data_2W7W
# 
_entry.id   2W7W 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.303 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2W7W         
PDBE  EBI-38491    
WWPDB D_1290038491 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2W7W 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2009-01-06 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Pedersen, H.L.'  1 ? 
'Willassen, N.P.' 2 ? 
'Leiros, I.'      3 ? 
# 
_citation.id                        primary 
_citation.title                     
;The first structure of a cold-adapted superoxide dismutase (SOD): biochemical and structural characterization of iron SOD from Aliivibrio salmonicida.
;
_citation.journal_abbrev            'Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun.' 
_citation.journal_volume            65 
_citation.page_first                84 
_citation.page_last                 92 
_citation.year                      2009 
_citation.journal_id_ASTM           ? 
_citation.country                   DK 
_citation.journal_id_ISSN           1744-3091 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19193992 
_citation.pdbx_database_id_DOI      10.1107/S1744309109001110 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Pedersen, H.L.'  1 ? 
primary 'Willassen, N.P.' 2 ? 
primary 'Leiros, I.'      3 ? 
# 
_cell.entry_id           2W7W 
_cell.length_a           70.720 
_cell.length_b           70.720 
_cell.length_c           170.250 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2W7W 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'SUPEROXIDE DISMUTASE [FE]' 21406.787 2   1.15.1.1 ? ? ? 
2 non-polymer syn 'FE (III) ION'              55.845    2   ?        ? ? ? 
3 water       nat water                       18.015    208 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSFELPALPFAKDALEPHISAETLDYHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTSTGGVFNNAAQIWNHTFYWNC
LAPNAGGQPTGAVAAAIDAAFGSFEEFKAKFTDSAINNFGSSWTWLVKNADGSLAIVNTSNAATPLTDEGVTPLLTVDLW
EHAYYIDFRNVRPDYMGAFWSLVNWSFVEENLAK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSFELPALPFAKDALEPHISAETLDYHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTSTGGVFNNAAQIWNHTFYWNC
LAPNAGGQPTGAVAAAIDAAFGSFEEFKAKFTDSAINNFGSSWTWLVKNADGSLAIVNTSNAATPLTDEGVTPLLTVDLW
EHAYYIDFRNVRPDYMGAFWSLVNWSFVEENLAK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   PHE n 
1 4   GLU n 
1 5   LEU n 
1 6   PRO n 
1 7   ALA n 
1 8   LEU n 
1 9   PRO n 
1 10  PHE n 
1 11  ALA n 
1 12  LYS n 
1 13  ASP n 
1 14  ALA n 
1 15  LEU n 
1 16  GLU n 
1 17  PRO n 
1 18  HIS n 
1 19  ILE n 
1 20  SER n 
1 21  ALA n 
1 22  GLU n 
1 23  THR n 
1 24  LEU n 
1 25  ASP n 
1 26  TYR n 
1 27  HIS n 
1 28  HIS n 
1 29  GLY n 
1 30  LYS n 
1 31  HIS n 
1 32  HIS n 
1 33  ASN n 
1 34  THR n 
1 35  TYR n 
1 36  VAL n 
1 37  VAL n 
1 38  LYS n 
1 39  LEU n 
1 40  ASN n 
1 41  GLY n 
1 42  LEU n 
1 43  ILE n 
1 44  PRO n 
1 45  GLY n 
1 46  THR n 
1 47  GLU n 
1 48  PHE n 
1 49  GLU n 
1 50  GLY n 
1 51  LYS n 
1 52  THR n 
1 53  LEU n 
1 54  GLU n 
1 55  GLU n 
1 56  ILE n 
1 57  ILE n 
1 58  LYS n 
1 59  THR n 
1 60  SER n 
1 61  THR n 
1 62  GLY n 
1 63  GLY n 
1 64  VAL n 
1 65  PHE n 
1 66  ASN n 
1 67  ASN n 
1 68  ALA n 
1 69  ALA n 
1 70  GLN n 
1 71  ILE n 
1 72  TRP n 
1 73  ASN n 
1 74  HIS n 
1 75  THR n 
1 76  PHE n 
1 77  TYR n 
1 78  TRP n 
1 79  ASN n 
1 80  CYS n 
1 81  LEU n 
1 82  ALA n 
1 83  PRO n 
1 84  ASN n 
1 85  ALA n 
1 86  GLY n 
1 87  GLY n 
1 88  GLN n 
1 89  PRO n 
1 90  THR n 
1 91  GLY n 
1 92  ALA n 
1 93  VAL n 
1 94  ALA n 
1 95  ALA n 
1 96  ALA n 
1 97  ILE n 
1 98  ASP n 
1 99  ALA n 
1 100 ALA n 
1 101 PHE n 
1 102 GLY n 
1 103 SER n 
1 104 PHE n 
1 105 GLU n 
1 106 GLU n 
1 107 PHE n 
1 108 LYS n 
1 109 ALA n 
1 110 LYS n 
1 111 PHE n 
1 112 THR n 
1 113 ASP n 
1 114 SER n 
1 115 ALA n 
1 116 ILE n 
1 117 ASN n 
1 118 ASN n 
1 119 PHE n 
1 120 GLY n 
1 121 SER n 
1 122 SER n 
1 123 TRP n 
1 124 THR n 
1 125 TRP n 
1 126 LEU n 
1 127 VAL n 
1 128 LYS n 
1 129 ASN n 
1 130 ALA n 
1 131 ASP n 
1 132 GLY n 
1 133 SER n 
1 134 LEU n 
1 135 ALA n 
1 136 ILE n 
1 137 VAL n 
1 138 ASN n 
1 139 THR n 
1 140 SER n 
1 141 ASN n 
1 142 ALA n 
1 143 ALA n 
1 144 THR n 
1 145 PRO n 
1 146 LEU n 
1 147 THR n 
1 148 ASP n 
1 149 GLU n 
1 150 GLY n 
1 151 VAL n 
1 152 THR n 
1 153 PRO n 
1 154 LEU n 
1 155 LEU n 
1 156 THR n 
1 157 VAL n 
1 158 ASP n 
1 159 LEU n 
1 160 TRP n 
1 161 GLU n 
1 162 HIS n 
1 163 ALA n 
1 164 TYR n 
1 165 TYR n 
1 166 ILE n 
1 167 ASP n 
1 168 PHE n 
1 169 ARG n 
1 170 ASN n 
1 171 VAL n 
1 172 ARG n 
1 173 PRO n 
1 174 ASP n 
1 175 TYR n 
1 176 MET n 
1 177 GLY n 
1 178 ALA n 
1 179 PHE n 
1 180 TRP n 
1 181 SER n 
1 182 LEU n 
1 183 VAL n 
1 184 ASN n 
1 185 TRP n 
1 186 SER n 
1 187 PHE n 
1 188 VAL n 
1 189 GLU n 
1 190 GLU n 
1 191 ASN n 
1 192 LEU n 
1 193 ALA n 
1 194 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    LFI1238 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'ALIIVIBRIO SALMONICIDA' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     316275 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    B6ENP9_ALISL 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          B6ENP9 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2W7W A 1 ? 194 ? B6ENP9 1 ? 194 ? 1 194 
2 1 2W7W B 1 ? 194 ? B6ENP9 1 ? 194 ? 1 194 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
FE  non-polymer         . 'FE (III) ION'  ? 'Fe 3'           55.845  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2W7W 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.87 
_exptl_crystal.density_percent_sol   57.19 
_exptl_crystal.description           NONE 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'1 MICROLITER DROPS OF A 6.5 MG/ML PROTEIN SOLUTION WITH A SOLUTION CONTAINING 0.1M TRIS-HCL, 1.4 M SODIUM CITRATE, PH 8.5 AT 291K.' 
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     110 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2006-02-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.8722 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE BM1A' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   BM1A 
_diffrn_source.pdbx_wavelength             0.8722 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2W7W 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            1.70 
_reflns.number_obs                   55155 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.12 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.50 
_reflns.B_iso_Wilson_estimate        15.51 
_reflns.pdbx_redundancy              5.8 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.79 
_reflns_shell.percent_possible_all   98.6 
_reflns_shell.Rmerge_I_obs           0.34 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.60 
_reflns_shell.pdbx_redundancy        5.5 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2W7W 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     52997 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             15.00 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    99.8 
_refine.ls_R_factor_obs                          0.207 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.205 
_refine.ls_R_factor_R_free                       0.239 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 3.600 
_refine.ls_number_reflns_R_free                  1984 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.956 
_refine.correlation_coeff_Fo_to_Fc_free          0.941 
_refine.B_iso_mean                               21.00 
_refine.aniso_B[1][1]                            0.91000 
_refine.aniso_B[2][2]                            0.91000 
_refine.aniso_B[3][3]                            -1.36000 
_refine.aniso_B[1][2]                            0.45000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1ISA' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.100 
_refine.pdbx_overall_ESU_R_Free                  0.102 
_refine.overall_SU_ML                            0.088 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             2.848 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3018 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             208 
_refine_hist.number_atoms_total               3228 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        15.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.014  0.022  ? 3114 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.467  1.910  ? 4260 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.820  5.000  ? 384  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       37.352 25.000 ? 148  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.988 15.000 ? 440  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       9.829  15.000 ? 4    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.105  0.200  ? 460  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.020  ? 2442 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.201  0.200  ? 1473 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.314  0.200  ? 2163 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.151  0.200  ? 181  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.166  0.200  ? 30   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.246  0.200  ? 5    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.858  1.500  ? 1954 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.431  2.000  ? 3076 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.127  3.000  ? 1356 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.046  4.500  ? 1184 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.70 
_refine_ls_shell.d_res_low                        1.74 
_refine_ls_shell.number_reflns_R_work             3790 
_refine_ls_shell.R_factor_R_work                  0.3270 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3440 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             129 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2W7W 
_struct.title                     'The crystal structure of iron superoxide dismutase from Aliivibrio salmonicida.' 
_struct.pdbx_descriptor           'SUPEROXIDE DISMUTASE [FE] (E.C.1.15.1.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2W7W 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
;DSC, SODB, FESOD, OXIDOREDUCTASE, COLD ADAPTATION, STRUCTURAL ANALYSIS, SUPEROXIDE DISMUTASE, DIFFERENTIAL SCANNING CALORIMETRY, ALIIVIBRIO SALMONICIDA
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 20  ? HIS A 28  ? SER A 20  HIS A 28  1 ? 9  
HELX_P HELX_P2  2  LYS A 30  ? ILE A 43  ? LYS A 30  ILE A 43  1 ? 14 
HELX_P HELX_P3  3  THR A 52  ? SER A 60  ? THR A 52  SER A 60  1 ? 9  
HELX_P HELX_P4  4  THR A 61  ? CYS A 80  ? THR A 61  CYS A 80  1 ? 20 
HELX_P HELX_P5  5  THR A 90  ? GLY A 102 ? THR A 90  GLY A 102 1 ? 13 
HELX_P HELX_P6  6  SER A 103 ? ASN A 117 ? SER A 103 ASN A 117 1 ? 15 
HELX_P HELX_P7  7  THR A 144 ? ASP A 148 ? THR A 144 ASP A 148 5 ? 5  
HELX_P HELX_P8  8  TRP A 160 ? ALA A 163 ? TRP A 160 ALA A 163 5 ? 4  
HELX_P HELX_P9  9  TYR A 164 ? ARG A 169 ? TYR A 164 ARG A 169 1 ? 6  
HELX_P HELX_P10 10 VAL A 171 ? VAL A 183 ? VAL A 171 VAL A 183 1 ? 13 
HELX_P HELX_P11 11 ASN A 184 ? ALA A 193 ? ASN A 184 ALA A 193 1 ? 10 
HELX_P HELX_P12 12 SER B 20  ? HIS B 28  ? SER B 20  HIS B 28  1 ? 9  
HELX_P HELX_P13 13 LYS B 30  ? ILE B 43  ? LYS B 30  ILE B 43  1 ? 14 
HELX_P HELX_P14 14 THR B 52  ? SER B 60  ? THR B 52  SER B 60  1 ? 9  
HELX_P HELX_P15 15 THR B 61  ? LEU B 81  ? THR B 61  LEU B 81  1 ? 21 
HELX_P HELX_P16 16 THR B 90  ? GLY B 102 ? THR B 90  GLY B 102 1 ? 13 
HELX_P HELX_P17 17 SER B 103 ? ASN B 117 ? SER B 103 ASN B 117 1 ? 15 
HELX_P HELX_P18 18 THR B 144 ? ASP B 148 ? THR B 144 ASP B 148 5 ? 5  
HELX_P HELX_P19 19 TRP B 160 ? ALA B 163 ? TRP B 160 ALA B 163 5 ? 4  
HELX_P HELX_P20 20 TYR B 164 ? ARG B 169 ? TYR B 164 ARG B 169 1 ? 6  
HELX_P HELX_P21 21 VAL B 171 ? SER B 181 ? VAL B 171 SER B 181 1 ? 11 
HELX_P HELX_P22 22 ASN B 184 ? LYS B 194 ? ASN B 184 LYS B 194 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? C FE . FE ? ? ? 1_555 A HIS 162 NE2 ? ? A FE 1195 A HIS 162  1_555 ? ? ? ? ? ? ? 2.123 ? 
metalc2  metalc ? ? C FE . FE ? ? ? 1_555 E HOH .   O   ? ? A FE 1195 A HOH 2069 1_555 ? ? ? ? ? ? ? 2.165 ? 
metalc3  metalc ? ? C FE . FE ? ? ? 1_555 A HIS 74  NE2 ? ? A FE 1195 A HIS 74   1_555 ? ? ? ? ? ? ? 2.197 ? 
metalc4  metalc ? ? C FE . FE ? ? ? 1_555 A HIS 27  NE2 ? ? A FE 1195 A HIS 27   1_555 ? ? ? ? ? ? ? 2.127 ? 
metalc5  metalc ? ? C FE . FE ? ? ? 1_555 A ASP 158 OD2 ? ? A FE 1195 A ASP 158  1_555 ? ? ? ? ? ? ? 1.843 ? 
metalc6  metalc ? ? D FE . FE ? ? ? 1_555 B HIS 74  NE2 ? ? B FE 1195 B HIS 74   1_555 ? ? ? ? ? ? ? 2.199 ? 
metalc7  metalc ? ? D FE . FE ? ? ? 1_555 B ASP 158 OD2 ? ? B FE 1195 B ASP 158  1_555 ? ? ? ? ? ? ? 1.926 ? 
metalc8  metalc ? ? D FE . FE ? ? ? 1_555 B HIS 162 NE2 ? ? B FE 1195 B HIS 162  1_555 ? ? ? ? ? ? ? 2.006 ? 
metalc9  metalc ? ? D FE . FE ? ? ? 1_555 F HOH .   O   ? ? B FE 1195 B HOH 2100 1_555 ? ? ? ? ? ? ? 2.155 ? 
metalc10 metalc ? ? D FE . FE ? ? ? 1_555 B HIS 27  NE2 ? ? B FE 1195 B HIS 27   1_555 ? ? ? ? ? ? ? 1.977 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 16 A . ? GLU 16 A PRO 17 A ? PRO 17 A 1 1.01  
2 GLU 16 B . ? GLU 16 B PRO 17 B ? PRO 17 B 1 -2.01 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3 ? 
BA ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 LEU A 134 ? SER A 140 ? LEU A 134 SER A 140 
AA 2 SER A 122 ? LYS A 128 ? SER A 122 LYS A 128 
AA 3 THR A 152 ? ASP A 158 ? THR A 152 ASP A 158 
BA 1 LEU B 134 ? SER B 140 ? LEU B 134 SER B 140 
BA 2 SER B 122 ? LYS B 128 ? SER B 122 LYS B 128 
BA 3 THR B 152 ? ASP B 158 ? THR B 152 ASP B 158 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N THR A 139 ? N THR A 139 O TRP A 123 ? O TRP A 123 
AA 2 3 N LYS A 128 ? N LYS A 128 O THR A 152 ? O THR A 152 
BA 1 2 N THR B 139 ? N THR B 139 O TRP B 123 ? O TRP B 123 
BA 2 3 N LYS B 128 ? N LYS B 128 O THR B 152 ? O THR B 152 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FE A1195' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FE B1195' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 HIS A 27  ? HIS A 27   . ? 1_555 ? 
2  AC1 5 HIS A 74  ? HIS A 74   . ? 1_555 ? 
3  AC1 5 ASP A 158 ? ASP A 158  . ? 1_555 ? 
4  AC1 5 HIS A 162 ? HIS A 162  . ? 1_555 ? 
5  AC1 5 HOH E .   ? HOH A 2069 . ? 1_555 ? 
6  AC2 5 HIS B 27  ? HIS B 27   . ? 1_555 ? 
7  AC2 5 HIS B 74  ? HIS B 74   . ? 1_555 ? 
8  AC2 5 ASP B 158 ? ASP B 158  . ? 1_555 ? 
9  AC2 5 HIS B 162 ? HIS B 162  . ? 1_555 ? 
10 AC2 5 HOH F .   ? HOH B 2100 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2W7W 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2W7W 
_atom_sites.fract_transf_matrix[1][1]   0.014140 
_atom_sites.fract_transf_matrix[1][2]   0.008164 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016328 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005874 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 2   ? -4.622  25.893 40.633  1.00 36.68 ? 2    SER A N   1 
ATOM   2    C  CA  . SER A 1 2   ? -3.158  25.718 40.885  1.00 36.60 ? 2    SER A CA  1 
ATOM   3    C  C   . SER A 1 2   ? -2.241  26.249 39.765  1.00 34.85 ? 2    SER A C   1 
ATOM   4    O  O   . SER A 1 2   ? -1.146  26.737 40.060  1.00 35.13 ? 2    SER A O   1 
ATOM   5    C  CB  . SER A 1 2   ? -2.833  24.256 41.167  1.00 37.60 ? 2    SER A CB  1 
ATOM   6    O  OG  . SER A 1 2   ? -3.175  23.454 40.041  1.00 42.24 ? 2    SER A OG  1 
ATOM   7    N  N   . PHE A 1 3   ? -2.657  26.146 38.494  1.00 32.54 ? 3    PHE A N   1 
ATOM   8    C  CA  . PHE A 1 3   ? -2.054  27.007 37.462  1.00 29.24 ? 3    PHE A CA  1 
ATOM   9    C  C   . PHE A 1 3   ? -2.745  28.357 37.382  1.00 27.49 ? 3    PHE A C   1 
ATOM   10   O  O   . PHE A 1 3   ? -3.966  28.431 37.497  1.00 27.17 ? 3    PHE A O   1 
ATOM   11   C  CB  . PHE A 1 3   ? -2.019  26.331 36.089  1.00 28.99 ? 3    PHE A CB  1 
ATOM   12   C  CG  . PHE A 1 3   ? -0.991  25.267 36.001  1.00 27.71 ? 3    PHE A CG  1 
ATOM   13   C  CD1 . PHE A 1 3   ? 0.352   25.587 36.092  1.00 25.46 ? 3    PHE A CD1 1 
ATOM   14   C  CD2 . PHE A 1 3   ? -1.369  23.938 35.883  1.00 26.30 ? 3    PHE A CD2 1 
ATOM   15   C  CE1 . PHE A 1 3   ? 1.304   24.600 36.059  1.00 25.96 ? 3    PHE A CE1 1 
ATOM   16   C  CE2 . PHE A 1 3   ? -0.437  22.953 35.840  1.00 24.65 ? 3    PHE A CE2 1 
ATOM   17   C  CZ  . PHE A 1 3   ? 0.912   23.275 35.927  1.00 26.99 ? 3    PHE A CZ  1 
ATOM   18   N  N   . GLU A 1 4   ? -1.959  29.408 37.174  1.00 25.23 ? 4    GLU A N   1 
ATOM   19   C  CA  . GLU A 1 4   ? -2.534  30.751 37.076  1.00 24.06 ? 4    GLU A CA  1 
ATOM   20   C  C   . GLU A 1 4   ? -2.562  31.257 35.638  1.00 22.33 ? 4    GLU A C   1 
ATOM   21   O  O   . GLU A 1 4   ? -1.750  30.826 34.823  1.00 21.82 ? 4    GLU A O   1 
ATOM   22   C  CB  . GLU A 1 4   ? -1.767  31.751 37.978  1.00 23.61 ? 4    GLU A CB  1 
ATOM   23   C  CG  . GLU A 1 4   ? -0.380  32.240 37.458  1.00 24.39 ? 4    GLU A CG  1 
ATOM   24   C  CD  . GLU A 1 4   ? 0.015   33.623 38.008  1.00 23.54 ? 4    GLU A CD  1 
ATOM   25   O  OE1 . GLU A 1 4   ? -0.684  34.085 38.937  1.00 23.26 ? 4    GLU A OE1 1 
ATOM   26   O  OE2 . GLU A 1 4   ? 0.999   34.248 37.504  1.00 21.63 ? 4    GLU A OE2 1 
ATOM   27   N  N   . LEU A 1 5   ? -3.510  32.154 35.341  1.00 20.86 ? 5    LEU A N   1 
ATOM   28   C  CA  . LEU A 1 5   ? -3.416  32.993 34.151  1.00 18.87 ? 5    LEU A CA  1 
ATOM   29   C  C   . LEU A 1 5   ? -2.453  34.107 34.461  1.00 18.67 ? 5    LEU A C   1 
ATOM   30   O  O   . LEU A 1 5   ? -2.803  34.991 35.239  1.00 18.54 ? 5    LEU A O   1 
ATOM   31   C  CB  . LEU A 1 5   ? -4.756  33.627 33.823  1.00 18.34 ? 5    LEU A CB  1 
ATOM   32   C  CG  . LEU A 1 5   ? -4.755  34.533 32.592  1.00 18.63 ? 5    LEU A CG  1 
ATOM   33   C  CD1 . LEU A 1 5   ? -4.453  33.658 31.339  1.00 17.12 ? 5    LEU A CD1 1 
ATOM   34   C  CD2 . LEU A 1 5   ? -6.051  35.382 32.467  1.00 17.99 ? 5    LEU A CD2 1 
ATOM   35   N  N   . PRO A 1 6   ? -1.241  34.073 33.876  1.00 18.78 ? 6    PRO A N   1 
ATOM   36   C  CA  . PRO A 1 6   ? -0.283  35.134 34.161  1.00 18.76 ? 6    PRO A CA  1 
ATOM   37   C  C   . PRO A 1 6   ? -0.752  36.444 33.563  1.00 20.39 ? 6    PRO A C   1 
ATOM   38   O  O   . PRO A 1 6   ? -1.315  36.443 32.472  1.00 21.82 ? 6    PRO A O   1 
ATOM   39   C  CB  . PRO A 1 6   ? 1.003   34.670 33.459  1.00 19.28 ? 6    PRO A CB  1 
ATOM   40   C  CG  . PRO A 1 6   ? 0.780   33.206 33.163  1.00 18.93 ? 6    PRO A CG  1 
ATOM   41   C  CD  . PRO A 1 6   ? -0.693  33.050 32.968  1.00 18.16 ? 6    PRO A CD  1 
ATOM   42   N  N   . ALA A 1 7   ? -0.506  37.553 34.255  1.00 20.40 ? 7    ALA A N   1 
ATOM   43   C  CA  . ALA A 1 7   ? -0.804  38.881 33.739  1.00 20.14 ? 7    ALA A CA  1 
ATOM   44   C  C   . ALA A 1 7   ? 0.003   39.123 32.479  1.00 20.06 ? 7    ALA A C   1 
ATOM   45   O  O   . ALA A 1 7   ? 1.082   38.571 32.332  1.00 19.52 ? 7    ALA A O   1 
ATOM   46   C  CB  . ALA A 1 7   ? -0.476  39.953 34.791  1.00 19.48 ? 7    ALA A CB  1 
ATOM   47   N  N   . LEU A 1 8   ? -0.513  39.966 31.581  1.00 20.05 ? 8    LEU A N   1 
ATOM   48   C  CA  . LEU A 1 8   ? 0.212   40.308 30.339  1.00 19.77 ? 8    LEU A CA  1 
ATOM   49   C  C   . LEU A 1 8   ? 1.479   41.076 30.675  1.00 20.31 ? 8    LEU A C   1 
ATOM   50   O  O   . LEU A 1 8   ? 1.529   41.716 31.732  1.00 21.02 ? 8    LEU A O   1 
ATOM   51   C  CB  . LEU A 1 8   ? -0.686  41.180 29.458  1.00 19.47 ? 8    LEU A CB  1 
ATOM   52   C  CG  . LEU A 1 8   ? -1.914  40.514 28.834  1.00 20.45 ? 8    LEU A CG  1 
ATOM   53   C  CD1 . LEU A 1 8   ? -2.881  41.570 28.392  1.00 18.83 ? 8    LEU A CD1 1 
ATOM   54   C  CD2 . LEU A 1 8   ? -1.512  39.612 27.670  1.00 20.28 ? 8    LEU A CD2 1 
ATOM   55   N  N   . PRO A 1 9   ? 2.506   41.044 29.798  1.00 19.32 ? 9    PRO A N   1 
ATOM   56   C  CA  . PRO A 1 9   ? 3.688   41.854 30.135  1.00 19.37 ? 9    PRO A CA  1 
ATOM   57   C  C   . PRO A 1 9   ? 3.597   43.325 29.673  1.00 18.52 ? 9    PRO A C   1 
ATOM   58   O  O   . PRO A 1 9   ? 4.621   44.028 29.584  1.00 18.08 ? 9    PRO A O   1 
ATOM   59   C  CB  . PRO A 1 9   ? 4.823   41.128 29.419  1.00 19.72 ? 9    PRO A CB  1 
ATOM   60   C  CG  . PRO A 1 9   ? 4.186   40.301 28.361  1.00 19.95 ? 9    PRO A CG  1 
ATOM   61   C  CD  . PRO A 1 9   ? 2.692   40.332 28.525  1.00 19.03 ? 9    PRO A CD  1 
ATOM   62   N  N   . PHE A 1 10  ? 2.389   43.799 29.383  1.00 18.17 ? 10   PHE A N   1 
ATOM   63   C  CA  . PHE A 1 10  ? 2.182   45.197 28.975  1.00 18.43 ? 10   PHE A CA  1 
ATOM   64   C  C   . PHE A 1 10  ? 0.765   45.556 29.340  1.00 19.38 ? 10   PHE A C   1 
ATOM   65   O  O   . PHE A 1 10  ? -0.068  44.669 29.498  1.00 20.50 ? 10   PHE A O   1 
ATOM   66   C  CB  . PHE A 1 10  ? 2.394   45.361 27.446  1.00 18.16 ? 10   PHE A CB  1 
ATOM   67   C  CG  . PHE A 1 10  ? 1.847   44.214 26.636  1.00 17.64 ? 10   PHE A CG  1 
ATOM   68   C  CD1 . PHE A 1 10  ? 0.473   44.098 26.419  1.00 20.76 ? 10   PHE A CD1 1 
ATOM   69   C  CD2 . PHE A 1 10  ? 2.699   43.242 26.108  1.00 19.42 ? 10   PHE A CD2 1 
ATOM   70   C  CE1 . PHE A 1 10  ? -0.046  43.024 25.710  1.00 21.63 ? 10   PHE A CE1 1 
ATOM   71   C  CE2 . PHE A 1 10  ? 2.198   42.166 25.399  1.00 20.29 ? 10   PHE A CE2 1 
ATOM   72   C  CZ  . PHE A 1 10  ? 0.832   42.053 25.196  1.00 19.40 ? 10   PHE A CZ  1 
ATOM   73   N  N   . ALA A 1 11  ? 0.471   46.849 29.461  1.00 20.32 ? 11   ALA A N   1 
ATOM   74   C  CA  . ALA A 1 11  ? -0.872  47.360 29.675  1.00 21.06 ? 11   ALA A CA  1 
ATOM   75   C  C   . ALA A 1 11  ? -1.846  46.965 28.548  1.00 22.01 ? 11   ALA A C   1 
ATOM   76   O  O   . ALA A 1 11  ? -1.428  46.701 27.421  1.00 22.07 ? 11   ALA A O   1 
ATOM   77   C  CB  . ALA A 1 11  ? -0.809  48.888 29.811  1.00 21.03 ? 11   ALA A CB  1 
ATOM   78   N  N   . LYS A 1 12  ? -3.139  46.931 28.857  1.00 22.29 ? 12   LYS A N   1 
ATOM   79   C  CA  . LYS A 1 12  ? -4.157  46.572 27.867  1.00 23.45 ? 12   LYS A CA  1 
ATOM   80   C  C   . LYS A 1 12  ? -4.256  47.484 26.628  1.00 23.99 ? 12   LYS A C   1 
ATOM   81   O  O   . LYS A 1 12  ? -4.754  47.061 25.588  1.00 25.34 ? 12   LYS A O   1 
ATOM   82   C  CB  . LYS A 1 12  ? -5.533  46.468 28.528  1.00 23.25 ? 12   LYS A CB  1 
ATOM   83   C  CG  . LYS A 1 12  ? -5.732  45.243 29.413  1.00 25.29 ? 12   LYS A CG  1 
ATOM   84   C  CD  . LYS A 1 12  ? -5.964  43.965 28.603  1.00 25.70 ? 12   LYS A CD  1 
ATOM   85   C  CE  . LYS A 1 12  ? -6.190  42.792 29.537  1.00 27.43 ? 12   LYS A CE  1 
ATOM   86   N  NZ  . LYS A 1 12  ? -7.628  42.782 29.973  1.00 29.59 ? 12   LYS A NZ  1 
ATOM   87   N  N   . ASP A 1 13  ? -3.805  48.726 26.718  1.00 23.64 ? 13   ASP A N   1 
ATOM   88   C  CA  . ASP A 1 13  ? -3.806  49.579 25.536  1.00 23.70 ? 13   ASP A CA  1 
ATOM   89   C  C   . ASP A 1 13  ? -2.412  49.782 24.957  1.00 23.33 ? 13   ASP A C   1 
ATOM   90   O  O   . ASP A 1 13  ? -2.190  50.676 24.118  1.00 23.46 ? 13   ASP A O   1 
ATOM   91   C  CB  . ASP A 1 13  ? -4.435  50.930 25.848  1.00 24.75 ? 13   ASP A CB  1 
ATOM   92   C  CG  . ASP A 1 13  ? -3.700  51.681 26.946  1.00 27.45 ? 13   ASP A CG  1 
ATOM   93   O  OD1 . ASP A 1 13  ? -2.734  51.134 27.526  1.00 27.62 ? 13   ASP A OD1 1 
ATOM   94   O  OD2 . ASP A 1 13  ? -4.115  52.823 27.245  1.00 32.15 ? 13   ASP A OD2 1 
ATOM   95   N  N   . ALA A 1 14  ? -1.468  48.948 25.390  1.00 22.01 ? 14   ALA A N   1 
ATOM   96   C  CA  . ALA A 1 14  ? -0.065  49.189 25.059  1.00 20.81 ? 14   ALA A CA  1 
ATOM   97   C  C   . ALA A 1 14  ? 0.273   48.817 23.634  1.00 20.91 ? 14   ALA A C   1 
ATOM   98   O  O   . ALA A 1 14  ? 1.306   49.253 23.116  1.00 19.41 ? 14   ALA A O   1 
ATOM   99   C  CB  . ALA A 1 14  ? 0.837   48.431 26.003  1.00 20.29 ? 14   ALA A CB  1 
ATOM   100  N  N   . LEU A 1 15  ? -0.559  47.980 23.014  1.00 20.96 ? 15   LEU A N   1 
ATOM   101  C  CA  . LEU A 1 15  ? -0.247  47.520 21.659  1.00 22.26 ? 15   LEU A CA  1 
ATOM   102  C  C   . LEU A 1 15  ? -0.986  48.315 20.575  1.00 23.69 ? 15   LEU A C   1 
ATOM   103  O  O   . LEU A 1 15  ? -0.839  48.041 19.376  1.00 24.08 ? 15   LEU A O   1 
ATOM   104  C  CB  . LEU A 1 15  ? -0.517  46.024 21.528  1.00 21.56 ? 15   LEU A CB  1 
ATOM   105  C  CG  . LEU A 1 15  ? 0.074   45.031 22.540  1.00 21.39 ? 15   LEU A CG  1 
ATOM   106  C  CD1 . LEU A 1 15  ? -0.405  43.639 22.193  1.00 17.63 ? 15   LEU A CD1 1 
ATOM   107  C  CD2 . LEU A 1 15  ? 1.581   45.039 22.595  1.00 18.55 ? 15   LEU A CD2 1 
ATOM   108  N  N   . GLU A 1 16  ? -1.778  49.298 21.001  1.00 24.65 ? 16   GLU A N   1 
ATOM   109  C  CA  . GLU A 1 16  ? -2.502  50.145 20.085  1.00 25.74 ? 16   GLU A CA  1 
ATOM   110  C  C   . GLU A 1 16  ? -1.514  51.009 19.288  1.00 25.58 ? 16   GLU A C   1 
ATOM   111  O  O   . GLU A 1 16  ? -0.394  51.236 19.759  1.00 26.26 ? 16   GLU A O   1 
ATOM   112  C  CB  . GLU A 1 16  ? -3.586  50.910 20.847  1.00 26.32 ? 16   GLU A CB  1 
ATOM   113  C  CG  . GLU A 1 16  ? -4.626  49.905 21.377  1.00 29.87 ? 16   GLU A CG  1 
ATOM   114  C  CD  . GLU A 1 16  ? -5.905  50.517 21.877  1.00 35.51 ? 16   GLU A CD  1 
ATOM   115  O  OE1 . GLU A 1 16  ? -6.995  50.051 21.483  1.00 36.40 ? 16   GLU A OE1 1 
ATOM   116  O  OE2 . GLU A 1 16  ? -5.827  51.458 22.695  1.00 40.37 ? 16   GLU A OE2 1 
ATOM   117  N  N   . PRO A 1 17  ? -1.875  51.387 18.037  1.00 25.09 ? 17   PRO A N   1 
ATOM   118  C  CA  . PRO A 1 17  ? -3.157  51.050 17.385  1.00 24.42 ? 17   PRO A CA  1 
ATOM   119  C  C   . PRO A 1 17  ? -3.105  49.738 16.592  1.00 24.17 ? 17   PRO A C   1 
ATOM   120  O  O   . PRO A 1 17  ? -3.945  49.534 15.694  1.00 24.26 ? 17   PRO A O   1 
ATOM   121  C  CB  . PRO A 1 17  ? -3.348  52.216 16.421  1.00 25.34 ? 17   PRO A CB  1 
ATOM   122  C  CG  . PRO A 1 17  ? -1.920  52.517 15.970  1.00 24.73 ? 17   PRO A CG  1 
ATOM   123  C  CD  . PRO A 1 17  ? -1.003  52.161 17.135  1.00 25.21 ? 17   PRO A CD  1 
ATOM   124  N  N   . HIS A 1 18  ? -2.145  48.863 16.920  1.00 22.56 ? 18   HIS A N   1 
ATOM   125  C  CA  . HIS A 1 18  ? -1.924  47.606 16.178  1.00 22.42 ? 18   HIS A CA  1 
ATOM   126  C  C   . HIS A 1 18  ? -2.827  46.438 16.580  1.00 21.60 ? 18   HIS A C   1 
ATOM   127  O  O   . HIS A 1 18  ? -3.403  45.778 15.728  1.00 21.64 ? 18   HIS A O   1 
ATOM   128  C  CB  . HIS A 1 18  ? -0.467  47.186 16.271  1.00 22.60 ? 18   HIS A CB  1 
ATOM   129  C  CG  . HIS A 1 18  ? 0.483   48.269 15.872  1.00 26.20 ? 18   HIS A CG  1 
ATOM   130  N  ND1 . HIS A 1 18  ? 0.422   48.890 14.641  1.00 27.07 ? 18   HIS A ND1 1 
ATOM   131  C  CD2 . HIS A 1 18  ? 1.502   48.864 16.544  1.00 27.88 ? 18   HIS A CD2 1 
ATOM   132  C  CE1 . HIS A 1 18  ? 1.363   49.820 14.573  1.00 27.86 ? 18   HIS A CE1 1 
ATOM   133  N  NE2 . HIS A 1 18  ? 2.039   49.816 15.709  1.00 29.43 ? 18   HIS A NE2 1 
ATOM   134  N  N   . ILE A 1 19  ? -2.910  46.166 17.874  1.00 19.64 ? 19   ILE A N   1 
ATOM   135  C  CA  . ILE A 1 19  ? -3.842  45.199 18.420  1.00 18.73 ? 19   ILE A CA  1 
ATOM   136  C  C   . ILE A 1 19  ? -4.637  45.943 19.501  1.00 18.55 ? 19   ILE A C   1 
ATOM   137  O  O   . ILE A 1 19  ? -4.052  46.602 20.363  1.00 17.81 ? 19   ILE A O   1 
ATOM   138  C  CB  . ILE A 1 19  ? -3.082  43.974 18.961  1.00 18.27 ? 19   ILE A CB  1 
ATOM   139  C  CG1 . ILE A 1 19  ? -2.383  43.284 17.790  1.00 18.66 ? 19   ILE A CG1 1 
ATOM   140  C  CG2 . ILE A 1 19  ? -3.995  43.018 19.757  1.00 19.66 ? 19   ILE A CG2 1 
ATOM   141  C  CD1 . ILE A 1 19  ? -1.813  41.952 18.108  1.00 13.40 ? 19   ILE A CD1 1 
ATOM   142  N  N   . SER A 1 20  ? -5.957  45.861 19.441  1.00 18.21 ? 20   SER A N   1 
ATOM   143  C  CA  . SER A 1 20  ? -6.802  46.641 20.329  1.00 18.32 ? 20   SER A CA  1 
ATOM   144  C  C   . SER A 1 20  ? -6.874  46.103 21.743  1.00 18.29 ? 20   SER A C   1 
ATOM   145  O  O   . SER A 1 20  ? -6.645  44.915 21.969  1.00 18.01 ? 20   SER A O   1 
ATOM   146  C  CB  . SER A 1 20  ? -8.215  46.732 19.791  1.00 17.90 ? 20   SER A CB  1 
ATOM   147  O  OG  . SER A 1 20  ? -8.857  45.474 19.733  1.00 20.54 ? 20   SER A OG  1 
ATOM   148  N  N   . ALA A 1 21  ? -7.226  46.987 22.679  1.00 17.17 ? 21   ALA A N   1 
ATOM   149  C  CA  . ALA A 1 21  ? -7.518  46.616 24.058  1.00 17.44 ? 21   ALA A CA  1 
ATOM   150  C  C   . ALA A 1 21  ? -8.614  45.555 24.066  1.00 18.02 ? 21   ALA A C   1 
ATOM   151  O  O   . ALA A 1 21  ? -8.583  44.627 24.857  1.00 17.92 ? 21   ALA A O   1 
ATOM   152  C  CB  . ALA A 1 21  ? -7.978  47.874 24.866  1.00 17.66 ? 21   ALA A CB  1 
ATOM   153  N  N   . GLU A 1 22  ? -9.587  45.712 23.176  1.00 17.91 ? 22   GLU A N   1 
ATOM   154  C  CA  . GLU A 1 22  ? -10.671 44.730 23.086  1.00 17.97 ? 22   GLU A CA  1 
ATOM   155  C  C   . GLU A 1 22  ? -10.213 43.307 22.733  1.00 18.29 ? 22   GLU A C   1 
ATOM   156  O  O   . GLU A 1 22  ? -10.720 42.322 23.306  1.00 17.75 ? 22   GLU A O   1 
ATOM   157  C  CB  . GLU A 1 22  ? -11.747 45.177 22.116  1.00 18.80 ? 22   GLU A CB  1 
ATOM   158  C  CG  . GLU A 1 22  ? -12.812 44.069 21.915  1.00 20.40 ? 22   GLU A CG  1 
ATOM   159  C  CD  . GLU A 1 22  ? -13.937 44.497 21.021  1.00 24.60 ? 22   GLU A CD  1 
ATOM   160  O  OE1 . GLU A 1 22  ? -13.764 45.529 20.312  1.00 24.17 ? 22   GLU A OE1 1 
ATOM   161  O  OE2 . GLU A 1 22  ? -14.984 43.796 21.024  1.00 25.34 ? 22   GLU A OE2 1 
ATOM   162  N  N   . THR A 1 23  ? -9.265  43.195 21.813  1.00 16.96 ? 23   THR A N   1 
ATOM   163  C  CA  . THR A 1 23  ? -8.696  41.899 21.446  1.00 17.19 ? 23   THR A CA  1 
ATOM   164  C  C   . THR A 1 23  ? -8.025  41.239 22.665  1.00 17.44 ? 23   THR A C   1 
ATOM   165  O  O   . THR A 1 23  ? -8.213  40.035 22.931  1.00 17.20 ? 23   THR A O   1 
ATOM   166  C  CB  . THR A 1 23  ? -7.687  42.040 20.259  1.00 18.29 ? 23   THR A CB  1 
ATOM   167  O  OG1 . THR A 1 23  ? -8.406  42.397 19.060  1.00 17.22 ? 23   THR A OG1 1 
ATOM   168  C  CG2 . THR A 1 23  ? -6.922  40.727 20.029  1.00 16.81 ? 23   THR A CG2 1 
ATOM   169  N  N   . LEU A 1 24  ? -7.258  42.038 23.407  1.00 18.24 ? 24   LEU A N   1 
ATOM   170  C  CA  . LEU A 1 24  ? -6.613  41.573 24.638  1.00 18.76 ? 24   LEU A CA  1 
ATOM   171  C  C   . LEU A 1 24  ? -7.609  41.128 25.683  1.00 18.97 ? 24   LEU A C   1 
ATOM   172  O  O   . LEU A 1 24  ? -7.406  40.106 26.342  1.00 20.38 ? 24   LEU A O   1 
ATOM   173  C  CB  . LEU A 1 24  ? -5.689  42.645 25.191  1.00 18.36 ? 24   LEU A CB  1 
ATOM   174  C  CG  . LEU A 1 24  ? -4.534  42.961 24.248  1.00 18.31 ? 24   LEU A CG  1 
ATOM   175  C  CD1 . LEU A 1 24  ? -3.607  43.972 24.926  1.00 14.52 ? 24   LEU A CD1 1 
ATOM   176  C  CD2 . LEU A 1 24  ? -3.738  41.734 23.893  1.00 16.28 ? 24   LEU A CD2 1 
ATOM   177  N  N   . ASP A 1 25  ? -8.733  41.825 25.770  1.00 19.90 ? 25   ASP A N   1 
ATOM   178  C  CA  . ASP A 1 25  ? -9.742  41.495 26.744  1.00 19.45 ? 25   ASP A CA  1 
ATOM   179  C  C   . ASP A 1 25  ? -10.270 40.113 26.474  1.00 18.65 ? 25   ASP A C   1 
ATOM   180  O  O   . ASP A 1 25  ? -10.440 39.343 27.408  1.00 18.29 ? 25   ASP A O   1 
ATOM   181  C  CB  . ASP A 1 25  ? -10.887 42.494 26.710  1.00 20.18 ? 25   ASP A CB  1 
ATOM   182  C  CG  . ASP A 1 25  ? -10.596 43.752 27.522  1.00 24.40 ? 25   ASP A CG  1 
ATOM   183  O  OD1 . ASP A 1 25  ? -9.576  43.791 28.245  1.00 26.50 ? 25   ASP A OD1 1 
ATOM   184  O  OD2 . ASP A 1 25  ? -11.412 44.697 27.438  1.00 29.35 ? 25   ASP A OD2 1 
ATOM   185  N  N   . TYR A 1 26  ? -10.512 39.811 25.192  1.00 17.91 ? 26   TYR A N   1 
ATOM   186  C  CA  . TYR A 1 26  ? -11.031 38.501 24.790  1.00 16.90 ? 26   TYR A CA  1 
ATOM   187  C  C   . TYR A 1 26  ? -9.963  37.449 24.736  1.00 15.62 ? 26   TYR A C   1 
ATOM   188  O  O   . TYR A 1 26  ? -10.138 36.355 25.249  1.00 15.79 ? 26   TYR A O   1 
ATOM   189  C  CB  . TYR A 1 26  ? -11.764 38.585 23.429  1.00 17.04 ? 26   TYR A CB  1 
ATOM   190  C  CG  . TYR A 1 26  ? -13.143 39.156 23.606  1.00 16.33 ? 26   TYR A CG  1 
ATOM   191  C  CD1 . TYR A 1 26  ? -14.206 38.358 24.051  1.00 14.56 ? 26   TYR A CD1 1 
ATOM   192  C  CD2 . TYR A 1 26  ? -13.374 40.494 23.379  1.00 18.95 ? 26   TYR A CD2 1 
ATOM   193  C  CE1 . TYR A 1 26  ? -15.476 38.903 24.260  1.00 15.84 ? 26   TYR A CE1 1 
ATOM   194  C  CE2 . TYR A 1 26  ? -14.626 41.026 23.563  1.00 16.07 ? 26   TYR A CE2 1 
ATOM   195  C  CZ  . TYR A 1 26  ? -15.660 40.238 23.997  1.00 16.40 ? 26   TYR A CZ  1 
ATOM   196  O  OH  . TYR A 1 26  ? -16.894 40.838 24.170  1.00 19.67 ? 26   TYR A OH  1 
ATOM   197  N  N   . HIS A 1 27  ? -8.863  37.773 24.091  1.00 14.73 ? 27   HIS A N   1 
ATOM   198  C  CA  . HIS A 1 27  ? -7.861  36.779 23.808  1.00 14.14 ? 27   HIS A CA  1 
