 ASP X CG  1 
ATOM   2897 O OD1 . ASP A 1 398 ? 32.296  59.107 77.133 1.00 46.22 ? 377 ASP X OD1 1 
ATOM   2898 O OD2 . ASP A 1 398 ? 31.761  61.242 77.020 1.00 45.21 ? 377 ASP X OD2 1 
ATOM   2899 N N   . TRP A 1 399 ? 30.819  56.305 77.717 1.00 43.50 ? 378 TRP X N   1 
ATOM   2900 C CA  . TRP A 1 399 ? 31.161  55.607 78.961 1.00 45.17 ? 378 TRP X CA  1 
ATOM   2901 C C   . TRP A 1 399 ? 32.225  56.293 79.787 1.00 46.54 ? 378 TRP X C   1 
ATOM   2902 O O   . TRP A 1 399 ? 32.517  55.867 80.900 1.00 47.45 ? 378 TRP X O   1 
ATOM   2903 C CB  . TRP A 1 399 ? 31.536  54.144 78.744 1.00 44.94 ? 378 TRP X CB  1 
ATOM   2904 C CG  . TRP A 1 399 ? 30.325  53.366 78.458 1.00 46.11 ? 378 TRP X CG  1 
ATOM   2905 C CD1 . TRP A 1 399 ? 29.943  52.851 77.247 1.00 46.63 ? 378 TRP X CD1 1 
ATOM   2906 C CD2 . TRP A 1 399 ? 29.276  53.074 79.373 1.00 46.53 ? 378 TRP X CD2 1 
ATOM   2907 N NE1 . TRP A 1 399 ? 28.724  52.255 77.363 1.00 48.05 ? 378 TRP X NE1 1 
ATOM   2908 C CE2 . TRP A 1 399 ? 28.286  52.374 78.656 1.00 46.76 ? 378 TRP X CE2 1 
ATOM   2909 C CE3 . TRP A 1 399 ? 29.065  53.355 80.737 1.00 50.81 ? 378 TRP X CE3 1 
ATOM   2910 C CZ2 . TRP A 1 399 ? 27.093  51.920 79.250 1.00 49.45 ? 378 TRP X CZ2 1 
ATOM   2911 C CZ3 . TRP A 1 399 ? 27.865  52.902 81.348 1.00 51.72 ? 378 TRP X CZ3 1 
ATOM   2912 C CH2 . TRP A 1 399 ? 26.891  52.198 80.590 1.00 50.07 ? 378 TRP X CH2 1 
ATOM   2913 N N   . MET A 1 400 ? 32.829  57.358 79.302 1.00 47.40 ? 379 MET X N   1 
ATOM   2914 C CA  . MET A 1 400 ? 33.774  57.952 80.222 1.00 49.11 ? 379 MET X CA  1 
ATOM   2915 C C   . MET A 1 400 ? 33.151  59.165 80.873 1.00 49.58 ? 379 MET X C   1 
ATOM   2916 O O   . MET A 1 400 ? 33.838  60.150 81.161 1.00 50.60 ? 379 MET X O   1 
ATOM   2917 C CB  . MET A 1 400 ? 35.151  58.199 79.573 1.00 49.53 ? 379 MET X CB  1 
ATOM   2918 C CG  . MET A 1 400 ? 35.362  59.472 78.824 1.00 52.73 ? 379 MET X CG  1 
ATOM   2919 S SD  . MET A 1 400 ? 36.823  59.307 77.738 1.00 60.46 ? 379 MET X SD  1 
ATOM   2920 C CE  . MET A 1 400 ? 37.822  58.031 78.581 1.00 57.55 ? 379 MET X CE  1 
ATOM   2921 N N   . ASP A 1 401 ? 31.831  59.090 81.075 1.00 49.32 ? 380 ASP X N   1 
ATOM   2922 C CA  . ASP A 1 401 ? 31.036  60.221 81.549 1.00 48.77 ? 380 ASP X CA  1 
ATOM   2923 C C   . ASP A 1 401 ? 29.536  59.865 81.561 1.00 49.46 ? 380 ASP X C   1 
ATOM   2924 O O   . ASP A 1 401 ? 28.659  60.652 81.190 1.00 49.04 ? 380 ASP X O   1 
ATOM   2925 C CB  . ASP A 1 401 ? 31.326  61.481 80.719 1.00 47.97 ? 380 ASP X CB  1 
ATOM   2926 C CG  . ASP A 1 401 ? 30.912  62.764 81.443 1.00 46.57 ? 380 ASP X CG  1 
ATOM   2927 O OD1 . ASP A 1 401 ? 30.613  62.680 82.662 1.00 43.97 ? 380 ASP X OD1 1 
ATOM   2928 O OD2 . ASP A 1 401 ? 30.864  63.832 80.794 1.00 41.97 ? 380 ASP X OD2 1 
ATOM   2929 N N   . ASP A 1 402 ? 29.241  58.665 82.028 1.00 50.48 ? 381 ASP X N   1 
ATOM   2930 C CA  . ASP A 1 402 ? 27.878  58.154 81.960 1.00 51.70 ? 381 ASP X CA  1 
ATOM   2931 C C   . ASP A 1 402 ? 26.841  58.826 82.900 1.00 51.94 ? 381 ASP X C   1 
ATOM   2932 O O   . ASP A 1 402 ? 25.626  58.573 82.802 1.00 52.79 ? 381 ASP X O   1 
ATOM   2933 C CB  . ASP A 1 402 ? 27.888  56.630 82.121 1.00 52.04 ? 381 ASP X CB  1 
ATOM   2934 C CG  . ASP A 1 402 ? 28.200  56.196 83.532 1.00 53.27 ? 381 ASP X CG  1 
ATOM   2935 O OD1 . ASP A 1 402 ? 29.199  56.640 84.128 1.00 53.40 ? 381 ASP X OD1 1 
ATOM   2936 O OD2 . ASP A 1 402 ? 27.427  55.383 84.046 1.00 57.29 ? 381 ASP X OD2 1 
ATOM   2937 N N   . ASN A 1 403 ? 27.296  59.689 83.798 1.00 51.80 ? 382 ASN X N   1 
ATOM   2938 C CA  . ASN A 1 403 ? 26.355  60.400 84.654 1.00 51.27 ? 382 ASN X CA  1 
ATOM   2939 C C   . ASN A 1 403 ? 26.144  61.884 84.314 1.00 50.13 ? 382 ASN X C   1 
ATOM   2940 O O   . ASN A 1 403 ? 25.658  62.667 85.124 1.00 51.09 ? 382 ASN X O   1 
ATOM   2941 C CB  . ASN A 1 403 ? 26.703  60.193 86.118 1.00 51.74 ? 382 ASN X CB  1 
ATOM   2942 C CG  . ASN A 1 403 ? 25.978  59.026 86.677 1.00 54.90 ? 382 ASN X CG  1 
ATOM   2943 O OD1 . ASN A 1 403 ? 24.765  58.879 86.445 1.00 58.25 ? 382 ASN X OD1 1 
ATOM   2944 N ND2 . ASN A 1 403 ? 26.700  58.140 87.372 1.00 57.63 ? 382 ASN X ND2 1 
ATOM   2945 N N   . ASN A 1 404 ? 26.514  62.265 83.105 1.00 47.60 ? 383 ASN X N   1 
ATOM   2946 C CA  . ASN A 1 404 ? 26.202  63.574 82.594 1.00 45.00 ? 383 ASN X CA  1 
ATOM   2947 C C   . ASN A 1 404 ? 24.744  63.668 82.042 1.00 44.02 ? 383 ASN X C   1 
ATOM   2948 O O   . ASN A 1 404 ? 24.429  63.083 81.001 1.00 44.43 ? 383 ASN X O   1 
ATOM   2949 C CB  . ASN A 1 404 ? 27.217  63.849 81.511 1.00 44.35 ? 383 ASN X CB  1 
ATOM   2950 C CG  . ASN A 1 404 ? 27.072  65.170 80.949 1.00 42.27 ? 383 ASN X CG  1 
ATOM   2951 O OD1 . ASN A 1 404 ? 28.041  65.757 80.484 1.00 39.92 ? 383 ASN X OD1 1 
ATOM   2952 N ND2 . ASN A 1 404 ? 25.851  65.684 80.974 1.00 40.42 ? 383 ASN X ND2 1 
ATOM   2953 N N   . GLY A 1 405 ? 23.861  64.370 82.748 1.00 41.98 ? 384 GLY X N   1 
ATOM   2954 C CA  . GLY A 1 405 ? 22.486  64.608 82.289 1.00 40.11 ? 384 GLY X CA  1 
ATOM   2955 C C   . GLY A 1 405 ? 22.278  65.296 80.926 1.00 39.10 ? 384 GLY X C   1 
ATOM   2956 O O   . GLY A 1 405 ? 21.299  64.989 80.237 1.00 39.31 ? 384 GLY X O   1 
ATOM   2957 N N   . ILE A 1 406 ? 23.151  66.229 80.532 1.00 36.99 ? 385 ILE X N   1 
ATOM   2958 C CA  . ILE A 1 406 ? 23.086  66.838 79.209 1.00 35.45 ? 385 ILE X CA  1 
ATOM   2959 C C   . ILE A 1 406 ? 23.393  65.777 78.152 1.00 35.35 ? 385 ILE X C   1 
ATOM   2960 O O   . ILE A 1 406 ? 22.757  65.679 77.100 1.00 35.67 ? 385 ILE X O   1 
ATOM   2961 C CB  . ILE A 1 406 ? 24.181  67.903 79.077 1.00 36.16 ? 385 ILE X CB  1 
ATOM   2962 C CG1 . ILE A 1 406 ? 24.169  68.861 80.289 1.00 37.02 ? 385 ILE X CG1 1 
ATOM   2963 C CG2 . ILE A 1 406 ? 24.134  68.639 77.723 1.00 32.66 ? 385 ILE X CG2 1 
ATOM   2964 C CD1 . ILE A 1 406 ? 22.988  69.721 80.351 1.00 37.27 ? 385 ILE X CD1 1 
ATOM   2965 N N   . LYS A 1 407 ? 24.412  64.986 78.416 1.00 34.89 ? 386 LYS X N   1 
ATOM   2966 C CA  . LYS A 1 407 ? 24.802  63.940 77.499 1.00 34.30 ? 386 LYS X CA  1 
ATOM   2967 C C   . LYS A 1 407 ? 23.741  62.857 77.353 1.00 34.01 ? 386 LYS X C   1 
ATOM   2968 O O   . LYS A 1 407 ? 23.463  62.421 76.228 1.00 34.00 ? 386 LYS X O   1 
ATOM   2969 C CB  . LYS A 1 407 ? 26.159  63.363 77.877 1.00 34.23 ? 386 LYS X CB  1 
ATOM   2970 C CG  . LYS A 1 407 ? 27.252  64.189 77.299 1.00 34.63 ? 386 LYS X CG  1 
ATOM   2971 C CD  . LYS A 1 407 ? 28.609  63.583 77.551 1.00 40.47 ? 386 LYS X CD  1 
ATOM   2972 C CE  . LYS A 1 407 ? 29.741  64.631 77.399 1.00 42.15 ? 386 LYS X CE  1 
ATOM   2973 N NZ  . LYS A 1 407 ? 31.088  63.992 77.442 1.00 43.03 ? 386 LYS X NZ  1 
ATOM   2974 N N   . ASN A 1 408 ? 23.139  62.441 78.468 1.00 33.12 ? 387 ASN X N   1 
ATOM   2975 C CA  . ASN A 1 408 ? 22.037  61.491 78.424 1.00 32.77 ? 387 ASN X CA  1 
ATOM   2976 C C   . ASN A 1 408 ? 20.857  62.066 77.620 1.00 31.92 ? 387 ASN X C   1 
ATOM   2977 O O   . ASN A 1 408 ? 20.290  61.385 76.774 1.00 31.33 ? 387 ASN X O   1 
ATOM   2978 C CB  . ASN A 1 408 ? 21.552  61.178 79.835 1.00 33.74 ? 387 ASN X CB  1 
ATOM   2979 C CG  . ASN A 1 408 ? 22.562  60.366 80.658 1.00 35.86 ? 387 ASN X CG  1 
ATOM   2980 O OD1 . ASN A 1 408 ? 23.643  60.045 80.209 1.00 39.56 ? 387 ASN X OD1 1 
ATOM   2981 N ND2 . ASN A 1 408 ? 22.192  60.042 81.876 1.00 39.10 ? 387 ASN X ND2 1 
ATOM   2982 N N   . ARG A 1 409 ? 20.505  63.324 77.891 1.00 30.81 ? 388 ARG X N   1 
ATOM   2983 C CA  . ARG A 1 409 ? 19.383  63.996 77.227 1.00 29.94 ? 388 ARG X CA  1 
ATOM   2984 C C   . ARG A 1 409 ? 19.638  64.113 75.744 1.00 29.54 ? 388 ARG X C   1 
ATOM   2985 O O   . ARG A 1 409 ? 18.811  63.717 74.918 1.00 28.74 ? 388 ARG X O   1 
ATOM   2986 C CB  . ARG A 1 409 ? 19.162  65.398 77.788 1.00 29.99 ? 388 ARG X CB  1 
ATOM   2987 C CG  . ARG A 1 409 ? 17.944  66.142 77.216 1.00 29.07 ? 388 ARG X CG  1 
ATOM   2988 C CD  . ARG A 1 409 ? 18.039  67.641 77.474 1.00 27.35 ? 388 ARG X CD  1 
ATOM   2989 N NE  . ARG A 1 409 ? 19.224  68.209 76.823 1.00 29.85 ? 388 ARG X NE  1 
ATOM   2990 C CZ  . ARG A 1 409 ? 19.827  69.348 77.181 1.00 29.21 ? 388 ARG X CZ  1 
ATOM   2991 N NH1 . ARG A 1 409 ? 20.895  69.764 76.538 1.00 23.81 ? 388 ARG X NH1 1 
ATOM   2992 N NH2 . ARG A 1 409 ? 19.390  70.057 78.209 1.00 30.60 ? 388 ARG X NH2 1 
ATOM   2993 N N   . ASP A 1 410 ? 20.800  64.637 75.390 1.00 28.88 ? 389 ASP X N   1 
ATOM   2994 C CA  . ASP A 1 410 ? 21.125  64.733 73.974 1.00 28.22 ? 389 ASP X CA  1 
ATOM   2995 C C   . ASP A 1 410 ? 21.265  63.359 73.263 1.00 29.00 ? 389 ASP X C   1 
ATOM   2996 O O   . ASP A 1 410 ? 20.966  63.231 72.045 1.00 29.50 ? 389 ASP X O   1 
ATOM   2997 C CB  . ASP A 1 410 ? 22.357  65.611 73.776 1.00 27.63 ? 389 ASP X CB  1 
ATOM   2998 C CG  . ASP A 1 410 ? 22.139  67.063 74.235 1.00 26.52 ? 389 ASP X CG  1 
ATOM   2999 O OD1 . ASP A 1 410 ? 20.986  67.476 74.471 1.00 24.51 ? 389 ASP X OD1 1 
ATOM   3000 O OD2 . ASP A 1 410 ? 23.139  67.806 74.357 1.00 25.79 ? 389 ASP X OD2 1 
ATOM   3001 N N   . GLY A 1 411 ? 21.711  62.325 73.983 1.00 28.90 ? 390 GLY X N   1 
ATOM   3002 C CA  . GLY A 1 411 ? 21.926  61.050 73.313 1.00 28.82 ? 390 GLY X CA  1 
ATOM   3003 C C   . GLY A 1 411 ? 20.552  60.479 73.037 1.00 29.66 ? 390 GLY X C   1 
ATOM   3004 O O   . GLY A 1 411 ? 20.312  59.762 72.044 1.00 30.29 ? 390 GLY X O   1 
ATOM   3005 N N   . LEU A 1 412 ? 19.615  60.791 73.915 1.00 28.97 ? 391 LEU X N   1 
ATOM   3006 C CA  . LEU A 1 412 ? 18.307  60.212 73.765 1.00 28.81 ? 391 LEU X CA  1 
ATOM   3007 C C   . LEU A 1 412 ? 17.675  60.932 72.584 1.00 28.82 ? 391 LEU X C   1 
ATOM   3008 O O   . LEU A 1 412 ? 16.992  60.343 71.746 1.00 29.11 ? 391 LEU X O   1 
ATOM   3009 C CB  . LEU A 1 412 ? 17.518  60.428 75.039 1.00 28.86 ? 391 LEU X CB  1 
ATOM   3010 C CG  . LEU A 1 412 ? 16.601  59.356 75.627 1.00 30.09 ? 391 LEU X CG  1 
ATOM   3011 C CD1 . LEU A 1 412 ? 16.967  57.994 75.192 1.00 31.03 ? 391 LEU X CD1 1 
ATOM   3012 C CD2 . LEU A 1 412 ? 16.523  59.411 77.165 1.00 30.82 ? 391 LEU X CD2 1 
ATOM   3013 N N   . ASP A 1 413 ? 17.960  62.215 72.480 1.00 28.56 ? 392 ASP X N   1 
ATOM   3014 C CA  . ASP A 1 413 ? 17.394  63.002 71.422 1.00 28.25 ? 392 ASP X CA  1 
ATOM   3015 C C   . ASP A 1 413 ? 17.889  62.422 70.090 1.00 27.07 ? 392 ASP X C   1 
ATOM   3016 O O   . ASP A 1 413 ? 17.116  62.169 69.177 1.00 27.57 ? 392 ASP X O   1 
ATOM   3017 C CB  . ASP A 1 413 ? 17.816  64.451 71.636 1.00 29.24 ? 392 ASP X CB  1 
ATOM   3018 C CG  . ASP A 1 413 ? 17.083  65.425 70.739 1.00 33.45 ? 392 ASP X CG  1 
ATOM   3019 O OD1 . ASP A 1 413 ? 16.726  65.075 69.594 1.00 41.42 ? 392 ASP X OD1 1 
ATOM   3020 O OD2 . ASP A 1 413 ? 16.870  66.564 71.168 1.00 36.25 ? 392 ASP X OD2 1 
ATOM   3021 N N   . ASP A 1 414 ? 19.186  62.196 69.976 1.00 25.89 ? 393 ASP X N   1 
ATOM   3022 C CA  . ASP A 1 414 ? 19.741  61.637 68.758 1.00 24.27 ? 393 ASP X CA  1 
ATOM   3023 C C   . ASP A 1 414 ? 19.169  60.234 68.453 1.00 23.44 ? 393 ASP X C   1 
ATOM   3024 O O   . ASP A 1 414 ? 19.043  59.829 67.292 1.00 21.95 ? 393 ASP X O   1 
ATOM   3025 C CB  . ASP A 1 414 ? 21.235  61.511 68.935 1.00 24.68 ? 393 ASP X CB  1 
ATOM   3026 C CG  . ASP A 1 414 ? 21.960  62.829 68.828 1.00 26.65 ? 393 ASP X CG  1 
ATOM   3027 O OD1 . ASP A 1 414 ? 21.381  63.762 68.267 1.00 28.66 ? 393 ASP X OD1 1 
ATOM   3028 O OD2 . ASP A 1 414 ? 23.133  62.932 69.280 1.00 29.55 ? 393 ASP X OD2 1 
ATOM   3029 N N   . ILE A 1 415 ? 18.883  59.457 69.493 1.00 22.87 ? 394 ILE X N   1 
ATOM   3030 C CA  . ILE A 1 415 ? 18.356  58.125 69.252 1.00 22.26 ? 394 ILE X CA  1 
ATOM   3031 C C   . ILE A 1 415 ? 16.994  58.239 68.583 1.00 22.29 ? 394 ILE X C   1 
ATOM   3032 O O   . ILE A 1 415 ? 16.705  57.558 67.604 1.00 21.98 ? 394 ILE X O   1 
ATOM   3033 C CB  . ILE A 1 415 ? 18.205  57.328 70.530 1.00 22.57 ? 394 ILE X CB  1 
ATOM   3034 C CG1 . ILE A 1 415 ? 19.584  56.803 70.976 1.00 22.04 ? 394 ILE X CG1 1 
ATOM   3035 C CG2 . ILE A 1 415 ? 17.167  56.206 70.333 1.00 18.20 ? 394 ILE X CG2 1 
ATOM   3036 C CD1 . ILE A 1 415 ? 19.584  56.195 72.346 1.00 22.49 ? 394 ILE X CD1 1 
ATOM   3037 N N   . VAL A 1 416 ? 16.164  59.146 69.071 1.00 21.74 ? 395 VAL X N   1 
ATOM   3038 C CA  . VAL A 1 416 ? 14.829  59.209 68.531 1.00 20.94 ? 395 VAL X CA  1 
ATOM   3039 C C   . VAL A 1 416 ? 14.863  59.680 67.076 1.00 21.23 ? 395 VAL X C   1 
ATOM   3040 O O   . VAL A 1 416 ? 14.221  59.038 66.194 1.00 20.95 ? 395 VAL X O   1 
ATOM   3041 C CB  . VAL A 1 416 ? 13.881  59.991 69.454 1.00 21.12 ? 395 VAL X CB  1 
ATOM   3042 C CG1 . VAL A 1 416 ? 12.495  60.076 68.870 1.00 21.24 ? 395 VAL X CG1 1 
ATOM   3043 C CG2 . VAL A 1 416 ? 13.789  59.279 70.830 1.00 19.91 ? 395 VAL X CG2 1 
ATOM   3044 N N   . GLY A 1 417 ? 15.655  60.747 66.830 1.00 20.22 ? 396 GLY X N   1 
ATOM   3045 C CA  . GLY A 1 417 ? 15.777  61.382 65.541 1.00 18.52 ? 396 GLY X CA  1 
ATOM   3046 C C   . GLY A 1 417 ? 16.495  60.500 64.548 1.00 20.07 ? 396 GLY X C   1 
ATOM   3047 O O   . GLY A 1 417 ? 16.090  60.438 63.378 1.00 20.85 ? 396 GLY X O   1 
ATOM   3048 N N   . ASP A 1 418 ? 17.553  59.790 64.978 1.00 20.65 ? 397 ASP X N   1 
ATOM   3049 C CA  . ASP A 1 418 ? 18.265  58.855 64.075 1.00 21.14 ? 397 ASP X CA  1 
ATOM   3050 C C   . ASP A 1 418 ? 17.357  57.719 63.667 1.00 21.03 ? 397 ASP X C   1 
ATOM   3051 O O   . ASP A 1 418 ? 17.176  57.439 62.492 1.00 22.08 ? 397 ASP X O   1 
ATOM   3052 C CB  . ASP A 1 418 ? 19.526  58.239 64.714 1.00 21.42 ? 397 ASP X CB  1 
ATOM   3053 C CG  . ASP A 1 418 ? 20.624  59.252 64.903 1.00 21.19 ? 397 ASP X CG  1 
ATOM   3054 O OD1 . ASP A 1 418 ? 20.542  60.314 64.259 1.00 18.94 ? 397 ASP X OD1 1 
ATOM   3055 O OD2 . ASP A 1 418 ? 21.549  59.009 65.705 1.00 21.24 ? 397 ASP X OD2 1 
ATOM   3056 N N   . HIS A 1 419 ? 16.780  57.062 64.648 1.00 20.59 ? 398 HIS X N   1 
ATOM   3057 C CA  . HIS A 1 419 ? 15.989  55.893 64.362 1.00 20.88 ? 398 HIS X CA  1 
ATOM   3058 C C   . HIS A 1 419 ? 14.712  56.221 63.585 1.00 22.15 ? 398 HIS X C   1 
ATOM   3059 O O   . HIS A 1 419 ? 14.353  55.467 62.670 1.00 24.18 ? 398 HIS X O   1 
ATOM   3060 C CB  . HIS A 1 419 ? 15.659  55.163 65.639 1.00 18.97 ? 398 HIS X CB  1 
ATOM   3061 C CG  . HIS A 1 419 ? 14.589  54.147 65.481 1.00 21.11 ? 398 HIS X CG  1 
ATOM   3062 N ND1 . HIS A 1 419 ? 14.743  53.005 64.720 1.00 19.80 ? 398 HIS X ND1 1 
ATOM   3063 C CD2 . HIS A 1 419 ? 13.339  54.086 65.998 1.00 23.64 ? 398 HIS X CD2 1 
ATOM   3064 C CE1 . HIS A 1 419 ? 13.648  52.275 64.797 1.00 19.26 ? 398 HIS X CE1 1 
ATOM   3065 N NE2 . HIS A 1 419 ? 12.786  52.898 65.581 1.00 22.20 ? 398 HIS X NE2 1 
ATOM   3066 N N   . ASN A 1 420 ? 14.048  57.339 63.883 1.00 21.82 ? 399 ASN X N   1 
ATOM   3067 C CA  . ASN A 1 420 ? 12.749  57.571 63.315 1.00 21.42 ? 399 ASN X CA  1 
ATOM   3068 C C   . ASN A 1 420 ? 12.742  58.436 62.043 1.00 22.28 ? 399 ASN X C   1 
ATOM   3069 O O   . ASN A 1 420 ? 11.766  58.406 61.268 1.00 22.01 ? 399 ASN X O   1 
ATOM   3070 C CB  . ASN A 1 420 ? 11.879  58.227 64.350 1.00 21.99 ? 399 ASN X CB  1 
ATOM   3071 C CG  . ASN A 1 420 ? 11.360  57.252 65.421 1.00 23.42 ? 399 ASN X CG  1 
ATOM   3072 O OD1 . ASN A 1 420 ? 10.541  56.374 65.155 1.00 25.57 ? 399 ASN X OD1 1 
ATOM   3073 N ND2 . ASN A 1 420 ? 11.784  57.468 66.650 1.00 22.58 ? 399 ASN X ND2 1 
ATOM   3074 N N   . VAL A 1 421 ? 13.788  59.237 61.826 1.00 21.75 ? 400 VAL X N   1 
ATOM   3075 C CA  . VAL A 1 421 ? 13.736  60.191 60.731 1.00 21.26 ? 400 VAL X CA  1 
ATOM   3076 C C   . VAL A 1 421 ? 15.015  60.132 59.911 1.00 22.62 ? 400 VAL X C   1 
ATOM   3077 O O   . VAL A 1 421 ? 14.964  59.813 58.716 1.00 22.40 ? 400 VAL X O   1 
ATOM   3078 C CB  . VAL A 1 421 ? 13.499  61.595 61.258 1.00 21.67 ? 400 VAL X CB  1 
ATOM   3079 C CG1 . VAL A 1 421 ? 13.639  62.678 60.155 1.00 19.65 ? 400 VAL X CG1 1 
ATOM   3080 C CG2 . VAL A 1 421 ? 12.153  61.674 61.995 1.00 20.98 ? 400 VAL X CG2 1 
ATOM   3081 N N   . ILE A 1 422 ? 16.177  60.369 60.531 1.00 23.59 ? 401 ILE X N   1 
ATOM   3082 C CA  . ILE A 1 422 ? 17.399  60.458 59.728 1.00 24.76 ? 401 ILE X CA  1 
ATOM   3083 C C   . ILE A 1 422 ? 17.902  59.177 59.095 1.00 26.57 ? 401 ILE X C   1 
ATOM   3084 O O   . ILE A 1 422 ? 18.142  59.128 57.874 1.00 27.78 ? 401 ILE X O   1 
ATOM   3085 C CB  . ILE A 1 422 ? 18.530  61.055 60.469 1.00 24.57 ? 401 ILE X CB  1 
ATOM   3086 C CG1 . ILE A 1 422 ? 18.090  62.450 60.919 1.00 25.93 ? 401 ILE X CG1 1 
ATOM   3087 C CG2 . ILE A 1 422 ? 19.712  61.123 59.566 1.00 21.83 ? 401 ILE X CG2 1 
ATOM   3088 C CD1 . ILE A 1 422 ? 18.967  63.123 61.877 1.00 21.60 ? 401 ILE X CD1 1 
ATOM   3089 N N   . CYS A 1 423 ? 18.077  58.121 59.876 1.00 26.80 ? 402 CYS X N   1 
ATOM   3090 C CA  . CYS A 1 423 ? 18.564  56.920 59.238 1.00 26.48 ? 402 CYS X CA  1 
ATOM   3091 C C   . CYS A 1 423 ? 17.566  56.345 58.252 1.00 27.48 ? 402 CYS X C   1 
ATOM   3092 O O   . CYS A 1 423 ? 17.975  55.862 57.211 1.00 27.78 ? 402 CYS X O   1 
ATOM   3093 C CB  . CYS A 1 423 ? 19.037  55.922 60.256 1.00 26.49 ? 402 CYS X CB  1 
ATOM   3094 S SG  . CYS A 1 423 ? 20.362  56.700 61.219 1.00 25.55 ? 402 CYS X SG  1 
ATOM   3095 N N   . PRO A 1 424 ? 16.246  56.411 58.549 1.00 28.01 ? 403 PRO X N   1 
ATOM   3096 C CA  . PRO A 1 424 ? 15.408  55.890 57.451 1.00 27.83 ? 403 PRO X CA  1 
ATOM   3097 C C   . PRO A 1 424 ? 15.509  56.748 56.177 1.00 27.57 ? 403 PRO X C   1 
ATOM   3098 O O   . PRO A 1 424 ? 15.402  56.218 55.065 1.00 27.61 ? 403 PRO X O   1 
ATOM   3099 C CB  . PRO A 1 424 ? 13.972  55.921 58.014 1.00 27.16 ? 403 PRO X CB  1 
ATOM   3100 C CG  . PRO A 1 424 ? 14.130  55.939 59.510 1.00 28.90 ? 403 PRO X CG  1 
ATOM   3101 C CD  . PRO A 1 424 ? 15.501  56.549 59.822 1.00 28.17 ? 403 PRO X CD  1 
ATOM   3102 N N   . LEU A 1 425 ? 15.706  58.051 56.317 1.00 27.03 ? 404 LEU X N   1 
ATOM   3103 C CA  . LEU A 1 425 ? 15.684  58.879 55.127 1.00 26.67 ? 404 LEU X CA  1 
ATOM   3104 C C   . LEU A 1 425 ? 16.969  58.606 54.314 1.00 26.81 ? 404 LEU X C   1 
ATOM   3105 O O   . LEU A 1 425 ? 16.919  58.417 53.080 1.00 26.63 ? 404 LEU X O   1 
ATOM   3106 C CB  . LEU A 1 425 ? 15.484  60.341 55.490 1.00 25.91 ? 404 LEU X CB  1 
ATOM   3107 C CG  . LEU A 1 425 ? 15.569  61.352 54.355 1.00 26.20 ? 404 LEU X CG  1 
ATOM   3108 C CD1 . LEU A 1 425 ? 14.716  62.622 54.601 1.00 26.74 ? 404 LEU X CD1 1 
ATOM   3109 C CD2 . LEU A 1 425 ? 17.021  61.693 54.122 1.00 26.14 ? 404 LEU X CD2 1 
ATOM   3110 N N   . MET A 1 426 ? 18.094  58.501 55.016 1.00 26.45 ? 405 MET X N   1 
ATOM   3111 C CA  . MET A 1 426 ? 19.353  58.078 54.393 1.00 26.90 ? 405 MET X CA  1 
ATOM   3112 C C   . MET A 1 426 ? 19.284  56.731 53.702 1.00 26.90 ? 405 MET X C   1 
ATOM   3113 O O   . MET A 1 426 ? 19.845  56.537 52.628 1.00 25.81 ? 405 MET X O   1 
ATOM   3114 C CB  . MET A 1 426 ? 20.500  58.108 55.383 1.00 26.45 ? 405 MET X CB  1 
ATOM   3115 C CG  . MET A 1 426 ? 20.706  59.522 55.916 1.00 28.79 ? 405 MET X CG  1 
ATOM   3116 S SD  . MET A 1 426 ? 21.165  60.711 54.636 1.00 32.52 ? 405 MET X SD  1 
ATOM   3117 C CE  . MET A 1 426 ? 22.395  59.705 53.763 1.00 29.58 ? 405 MET X CE  1 
ATOM   3118 N N   . HIS A 1 427 ? 18.587  55.785 54.290 1.00 27.69 ? 406 HIS X N   1 
ATOM   3119 C CA  . HIS A 1 427 ? 18.430  54.550 53.566 1.00 29.18 ? 406 HIS X CA  1 
ATOM   3120 C C   . HIS A 1 427 ? 17.681  54.829 52.237 1.00 29.61 ? 406 HIS X C   1 
ATOM   3121 O O   . HIS A 1 427 ? 18.099  54.344 51.160 1.00 30.34 ? 406 HIS X O   1 
ATOM   3122 C CB  . HIS A 1 427 ? 17.672  53.541 54.405 1.00 29.68 ? 406 HIS X CB  1 
ATOM   3123 C CG  . HIS A 1 427 ? 17.579  52.186 53.788 1.00 31.09 ? 406 HIS X CG  1 
ATOM   3124 N ND1 . HIS A 1 427 ? 18.681  51.374 53.617 1.00 31.56 ? 406 HIS X ND1 1 
ATOM   3125 C CD2 . HIS A 1 427 ? 16.509  51.479 53.341 1.00 33.01 ? 406 HIS X CD2 1 
ATOM   3126 C CE1 . HIS A 1 427 ? 18.299  50.226 53.079 1.00 33.53 ? 406 HIS X CE1 1 
ATOM   3127 N NE2 . HIS A 1 427 ? 16.985  50.258 52.910 1.00 34.87 ? 406 HIS X NE2 1 
ATOM   3128 N N   . PHE A 1 428 ? 16.593  55.603 52.313 1.00 28.52 ? 407 PHE X N   1 
ATOM   3129 C CA  . PHE A 1 428 ? 15.739  55.811 51.159 1.00 27.92 ? 407 PHE X CA  1 
ATOM   3130 C C   . PHE A 1 428 ? 16.582  56.539 50.105 1.00 29.56 ? 407 PHE X C   1 
ATOM   3131 O O   . PHE A 1 428 ? 16.524  56.172 48.904 1.00 29.30 ? 407 PHE X O   1 
ATOM   3132 C CB  . PHE A 1 428 ? 14.432  56.580 51.535 1.00 27.55 ? 407 PHE X CB  1 
ATOM   3133 C CG  . PHE A 1 428 ? 13.673  57.159 50.352 1.00 22.34 ? 407 PHE X CG  1 
ATOM   3134 C CD1 . PHE A 1 428 ? 12.758  56.378 49.631 1.00 21.93 ? 407 PHE X CD1 1 
ATOM   3135 C CD2 . PHE A 1 428 ? 13.869  58.466 49.974 1.00 16.05 ? 407 PHE X CD2 1 
ATOM   3136 C CE1 . PHE A 1 428 ? 12.053  56.890 48.539 1.00 17.42 ? 407 PHE X CE1 1 
ATOM   3137 C CE2 . PHE A 1 428 ? 13.213  58.983 48.889 1.00 18.53 ? 407 PHE X CE2 1 
ATOM   3138 C CZ  . PHE A 1 428 ? 12.275  58.196 48.158 1.00 16.69 ? 407 PHE X CZ  1 
ATOM   3139 N N   . VAL A 1 429 ? 17.374  57.536 50.538 1.00 29.35 ? 408 VAL X N   1 
ATOM   3140 C CA  . VAL A 1 429 ? 18.075  58.304 49.556 1.00 30.71 ? 408 VAL X CA  1 
ATOM   3141 C C   . VAL A 1 429 ? 19.161  57.450 48.943 1.00 31.38 ? 408 VAL X C   1 
ATOM   3142 O O   . VAL A 1 429 ? 19.417  57.509 47.720 1.00 31.07 ? 408 VAL X O   1 
ATOM   3143 C CB  . VAL A 1 429 ? 18.702  59.582 50.092 1.00 31.40 ? 408 VAL X CB  1 
ATOM   3144 C CG1 . VAL A 1 429 ? 19.343  59.323 51.342 1.00 32.02 ? 408 VAL X CG1 1 
ATOM   3145 C CG2 . VAL A 1 429 ? 19.771  60.080 49.114 1.00 32.67 ? 408 VAL X CG2 1 
ATOM   3146 N N   . ASN A 1 430 ? 19.791  56.629 49.764 1.00 31.70 ? 409 ASN X N   1 
ATOM   3147 C CA  . ASN A 1 430 ? 20.804  55.757 49.186 1.00 32.46 ? 409 ASN X CA  1 
ATOM   3148 C C   . ASN A 1 430 ? 20.188  54.847 48.146 1.00 32.93 ? 409 ASN X C   1 
ATOM   3149 O O   . ASN A 1 430 ? 20.690  54.788 47.029 1.00 33.17 ? 409 ASN X O   1 
ATOM   3150 C CB  . ASN A 1 430 ? 21.720  55.067 50.221 1.00 32.14 ? 409 ASN X CB  1 
ATOM   3151 C CG  . ASN A 1 430 ? 22.910  56.000 50.638 1.00 34.43 ? 409 ASN X CG  1 
ATOM   3152 O OD1 . ASN A 1 430 ? 23.741  56.370 49.777 1.00 39.74 ? 409 ASN X OD1 1 
ATOM   3153 N ND2 . ASN A 1 430 ? 22.958  56.434 51.927 1.00 29.74 ? 409 ASN X ND2 1 
ATOM   3154 N N   . LYS A 1 431 ? 19.078  54.188 48.448 1.00 33.14 ? 410 LYS X N   1 
ATOM   3155 C CA  . LYS A 1 431 ? 18.450  53.364 47.402 1.00 33.79 ? 410 LYS X CA  1 
ATOM   3156 C C   . LYS A 1 431 ? 17.869  54.166 46.223 1.00 33.72 ? 410 LYS X C   1 
ATOM   3157 O O   . LYS A 1 431 ? 17.859  53.671 45.090 1.00 32.80 ? 410 LYS X O   1 
ATOM   3158 C CB  . LYS A 1 431 ? 17.331  52.545 47.989 1.00 34.25 ? 410 LYS X CB  1 
ATOM   3159 C CG  . LYS A 1 431 ? 17.779  51.722 49.159 1.00 37.33 ? 410 LYS X CG  1 
ATOM   3160 C CD  . LYS A 1 431 ? 18.749  50.708 48.682 1.00 41.04 ? 410 LYS X CD  1 
ATOM   3161 C CE  . LYS A 1 431 ? 18.919  49.666 49.722 1.00 43.95 ? 410 LYS X CE  1 
ATOM   3162 N NZ  . LYS A 1 431 ? 19.358  48.475 48.952 1.00 47.88 ? 410 LYS X NZ  1 
ATOM   3163 N N   . TYR A 1 432 ? 17.357  55.381 46.481 1.00 32.72 ? 411 TYR X N   1 
ATOM   3164 C CA  . TYR A 1 432 ? 16.718  56.107 45.406 1.00 31.64 ? 411 TYR X CA  1 
ATOM   3165 C C   . TYR A 1 432 ? 17.769  56.478 44.401 1.00 31.89 ? 411 TYR X C   1 
ATOM   3166 O O   . TYR A 1 432 ? 17.590  56.283 43.196 1.00 32.30 ? 411 TYR X O   1 
ATOM   3167 C CB  . TYR A 1 432 ? 16.020  57.390 45.853 1.00 31.17 ? 411 TYR X CB  1 
ATOM   3168 C CG  . TYR A 1 432 ? 15.200  57.963 44.714 1.00 29.83 ? 411 TYR X CG  1 
ATOM   3169 C CD1 . TYR A 1 432 ? 13.919  57.435 44.434 1.00 27.49 ? 411 TYR X CD1 1 
ATOM   3170 C CD2 . TYR A 1 432 ? 15.709  58.990 43.887 1.00 27.28 ? 411 TYR X CD2 1 
ATOM   3171 C CE1 . TYR A 1 432 ? 13.147  57.912 43.410 1.00 26.93 ? 411 TYR X CE1 1 
ATOM   3172 C CE2 . TYR A 1 432 ? 14.949  59.486 42.828 1.00 26.90 ? 411 TYR X CE2 1 
ATOM   3173 C CZ  . TYR A 1 432 ? 13.648  58.942 42.582 1.00 29.85 ? 411 TYR X CZ  1 
ATOM   3174 O OH  . TYR A 1 432 ? 12.839  59.389 41.509 1.00 27.66 ? 411 TYR X OH  1 
ATOM   3175 N N   . THR A 1 433 ? 18.877  57.014 44.898 1.00 31.37 ? 412 THR X N   1 
ATOM   3176 C CA  . THR A 1 433 ? 19.937  57.486 44.019 1.00 30.90 ? 412 THR X CA  1 
ATOM   3177 C C   . THR A 1 433 ? 20.487  56.417 43.031 1.00 30.94 ? 412 THR X C   1 
ATOM   3178 O O   . THR A 1 433 ? 20.789  56.730 41.898 1.00 30.63 ? 412 THR X O   1 
ATOM   3179 C CB  . THR A 1 433 ? 21.040  58.177 44.842 1.00 30.95 ? 412 THR X CB  1 
ATOM   3180 O OG1 . THR A 1 433 ? 20.466  59.301 45.518 1.00 31.32 ? 412 THR X OG1 1 
ATOM   3181 C CG2 . THR A 1 433 ? 22.199  58.640 43.967 1.00 29.80 ? 412 THR X CG2 1 
ATOM   3182 N N   . LYS A 1 434 ? 20.585  55.166 43.431 1.00 31.30 ? 413 LYS X N   1 
ATOM   3183 C CA  . LYS A 1 434 ? 21.043  54.160 42.488 1.00 33.25 ? 413 LYS X CA  1 
ATOM   3184 C C   . LYS A 1 434 ? 20.220  54.240 41.164 1.00 34.01 ? 413 LYS X C   1 
ATOM   3185 O O   . LYS A 1 434 ? 20.791  54.091 40.102 1.00 34.33 ? 413 LYS X O   1 
ATOM   3186 C CB  . LYS A 1 434 ? 21.097  52.740 43.149 1.00 33.70 ? 413 LYS X CB  1 
ATOM   3187 C CG  . LYS A 1 434 ? 21.541  51.537 42.258 1.00 35.04 ? 413 LYS X CG  1 
ATOM   3188 N N   . PHE A 1 435 ? 18.909  54.524 41.192 1.00 34.17 ? 414 PHE X N   1 
ATOM   3189 C CA  . PHE A 1 435 ? 18.164  54.609 39.916 1.00 33.49 ? 414 PHE X CA  1 
ATOM   3190 C C   . PHE A 1 435 ? 17.554  55.966 39.541 1.00 33.85 ? 414 PHE X C   1 
ATOM   3191 O O   . PHE A 1 435 ? 16.963  56.118 38.466 1.00 33.37 ? 414 PHE X O   1 
ATOM   3192 C CB  . PHE A 1 435 ? 16.979  53.688 39.905 1.00 33.49 ? 414 PHE X CB  1 
ATOM   3193 C CG  . PHE A 1 435 ? 17.276  52.272 40.207 1.00 33.55 ? 414 PHE X CG  1 
ATOM   3194 C CD1 . PHE A 1 435 ? 17.388  51.346 39.186 1.00 32.74 ? 414 PHE X CD1 1 
ATOM   3195 C CD2 . PHE A 1 435 ? 17.339  51.837 41.521 1.00 32.93 ? 414 PHE X CD2 1 
ATOM   3196 C CE1 . PHE A 1 435 ? 17.611  50.011 39.488 1.00 34.53 ? 414 PHE X CE1 1 
ATOM   3197 C CE2 . PHE A 1 435 ? 17.555  50.502 41.834 1.00 32.02 ? 414 PHE X CE2 1 
ATOM   3198 C CZ  . PHE A 1 435 ? 17.691  49.591 40.824 1.00 33.34 ? 414 PHE X CZ  1 
ATOM   3199 N N   . GLY A 1 436 ? 17.638  56.955 40.405 1.00 33.98 ? 415 GLY X N   1 
ATOM   3200 C CA  . GLY A 1 436 ? 16.877  58.173 40.102 1.00 34.32 ? 415 GLY X CA  1 
ATOM   3201 C C   . GLY A 1 436 ? 17.636  59.102 39.181 1.00 33.94 ? 415 GLY X C   1 
ATOM   3202 O O   . GLY A 1 436 ? 18.738  58.778 38.736 1.00 34.30 ? 415 GLY X O   1 
ATOM   3203 N N   . ASN A 1 437 ? 17.057  60.266 38.924 1.00 33.62 ? 416 ASN X N   1 
ATOM   3204 C CA  . ASN A 1 437 ? 17.619  61.194 37.951 1.00 34.07 ? 416 ASN X CA  1 
ATOM   3205 C C   . ASN A 1 437 ? 18.244  62.429 38.570 1.00 33.30 ? 416 ASN X C   1 
ATOM   3206 O O   . ASN A 1 437 ? 18.603  63.340 37.860 1.00 33.18 ? 416 ASN X O   1 
ATOM   3207 C CB  . ASN A 1 437 ? 16.594  61.558 36.826 1.00 34.59 ? 416 ASN X CB  1 
ATOM   3208 C CG  . ASN A 1 437 ? 17.227  62.360 35.678 1.00 36.10 ? 416 ASN X CG  1 
ATOM   3209 O OD1 . ASN A 1 437 ? 16.754  63.452 35.354 1.00 38.74 ? 416 ASN X OD1 1 
ATOM   3210 N ND2 . ASN A 1 437 ? 18.327  61.837 35.094 1.00 37.06 ? 416 ASN X ND2 1 
ATOM   3211 N N   . GLY A 1 438 ? 18.427  62.429 39.888 1.00 33.31 ? 417 GLY X N   1 
ATOM   3212 C CA  . GLY A 1 438 ? 19.115  63.539 40.591 1.00 32.24 ? 417 GLY X CA  1 
ATOM   3213 C C   . GLY A 1 438 ? 18.551  63.758 41.988 1.00 31.16 ? 417 GLY X C   1 
ATOM   3214 O O   . GLY A 1 438 ? 17.337  63.804 42.167 1.00 31.72 ? 417 GLY X O   1 
ATOM   3215 N N   . THR A 1 439 ? 19.426  63.903 42.971 1.00 29.62 ? 418 THR X N   1 
ATOM   3216 C CA  . THR A 1 439 ? 19.031  63.922 44.360 1.00 28.22 ? 418 THR X CA  1 
ATOM   3217 C C   . THR A 1 439 ? 19.733  65.141 44.954 1.00 28.51 ? 418 THR X C   1 
ATOM   3218 O O   . THR A 1 439 ? 20.929  65.399 44.625 1.00 27.81 ? 418 THR X O   1 
ATOM   3219 C CB  . THR A 1 439 ? 19.591  62.668 45.076 1.00 28.91 ? 418 THR X CB  1 
ATOM   3220 O OG1 . THR A 1 439 ? 19.052  61.465 44.493 1.00 27.70 ? 418 THR X OG1 1 
ATOM   3221 C CG2 . THR A 1 439 ? 19.355  62.717 46.612 1.00 27.06 ? 418 THR X CG2 1 
ATOM   3222 N N   . TYR A 1 440 ? 19.036  65.896 45.811 1.00 27.16 ? 419 TYR X N   1 
ATOM   3223 C CA  . TYR A 1 440 ? 19.715  66.968 46.531 1.00 26.61 ? 419 TYR X CA  1 
ATOM   3224 C C   . TYR A 1 440 ? 19.374  66.908 48.005 1.00 26.97 ? 419 TYR X C   1 
ATOM   3225 O O   . TYR A 1 440 ? 18.182  66.831 48.382 1.00 26.84 ? 419 TYR X O   1 
ATOM   3226 C CB  . TYR A 1 440 ? 19.394  68.342 45.983 1.00 26.78 ? 419 TYR X CB  1 
ATOM   3227 C CG  . TYR A 1 440 ? 19.836  68.569 44.558 1.00 27.49 ? 419 TYR X CG  1 
ATOM   3228 C CD1 . TYR A 1 440 ? 19.015  68.182 43.494 1.00 26.23 ? 419 TYR X CD1 1 
ATOM   3229 C CD2 . TYR A 1 440 ? 21.050  69.190 44.265 1.00 26.06 ? 419 TYR X CD2 1 
ATOM   3230 C CE1 . TYR A 1 440 ? 19.393  68.364 42.219 1.00 24.83 ? 419 TYR X CE1 1 
ATOM   3231 C CE2 . TYR A 1 440 ? 21.428  69.394 42.971 1.00 25.93 ? 419 TYR X CE2 1 
ATOM   3232 C CZ  . TYR A 1 440 ? 20.583  68.977 41.951 1.00 27.69 ? 419 TYR X CZ  1 
ATOM   3233 O OH  . TYR A 1 440 ? 20.899  69.181 40.628 1.00 31.09 ? 419 TYR X OH  1 
ATOM   3234 N N   . LEU A 1 441 ? 20.420  66.929 48.849 1.00 26.57 ? 420 LEU X N   1 
ATOM   3235 C CA  . LEU A 1 441 ? 20.228  66.579 50.250 1.00 25.34 ? 420 LEU X CA  1 
ATOM   3236 C C   . LEU A 1 441 ? 20.581  67.716 51.228 1.00 25.03 ? 420 LEU X C   1 
ATOM   3237 O O   . LEU A 1 441 ? 21.638  68.317 51.105 1.00 25.66 ? 420 LEU X O   1 
ATOM   3238 C CB  . LEU A 1 441 ? 20.996  65.301 50.519 1.00 24.10 ? 420 LEU X CB  1 
ATOM   3239 C CG  . LEU A 1 441 ? 20.952  64.867 51.969 1.00 24.84 ? 420 LEU X CG  1 
ATOM   3240 C CD1 . LEU A 1 441 ? 19.470  64.656 52.383 1.00 23.95 ? 420 LEU X CD1 1 
ATOM   3241 C CD2 . LEU A 1 441 ? 21.820  63.619 52.194 1.00 23.09 ? 420 LEU X CD2 1 
ATOM   3242 N N   . TYR A 1 442 ? 19.693  68.067 52.158 1.00 24.87 ? 421 TYR X N   1 
ATOM   3243 C CA  . TYR A 1 442 ? 20.018  69.190 53.070 1.00 25.24 ? 421 TYR X CA  1 
ATOM   3244 C C   . TYR A 1 442 ? 19.993  68.779 54.529 1.00 25.83 ? 421 TYR X C   1 
ATOM   3245 O O   . TYR A 1 442 ? 19.340  67.820 54.890 1.00 26.37 ? 421 TYR X O   1 
ATOM   3246 C CB  . TYR A 1 442 ? 19.072  70.377 52.897 1.00 24.68 ? 421 TYR X CB  1 
ATOM   3247 C CG  . TYR A 1 442 ? 17.650  70.110 53.377 1.00 24.81 ? 421 TYR X CG  1 
ATOM   3248 C CD1 . TYR A 1 442 ? 17.319  70.218 54.722 1.00 23.19 ? 421 TYR X CD1 1 
ATOM   3249 C CD2 . TYR A 1 442 ? 16.628  69.723 52.467 1.00 23.77 ? 421 TYR X CD2 1 
ATOM   3250 C CE1 . TYR A 1 442 ? 15.973  69.945 55.173 1.00 25.20 ? 421 TYR X CE1 1 
ATOM   3251 C CE2 . TYR A 1 442 ? 15.299  69.472 52.887 1.00 23.92 ? 421 TYR X CE2 1 
ATOM   3252 C CZ  . TYR A 1 442 ? 14.984  69.580 54.253 1.00 25.18 ? 421 TYR X CZ  1 
ATOM   3253 O OH  . TYR A 1 442 ? 13.714  69.312 54.706 1.00 23.42 ? 421 TYR X OH  1 
ATOM   3254 N N   . PHE A 1 443 ? 20.691  69.518 55.370 1.00 26.28 ? 422 PHE X N   1 
ATOM   3255 C CA  . PHE A 1 443 ? 20.634  69.296 56.800 1.00 26.42 ? 422 PHE X CA  1 
ATOM   3256 C C   . PHE A 1 443 ? 20.276  70.669 57.365 1.00 27.51 ? 422 PHE X C   1 
ATOM   3257 O O   . PHE A 1 443 ? 21.092  71.603 57.302 1.00 28.45 ? 422 PHE X O   1 
ATOM   3258 C CB  . PHE A 1 443 ? 22.011  68.818 57.274 1.00 26.31 ? 422 PHE X CB  1 
ATOM   3259 C CG  . PHE A 1 443 ? 22.122  68.572 58.750 1.00 24.57 ? 422 PHE X CG  1 
ATOM   3260 C CD1 . PHE A 1 443 ? 21.667  67.362 59.316 1.00 24.30 ? 422 PHE X CD1 1 
ATOM   3261 C CD2 . PHE A 1 443 ? 22.732  69.508 59.568 1.00 22.17 ? 422 PHE X CD2 1 
ATOM   3262 C CE1 . PHE A 1 443 ? 21.796  67.108 60.713 1.00 24.13 ? 422 PHE X CE1 1 
ATOM   3263 C CE2 . PHE A 1 443 ? 22.869  69.288 60.949 1.00 24.51 ? 422 PHE X CE2 1 
ATOM   3264 C CZ  . PHE A 1 443 ? 22.390  68.073 61.539 1.00 23.24 ? 422 PHE X CZ  1 
ATOM   3265 N N   . PHE A 1 444 ? 19.044  70.832 57.846 1.00 27.96 ? 423 PHE X N   1 
ATOM   3266 C CA  . PHE A 1 444 ? 18.603  72.126 58.328 1.00 28.40 ? 423 PHE X CA  1 
ATOM   3267 C C   . PHE A 1 444 ? 18.931  72.334 59.818 1.00 29.66 ? 423 PHE X C   1 
ATOM   3268 O O   . PHE A 1 444 ? 18.396  71.607 60.648 1.00 29.69 ? 423 PHE X O   1 
ATOM   3269 C CB  . PHE A 1 444 ? 17.107  72.272 58.132 1.00 27.50 ? 423 PHE X CB  1 
ATOM   3270 C CG  . PHE A 1 444 ? 16.543  73.533 58.748 1.00 27.49 ? 423 PHE X CG  1 
ATOM   3271 C CD1 . PHE A 1 444 ? 16.484  74.705 58.021 1.00 24.28 ? 423 PHE X CD1 1 
ATOM   3272 C CD2 . PHE A 1 444 ? 16.100  73.542 60.062 1.00 27.49 ? 423 PHE X CD2 1 
ATOM   3273 C CE1 . PHE A 1 444 ? 15.975  75.823 58.556 1.00 23.72 ? 423 PHE X CE1 1 
ATOM   3274 C CE2 . PHE A 1 444 ? 15.588  74.700 60.629 1.00 26.33 ? 423 PHE X CE2 1 
ATOM   3275 C CZ  . PHE A 1 444 ? 15.537  75.834 59.880 1.00 26.10 ? 423 PHE X CZ  1 
ATOM   3276 N N   . ASN A 1 445 ? 19.755  73.331 60.170 1.00 30.18 ? 424 ASN X N   1 
ATOM   3277 C CA  . ASN A 1 445 ? 20.154  73.469 61.589 1.00 31.79 ? 424 ASN X CA  1 
ATOM   3278 C C   . ASN A 1 445 ? 20.245  74.896 62.172 1.00 32.40 ? 424 ASN X C   1 
ATOM   3279 O O   . ASN A 1 445 ? 21.135  75.201 62.968 1.00 32.08 ? 424 ASN X O   1 
ATOM   3280 C CB  . ASN A 1 445 ? 21.457  72.696 61.887 1.00 31.06 ? 424 ASN X CB  1 
ATOM   3281 C CG  . ASN A 1 445 ? 22.609  73.223 61.076 1.00 32.30 ? 424 ASN X CG  1 
ATOM   3282 O OD1 . ASN A 1 445 ? 22.396  74.066 60.203 1.00 33.75 ? 424 ASN X OD1 1 
ATOM   3283 N ND2 . ASN A 1 445 ? 23.822  72.752 61.341 1.00 30.05 ? 424 ASN X ND2 1 
ATOM   3284 N N   . HIS A 1 446 ? 19.317  75.760 61.797 1.00 33.00 ? 425 HIS X N   1 
ATOM   3285 C CA  . HIS A 1 446 ? 19.247  77.040 62.435 1.00 33.78 ? 425 HIS X CA  1 
ATOM   3286 C C   . HIS A 1 446 ? 18.134  76.992 63.453 1.00 34.51 ? 425 HIS X C   1 
ATOM   3287 O O   . HIS A 1 446 ? 16.995  76.645 63.134 1.00 35.61 ? 425 HIS X O   1 
ATOM   3288 C CB  . HIS A 1 446 ? 18.949  78.137 61.426 1.00 33.75 ? 425 HIS X CB  1 
ATOM   3289 C CG  . HIS A 1 446 ? 18.799  79.490 62.048 1.00 35.51 ? 425 HIS X CG  1 
ATOM   3290 N ND1 . HIS A 1 446 ? 19.869  80.201 62.544 1.00 36.61 ? 425 HIS X ND1 1 
ATOM   3291 C CD2 . HIS A 1 446 ? 17.701  80.254 62.282 1.00 37.48 ? 425 HIS X CD2 1 
ATOM   3292 C CE1 . HIS A 1 446 ? 19.441  81.353 63.039 1.00 35.49 ? 425 HIS X CE1 1 
ATOM   3293 N NE2 . HIS A 1 446 ? 18.130  81.409 62.894 1.00 35.37 ? 425 HIS X NE2 1 
ATOM   3294 N N   . ARG A 1 447 ? 18.438  77.344 64.690 1.00 34.83 ? 426 ARG X N   1 
ATOM   3295 C CA  . ARG A 1 447 ? 17.383  77.514 65.667 1.00 34.46 ? 426 ARG X CA  1 
ATOM   3296 C C   . ARG A 1 447 ? 16.809  78.929 65.538 1.00 34.03 ? 426 ARG X C   1 
ATOM   3297 O O   . ARG A 1 447 ? 17.536  79.908 65.688 1.00 33.11 ? 426 ARG X O   1 
ATOM   3298 C CB  . ARG A 1 447 ? 17.912  77.277 67.089 1.00 34.78 ? 426 ARG X CB  1 
ATOM   3299 C CG  . ARG A 1 447 ? 16.774  77.132 68.112 1.00 34.76 ? 426 ARG X CG  1 
ATOM   3300 C CD  . ARG A 1 447 ? 17.313  77.003 69.482 1.00 35.69 ? 426 ARG X CD  1 
ATOM   3301 N NE  . ARG A 1 447 ? 16.409  77.598 70.458 1.00 38.30 ? 426 ARG X NE  1 
ATOM   3302 C CZ  . ARG A 1 447 ? 15.464  76.927 71.115 1.00 39.72 ? 426 ARG X CZ  1 
ATOM   3303 N NH1 . ARG A 1 447 ? 14.711  77.573 71.978 1.00 40.79 ? 426 ARG X NH1 1 
ATOM   3304 N NH2 . ARG A 1 447 ? 15.280  75.611 70.931 1.00 38.81 ? 426 ARG X NH2 1 
ATOM   3305 N N   . ALA A 1 448 ? 15.514  79.038 65.258 1.00 33.85 ? 427 ALA X N   1 
ATOM   3306 C CA  . ALA A 1 448 ? 14.894  80.360 65.151 1.00 34.11 ? 427 ALA X CA  1 
ATOM   3307 C C   . ALA A 1 448 ? 15.089  81.225 66.400 1.00 35.04 ? 427 ALA X C   1 
ATOM   3308 O O   . ALA A 1 448 ? 15.042  80.767 67.568 1.00 35.68 ? 427 ALA X O   1 
ATOM   3309 C CB  . ALA A 1 448 ? 13.436  80.262 64.814 1.00 32.72 ? 427 ALA X CB  1 
ATOM   3310 N N   . SER A 1 449 ? 15.309  82.501 66.161 1.00 35.66 ? 428 SER X N   1 
ATOM   3311 C CA  . SER A 1 449 ? 15.615  83.365 67.268 1.00 36.39 ? 428 SER X CA  1 
ATOM   3312 C C   . SER A 1 449 ? 14.335  83.646 68.059 1.00 36.44 ? 428 SER X C   1 
ATOM   3313 O O   . SER A 1 449 ? 14.425  84.071 69.201 1.00 36.57 ? 428 SER X O   1 
ATOM   3314 C CB  . SER A 1 449 ? 16.264  84.655 66.784 1.00 35.90 ? 428 SER X CB  1 
ATOM   3315 O OG  . SER A 1 449 ? 15.304  85.395 66.066 1.00 38.97 ? 428 SER X OG  1 
ATOM   3316 N N   . ASN A 1 450 ? 13.154  83.408 67.473 1.00 35.80 ? 429 ASN X N   1 
ATOM   3317 C CA  . ASN A 1 450 ? 11.900  83.740 68.169 1.00 35.06 ? 429 ASN X CA  1 
ATOM   3318 C C   . ASN A 1 450 ? 11.206  82.494 68.698 1.00 34.93 ? 429 ASN X C   1 
ATOM   3319 O O   . ASN A 1 450 ? 9.987   82.538 68.975 1.00 34.34 ? 429 ASN X O   1 
ATOM   3320 C CB  . ASN A 1 450 ? 10.917  84.482 67.241 1.00 34.91 ? 429 ASN X CB  1 
ATOM   3321 C CG  . ASN A 1 450 ? 10.755  83.788 65.868 1.00 36.44 ? 429 ASN X CG  1 
ATOM   3322 O OD1 . ASN A 1 450 ? 11.158  82.632 65.708 1.00 37.16 ? 429 ASN X OD1 1 
ATOM   3323 N ND2 . ASN A 1 450 ? 10.184  84.501 64.871 1.00 35.67 ? 429 ASN X ND2 1 
ATOM   3324 N N   . LEU A 1 451 ? 11.947  81.391 68.813 1.00 33.90 ? 430 LEU X N   1 
ATOM   3325 C CA  . LEU A 1 451 ? 11.329  80.112 69.126 1.00 34.41 ? 430 LEU X CA  1 
ATOM   3326 C C   . LEU A 1 451 ? 10.787  80.111 70.573 1.00 34.72 ? 430 LEU X C   1 
ATOM   3327 O O   . LEU A 1 451 ? 11.461  80.540 71.509 1.00 35.34 ? 430 LEU X O   1 
ATOM   3328 C CB  . LEU A 1 451 ? 12.365  79.013 68.983 1.00 34.34 ? 430 LEU X CB  1 
ATOM   3329 C CG  . LEU A 1 451 ? 12.337  77.717 68.148 1.00 35.69 ? 430 LEU X CG  1 
ATOM   3330 C CD1 . LEU A 1 451 ? 12.668  76.624 69.138 1.00 36.11 ? 430 LEU X CD1 1 
ATOM   3331 C CD2 . LEU A 1 451 ? 11.078  77.328 67.348 1.00 35.08 ? 430 LEU X CD2 1 
ATOM   3332 N N   . VAL A 1 452 ? 9.582   79.604 70.777 1.00 34.10 ? 431 VAL X N   1 
ATOM   3333 C CA  . VAL A 1 452 ? 9.009   79.628 72.108 1.00 32.56 ? 431 VAL X CA  1 
ATOM   3334 C C   . VAL A 1 452 ? 9.271   78.320 72.885 1.00 32.14 ? 431 VAL X C   1 
ATOM   3335 O O   . VAL A 1 452 ? 9.020   78.224 74.069 1.00 32.38 ? 431 VAL X O   1 
ATOM   3336 C CB  . VAL A 1 452 ? 7.489   79.943 72.004 1.00 33.79 ? 431 VAL X CB  1 
ATOM   3337 C CG1 . VAL A 1 452 ? 7.274   81.351 71.363 1.00 30.09 ? 431 VAL X CG1 1 
ATOM   3338 C CG2 . VAL A 1 452 ? 6.797   78.862 71.173 1.00 32.52 ? 431 VAL X CG2 1 
ATOM   3339 N N   . TRP A 1 453 ? 9.791   77.301 72.223 1.00 31.31 ? 432 TRP X N   1 
ATOM   3340 C CA  . TRP A 1 453 ? 10.152  76.062 72.898 1.00 29.63 ? 432 TRP X CA  1 
ATOM   3341 C C   . TRP A 1 453 ? 11.537  76.152 73.558 1.00 29.68 ? 432 TRP X C   1 
ATOM   3342 O O   . TRP A 1 453 ? 12.425  76.852 73.071 1.00 29.75 ? 432 TRP X O   1 
ATOM   3343 C CB  . TRP A 1 453 ? 10.148  74.941 71.882 1.00 29.32 ? 432 TRP X CB  1 
ATOM   3344 C CG  . TRP A 1 453 ? 8.782   74.675 71.252 1.00 26.99 ? 432 TRP X CG  1 
ATOM   3345 C CD1 . TRP A 1 453 ? 8.353   75.094 70.008 1.00 23.80 ? 432 TRP X CD1 1 
ATOM   3346 C CD2 . TRP A 1 453 ? 7.694   73.930 71.814 1.00 23.42 ? 432 TRP X CD2 1 
ATOM   3347 N NE1 . TRP A 1 453 ? 7.074   74.655 69.767 1.00 20.77 ? 432 TRP X NE1 1 
ATOM   3348 C CE2 . TRP A 1 453 ? 6.639   73.933 70.851 1.00 23.71 ? 432 TRP X CE2 1 
ATOM   3349 C CE3 . TRP A 1 453 ? 7.487   73.287 73.040 1.00 23.54 ? 432 TRP X CE3 1 
ATOM   3350 C CZ2 . TRP A 1 453 ? 5.393   73.293 71.077 1.00 21.15 ? 432 TRP X CZ2 1 
ATOM   3351 C CZ3 . TRP A 1 453 ? 6.228   72.621 73.271 1.00 21.46 ? 432 TRP X CZ3 1 
ATOM   3352 C CH2 . TRP A 1 453 ? 5.216   72.642 72.284 1.00 23.06 ? 432 TRP X CH2 1 
ATOM   3353 N N   . PRO A 1 454 ? 11.749  75.416 74.662 1.00 29.14 ? 433 PRO X N   1 
ATOM   3354 C CA  . PRO A 1 454 ? 13.019  75.575 75.377 1.00 28.53 ? 433 PRO X CA  1 
ATOM   3355 C C   . PRO A 1 454 ? 14.290  75.243 74.572 1.00 29.21 ? 433 PRO X C   1 
ATOM   3356 O O   . PRO A 1 454 ? 14.280  74.424 73.654 1.00 29.23 ? 433 PRO X O   1 
ATOM   3357 C CB  . PRO A 1 454 ? 12.887  74.586 76.535 1.00 28.52 ? 433 PRO X CB  1 
ATOM   3358 C CG  . PRO A 1 454 ? 11.873  73.572 76.086 1.00 27.62 ? 433 PRO X CG  1 
ATOM   3359 C CD  . PRO A 1 454 ? 10.937  74.281 75.167 1.00 28.33 ? 433 PRO X CD  1 
ATOM   3360 N N   . GLU A 1 455 ? 15.383  75.879 74.970 1.00 30.88 ? 434 GLU X N   1 
ATOM   3361 C CA  . GLU A 1 455 ? 16.735  75.692 74.444 1.00 32.19 ? 434 GLU X CA  1 
ATOM   3362 C C   . GLU A 1 455 ? 17.107  74.228 74.198 1.00 30.51 ? 434 GLU X C   1 
ATOM   3363 O O   . GLU A 1 455 ? 17.650  73.912 73.157 1.00 30.19 ? 434 GLU X O   1 
ATOM   3364 C CB  . GLU A 1 455 ? 17.738  76.272 75.433 1.00 33.58 ? 434 GLU X CB  1 
ATOM   3365 C CG  . GLU A 1 455 ? 18.855  77.028 74.783 1.00 43.54 ? 434 GLU X CG  1 
ATOM   3366 C CD  . GLU A 1 455 ? 18.334  78.385 74.279 1.00 56.38 ? 434 GLU X CD  1 
ATOM   3367 O OE1 . GLU A 1 455 ? 17.850  79.174 75.146 1.00 58.58 ? 434 GLU X OE1 1 
ATOM   3368 O OE2 . GLU A 1 455 ? 18.388  78.658 73.031 1.00 61.35 ? 434 GLU X OE2 1 
ATOM   3369 N N   . TRP A 1 456 ? 16.834  73.337 75.144 1.00 29.23 ? 435 TRP X N   1 
ATOM   3370 C CA  . TRP A 1 456 ? 17.325  71.937 75.034 1.00 28.85 ? 435 TRP X CA  1 
ATOM   3371 C C   . TRP A 1 456 ? 16.694  71.144 73.871 1.00 28.40 ? 435 TRP X C   1 
ATOM   3372 O O   . TRP A 1 456 ? 17.202  70.115 73.455 1.00 28.00 ? 435 TRP X O   1 
ATOM   3373 C CB  . TRP A 1 456 ? 17.124  71.145 76.341 1.00 27.98 ? 435 TRP X CB  1 
ATOM   3374 C CG  . TRP A 1 456 ? 15.627  70.796 76.675 1.00 29.06 ? 435 TRP X CG  1 
ATOM   3375 C CD1 . TRP A 1 456 ? 14.795  71.479 77.538 1.00 30.01 ? 435 TRP X CD1 1 
ATOM   3376 C CD2 . TRP A 1 456 ? 14.839  69.668 76.195 1.00 28.58 ? 435 TRP X CD2 1 
ATOM   3377 N NE1 . TRP A 1 456 ? 13.550  70.856 77.621 1.00 27.97 ? 435 TRP X NE1 1 