ATOM   199  C  C   . HIS A 1 27  ? -7.117  36.342 25.073  1.00 14.94 ? 27   HIS A C   1 
ATOM   200  O  O   . HIS A 1 27  ? -6.970  35.150 25.322  1.00 15.30 ? 27   HIS A O   1 
ATOM   201  C  CB  . HIS A 1 27  ? -6.974  37.267 22.664  1.00 13.21 ? 27   HIS A CB  1 
ATOM   202  C  CG  . HIS A 1 27  ? -6.101  36.198 22.063  1.00 10.50 ? 27   HIS A CG  1 
ATOM   203  N  ND1 . HIS A 1 27  ? -5.141  36.478 21.113  1.00 11.29 ? 27   HIS A ND1 1 
ATOM   204  C  CD2 . HIS A 1 27  ? -6.024  34.867 22.290  1.00 10.22 ? 27   HIS A CD2 1 
ATOM   205  C  CE1 . HIS A 1 27  ? -4.504  35.368 20.783  1.00 10.86 ? 27   HIS A CE1 1 
ATOM   206  N  NE2 . HIS A 1 27  ? -5.030  34.371 21.473  1.00 10.06 ? 27   HIS A NE2 1 
ATOM   207  N  N   . HIS A 1 28  ? -6.680  37.289 25.896  1.00 15.27 ? 28   HIS A N   1 
ATOM   208  C  CA  . HIS A 1 28  ? -6.088  36.940 27.201  1.00 15.79 ? 28   HIS A CA  1 
ATOM   209  C  C   . HIS A 1 28  ? -7.172  36.642 28.265  1.00 16.14 ? 28   HIS A C   1 
ATOM   210  O  O   . HIS A 1 28  ? -7.212  35.553 28.861  1.00 15.27 ? 28   HIS A O   1 
ATOM   211  C  CB  . HIS A 1 28  ? -5.115  38.050 27.637  1.00 16.60 ? 28   HIS A CB  1 
ATOM   212  C  CG  . HIS A 1 28  ? -4.496  37.834 28.987  1.00 16.90 ? 28   HIS A CG  1 
ATOM   213  N  ND1 . HIS A 1 28  ? -5.053  38.347 30.144  1.00 20.82 ? 28   HIS A ND1 1 
ATOM   214  C  CD2 . HIS A 1 28  ? -3.367  37.189 29.361  1.00 16.07 ? 28   HIS A CD2 1 
ATOM   215  C  CE1 . HIS A 1 28  ? -4.302  38.000 31.175  1.00 17.72 ? 28   HIS A CE1 1 
ATOM   216  N  NE2 . HIS A 1 28  ? -3.266  37.309 30.727  1.00 15.57 ? 28   HIS A NE2 1 
ATOM   217  N  N   . GLY A 1 29  ? -8.098  37.566 28.458  1.00 16.39 ? 29   GLY A N   1 
ATOM   218  C  CA  . GLY A 1 29  ? -9.114  37.396 29.513  1.00 18.42 ? 29   GLY A CA  1 
ATOM   219  C  C   . GLY A 1 29  ? -10.130 36.272 29.393  1.00 19.47 ? 29   GLY A C   1 
ATOM   220  O  O   . GLY A 1 29  ? -10.668 35.811 30.409  1.00 18.96 ? 29   GLY A O   1 
ATOM   221  N  N   . LYS A 1 30  ? -10.452 35.869 28.160  1.00 19.91 ? 30   LYS A N   1 
ATOM   222  C  CA  . LYS A 1 30  ? -11.392 34.789 27.925  1.00 18.82 ? 30   LYS A CA  1 
ATOM   223  C  C   . LYS A 1 30  ? -10.725 33.536 27.396  1.00 17.96 ? 30   LYS A C   1 
ATOM   224  O  O   . LYS A 1 30  ? -10.736 32.542 28.088  1.00 17.98 ? 30   LYS A O   1 
ATOM   225  C  CB  . LYS A 1 30  ? -12.520 35.199 26.976  1.00 20.16 ? 30   LYS A CB  1 
ATOM   226  C  CG  . LYS A 1 30  ? -13.247 36.487 27.356  1.00 22.13 ? 30   LYS A CG  1 
ATOM   227  C  CD  . LYS A 1 30  ? -14.203 36.297 28.524  1.00 30.21 ? 30   LYS A CD  1 
ATOM   228  C  CE  . LYS A 1 30  ? -15.235 37.436 28.576  1.00 34.53 ? 30   LYS A CE  1 
ATOM   229  N  NZ  . LYS A 1 30  ? -16.127 37.383 29.788  1.00 37.39 ? 30   LYS A NZ  1 
ATOM   230  N  N   . HIS A 1 31  ? -10.121 33.571 26.202  1.00 17.05 ? 31   HIS A N   1 
ATOM   231  C  CA  . HIS A 1 31  ? -9.551  32.342 25.609  1.00 15.28 ? 31   HIS A CA  1 
ATOM   232  C  C   . HIS A 1 31  ? -8.429  31.735 26.452  1.00 16.13 ? 31   HIS A C   1 
ATOM   233  O  O   . HIS A 1 31  ? -8.455  30.563 26.809  1.00 14.57 ? 31   HIS A O   1 
ATOM   234  C  CB  . HIS A 1 31  ? -9.004  32.624 24.200  1.00 16.60 ? 31   HIS A CB  1 
ATOM   235  C  CG  . HIS A 1 31  ? -10.065 32.942 23.200  1.00 15.26 ? 31   HIS A CG  1 
ATOM   236  N  ND1 . HIS A 1 31  ? -10.656 31.966 22.419  1.00 13.58 ? 31   HIS A ND1 1 
ATOM   237  C  CD2 . HIS A 1 31  ? -10.667 34.110 22.871  1.00 13.09 ? 31   HIS A CD2 1 
ATOM   238  C  CE1 . HIS A 1 31  ? -11.579 32.520 21.650  1.00 15.36 ? 31   HIS A CE1 1 
ATOM   239  N  NE2 . HIS A 1 31  ? -11.599 33.821 21.898  1.00 14.25 ? 31   HIS A NE2 1 
ATOM   240  N  N   . HIS A 1 32  ? -7.423  32.535 26.754  1.00 15.83 ? 32   HIS A N   1 
ATOM   241  C  CA  . HIS A 1 32  ? -6.263  32.048 27.490  1.00 16.28 ? 32   HIS A CA  1 
ATOM   242  C  C   . HIS A 1 32  ? -6.710  31.581 28.883  1.00 17.81 ? 32   HIS A C   1 
ATOM   243  O  O   . HIS A 1 32  ? -6.281  30.537 29.393  1.00 18.05 ? 32   HIS A O   1 
ATOM   244  C  CB  . HIS A 1 32  ? -5.255  33.197 27.593  1.00 17.34 ? 32   HIS A CB  1 
ATOM   245  C  CG  . HIS A 1 32  ? -3.884  32.779 28.012  1.00 17.54 ? 32   HIS A CG  1 
ATOM   246  N  ND1 . HIS A 1 32  ? -2.821  33.659 28.058  1.00 17.55 ? 32   HIS A ND1 1 
ATOM   247  C  CD2 . HIS A 1 32  ? -3.401  31.586 28.426  1.00 16.17 ? 32   HIS A CD2 1 
ATOM   248  C  CE1 . HIS A 1 32  ? -1.742  33.024 28.467  1.00 14.34 ? 32   HIS A CE1 1 
ATOM   249  N  NE2 . HIS A 1 32  ? -2.062  31.759 28.681  1.00 15.99 ? 32   HIS A NE2 1 
ATOM   250  N  N   . ASN A 1 33  ? -7.590  32.360 29.504  1.00 19.57 ? 33   ASN A N   1 
ATOM   251  C  CA  . ASN A 1 33  ? -8.145  31.984 30.787  1.00 19.26 ? 33   ASN A CA  1 
ATOM   252  C  C   . ASN A 1 33  ? -8.893  30.644 30.779  1.00 19.69 ? 33   ASN A C   1 
ATOM   253  O  O   . ASN A 1 33  ? -8.681  29.864 31.688  1.00 19.77 ? 33   ASN A O   1 
ATOM   254  C  CB  . ASN A 1 33  ? -9.045  33.082 31.329  1.00 20.13 ? 33   ASN A CB  1 
ATOM   255  C  CG  . ASN A 1 33  ? -9.525  32.782 32.728  1.00 20.27 ? 33   ASN A CG  1 
ATOM   256  O  OD1 . ASN A 1 33  ? -8.725  32.732 33.642  1.00 21.74 ? 33   ASN A OD1 1 
ATOM   257  N  ND2 . ASN A 1 33  ? -10.833 32.568 32.897  1.00 20.87 ? 33   ASN A ND2 1 
ATOM   258  N  N   . THR A 1 34  ? -9.767  30.403 29.790  1.00 19.55 ? 34   THR A N   1 
ATOM   259  C  CA  . THR A 1 34  ? -10.483 29.117 29.637  1.00 19.92 ? 34   THR A CA  1 
ATOM   260  C  C   . THR A 1 34  ? -9.543  27.911 29.637  1.00 19.83 ? 34   THR A C   1 
ATOM   261  O  O   . THR A 1 34  ? -9.827  26.889 30.284  1.00 20.60 ? 34   THR A O   1 
ATOM   262  C  CB  . THR A 1 34  ? -11.367 29.100 28.358  1.00 20.19 ? 34   THR A CB  1 
ATOM   263  O  OG1 . THR A 1 34  ? -12.332 30.163 28.420  1.00 23.25 ? 34   THR A OG1 1 
ATOM   264  C  CG2 . THR A 1 34  ? -12.098 27.796 28.189  1.00 20.36 ? 34   THR A CG2 1 
ATOM   265  N  N   . TYR A 1 35  ? -8.418  27.996 28.941  1.00 19.36 ? 35   TYR A N   1 
ATOM   266  C  CA  . TYR A 1 35  ? -7.489  26.850 28.954  1.00 19.46 ? 35   TYR A CA  1 
ATOM   267  C  C   . TYR A 1 35  ? -6.905  26.536 30.343  1.00 19.29 ? 35   TYR A C   1 
ATOM   268  O  O   . TYR A 1 35  ? -6.612  25.373 30.659  1.00 19.73 ? 35   TYR A O   1 
ATOM   269  C  CB  . TYR A 1 35  ? -6.342  27.035 27.954  1.00 18.93 ? 35   TYR A CB  1 
ATOM   270  C  CG  . TYR A 1 35  ? -6.729  27.174 26.482  1.00 20.61 ? 35   TYR A CG  1 
ATOM   271  C  CD1 . TYR A 1 35  ? -7.405  26.148 25.793  1.00 18.16 ? 35   TYR A CD1 1 
ATOM   272  C  CD2 . TYR A 1 35  ? -6.372  28.329 25.759  1.00 16.94 ? 35   TYR A CD2 1 
ATOM   273  C  CE1 . TYR A 1 35  ? -7.746  26.285 24.415  1.00 18.45 ? 35   TYR A CE1 1 
ATOM   274  C  CE2 . TYR A 1 35  ? -6.670  28.463 24.399  1.00 21.73 ? 35   TYR A CE2 1 
ATOM   275  C  CZ  . TYR A 1 35  ? -7.362  27.450 23.732  1.00 21.35 ? 35   TYR A CZ  1 
ATOM   276  O  OH  . TYR A 1 35  ? -7.661  27.617 22.381  1.00 21.02 ? 35   TYR A OH  1 
ATOM   277  N  N   . VAL A 1 36  ? -6.645  27.581 31.138  1.00 20.16 ? 36   VAL A N   1 
ATOM   278  C  CA  . VAL A 1 36  ? -6.130  27.444 32.522  1.00 19.02 ? 36   VAL A CA  1 
ATOM   279  C  C   . VAL A 1 36  ? -7.206  26.774 33.372  1.00 19.86 ? 36   VAL A C   1 
ATOM   280  O  O   . VAL A 1 36  ? -6.953  25.808 34.096  1.00 20.25 ? 36   VAL A O   1 
ATOM   281  C  CB  . VAL A 1 36  ? -5.715  28.857 33.088  1.00 18.27 ? 36   VAL A CB  1 
ATOM   282  C  CG1 . VAL A 1 36  ? -5.322  28.795 34.563  1.00 18.03 ? 36   VAL A CG1 1 
ATOM   283  C  CG2 . VAL A 1 36  ? -4.554  29.450 32.295  1.00 17.50 ? 36   VAL A CG2 1 
ATOM   284  N  N   . VAL A 1 37  ? -8.438  27.226 33.224  1.00 21.13 ? 37   VAL A N   1 
ATOM   285  C  CA  . VAL A 1 37  ? -9.542  26.692 34.015  1.00 22.13 ? 37   VAL A CA  1 
ATOM   286  C  C   . VAL A 1 37  ? -9.862  25.262 33.608  1.00 24.04 ? 37   VAL A C   1 
ATOM   287  O  O   . VAL A 1 37  ? -10.135 24.414 34.476  1.00 24.48 ? 37   VAL A O   1 
ATOM   288  C  CB  . VAL A 1 37  ? -10.801 27.574 33.911  1.00 21.49 ? 37   VAL A CB  1 
ATOM   289  C  CG1 . VAL A 1 37  ? -11.928 26.970 34.686  1.00 22.33 ? 37   VAL A CG1 1 
ATOM   290  C  CG2 . VAL A 1 37  ? -10.504 28.953 34.510  1.00 19.04 ? 37   VAL A CG2 1 
ATOM   291  N  N   . LYS A 1 38  ? -9.829  24.991 32.300  1.00 24.89 ? 38   LYS A N   1 
ATOM   292  C  CA  . LYS A 1 38  ? -10.062 23.640 31.815  1.00 25.69 ? 38   LYS A CA  1 
ATOM   293  C  C   . LYS A 1 38  ? -8.973  22.684 32.305  1.00 25.26 ? 38   LYS A C   1 
ATOM   294  O  O   . LYS A 1 38  ? -9.309  21.621 32.809  1.00 25.52 ? 38   LYS A O   1 
ATOM   295  C  CB  . LYS A 1 38  ? -10.244 23.584 30.293  1.00 25.99 ? 38   LYS A CB  1 
ATOM   296  C  CG  . LYS A 1 38  ? -11.616 23.977 29.800  1.00 27.97 ? 38   LYS A CG  1 
ATOM   297  C  CD  . LYS A 1 38  ? -11.608 24.137 28.278  1.00 31.77 ? 38   LYS A CD  1 
ATOM   298  C  CE  . LYS A 1 38  ? -12.961 24.551 27.729  1.00 29.11 ? 38   LYS A CE  1 
ATOM   299  N  NZ  . LYS A 1 38  ? -13.830 23.390 27.772  1.00 31.80 ? 38   LYS A NZ  1 
ATOM   300  N  N   . LEU A 1 39  ? -7.697  23.071 32.200  1.00 25.21 ? 39   LEU A N   1 
ATOM   301  C  CA  . LEU A 1 39  ? -6.599  22.240 32.685  1.00 25.75 ? 39   LEU A CA  1 
ATOM   302  C  C   . LEU A 1 39  ? -6.675  21.959 34.205  1.00 27.47 ? 39   LEU A C   1 
ATOM   303  O  O   . LEU A 1 39  ? -6.591  20.807 34.630  1.00 27.66 ? 39   LEU A O   1 
ATOM   304  C  CB  . LEU A 1 39  ? -5.239  22.839 32.325  1.00 25.74 ? 39   LEU A CB  1 
ATOM   305  C  CG  . LEU A 1 39  ? -4.047  21.930 32.720  1.00 25.49 ? 39   LEU A CG  1 
ATOM   306  C  CD1 . LEU A 1 39  ? -4.010  20.589 31.941  1.00 25.21 ? 39   LEU A CD1 1 
ATOM   307  C  CD2 . LEU A 1 39  ? -2.718  22.641 32.602  1.00 24.90 ? 39   LEU A CD2 1 
ATOM   308  N  N   . ASN A 1 40  ? -6.842  23.011 35.008  1.00 28.39 ? 40   ASN A N   1 
ATOM   309  C  CA  . ASN A 1 40  ? -6.981  22.878 36.469  1.00 28.93 ? 40   ASN A CA  1 
ATOM   310  C  C   . ASN A 1 40  ? -8.070  21.862 36.862  1.00 29.36 ? 40   ASN A C   1 
ATOM   311  O  O   . ASN A 1 40  ? -7.932  21.132 37.855  1.00 29.11 ? 40   ASN A O   1 
ATOM   312  C  CB  . ASN A 1 40  ? -7.223  24.255 37.109  1.00 27.65 ? 40   ASN A CB  1 
ATOM   313  C  CG  . ASN A 1 40  ? -5.970  25.105 37.153  1.00 27.92 ? 40   ASN A CG  1 
ATOM   314  O  OD1 . ASN A 1 40  ? -4.859  24.591 37.091  1.00 30.00 ? 40   ASN A OD1 1 
ATOM   315  N  ND2 . ASN A 1 40  ? -6.138  26.425 37.272  1.00 25.99 ? 40   ASN A ND2 1 
ATOM   316  N  N   . GLY A 1 41  ? -9.121  21.791 36.058  1.00 30.24 ? 41   GLY A N   1 
ATOM   317  C  CA  . GLY A 1 41  ? -10.199 20.808 36.248  1.00 31.85 ? 41   GLY A CA  1 
ATOM   318  C  C   . GLY A 1 41  ? -9.992  19.398 35.688  1.00 33.42 ? 41   GLY A C   1 
ATOM   319  O  O   . GLY A 1 41  ? -10.766 18.484 35.997  1.00 33.89 ? 41   GLY A O   1 
ATOM   320  N  N   . LEU A 1 42  ? -8.984  19.221 34.837  1.00 33.95 ? 42   LEU A N   1 
ATOM   321  C  CA  . LEU A 1 42  ? -8.686  17.911 34.255  1.00 34.86 ? 42   LEU A CA  1 
ATOM   322  C  C   . LEU A 1 42  ? -7.690  17.118 35.085  1.00 35.05 ? 42   LEU A C   1 
ATOM   323  O  O   . LEU A 1 42  ? -7.761  15.898 35.124  1.00 35.93 ? 42   LEU A O   1 
ATOM   324  C  CB  . LEU A 1 42  ? -8.164  18.042 32.820  1.00 34.30 ? 42   LEU A CB  1 
ATOM   325  C  CG  . LEU A 1 42  ? -9.188  18.266 31.701  1.00 35.34 ? 42   LEU A CG  1 
ATOM   326  C  CD1 . LEU A 1 42  ? -8.498  18.537 30.380  1.00 34.23 ? 42   LEU A CD1 1 
ATOM   327  C  CD2 . LEU A 1 42  ? -10.155 17.107 31.549  1.00 36.23 ? 42   LEU A CD2 1 
ATOM   328  N  N   . ILE A 1 43  ? -6.779  17.804 35.764  1.00 35.75 ? 43   ILE A N   1 
ATOM   329  C  CA  . ILE A 1 43  ? -5.642  17.134 36.375  1.00 36.74 ? 43   ILE A CA  1 
ATOM   330  C  C   . ILE A 1 43  ? -5.817  16.506 37.766  1.00 37.66 ? 43   ILE A C   1 
ATOM   331  O  O   . ILE A 1 43  ? -5.038  15.620 38.118  1.00 37.83 ? 43   ILE A O   1 
ATOM   332  C  CB  . ILE A 1 43  ? -4.332  17.993 36.331  1.00 36.61 ? 43   ILE A CB  1 
ATOM   333  C  CG1 . ILE A 1 43  ? -4.362  19.167 37.306  1.00 36.39 ? 43   ILE A CG1 1 
ATOM   334  C  CG2 . ILE A 1 43  ? -4.029  18.454 34.900  1.00 37.29 ? 43   ILE A CG2 1 
ATOM   335  C  CD1 . ILE A 1 43  ? -3.330  20.232 36.981  1.00 36.87 ? 43   ILE A CD1 1 
ATOM   336  N  N   . PRO A 1 44  ? -6.788  16.976 38.581  1.00 38.59 ? 44   PRO A N   1 
ATOM   337  C  CA  . PRO A 1 44  ? -6.963  16.327 39.903  1.00 39.16 ? 44   PRO A CA  1 
ATOM   338  C  C   . PRO A 1 44  ? -7.273  14.827 39.825  1.00 39.35 ? 44   PRO A C   1 
ATOM   339  O  O   . PRO A 1 44  ? -8.203  14.416 39.113  1.00 38.98 ? 44   PRO A O   1 
ATOM   340  C  CB  . PRO A 1 44  ? -8.141  17.097 40.517  1.00 39.36 ? 44   PRO A CB  1 
ATOM   341  C  CG  . PRO A 1 44  ? -8.040  18.461 39.854  1.00 39.53 ? 44   PRO A CG  1 
ATOM   342  C  CD  . PRO A 1 44  ? -7.717  18.108 38.423  1.00 38.69 ? 44   PRO A CD  1 
ATOM   343  N  N   . GLY A 1 45  ? -6.472  14.036 40.542  1.00 39.33 ? 45   GLY A N   1 
ATOM   344  C  CA  . GLY A 1 45  ? -6.616  12.574 40.572  1.00 39.32 ? 45   GLY A CA  1 
ATOM   345  C  C   . GLY A 1 45  ? -6.086  11.885 39.324  1.00 39.13 ? 45   GLY A C   1 
ATOM   346  O  O   . GLY A 1 45  ? -6.549  10.795 38.956  1.00 39.75 ? 45   GLY A O   1 
ATOM   347  N  N   . THR A 1 46  ? -5.140  12.533 38.654  1.00 38.07 ? 46   THR A N   1 
ATOM   348  C  CA  . THR A 1 46  ? -4.478  11.966 37.486  1.00 36.94 ? 46   THR A CA  1 
ATOM   349  C  C   . THR A 1 46  ? -3.003  12.009 37.784  1.00 36.58 ? 46   THR A C   1 
ATOM   350  O  O   . THR A 1 46  ? -2.573  12.630 38.761  1.00 36.42 ? 46   THR A O   1 
ATOM   351  C  CB  . THR A 1 46  ? -4.693  12.779 36.164  1.00 36.98 ? 46   THR A CB  1 
ATOM   352  O  OG1 . THR A 1 46  ? -3.957  14.006 36.224  1.00 35.28 ? 46   THR A OG1 1 
ATOM   353  C  CG2 . THR A 1 46  ? -6.160  13.062 35.876  1.00 36.61 ? 46   THR A CG2 1 
ATOM   354  N  N   . GLU A 1 47  ? -2.237  11.364 36.910  1.00 36.62 ? 47   GLU A N   1 
ATOM   355  C  CA  . GLU A 1 47  ? -0.784  11.372 36.963  1.00 36.61 ? 47   GLU A CA  1 
ATOM   356  C  C   . GLU A 1 47  ? -0.147  12.752 36.782  1.00 36.00 ? 47   GLU A C   1 
ATOM   357  O  O   . GLU A 1 47  ? 1.061   12.895 36.985  1.00 35.91 ? 47   GLU A O   1 
ATOM   358  C  CB  . GLU A 1 47  ? -0.236  10.426 35.899  1.00 36.67 ? 47   GLU A CB  1 
ATOM   359  C  CG  . GLU A 1 47  ? -0.637  10.787 34.472  1.00 38.49 ? 47   GLU A CG  1 
ATOM   360  C  CD  . GLU A 1 47  ? 0.340   10.228 33.452  1.00 42.93 ? 47   GLU A CD  1 
ATOM   361  O  OE1 . GLU A 1 47  ? -0.109  9.447  32.588  1.00 44.74 ? 47   GLU A OE1 1 
ATOM   362  O  OE2 . GLU A 1 47  ? 1.556   10.552 33.519  1.00 42.83 ? 47   GLU A OE2 1 
ATOM   363  N  N   . PHE A 1 48  ? -0.952  13.747 36.381  1.00 35.54 ? 48   PHE A N   1 
ATOM   364  C  CA  . PHE A 1 48  ? -0.445  15.102 36.085  1.00 34.71 ? 48   PHE A CA  1 
ATOM   365  C  C   . PHE A 1 48  ? -0.582  16.063 37.272  1.00 35.60 ? 48   PHE A C   1 
ATOM   366  O  O   . PHE A 1 48  ? -0.106  17.205 37.216  1.00 35.10 ? 48   PHE A O   1 
ATOM   367  C  CB  . PHE A 1 48  ? -1.125  15.698 34.850  1.00 33.77 ? 48   PHE A CB  1 
ATOM   368  C  CG  . PHE A 1 48  ? -1.071  14.816 33.628  1.00 31.68 ? 48   PHE A CG  1 
ATOM   369  C  CD1 . PHE A 1 48  ? 0.121   14.624 32.945  1.00 30.22 ? 48   PHE A CD1 1 
ATOM   370  C  CD2 . PHE A 1 48  ? -2.222  14.204 33.150  1.00 31.03 ? 48   PHE A CD2 1 
ATOM   371  C  CE1 . PHE A 1 48  ? 0.170   13.814 31.801  1.00 30.66 ? 48   PHE A CE1 1 
ATOM   372  C  CE2 . PHE A 1 48  ? -2.196  13.382 32.016  1.00 31.28 ? 48   PHE A CE2 1 
ATOM   373  C  CZ  . PHE A 1 48  ? -0.984  13.191 31.337  1.00 32.12 ? 48   PHE A CZ  1 
ATOM   374  N  N   . GLU A 1 49  ? -1.227  15.592 38.342  1.00 35.89 ? 49   GLU A N   1 
ATOM   375  C  CA  . GLU A 1 49  ? -1.250  16.297 39.626  1.00 36.91 ? 49   GLU A CA  1 
ATOM   376  C  C   . GLU A 1 49  ? 0.182   16.467 40.122  1.00 35.93 ? 49   GLU A C   1 
ATOM   377  O  O   . GLU A 1 49  ? 0.926   15.494 40.232  1.00 36.17 ? 49   GLU A O   1 
ATOM   378  C  CB  . GLU A 1 49  ? -2.048  15.471 40.635  1.00 36.98 ? 49   GLU A CB  1 
ATOM   379  C  CG  . GLU A 1 49  ? -2.765  16.243 41.721  1.00 38.99 ? 49   GLU A CG  1 
ATOM   380  C  CD  . GLU A 1 49  ? -3.888  15.416 42.406  1.00 40.20 ? 49   GLU A CD  1 
ATOM   381  O  OE1 . GLU A 1 49  ? -4.141  14.235 42.035  1.00 42.38 ? 49   GLU A OE1 1 
ATOM   382  O  OE2 . GLU A 1 49  ? -4.525  15.964 43.333  1.00 45.59 ? 49   GLU A OE2 1 
ATOM   383  N  N   . GLY A 1 50  ? 0.573   17.703 40.397  1.00 35.42 ? 50   GLY A N   1 
ATOM   384  C  CA  . GLY A 1 50  ? 1.912   17.989 40.904  1.00 34.59 ? 50   GLY A CA  1 
ATOM   385  C  C   . GLY A 1 50  ? 3.005   18.023 39.861  1.00 33.78 ? 50   GLY A C   1 
ATOM   386  O  O   . GLY A 1 50  ? 4.180   18.093 40.198  1.00 34.09 ? 50   GLY A O   1 
ATOM   387  N  N   . LYS A 1 51  ? 2.631   17.982 38.584  1.00 32.94 ? 51   LYS A N   1 
ATOM   388  C  CA  . LYS A 1 51  ? 3.599   18.196 37.514  1.00 32.18 ? 51   LYS A CA  1 
ATOM   389  C  C   . LYS A 1 51  ? 3.607   19.666 37.127  1.00 30.86 ? 51   LYS A C   1 
ATOM   390  O  O   . LYS A 1 51  ? 2.601   20.372 37.326  1.00 30.43 ? 51   LYS A O   1 
ATOM   391  C  CB  . LYS A 1 51  ? 3.254   17.339 36.297  1.00 32.41 ? 51   LYS A CB  1 
ATOM   392  C  CG  . LYS A 1 51  ? 4.142   16.132 36.134  1.00 35.10 ? 51   LYS A CG  1 
ATOM   393  C  CD  . LYS A 1 51  ? 3.585   14.934 36.837  1.00 40.35 ? 51   LYS A CD  1 
ATOM   394  C  CE  . LYS A 1 51  ? 4.599   13.789 36.796  1.00 42.99 ? 51   LYS A CE  1 
ATOM   395  N  NZ  . LYS A 1 51  ? 4.309   12.794 37.859  1.00 43.75 ? 51   LYS A NZ  1 
ATOM   396  N  N   . THR A 1 52  ? 4.736   20.122 36.582  1.00 29.98 ? 52   THR A N   1 
ATOM   397  C  CA  . THR A 1 52  ? 4.822   21.459 36.004  1.00 28.91 ? 52   THR A CA  1 
ATOM   398  C  C   . THR A 1 52  ? 4.045   21.518 34.674  1.00 28.73 ? 52   THR A C   1 
ATOM   399  O  O   . THR A 1 52  ? 3.677   20.475 34.110  1.00 28.18 ? 52   THR A O   1 
ATOM   400  C  CB  . THR A 1 52  ? 6.274   21.900 35.769  1.00 28.98 ? 52   THR A CB  1 
ATOM   401  O  OG1 . THR A 1 52  ? 6.824   21.183 34.662  1.00 29.52 ? 52   THR A OG1 1 
ATOM   402  C  CG2 . THR A 1 52  ? 7.106   21.642 36.988  1.00 28.50 ? 52   THR A CG2 1 
ATOM   403  N  N   . LEU A 1 53  ? 3.792   22.728 34.186  1.00 27.71 ? 53   LEU A N   1 
ATOM   404  C  CA  . LEU A 1 53  ? 3.058   22.894 32.928  1.00 27.58 ? 53   LEU A CA  1 
ATOM   405  C  C   . LEU A 1 53  ? 3.804   22.197 31.786  1.00 27.91 ? 53   LEU A C   1 
ATOM   406  O  O   . LEU A 1 53  ? 3.224   21.386 31.067  1.00 27.91 ? 53   LEU A O   1 
ATOM   407  C  CB  . LEU A 1 53  ? 2.859   24.380 32.625  1.00 27.78 ? 53   LEU A CB  1 
ATOM   408  C  CG  . LEU A 1 53  ? 1.945   24.730 31.457  1.00 26.10 ? 53   LEU A CG  1 
ATOM   409  C  CD1 . LEU A 1 53  ? 0.585   24.057 31.628  1.00 23.42 ? 53   LEU A CD1 1 
ATOM   410  C  CD2 . LEU A 1 53  ? 1.837   26.253 31.323  1.00 26.61 ? 53   LEU A CD2 1 
ATOM   411  N  N   . GLU A 1 54  ? 5.101   22.483 31.665  1.00 27.72 ? 54   GLU A N   1 
ATOM   412  C  CA  . GLU A 1 54  ? 5.937   21.872 30.647  1.00 28.37 ? 54   GLU A CA  1 
ATOM   413  C  C   . GLU A 1 54  ? 6.021   20.353 30.744  1.00 28.53 ? 54   GLU A C   1 
ATOM   414  O  O   . GLU A 1 54  ? 6.047   19.685 29.712  1.00 28.48 ? 54   GLU A O   1 
ATOM   415  C  CB  . GLU A 1 54  ? 7.334   22.449 30.692  1.00 28.68 ? 54   GLU A CB  1 
ATOM   416  C  CG  . GLU A 1 54  ? 7.427   23.901 30.292  1.00 31.20 ? 54   GLU A CG  1 
ATOM   417  C  CD  . GLU A 1 54  ? 8.797   24.242 29.733  1.00 35.08 ? 54   GLU A CD  1 
ATOM   418  O  OE1 . GLU A 1 54  ? 9.687   23.347 29.717  1.00 38.45 ? 54   GLU A OE1 1 
ATOM   419  O  OE2 . GLU A 1 54  ? 8.986   25.400 29.286  1.00 38.30 ? 54   GLU A OE2 1 
ATOM   420  N  N   . GLU A 1 55  ? 6.072   19.807 31.962  1.00 28.04 ? 55   GLU A N   1 
ATOM   421  C  CA  . GLU A 1 55  ? 6.083   18.358 32.131  1.00 28.79 ? 55   GLU A CA  1 
ATOM   422  C  C   . GLU A 1 55  ? 4.780   17.753 31.617  1.00 27.50 ? 55   GLU A C   1 
ATOM   423  O  O   . GLU A 1 55  ? 4.789   16.695 30.971  1.00 27.56 ? 55   GLU A O   1 
ATOM   424  C  CB  . GLU A 1 55  ? 6.304   17.943 33.594  1.00 28.63 ? 55   GLU A CB  1 
ATOM   425  C  CG  . GLU A 1 55  ? 7.777   17.962 34.093  1.00 31.15 ? 55   GLU A CG  1 
ATOM   426  C  CD  . GLU A 1 55  ? 7.918   17.997 35.664  1.00 32.44 ? 55   GLU A CD  1 
ATOM   427  O  OE1 . GLU A 1 55  ? 6.893   18.047 36.417  1.00 33.66 ? 55   GLU A OE1 1 
ATOM   428  O  OE2 . GLU A 1 55  ? 9.081   18.003 36.143  1.00 37.08 ? 55   GLU A OE2 1 
ATOM   429  N  N   . ILE A 1 56  ? 3.659   18.406 31.917  1.00 26.09 ? 56   ILE A N   1 
ATOM   430  C  CA  . ILE A 1 56  ? 2.378   17.949 31.413  1.00 24.85 ? 56   ILE A CA  1 
ATOM   431  C  C   . ILE A 1 56  ? 2.379   17.949 29.877  1.00 24.27 ? 56   ILE A C   1 
ATOM   432  O  O   . ILE A 1 56  ? 2.037   16.942 29.249  1.00 24.67 ? 56   ILE A O   1 
ATOM   433  C  CB  . ILE A 1 56  ? 1.216   18.787 31.937  1.00 24.89 ? 56   ILE A CB  1 
ATOM   434  C  CG1 . ILE A 1 56  ? 1.098   18.639 33.462  1.00 25.47 ? 56   ILE A CG1 1 
ATOM   435  C  CG2 . ILE A 1 56  ? -0.071  18.307 31.320  1.00 23.77 ? 56   ILE A CG2 1 
ATOM   436  C  CD1 . ILE A 1 56  ? 0.295   19.747 34.113  1.00 22.84 ? 56   ILE A CD1 1 
ATOM   437  N  N   . ILE A 1 57  ? 2.778   19.063 29.270  1.00 23.82 ? 57   ILE A N   1 
ATOM   438  C  CA  . ILE A 1 57  ? 2.728   19.181 27.808  1.00 23.34 ? 57   ILE A CA  1 
ATOM   439  C  C   . ILE A 1 57  ? 3.486   18.022 27.153  1.00 24.62 ? 57   ILE A C   1 
ATOM   440  O  O   . ILE A 1 57  ? 3.022   17.406 26.189  1.00 23.83 ? 57   ILE A O   1 
ATOM   441  C  CB  . ILE A 1 57  ? 3.262   20.529 27.355  1.00 22.95 ? 57   ILE A CB  1 
ATOM   442  C  CG1 . ILE A 1 57  ? 2.371   21.638 27.929  1.00 21.95 ? 57   ILE A CG1 1 
ATOM   443  C  CG2 . ILE A 1 57  ? 3.332   20.590 25.834  1.00 22.51 ? 57   ILE A CG2 1 
ATOM   444  C  CD1 . ILE A 1 57  ? 2.964   22.997 27.792  1.00 21.69 ? 57   ILE A CD1 1 
ATOM   445  N  N   . LYS A 1 58  ? 4.625   17.696 27.746  1.00 25.19 ? 58   LYS A N   1 
ATOM   446  C  CA  . LYS A 1 58  ? 5.516   16.692 27.208  1.00 25.99 ? 58   LYS A CA  1 
ATOM   447  C  C   . LYS A 1 58  ? 5.114   15.242 27.468  1.00 26.37 ? 58   LYS A C   1 
ATOM   448  O  O   . LYS A 1 58  ? 5.678   14.334 26.837  1.00 27.26 ? 58   LYS A O   1 
ATOM   449  C  CB  . LYS A 1 58  ? 6.945   16.940 27.705  1.00 25.90 ? 58   LYS A CB  1 
ATOM   450  C  CG  . LYS A 1 58  ? 7.682   18.018 26.952  1.00 26.70 ? 58   LYS A CG  1 
ATOM   451  C  CD  . LYS A 1 58  ? 9.018   18.323 27.639  1.00 29.94 ? 58   LYS A CD  1 
ATOM   452  C  CE  . LYS A 1 58  ? 9.700   19.536 27.017  1.00 32.68 ? 58   LYS A CE  1 
ATOM   453  N  NZ  . LYS A 1 58  ? 10.603  20.271 27.973  1.00 33.50 ? 58   LYS A NZ  1 
ATOM   454  N  N   . THR A 1 59  ? 4.139   15.007 28.345  1.00 26.73 ? 59   THR A N   1 
ATOM   455  C  CA  . THR A 1 59  ? 3.730   13.636 28.676  1.00 26.87 ? 59   THR A CA  1 
ATOM   456  C  C   . THR A 1 59  ? 2.237   13.335 28.521  1.00 26.82 ? 59   THR A C   1 
ATOM   457  O  O   . THR A 1 59  ? 1.776   12.263 28.926  1.00 27.23 ? 59   THR A O   1 
ATOM   458  C  CB  . THR A 1 59  ? 4.142   13.249 30.111  1.00 27.52 ? 59   THR A CB  1 
ATOM   459  O  OG1 . THR A 1 59  ? 3.447   14.095 31.047  1.00 29.15 ? 59   THR A OG1 1 
ATOM   460  C  CG2 . THR A 1 59  ? 5.662   13.394 30.299  1.00 27.62 ? 59   THR A CG2 1 
ATOM   461  N  N   . SER A 1 60  ? 1.484   14.259 27.932  1.00 25.65 ? 60   SER A N   1 
ATOM   462  C  CA  . SER A 1 60  ? 0.047   14.081 27.809  1.00 26.43 ? 60   SER A CA  1 
ATOM   463  C  C   . SER A 1 60  ? -0.383  14.025 26.343  1.00 26.11 ? 60   SER A C   1 
ATOM   464  O  O   . SER A 1 60  ? 0.408   14.336 25.442  1.00 26.58 ? 60   SER A O   1 
ATOM   465  C  CB  . SER A 1 60  ? -0.672  15.239 28.518  1.00 26.03 ? 60   SER A CB  1 
ATOM   466  O  OG  . SER A 1 60  ? -0.324  16.467 27.921  1.00 26.54 ? 60   SER A OG  1 
ATOM   467  N  N   . THR A 1 61  ? -1.640  13.626 26.145  1.00 25.89 ? 61   THR A N   1 
ATOM   468  C  CA  . THR A 1 61  ? -2.332  13.619 24.867  1.00 25.11 ? 61   THR A CA  1 
ATOM   469  C  C   . THR A 1 61  ? -3.761  14.123 25.107  1.00 24.56 ? 61   THR A C   1 
ATOM   470  O  O   . THR A 1 61  ? -4.078  14.511 26.218  1.00 25.35 ? 61   THR A O   1 
ATOM   471  C  CB  . THR A 1 61  ? -2.346  12.201 24.252  1.00 25.86 ? 61   THR A CB  1 
ATOM   472  O  OG1 . THR A 1 61  ? -3.122  12.238 23.043  1.00 29.22 ? 61   THR A OG1 1 
ATOM   473  C  CG2 . THR A 1 61  ? -2.925  11.182 25.207  1.00 22.68 ? 61   THR A CG2 1 
ATOM   474  N  N   . GLY A 1 62  ? -4.597  14.166 24.079  1.00 23.64 ? 62   GLY A N   1 
ATOM   475  C  CA  . GLY A 1 62  ? -6.015  14.511 24.255  1.00 22.93 ? 62   GLY A CA  1 
ATOM   476  C  C   . GLY A 1 62  ? -6.226  15.870 24.902  1.00 22.45 ? 62   GLY A C   1 
ATOM   477  O  O   . GLY A 1 62  ? -5.406  16.770 24.730  1.00 22.84 ? 62   GLY A O   1 
ATOM   478  N  N   . GLY A 1 63  ? -7.325  15.996 25.638  1.00 21.50 ? 63   GLY A N   1 
ATOM   479  C  CA  . GLY A 1 63  ? -7.751  17.251 26.277  1.00 21.02 ? 63   GLY A CA  1 
ATOM   480  C  C   . GLY A 1 63  ? -6.785  17.905 27.229  1.00 20.60 ? 63   GLY A C   1 
ATOM   481  O  O   . GLY A 1 63  ? -6.696  19.131 27.286  1.00 21.42 ? 63   GLY A O   1 
ATOM   482  N  N   . VAL A 1 64  ? -6.085  17.093 28.012  1.00 19.97 ? 64   VAL A N   1 
ATOM   483  C  CA  . VAL A 1 64  ? -5.045  17.589 28.887  1.00 18.84 ? 64   VAL A CA  1 
ATOM   484  C  C   . VAL A 1 64  ? -3.975  18.270 28.034  1.00 19.13 ? 64   VAL A C   1 
ATOM   485  O  O   . VAL A 1 64  ? -3.538  19.366 28.358  1.00 19.18 ? 64   VAL A O   1 
ATOM   486  C  CB  . VAL A 1 64  ? -4.418  16.453 29.710  1.00 19.06 ? 64   VAL A CB  1 
ATOM   487  C  CG1 . VAL A 1 64  ? -3.177  16.942 30.460  1.00 19.17 ? 64   VAL A CG1 1 
ATOM   488  C  CG2 . VAL A 1 64  ? -5.418  15.871 30.661  1.00 19.65 ? 64   VAL A CG2 1 
ATOM   489  N  N   . PHE A 1 65  ? -3.549  17.634 26.947  1.00 19.03 ? 65   PHE A N   1 
ATOM   490  C  CA  . PHE A 1 65  ? -2.462  18.192 26.133  1.00 19.14 ? 65   PHE A CA  1 
ATOM   491  C  C   . PHE A 1 65  ? -2.909  19.520 25.537  1.00 18.63 ? 65   PHE A C   1 
ATOM   492  O  O   . PHE A 1 65  ? -2.152  20.522 25.548  1.00 20.24 ? 65   PHE A O   1 
ATOM   493  C  CB  . PHE A 1 65  ? -2.060  17.251 24.982  1.00 18.48 ? 65   PHE A CB  1 
ATOM   494  C  CG  . PHE A 1 65  ? -1.086  17.862 24.033  1.00 17.32 ? 65   PHE A CG  1 
ATOM   495  C  CD1 . PHE A 1 65  ? 0.285   17.801 24.311  1.00 17.59 ? 65   PHE A CD1 1 
ATOM   496  C  CD2 . PHE A 1 65  ? -1.512  18.556 22.903  1.00 17.16 ? 65   PHE A CD2 1 
ATOM   497  C  CE1 . PHE A 1 65  ? 1.210   18.404 23.492  1.00 16.26 ? 65   PHE A CE1 1 
ATOM   498  C  CE2 . PHE A 1 65  ? -0.568  19.181 22.038  1.00 16.01 ? 65   PHE A CE2 1 
ATOM   499  C  CZ  . PHE A 1 65  ? 0.803   19.080 22.336  1.00 19.70 ? 65   PHE A CZ  1 
ATOM   500  N  N   . ASN A 1 66  ? -4.127  19.515 24.997  1.00 19.30 ? 66   ASN A N   1 
ATOM   501  C  CA  . ASN A 1 66  ? -4.670  20.648 24.267  1.00 18.67 ? 66   ASN A CA  1 
ATOM   502  C  C   . ASN A 1 66  ? -4.703  21.895 25.141  1.00 19.18 ? 66   ASN A C   1 
ATOM   503  O  O   . ASN A 1 66  ? -4.260  22.950 24.719  1.00 19.54 ? 66   ASN A O   1 
ATOM   504  C  CB  . ASN A 1 66  ? -6.094  20.362 23.777  1.00 18.68 ? 66   ASN A CB  1 
ATOM   505  C  CG  . ASN A 1 66  ? -6.129  19.518 22.515  1.00 18.15 ? 66   ASN A CG  1 
ATOM   506  O  OD1 . ASN A 1 66  ? -5.110  19.333 21.855  1.00 16.36 ? 66   ASN A OD1 1 
ATOM   507  N  ND2 . ASN A 1 66  ? -7.320  19.003 22.170  1.00 20.27 ? 66   ASN A ND2 1 
ATOM   508  N  N   . ASN A 1 67  ? -5.279  21.769 26.335  1.00 18.78 ? 67   ASN A N   1 
ATOM   509  C  CA  . ASN A 1 67  ? -5.365  22.887 27.268  1.00 19.66 ? 67   ASN A CA  1 
ATOM   510  C  C   . ASN A 1 67  ? -3.990  23.339 27.766  1.00 19.13 ? 67   ASN A C   1 
ATOM   511  O  O   . ASN A 1 67  ? -3.679  24.537 27.727  1.00 20.26 ? 67   ASN A O   1 
ATOM   512  C  CB  . ASN A 1 67  ? -6.327  22.543 28.427  1.00 19.94 ? 67   ASN A CB  1 
ATOM   513  C  CG  . ASN A 1 67  ? -7.763  22.366 27.951  1.00 22.38 ? 67   ASN A CG  1 
ATOM   514  O  OD1 . ASN A 1 67  ? -8.311  21.266 27.987  1.00 26.58 ? 67   ASN A OD1 1 
ATOM   515  N  ND2 . ASN A 1 67  ? -8.366  23.432 27.496  1.00 21.35 ? 67   ASN A ND2 1 
ATOM   516  N  N   . ALA A 1 68  ? -3.163  22.385 28.195  1.00 18.71 ? 68   ALA A N   1 
ATOM   517  C  CA  . ALA A 1 68  ? -1.856  22.689 28.753  1.00 17.99 ? 68   ALA A CA  1 
ATOM   518  C  C   . ALA A 1 68  ? -0.961  23.335 27.711  1.00 17.22 ? 68   ALA A C   1 
ATOM   519  O  O   . ALA A 1 68  ? -0.284  24.328 27.992  1.00 17.99 ? 68   ALA A O   1 
ATOM   520  C  CB  . ALA A 1 68  ? -1.186  21.399 29.362  1.00 17.98 ? 68   ALA A CB  1 
ATOM   521  N  N   . ALA A 1 69  ? -0.983  22.803 26.485  1.00 16.51 ? 69   ALA A N   1 
ATOM   522  C  CA  . ALA A 1 69  ? -0.139  23.342 25.406  1.00 14.43 ? 69   ALA A CA  1 
ATOM   523  C  C   . ALA A 1 69  ? -0.586  24.744 25.015  1.00 14.22 ? 69   ALA A C   1 
ATOM   524  O  O   . ALA A 1 69  ? 0.222   25.611 24.804  1.00 13.96 ? 69   ALA A O   1 
ATOM   525  C  CB  . ALA A 1 69  ? -0.096  22.397 24.181  1.00 14.99 ? 69   ALA A CB  1 
ATOM   526  N  N   . GLN A 1 70  ? -1.884  24.964 24.952  1.00 13.77 ? 70   GLN A N   1 
ATOM   527  C  CA  . GLN A 1 70  ? -2.383  26.306 24.615  1.00 15.12 ? 70   GLN A CA  1 
ATOM   528  C  C   . GLN A 1 70  ? -2.092  27.349 25.692  1.00 15.21 ? 70   GLN A C   1 
ATOM   529  O  O   . GLN A 1 70  ? -1.936  28.550 25.384  1.00 15.40 ? 70   GLN A O   1 
ATOM   530  C  CB  . GLN A 1 70  ? -3.874  26.253 24.307  1.00 15.19 ? 70   GLN A CB  1 
ATOM   531  C  CG  . GLN A 1 70  ? -4.247  25.658 22.924  1.00 16.66 ? 70   GLN A CG  1 
ATOM   532  C  CD  . GLN A 1 70  ? -3.751  26.488 21.772  1.00 15.88 ? 70   GLN A CD  1 
ATOM   533  O  OE1 . GLN A 1 70  ? -2.606  26.369 21.373  1.00 17.40 ? 70   GLN A OE1 1 
ATOM   534  N  NE2 . GLN A 1 70  ? -4.614  27.325 21.224  1.00 14.64 ? 70   GLN A NE2 1 
ATOM   535  N  N   . ILE A 1 71  ? -2.033  26.934 26.952  1.00 15.48 ? 71   ILE A N   1 
ATOM   536  C  CA  . ILE A 1 71  ? -1.620  27.888 28.005  1.00 16.06 ? 71   ILE A CA  1 
ATOM   537  C  C   . ILE A 1 71  ? -0.210  28.365 27.743  1.00 15.66 ? 71   ILE A C   1 
ATOM   538  O  O   . ILE A 1 71  ? 0.068   29.564 27.771  1.00 15.78 ? 71   ILE A O   1 
ATOM   539  C  CB  . ILE A 1 71  ? -1.702  27.267 29.445  1.00 16.32 ? 71   ILE A CB  1 
ATOM   540  C  CG1 . ILE A 1 71  ? -3.131  26.858 29.792  1.00 18.02 ? 71   ILE A CG1 1 
ATOM   541  C  CG2 . ILE A 1 71  ? -1.263  28.275 30.485  1.00 14.99 ? 71   ILE A CG2 1 
ATOM   542  C  CD1 . ILE A 1 71  ? -3.196  25.820 30.910  1.00 18.76 ? 71   ILE A CD1 1 
ATOM   543  N  N   . TRP A 1 72  ? 0.694   27.421 27.504  1.00 17.15 ? 72   TRP A N   1 
ATOM   544  C  CA  . TRP A 1 72  ? 2.105   27.740 27.235  1.00 17.03 ? 72   TRP A CA  1 
ATOM   545  C  C   . TRP A 1 72  ? 2.258   28.563 25.955  1.00 17.34 ? 72   TRP A C   1 
ATOM   546  O  O   . TRP A 1 72  ? 3.016   29.542 25.900  1.00 17.30 ? 72   TRP A O   1 
ATOM   547  C  CB  . TRP A 1 72  ? 2.904   26.440 27.126  1.00 17.92 ? 72   TRP A CB  1 
ATOM   548  C  CG  . TRP A 1 72  ? 4.348   26.638 27.178  1.00 19.72 ? 72   TRP A CG  1 
ATOM   549  C  CD1 . TRP A 1 72  ? 5.156   26.529 28.286  1.00 20.23 ? 72   TRP A CD1 1 
ATOM   550  C  CD2 . TRP A 1 72  ? 5.212   26.986 26.084  1.00 22.75 ? 72   TRP A CD2 1 
ATOM   551  N  NE1 . TRP A 1 72  ? 6.454   26.757 27.935  1.00 19.83 ? 72   TRP A NE1 1 
ATOM   552  C  CE2 . TRP A 1 72  ? 6.521   27.079 26.607  1.00 20.59 ? 72   TRP A CE2 1 
ATOM   553  C  CE3 . TRP A 1 72  ? 5.005   27.244 24.711  1.00 24.10 ? 72   TRP A CE3 1 
ATOM   554  C  CZ2 . TRP A 1 72  ? 7.625   27.400 25.815  1.00 20.17 ? 72   TRP A CZ2 1 
ATOM   555  C  CZ3 . TRP A 1 72  ? 6.110   27.571 23.921  1.00 20.47 ? 72   TRP A CZ3 1 
ATOM   556  C  CH2 . TRP A 1 72  ? 7.410   27.639 24.489  1.00 21.09 ? 72   TRP A CH2 1 
ATOM   557  N  N   . ASN A 1 73  ? 1.538   28.148 24.908  1.00 16.50 ? 73   ASN A N   1 
ATOM   558  C  CA  . ASN A 1 73  ? 1.637   28.806 23.611  1.00 15.68 ? 73   ASN A CA  1 
ATOM   559  C  C   . ASN A 1 73  ? 1.260   30.259 23.737  1.00 15.72 ? 73   ASN A C   1 
ATOM   560  O  O   . ASN A 1 73  ? 1.954   31.116 23.203  1.00 15.18 ? 73   ASN A O   1 
ATOM   561  C  CB  . ASN A 1 73  ? 0.755   28.085 22.563  1.00 15.45 ? 73   ASN A CB  1 
ATOM   562  C  CG  . ASN A 1 73  ? 1.323   26.724 22.149  1.00 16.93 ? 73   ASN A CG  1 
ATOM   563  O  OD1 . ASN A 1 73  ? 2.533   26.486 22.237  1.00 17.47 ? 73   ASN A OD1 1 
ATOM   564  N  ND2 . ASN A 1 73  ? 0.439   25.805 21.720  1.00 17.82 ? 73   ASN A ND2 1 
ATOM   565  N  N   . HIS A 1 74  ? 0.174   30.539 24.462  1.00 14.81 ? 74   HIS A N   1 
ATOM   566  C  CA  . HIS A 1 74  ? -0.275  31.919 24.624  1.00 15.35 ? 74   HIS A CA  1 
ATOM   567  C  C   . HIS A 1 74  ? 0.652   32.830 25.443  1.00 16.11 ? 74   HIS A C   1 
ATOM   568  O  O   . HIS A 1 74  ? 0.864   33.997 25.077  1.00 17.55 ? 74   HIS A O   1 
ATOM   569  C  CB  . HIS A 1 74  ? -1.676  31.966 25.185  1.00 14.15 ? 74   HIS A CB  1 
ATOM   570  C  CG  . HIS A 1 74  ? -2.726  31.626 24.174  1.00 13.45 ? 74   HIS A CG  1 
ATOM   571  N  ND1 . HIS A 1 74  ? -3.048  30.325 23.861  1.00 13.48 ? 74   HIS A ND1 1 
ATOM   572  C  CD2 . HIS A 1 74  ? -3.516  32.406 23.397  1.00 13.35 ? 74   HIS A CD2 1 
ATOM   573  C  CE1 . HIS A 1 74  ? -3.987  30.314 22.931  1.00 13.31 ? 74   HIS A CE1 1 
ATOM   574  N  NE2 . HIS A 1 74  ? -4.291  31.566 22.628  1.00 14.18 ? 74   HIS A NE2 1 
ATOM   575  N  N   . THR A 1 75  ? 1.167   32.327 26.558  1.00 17.17 ? 75   THR A N   1 
ATOM   576  C  CA  . THR A 1 75  ? 2.058   33.117 27.406  1.00 17.20 ? 75   THR A CA  1 
ATOM   577  C  C   . THR A 1 75  ? 3.311   33.467 26.613  1.00 16.77 ? 75   THR A C   1 
ATOM   578  O  O   . THR A 1 75  ? 3.832   34.601 26.680  1.00 16.19 ? 75   THR A O   1 
ATOM   579  C  CB  . THR A 1 75  ? 2.414   32.290 28.678  1.00 18.41 ? 75   THR A CB  1 
ATOM   580  O  OG1 . THR A 1 75  ? 1.246   32.184 29.483  1.00 19.58 ? 75   THR A OG1 1 
ATOM   581  C  CG2 . THR A 1 75  ? 3.503   32.958 29.531  1.00 18.83 ? 75   THR A CG2 1 
ATOM   582  N  N   . PHE A 1 76  ? 3.786   32.495 25.841  1.00 16.87 ? 76   PHE A N   1 
ATOM   583  C  CA  . PHE A 1 76  ? 4.950   32.695 24.959  1.00 17.79 ? 76   PHE A CA  1 
ATOM   584  C  C   . PHE A 1 76  ? 4.636   33.754 23.908  1.00 17.33 ? 76   PHE A C   1 
ATOM   585  O  O   . PHE A 1 76  ? 5.423   34.671 23.684  1.00 16.65 ? 76   PHE A O   1 
ATOM   586  C  CB  . PHE A 1 76  ? 5.333   31.364 24.311  1.00 17.85 ? 76   PHE A CB  1 
ATOM   587  C  CG  . PHE A 1 76  ? 6.617   31.401 23.531  1.00 19.35 ? 76   PHE A CG  1 
ATOM   588  C  CD1 . PHE A 1 76  ? 7.825   31.101 24.148  1.00 19.13 ? 76   PHE A CD1 1 
ATOM   589  C  CD2 . PHE A 1 76  ? 6.621   31.708 22.180  1.00 20.74 ? 76   PHE A CD2 1 
ATOM   590  C  CE1 . PHE A 1 76  ? 9.007   31.126 23.425  1.00 20.18 ? 76   PHE A CE1 1 
ATOM   591  C  CE2 . PHE A 1 76  ? 7.801   31.739 21.462  1.00 20.32 ? 76   PHE A CE2 1 
ATOM   592  C  CZ  . PHE A 1 76  ? 8.993   31.441 22.079  1.00 19.76 ? 76   PHE A CZ  1 
ATOM   593  N  N   . TYR A 1 77  ? 3.478   33.633 23.264  1.00 16.99 ? 77   TYR A N   1 
ATOM   594  C  CA  . TYR A 1 77  ? 2.994   34.652 22.321  1.00 16.30 ? 77   TYR A CA  1 
ATOM   595  C  C   . TYR A 1 77  ? 2.993   36.059 22.897  1.00 16.14 ? 77   TYR A C   1 
ATOM   596  O  O   . TYR A 1 77  ? 3.548   36.958 22.286  1.00 16.78 ? 77   TYR A O   1 
ATOM   597  C  CB  . TYR A 1 77  ? 1.588   34.259 21.835  1.00 16.04 ? 77   TYR A CB  1 
ATOM   598  C  CG  . TYR A 1 77  ? 0.845   35.235 20.957  1.00 15.37 ? 77   TYR A CG  1 
ATOM   599  C  CD1 . TYR A 1 77  ? 1.313   35.586 19.677  1.00 17.16 ? 77   TYR A CD1 1 
ATOM   600  C  CD2 . TYR A 1 77  ? -0.373  35.746 21.377  1.00 13.99 ? 77   TYR A CD2 1 
ATOM   601  C  CE1 . TYR A 1 77  ? 0.595   36.476 18.870  1.00 13.13 ? 77   TYR A CE1 1 
ATOM   602  C  CE2 . TYR A 1 77  ? -1.107  36.586 20.586  1.00 16.09 ? 77   TYR A CE2 1 
ATOM   603  C  CZ  . TYR A 1 77  ? -0.631  36.952 19.335  1.00 16.03 ? 77   TYR A CZ  1 
ATOM   604  O  OH  . TYR A 1 77  ? -1.390  37.824 18.602  1.00 15.82 ? 77   TYR A OH  1 
ATOM   605  N  N   . TRP A 1 78  ? 2.348   36.259 24.053  1.00 16.84 ? 78   TRP A N   1 
ATOM   606  C  CA  . TRP A 1 78  ? 2.270   37.587 24.681  1.00 16.62 ? 78   TRP A CA  1 
ATOM   607  C  C   . TRP A 1 78  ? 3.658   38.214 24.882  1.00 16.97 ? 78   TRP A C   1 
ATOM   608  O  O   . TRP A 1 78  ? 3.850   39.430 24.661  1.00 18.01 ? 78   TRP A O   1 
ATOM   609  C  CB  . TRP A 1 78  ? 1.513   37.507 26.016  1.00 16.38 ? 78   TRP A CB  1 
ATOM   610  C  CG  . TRP A 1 78  ? 0.094   37.012 25.913  1.00 16.15 ? 78   TRP A CG  1 
ATOM   611  C  CD1 . TRP A 1 78  ? -0.490  36.068 26.717  1.00 16.48 ? 78   TRP A CD1 1 
ATOM   612  C  CD2 . TRP A 1 78  ? -0.924  37.444 24.992  1.00 15.70 ? 78   TRP A CD2 1 
ATOM   613  N  NE1 . TRP A 1 78  ? -1.804  35.884 26.345  1.00 16.61 ? 78   TRP A NE1 1 
ATOM   614  C  CE2 . TRP A 1 78  ? -2.094  36.707 25.288  1.00 16.13 ? 78   TRP A CE2 1 
ATOM   615  C  CE3 . TRP A 1 78  ? -0.954  38.346 23.918  1.00 13.81 ? 78   TRP A CE3 1 
ATOM   616  C  CZ2 . TRP A 1 78  ? -3.291  36.868 24.560  1.00 17.03 ? 78   TRP A CZ2 1 
ATOM   617  C  CZ3 . TRP A 1 78  ? -2.148  38.526 23.223  1.00 15.22 ? 78   TRP A CZ3 1 
ATOM   618  C  CH2 . TRP A 1 78  ? -3.300  37.801 23.553  1.00 14.54 ? 78   TRP A CH2 1 
ATOM   619  N  N   . ASN A 1 79  ? 4.612   37.380 25.275  1.00 17.67 ? 79   ASN A N   1 
ATOM   620  C  CA  . ASN A 1 79  ? 5.993   37.799 25.480  1.00 18.86 ? 79   ASN A CA  1 
ATOM   621  C  C   . ASN A 1 79  ? 6.671   38.128 24.148  1.00 20.18 ? 79   ASN A C   1 
ATOM   622  O  O   . ASN A 1 79  ? 7.736   38.743 24.139  1.00 19.51 ? 79   ASN A O   1 
ATOM   623  C  CB  . ASN A 1 79  ? 6.813   36.701 26.208  1.00 19.25 ? 79   ASN A CB  1 
ATOM   624  C  CG  . ASN A 1 79  ? 6.536   36.614 27.720  1.00 19.75 ? 79   ASN A CG  1 
ATOM   625  O  OD1 . ASN A 1 79  ? 6.271   35.532 28.252  1.00 21.98 ? 79   ASN A OD1 1 
ATOM   626  N  ND2 . ASN A 1 79  ? 6.641   37.727 28.407  1.00 19.22 ? 79   ASN A ND2 1 
ATOM   627  N  N   . CYS A 1 80  ? 6.093   37.687 23.021  1.00 20.38 ? 80   CYS A N   1 
ATOM   628  C  CA  . CYS A 1 80  ? 6.645   38.054 21.711  1.00 19.13 ? 80   CYS A CA  1 
ATOM   629  C  C   . CYS A 1 80  ? 6.165   39.415 21.245  1.00 18.90 ? 80   CYS A C   1 
ATOM   630  O  O   . CYS A 1 80  ? 6.615   39.892 20.213  1.00 17.86 ? 80   CYS A O   1 
ATOM   631  C  CB  . CYS A 1 80  ? 6.253   37.027 20.637  1.00 20.00 ? 80   CYS A CB  1 
ATOM   632  S  SG  . CYS A 1 80  ? 6.991   35.400 20.839  1.00 18.11 ? 80   CYS A SG  1 
ATOM   633  N  N   . LEU A 1 81  ? 5.194   39.996 21.952  1.00 18.10 ? 81   LEU A N   1 
ATOM   634  C  CA  . LEU A 1 81  ? 4.661   41.317 21.597  1.00 18.77 ? 81   LEU A CA  1 
ATOM   635  C  C   . LEU A 1 81  ? 5.051   42.386 22.613  1.00 19.78 ? 81   LEU A C   1 
ATOM   636  O  O   . LEU A 1 81  ? 5.123   42.104 23.825  1.00 20.41 ? 81   LEU A O   1 
ATOM   637  C  CB  . LEU A 1 81  ? 3.140   41.248 21.476  1.00 17.68 ? 81   LEU A CB  1 
ATOM   638  C  CG  . LEU A 1 81  ? 2.545   40.136 20.594  1.00 18.81 ? 81   LEU A CG  1 
ATOM   639  C  CD1 . LEU A 1 81  ? 1.026   40.027 20.867  1.00 16.28 ? 81   LEU A CD1 1 
ATOM   640  C  CD2 . LEU A 1 81  ? 2.806   40.390 19.109  1.00 22.29 ? 81   LEU A CD2 1 
ATOM   641  N  N   . ALA A 1 82  ? 5.248   43.625 22.148  1.00 21.09 ? 82   ALA A N   1 
ATOM   642  C  CA  . ALA A 1 82  ? 5.698   44.708 23.033  1.00 21.01 ? 82   ALA A CA  1 
ATOM   643  C  C   . ALA A 1 82  ? 5.427   46.103 22.442  1.00 21.66 ? 82   ALA A C   1 
ATOM   644  O  O   . ALA A 1 82  ? 5.451   46.279 21.215  1.00 20.35 ? 82   ALA A O   1 
ATOM   645  C  CB  . ALA A 1 82  ? 7.195   44.534 23.410  1.00 21.57 ? 82   ALA A CB  1 
ATOM   646  N  N   . PRO A 1 83  ? 5.118   47.078 23.315  1.00 22.16 ? 83   PRO A N   1 
ATOM   647  C  CA  . PRO A 1 83  ? 5.022   48.461 22.866  1.00 23.46 ? 83   PRO A CA  1 
ATOM   648  C  C   . PRO A 1 83  ? 6.416   48.962 22.579  1.00 24.68 ? 83   PRO A C   1 
ATOM   649  O  O   . PRO A 1 83  ? 7.380   48.393 23.095  1.00 25.35 ? 83   PRO A O   1 
ATOM   650  C  CB  . PRO A 1 83  ? 4.431   49.186 24.083  1.00 23.53 ? 83   PRO A CB  1 
ATOM   651  C  CG  . PRO A 1 83  ? 4.824   48.342 25.253  1.00 23.09 ? 83   PRO A CG  1 
ATOM   652  C  CD  . PRO A 1 83  ? 4.827   46.931 24.757  1.00 21.95 ? 83   PRO A CD  1 
ATOM   653  N  N   . ASN A 1 84  ? 6.554   49.992 21.746  1.00 25.39 ? 84   ASN A N   1 
ATOM   654  C  CA  . ASN A 1 84  ? 7.891   50.520 21.463  1.00 26.43 ? 84   ASN A CA  1 
ATOM   655  C  C   . ASN A 1 84  ? 8.896   49.433 21.072  1.00 26.71 ? 84   ASN A C   1 
ATOM   656  O  O   . ASN A 1 84  ? 10.040  49.417 21.556  1.00 27.35 ? 84   ASN A O   1 
ATOM   657  C  CB  . ASN A 1 84  ? 8.416   51.300 22.670  1.00 27.21 ? 84   ASN A CB  1 
ATOM   658  C  CG  . ASN A 1 84  ? 7.474   52.413 23.087  1.00 30.12 ? 84   ASN A CG  1 
ATOM   659  O  OD1 . ASN A 1 84  ? 6.970   53.159 22.242  1.00 33.49 ? 84   ASN A OD1 1 
ATOM   660  N  ND2 . ASN A 1 84  ? 7.212   52.518 24.393  1.00 32.94 ? 84   ASN A ND2 1 
ATOM   661  N  N   . ALA A 1 85  ? 8.468   48.519 20.208  1.00 25.75 ? 85   ALA A N   1 
ATOM   662  C  CA  . ALA A 1 85  ? 9.319   47.416 19.757  1.00 25.65 ? 85   ALA A CA  1 
ATOM   663  C  C   . ALA A 1 85  ? 9.194   47.295 18.226  1.00 26.24 ? 85   ALA A C   1 
ATOM   664  O  O   . ALA A 1 85  ? 9.140   48.313 17.519  1.00 25.51 ? 85   ALA A O   1 
ATOM   665  C  CB  . ALA A 1 85  ? 8.907   46.137 20.448  1.00 25.83 ? 85   ALA A CB  1 
ATOM   666  N  N   . GLY A 1 86  ? 9.154   46.070 17.701  1.00 26.47 ? 86   GLY A N   1 
ATOM   667  C  CA  . GLY A 1 86  ? 8.939   45.891 16.261  1.00 27.34 ? 86   GLY A CA  1 
ATOM   668  C  C   . GLY A 1 86  ? 10.164  46.309 15.470  1.00 28.53 ? 86   GLY A C   1 
ATOM   669  O  O   . GLY A 1 86  ? 11.272  46.372 16.019  1.00 27.92 ? 86   GLY A O   1 
ATOM   670  N  N   . GLY A 1 87  ? 9.968   46.613 14.188  1.00 28.65 ? 87   GLY A N   1 
ATOM   671  C  CA  . GLY A 1 87  ? 11.080  46.978 13.303  1.00 29.55 ? 87   GLY A CA  1 
ATOM   672  C  C   . GLY A 1 87  ? 12.122  45.881 13.180  1.00 30.53 ? 87   GLY A C   1 
ATOM   673  O  O   . GLY A 1 87  ? 11.817  44.698 13.301  1.00 30.22 ? 87   GLY A O   1 
ATOM   674  N  N   . GLN A 1 88  ? 13.369  46.270 12.959  1.00 31.23 ? 88   GLN A N   1 
ATOM   675  C  CA  . GLN A 1 88  ? 14.393  45.294 12.633  1.00 32.73 ? 88   GLN A CA  1 
ATOM   676  C  C   . GLN A 1 88  ? 15.104  44.819 13.886  1.00 32.86 ? 88   GLN A C   1 
ATOM   677  O  O   . GLN A 1 88  ? 15.343  45.614 14.789  1.00 33.67 ? 88   GLN A O   1 
ATOM   678  C  CB  . GLN A 1 88  ? 15.402  45.905 11.661  1.00 33.61 ? 88   GLN A CB  1 
ATOM   679  C  CG  . GLN A 1 88  ? 14.899  46.037 10.225  1.00 36.24 ? 88   GLN A CG  1 
ATOM   680  C  CD  . GLN A 1 88  ? 16.027  46.342 9.261   1.00 41.37 ? 88   GLN A CD  1 
ATOM   681  O  OE1 . GLN A 1 88  ? 16.778  45.438 8.824   1.00 42.40 ? 88   GLN A OE1 1 
ATOM   682  N  NE2 . GLN A 1 88  ? 16.171  47.627 8.926   1.00 42.16 ? 88   GLN A NE2 1 
ATOM   683  N  N   . PRO A 1 89  ? 15.451  43.526 13.950  1.00 33.16 ? 89   PRO A N   1 
ATOM   684  C  CA  . PRO A 1 89  ? 16.253  43.035 15.060  1.00 33.27 ? 89   PRO A CA  1 
ATOM   685  C  C   . PRO A 1 89  ? 17.666  43.597 14.999  1.00 33.97 ? 89   PRO A C   1 
ATOM   686  O  O   . PRO A 1 89  ? 18.168  43.946 13.916  1.00 34.36 ? 89   PRO A O   1 
ATOM   687  C  CB  . PRO A 1 89  ? 16.288  41.528 14.826  1.00 33.59 ? 89   PRO A CB  1 
ATOM   688  C  CG  . PRO A 1 89  ? 16.056  41.350 13.390  1.00 32.30 ? 89   PRO A CG  1 
ATOM   689  C  CD  . PRO A 1 89  ? 15.131  42.459 12.992  1.00 32.79 ? 89   PRO A CD  1 
ATOM   690  N  N   . THR A 1 90  ? 18.292  43.718 16.164  1.00 34.05 ? 90   THR A N   1 
ATOM   691  C  CA  . THR A 1 90  ? 19.725  44.018 16.244  1.00 34.52 ? 90   THR A CA  1 
ATOM   692  C  C   . THR A 1 90  ? 20.396  42.879 17.011  1.00 34.19 ? 90   THR A C   1 
ATOM   693  O  O   . THR A 1 90  ? 19.721  41.913 17.415  1.00 34.11 ? 90   THR A O   1 
ATOM   694  C  CB  . THR A 1 90  ? 19.979  45.326 16.971  1.00 34.76 ? 90   THR A CB  1 
ATOM   695  O  OG1 . THR A 1 90  ? 19.449  45.217 18.302  1.00 35.34 ? 90   THR A OG1 1 
ATOM   696  C  CG2 . THR A 1 90  ? 19.311  46.500 16.217  1.00 35.37 ? 90   THR A CG2 1 
ATOM   697  N  N   . GLY A 1 91  ? 21.710  42.985 17.198  1.00 33.49 ? 91   GLY A N   1 
ATOM   698  C  CA  . GLY A 1 91  ? 22.424  42.081 18.083  1.00 33.04 ? 91   GLY A CA  1 
ATOM   699  C  C   . GLY A 1 91  ? 22.556  40.659 17.568  1.00 32.72 ? 91   GLY A C   1 
ATOM   700  O  O   . GLY A 1 91  ? 22.718  40.430 16.363  1.00 32.27 ? 91   GLY A O   1 
ATOM   701  N  N   . ALA A 1 92  ? 22.507  39.705 18.495  1.00 32.59 ? 92   ALA A N   1 
ATOM   702  C  CA  . ALA A 1 92  ? 22.797  38.309 18.167  1.00 32.68 ? 92   ALA A CA  1 
ATOM   703  C  C   . ALA A 1 92  ? 21.694  37.732 17.286  1.00 32.74 ? 92   ALA A C   1 
ATOM   704  O  O   . ALA A 1 92  ? 21.942  36.830 16.484  1.00 32.58 ? 92   ALA A O   1 
ATOM   705  C  CB  . ALA A 1 92  ? 22.993  37.460 19.454  1.00 32.92 ? 92   ALA A CB  1 
ATOM   706  N  N   . VAL A 1 93  ? 20.482  38.263 17.440  1.00 32.77 ? 93   VAL A N   1 
ATOM   707  C  CA  . VAL A 1 93  ? 19.342  37.784 16.664  1.00 33.30 ? 93   VAL A CA  1 
ATOM   708  C  C   . VAL A 1 93  ? 19.434  38.217 15.208  1.00 33.45 ? 93   VAL A C   1 
ATOM   709  O  O   . VAL A 1 93  ? 19.268  37.391 14.321  1.00 33.82 ? 93   VAL A O   1 
ATOM   710  C  CB  . VAL A 1 93  ? 17.980  38.163 17.295  1.00 33.63 ? 93   VAL A CB  1 
ATOM   711  C  CG1 . VAL A 1 93  ? 16.835  37.869 16.339  1.00 33.12 ? 93   VAL A CG1 1 
ATOM   712  C  CG2 . VAL A 1 93  ? 17.782  37.355 18.560  1.00 34.22 ? 93   VAL A CG2 1 
ATOM   713  N  N   . ALA A 1 94  ? 19.712  39.499 14.967  1.00 33.49 ? 94   ALA A N   1 
ATOM   714  C  CA  . ALA A 1 94  ? 19.966  39.980 13.605  1.00 33.68 ? 94   ALA A CA  1 
ATOM   715  C  C   . ALA A 1 94  ? 20.976  39.106 12.839  1.00 33.74 ? 94   ALA A C   1 
ATOM   716  O  O   . ALA A 1 94  ? 20.725  38.726 11.693  1.00 33.95 ? 94   ALA A O   1 
ATOM   717  C  CB  . ALA A 1 94  ? 20.401  41.435 13.610  1.00 33.29 ? 94   ALA A CB  1 
ATOM   718  N  N   . ALA A 1 95  ? 22.099  38.773 13.468  1.00 34.26 ? 95   ALA A N   1 
ATOM   719  C  CA  . ALA A 1 95  ? 23.143  37.975 12.801  1.00 34.41 ? 95   ALA A CA  1 
ATOM   720  C  C   . ALA A 1 95  ? 22.735  36.528 12.547  1.00 34.35 ? 95   ALA A C   1 
ATOM   721  O  O   . ALA A 1 95  ? 23.122  35.931 11.540  1.00 35.02 ? 95   ALA A O   1 
ATOM   722  C  CB  . ALA A 1 95  ? 24.455  38.032 13.579  1.00 34.68 ? 95   ALA A CB  1 
ATOM   723  N  N   . ALA A 1 96  ? 21.974  35.967 13.471  1.00 33.89 ? 96   ALA A N   1 
ATOM   724  C  CA  . ALA A 1 96  ? 21.432  34.624 13.334  1.00 33.89 ? 96   ALA A CA  1 
ATOM   725  C  C   . ALA A 1 96  ? 20.493  34.596 12.138  1.00 34.13 ? 96   ALA A C   1 
ATOM   726  O  O   . ALA A 1 96  ? 20.515  33.669 11.324  1.00 34.27 ? 96   ALA A O   1 
ATOM   727  C  CB  . ALA A 1 96  ? 20.687  34.262 14.592  1.00 33.93 ? 96   ALA A CB  1 
ATOM   728  N  N   . ILE A 1 97  ? 19.675  35.635 12.020  1.00 34.20 ? 97   ILE A N   1 
ATOM   729  C  CA  . ILE A 1 97  ? 18.677  35.681 10.953  1.00 34.43 ? 97   ILE A CA  1 
ATOM   730  C  C   . ILE A 1 97  ? 19.310  35.873 9.575   1.00 35.60 ? 97   ILE A C   1 
ATOM   731  O  O   . ILE A 1 97  ? 18.877  35.256 8.604   1.00 35.83 ? 97   ILE A O   1 
ATOM   732  C  CB  . ILE A 1 97  ? 17.550  36.686 11.263  1.00 33.89 ? 97   ILE A CB  1 
ATOM   733  C  CG1 . ILE A 1 97  ? 16.580  36.065 12.274  1.00 32.16 ? 97   ILE A CG1 1 
ATOM   734  C  CG2 . ILE A 1 97  ? 16.822  37.112 9.984   1.00 33.88 ? 97   ILE A CG2 1 
ATOM   735  C  CD1 . ILE A 1 97  ? 15.576  37.048 12.874  1.00 33.46 ? 97   ILE A CD1 1 
ATOM   736  N  N   . ASP A 1 98  ? 20.334  36.722 9.494   1.00 36.59 ? 98   ASP A N   1 
ATOM   737  C  CA  . ASP A 1 98  ? 21.125  36.856 8.263   1.00 37.42 ? 98   ASP A CA  1 
ATOM   738  C  C   . ASP A 1 98  ? 21.817  35.558 7.882   1.00 37.59 ? 98   ASP A C   1 
ATOM   739  O  O   . ASP A 1 98  ? 21.784  35.175 6.710   1.00 38.69 ? 98   ASP A O   1 
ATOM   740  C  CB  . ASP A 1 98  ? 22.151  37.969 8.375   1.00 37.53 ? 98   ASP A CB  1 
ATOM   741  C  CG  . ASP A 1 98  ? 21.509  39.327 8.472   1.00 39.49 ? 98   ASP A CG  1 
ATOM   742  O  OD1 . ASP A 1 98  ? 20.289  39.422 8.188   1.00 38.56 ? 98   ASP A OD1 1 
ATOM   743  O  OD2 . ASP A 1 98  ? 22.214  40.292 8.856   1.00 41.20 ? 98   ASP A OD2 1 
ATOM   744  N  N   . ALA A 1 99  ? 22.429  34.878 8.853   1.00 37.14 ? 99   ALA A N   1 
ATOM   745  C  CA  . ALA A 1 99  ? 23.101  33.609 8.578   1.00 37.19 ? 99   ALA A CA  1 
ATOM   746  C  C   . ALA A 1 99  ? 22.111  32.585 8.011   1.00 37.08 ? 99   ALA A C   1 
ATOM   747  O  O   . ALA A 1 99  ? 22.405  31.893 7.038   1.00 37.99 ? 99   ALA A O   1 
ATOM   748  C  CB  . ALA A 1 99  ? 23.784  33.066 9.831   1.00 36.57 ? 99   ALA A CB  1 
ATOM   749  N  N   . ALA A 1 100 ? 20.921  32.523 8.597   1.00 36.67 ? 100  ALA A N   1 
ATOM   750  C  CA  . ALA A 1 100 ? 19.955  31.490 8.244   1.00 35.20 ? 100  ALA A CA  1 
ATOM   751  C  C   . ALA A 1 100 ? 19.109  31.802 7.005   1.00 34.77 ? 100  ALA A C   1 
ATOM   752  O  O   . ALA A 1 100 ? 18.765  30.907 6.232   1.00 34.14 ? 100  ALA A O   1 
ATOM   753  C  CB  . ALA A 1 100 ? 19.083  31.205 9.433   1.00 35.48 ? 100  ALA A CB  1 
ATOM   754  N  N   . PHE A 1 101 ? 18.774  33.068 6.805   1.00 34.00 ? 101  PHE A N   1 
ATOM   755  C  CA  . PHE A 1 101 ? 17.810  33.405 5.772   1.00 33.41 ? 101  PHE A CA  1 
ATOM   756  C  C   . PHE A 1 101 ? 18.349  34.423 4.766   1.00 33.58 ? 101  PHE A C   1 
ATOM   757  O  O   . PHE A 1 101 ? 17.677  34.739 3.782   1.00 32.75 ? 101  PHE A O   1 
ATOM   758  C  CB  . PHE A 1 101 ? 16.504  33.921 6.408   1.00 33.08 ? 101  PHE A CB  1 
ATOM   759  C  CG  . PHE A 1 101 ? 15.898  32.986 7.439   1.00 31.53 ? 101  PHE A CG  1 
ATOM   760  C  CD1 . PHE A 1 101 ? 15.040  31.969 7.056   1.00 29.31 ? 101  PHE A CD1 1 
ATOM   761  C  CD2 . PHE A 1 101 ? 16.161  33.155 8.794   1.00 30.60 ? 101  PHE A CD2 1 
ATOM   762  C  CE1 . PHE A 1 101 ? 14.471  31.124 7.997   1.00 27.57 ? 101  PHE A CE1 1 
ATOM   763  C  CE2 . PHE A 1 101 ? 15.591  32.304 9.746   1.00 30.58 ? 101  PHE A CE2 1 
ATOM   764  C  CZ  . PHE A 1 101 ? 14.739  31.286 9.335   1.00 29.39 ? 101  PHE A CZ  1 
ATOM   765  N  N   . GLY A 1 102 ? 19.551  34.939 5.024   1.00 34.08 ? 102  GLY A N   1 
ATOM   766  C  CA  . GLY A 1 102 ? 20.193  35.906 4.122   1.00 34.41 ? 102  GLY A CA  1 
ATOM   767  C  C   . GLY A 1 102 ? 20.058  37.347 4.581   1.00 34.46 ? 102  GLY A C   1 
ATOM   768  O  O   . GLY A 1 102 ? 21.054  38.076 4.654   1.00 34.83 ? 102  GLY A O   1 
ATOM   769  N  N   . SER A 1 103 ? 18.821  37.764 4.873   1.00 33.52 ? 103  SER A N   1 
ATOM   770  C  CA  . SER A 1 103 ? 18.567  39.082 5.437   1.00 32.87 ? 103  SER A CA  1 
ATOM   771  C  C   . SER A 1 103 ? 17.296  39.061 6.271   1.00 32.47 ? 103  SER A C   1 
ATOM   772  O  O   . SER A 1 103 ? 16.504  38.116 6.182   1.00 32.95 ? 103  SER A O   1 
ATOM   773  C  CB  . SER A 1 103 ? 18.456  40.150 4.342   1.00 33.04 ? 103  SER A CB  1 
ATOM   774  O  OG  . SER A 1 103 ? 17.397  39.862 3.443   1.00 32.38 ? 103  SER A OG  1 
ATOM   775  N  N   . PHE A 1 104 ? 17.102  40.096 7.082   1.00 31.53 ? 104  PHE A N   1 
ATOM   776  C  CA  . PHE A 1 104 ? 15.850  40.229 7.798   1.00 30.52 ? 104  PHE A CA  1 
ATOM   777  C  C   . PHE A 1 104 ? 14.686  40.261 6.809   1.00 30.35 ? 104  PHE A C   1 
ATOM   778  O  O   . PHE A 1 104 ? 13.695  39.550 7.004   1.00 29.33 ? 104  PHE A O   1 
ATOM   779  C  CB  . PHE A 1 104 ? 15.831  41.462 8.710   1.00 30.34 ? 104  PHE A CB  1 
ATOM   780  C  CG  . PHE A 1 104 ? 14.505  41.696 9.362   1.00 28.12 ? 104  PHE A CG  1 
ATOM   781  C  CD1 . PHE A 1 104 ? 13.953  40.737 10.195  1.00 26.19 ? 104  PHE A CD1 1 
ATOM   782  C  CD2 . PHE A 1 104 ? 13.798  42.860 9.122   1.00 27.98 ? 104  PHE A CD2 1 
ATOM   783  C  CE1 . PHE A 1 104 ? 12.710  40.930 10.800  1.00 27.40 ? 104  PHE A CE1 1 
ATOM   784  C  CE2 . PHE A 1 104 ? 12.539  43.073 9.726   1.00 29.77 ? 104  PHE A CE2 1 
ATOM   785  C  CZ  . PHE A 1 104 ? 12.002  42.094 10.570  1.00 28.85 ? 104  PHE A CZ  1 
ATOM   786  N  N   . GLU A 1 105 ? 14.810  41.069 5.751   1.00 30.60 ? 105  GLU A N   1 
ATOM   787  C  CA  . GLU A 1 105 ? 13.734  41.220 4.762   1.00 30.96 ? 105  GLU A CA  1 
ATOM   788  C  C   . GLU A 1 105 ? 13.305  39.870 4.186   1.00 30.75 ? 105  GLU A C   1 
ATOM   789  O  O   . GLU A 1 105 ? 12.101  39.595 4.048   1.00 30.94 ? 105  GLU A O   1 
ATOM   790  C  CB  . GLU A 1 105 ? 14.116  42.201 3.652   1.00 31.65 ? 105  GLU A CB  1 
ATOM   791  C  CG  . GLU A 1 105 ? 14.195  43.669 4.087   0.50 32.70 ? 105  GLU A CG  1 
ATOM   792  C  CD  . GLU A 1 105 ? 12.868  44.267 4.557   0.50 34.35 ? 105  GLU A CD  1 
ATOM   793  O  OE1 . GLU A 1 105 ? 11.782  43.752 4.201   0.50 34.02 ? 105  GLU A OE1 1 
ATOM   794  O  OE2 . GLU A 1 105 ? 12.923  45.277 5.295   0.50 35.16 ? 105  GLU A OE2 1 
ATOM   795  N  N   . GLU A 1 106 ? 14.290  39.018 3.897   1.00 30.17 ? 106  GLU A N   1 
ATOM   796  C  CA  . GLU A 1 106 ? 14.041  37.673 3.373   1.00 29.21 ? 106  GLU A CA  1 
ATOM   797  C  C   . GLU A 1 106 ? 13.411  36.740 4.379   1.00 28.40 ? 106  GLU A C   1 
ATOM   798  O  O   . GLU A 1 106 ? 12.513  35.968 4.027   1.00 27.70 ? 106  GLU A O   1 
ATOM   799  C  CB  . GLU A 1 106 ? 15.343  37.051 2.908   1.00 30.26 ? 106  GLU A CB  1 
ATOM   800  C  CG  . GLU A 1 106 ? 15.864  37.595 1.582   1.00 33.29 ? 106  GLU A CG  1 
ATOM   801  C  CD  . GLU A 1 106 ? 17.297  37.174 1.356   1.00 38.62 ? 106  GLU A CD  1 
ATOM   802  O  OE1 . GLU A 1 106 ? 18.196  37.827 1.916   1.00 40.02 ? 106  GLU A OE1 1 
ATOM   803  O  OE2 . GLU A 1 106 ? 17.528  36.172 0.639   1.00 41.67 ? 106  GLU A OE2 1 
ATOM   804  N  N   . PHE A 1 107 ? 13.907  36.769 5.615   1.00 26.76 ? 107  PHE A N   1 
ATOM   805  C  CA  . PHE A 1 107 ? 13.294  36.040 6.714   1.00 24.68 ? 107  PHE A CA  1 
ATOM   806  C  C   . PHE A 1 107 ? 11.842  36.520 6.885   1.00 23.73 ? 107  PHE A C   1 
ATOM   807  O  O   . PHE A 1 107 ? 10.950  35.713 7.043   1.00 23.76 ? 107  PHE A O   1 
ATOM   808  C  CB  . PHE A 1 107 ? 14.063  36.226 8.034   1.00 24.40 ? 107  PHE A CB  1 
ATOM   809  C  CG  . PHE A 1 107 ? 13.210  35.972 9.270   1.00 24.90 ? 107  PHE A CG  1 
ATOM   810  C  CD1 . PHE A 1 107 ? 12.938  34.671 9.687   1.00 24.61 ? 107  PHE A CD1 1 
ATOM   811  C  CD2 . PHE A 1 107 ? 12.646  37.036 9.978   1.00 25.66 ? 107  PHE A CD2 1 
ATOM   812  C  CE1 . PHE A 1 107 ? 12.148  34.422 10.804  1.00 25.18 ? 107  PHE A CE1 1 
ATOM   813  C  CE2 . PHE A 1 107 ? 11.827  36.795 11.095  1.00 24.42 ? 107  PHE A CE2 1 
ATOM   814  C  CZ  . PHE A 1 107 ? 11.592  35.482 11.500  1.00 24.63 ? 107  PHE A CZ  1 
ATOM   815  N  N   . LYS A 1 108 ? 11.628  37.831 6.864   1.00 22.50 ? 108  LYS A N   1 
ATOM   816  C  CA  . LYS A 1 108 ? 10.287  38.404 7.031   1.00 22.25 ? 108  LYS A CA  1 
ATOM   817  C  C   . LYS A 1 108 ? 9.251   37.914 5.990   1.00 22.22 ? 108  LYS A C   1 
ATOM   818  O  O   . LYS A 1 108 ? 8.093   37.610 6.328   1.00 23.04 ? 108  LYS A O   1 
ATOM   819  C  CB  . LYS A 1 108 ? 10.384  39.932 7.020   1.00 21.67 ? 108  LYS A CB  1 
ATOM   820  C  CG  . LYS A 1 108 ? 9.132   40.627 7.435   1.00 22.14 ? 108  LYS A CG  1 
ATOM   821  C  CD  . LYS A 1 108 ? 9.322   42.122 7.544   1.00 25.68 ? 108  LYS A CD  1 
ATOM   822  C  CE  . LYS A 1 108 ? 7.974   42.809 7.409   1.00 27.15 ? 108  LYS A CE  1 
ATOM   823  N  NZ  . LYS A 1 108 ? 8.064   44.277 7.590   1.00 26.66 ? 108  LYS A NZ  1 
ATOM   824  N  N   . ALA A 1 109 ? 9.664   37.860 4.725   1.00 23.00 ? 109  ALA A N   1 
ATOM   825  C  CA  . ALA A 1 109 ? 8.795   37.422 3.622   1.00 23.47 ? 109  ALA A CA  1 
ATOM   826  C  C   . ALA A 1 109 ? 8.458   35.960 3.798   1.00 23.30 ? 109  ALA A C   1 
ATOM   827  O  O   . ALA A 1 109 ? 7.301   35.547 3.612   1.00 24.79 ? 109  ALA A O   1 
ATOM   828  C  CB  . ALA A 1 109 ? 9.486   37.634 2.282   1.00 23.54 ? 109  ALA A CB  1 
ATOM   829  N  N   . LYS A 1 110 ? 9.459   35.171 4.162   1.00 23.22 ? 110  LYS A N   1 
ATOM   830  C  CA  . LYS A 1 110 ? 9.281   33.730 4.379   1.00 23.30 ? 110  LYS A CA  1 
ATOM   831  C  C   . LYS A 1 110 ? 8.374   33.389 5.550   1.00 22.63 ? 110  LYS A C   1 
ATOM   832  O  O   . LYS A 1 110 ? 7.477   32.563 5.412   1.00 22.84 ? 110  LYS A O   1 
ATOM   833  C  CB  . LYS A 1 110 ? 10.634  33.042 4.585   1.00 23.51 ? 110  LYS A CB  1 
ATOM   834  C  CG  . LYS A 1 110 ? 11.533  33.035 3.364   1.00 26.36 ? 110  LYS A CG  1 
ATOM   835  C  CD  . LYS A 1 110 ? 11.188  31.898 2.388   0.50 28.05 ? 110  LYS A CD  1 
ATOM   836  C  CE  . LYS A 1 110 ? 12.315  31.668 1.370   0.50 27.47 ? 110  LYS A CE  1 
ATOM   837  N  NZ  . LYS A 1 110 ? 11.792  31.041 0.123   0.50 27.46 ? 110  LYS A NZ  1 
ATOM   838  N  N   . PHE A 1 111 ? 8.638   33.994 6.712   1.00 22.04 ? 111  PHE A N   1 
ATOM   839  C  CA  . PHE A 1 111 ? 7.793   33.833 7.902   1.00 20.77 ? 111  PHE A CA  1 
ATOM   840  C  C   . PHE A 1 111 ? 6.342   34.225 7.583   1.00 20.17 ? 111  PHE A C   1 
ATOM   841  O  O   . PHE A 1 111 ? 5.394   33.502 7.903   1.00 20.61 ? 111  PHE A O   1 
ATOM   842  C  CB  . PHE A 1 111 ? 8.322   34.721 9.039   1.00 20.20 ? 111  PHE A CB  1 
ATOM   843  C  CG  . PHE A 1 111 ? 7.718   34.410 10.390  1.00 19.91 ? 111  PHE A CG  1 
ATOM   844  C  CD1 . PHE A 1 111 ? 8.294   33.451 11.211  1.00 16.91 ? 111  PHE A CD1 1 
ATOM   845  C  CD2 . PHE A 1 111 ? 6.564   35.086 10.831  1.00 16.51 ? 111  PHE A CD2 1 
ATOM   846  C  CE1 . PHE A 1 111 ? 7.752   33.179 12.471  1.00 21.19 ? 111  PHE A CE1 1 
ATOM   847  C  CE2 . PHE A 1 111 ? 6.015   34.821 12.077  1.00 16.78 ? 111  PHE A CE2 1 
ATOM   848  C  CZ  . PHE A 1 111 ? 6.603   33.855 12.909  1.00 18.87 ? 111  PHE A CZ  1 
ATOM   849  N  N   . THR A 1 112 ? 6.181   35.400 6.974   1.00 20.33 ? 112  THR A N   1 
ATOM   850  C  CA  . THR A 1 112 ? 4.894   35.879 6.569   1.00 20.05 ? 112  THR A CA  1 
ATOM   851  C  C   . THR A 1 112 ? 4.156   34.963 5.622   1.00 20.37 ? 112  THR A C   1 
ATOM   852  O  O   . THR A 1 112 ? 2.951   34.744 5.803   1.00 18.99 ? 112  THR A O   1 
ATOM   853  C  CB  . THR A 1 112 ? 4.983   37.281 6.000   1.00 20.33 ? 112  THR A CB  1 
ATOM   854  O  OG1 . THR A 1 112 ? 5.537   38.137 6.999   1.00 22.79 ? 112  THR A OG1 1 
ATOM   855  C  CG2 . THR A 1 112 ? 3.618   37.807 5.647   1.00 20.47 ? 112  THR A CG2 1 
ATOM   856  N  N   . ASP A 1 113 ? 4.850   34.405 4.628   1.00 20.70 ? 113  ASP A N   1 
ATOM   857  C  CA  . ASP A 1 113 ? 4.171   33.490 3.695   1.00 21.63 ? 113  ASP A CA  1 
ATOM   858  C  C   . ASP A 1 113 ? 3.755   32.225 4.424   1.00 21.28 ? 113  ASP A C   1 
ATOM   859  O  O   . ASP A 1 113 ? 2.649   31.692 4.228   1.00 22.00 ? 113  ASP A O   1 
ATOM   860  C  CB  . ASP A 1 113 ? 5.046   33.130 2.490   1.00 22.73 ? 113  ASP A CB  1 
ATOM   861  C  CG  . ASP A 1 113 ? 4.426   32.015 1.640   1.00 26.65 ? 113  ASP A CG  1 
ATOM   862  O  OD1 . ASP A 1 113 ? 3.515   32.332 0.842   1.00 27.93 ? 113  ASP A OD1 1 
ATOM   863  O  OD2 . ASP A 1 113 ? 4.801   30.817 1.807   1.00 31.53 ? 113  ASP A OD2 1 
ATOM   864  N  N   . SER A 1 114 ? 4.637   31.742 5.285   1.00 21.22 ? 114  SER A N   1 
ATOM   865  C  CA  . SER A 1 114 ? 4.345   30.521 6.019   1.00 20.98 ? 114  SER A CA  1 
ATOM   866  C  C   . SER A 1 114 ? 3.099   30.709 6.943   1.00 20.04 ? 114  SER A C   1 
ATOM   867  O  O   . SER A 1 114 ? 2.296   29.799 7.097   1.00 19.94 ? 114  SER A O   1 
ATOM   868  C  CB  . SER A 1 114 ? 5.601   30.092 6.769   1.00 20.77 ? 114  SER A CB  1 
ATOM   869  O  OG  . SER A 1 114 ? 5.313   29.026 7.642   1.00 24.42 ? 114  SER A OG  1 
ATOM   870  N  N   . ALA A 1 115 ? 2.908   31.910 7.479   1.00 19.98 ? 115  ALA A N   1 
ATOM   871  C  CA  . ALA A 1 115 ? 1.807   32.199 8.380   1.00 20.22 ? 115  ALA A CA  1 
ATOM   872  C  C   . ALA A 1 115 ? 0.482   32.377 7.636   1.00 20.71 ? 115  ALA A C   1 
ATOM   873  O  O   . ALA A 1 115 ? -0.547  31.798 8.029   1.00 20.29 ? 115  ALA A O   1 
ATOM   874  C  CB  . ALA A 1 115 ? 2.122   33.454 9.243   1.00 19.67 ? 115  ALA A CB  1 
ATOM   875  N  N   . ILE A 1 116 ? 0.503   33.173 6.569   1.00 20.73 ? 116  ILE A N   1 
ATOM   876  C  CA  . ILE A 1 116 ? -0.717  33.479 5.826   1.00 22.07 ? 116  ILE A CA  1 
ATOM   877  C  C   . ILE A 1 116 ? -1.317  32.167 5.332   1.00 21.97 ? 116  ILE A C   1 
ATOM   878  O  O   . ILE A 1 116 ? -2.534  31.990 5.343   1.00 22.14 ? 116  ILE A O   1 
ATOM   879  C  CB  . ILE A 1 116 ? -0.420  34.479 4.665   1.00 22.51 ? 116  ILE A CB  1 
ATOM   880  C  CG1 . ILE A 1 116 ? -0.341  35.895 5.228   1.00 25.81 ? 116  ILE A CG1 1 
ATOM   881  C  CG2 . ILE A 1 116 ? -1.456  34.402 3.537   1.00 24.92 ? 116  ILE A CG2 1 
ATOM   882  C  CD1 . ILE A 1 116 ? 0.555   36.799 4.364   1.00 27.76 ? 116  ILE A CD1 1 
ATOM   883  N  N   . ASN A 1 117 ? -0.441  31.236 4.983   1.00 21.69 ? 117  ASN A N   1 
ATOM   884  C  CA  . ASN A 1 117 ? -0.858  29.973 4.376   1.00 22.07 ? 117  ASN A CA  1 
ATOM   885  C  C   . ASN A 1 117 ? -0.999  28.824 5.338   1.00 21.01 ? 117  ASN A C   1 
ATOM   886  O  O   . ASN A 1 117 ? -1.233  27.709 4.893   1.00 21.82 ? 117  ASN A O   1 
ATOM   887  C  CB  . ASN A 1 117 ? 0.113   29.600 3.224   1.00 22.19 ? 117  ASN A CB  1 
ATOM   888  C  CG  . ASN A 1 117 ? 0.016   30.577 2.064   1.00 25.53 ? 117  ASN A CG  1 
ATOM   889  O  OD1 . ASN A 1 117 ? 1.033   31.106 1.597   1.00 29.94 ? 117  ASN A OD1 1 
ATOM   890  N  ND2 . ASN A 1 117 ? -1.227  30.892 1.641   1.00 23.96 ? 117  ASN A ND2 1 
ATOM   891  N  N   . ASN A 1 118 ? -0.887  29.073 6.647   1.00 19.50 ? 118  ASN A N   1 
ATOM   892  C  CA  . ASN A 1 118 ? -1.029  28.020 7.684   1.00 17.97 ? 118  ASN A CA  1 
ATOM   893  C  C   . ASN A 1 118 ? -2.516  27.714 7.857   1.00 17.32 ? 118  ASN A C   1 
ATOM   894  O  O   . ASN A 1 118 ? -3.280  28.570 8.340   1.00 18.23 ? 118  ASN A O   1 
ATOM   895  C  CB  . ASN A 1 118 ? -0.405  28.520 8.996   1.00 17.35 ? 118  ASN A CB  1 
ATOM   896  C  CG  . ASN A 1 118 ? 0.046   27.413 9.925   1.00 17.64 ? 118  ASN A CG  1 
ATOM   897  O  OD1 . ASN A 1 118 ? -0.250  26.222 9.754   1.00 16.24 ? 118  ASN A OD1 1 
ATOM   898  N  ND2 . ASN A 1 118 ? 0.786   27.806 10.956  1.00 18.26 ? 118  ASN A ND2 1 
ATOM   899  N  N   . PHE A 1 119 ? -2.949  26.537 7.399   1.00 16.45 ? 119  PHE A N   1 
ATOM   900  C  CA  . PHE A 1 119 ? -4.371  26.254 7.264   1.00 17.04 ? 119  PHE A CA  1 
ATOM   901  C  C   . PHE A 1 119 ? -5.110  25.903 8.560   1.00 16.83 ? 119  PHE A C   1 
ATOM   902  O  O   . PHE A 1 119 ? -4.703  24.997 9.270   1.00 17.00 ? 119  PHE A O   1 
ATOM   903  C  CB  . PHE A 1 119 ? -4.587  25.152 6.236   1.00 16.66 ? 119  PHE A CB  1 
ATOM   904  C  CG  . PHE A 1 119 ? -6.011  25.022 5.803   1.00 16.17 ? 119  PHE A CG  1 
ATOM   905  C  CD1 . PHE A 1 119 ? -6.575  25.963 4.938   1.00 15.73 ? 119  PHE A CD1 1 
ATOM   906  C  CD2 . PHE A 1 119 ? -6.794  23.972 6.269   1.00 14.30 ? 119  PHE A CD2 1 
ATOM   907  C  CE1 . PHE A 1 119 ? -7.891  25.841 4.513   1.00 13.17 ? 119  PHE A CE1 1 
ATOM   908  C  CE2 . PHE A 1 119 ? -8.129  23.837 5.863   1.00 12.92 ? 119  PHE A CE2 1 
ATOM   909  C  CZ  . PHE A 1 119 ? -8.680  24.782 4.991   1.00 14.90 ? 119  PHE A CZ  1 
ATOM   910  N  N   . GLY A 1 120 ? -6.201  26.620 8.846   1.00 14.73 ? 120  GLY A N   1 
ATOM   911  C  CA  . GLY A 1 120 ? -6.978  26.376 10.049  1.00 14.56 ? 120  GLY A CA  1 
ATOM   912  C  C   . GLY A 1 120 ? -6.418  27.073 11.275  1.00 14.68 ? 120  GLY A C   1 
ATOM   913  O  O   . GLY A 1 120 ? -5.619  27.980 11.164  1.00 14.43 ? 120  GLY A O   1 
ATOM   914  N  N   . SER A 1 121 ? -6.852  26.630 12.452  1.00 14.69 ? 121  SER A N   1 
ATOM   915  C  CA  . SER A 1 121 ? -6.279  27.102 13.720  1.00 14.64 ? 121  SER A CA  1 
ATOM   916  C  C   . SER A 1 121 ? -4.822  26.651 13.828  1.00 14.44 ? 121  SER A C   1 
ATOM   917  O  O   . SER A 1 121 ? -4.517  25.445 13.760  1.00 14.91 ? 121  SER A O   1 
ATOM   918  C  CB  . SER A 1 121 ? -7.147  26.607 14.870  1.00 15.09 ? 121  SER A CB  1 
ATOM   919  O  OG  . SER A 1 121 ? -8.440  27.155 14.680  1.00 14.33 ? 121  SER A OG  1 
ATOM   920  N  N   . SER A 1 122 ? -3.913  27.606 13.978  1.00 13.60 ? 122  SER A N   1 
ATOM   921  C  CA  . SER A 1 122 ? -2.478  27.254 13.871  1.00 14.08 ? 122  SER A CA  1 
ATOM   922  C  C   . SER A 1 122 ? -1.505  28.293 14.448  1.00 15.02 ? 122  SER A C   1 
ATOM   923  O  O   . SER A 1 122 ? -1.903  29.353 14.905  1.00 15.48 ? 122  SER A O   1 
ATOM   924  C  CB  . SER A 1 122 ? -2.118  27.019 12.409  1.00 12.72 ? 122  SER A CB  1 
ATOM   925  O  OG  . SER A 1 122 ? -2.473  28.125 11.629  1.00 14.54 ? 122  SER A OG  1 
ATOM   926  N  N   . TRP A 1 123 ? -0.218  27.937 14.410  1.00 14.74 ? 123  TRP A N   1 
ATOM   927  C  CA  . TRP A 1 123 ? 0.844   28.748 14.980  1.00 15.40 ? 123  TRP A CA  1 
ATOM   928  C  C   . TRP A 1 123 ? 2.009   28.682 14.005  1.00 15.03 ? 123  TRP A C   1 
ATOM   929  O  O   . TRP A 1 123 ? 2.356   27.610 13.548  1.00 15.35 ? 123  TRP A O   1 
ATOM   930  C  CB  . TRP A 1 123 ? 1.294   28.157 16.349  1.00 14.88 ? 123  TRP A CB  1 
ATOM   931  C  CG  . TRP A 1 123 ? 0.237   28.136 17.461  1.00 13.60 ? 123  TRP A CG  1 