ATOM   3378 C CE2 . TRP A 1 456 ? 13.548  69.751 76.818 1.00 28.07 ? 435 TRP X CE2 1 
ATOM   3379 C CE3 . TRP A 1 456 ? 15.093  68.605 75.311 1.00 27.12 ? 435 TRP X CE3 1 
ATOM   3380 C CZ2 . TRP A 1 456 ? 12.516  68.831 76.554 1.00 25.15 ? 435 TRP X CZ2 1 
ATOM   3381 C CZ3 . TRP A 1 456 ? 14.073  67.673 75.075 1.00 25.99 ? 435 TRP X CZ3 1 
ATOM   3382 C CH2 . TRP A 1 456 ? 12.797  67.803 75.694 1.00 25.01 ? 435 TRP X CH2 1 
ATOM   3383 N N   . MET A 1 457 ? 15.575  71.608 73.360 1.00 28.00 ? 436 MET X N   1 
ATOM   3384 C CA  . MET A 1 457 ? 14.929  70.851 72.330 1.00 28.11 ? 436 MET X CA  1 
ATOM   3385 C C   . MET A 1 457 ? 15.672  70.968 71.009 1.00 27.95 ? 436 MET X C   1 
ATOM   3386 O O   . MET A 1 457 ? 15.454  70.130 70.129 1.00 28.41 ? 436 MET X O   1 
ATOM   3387 C CB  . MET A 1 457 ? 13.444  71.241 72.191 1.00 28.55 ? 436 MET X CB  1 
ATOM   3388 C CG  . MET A 1 457 ? 12.560  70.792 73.382 1.00 27.90 ? 436 MET X CG  1 
ATOM   3389 S SD  . MET A 1 457 ? 10.820  71.270 73.185 1.00 31.08 ? 436 MET X SD  1 
ATOM   3390 C CE  . MET A 1 457 ? 10.345  69.993 71.946 1.00 29.45 ? 436 MET X CE  1 
ATOM   3391 N N   . GLY A 1 458 ? 16.536  71.986 70.872 1.00 27.33 ? 437 GLY X N   1 
ATOM   3392 C CA  . GLY A 1 458 ? 17.413  72.123 69.709 1.00 26.65 ? 437 GLY X CA  1 
ATOM   3393 C C   . GLY A 1 458 ? 16.765  72.701 68.457 1.00 27.35 ? 437 GLY X C   1 
ATOM   3394 O O   . GLY A 1 458 ? 15.916  73.588 68.541 1.00 28.25 ? 437 GLY X O   1 
ATOM   3395 N N   . VAL A 1 459 ? 17.184  72.226 67.282 1.00 27.19 ? 438 VAL X N   1 
ATOM   3396 C CA  . VAL A 1 459 ? 16.523  72.566 66.017 1.00 26.96 ? 438 VAL X CA  1 
ATOM   3397 C C   . VAL A 1 459 ? 15.491  71.471 65.762 1.00 27.59 ? 438 VAL X C   1 
ATOM   3398 O O   . VAL A 1 459 ? 15.809  70.350 65.339 1.00 27.95 ? 438 VAL X O   1 
ATOM   3399 C CB  . VAL A 1 459 ? 17.494  72.573 64.851 1.00 27.19 ? 438 VAL X CB  1 
ATOM   3400 C CG1 . VAL A 1 459 ? 16.778  73.034 63.552 1.00 25.19 ? 438 VAL X CG1 1 
ATOM   3401 C CG2 . VAL A 1 459 ? 18.714  73.420 65.200 1.00 26.69 ? 438 VAL X CG2 1 
ATOM   3402 N N   . ILE A 1 460 ? 14.249  71.828 66.031 1.00 27.08 ? 439 ILE X N   1 
ATOM   3403 C CA  . ILE A 1 460 ? 13.181  70.919 66.306 1.00 25.99 ? 439 ILE X CA  1 
ATOM   3404 C C   . ILE A 1 460 ? 12.435  70.376 65.061 1.00 25.91 ? 439 ILE X C   1 
ATOM   3405 O O   . ILE A 1 460 ? 12.265  71.098 64.041 1.00 25.10 ? 439 ILE X O   1 
ATOM   3406 C CB  . ILE A 1 460 ? 12.173  71.776 66.943 1.00 26.12 ? 439 ILE X CB  1 
ATOM   3407 C CG1 . ILE A 1 460 ? 12.446  72.033 68.392 1.00 27.74 ? 439 ILE X CG1 1 
ATOM   3408 C CG2 . ILE A 1 460 ? 10.838  71.208 66.848 1.00 28.36 ? 439 ILE X CG2 1 
ATOM   3409 C CD1 . ILE A 1 460 ? 11.309  73.007 68.818 1.00 29.55 ? 439 ILE X CD1 1 
ATOM   3410 N N   . HIS A 1 461 ? 11.932  69.131 65.159 1.00 24.81 ? 440 HIS X N   1 
ATOM   3411 C CA  . HIS A 1 461 ? 10.975  68.614 64.183 1.00 23.70 ? 440 HIS X CA  1 
ATOM   3412 C C   . HIS A 1 461 ? 9.973   69.728 63.831 1.00 24.51 ? 440 HIS X C   1 
ATOM   3413 O O   . HIS A 1 461 ? 9.436   70.358 64.708 1.00 23.86 ? 440 HIS X O   1 
ATOM   3414 C CB  . HIS A 1 461 ? 10.273  67.435 64.802 1.00 22.70 ? 440 HIS X CB  1 
ATOM   3415 C CG  . HIS A 1 461 ? 9.557   66.536 63.840 1.00 23.10 ? 440 HIS X CG  1 
ATOM   3416 N ND1 . HIS A 1 461 ? 10.172  65.962 62.737 1.00 21.15 ? 440 HIS X ND1 1 
ATOM   3417 C CD2 . HIS A 1 461 ? 8.293   66.029 63.879 1.00 20.92 ? 440 HIS X CD2 1 
ATOM   3418 C CE1 . HIS A 1 461 ? 9.295   65.189 62.111 1.00 22.01 ? 440 HIS X CE1 1 
ATOM   3419 N NE2 . HIS A 1 461 ? 8.156   65.195 62.795 1.00 20.34 ? 440 HIS X NE2 1 
ATOM   3420 N N   . GLY A 1 462 ? 9.740   69.985 62.544 1.00 25.16 ? 441 GLY X N   1 
ATOM   3421 C CA  . GLY A 1 462 ? 8.653   70.857 62.148 1.00 26.03 ? 441 GLY X CA  1 
ATOM   3422 C C   . GLY A 1 462 ? 9.040   72.315 61.978 1.00 27.15 ? 441 GLY X C   1 
ATOM   3423 O O   . GLY A 1 462 ? 8.318   73.128 61.420 1.00 28.52 ? 441 GLY X O   1 
ATOM   3424 N N   . TYR A 1 463 ? 10.204  72.692 62.422 1.00 27.49 ? 442 TYR X N   1 
ATOM   3425 C CA  . TYR A 1 463 ? 10.452  74.111 62.382 1.00 26.90 ? 442 TYR X CA  1 
ATOM   3426 C C   . TYR A 1 463 ? 11.210  74.598 61.171 1.00 26.00 ? 442 TYR X C   1 
ATOM   3427 O O   . TYR A 1 463 ? 11.636  75.740 61.155 1.00 26.95 ? 442 TYR X O   1 
ATOM   3428 C CB  . TYR A 1 463 ? 11.010  74.603 63.744 1.00 26.62 ? 442 TYR X CB  1 
ATOM   3429 C CG  . TYR A 1 463 ? 9.832   74.775 64.685 1.00 29.14 ? 442 TYR X CG  1 
ATOM   3430 C CD1 . TYR A 1 463 ? 9.049   73.664 65.065 1.00 29.64 ? 442 TYR X CD1 1 
ATOM   3431 C CD2 . TYR A 1 463 ? 9.416   76.061 65.113 1.00 28.23 ? 442 TYR X CD2 1 
ATOM   3432 C CE1 . TYR A 1 463 ? 7.887   73.824 65.900 1.00 30.62 ? 442 TYR X CE1 1 
ATOM   3433 C CE2 . TYR A 1 463 ? 8.285   76.216 65.945 1.00 28.08 ? 442 TYR X CE2 1 
ATOM   3434 C CZ  . TYR A 1 463 ? 7.523   75.114 66.336 1.00 29.29 ? 442 TYR X CZ  1 
ATOM   3435 O OH  . TYR A 1 463 ? 6.408   75.316 67.140 1.00 28.18 ? 442 TYR X OH  1 
ATOM   3436 N N   . GLU A 1 464 ? 11.402  73.760 60.157 1.00 25.73 ? 443 GLU X N   1 
ATOM   3437 C CA  . GLU A 1 464 ? 11.956  74.301 58.863 1.00 25.06 ? 443 GLU X CA  1 
ATOM   3438 C C   . GLU A 1 464 ? 10.821  74.783 58.002 1.00 24.91 ? 443 GLU X C   1 
ATOM   3439 O O   . GLU A 1 464 ? 11.031  75.582 57.121 1.00 25.48 ? 443 GLU X O   1 
ATOM   3440 C CB  . GLU A 1 464 ? 12.823  73.332 58.050 1.00 23.67 ? 443 GLU X CB  1 
ATOM   3441 C CG  . GLU A 1 464 ? 12.040  72.356 57.185 1.00 23.24 ? 443 GLU X CG  1 
ATOM   3442 C CD  . GLU A 1 464 ? 11.166  71.427 58.026 1.00 25.17 ? 443 GLU X CD  1 
ATOM   3443 O OE1 . GLU A 1 464 ? 11.330  71.413 59.261 1.00 28.94 ? 443 GLU X OE1 1 
ATOM   3444 O OE2 . GLU A 1 464 ? 10.301  70.729 57.489 1.00 24.20 ? 443 GLU X OE2 1 
ATOM   3445 N N   . ILE A 1 465 ? 9.618   74.303 58.297 1.00 25.15 ? 444 ILE X N   1 
ATOM   3446 C CA  . ILE A 1 465 ? 8.431   74.641 57.539 1.00 25.44 ? 444 ILE X CA  1 
ATOM   3447 C C   . ILE A 1 465 ? 8.260   76.163 57.417 1.00 25.80 ? 444 ILE X C   1 
ATOM   3448 O O   . ILE A 1 465 ? 8.132   76.683 56.329 1.00 25.82 ? 444 ILE X O   1 
ATOM   3449 C CB  . ILE A 1 465 ? 7.174   73.967 58.181 1.00 25.40 ? 444 ILE X CB  1 
ATOM   3450 C CG1 . ILE A 1 465 ? 7.320   72.452 58.153 1.00 24.72 ? 444 ILE X CG1 1 
ATOM   3451 C CG2 . ILE A 1 465 ? 5.911   74.391 57.484 1.00 24.34 ? 444 ILE X CG2 1 
ATOM   3452 C CD1 . ILE A 1 465 ? 6.086   71.709 58.625 1.00 22.84 ? 444 ILE X CD1 1 
ATOM   3453 N N   . GLU A 1 466 ? 8.278   76.881 58.534 1.00 27.15 ? 445 GLU X N   1 
ATOM   3454 C CA  . GLU A 1 466 ? 8.134   78.351 58.496 1.00 27.88 ? 445 GLU X CA  1 
ATOM   3455 C C   . GLU A 1 466 ? 9.194   79.043 57.648 1.00 27.49 ? 445 GLU X C   1 
ATOM   3456 O O   . GLU A 1 466 ? 8.930   80.103 57.068 1.00 27.49 ? 445 GLU X O   1 
ATOM   3457 C CB  . GLU A 1 466 ? 8.132   78.957 59.908 1.00 28.63 ? 445 GLU X CB  1 
ATOM   3458 C CG  . GLU A 1 466 ? 9.356   78.624 60.737 1.00 30.58 ? 445 GLU X CG  1 
ATOM   3459 C CD  . GLU A 1 466 ? 9.126   78.867 62.230 1.00 32.22 ? 445 GLU X CD  1 
ATOM   3460 O OE1 . GLU A 1 466 ? 8.204   78.223 62.810 1.00 32.28 ? 445 GLU X OE1 1 
ATOM   3461 O OE2 . GLU A 1 466 ? 9.885   79.685 62.820 1.00 31.89 ? 445 GLU X OE2 1 
ATOM   3462 N N   . PHE A 1 467 ? 10.386  78.468 57.536 1.00 26.80 ? 446 PHE X N   1 
ATOM   3463 C CA  . PHE A 1 467 ? 11.290  79.032 56.531 1.00 26.33 ? 446 PHE X CA  1 
ATOM   3464 C C   . PHE A 1 467 ? 10.844  78.715 55.111 1.00 26.63 ? 446 PHE X C   1 
ATOM   3465 O O   . PHE A 1 467 ? 10.814  79.572 54.244 1.00 27.30 ? 446 PHE X O   1 
ATOM   3466 C CB  . PHE A 1 467 ? 12.736  78.657 56.782 1.00 25.82 ? 446 PHE X CB  1 
ATOM   3467 C CG  . PHE A 1 467 ? 13.283  79.272 58.028 1.00 24.66 ? 446 PHE X CG  1 
ATOM   3468 C CD1 . PHE A 1 467 ? 12.989  78.713 59.270 1.00 21.94 ? 446 PHE X CD1 1 
ATOM   3469 C CD2 . PHE A 1 467 ? 14.042  80.434 57.969 1.00 24.08 ? 446 PHE X CD2 1 
ATOM   3470 C CE1 . PHE A 1 467 ? 13.448  79.292 60.420 1.00 21.63 ? 446 PHE X CE1 1 
ATOM   3471 C CE2 . PHE A 1 467 ? 14.536  81.028 59.139 1.00 23.45 ? 446 PHE X CE2 1 
ATOM   3472 C CZ  . PHE A 1 467 ? 14.223  80.463 60.372 1.00 21.53 ? 446 PHE X CZ  1 
ATOM   3473 N N   . VAL A 1 468 ? 10.465  77.474 54.870 1.00 27.00 ? 447 VAL X N   1 
ATOM   3474 C CA  . VAL A 1 468 ? 10.134  77.072 53.529 1.00 26.71 ? 447 VAL X CA  1 
ATOM   3475 C C   . VAL A 1 468 ? 8.925   77.850 53.068 1.00 27.78 ? 447 VAL X C   1 
ATOM   3476 O O   . VAL A 1 468 ? 8.803   78.109 51.866 1.00 27.83 ? 447 VAL X O   1 
ATOM   3477 C CB  . VAL A 1 468 ? 9.740   75.622 53.484 1.00 26.72 ? 447 VAL X CB  1 
ATOM   3478 C CG1 . VAL A 1 468 ? 8.932   75.326 52.200 1.00 24.38 ? 447 VAL X CG1 1 
ATOM   3479 C CG2 . VAL A 1 468 ? 10.963  74.741 53.655 1.00 27.06 ? 447 VAL X CG2 1 
ATOM   3480 N N   . PHE A 1 469 ? 8.015   78.175 53.997 1.00 27.87 ? 448 PHE X N   1 
ATOM   3481 C CA  . PHE A 1 469 ? 6.824   78.926 53.642 1.00 29.08 ? 448 PHE X CA  1 
ATOM   3482 C C   . PHE A 1 469 ? 6.989   80.464 53.706 1.00 30.04 ? 448 PHE X C   1 
ATOM   3483 O O   . PHE A 1 469 ? 6.043   81.243 53.425 1.00 29.35 ? 448 PHE X O   1 
ATOM   3484 C CB  . PHE A 1 469 ? 5.627   78.470 54.438 1.00 28.93 ? 448 PHE X CB  1 
ATOM   3485 C CG  . PHE A 1 469 ? 4.922   77.296 53.828 1.00 30.54 ? 448 PHE X CG  1 
ATOM   3486 C CD1 . PHE A 1 469 ? 5.401   75.998 54.036 1.00 29.86 ? 448 PHE X CD1 1 
ATOM   3487 C CD2 . PHE A 1 469 ? 3.761   77.482 53.041 1.00 31.10 ? 448 PHE X CD2 1 
ATOM   3488 C CE1 . PHE A 1 469 ? 4.746   74.896 53.456 1.00 30.84 ? 448 PHE X CE1 1 
ATOM   3489 C CE2 . PHE A 1 469 ? 3.068   76.387 52.458 1.00 27.24 ? 448 PHE X CE2 1 
ATOM   3490 C CZ  . PHE A 1 469 ? 3.556   75.106 52.655 1.00 31.35 ? 448 PHE X CZ  1 
ATOM   3491 N N   . GLY A 1 470 ? 8.199   80.891 54.053 1.00 30.57 ? 449 GLY X N   1 
ATOM   3492 C CA  . GLY A 1 470 ? 8.478   82.308 54.077 1.00 32.41 ? 449 GLY X CA  1 
ATOM   3493 C C   . GLY A 1 470 ? 7.892   83.192 55.162 1.00 33.37 ? 449 GLY X C   1 
ATOM   3494 O O   . GLY A 1 470 ? 7.854   84.357 54.970 1.00 33.54 ? 449 GLY X O   1 
ATOM   3495 N N   . LEU A 1 471 ? 7.479   82.669 56.314 1.00 34.93 ? 450 LEU X N   1 
ATOM   3496 C CA  . LEU A 1 471 ? 7.021   83.525 57.442 1.00 36.00 ? 450 LEU X CA  1 
ATOM   3497 C C   . LEU A 1 471 ? 8.031   84.565 57.920 1.00 37.43 ? 450 LEU X C   1 
ATOM   3498 O O   . LEU A 1 471 ? 7.639   85.602 58.451 1.00 38.71 ? 450 LEU X O   1 
ATOM   3499 C CB  . LEU A 1 471 ? 6.576   82.702 58.653 1.00 35.28 ? 450 LEU X CB  1 
ATOM   3500 C CG  . LEU A 1 471 ? 5.347   81.835 58.419 1.00 34.01 ? 450 LEU X CG  1 
ATOM   3501 C CD1 . LEU A 1 471 ? 4.135   82.585 58.744 1.00 34.16 ? 450 LEU X CD1 1 
ATOM   3502 C CD2 . LEU A 1 471 ? 5.317   81.443 56.957 1.00 33.75 ? 450 LEU X CD2 1 
ATOM   3503 N N   . PRO A 1 472 ? 9.328   84.310 57.759 1.00 38.09 ? 451 PRO X N   1 
ATOM   3504 C CA  . PRO A 1 472 ? 10.215  85.370 58.228 1.00 38.98 ? 451 PRO X CA  1 
ATOM   3505 C C   . PRO A 1 472 ? 10.250  86.643 57.364 1.00 39.78 ? 451 PRO X C   1 
ATOM   3506 O O   . PRO A 1 472 ? 11.023  87.542 57.676 1.00 40.24 ? 451 PRO X O   1 
ATOM   3507 C CB  . PRO A 1 472 ? 11.601  84.704 58.220 1.00 38.33 ? 451 PRO X CB  1 
ATOM   3508 C CG  . PRO A 1 472 ? 11.311  83.283 58.376 1.00 38.50 ? 451 PRO X CG  1 
ATOM   3509 C CD  . PRO A 1 472 ? 10.053  83.053 57.561 1.00 38.65 ? 451 PRO X CD  1 
ATOM   3510 N N   . LEU A 1 473 ? 9.494   86.723 56.275 1.00 40.36 ? 452 LEU X N   1 
ATOM   3511 C CA  . LEU A 1 473 ? 9.392   88.006 55.620 1.00 41.22 ? 452 LEU X CA  1 
ATOM   3512 C C   . LEU A 1 473 ? 8.308   88.896 56.227 1.00 42.79 ? 452 LEU X C   1 
ATOM   3513 O O   . LEU A 1 473 ? 8.213   90.056 55.857 1.00 43.89 ? 452 LEU X O   1 
ATOM   3514 C CB  . LEU A 1 473 ? 9.107   87.900 54.145 1.00 40.37 ? 452 LEU X CB  1 
ATOM   3515 C CG  . LEU A 1 473 ? 9.565   86.785 53.234 1.00 41.40 ? 452 LEU X CG  1 
ATOM   3516 C CD1 . LEU A 1 473 ? 9.600   87.303 51.778 1.00 40.68 ? 452 LEU X CD1 1 
ATOM   3517 C CD2 . LEU A 1 473 ? 10.878  86.230 53.659 1.00 42.33 ? 452 LEU X CD2 1 
ATOM   3518 N N   . VAL A 1 474 ? 7.448   88.394 57.105 1.00 44.13 ? 453 VAL X N   1 
ATOM   3519 C CA  . VAL A 1 474 ? 6.520   89.332 57.728 1.00 45.66 ? 453 VAL X CA  1 
ATOM   3520 C C   . VAL A 1 474 ? 7.182   89.884 59.015 1.00 47.66 ? 453 VAL X C   1 
ATOM   3521 O O   . VAL A 1 474 ? 7.470   89.136 59.966 1.00 47.93 ? 453 VAL X O   1 
ATOM   3522 C CB  . VAL A 1 474 ? 5.056   88.770 57.940 1.00 45.48 ? 453 VAL X CB  1 
ATOM   3523 C CG1 . VAL A 1 474 ? 4.702   87.639 56.955 1.00 45.13 ? 453 VAL X CG1 1 
ATOM   3524 C CG2 . VAL A 1 474 ? 4.839   88.295 59.323 1.00 45.34 ? 453 VAL X CG2 1 
ATOM   3525 N N   . LYS A 1 475 ? 7.475   91.185 59.033 1.00 49.30 ? 454 LYS X N   1 
ATOM   3526 C CA  . LYS A 1 475 ? 8.177   91.772 60.188 1.00 50.78 ? 454 LYS X CA  1 
ATOM   3527 C C   . LYS A 1 475 ? 7.485   91.612 61.561 1.00 49.95 ? 454 LYS X C   1 
ATOM   3528 O O   . LYS A 1 475 ? 8.164   91.362 62.560 1.00 48.94 ? 454 LYS X O   1 
ATOM   3529 C CB  . LYS A 1 475 ? 8.602   93.230 59.898 1.00 51.80 ? 454 LYS X CB  1 
ATOM   3530 C CG  . LYS A 1 475 ? 9.811   93.307 58.898 1.00 57.48 ? 454 LYS X CG  1 
ATOM   3531 C CD  . LYS A 1 475 ? 10.849  92.087 59.123 1.00 66.19 ? 454 LYS X CD  1 
ATOM   3532 C CE  . LYS A 1 475 ? 11.903  91.869 57.975 1.00 67.72 ? 454 LYS X CE  1 
ATOM   3533 N NZ  . LYS A 1 475 ? 11.421  92.407 56.635 1.00 69.49 ? 454 LYS X NZ  1 
ATOM   3534 N N   . GLU A 1 476 ? 6.152   91.736 61.595 1.00 49.46 ? 455 GLU X N   1 
ATOM   3535 C CA  . GLU A 1 476 ? 5.379   91.585 62.830 1.00 49.76 ? 455 GLU X CA  1 
ATOM   3536 C C   . GLU A 1 476 ? 5.790   90.289 63.531 1.00 49.28 ? 455 GLU X C   1 
ATOM   3537 O O   . GLU A 1 476 ? 5.590   90.131 64.749 1.00 49.63 ? 455 GLU X O   1 
ATOM   3538 C CB  . GLU A 1 476 ? 3.863   91.518 62.559 1.00 50.37 ? 455 GLU X CB  1 
ATOM   3539 C CG  . GLU A 1 476 ? 3.194   92.718 61.839 1.00 55.09 ? 455 GLU X CG  1 
ATOM   3540 C CD  . GLU A 1 476 ? 3.844   93.141 60.476 1.00 63.23 ? 455 GLU X CD  1 
ATOM   3541 O OE1 . GLU A 1 476 ? 4.396   92.279 59.721 1.00 65.47 ? 455 GLU X OE1 1 
ATOM   3542 O OE2 . GLU A 1 476 ? 3.784   94.368 60.152 1.00 64.84 ? 455 GLU X OE2 1 
ATOM   3543 N N   . LEU A 1 477 ? 6.352   89.344 62.782 1.00 48.25 ? 456 LEU X N   1 
ATOM   3544 C CA  . LEU A 1 477 ? 6.656   88.055 63.386 1.00 47.42 ? 456 LEU X CA  1 
ATOM   3545 C C   . LEU A 1 477 ? 8.012   87.975 64.125 1.00 47.37 ? 456 LEU X C   1 
ATOM   3546 O O   . LEU A 1 477 ? 8.229   87.089 64.959 1.00 46.85 ? 456 LEU X O   1 
ATOM   3547 C CB  . LEU A 1 477 ? 6.425   86.908 62.410 1.00 47.14 ? 456 LEU X CB  1 
ATOM   3548 C CG  . LEU A 1 477 ? 4.959   86.608 62.024 1.00 46.42 ? 456 LEU X CG  1 
ATOM   3549 C CD1 . LEU A 1 477 ? 4.918   85.293 61.244 1.00 45.25 ? 456 LEU X CD1 1 
ATOM   3550 C CD2 . LEU A 1 477 ? 3.907   86.604 63.170 1.00 42.11 ? 456 LEU X CD2 1 
ATOM   3551 N N   . ASN A 1 478 ? 8.887   88.942 63.869 1.00 47.25 ? 457 ASN X N   1 
ATOM   3552 C CA  . ASN A 1 478 ? 10.014  89.180 64.765 1.00 47.51 ? 457 ASN X CA  1 
ATOM   3553 C C   . ASN A 1 478 ? 11.186  88.278 64.393 1.00 46.51 ? 457 ASN X C   1 
ATOM   3554 O O   . ASN A 1 478 ? 11.858  87.784 65.310 1.00 46.72 ? 457 ASN X O   1 
ATOM   3555 C CB  . ASN A 1 478 ? 9.663   88.908 66.277 1.00 48.38 ? 457 ASN X CB  1 
ATOM   3556 C CG  . ASN A 1 478 ? 8.709   90.004 66.952 1.00 52.52 ? 457 ASN X CG  1 
ATOM   3557 O OD1 . ASN A 1 478 ? 8.601   91.142 66.470 1.00 56.55 ? 457 ASN X OD1 1 
ATOM   3558 N ND2 . ASN A 1 478 ? 8.051   89.624 68.098 1.00 55.27 ? 457 ASN X ND2 1 
ATOM   3559 N N   . TYR A 1 479 ? 11.446  88.024 63.104 1.00 44.52 ? 458 TYR X N   1 
ATOM   3560 C CA  . TYR A 1 479 ? 12.715  87.315 62.765 1.00 42.99 ? 458 TYR X CA  1 
ATOM   3561 C C   . TYR A 1 479 ? 13.865  88.309 62.559 1.00 43.06 ? 458 TYR X C   1 
ATOM   3562 O O   . TYR A 1 479 ? 13.656  89.484 62.266 1.00 42.99 ? 458 TYR X O   1 
ATOM   3563 C CB  . TYR A 1 479 ? 12.611  86.343 61.560 1.00 41.48 ? 458 TYR X CB  1 
ATOM   3564 C CG  . TYR A 1 479 ? 11.607  85.204 61.725 1.00 39.18 ? 458 TYR X CG  1 
ATOM   3565 C CD1 . TYR A 1 479 ? 10.237  85.397 61.496 1.00 37.08 ? 458 TYR X CD1 1 
ATOM   3566 C CD2 . TYR A 1 479 ? 12.028  83.936 62.119 1.00 36.18 ? 458 TYR X CD2 1 
ATOM   3567 C CE1 . TYR A 1 479 ? 9.320   84.371 61.659 1.00 33.33 ? 458 TYR X CE1 1 
ATOM   3568 C CE2 . TYR A 1 479 ? 11.137  82.897 62.292 1.00 31.96 ? 458 TYR X CE2 1 
ATOM   3569 C CZ  . TYR A 1 479 ? 9.782   83.097 62.063 1.00 33.39 ? 458 TYR X CZ  1 
ATOM   3570 O OH  . TYR A 1 479 ? 8.913   82.000 62.206 1.00 26.02 ? 458 TYR X OH  1 
ATOM   3571 N N   . THR A 1 480 ? 15.090  87.843 62.732 1.00 42.82 ? 459 THR X N   1 
ATOM   3572 C CA  . THR A 1 480 ? 16.216  88.707 62.439 1.00 41.80 ? 459 THR X CA  1 
ATOM   3573 C C   . THR A 1 480 ? 16.253  88.874 60.927 1.00 42.05 ? 459 THR X C   1 
ATOM   3574 O O   . THR A 1 480 ? 15.578  88.170 60.201 1.00 41.88 ? 459 THR X O   1 
ATOM   3575 C CB  . THR A 1 480 ? 17.549  88.104 62.967 1.00 41.64 ? 459 THR X CB  1 
ATOM   3576 O OG1 . THR A 1 480 ? 17.951  86.973 62.170 1.00 39.24 ? 459 THR X OG1 1 
ATOM   3577 C CG2 . THR A 1 480 ? 17.370  87.695 64.398 1.00 40.38 ? 459 THR X CG2 1 
ATOM   3578 N N   . ALA A 1 481 ? 17.060  89.793 60.440 1.00 41.89 ? 460 ALA X N   1 
ATOM   3579 C CA  . ALA A 1 481 ? 17.176  89.932 59.017 1.00 41.29 ? 460 ALA X CA  1 
ATOM   3580 C C   . ALA A 1 481 ? 17.959  88.751 58.412 1.00 40.94 ? 460 ALA X C   1 
ATOM   3581 O O   . ALA A 1 481 ? 17.775  88.418 57.240 1.00 40.11 ? 460 ALA X O   1 
ATOM   3582 C CB  . ALA A 1 481 ? 17.834  91.263 58.682 1.00 41.14 ? 460 ALA X CB  1 
ATOM   3583 N N   . GLU A 1 482 ? 18.864  88.128 59.164 1.00 40.58 ? 461 GLU X N   1 
ATOM   3584 C CA  . GLU A 1 482 ? 19.601  87.029 58.519 1.00 40.80 ? 461 GLU X CA  1 
ATOM   3585 C C   . GLU A 1 482 ? 18.678  85.778 58.410 1.00 40.06 ? 461 GLU X C   1 
ATOM   3586 O O   . GLU A 1 482 ? 18.849  84.896 57.539 1.00 38.85 ? 461 GLU X O   1 
ATOM   3587 C CB  . GLU A 1 482 ? 21.028  86.782 59.081 1.00 40.53 ? 461 GLU X CB  1 
ATOM   3588 C CG  . GLU A 1 482 ? 21.263  87.160 60.527 1.00 44.15 ? 461 GLU X CG  1 
ATOM   3589 C CD  . GLU A 1 482 ? 21.296  88.686 60.800 1.00 48.03 ? 461 GLU X CD  1 
ATOM   3590 O OE1 . GLU A 1 482 ? 22.265  89.364 60.379 1.00 47.99 ? 461 GLU X OE1 1 
ATOM   3591 O OE2 . GLU A 1 482 ? 20.361  89.207 61.472 1.00 49.38 ? 461 GLU X OE2 1 
ATOM   3592 N N   . GLU A 1 483 ? 17.633  85.785 59.245 1.00 39.14 ? 462 GLU X N   1 
ATOM   3593 C CA  . GLU A 1 483 ? 16.595  84.801 59.120 1.00 37.54 ? 462 GLU X CA  1 
ATOM   3594 C C   . GLU A 1 483 ? 15.702  85.060 57.935 1.00 37.16 ? 462 GLU X C   1 
ATOM   3595 O O   . GLU A 1 483 ? 15.326  84.119 57.251 1.00 38.05 ? 462 GLU X O   1 
ATOM   3596 C CB  . GLU A 1 483 ? 15.810  84.664 60.396 1.00 37.39 ? 462 GLU X CB  1 
ATOM   3597 C CG  . GLU A 1 483 ? 16.590  83.881 61.436 1.00 36.70 ? 462 GLU X CG  1 
ATOM   3598 C CD  . GLU A 1 483 ? 15.941  83.911 62.808 1.00 37.61 ? 462 GLU X CD  1 
ATOM   3599 O OE1 . GLU A 1 483 ? 15.046  84.764 63.062 1.00 37.14 ? 462 GLU X OE1 1 
ATOM   3600 O OE2 . GLU A 1 483 ? 16.339  83.067 63.626 1.00 36.06 ? 462 GLU X OE2 1 
ATOM   3601 N N   . GLU A 1 484 ? 15.396  86.314 57.636 1.00 36.23 ? 463 GLU X N   1 
ATOM   3602 C CA  . GLU A 1 484 ? 14.605  86.596 56.434 1.00 35.34 ? 463 GLU X CA  1 
ATOM   3603 C C   . GLU A 1 484 ? 15.398  86.192 55.234 1.00 34.18 ? 463 GLU X C   1 
ATOM   3604 O O   . GLU A 1 484 ? 14.835  85.701 54.246 1.00 35.20 ? 463 GLU X O   1 
ATOM   3605 C CB  . GLU A 1 484 ? 14.189  88.064 56.312 1.00 35.34 ? 463 GLU X CB  1 
ATOM   3606 C CG  . GLU A 1 484 ? 14.179  88.560 54.866 1.00 38.44 ? 463 GLU X CG  1 
ATOM   3607 C CD  . GLU A 1 484 ? 13.477  89.914 54.666 1.00 42.46 ? 463 GLU X CD  1 
ATOM   3608 O OE1 . GLU A 1 484 ? 13.466  90.731 55.633 1.00 44.59 ? 463 GLU X OE1 1 
ATOM   3609 O OE2 . GLU A 1 484 ? 12.951  90.154 53.536 1.00 41.35 ? 463 GLU X OE2 1 
ATOM   3610 N N   . ALA A 1 485 ? 16.710  86.382 55.303 1.00 32.93 ? 464 ALA X N   1 
ATOM   3611 C CA  . ALA A 1 485 ? 17.546  86.058 54.147 1.00 32.45 ? 464 ALA X CA  1 
ATOM   3612 C C   . ALA A 1 485 ? 17.590  84.554 53.903 1.00 32.55 ? 464 ALA X C   1 
ATOM   3613 O O   . ALA A 1 485 ? 17.516  84.103 52.765 1.00 32.92 ? 464 ALA X O   1 
ATOM   3614 C CB  . ALA A 1 485 ? 18.960  86.633 54.284 1.00 31.52 ? 464 ALA X CB  1 
ATOM   3615 N N   . LEU A 1 486 ? 17.717  83.779 54.978 1.00 32.25 ? 465 LEU X N   1 
ATOM   3616 C CA  . LEU A 1 486 ? 17.800  82.343 54.848 1.00 31.66 ? 465 LEU X CA  1 
ATOM   3617 C C   . LEU A 1 486 ? 16.488  81.825 54.266 1.00 31.93 ? 465 LEU X C   1 
ATOM   3618 O O   . LEU A 1 486 ? 16.481  80.974 53.346 1.00 32.08 ? 465 LEU X O   1 