ATOM   932  C  CD1 . TRP A 1 123 ? -0.701  27.182 17.681  1.00 15.09 ? 123  TRP A CD1 1 
ATOM   933  C  CD2 . TRP A 1 123 ? 0.009   29.159 18.454  1.00 15.47 ? 123  TRP A CD2 1 
ATOM   934  N  NE1 . TRP A 1 123 ? -1.502  27.522 18.782  1.00 13.87 ? 123  TRP A NE1 1 
ATOM   935  C  CE2 . TRP A 1 123 ? -1.086  28.743 19.252  1.00 13.13 ? 123  TRP A CE2 1 
ATOM   936  C  CE3 . TRP A 1 123 ? 0.638   30.391 18.748  1.00 15.67 ? 123  TRP A CE3 1 
ATOM   937  C  CZ2 . TRP A 1 123 ? -1.563  29.507 20.338  1.00 16.10 ? 123  TRP A CZ2 1 
ATOM   938  C  CZ3 . TRP A 1 123 ? 0.178   31.140 19.823  1.00 15.58 ? 123  TRP A CZ3 1 
ATOM   939  C  CH2 . TRP A 1 123 ? -0.916  30.694 20.617  1.00 14.27 ? 123  TRP A CH2 1 
ATOM   940  N  N   . THR A 1 124 ? 2.631   29.818 13.698  1.00 15.59 ? 124  THR A N   1 
ATOM   941  C  CA  . THR A 1 124 ? 3.895   29.811 12.929  1.00 16.82 ? 124  THR A CA  1 
ATOM   942  C  C   . THR A 1 124 ? 5.030   30.225 13.858  1.00 17.64 ? 124  THR A C   1 
ATOM   943  O  O   . THR A 1 124 ? 4.904   31.225 14.581  1.00 19.24 ? 124  THR A O   1 
ATOM   944  C  CB  . THR A 1 124 ? 3.830   30.728 11.650  1.00 15.84 ? 124  THR A CB  1 
ATOM   945  O  OG1 . THR A 1 124 ? 2.920   30.159 10.696  1.00 18.31 ? 124  THR A OG1 1 
ATOM   946  C  CG2 . THR A 1 124 ? 5.187   30.881 10.987  1.00 18.76 ? 124  THR A CG2 1 
ATOM   947  N  N   . TRP A 1 125 ? 6.127   29.457 13.828  1.00 18.15 ? 125  TRP A N   1 
ATOM   948  C  CA  . TRP A 1 125 ? 7.282   29.609 14.737  1.00 19.14 ? 125  TRP A CA  1 
ATOM   949  C  C   . TRP A 1 125 ? 8.605   29.858 14.028  1.00 20.53 ? 125  TRP A C   1 
ATOM   950  O  O   . TRP A 1 125 ? 8.867   29.311 12.948  1.00 21.42 ? 125  TRP A O   1 
ATOM   951  C  CB  . TRP A 1 125 ? 7.497   28.334 15.575  1.00 17.62 ? 125  TRP A CB  1 
ATOM   952  C  CG  . TRP A 1 125 ? 6.281   27.798 16.228  1.00 17.36 ? 125  TRP A CG  1 
ATOM   953  C  CD1 . TRP A 1 125 ? 5.305   27.023 15.640  1.00 18.40 ? 125  TRP A CD1 1 
ATOM   954  C  CD2 . TRP A 1 125 ? 5.891   27.961 17.598  1.00 17.97 ? 125  TRP A CD2 1 
ATOM   955  N  NE1 . TRP A 1 125 ? 4.323   26.701 16.573  1.00 19.68 ? 125  TRP A NE1 1 
ATOM   956  C  CE2 . TRP A 1 125 ? 4.654   27.271 17.774  1.00 17.24 ? 125  TRP A CE2 1 
ATOM   957  C  CE3 . TRP A 1 125 ? 6.454   28.628 18.701  1.00 15.27 ? 125  TRP A CE3 1 
ATOM   958  C  CZ2 . TRP A 1 125 ? 3.989   27.219 19.008  1.00 18.61 ? 125  TRP A CZ2 1 
ATOM   959  C  CZ3 . TRP A 1 125 ? 5.768   28.577 19.935  1.00 16.76 ? 125  TRP A CZ3 1 
ATOM   960  C  CH2 . TRP A 1 125 ? 4.566   27.876 20.072  1.00 17.77 ? 125  TRP A CH2 1 
ATOM   961  N  N   . LEU A 1 126 ? 9.458   30.665 14.655  1.00 21.81 ? 126  LEU A N   1 
ATOM   962  C  CA  . LEU A 1 126 ? 10.883  30.649 14.362  1.00 23.07 ? 126  LEU A CA  1 
ATOM   963  C  C   . LEU A 1 126 ? 11.466  29.860 15.510  1.00 24.20 ? 126  LEU A C   1 
ATOM   964  O  O   . LEU A 1 126 ? 11.229  30.225 16.665  1.00 24.39 ? 126  LEU A O   1 
ATOM   965  C  CB  . LEU A 1 126 ? 11.466  32.067 14.389  1.00 22.71 ? 126  LEU A CB  1 
ATOM   966  C  CG  . LEU A 1 126 ? 13.013  32.127 14.407  1.00 22.90 ? 126  LEU A CG  1 
ATOM   967  C  CD1 . LEU A 1 126 ? 13.650  31.406 13.185  1.00 21.60 ? 126  LEU A CD1 1 
ATOM   968  C  CD2 . LEU A 1 126 ? 13.528  33.565 14.569  1.00 24.10 ? 126  LEU A CD2 1 
ATOM   969  N  N   . VAL A 1 127 ? 12.195  28.788 15.198  1.00 25.46 ? 127  VAL A N   1 
ATOM   970  C  CA  . VAL A 1 127 ? 12.798  27.910 16.200  1.00 26.51 ? 127  VAL A CA  1 
ATOM   971  C  C   . VAL A 1 127 ? 14.320  27.800 16.029  1.00 28.57 ? 127  VAL A C   1 
ATOM   972  O  O   . VAL A 1 127 ? 14.860  28.069 14.959  1.00 27.64 ? 127  VAL A O   1 
ATOM   973  C  CB  . VAL A 1 127 ? 12.223  26.497 16.158  1.00 26.75 ? 127  VAL A CB  1 
ATOM   974  C  CG1 . VAL A 1 127 ? 10.683  26.536 16.184  1.00 25.56 ? 127  VAL A CG1 1 
ATOM   975  C  CG2 . VAL A 1 127 ? 12.716  25.754 14.929  1.00 25.04 ? 127  VAL A CG2 1 
ATOM   976  N  N   . LYS A 1 128 ? 14.999  27.422 17.108  1.00 30.96 ? 128  LYS A N   1 
ATOM   977  C  CA  . LYS A 1 128 ? 16.415  27.076 17.032  1.00 33.81 ? 128  LYS A CA  1 
ATOM   978  C  C   . LYS A 1 128 ? 16.519  25.561 17.142  1.00 34.99 ? 128  LYS A C   1 
ATOM   979  O  O   . LYS A 1 128 ? 16.058  24.969 18.121  1.00 35.31 ? 128  LYS A O   1 
ATOM   980  C  CB  . LYS A 1 128 ? 17.211  27.765 18.144  1.00 33.13 ? 128  LYS A CB  1 
ATOM   981  C  CG  . LYS A 1 128 ? 18.730  27.630 17.986  1.00 34.49 ? 128  LYS A CG  1 
ATOM   982  C  CD  . LYS A 1 128 ? 19.514  28.431 19.053  1.00 35.12 ? 128  LYS A CD  1 
ATOM   983  C  CE  . LYS A 1 128 ? 19.559  27.712 20.415  1.00 37.12 ? 128  LYS A CE  1 
ATOM   984  N  NZ  . LYS A 1 128 ? 19.692  26.226 20.247  1.00 37.97 ? 128  LYS A NZ  1 
ATOM   985  N  N   . ASN A 1 129 ? 17.101  24.931 16.130  1.00 36.77 ? 129  ASN A N   1 
ATOM   986  C  CA  . ASN A 1 129 ? 17.222  23.475 16.142  1.00 38.79 ? 129  ASN A CA  1 
ATOM   987  C  C   . ASN A 1 129 ? 18.311  22.990 17.079  1.00 39.75 ? 129  ASN A C   1 
ATOM   988  O  O   . ASN A 1 129 ? 19.174  23.764 17.487  1.00 39.14 ? 129  ASN A O   1 
ATOM   989  C  CB  . ASN A 1 129 ? 17.479  22.951 14.739  1.00 38.94 ? 129  ASN A CB  1 
ATOM   990  C  CG  . ASN A 1 129 ? 16.262  23.017 13.878  1.00 40.09 ? 129  ASN A CG  1 
ATOM   991  O  OD1 . ASN A 1 129 ? 16.326  23.487 12.749  1.00 42.29 ? 129  ASN A OD1 1 
ATOM   992  N  ND2 . ASN A 1 129 ? 15.131  22.567 14.410  1.00 40.45 ? 129  ASN A ND2 1 
ATOM   993  N  N   . ALA A 1 130 ? 18.258  21.702 17.417  1.00 41.40 ? 130  ALA A N   1 
ATOM   994  C  CA  . ALA A 1 130 ? 19.300  21.074 18.225  1.00 42.69 ? 130  ALA A CA  1 
ATOM   995  C  C   . ALA A 1 130 ? 20.693  21.505 17.753  1.00 43.49 ? 130  ALA A C   1 
ATOM   996  O  O   . ALA A 1 130 ? 21.503  21.961 18.553  1.00 43.62 ? 130  ALA A O   1 
ATOM   997  C  CB  . ALA A 1 130 ? 19.155  19.547 18.224  1.00 42.65 ? 130  ALA A CB  1 
ATOM   998  N  N   . ASP A 1 131 ? 20.943  21.415 16.451  1.00 44.56 ? 131  ASP A N   1 
ATOM   999  C  CA  . ASP A 1 131 ? 22.264  21.732 15.902  1.00 45.18 ? 131  ASP A CA  1 
ATOM   1000 C  C   . ASP A 1 131 ? 22.626  23.222 15.923  1.00 44.60 ? 131  ASP A C   1 
ATOM   1001 O  O   . ASP A 1 131 ? 23.783  23.572 15.743  1.00 45.50 ? 131  ASP A O   1 
ATOM   1002 C  CB  . ASP A 1 131 ? 22.413  21.160 14.489  1.00 45.63 ? 131  ASP A CB  1 
ATOM   1003 C  CG  . ASP A 1 131 ? 21.832  22.071 13.423  1.00 48.17 ? 131  ASP A CG  1 
ATOM   1004 O  OD1 . ASP A 1 131 ? 20.886  22.846 13.716  1.00 49.68 ? 131  ASP A OD1 1 
ATOM   1005 O  OD2 . ASP A 1 131 ? 22.328  22.006 12.276  1.00 50.97 ? 131  ASP A OD2 1 
ATOM   1006 N  N   . GLY A 1 132 ? 21.645  24.097 16.131  1.00 44.04 ? 132  GLY A N   1 
ATOM   1007 C  CA  . GLY A 1 132 ? 21.909  25.533 16.221  1.00 42.48 ? 132  GLY A CA  1 
ATOM   1008 C  C   . GLY A 1 132 ? 21.389  26.368 15.060  1.00 41.56 ? 132  GLY A C   1 
ATOM   1009 O  O   . GLY A 1 132 ? 21.382  27.597 15.130  1.00 40.93 ? 132  GLY A O   1 
ATOM   1010 N  N   . SER A 1 133 ? 20.965  25.701 13.987  1.00 40.65 ? 133  SER A N   1 
ATOM   1011 C  CA  . SER A 1 133 ? 20.408  26.383 12.815  1.00 39.40 ? 133  SER A CA  1 
ATOM   1012 C  C   . SER A 1 133 ? 18.977  26.870 13.070  1.00 38.29 ? 133  SER A C   1 
ATOM   1013 O  O   . SER A 1 133 ? 18.218  26.246 13.827  1.00 37.81 ? 133  SER A O   1 
ATOM   1014 C  CB  . SER A 1 133 ? 20.450  25.468 11.587  1.00 39.69 ? 133  SER A CB  1 
ATOM   1015 O  OG  . SER A 1 133 ? 19.818  24.213 11.832  1.00 40.54 ? 133  SER A OG  1 
ATOM   1016 N  N   . LEU A 1 134 ? 18.615  27.983 12.435  1.00 36.40 ? 134  LEU A N   1 
ATOM   1017 C  CA  . LEU A 1 134 ? 17.268  28.505 12.563  1.00 34.45 ? 134  LEU A CA  1 
ATOM   1018 C  C   . LEU A 1 134 ? 16.316  27.841 11.568  1.00 33.65 ? 134  LEU A C   1 
ATOM   1019 O  O   . LEU A 1 134 ? 16.746  27.351 10.536  1.00 33.59 ? 134  LEU A O   1 
ATOM   1020 C  CB  . LEU A 1 134 ? 17.279  30.019 12.382  1.00 34.84 ? 134  LEU A CB  1 
ATOM   1021 C  CG  . LEU A 1 134 ? 17.415  30.903 13.643  1.00 34.67 ? 134  LEU A CG  1 
ATOM   1022 C  CD1 . LEU A 1 134 ? 18.257  30.293 14.770  1.00 30.88 ? 134  LEU A CD1 1 
ATOM   1023 C  CD2 . LEU A 1 134 ? 17.897  32.302 13.265  1.00 33.65 ? 134  LEU A CD2 1 
ATOM   1024 N  N   . ALA A 1 135 ? 15.026  27.821 11.887  1.00 31.97 ? 135  ALA A N   1 
ATOM   1025 C  CA  . ALA A 1 135 ? 14.005  27.258 10.999  1.00 29.89 ? 135  ALA A CA  1 
ATOM   1026 C  C   . ALA A 1 135 ? 12.646  27.917 11.251  1.00 29.01 ? 135  ALA A C   1 
ATOM   1027 O  O   . ALA A 1 135 ? 12.361  28.363 12.365  1.00 28.29 ? 135  ALA A O   1 
ATOM   1028 C  CB  . ALA A 1 135 ? 13.904  25.771 11.200  1.00 30.47 ? 135  ALA A CB  1 
ATOM   1029 N  N   . ILE A 1 136 ? 11.820  27.980 10.211  1.00 27.45 ? 136  ILE A N   1 
ATOM   1030 C  CA  . ILE A 1 136 ? 10.437  28.402 10.356  1.00 25.95 ? 136  ILE A CA  1 
ATOM   1031 C  C   . ILE A 1 136 ? 9.583   27.137 10.323  1.00 25.61 ? 136  ILE A C   1 
ATOM   1032 O  O   . ILE A 1 136 ? 9.690   26.351 9.384   1.00 25.69 ? 136  ILE A O   1 
ATOM   1033 C  CB  . ILE A 1 136 ? 10.025  29.336 9.231   1.00 25.63 ? 136  ILE A CB  1 
ATOM   1034 C  CG1 . ILE A 1 136 ? 10.903  30.588 9.278   1.00 24.12 ? 136  ILE A CG1 1 
ATOM   1035 C  CG2 . ILE A 1 136 ? 8.532   29.627 9.327   1.00 25.07 ? 136  ILE A CG2 1 
ATOM   1036 C  CD1 . ILE A 1 136 ? 10.700  31.603 8.165   1.00 26.39 ? 136  ILE A CD1 1 
ATOM   1037 N  N   . VAL A 1 137 ? 8.783   26.907 11.365  1.00 24.45 ? 137  VAL A N   1 
ATOM   1038 C  CA  . VAL A 1 137 ? 7.861   25.760 11.380  1.00 23.22 ? 137  VAL A CA  1 
ATOM   1039 C  C   . VAL A 1 137 ? 6.447   26.151 11.717  1.00 22.09 ? 137  VAL A C   1 
ATOM   1040 O  O   . VAL A 1 137 ? 6.232   27.024 12.560  1.00 21.35 ? 137  VAL A O   1 
ATOM   1041 C  CB  . VAL A 1 137 ? 8.300   24.615 12.340  1.00 23.31 ? 137  VAL A CB  1 
ATOM   1042 C  CG1 . VAL A 1 137 ? 9.745   24.269 12.123  1.00 24.68 ? 137  VAL A CG1 1 
ATOM   1043 C  CG2 . VAL A 1 137 ? 8.106   24.976 13.762  1.00 25.52 ? 137  VAL A CG2 1 
ATOM   1044 N  N   . ASN A 1 138 ? 5.491   25.503 11.048  1.00 20.23 ? 138  ASN A N   1 
ATOM   1045 C  CA  . ASN A 1 138 ? 4.060   25.682 11.337  1.00 19.87 ? 138  ASN A CA  1 
ATOM   1046 C  C   . ASN A 1 138 ? 3.566   24.526 12.177  1.00 18.94 ? 138  ASN A C   1 
ATOM   1047 O  O   . ASN A 1 138 ? 3.940   23.358 11.920  1.00 19.32 ? 138  ASN A O   1 
ATOM   1048 C  CB  . ASN A 1 138 ? 3.237   25.684 10.049  1.00 19.30 ? 138  ASN A CB  1 
ATOM   1049 C  CG  . ASN A 1 138 ? 3.464   26.905 9.197   1.00 19.64 ? 138  ASN A CG  1 
ATOM   1050 O  OD1 . ASN A 1 138 ? 4.139   27.857 9.589   1.00 20.58 ? 138  ASN A OD1 1 
ATOM   1051 N  ND2 . ASN A 1 138 ? 2.863   26.901 8.023   1.00 19.49 ? 138  ASN A ND2 1 
ATOM   1052 N  N   . THR A 1 139 ? 2.692   24.810 13.150  1.00 18.24 ? 139  THR A N   1 
ATOM   1053 C  CA  . THR A 1 139 ? 2.005   23.733 13.870  1.00 17.36 ? 139  THR A CA  1 
ATOM   1054 C  C   . THR A 1 139 ? 0.522   23.931 13.821  1.00 17.39 ? 139  THR A C   1 
ATOM   1055 O  O   . THR A 1 139 ? 0.035   25.039 13.651  1.00 17.71 ? 139  THR A O   1 
ATOM   1056 C  CB  . THR A 1 139 ? 2.371   23.646 15.362  1.00 17.83 ? 139  THR A CB  1 
ATOM   1057 O  OG1 . THR A 1 139 ? 2.100   24.906 16.008  1.00 18.80 ? 139  THR A OG1 1 
ATOM   1058 C  CG2 . THR A 1 139 ? 3.833   23.222 15.509  1.00 17.09 ? 139  THR A CG2 1 
ATOM   1059 N  N   . SER A 1 140 ? -0.214  22.846 13.989  1.00 17.12 ? 140  SER A N   1 
ATOM   1060 C  CA  . SER A 1 140 ? -1.652  22.952 13.888  1.00 17.90 ? 140  SER A CA  1 
ATOM   1061 C  C   . SER A 1 140 ? -2.309  22.886 15.279  1.00 17.52 ? 140  SER A C   1 
ATOM   1062 O  O   . SER A 1 140 ? -1.932  22.038 16.125  1.00 17.39 ? 140  SER A O   1 
ATOM   1063 C  CB  . SER A 1 140 ? -2.148  21.808 12.991  1.00 18.34 ? 140  SER A CB  1 
ATOM   1064 O  OG  . SER A 1 140 ? -3.563  21.742 13.028  1.00 24.32 ? 140  SER A OG  1 
ATOM   1065 N  N   . ASN A 1 141 ? -3.334  23.714 15.485  1.00 15.18 ? 141  ASN A N   1 
ATOM   1066 C  CA  . ASN A 1 141 ? -4.138  23.685 16.701  1.00 16.66 ? 141  ASN A CA  1 
ATOM   1067 C  C   . ASN A 1 141 ? -3.362  24.032 17.970  1.00 16.13 ? 141  ASN A C   1 
ATOM   1068 O  O   . ASN A 1 141 ? -2.995  25.202 18.158  1.00 16.14 ? 141  ASN A O   1 
ATOM   1069 C  CB  . ASN A 1 141 ? -4.892  22.341 16.799  1.00 16.31 ? 141  ASN A CB  1 
ATOM   1070 C  CG  . ASN A 1 141 ? -6.039  22.236 15.788  1.00 18.41 ? 141  ASN A CG  1 
ATOM   1071 O  OD1 . ASN A 1 141 ? -6.385  23.206 15.121  1.00 19.91 ? 141  ASN A OD1 1 
ATOM   1072 N  ND2 . ASN A 1 141 ? -6.676  21.077 15.728  1.00 19.18 ? 141  ASN A ND2 1 
ATOM   1073 N  N   . ALA A 1 142 ? -3.093  23.042 18.823  1.00 17.51 ? 142  ALA A N   1 
ATOM   1074 C  CA  . ALA A 1 142 ? -2.324  23.249 20.060  1.00 17.21 ? 142  ALA A CA  1 
ATOM   1075 C  C   . ALA A 1 142 ? -0.877  22.729 19.978  1.00 18.02 ? 142  ALA A C   1 
ATOM   1076 O  O   . ALA A 1 142 ? -0.073  22.984 20.871  1.00 17.08 ? 142  ALA A O   1 
ATOM   1077 C  CB  . ALA A 1 142 ? -3.037  22.634 21.268  1.00 18.47 ? 142  ALA A CB  1 
ATOM   1078 N  N   . ALA A 1 143 ? -0.551  22.004 18.907  1.00 18.70 ? 143  ALA A N   1 
ATOM   1079 C  CA  . ALA A 1 143 ? 0.784   21.473 18.741  1.00 19.48 ? 143  ALA A CA  1 
ATOM   1080 C  C   . ALA A 1 143 ? 1.797   22.593 18.828  1.00 19.57 ? 143  ALA A C   1 
ATOM   1081 O  O   . ALA A 1 143 ? 1.496   23.758 18.492  1.00 20.08 ? 143  ALA A O   1 
ATOM   1082 C  CB  . ALA A 1 143 ? 0.934   20.714 17.428  1.00 20.25 ? 143  ALA A CB  1 
ATOM   1083 N  N   . THR A 1 144 ? 2.997   22.229 19.280  1.00 20.55 ? 144  THR A N   1 
ATOM   1084 C  CA  . THR A 1 144 ? 4.033   23.195 19.647  1.00 19.81 ? 144  THR A CA  1 
ATOM   1085 C  C   . THR A 1 144 ? 5.417   22.529 19.551  1.00 20.63 ? 144  THR A C   1 
ATOM   1086 O  O   . THR A 1 144 ? 5.545   21.375 19.906  1.00 20.86 ? 144  THR A O   1 
ATOM   1087 C  CB  . THR A 1 144 ? 3.798   23.728 21.100  1.00 20.25 ? 144  THR A CB  1 
ATOM   1088 O  OG1 . THR A 1 144 ? 4.907   24.540 21.518  1.00 20.74 ? 144  THR A OG1 1 
ATOM   1089 C  CG2 . THR A 1 144 ? 3.569   22.595 22.136  1.00 16.67 ? 144  THR A CG2 1 
ATOM   1090 N  N   . PRO A 1 145 ? 6.442   23.247 19.051  1.00 21.83 ? 145  PRO A N   1 
ATOM   1091 C  CA  . PRO A 1 145 ? 7.804   22.689 18.967  1.00 22.91 ? 145  PRO A CA  1 
ATOM   1092 C  C   . PRO A 1 145 ? 8.464   22.509 20.336  1.00 25.58 ? 145  PRO A C   1 
ATOM   1093 O  O   . PRO A 1 145 ? 9.651   22.159 20.410  1.00 25.95 ? 145  PRO A O   1 
ATOM   1094 C  CB  . PRO A 1 145 ? 8.587   23.746 18.170  1.00 22.81 ? 145  PRO A CB  1 
ATOM   1095 C  CG  . PRO A 1 145 ? 7.796   24.997 18.274  1.00 21.80 ? 145  PRO A CG  1 
ATOM   1096 C  CD  . PRO A 1 145 ? 6.375   24.621 18.518  1.00 21.86 ? 145  PRO A CD  1 
ATOM   1097 N  N   . LEU A 1 146 ? 7.721   22.766 21.409  1.00 26.64 ? 146  LEU A N   1 
ATOM   1098 C  CA  . LEU A 1 146 ? 8.245   22.507 22.738  1.00 27.93 ? 146  LEU A CA  1 
ATOM   1099 C  C   . LEU A 1 146 ? 8.357   21.004 22.972  1.00 28.79 ? 146  LEU A C   1 
ATOM   1100 O  O   . LEU A 1 146 ? 9.197   20.565 23.749  1.00 29.61 ? 146  LEU A O   1 
ATOM   1101 C  CB  . LEU A 1 146 ? 7.363   23.179 23.793  1.00 27.19 ? 146  LEU A CB  1 
ATOM   1102 C  CG  . LEU A 1 146 ? 7.664   22.884 25.258  1.00 28.21 ? 146  LEU A CG  1 
ATOM   1103 C  CD1 . LEU A 1 146 ? 8.917   23.650 25.678  1.00 28.71 ? 146  LEU A CD1 1 
ATOM   1104 C  CD2 . LEU A 1 146 ? 6.471   23.250 26.111  1.00 26.54 ? 146  LEU A CD2 1 
ATOM   1105 N  N   . THR A 1 147 ? 7.517   20.215 22.299  1.00 30.09 ? 147  THR A N   1 
ATOM   1106 C  CA  . THR A 1 147 ? 7.543   18.755 22.423  1.00 31.06 ? 147  THR A CA  1 
ATOM   1107 C  C   . THR A 1 147 ? 8.548   18.058 21.478  1.00 32.61 ? 147  THR A C   1 
ATOM   1108 O  O   . THR A 1 147 ? 8.683   16.831 21.503  1.00 32.75 ? 147  THR A O   1 
ATOM   1109 C  CB  . THR A 1 147 ? 6.169   18.157 22.168  1.00 30.90 ? 147  THR A CB  1 
ATOM   1110 O  OG1 . THR A 1 147 ? 5.741   18.512 20.848  1.00 30.64 ? 147  THR A OG1 1 
ATOM   1111 C  CG2 . THR A 1 147 ? 5.146   18.654 23.196  1.00 31.68 ? 147  THR A CG2 1 
ATOM   1112 N  N   . ASP A 1 148 ? 9.238   18.827 20.639  1.00 34.01 ? 148  ASP A N   1 
ATOM   1113 C  CA  . ASP A 1 148 ? 10.294  18.260 19.787  1.00 35.95 ? 148  ASP A CA  1 
ATOM   1114 C  C   . ASP A 1 148 ? 11.581  18.390 20.569  1.00 36.40 ? 148  ASP A C   1 
ATOM   1115 O  O   . ASP A 1 148 ? 11.963  19.507 20.940  1.00 36.21 ? 148  ASP A O   1 
ATOM   1116 C  CB  . ASP A 1 148 ? 10.417  19.011 18.446  1.00 36.30 ? 148  ASP A CB  1 
ATOM   1117 C  CG  . ASP A 1 148 ? 9.170   18.865 17.550  1.00 37.94 ? 148  ASP A CG  1 
ATOM   1118 O  OD1 . ASP A 1 148 ? 8.550   17.770 17.512  1.00 36.70 ? 148  ASP A OD1 1 
ATOM   1119 O  OD2 . ASP A 1 148 ? 8.821   19.862 16.873  1.00 38.78 ? 148  ASP A OD2 1 
ATOM   1120 N  N   . GLU A 1 149 ? 12.244  17.259 20.839  1.00 37.51 ? 149  GLU A N   1 
ATOM   1121 C  CA  . GLU A 1 149 ? 13.441  17.284 21.703  1.00 38.02 ? 149  GLU A CA  1 
ATOM   1122 C  C   . GLU A 1 149 ? 14.598  18.000 20.991  1.00 37.64 ? 149  GLU A C   1 
ATOM   1123 O  O   . GLU A 1 149 ? 14.842  17.781 19.798  1.00 37.78 ? 149  GLU A O   1 
ATOM   1124 C  CB  . GLU A 1 149 ? 13.803  15.883 22.254  0.50 37.91 ? 149  GLU A CB  1 
ATOM   1125 C  CG  . GLU A 1 149 ? 15.010  15.154 21.649  0.50 38.74 ? 149  GLU A CG  1 
ATOM   1126 C  CD  . GLU A 1 149 ? 15.353  13.858 22.408  0.50 38.87 ? 149  GLU A CD  1 
ATOM   1127 O  OE1 . GLU A 1 149 ? 16.429  13.799 23.047  0.50 39.37 ? 149  GLU A OE1 1 
ATOM   1128 O  OE2 . GLU A 1 149 ? 14.543  12.902 22.378  0.50 39.53 ? 149  GLU A OE2 1 
ATOM   1129 N  N   . GLY A 1 150 ? 15.253  18.906 21.713  1.00 37.27 ? 150  GLY A N   1 
ATOM   1130 C  CA  . GLY A 1 150 ? 16.345  19.694 21.152  1.00 36.64 ? 150  GLY A CA  1 
ATOM   1131 C  C   . GLY A 1 150 ? 15.962  21.043 20.556  1.00 36.21 ? 150  GLY A C   1 
ATOM   1132 O  O   . GLY A 1 150 ? 16.819  21.928 20.429  1.00 36.70 ? 150  GLY A O   1 
ATOM   1133 N  N   . VAL A 1 151 ? 14.686  21.209 20.196  1.00 34.84 ? 151  VAL A N   1 
ATOM   1134 C  CA  . VAL A 1 151 ? 14.237  22.411 19.483  1.00 33.14 ? 151  VAL A CA  1 
ATOM   1135 C  C   . VAL A 1 151 ? 13.796  23.469 20.477  1.00 32.41 ? 151  VAL A C   1 
ATOM   1136 O  O   . VAL A 1 151 ? 13.109  23.151 21.449  1.00 32.42 ? 151  VAL A O   1 
ATOM   1137 C  CB  . VAL A 1 151 ? 13.126  22.070 18.462  1.00 32.97 ? 151  VAL A CB  1 
ATOM   1138 C  CG1 . VAL A 1 151 ? 12.687  23.298 17.678  1.00 32.85 ? 151  VAL A CG1 1 
ATOM   1139 C  CG2 . VAL A 1 151 ? 13.621  20.998 17.492  1.00 32.80 ? 151  VAL A CG2 1 
ATOM   1140 N  N   . THR A 1 152 ? 14.216  24.716 20.241  1.00 31.77 ? 152  THR A N   1 
ATOM   1141 C  CA  . THR A 1 152 ? 13.926  25.842 21.127  1.00 30.42 ? 152  THR A CA  1 
ATOM   1142 C  C   . THR A 1 152 ? 13.068  26.877 20.388  1.00 29.14 ? 152  THR A C   1 
ATOM   1143 O  O   . THR A 1 152 ? 13.556  27.517 19.443  1.00 29.96 ? 152  THR A O   1 
ATOM   1144 C  CB  . THR A 1 152 ? 15.247  26.540 21.638  1.00 30.83 ? 152  THR A CB  1 
ATOM   1145 O  OG1 . THR A 1 152 ? 16.165  25.563 22.145  1.00 31.09 ? 152  THR A OG1 1 
ATOM   1146 C  CG2 . THR A 1 152 ? 14.944  27.579 22.739  1.00 30.34 ? 152  THR A CG2 1 
ATOM   1147 N  N   . PRO A 1 153 ? 11.785  27.034 20.788  1.00 27.33 ? 153  PRO A N   1 
ATOM   1148 C  CA  . PRO A 1 153 ? 10.984  28.138 20.245  1.00 25.96 ? 153  PRO A CA  1 
ATOM   1149 C  C   . PRO A 1 153 ? 11.623  29.506 20.512  1.00 24.61 ? 153  PRO A C   1 
ATOM   1150 O  O   . PRO A 1 153 ? 12.059  29.759 21.634  1.00 23.65 ? 153  PRO A O   1 
ATOM   1151 C  CB  . PRO A 1 153 ? 9.647   28.015 20.998  1.00 26.01 ? 153  PRO A CB  1 
ATOM   1152 C  CG  . PRO A 1 153 ? 9.578   26.615 21.443  1.00 26.70 ? 153  PRO A CG  1 
ATOM   1153 C  CD  . PRO A 1 153 ? 10.993  26.168 21.689  1.00 27.08 ? 153  PRO A CD  1 
ATOM   1154 N  N   . LEU A 1 154 ? 11.660  30.368 19.494  1.00 22.53 ? 154  LEU A N   1 
ATOM   1155 C  CA  . LEU A 1 154 ? 12.176  31.710 19.631  1.00 21.54 ? 154  LEU A CA  1 
ATOM   1156 C  C   . LEU A 1 154 ? 11.136  32.794 19.445  1.00 21.25 ? 154  LEU A C   1 
ATOM   1157 O  O   . LEU A 1 154 ? 11.262  33.855 20.029  1.00 21.56 ? 154  LEU A O   1 
ATOM   1158 C  CB  . LEU A 1 154 ? 13.261  31.953 18.587  1.00 21.93 ? 154  LEU A CB  1 
ATOM   1159 C  CG  . LEU A 1 154 ? 14.422  30.973 18.495  1.00 22.42 ? 154  LEU A CG  1 
ATOM   1160 C  CD1 . LEU A 1 154 ? 15.406  31.537 17.519  1.00 23.02 ? 154  LEU A CD1 1 
ATOM   1161 C  CD2 . LEU A 1 154 ? 15.072  30.735 19.854  1.00 23.41 ? 154  LEU A CD2 1 
ATOM   1162 N  N   . LEU A 1 155 ? 10.155  32.556 18.572  1.00 20.11 ? 155  LEU A N   1 
ATOM   1163 C  CA  . LEU A 1 155 ? 9.151   33.572 18.198  1.00 18.73 ? 155  LEU A CA  1 
ATOM   1164 C  C   . LEU A 1 155 ? 7.960   32.821 17.661  1.00 18.63 ? 155  LEU A C   1 
ATOM   1165 O  O   . LEU A 1 155 ? 8.130   31.771 17.029  1.00 17.81 ? 155  LEU A O   1 
ATOM   1166 C  CB  . LEU A 1 155 ? 9.687   34.520 17.132  1.00 18.19 ? 155  LEU A CB  1 
ATOM   1167 C  CG  . LEU A 1 155 ? 8.855   35.682 16.576  1.00 20.03 ? 155  LEU A CG  1 
ATOM   1168 C  CD1 . LEU A 1 155 ? 8.507   36.749 17.617  1.00 18.92 ? 155  LEU A CD1 1 
ATOM   1169 C  CD2 . LEU A 1 155 ? 9.620   36.325 15.427  1.00 18.07 ? 155  LEU A CD2 1 
ATOM   1170 N  N   . THR A 1 156 ? 6.761   33.336 17.906  1.00 17.30 ? 156  THR A N   1 
ATOM   1171 C  CA  . THR A 1 156 ? 5.589   32.686 17.358  1.00 16.54 ? 156  THR A CA  1 
ATOM   1172 C  C   . THR A 1 156 ? 4.569   33.748 17.031  1.00 16.20 ? 156  THR A C   1 
ATOM   1173 O  O   . THR A 1 156 ? 4.578   34.816 17.631  1.00 17.42 ? 156  THR A O   1 
ATOM   1174 C  CB  . THR A 1 156 ? 4.997   31.650 18.312  1.00 16.08 ? 156  THR A CB  1 
ATOM   1175 O  OG1 . THR A 1 156 ? 4.096   30.788 17.572  1.00 18.65 ? 156  THR A OG1 1 
ATOM   1176 C  CG2 . THR A 1 156 ? 4.252   32.303 19.450  1.00 15.75 ? 156  THR A CG2 1 
ATOM   1177 N  N   . VAL A 1 157 ? 3.694   33.453 16.074  1.00 15.03 ? 157  VAL A N   1 
ATOM   1178 C  CA  . VAL A 1 157 ? 2.442   34.196 15.897  1.00 13.75 ? 157  VAL A CA  1 
ATOM   1179 C  C   . VAL A 1 157 ? 1.263   33.226 15.999  1.00 14.25 ? 157  VAL A C   1 
ATOM   1180 O  O   . VAL A 1 157 ? 1.301   32.143 15.388  1.00 15.11 ? 157  VAL A O   1 
ATOM   1181 C  CB  . VAL A 1 157 ? 2.422   35.003 14.529  1.00 14.74 ? 157  VAL A CB  1 
ATOM   1182 C  CG1 . VAL A 1 157 ? 2.662   34.095 13.303  1.00 11.28 ? 157  VAL A CG1 1 
ATOM   1183 C  CG2 . VAL A 1 157 ? 1.168   35.848 14.401  1.00 12.37 ? 157  VAL A CG2 1 
ATOM   1184 N  N   . ASP A 1 158 ? 0.251   33.615 16.788  1.00 14.00 ? 158  ASP A N   1 
ATOM   1185 C  CA  . ASP A 1 158 ? -1.040  32.910 16.917  1.00 13.38 ? 158  ASP A CA  1 
ATOM   1186 C  C   . ASP A 1 158 ? -1.854  33.215 15.660  1.00 13.74 ? 158  ASP A C   1 
ATOM   1187 O  O   . ASP A 1 158 ? -2.126  34.390 15.329  1.00 12.78 ? 158  ASP A O   1 
ATOM   1188 C  CB  . ASP A 1 158 ? -1.790  33.408 18.179  1.00 13.12 ? 158  ASP A CB  1 
ATOM   1189 C  CG  . ASP A 1 158 ? -2.954  32.505 18.598  1.00 15.30 ? 158  ASP A CG  1 
ATOM   1190 O  OD1 . ASP A 1 158 ? -3.229  31.539 17.888  1.00 13.98 ? 158  ASP A OD1 1 
ATOM   1191 O  OD2 . ASP A 1 158 ? -3.589  32.739 19.686  1.00 15.69 ? 158  ASP A OD2 1 
ATOM   1192 N  N   . LEU A 1 159 ? -2.287  32.174 14.966  1.00 12.53 ? 159  LEU A N   1 
ATOM   1193 C  CA  . LEU A 1 159 ? -3.057  32.370 13.731  1.00 13.16 ? 159  LEU A CA  1 
ATOM   1194 C  C   . LEU A 1 159 ? -4.460  31.805 13.866  1.00 13.22 ? 159  LEU A C   1 
ATOM   1195 O  O   . LEU A 1 159 ? -5.201  31.735 12.882  1.00 14.51 ? 159  LEU A O   1 
ATOM   1196 C  CB  . LEU A 1 159 ? -2.342  31.793 12.491  1.00 13.95 ? 159  LEU A CB  1 
ATOM   1197 C  CG  . LEU A 1 159 ? -1.000  32.468 12.266  1.00 11.59 ? 159  LEU A CG  1 
ATOM   1198 C  CD1 . LEU A 1 159 ? -0.019  31.469 11.616  1.00 11.15 ? 159  LEU A CD1 1 
ATOM   1199 C  CD2 . LEU A 1 159 ? -1.102  33.749 11.473  1.00 13.35 ? 159  LEU A CD2 1 
ATOM   1200 N  N   . TRP A 1 160 ? -4.809  31.350 15.072  1.00 12.26 ? 160  TRP A N   1 
ATOM   1201 C  CA  . TRP A 1 160 ? -6.198  31.041 15.359  1.00 10.76 ? 160  TRP A CA  1 
ATOM   1202 C  C   . TRP A 1 160 ? -6.921  32.327 15.006  1.00 12.42 ? 160  TRP A C   1 
ATOM   1203 O  O   . TRP A 1 160 ? -6.381  33.407 15.241  1.00 10.90 ? 160  TRP A O   1 
ATOM   1204 C  CB  . TRP A 1 160 ? -6.407  30.683 16.826  1.00 10.70 ? 160  TRP A CB  1 
ATOM   1205 C  CG  . TRP A 1 160 ? -6.001  29.287 17.241  1.00 11.39 ? 160  TRP A CG  1 
ATOM   1206 C  CD1 . TRP A 1 160 ? -4.765  28.727 17.103  1.00 11.26 ? 160  TRP A CD1 1 
ATOM   1207 C  CD2 . TRP A 1 160 ? -6.830  28.288 17.871  1.00 10.02 ? 160  TRP A CD2 1 
ATOM   1208 N  NE1 . TRP A 1 160 ? -4.767  27.473 17.634  1.00 9.28  ? 160  TRP A NE1 1 
ATOM   1209 C  CE2 . TRP A 1 160 ? -6.028  27.174 18.094  1.00 12.22 ? 160  TRP A CE2 1 
ATOM   1210 C  CE3 . TRP A 1 160 ? -8.181  28.244 18.273  1.00 14.63 ? 160  TRP A CE3 1 
ATOM   1211 C  CZ2 . TRP A 1 160 ? -6.516  25.998 18.694  1.00 11.24 ? 160  TRP A CZ2 1 
ATOM   1212 C  CZ3 . TRP A 1 160 ? -8.667  27.070 18.888  1.00 11.64 ? 160  TRP A CZ3 1 
ATOM   1213 C  CH2 . TRP A 1 160 ? -7.838  25.972 19.088  1.00 11.39 ? 160  TRP A CH2 1 
ATOM   1214 N  N   . GLU A 1 161 ? -8.131  32.225 14.465  1.00 10.96 ? 161  GLU A N   1 
ATOM   1215 C  CA  . GLU A 1 161 ? -8.877  33.418 14.030  1.00 12.32 ? 161  GLU A CA  1 
ATOM   1216 C  C   . GLU A 1 161 ? -9.221  34.376 15.162  1.00 13.04 ? 161  GLU A C   1 
ATOM   1217 O  O   . GLU A 1 161 ? -9.359  35.569 14.918  1.00 13.62 ? 161  GLU A O   1 
ATOM   1218 C  CB  . GLU A 1 161 ? -10.162 33.005 13.276  1.00 11.66 ? 161  GLU A CB  1 
ATOM   1219 C  CG  . GLU A 1 161 ? -9.815  32.440 11.895  1.00 10.90 ? 161  GLU A CG  1 
ATOM   1220 C  CD  . GLU A 1 161 ? -10.975 31.880 11.102  1.00 14.32 ? 161  GLU A CD  1 
ATOM   1221 O  OE1 . GLU A 1 161 ? -11.846 31.198 11.681  1.00 16.56 ? 161  GLU A OE1 1 
ATOM   1222 O  OE2 . GLU A 1 161 ? -10.991 32.108 9.865   1.00 17.77 ? 161  GLU A OE2 1 
ATOM   1223 N  N   . HIS A 1 162 ? -9.435  33.844 16.372  1.00 11.96 ? 162  HIS A N   1 
ATOM   1224 C  CA  . HIS A 1 162 ? -9.662  34.707 17.514  1.00 12.27 ? 162  HIS A CA  1 
ATOM   1225 C  C   . HIS A 1 162 ? -8.487  35.698 17.768  1.00 11.85 ? 162  HIS A C   1 
ATOM   1226 O  O   . HIS A 1 162 ? -8.716  36.753 18.375  1.00 13.71 ? 162  HIS A O   1 
ATOM   1227 C  CB  . HIS A 1 162 ? -10.024 33.940 18.791  1.00 10.94 ? 162  HIS A CB  1 
ATOM   1228 C  CG  . HIS A 1 162 ? -8.920  33.070 19.322  1.00 11.33 ? 162  HIS A CG  1 
ATOM   1229 N  ND1 . HIS A 1 162 ? -9.047  31.702 19.410  1.00 12.36 ? 162  HIS A ND1 1 
ATOM   1230 C  CD2 . HIS A 1 162 ? -7.679  33.366 19.780  1.00 6.15  ? 162  HIS A CD2 1 
ATOM   1231 C  CE1 . HIS A 1 162 ? -7.932  31.184 19.904  1.00 10.57 ? 162  HIS A CE1 1 
ATOM   1232 N  NE2 . HIS A 1 162 ? -7.093  32.172 20.159  1.00 8.62  ? 162  HIS A NE2 1 
ATOM   1233 N  N   . ALA A 1 163 ? -7.285  35.385 17.283  1.00 12.17 ? 163  ALA A N   1 
ATOM   1234 C  CA  . ALA A 1 163 ? -6.126  36.291 17.495  1.00 12.47 ? 163  ALA A CA  1 
ATOM   1235 C  C   . ALA A 1 163 ? -6.230  37.629 16.752  1.00 14.01 ? 163  ALA A C   1 
ATOM   1236 O  O   . ALA A 1 163 ? -5.621  38.633 17.165  1.00 11.97 ? 163  ALA A O   1 
ATOM   1237 C  CB  . ALA A 1 163 ? -4.810  35.601 17.160  1.00 12.83 ? 163  ALA A CB  1 
ATOM   1238 N  N   . TYR A 1 164 ? -7.004  37.663 15.665  1.00 14.33 ? 164  TYR A N   1 
ATOM   1239 C  CA  . TYR A 1 164 ? -7.026  38.826 14.778  1.00 14.47 ? 164  TYR A CA  1 
ATOM   1240 C  C   . TYR A 1 164 ? -8.424  39.184 14.293  1.00 15.07 ? 164  TYR A C   1 
ATOM   1241 O  O   . TYR A 1 164 ? -8.597  40.229 13.711  1.00 15.03 ? 164  TYR A O   1 
ATOM   1242 C  CB  . TYR A 1 164 ? -6.142  38.573 13.559  1.00 14.86 ? 164  TYR A CB  1 
ATOM   1243 C  CG  . TYR A 1 164 ? -6.454  37.320 12.721  1.00 14.87 ? 164  TYR A CG  1 
ATOM   1244 C  CD1 . TYR A 1 164 ? -7.419  37.349 11.701  1.00 14.46 ? 164  TYR A CD1 1 
ATOM   1245 C  CD2 . TYR A 1 164 ? -5.726  36.135 12.894  1.00 12.40 ? 164  TYR A CD2 1 
ATOM   1246 C  CE1 . TYR A 1 164 ? -7.680  36.242 10.921  1.00 12.89 ? 164  TYR A CE1 1 
ATOM   1247 C  CE2 . TYR A 1 164 ? -5.974  35.018 12.105  1.00 14.80 ? 164  TYR A CE2 1 
ATOM   1248 C  CZ  . TYR A 1 164 ? -6.963  35.069 11.122  1.00 14.19 ? 164  TYR A CZ  1 
ATOM   1249 O  OH  . TYR A 1 164 ? -7.214  33.955 10.323  1.00 15.08 ? 164  TYR A OH  1 
ATOM   1250 N  N   . TYR A 1 165 ? -9.426  38.341 14.497  1.00 14.11 ? 165  TYR A N   1 
ATOM   1251 C  CA  . TYR A 1 165 ? -10.708 38.625 13.866  1.00 14.94 ? 165  TYR A CA  1 
ATOM   1252 C  C   . TYR A 1 165 ? -11.332 39.970 14.269  1.00 14.91 ? 165  TYR A C   1 
ATOM   1253 O  O   . TYR A 1 165 ? -12.002 40.643 13.452  1.00 16.68 ? 165  TYR A O   1 
ATOM   1254 C  CB  . TYR A 1 165 ? -11.720 37.468 14.017  1.00 14.90 ? 165  TYR A CB  1 
ATOM   1255 C  CG  . TYR A 1 165 ? -12.519 37.242 12.748  1.00 14.91 ? 165  TYR A CG  1 
ATOM   1256 C  CD1 . TYR A 1 165 ? -11.981 36.502 11.696  1.00 12.92 ? 165  TYR A CD1 1 
ATOM   1257 C  CD2 . TYR A 1 165 ? -13.792 37.786 12.597  1.00 13.89 ? 165  TYR A CD2 1 
ATOM   1258 C  CE1 . TYR A 1 165 ? -12.682 36.308 10.499  1.00 12.60 ? 165  TYR A CE1 1 
ATOM   1259 C  CE2 . TYR A 1 165 ? -14.516 37.607 11.409  1.00 13.86 ? 165  TYR A CE2 1 
ATOM   1260 C  CZ  . TYR A 1 165 ? -13.942 36.866 10.360  1.00 12.98 ? 165  TYR A CZ  1 
ATOM   1261 O  OH  . TYR A 1 165 ? -14.645 36.678 9.178   1.00 14.66 ? 165  TYR A OH  1 
ATOM   1262 N  N   . ILE A 1 166 ? -11.135 40.376 15.523  1.00 14.20 ? 166  ILE A N   1 
ATOM   1263 C  CA  . ILE A 1 166 ? -11.822 41.591 16.003  1.00 13.58 ? 166  ILE A CA  1 
ATOM   1264 C  C   . ILE A 1 166 ? -11.294 42.810 15.255  1.00 13.72 ? 166  ILE A C   1 
ATOM   1265 O  O   . ILE A 1 166 ? -12.055 43.686 14.824  1.00 13.91 ? 166  ILE A O   1 
ATOM   1266 C  CB  . ILE A 1 166 ? -11.705 41.765 17.554  1.00 13.50 ? 166  ILE A CB  1 
ATOM   1267 C  CG1 . ILE A 1 166 ? -12.577 40.753 18.281  1.00 11.09 ? 166  ILE A CG1 1 
ATOM   1268 C  CG2 . ILE A 1 166 ? -12.152 43.187 18.014  1.00 10.22 ? 166  ILE A CG2 1 
ATOM   1269 C  CD1 . ILE A 1 166 ? -12.185 40.569 19.748  1.00 12.48 ? 166  ILE A CD1 1 
ATOM   1270 N  N   . ASP A 1 167 ? -9.973  42.856 15.103  1.00 14.73 ? 167  ASP A N   1 
ATOM   1271 C  CA  . ASP A 1 167 ? -9.296  44.030 14.547  1.00 15.63 ? 167  ASP A CA  1 
ATOM   1272 C  C   . ASP A 1 167 ? -9.108  43.960 13.048  1.00 16.20 ? 167  ASP A C   1 
ATOM   1273 O  O   . ASP A 1 167 ? -9.095  45.011 12.382  1.00 16.93 ? 167  ASP A O   1 
ATOM   1274 C  CB  . ASP A 1 167 ? -7.901  44.140 15.174  1.00 16.02 ? 167  ASP A CB  1 
ATOM   1275 C  CG  . ASP A 1 167 ? -7.954  44.414 16.672  1.00 20.30 ? 167  ASP A CG  1 
ATOM   1276 O  OD1 . ASP A 1 167 ? -8.922  45.068 17.145  1.00 23.59 ? 167  ASP A OD1 1 
ATOM   1277 O  OD2 . ASP A 1 167 ? -7.002  44.001 17.366  1.00 24.70 ? 167  ASP A OD2 1 
ATOM   1278 N  N   . PHE A 1 168 ? -8.895  42.731 12.526  1.00 16.21 ? 168  PHE A N   1 
ATOM   1279 C  CA  . PHE A 1 168 ? -8.579  42.534 11.111  1.00 16.64 ? 168  PHE A CA  1 
ATOM   1280 C  C   . PHE A 1 168 ? -9.568  41.661 10.322  1.00 17.15 ? 168  PHE A C   1 
ATOM   1281 O  O   . PHE A 1 168 ? -9.385  41.450 9.113   1.00 17.83 ? 168  PHE A O   1 
ATOM   1282 C  CB  . PHE A 1 168 ? -7.147  42.030 10.933  1.00 15.74 ? 168  PHE A CB  1 
ATOM   1283 C  CG  . PHE A 1 168 ? -6.148  42.925 11.580  1.00 16.51 ? 168  PHE A CG  1 
ATOM   1284 C  CD1 . PHE A 1 168 ? -5.836  44.146 11.010  1.00 18.13 ? 168  PHE A CD1 1 
ATOM   1285 C  CD2 . PHE A 1 168 ? -5.590  42.593 12.819  1.00 19.09 ? 168  PHE A CD2 1 
ATOM   1286 C  CE1 . PHE A 1 168 ? -4.941  45.022 11.644  1.00 21.59 ? 168  PHE A CE1 1 
ATOM   1287 C  CE2 . PHE A 1 168 ? -4.687  43.443 13.452  1.00 19.79 ? 168  PHE A CE2 1 
ATOM   1288 C  CZ  . PHE A 1 168 ? -4.362  44.670 12.860  1.00 19.52 ? 168  PHE A CZ  1 
ATOM   1289 N  N   . ARG A 1 169 ? -10.622 41.188 10.990  1.00 16.53 ? 169  ARG A N   1 
ATOM   1290 C  CA  . ARG A 1 169 ? -11.581 40.285 10.340  1.00 16.09 ? 169  ARG A CA  1 
ATOM   1291 C  C   . ARG A 1 169 ? -10.787 39.215 9.578   1.00 16.23 ? 169  ARG A C   1 
ATOM   1292 O  O   . ARG A 1 169 ? -9.823  38.654 10.133  1.00 16.45 ? 169  ARG A O   1 
ATOM   1293 C  CB  . ARG A 1 169 ? -12.508 41.048 9.402   1.00 15.80 ? 169  ARG A CB  1 
ATOM   1294 C  CG  . ARG A 1 169 ? -13.447 42.000 10.094  1.00 16.27 ? 169  ARG A CG  1 
ATOM   1295 C  CD  . ARG A 1 169 ? -14.630 41.250 10.670  1.00 14.48 ? 169  ARG A CD  1 
ATOM   1296 N  NE  . ARG A 1 169 ? -15.585 42.136 11.321  1.00 17.82 ? 169  ARG A NE  1 
ATOM   1297 C  CZ  . ARG A 1 169 ? -15.488 42.551 12.583  1.00 19.95 ? 169  ARG A CZ  1 
ATOM   1298 N  NH1 . ARG A 1 169 ? -14.479 42.150 13.360  1.00 16.90 ? 169  ARG A NH1 1 
ATOM   1299 N  NH2 . ARG A 1 169 ? -16.417 43.371 13.079  1.00 17.73 ? 169  ARG A NH2 1 
ATOM   1300 N  N   . ASN A 1 170 ? -11.163 38.916 8.327   1.00 15.84 ? 170  ASN A N   1 
ATOM   1301 C  CA  . ASN A 1 170 ? -10.505 37.819 7.569   1.00 16.08 ? 170  ASN A CA  1 
ATOM   1302 C  C   . ASN A 1 170 ? -9.086  38.040 7.011   1.00 16.56 ? 170  ASN A C   1 
ATOM   1303 O  O   . ASN A 1 170 ? -8.515  37.138 6.372   1.00 17.59 ? 170  ASN A O   1 
ATOM   1304 C  CB  . ASN A 1 170 ? -11.403 37.377 6.419   1.00 15.02 ? 170  ASN A CB  1 
ATOM   1305 C  CG  . ASN A 1 170 ? -11.636 38.465 5.421   1.00 14.03 ? 170  ASN A CG  1 
ATOM   1306 O  OD1 . ASN A 1 170 ? -12.045 39.595 5.756   1.00 12.75 ? 170  ASN A OD1 1 
ATOM   1307 N  ND2 . ASN A 1 170 ? -11.404 38.136 4.160   1.00 16.16 ? 170  ASN A ND2 1 
ATOM   1308 N  N   . VAL A 1 171 ? -8.523  39.229 7.219   1.00 16.54 ? 171  VAL A N   1 
ATOM   1309 C  CA  . VAL A 1 171 ? -7.294  39.623 6.517   1.00 15.53 ? 171  VAL A CA  1 
ATOM   1310 C  C   . VAL A 1 171 ? -6.011  39.366 7.291   1.00 15.63 ? 171  VAL A C   1 
ATOM   1311 O  O   . VAL A 1 171 ? -5.466  40.270 7.934   1.00 16.11 ? 171  VAL A O   1 
ATOM   1312 C  CB  . VAL A 1 171 ? -7.381  41.100 6.082   1.00 15.54 ? 171  VAL A CB  1 
ATOM   1313 C  CG1 . VAL A 1 171 ? -6.380  41.411 4.967   1.00 15.13 ? 171  VAL A CG1 1 
ATOM   1314 C  CG2 . VAL A 1 171 ? -8.803  41.414 5.623   1.00 13.42 ? 171  VAL A CG2 1 
ATOM   1315 N  N   . ARG A 1 172 ? -5.451  38.164 7.141   1.00 15.53 ? 172  ARG A N   1 
ATOM   1316 C  CA  . ARG A 1 172 ? -4.214  37.856 7.816   1.00 16.59 ? 172  ARG A CA  1 
ATOM   1317 C  C   . ARG A 1 172 ? -3.075  38.770 7.419   1.00 17.78 ? 172  ARG A C   1 
ATOM   1318 O  O   . ARG A 1 172 ? -2.229  39.084 8.289   1.00 18.65 ? 172  ARG A O   1 
ATOM   1319 C  CB  . ARG A 1 172 ? -3.792  36.391 7.658   1.00 16.35 ? 172  ARG A CB  1 
ATOM   1320 C  CG  . ARG A 1 172 ? -4.632  35.429 8.453   1.00 15.93 ? 172  ARG A CG  1 
ATOM   1321 C  CD  . ARG A 1 172 ? -4.050  34.032 8.245   1.00 15.69 ? 172  ARG A CD  1 
ATOM   1322 N  NE  . ARG A 1 172 ? -4.683  33.012 9.082   1.00 18.75 ? 172  ARG A NE  1 
ATOM   1323 C  CZ  . ARG A 1 172 ? -4.374  31.721 9.041   1.00 17.01 ? 172  ARG A CZ  1 
ATOM   1324 N  NH1 . ARG A 1 172 ? -3.443  31.301 8.220   1.00 19.81 ? 172  ARG A NH1 1 
ATOM   1325 N  NH2 . ARG A 1 172 ? -4.969  30.853 9.842   1.00 17.30 ? 172  ARG A NH2 1 
ATOM   1326 N  N   . PRO A 1 173 ? -2.981  39.162 6.116   1.00 17.78 ? 173  PRO A N   1 
ATOM   1327 C  CA  . PRO A 1 173 ? -1.867  40.075 5.834   1.00 18.38 ? 173  PRO A CA  1 
ATOM   1328 C  C   . PRO A 1 173 ? -1.846  41.378 6.666   1.00 17.88 ? 173  PRO A C   1 
ATOM   1329 O  O   . PRO A 1 173 ? -0.756  41.903 6.989   1.00 18.50 ? 173  PRO A O   1 
ATOM   1330 C  CB  . PRO A 1 173 ? -2.017  40.343 4.320   1.00 18.55 ? 173  PRO A CB  1 
ATOM   1331 C  CG  . PRO A 1 173 ? -2.625  39.008 3.791   1.00 19.44 ? 173  PRO A CG  1 
ATOM   1332 C  CD  . PRO A 1 173 ? -3.684  38.748 4.871   1.00 18.44 ? 173  PRO A CD  1 
ATOM   1333 N  N   . ASP A 1 174 ? -3.008  41.912 6.988   1.00 17.76 ? 174  ASP A N   1 
ATOM   1334 C  CA  . ASP A 1 174 ? -3.094  43.120 7.827   1.00 17.76 ? 174  ASP A CA  1 
ATOM   1335 C  C   . ASP A 1 174 ? -2.641  42.826 9.269   1.00 18.21 ? 174  ASP A C   1 
ATOM   1336 O  O   . ASP A 1 174 ? -1.911  43.616 9.878   1.00 18.65 ? 174  ASP A O   1 
ATOM   1337 C  CB  . ASP A 1 174 ? -4.535  43.648 7.830   1.00 17.27 ? 174  ASP A CB  1 
ATOM   1338 C  CG  . ASP A 1 174 ? -4.934  44.325 6.501   1.00 19.25 ? 174  ASP A CG  1 
ATOM   1339 O  OD1 . ASP A 1 174 ? -4.048  44.578 5.654   1.00 18.66 ? 174  ASP A OD1 1 
ATOM   1340 O  OD2 . ASP A 1 174 ? -6.145  44.593 6.296   1.00 20.02 ? 174  ASP A OD2 1 
ATOM   1341 N  N   . TYR A 1 175 ? -3.083  41.689 9.808   1.00 17.05 ? 175  TYR A N   1 
ATOM   1342 C  CA  . TYR A 1 175 ? -2.617  41.182 11.110  1.00 17.20 ? 175  TYR A CA  1 
ATOM   1343 C  C   . TYR A 1 175 ? -1.122  40.955 11.162  1.00 17.89 ? 175  TYR A C   1 
ATOM   1344 O  O   . TYR A 1 175 ? -0.464  41.323 12.142  1.00 19.09 ? 175  TYR A O   1 
ATOM   1345 C  CB  . TYR A 1 175 ? -3.327  39.859 11.419  1.00 15.34 ? 175  TYR A CB  1 
ATOM   1346 C  CG  . TYR A 1 175 ? -2.864  39.091 12.625  1.00 15.79 ? 175  TYR A CG  1 
ATOM   1347 C  CD1 . TYR A 1 175 ? -2.921  39.634 13.906  1.00 14.38 ? 175  TYR A CD1 1 
ATOM   1348 C  CD2 . TYR A 1 175 ? -2.424  37.757 12.487  1.00 11.51 ? 175  TYR A CD2 1 
ATOM   1349 C  CE1 . TYR A 1 175 ? -2.506  38.895 15.014  1.00 15.66 ? 175  TYR A CE1 1 
ATOM   1350 C  CE2 . TYR A 1 175 ? -2.040  37.015 13.586  1.00 15.21 ? 175  TYR A CE2 1 
ATOM   1351 C  CZ  . TYR A 1 175 ? -2.081  37.590 14.855  1.00 16.45 ? 175  TYR A CZ  1 
ATOM   1352 O  OH  . TYR A 1 175 ? -1.682  36.805 15.939  1.00 15.81 ? 175  TYR A OH  1 
ATOM   1353 N  N   . MET A 1 176 ? -0.557  40.337 10.131  1.00 17.86 ? 176  MET A N   1 
ATOM   1354 C  CA  . MET A 1 176 ? 0.917   40.218 10.098  1.00 18.25 ? 176  MET A CA  1 
ATOM   1355 C  C   . MET A 1 176 ? 1.619   41.566 10.080  1.00 18.85 ? 176  MET A C   1 
ATOM   1356 O  O   . MET A 1 176 ? 2.673   41.696 10.683  1.00 20.10 ? 176  MET A O   1 
ATOM   1357 C  CB  . MET A 1 176 ? 1.417   39.332 8.964   1.00 17.68 ? 176  MET A CB  1 
ATOM   1358 C  CG  . MET A 1 176 ? 0.914   37.917 9.068   1.00 17.54 ? 176  MET A CG  1 
ATOM   1359 S  SD  . MET A 1 176 ? 1.340   37.125 10.623  1.00 19.94 ? 176  MET A SD  1 
ATOM   1360 C  CE  . MET A 1 176 ? 3.101   37.059 10.468  1.00 15.91 ? 176  MET A CE  1 
ATOM   1361 N  N   . GLY A 1 177 ? 1.030   42.569 9.430   1.00 19.68 ? 177  GLY A N   1 
ATOM   1362 C  CA  . GLY A 1 177 ? 1.598   43.926 9.447   1.00 19.01 ? 177  GLY A CA  1 
ATOM   1363 C  C   . GLY A 1 177 ? 1.683   44.435 10.883  1.00 19.69 ? 177  GLY A C   1 
ATOM   1364 O  O   . GLY A 1 177 ? 2.690   45.018 11.299  1.00 20.70 ? 177  GLY A O   1 
ATOM   1365 N  N   . ALA A 1 178 ? 0.631   44.170 11.652  1.00 19.07 ? 178  ALA A N   1 
ATOM   1366 C  CA  . ALA A 1 178 ? 0.578   44.489 13.082  1.00 18.93 ? 178  ALA A CA  1 
ATOM   1367 C  C   . ALA A 1 178 ? 1.620   43.706 13.888  1.00 18.66 ? 178  ALA A C   1 
ATOM   1368 O  O   . ALA A 1 178 ? 2.382   44.287 14.699  1.00 19.03 ? 178  ALA A O   1 
ATOM   1369 C  CB  . ALA A 1 178 ? -0.845  44.231 13.618  1.00 18.40 ? 178  ALA A CB  1 
ATOM   1370 N  N   . PHE A 1 179 ? 1.680   42.401 13.652  1.00 17.35 ? 179  PHE A N   1 
ATOM   1371 C  CA  . PHE A 1 179 ? 2.654   41.536 14.301  1.00 17.34 ? 179  PHE A CA  1 
ATOM   1372 C  C   . PHE A 1 179 ? 4.018   42.145 14.185  1.00 18.99 ? 179  PHE A C   1 
ATOM   1373 O  O   . PHE A 1 179 ? 4.682   42.332 15.200  1.00 19.50 ? 179  PHE A O   1 
ATOM   1374 C  CB  . PHE A 1 179 ? 2.689   40.179 13.626  1.00 16.12 ? 179  PHE A CB  1 
ATOM   1375 C  CG  . PHE A 1 179 ? 3.645   39.207 14.236  1.00 13.27 ? 179  PHE A CG  1 
ATOM   1376 C  CD1 . PHE A 1 179 ? 3.421   38.701 15.510  1.00 14.00 ? 179  PHE A CD1 1 
ATOM   1377 C  CD2 . PHE A 1 179 ? 4.768   38.769 13.520  1.00 12.58 ? 179  PHE A CD2 1 
ATOM   1378 C  CE1 . PHE A 1 179 ? 4.307   37.768 16.078  1.00 12.65 ? 179  PHE A CE1 1 
ATOM   1379 C  CE2 . PHE A 1 179 ? 5.666   37.846 14.093  1.00 15.41 ? 179  PHE A CE2 1 
ATOM   1380 C  CZ  . PHE A 1 179 ? 5.430   37.337 15.362  1.00 14.26 ? 179  PHE A CZ  1 
ATOM   1381 N  N   . TRP A 1 180 ? 4.445   42.454 12.952  1.00 19.52 ? 180  TRP A N   1 
ATOM   1382 C  CA  . TRP A 1 180 ? 5.809   42.988 12.734  1.00 19.55 ? 180  TRP A CA  1 
ATOM   1383 C  C   . TRP A 1 180 ? 6.061   44.340 13.432  1.00 20.35 ? 180  TRP A C   1 
ATOM   1384 O  O   . TRP A 1 180 ? 7.173   44.622 13.819  1.00 21.00 ? 180  TRP A O   1 
ATOM   1385 C  CB  . TRP A 1 180 ? 6.197   43.040 11.231  1.00 19.88 ? 180  TRP A CB  1 
ATOM   1386 C  CG  . TRP A 1 180 ? 6.213   41.725 10.541  1.00 18.56 ? 180  TRP A CG  1 
ATOM   1387 C  CD1 . TRP A 1 180 ? 5.367   41.318 9.530   1.00 19.45 ? 180  TRP A CD1 1 
ATOM   1388 C  CD2 . TRP A 1 180 ? 7.103   40.608 10.790  1.00 17.91 ? 180  TRP A CD2 1 
ATOM   1389 N  NE1 . TRP A 1 180 ? 5.680   40.016 9.160   1.00 17.28 ? 180  TRP A NE1 1 
ATOM   1390 C  CE2 . TRP A 1 180 ? 6.740   39.574 9.902   1.00 17.87 ? 180  TRP A CE2 1 
ATOM   1391 C  CE3 . TRP A 1 180 ? 8.159   40.386 11.681  1.00 16.47 ? 180  TRP A CE3 1 
ATOM   1392 C  CZ2 . TRP A 1 180 ? 7.395   38.332 9.893   1.00 18.89 ? 180  TRP A CZ2 1 
ATOM   1393 C  CZ3 . TRP A 1 180 ? 8.805   39.161 11.665  1.00 18.79 ? 180  TRP A CZ3 1 
ATOM   1394 C  CH2 . TRP A 1 180 ? 8.426   38.154 10.775  1.00 19.58 ? 180  TRP A CH2 1 
ATOM   1395 N  N   . SER A 1 181 ? 5.025   45.155 13.589  1.00 20.84 ? 181  SER A N   1 
ATOM   1396 C  CA  . SER A 1 181 ? 5.089   46.395 14.365  1.00 21.65 ? 181  SER A CA  1 
ATOM   1397 C  C   . SER A 1 181 ? 5.243   46.146 15.868  1.00 21.06 ? 181  SER A C   1 
ATOM   1398 O  O   . SER A 1 181 ? 5.667   47.042 16.607  1.00 21.21 ? 181  SER A O   1 
ATOM   1399 C  CB  . SER A 1 181 ? 3.801   47.205 14.173  1.00 22.16 ? 181  SER A CB  1 
ATOM   1400 O  OG  . SER A 1 181 ? 3.728   47.774 12.875  1.00 25.16 ? 181  SER A OG  1 
ATOM   1401 N  N   . LEU A 1 182 ? 4.846   44.960 16.325  1.00 19.99 ? 182  LEU A N   1 
ATOM   1402 C  CA  . LEU A 1 182 ? 4.855   44.637 17.740  1.00 20.12 ? 182  LEU A CA  1 
ATOM   1403 C  C   . LEU A 1 182 ? 5.987   43.681 18.180  1.00 20.01 ? 182  LEU A C   1 
ATOM   1404 O  O   . LEU A 1 182 ? 6.202   43.481 19.376  1.00 20.69 ? 182  LEU A O   1 
ATOM   1405 C  CB  . LEU A 1 182 ? 3.489   44.082 18.146  1.00 19.09 ? 182  LEU A CB  1 
ATOM   1406 C  CG  . LEU A 1 182 ? 2.286   45.008 17.999  1.00 18.53 ? 182  LEU A CG  1 
ATOM   1407 C  CD1 . LEU A 1 182 ? 0.975   44.239 18.259  1.00 14.74 ? 182  LEU A CD1 1 
ATOM   1408 C  CD2 . LEU A 1 182 ? 2.361   46.216 18.913  1.00 16.84 ? 182  LEU A CD2 1 
ATOM   1409 N  N   . VAL A 1 183 ? 6.722   43.088 17.251  1.00 20.17 ? 183  VAL A N   1 
ATOM   1410 C  CA  . VAL A 1 183 ? 7.732   42.070 17.666  1.00 20.57 ? 183  VAL A CA  1 
ATOM   1411 C  C   . VAL A 1 183 ? 8.718   42.537 18.748  1.00 21.35 ? 183  VAL A C   1 
ATOM   1412 O  O   . VAL A 1 183 ? 9.416   43.547 18.590  1.00 21.48 ? 183  VAL A O   1 
ATOM   1413 C  CB  . VAL A 1 183 ? 8.460   41.394 16.477  1.00 20.77 ? 183  VAL A CB  1 
ATOM   1414 C  CG1 . VAL A 1 183 ? 9.446   40.356 16.968  1.00 18.43 ? 183  VAL A CG1 1 
ATOM   1415 C  CG2 . VAL A 1 183 ? 7.441   40.658 15.642  1.00 22.71 ? 183  VAL A CG2 1 
ATOM   1416 N  N   . ASN A 1 184 ? 8.742   41.776 19.840  1.00 21.70 ? 184  ASN A N   1 
ATOM   1417 C  CA  . ASN A 1 184 ? 9.642   41.982 20.996  1.00 21.85 ? 184  ASN A CA  1 
ATOM   1418 C  C   . ASN A 1 184 ? 10.942  41.235 20.782  1.00 21.32 ? 184  ASN A C   1 
ATOM   1419 O  O   . ASN A 1 184 ? 11.121  40.097 21.214  1.00 20.55 ? 184  ASN A O   1 
ATOM   1420 C  CB  . ASN A 1 184 ? 8.966   41.499 22.277  1.00 22.41 ? 184  ASN A CB  1 
ATOM   1421 C  CG  . ASN A 1 184 ? 9.662   41.978 23.533  1.00 24.10 ? 184  ASN A CG  1 
ATOM   1422 O  OD1 . ASN A 1 184 ? 10.645  42.711 23.475  1.00 23.71 ? 184  ASN A OD1 1 
ATOM   1423 N  ND2 . ASN A 1 184 ? 9.162   41.534 24.688  1.00 26.48 ? 184  ASN A ND2 1 
ATOM   1424 N  N   . TRP A 1 185 ? 11.852  41.887 20.079  1.00 21.95 ? 185  TRP A N   1 
ATOM   1425 C  CA  . TRP A 1 185 ? 13.146  41.304 19.764  1.00 22.17 ? 185  TRP A CA  1 
ATOM   1426 C  C   . TRP A 1 185 ? 13.983  40.980 21.018  1.00 23.33 ? 185  TRP A C   1 
ATOM   1427 O  O   . TRP A 1 185 ? 14.809  40.051 20.990  1.00 23.26 ? 185  TRP A O   1 
ATOM   1428 C  CB  . TRP A 1 185 ? 13.895  42.215 18.791  1.00 22.64 ? 185  TRP A CB  1 
ATOM   1429 C  CG  . TRP A 1 185 ? 13.225  42.221 17.435  1.00 23.25 ? 185  TRP A CG  1 
ATOM   1430 C  CD1 . TRP A 1 185 ? 12.608  43.276 16.806  1.00 25.31 ? 185  TRP A CD1 1 
ATOM   1431 C  CD2 . TRP A 1 185 ? 13.053  41.086 16.578  1.00 24.64 ? 185  TRP A CD2 1 
ATOM   1432 N  NE1 . TRP A 1 185 ? 12.070  42.859 15.600  1.00 24.56 ? 185  TRP A NE1 1 
ATOM   1433 C  CE2 . TRP A 1 185 ? 12.345  41.522 15.435  1.00 25.06 ? 185  TRP A CE2 1 
ATOM   1434 C  CE3 . TRP A 1 185 ? 13.448  39.739 16.662  1.00 24.38 ? 185  TRP A CE3 1 
ATOM   1435 C  CZ2 . TRP A 1 185 ? 12.020  40.659 14.387  1.00 24.10 ? 185  TRP A CZ2 1 
ATOM   1436 C  CZ3 . TRP A 1 185 ? 13.123  38.888 15.624  1.00 24.75 ? 185  TRP A CZ3 1 
ATOM   1437 C  CH2 . TRP A 1 185 ? 12.411  39.350 14.504  1.00 24.86 ? 185  TRP A CH2 1 
ATOM   1438 N  N   . SER A 1 186 ? 13.740  41.717 22.108  1.00 23.77 ? 186  SER A N   1 
ATOM   1439 C  CA  . SER A 1 186 ? 14.338  41.411 23.432  1.00 23.98 ? 186  SER A CA  1 
ATOM   1440 C  C   . SER A 1 186 ? 14.070  39.991 23.851  1.00 23.50 ? 186  SER A C   1 
ATOM   1441 O  O   . SER A 1 186 ? 14.992  39.273 24.266  1.00 23.64 ? 186  SER A O   1 
ATOM   1442 C  CB  . SER A 1 186 ? 13.818  42.348 24.533  1.00 24.51 ? 186  SER A CB  1 
ATOM   1443 O  OG  . SER A 1 186 ? 14.036  43.697 24.151  1.00 27.59 ? 186  SER A OG  1 
ATOM   1444 N  N   . PHE A 1 187 ? 12.808  39.582 23.718  1.00 22.90 ? 187  PHE A N   1 
ATOM   1445 C  CA  . PHE A 1 187 ? 12.394  38.251 24.146  1.00 22.87 ? 187  PHE A CA  1 
ATOM   1446 C  C   . PHE A 1 187 ? 13.015  37.195 23.219  1.00 22.96 ? 187  PHE A C   1 
ATOM   1447 O  O   . PHE A 1 187 ? 13.579  36.196 23.680  1.00 21.26 ? 187  PHE A O   1 
ATOM   1448 C  CB  . PHE A 1 187 ? 10.850  38.171 24.173  1.00 23.20 ? 187  PHE A CB  1 
ATOM   1449 C  CG  . PHE A 1 187 ? 10.308  36.822 24.609  1.00 22.56 ? 187  PHE A CG  1 
ATOM   1450 C  CD1 . PHE A 1 187 ? 10.495  36.370 25.920  1.00 21.16 ? 187  PHE A CD1 1 
ATOM   1451 C  CD2 . PHE A 1 187 ? 9.610   36.006 23.705  1.00 22.00 ? 187  PHE A CD2 1 
ATOM   1452 C  CE1 . PHE A 1 187 ? 10.000  35.133 26.332  1.00 21.77 ? 187  PHE A CE1 1 
ATOM   1453 C  CE2 . PHE A 1 187 ? 9.105   34.765 24.102  1.00 19.05 ? 187  PHE A CE2 1 
ATOM   1454 C  CZ  . PHE A 1 187 ? 9.299   34.320 25.406  1.00 21.16 ? 187  PHE A CZ  1 
ATOM   1455 N  N   . VAL A 1 188 ? 12.931  37.430 21.908  1.00 22.98 ? 188  VAL A N   1 
ATOM   1456 C  CA  . VAL A 1 188 ? 13.580  36.526 20.946  1.00 23.50 ? 188  VAL A CA  1 
ATOM   1457 C  C   . VAL A 1 188 ? 15.072  36.369 21.240  1.00 25.03 ? 188  VAL A C   1 
ATOM   1458 O  O   . VAL A 1 188 ? 15.591  35.260 21.201  1.00 24.02 ? 188  VAL A O   1 
ATOM   1459 C  CB  . VAL A 1 188 ? 13.406  36.983 19.470  1.00 24.16 ? 188  VAL A CB  1 
ATOM   1460 C  CG1 . VAL A 1 188 ? 13.926  35.910 18.530  1.00 23.05 ? 188  VAL A CG1 1 
ATOM   1461 C  CG2 . VAL A 1 188 ? 11.967  37.284 19.161  1.00 20.70 ? 188  VAL A CG2 1 
ATOM   1462 N  N   . GLU A 1 189 ? 15.753  37.495 21.493  1.00 26.65 ? 189  GLU A N   1 
ATOM   1463 C  CA  . GLU A 1 189 ? 17.162  37.486 21.932  1.00 28.02 ? 189  GLU A CA  1 
ATOM   1464 C  C   . GLU A 1 189 ? 17.398  36.617 23.188  1.00 27.69 ? 189  GLU A C   1 
ATOM   1465 O  O   . GLU A 1 189 ? 18.300  35.787 23.185  1.00 27.84 ? 189  GLU A O   1 
ATOM   1466 C  CB  . GLU A 1 189 ? 17.670  38.912 22.146  1.00 29.23 ? 189  GLU A CB  1 
ATOM   1467 C  CG  . GLU A 1 189 ? 19.202  39.061 22.235  1.00 33.84 ? 189  GLU A CG  1 
ATOM   1468 C  CD  . GLU A 1 189 ? 19.862  39.619 20.958  1.00 39.91 ? 189  GLU A CD  1 
ATOM   1469 O  OE1 . GLU A 1 189 ? 19.202  39.692 19.882  1.00 40.38 ? 189  GLU A OE1 1 
ATOM   1470 O  OE2 . GLU A 1 189 ? 21.061  39.995 21.039  1.00 40.41 ? 189  GLU A OE2 1 
ATOM   1471 N  N   . GLU A 1 190 ? 16.570  36.794 24.228  1.00 27.40 ? 190  GLU A N   1 
ATOM   1472 C  CA  . GLU A 1 190 ? 16.600  35.948 25.435  1.00 27.04 ? 190  GLU A CA  1 
ATOM   1473 C  C   . GLU A 1 190 ? 16.486  34.460 25.109  1.00 27.67 ? 190  GLU A C   1 
ATOM   1474 O  O   . GLU A 1 190 ? 17.181  33.640 25.701  1.00 27.21 ? 190  GLU A O   1 
ATOM   1475 C  CB  . GLU A 1 190 ? 15.489  36.345 26.428  1.00 27.27 ? 190  GLU A CB  1 
ATOM   1476 C  CG  . GLU A 1 190 ? 15.305  35.377 27.634  0.50 26.66 ? 190  GLU A CG  1 
ATOM   1477 C  CD  . GLU A 1 190 ? 13.842  35.201 28.088  0.50 26.74 ? 190  GLU A CD  1 
ATOM   1478 O  OE1 . GLU A 1 190 ? 13.275  34.090 27.877  0.50 24.67 ? 190  GLU A OE1 1 
ATOM   1479 O  OE2 . GLU A 1 190 ? 13.261  36.161 28.654  0.50 24.27 ? 190  GLU A OE2 1 
ATOM   1480 N  N   . ASN A 1 191 ? 15.584  34.112 24.188  1.00 28.22 ? 191  ASN A N   1 
ATOM   1481 C  CA  . ASN A 1 191 ? 15.361  32.707 23.831  1.00 28.57 ? 191  ASN A CA  1 
ATOM   1482 C  C   . ASN A 1 191 ? 16.517  32.133 23.046  1.00 29.43 ? 191  ASN A C   1 
ATOM   1483 O  O   . ASN A 1 191 ? 16.789  30.947 23.148  1.00 29.19 ? 191  ASN A O   1 
ATOM   1484 C  CB  . ASN A 1 191 ? 14.072  32.551 23.010  1.00 28.93 ? 191  ASN A CB  1 
ATOM   1485 C  CG  . ASN A 1 191 ? 12.842  32.958 23.771  1.00 28.04 ? 191  ASN A CG  1 
ATOM   1486 O  OD1 . ASN A 1 191 ? 12.749  32.734 24.972  1.00 27.81 ? 191  ASN A OD1 1 
ATOM   1487 N  ND2 . ASN A 1 191 ? 11.884  33.571 23.079  1.00 28.47 ? 191  ASN A ND2 1 
ATOM   1488 N  N   . LEU A 1 192 ? 17.189  32.979 22.261  1.00 31.05 ? 192  LEU A N   1 
ATOM   1489 C  CA  . LEU A 1 192 ? 18.333  32.553 21.442  1.00 32.52 ? 192  LEU A CA  1 
ATOM   1490 C  C   . LEU A 1 192 ? 19.474  32.033 22.320  1.00 34.12 ? 192  LEU A C   1 
ATOM   1491 O  O   . LEU A 1 192 ? 20.155  31.070 21.959  1.00 34.94 ? 192  LEU A O   1 
ATOM   1492 C  CB  . LEU A 1 192 ? 18.806  33.698 20.539  1.00 31.97 ? 192  LEU A CB  1 
ATOM   1493 C  CG  . LEU A 1 192 ? 19.852  33.424 19.447  1.00 31.97 ? 192  LEU A CG  1 
ATOM   1494 C  CD1 . LEU A 1 192 ? 19.352  32.519 18.318  1.00 30.05 ? 192  LEU A CD1 1 
ATOM   1495 C  CD2 . LEU A 1 192 ? 20.362  34.734 18.874  1.00 32.52 ? 192  LEU A CD2 1 
ATOM   1496 N  N   . ALA A 1 193 ? 19.653  32.664 23.485  1.00 35.54 ? 193  ALA A N   1 
ATOM   1497 C  CA  . ALA A 1 193 ? 20.701  32.295 24.439  1.00 37.08 ? 193  ALA A CA  1 
ATOM   1498 C  C   . ALA A 1 193 ? 20.407  31.003 25.239  1.00 38.01 ? 193  ALA A C   1 
ATOM   1499 O  O   . ALA A 1 193 ? 21.253  30.542 26.012  1.00 38.42 ? 193  ALA A O   1 
ATOM   1500 C  CB  . ALA A 1 193 ? 20.984  33.485 25.399  1.00 36.78 ? 193  ALA A CB  1 
ATOM   1501 N  N   . LYS A 1 194 ? 19.219  30.421 25.048  1.00 39.24 ? 194  LYS A N   1 
ATOM   1502 C  CA  . LYS A 1 194 ? 18.830  29.192 25.766  1.00 40.08 ? 194  LYS A CA  1 
ATOM   1503 C  C   . LYS A 1 194 ? 19.441  27.903 25.188  1.00 40.81 ? 194  LYS A C   1 
ATOM   1504 O  O   . LYS A 1 194 ? 19.142  27.492 24.055  1.00 41.24 ? 194  LYS A O   1 
ATOM   1505 C  CB  . LYS A 1 194 ? 17.304  29.071 25.860  1.00 40.14 ? 194  LYS A CB  1 
ATOM   1506 C  CG  . LYS A 1 194 ? 16.662  30.065 26.819  1.00 39.53 ? 194  LYS A CG  1 
ATOM   1507 C  CD  . LYS A 1 194 ? 15.152  30.034 26.686  1.00 39.50 ? 194  LYS A CD  1 
ATOM   1508 C  CE  . LYS A 1 194 ? 14.580  28.763 27.251  1.00 39.98 ? 194  LYS A CE  1 
ATOM   1509 N  NZ  . LYS A 1 194 ? 13.122  28.898 27.503  1.00 39.34 ? 194  LYS A NZ  1 
ATOM   1510 N  N   . SER B 1 2   ? -14.113 26.628 -14.346 1.00 30.26 ? 2    SER B N   1 
ATOM   1511 C  CA  . SER B 1 2   ? -13.992 27.658 -13.287 1.00 28.68 ? 2    SER B CA  1 
ATOM   1512 C  C   . SER B 1 2   ? -15.280 27.782 -12.423 1.00 27.73 ? 2    SER B C   1 
ATOM   1513 O  O   . SER B 1 2   ? -16.388 28.047 -12.921 1.00 27.44 ? 2    SER B O   1 
ATOM   1514 C  CB  . SER B 1 2   ? -13.576 28.985 -13.927 1.00 28.86 ? 2    SER B CB  1 
ATOM   1515 O  OG  . SER B 1 2   ? -14.478 30.021 -13.591 1.00 31.09 ? 2    SER B OG  1 
ATOM   1516 N  N   . PHE B 1 3   ? -15.107 27.599 -11.116 1.00 25.83 ? 3    PHE B N   1 
ATOM   1517 C  CA  . PHE B 1 3   ? -16.212 27.701 -10.163 1.00 23.63 ? 3    PHE B CA  1 
ATOM   1518 C  C   . PHE B 1 3   ? -16.556 29.131 -9.822  1.00 23.09 ? 3    PHE B C   1 
ATOM   1519 O  O   . PHE B 1 3   ? -15.743 30.040 -9.956  1.00 22.26 ? 3    PHE B O   1 
ATOM   1520 C  CB  . PHE B 1 3   ? -15.916 26.898 -8.904  1.00 22.10 ? 3    PHE B CB  1 
ATOM   1521 C  CG  . PHE B 1 3   ? -15.684 25.464 -9.185  1.00 21.04 ? 3    PHE B CG  1 
ATOM   1522 C  CD1 . PHE B 1 3   ? -16.757 24.582 -9.294  1.00 19.23 ? 3    PHE B CD1 1 
ATOM   1523 C  CD2 . PHE B 1 3   ? -14.401 25.000 -9.402  1.00 19.95 ? 3    PHE B CD2 1 
ATOM   1524 C  CE1 . PHE B 1 3   ? -16.528 23.233 -9.585  1.00 19.72 ? 3    PHE B CE1 1 
ATOM   1525 C  CE2 . PHE B 1 3   ? -14.162 23.666 -9.692  1.00 20.70 ? 3    PHE B CE2 1 
ATOM   1526 C  CZ  . PHE B 1 3   ? -15.240 22.789 -9.789  1.00 16.67 ? 3    PHE B CZ  1 
ATOM   1527 N  N   . GLU B 1 4   ? -17.806 29.316 -9.435  1.00 23.42 ? 4    GLU B N   1 
ATOM   1528 C  CA  . GLU B 1 4   ? -18.305 30.615 -9.005  1.00 24.32 ? 4    GLU B CA  1 
ATOM   1529 C  C   . GLU B 1 4   ? -18.772 30.451 -7.587  1.00 23.09 ? 4    GLU B C   1 
ATOM   1530 O  O   . GLU B 1 4   ? -19.079 29.332 -7.151  1.00 23.00 ? 4    GLU B O   1 
ATOM   1531 C  CB  . GLU B 1 4   ? -19.506 31.031 -9.852  1.00 24.43 ? 4    GLU B CB  1 
ATOM   1532 C  CG  . GLU B 1 4   ? -19.161 31.337 -11.285 1.00 30.26 ? 4    GLU B CG  1 
ATOM   1533 C  CD  . GLU B 1 4   ? -20.402 31.503 -12.102 1.00 36.43 ? 4    GLU B CD  1 
ATOM   1534 O  OE1 . GLU B 1 4   ? -20.985 30.463 -12.504 1.00 40.17 ? 4    GLU B OE1 1 
ATOM   1535 O  OE2 . GLU B 1 4   ? -20.816 32.665 -12.311 1.00 38.56 ? 4    GLU B OE2 1 
ATOM   1536 N  N   . LEU B 1 5   ? -18.842 31.582 -6.896  1.00 22.52 ? 5    LEU B N   1 
ATOM   1537 C  CA  . LEU B 1 5   ? -19.430 31.697 -5.569  1.00 20.98 ? 5    LEU B CA  1 
ATOM   1538 C  C   . LEU B 1 5   ? -20.919 31.460 -5.621  1.00 20.36 ? 5    LEU B C   1 
ATOM   1539 O  O   . LEU B 1 5   ? -21.640 32.249 -6.232  1.00 18.88 ? 5    LEU B O   1 
ATOM   1540 C  CB  . LEU B 1 5   ? -19.179 33.120 -5.046  1.00 20.86 ? 5    LEU B CB  1 
ATOM   1541 C  CG  . LEU B 1 5   ? -19.798 33.643 -3.725  1.00 21.32 ? 5    LEU B CG  1 
ATOM   1542 C  CD1 . LEU B 1 5   ? -19.382 32.783 -2.558  1.00 19.27 ? 5    LEU B CD1 1 
ATOM   1543 C  CD2 . LEU B 1 5   ? -19.377 35.065 -3.507  1.00 21.24 ? 5    LEU B CD2 1 
ATOM   1544 N  N   . PRO B 1 6   ? -21.401 30.386 -4.962  1.00 20.61 ? 6    PRO B N   1 
ATOM   1545 C  CA  . PRO B 1 6   ? -22.830 30.101 -4.934  1.00 20.90 ? 6    PRO B CA  1 
ATOM   1546 C  C   . PRO B 1 6   ? -23.582 31.212 -4.191  1.00 21.53 ? 6    PRO B C   1 
ATOM   1547 O  O   . PRO B 1 6   ? -23.128 31.684 -3.169  1.00 22.88 ? 6    PRO B O   1 
ATOM   1548 C  CB  . PRO B 1 6   ? -22.901 28.780 -4.155  1.00 21.19 ? 6    PRO B CB  1 
ATOM   1549 C  CG  . PRO B 1 6   ? -21.549 28.203 -4.213  1.00 20.83 ? 6    PRO B CG  1 
ATOM   1550 C  CD  . PRO B 1 6   ? -20.626 29.365 -4.223  1.00 19.87 ? 6    PRO B CD  1 
ATOM   1551 N  N   . ALA B 1 7   ? -24.731 31.612 -4.700  1.00 22.11 ? 7    ALA B N   1 
ATOM   1552 C  CA  . ALA B 1 7   ? -25.489 32.708 -4.142  1.00 21.45 ? 7    ALA B CA  1 
ATOM   1553 C  C   . ALA B 1 7   ? -26.033 32.257 -2.783  1.00 21.70 ? 7    ALA B C   1 
ATOM   1554 O  O   . ALA B 1 7   ? -26.337 31.070 -2.617  1.00 21.82 ? 7    ALA B O   1 
ATOM   1555 C  CB  . ALA B 1 7   ? -26.626 32.998 -5.057  1.00 23.11 ? 7    ALA B CB  1 
ATOM   1556 N  N   . LEU B 1 8   ? -26.166 33.171 -1.814  1.00 20.89 ? 8    LEU B N   1 
ATOM   1557 C  CA  . LEU B 1 8   ? -26.764 32.753 -0.518  1.00 19.97 ? 8    LEU B CA  1 
ATOM   1558 C  C   . LEU B 1 8   ? -28.208 32.417 -0.764  1.00 19.58 ? 8    LEU B C   1 
ATOM   1559 O  O   . LEU B 1 8   ? -28.835 33.085 -1.569  1.00 19.68 ? 8    LEU B O   1 
ATOM   1560 C  CB  . LEU B 1 8   ? -26.714 33.885 0.516   1.00 20.09 ? 8    LEU B CB  1 
ATOM   1561 C  CG  . LEU B 1 8   ? -25.596 34.034 1.528   1.00 20.39 ? 8    LEU B CG  1 
ATOM   1562 C  CD1 . LEU B 1 8   ? -25.985 35.201 2.437   1.00 18.05 ? 8    LEU B CD1 1 
ATOM   1563 C  CD2 . LEU B 1 8   ? -25.357 32.806 2.325   1.00 16.24 ? 8    LEU B CD2 1 
ATOM   1564 N  N   . PRO B 1 9   ? -28.748 31.374 -0.101  1.00 18.81 ? 9    PRO B N   1 
ATOM   1565 C  CA  . PRO B 1 9   ? -30.177 31.051 -0.285  1.00 18.16 ? 9    PRO B CA  1 
ATOM   1566 C  C   . PRO B 1 9   ? -31.239 31.912 0.390   1.00 18.37 ? 9    PRO B C   1 
ATOM   1567 O  O   . PRO B 1 9   ? -32.420 31.576 0.279   1.00 19.50 ? 9    PRO B O   1 
ATOM   1568 C  CB  . PRO B 1 9   ? -30.299 29.612 0.226   1.00 17.26 ? 9    PRO B CB  1 
ATOM   1569 C  CG  . PRO B 1 9   ? -29.187 29.406 1.107   1.00 18.26 ? 9    PRO B CG  1 
ATOM   1570 C  CD  . PRO B 1 9   ? -28.060 30.358 0.727   1.00 18.64 ? 9    PRO B CD  1 
ATOM   1571 N  N   . PHE B 1 10  ? -30.857 33.007 1.041   1.00 17.33 ? 10   PHE B N   1 
ATOM   1572 C  CA  . PHE B 1 10  ? -31.809 33.845 1.791   1.00 17.11 ? 10   PHE B CA  1 
ATOM   1573 C  C   . PHE B 1 10  ? -31.207 35.259 1.774   1.00 17.75 ? 10   PHE B C   1 
ATOM   1574 O  O   . PHE B 1 10  ? -30.035 35.424 1.423   1.00 17.50 ? 10   PHE B O   1 
ATOM   1575 C  CB  . PHE B 1 10  ? -31.972 33.310 3.238   1.00 15.88 ? 10   PHE B CB  1 
ATOM   1576 C  CG  . PHE B 1 10  ? -30.693 32.751 3.847   1.00 14.91 ? 10   PHE B CG  1 
ATOM   1577 C  CD1 . PHE B 1 10  ? -29.666 33.585 4.260   1.00 16.70 ? 10   PHE B CD1 1 
ATOM   1578 C  CD2 . PHE B 1 10  ? -30.543 31.383 3.997   1.00 14.33 ? 10   PHE B CD2 1 
ATOM   1579 C  CE1 . PHE B 1 10  ? -28.498 33.070 4.806   1.00 11.00 ? 10   PHE B CE1 1 
ATOM   1580 C  CE2 . PHE B 1 10  ? -29.380 30.826 4.540   1.00 12.19 ? 10   PHE B CE2 1 
ATOM   1581 C  CZ  . PHE B 1 10  ? -28.340 31.660 4.935   1.00 12.61 ? 10   PHE B CZ  1 
ATOM   1582 N  N   . ALA B 1 11  ? -31.972 36.287 2.150   1.00 19.32 ? 11   ALA B N   1 
ATOM   1583 C  CA  . ALA B 1 11  ? -31.402 37.645 2.207   1.00 20.51 ? 11   ALA B CA  1 
ATOM   1584 C  C   . ALA B 1 11  ? -30.389 37.810 3.325   1.00 22.22 ? 11   ALA B C   1 
ATOM   1585 O  O   . ALA B 1 11  ? -30.354 37.019 4.270   1.00 22.80 ? 11   ALA B O   1 
ATOM   1586 C  CB  . ALA B 1 11  ? -32.488 38.654 2.389   1.00 20.47 ? 11   ALA B CB  1 
ATOM   1587 N  N   . LYS B 1 12  ? -29.567 38.852 3.234   1.00 23.49 ? 12   LYS B N   1 
ATOM   1588 C  CA  . LYS B 1 12  ? -28.517 39.089 4.216   1.00 25.05 ? 12   LYS B CA  1 
ATOM   1589 C  C   . LYS B 1 12  ? -28.998 39.287 5.661   1.00 25.00 ? 12   LYS B C   1 
ATOM   1590 O  O   . LYS B 1 12  ? -28.248 39.002 6.602   1.00 24.89 ? 12   LYS B O   1 
ATOM   1591 C  CB  . LYS B 1 12  ? -27.670 40.293 3.805   1.00 25.24 ? 12   LYS B CB  1 
ATOM   1592 C  CG  . LYS B 1 12  ? -26.609 39.972 2.771   1.00 27.90 ? 12   LYS B CG  1 
ATOM   1593 C  CD  . LYS B 1 12  ? -25.674 38.877 3.247   1.00 28.07 ? 12   LYS B CD  1 
ATOM   1594 C  CE  . LYS B 1 12  ? -24.567 38.652 2.240   1.00 30.98 ? 12   LYS B CE  1 
ATOM   1595 N  NZ  . LYS B 1 12  ? -23.789 39.900 1.978   1.00 32.22 ? 12   LYS B NZ  1 
ATOM   1596 N  N   . ASP B 1 13  ? -30.217 39.786 5.834   1.00 25.38 ? 13   ASP B N   1 
ATOM   1597 C  CA  . ASP B 1 13  ? -30.786 40.026 7.158   1.00 25.91 ? 13   ASP B CA  1 
ATOM   1598 C  C   . ASP B 1 13  ? -31.839 38.985 7.540   1.00 25.15 ? 13   ASP B C   1 
ATOM   1599 O  O   . ASP B 1 13  ? -32.605 39.179 8.495   1.00 26.05 ? 13   ASP B O   1 
ATOM   1600 C  CB  . ASP B 1 13  ? -31.367 41.460 7.257   1.00 26.20 ? 13   ASP B CB  1 
ATOM   1601 C  CG  . ASP B 1 13  ? -32.551 41.709 6.307   1.00 29.61 ? 13   ASP B CG  1 
ATOM   1602 O  OD1 . ASP B 1 13  ? -32.948 40.801 5.548   1.00 30.00 ? 13   ASP B OD1 1 
ATOM   1603 O  OD2 . ASP B 1 13  ? -33.098 42.845 6.324   1.00 33.87 ? 13   ASP B OD2 1 
ATOM   1604 N  N   . ALA B 1 14  ? -31.880 37.874 6.811   1.00 24.51 ? 14   ALA B N   1 
ATOM   1605 C  CA  . ALA B 1 14  ? -32.903 36.861 7.059   1.00 23.53 ? 14   ALA B CA  1 
ATOM   1606 C  C   . ALA B 1 14  ? -32.696 36.101 8.377   1.00 22.80 ? 14   ALA B C   1 
ATOM   1607 O  O   . ALA B 1 14  ? -33.628 35.499 8.892   1.00 23.31 ? 14   ALA B O   1 
ATOM   1608 C  CB  . ALA B 1 14  ? -32.999 35.889 5.885   1.00 23.25 ? 14   ALA B CB  1 
ATOM   1609 N  N   . LEU B 1 15  ? -31.468 36.081 8.890   1.00 21.95 ? 15   LEU B N   1 
ATOM   1610 C  CA  . LEU B 1 15  ? -31.181 35.237 10.040  1.00 21.27 ? 15   LEU B CA  1 
ATOM   1611 C  C   . LEU B 1 15  ? -31.083 36.034 11.322  1.00 22.83 ? 15   LEU B C   1 
ATOM   1612 O  O   . LEU B 1 15  ? -30.724 35.472 12.369  1.00 23.02 ? 15   LEU B O   1 
ATOM   1613 C  CB  . LEU B 1 15  ? -29.883 34.434 9.838   1.00 19.73 ? 15   LEU B CB  1 
ATOM   1614 C  CG  . LEU B 1 15  ? -29.742 33.720 8.493   1.00 16.17 ? 15   LEU B CG  1 
ATOM   1615 C  CD1 . LEU B 1 15  ? -28.453 32.990 8.497   1.00 12.69 ? 15   LEU B CD1 1 
ATOM   1616 C  CD2 . LEU B 1 15  ? -30.918 32.742 8.238   1.00 12.25 ? 15   LEU B CD2 1 
ATOM   1617 N  N   . GLU B 1 16  ? -31.395 37.329 11.236  1.00 23.44 ? 16   GLU B N   1 
ATOM   1618 C  CA  . GLU B 1 16  ? -31.366 38.242 12.378  1.00 23.98 ? 16   GLU B CA  1 
ATOM   1619 C  C   . GLU B 1 16  ? -32.478 37.896 13.361  1.00 24.09 ? 16   GLU B C   1 
ATOM   1620 O  O   . GLU B 1 16  ? -33.530 37.390 12.949  1.00 22.85 ? 16   GLU B O   1 
ATOM   1621 C  CB  . GLU B 1 16  ? -31.502 39.696 11.917  1.00 24.73 ? 16   GLU B CB  1 
ATOM   1622 C  CG  . GLU B 1 16  ? -30.438 40.164 10.943  1.00 27.33 ? 16   GLU B CG  1 
ATOM   1623 C  CD  . GLU B 1 16  ? -29.318 40.978 11.584  1.00 32.85 ? 16   GLU B CD  1 
ATOM   1624 O  OE1 . GLU B 1 16  ? -28.475 41.522 10.829  1.00 33.55 ? 16   GLU B OE1 1 
ATOM   1625 O  OE2 . GLU B 1 16  ? -29.262 41.080 12.842  1.00 35.72 ? 16   GLU B OE2 1 
ATOM   1626 N  N   . PRO B 1 17  ? -32.244 38.123 14.674  1.00 24.41 ? 17   PRO B N   1 
ATOM   1627 C  CA  . PRO B 1 17  ? -31.024 38.632 15.302  1.00 23.77 ? 17   PRO B CA  1 
ATOM   1628 C  C   . PRO B 1 17  ? -29.981 37.567 15.604  1.00 23.17 ? 17   PRO B C   1 
ATOM   1629 O  O   . PRO B 1 17  ? -28.988 37.886 16.234  1.00 24.90 ? 17   PRO B O   1 
ATOM   1630 C  CB  . PRO B 1 17  ? -31.525 39.238 16.623  1.00 24.69 ? 17   PRO B CB  1 
ATOM   1631 C  CG  . PRO B 1 17  ? -32.848 38.589 16.901  1.00 24.53 ? 17   PRO B CG  1 
ATOM   1632 C  CD  . PRO B 1 17  ? -33.298 37.837 15.669  1.00 24.73 ? 17   PRO B CD  1 
ATOM   1633 N  N   . HIS B 1 18  ? -30.181 36.337 15.128  1.00 22.28 ? 18   HIS B N   1 
ATOM   1634 C  CA  . HIS B 1 18  ? -29.318 35.179 15.484  1.00 21.02 ? 18   HIS B CA  1 
ATOM   1635 C  C   . HIS B 1 18  ? -27.954 35.162 14.843  1.00 20.21 ? 18   HIS B C   1 
ATOM   1636 O  O   . HIS B 1 18  ? -26.918 34.954 15.521  1.00 19.36 ? 18   HIS B O   1 
ATOM   1637 C  CB  . HIS B 1 18  ? -30.046 33.879 15.170  1.00 21.10 ? 18   HIS B CB  1 
ATOM   1638 C  CG  . HIS B 1 18  ? -31.431 33.831 15.722  1.00 22.29 ? 18   HIS B CG  1 
ATOM   1639 N  ND1 . HIS B 1 18  ? -31.688 33.714 17.071  1.00 24.60 ? 18   HIS B ND1 1 
ATOM   1640 C  CD2 . HIS B 1 18  ? -32.639 33.880 15.110  1.00 24.19 ? 18   HIS B CD2 1 
ATOM   1641 C  CE1 . HIS B 1 18  ? -32.992 33.705 17.266  1.00 23.13 ? 18   HIS B CE1 1 
ATOM   1642 N  NE2 . HIS B 1 18  ? -33.591 33.810 16.093  1.00 24.48 ? 18   HIS B NE2 1 
ATOM   1643 N  N   . ILE B 1 19  ? -27.931 35.366 13.531  1.00 18.96 ? 19   ILE B N   1 
ATOM   1644 C  CA  . ILE B 1 19  ? -26.666 35.564 12.827  1.00 17.80 ? 19   ILE B CA  1 
ATOM   1645 C  C   . ILE B 1 19  ? -26.824 36.870 12.069  1.00 17.17 ? 19   ILE B C   1 
ATOM   1646 O  O   . ILE B 1 19  ? -27.855 37.080 11.431  1.00 17.63 ? 19   ILE B O   1 
ATOM   1647 C  CB  . ILE B 1 19  ? -26.312 34.355 11.892  1.00 17.29 ? 19   ILE B CB  1 
ATOM   1648 C  CG1 . ILE B 1 19  ? -25.986 33.137 12.756  1.00 17.29 ? 19   ILE B CG1 1 
ATOM   1649 C  CG2 . ILE B 1 19  ? -25.132 34.709 11.009  1.00 16.06 ? 19   ILE B CG2 1 
ATOM   1650 C  CD1 . ILE B 1 19  ? -25.580 31.899 11.977  1.00 16.94 ? 19   ILE B CD1 1 
ATOM   1651 N  N   . SER B 1 20  ? -25.877 37.787 12.226  1.00 16.26 ? 20   SER B N   1 
ATOM   1652 C  CA  . SER B 1 20  ? -26.036 39.115 11.641  1.00 16.70 ? 20   SER B CA  1 
ATOM   1653 C  C   . SER B 1 20  ? -25.731 39.190 10.146  1.00 16.11 ? 20   SER B C   1 
ATOM   1654 O  O   . SER B 1 20  ? -25.065 38.342 9.572   1.00 15.94 ? 20   SER B O   1 
ATOM   1655 C  CB  . SER B 1 20  ? -25.127 40.100 12.358  1.00 15.71 ? 20   SER B CB  1 
ATOM   1656 O  OG  . SER B 1 20  ? -23.789 39.683 12.185  1.00 17.21 ? 20   SER B OG  1 
ATOM   1657 N  N   . ALA B 1 21  ? -26.183 40.260 9.518   1.00 15.77 ? 21   ALA B N   1 
ATOM   1658 C  CA  . ALA B 1 21  ? -25.862 40.524 8.144   1.00 15.90 ? 21   ALA B CA  1 
ATOM   1659 C  C   . ALA B 1 21  ? -24.363 40.710 7.997   1.00 15.90 ? 21   ALA B C   1 
ATOM   1660 O  O   . ALA B 1 21  ? -23.757 40.323 6.985   1.00 16.52 ? 21   ALA B O   1 
ATOM   1661 C  CB  . ALA B 1 21  ? -26.617 41.782 7.676   1.00 15.50 ? 21   ALA B CB  1 
ATOM   1662 N  N   . GLU B 1 22  ? -23.749 41.277 9.024   1.00 17.17 ? 22   GLU B N   1 
ATOM   1663 C  CA  . GLU B 1 22  ? -22.329 41.527 8.935   1.00 17.53 ? 22   GLU B CA  1 