ATOM   3619 C CB  . LEU A 1 486 ? 18.092  81.715 56.207 1.00 31.43 ? 465 LEU X CB  1 
ATOM   3620 C CG  . LEU A 1 486 ? 17.792  80.233 56.325 1.00 28.94 ? 465 LEU X CG  1 
ATOM   3621 C CD1 . LEU A 1 486 ? 18.679  79.449 55.430 1.00 27.73 ? 465 LEU X CD1 1 
ATOM   3622 C CD2 . LEU A 1 486 ? 17.961  79.815 57.744 1.00 26.59 ? 465 LEU X CD2 1 
ATOM   3623 N N   . SER A 1 487 ? 15.386  82.368 54.770 1.00 31.01 ? 466 SER X N   1 
ATOM   3624 C CA  . SER A 1 487 ? 14.097  81.982 54.254 1.00 31.69 ? 466 SER X CA  1 
ATOM   3625 C C   . SER A 1 487 ? 14.052  82.215 52.765 1.00 32.14 ? 466 SER X C   1 
ATOM   3626 O O   . SER A 1 487 ? 13.495  81.408 52.025 1.00 33.26 ? 466 SER X O   1 
ATOM   3627 C CB  . SER A 1 487 ? 12.951  82.752 54.915 1.00 32.10 ? 466 SER X CB  1 
ATOM   3628 O OG  . SER A 1 487 ? 11.687  82.327 54.422 1.00 30.55 ? 466 SER X OG  1 
ATOM   3629 N N   . ARG A 1 488 ? 14.619  83.315 52.302 1.00 32.15 ? 467 ARG X N   1 
ATOM   3630 C CA  . ARG A 1 488 ? 14.624  83.534 50.865 1.00 31.70 ? 467 ARG X CA  1 
ATOM   3631 C C   . ARG A 1 488 ? 15.528  82.559 50.149 1.00 31.73 ? 467 ARG X C   1 
ATOM   3632 O O   . ARG A 1 488 ? 15.149  82.117 49.073 1.00 31.45 ? 467 ARG X O   1 
ATOM   3633 C CB  . ARG A 1 488 ? 14.987  84.957 50.507 1.00 31.99 ? 467 ARG X CB  1 
ATOM   3634 C CG  . ARG A 1 488 ? 13.874  85.974 50.751 1.00 32.69 ? 467 ARG X CG  1 
ATOM   3635 C CD  . ARG A 1 488 ? 14.360  87.434 50.371 1.00 35.79 ? 467 ARG X CD  1 
ATOM   3636 N NE  . ARG A 1 488 ? 13.457  88.435 50.931 1.00 34.63 ? 467 ARG X NE  1 
ATOM   3637 C CZ  . ARG A 1 488 ? 12.345  88.811 50.324 1.00 31.66 ? 467 ARG X CZ  1 
ATOM   3638 N NH1 . ARG A 1 488 ? 12.077  88.271 49.139 1.00 28.15 ? 467 ARG X NH1 1 
ATOM   3639 N NH2 . ARG A 1 488 ? 11.519  89.692 50.901 1.00 28.33 ? 467 ARG X NH2 1 
ATOM   3640 N N   . ARG A 1 489 ? 16.702  82.173 50.687 1.00 31.75 ? 468 ARG X N   1 
ATOM   3641 C CA  . ARG A 1 489 ? 17.420  81.149 49.899 1.00 32.54 ? 468 ARG X CA  1 
ATOM   3642 C C   . ARG A 1 489 ? 16.620  79.852 49.857 1.00 31.70 ? 468 ARG X C   1 
ATOM   3643 O O   . ARG A 1 489 ? 16.612  79.151 48.846 1.00 31.28 ? 468 ARG X O   1 
ATOM   3644 C CB  . ARG A 1 489 ? 18.806  80.799 50.369 1.00 32.48 ? 468 ARG X CB  1 
ATOM   3645 C CG  . ARG A 1 489 ? 19.491  81.821 51.119 1.00 37.34 ? 468 ARG X CG  1 
ATOM   3646 C CD  . ARG A 1 489 ? 21.034  81.575 51.088 1.00 42.04 ? 468 ARG X CD  1 
ATOM   3647 N NE  . ARG A 1 489 ? 21.513  80.213 51.374 1.00 44.43 ? 468 ARG X NE  1 
ATOM   3648 C CZ  . ARG A 1 489 ? 21.834  79.796 52.603 1.00 48.30 ? 468 ARG X CZ  1 
ATOM   3649 N NH1 . ARG A 1 489 ? 21.626  80.638 53.619 1.00 49.24 ? 468 ARG X NH1 1 
ATOM   3650 N NH2 . ARG A 1 489 ? 22.346  78.564 52.833 1.00 45.72 ? 468 ARG X NH2 1 
ATOM   3651 N N   . ILE A 1 490 ? 15.963  79.518 50.960 1.00 30.53 ? 469 ILE X N   1 
ATOM   3652 C CA  . ILE A 1 490 ? 15.238  78.281 50.940 1.00 29.88 ? 469 ILE X CA  1 
ATOM   3653 C C   . ILE A 1 490 ? 14.097  78.261 49.911 1.00 30.31 ? 469 ILE X C   1 
ATOM   3654 O O   . ILE A 1 490 ? 14.024  77.329 49.102 1.00 29.54 ? 469 ILE X O   1 
ATOM   3655 C CB  . ILE A 1 490 ? 14.830  77.852 52.339 1.00 29.57 ? 469 ILE X CB  1 
ATOM   3656 C CG1 . ILE A 1 490 ? 16.120  77.506 53.101 1.00 28.40 ? 469 ILE X CG1 1 
ATOM   3657 C CG2 . ILE A 1 490 ? 13.908  76.652 52.268 1.00 27.82 ? 469 ILE X CG2 1 
ATOM   3658 C CD1 . ILE A 1 490 ? 15.926  77.163 54.525 1.00 24.47 ? 469 ILE X CD1 1 
ATOM   3659 N N   . MET A 1 491 ? 13.236  79.287 49.919 1.00 30.59 ? 470 MET X N   1 
ATOM   3660 C CA  . MET A 1 491 ? 12.146  79.359 48.942 1.00 31.19 ? 470 MET X CA  1 
ATOM   3661 C C   . MET A 1 491 ? 12.667  79.350 47.493 1.00 31.04 ? 470 MET X C   1 
ATOM   3662 O O   . MET A 1 491 ? 12.011  78.821 46.569 1.00 30.93 ? 470 MET X O   1 
ATOM   3663 C CB  . MET A 1 491 ? 11.232  80.578 49.154 1.00 30.90 ? 470 MET X CB  1 
ATOM   3664 C CG  . MET A 1 491 ? 10.376  80.503 50.391 1.00 32.70 ? 470 MET X CG  1 
ATOM   3665 S SD  . MET A 1 491 ? 9.271   81.942 50.551 1.00 36.88 ? 470 MET X SD  1 
ATOM   3666 C CE  . MET A 1 491 ? 10.436  83.263 50.853 1.00 35.35 ? 470 MET X CE  1 
ATOM   3667 N N   . HIS A 1 492 ? 13.828  79.943 47.284 1.00 30.48 ? 471 HIS X N   1 
ATOM   3668 C CA  . HIS A 1 492 ? 14.252  80.084 45.931 1.00 30.73 ? 471 HIS X CA  1 
ATOM   3669 C C   . HIS A 1 492 ? 14.835  78.730 45.514 1.00 30.42 ? 471 HIS X C   1 
ATOM   3670 O O   . HIS A 1 492 ? 14.652  78.302 44.347 1.00 30.63 ? 471 HIS X O   1 
ATOM   3671 C CB  . HIS A 1 492 ? 15.191  81.300 45.717 1.00 30.97 ? 471 HIS X CB  1 
ATOM   3672 C CG  . HIS A 1 492 ? 15.465  81.588 44.271 1.00 33.49 ? 471 HIS X CG  1 
ATOM   3673 N ND1 . HIS A 1 492 ? 14.492  82.065 43.401 1.00 36.66 ? 471 HIS X ND1 1 
ATOM   3674 C CD2 . HIS A 1 492 ? 16.583  81.406 43.519 1.00 33.24 ? 471 HIS X CD2 1 
ATOM   3675 C CE1 . HIS A 1 492 ? 15.010  82.194 42.187 1.00 34.08 ? 471 HIS X CE1 1 
ATOM   3676 N NE2 . HIS A 1 492 ? 16.277  81.808 42.232 1.00 34.67 ? 471 HIS X NE2 1 
ATOM   3677 N N   . TYR A 1 493 ? 15.495  78.038 46.448 1.00 29.92 ? 472 TYR X N   1 
ATOM   3678 C CA  . TYR A 1 493 ? 15.954  76.659 46.177 1.00 30.29 ? 472 TYR X CA  1 
ATOM   3679 C C   . TYR A 1 493 ? 14.738  75.744 45.890 1.00 30.51 ? 472 TYR X C   1 
ATOM   3680 O O   . TYR A 1 493 ? 14.669  75.090 44.822 1.00 30.19 ? 472 TYR X O   1 
ATOM   3681 C CB  . TYR A 1 493 ? 16.676  76.055 47.352 1.00 29.76 ? 472 TYR X CB  1 
ATOM   3682 C CG  . TYR A 1 493 ? 18.108  76.431 47.596 1.00 31.59 ? 472 TYR X CG  1 
ATOM   3683 C CD1 . TYR A 1 493 ? 18.996  76.704 46.545 1.00 35.38 ? 472 TYR X CD1 1 
ATOM   3684 C CD2 . TYR A 1 493 ? 18.613  76.424 48.894 1.00 30.53 ? 472 TYR X CD2 1 
ATOM   3685 C CE1 . TYR A 1 493 ? 20.355  77.020 46.799 1.00 33.24 ? 472 TYR X CE1 1 
ATOM   3686 C CE2 . TYR A 1 493 ? 19.908  76.718 49.154 1.00 32.47 ? 472 TYR X CE2 1 
ATOM   3687 C CZ  . TYR A 1 493 ? 20.788  77.022 48.112 1.00 36.07 ? 472 TYR X CZ  1 
ATOM   3688 O OH  . TYR A 1 493 ? 22.102  77.317 48.425 1.00 39.09 ? 472 TYR X OH  1 
ATOM   3689 N N   . TRP A 1 494 ? 13.796  75.687 46.845 1.00 29.90 ? 473 TRP X N   1 
ATOM   3690 C CA  . TRP A 1 494 ? 12.596  74.862 46.661 1.00 29.51 ? 473 TRP X CA  1 
ATOM   3691 C C   . TRP A 1 494 ? 11.972  75.193 45.296 1.00 29.76 ? 473 TRP X C   1 
ATOM   3692 O O   . TRP A 1 494 ? 11.647  74.288 44.526 1.00 30.37 ? 473 TRP X O   1 
ATOM   3693 C CB  . TRP A 1 494 ? 11.570  75.042 47.783 1.00 28.64 ? 473 TRP X CB  1 
ATOM   3694 C CG  . TRP A 1 494 ? 11.677  74.090 48.977 1.00 28.91 ? 473 TRP X CG  1 
ATOM   3695 C CD1 . TRP A 1 494 ? 10.644  73.393 49.561 1.00 28.72 ? 473 TRP X CD1 1 
ATOM   3696 C CD2 . TRP A 1 494 ? 12.855  73.748 49.746 1.00 28.19 ? 473 TRP X CD2 1 
ATOM   3697 N NE1 . TRP A 1 494 ? 11.101  72.642 50.620 1.00 26.04 ? 473 TRP X NE1 1 
ATOM   3698 C CE2 . TRP A 1 494 ? 12.448  72.845 50.763 1.00 27.78 ? 473 TRP X CE2 1 
ATOM   3699 C CE3 . TRP A 1 494 ? 14.204  74.105 49.668 1.00 25.98 ? 473 TRP X CE3 1 
ATOM   3700 C CZ2 . TRP A 1 494 ? 13.352  72.296 51.693 1.00 25.75 ? 473 TRP X CZ2 1 
ATOM   3701 C CZ3 . TRP A 1 494 ? 15.080  73.572 50.576 1.00 25.86 ? 473 TRP X CZ3 1 
ATOM   3702 C CH2 . TRP A 1 494 ? 14.652  72.669 51.585 1.00 25.96 ? 473 TRP X CH2 1 
ATOM   3703 N N   . ALA A 1 495 ? 11.833  76.478 44.960 1.00 29.11 ? 474 ALA X N   1 
ATOM   3704 C CA  . ALA A 1 495 ? 11.007  76.843 43.778 1.00 28.01 ? 474 ALA X CA  1 
ATOM   3705 C C   . ALA A 1 495 ? 11.777  76.610 42.509 1.00 27.78 ? 474 ALA X C   1 
ATOM   3706 O O   . ALA A 1 495 ? 11.229  76.205 41.496 1.00 27.43 ? 474 ALA X O   1 
ATOM   3707 C CB  . ALA A 1 495 ? 10.556  78.282 43.847 1.00 26.60 ? 474 ALA X CB  1 
ATOM   3708 N N   . THR A 1 496 ? 13.063  76.886 42.567 1.00 28.02 ? 475 THR X N   1 
ATOM   3709 C CA  . THR A 1 496 ? 13.864  76.730 41.395 1.00 28.36 ? 475 THR X CA  1 
ATOM   3710 C C   . THR A 1 496 ? 13.984  75.256 41.103 1.00 29.93 ? 475 THR X C   1 
ATOM   3711 O O   . THR A 1 496 ? 13.967  74.830 39.917 1.00 31.42 ? 475 THR X O   1 
ATOM   3712 C CB  . THR A 1 496 ? 15.244  77.227 41.621 1.00 28.25 ? 475 THR X CB  1 
ATOM   3713 O OG1 . THR A 1 496 ? 15.198  78.644 41.862 1.00 27.64 ? 475 THR X OG1 1 
ATOM   3714 C CG2 . THR A 1 496 ? 16.052  76.908 40.416 1.00 24.92 ? 475 THR X CG2 1 
ATOM   3715 N N   . PHE A 1 497 ? 14.113  74.464 42.169 1.00 29.61 ? 476 PHE X N   1 
ATOM   3716 C CA  . PHE A 1 497 ? 14.108  73.030 42.002 1.00 29.02 ? 476 PHE X CA  1 
ATOM   3717 C C   . PHE A 1 497 ? 12.748  72.582 41.440 1.00 29.88 ? 476 PHE X C   1 
ATOM   3718 O O   . PHE A 1 497 ? 12.698  71.739 40.533 1.00 30.80 ? 476 PHE X O   1 
ATOM   3719 C CB  . PHE A 1 497 ? 14.438  72.291 43.310 1.00 28.79 ? 476 PHE X CB  1 
ATOM   3720 C CG  . PHE A 1 497 ? 14.123  70.810 43.261 1.00 27.13 ? 476 PHE X CG  1 
ATOM   3721 C CD1 . PHE A 1 497 ? 15.057  69.903 42.752 1.00 23.62 ? 476 PHE X CD1 1 
ATOM   3722 C CD2 . PHE A 1 497 ? 12.850  70.343 43.637 1.00 24.02 ? 476 PHE X CD2 1 
ATOM   3723 C CE1 . PHE A 1 497 ? 14.756  68.549 42.655 1.00 21.63 ? 476 PHE X CE1 1 
ATOM   3724 C CE2 . PHE A 1 497 ? 12.527  68.998 43.556 1.00 22.47 ? 476 PHE X CE2 1 
ATOM   3725 C CZ  . PHE A 1 497 ? 13.481  68.082 43.087 1.00 23.14 ? 476 PHE X CZ  1 
ATOM   3726 N N   . ALA A 1 498 ? 11.639  73.102 41.955 1.00 29.37 ? 477 ALA X N   1 
ATOM   3727 C CA  . ALA A 1 498 ? 10.375  72.665 41.397 1.00 29.66 ? 477 ALA X CA  1 
ATOM   3728 C C   . ALA A 1 498 ? 10.256  72.991 39.888 1.00 30.82 ? 477 ALA X C   1 
ATOM   3729 O O   . ALA A 1 498 ? 9.677   72.190 39.122 1.00 30.91 ? 477 ALA X O   1 
ATOM   3730 C CB  . ALA A 1 498 ? 9.230   73.234 42.144 1.00 28.87 ? 477 ALA X CB  1 
ATOM   3731 N N   . LYS A 1 499 ? 10.782  74.156 39.469 1.00 31.35 ? 478 LYS X N   1 
ATOM   3732 C CA  . LYS A 1 499 ? 10.640  74.636 38.091 1.00 32.11 ? 478 LYS X CA  1 
ATOM   3733 C C   . LYS A 1 499 ? 11.586  73.885 37.096 1.00 32.22 ? 478 LYS X C   1 
ATOM   3734 O O   . LYS A 1 499 ? 11.232  73.670 35.945 1.00 31.49 ? 478 LYS X O   1 
ATOM   3735 C CB  . LYS A 1 499 ? 10.815  76.160 38.055 1.00 33.25 ? 478 LYS X CB  1 
ATOM   3736 C CG  . LYS A 1 499 ? 10.962  76.796 36.640 1.00 38.39 ? 478 LYS X CG  1 
ATOM   3737 C CD  . LYS A 1 499 ? 11.433  78.289 36.649 1.00 44.50 ? 478 LYS X CD  1 
ATOM   3738 C CE  . LYS A 1 499 ? 11.234  78.920 35.218 1.00 49.14 ? 478 LYS X CE  1 
ATOM   3739 N NZ  . LYS A 1 499 ? 10.965  80.447 35.103 1.00 52.08 ? 478 LYS X NZ  1 
ATOM   3740 N N   . THR A 1 500 ? 12.736  73.402 37.573 1.00 31.70 ? 479 THR X N   1 
ATOM   3741 C CA  . THR A 1 500 ? 13.755  72.864 36.696 1.00 31.32 ? 479 THR X CA  1 
ATOM   3742 C C   . THR A 1 500 ? 14.363  71.514 37.088 1.00 32.07 ? 479 THR X C   1 
ATOM   3743 O O   . THR A 1 500 ? 15.145  70.955 36.328 1.00 31.68 ? 479 THR X O   1 
ATOM   3744 C CB  . THR A 1 500 ? 14.980  73.802 36.693 1.00 31.83 ? 479 THR X CB  1 
ATOM   3745 O OG1 . THR A 1 500 ? 15.725  73.594 37.909 1.00 31.00 ? 479 THR X OG1 1 
ATOM   3746 C CG2 . THR A 1 500 ? 14.569  75.309 36.546 1.00 30.60 ? 479 THR X CG2 1 
ATOM   3747 N N   . GLY A 1 501 ? 14.094  71.025 38.296 1.00 32.84 ? 480 GLY X N   1 
ATOM   3748 C CA  . GLY A 1 501 ? 14.721  69.779 38.778 1.00 33.00 ? 480 GLY X CA  1 
ATOM   3749 C C   . GLY A 1 501 ? 16.141  69.942 39.309 1.00 33.29 ? 480 GLY X C   1 
ATOM   3750 O O   . GLY A 1 501 ? 16.858  68.955 39.505 1.00 32.36 ? 480 GLY X O   1 
ATOM   3751 N N   . ASN A 1 502 ? 16.527  71.198 39.540 1.00 33.93 ? 481 ASN X N   1 
ATOM   3752 C CA  . ASN A 1 502 ? 17.825  71.586 40.101 1.00 34.85 ? 481 ASN X CA  1 
ATOM   3753 C C   . ASN A 1 502 ? 17.673  72.862 40.992 1.00 35.83 ? 481 ASN X C   1 
ATOM   3754 O O   . ASN A 1 502 ? 17.127  73.873 40.547 1.00 35.87 ? 481 ASN X O   1 
ATOM   3755 C CB  . ASN A 1 502 ? 18.784  71.852 38.939 1.00 34.76 ? 481 ASN X CB  1 
ATOM   3756 C CG  . ASN A 1 502 ? 20.188  72.199 39.393 1.00 35.10 ? 481 ASN X CG  1 
ATOM   3757 O OD1 . ASN A 1 502 ? 20.425  72.568 40.561 1.00 35.14 ? 481 ASN X OD1 1 
ATOM   3758 N ND2 . ASN A 1 502 ? 21.137  72.080 38.468 1.00 30.54 ? 481 ASN X ND2 1 
ATOM   3759 N N   . PRO A 1 503 ? 18.110  72.820 42.268 1.00 36.68 ? 482 PRO X N   1 
ATOM   3760 C CA  . PRO A 1 503 ? 17.859  74.033 43.061 1.00 37.62 ? 482 PRO X CA  1 
ATOM   3761 C C   . PRO A 1 503 ? 18.801  75.209 42.758 1.00 39.34 ? 482 PRO X C   1 
ATOM   3762 O O   . PRO A 1 503 ? 18.616  76.310 43.280 1.00 39.57 ? 482 PRO X O   1 
ATOM   3763 C CB  . PRO A 1 503 ? 18.056  73.555 44.487 1.00 36.38 ? 482 PRO X CB  1 
ATOM   3764 C CG  . PRO A 1 503 ? 18.996  72.446 44.362 1.00 36.20 ? 482 PRO X CG  1 
ATOM   3765 C CD  . PRO A 1 503 ? 18.651  71.733 43.097 1.00 36.21 ? 482 PRO X CD  1 
ATOM   3766 N N   . ASN A 1 504 ? 19.792  74.983 41.907 1.00 41.73 ? 483 ASN X N   1 
ATOM   3767 C CA  . ASN A 1 504 ? 20.743  76.024 41.569 1.00 43.86 ? 483 ASN X CA  1 
ATOM   3768 C C   . ASN A 1 504 ? 20.311  76.857 40.401 1.00 46.33 ? 483 ASN X C   1 
ATOM   3769 O O   . ASN A 1 504 ? 19.774  76.372 39.403 1.00 46.22 ? 483 ASN X O   1 
ATOM   3770 C CB  . ASN A 1 504 ? 22.104  75.426 41.330 1.00 42.91 ? 483 ASN X CB  1 
ATOM   3771 C CG  . ASN A 1 504 ? 22.596  74.680 42.539 1.00 42.19 ? 483 ASN X CG  1 
ATOM   3772 O OD1 . ASN A 1 504 ? 22.924  75.288 43.562 1.00 41.59 ? 483 ASN X OD1 1 
ATOM   3773 N ND2 . ASN A 1 504 ? 22.622  73.361 42.454 1.00 38.46 ? 483 ASN X ND2 1 
ATOM   3774 N N   . GLU A 1 505 ? 20.533  78.140 40.587 1.00 50.29 ? 484 GLU X N   1 
ATOM   3775 C CA  . GLU A 1 505 ? 20.331  79.183 39.597 1.00 54.01 ? 484 GLU X CA  1 
ATOM   3776 C C   . GLU A 1 505 ? 21.574  79.138 38.635 1.00 55.71 ? 484 GLU X C   1 
ATOM   3777 O O   . GLU A 1 505 ? 22.725  79.065 39.103 1.00 55.51 ? 484 GLU X O   1 
ATOM   3778 C CB  . GLU A 1 505 ? 20.226  80.506 40.407 1.00 54.67 ? 484 GLU X CB  1 
ATOM   3779 C CG  . GLU A 1 505 ? 19.559  81.712 39.764 1.00 57.18 ? 484 GLU X CG  1 
ATOM   3780 C CD  . GLU A 1 505 ? 18.397  81.335 38.871 1.00 61.09 ? 484 GLU X CD  1 
ATOM   3781 O OE1 . GLU A 1 505 ? 17.358  82.020 38.985 1.00 61.14 ? 484 GLU X OE1 1 
ATOM   3782 O OE2 . GLU A 1 505 ? 18.522  80.367 38.059 1.00 63.12 ? 484 GLU X OE2 1 
ATOM   3783 N N   . PRO A 1 506 ? 21.357  79.113 37.292 1.00 57.69 ? 485 PRO X N   1 
ATOM   3784 C CA  . PRO A 1 506 ? 22.550  78.995 36.361 1.00 58.70 ? 485 PRO X CA  1 
ATOM   3785 C C   . PRO A 1 506 ? 23.642  80.129 36.329 1.00 59.48 ? 485 PRO X C   1 
ATOM   3786 O O   . PRO A 1 506 ? 23.412  81.307 36.713 1.00 60.16 ? 485 PRO X O   1 
ATOM   3787 C CB  . PRO A 1 506 ? 21.910  78.803 34.971 1.00 58.67 ? 485 PRO X CB  1 
ATOM   3788 C CG  . PRO A 1 506 ? 20.475  78.278 35.265 1.00 59.09 ? 485 PRO X CG  1 
ATOM   3789 C CD  . PRO A 1 506 ? 20.063  78.891 36.601 1.00 57.70 ? 485 PRO X CD  1 
ATOM   3790 N N   . SER A 1 511 ? 26.842  80.319 45.000 1.00 52.15 ? 490 SER X N   1 
ATOM   3791 C CA  . SER A 1 511 ? 27.548  79.122 45.604 1.00 52.45 ? 490 SER X CA  1 
ATOM   3792 C C   . SER A 1 511 ? 26.759  77.748 45.688 1.00 51.08 ? 490 SER X C   1 
ATOM   3793 O O   . SER A 1 511 ? 25.725  77.650 46.352 1.00 50.75 ? 490 SER X O   1 
ATOM   3794 C CB  . SER A 1 511 ? 28.185  79.467 46.978 1.00 52.71 ? 490 SER X CB  1 
ATOM   3795 O OG  . SER A 1 511 ? 28.694  78.284 47.584 1.00 51.87 ? 490 SER X OG  1 
ATOM   3796 N N   . LYS A 1 512 ? 27.306  76.704 45.063 1.00 49.48 ? 491 LYS X N   1 
ATOM   3797 C CA  . LYS A 1 512 ? 26.518  75.529 44.656 1.00 48.47 ? 491 LYS X CA  1 
ATOM   3798 C C   . LYS A 1 512 ? 25.978  74.583 45.760 1.00 46.44 ? 491 LYS X C   1 
ATOM   3799 O O   . LYS A 1 512 ? 26.661  74.308 46.749 1.00 46.77 ? 491 LYS X O   1 
ATOM   3800 C CB  . LYS A 1 512 ? 27.298  74.669 43.632 1.00 49.21 ? 491 LYS X CB  1 
ATOM   3801 C CG  . LYS A 1 512 ? 27.721  75.370 42.345 1.00 51.92 ? 491 LYS X CG  1 
ATOM   3802 C CD  . LYS A 1 512 ? 26.534  75.893 41.485 1.00 55.60 ? 491 LYS X CD  1 
ATOM   3803 C CE  . LYS A 1 512 ? 26.778  75.693 39.941 1.00 57.43 ? 491 LYS X CE  1 
ATOM   3804 N NZ  . LYS A 1 512 ? 28.091  76.231 39.387 1.00 54.27 ? 491 LYS X NZ  1 
ATOM   3805 N N   . TRP A 1 513 ? 24.756  74.077 45.548 1.00 42.73 ? 492 TRP X N   1 
ATOM   3806 C CA  . TRP A 1 513 ? 24.255  72.926 46.247 1.00 38.98 ? 492 TRP X CA  1 
ATOM   3807 C C   . TRP A 1 513 ? 24.553  71.747 45.357 1.00 37.72 ? 492 TRP X C   1 
ATOM   3808 O O   . TRP A 1 513 ? 23.866  71.520 44.404 1.00 37.16 ? 492 TRP X O   1 
ATOM   3809 C CB  . TRP A 1 513 ? 22.750  73.061 46.408 1.00 38.43 ? 492 TRP X CB  1 
ATOM   3810 C CG  . TRP A 1 513 ? 22.060  71.993 47.248 1.00 36.42 ? 492 TRP X CG  1 
ATOM   3811 C CD1 . TRP A 1 513 ? 22.505  70.731 47.524 1.00 36.66 ? 492 TRP X CD1 1 
ATOM   3812 C CD2 . TRP A 1 513 ? 20.773  72.091 47.843 1.00 32.78 ? 492 TRP X CD2 1 
ATOM   3813 N NE1 . TRP A 1 513 ? 21.592  70.056 48.293 1.00 35.67 ? 492 TRP X NE1 1 
ATOM   3814 C CE2 . TRP A 1 513 ? 20.515  70.870 48.494 1.00 33.72 ? 492 TRP X CE2 1 
ATOM   3815 C CE3 . TRP A 1 513 ? 19.828  73.101 47.909 1.00 29.73 ? 492 TRP X CE3 1 
ATOM   3816 C CZ2 . TRP A 1 513 ? 19.357  70.641 49.207 1.00 33.76 ? 492 TRP X CZ2 1 
ATOM   3817 C CZ3 . TRP A 1 513 ? 18.685  72.878 48.596 1.00 31.66 ? 492 TRP X CZ3 1 
ATOM   3818 C CH2 . TRP A 1 513 ? 18.449  71.655 49.248 1.00 34.02 ? 492 TRP X CH2 1 
ATOM   3819 N N   . PRO A 1 514 ? 25.592  70.974 45.661 1.00 37.23 ? 493 PRO X N   1 
ATOM   3820 C CA  . PRO A 1 514 ? 25.903  69.850 44.771 1.00 36.63 ? 493 PRO X CA  1 
ATOM   3821 C C   . PRO A 1 514 ? 24.937  68.693 44.844 1.00 36.64 ? 493 PRO X C   1 
ATOM   3822 O O   . PRO A 1 514 ? 24.232  68.487 45.840 1.00 36.81 ? 493 PRO X O   1 
ATOM   3823 C CB  . PRO A 1 514 ? 27.266  69.368 45.247 1.00 36.21 ? 493 PRO X CB  1 
ATOM   3824 C CG  . PRO A 1 514 ? 27.402  69.837 46.614 1.00 36.91 ? 493 PRO X CG  1 
ATOM   3825 C CD  . PRO A 1 514 ? 26.512  71.058 46.804 1.00 37.13 ? 493 PRO X CD  1 
ATOM   3826 N N   . LEU A 1 515 ? 24.942  67.925 43.776 1.00 36.34 ? 494 LEU X N   1 
ATOM   3827 C CA  . LEU A 1 515 ? 24.119  66.764 43.641 1.00 36.14 ? 494 LEU X CA  1 
ATOM   3828 C C   . LEU A 1 515 ? 24.581  65.694 44.668 1.00 36.35 ? 494 LEU X C   1 
ATOM   3829 O O   . LEU A 1 515 ? 25.751  65.586 45.009 1.00 37.21 ? 494 LEU X O   1 
ATOM   3830 C CB  . LEU A 1 515 ? 24.295  66.298 42.195 1.00 35.84 ? 494 LEU X CB  1 
ATOM   3831 C CG  . LEU A 1 515 ? 23.325  65.629 41.217 1.00 37.42 ? 494 LEU X CG  1 
ATOM   3832 C CD1 . LEU A 1 515 ? 21.879  66.145 41.240 1.00 36.89 ? 494 LEU X CD1 1 
ATOM   3833 C CD2 . LEU A 1 515 ? 23.917  65.779 39.818 1.00 37.61 ? 494 LEU X CD2 1 
ATOM   3834 N N   . PHE A 1 516 ? 23.659  64.915 45.200 1.00 36.22 ? 495 PHE X N   1 
ATOM   3835 C CA  . PHE A 1 516 ? 24.066  63.834 46.035 1.00 35.62 ? 495 PHE X CA  1 
ATOM   3836 C C   . PHE A 1 516 ? 24.261  62.622 45.118 1.00 36.60 ? 495 PHE X C   1 
ATOM   3837 O O   . PHE A 1 516 ? 23.368  62.253 44.359 1.00 37.48 ? 495 PHE X O   1 
ATOM   3838 C CB  . PHE A 1 516 ? 23.006  63.599 47.097 1.00 34.56 ? 495 PHE X CB  1 
ATOM   3839 C CG  . PHE A 1 516 ? 23.190  62.329 47.887 1.00 32.53 ? 495 PHE X CG  1 
ATOM   3840 C CD1 . PHE A 1 516 ? 22.869  61.098 47.341 1.00 30.94 ? 495 PHE X CD1 1 
ATOM   3841 C CD2 . PHE A 1 516 ? 23.656  62.364 49.177 1.00 31.69 ? 495 PHE X CD2 1 
ATOM   3842 C CE1 . PHE A 1 516 ? 23.015  59.943 48.050 1.00 28.14 ? 495 PHE X CE1 1 
ATOM   3843 C CE2 . PHE A 1 516 ? 23.796  61.202 49.906 1.00 30.42 ? 495 PHE X CE2 1 
ATOM   3844 C CZ  . PHE A 1 516 ? 23.478  59.991 49.329 1.00 29.97 ? 495 PHE X CZ  1 
ATOM   3845 N N   . THR A 1 517 ? 25.435  62.016 45.171 1.00 37.55 ? 496 THR X N   1 
ATOM   3846 C CA  . THR A 1 517 ? 25.772  60.872 44.312 1.00 38.01 ? 496 THR X CA  1 
ATOM   3847 C C   . THR A 1 517 ? 26.101  59.697 45.198 1.00 38.98 ? 496 THR X C   1 
ATOM   3848 O O   . THR A 1 517 ? 26.594  59.856 46.322 1.00 38.58 ? 496 THR X O   1 
ATOM   3849 C CB  . THR A 1 517 ? 27.073  61.123 43.523 1.00 38.10 ? 496 THR X CB  1 
ATOM   3850 O OG1 . THR A 1 517 ? 28.156  61.384 44.453 1.00 39.53 ? 496 THR X OG1 1 
ATOM   3851 C CG2 . THR A 1 517 ? 26.926  62.288 42.584 1.00 35.28 ? 496 THR X CG2 1 
ATOM   3852 N N   . THR A 1 518 ? 25.876  58.498 44.706 1.00 40.44 ? 497 THR X N   1 
ATOM   3853 C CA  . THR A 1 518 ? 26.097  57.395 45.605 1.00 41.89 ? 497 THR X CA  1 
ATOM   3854 C C   . THR A 1 518 ? 27.606  57.323 46.020 1.00 42.96 ? 497 THR X C   1 
ATOM   3855 O O   . THR A 1 518 ? 27.914  56.959 47.165 1.00 43.15 ? 497 THR X O   1 
ATOM   3856 C CB  . THR A 1 518 ? 25.378  56.018 45.142 1.00 43.02 ? 497 THR X CB  1 
ATOM   3857 O OG1 . THR A 1 518 ? 25.034  56.047 43.738 1.00 41.94 ? 497 THR X OG1 1 
ATOM   3858 C CG2 . THR A 1 518 ? 24.059  55.606 46.081 1.00 42.47 ? 497 THR X CG2 1 
ATOM   3859 N N   . LYS A 1 519 ? 28.525  57.741 45.131 1.00 43.32 ? 498 LYS X N   1 
ATOM   3860 C CA  . LYS A 1 519 ? 29.970  57.694 45.419 1.00 42.97 ? 498 LYS X CA  1 
ATOM   3861 C C   . LYS A 1 519 ? 30.369  58.691 46.504 1.00 43.33 ? 498 LYS X C   1 
ATOM   3862 O O   . LYS A 1 519 ? 30.989  58.306 47.513 1.00 43.28 ? 498 LYS X O   1 
ATOM   3863 C CB  . LYS A 1 519 ? 30.830  57.914 44.147 1.00 42.97 ? 498 LYS X CB  1 
ATOM   3864 N N   . GLU A 1 520 ? 30.030  59.969 46.301 1.00 42.84 ? 499 GLU X N   1 
ATOM   3865 C CA  . GLU A 1 520 ? 30.552  61.036 47.170 1.00 42.67 ? 499 GLU X CA  1 
ATOM   3866 C C   . GLU A 1 520 ? 29.670  61.464 48.347 1.00 41.19 ? 499 GLU X C   1 
ATOM   3867 O O   . GLU A 1 520 ? 30.142  62.071 49.287 1.00 39.88 ? 499 GLU X O   1 
ATOM   3868 C CB  . GLU A 1 520 ? 30.810  62.284 46.345 1.00 44.19 ? 499 GLU X CB  1 
ATOM   3869 C CG  . GLU A 1 520 ? 32.249  62.638 46.182 1.00 48.12 ? 499 GLU X CG  1 
ATOM   3870 C CD  . GLU A 1 520 ? 32.837  61.947 45.021 1.00 54.55 ? 499 GLU X CD  1 
ATOM   3871 O OE1 . GLU A 1 520 ? 32.083  61.708 44.039 1.00 56.94 ? 499 GLU X OE1 1 
ATOM   3872 O OE2 . GLU A 1 520 ? 34.049  61.644 45.096 1.00 58.99 ? 499 GLU X OE2 1 
ATOM   3873 N N   . GLN A 1 521 ? 28.372  61.210 48.237 1.00 40.71 ? 500 GLN X N   1 
ATOM   3874 C CA  . GLN A 1 521 ? 27.405  61.485 49.299 1.00 39.41 ? 500 GLN X CA  1 
ATOM   3875 C C   . GLN A 1 521 ? 27.361  62.894 49.872 1.00 38.23 ? 500 GLN X C   1 
ATOM   3876 O O   . GLN A 1 521 ? 27.176  63.071 51.070 1.00 37.89 ? 500 GLN X O   1 
ATOM   3877 C CB  . GLN A 1 521 ? 27.575  60.439 50.388 1.00 39.18 ? 500 GLN X CB  1 
ATOM   3878 C CG  . GLN A 1 521 ? 26.848  59.182 49.966 1.00 40.67 ? 500 GLN X CG  1 
ATOM   3879 C CD  . GLN A 1 521 ? 27.380  57.945 50.609 1.00 42.13 ? 500 GLN X CD  1 
ATOM   3880 O OE1 . GLN A 1 521 ? 27.429  57.848 51.818 1.00 43.27 ? 500 GLN X OE1 1 
ATOM   3881 N NE2 . GLN A 1 521 ? 27.792  56.981 49.794 1.00 42.24 ? 500 GLN X NE2 1 
ATOM   3882 N N   . LYS A 1 522 ? 27.504  63.904 49.021 1.00 37.35 ? 501 LYS X N   1 
ATOM   3883 C CA  . LYS A 1 522 ? 27.494  65.297 49.508 1.00 36.80 ? 501 LYS X CA  1 
ATOM   3884 C C   . LYS A 1 522 ? 26.117  65.887 49.912 1.00 35.83 ? 501 LYS X C   1 
ATOM   3885 O O   . LYS A 1 522 ? 25.070  65.530 49.366 1.00 35.81 ? 501 LYS X O   1 
ATOM   3886 C CB  . LYS A 1 522 ? 28.137  66.229 48.481 1.00 37.10 ? 501 LYS X CB  1 
ATOM   3887 C CG  . LYS A 1 522 ? 29.294  65.628 47.713 1.00 39.34 ? 501 LYS X CG  1 
ATOM   3888 C CD  . LYS A 1 522 ? 30.300  66.735 47.338 1.00 41.06 ? 501 LYS X CD  1 
ATOM   3889 C CE  . LYS A 1 522 ? 31.363  66.268 46.320 1.00 40.41 ? 501 LYS X CE  1 
ATOM   3890 N NZ  . LYS A 1 522 ? 31.708  67.416 45.453 1.00 40.11 ? 501 LYS X NZ  1 
ATOM   3891 N N   . PHE A 1 523 ? 26.130  66.809 50.860 1.00 34.63 ? 502 PHE X N   1 
ATOM   3892 C CA  . PHE A 1 523 ? 24.960  67.601 51.122 1.00 33.99 ? 502 PHE X CA  1 
ATOM   3893 C C   . PHE A 1 523 ? 25.372  68.957 51.673 1.00 35.17 ? 502 PHE X C   1 
ATOM   3894 O O   . PHE A 1 523 ? 26.579  69.186 51.938 1.00 35.06 ? 502 PHE X O   1 
ATOM   3895 C CB  . PHE A 1 523 ? 24.109  66.916 52.151 1.00 33.48 ? 502 PHE X CB  1 
ATOM   3896 C CG  . PHE A 1 523 ? 24.792  66.726 53.501 1.00 31.53 ? 502 PHE X CG  1 
ATOM   3897 C CD1 . PHE A 1 523 ? 24.503  67.583 54.575 1.00 27.91 ? 502 PHE X CD1 1 
ATOM   3898 C CD2 . PHE A 1 523 ? 25.690  65.668 53.709 1.00 28.40 ? 502 PHE X CD2 1 
ATOM   3899 C CE1 . PHE A 1 523 ? 25.080  67.393 55.839 1.00 27.39 ? 502 PHE X CE1 1 
ATOM   3900 C CE2 . PHE A 1 523 ? 26.281  65.470 54.973 1.00 28.49 ? 502 PHE X CE2 1 
ATOM   3901 C CZ  . PHE A 1 523 ? 25.966  66.333 56.047 1.00 27.24 ? 502 PHE X CZ  1 
ATOM   3902 N N   . ILE A 1 524 ? 24.368  69.819 51.892 1.00 35.41 ? 503 ILE X N   1 
ATOM   3903 C CA  . ILE A 1 524 ? 24.560  71.144 52.486 1.00 36.25 ? 503 ILE X CA  1 
ATOM   3904 C C   . ILE A 1 524 ? 23.854  71.383 53.840 1.00 36.46 ? 503 ILE X C   1 
ATOM   3905 O O   . ILE A 1 524 ? 22.925  70.667 54.211 1.00 35.88 ? 503 ILE X O   1 
ATOM   3906 C CB  . ILE A 1 524 ? 24.066  72.257 51.524 1.00 36.98 ? 503 ILE X CB  1 
ATOM   3907 C CG1 . ILE A 1 524 ? 22.602  72.078 51.176 1.00 36.65 ? 503 ILE X CG1 1 
ATOM   3908 C CG2 . ILE A 1 524 ? 24.802  72.263 50.209 1.00 37.31 ? 503 ILE X CG2 1 
ATOM   3909 C CD1 . ILE A 1 524 ? 22.074  73.341 50.617 1.00 39.95 ? 503 ILE X CD1 1 
ATOM   3910 N N   . ASP A 1 525 ? 24.288  72.414 54.565 1.00 37.80 ? 504 ASP X N   1 
ATOM   3911 C CA  . ASP A 1 525 ? 23.552  72.899 55.730 1.00 39.63 ? 504 ASP X CA  1 
ATOM   3912 C C   . ASP A 1 525 ? 22.599  73.955 55.244 1.00 39.57 ? 504 ASP X C   1 
ATOM   3913 O O   . ASP A 1 525 ? 22.761  74.521 54.170 1.00 39.35 ? 504 ASP X O   1 
ATOM   3914 C CB  . ASP A 1 525 ? 24.400  73.698 56.707 1.00 40.95 ? 504 ASP X CB  1 
ATOM   3915 C CG  . ASP A 1 525 ? 25.740  73.049 57.061 1.00 48.15 ? 504 ASP X CG  1 
ATOM   3916 O OD1 . ASP A 1 525 ? 25.793  71.793 57.286 1.00 53.02 ? 504 ASP X OD1 1 
ATOM   3917 O OD2 . ASP A 1 525 ? 26.742  73.835 57.160 1.00 52.06 ? 504 ASP X OD2 1 
ATOM   3918 N N   . LEU A 1 526 ? 21.651  74.296 56.089 1.00 39.28 ? 505 LEU X N   1 
ATOM   3919 C CA  . LEU A 1 526 ? 20.816  75.393 55.806 1.00 39.46 ? 505 LEU X CA  1 
ATOM   3920 C C   . LEU A 1 526 ? 20.776  76.173 57.095 1.00 40.88 ? 505 LEU X C   1 
ATOM   3921 O O   . LEU A 1 526 ? 20.158  75.741 58.051 1.00 41.95 ? 505 LEU X O   1 
ATOM   3922 C CB  . LEU A 1 526 ? 19.437  74.879 55.432 1.00 38.35 ? 505 LEU X CB  1 
ATOM   3923 C CG  . LEU A 1 526 ? 18.983  74.832 53.968 1.00 36.67 ? 505 LEU X CG  1 
ATOM   3924 C CD1 . LEU A 1 526 ? 20.058  75.221 52.911 1.00 33.80 ? 505 LEU X CD1 1 
ATOM   3925 C CD2 . LEU A 1 526 ? 18.310  73.516 53.655 1.00 32.91 ? 505 LEU X CD2 1 
ATOM   3926 N N   . ASN A 1 527 ? 21.455  77.309 57.145 1.00 42.33 ? 506 ASN X N   1 
ATOM   3927 C CA  . ASN A 1 527 ? 21.428  78.154 58.338 1.00 43.84 ? 506 ASN X CA  1 
ATOM   3928 C C   . ASN A 1 527 ? 21.931  79.525 57.962 1.00 44.70 ? 506 ASN X C   1 
ATOM   3929 O O   . ASN A 1 527 ? 22.439  79.692 56.886 1.00 45.16 ? 506 ASN X O   1 
ATOM   3930 C CB  . ASN A 1 527 ? 22.349  77.568 59.404 1.00 43.88 ? 506 ASN X CB  1 
ATOM   3931 C CG  . ASN A 1 527 ? 23.743  77.345 58.867 1.00 44.00 ? 506 ASN X CG  1 
ATOM   3932 O OD1 . ASN A 1 527 ? 24.290  78.215 58.189 1.00 44.88 ? 506 ASN X OD1 1 
ATOM   3933 N ND2 . ASN A 1 527 ? 24.303  76.175 59.114 1.00 42.11 ? 506 ASN X ND2 1 
ATOM   3934 N N   . THR A 1 528 ? 21.823  80.489 58.860 1.00 46.90 ? 507 THR X N   1 
ATOM   3935 C CA  . THR A 1 528 ? 22.357  81.854 58.657 1.00 48.66 ? 507 THR X CA  1 
ATOM   3936 C C   . THR A 1 528 ? 23.891  81.983 58.327 1.00 50.11 ? 507 THR X C   1 
ATOM   3937 O O   . THR A 1 528 ? 24.274  82.783 57.477 1.00 50.13 ? 507 THR X O   1 
ATOM   3938 C CB  . THR A 1 528 ? 21.916  82.747 59.837 1.00 48.60 ? 507 THR X CB  1 
ATOM   3939 O OG1 . THR A 1 528 ? 22.375  82.179 61.072 1.00 48.74 ? 507 THR X OG1 1 
ATOM   3940 C CG2 . THR A 1 528 ? 20.402  82.760 59.912 1.00 48.17 ? 507 THR X CG2 1 
ATOM   3941 N N   . GLU A 1 529 ? 24.763  81.210 58.981 1.00 52.32 ? 508 GLU X N   1 
ATOM   3942 C CA  . GLU A 1 529 ? 26.209  81.160 58.627 1.00 54.06 ? 508 GLU X CA  1 
ATOM   3943 C C   . GLU A 1 529 ? 26.403  80.833 57.109 1.00 55.41 ? 508 GLU X C   1 
ATOM   3944 O O   . GLU A 1 529 ? 25.539  80.199 56.516 1.00 55.54 ? 508 GLU X O   1 
ATOM   3945 C CB  . GLU A 1 529 ? 26.941  80.126 59.525 1.00 53.87 ? 508 GLU X CB  1 
ATOM   3946 C CG  . GLU A 1 529 ? 26.843  80.401 61.038 1.00 53.84 ? 508 GLU X CG  1 
ATOM   3947 N N   . PRO A 1 530 ? 27.528  81.256 56.464 1.00 57.08 ? 509 PRO X N   1 
ATOM   3948 C CA  . PRO A 1 530 ? 27.571  80.936 55.005 1.00 57.64 ? 509 PRO X CA  1 
ATOM   3949 C C   . PRO A 1 530 ? 27.612  79.412 54.757 1.00 58.07 ? 509 PRO X C   1 
ATOM   3950 O O   . PRO A 1 530 ? 28.198  78.667 55.558 1.00 59.00 ? 509 PRO X O   1 
ATOM   3951 C CB  . PRO A 1 530 ? 28.881  81.593 54.529 1.00 57.74 ? 509 PRO X CB  1 
ATOM   3952 C CG  . PRO A 1 530 ? 29.799  81.541 55.749 1.00 57.63 ? 509 PRO X CG  1 
ATOM   3953 C CD  . PRO A 1 530 ? 28.852  81.724 56.964 1.00 57.43 ? 509 PRO X CD  1 
ATOM   3954 N N   . MET A 1 531 ? 27.011  78.944 53.666 1.00 57.84 ? 510 MET X N   1 
ATOM   3955 C CA  . MET A 1 531 ? 26.793  77.503 53.513 1.00 57.41 ? 510 MET X CA  1 
ATOM   3956 C C   . MET A 1 531 ? 28.061  76.702 53.314 1.00 55.22 ? 510 MET X C   1 
ATOM   3957 O O   . MET A 1 531 ? 28.976  77.171 52.683 1.00 55.31 ? 510 MET X O   1 
ATOM   3958 C CB  . MET A 1 531 ? 25.767  77.187 52.402 1.00 58.97 ? 510 MET X CB  1 
ATOM   3959 C CG  . MET A 1 531 ? 26.231  77.350 50.930 1.00 63.20 ? 510 MET X CG  1 
ATOM   3960 S SD  . MET A 1 531 ? 25.126  76.317 49.880 1.00 73.74 ? 510 MET X SD  1 
ATOM   3961 C CE  . MET A 1 531 ? 23.513  76.559 50.717 1.00 66.42 ? 510 MET X CE  1 
ATOM   3962 N N   . LYS A 1 532 ? 28.095  75.497 53.870 1.00 53.09 ? 511 LYS X N   1 
ATOM   3963 C CA  . LYS A 1 532 ? 29.173  74.534 53.625 1.00 51.28 ? 511 LYS X CA  1 
ATOM   3964 C C   . LYS A 1 532 ? 28.617  73.225 53.087 1.00 48.98 ? 511 LYS X C   1 
ATOM   3965 O O   . LYS A 1 532 ? 27.423  72.919 53.233 1.00 48.56 ? 511 LYS X O   1 
ATOM   3966 C CB  . LYS A 1 532 ? 29.973  74.248 54.897 1.00 51.54 ? 511 LYS X CB  1 
ATOM   3967 C CG  . LYS A 1 532 ? 30.748  75.457 55.398 1.00 55.20 ? 511 LYS X CG  1 
ATOM   3968 C CD  . LYS A 1 532 ? 31.134  75.317 56.876 1.00 60.51 ? 511 LYS X CD  1 
ATOM   3969 C CE  . LYS A 1 532 ? 31.702  76.624 57.422 1.00 63.07 ? 511 LYS X CE  1 
ATOM   3970 N NZ  . LYS A 1 532 ? 32.174  76.419 58.824 1.00 65.18 ? 511 LYS X NZ  1 
ATOM   3971 N N   . VAL A 1 533 ? 29.499  72.454 52.471 1.00 45.91 ? 512 VAL X N   1 
ATOM   3972 C CA  . VAL A 1 533 ? 29.126  71.193 51.893 1.00 43.01 ? 512 VAL X CA  1 
ATOM   3973 C C   . VAL A 1 533 ? 29.747  70.116 52.770 1.00 42.54 ? 512 VAL X C   1 
ATOM   3974 O O   . VAL A 1 533 ? 30.916  70.228 53.160 1.00 42.21 ? 512 VAL X O   1 
ATOM   3975 C CB  . VAL A 1 533 ? 29.640  71.094 50.437 1.00 42.85 ? 512 VAL X CB  1 
ATOM   3976 C CG1 . VAL A 1 533 ? 29.588  69.655 49.912 1.00 40.93 ? 512 VAL X CG1 1 
ATOM   3977 C CG2 . VAL A 1 533 ? 28.883  72.071 49.517 1.00 40.36 ? 512 VAL X CG2 1 
ATOM   3978 N N   . HIS A 1 534 ? 28.978  69.083 53.115 1.00 41.49 ? 513 HIS X N   1 
ATOM   3979 C CA  . HIS A 1 534 ? 29.538  68.000 53.931 1.00 40.43 ? 513 HIS X CA  1 
ATOM   3980 C C   . HIS A 1 534 ? 29.367  66.661 53.241 1.00 39.51 ? 513 HIS X C   1 
ATOM   3981 O O   . HIS A 1 534 ? 28.788  66.605 52.163 1.00 39.52 ? 513 HIS X O   1 
ATOM   3982 C CB  . HIS A 1 534 ? 28.831  67.915 55.272 1.00 40.78 ? 513 HIS X CB  1 
ATOM   3983 C CG  . HIS A 1 534 ? 28.803  69.189 56.043 1.00 41.08 ? 513 HIS X CG  1 
ATOM   3984 N ND1 . HIS A 1 534 ? 29.848  69.591 56.843 1.00 42.10 ? 513 HIS X ND1 1 
ATOM   3985 C CD2 . HIS A 1 534 ? 27.830  70.121 56.191 1.00 42.84 ? 513 HIS X CD2 1 
ATOM   3986 C CE1 . HIS A 1 534 ? 29.529  70.736 57.431 1.00 43.62 ? 513 HIS X CE1 1 
ATOM   3987 N NE2 . HIS A 1 534 ? 28.307  71.074 57.061 1.00 42.42 ? 513 HIS X NE2 1 
ATOM   3988 N N   . GLN A 1 535 ? 29.800  65.577 53.894 1.00 38.86 ? 514 GLN X N   1 
ATOM   3989 C CA  . GLN A 1 535 ? 29.633  64.213 53.333 1.00 37.67 ? 514 GLN X CA  1 
ATOM   3990 C C   . GLN A 1 535 ? 29.164  63.136 54.304 1.00 36.01 ? 514 GLN X C   1 
ATOM   3991 O O   . GLN A 1 535 ? 29.312  63.255 55.490 1.00 35.47 ? 514 GLN X O   1 
ATOM   3992 C CB  . GLN A 1 535 ? 30.929  63.755 52.693 1.00 37.54 ? 514 GLN X CB  1 
ATOM   3993 C CG  . GLN A 1 535 ? 31.066  64.257 51.297 1.00 41.69 ? 514 GLN X CG  1 
ATOM   3994 C CD  . GLN A 1 535 ? 32.470  64.057 50.726 1.00 45.79 ? 514 GLN X CD  1 
ATOM   3995 O OE1 . GLN A 1 535 ? 33.368  64.854 50.978 1.00 48.23 ? 514 GLN X OE1 1 
ATOM   3996 N NE2 . GLN A 1 535 ? 32.651  63.003 49.938 1.00 46.06 ? 514 GLN X NE2 1 
ATOM   3997 N N   . ARG A 1 536 ? 28.619  62.060 53.760 1.00 35.44 ? 515 ARG X N   1 
ATOM   3998 C CA  . ARG A 1 536 ? 28.189  60.910 54.532 1.00 34.25 ? 515 ARG X CA  1 
ATOM   3999 C C   . ARG A 1 536 ? 27.436  61.298 55.851 1.00 33.61 ? 515 ARG X C   1 
ATOM   4000 O O   . ARG A 1 536 ? 27.907  61.066 56.978 1.00 33.22 ? 515 ARG X O   1 
ATOM   4001 C CB  . ARG A 1 536 ? 29.397  60.004 54.747 1.00 34.78 ? 515 ARG X CB  1 
ATOM   4002 C CG  . ARG A 1 536 ? 29.848  59.151 53.506 1.00 37.21 ? 515 ARG X CG  1 
ATOM   4003 C CD  . ARG A 1 536 ? 31.283  58.590 53.679 1.00 38.81 ? 515 ARG X CD  1 
ATOM   4004 N NE  . ARG A 1 536 ? 31.656  57.615 52.661 1.00 38.31 ? 515 ARG X NE  1 
ATOM   4005 N N   . LEU A 1 537 ? 26.261  61.905 55.678 1.00 32.62 ? 516 LEU X N   1 
ATOM   4006 C CA  . LEU A 1 537 ? 25.444  62.418 56.772 1.00 32.44 ? 516 LEU X CA  1 
ATOM   4007 C C   . LEU A 1 537 ? 25.062  61.340 57.783 1.00 32.74 ? 516 LEU X C   1 
ATOM   4008 O O   . LEU A 1 537 ? 24.328  60.411 57.448 1.00 33.81 ? 516 LEU X O   1 
ATOM   4009 C CB  . LEU A 1 537 ? 24.159  63.003 56.195 1.00 32.74 ? 516 LEU X CB  1 
ATOM   4010 C CG  . LEU A 1 537 ? 22.969  63.348 57.105 1.00 32.68 ? 516 LEU X CG  1 
ATOM   4011 C CD1 . LEU A 1 537 ? 23.408  64.145 58.287 1.00 33.36 ? 516 LEU X CD1 1 
ATOM   4012 C CD2 . LEU A 1 537 ? 21.961  64.157 56.346 1.00 29.92 ? 516 LEU X CD2 1 
ATOM   4013 N N   . ARG A 1 538 ? 25.522  61.502 59.022 1.00 31.97 ? 517 ARG X N   1 
ATOM   4014 C CA  . ARG A 1 538 ? 25.408  60.520 60.116 1.00 30.77 ? 517 ARG X CA  1 
ATOM   4015 C C   . ARG A 1 538 ? 25.622  59.073 59.794 1.00 30.31 ? 517 ARG X C   1 
ATOM   4016 O O   . ARG A 1 538 ? 24.893  58.217 60.317 1.00 29.48 ? 517 ARG X O   1 
ATOM   4017 C CB  . ARG A 1 538 ? 24.153  60.780 60.960 1.00 31.09 ? 517 ARG X CB  1 
ATOM   4018 C CG  . ARG A 1 538 ? 24.258  62.219 61.572 1.00 32.82 ? 517 ARG X CG  1 
ATOM   4019 C CD  . ARG A 1 538 ? 23.117  62.625 62.447 1.00 36.10 ? 517 ARG X CD  1 
ATOM   4020 N NE  . ARG A 1 538 ? 23.022  61.762 63.619 1.00 40.58 ? 517 ARG X NE  1 
ATOM   4021 C CZ  . ARG A 1 538 ? 23.747  61.943 64.724 1.00 41.25 ? 517 ARG X CZ  1 
ATOM   4022 N NH1 . ARG A 1 538 ? 24.592  62.961 64.761 1.00 41.95 ? 517 ARG X NH1 1 
ATOM   4023 N NH2 . ARG A 1 538 ? 23.637  61.120 65.773 1.00 39.35 ? 517 ARG X NH2 1 
ATOM   4024 N N   . VAL A 1 539 ? 26.654  58.778 58.975 1.00 30.20 ? 518 VAL X N   1 
ATOM   4025 C CA  . VAL A 1 539 ? 26.896  57.370 58.546 1.00 29.52 ? 518 VAL X CA  1 
ATOM   4026 C C   . VAL A 1 539 ? 27.098  56.429 59.699 1.00 30.09 ? 518 VAL X C   1 
ATOM   4027 O O   . VAL A 1 539 ? 26.538  55.353 59.708 1.00 30.24 ? 518 VAL X O   1 
ATOM   4028 C CB  . VAL A 1 539 ? 28.197  57.135 57.798 1.00 29.52 ? 518 VAL X CB  1 
ATOM   4029 C CG1 . VAL A 1 539 ? 27.960  56.475 56.452 1.00 27.26 ? 518 VAL X CG1 1 
ATOM   4030 C CG2 . VAL A 1 539 ? 29.098  58.360 57.814 1.00 28.38 ? 518 VAL X CG2 1 
ATOM   4031 N N   . GLN A 1 540 ? 27.988  56.790 60.625 1.00 30.28 ? 519 GLN X N   1 
ATOM   4032 C CA  . GLN A 1 540 ? 28.248  55.915 61.755 1.00 31.06 ? 519 GLN X CA  1 
ATOM   4033 C C   . GLN A 1 540 ? 26.944  55.451 62.398 1.00 29.79 ? 519 GLN X C   1 
ATOM   4034 O O   . GLN A 1 540 ? 26.696  54.266 62.490 1.00 28.88 ? 519 GLN X O   1 
ATOM   4035 C CB  . GLN A 1 540 ? 29.138  56.593 62.793 1.00 31.95 ? 519 GLN X CB  1 
ATOM   4036 C CG  . GLN A 1 540 ? 29.913  55.593 63.667 1.00 36.26 ? 519 GLN X CG  1 
ATOM   4037 C CD  . GLN A 1 540 ? 31.017  54.842 62.882 1.00 43.53 ? 519 GLN X CD  1 
ATOM   4038 O OE1 . GLN A 1 540 ? 31.636  55.395 61.952 1.00 46.44 ? 519 GLN X OE1 1 
ATOM   4039 N NE2 . GLN A 1 540 ? 31.275  53.586 63.269 1.00 46.51 ? 519 GLN X NE2 1 
ATOM   4040 N N   . MET A 1 541 ? 26.092  56.390 62.800 1.00 29.47 ? 520 MET X N   1 
ATOM   4041 C CA  . MET A 1 541 ? 24.840  55.983 63.427 1.00 29.22 ? 520 MET X CA  1 
ATOM   4042 C C   . MET A 1 541 ? 23.903  55.237 62.475 1.00 28.08 ? 520 MET X C   1 
ATOM   4043 O O   . MET A 1 541 ? 23.336  54.200 62.856 1.00 28.25 ? 520 MET X O   1 
ATOM   4044 C CB  . MET A 1 541 ? 24.159  57.119 64.214 1.00 28.92 ? 520 MET X CB  1 
ATOM   4045 C CG  . MET A 1 541 ? 25.039  57.756 65.334 1.00 33.85 ? 520 MET X CG  1 
ATOM   4046 S SD  . MET A 1 541 ? 25.607  56.710 66.790 1.00 45.27 ? 520 MET X SD  1 
ATOM   4047 C CE  . MET A 1 541 ? 27.036  55.798 66.109 1.00 36.53 ? 520 MET X CE  1 
ATOM   4048 N N   . CYS A 1 542 ? 23.773  55.701 61.233 1.00 26.93 ? 521 CYS X N   1 
ATOM   4049 C CA  . CYS A 1 542 ? 22.874  55.023 60.289 1.00 25.95 ? 521 CYS X CA  1 
ATOM   4050 C C   . CYS A 1 542 ? 23.345  53.621 59.819 1.00 25.64 ? 521 CYS X C   1 
ATOM   4051 O O   . CYS A 1 542 ? 22.512  52.744 59.514 1.00 25.65 ? 521 CYS X O   1 
ATOM   4052 C CB  . CYS A 1 542 ? 22.511  55.953 59.150 1.00 25.31 ? 521 CYS X CB  1 
ATOM   4053 S SG  . CYS A 1 542 ? 21.603  57.444 59.802 1.00 28.81 ? 521 CYS X SG  1 
ATOM   4054 N N   . VAL A 1 543 ? 24.650  53.362 59.806 1.00 24.79 ? 522 VAL X N   1 
ATOM   4055 C CA  . VAL A 1 543 ? 25.073  51.973 59.616 1.00 25.21 ? 522 VAL X CA  1 
ATOM   4056 C C   . VAL A 1 543 ? 24.578  51.081 60.767 1.00 25.98 ? 522 VAL X C   1 
ATOM   4057 O O   . VAL A 1 543 ? 24.222  49.906 60.566 1.00 26.31 ? 522 VAL X O   1 
ATOM   4058 C CB  . VAL A 1 543 ? 26.594  51.793 59.412 1.00 25.30 ? 522 VAL X CB  1 
ATOM   4059 C CG1 . VAL A 1 543 ? 27.011  50.321 59.683 1.00 22.46 ? 522 VAL X CG1 1 
ATOM   4060 C CG2 . VAL A 1 543 ? 26.952  52.199 57.979 1.00 25.00 ? 522 VAL X CG2 1 
ATOM   4061 N N   . PHE A 1 544 ? 24.536  51.644 61.971 1.00 25.98 ? 523 PHE X N   1 
ATOM   4062 C CA  . PHE A 1 544 ? 24.018  50.902 63.082 1.00 25.89 ? 523 PHE X CA  1 
ATOM   4063 C C   . PHE A 1 544 ? 22.507  50.634 62.945 1.00 26.65 ? 523 PHE X C   1 
ATOM   4064 O O   . PHE A 1 544 ? 22.063  49.489 63.105 1.00 27.73 ? 523 PHE X O   1 
ATOM   4065 C CB  . PHE A 1 544 ? 24.279  51.649 64.373 1.00 25.56 ? 523 PHE X CB  1 
ATOM   4066 C CG  . PHE A 1 544 ? 23.486  51.115 65.527 1.00 24.16 ? 523 PHE X CG  1 
ATOM   4067 C CD1 . PHE A 1 544 ? 23.906  49.970 66.185 1.00 21.56 ? 523 PHE X CD1 1 
ATOM   4068 C CD2 . PHE A 1 544 ? 22.322  51.748 65.928 1.00 22.53 ? 523 PHE X CD2 1 
ATOM   4069 C CE1 . PHE A 1 544 ? 23.236  49.463 67.229 1.00 22.49 ? 523 PHE X CE1 1 
ATOM   4070 C CE2 . PHE A 1 544 ? 21.591  51.246 66.991 1.00 26.05 ? 523 PHE X CE2 1 
ATOM   4071 C CZ  . PHE A 1 544 ? 22.073  50.082 67.666 1.00 27.55 ? 523 PHE X CZ  1 
ATOM   4072 N N   . TRP A 1 545 ? 21.712  51.670 62.669 1.00 26.05 ? 524 TRP X N   1 
ATOM   4073 C CA  . TRP A 1 545 ? 20.283  51.469 62.528 1.00 25.88 ? 524 TRP X CA  1 
ATOM   4074 C C   . TRP A 1 545 ? 19.883  50.787 61.246 1.00 27.27 ? 524 TRP X C   1 
ATOM   4075 O O   . TRP A 1 545 ? 18.895  50.148 61.239 1.00 28.17 ? 524 TRP X O   1 
ATOM   4076 C CB  . TRP A 1 545 ? 19.540  52.785 62.567 1.00 25.53 ? 524 TRP X CB  1 
ATOM   4077 C CG  . TRP A 1 545 ? 19.627  53.456 63.892 1.00 22.84 ? 524 TRP X CG  1 
ATOM   4078 C CD1 . TRP A 1 545 ? 20.445  54.512 64.225 1.00 20.46 ? 524 TRP X CD1 1 
ATOM   4079 C CD2 . TRP A 1 545 ? 18.907  53.104 65.085 1.00 16.31 ? 524 TRP X CD2 1 
ATOM   4080 N NE1 . TRP A 1 545 ? 20.264  54.833 65.541 1.00 19.78 ? 524 TRP X NE1 1 
ATOM   4081 C CE2 . TRP A 1 545 ? 19.315  53.986 66.087 1.00 19.40 ? 524 TRP X CE2 1 
ATOM   4082 C CE3 . TRP A 1 545 ? 17.967  52.116 65.399 1.00 16.51 ? 524 TRP X CE3 1 
ATOM   4083 C CZ2 . TRP A 1 545 ? 18.781  53.928 67.401 1.00 18.57 ? 524 TRP X CZ2 1 
ATOM   4084 C CZ3 . TRP A 1 545 ? 17.441  52.063 66.657 1.00 15.37 ? 524 TRP X CZ3 1 
ATOM   4085 C CH2 . TRP A 1 545 ? 17.859  52.955 67.660 1.00 17.33 ? 524 TRP X CH2 1 
ATOM   4086 N N   . ASN A 1 546 ? 20.605  50.935 60.143 1.00 29.00 ? 525 ASN X N   1 
ATOM   4087 C CA  . ASN A 1 546 ? 20.120  50.375 58.883 1.00 29.88 ? 525 ASN X CA  1 
ATOM   4088 C C   . ASN A 1 546 ? 20.679  48.990 58.584 1.00 30.86 ? 525 ASN X C   1 
ATOM   4089 O O   . ASN A 1 546 ? 19.990  48.180 57.995 1.00 29.83 ? 525 ASN X O   1 
ATOM   4090 C CB  . ASN A 1 546 ? 20.396  51.320 57.714 1.00 30.27 ? 525 ASN X CB  1 
ATOM   4091 C CG  . ASN A 1 546 ? 19.553  52.589 57.770 1.00 30.87 ? 525 ASN X CG  1 
ATOM   4092 O OD1 . ASN A 1 546 ? 18.418  52.579 58.237 1.00 34.21 ? 525 ASN X OD1 1 
ATOM   4093 N ND2 . ASN A 1 546 ? 20.122  53.690 57.331 1.00 30.34 ? 525 ASN X ND2 1 
ATOM   4094 N N   . GLN A 1 547 ? 21.926  48.725 58.995 1.00 32.27 ? 526 GLN X N   1 
ATOM   4095 C CA  . GLN A 1 547 ? 22.558  47.415 58.783 1.00 32.87 ? 526 GLN X CA  1 
ATOM   4096 C C   . GLN A 1 547 ? 22.622  46.589 60.077 1.00 33.09 ? 526 GLN X C   1 
ATOM   4097 O O   . GLN A 1 547 ? 22.025  45.485 60.144 1.00 33.90 ? 526 GLN X O   1 
ATOM   4098 C CB  . GLN A 1 547 ? 23.958  47.549 58.189 1.00 33.19 ? 526 GLN X CB  1 
ATOM   4099 C CG  . GLN A 1 547 ? 24.045  47.786 56.644 1.00 36.82 ? 526 GLN X CG  1 