ATOM   1664 C  C   . GLU B 1 22  ? -21.608 40.230 8.820   1.00 17.91 ? 22   GLU B C   1 
ATOM   1665 O  O   . GLU B 1 22  ? -20.665 40.111 8.037   1.00 18.28 ? 22   GLU B O   1 
ATOM   1666 C  CB  . GLU B 1 22  ? -21.788 42.292 10.131  1.00 18.08 ? 22   GLU B CB  1 
ATOM   1667 C  CG  . GLU B 1 22  ? -20.284 42.530 9.995   1.00 17.72 ? 22   GLU B CG  1 
ATOM   1668 C  CD  . GLU B 1 22  ? -19.678 43.384 11.114  1.00 20.31 ? 22   GLU B CD  1 
ATOM   1669 O  OE1 . GLU B 1 22  ? -20.400 43.713 12.068  1.00 24.21 ? 22   GLU B OE1 1 
ATOM   1670 O  OE2 . GLU B 1 22  ? -18.464 43.732 11.038  1.00 21.65 ? 22   GLU B OE2 1 
ATOM   1671 N  N   . THR B 1 23  ? -22.044 39.246 9.611   1.00 17.68 ? 23   THR B N   1 
ATOM   1672 C  CA  . THR B 1 23  ? -21.378 37.931 9.630   1.00 17.51 ? 23   THR B CA  1 
ATOM   1673 C  C   . THR B 1 23  ? -21.501 37.290 8.242   1.00 17.30 ? 23   THR B C   1 
ATOM   1674 O  O   . THR B 1 23  ? -20.539 36.731 7.697   1.00 16.87 ? 23   THR B O   1 
ATOM   1675 C  CB  . THR B 1 23  ? -21.976 37.016 10.713  1.00 17.47 ? 23   THR B CB  1 
ATOM   1676 O  OG1 . THR B 1 23  ? -21.454 37.424 11.995  1.00 16.70 ? 23   THR B OG1 1 
ATOM   1677 C  CG2 . THR B 1 23  ? -21.549 35.576 10.478  1.00 17.80 ? 23   THR B CG2 1 
ATOM   1678 N  N   . LEU B 1 24  ? -22.703 37.366 7.689   1.00 16.70 ? 24   LEU B N   1 
ATOM   1679 C  CA  . LEU B 1 24  ? -22.945 36.878 6.341   1.00 17.55 ? 24   LEU B CA  1 
ATOM   1680 C  C   . LEU B 1 24  ? -22.105 37.586 5.269   1.00 17.78 ? 24   LEU B C   1 
ATOM   1681 O  O   . LEU B 1 24  ? -21.630 36.949 4.330   1.00 17.47 ? 24   LEU B O   1 
ATOM   1682 C  CB  . LEU B 1 24  ? -24.436 36.947 6.003   1.00 17.13 ? 24   LEU B CB  1 
ATOM   1683 C  CG  . LEU B 1 24  ? -25.332 36.052 6.861   1.00 19.73 ? 24   LEU B CG  1 
ATOM   1684 C  CD1 . LEU B 1 24  ? -26.780 36.277 6.530   1.00 17.21 ? 24   LEU B CD1 1 
ATOM   1685 C  CD2 . LEU B 1 24  ? -24.989 34.599 6.697   1.00 19.87 ? 24   LEU B CD2 1 
ATOM   1686 N  N   . ASP B 1 25  ? -21.921 38.892 5.427   1.00 17.76 ? 25   ASP B N   1 
ATOM   1687 C  CA  . ASP B 1 25  ? -21.064 39.688 4.545   1.00 18.83 ? 25   ASP B CA  1 
ATOM   1688 C  C   . ASP B 1 25  ? -19.644 39.160 4.497   1.00 17.95 ? 25   ASP B C   1 
ATOM   1689 O  O   . ASP B 1 25  ? -19.060 39.128 3.432   1.00 18.66 ? 25   ASP B O   1 
ATOM   1690 C  CB  . ASP B 1 25  ? -20.974 41.139 5.017   1.00 19.72 ? 25   ASP B CB  1 
ATOM   1691 C  CG  . ASP B 1 25  ? -22.166 41.963 4.616   1.00 22.68 ? 25   ASP B CG  1 
ATOM   1692 O  OD1 . ASP B 1 25  ? -22.924 41.495 3.749   1.00 24.59 ? 25   ASP B OD1 1 
ATOM   1693 O  OD2 . ASP B 1 25  ? -22.362 43.067 5.185   1.00 25.18 ? 25   ASP B OD2 1 
ATOM   1694 N  N   . TYR B 1 26  ? -19.087 38.792 5.656   1.00 16.95 ? 26   TYR B N   1 
ATOM   1695 C  CA  . TYR B 1 26  ? -17.745 38.234 5.726   1.00 15.90 ? 26   TYR B CA  1 
ATOM   1696 C  C   . TYR B 1 26  ? -17.677 36.756 5.442   1.00 15.19 ? 26   TYR B C   1 
ATOM   1697 O  O   . TYR B 1 26  ? -16.856 36.312 4.635   1.00 15.44 ? 26   TYR B O   1 
ATOM   1698 C  CB  . TYR B 1 26  ? -17.098 38.520 7.103   1.00 15.97 ? 26   TYR B CB  1 
ATOM   1699 C  CG  . TYR B 1 26  ? -16.643 39.946 7.237   1.00 14.79 ? 26   TYR B CG  1 
ATOM   1700 C  CD1 . TYR B 1 26  ? -17.490 40.914 7.764   1.00 14.39 ? 26   TYR B CD1 1 
ATOM   1701 C  CD2 . TYR B 1 26  ? -15.397 40.336 6.791   1.00 14.31 ? 26   TYR B CD2 1 
ATOM   1702 C  CE1 . TYR B 1 26  ? -17.074 42.240 7.897   1.00 17.31 ? 26   TYR B CE1 1 
ATOM   1703 C  CE2 . TYR B 1 26  ? -14.993 41.645 6.889   1.00 14.66 ? 26   TYR B CE2 1 
ATOM   1704 C  CZ  . TYR B 1 26  ? -15.823 42.590 7.442   1.00 16.62 ? 26   TYR B CZ  1 
ATOM   1705 O  OH  . TYR B 1 26  ? -15.399 43.911 7.539   1.00 19.23 ? 26   TYR B OH  1 
ATOM   1706 N  N   . HIS B 1 27  ? -18.557 35.974 6.058   1.00 14.78 ? 27   HIS B N   1 
ATOM   1707 C  CA  . HIS B 1 27  ? -18.419 34.535 5.979   1.00 13.13 ? 27   HIS B CA  1 
ATOM   1708 C  C   . HIS B 1 27  ? -18.695 34.066 4.532   1.00 13.34 ? 27   HIS B C   1 
ATOM   1709 O  O   . HIS B 1 27  ? -17.945 33.248 3.996   1.00 11.93 ? 27   HIS B O   1 
ATOM   1710 C  CB  . HIS B 1 27  ? -19.347 33.852 7.015   1.00 12.61 ? 27   HIS B CB  1 
ATOM   1711 C  CG  . HIS B 1 27  ? -19.011 32.409 7.283   1.00 9.89  ? 27   HIS B CG  1 
ATOM   1712 N  ND1 . HIS B 1 27  ? -19.744 31.639 8.154   1.00 6.94  ? 27   HIS B ND1 1 
ATOM   1713 C  CD2 . HIS B 1 27  ? -18.018 31.607 6.825   1.00 9.86  ? 27   HIS B CD2 1 
ATOM   1714 C  CE1 . HIS B 1 27  ? -19.247 30.412 8.204   1.00 11.93 ? 27   HIS B CE1 1 
ATOM   1715 N  NE2 . HIS B 1 27  ? -18.187 30.362 7.421   1.00 6.71  ? 27   HIS B NE2 1 
ATOM   1716 N  N   . HIS B 1 28  ? -19.774 34.574 3.927   1.00 13.69 ? 28   HIS B N   1 
ATOM   1717 C  CA  . HIS B 1 28  ? -20.140 34.252 2.543   1.00 14.73 ? 28   HIS B CA  1 
ATOM   1718 C  C   . HIS B 1 28  ? -19.326 35.105 1.582   1.00 15.18 ? 28   HIS B C   1 
ATOM   1719 O  O   . HIS B 1 28  ? -18.615 34.581 0.738   1.00 14.59 ? 28   HIS B O   1 
ATOM   1720 C  CB  . HIS B 1 28  ? -21.644 34.457 2.288   1.00 14.52 ? 28   HIS B CB  1 
ATOM   1721 C  CG  . HIS B 1 28  ? -22.061 34.183 0.862   1.00 16.27 ? 28   HIS B CG  1 
ATOM   1722 N  ND1 . HIS B 1 28  ? -22.369 35.190 -0.029  1.00 17.91 ? 28   HIS B ND1 1 
ATOM   1723 C  CD2 . HIS B 1 28  ? -22.163 33.021 0.162   1.00 17.91 ? 28   HIS B CD2 1 
ATOM   1724 C  CE1 . HIS B 1 28  ? -22.689 34.658 -1.200  1.00 18.60 ? 28   HIS B CE1 1 
ATOM   1725 N  NE2 . HIS B 1 28  ? -22.548 33.348 -1.121  1.00 19.01 ? 28   HIS B NE2 1 
ATOM   1726 N  N   . GLY B 1 29  ? -19.405 36.423 1.741   1.00 15.48 ? 29   GLY B N   1 
ATOM   1727 C  CA  . GLY B 1 29  ? -18.782 37.335 0.778   1.00 16.92 ? 29   GLY B CA  1 
ATOM   1728 C  C   . GLY B 1 29  ? -17.275 37.232 0.670   1.00 18.21 ? 29   GLY B C   1 
ATOM   1729 O  O   . GLY B 1 29  ? -16.687 37.480 -0.392  1.00 18.89 ? 29   GLY B O   1 
ATOM   1730 N  N   . LYS B 1 30  ? -16.630 36.879 1.767   1.00 18.62 ? 30   LYS B N   1 
ATOM   1731 C  CA  . LYS B 1 30  ? -15.184 36.862 1.789   1.00 18.71 ? 30   LYS B CA  1 
ATOM   1732 C  C   . LYS B 1 30  ? -14.657 35.457 1.887   1.00 18.27 ? 30   LYS B C   1 
ATOM   1733 O  O   . LYS B 1 30  ? -13.947 35.012 0.992   1.00 19.37 ? 30   LYS B O   1 
ATOM   1734 C  CB  . LYS B 1 30  ? -14.627 37.725 2.917   1.00 19.44 ? 30   LYS B CB  1 
ATOM   1735 C  CG  . LYS B 1 30  ? -15.215 39.130 2.960   1.00 22.26 ? 30   LYS B CG  1 
ATOM   1736 C  CD  . LYS B 1 30  ? -14.749 39.941 1.799   1.00 27.05 ? 30   LYS B CD  1 
ATOM   1737 C  CE  . LYS B 1 30  ? -15.513 41.263 1.673   1.00 31.01 ? 30   LYS B CE  1 
ATOM   1738 N  NZ  . LYS B 1 30  ? -15.476 41.979 2.964   1.00 31.59 ? 30   LYS B NZ  1 
ATOM   1739 N  N   . HIS B 1 31  ? -14.983 34.751 2.965   1.00 16.87 ? 31   HIS B N   1 
ATOM   1740 C  CA  . HIS B 1 31  ? -14.370 33.455 3.216   1.00 15.03 ? 31   HIS B CA  1 
ATOM   1741 C  C   . HIS B 1 31  ? -14.742 32.412 2.185   1.00 14.50 ? 31   HIS B C   1 
ATOM   1742 O  O   . HIS B 1 31  ? -13.872 31.797 1.623   1.00 15.34 ? 31   HIS B O   1 
ATOM   1743 C  CB  . HIS B 1 31  ? -14.764 32.930 4.594   1.00 15.71 ? 31   HIS B CB  1 
ATOM   1744 C  CG  . HIS B 1 31  ? -14.170 33.689 5.742   1.00 11.88 ? 31   HIS B CG  1 
ATOM   1745 N  ND1 . HIS B 1 31  ? -12.950 33.367 6.283   1.00 11.05 ? 31   HIS B ND1 1 
ATOM   1746 C  CD2 . HIS B 1 31  ? -14.650 34.712 6.483   1.00 10.05 ? 31   HIS B CD2 1 
ATOM   1747 C  CE1 . HIS B 1 31  ? -12.694 34.157 7.306   1.00 11.05 ? 31   HIS B CE1 1 
ATOM   1748 N  NE2 . HIS B 1 31  ? -13.706 34.992 7.444   1.00 12.58 ? 31   HIS B NE2 1 
ATOM   1749 N  N   . HIS B 1 32  ? -16.038 32.175 1.983   1.00 14.22 ? 32   HIS B N   1 
ATOM   1750 C  CA  . HIS B 1 32  ? -16.520 31.226 0.986   1.00 13.57 ? 32   HIS B CA  1 
ATOM   1751 C  C   . HIS B 1 32  ? -15.988 31.634 -0.395  1.00 13.75 ? 32   HIS B C   1 
ATOM   1752 O  O   . HIS B 1 32  ? -15.569 30.777 -1.126  1.00 14.25 ? 32   HIS B O   1 
ATOM   1753 C  CB  . HIS B 1 32  ? -18.068 31.244 0.963   1.00 12.15 ? 32   HIS B CB  1 
ATOM   1754 C  CG  . HIS B 1 32  ? -18.698 30.043 0.308   1.00 13.90 ? 32   HIS B CG  1 
ATOM   1755 N  ND1 . HIS B 1 32  ? -20.059 29.866 0.255   1.00 13.78 ? 32   HIS B ND1 1 
ATOM   1756 C  CD2 . HIS B 1 32  ? -18.157 28.970 -0.324  1.00 13.05 ? 32   HIS B CD2 1 
ATOM   1757 C  CE1 . HIS B 1 32  ? -20.338 28.730 -0.362  1.00 10.65 ? 32   HIS B CE1 1 
ATOM   1758 N  NE2 . HIS B 1 32  ? -19.200 28.162 -0.721  1.00 14.10 ? 32   HIS B NE2 1 
ATOM   1759 N  N   . ASN B 1 33  ? -16.053 32.922 -0.761  1.00 14.03 ? 33   ASN B N   1 
ATOM   1760 C  CA  . ASN B 1 33  ? -15.509 33.342 -2.053  1.00 14.68 ? 33   ASN B CA  1 
ATOM   1761 C  C   . ASN B 1 33  ? -14.025 33.064 -2.161  1.00 14.91 ? 33   ASN B C   1 
ATOM   1762 O  O   . ASN B 1 33  ? -13.544 32.700 -3.214  1.00 16.14 ? 33   ASN B O   1 
ATOM   1763 C  CB  . ASN B 1 33  ? -15.762 34.815 -2.365  1.00 14.35 ? 33   ASN B CB  1 
ATOM   1764 C  CG  . ASN B 1 33  ? -15.333 35.187 -3.782  1.00 16.96 ? 33   ASN B CG  1 
ATOM   1765 O  OD1 . ASN B 1 33  ? -14.336 35.914 -3.991  1.00 18.07 ? 33   ASN B OD1 1 
ATOM   1766 N  ND2 . ASN B 1 33  ? -16.053 34.682 -4.757  1.00 16.17 ? 33   ASN B ND2 1 
ATOM   1767 N  N   . THR B 1 34  ? -13.294 33.249 -1.071  1.00 14.87 ? 34   THR B N   1 
ATOM   1768 C  CA  . THR B 1 34  ? -11.844 33.066 -1.118  1.00 14.88 ? 34   THR B CA  1 
ATOM   1769 C  C   . THR B 1 34  ? -11.472 31.627 -1.440  1.00 15.20 ? 34   THR B C   1 
ATOM   1770 O  O   . THR B 1 34  ? -10.508 31.367 -2.169  1.00 15.58 ? 34   THR B O   1 
ATOM   1771 C  CB  . THR B 1 34  ? -11.165 33.566 0.178   1.00 13.93 ? 34   THR B CB  1 
ATOM   1772 O  OG1 . THR B 1 34  ? -11.283 34.995 0.217   1.00 14.09 ? 34   THR B OG1 1 
ATOM   1773 C  CG2 . THR B 1 34  ? -9.686  33.210 0.189   1.00 13.96 ? 34   THR B CG2 1 
ATOM   1774 N  N   . TYR B 1 35  ? -12.244 30.691 -0.899  1.00 15.45 ? 35   TYR B N   1 
ATOM   1775 C  CA  . TYR B 1 35  ? -12.080 29.262 -1.266  1.00 14.58 ? 35   TYR B CA  1 
ATOM   1776 C  C   . TYR B 1 35  ? -12.258 29.029 -2.772  1.00 15.00 ? 35   TYR B C   1 
ATOM   1777 O  O   . TYR B 1 35  ? -11.493 28.269 -3.382  1.00 15.09 ? 35   TYR B O   1 
ATOM   1778 C  CB  . TYR B 1 35  ? -13.049 28.363 -0.453  1.00 15.18 ? 35   TYR B CB  1 
ATOM   1779 C  CG  . TYR B 1 35  ? -12.731 28.337 1.036   1.00 13.28 ? 35   TYR B CG  1 
ATOM   1780 C  CD1 . TYR B 1 35  ? -11.428 28.040 1.488   1.00 10.13 ? 35   TYR B CD1 1 
ATOM   1781 C  CD2 . TYR B 1 35  ? -13.706 28.630 1.991   1.00 14.23 ? 35   TYR B CD2 1 
ATOM   1782 C  CE1 . TYR B 1 35  ? -11.108 28.017 2.873   1.00 11.49 ? 35   TYR B CE1 1 
ATOM   1783 C  CE2 . TYR B 1 35  ? -13.395 28.631 3.379   1.00 10.76 ? 35   TYR B CE2 1 
ATOM   1784 C  CZ  . TYR B 1 35  ? -12.086 28.308 3.795   1.00 14.55 ? 35   TYR B CZ  1 
ATOM   1785 O  OH  . TYR B 1 35  ? -11.759 28.292 5.128   1.00 14.64 ? 35   TYR B OH  1 
ATOM   1786 N  N   . VAL B 1 36  ? -13.262 29.671 -3.360  1.00 13.70 ? 36   VAL B N   1 
ATOM   1787 C  CA  . VAL B 1 36  ? -13.491 29.594 -4.816  1.00 14.28 ? 36   VAL B CA  1 
ATOM   1788 C  C   . VAL B 1 36  ? -12.258 30.087 -5.570  1.00 14.52 ? 36   VAL B C   1 
ATOM   1789 O  O   . VAL B 1 36  ? -11.746 29.386 -6.465  1.00 14.30 ? 36   VAL B O   1 
ATOM   1790 C  CB  . VAL B 1 36  ? -14.723 30.365 -5.227  1.00 14.21 ? 36   VAL B CB  1 
ATOM   1791 C  CG1 . VAL B 1 36  ? -14.938 30.289 -6.745  1.00 14.78 ? 36   VAL B CG1 1 
ATOM   1792 C  CG2 . VAL B 1 36  ? -15.932 29.775 -4.559  1.00 15.26 ? 36   VAL B CG2 1 
ATOM   1793 N  N   . VAL B 1 37  ? -11.790 31.285 -5.191  1.00 15.28 ? 37   VAL B N   1 
ATOM   1794 C  CA  . VAL B 1 37  ? -10.675 31.946 -5.850  1.00 16.34 ? 37   VAL B CA  1 
ATOM   1795 C  C   . VAL B 1 37  ? -9.440  31.081 -5.783  1.00 16.54 ? 37   VAL B C   1 
ATOM   1796 O  O   . VAL B 1 37  ? -8.770  30.864 -6.807  1.00 15.55 ? 37   VAL B O   1 
ATOM   1797 C  CB  . VAL B 1 37  ? -10.437 33.345 -5.240  1.00 16.60 ? 37   VAL B CB  1 
ATOM   1798 C  CG1 . VAL B 1 37  ? -9.002  33.845 -5.527  1.00 16.71 ? 37   VAL B CG1 1 
ATOM   1799 C  CG2 . VAL B 1 37  ? -11.511 34.300 -5.717  1.00 17.47 ? 37   VAL B CG2 1 
ATOM   1800 N  N   . LYS B 1 38  ? -9.169  30.519 -4.604  1.00 15.63 ? 38   LYS B N   1 
ATOM   1801 C  CA  . LYS B 1 38  ? -8.014  29.657 -4.456  1.00 14.60 ? 38   LYS B CA  1 
ATOM   1802 C  C   . LYS B 1 38  ? -8.137  28.349 -5.238  1.00 14.80 ? 38   LYS B C   1 
ATOM   1803 O  O   . LYS B 1 38  ? -7.176  27.935 -5.867  1.00 15.28 ? 38   LYS B O   1 
ATOM   1804 C  CB  . LYS B 1 38  ? -7.692  29.401 -2.973  1.00 15.07 ? 38   LYS B CB  1 
ATOM   1805 C  CG  . LYS B 1 38  ? -7.151  30.599 -2.293  1.00 12.85 ? 38   LYS B CG  1 
ATOM   1806 C  CD  . LYS B 1 38  ? -6.790  30.332 -0.861  1.00 18.54 ? 38   LYS B CD  1 
ATOM   1807 C  CE  . LYS B 1 38  ? -6.424  31.656 -0.199  1.00 23.59 ? 38   LYS B CE  1 
ATOM   1808 N  NZ  . LYS B 1 38  ? -5.629  31.449 1.030   1.00 30.85 ? 38   LYS B NZ  1 
ATOM   1809 N  N   . LEU B 1 39  ? -9.301  27.688 -5.200  1.00 14.73 ? 39   LEU B N   1 
ATOM   1810 C  CA  . LEU B 1 39  ? -9.488  26.475 -6.034  1.00 13.99 ? 39   LEU B CA  1 
ATOM   1811 C  C   . LEU B 1 39  ? -9.197  26.762 -7.503  1.00 14.73 ? 39   LEU B C   1 
ATOM   1812 O  O   . LEU B 1 39  ? -8.436  26.046 -8.131  1.00 14.87 ? 39   LEU B O   1 
ATOM   1813 C  CB  . LEU B 1 39  ? -10.912 25.884 -5.901  1.00 14.54 ? 39   LEU B CB  1 
ATOM   1814 C  CG  . LEU B 1 39  ? -11.039 24.476 -6.533  1.00 14.46 ? 39   LEU B CG  1 
ATOM   1815 C  CD1 . LEU B 1 39  ? -9.948  23.499 -6.125  1.00 14.22 ? 39   LEU B CD1 1 
ATOM   1816 C  CD2 . LEU B 1 39  ? -12.449 23.861 -6.335  1.00 13.02 ? 39   LEU B CD2 1 
ATOM   1817 N  N   . ASN B 1 40  ? -9.804  27.822 -8.034  1.00 15.18 ? 40   ASN B N   1 
ATOM   1818 C  CA  . ASN B 1 40  ? -9.666  28.194 -9.440  1.00 16.06 ? 40   ASN B CA  1 
ATOM   1819 C  C   . ASN B 1 40  ? -8.217  28.435 -9.840  1.00 16.31 ? 40   ASN B C   1 
ATOM   1820 O  O   . ASN B 1 40  ? -7.868  28.248 -10.988 1.00 17.86 ? 40   ASN B O   1 
ATOM   1821 C  CB  . ASN B 1 40  ? -10.527 29.414 -9.774  1.00 16.49 ? 40   ASN B CB  1 
ATOM   1822 C  CG  . ASN B 1 40  ? -12.014 29.075 -9.809  1.00 15.79 ? 40   ASN B CG  1 
ATOM   1823 O  OD1 . ASN B 1 40  ? -12.384 27.923 -10.021 1.00 19.54 ? 40   ASN B OD1 1 
ATOM   1824 N  ND2 . ASN B 1 40  ? -12.860 30.057 -9.594  1.00 16.53 ? 40   ASN B ND2 1 
ATOM   1825 N  N   . GLY B 1 41  ? -7.378  28.800 -8.878  1.00 16.48 ? 41   GLY B N   1 
ATOM   1826 C  CA  . GLY B 1 41  ? -5.987  29.158 -9.138  1.00 14.96 ? 41   GLY B CA  1 
ATOM   1827 C  C   . GLY B 1 41  ? -5.155  27.903 -9.161  1.00 15.77 ? 41   GLY B C   1 
ATOM   1828 O  O   . GLY B 1 41  ? -4.143  27.858 -9.838  1.00 15.84 ? 41   GLY B O   1 
ATOM   1829 N  N   . LEU B 1 42  ? -5.624  26.864 -8.456  1.00 16.54 ? 42   LEU B N   1 
ATOM   1830 C  CA  . LEU B 1 42  ? -4.853  25.631 -8.320  1.00 17.87 ? 42   LEU B CA  1 
ATOM   1831 C  C   . LEU B 1 42  ? -5.126  24.657 -9.456  1.00 19.11 ? 42   LEU B C   1 
ATOM   1832 O  O   . LEU B 1 42  ? -4.255  23.904 -9.861  1.00 19.91 ? 42   LEU B O   1 
ATOM   1833 C  CB  . LEU B 1 42  ? -5.138  24.948 -6.980  1.00 17.35 ? 42   LEU B CB  1 
ATOM   1834 C  CG  . LEU B 1 42  ? -4.592  25.610 -5.699  1.00 19.14 ? 42   LEU B CG  1 
ATOM   1835 C  CD1 . LEU B 1 42  ? -5.071  24.921 -4.417  1.00 18.27 ? 42   LEU B CD1 1 
ATOM   1836 C  CD2 . LEU B 1 42  ? -3.089  25.654 -5.733  1.00 19.19 ? 42   LEU B CD2 1 
ATOM   1837 N  N   . ILE B 1 43  ? -6.319  24.677 -10.002 1.00 20.03 ? 43   ILE B N   1 
ATOM   1838 C  CA  . ILE B 1 43  ? -6.662  23.593 -10.906 1.00 22.40 ? 43   ILE B CA  1 
ATOM   1839 C  C   . ILE B 1 43  ? -6.176  23.664 -12.373 1.00 22.76 ? 43   ILE B C   1 
ATOM   1840 O  O   . ILE B 1 43  ? -6.077  22.613 -12.999 1.00 22.77 ? 43   ILE B O   1 
ATOM   1841 C  CB  . ILE B 1 43  ? -8.147  23.188 -10.815 1.00 22.14 ? 43   ILE B CB  1 
ATOM   1842 C  CG1 . ILE B 1 43  ? -9.044  24.299 -11.299 1.00 23.40 ? 43   ILE B CG1 1 
ATOM   1843 C  CG2 . ILE B 1 43  ? -8.509  22.811 -9.368  1.00 24.10 ? 43   ILE B CG2 1 
ATOM   1844 C  CD1 . ILE B 1 43  ? -10.487 23.951 -11.124 1.00 25.88 ? 43   ILE B CD1 1 
ATOM   1845 N  N   . PRO B 1 44  ? -5.896  24.882 -12.924 1.00 23.46 ? 44   PRO B N   1 
ATOM   1846 C  CA  . PRO B 1 44  ? -5.426  24.950 -14.340 1.00 24.30 ? 44   PRO B CA  1 
ATOM   1847 C  C   . PRO B 1 44  ? -4.282  24.008 -14.623 1.00 25.02 ? 44   PRO B C   1 
ATOM   1848 O  O   . PRO B 1 44  ? -3.321  23.990 -13.871 1.00 25.46 ? 44   PRO B O   1 
ATOM   1849 C  CB  . PRO B 1 44  ? -4.945  26.388 -14.474 1.00 23.74 ? 44   PRO B CB  1 
ATOM   1850 C  CG  . PRO B 1 44  ? -5.890  27.148 -13.525 1.00 24.05 ? 44   PRO B CG  1 
ATOM   1851 C  CD  . PRO B 1 44  ? -6.028  26.237 -12.340 1.00 23.12 ? 44   PRO B CD  1 
ATOM   1852 N  N   . GLY B 1 45  ? -4.414  23.211 -15.683 1.00 26.97 ? 45   GLY B N   1 
ATOM   1853 C  CA  . GLY B 1 45  ? -3.358  22.310 -16.122 1.00 27.14 ? 45   GLY B CA  1 
ATOM   1854 C  C   . GLY B 1 45  ? -3.120  21.133 -15.197 1.00 28.41 ? 45   GLY B C   1 
ATOM   1855 O  O   . GLY B 1 45  ? -2.036  20.522 -15.216 1.00 28.53 ? 45   GLY B O   1 
ATOM   1856 N  N   . THR B 1 46  ? -4.118  20.793 -14.382 1.00 27.87 ? 46   THR B N   1 
ATOM   1857 C  CA  . THR B 1 46  ? -3.995  19.613 -13.533 1.00 27.73 ? 46   THR B CA  1 
ATOM   1858 C  C   . THR B 1 46  ? -5.086  18.618 -13.936 1.00 27.93 ? 46   THR B C   1 
ATOM   1859 O  O   . THR B 1 46  ? -6.037  18.973 -14.648 1.00 28.47 ? 46   THR B O   1 
ATOM   1860 C  CB  . THR B 1 46  ? -4.180  19.953 -12.039 1.00 27.31 ? 46   THR B CB  1 
ATOM   1861 O  OG1 . THR B 1 46  ? -5.551  20.322 -11.826 1.00 25.03 ? 46   THR B OG1 1 
ATOM   1862 C  CG2 . THR B 1 46  ? -3.264  21.099 -11.576 1.00 27.95 ? 46   THR B CG2 1 
ATOM   1863 N  N   . GLU B 1 47  ? -4.989  17.382 -13.458 1.00 28.95 ? 47   GLU B N   1 
ATOM   1864 C  CA  . GLU B 1 47  ? -6.097  16.420 -13.651 1.00 28.98 ? 47   GLU B CA  1 
ATOM   1865 C  C   . GLU B 1 47  ? -7.462  16.911 -13.152 1.00 28.88 ? 47   GLU B C   1 
ATOM   1866 O  O   . GLU B 1 47  ? -8.499  16.323 -13.503 1.00 28.49 ? 47   GLU B O   1 
ATOM   1867 C  CB  . GLU B 1 47  ? -5.788  15.089 -12.983 1.00 29.44 ? 47   GLU B CB  1 
ATOM   1868 C  CG  . GLU B 1 47  ? -5.368  15.223 -11.513 1.00 32.92 ? 47   GLU B CG  1 
ATOM   1869 C  CD  . GLU B 1 47  ? -5.414  13.916 -10.749 1.00 35.67 ? 47   GLU B CD  1 
ATOM   1870 O  OE1 . GLU B 1 47  ? -6.471  13.245 -10.728 1.00 36.06 ? 47   GLU B OE1 1 
ATOM   1871 O  OE2 . GLU B 1 47  ? -4.387  13.572 -10.131 1.00 39.86 ? 47   GLU B OE2 1 
ATOM   1872 N  N   . PHE B 1 48  ? -7.479  17.975 -12.341 1.00 27.94 ? 48   PHE B N   1 
ATOM   1873 C  CA  . PHE B 1 48  ? -8.736  18.440 -11.724 1.00 27.43 ? 48   PHE B CA  1 
ATOM   1874 C  C   . PHE B 1 48  ? -9.533  19.357 -12.595 1.00 28.21 ? 48   PHE B C   1 
ATOM   1875 O  O   . PHE B 1 48  ? -10.721 19.597 -12.336 1.00 27.66 ? 48   PHE B O   1 
ATOM   1876 C  CB  . PHE B 1 48  ? -8.470  19.060 -10.341 1.00 26.34 ? 48   PHE B CB  1 
ATOM   1877 C  CG  . PHE B 1 48  ? -7.801  18.107 -9.410  1.00 23.63 ? 48   PHE B CG  1 
ATOM   1878 C  CD1 . PHE B 1 48  ? -8.468  16.968 -8.989  1.00 22.57 ? 48   PHE B CD1 1 
ATOM   1879 C  CD2 . PHE B 1 48  ? -6.491  18.302 -9.008  1.00 23.59 ? 48   PHE B CD2 1 
ATOM   1880 C  CE1 . PHE B 1 48  ? -7.839  16.051 -8.150  1.00 23.45 ? 48   PHE B CE1 1 
ATOM   1881 C  CE2 . PHE B 1 48  ? -5.858  17.391 -8.160  1.00 23.74 ? 48   PHE B CE2 1 
ATOM   1882 C  CZ  . PHE B 1 48  ? -6.545  16.260 -7.734  1.00 23.01 ? 48   PHE B CZ  1 
ATOM   1883 N  N   . GLU B 1 49  ? -8.872  19.863 -13.630 1.00 29.69 ? 49   GLU B N   1 
ATOM   1884 C  CA  . GLU B 1 49  ? -9.493  20.729 -14.622 1.00 31.76 ? 49   GLU B CA  1 
ATOM   1885 C  C   . GLU B 1 49  ? -10.604 19.950 -15.297 1.00 31.08 ? 49   GLU B C   1 
ATOM   1886 O  O   . GLU B 1 49  ? -10.390 18.815 -15.733 1.00 31.47 ? 49   GLU B O   1 
ATOM   1887 C  CB  . GLU B 1 49  ? -8.440  21.131 -15.652 1.00 32.08 ? 49   GLU B CB  1 
ATOM   1888 C  CG  . GLU B 1 49  ? -8.657  22.462 -16.350 1.00 33.65 ? 49   GLU B CG  1 
ATOM   1889 C  CD  . GLU B 1 49  ? -7.461  22.795 -17.248 1.00 34.52 ? 49   GLU B CD  1 
ATOM   1890 O  OE1 . GLU B 1 49  ? -6.480  21.999 -17.286 1.00 38.90 ? 49   GLU B OE1 1 
ATOM   1891 O  OE2 . GLU B 1 49  ? -7.499  23.847 -17.912 1.00 40.38 ? 49   GLU B OE2 1 
ATOM   1892 N  N   . GLY B 1 50  ? -11.794 20.535 -15.336 1.00 30.83 ? 50   GLY B N   1 
ATOM   1893 C  CA  . GLY B 1 50  ? -12.939 19.888 -15.983 1.00 30.78 ? 50   GLY B CA  1 
ATOM   1894 C  C   . GLY B 1 50  ? -13.847 19.060 -15.073 1.00 30.25 ? 50   GLY B C   1 
ATOM   1895 O  O   . GLY B 1 50  ? -15.007 18.823 -15.423 1.00 30.99 ? 50   GLY B O   1 
ATOM   1896 N  N   . LYS B 1 51  ? -13.326 18.648 -13.908 1.00 29.21 ? 51   LYS B N   1 
ATOM   1897 C  CA  . LYS B 1 51  ? -14.025 17.789 -12.925 1.00 27.77 ? 51   LYS B CA  1 
ATOM   1898 C  C   . LYS B 1 51  ? -15.113 18.528 -12.143 1.00 26.99 ? 51   LYS B C   1 
ATOM   1899 O  O   . LYS B 1 51  ? -15.041 19.754 -12.004 1.00 26.55 ? 51   LYS B O   1 
ATOM   1900 C  CB  . LYS B 1 51  ? -13.002 17.217 -11.956 1.00 27.81 ? 51   LYS B CB  1 
ATOM   1901 C  CG  . LYS B 1 51  ? -11.957 16.368 -12.621 1.00 28.43 ? 51   LYS B CG  1 
ATOM   1902 C  CD  . LYS B 1 51  ? -12.410 14.920 -12.739 0.50 28.34 ? 51   LYS B CD  1 
ATOM   1903 C  CE  . LYS B 1 51  ? -11.538 14.161 -13.718 0.50 28.02 ? 51   LYS B CE  1 
ATOM   1904 N  NZ  . LYS B 1 51  ? -11.904 14.476 -15.122 0.50 26.95 ? 51   LYS B NZ  1 
ATOM   1905 N  N   . THR B 1 52  ? -16.124 17.804 -11.653 1.00 25.71 ? 52   THR B N   1 
ATOM   1906 C  CA  . THR B 1 52  ? -17.136 18.430 -10.788 1.00 24.74 ? 52   THR B CA  1 
ATOM   1907 C  C   . THR B 1 52  ? -16.498 18.672 -9.433  1.00 22.82 ? 52   THR B C   1 
ATOM   1908 O  O   . THR B 1 52  ? -15.472 18.068 -9.094  1.00 21.85 ? 52   THR B O   1 
ATOM   1909 C  CB  . THR B 1 52  ? -18.421 17.573 -10.547 1.00 24.88 ? 52   THR B CB  1 
ATOM   1910 O  OG1 . THR B 1 52  ? -18.076 16.366 -9.864  1.00 26.73 ? 52   THR B OG1 1 
ATOM   1911 C  CG2 . THR B 1 52  ? -19.142 17.247 -11.859 1.00 28.01 ? 52   THR B CG2 1 
ATOM   1912 N  N   . LEU B 1 53  ? -17.113 19.552 -8.660  1.00 21.87 ? 53   LEU B N   1 
ATOM   1913 C  CA  . LEU B 1 53  ? -16.589 19.859 -7.328  1.00 20.87 ? 53   LEU B CA  1 
ATOM   1914 C  C   . LEU B 1 53  ? -16.505 18.589 -6.474  1.00 20.56 ? 53   LEU B C   1 
ATOM   1915 O  O   . LEU B 1 53  ? -15.480 18.332 -5.830  1.00 20.61 ? 53   LEU B O   1 
ATOM   1916 C  CB  . LEU B 1 53  ? -17.455 20.911 -6.660  1.00 20.56 ? 53   LEU B CB  1 
ATOM   1917 C  CG  . LEU B 1 53  ? -16.984 21.440 -5.321  1.00 19.84 ? 53   LEU B CG  1 
ATOM   1918 C  CD1 . LEU B 1 53  ? -15.769 22.286 -5.524  1.00 20.18 ? 53   LEU B CD1 1 
ATOM   1919 C  CD2 . LEU B 1 53  ? -18.094 22.263 -4.709  1.00 18.22 ? 53   LEU B CD2 1 
ATOM   1920 N  N   . GLU B 1 54  ? -17.568 17.782 -6.495  1.00 19.85 ? 54   GLU B N   1 
ATOM   1921 C  CA  . GLU B 1 54  ? -17.615 16.557 -5.703  1.00 20.15 ? 54   GLU B CA  1 
ATOM   1922 C  C   . GLU B 1 54  ? -16.541 15.534 -6.125  1.00 19.42 ? 54   GLU B C   1 
ATOM   1923 O  O   . GLU B 1 54  ? -15.966 14.852 -5.272  1.00 18.41 ? 54   GLU B O   1 
ATOM   1924 C  CB  . GLU B 1 54  ? -19.053 15.979 -5.649  1.00 19.77 ? 54   GLU B CB  1 
ATOM   1925 C  CG  . GLU B 1 54  ? -19.948 16.781 -4.707  1.00 22.54 ? 54   GLU B CG  1 
ATOM   1926 C  CD  . GLU B 1 54  ? -21.385 16.271 -4.551  1.00 24.42 ? 54   GLU B CD  1 
ATOM   1927 O  OE1 . GLU B 1 54  ? -21.652 15.065 -4.780  1.00 30.76 ? 54   GLU B OE1 1 
ATOM   1928 O  OE2 . GLU B 1 54  ? -22.274 17.089 -4.180  1.00 28.81 ? 54   GLU B OE2 1 
ATOM   1929 N  N   . GLU B 1 55  ? -16.236 15.450 -7.424  1.00 19.31 ? 55   GLU B N   1 
ATOM   1930 C  CA  . GLU B 1 55  ? -15.173 14.521 -7.886  1.00 18.72 ? 55   GLU B CA  1 
ATOM   1931 C  C   . GLU B 1 55  ? -13.816 14.998 -7.379  1.00 18.64 ? 55   GLU B C   1 
ATOM   1932 O  O   . GLU B 1 55  ? -12.945 14.201 -6.968  1.00 19.83 ? 55   GLU B O   1 
ATOM   1933 C  CB  . GLU B 1 55  ? -15.163 14.398 -9.432  1.00 19.54 ? 55   GLU B CB  1 
ATOM   1934 C  CG  . GLU B 1 55  ? -16.373 13.648 -10.011 0.50 18.89 ? 55   GLU B CG  1 
ATOM   1935 C  CD  . GLU B 1 55  ? -16.591 13.822 -11.532 0.50 19.66 ? 55   GLU B CD  1 
ATOM   1936 O  OE1 . GLU B 1 55  ? -16.449 14.938 -12.100 0.50 17.95 ? 55   GLU B OE1 1 
ATOM   1937 O  OE2 . GLU B 1 55  ? -16.947 12.806 -12.165 0.50 19.64 ? 55   GLU B OE2 1 
ATOM   1938 N  N   . ILE B 1 56  ? -13.601 16.310 -7.439  1.00 17.39 ? 56   ILE B N   1 
ATOM   1939 C  CA  . ILE B 1 56  ? -12.343 16.895 -6.967  1.00 17.11 ? 56   ILE B CA  1 
ATOM   1940 C  C   . ILE B 1 56  ? -12.155 16.563 -5.472  1.00 17.43 ? 56   ILE B C   1 
ATOM   1941 O  O   . ILE B 1 56  ? -11.103 16.057 -5.039  1.00 16.96 ? 56   ILE B O   1 
ATOM   1942 C  CB  . ILE B 1 56  ? -12.306 18.445 -7.214  1.00 17.35 ? 56   ILE B CB  1 
ATOM   1943 C  CG1 . ILE B 1 56  ? -12.250 18.767 -8.701  1.00 18.01 ? 56   ILE B CG1 1 
ATOM   1944 C  CG2 . ILE B 1 56  ? -11.084 19.103 -6.547  1.00 14.83 ? 56   ILE B CG2 1 
ATOM   1945 C  CD1 . ILE B 1 56  ? -12.476 20.280 -9.035  1.00 16.45 ? 56   ILE B CD1 1 
ATOM   1946 N  N   . ILE B 1 57  ? -13.179 16.871 -4.681  1.00 17.12 ? 57   ILE B N   1 
ATOM   1947 C  CA  . ILE B 1 57  ? -13.157 16.558 -3.239  1.00 17.41 ? 57   ILE B CA  1 
ATOM   1948 C  C   . ILE B 1 57  ? -12.774 15.102 -2.979  1.00 18.40 ? 57   ILE B C   1 
ATOM   1949 O  O   . ILE B 1 57  ? -11.895 14.832 -2.160  1.00 17.57 ? 57   ILE B O   1 
ATOM   1950 C  CB  . ILE B 1 57  ? -14.467 16.929 -2.555  1.00 17.06 ? 57   ILE B CB  1 
ATOM   1951 C  CG1 . ILE B 1 57  ? -14.631 18.451 -2.587  1.00 15.74 ? 57   ILE B CG1 1 
ATOM   1952 C  CG2 . ILE B 1 57  ? -14.446 16.476 -1.118  1.00 17.86 ? 57   ILE B CG2 1 
ATOM   1953 C  CD1 . ILE B 1 57  ? -16.070 18.951 -2.394  1.00 14.08 ? 57   ILE B CD1 1 
ATOM   1954 N  N   . LYS B 1 58  ? -13.412 14.183 -3.718  1.00 19.44 ? 58   LYS B N   1 
ATOM   1955 C  CA  . LYS B 1 58  ? -13.215 12.743 -3.549  1.00 21.45 ? 58   LYS B CA  1 
ATOM   1956 C  C   . LYS B 1 58  ? -11.864 12.237 -4.070  1.00 21.73 ? 58   LYS B C   1 
ATOM   1957 O  O   . LYS B 1 58  ? -11.429 11.142 -3.721  1.00 21.68 ? 58   LYS B O   1 
ATOM   1958 C  CB  . LYS B 1 58  ? -14.356 11.975 -4.221  1.00 21.08 ? 58   LYS B CB  1 
ATOM   1959 C  CG  . LYS B 1 58  ? -15.637 11.958 -3.433  1.00 23.14 ? 58   LYS B CG  1 
ATOM   1960 C  CD  . LYS B 1 58  ? -16.746 11.197 -4.160  1.00 24.07 ? 58   LYS B CD  1 
ATOM   1961 C  CE  . LYS B 1 58  ? -18.027 11.145 -3.330  1.00 28.81 ? 58   LYS B CE  1 
ATOM   1962 N  NZ  . LYS B 1 58  ? -19.247 11.518 -4.122  1.00 28.35 ? 58   LYS B NZ  1 
ATOM   1963 N  N   . THR B 1 59  ? -11.180 13.018 -4.896  1.00 22.42 ? 59   THR B N   1 
ATOM   1964 C  CA  . THR B 1 59  ? -9.967  12.468 -5.538  1.00 22.93 ? 59   THR B CA  1 
ATOM   1965 C  C   . THR B 1 59  ? -8.689  13.280 -5.250  1.00 23.44 ? 59   THR B C   1 
ATOM   1966 O  O   . THR B 1 59  ? -7.614  12.967 -5.769  1.00 24.85 ? 59   THR B O   1 
ATOM   1967 C  CB  . THR B 1 59  ? -10.181 12.294 -7.065  1.00 22.93 ? 59   THR B CB  1 
ATOM   1968 O  OG1 . THR B 1 59  ? -10.330 13.588 -7.674  1.00 22.94 ? 59   THR B OG1 1 
ATOM   1969 C  CG2 . THR B 1 59  ? -11.460 11.445 -7.375  1.00 23.56 ? 59   THR B CG2 1 
ATOM   1970 N  N   . SER B 1 60  ? -8.793  14.327 -4.428  1.00 22.64 ? 60   SER B N   1 
ATOM   1971 C  CA  . SER B 1 60  ? -7.659  15.243 -4.213  1.00 21.87 ? 60   SER B CA  1 
ATOM   1972 C  C   . SER B 1 60  ? -7.105  15.213 -2.790  1.00 22.24 ? 60   SER B C   1 
ATOM   1973 O  O   . SER B 1 60  ? -7.717  14.625 -1.893  1.00 22.08 ? 60   SER B O   1 
ATOM   1974 C  CB  . SER B 1 60  ? -8.092  16.673 -4.532  1.00 21.77 ? 60   SER B CB  1 
ATOM   1975 O  OG  . SER B 1 60  ? -9.091  17.071 -3.616  1.00 20.21 ? 60   SER B OG  1 
ATOM   1976 N  N   . THR B 1 61  ? -5.951  15.868 -2.600  1.00 22.58 ? 61   THR B N   1 
ATOM   1977 C  CA  . THR B 1 61  ? -5.348  16.101 -1.275  1.00 22.80 ? 61   THR B CA  1 
ATOM   1978 C  C   . THR B 1 61  ? -4.754  17.511 -1.208  1.00 21.67 ? 61   THR B C   1 
ATOM   1979 O  O   . THR B 1 61  ? -4.828  18.259 -2.187  1.00 21.45 ? 61   THR B O   1 
ATOM   1980 C  CB  . THR B 1 61  ? -4.219  15.087 -0.905  1.00 23.79 ? 61   THR B CB  1 
ATOM   1981 O  OG1 . THR B 1 61  ? -3.108  15.244 -1.793  1.00 26.12 ? 61   THR B OG1 1 
ATOM   1982 C  CG2 . THR B 1 61  ? -4.709  13.647 -0.915  1.00 24.32 ? 61   THR B CG2 1 
ATOM   1983 N  N   . GLY B 1 62  ? -4.198  17.875 -0.049  1.00 20.63 ? 62   GLY B N   1 
ATOM   1984 C  CA  . GLY B 1 62  ? -3.505  19.137 0.111   1.00 18.89 ? 62   GLY B CA  1 
ATOM   1985 C  C   . GLY B 1 62  ? -4.398  20.341 -0.130  1.00 18.60 ? 62   GLY B C   1 
ATOM   1986 O  O   . GLY B 1 62  ? -5.585  20.343 0.241   1.00 19.16 ? 62   GLY B O   1 
ATOM   1987 N  N   . GLY B 1 63  ? -3.832  21.339 -0.805  1.00 18.18 ? 63   GLY B N   1 
ATOM   1988 C  CA  . GLY B 1 63  ? -4.539  22.595 -1.099  1.00 16.97 ? 63   GLY B CA  1 
ATOM   1989 C  C   . GLY B 1 63  ? -5.748  22.500 -1.989  1.00 17.06 ? 63   GLY B C   1 
ATOM   1990 O  O   . GLY B 1 63  ? -6.701  23.259 -1.830  1.00 17.15 ? 63   GLY B O   1 
ATOM   1991 N  N   . VAL B 1 64  ? -5.712  21.589 -2.951  1.00 16.52 ? 64   VAL B N   1 
ATOM   1992 C  CA  . VAL B 1 64  ? -6.832  21.392 -3.845  1.00 15.39 ? 64   VAL B CA  1 
ATOM   1993 C  C   . VAL B 1 64  ? -7.974  20.890 -2.997  1.00 15.34 ? 64   VAL B C   1 
ATOM   1994 O  O   . VAL B 1 64  ? -9.079  21.439 -3.063  1.00 15.40 ? 64   VAL B O   1 
ATOM   1995 C  CB  . VAL B 1 64  ? -6.474  20.404 -5.011  1.00 15.99 ? 64   VAL B CB  1 
ATOM   1996 C  CG1 . VAL B 1 64  ? -7.712  19.968 -5.772  1.00 15.15 ? 64   VAL B CG1 1 
ATOM   1997 C  CG2 . VAL B 1 64  ? -5.504  21.061 -5.979  1.00 16.46 ? 64   VAL B CG2 1 
ATOM   1998 N  N   . PHE B 1 65  ? -7.707  19.873 -2.169  1.00 14.69 ? 65   PHE B N   1 
ATOM   1999 C  CA  . PHE B 1 65  ? -8.738  19.342 -1.283  1.00 15.63 ? 65   PHE B CA  1 
ATOM   2000 C  C   . PHE B 1 65  ? -9.278  20.408 -0.349  1.00 16.11 ? 65   PHE B C   1 
ATOM   2001 O  O   . PHE B 1 65  ? -10.510 20.654 -0.264  1.00 17.46 ? 65   PHE B O   1 
ATOM   2002 C  CB  . PHE B 1 65  ? -8.208  18.164 -0.438  1.00 14.88 ? 65   PHE B CB  1 
ATOM   2003 C  CG  . PHE B 1 65  ? -9.231  17.627 0.516   1.00 15.57 ? 65   PHE B CG  1 
ATOM   2004 C  CD1 . PHE B 1 65  ? -10.142 16.663 0.092   1.00 14.29 ? 65   PHE B CD1 1 
ATOM   2005 C  CD2 . PHE B 1 65  ? -9.357  18.161 1.813   1.00 15.37 ? 65   PHE B CD2 1 
ATOM   2006 C  CE1 . PHE B 1 65  ? -11.119 16.188 0.965   1.00 17.31 ? 65   PHE B CE1 1 
ATOM   2007 C  CE2 . PHE B 1 65  ? -10.338 17.701 2.697   1.00 13.27 ? 65   PHE B CE2 1 
ATOM   2008 C  CZ  . PHE B 1 65  ? -11.222 16.700 2.273   1.00 13.63 ? 65   PHE B CZ  1 
ATOM   2009 N  N   . ASN B 1 66  ? -8.359  21.079 0.338   1.00 15.62 ? 66   ASN B N   1 
ATOM   2010 C  CA  . ASN B 1 66  ? -8.768  22.028 1.377   1.00 14.57 ? 66   ASN B CA  1 
ATOM   2011 C  C   . ASN B 1 66  ? -9.753  23.012 0.824   1.00 14.50 ? 66   ASN B C   1 
ATOM   2012 O  O   . ASN B 1 66  ? -10.781 23.272 1.425   1.00 13.89 ? 66   ASN B O   1 
ATOM   2013 C  CB  . ASN B 1 66  ? -7.556  22.752 1.977   1.00 15.54 ? 66   ASN B CB  1 
ATOM   2014 C  CG  . ASN B 1 66  ? -6.811  21.905 2.975   1.00 13.72 ? 66   ASN B CG  1 
ATOM   2015 O  OD1 . ASN B 1 66  ? -7.307  20.871 3.426   1.00 15.22 ? 66   ASN B OD1 1 
ATOM   2016 N  ND2 . ASN B 1 66  ? -5.568  22.307 3.284   1.00 15.19 ? 66   ASN B ND2 1 
ATOM   2017 N  N   . ASN B 1 67  ? -9.454  23.573 -0.341  1.00 14.83 ? 67   ASN B N   1 
ATOM   2018 C  CA  . ASN B 1 67  ? -10.330 24.594 -0.913  1.00 13.45 ? 67   ASN B CA  1 
ATOM   2019 C  C   . ASN B 1 67  ? -11.602 24.053 -1.499  1.00 13.28 ? 67   ASN B C   1 
ATOM   2020 O  O   . ASN B 1 67  ? -12.662 24.622 -1.275  1.00 12.16 ? 67   ASN B O   1 
ATOM   2021 C  CB  . ASN B 1 67  ? -9.584  25.451 -1.931  1.00 14.77 ? 67   ASN B CB  1 
ATOM   2022 C  CG  . ASN B 1 67  ? -8.502  26.284 -1.292  1.00 15.85 ? 67   ASN B CG  1 
ATOM   2023 O  OD1 . ASN B 1 67  ? -7.305  25.984 -1.407  1.00 20.01 ? 67   ASN B OD1 1 
ATOM   2024 N  ND2 . ASN B 1 67  ? -8.913  27.330 -0.605  1.00 12.95 ? 67   ASN B ND2 1 
ATOM   2025 N  N   . ALA B 1 68  ? -11.507 22.952 -2.239  1.00 12.67 ? 68   ALA B N   1 
ATOM   2026 C  CA  . ALA B 1 68  ? -12.715 22.371 -2.853  1.00 12.49 ? 68   ALA B CA  1 
ATOM   2027 C  C   . ALA B 1 68  ? -13.657 21.937 -1.764  1.00 12.26 ? 68   ALA B C   1 
ATOM   2028 O  O   . ALA B 1 68  ? -14.863 22.184 -1.870  1.00 12.74 ? 68   ALA B O   1 
ATOM   2029 C  CB  . ALA B 1 68  ? -12.346 21.162 -3.742  1.00 13.24 ? 68   ALA B CB  1 