ATOM   4100 C CD  . GLN A 1 547 ? 25.386  48.472 56.188 1.00 39.88 ? 526 GLN X CD  1 
ATOM   4101 N N   . PHE A 1 548 ? 23.318  47.086 61.108 1.00 31.42 ? 527 PHE X N   1 
ATOM   4102 C CA  . PHE A 1 548 ? 23.589  46.225 62.262 1.00 29.92 ? 527 PHE X CA  1 
ATOM   4103 C C   . PHE A 1 548 ? 22.362  45.812 63.114 1.00 30.32 ? 527 PHE X C   1 
ATOM   4104 O O   . PHE A 1 548 ? 22.143  44.622 63.371 1.00 30.88 ? 527 PHE X O   1 
ATOM   4105 C CB  . PHE A 1 548 ? 24.678  46.803 63.168 1.00 29.32 ? 527 PHE X CB  1 
ATOM   4106 C CG  . PHE A 1 548 ? 24.983  45.930 64.374 1.00 27.18 ? 527 PHE X CG  1 
ATOM   4107 C CD1 . PHE A 1 548 ? 25.732  44.741 64.234 1.00 24.12 ? 527 PHE X CD1 1 
ATOM   4108 C CD2 . PHE A 1 548 ? 24.492  46.266 65.639 1.00 24.17 ? 527 PHE X CD2 1 
ATOM   4109 C CE1 . PHE A 1 548 ? 26.000  43.937 65.334 1.00 23.49 ? 527 PHE X CE1 1 
ATOM   4110 C CE2 . PHE A 1 548 ? 24.735  45.435 66.749 1.00 24.27 ? 527 PHE X CE2 1 
ATOM   4111 C CZ  . PHE A 1 548 ? 25.493  44.274 66.596 1.00 22.73 ? 527 PHE X CZ  1 
ATOM   4112 N N   . LEU A 1 549 ? 21.588  46.772 63.594 1.00 29.82 ? 528 LEU X N   1 
ATOM   4113 C CA  . LEU A 1 549 ? 20.527  46.437 64.516 1.00 29.85 ? 528 LEU X CA  1 
ATOM   4114 C C   . LEU A 1 549 ? 19.497  45.465 63.908 1.00 30.53 ? 528 LEU X C   1 
ATOM   4115 O O   . LEU A 1 549 ? 19.063  44.510 64.561 1.00 30.10 ? 528 LEU X O   1 
ATOM   4116 C CB  . LEU A 1 549 ? 19.836  47.709 65.003 1.00 29.21 ? 528 LEU X CB  1 
ATOM   4117 C CG  . LEU A 1 549 ? 18.770  47.471 66.090 1.00 28.62 ? 528 LEU X CG  1 
ATOM   4118 C CD1 . LEU A 1 549 ? 19.370  46.695 67.330 1.00 25.70 ? 528 LEU X CD1 1 
ATOM   4119 C CD2 . LEU A 1 549 ? 18.117  48.783 66.510 1.00 23.33 ? 528 LEU X CD2 1 
ATOM   4120 N N   . PRO A 1 550 ? 19.076  45.728 62.666 1.00 31.27 ? 529 PRO X N   1 
ATOM   4121 C CA  . PRO A 1 550 ? 18.150  44.811 62.018 1.00 32.42 ? 529 PRO X CA  1 
ATOM   4122 C C   . PRO A 1 550 ? 18.693  43.402 61.987 1.00 33.77 ? 529 PRO X C   1 
ATOM   4123 O O   . PRO A 1 550 ? 17.972  42.476 62.340 1.00 34.73 ? 529 PRO X O   1 
ATOM   4124 C CB  . PRO A 1 550 ? 18.028  45.375 60.583 1.00 31.87 ? 529 PRO X CB  1 
ATOM   4125 C CG  . PRO A 1 550 ? 18.328  46.815 60.721 1.00 31.33 ? 529 PRO X CG  1 
ATOM   4126 C CD  . PRO A 1 550 ? 19.089  47.048 62.010 1.00 31.30 ? 529 PRO X CD  1 
ATOM   4127 N N   . LYS A 1 551 ? 19.940  43.227 61.547 1.00 35.18 ? 530 LYS X N   1 
ATOM   4128 C CA  . LYS A 1 551 ? 20.595  41.921 61.611 1.00 36.76 ? 530 LYS X CA  1 
ATOM   4129 C C   . LYS A 1 551 ? 20.554  41.317 63.013 1.00 36.87 ? 530 LYS X C   1 
ATOM   4130 O O   . LYS A 1 551 ? 20.166  40.165 63.177 1.00 37.28 ? 530 LYS X O   1 
ATOM   4131 C CB  . LYS A 1 551 ? 22.034  41.972 61.088 1.00 37.41 ? 530 LYS X CB  1 
ATOM   4132 C CG  . LYS A 1 551 ? 22.608  40.577 60.879 1.00 42.15 ? 530 LYS X CG  1 
ATOM   4133 C CD  . LYS A 1 551 ? 23.741  40.513 59.805 1.00 50.47 ? 530 LYS X CD  1 
ATOM   4134 C CE  . LYS A 1 551 ? 24.432  39.088 59.823 1.00 53.84 ? 530 LYS X CE  1 
ATOM   4135 N NZ  . LYS A 1 551 ? 25.796  39.009 59.172 1.00 56.17 ? 530 LYS X NZ  1 
ATOM   4136 N N   . LEU A 1 552 ? 20.921  42.084 64.028 1.00 37.05 ? 531 LEU X N   1 
ATOM   4137 C CA  . LEU A 1 552 ? 20.906  41.547 65.373 1.00 37.78 ? 531 LEU X CA  1 
ATOM   4138 C C   . LEU A 1 552 ? 19.507  41.090 65.839 1.00 38.86 ? 531 LEU X C   1 
ATOM   4139 O O   . LEU A 1 552 ? 19.360  40.035 66.490 1.00 37.90 ? 531 LEU X O   1 
ATOM   4140 C CB  . LEU A 1 552 ? 21.643  42.512 66.314 1.00 37.43 ? 531 LEU X CB  1 
ATOM   4141 C CG  . LEU A 1 552 ? 21.379  42.900 67.766 1.00 36.25 ? 531 LEU X CG  1 
ATOM   4142 C CD1 . LEU A 1 552 ? 20.495  41.922 68.425 1.00 38.28 ? 531 LEU X CD1 1 
ATOM   4143 C CD2 . LEU A 1 552 ? 22.701  43.074 68.521 1.00 34.89 ? 531 LEU X CD2 1 
ATOM   4144 N N   . LEU A 1 553 ? 18.470  41.844 65.498 1.00 40.50 ? 532 LEU X N   1 
ATOM   4145 C CA  . LEU A 1 553 ? 17.126  41.390 65.886 1.00 43.02 ? 532 LEU X CA  1 
ATOM   4146 C C   . LEU A 1 553 ? 16.572  40.248 65.021 1.00 44.93 ? 532 LEU X C   1 
ATOM   4147 O O   . LEU A 1 553 ? 15.771  39.477 65.514 1.00 45.20 ? 532 LEU X O   1 
ATOM   4148 C CB  . LEU A 1 553 ? 16.094  42.526 66.009 1.00 42.36 ? 532 LEU X CB  1 
ATOM   4149 C CG  . LEU A 1 553 ? 16.309  43.712 66.955 1.00 41.33 ? 532 LEU X CG  1 
ATOM   4150 C CD1 . LEU A 1 553 ? 15.586  44.902 66.395 1.00 38.85 ? 532 LEU X CD1 1 
ATOM   4151 C CD2 . LEU A 1 553 ? 15.890  43.476 68.415 1.00 40.83 ? 532 LEU X CD2 1 
ATOM   4152 N N   . ASN A 1 554 ? 16.988  40.124 63.759 1.00 47.61 ? 533 ASN X N   1 
ATOM   4153 C CA  . ASN A 1 554 ? 16.633  38.928 62.968 1.00 50.74 ? 533 ASN X CA  1 
ATOM   4154 C C   . ASN A 1 554 ? 17.186  37.634 63.585 1.00 52.20 ? 533 ASN X C   1 
ATOM   4155 O O   . ASN A 1 554 ? 16.624  36.555 63.422 1.00 52.78 ? 533 ASN X O   1 
ATOM   4156 C CB  . ASN A 1 554 ? 17.117  39.017 61.507 1.00 50.64 ? 533 ASN X CB  1 
ATOM   4157 C CG  . ASN A 1 554 ? 16.369  38.045 60.596 1.00 53.38 ? 533 ASN X CG  1 
ATOM   4158 O OD1 . ASN A 1 554 ? 15.178  37.831 60.796 1.00 57.32 ? 533 ASN X OD1 1 
ATOM   4159 N ND2 . ASN A 1 554 ? 17.051  37.452 59.602 1.00 56.02 ? 533 ASN X ND2 1 
ATOM   4160 N N   . ALA A 1 555 ? 18.312  37.745 64.272 1.00 54.15 ? 534 ALA X N   1 
ATOM   4161 C CA  . ALA A 1 555 ? 19.032  36.572 64.696 1.00 55.99 ? 534 ALA X CA  1 
ATOM   4162 C C   . ALA A 1 555 ? 18.603  36.136 66.093 1.00 57.87 ? 534 ALA X C   1 
ATOM   4163 O O   . ALA A 1 555 ? 18.490  34.936 66.340 1.00 58.65 ? 534 ALA X O   1 
ATOM   4164 C CB  . ALA A 1 555 ? 20.518  36.819 64.629 1.00 55.73 ? 534 ALA X CB  1 
ATOM   4165 N N   . THR A 1 556 ? 18.331  37.099 66.983 1.00 59.78 ? 535 THR X N   1 
ATOM   4166 C CA  . THR A 1 556 ? 17.896  36.826 68.383 1.00 61.17 ? 535 THR X CA  1 
ATOM   4167 C C   . THR A 1 556 ? 16.382  36.880 68.582 1.00 61.58 ? 535 THR X C   1 
ATOM   4168 O O   . THR A 1 556 ? 15.614  36.643 67.647 1.00 62.46 ? 535 THR X O   1 
ATOM   4169 C CB  . THR A 1 556 ? 18.510  37.836 69.396 1.00 61.68 ? 535 THR X CB  1 
ATOM   4170 O OG1 . THR A 1 556 ? 18.154  39.179 69.030 1.00 62.42 ? 535 THR X OG1 1 
ATOM   4171 C CG2 . THR A 1 556 ? 20.022  37.737 69.419 1.00 62.47 ? 535 THR X CG2 1 
HETATM 4172 C C1  . NAG B 2 .   ? 18.869  62.618 34.001 0.70 33.39 ? 1   NAG A C1  1 
HETATM 4173 C C2  . NAG B 2 .   ? 20.389  62.535 34.030 0.70 32.17 ? 1   NAG A C2  1 
HETATM 4174 C C3  . NAG B 2 .   ? 21.010  63.136 32.781 0.70 34.85 ? 1   NAG A C3  1 
HETATM 4175 C C4  . NAG B 2 .   ? 20.324  62.663 31.504 0.70 37.71 ? 1   NAG A C4  1 
HETATM 4176 C C5  . NAG B 2 .   ? 18.839  62.949 31.730 0.70 37.50 ? 1   NAG A C5  1 
HETATM 4177 C C6  . NAG B 2 .   ? 17.922  62.697 30.532 0.70 38.08 ? 1   NAG A C6  1 
HETATM 4178 C C7  . NAG B 2 .   ? 21.304  62.511 36.263 0.70 26.73 ? 1   NAG A C7  1 
HETATM 4179 C C8  . NAG B 2 .   ? 21.979  63.229 37.389 0.70 22.40 ? 1   NAG A C8  1 
HETATM 4180 N N2  . NAG B 2 .   ? 20.933  63.227 35.192 0.70 30.03 ? 1   NAG A N2  1 
HETATM 4181 O O3  . NAG B 2 .   ? 22.364  62.781 32.768 0.70 33.02 ? 1   NAG A O3  1 
HETATM 4182 O O4  . NAG B 2 .   ? 20.902  63.312 30.374 0.70 41.45 ? 1   NAG A O4  1 
HETATM 4183 O O5  . NAG B 2 .   ? 18.464  62.086 32.777 0.70 34.53 ? 1   NAG A O5  1 
HETATM 4184 O O6  . NAG B 2 .   ? 17.695  61.301 30.375 0.70 38.81 ? 1   NAG A O6  1 
HETATM 4185 O O7  . NAG B 2 .   ? 21.099  61.296 36.338 0.70 24.08 ? 1   NAG A O7  1 
HETATM 4186 C C1  . NAG B 2 .   ? 21.559  62.389 29.440 0.70 44.92 ? 2   NAG A C1  1 
HETATM 4187 C C2  . NAG B 2 .   ? 21.673  63.003 28.037 0.70 46.28 ? 2   NAG A C2  1 
HETATM 4188 C C3  . NAG B 2 .   ? 22.580  62.263 27.039 0.70 48.31 ? 2   NAG A C3  1 
HETATM 4189 C C4  . NAG B 2 .   ? 23.715  61.447 27.636 0.70 48.12 ? 2   NAG A C4  1 
HETATM 4190 C C5  . NAG B 2 .   ? 23.234  60.864 28.968 0.70 46.83 ? 2   NAG A C5  1 
HETATM 4191 C C6  . NAG B 2 .   ? 24.306  60.038 29.670 0.70 44.60 ? 2   NAG A C6  1 
HETATM 4192 C C7  . NAG B 2 .   ? 19.707  64.197 27.435 0.70 44.06 ? 2   NAG A C7  1 
HETATM 4193 C C8  . NAG B 2 .   ? 18.329  64.189 26.823 0.70 42.83 ? 2   NAG A C8  1 
HETATM 4194 N N2  . NAG B 2 .   ? 20.365  63.050 27.417 0.70 44.92 ? 2   NAG A N2  1 
HETATM 4195 O O3  . NAG B 2 .   ? 23.182  63.203 26.176 0.70 50.30 ? 2   NAG A O3  1 
HETATM 4196 O O4  . NAG B 2 .   ? 24.139  60.497 26.654 0.70 49.43 ? 2   NAG A O4  1 
HETATM 4197 O O5  . NAG B 2 .   ? 22.855  61.947 29.794 0.70 45.17 ? 2   NAG A O5  1 
HETATM 4198 O O6  . NAG B 2 .   ? 25.407  60.903 29.747 0.70 41.70 ? 2   NAG A O6  1 
HETATM 4199 O O7  . NAG B 2 .   ? 20.213  65.206 27.936 0.70 41.58 ? 2   NAG A O7  1 
HETATM 4200 O OAU . BM4 C 3 .   ? 5.897   64.022 63.009 1.00 19.06 ? 601 BM4 X OAU 1 
HETATM 4201 C CAS . BM4 C 3 .   ? 4.844   64.679 63.585 1.00 20.83 ? 601 BM4 X CAS 1 
HETATM 4202 C CAQ . BM4 C 3 .   ? 4.715   66.062 63.430 1.00 20.27 ? 601 BM4 X CAQ 1 
HETATM 4203 C CAT . BM4 C 3 .   ? 3.902   63.967 64.327 1.00 17.77 ? 601 BM4 X CAT 1 
HETATM 4204 C CAR . BM4 C 3 .   ? 2.834   64.655 64.896 1.00 19.74 ? 601 BM4 X CAR 1 
HETATM 4205 C CAP . BM4 C 3 .   ? 2.721   66.040 64.750 1.00 23.05 ? 601 BM4 X CAP 1 
HETATM 4206 C CAO . BM4 C 3 .   ? 3.672   66.768 64.031 1.00 23.68 ? 601 BM4 X CAO 1 
HETATM 4207 C CAC . BM4 C 3 .   ? 3.554   68.313 63.853 1.00 25.24 ? 601 BM4 X CAC 1 
HETATM 4208 C CAM . BM4 C 3 .   ? 2.589   68.552 62.690 1.00 24.76 ? 601 BM4 X CAM 1 
HETATM 4209 C CAN . BM4 C 3 .   ? 3.322   68.430 61.334 1.00 23.69 ? 601 BM4 X CAN 1 
HETATM 4210 C CAB . BM4 C 3 .   ? 2.996   69.034 65.107 1.00 26.82 ? 601 BM4 X CAB 1 
HETATM 4211 C CAD . BM4 C 3 .   ? 4.913   68.923 63.408 1.00 26.10 ? 601 BM4 X CAD 1 
HETATM 4212 C CAE . BM4 C 3 .   ? 5.928   69.200 64.527 1.00 27.39 ? 601 BM4 X CAE 1 
HETATM 4213 C CAF . BM4 C 3 .   ? 5.393   70.240 65.520 1.00 29.42 ? 601 BM4 X CAF 1 
HETATM 4214 C CAG . BM4 C 3 .   ? 4.783   69.570 66.754 1.00 26.35 ? 601 BM4 X CAG 1 
HETATM 4215 N NAA . BM4 C 3 .   ? 3.720   68.637 66.338 1.00 31.78 ? 601 BM4 X NAA 1 
HETATM 4216 C CAH . BM4 C 3 .   ? 2.868   68.223 67.475 1.00 34.31 ? 601 BM4 X CAH 1 
HETATM 4217 C CAI . BM4 C 3 .   ? 3.743   67.401 68.466 1.00 40.76 ? 601 BM4 X CAI 1 
HETATM 4218 C CAJ . BM4 C 3 .   ? 3.057   66.111 68.942 1.00 41.23 ? 601 BM4 X CAJ 1 
HETATM 4219 C CAK . BM4 C 3 .   ? 4.051   64.985 69.281 1.00 41.81 ? 601 BM4 X CAK 1 
HETATM 4220 C CAL . BM4 C 3 .   ? 3.327   63.626 69.455 1.00 40.07 ? 601 BM4 X CAL 1 
HETATM 4221 C CAV . BM4 C 3 .   ? 2.707   63.457 70.847 1.00 37.20 ? 601 BM4 X CAV 1 
HETATM 4222 C CAW . BM4 C 3 .   ? 1.382   62.686 70.825 1.00 37.64 ? 601 BM4 X CAW 1 
HETATM 4223 C CAX . BM4 C 3 .   ? 1.200   61.824 72.092 1.00 38.39 ? 601 BM4 X CAX 1 
HETATM 4224 C CAY . BM4 C 3 .   ? -0.219  61.946 72.680 1.00 39.88 ? 601 BM4 X CAY 1 
HETATM 4225 N NAZ . BM4 C 3 .   ? -0.634  60.686 73.332 1.00 41.19 ? 601 BM4 X NAZ 1 
HETATM 4226 C C1  . NAG D 4 .   ? -18.914 83.614 50.364 0.70 53.03 ? 602 NAG X C1  1 
HETATM 4227 C C2  . NAG D 4 .   ? -18.500 83.975 51.817 0.70 54.76 ? 602 NAG X C2  1 
HETATM 4228 C C3  . NAG D 4 .   ? -18.227 85.478 52.055 0.70 56.26 ? 602 NAG X C3  1 
HETATM 4229 C C4  . NAG D 4 .   ? -18.929 86.472 51.107 0.70 57.02 ? 602 NAG X C4  1 
HETATM 4230 C C5  . NAG D 4 .   ? -19.501 85.810 49.856 0.70 56.69 ? 602 NAG X C5  1 
HETATM 4231 C C6  . NAG D 4 .   ? -19.470 86.762 48.670 0.70 56.88 ? 602 NAG X C6  1 
HETATM 4232 C C7  . NAG D 4 .   ? -19.103 83.297 54.188 0.70 55.08 ? 602 NAG X C7  1 
HETATM 4233 C C8  . NAG D 4 .   ? -19.145 84.494 55.104 0.70 55.30 ? 602 NAG X C8  1 
HETATM 4234 N N2  . NAG D 4 .   ? -19.394 83.466 52.867 0.70 54.70 ? 602 NAG X N2  1 
HETATM 4235 O O3  . NAG D 4 .   ? -16.833 85.740 52.007 0.70 54.73 ? 602 NAG X O3  1 
HETATM 4236 O O4  . NAG D 4 .   ? -19.932 87.189 51.801 0.70 57.92 ? 602 NAG X O4  1 
HETATM 4237 O O5  . NAG D 4 .   ? -18.694 84.713 49.514 0.70 54.74 ? 602 NAG X O5  1 
HETATM 4238 O O6  . NAG D 4 .   ? -19.844 86.002 47.541 0.70 55.94 ? 602 NAG X O6  1 
HETATM 4239 O O7  . NAG D 4 .   ? -18.839 82.204 54.700 0.70 52.29 ? 602 NAG X O7  1 
HETATM 4240 C C1  . NAG E 4 .   ? 6.897   90.411 68.575 0.70 57.47 ? 605 NAG X C1  1 
HETATM 4241 C C2  . NAG E 4 .   ? 5.766   89.432 68.964 0.70 57.94 ? 605 NAG X C2  1 
HETATM 4242 C C3  . NAG E 4 .   ? 4.808   89.948 70.036 0.70 58.42 ? 605 NAG X C3  1 
HETATM 4243 C C4  . NAG E 4 .   ? 5.626   90.296 71.237 0.70 58.47 ? 605 NAG X C4  1 
HETATM 4244 C C5  . NAG E 4 .   ? 6.239   91.568 70.660 0.70 59.18 ? 605 NAG X C5  1 
HETATM 4245 C C6  . NAG E 4 .   ? 6.742   92.514 71.758 0.70 60.08 ? 605 NAG X C6  1 
HETATM 4246 C C7  . NAG E 4 .   ? 4.456   87.866 67.986 0.70 56.93 ? 605 NAG X C7  1 
HETATM 4247 C C8  . NAG E 4 .   ? 3.058   87.540 67.511 0.70 57.31 ? 605 NAG X C8  1 
HETATM 4248 N N2  . NAG E 4 .   ? 4.930   89.080 67.847 0.70 57.34 ? 605 NAG X N2  1 
HETATM 4249 O O3  . NAG E 4 .   ? 3.803   89.045 70.422 0.70 59.05 ? 605 NAG X O3  1 
HETATM 4250 O O4  . NAG E 4 .   ? 4.774   90.456 72.364 0.70 55.90 ? 605 NAG X O4  1 
HETATM 4251 O O5  . NAG E 4 .   ? 7.243   91.243 69.689 0.70 58.40 ? 605 NAG X O5  1 
HETATM 4252 O O6  . NAG E 4 .   ? 7.562   91.824 72.678 0.70 60.52 ? 605 NAG X O6  1 
HETATM 4253 O O7  . NAG E 4 .   ? 5.183   87.059 68.546 0.70 55.09 ? 605 NAG X O7  1 
HETATM 4254 O O   . HOH F 5 .   ? 20.856  82.698 53.721 1.00 45.52 ? 701 HOH X O   1 
HETATM 4255 O O   . HOH F 5 .   ? 26.946  55.161 44.972 1.00 33.19 ? 702 HOH X O   1 
HETATM 4256 O O   . HOH F 5 .   ? 11.950  67.466 83.317 1.00 27.84 ? 703 HOH X O   1 
HETATM 4257 O O   . HOH F 5 .   ? 3.902   80.930 51.524 1.00 22.03 ? 704 HOH X O   1 
HETATM 4258 O O   . HOH F 5 .   ? -20.650 75.615 37.772 1.00 47.06 ? 705 HOH X O   1 
HETATM 4259 O O   . HOH F 5 .   ? 19.102  75.252 71.635 1.00 40.66 ? 706 HOH X O   1 
HETATM 4260 O O   . HOH F 5 .   ? 10.327  68.826 59.906 1.00 22.28 ? 707 HOH X O   1 
HETATM 4261 O O   . HOH F 5 .   ? -9.281  44.815 51.269 1.00 42.42 ? 708 HOH X O   1 
HETATM 4262 O O   . HOH F 5 .   ? 7.242   65.341 81.788 1.00 36.51 ? 709 HOH X O   1 
HETATM 4263 O O   . HOH F 5 .   ? 10.346  52.098 37.438 1.00 35.55 ? 710 HOH X O   1 
HETATM 4264 O O   . HOH F 5 .   ? 2.301   63.829 77.197 1.00 27.88 ? 711 HOH X O   1 
HETATM 4265 O O   . HOH F 5 .   ? 1.293   43.782 54.734 1.00 25.93 ? 712 HOH X O   1 
HETATM 4266 O O   . HOH F 5 .   ? -4.253  86.007 39.670 1.00 31.69 ? 713 HOH X O   1 
HETATM 4267 O O   . HOH F 5 .   ? 13.023  86.659 47.429 1.00 35.70 ? 714 HOH X O   1 
HETATM 4268 O O   . HOH F 5 .   ? 3.957   55.648 78.256 1.00 30.13 ? 715 HOH X O   1 
HETATM 4269 O O   . HOH F 5 .   ? 19.331  68.069 38.967 1.00 31.34 ? 716 HOH X O   1 
HETATM 4270 O O   . HOH F 5 .   ? -9.015  43.018 70.086 1.00 57.77 ? 717 HOH X O   1 
HETATM 4271 O O   . HOH F 5 .   ? 19.426  84.997 62.829 1.00 29.47 ? 718 HOH X O   1 
HETATM 4272 O O   . HOH F 5 .   ? 5.260   48.003 75.424 1.00 30.72 ? 719 HOH X O   1 
HETATM 4273 O O   . HOH F 5 .   ? -2.250  78.030 62.497 1.00 27.88 ? 720 HOH X O   1 
HETATM 4274 O O   . HOH F 5 .   ? -6.555  46.356 51.503 1.00 44.54 ? 721 HOH X O   1 
HETATM 4275 O O   . HOH F 5 .   ? -15.584 60.541 48.637 1.00 26.99 ? 722 HOH X O   1 
HETATM 4276 O O   . HOH F 5 .   ? -4.393  70.424 62.484 1.00 20.66 ? 723 HOH X O   1 
HETATM 4277 O O   . HOH F 5 .   ? -5.769  45.138 57.622 1.00 28.21 ? 724 HOH X O   1 
HETATM 4278 O O   . HOH F 5 .   ? 0.189   70.531 68.671 1.00 29.46 ? 725 HOH X O   1 
HETATM 4279 O O   . HOH F 5 .   ? 4.821   62.515 61.145 1.00 22.88 ? 726 HOH X O   1 
HETATM 4280 O O   . HOH F 5 .   ? 18.391  60.671 41.858 1.00 23.88 ? 727 HOH X O   1 
HETATM 4281 O O   . HOH F 5 .   ? 23.879  77.966 54.901 1.00 51.19 ? 728 HOH X O   1 
HETATM 4282 O O   . HOH F 5 .   ? 3.616   56.680 70.324 1.00 29.41 ? 729 HOH X O   1 
HETATM 4283 O O   . HOH F 5 .   ? 17.829  50.998 45.112 1.00 29.35 ? 730 HOH X O   1 
HETATM 4284 O O   . HOH F 5 .   ? -17.299 51.287 48.024 1.00 36.61 ? 731 HOH X O   1 
HETATM 4285 O O   . HOH F 5 .   ? 3.553   69.137 57.966 1.00 15.45 ? 732 HOH X O   1 
HETATM 4286 O O   . HOH F 5 .   ? -4.299  52.077 56.526 1.00 30.33 ? 733 HOH X O   1 
HETATM 4287 O O   . HOH F 5 .   ? 6.901   42.020 49.233 1.00 49.74 ? 734 HOH X O   1 
HETATM 4288 O O   . HOH F 5 .   ? -10.765 65.907 68.953 1.00 29.22 ? 735 HOH X O   1 
HETATM 4289 O O   . HOH F 5 .   ? -21.310 66.486 46.396 1.00 50.92 ? 736 HOH X O   1 
HETATM 4290 O O   . HOH F 5 .   ? 21.297  51.935 53.794 1.00 29.29 ? 737 HOH X O   1 
HETATM 4291 O O   . HOH F 5 .   ? 16.396  80.271 70.247 1.00 36.92 ? 738 HOH X O   1 
HETATM 4292 O O   . HOH F 5 .   ? 13.312  69.052 57.416 1.00 26.35 ? 739 HOH X O   1 
HETATM 4293 O O   . HOH F 5 .   ? -9.892  52.095 55.057 1.00 20.66 ? 740 HOH X O   1 
HETATM 4294 O O   . HOH F 5 .   ? -15.524 66.572 51.959 1.00 30.31 ? 741 HOH X O   1 
HETATM 4295 O O   . HOH F 5 .   ? -20.302 56.812 59.705 1.00 26.70 ? 742 HOH X O   1 
HETATM 4296 O O   . HOH F 5 .   ? 7.205   52.619 56.549 1.00 15.95 ? 743 HOH X O   1 
HETATM 4297 O O   . HOH F 5 .   ? 16.892  72.543 84.450 1.00 60.45 ? 744 HOH X O   1 
HETATM 4298 O O   . HOH F 5 .   ? -20.531 69.220 51.241 1.00 35.53 ? 745 HOH X O   1 
HETATM 4299 O O   . HOH F 5 .   ? 16.237  74.225 77.653 1.00 39.89 ? 746 HOH X O   1 
HETATM 4300 O O   . HOH F 5 .   ? -0.122  69.368 59.625 1.00 25.47 ? 747 HOH X O   1 
HETATM 4301 O O   . HOH F 5 .   ? -21.155 47.104 57.930 1.00 45.73 ? 748 HOH X O   1 
HETATM 4302 O O   . HOH F 5 .   ? -6.411  49.640 61.115 1.00 31.82 ? 749 HOH X O   1 
HETATM 4303 O O   . HOH F 5 .   ? 3.039   54.330 63.755 1.00 21.62 ? 750 HOH X O   1 
HETATM 4304 O O   . HOH F 5 .   ? -3.690  51.250 59.770 1.00 24.49 ? 751 HOH X O   1 
HETATM 4305 O O   . HOH F 5 .   ? -0.234  67.769 64.739 1.00 20.61 ? 752 HOH X O   1 
HETATM 4306 O O   . HOH F 5 .   ? 10.608  56.038 68.881 1.00 15.98 ? 753 HOH X O   1 
HETATM 4307 O O   . HOH F 5 .   ? -0.504  63.437 59.217 1.00 15.67 ? 754 HOH X O   1 
HETATM 4308 O O   . HOH F 5 .   ? -1.242  71.884 73.706 1.00 35.10 ? 755 HOH X O   1 
HETATM 4309 O O   . HOH F 5 .   ? 2.964   81.971 32.466 1.00 28.90 ? 756 HOH X O   1 
HETATM 4310 O O   . HOH F 5 .   ? 30.654  52.525 65.747 1.00 31.63 ? 757 HOH X O   1 
HETATM 4311 O O   . HOH F 5 .   ? 18.235  79.918 46.739 1.00 55.55 ? 758 HOH X O   1 
HETATM 4312 O O   . HOH F 5 .   ? 24.941  58.844 52.517 1.00 53.11 ? 759 HOH X O   1 
HETATM 4313 O O   . HOH F 5 .   ? 0.512   77.744 62.143 1.00 31.35 ? 760 HOH X O   1 
HETATM 4314 O O   . HOH F 5 .   ? 25.525  75.256 54.914 1.00 78.10 ? 761 HOH X O   1 
HETATM 4315 O O   . HOH F 5 .   ? 3.369   51.718 64.481 1.00 22.68 ? 762 HOH X O   1 
HETATM 4316 O O   . HOH F 5 .   ? 3.717   67.366 36.783 1.00 31.29 ? 763 HOH X O   1 
HETATM 4317 O O   . HOH F 5 .   ? -6.422  84.157 38.996 1.00 35.05 ? 764 HOH X O   1 
HETATM 4318 O O   . HOH F 5 .   ? 22.166  59.893 86.638 1.00 38.60 ? 765 HOH X O   1 
HETATM 4319 O O   . HOH F 5 .   ? 16.478  59.270 31.867 1.00 33.53 ? 766 HOH X O   1 
HETATM 4320 O O   . HOH F 5 .   ? 13.068  83.778 48.007 1.00 28.53 ? 767 HOH X O   1 
HETATM 4321 O O   . HOH F 5 .   ? 7.569   63.669 79.303 1.00 22.50 ? 768 HOH X O   1 
HETATM 4322 O O   . HOH F 5 .   ? -0.083  40.549 57.478 1.00 38.08 ? 769 HOH X O   1 
HETATM 4323 O O   . HOH F 5 .   ? -9.762  62.266 59.762 1.00 28.78 ? 770 HOH X O   1 
HETATM 4324 O O   . HOH F 5 .   ? 20.741  59.487 41.328 1.00 29.51 ? 771 HOH X O   1 
HETATM 4325 O O   . HOH F 5 .   ? 18.342  91.338 62.433 1.00 38.32 ? 772 HOH X O   1 
HETATM 4326 O O   . HOH F 5 .   ? 13.967  51.570 56.383 1.00 36.39 ? 773 HOH X O   1 
HETATM 4327 O O   . HOH F 5 .   ? 22.381  49.376 56.279 1.00 52.85 ? 774 HOH X O   1 
HETATM 4328 O O   . HOH F 5 .   ? -15.366 72.989 54.367 1.00 26.38 ? 775 HOH X O   1 
HETATM 4329 O O   . HOH F 5 .   ? 4.135   78.107 78.803 1.00 45.24 ? 776 HOH X O   1 
HETATM 4330 O O   . HOH F 5 .   ? -3.443  46.635 72.363 1.00 27.36 ? 777 HOH X O   1 
HETATM 4331 O O   . HOH F 5 .   ? -4.420  71.101 34.247 1.00 27.84 ? 778 HOH X O   1 
HETATM 4332 O O   . HOH F 5 .   ? -15.475 67.718 49.548 1.00 29.37 ? 779 HOH X O   1 
HETATM 4333 O O   . HOH F 5 .   ? -3.173  52.189 44.160 1.00 33.08 ? 780 HOH X O   1 
HETATM 4334 O O   . HOH F 5 .   ? 21.189  77.759 65.403 1.00 35.96 ? 781 HOH X O   1 
HETATM 4335 O O   . HOH F 5 .   ? -17.871 63.854 67.407 1.00 40.47 ? 782 HOH X O   1 
HETATM 4336 O O   . HOH F 5 .   ? -0.214  94.124 51.768 1.00 43.22 ? 783 HOH X O   1 
HETATM 4337 O O   . HOH F 5 .   ? -20.259 59.276 59.267 1.00 30.81 ? 784 HOH X O   1 
HETATM 4338 O O   . HOH F 5 .   ? -18.010 68.605 49.028 1.00 31.91 ? 785 HOH X O   1 
HETATM 4339 O O   . HOH F 5 .   ? -13.591 58.100 56.534 1.00 25.06 ? 786 HOH X O   1 
HETATM 4340 O O   . HOH F 5 .   ? -7.437  70.768 56.565 1.00 31.28 ? 787 HOH X O   1 
HETATM 4341 O O   . HOH F 5 .   ? 15.607  53.001 61.677 1.00 31.73 ? 788 HOH X O   1 
HETATM 4342 O O   . HOH F 5 .   ? -6.567  94.328 46.488 1.00 48.85 ? 789 HOH X O   1 
HETATM 4343 O O   . HOH F 5 .   ? 20.577  72.516 79.369 1.00 48.27 ? 790 HOH X O   1 
HETATM 4344 O O   . HOH F 5 .   ? -1.170  75.218 31.463 1.00 40.50 ? 791 HOH X O   1 
HETATM 4345 O O   . HOH F 5 .   ? 9.384   56.287 36.221 1.00 24.88 ? 792 HOH X O   1 
HETATM 4346 O O   . HOH F 5 .   ? 11.513  87.251 44.874 1.00 35.07 ? 793 HOH X O   1 
HETATM 4347 O O   . HOH F 5 .   ? 22.424  72.313 77.247 1.00 35.04 ? 794 HOH X O   1 
HETATM 4348 O O   . HOH F 5 .   ? -15.641 56.773 72.895 1.00 40.71 ? 795 HOH X O   1 
HETATM 4349 O O   . HOH F 5 .   ? -10.763 81.706 55.936 1.00 32.01 ? 796 HOH X O   1 
HETATM 4350 O O   . HOH F 5 .   ? 11.685  46.096 75.276 1.00 46.38 ? 797 HOH X O   1 
HETATM 4351 O O   . HOH F 5 .   ? -5.729  74.662 70.190 1.00 43.29 ? 798 HOH X O   1 
HETATM 4352 O O   . HOH F 5 .   ? 3.488   46.186 61.391 1.00 34.31 ? 799 HOH X O   1 
HETATM 4353 O O   . HOH F 5 .   ? 8.638   50.483 37.110 1.00 24.33 ? 800 HOH X O   1 
HETATM 4354 O O   . HOH F 5 .   ? 16.410  58.053 36.043 1.00 35.53 ? 801 HOH X O   1 
HETATM 4355 O O   . HOH F 5 .   ? 31.725  70.318 46.686 1.00 37.35 ? 802 HOH X O   1 
HETATM 4356 O O   . HOH F 5 .   ? -6.007  45.830 47.673 1.00 57.19 ? 803 HOH X O   1 
HETATM 4357 O O   . HOH F 5 .   ? 25.532  84.075 54.824 1.00 41.17 ? 804 HOH X O   1 
HETATM 4358 O O   . HOH F 5 .   ? 25.350  48.542 77.010 1.00 34.40 ? 805 HOH X O   1 
HETATM 4359 O O   . HOH F 5 .   ? 8.842   94.553 71.449 1.00 48.50 ? 806 HOH X O   1 
HETATM 4360 O O   . HOH F 5 .   ? -15.840 44.745 72.682 1.00 62.40 ? 807 HOH X O   1 
HETATM 4361 O O   . HOH F 5 .   ? -12.579 63.090 59.187 1.00 35.74 ? 808 HOH X O   1 
HETATM 4362 O O   . HOH F 5 .   ? 12.984  84.269 41.347 1.00 42.58 ? 809 HOH X O   1 
HETATM 4363 O O   . HOH F 5 .   ? 14.142  79.333 35.282 1.00 54.58 ? 810 HOH X O   1 
HETATM 4364 O O   . HOH F 5 .   ? -14.436 86.730 42.558 1.00 55.25 ? 811 HOH X O   1 
HETATM 4365 O O   . HOH F 5 .   ? -10.009 56.119 45.227 1.00 38.13 ? 812 HOH X O   1 
HETATM 4366 O O   . HOH F 5 .   ? -20.159 58.477 45.424 1.00 40.99 ? 813 HOH X O   1 
HETATM 4367 O O   . HOH F 5 .   ? 27.669  82.803 42.616 1.00 36.25 ? 814 HOH X O   1 
HETATM 4368 O O   . HOH F 5 .   ? -14.602 44.070 45.649 1.00 60.81 ? 815 HOH X O   1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'NAG X 602 HAS WRONG CHIRALITY AT ATOM C1' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -20 ?   ?   ?   X . n 
A 1 2   ASN 2   -19 ?   ?   ?   X . n 
A 1 3   LEU 3   -18 ?   ?   ?   X . n 
A 1 4   LEU 4   -17 ?   ?   ?   X . n 
A 1 5   VAL 5   -16 ?   ?   ?   X . n 
A 1 6   THR 6   -15 ?   ?   ?   X . n 
A 1 7   SER 7   -14 ?   ?   ?   X . n 
A 1 8   SER 8   -13 ?   ?   ?   X . n 
A 1 9   LEU 9   -12 ?   ?   ?   X . n 
A 1 10  GLY 10  -11 ?   ?   ?   X . n 
A 1 11  VAL 11  -10 ?   ?   ?   X . n 
A 1 12  LEU 12  -9  ?   ?   ?   X . n 
A 1 13  LEU 13  -8  ?   ?   ?   X . n 
A 1 14  HIS 14  -7  ?   ?   ?   X . n 
A 1 15  LEU 15  -6  ?   ?   ?   X . n 
A 1 16  VAL 16  -5  ?   ?   ?   X . n 
A 1 17  VAL 17  -4  ?   ?   ?   X . n 
A 1 18  LEU 18  -3  ?   ?   ?   X . n 
A 1 19  CYS 19  -2  ?   ?   ?   X . n 
A 1 20  GLN 20  -1  ?   ?   ?   X . n 
A 1 21  ALA 21  0   ?   ?   ?   X . n 
A 1 22  ASP 22  1   ?   ?   ?   X . n 
A 1 23  ASP 23  2   ?   ?   ?   X . n 
A 1 24  HIS 24  3   ?   ?   ?   X . n 
A 1 25  SER 25  4   4   SER SER X . n 
A 1 26  GLU 26  5   5   GLU GLU X . n 
A 1 27  LEU 27  6   6   LEU LEU X . n 
A 1 28  LEU 28  7   7   LEU LEU X . n 
A 1 29  VAL 29  8   8   VAL VAL X . n 
A 1 30  ASN 30  9   9   ASN ASN X . n 
A 1 31  THR 31  10  10  THR THR X . n 
A 1 32  LYS 32  11  11  LYS LYS X . n 
A 1 33  SER 33  12  12  SER SER X . n 
A 1 34  GLY 34  13  13  GLY GLY X . n 
A 1 35  LYS 35  14  14  LYS LYS X . n 
A 1 36  VAL 36  15  15  VAL VAL X . n 
A 1 37  MET 37  16  16  MET MET X . n 
A 1 38  GLY 38  17  17  GLY GLY X . n 
A 1 39  THR 39  18  18  THR THR X . n 
A 1 40  ARG 40  19  19  ARG ARG X . n 
A 1 41  VAL 41  20  20  VAL VAL X . n 
A 1 42  PRO 42  21  21  PRO PRO X . n 
A 1 43  VAL 43  22  22  VAL VAL X . n 
A 1 44  LEU 44  23  23  LEU LEU X . n 
A 1 45  SER 45  24  24  SER SER X . n 
A 1 46  SER 46  25  25  SER SER X . n 
A 1 47  HIS 47  26  26  HIS HIS X . n 
A 1 48  ILE 48  27  27  ILE ILE X . n 
A 1 49  SER 49  28  28  SER SER X . n 
A 1 50  ALA 50  29  29  ALA ALA X . n 
A 1 51  PHE 51  30  30  PHE PHE X . n 
A 1 52  LEU 52  31  31  LEU LEU X . n 
A 1 53  GLY 53  32  32  GLY GLY X . n 
A 1 54  ILE 54  33  33  ILE ILE X . n 
A 1 55  PRO 55  34  34  PRO PRO X . n 
A 1 56  PHE 56  35  35  PHE PHE X . n 
A 1 57  ALA 57  36  36  ALA ALA X . n 
A 1 58  GLU 58  37  37  GLU GLU X . n 
A 1 59  PRO 59  38  38  PRO PRO X . n 
A 1 60  PRO 60  39  39  PRO PRO X . n 
A 1 61  VAL 61  40  40  VAL VAL X . n 
A 1 62  GLY 62  41  41  GLY GLY X . n 
A 1 63  ASN 63  42  42  ASN ASN X . n 
A 1 64  MET 64  43  43  MET MET X . n 
A 1 65  ARG 65  44  44  ARG ARG X . n 
A 1 66  PHE 66  45  45  PHE PHE X . n 
A 1 67  ARG 67  46  46  ARG ARG X . n 
A 1 68  ARG 68  47  47  ARG ARG X . n 
A 1 69  PRO 69  48  48  PRO PRO X . n 
A 1 70  GLU 70  49  49  GLU GLU X . n 
A 1 71  PRO 71  50  50  PRO PRO X . n 
A 1 72  LYS 72  51  51  LYS LYS X . n 
A 1 73  LYS 73  52  52  LYS LYS X . n 
A 1 74  PRO 74  53  53  PRO PRO X . n 
A 1 75  TRP 75  54  54  TRP TRP X . n 
A 1 76  SER 76  55  55  SER SER X . n 
A 1 77  GLY 77  56  56  GLY GLY X . n 
A 1 78  VAL 78  57  57  VAL VAL X . n 
A 1 79  TRP 79  58  58  TRP TRP X . n 
A 1 80  ASN 80  59  59  ASN ASN X . n 
A 1 81  ALA 81  60  60  ALA ALA X . n 
A 1 82  SER 82  61  61  SER SER X . n 
A 1 83  THR 83  62  62  THR THR X . n 
A 1 84  TYR 84  63  63  TYR TYR X . n 
A 1 85  PRO 85  64  64  PRO PRO X . n 
A 1 86  ASN 86  65  65  ASN ASN X . n 
A 1 87  ASN 87  66  66  ASN ASN X . n 
A 1 88  CYS 88  67  67  CYS CYS X . n 
A 1 89  GLN 89  68  68  GLN GLN X . n 
A 1 90  GLN 90  69  69  GLN GLN X . n 
A 1 91  TYR 91  70  70  TYR TYR X . n 
A 1 92  VAL 92  71  71  VAL VAL X . n 
A 1 93  ASP 93  72  72  ASP ASP X . n 
A 1 94  GLU 94  73  73  GLU GLU X . n 
A 1 95  GLN 95  74  74  GLN GLN X . n 
A 1 96  PHE 96  75  75  PHE PHE X . n 
A 1 97  PRO 97  76  76  PRO PRO X . n 
A 1 98  GLY 98  77  77  GLY GLY X . n 
A 1 99  PHE 99  78  78  PHE PHE X . n 
A 1 100 SER 100 79  79  SER SER X . n 
A 1 101 GLY 101 80  80  GLY GLY X . n 
A 1 102 SER 102 81  81  SER SER X . n 
A 1 103 GLU 103 82  82  GLU GLU X . n 
A 1 104 MET 104 83  83  MET MET X . n 
A 1 105 TRP 105 84  84  TRP TRP X . n 
A 1 106 ASN 106 85  85  ASN ASN X . n 
A 1 107 PRO 107 86  86  PRO PRO X . n 
A 1 108 ASN 108 87  87  ASN ASN X . n 
A 1 109 ARG 109 88  88  ARG ARG X . n 
A 1 110 GLU 110 89  89  GLU GLU X . n 
A 1 111 MET 111 90  90  MET MET X . n 
A 1 112 SER 112 91  91  SER SER X . n 
A 1 113 GLU 113 92  92  GLU GLU X . n 
A 1 114 ASP 114 93  93  ASP ASP X . n 
A 1 115 CYS 115 94  94  CYS CYS X . n 
A 1 116 LEU 116 95  95  LEU LEU X . n 
A 1 117 TYR 117 96  96  TYR TYR X . n 
A 1 118 LEU 118 97  97  LEU LEU X . n 
A 1 119 ASN 119 98  98  ASN ASN X . n 
A 1 120 ILE 120 99  99  ILE ILE X . n 
A 1 121 TRP 121 100 100 TRP TRP X . n 
A 1 122 VAL 122 101 101 VAL VAL X . n 
A 1 123 PRO 123 102 102 PRO PRO X . n 
A 1 124 SER 124 103 103 SER SER X . n 
A 1 125 PRO 125 104 104 PRO PRO X . n 
A 1 126 ARG 126 105 105 ARG ARG X . n 
A 1 127 PRO 127 106 106 PRO PRO X . n 
A 1 128 LYS 128 107 107 LYS LYS X . n 
A 1 129 SER 129 108 108 SER SER X . n 
A 1 130 THR 130 109 109 THR THR X . n 
A 1 131 THR 131 110 110 THR THR X . n 
A 1 132 VAL 132 111 111 VAL VAL X . n 
A 1 133 MET 133 112 112 MET MET X . n 
A 1 134 VAL 134 113 113 VAL VAL X . n 
A 1 135 TRP 135 114 114 TRP TRP X . n 
A 1 136 ILE 136 115 115 ILE ILE X . n 
A 1 137 TYR 137 116 116 TYR TYR X . n 
A 1 138 GLY 138 117 117 GLY GLY X . n 
A 1 139 GLY 139 118 118 GLY GLY X . n 
A 1 140 GLY 140 119 119 GLY GLY X . n 
A 1 141 PHE 141 120 120 PHE PHE X . n 
A 1 142 TYR 142 121 121 TYR TYR X . n 
A 1 143 SER 143 122 122 SER SER X . n 
A 1 144 GLY 144 123 123 GLY GLY X . n 
A 1 145 SER 145 124 124 SER SER X . n 
A 1 146 SER 146 125 125 SER SER X . n 
A 1 147 THR 147 126 126 THR THR X . n 
A 1 148 LEU 148 127 127 LEU LEU X . n 
A 1 149 ASP 149 128 128 ASP ASP X . n 
A 1 150 VAL 150 129 129 VAL VAL X . n 
A 1 151 TYR 151 130 130 TYR TYR X . n 
A 1 152 ASN 152 131 131 ASN ASN X . n 
A 1 153 GLY 153 132 132 GLY GLY X . n 
A 1 154 LYS 154 133 133 LYS LYS X . n 
A 1 155 TYR 155 134 134 TYR TYR X . n 
A 1 156 LEU 156 135 135 LEU LEU X . n 
A 1 157 ALA 157 136 136 ALA ALA X . n 
A 1 158 TYR 158 137 137 TYR TYR X . n 
A 1 159 THR 159 138 138 THR THR X . n 
A 1 160 GLU 160 139 139 GLU GLU X . n 
A 1 161 GLU 161 140 140 GLU GLU X . n 
A 1 162 VAL 162 141 141 VAL VAL X . n 
A 1 163 VAL 163 142 142 VAL VAL X . n 
A 1 164 LEU 164 143 143 LEU LEU X . n 
A 1 165 VAL 165 144 144 VAL VAL X . n 
A 1 166 SER 166 145 145 SER SER X . n 
A 1 167 LEU 167 146 146 LEU LEU X . n 
A 1 168 SER 168 147 147 SER SER X . n 
A 1 169 TYR 169 148 148 TYR TYR X . n 
A 1 170 ARG 170 149 149 ARG ARG X . n 
A 1 171 VAL 171 150 150 VAL VAL X . n 
A 1 172 GLY 172 151 151 GLY GLY X . n 
A 1 173 ALA 173 152 152 ALA ALA X . n 
A 1 174 PHE 174 153 153 PHE PHE X . n 
A 1 175 GLY 175 154 154 GLY GLY X . n 
A 1 176 PHE 176 155 155 PHE PHE X . n 
A 1 177 LEU 177 156 156 LEU LEU X . n 
A 1 178 ALA 178 157 157 ALA ALA X . n 
A 1 179 LEU 179 158 158 LEU LEU X . n 
A 1 180 HIS 180 159 159 HIS HIS X . n 
A 1 181 GLY 181 160 160 GLY GLY X . n 
A 1 182 SER 182 161 161 SER SER X . n 
A 1 183 GLN 183 162 162 GLN GLN X . n 
A 1 184 GLU 184 163 163 GLU GLU X . n 
A 1 185 ALA 185 164 164 ALA ALA X . n 
A 1 186 PRO 186 165 165 PRO PRO X . n 
A 1 187 GLY 187 166 166 GLY GLY X . n 
A 1 188 ASN 188 167 167 ASN ASN X . n 
A 1 189 VAL 189 168 168 VAL VAL X . n 
A 1 190 GLY 190 169 169 GLY GLY X . n 
A 1 191 LEU 191 170 170 LEU LEU X . n 
A 1 192 LEU 192 171 171 LEU LEU X . n 
A 1 193 ASP 193 172 172 ASP ASP X . n 
A 1 194 GLN 194 173 173 GLN GLN X . n 
A 1 195 ARG 195 174 174 ARG ARG X . n 
A 1 196 MET 196 175 175 MET MET X . n 
A 1 197 ALA 197 176 176 ALA ALA X . n 
A 1 198 LEU 198 177 177 LEU LEU X . n 
A 1 199 GLN 199 178 178 GLN GLN X . n 
A 1 200 TRP 200 179 179 TRP TRP X . n 
A 1 201 VAL 201 180 180 VAL VAL X . n 
A 1 202 HIS 202 181 181 HIS HIS X . n 
A 1 203 ASP 203 182 182 ASP ASP X . n 
A 1 204 ASN 204 183 183 ASN ASN X . n 
A 1 205 ILE 205 184 184 ILE ILE X . n 
A 1 206 GLN 206 185 185 GLN GLN X . n 
A 1 207 PHE 207 186 186 PHE PHE X . n 
A 1 208 PHE 208 187 187 PHE PHE X . n 
A 1 209 GLY 209 188 188 GLY GLY X . n 
A 1 210 GLY 210 189 189 GLY GLY X . n 
A 1 211 ASP 211 190 190 ASP ASP X . n 
A 1 212 PRO 212 191 191 PRO PRO X . n 
A 1 213 LYS 213 192 192 LYS LYS X . n 
A 1 214 THR 214 193 193 THR THR X . n 
A 1 215 VAL 215 194 194 VAL VAL X . n 
A 1 216 THR 216 195 195 THR THR X . n 
A 1 217 ILE 217 196 196 ILE ILE X . n 
A 1 218 PHE 218 197 197 PHE PHE X . n 
A 1 219 GLY 219 198 198 GLY GLY X . n 
A 1 220 GLU 220 199 199 GLU GLU X . n 
A 1 221 SER 221 200 200 SER SER X . n 
A 1 222 ALA 222 201 201 ALA ALA X . n 
A 1 223 GLY 223 202 202 GLY GLY X . n 
A 1 224 GLY 224 203 203 GLY GLY X . n 
A 1 225 ALA 225 204 204 ALA ALA X . n 
A 1 226 SER 226 205 205 SER SER X . n 
A 1 227 VAL 227 206 206 VAL VAL X . n 
A 1 228 GLY 228 207 207 GLY GLY X . n 
A 1 229 MET 229 208 208 MET MET X . n 
A 1 230 HIS 230 209 209 HIS HIS X . n 
A 1 231 ILE 231 210 210 ILE ILE X . n 
A 1 232 LEU 232 211 211 LEU LEU X . n 
A 1 233 SER 233 212 212 SER SER X . n 
A 1 234 PRO 234 213 213 PRO PRO X . n 
A 1 235 GLY 235 214 214 GLY GLY X . n 
A 1 236 SER 236 215 215 SER SER X . n 
A 1 237 ARG 237 216 216 ARG ARG X . n 
A 1 238 ASP 238 217 217 ASP ASP X . n 
A 1 239 LEU 239 218 218 LEU LEU X . n 
A 1 240 PHE 240 219 219 PHE PHE X . n 
A 1 241 ARG 241 220 220 ARG ARG X . n 
A 1 242 ARG 242 221 221 ARG ARG X . n 
A 1 243 ALA 243 222 222 ALA ALA X . n 
A 1 244 ILE 244 223 223 ILE ILE X . n 
A 1 245 LEU 245 224 224 LEU LEU X . n 
A 1 246 GLN 246 225 225 GLN GLN X . n 
A 1 247 SER 247 226 226 SER SER X . n 
A 1 248 GLY 248 227 227 GLY GLY X . n 
A 1 249 SER 249 228 228 SER SER X . n 
A 1 250 PRO 250 229 229 PRO PRO X . n 
A 1 251 ASN 251 230 230 ASN ASN X . n 
A 1 252 CYS 252 231 231 CYS CYS X . n 
A 1 253 PRO 253 232 232 PRO PRO X . n 
A 1 254 TRP 254 233 233 TRP TRP X . n 
A 1 255 ALA 255 234 234 ALA ALA X . n 
A 1 256 SER 256 235 235 SER SER X . n 
A 1 257 VAL 257 236 236 VAL VAL X . n 
A 1 258 SER 258 237 237 SER SER X . n 
A 1 259 VAL 259 238 238 VAL VAL X . n 
A 1 260 ALA 260 239 239 ALA ALA X . n 
A 1 261 GLU 261 240 240 GLU GLU X . n 
A 1 262 GLY 262 241 241 GLY GLY X . n 
A 1 263 ARG 263 242 242 ARG ARG X . n 
A 1 264 ARG 264 243 243 ARG ARG X . n 
A 1 265 ARG 265 244 244 ARG ARG X . n 
A 1 266 ALA 266 245 245 ALA ALA X . n 
A 1 267 VAL 267 246 246 VAL VAL X . n 
A 1 268 GLU 268 247 247 GLU GLU X . n 
A 1 269 LEU 269 248 248 LEU LEU X . n 
A 1 270 GLY 270 249 249 GLY GLY X . n 
A 1 271 ARG 271 250 250 ARG ARG X . n 
A 1 272 ASN 272 251 251 ASN ASN X . n 
A 1 273 LEU 273 252 252 LEU LEU X . n 
A 1 274 ASN 274 253 253 ASN ASN X . n 
A 1 275 CYS 275 254 254 CYS CYS X . n 
A 1 276 ASN 276 255 255 ASN ASN X . n 
A 1 277 LEU 277 256 256 LEU LEU X . n 
A 1 278 ASN 278 257 257 ASN ASN X . n 
A 1 279 SER 279 258 258 SER SER X . n 
A 1 280 ASP 280 259 259 ASP ASP X . n 
A 1 281 GLU 281 260 260 GLU GLU X . n 
A 1 282 GLU 282 261 261 GLU GLU X . n 
A 1 283 LEU 283 262 262 LEU LEU X . n 
A 1 284 ILE 284 263 263 ILE ILE X . n 
A 1 285 HIS 285 264 264 HIS HIS X . n 
A 1 286 CYS 286 265 265 CYS CYS X . n 
A 1 287 LEU 287 266 266 LEU LEU X . n 
A 1 288 ARG 288 267 267 ARG ARG X . n 
A 1 289 GLU 289 268 268 GLU GLU X . n 
A 1 290 LYS 290 269 269 LYS LYS X . n 
A 1 291 LYS 291 270 270 LYS LYS X . n 
A 1 292 PRO 292 271 271 PRO PRO X . n 
A 1 293 GLN 293 272 272 GLN GLN X . n 
A 1 294 GLU 294 273 273 GLU GLU X . n 
A 1 295 LEU 295 274 274 LEU LEU X . n 
A 1 296 ILE 296 275 275 ILE ILE X . n 
A 1 297 ASP 297 276 276 ASP ASP X . n 
A 1 298 VAL 298 277 277 VAL VAL X . n 
A 1 299 GLU 299 278 278 GLU GLU X . n 
A 1 300 TRP 300 279 279 TRP TRP X . n 
A 1 301 ASN 301 280 280 ASN ASN X . n 
A 1 302 VAL 302 281 281 VAL VAL X . n 
A 1 303 LEU 303 282 282 LEU LEU X . n 
A 1 304 PRO 304 283 283 PRO PRO X . n 
A 1 305 PHE 305 284 284 PHE PHE X . n 
A 1 306 ASP 306 285 285 ASP ASP X . n 
A 1 307 SER 307 286 286 SER SER X . n 
A 1 308 ILE 308 287 287 ILE ILE X . n 
A 1 309 PHE 309 288 288 PHE PHE X . n 
A 1 310 ARG 310 289 289 ARG ARG X . n 
A 1 311 PHE 311 290 290 PHE PHE X . n 
A 1 312 SER 312 291 291 SER SER X . n 
A 1 313 PHE 313 292 292 PHE PHE X . n 
A 1 314 VAL 314 293 293 VAL VAL X . n 
A 1 315 PRO 315 294 294 PRO PRO X . n 
A 1 316 VAL 316 295 295 VAL VAL X . n 
A 1 317 ILE 317 296 296 ILE ILE X . n 
A 1 318 ASP 318 297 297 ASP ASP X . n 
A 1 319 GLY 319 298 298 GLY GLY X . n 
A 1 320 GLU 320 299 299 GLU GLU X . n 
A 1 321 PHE 321 300 300 PHE PHE X . n 
A 1 322 PHE 322 301 301 PHE PHE X . n 
A 1 323 PRO 323 302 302 PRO PRO X . n 
A 1 324 THR 324 303 303 THR THR X . n 
A 1 325 SER 325 304 304 SER SER X . n 
A 1 326 LEU 326 305 305 LEU LEU X . n 
A 1 327 GLU 327 306 306 GLU GLU X . n 
A 1 328 SER 328 307 307 SER SER X . n 
A 1 329 MET 329 308 308 MET MET X . n 
A 1 330 LEU 330 309 309 LEU LEU X . n 
A 1 331 ASN 331 310 310 ASN ASN X . n 
A 1 332 SER 332 311 311 SER SER X . n 
A 1 333 GLY 333 312 312 GLY GLY X . n 
A 1 334 ASN 334 313 313 ASN ASN X . n 
A 1 335 PHE 335 314 314 PHE PHE X . n 
A 1 336 LYS 336 315 315 LYS LYS X . n 
A 1 337 LYS 337 316 316 LYS LYS X . n 
A 1 338 THR 338 317 317 THR THR X . n 
A 1 339 GLN 339 318 318 GLN GLN X . n 
A 1 340 ILE 340 319 319 ILE ILE X . n 
A 1 341 LEU 341 320 320 LEU LEU X . n 
A 1 342 LEU 342 321 321 LEU LEU X . n 
A 1 343 GLY 343 322 322 GLY GLY X . n 
A 1 344 VAL 344 323 323 VAL VAL X . n 
A 1 345 ASN 345 324 324 ASN ASN X . n 
A 1 346 LYS 346 325 325 LYS LYS X . n 
A 1 347 ASP 347 326 326 ASP ASP X . n 
A 1 348 GLU 348 327 327 GLU GLU X . n 
A 1 349 GLY 349 328 328 GLY GLY X . n 
A 1 350 SER 350 329 329 SER SER X . n 
A 1 351 PHE 351 330 330 PHE PHE X . n 
A 1 352 PHE 352 331 331 PHE PHE X . n 
A 1 353 LEU 353 332 332 LEU LEU X . n 
A 1 354 LEU 354 333 333 LEU LEU X . n 
A 1 355 TYR 355 334 334 TYR TYR X . n 
A 1 356 GLY 356 335 335 GLY GLY X . n 
A 1 357 ALA 357 336 336 ALA ALA X . n 
A 1 358 PRO 358 337 337 PRO PRO X . n 
A 1 359 GLY 359 338 338 GLY GLY X . n 
A 1 360 PHE 360 339 339 PHE PHE X . n 
A 1 361 SER 361 340 340 SER SER X . n 
A 1 362 LYS 362 341 341 LYS LYS X . n 
A 1 363 ASP 363 342 342 ASP ASP X . n 
A 1 364 SER 364 343 343 SER SER X . n 
A 1 365 GLU 365 344 344 GLU GLU X . n 
A 1 366 SER 366 345 345 SER SER X . n 
A 1 367 LYS 367 346 346 LYS LYS X . n 
A 1 368 ILE 368 347 347 ILE ILE X . n 
A 1 369 SER 369 348 348 SER SER X . n 
A 1 370 ARG 370 349 349 ARG ARG X . n 
A 1 371 GLU 371 350 350 GLU GLU X . n 
A 1 372 ASP 372 351 351 ASP ASP X . n 
A 1 373 PHE 373 352 352 PHE PHE X . n 
A 1 374 MET 374 353 353 MET MET X . n 
A 1 375 SER 375 354 354 SER SER X . n 
A 1 376 GLY 376 355 355 GLY GLY X . n 
A 1 377 VAL 377 356 356 VAL VAL X . n 
A 1 378 LYS 378 357 357 LYS LYS X . n 
A 1 379 LEU 379 358 358 LEU LEU X . n 
A 1 380 SER 380 359 359 SER SER X . n 
A 1 381 VAL 381 360 360 VAL VAL X . n 
A 1 382 PRO 382 361 361 PRO PRO X . n 
A 1 383 HIS 383 362 362 HIS HIS X . n 
A 1 384 ALA 384 363 363 ALA ALA X . n 
A 1 385 ASN 385 364 364 ASN ASN X . n 
A 1 386 ASP 386 365 365 ASP ASP X . n 
A 1 387 LEU 387 366 366 LEU LEU X . n 
A 1 388 GLY 388 367 367 GLY GLY X . n 
A 1 389 LEU 389 368 368 LEU LEU X . n 
A 1 390 ASP 390 369 369 ASP ASP X . n 
A 1 391 ALA 391 370 370 ALA ALA X . n 
A 1 392 VAL 392 371 371 VAL VAL X . n 
A 1 393 THR 393 372 372 THR THR X . n 
A 1 394 LEU 394 373 373 LEU LEU X . n 
A 1 395 GLN 395 374 374 GLN GLN X . n 
A 1 396 TYR 396 375 375 TYR TYR X . n 
A 1 397 THR 397 376 376 THR THR X . n 
A 1 398 ASP 398 377 377 ASP ASP X . n 
A 1 399 TRP 399 378 378 TRP TRP X . n 
A 1 400 MET 400 379 379 MET MET X . n 
A 1 401 ASP 401 380 380 ASP ASP X . n 
A 1 402 ASP 402 381 381 ASP ASP X . n 
A 1 403 ASN 403 382 382 ASN ASN X . n 
A 1 404 ASN 404 383 383 ASN ASN X . n 
A 1 405 GLY 405 384 384 GLY GLY X . n 
A 1 406 ILE 406 385 385 ILE ILE X . n 
A 1 407 LYS 407 386 386 LYS LYS X . n 
A 1 408 ASN 408 387 387 ASN ASN X . n 
A 1 409 ARG 409 388 388 ARG ARG X . n 
A 1 410 ASP 410 389 389 ASP ASP X . n 
A 1 411 GLY 411 390 390 GLY GLY X . n 
A 1 412 LEU 412 391 391 LEU LEU X . n 
A 1 413 ASP 413 392 392 ASP ASP X . n 
A 1 414 ASP 414 393 393 ASP ASP X . n 
A 1 415 ILE 415 394 394 ILE ILE X . n 
A 1 416 VAL 416 395 395 VAL VAL X . n 
A 1 417 GLY 417 396 396 GLY GLY X . n 
A 1 418 ASP 418 397 397 ASP ASP X . n 
A 1 419 HIS 419 398 398 HIS HIS X . n 
A 1 420 ASN 420 399 399 ASN ASN X . n 
A 1 421 VAL 421 400 400 VAL VAL X . n 
A 1 422 ILE 422 401 401 ILE ILE X . n 
A 1 423 CYS 423 402 402 CYS CYS X . n 
A 1 424 PRO 424 403 403 PRO PRO X . n 
A 1 425 LEU 425 404 404 LEU LEU X . n 
A 1 426 MET 426 405 405 MET MET X . n 
A 1 427 HIS 427 406 406 HIS HIS X . n 
A 1 428 PHE 428 407 407 PHE PHE X . n 
A 1 429 VAL 429 408 408 VAL VAL X . n 
A 1 430 ASN 430 409 409 ASN ASN X . n 
A 1 431 LYS 431 410 410 LYS LYS X . n 
A 1 432 TYR 432 411 411 TYR TYR X . n 
A 1 433 THR 433 412 412 THR THR X . n 
A 1 434 LYS 434 413 413 LYS LYS X . n 
A 1 435 PHE 435 414 414 PHE PHE X . n 
A 1 436 GLY 436 415 415 GLY GLY X . n 
A 1 437 ASN 437 416 416 ASN ASN X . n 
A 1 438 GLY 438 417 417 GLY GLY X . n 
A 1 439 THR 439 418 418 THR THR X . n 
A 1 440 TYR 440 419 419 TYR TYR X . n 
A 1 441 LEU 441 420 420 LEU LEU X . n 
A 1 442 TYR 442 421 421 TYR TYR X . n 
A 1 443 PHE 443 422 422 PHE PHE X . n 
A 1 444 PHE 444 423 423 PHE PHE X . n 
A 1 445 ASN 445 424 424 ASN ASN X . n 
A 1 446 HIS 446 425 425 HIS HIS X . n 
A 1 447 ARG 447 426 426 ARG ARG X . n 
A 1 448 ALA 448 427 427 ALA ALA X . n 
A 1 449 SER 449 428 428 SER SER X . n 
A 1 450 ASN 450 429 429 ASN ASN X . n 
A 1 451 LEU 451 430 430 LEU LEU X . n 
A 1 452 VAL 452 431 431 VAL VAL X . n 
A 1 453 TRP 453 432 432 TRP TRP X . n 
A 1 454 PRO 454 433 433 PRO PRO X . n 
A 1 455 GLU 455 434 434 GLU GLU X . n 
A 1 456 TRP 456 435 435 TRP TRP X . n 
A 1 457 MET 457 436 436 MET MET X . n 
A 1 458 GLY 458 437 437 GLY GLY X . n 
A 1 459 VAL 459 438 438 VAL VAL X . n 
A 1 460 ILE 460 439 439 ILE ILE X . n 
A 1 461 HIS 461 440 440 HIS HIS X . n 
A 1 462 GLY 462 441 441 GLY GLY X . n 
A 1 463 TYR 463 442 442 TYR TYR X . n 
A 1 464 GLU 464 443 443 GLU GLU X . n 