ATOM   2030 N  N   . ALA B 1 69  ? -13.147 21.247 -0.747  1.00 12.63 ? 69   ALA B N   1 
ATOM   2031 C  CA  . ALA B 1 69  ? -14.023 20.717 0.310   1.00 13.26 ? 69   ALA B CA  1 
ATOM   2032 C  C   . ALA B 1 69  ? -14.707 21.849 1.073   1.00 12.69 ? 69   ALA B C   1 
ATOM   2033 O  O   . ALA B 1 69  ? -15.907 21.779 1.354   1.00 12.99 ? 69   ALA B O   1 
ATOM   2034 C  CB  . ALA B 1 69  ? -13.257 19.742 1.254   1.00 12.91 ? 69   ALA B CB  1 
ATOM   2035 N  N   . GLN B 1 70  ? -13.965 22.916 1.370   1.00 11.77 ? 70   GLN B N   1 
ATOM   2036 C  CA  . GLN B 1 70  ? -14.556 24.097 2.014   1.00 11.46 ? 70   GLN B CA  1 
ATOM   2037 C  C   . GLN B 1 70  ? -15.621 24.754 1.186   1.00 12.51 ? 70   GLN B C   1 
ATOM   2038 O  O   . GLN B 1 70  ? -16.573 25.294 1.731   1.00 12.92 ? 70   GLN B O   1 
ATOM   2039 C  CB  . GLN B 1 70  ? -13.468 25.106 2.406   1.00 11.10 ? 70   GLN B CB  1 
ATOM   2040 C  CG  . GLN B 1 70  ? -12.594 24.687 3.602   1.00 9.97  ? 70   GLN B CG  1 
ATOM   2041 C  CD  . GLN B 1 70  ? -13.385 24.635 4.910   1.00 12.95 ? 70   GLN B CD  1 
ATOM   2042 O  OE1 . GLN B 1 70  ? -14.054 23.652 5.191   1.00 11.05 ? 70   GLN B OE1 1 
ATOM   2043 N  NE2 . GLN B 1 70  ? -13.281 25.688 5.719   1.00 11.43 ? 70   GLN B NE2 1 
ATOM   2044 N  N   . ILE B 1 71  ? -15.498 24.724 -0.147  1.00 13.08 ? 71   ILE B N   1 
ATOM   2045 C  CA  . ILE B 1 71  ? -16.590 25.281 -0.967  1.00 12.07 ? 71   ILE B CA  1 
ATOM   2046 C  C   . ILE B 1 71  ? -17.894 24.532 -0.741  1.00 12.01 ? 71   ILE B C   1 
ATOM   2047 O  O   . ILE B 1 71  ? -18.930 25.152 -0.445  1.00 11.13 ? 71   ILE B O   1 
ATOM   2048 C  CB  . ILE B 1 71  ? -16.241 25.319 -2.504  1.00 12.52 ? 71   ILE B CB  1 
ATOM   2049 C  CG1 . ILE B 1 71  ? -14.975 26.138 -2.744  1.00 11.62 ? 71   ILE B CG1 1 
ATOM   2050 C  CG2 . ILE B 1 71  ? -17.433 25.918 -3.316  1.00 9.13  ? 71   ILE B CG2 1 
ATOM   2051 C  CD1 . ILE B 1 71  ? -14.421 26.017 -4.210  1.00 12.75 ? 71   ILE B CD1 1 
ATOM   2052 N  N   . TRP B 1 72  ? -17.829 23.205 -0.862  1.00 11.88 ? 72   TRP B N   1 
ATOM   2053 C  CA  . TRP B 1 72  ? -18.984 22.336 -0.660  1.00 13.78 ? 72   TRP B CA  1 
ATOM   2054 C  C   . TRP B 1 72  ? -19.537 22.490 0.766   1.00 12.88 ? 72   TRP B C   1 
ATOM   2055 O  O   . TRP B 1 72  ? -20.750 22.695 0.942   1.00 13.88 ? 72   TRP B O   1 
ATOM   2056 C  CB  . TRP B 1 72  ? -18.568 20.873 -0.895  1.00 13.91 ? 72   TRP B CB  1 
ATOM   2057 C  CG  . TRP B 1 72  ? -19.711 19.931 -1.051  1.00 16.65 ? 72   TRP B CG  1 
ATOM   2058 C  CD1 . TRP B 1 72  ? -20.294 19.542 -2.217  1.00 16.61 ? 72   TRP B CD1 1 
ATOM   2059 C  CD2 . TRP B 1 72  ? -20.418 19.259 0.004   1.00 18.45 ? 72   TRP B CD2 1 
ATOM   2060 N  NE1 . TRP B 1 72  ? -21.321 18.662 -1.961  1.00 19.79 ? 72   TRP B NE1 1 
ATOM   2061 C  CE2 . TRP B 1 72  ? -21.422 18.477 -0.601  1.00 19.64 ? 72   TRP B CE2 1 
ATOM   2062 C  CE3 . TRP B 1 72  ? -20.277 19.221 1.407   1.00 18.33 ? 72   TRP B CE3 1 
ATOM   2063 C  CZ2 . TRP B 1 72  ? -22.291 17.668 0.141   1.00 15.76 ? 72   TRP B CZ2 1 
ATOM   2064 C  CZ3 . TRP B 1 72  ? -21.148 18.435 2.152   1.00 16.84 ? 72   TRP B CZ3 1 
ATOM   2065 C  CH2 . TRP B 1 72  ? -22.161 17.680 1.515   1.00 16.61 ? 72   TRP B CH2 1 
ATOM   2066 N  N   . ASN B 1 73  ? -18.634 22.390 1.762   1.00 13.03 ? 73   ASN B N   1 
ATOM   2067 C  CA  . ASN B 1 73  ? -18.978 22.552 3.202   1.00 12.70 ? 73   ASN B CA  1 
ATOM   2068 C  C   . ASN B 1 73  ? -19.774 23.826 3.413   1.00 12.13 ? 73   ASN B C   1 
ATOM   2069 O  O   . ASN B 1 73  ? -20.763 23.820 4.100   1.00 13.47 ? 73   ASN B O   1 
ATOM   2070 C  CB  . ASN B 1 73  ? -17.684 22.549 4.084   1.00 12.35 ? 73   ASN B CB  1 
ATOM   2071 C  CG  . ASN B 1 73  ? -17.030 21.192 4.133   1.00 13.01 ? 73   ASN B CG  1 
ATOM   2072 O  OD1 . ASN B 1 73  ? -17.669 20.206 3.782   1.00 12.17 ? 73   ASN B OD1 1 
ATOM   2073 N  ND2 . ASN B 1 73  ? -15.757 21.124 4.531   1.00 12.72 ? 73   ASN B ND2 1 
ATOM   2074 N  N   . HIS B 1 74  ? -19.352 24.944 2.837   1.00 13.86 ? 74   HIS B N   1 
ATOM   2075 C  CA  . HIS B 1 74  ? -20.101 26.168 3.060   1.00 12.42 ? 74   HIS B CA  1 
ATOM   2076 C  C   . HIS B 1 74  ? -21.417 26.207 2.358   1.00 13.40 ? 74   HIS B C   1 
ATOM   2077 O  O   . HIS B 1 74  ? -22.403 26.666 2.938   1.00 14.27 ? 74   HIS B O   1 
ATOM   2078 C  CB  . HIS B 1 74  ? -19.293 27.382 2.696   1.00 11.87 ? 74   HIS B CB  1 
ATOM   2079 C  CG  . HIS B 1 74  ? -18.262 27.673 3.706   1.00 12.75 ? 74   HIS B CG  1 
ATOM   2080 N  ND1 . HIS B 1 74  ? -17.052 27.011 3.740   1.00 8.69  ? 74   HIS B ND1 1 
ATOM   2081 C  CD2 . HIS B 1 74  ? -18.284 28.489 4.785   1.00 12.03 ? 74   HIS B CD2 1 
ATOM   2082 C  CE1 . HIS B 1 74  ? -16.355 27.434 4.778   1.00 10.41 ? 74   HIS B CE1 1 
ATOM   2083 N  NE2 . HIS B 1 74  ? -17.084 28.321 5.432   1.00 11.87 ? 74   HIS B NE2 1 
ATOM   2084 N  N   . THR B 1 75  ? -21.450 25.744 1.103   1.00 13.23 ? 75   THR B N   1 
ATOM   2085 C  CA  . THR B 1 75  ? -22.710 25.691 0.380   1.00 12.85 ? 75   THR B CA  1 
ATOM   2086 C  C   . THR B 1 75  ? -23.748 24.906 1.170   1.00 12.60 ? 75   THR B C   1 
ATOM   2087 O  O   . THR B 1 75  ? -24.903 25.333 1.338   1.00 12.62 ? 75   THR B O   1 
ATOM   2088 C  CB  . THR B 1 75  ? -22.500 25.121 -1.042  1.00 12.71 ? 75   THR B CB  1 
ATOM   2089 O  OG1 . THR B 1 75  ? -21.649 26.028 -1.765  1.00 13.77 ? 75   THR B OG1 1 
ATOM   2090 C  CG2 . THR B 1 75  ? -23.814 25.019 -1.784  1.00 10.98 ? 75   THR B CG2 1 
ATOM   2091 N  N   . PHE B 1 76  ? -23.331 23.746 1.648   1.00 13.49 ? 76   PHE B N   1 
ATOM   2092 C  CA  . PHE B 1 76  ? -24.187 22.873 2.429   1.00 13.06 ? 76   PHE B CA  1 
ATOM   2093 C  C   . PHE B 1 76  ? -24.631 23.598 3.708   1.00 12.46 ? 76   PHE B C   1 
ATOM   2094 O  O   . PHE B 1 76  ? -25.814 23.602 4.034   1.00 12.30 ? 76   PHE B O   1 
ATOM   2095 C  CB  . PHE B 1 76  ? -23.378 21.634 2.763   1.00 13.07 ? 76   PHE B CB  1 
ATOM   2096 C  CG  . PHE B 1 76  ? -24.188 20.515 3.375   1.00 14.66 ? 76   PHE B CG  1 
ATOM   2097 C  CD1 . PHE B 1 76  ? -24.840 19.589 2.566   1.00 16.42 ? 76   PHE B CD1 1 
ATOM   2098 C  CD2 . PHE B 1 76  ? -24.284 20.391 4.769   1.00 15.23 ? 76   PHE B CD2 1 
ATOM   2099 C  CE1 . PHE B 1 76  ? -25.584 18.556 3.130   1.00 11.01 ? 76   PHE B CE1 1 
ATOM   2100 C  CE2 . PHE B 1 76  ? -25.024 19.383 5.337   1.00 12.12 ? 76   PHE B CE2 1 
ATOM   2101 C  CZ  . PHE B 1 76  ? -25.698 18.471 4.507   1.00 14.66 ? 76   PHE B CZ  1 
ATOM   2102 N  N   . TYR B 1 77  ? -23.668 24.205 4.418   1.00 12.14 ? 77   TYR B N   1 
ATOM   2103 C  CA  . TYR B 1 77  ? -23.950 24.973 5.634   1.00 12.58 ? 77   TYR B CA  1 
ATOM   2104 C  C   . TYR B 1 77  ? -25.030 26.024 5.414   1.00 12.17 ? 77   TYR B C   1 
ATOM   2105 O  O   . TYR B 1 77  ? -25.999 26.061 6.177   1.00 14.45 ? 77   TYR B O   1 
ATOM   2106 C  CB  . TYR B 1 77  ? -22.646 25.590 6.159   1.00 12.05 ? 77   TYR B CB  1 
ATOM   2107 C  CG  . TYR B 1 77  ? -22.767 26.521 7.355   1.00 14.18 ? 77   TYR B CG  1 
ATOM   2108 C  CD1 . TYR B 1 77  ? -23.261 26.059 8.609   1.00 14.36 ? 77   TYR B CD1 1 
ATOM   2109 C  CD2 . TYR B 1 77  ? -22.365 27.860 7.255   1.00 14.01 ? 77   TYR B CD2 1 
ATOM   2110 C  CE1 . TYR B 1 77  ? -23.334 26.917 9.727   1.00 12.88 ? 77   TYR B CE1 1 
ATOM   2111 C  CE2 . TYR B 1 77  ? -22.434 28.706 8.349   1.00 13.19 ? 77   TYR B CE2 1 
ATOM   2112 C  CZ  . TYR B 1 77  ? -22.929 28.236 9.573   1.00 12.82 ? 77   TYR B CZ  1 
ATOM   2113 O  OH  . TYR B 1 77  ? -23.002 29.105 10.621  1.00 14.77 ? 77   TYR B OH  1 
ATOM   2114 N  N   . TRP B 1 78  ? -24.947 26.828 4.362   1.00 12.75 ? 78   TRP B N   1 
ATOM   2115 C  CA  . TRP B 1 78  ? -26.007 27.861 4.147   1.00 11.31 ? 78   TRP B CA  1 
ATOM   2116 C  C   . TRP B 1 78  ? -27.364 27.216 3.936   1.00 12.76 ? 78   TRP B C   1 
ATOM   2117 O  O   . TRP B 1 78  ? -28.406 27.732 4.414   1.00 14.33 ? 78   TRP B O   1 
ATOM   2118 C  CB  . TRP B 1 78  ? -25.735 28.803 2.952   1.00 12.95 ? 78   TRP B CB  1 
ATOM   2119 C  CG  . TRP B 1 78  ? -24.386 29.422 2.924   1.00 12.08 ? 78   TRP B CG  1 
ATOM   2120 C  CD1 . TRP B 1 78  ? -23.485 29.344 1.884   1.00 13.87 ? 78   TRP B CD1 1 
ATOM   2121 C  CD2 . TRP B 1 78  ? -23.739 30.183 3.955   1.00 15.03 ? 78   TRP B CD2 1 
ATOM   2122 N  NE1 . TRP B 1 78  ? -22.342 29.996 2.200   1.00 13.05 ? 78   TRP B NE1 1 
ATOM   2123 C  CE2 . TRP B 1 78  ? -22.455 30.531 3.458   1.00 14.69 ? 78   TRP B CE2 1 
ATOM   2124 C  CE3 . TRP B 1 78  ? -24.115 30.603 5.246   1.00 13.43 ? 78   TRP B CE3 1 
ATOM   2125 C  CZ2 . TRP B 1 78  ? -21.533 31.268 4.206   1.00 14.09 ? 78   TRP B CZ2 1 
ATOM   2126 C  CZ3 . TRP B 1 78  ? -23.224 31.345 5.994   1.00 12.81 ? 78   TRP B CZ3 1 
ATOM   2127 C  CH2 . TRP B 1 78  ? -21.934 31.678 5.467   1.00 14.04 ? 78   TRP B CH2 1 
ATOM   2128 N  N   . ASN B 1 79  ? -27.394 26.152 3.160   1.00 12.57 ? 79   ASN B N   1 
ATOM   2129 C  CA  . ASN B 1 79  ? -28.653 25.387 3.000   1.00 12.80 ? 79   ASN B CA  1 
ATOM   2130 C  C   . ASN B 1 79  ? -29.207 24.833 4.320   1.00 14.18 ? 79   ASN B C   1 
ATOM   2131 O  O   . ASN B 1 79  ? -30.375 24.474 4.393   1.00 12.86 ? 79   ASN B O   1 
ATOM   2132 C  CB  . ASN B 1 79  ? -28.477 24.228 2.000   1.00 13.22 ? 79   ASN B CB  1 
ATOM   2133 C  CG  . ASN B 1 79  ? -28.314 24.695 0.554   1.00 16.31 ? 79   ASN B CG  1 
ATOM   2134 O  OD1 . ASN B 1 79  ? -27.573 24.064 -0.250  1.00 20.61 ? 79   ASN B OD1 1 
ATOM   2135 N  ND2 . ASN B 1 79  ? -29.010 25.756 0.199   1.00 15.37 ? 79   ASN B ND2 1 
ATOM   2136 N  N   . CYS B 1 80  ? -28.364 24.727 5.352   1.00 14.26 ? 80   CYS B N   1 
ATOM   2137 C  CA  . CYS B 1 80  ? -28.838 24.208 6.642   1.00 14.83 ? 80   CYS B CA  1 
ATOM   2138 C  C   . CYS B 1 80  ? -29.543 25.261 7.498   1.00 15.36 ? 80   CYS B C   1 
ATOM   2139 O  O   . CYS B 1 80  ? -30.203 24.916 8.512   1.00 16.74 ? 80   CYS B O   1 
ATOM   2140 C  CB  . CYS B 1 80  ? -27.697 23.621 7.431   1.00 13.39 ? 80   CYS B CB  1 
ATOM   2141 S  SG  . CYS B 1 80  ? -27.116 22.069 6.782   1.00 16.03 ? 80   CYS B SG  1 
ATOM   2142 N  N   . LEU B 1 81  ? -29.375 26.531 7.114   1.00 15.08 ? 81   LEU B N   1 
ATOM   2143 C  CA  . LEU B 1 81  ? -29.968 27.668 7.786   1.00 15.26 ? 81   LEU B CA  1 
ATOM   2144 C  C   . LEU B 1 81  ? -31.145 28.252 7.001   1.00 16.24 ? 81   LEU B C   1 
ATOM   2145 O  O   . LEU B 1 81  ? -31.191 28.192 5.769   1.00 15.59 ? 81   LEU B O   1 
ATOM   2146 C  CB  . LEU B 1 81  ? -28.910 28.753 7.976   1.00 15.05 ? 81   LEU B CB  1 
ATOM   2147 C  CG  . LEU B 1 81  ? -27.649 28.222 8.636   1.00 14.70 ? 81   LEU B CG  1 
ATOM   2148 C  CD1 . LEU B 1 81  ? -26.534 29.286 8.609   1.00 10.14 ? 81   LEU B CD1 1 
ATOM   2149 C  CD2 . LEU B 1 81  ? -27.900 27.669 10.056  1.00 16.29 ? 81   LEU B CD2 1 
ATOM   2150 N  N   . ALA B 1 82  ? -32.087 28.846 7.732   1.00 14.96 ? 82   ALA B N   1 
ATOM   2151 C  CA  . ALA B 1 82  ? -33.253 29.472 7.108   1.00 14.53 ? 82   ALA B CA  1 
ATOM   2152 C  C   . ALA B 1 82  ? -33.968 30.355 8.119   1.00 15.44 ? 82   ALA B C   1 
ATOM   2153 O  O   . ALA B 1 82  ? -33.927 30.071 9.326   1.00 14.63 ? 82   ALA B O   1 
ATOM   2154 C  CB  . ALA B 1 82  ? -34.219 28.421 6.571   1.00 16.75 ? 82   ALA B CB  1 
ATOM   2155 N  N   . PRO B 1 83  ? -34.603 31.446 7.626   1.00 15.93 ? 83   PRO B N   1 
ATOM   2156 C  CA  . PRO B 1 83  ? -35.580 32.240 8.382   1.00 18.08 ? 83   PRO B CA  1 
ATOM   2157 C  C   . PRO B 1 83  ? -36.828 31.397 8.639   1.00 19.81 ? 83   PRO B C   1 
ATOM   2158 O  O   . PRO B 1 83  ? -37.088 30.455 7.885   1.00 21.13 ? 83   PRO B O   1 
ATOM   2159 C  CB  . PRO B 1 83  ? -35.910 33.386 7.422   1.00 17.77 ? 83   PRO B CB  1 
ATOM   2160 C  CG  . PRO B 1 83  ? -35.614 32.860 6.064   1.00 16.81 ? 83   PRO B CG  1 
ATOM   2161 C  CD  . PRO B 1 83  ? -34.403 31.992 6.261   1.00 16.31 ? 83   PRO B CD  1 
ATOM   2162 N  N   . ASN B 1 84  ? -37.573 31.713 9.694   1.00 21.41 ? 84   ASN B N   1 
ATOM   2163 C  CA  . ASN B 1 84  ? -38.781 30.967 10.041  1.00 22.57 ? 84   ASN B CA  1 
ATOM   2164 C  C   . ASN B 1 84  ? -38.609 29.432 10.102  1.00 22.39 ? 84   ASN B C   1 
ATOM   2165 O  O   . ASN B 1 84  ? -39.501 28.661 9.681   1.00 23.21 ? 84   ASN B O   1 
ATOM   2166 C  CB  . ASN B 1 84  ? -39.934 31.375 9.107   1.00 23.51 ? 84   ASN B CB  1 
ATOM   2167 C  CG  . ASN B 1 84  ? -40.144 32.869 9.092   1.00 28.44 ? 84   ASN B CG  1 
ATOM   2168 O  OD1 . ASN B 1 84  ? -39.818 33.543 8.109   1.00 33.57 ? 84   ASN B OD1 1 
ATOM   2169 N  ND2 . ASN B 1 84  ? -40.673 33.414 10.200  1.00 33.67 ? 84   ASN B ND2 1 
ATOM   2170 N  N   . ALA B 1 85  ? -37.474 28.974 10.626  1.00 20.47 ? 85   ALA B N   1 
ATOM   2171 C  CA  . ALA B 1 85  ? -37.267 27.545 10.729  1.00 19.86 ? 85   ALA B CA  1 
ATOM   2172 C  C   . ALA B 1 85  ? -36.885 27.162 12.162  1.00 19.85 ? 85   ALA B C   1 
ATOM   2173 O  O   . ALA B 1 85  ? -37.525 27.622 13.098  1.00 19.58 ? 85   ALA B O   1 
ATOM   2174 C  CB  . ALA B 1 85  ? -36.251 27.034 9.667   1.00 20.05 ? 85   ALA B CB  1 
ATOM   2175 N  N   . GLY B 1 86  ? -35.888 26.301 12.343  1.00 19.02 ? 86   GLY B N   1 
ATOM   2176 C  CA  . GLY B 1 86  ? -35.492 25.876 13.675  1.00 19.66 ? 86   GLY B CA  1 
ATOM   2177 C  C   . GLY B 1 86  ? -36.555 25.112 14.452  1.00 20.62 ? 86   GLY B C   1 
ATOM   2178 O  O   . GLY B 1 86  ? -37.481 24.527 13.869  1.00 21.31 ? 86   GLY B O   1 
ATOM   2179 N  N   . GLY B 1 87  ? -36.431 25.104 15.775  1.00 20.24 ? 87   GLY B N   1 
ATOM   2180 C  CA  . GLY B 1 87  ? -37.383 24.355 16.595  1.00 19.94 ? 87   GLY B CA  1 
ATOM   2181 C  C   . GLY B 1 87  ? -37.241 22.863 16.377  1.00 19.91 ? 87   GLY B C   1 
ATOM   2182 O  O   . GLY B 1 87  ? -36.189 22.396 15.988  1.00 20.16 ? 87   GLY B O   1 
ATOM   2183 N  N   . GLN B 1 88  ? -38.315 22.127 16.634  1.00 20.07 ? 88   GLN B N   1 
ATOM   2184 C  CA  . GLN B 1 88  ? -38.314 20.676 16.547  1.00 20.81 ? 88   GLN B CA  1 
ATOM   2185 C  C   . GLN B 1 88  ? -38.574 20.251 15.112  1.00 20.52 ? 88   GLN B C   1 
ATOM   2186 O  O   . GLN B 1 88  ? -39.419 20.844 14.436  1.00 20.70 ? 88   GLN B O   1 
ATOM   2187 C  CB  . GLN B 1 88  ? -39.460 20.105 17.379  1.00 21.19 ? 88   GLN B CB  1 
ATOM   2188 C  CG  . GLN B 1 88  ? -39.361 20.329 18.889  1.00 23.27 ? 88   GLN B CG  1 
ATOM   2189 C  CD  . GLN B 1 88  ? -39.035 19.065 19.635  1.00 26.76 ? 88   GLN B CD  1 
ATOM   2190 O  OE1 . GLN B 1 88  ? -39.103 17.962 19.073  1.00 28.64 ? 88   GLN B OE1 1 
ATOM   2191 N  NE2 . GLN B 1 88  ? -38.683 19.203 20.916  1.00 26.31 ? 88   GLN B NE2 1 
ATOM   2192 N  N   . PRO B 1 89  ? -37.900 19.184 14.667  1.00 20.13 ? 89   PRO B N   1 
ATOM   2193 C  CA  . PRO B 1 89  ? -38.211 18.637 13.348  1.00 20.18 ? 89   PRO B CA  1 
ATOM   2194 C  C   . PRO B 1 89  ? -39.598 17.940 13.388  1.00 20.08 ? 89   PRO B C   1 
ATOM   2195 O  O   . PRO B 1 89  ? -40.084 17.589 14.487  1.00 20.54 ? 89   PRO B O   1 
ATOM   2196 C  CB  . PRO B 1 89  ? -37.104 17.598 13.141  1.00 19.36 ? 89   PRO B CB  1 
ATOM   2197 C  CG  . PRO B 1 89  ? -36.739 17.160 14.509  1.00 20.79 ? 89   PRO B CG  1 
ATOM   2198 C  CD  . PRO B 1 89  ? -36.848 18.414 15.357  1.00 20.00 ? 89   PRO B CD  1 
ATOM   2199 N  N   . THR B 1 90  ? -40.230 17.739 12.230  1.00 20.39 ? 90   THR B N   1 
ATOM   2200 C  CA  . THR B 1 90  ? -41.445 16.933 12.202  1.00 20.46 ? 90   THR B CA  1 
ATOM   2201 C  C   . THR B 1 90  ? -41.312 15.754 11.230  1.00 19.83 ? 90   THR B C   1 
ATOM   2202 O  O   . THR B 1 90  ? -40.252 15.506 10.677  1.00 18.71 ? 90   THR B O   1 
ATOM   2203 C  CB  . THR B 1 90  ? -42.707 17.728 11.804  1.00 21.24 ? 90   THR B CB  1 
ATOM   2204 O  OG1 . THR B 1 90  ? -42.500 18.262 10.505  1.00 24.78 ? 90   THR B OG1 1 
ATOM   2205 C  CG2 . THR B 1 90  ? -43.018 18.887 12.792  1.00 23.07 ? 90   THR B CG2 1 
ATOM   2206 N  N   . GLY B 1 91  ? -42.402 15.013 11.066  1.00 18.81 ? 91   GLY B N   1 
ATOM   2207 C  CA  . GLY B 1 91  ? -42.494 13.978 10.041  1.00 17.94 ? 91   GLY B CA  1 
ATOM   2208 C  C   . GLY B 1 91  ? -41.335 13.010 9.962   1.00 17.81 ? 91   GLY B C   1 
ATOM   2209 O  O   . GLY B 1 91  ? -40.951 12.383 10.961  1.00 17.61 ? 91   GLY B O   1 
ATOM   2210 N  N   . ALA B 1 92  ? -40.795 12.864 8.748   1.00 17.14 ? 92   ALA B N   1 
ATOM   2211 C  CA  . ALA B 1 92  ? -39.761 11.853 8.474   1.00 16.21 ? 92   ALA B CA  1 
ATOM   2212 C  C   . ALA B 1 92  ? -38.420 12.095 9.199   1.00 16.30 ? 92   ALA B C   1 
ATOM   2213 O  O   . ALA B 1 92  ? -37.774 11.147 9.659   1.00 16.09 ? 92   ALA B O   1 
ATOM   2214 C  CB  . ALA B 1 92  ? -39.533 11.742 6.951   1.00 16.15 ? 92   ALA B CB  1 
ATOM   2215 N  N   . VAL B 1 93  ? -37.978 13.347 9.273   1.00 15.49 ? 93   VAL B N   1 
ATOM   2216 C  CA  . VAL B 1 93  ? -36.708 13.643 9.983   1.00 15.13 ? 93   VAL B CA  1 
ATOM   2217 C  C   . VAL B 1 93  ? -36.889 13.357 11.483  1.00 14.62 ? 93   VAL B C   1 
ATOM   2218 O  O   . VAL B 1 93  ? -36.048 12.727 12.128  1.00 15.55 ? 93   VAL B O   1 
ATOM   2219 C  CB  . VAL B 1 93  ? -36.266 15.136 9.775   1.00 15.68 ? 93   VAL B CB  1 
ATOM   2220 C  CG1 . VAL B 1 93  ? -34.984 15.447 10.573  1.00 14.76 ? 93   VAL B CG1 1 
ATOM   2221 C  CG2 . VAL B 1 93  ? -35.995 15.414 8.282   1.00 15.98 ? 93   VAL B CG2 1 
ATOM   2222 N  N   . ALA B 1 94  ? -38.001 13.824 12.035  1.00 15.07 ? 94   ALA B N   1 
ATOM   2223 C  CA  . ALA B 1 94  ? -38.312 13.573 13.444  1.00 14.48 ? 94   ALA B CA  1 
ATOM   2224 C  C   . ALA B 1 94  ? -38.285 12.098 13.775  1.00 13.87 ? 94   ALA B C   1 
ATOM   2225 O  O   . ALA B 1 94  ? -37.698 11.712 14.783  1.00 14.73 ? 94   ALA B O   1 
ATOM   2226 C  CB  . ALA B 1 94  ? -39.658 14.133 13.813  1.00 14.02 ? 94   ALA B CB  1 
ATOM   2227 N  N   . ALA B 1 95  ? -38.951 11.275 12.957  1.00 15.38 ? 95   ALA B N   1 
ATOM   2228 C  CA  . ALA B 1 95  ? -39.017 9.848  13.234  1.00 15.07 ? 95   ALA B CA  1 
ATOM   2229 C  C   . ALA B 1 95  ? -37.641 9.231  13.144  1.00 15.60 ? 95   ALA B C   1 
ATOM   2230 O  O   . ALA B 1 95  ? -37.309 8.334  13.919  1.00 17.69 ? 95   ALA B O   1 
ATOM   2231 C  CB  . ALA B 1 95  ? -39.970 9.143  12.276  1.00 15.49 ? 95   ALA B CB  1 
ATOM   2232 N  N   . ALA B 1 96  ? -36.858 9.649  12.155  1.00 14.86 ? 96   ALA B N   1 
ATOM   2233 C  CA  . ALA B 1 96  ? -35.519 9.117  11.978  1.00 14.45 ? 96   ALA B CA  1 
ATOM   2234 C  C   . ALA B 1 96  ? -34.614 9.462  13.153  1.00 15.09 ? 96   ALA B C   1 
ATOM   2235 O  O   . ALA B 1 96  ? -33.790 8.665  13.589  1.00 14.65 ? 96   ALA B O   1 
ATOM   2236 C  CB  . ALA B 1 96  ? -34.905 9.612  10.661  1.00 14.42 ? 96   ALA B CB  1 
ATOM   2237 N  N   . ILE B 1 97  ? -34.737 10.684 13.642  1.00 15.81 ? 97   ILE B N   1 
ATOM   2238 C  CA  . ILE B 1 97  ? -33.951 11.122 14.809  1.00 14.97 ? 97   ILE B CA  1 
ATOM   2239 C  C   . ILE B 1 97  ? -34.416 10.398 16.092  1.00 16.82 ? 97   ILE B C   1 
ATOM   2240 O  O   . ILE B 1 97  ? -33.603 9.974  16.887  1.00 17.81 ? 97   ILE B O   1 
ATOM   2241 C  CB  . ILE B 1 97  ? -33.968 12.669 14.909  1.00 15.08 ? 97   ILE B CB  1 
ATOM   2242 C  CG1 . ILE B 1 97  ? -33.117 13.240 13.774  1.00 12.81 ? 97   ILE B CG1 1 
ATOM   2243 C  CG2 . ILE B 1 97  ? -33.479 13.133 16.260  1.00 15.27 ? 97   ILE B CG2 1 
ATOM   2244 C  CD1 . ILE B 1 97  ? -32.983 14.790 13.708  1.00 13.09 ? 97   ILE B CD1 1 
ATOM   2245 N  N   . ASP B 1 98  ? -35.718 10.212 16.266  1.00 18.41 ? 98   ASP B N   1 
ATOM   2246 C  CA  . ASP B 1 98  ? -36.249 9.465  17.430  1.00 19.64 ? 98   ASP B CA  1 
ATOM   2247 C  C   . ASP B 1 98  ? -35.677 8.052  17.499  1.00 20.71 ? 98   ASP B C   1 
ATOM   2248 O  O   . ASP B 1 98  ? -35.276 7.572  18.564  1.00 20.97 ? 98   ASP B O   1 
ATOM   2249 C  CB  . ASP B 1 98  ? -37.764 9.387  17.352  1.00 19.39 ? 98   ASP B CB  1 
ATOM   2250 C  CG  . ASP B 1 98  ? -38.429 10.657 17.799  1.00 23.04 ? 98   ASP B CG  1 
ATOM   2251 O  OD1 . ASP B 1 98  ? -37.723 11.615 18.178  1.00 27.06 ? 98   ASP B OD1 1 
ATOM   2252 O  OD2 . ASP B 1 98  ? -39.679 10.733 17.756  1.00 28.69 ? 98   ASP B OD2 1 
ATOM   2253 N  N   . ALA B 1 99  ? -35.632 7.386  16.349  1.00 21.12 ? 99   ALA B N   1 
ATOM   2254 C  CA  . ALA B 1 99  ? -35.161 6.016  16.284  1.00 20.39 ? 99   ALA B CA  1 
ATOM   2255 C  C   . ALA B 1 99  ? -33.663 5.966  16.550  1.00 20.10 ? 99   ALA B C   1 
ATOM   2256 O  O   . ALA B 1 99  ? -33.184 5.092  17.264  1.00 20.03 ? 99   ALA B O   1 
ATOM   2257 C  CB  . ALA B 1 99  ? -35.482 5.420  14.903  1.00 21.15 ? 99   ALA B CB  1 
ATOM   2258 N  N   . ALA B 1 100 ? -32.896 6.894  15.992  1.00 19.13 ? 100  ALA B N   1 
ATOM   2259 C  CA  . ALA B 1 100 ? -31.437 6.763  16.129  1.00 17.83 ? 100  ALA B CA  1 
ATOM   2260 C  C   . ALA B 1 100 ? -30.929 7.214  17.494  1.00 18.29 ? 100  ALA B C   1 
ATOM   2261 O  O   . ALA B 1 100 ? -29.891 6.710  17.959  1.00 18.67 ? 100  ALA B O   1 
ATOM   2262 C  CB  . ALA B 1 100 ? -30.741 7.559  15.048  1.00 17.37 ? 100  ALA B CB  1 
ATOM   2263 N  N   . PHE B 1 101 ? -31.628 8.187  18.081  1.00 17.64 ? 101  PHE B N   1 
ATOM   2264 C  CA  . PHE B 1 101 ? -31.166 8.924  19.272  1.00 17.53 ? 101  PHE B CA  1 
ATOM   2265 C  C   . PHE B 1 101 ? -32.099 8.891  20.464  1.00 17.39 ? 101  PHE B C   1 
ATOM   2266 O  O   . PHE B 1 101 ? -31.685 9.227  21.575  1.00 18.99 ? 101  PHE B O   1 
ATOM   2267 C  CB  . PHE B 1 101 ? -30.844 10.388 18.930  1.00 16.31 ? 101  PHE B CB  1 
ATOM   2268 C  CG  . PHE B 1 101 ? -29.796 10.526 17.885  1.00 17.31 ? 101  PHE B CG  1 
ATOM   2269 C  CD1 . PHE B 1 101 ? -28.454 10.436 18.222  1.00 13.49 ? 101  PHE B CD1 1 
ATOM   2270 C  CD2 . PHE B 1 101 ? -30.151 10.714 16.542  1.00 17.75 ? 101  PHE B CD2 1 
ATOM   2271 C  CE1 . PHE B 1 101 ? -27.470 10.528 17.219  1.00 16.69 ? 101  PHE B CE1 1 
ATOM   2272 C  CE2 . PHE B 1 101 ? -29.177 10.848 15.549  1.00 18.84 ? 101  PHE B CE2 1 
ATOM   2273 C  CZ  . PHE B 1 101 ? -27.844 10.744 15.873  1.00 15.60 ? 101  PHE B CZ  1 
ATOM   2274 N  N   . GLY B 1 102 ? -33.353 8.487  20.269  1.00 18.04 ? 102  GLY B N   1 
ATOM   2275 C  CA  . GLY B 1 102 ? -34.259 8.403  21.398  1.00 16.75 ? 102  GLY B CA  1 
ATOM   2276 C  C   . GLY B 1 102 ? -35.309 9.492  21.361  1.00 15.75 ? 102  GLY B C   1 
ATOM   2277 O  O   . GLY B 1 102 ? -36.485 9.207  21.590  1.00 17.52 ? 102  GLY B O   1 
ATOM   2278 N  N   . SER B 1 103 ? -34.902 10.716 21.044  1.00 14.45 ? 103  SER B N   1 
ATOM   2279 C  CA  . SER B 1 103 ? -35.821 11.840 20.981  1.00 13.56 ? 103  SER B CA  1 
ATOM   2280 C  C   . SER B 1 103 ? -35.068 12.968 20.310  1.00 14.07 ? 103  SER B C   1 
ATOM   2281 O  O   . SER B 1 103 ? -33.842 12.909 20.193  1.00 13.18 ? 103  SER B O   1 
ATOM   2282 C  CB  . SER B 1 103 ? -36.196 12.287 22.407  1.00 13.63 ? 103  SER B CB  1 
ATOM   2283 O  OG  . SER B 1 103 ? -35.012 12.524 23.173  1.00 11.35 ? 103  SER B OG  1 
ATOM   2284 N  N   . PHE B 1 104 ? -35.765 14.000 19.871  1.00 13.73 ? 104  PHE B N   1 
ATOM   2285 C  CA  . PHE B 1 104 ? -35.030 15.170 19.385  1.00 14.61 ? 104  PHE B CA  1 
ATOM   2286 C  C   . PHE B 1 104 ? -34.135 15.801 20.483  1.00 14.61 ? 104  PHE B C   1 
ATOM   2287 O  O   . PHE B 1 104 ? -33.019 16.333 20.212  1.00 14.91 ? 104  PHE B O   1 
ATOM   2288 C  CB  . PHE B 1 104 ? -35.983 16.228 18.811  1.00 13.96 ? 104  PHE B CB  1 
ATOM   2289 C  CG  . PHE B 1 104 ? -35.275 17.468 18.407  1.00 14.69 ? 104  PHE B CG  1 
ATOM   2290 C  CD1 . PHE B 1 104 ? -34.332 17.423 17.399  1.00 14.76 ? 104  PHE B CD1 1 
ATOM   2291 C  CD2 . PHE B 1 104 ? -35.520 18.675 19.057  1.00 12.57 ? 104  PHE B CD2 1 
ATOM   2292 C  CE1 . PHE B 1 104 ? -33.607 18.560 17.035  1.00 16.66 ? 104  PHE B CE1 1 
ATOM   2293 C  CE2 . PHE B 1 104 ? -34.816 19.825 18.678  1.00 15.00 ? 104  PHE B CE2 1 
ATOM   2294 C  CZ  . PHE B 1 104 ? -33.862 19.762 17.680  1.00 16.42 ? 104  PHE B CZ  1 
ATOM   2295 N  N   . GLU B 1 105 ? -34.660 15.816 21.712  1.00 14.75 ? 105  GLU B N   1 
ATOM   2296 C  CA  . GLU B 1 105 ? -33.948 16.453 22.856  1.00 14.09 ? 105  GLU B CA  1 
ATOM   2297 C  C   . GLU B 1 105 ? -32.623 15.764 23.082  1.00 13.82 ? 105  GLU B C   1 
ATOM   2298 O  O   . GLU B 1 105 ? -31.573 16.413 23.244  1.00 14.02 ? 105  GLU B O   1 
ATOM   2299 C  CB  . GLU B 1 105 ? -34.804 16.335 24.112  1.00 15.51 ? 105  GLU B CB  1 
ATOM   2300 C  CG  . GLU B 1 105 ? -35.983 17.214 24.137  1.00 13.88 ? 105  GLU B CG  1 
ATOM   2301 C  CD  . GLU B 1 105 ? -37.172 16.743 23.338  1.00 19.32 ? 105  GLU B CD  1 
ATOM   2302 O  OE1 . GLU B 1 105 ? -37.255 15.567 22.917  1.00 16.46 ? 105  GLU B OE1 1 
ATOM   2303 O  OE2 . GLU B 1 105 ? -38.078 17.569 23.132  1.00 20.48 ? 105  GLU B OE2 1 
ATOM   2304 N  N   . GLU B 1 106 ? -32.644 14.446 23.055  1.00 13.68 ? 106  GLU B N   1 
ATOM   2305 C  CA  . GLU B 1 106 ? -31.388 13.705 23.229  1.00 15.20 ? 106  GLU B CA  1 
ATOM   2306 C  C   . GLU B 1 106 ? -30.376 13.926 22.094  1.00 15.36 ? 106  GLU B C   1 
ATOM   2307 O  O   . GLU B 1 106 ? -29.151 13.979 22.338  1.00 15.05 ? 106  GLU B O   1 
ATOM   2308 C  CB  . GLU B 1 106 ? -31.669 12.216 23.382  1.00 15.01 ? 106  GLU B CB  1 
ATOM   2309 C  CG  . GLU B 1 106 ? -32.336 11.862 24.732  1.00 17.48 ? 106  GLU B CG  1 
ATOM   2310 C  CD  . GLU B 1 106 ? -32.977 10.498 24.731  1.00 19.57 ? 106  GLU B CD  1 
ATOM   2311 O  OE1 . GLU B 1 106 ? -32.289 9.539  25.146  1.00 21.48 ? 106  GLU B OE1 1 
ATOM   2312 O  OE2 . GLU B 1 106 ? -34.147 10.400 24.317  1.00 18.69 ? 106  GLU B OE2 1 
ATOM   2313 N  N   . PHE B 1 107 ? -30.863 13.943 20.854  1.00 15.58 ? 107  PHE B N   1 
ATOM   2314 C  CA  . PHE B 1 107 ? -29.988 14.198 19.688  1.00 14.26 ? 107  PHE B CA  1 
ATOM   2315 C  C   . PHE B 1 107 ? -29.428 15.611 19.812  1.00 14.15 ? 107  PHE B C   1 
ATOM   2316 O  O   . PHE B 1 107 ? -28.251 15.839 19.576  1.00 14.50 ? 107  PHE B O   1 
ATOM   2317 C  CB  . PHE B 1 107 ? -30.742 14.082 18.339  1.00 15.09 ? 107  PHE B CB  1 
ATOM   2318 C  CG  . PHE B 1 107 ? -30.104 14.871 17.206  1.00 15.00 ? 107  PHE B CG  1 
ATOM   2319 C  CD1 . PHE B 1 107 ? -28.969 14.394 16.557  1.00 12.43 ? 107  PHE B CD1 1 
ATOM   2320 C  CD2 . PHE B 1 107 ? -30.657 16.072 16.785  1.00 16.73 ? 107  PHE B CD2 1 
ATOM   2321 C  CE1 . PHE B 1 107 ? -28.367 15.135 15.513  1.00 11.39 ? 107  PHE B CE1 1 
ATOM   2322 C  CE2 . PHE B 1 107 ? -30.075 16.814 15.743  1.00 16.52 ? 107  PHE B CE2 1 
ATOM   2323 C  CZ  . PHE B 1 107 ? -28.918 16.342 15.113  1.00 14.62 ? 107  PHE B CZ  1 
ATOM   2324 N  N   . LYS B 1 108 ? -30.280 16.573 20.146  1.00 14.91 ? 108  LYS B N   1 
ATOM   2325 C  CA  . LYS B 1 108 ? -29.812 17.975 20.265  1.00 15.38 ? 108  LYS B CA  1 
ATOM   2326 C  C   . LYS B 1 108 ? -28.682 18.140 21.290  1.00 15.48 ? 108  LYS B C   1 
ATOM   2327 O  O   . LYS B 1 108 ? -27.658 18.815 21.002  1.00 15.46 ? 108  LYS B O   1 
ATOM   2328 C  CB  . LYS B 1 108 ? -30.986 18.918 20.525  1.00 15.45 ? 108  LYS B CB  1 
ATOM   2329 C  CG  . LYS B 1 108 ? -30.595 20.369 20.787  1.00 17.58 ? 108  LYS B CG  1 
ATOM   2330 C  CD  . LYS B 1 108 ? -31.790 21.166 21.225  1.00 17.44 ? 108  LYS B CD  1 
ATOM   2331 C  CE  . LYS B 1 108 ? -31.315 22.556 21.600  1.00 17.74 ? 108  LYS B CE  1 
ATOM   2332 N  NZ  . LYS B 1 108 ? -32.478 23.425 21.912  1.00 16.99 ? 108  LYS B NZ  1 
ATOM   2333 N  N   . ALA B 1 109 ? -28.841 17.522 22.464  1.00 14.91 ? 109  ALA B N   1 
ATOM   2334 C  CA  . ALA B 1 109 ? -27.803 17.574 23.519  1.00 14.40 ? 109  ALA B CA  1 
ATOM   2335 C  C   . ALA B 1 109 ? -26.519 16.932 23.041  1.00 14.24 ? 109  ALA B C   1 
ATOM   2336 O  O   . ALA B 1 109 ? -25.421 17.479 23.243  1.00 13.86 ? 109  ALA B O   1 
ATOM   2337 C  CB  . ALA B 1 109 ? -28.310 16.861 24.814  1.00 14.74 ? 109  ALA B CB  1 
ATOM   2338 N  N   . LYS B 1 110 ? -26.637 15.772 22.403  1.00 14.33 ? 110  LYS B N   1 
ATOM   2339 C  CA  . LYS B 1 110 ? -25.445 15.049 21.878  1.00 13.11 ? 110  LYS B CA  1 
ATOM   2340 C  C   . LYS B 1 110 ? -24.690 15.869 20.803  1.00 13.83 ? 110  LYS B C   1 
ATOM   2341 O  O   . LYS B 1 110 ? -23.446 15.958 20.807  1.00 12.01 ? 110  LYS B O   1 
ATOM   2342 C  CB  . LYS B 1 110 ? -25.856 13.664 21.364  1.00 15.00 ? 110  LYS B CB  1 
ATOM   2343 C  CG  . LYS B 1 110 ? -24.800 12.619 21.428  0.50 15.97 ? 110  LYS B CG  1 
ATOM   2344 C  CD  . LYS B 1 110 ? -25.416 11.244 21.325  0.50 19.94 ? 110  LYS B CD  1 
ATOM   2345 C  CE  . LYS B 1 110 ? -24.359 10.228 20.911  0.50 19.20 ? 110  LYS B CE  1 
ATOM   2346 N  NZ  . LYS B 1 110 ? -24.108 10.216 19.442  0.50 16.41 ? 110  LYS B NZ  1 
ATOM   2347 N  N   . PHE B 1 111 ? -25.451 16.501 19.912  1.00 12.75 ? 111  PHE B N   1 
ATOM   2348 C  CA  . PHE B 1 111 ? -24.927 17.282 18.794  1.00 12.00 ? 111  PHE B CA  1 
ATOM   2349 C  C   . PHE B 1 111 ? -24.297 18.557 19.343  1.00 12.87 ? 111  PHE B C   1 
ATOM   2350 O  O   . PHE B 1 111 ? -23.194 18.912 18.917  1.00 14.01 ? 111  PHE B O   1 
ATOM   2351 C  CB  . PHE B 1 111 ? -26.079 17.611 17.805  1.00 13.70 ? 111  PHE B CB  1 
ATOM   2352 C  CG  . PHE B 1 111 ? -25.628 18.241 16.491  1.00 11.79 ? 111  PHE B CG  1 
ATOM   2353 C  CD1 . PHE B 1 111 ? -25.436 17.441 15.322  1.00 14.42 ? 111  PHE B CD1 1 
ATOM   2354 C  CD2 . PHE B 1 111 ? -25.419 19.623 16.393  1.00 12.51 ? 111  PHE B CD2 1 
ATOM   2355 C  CE1 . PHE B 1 111 ? -25.026 18.018 14.107  1.00 13.48 ? 111  PHE B CE1 1 
ATOM   2356 C  CE2 . PHE B 1 111 ? -25.020 20.209 15.167  1.00 12.35 ? 111  PHE B CE2 1 
ATOM   2357 C  CZ  . PHE B 1 111 ? -24.826 19.406 14.035  1.00 13.43 ? 111  PHE B CZ  1 
ATOM   2358 N  N   . THR B 1 112 ? -24.985 19.246 20.271  1.00 12.52 ? 112  THR B N   1 
ATOM   2359 C  CA  . THR B 1 112 ? -24.357 20.424 20.899  1.00 13.06 ? 112  THR B CA  1 
ATOM   2360 C  C   . THR B 1 112 ? -23.107 20.077 21.672  1.00 14.17 ? 112  THR B C   1 
ATOM   2361 O  O   . THR B 1 112 ? -22.122 20.785 21.562  1.00 14.83 ? 112  THR B O   1 
ATOM   2362 C  CB  . THR B 1 112 ? -25.337 21.128 21.814  1.00 13.36 ? 112  THR B CB  1 
ATOM   2363 O  OG1 . THR B 1 112 ? -26.567 21.215 21.095  1.00 9.83  ? 112  THR B OG1 1 
ATOM   2364 C  CG2 . THR B 1 112 ? -24.881 22.536 22.223  1.00 15.47 ? 112  THR B CG2 1 
ATOM   2365 N  N   . ASP B 1 113 ? -23.122 18.977 22.441  1.00 15.79 ? 113  ASP B N   1 
ATOM   2366 C  CA  . ASP B 1 113 ? -21.899 18.596 23.149  1.00 16.84 ? 113  ASP B CA  1 
ATOM   2367 C  C   . ASP B 1 113 ? -20.764 18.273 22.183  1.00 16.36 ? 113  ASP B C   1 
ATOM   2368 O  O   . ASP B 1 113 ? -19.581 18.612 22.420  1.00 15.08 ? 113  ASP B O   1 
ATOM   2369 C  CB  . ASP B 1 113 ? -22.151 17.424 24.101  1.00 17.74 ? 113  ASP B CB  1 
ATOM   2370 C  CG  . ASP B 1 113 ? -20.845 16.861 24.679  1.00 24.70 ? 113  ASP B CG  1 
ATOM   2371 O  OD1 . ASP B 1 113 ? -20.194 17.557 25.491  1.00 30.17 ? 113  ASP B OD1 1 
ATOM   2372 O  OD2 . ASP B 1 113 ? -20.432 15.730 24.300  1.00 32.49 ? 113  ASP B OD2 1 
ATOM   2373 N  N   . SER B 1 114 ? -21.096 17.587 21.094  1.00 16.49 ? 114  SER B N   1 
ATOM   2374 C  CA  . SER B 1 114 ? -20.050 17.227 20.113  1.00 16.87 ? 114  SER B CA  1 
ATOM   2375 C  C   . SER B 1 114 ? -19.449 18.467 19.458  1.00 16.30 ? 114  SER B C   1 
ATOM   2376 O  O   . SER B 1 114 ? -18.236 18.563 19.243  1.00 15.93 ? 114  SER B O   1 
ATOM   2377 C  CB  . SER B 1 114 ? -20.620 16.314 19.029  1.00 17.11 ? 114  SER B CB  1 
ATOM   2378 O  OG  . SER B 1 114 ? -19.563 15.722 18.293  1.00 23.26 ? 114  SER B OG  1 
ATOM   2379 N  N   . ALA B 1 115 ? -20.309 19.426 19.170  1.00 15.29 ? 115  ALA B N   1 
ATOM   2380 C  CA  . ALA B 1 115 ? -19.877 20.699 18.598  1.00 16.62 ? 115  ALA B CA  1 
ATOM   2381 C  C   . ALA B 1 115 ? -19.016 21.569 19.532  1.00 17.81 ? 115  ALA B C   1 
ATOM   2382 O  O   . ALA B 1 115 ? -17.983 22.140 19.132  1.00 17.50 ? 115  ALA B O   1 
ATOM   2383 C  CB  . ALA B 1 115 ? -21.111 21.486 18.156  1.00 14.99 ? 115  ALA B CB  1 
ATOM   2384 N  N   . ILE B 1 116 ? -19.482 21.737 20.762  1.00 18.82 ? 116  ILE B N   1 
ATOM   2385 C  CA  . ILE B 1 116 ? -18.800 22.609 21.727  1.00 20.61 ? 116  ILE B CA  1 
ATOM   2386 C  C   . ILE B 1 116 ? -17.358 22.170 21.896  1.00 20.13 ? 116  ILE B C   1 
ATOM   2387 O  O   . ILE B 1 116 ? -16.468 22.987 21.970  1.00 21.42 ? 116  ILE B O   1 
ATOM   2388 C  CB  . ILE B 1 116 ? -19.565 22.572 23.121  1.00 20.40 ? 116  ILE B CB  1 
ATOM   2389 C  CG1 . ILE B 1 116 ? -20.924 23.268 23.040  1.00 24.34 ? 116  ILE B CG1 1 
ATOM   2390 C  CG2 . ILE B 1 116 ? -18.718 23.062 24.260  1.00 24.94 ? 116  ILE B CG2 1 
ATOM   2391 C  CD1 . ILE B 1 116 ? -20.941 24.518 22.225  1.00 28.28 ? 116  ILE B CD1 1 
ATOM   2392 N  N   . ASN B 1 117 ? -17.162 20.860 21.922  1.00 19.38 ? 117  ASN B N   1 
ATOM   2393 C  CA  . ASN B 1 117 ? -15.904 20.198 22.244  1.00 20.86 ? 117  ASN B CA  1 
ATOM   2394 C  C   . ASN B 1 117 ? -15.068 19.712 21.032  1.00 19.49 ? 117  ASN B C   1 
ATOM   2395 O  O   . ASN B 1 117 ? -14.066 19.001 21.185  1.00 22.37 ? 117  ASN B O   1 