A 1 465 ILE 465 444 444 ILE ILE X . n 
A 1 466 GLU 466 445 445 GLU GLU X . n 
A 1 467 PHE 467 446 446 PHE PHE X . n 
A 1 468 VAL 468 447 447 VAL VAL X . n 
A 1 469 PHE 469 448 448 PHE PHE X . n 
A 1 470 GLY 470 449 449 GLY GLY X . n 
A 1 471 LEU 471 450 450 LEU LEU X . n 
A 1 472 PRO 472 451 451 PRO PRO X . n 
A 1 473 LEU 473 452 452 LEU LEU X . n 
A 1 474 VAL 474 453 453 VAL VAL X . n 
A 1 475 LYS 475 454 454 LYS LYS X . n 
A 1 476 GLU 476 455 455 GLU GLU X . n 
A 1 477 LEU 477 456 456 LEU LEU X . n 
A 1 478 ASN 478 457 457 ASN ASN X . n 
A 1 479 TYR 479 458 458 TYR TYR X . n 
A 1 480 THR 480 459 459 THR THR X . n 
A 1 481 ALA 481 460 460 ALA ALA X . n 
A 1 482 GLU 482 461 461 GLU GLU X . n 
A 1 483 GLU 483 462 462 GLU GLU X . n 
A 1 484 GLU 484 463 463 GLU GLU X . n 
A 1 485 ALA 485 464 464 ALA ALA X . n 
A 1 486 LEU 486 465 465 LEU LEU X . n 
A 1 487 SER 487 466 466 SER SER X . n 
A 1 488 ARG 488 467 467 ARG ARG X . n 
A 1 489 ARG 489 468 468 ARG ARG X . n 
A 1 490 ILE 490 469 469 ILE ILE X . n 
A 1 491 MET 491 470 470 MET MET X . n 
A 1 492 HIS 492 471 471 HIS HIS X . n 
A 1 493 TYR 493 472 472 TYR TYR X . n 
A 1 494 TRP 494 473 473 TRP TRP X . n 
A 1 495 ALA 495 474 474 ALA ALA X . n 
A 1 496 THR 496 475 475 THR THR X . n 
A 1 497 PHE 497 476 476 PHE PHE X . n 
A 1 498 ALA 498 477 477 ALA ALA X . n 
A 1 499 LYS 499 478 478 LYS LYS X . n 
A 1 500 THR 500 479 479 THR THR X . n 
A 1 501 GLY 501 480 480 GLY GLY X . n 
A 1 502 ASN 502 481 481 ASN ASN X . n 
A 1 503 PRO 503 482 482 PRO PRO X . n 
A 1 504 ASN 504 483 483 ASN ASN X . n 
A 1 505 GLU 505 484 484 GLU GLU X . n 
A 1 506 PRO 506 485 485 PRO PRO X . n 
A 1 507 HIS 507 486 ?   ?   ?   X . n 
A 1 508 SER 508 487 ?   ?   ?   X . n 
A 1 509 GLN 509 488 ?   ?   ?   X . n 
A 1 510 GLU 510 489 ?   ?   ?   X . n 
A 1 511 SER 511 490 490 SER SER X . n 
A 1 512 LYS 512 491 491 LYS LYS X . n 
A 1 513 TRP 513 492 492 TRP TRP X . n 
A 1 514 PRO 514 493 493 PRO PRO X . n 
A 1 515 LEU 515 494 494 LEU LEU X . n 
A 1 516 PHE 516 495 495 PHE PHE X . n 
A 1 517 THR 517 496 496 THR THR X . n 
A 1 518 THR 518 497 497 THR THR X . n 
A 1 519 LYS 519 498 498 LYS LYS X . n 
A 1 520 GLU 520 499 499 GLU GLU X . n 
A 1 521 GLN 521 500 500 GLN GLN X . n 
A 1 522 LYS 522 501 501 LYS LYS X . n 
A 1 523 PHE 523 502 502 PHE PHE X . n 
A 1 524 ILE 524 503 503 ILE ILE X . n 
A 1 525 ASP 525 504 504 ASP ASP X . n 
A 1 526 LEU 526 505 505 LEU LEU X . n 
A 1 527 ASN 527 506 506 ASN ASN X . n 
A 1 528 THR 528 507 507 THR THR X . n 
A 1 529 GLU 529 508 508 GLU GLU X . n 
A 1 530 PRO 530 509 509 PRO PRO X . n 
A 1 531 MET 531 510 510 MET MET X . n 
A 1 532 LYS 532 511 511 LYS LYS X . n 
A 1 533 VAL 533 512 512 VAL VAL X . n 
A 1 534 HIS 534 513 513 HIS HIS X . n 
A 1 535 GLN 535 514 514 GLN GLN X . n 
A 1 536 ARG 536 515 515 ARG ARG X . n 
A 1 537 LEU 537 516 516 LEU LEU X . n 
A 1 538 ARG 538 517 517 ARG ARG X . n 
A 1 539 VAL 539 518 518 VAL VAL X . n 
A 1 540 GLN 540 519 519 GLN GLN X . n 
A 1 541 MET 541 520 520 MET MET X . n 
A 1 542 CYS 542 521 521 CYS CYS X . n 
A 1 543 VAL 543 522 522 VAL VAL X . n 
A 1 544 PHE 544 523 523 PHE PHE X . n 
A 1 545 TRP 545 524 524 TRP TRP X . n 
A 1 546 ASN 546 525 525 ASN ASN X . n 
A 1 547 GLN 547 526 526 GLN GLN X . n 
A 1 548 PHE 548 527 527 PHE PHE X . n 
A 1 549 LEU 549 528 528 LEU LEU X . n 
A 1 550 PRO 550 529 529 PRO PRO X . n 
A 1 551 LYS 551 530 530 LYS LYS X . n 
A 1 552 LEU 552 531 531 LEU LEU X . n 
A 1 553 LEU 553 532 532 LEU LEU X . n 
A 1 554 ASN 554 533 533 ASN ASN X . n 
A 1 555 ALA 555 534 534 ALA ALA X . n 
A 1 556 THR 556 535 535 THR THR X . n 
A 1 557 ALA 557 536 ?   ?   ?   X . n 
A 1 558 CYS 558 537 ?   ?   ?   X . n 
A 1 559 ASP 559 538 ?   ?   ?   X . n 
A 1 560 GLY 560 539 ?   ?   ?   X . n 
A 1 561 GLU 561 540 ?   ?   ?   X . n 
A 1 562 LEU 562 541 ?   ?   ?   X . n 
A 1 563 SER 563 542 ?   ?   ?   X . n 
A 1 564 SER 564 543 ?   ?   ?   X . n 
A 1 565 SER 565 544 ?   ?   ?   X . n 
A 1 566 GLY 566 545 ?   ?   ?   X . n 
A 1 567 THR 567 546 ?   ?   ?   X . n 
A 1 568 SER 568 547 ?   ?   ?   X . n 
A 1 569 SER 569 548 ?   ?   ?   X . n 
A 1 570 SER 570 549 ?   ?   ?   X . n 
A 1 571 LYS 571 550 ?   ?   ?   X . n 
A 1 572 GLY 572 551 ?   ?   ?   X . n 
A 1 573 ILE 573 552 ?   ?   ?   X . n 
A 1 574 ILE 574 553 ?   ?   ?   X . n 
A 1 575 PHE 575 554 ?   ?   ?   X . n 
A 1 576 TYR 576 555 ?   ?   ?   X . n 
A 1 577 VAL 577 556 ?   ?   ?   X . n 
A 1 578 LEU 578 557 ?   ?   ?   X . n 
A 1 579 PHE 579 558 ?   ?   ?   X . n 
A 1 580 SER 580 559 ?   ?   ?   X . n 
A 1 581 ILE 581 560 ?   ?   ?   X . n 
A 1 582 LEU 582 561 ?   ?   ?   X . n 
A 1 583 TYR 583 562 ?   ?   ?   X . n 
A 1 584 LEU 584 563 ?   ?   ?   X . n 
A 1 585 ILE 585 564 ?   ?   ?   X . n 
A 1 586 PHE 586 565 ?   ?   ?   X . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 BM4 1   601 1536 BM4 BM4 X . 
D 4 NAG 1   602 1537 NAG NAG X . 
E 4 NAG 1   605 1540 NAG NAG X . 
F 5 HOH 1   701 2100 HOH HOH X . 
F 5 HOH 2   702 2106 HOH HOH X . 
F 5 HOH 3   703 2079 HOH HOH X . 
F 5 HOH 4   704 2032 HOH HOH X . 
F 5 HOH 5   705 2013 HOH HOH X . 
F 5 HOH 6   706 2095 HOH HOH X . 
F 5 HOH 7   707 2049 HOH HOH X . 
F 5 HOH 8   708 2042 HOH HOH X . 
F 5 HOH 9   709 2078 HOH HOH X . 
F 5 HOH 10  710 2075 HOH HOH X . 
F 5 HOH 11  711 2076 HOH HOH X . 
F 5 HOH 12  712 2070 HOH HOH X . 
F 5 HOH 13  713 2022 HOH HOH X . 
F 5 HOH 14  714 2099 HOH HOH X . 
F 5 HOH 15  715 2066 HOH HOH X . 
F 5 HOH 16  716 2092 HOH HOH X . 
F 5 HOH 17  717 2059 HOH HOH X . 
F 5 HOH 18  718 2097 HOH HOH X . 
F 5 HOH 19  719 2065 HOH HOH X . 
F 5 HOH 20  720 2029 HOH HOH X . 
F 5 HOH 21  721 2044 HOH HOH X . 
F 5 HOH 22  722 2006 HOH HOH X . 
F 5 HOH 23  723 2027 HOH HOH X . 
F 5 HOH 24  724 2040 HOH HOH X . 
F 5 HOH 25  725 2017 HOH HOH X . 
F 5 HOH 26  726 2113 HOH HOH X . 
F 5 HOH 27  727 2091 HOH HOH X . 
F 5 HOH 28  728 2102 HOH HOH X . 
F 5 HOH 29  729 2068 HOH HOH X . 
F 5 HOH 30  730 2073 HOH HOH X . 
F 5 HOH 31  731 2009 HOH HOH X . 
F 5 HOH 32  732 2024 HOH HOH X . 
F 5 HOH 33  733 2037 HOH HOH X . 
F 5 HOH 34  734 2072 HOH HOH X . 
F 5 HOH 35  735 2063 HOH HOH X . 
F 5 HOH 36  736 2007 HOH HOH X . 
F 5 HOH 37  737 2088 HOH HOH X . 
F 5 HOH 38  738 2094 HOH HOH X . 
F 5 HOH 39  739 2051 HOH HOH X . 
F 5 HOH 40  740 2039 HOH HOH X . 
F 5 HOH 41  741 2020 HOH HOH X . 
F 5 HOH 42  742 2061 HOH HOH X . 
F 5 HOH 43  743 2053 HOH HOH X . 
F 5 HOH 44  744 2081 HOH HOH X . 
F 5 HOH 45  745 2021 HOH HOH X . 
F 5 HOH 46  746 2096 HOH HOH X . 
F 5 HOH 47  747 2031 HOH HOH X . 
F 5 HOH 48  748 2060 HOH HOH X . 
F 5 HOH 49  749 2041 HOH HOH X . 
F 5 HOH 50  750 2069 HOH HOH X . 
F 5 HOH 51  751 2038 HOH HOH X . 
F 5 HOH 52  752 2026 HOH HOH X . 
F 5 HOH 53  753 2067 HOH HOH X . 
F 5 HOH 54  754 2025 HOH HOH X . 
F 5 HOH 55  755 2018 HOH HOH X . 
F 5 HOH 56  756 2023 HOH HOH X . 
F 5 HOH 57  757 2111 HOH HOH X . 
F 5 HOH 58  758 2101 HOH HOH X . 
F 5 HOH 59  759 2107 HOH HOH X . 
F 5 HOH 60  760 2030 HOH HOH X . 
F 5 HOH 61  761 2110 HOH HOH X . 
F 5 HOH 62  762 2057 HOH HOH X . 
F 5 HOH 63  763 2048 HOH HOH X . 
F 5 HOH 64  764 2001 HOH HOH X . 
F 5 HOH 65  765 2084 HOH HOH X . 
F 5 HOH 66  766 2114 HOH HOH X . 
F 5 HOH 67  767 2034 HOH HOH X . 
F 5 HOH 68  768 2077 HOH HOH X . 
F 5 HOH 69  769 2055 HOH HOH X . 
F 5 HOH 70  770 2035 HOH HOH X . 
F 5 HOH 71  771 2089 HOH HOH X . 
F 5 HOH 72  772 2098 HOH HOH X . 
F 5 HOH 73  773 2052 HOH HOH X . 
F 5 HOH 74  774 2112 HOH HOH X . 
F 5 HOH 75  775 2015 HOH HOH X . 
F 5 HOH 76  776 2080 HOH HOH X . 
F 5 HOH 77  777 2056 HOH HOH X . 
F 5 HOH 78  778 2046 HOH HOH X . 
F 5 HOH 79  779 2005 HOH HOH X . 
F 5 HOH 80  780 2045 HOH HOH X . 
F 5 HOH 81  781 2093 HOH HOH X . 
F 5 HOH 82  782 2062 HOH HOH X . 
F 5 HOH 83  783 2003 HOH HOH X . 
F 5 HOH 84  784 2008 HOH HOH X . 
F 5 HOH 85  785 2012 HOH HOH X . 
F 5 HOH 86  786 2036 HOH HOH X . 
F 5 HOH 87  787 2028 HOH HOH X . 
F 5 HOH 88  788 2087 HOH HOH X . 
F 5 HOH 89  789 2004 HOH HOH X . 
F 5 HOH 90  790 2085 HOH HOH X . 
F 5 HOH 91  791 2047 HOH HOH X . 
F 5 HOH 92  792 2074 HOH HOH X . 
F 5 HOH 93  793 2033 HOH HOH X . 
F 5 HOH 94  794 2086 HOH HOH X . 
F 5 HOH 95  795 2064 HOH HOH X . 
F 5 HOH 96  796 2014 HOH HOH X . 
F 5 HOH 97  797 2082 HOH HOH X . 
F 5 HOH 98  798 2019 HOH HOH X . 
F 5 HOH 99  799 2054 HOH HOH X . 
F 5 HOH 100 800 2050 HOH HOH X . 
F 5 HOH 101 801 2090 HOH HOH X . 
F 5 HOH 102 802 2108 HOH HOH X . 
F 5 HOH 103 803 2071 HOH HOH X . 
F 5 HOH 104 804 2109 HOH HOH X . 
F 5 HOH 105 805 2083 HOH HOH X . 
F 5 HOH 106 806 2115 HOH HOH X . 
F 5 HOH 107 807 2058 HOH HOH X . 
F 5 HOH 108 808 2016 HOH HOH X . 
F 5 HOH 109 809 2103 HOH HOH X . 
F 5 HOH 110 810 2104 HOH HOH X . 
F 5 HOH 111 811 2002 HOH HOH X . 
F 5 HOH 112 812 2010 HOH HOH X . 
F 5 HOH 113 813 2011 HOH HOH X . 
F 5 HOH 114 814 2105 HOH HOH X . 
F 5 HOH 115 815 2043 HOH HOH X . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 80  X ASN 59  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 437 X ASN 416 ? ASN 'GLYCOSYLATION SITE' 
3 A ASN 478 X ASN 457 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-04-07 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-07-12 
5 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Advisory                    
4 5 'Structure model' Advisory                    
5 5 'Structure model' 'Atomic model'              
6 5 'Structure model' 'Data collection'           
7 5 'Structure model' 'Derived calculations'      
8 5 'Structure model' Other                       
9 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' database_PDB_caveat           
2  5 'Structure model' atom_site                     
3  5 'Structure model' chem_comp                     
4  5 'Structure model' entity                        
5  5 'Structure model' pdbx_branch_scheme            
6  5 'Structure model' pdbx_chem_comp_identifier     
7  5 'Structure model' pdbx_database_status          
8  5 'Structure model' pdbx_entity_branch            
9  5 'Structure model' pdbx_entity_branch_descriptor 
10 5 'Structure model' pdbx_entity_branch_link       
11 5 'Structure model' pdbx_entity_branch_list       
12 5 'Structure model' pdbx_entity_nonpoly           
13 5 'Structure model' pdbx_nonpoly_scheme           
14 5 'Structure model' pdbx_struct_assembly_gen      
15 5 'Structure model' pdbx_unobs_or_zero_occ_atoms  
16 5 'Structure model' struct_asym                   
17 5 'Structure model' struct_conn                   
18 5 'Structure model' struct_site                   
19 5 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  5 'Structure model' '_atom_site.B_iso_or_equiv'                   
2  5 'Structure model' '_atom_site.Cartn_x'                          
3  5 'Structure model' '_atom_site.Cartn_y'                          
4  5 'Structure model' '_atom_site.Cartn_z'                          
5  5 'Structure model' '_atom_site.auth_asym_id'                     
6  5 'Structure model' '_atom_site.auth_atom_id'                     
7  5 'Structure model' '_atom_site.auth_comp_id'                     
8  5 'Structure model' '_atom_site.auth_seq_id'                      
9  5 'Structure model' '_atom_site.label_asym_id'                    
10 5 'Structure model' '_atom_site.label_atom_id'                    
11 5 'Structure model' '_atom_site.label_comp_id'                    
12 5 'Structure model' '_atom_site.label_entity_id'                  
13 5 'Structure model' '_atom_site.occupancy'                        
14 5 'Structure model' '_atom_site.type_symbol'                      
15 5 'Structure model' '_chem_comp.name'                             
16 5 'Structure model' '_chem_comp.type'                             
17 5 'Structure model' '_pdbx_database_status.status_code_sf'        
18 5 'Structure model' '_pdbx_entity_nonpoly.entity_id'              
19 5 'Structure model' '_pdbx_entity_nonpoly.name'                   
20 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
21 5 'Structure model' '_pdbx_unobs_or_zero_occ_atoms.label_asym_id' 
22 5 'Structure model' '_struct_conn.pdbx_role'                      
23 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
24 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
25 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
26 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
27 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
28 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.4.0067 ? 1 
HKL-2000  'data reduction' .        ? 2 
SCALEPACK 'data scaling'   .        ? 3 
REFMAC    phasing          .        ? 4 
# 
loop_
_pdbx_database_remark.id 
_pdbx_database_remark.text 
650 
;
HELIX
DETERMINATION METHOD: AUTHOR PROVIDED.
;
700 
;
SHEET
DETERMINATION METHOD: AUTHOR PROVIDED.
;
# 
_pdbx_entry_details.entry_id                 2W6C 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       
;5H (BMP): THE ELECTRON DENSITY FOR THE INHIBITOR WAS NOT
 COMPLETE SO ONLY PART OF IT WAS FIT TO THE DENSITY AND
 DEPOSITED. THE FORMULA OF THIS PART IS C23H40N2O
;
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   CB 
_pdbx_validate_close_contact.auth_asym_id_1   X 
_pdbx_validate_close_contact.auth_comp_id_1   THR 
_pdbx_validate_close_contact.auth_seq_id_1    497 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   X 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    702 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.79 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            X 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_1             260 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            X 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_2             260 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.646 
_pdbx_validate_rmsd_bond.bond_target_value         1.517 
_pdbx_validate_rmsd_bond.bond_deviation            0.129 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.019 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA X LEU 143 ? ? CB X LEU 143 ? ? CG  X LEU 143 ? ? 100.09 115.30 -15.21 2.30 N 
2 1 C  X ASP 190 ? ? N  X PRO 191 ? ? CA  X PRO 191 ? ? 110.06 119.30 -9.24  1.50 Y 
3 1 NE X ARG 243 ? ? CZ X ARG 243 ? ? NH2 X ARG 243 ? ? 116.79 120.30 -3.51  0.50 N 
4 1 NE X ARG 244 ? ? CZ X ARG 244 ? ? NH2 X ARG 244 ? ? 117.19 120.30 -3.11  0.50 N 
5 1 CB X VAL 295 ? ? CA X VAL 295 ? ? C   X VAL 295 ? ? 99.35  111.40 -12.05 1.90 N 
6 1 CA X LEU 430 ? ? CB X LEU 430 ? ? CG  X LEU 430 ? ? 130.35 115.30 15.05  2.30 N 
7 1 CA X LEU 494 ? ? CB X LEU 494 ? ? CG  X LEU 494 ? ? 131.61 115.30 16.31  2.30 N 
8 1 CB X VAL 518 ? ? CA X VAL 518 ? ? C   X VAL 518 ? ? 99.55  111.40 -11.85 1.90 N 
9 1 CA X LEU 531 ? ? CB X LEU 531 ? ? CG  X LEU 531 ? ? 131.27 115.30 15.97  2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN X 42  ? ? -61.08  0.92    
2  1 PHE X 45  ? ? 66.00   -9.50   
3  1 ALA X 60  ? ? -104.91 51.67   
4  1 ARG X 105 ? ? -35.25  123.42  
5  1 SER X 108 ? ? -158.90 60.44   
6  1 PHE X 155 ? ? -141.34 13.82   
7  1 SER X 200 ? ? 56.56   -125.00 
8  1 PRO X 294 ? ? -48.76  153.77  
9  1 GLU X 299 ? ? -120.09 -80.76  
10 1 ASP X 380 ? ? 174.87  42.92   
11 1 VAL X 400 ? ? -132.50 -58.57  
12 1 ASN X 424 ? ? -140.47 39.18   
13 1 ASN X 457 ? ? 86.16   37.69   
14 1 GLN X 526 ? ? -105.04 -61.13  
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    C1 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    X 
_pdbx_validate_chiral.auth_comp_id    NAG 
_pdbx_validate_chiral.auth_seq_id     602 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 X ASN 42  ? CG  ? A ASN 63  CG  
2  1 Y 1 X ASN 42  ? OD1 ? A ASN 63  OD1 
3  1 Y 1 X ASN 42  ? ND2 ? A ASN 63  ND2 
4  1 Y 1 X ARG 46  ? CZ  ? A ARG 67  CZ  
5  1 Y 1 X ARG 46  ? NH1 ? A ARG 67  NH1 
6  1 Y 1 X ARG 46  ? NH2 ? A ARG 67  NH2 
7  1 Y 1 X ARG 250 ? CZ  ? A ARG 271 CZ  
8  1 Y 1 X ARG 250 ? NH1 ? A ARG 271 NH1 
9  1 Y 1 X ARG 250 ? NH2 ? A ARG 271 NH2 
10 1 Y 1 X ASN 257 ? CG  ? A ASN 278 CG  
11 1 Y 1 X ASN 257 ? OD1 ? A ASN 278 OD1 
12 1 Y 1 X ASN 257 ? ND2 ? A ASN 278 ND2 
13 1 Y 1 X GLU 260 ? OE1 ? A GLU 281 OE1 
14 1 Y 1 X GLU 260 ? OE2 ? A GLU 281 OE2 
15 1 Y 1 X GLU 268 ? OE1 ? A GLU 289 OE1 
16 1 Y 1 X GLU 268 ? OE2 ? A GLU 289 OE2 
17 1 Y 1 X LYS 270 ? CD  ? A LYS 291 CD  
18 1 Y 1 X LYS 270 ? CE  ? A LYS 291 CE  
19 1 Y 1 X LYS 270 ? NZ  ? A LYS 291 NZ  
20 1 Y 1 X GLU 344 ? OE1 ? A GLU 365 OE1 
21 1 Y 1 X GLU 344 ? OE2 ? A GLU 365 OE2 
22 1 Y 1 X LYS 357 ? NZ  ? A LYS 378 NZ  
23 1 Y 1 X ASP 365 ? OD1 ? A ASP 386 OD1 
24 1 Y 1 X ASP 365 ? OD2 ? A ASP 386 OD2 
25 1 Y 1 X LYS 413 ? CD  ? A LYS 434 CD  
26 1 Y 1 X LYS 413 ? CE  ? A LYS 434 CE  
27 1 Y 1 X LYS 413 ? NZ  ? A LYS 434 NZ  
28 1 Y 1 X LYS 498 ? CG  ? A LYS 519 CG  
29 1 Y 1 X LYS 498 ? CD  ? A LYS 519 CD  
30 1 Y 1 X LYS 498 ? CE  ? A LYS 519 CE  
31 1 Y 1 X LYS 498 ? NZ  ? A LYS 519 NZ  
32 1 Y 1 X GLU 508 ? CD  ? A GLU 529 CD  
33 1 Y 1 X GLU 508 ? OE1 ? A GLU 529 OE1 
34 1 Y 1 X GLU 508 ? OE2 ? A GLU 529 OE2 
35 1 Y 1 X ARG 515 ? CZ  ? A ARG 536 CZ  
36 1 Y 1 X ARG 515 ? NH1 ? A ARG 536 NH1 
37 1 Y 1 X ARG 515 ? NH2 ? A ARG 536 NH2 
38 1 Y 1 X GLN 526 ? OE1 ? A GLN 547 OE1 
39 1 Y 1 X GLN 526 ? NE2 ? A GLN 547 NE2 
40 1 N 1 X BM4 601 ? C24 ? C BM4 1   C24 
41 1 N 1 X BM4 601 ? C25 ? C BM4 1   C25 
42 1 N 1 X BM4 601 ? C26 ? C BM4 1   C26 
43 1 N 1 X BM4 601 ? C27 ? C BM4 1   C27 
44 1 N 1 X BM4 601 ? C28 ? C BM4 1   C28 
45 1 N 1 X BM4 601 ? C29 ? C BM4 1   C29 
46 1 N 1 X BM4 601 ? C30 ? C BM4 1   C30 
47 1 N 1 X BM4 601 ? C31 ? C BM4 1   C31 
48 1 N 1 X BM4 601 ? C32 ? C BM4 1   C32 
49 1 N 1 X BM4 601 ? C33 ? C BM4 1   C33 
50 1 N 1 X BM4 601 ? C34 ? C BM4 1   C34 
51 1 N 1 X BM4 601 ? C35 ? C BM4 1   C35 
52 1 N 1 X BM4 601 ? O2  ? C BM4 1   O2  
53 1 N 1 X BM4 601 ? C36 ? C BM4 1   C36 
54 1 N 1 X BM4 601 ? C37 ? C BM4 1   C37 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 X MET -20 ? A MET 1   
2  1 Y 1 X ASN -19 ? A ASN 2   
3  1 Y 1 X LEU -18 ? A LEU 3   
4  1 Y 1 X LEU -17 ? A LEU 4   
5  1 Y 1 X VAL -16 ? A VAL 5   
6  1 Y 1 X THR -15 ? A THR 6   
7  1 Y 1 X SER -14 ? A SER 7   
8  1 Y 1 X SER -13 ? A SER 8   
9  1 Y 1 X LEU -12 ? A LEU 9   
10 1 Y 1 X GLY -11 ? A GLY 10  
11 1 Y 1 X VAL -10 ? A VAL 11  
12 1 Y 1 X LEU -9  ? A LEU 12  
13 1 Y 1 X LEU -8  ? A LEU 13  
14 1 Y 1 X HIS -7  ? A HIS 14  
15 1 Y 1 X LEU -6  ? A LEU 15  
16 1 Y 1 X VAL -5  ? A VAL 16  
17 1 Y 1 X VAL -4  ? A VAL 17  
18 1 Y 1 X LEU -3  ? A LEU 18  
19 1 Y 1 X CYS -2  ? A CYS 19  
20 1 Y 1 X GLN -1  ? A GLN 20  
21 1 Y 1 X ALA 0   ? A ALA 21  
22 1 Y 1 X ASP 1   ? A ASP 22  
23 1 Y 1 X ASP 2   ? A ASP 23  
24 1 Y 1 X HIS 3   ? A HIS 24  
25 1 Y 1 X HIS 486 ? A HIS 507 
26 1 Y 1 X SER 487 ? A SER 508 
27 1 Y 1 X GLN 488 ? A GLN 509 
28 1 Y 1 X GLU 489 ? A GLU 510 
29 1 Y 1 X ALA 536 ? A ALA 557 
30 1 Y 1 X CYS 537 ? A CYS 558 
31 1 Y 1 X ASP 538 ? A ASP 559 
32 1 Y 1 X GLY 539 ? A GLY 560 
33 1 Y 1 X GLU 540 ? A GLU 561 
34 1 Y 1 X LEU 541 ? A LEU 562 
35 1 Y 1 X SER 542 ? A SER 563 
36 1 Y 1 X SER 543 ? A SER 564 
37 1 Y 1 X SER 544 ? A SER 565 
38 1 Y 1 X GLY 545 ? A GLY 566 
39 1 Y 1 X THR 546 ? A THR 567 
40 1 Y 1 X SER 547 ? A SER 568 
41 1 Y 1 X SER 548 ? A SER 569 
42 1 Y 1 X SER 549 ? A SER 570 
43 1 Y 1 X LYS 550 ? A LYS 571 
44 1 Y 1 X GLY 551 ? A GLY 572 
45 1 Y 1 X ILE 552 ? A ILE 573 
46 1 Y 1 X ILE 553 ? A ILE 574 
47 1 Y 1 X PHE 554 ? A PHE 575 
48 1 Y 1 X TYR 555 ? A TYR 576 
49 1 Y 1 X VAL 556 ? A VAL 577 
50 1 Y 1 X LEU 557 ? A LEU 578 
51 1 Y 1 X PHE 558 ? A PHE 579 
52 1 Y 1 X SER 559 ? A SER 580 
53 1 Y 1 X ILE 560 ? A ILE 581 
54 1 Y 1 X LEU 561 ? A LEU 582 
55 1 Y 1 X TYR 562 ? A TYR 583 
56 1 Y 1 X LEU 563 ? A LEU 584 
57 1 Y 1 X ILE 564 ? A ILE 585 
58 1 Y 1 X PHE 565 ? A PHE 586 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
B 2 NAG 1 A NAG 1 X NAG 1538 n 
B 2 NAG 2 A NAG 2 X NAG 1539 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 DGlcpNAcb1-4DGlcpNAcb1-                               'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}'    LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  2 
_pdbx_entity_branch_link.entity_branch_list_num_1   2 
_pdbx_entity_branch_link.comp_id_1                  NAG 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   1 
_pdbx_entity_branch_link.comp_id_2                  NAG 
_pdbx_entity_branch_link.atom_id_2                  O4 
_pdbx_entity_branch_link.leaving_atom_id_2          HO4 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 '3-[(3R)-3-ethyl-1-{9-[(3S)-3-ethyl-3-(3-hydroxyphenyl)azepan-1-yl]nonyl}azepan-3-yl]phenol' BM4 
4 2-acetamido-2-deoxy-beta-D-glucopyranose                                                     NAG 
5 water                                                                                        HOH 
#