ATOM   2396 C  CB  . ASN B 1 117 ? -16.205 19.079 23.241  1.00 21.23 ? 117  ASN B CB  1 
ATOM   2397 C  CG  . ASN B 1 117 ? -16.613 19.638 24.590  1.00 23.86 ? 117  ASN B CG  1 
ATOM   2398 O  OD1 . ASN B 1 117 ? -15.760 20.152 25.313  1.00 27.16 ? 117  ASN B OD1 1 
ATOM   2399 N  ND2 . ASN B 1 117 ? -17.927 19.617 24.908  1.00 23.17 ? 117  ASN B ND2 1 
ATOM   2400 N  N   . ASN B 1 118 ? -15.475 20.145 19.844  1.00 18.10 ? 118  ASN B N   1 
ATOM   2401 C  CA  . ASN B 1 118 ? -14.749 19.916 18.586  1.00 15.73 ? 118  ASN B CA  1 
ATOM   2402 C  C   . ASN B 1 118 ? -13.609 20.906 18.480  1.00 15.44 ? 118  ASN B C   1 
ATOM   2403 O  O   . ASN B 1 118 ? -13.822 22.077 18.156  1.00 14.41 ? 118  ASN B O   1 
ATOM   2404 C  CB  . ASN B 1 118 ? -15.725 20.081 17.409  1.00 15.41 ? 118  ASN B CB  1 
ATOM   2405 C  CG  . ASN B 1 118 ? -15.270 19.360 16.143  1.00 15.85 ? 118  ASN B CG  1 
ATOM   2406 O  OD1 . ASN B 1 118 ? -14.120 18.862 16.027  1.00 14.93 ? 118  ASN B OD1 1 
ATOM   2407 N  ND2 . ASN B 1 118 ? -16.148 19.348 15.157  1.00 14.82 ? 118  ASN B ND2 1 
ATOM   2408 N  N   . PHE B 1 119 ? -12.394 20.445 18.766  1.00 14.07 ? 119  PHE B N   1 
ATOM   2409 C  CA  . PHE B 1 119 ? -11.277 21.354 19.012  1.00 14.79 ? 119  PHE B CA  1 
ATOM   2410 C  C   . PHE B 1 119 ? -10.731 22.021 17.751  1.00 15.14 ? 119  PHE B C   1 
ATOM   2411 O  O   . PHE B 1 119 ? -10.511 21.355 16.736  1.00 13.71 ? 119  PHE B O   1 
ATOM   2412 C  CB  . PHE B 1 119 ? -10.131 20.566 19.694  1.00 14.63 ? 119  PHE B CB  1 
ATOM   2413 C  CG  . PHE B 1 119 ? -9.047  21.457 20.282  1.00 14.15 ? 119  PHE B CG  1 
ATOM   2414 C  CD1 . PHE B 1 119 ? -9.316  22.245 21.398  1.00 15.12 ? 119  PHE B CD1 1 
ATOM   2415 C  CD2 . PHE B 1 119 ? -7.792  21.540 19.691  1.00 10.90 ? 119  PHE B CD2 1 
ATOM   2416 C  CE1 . PHE B 1 119 ? -8.338  23.075 21.946  1.00 13.55 ? 119  PHE B CE1 1 
ATOM   2417 C  CE2 . PHE B 1 119 ? -6.800  22.349 20.247  1.00 15.05 ? 119  PHE B CE2 1 
ATOM   2418 C  CZ  . PHE B 1 119 ? -7.081  23.129 21.367  1.00 15.09 ? 119  PHE B CZ  1 
ATOM   2419 N  N   . GLY B 1 120 ? -10.462 23.324 17.828  1.00 14.24 ? 120  GLY B N   1 
ATOM   2420 C  CA  . GLY B 1 120 ? -10.023 24.088 16.683  1.00 14.14 ? 120  GLY B CA  1 
ATOM   2421 C  C   . GLY B 1 120 ? -11.078 24.295 15.595  1.00 13.23 ? 120  GLY B C   1 
ATOM   2422 O  O   . GLY B 1 120 ? -12.315 24.277 15.839  1.00 12.95 ? 120  GLY B O   1 
ATOM   2423 N  N   . SER B 1 121 ? -10.584 24.545 14.381  1.00 14.10 ? 121  SER B N   1 
ATOM   2424 C  CA  . SER B 1 121 ? -11.443 24.846 13.212  1.00 13.92 ? 121  SER B CA  1 
ATOM   2425 C  C   . SER B 1 121 ? -12.051 23.531 12.801  1.00 12.75 ? 121  SER B C   1 
ATOM   2426 O  O   . SER B 1 121 ? -11.316 22.564 12.640  1.00 13.81 ? 121  SER B O   1 
ATOM   2427 C  CB  . SER B 1 121 ? -10.591 25.351 12.063  1.00 13.84 ? 121  SER B CB  1 
ATOM   2428 O  OG  . SER B 1 121 ? -10.091 26.640 12.353  1.00 17.15 ? 121  SER B OG  1 
ATOM   2429 N  N   . SER B 1 122 ? -13.368 23.430 12.678  1.00 13.24 ? 122  SER B N   1 
ATOM   2430 C  CA  . SER B 1 122 ? -13.941 22.096 12.596  1.00 11.87 ? 122  SER B CA  1 
ATOM   2431 C  C   . SER B 1 122 ? -15.384 22.170 12.175  1.00 12.45 ? 122  SER B C   1 
ATOM   2432 O  O   . SER B 1 122 ? -15.917 23.274 12.041  1.00 10.85 ? 122  SER B O   1 
ATOM   2433 C  CB  . SER B 1 122 ? -13.780 21.393 13.935  1.00 13.33 ? 122  SER B CB  1 
ATOM   2434 O  OG  . SER B 1 122 ? -14.453 22.123 14.969  1.00 15.21 ? 122  SER B OG  1 
ATOM   2435 N  N   . TRP B 1 123 ? -16.017 21.009 11.951  1.00 11.56 ? 123  TRP B N   1 
ATOM   2436 C  CA  . TRP B 1 123 ? -17.425 20.942 11.530  1.00 11.23 ? 123  TRP B CA  1 
ATOM   2437 C  C   . TRP B 1 123 ? -18.100 19.851 12.342  1.00 10.42 ? 123  TRP B C   1 
ATOM   2438 O  O   . TRP B 1 123 ? -17.500 18.773 12.543  1.00 12.40 ? 123  TRP B O   1 
ATOM   2439 C  CB  . TRP B 1 123 ? -17.581 20.575 10.033  1.00 8.92  ? 123  TRP B CB  1 
ATOM   2440 C  CG  . TRP B 1 123 ? -16.959 21.580 9.066   1.00 10.69 ? 123  TRP B CG  1 
ATOM   2441 C  CD1 . TRP B 1 123 ? -15.639 21.731 8.741   1.00 10.22 ? 123  TRP B CD1 1 
ATOM   2442 C  CD2 . TRP B 1 123 ? -17.670 22.602 8.376   1.00 7.32  ? 123  TRP B CD2 1 
ATOM   2443 N  NE1 . TRP B 1 123 ? -15.508 22.771 7.829   1.00 8.15  ? 123  TRP B NE1 1 
ATOM   2444 C  CE2 . TRP B 1 123 ? -16.748 23.335 7.624   1.00 9.47  ? 123  TRP B CE2 1 
ATOM   2445 C  CE3 . TRP B 1 123 ? -19.013 22.942 8.309   1.00 8.11  ? 123  TRP B CE3 1 
ATOM   2446 C  CZ2 . TRP B 1 123 ? -17.134 24.424 6.817   1.00 7.22  ? 123  TRP B CZ2 1 
ATOM   2447 C  CZ3 . TRP B 1 123 ? -19.403 23.984 7.510   1.00 8.77  ? 123  TRP B CZ3 1 
ATOM   2448 C  CH2 . TRP B 1 123 ? -18.467 24.725 6.772   1.00 11.28 ? 123  TRP B CH2 1 
ATOM   2449 N  N   . THR B 1 124 ? -19.323 20.087 12.792  1.00 10.21 ? 124  THR B N   1 
ATOM   2450 C  CA  . THR B 1 124 ? -20.110 18.971 13.397  1.00 11.22 ? 124  THR B CA  1 
ATOM   2451 C  C   . THR B 1 124 ? -21.279 18.523 12.545  1.00 10.90 ? 124  THR B C   1 
ATOM   2452 O  O   . THR B 1 124 ? -22.046 19.342 12.106  1.00 11.94 ? 124  THR B O   1 
ATOM   2453 C  CB  . THR B 1 124 ? -20.534 19.249 14.873  1.00 10.40 ? 124  THR B CB  1 
ATOM   2454 O  OG1 . THR B 1 124 ? -19.352 19.140 15.678  1.00 10.24 ? 124  THR B OG1 1 
ATOM   2455 C  CG2 . THR B 1 124 ? -21.489 18.139 15.413  1.00 10.91 ? 124  THR B CG2 1 
ATOM   2456 N  N   . TRP B 1 125 ? -21.422 17.205 12.326  1.00 11.92 ? 125  TRP B N   1 
ATOM   2457 C  CA  . TRP B 1 125 ? -22.408 16.713 11.348  1.00 11.77 ? 125  TRP B CA  1 
ATOM   2458 C  C   . TRP B 1 125 ? -23.365 15.680 11.897  1.00 12.41 ? 125  TRP B C   1 
ATOM   2459 O  O   . TRP B 1 125 ? -22.980 14.802 12.696  1.00 13.29 ? 125  TRP B O   1 
ATOM   2460 C  CB  . TRP B 1 125 ? -21.709 16.005 10.171  1.00 10.91 ? 125  TRP B CB  1 
ATOM   2461 C  CG  . TRP B 1 125 ? -20.566 16.754 9.561   1.00 10.29 ? 125  TRP B CG  1 
ATOM   2462 C  CD1 . TRP B 1 125 ? -19.286 16.838 10.070  1.00 8.68  ? 125  TRP B CD1 1 
ATOM   2463 C  CD2 . TRP B 1 125 ? -20.546 17.458 8.299   1.00 10.54 ? 125  TRP B CD2 1 
ATOM   2464 N  NE1 . TRP B 1 125 ? -18.486 17.567 9.218   1.00 10.71 ? 125  TRP B NE1 1 
ATOM   2465 C  CE2 . TRP B 1 125 ? -19.224 17.960 8.130   1.00 10.69 ? 125  TRP B CE2 1 
ATOM   2466 C  CE3 . TRP B 1 125 ? -21.514 17.730 7.303   1.00 6.26  ? 125  TRP B CE3 1 
ATOM   2467 C  CZ2 . TRP B 1 125 ? -18.837 18.732 7.013   1.00 10.80 ? 125  TRP B CZ2 1 
ATOM   2468 C  CZ3 . TRP B 1 125 ? -21.129 18.450 6.156   1.00 6.60  ? 125  TRP B CZ3 1 
ATOM   2469 C  CH2 . TRP B 1 125 ? -19.790 18.973 6.041   1.00 7.08  ? 125  TRP B CH2 1 
ATOM   2470 N  N   . LEU B 1 126 ? -24.589 15.736 11.382  1.00 12.02 ? 126  LEU B N   1 
ATOM   2471 C  CA  . LEU B 1 126 ? -25.488 14.576 11.397  1.00 11.65 ? 126  LEU B CA  1 
ATOM   2472 C  C   . LEU B 1 126 ? -25.402 13.921 10.002  1.00 12.79 ? 126  LEU B C   1 
ATOM   2473 O  O   . LEU B 1 126 ? -25.559 14.624 8.996   1.00 13.34 ? 126  LEU B O   1 
ATOM   2474 C  CB  . LEU B 1 126 ? -26.916 15.038 11.702  1.00 10.93 ? 126  LEU B CB  1 
ATOM   2475 C  CG  . LEU B 1 126 ? -27.879 13.859 11.531  1.00 11.27 ? 126  LEU B CG  1 
ATOM   2476 C  CD1 . LEU B 1 126 ? -27.630 12.768 12.536  1.00 12.41 ? 126  LEU B CD1 1 
ATOM   2477 C  CD2 . LEU B 1 126 ? -29.311 14.382 11.594  1.00 8.75  ? 126  LEU B CD2 1 
ATOM   2478 N  N   . VAL B 1 127 ? -25.095 12.620 9.941   1.00 12.79 ? 127  VAL B N   1 
ATOM   2479 C  CA  . VAL B 1 127 ? -24.916 11.901 8.652   1.00 13.45 ? 127  VAL B CA  1 
ATOM   2480 C  C   . VAL B 1 127 ? -25.780 10.639 8.637   1.00 14.66 ? 127  VAL B C   1 
ATOM   2481 O  O   . VAL B 1 127 ? -26.144 10.146 9.697   1.00 15.53 ? 127  VAL B O   1 
ATOM   2482 C  CB  . VAL B 1 127 ? -23.438 11.444 8.393   1.00 13.14 ? 127  VAL B CB  1 
ATOM   2483 C  CG1 . VAL B 1 127 ? -22.458 12.614 8.479   1.00 11.48 ? 127  VAL B CG1 1 
ATOM   2484 C  CG2 . VAL B 1 127 ? -22.983 10.371 9.384   1.00 11.71 ? 127  VAL B CG2 1 
ATOM   2485 N  N   . LYS B 1 128 ? -26.069 10.140 7.432   1.00 16.31 ? 128  LYS B N   1 
ATOM   2486 C  CA  . LYS B 1 128 ? -26.759 8.880  7.227   1.00 17.39 ? 128  LYS B CA  1 
ATOM   2487 C  C   . LYS B 1 128 ? -25.704 7.939  6.688   1.00 19.08 ? 128  LYS B C   1 
ATOM   2488 O  O   . LYS B 1 128 ? -25.093 8.221  5.654   1.00 18.77 ? 128  LYS B O   1 
ATOM   2489 C  CB  . LYS B 1 128 ? -27.870 9.079  6.198   1.00 18.80 ? 128  LYS B CB  1 
ATOM   2490 C  CG  . LYS B 1 128 ? -28.637 7.793  5.862   1.00 22.30 ? 128  LYS B CG  1 
ATOM   2491 C  CD  . LYS B 1 128 ? -29.619 7.984  4.759   1.00 27.21 ? 128  LYS B CD  1 
ATOM   2492 C  CE  . LYS B 1 128 ? -28.984 8.635  3.568   1.00 31.53 ? 128  LYS B CE  1 
ATOM   2493 N  NZ  . LYS B 1 128 ? -30.046 9.261  2.738   1.00 33.44 ? 128  LYS B NZ  1 
ATOM   2494 N  N   . ASN B 1 129 ? -25.455 6.850  7.407   1.00 19.86 ? 129  ASN B N   1 
ATOM   2495 C  CA  . ASN B 1 129 ? -24.492 5.830  6.977   1.00 22.36 ? 129  ASN B CA  1 
ATOM   2496 C  C   . ASN B 1 129 ? -25.018 4.983  5.821   1.00 23.39 ? 129  ASN B C   1 
ATOM   2497 O  O   . ASN B 1 129 ? -26.223 4.997  5.503   1.00 22.95 ? 129  ASN B O   1 
ATOM   2498 C  CB  . ASN B 1 129 ? -24.156 4.908  8.148   1.00 22.58 ? 129  ASN B CB  1 
ATOM   2499 C  CG  . ASN B 1 129 ? -23.301 5.568  9.177   1.00 24.59 ? 129  ASN B CG  1 
ATOM   2500 O  OD1 . ASN B 1 129 ? -23.572 5.489  10.378  1.00 27.05 ? 129  ASN B OD1 1 
ATOM   2501 N  ND2 . ASN B 1 129 ? -22.245 6.230  8.722   1.00 25.32 ? 129  ASN B ND2 1 
ATOM   2502 N  N   . ALA B 1 130 ? -24.114 4.229  5.192   1.00 24.65 ? 130  ALA B N   1 
ATOM   2503 C  CA  . ALA B 1 130 ? -24.494 3.332  4.075   1.00 25.27 ? 130  ALA B CA  1 
ATOM   2504 C  C   . ALA B 1 130 ? -25.728 2.449  4.347   1.00 25.10 ? 130  ALA B C   1 
ATOM   2505 O  O   . ALA B 1 130 ? -26.616 2.317  3.488   1.00 25.45 ? 130  ALA B O   1 
ATOM   2506 C  CB  . ALA B 1 130 ? -23.312 2.480  3.680   1.00 25.02 ? 130  ALA B CB  1 
ATOM   2507 N  N   . ASP B 1 131 ? -25.784 1.863  5.542   1.00 25.22 ? 131  ASP B N   1 
ATOM   2508 C  CA  . ASP B 1 131 ? -26.873 0.958  5.942   1.00 25.13 ? 131  ASP B CA  1 
ATOM   2509 C  C   . ASP B 1 131 ? -28.164 1.649  6.382   1.00 24.15 ? 131  ASP B C   1 
ATOM   2510 O  O   . ASP B 1 131 ? -29.101 0.987  6.839   1.00 24.84 ? 131  ASP B O   1 
ATOM   2511 C  CB  . ASP B 1 131 ? -26.388 -0.005 7.044   1.00 25.89 ? 131  ASP B CB  1 
ATOM   2512 C  CG  . ASP B 1 131 ? -26.154 0.694  8.378   1.00 27.13 ? 131  ASP B CG  1 
ATOM   2513 O  OD1 . ASP B 1 131 ? -26.240 1.938  8.436   1.00 28.01 ? 131  ASP B OD1 1 
ATOM   2514 O  OD2 . ASP B 1 131 ? -25.904 -0.009 9.382   1.00 28.57 ? 131  ASP B OD2 1 
ATOM   2515 N  N   . GLY B 1 132 ? -28.218 2.972  6.234   1.00 22.41 ? 132  GLY B N   1 
ATOM   2516 C  CA  . GLY B 1 132 ? -29.404 3.742  6.601   1.00 20.45 ? 132  GLY B CA  1 
ATOM   2517 C  C   . GLY B 1 132 ? -29.385 4.350  8.008   1.00 19.58 ? 132  GLY B C   1 
ATOM   2518 O  O   . GLY B 1 132 ? -30.227 5.207  8.333   1.00 18.58 ? 132  GLY B O   1 
ATOM   2519 N  N   . SER B 1 133 ? -28.415 3.952  8.837   1.00 18.77 ? 133  SER B N   1 
ATOM   2520 C  CA  . SER B 1 133 ? -28.378 4.466  10.225  1.00 17.92 ? 133  SER B CA  1 
ATOM   2521 C  C   . SER B 1 133 ? -27.798 5.864  10.304  1.00 17.99 ? 133  SER B C   1 
ATOM   2522 O  O   . SER B 1 133 ? -27.082 6.276  9.411   1.00 17.62 ? 133  SER B O   1 
ATOM   2523 C  CB  . SER B 1 133 ? -27.666 3.516  11.177  1.00 18.37 ? 133  SER B CB  1 
ATOM   2524 O  OG  . SER B 1 133 ? -26.302 3.421  10.815  1.00 18.99 ? 133  SER B OG  1 
ATOM   2525 N  N   . LEU B 1 134 ? -28.188 6.593  11.349  1.00 17.27 ? 134  LEU B N   1 
ATOM   2526 C  CA  . LEU B 1 134 ? -27.770 7.969  11.554  1.00 17.55 ? 134  LEU B CA  1 
ATOM   2527 C  C   . LEU B 1 134 ? -26.642 8.037  12.577  1.00 17.88 ? 134  LEU B C   1 
ATOM   2528 O  O   . LEU B 1 134 ? -26.543 7.170  13.490  1.00 18.01 ? 134  LEU B O   1 
ATOM   2529 C  CB  . LEU B 1 134 ? -28.978 8.773  12.020  1.00 17.27 ? 134  LEU B CB  1 
ATOM   2530 C  CG  . LEU B 1 134 ? -29.851 9.493  10.987  1.00 19.77 ? 134  LEU B CG  1 
ATOM   2531 C  CD1 . LEU B 1 134 ? -30.234 8.631  9.793   1.00 19.54 ? 134  LEU B CD1 1 
ATOM   2532 C  CD2 . LEU B 1 134 ? -31.097 10.070 11.669  1.00 17.18 ? 134  LEU B CD2 1 
ATOM   2533 N  N   . ALA B 1 135 ? -25.766 9.032  12.443  1.00 16.81 ? 135  ALA B N   1 
ATOM   2534 C  CA  . ALA B 1 135 ? -24.660 9.174  13.376  1.00 17.04 ? 135  ALA B CA  1 
ATOM   2535 C  C   . ALA B 1 135 ? -24.254 10.621 13.452  1.00 17.04 ? 135  ALA B C   1 
ATOM   2536 O  O   . ALA B 1 135 ? -24.513 11.369 12.520  1.00 18.31 ? 135  ALA B O   1 
ATOM   2537 C  CB  . ALA B 1 135 ? -23.493 8.323  12.934  1.00 17.26 ? 135  ALA B CB  1 
ATOM   2538 N  N   . ILE B 1 136 ? -23.666 11.010 14.579  1.00 16.62 ? 136  ILE B N   1 
ATOM   2539 C  CA  . ILE B 1 136 ? -23.026 12.309 14.747  1.00 15.92 ? 136  ILE B CA  1 
ATOM   2540 C  C   . ILE B 1 136 ? -21.543 12.126 14.583  1.00 15.43 ? 136  ILE B C   1 
ATOM   2541 O  O   . ILE B 1 136 ? -20.969 11.221 15.186  1.00 16.11 ? 136  ILE B O   1 
ATOM   2542 C  CB  . ILE B 1 136 ? -23.332 12.959 16.150  1.00 15.96 ? 136  ILE B CB  1 
ATOM   2543 C  CG1 . ILE B 1 136 ? -24.824 13.306 16.232  1.00 16.62 ? 136  ILE B CG1 1 
ATOM   2544 C  CG2 . ILE B 1 136 ? -22.586 14.273 16.310  1.00 13.78 ? 136  ILE B CG2 1 
ATOM   2545 C  CD1 . ILE B 1 136 ? -25.340 13.570 17.677  1.00 17.07 ? 136  ILE B CD1 1 
ATOM   2546 N  N   . VAL B 1 137 ? -20.915 13.016 13.811  1.00 15.55 ? 137  VAL B N   1 
ATOM   2547 C  CA  . VAL B 1 137 ? -19.513 12.878 13.382  1.00 15.31 ? 137  VAL B CA  1 
ATOM   2548 C  C   . VAL B 1 137 ? -18.879 14.265 13.415  1.00 14.66 ? 137  VAL B C   1 
ATOM   2549 O  O   . VAL B 1 137 ? -19.480 15.245 12.951  1.00 15.26 ? 137  VAL B O   1 
ATOM   2550 C  CB  . VAL B 1 137 ? -19.466 12.344 11.907  1.00 16.18 ? 137  VAL B CB  1 
ATOM   2551 C  CG1 . VAL B 1 137 ? -18.103 12.388 11.334  1.00 18.00 ? 137  VAL B CG1 1 
ATOM   2552 C  CG2 . VAL B 1 137 ? -20.026 10.942 11.826  1.00 16.63 ? 137  VAL B CG2 1 
ATOM   2553 N  N   . ASN B 1 138 ? -17.663 14.340 13.926  1.00 15.17 ? 138  ASN B N   1 
ATOM   2554 C  CA  . ASN B 1 138 ? -16.898 15.577 13.934  1.00 14.91 ? 138  ASN B CA  1 
ATOM   2555 C  C   . ASN B 1 138 ? -15.794 15.501 12.881  1.00 15.55 ? 138  ASN B C   1 
ATOM   2556 O  O   . ASN B 1 138 ? -15.140 14.461 12.738  1.00 15.72 ? 138  ASN B O   1 
ATOM   2557 C  CB  . ASN B 1 138 ? -16.299 15.795 15.327  1.00 14.83 ? 138  ASN B CB  1 
ATOM   2558 C  CG  . ASN B 1 138 ? -17.292 16.426 16.333  1.00 17.39 ? 138  ASN B CG  1 
ATOM   2559 O  OD1 . ASN B 1 138 ? -18.445 16.756 16.007  1.00 19.40 ? 138  ASN B OD1 1 
ATOM   2560 N  ND2 . ASN B 1 138 ? -16.830 16.606 17.569  1.00 18.48 ? 138  ASN B ND2 1 
ATOM   2561 N  N   . THR B 1 139 ? -15.569 16.587 12.137  1.00 15.67 ? 139  THR B N   1 
ATOM   2562 C  CA  . THR B 1 139 ? -14.394 16.623 11.278  1.00 15.55 ? 139  THR B CA  1 
ATOM   2563 C  C   . THR B 1 139 ? -13.634 17.908 11.540  1.00 16.78 ? 139  THR B C   1 
ATOM   2564 O  O   . THR B 1 139 ? -14.209 18.902 11.992  1.00 18.17 ? 139  THR B O   1 
ATOM   2565 C  CB  . THR B 1 139 ? -14.753 16.537 9.779   1.00 15.90 ? 139  THR B CB  1 
ATOM   2566 O  OG1 . THR B 1 139 ? -15.499 17.704 9.403   1.00 11.46 ? 139  THR B OG1 1 
ATOM   2567 C  CG2 . THR B 1 139 ? -15.584 15.262 9.497   1.00 13.30 ? 139  THR B CG2 1 
ATOM   2568 N  N   . SER B 1 140 ? -12.339 17.870 11.274  1.00 17.28 ? 140  SER B N   1 
ATOM   2569 C  CA  . SER B 1 140 ? -11.450 18.968 11.536  1.00 17.78 ? 140  SER B CA  1 
ATOM   2570 C  C   . SER B 1 140 ? -10.976 19.683 10.241  1.00 17.72 ? 140  SER B C   1 
ATOM   2571 O  O   . SER B 1 140 ? -10.619 19.035 9.236   1.00 17.79 ? 140  SER B O   1 
ATOM   2572 C  CB  . SER B 1 140 ? -10.286 18.451 12.397  1.00 18.33 ? 140  SER B CB  1 
ATOM   2573 O  OG  . SER B 1 140 ? -9.081  19.187 12.156  1.00 21.37 ? 140  SER B OG  1 
ATOM   2574 N  N   . ASN B 1 141 ? -10.990 21.010 10.270  1.00 16.88 ? 141  ASN B N   1 
ATOM   2575 C  CA  . ASN B 1 141 ? -10.464 21.846 9.196   1.00 16.94 ? 141  ASN B CA  1 
ATOM   2576 C  C   . ASN B 1 141 ? -11.370 21.745 7.988   1.00 16.15 ? 141  ASN B C   1 
ATOM   2577 O  O   . ASN B 1 141 ? -12.525 22.203 8.074   1.00 16.51 ? 141  ASN B O   1 
ATOM   2578 C  CB  . ASN B 1 141 ? -8.963  21.578 8.903   1.00 16.97 ? 141  ASN B CB  1 
ATOM   2579 C  CG  . ASN B 1 141 ? -8.041  22.175 9.986   1.00 17.05 ? 141  ASN B CG  1 
ATOM   2580 O  OD1 . ASN B 1 141 ? -8.501  22.875 10.870  1.00 13.08 ? 141  ASN B OD1 1 
ATOM   2581 N  ND2 . ASN B 1 141 ? -6.773  21.861 9.938   1.00 16.51 ? 141  ASN B ND2 1 
ATOM   2582 N  N   . ALA B 1 142 ? -10.886 21.163 6.886   1.00 15.34 ? 142  ALA B N   1 
ATOM   2583 C  CA  . ALA B 1 142 ? -11.705 21.050 5.657   1.00 15.00 ? 142  ALA B CA  1 
ATOM   2584 C  C   . ALA B 1 142 ? -12.361 19.689 5.489   1.00 14.22 ? 142  ALA B C   1 
ATOM   2585 O  O   . ALA B 1 142 ? -13.246 19.544 4.636   1.00 13.57 ? 142  ALA B O   1 
ATOM   2586 C  CB  . ALA B 1 142 ? -10.852 21.389 4.396   1.00 14.49 ? 142  ALA B CB  1 
ATOM   2587 N  N   . ALA B 1 143 ? -11.980 18.713 6.315   1.00 13.93 ? 143  ALA B N   1 
ATOM   2588 C  CA  . ALA B 1 143 ? -12.504 17.345 6.164   1.00 14.93 ? 143  ALA B CA  1 
ATOM   2589 C  C   . ALA B 1 143 ? -14.015 17.285 6.228   1.00 15.90 ? 143  ALA B C   1 
ATOM   2590 O  O   . ALA B 1 143 ? -14.658 18.135 6.833   1.00 16.87 ? 143  ALA B O   1 
ATOM   2591 C  CB  . ALA B 1 143 ? -11.879 16.370 7.195   1.00 14.79 ? 143  ALA B CB  1 
ATOM   2592 N  N   . THR B 1 144 ? -14.583 16.294 5.565   1.00 16.68 ? 144  THR B N   1 
ATOM   2593 C  CA  . THR B 1 144 ? -16.028 16.249 5.364   1.00 16.52 ? 144  THR B CA  1 
ATOM   2594 C  C   . THR B 1 144 ? -16.417 14.773 5.201   1.00 17.97 ? 144  THR B C   1 
ATOM   2595 O  O   . THR B 1 144 ? -15.641 14.000 4.616   1.00 18.49 ? 144  THR B O   1 
ATOM   2596 C  CB  . THR B 1 144 ? -16.462 17.078 4.102   1.00 16.54 ? 144  THR B CB  1 
ATOM   2597 O  OG1 . THR B 1 144 ? -17.824 16.809 3.788   1.00 18.69 ? 144  THR B OG1 1 
ATOM   2598 C  CG2 . THR B 1 144 ? -15.576 16.766 2.878   1.00 15.60 ? 144  THR B CG2 1 
ATOM   2599 N  N   . PRO B 1 145 ? -17.588 14.375 5.731   1.00 18.72 ? 145  PRO B N   1 
ATOM   2600 C  CA  . PRO B 1 145 ? -18.107 13.003 5.533   1.00 19.09 ? 145  PRO B CA  1 
ATOM   2601 C  C   . PRO B 1 145 ? -18.410 12.685 4.054   1.00 20.70 ? 145  PRO B C   1 
ATOM   2602 O  O   . PRO B 1 145 ? -18.590 11.507 3.697   1.00 20.23 ? 145  PRO B O   1 
ATOM   2603 C  CB  . PRO B 1 145 ? -19.352 12.941 6.413   1.00 19.08 ? 145  PRO B CB  1 
ATOM   2604 C  CG  . PRO B 1 145 ? -19.679 14.377 6.786   1.00 19.54 ? 145  PRO B CG  1 
ATOM   2605 C  CD  . PRO B 1 145 ? -18.484 15.224 6.531   1.00 17.77 ? 145  PRO B CD  1 
ATOM   2606 N  N   . LEU B 1 146 ? -18.426 13.706 3.186   1.00 21.22 ? 146  LEU B N   1 
ATOM   2607 C  CA  . LEU B 1 146 ? -18.571 13.462 1.756   1.00 24.15 ? 146  LEU B CA  1 
ATOM   2608 C  C   . LEU B 1 146 ? -17.559 12.430 1.239   1.00 24.94 ? 146  LEU B C   1 
ATOM   2609 O  O   . LEU B 1 146 ? -17.875 11.654 0.357   1.00 27.16 ? 146  LEU B O   1 
ATOM   2610 C  CB  . LEU B 1 146 ? -18.420 14.770 0.979   1.00 23.72 ? 146  LEU B CB  1 
ATOM   2611 C  CG  . LEU B 1 146 ? -18.932 14.836 -0.450  1.00 25.36 ? 146  LEU B CG  1 
ATOM   2612 C  CD1 . LEU B 1 146 ? -20.453 14.555 -0.545  1.00 26.25 ? 146  LEU B CD1 1 
ATOM   2613 C  CD2 . LEU B 1 146 ? -18.570 16.192 -1.049  1.00 24.84 ? 146  LEU B CD2 1 
ATOM   2614 N  N   . THR B 1 147 ? -16.347 12.421 1.777   1.00 26.07 ? 147  THR B N   1 
ATOM   2615 C  CA  . THR B 1 147 ? -15.321 11.489 1.303   1.00 26.71 ? 147  THR B CA  1 
ATOM   2616 C  C   . THR B 1 147 ? -15.380 10.071 1.900   1.00 27.06 ? 147  THR B C   1 
ATOM   2617 O  O   . THR B 1 147 ? -14.551 9.227  1.553   1.00 27.88 ? 147  THR B O   1 
ATOM   2618 C  CB  . THR B 1 147 ? -13.896 12.071 1.447   1.00 26.22 ? 147  THR B CB  1 
ATOM   2619 O  OG1 . THR B 1 147 ? -13.523 12.141 2.827   1.00 27.16 ? 147  THR B OG1 1 
ATOM   2620 C  CG2 . THR B 1 147 ? -13.848 13.459 0.854   1.00 26.46 ? 147  THR B CG2 1 
ATOM   2621 N  N   . ASP B 1 148 ? -16.332 9.801  2.787   1.00 27.35 ? 148  ASP B N   1 
ATOM   2622 C  CA  . ASP B 1 148 ? -16.551 8.413  3.250   1.00 28.06 ? 148  ASP B CA  1 
ATOM   2623 C  C   . ASP B 1 148 ? -17.613 7.815  2.369   1.00 27.61 ? 148  ASP B C   1 
ATOM   2624 O  O   . ASP B 1 148 ? -18.686 8.384  2.232   1.00 28.10 ? 148  ASP B O   1 
ATOM   2625 C  CB  . ASP B 1 148 ? -16.994 8.365  4.710   1.00 28.39 ? 148  ASP B CB  1 
ATOM   2626 C  CG  . ASP B 1 148 ? -15.977 8.995  5.642   1.00 32.36 ? 148  ASP B CG  1 
ATOM   2627 O  OD1 . ASP B 1 148 ? -14.749 8.758  5.457   1.00 34.52 ? 148  ASP B OD1 1 
ATOM   2628 O  OD2 . ASP B 1 148 ? -16.410 9.745  6.554   1.00 35.17 ? 148  ASP B OD2 1 
ATOM   2629 N  N   . GLU B 1 149 ? -17.318 6.677  1.755   1.00 27.99 ? 149  GLU B N   1 
ATOM   2630 C  CA  . GLU B 1 149 ? -18.189 6.138  0.727   1.00 27.80 ? 149  GLU B CA  1 
ATOM   2631 C  C   . GLU B 1 149 ? -19.527 5.650  1.310   1.00 27.54 ? 149  GLU B C   1 
ATOM   2632 O  O   . GLU B 1 149 ? -19.549 4.961  2.324   1.00 28.14 ? 149  GLU B O   1 
ATOM   2633 C  CB  . GLU B 1 149 ? -17.456 5.046  -0.073  1.00 28.93 ? 149  GLU B CB  1 
ATOM   2634 C  CG  . GLU B 1 149 ? -16.729 5.582  -1.309  0.50 30.00 ? 149  GLU B CG  1 
ATOM   2635 C  CD  . GLU B 1 149 ? -17.681 6.231  -2.314  0.50 32.66 ? 149  GLU B CD  1 
ATOM   2636 O  OE1 . GLU B 1 149 ? -18.759 5.650  -2.567  0.50 31.94 ? 149  GLU B OE1 1 
ATOM   2637 O  OE2 . GLU B 1 149 ? -17.355 7.319  -2.851  0.50 33.33 ? 149  GLU B OE2 1 
ATOM   2638 N  N   . GLY B 1 150 ? -20.633 6.041  0.685   1.00 26.60 ? 150  GLY B N   1 
ATOM   2639 C  CA  . GLY B 1 150 ? -21.936 5.618  1.140   1.00 26.27 ? 150  GLY B CA  1 
ATOM   2640 C  C   . GLY B 1 150 ? -22.551 6.481  2.243   1.00 25.98 ? 150  GLY B C   1 
ATOM   2641 O  O   . GLY B 1 150 ? -23.716 6.283  2.618   1.00 26.75 ? 150  GLY B O   1 
ATOM   2642 N  N   . VAL B 1 151 ? -21.788 7.455  2.738   1.00 23.78 ? 151  VAL B N   1 
ATOM   2643 C  CA  . VAL B 1 151 ? -22.245 8.327  3.805   1.00 21.98 ? 151  VAL B CA  1 
ATOM   2644 C  C   . VAL B 1 151 ? -22.759 9.613  3.213   1.00 20.92 ? 151  VAL B C   1 
ATOM   2645 O  O   . VAL B 1 151 ? -22.066 10.255 2.418   1.00 20.40 ? 151  VAL B O   1 
ATOM   2646 C  CB  . VAL B 1 151 ? -21.110 8.671  4.769   1.00 21.87 ? 151  VAL B CB  1 
ATOM   2647 C  CG1 . VAL B 1 151 ? -21.604 9.630  5.878   1.00 20.49 ? 151  VAL B CG1 1 
ATOM   2648 C  CG2 . VAL B 1 151 ? -20.554 7.418  5.350   1.00 22.49 ? 151  VAL B CG2 1 
ATOM   2649 N  N   . THR B 1 152 ? -23.967 9.981  3.608   1.00 18.95 ? 152  THR B N   1 
ATOM   2650 C  CA  . THR B 1 152 ? -24.621 11.192 3.135   1.00 17.19 ? 152  THR B CA  1 
ATOM   2651 C  C   . THR B 1 152 ? -24.738 12.208 4.263   1.00 15.56 ? 152  THR B C   1 
ATOM   2652 O  O   . THR B 1 152 ? -25.393 11.931 5.250   1.00 14.77 ? 152  THR B O   1 
ATOM   2653 C  CB  . THR B 1 152 ? -26.055 10.834 2.681   1.00 17.11 ? 152  THR B CB  1 
ATOM   2654 O  OG1 . THR B 1 152 ? -25.971 9.837  1.650   1.00 19.93 ? 152  THR B OG1 1 
ATOM   2655 C  CG2 . THR B 1 152 ? -26.772 12.021 2.162   1.00 16.61 ? 152  THR B CG2 1 
ATOM   2656 N  N   . PRO B 1 153 ? -24.073 13.387 4.142   1.00 14.52 ? 153  PRO B N   1 
ATOM   2657 C  CA  . PRO B 1 153 ? -24.353 14.410 5.139   1.00 13.20 ? 153  PRO B CA  1 
ATOM   2658 C  C   . PRO B 1 153 ? -25.781 14.881 5.162   1.00 12.62 ? 153  PRO B C   1 
ATOM   2659 O  O   . PRO B 1 153 ? -26.393 15.068 4.116   1.00 12.87 ? 153  PRO B O   1 
ATOM   2660 C  CB  . PRO B 1 153 ? -23.473 15.573 4.694   1.00 13.46 ? 153  PRO B CB  1 
ATOM   2661 C  CG  . PRO B 1 153 ? -22.331 14.943 4.005   1.00 13.16 ? 153  PRO B CG  1 
ATOM   2662 C  CD  . PRO B 1 153 ? -23.023 13.823 3.211   1.00 14.02 ? 153  PRO B CD  1 
ATOM   2663 N  N   . LEU B 1 154 ? -26.317 15.067 6.367   1.00 11.78 ? 154  LEU B N   1 
ATOM   2664 C  CA  . LEU B 1 154 ? -27.694 15.537 6.508   1.00 11.19 ? 154  LEU B CA  1 
ATOM   2665 C  C   . LEU B 1 154 ? -27.800 16.936 7.082   1.00 12.23 ? 154  LEU B C   1 
ATOM   2666 O  O   . LEU B 1 154 ? -28.766 17.681 6.820   1.00 11.77 ? 154  LEU B O   1 
ATOM   2667 C  CB  . LEU B 1 154 ? -28.442 14.577 7.426   1.00 11.46 ? 154  LEU B CB  1 
ATOM   2668 C  CG  . LEU B 1 154 ? -28.512 13.085 7.051   1.00 8.90  ? 154  LEU B CG  1 
ATOM   2669 C  CD1 . LEU B 1 154 ? -29.261 12.308 8.152   1.00 6.43  ? 154  LEU B CD1 1 
ATOM   2670 C  CD2 . LEU B 1 154 ? -29.118 12.862 5.645   1.00 12.29 ? 154  LEU B CD2 1 
ATOM   2671 N  N   . LEU B 1 155 ? -26.872 17.268 7.962   1.00 11.88 ? 155  LEU B N   1 
ATOM   2672 C  CA  . LEU B 1 155 ? -26.910 18.552 8.654   1.00 12.40 ? 155  LEU B CA  1 
ATOM   2673 C  C   . LEU B 1 155 ? -25.527 18.873 9.151   1.00 12.14 ? 155  LEU B C   1 
ATOM   2674 O  O   . LEU B 1 155 ? -24.808 17.981 9.554   1.00 11.64 ? 155  LEU B O   1 
ATOM   2675 C  CB  . LEU B 1 155 ? -27.897 18.531 9.842   1.00 11.56 ? 155  LEU B CB  1 
ATOM   2676 C  CG  . LEU B 1 155 ? -27.926 19.721 10.803  1.00 12.37 ? 155  LEU B CG  1 
ATOM   2677 C  CD1 . LEU B 1 155 ? -28.624 20.903 10.148  1.00 13.20 ? 155  LEU B CD1 1 
ATOM   2678 C  CD2 . LEU B 1 155 ? -28.617 19.307 12.098  1.00 13.73 ? 155  LEU B CD2 1 
ATOM   2679 N  N   . THR B 1 156 ? -25.133 20.143 9.098   1.00 11.95 ? 156  THR B N   1 
ATOM   2680 C  CA  . THR B 1 156 ? -23.817 20.538 9.650   1.00 12.34 ? 156  THR B CA  1 
ATOM   2681 C  C   . THR B 1 156 ? -23.885 21.854 10.382  1.00 11.47 ? 156  THR B C   1 
ATOM   2682 O  O   . THR B 1 156 ? -24.732 22.701 10.088  1.00 13.85 ? 156  THR B O   1 
ATOM   2683 C  CB  . THR B 1 156 ? -22.692 20.645 8.556   1.00 11.64 ? 156  THR B CB  1 
ATOM   2684 O  OG1 . THR B 1 156 ? -21.397 20.555 9.167   1.00 12.87 ? 156  THR B OG1 1 
ATOM   2685 C  CG2 . THR B 1 156 ? -22.777 22.001 7.768   1.00 12.78 ? 156  THR B CG2 1 
ATOM   2686 N  N   . VAL B 1 157 ? -22.935 22.051 11.299  1.00 11.81 ? 157  VAL B N   1 
ATOM   2687 C  CA  . VAL B 1 157 ? -22.643 23.401 11.840  1.00 11.31 ? 157  VAL B CA  1 
ATOM   2688 C  C   . VAL B 1 157 ? -21.171 23.694 11.656  1.00 12.20 ? 157  VAL B C   1 
ATOM   2689 O  O   . VAL B 1 157 ? -20.338 22.854 11.953  1.00 11.91 ? 157  VAL B O   1 
ATOM   2690 C  CB  . VAL B 1 157 ? -23.060 23.526 13.358  1.00 13.32 ? 157  VAL B CB  1 
ATOM   2691 C  CG1 . VAL B 1 157 ? -22.276 22.547 14.267  1.00 6.27  ? 157  VAL B CG1 1 
ATOM   2692 C  CG2 . VAL B 1 157 ? -22.882 24.925 13.819  1.00 11.10 ? 157  VAL B CG2 1 
ATOM   2693 N  N   . ASP B 1 158 ? -20.863 24.870 11.108  1.00 11.88 ? 158  ASP B N   1 
ATOM   2694 C  CA  . ASP B 1 158 ? -19.469 25.365 10.931  1.00 11.31 ? 158  ASP B CA  1 
ATOM   2695 C  C   . ASP B 1 158 ? -18.979 25.933 12.276  1.00 11.16 ? 158  ASP B C   1 
ATOM   2696 O  O   . ASP B 1 158 ? -19.638 26.839 12.847  1.00 12.04 ? 158  ASP B O   1 
ATOM   2697 C  CB  . ASP B 1 158 ? -19.479 26.486 9.884   1.00 11.07 ? 158  ASP B CB  1 
ATOM   2698 C  CG  . ASP B 1 158 ? -18.067 26.966 9.443   1.00 11.79 ? 158  ASP B CG  1 
ATOM   2699 O  OD1 . ASP B 1 158 ? -17.031 26.430 9.898   1.00 12.10 ? 158  ASP B OD1 1 
ATOM   2700 O  OD2 . ASP B 1 158 ? -18.003 27.890 8.564   1.00 13.53 ? 158  ASP B OD2 1 
ATOM   2701 N  N   . LEU B 1 159 ? -17.851 25.402 12.746  1.00 11.15 ? 159  LEU B N   1 
ATOM   2702 C  CA  . LEU B 1 159 ? -17.268 25.752 14.055  1.00 10.26 ? 159  LEU B CA  1 
ATOM   2703 C  C   . LEU B 1 159 ? -15.898 26.403 13.902  1.00 10.91 ? 159  LEU B C   1 
ATOM   2704 O  O   . LEU B 1 159 ? -15.151 26.586 14.866  1.00 12.04 ? 159  LEU B O   1 
ATOM   2705 C  CB  . LEU B 1 159 ? -17.227 24.556 15.013  1.00 8.28  ? 159  LEU B CB  1 
ATOM   2706 C  CG  . LEU B 1 159 ? -18.610 23.996 15.294  1.00 10.46 ? 159  LEU B CG  1 
ATOM   2707 C  CD1 . LEU B 1 159 ? -18.400 22.549 15.542  1.00 5.54  ? 159  LEU B CD1 1 
ATOM   2708 C  CD2 . LEU B 1 159 ? -19.417 24.674 16.434  1.00 11.28 ? 159  LEU B CD2 1 
ATOM   2709 N  N   . TRP B 1 160 ? -15.581 26.824 12.689  1.00 11.75 ? 160  TRP B N   1 
ATOM   2710 C  CA  . TRP B 1 160 ? -14.473 27.751 12.512  1.00 10.51 ? 160  TRP B CA  1 
ATOM   2711 C  C   . TRP B 1 160 ? -14.822 29.044 13.236  1.00 11.94 ? 160  TRP B C   1 
ATOM   2712 O  O   . TRP B 1 160 ? -15.989 29.412 13.220  1.00 11.41 ? 160  TRP B O   1 
ATOM   2713 C  CB  . TRP B 1 160 ? -14.272 28.031 11.032  1.00 10.53 ? 160  TRP B CB  1 
ATOM   2714 C  CG  . TRP B 1 160 ? -13.583 26.922 10.278  1.00 9.06  ? 160  TRP B CG  1 
ATOM   2715 C  CD1 . TRP B 1 160 ? -14.026 25.619 10.097  1.00 8.37  ? 160  TRP B CD1 1 
ATOM   2716 C  CD2 . TRP B 1 160 ? -12.385 27.042 9.543   1.00 10.26 ? 160  TRP B CD2 1 
ATOM   2717 N  NE1 . TRP B 1 160 ? -13.107 24.920 9.322   1.00 11.29 ? 160  TRP B NE1 1 
ATOM   2718 C  CE2 . TRP B 1 160 ? -12.087 25.776 8.981   1.00 7.16  ? 160  TRP B CE2 1 
ATOM   2719 C  CE3 . TRP B 1 160 ? -11.483 28.098 9.340   1.00 10.99 ? 160  TRP B CE3 1 
ATOM   2720 C  CZ2 . TRP B 1 160 ? -10.954 25.566 8.168   1.00 10.51 ? 160  TRP B CZ2 1 
ATOM   2721 C  CZ3 . TRP B 1 160 ? -10.360 27.866 8.547   1.00 10.62 ? 160  TRP B CZ3 1 
ATOM   2722 C  CH2 . TRP B 1 160 ? -10.113 26.628 7.973   1.00 9.12  ? 160  TRP B CH2 1 
ATOM   2723 N  N   . GLU B 1 161 ? -13.848 29.728 13.854  1.00 11.55 ? 161  GLU B N   1 
ATOM   2724 C  CA  . GLU B 1 161 ? -14.189 30.926 14.661  1.00 11.82 ? 161  GLU B CA  1 
ATOM   2725 C  C   . GLU B 1 161 ? -14.838 32.001 13.811  1.00 12.51 ? 161  GLU B C   1 
ATOM   2726 O  O   . GLU B 1 161 ? -15.758 32.724 14.293  1.00 13.21 ? 161  GLU B O   1 
ATOM   2727 C  CB  . GLU B 1 161 ? -12.971 31.417 15.471  1.00 12.64 ? 161  GLU B CB  1 
ATOM   2728 C  CG  . GLU B 1 161 ? -12.586 30.389 16.514  1.00 12.68 ? 161  GLU B CG  1 
ATOM   2729 C  CD  . GLU B 1 161 ? -11.394 30.775 17.347  1.00 16.70 ? 161  GLU B CD  1 
ATOM   2730 O  OE1 . GLU B 1 161 ? -11.520 30.662 18.588  1.00 17.16 ? 161  GLU B OE1 1 
ATOM   2731 O  OE2 . GLU B 1 161 ? -10.345 31.154 16.762  1.00 14.51 ? 161  GLU B OE2 1 
ATOM   2732 N  N   . HIS B 1 162 ? -14.440 32.078 12.531  1.00 11.67 ? 162  HIS B N   1 
ATOM   2733 C  CA  . HIS B 1 162 ? -15.016 33.113 11.630  1.00 12.27 ? 162  HIS B CA  1 
ATOM   2734 C  C   . HIS B 1 162 ? -16.526 33.012 11.554  1.00 13.10 ? 162  HIS B C   1 
ATOM   2735 O  O   . HIS B 1 162 ? -17.245 34.012 11.336  1.00 14.53 ? 162  HIS B O   1 
ATOM   2736 C  CB  . HIS B 1 162 ? -14.373 33.086 10.227  1.00 11.42 ? 162  HIS B CB  1 
ATOM   2737 C  CG  . HIS B 1 162 ? -14.597 31.823 9.428   1.00 9.63  ? 162  HIS B CG  1 
ATOM   2738 N  ND1 . HIS B 1 162 ? -13.543 31.110 8.897   1.00 9.50  ? 162  HIS B ND1 1 
ATOM   2739 C  CD2 . HIS B 1 162 ? -15.721 31.229 8.965   1.00 10.75 ? 162  HIS B CD2 1 
ATOM   2740 C  CE1 . HIS B 1 162 ? -14.012 30.110 8.171   1.00 13.46 ? 162  HIS B CE1 1 
ATOM   2741 N  NE2 . HIS B 1 162 ? -15.331 30.142 8.217   1.00 11.46 ? 162  HIS B NE2 1 
ATOM   2742 N  N   . ALA B 1 163 ? -17.041 31.832 11.834  1.00 13.17 ? 163  ALA B N   1 
ATOM   2743 C  CA  . ALA B 1 163 ? -18.481 31.608 11.689  1.00 14.09 ? 163  ALA B CA  1 
ATOM   2744 C  C   . ALA B 1 163 ? -19.319 32.284 12.761  1.00 14.73 ? 163  ALA B C   1 
ATOM   2745 O  O   . ALA B 1 163 ? -20.495 32.598 12.527  1.00 14.21 ? 163  ALA B O   1 
ATOM   2746 C  CB  . ALA B 1 163 ? -18.764 30.107 11.681  1.00 14.17 ? 163  ALA B CB  1 
ATOM   2747 N  N   . TYR B 1 164 ? -18.721 32.494 13.932  1.00 14.20 ? 164  TYR B N   1 
ATOM   2748 C  CA  . TYR B 1 164 ? -19.457 33.033 15.069  1.00 13.79 ? 164  TYR B CA  1 
ATOM   2749 C  C   . TYR B 1 164 ? -18.782 34.209 15.800  1.00 13.31 ? 164  TYR B C   1 
ATOM   2750 O  O   . TYR B 1 164 ? -19.404 34.777 16.687  1.00 12.47 ? 164  TYR B O   1 
ATOM   2751 C  CB  . TYR B 1 164 ? -19.820 31.918 16.072  1.00 13.02 ? 164  TYR B CB  1 
ATOM   2752 C  CG  . TYR B 1 164 ? -18.628 31.145 16.628  1.00 12.21 ? 164  TYR B CG  1 
ATOM   2753 C  CD1 . TYR B 1 164 ? -17.919 31.617 17.739  1.00 10.69 ? 164  TYR B CD1 1 
ATOM   2754 C  CD2 . TYR B 1 164 ? -18.227 29.947 16.065  1.00 16.16 ? 164  TYR B CD2 1 
ATOM   2755 C  CE1 . TYR B 1 164 ? -16.842 30.937 18.235  1.00 14.21 ? 164  TYR B CE1 1 
ATOM   2756 C  CE2 . TYR B 1 164 ? -17.185 29.258 16.570  1.00 14.28 ? 164  TYR B CE2 1 
ATOM   2757 C  CZ  . TYR B 1 164 ? -16.475 29.759 17.661  1.00 14.14 ? 164  TYR B CZ  1 
ATOM   2758 O  OH  . TYR B 1 164 ? -15.413 29.096 18.174  1.00 14.23 ? 164  TYR B OH  1 
ATOM   2759 N  N   . TYR B 1 165 ? -17.542 34.571 15.443  1.00 13.48 ? 165  TYR B N   1 
ATOM   2760 C  CA  . TYR B 1 165 ? -16.763 35.475 16.282  1.00 14.38 ? 165  TYR B CA  1 
ATOM   2761 C  C   . TYR B 1 165 ? -17.350 36.892 16.339  1.00 15.94 ? 165  TYR B C   1 
ATOM   2762 O  O   . TYR B 1 165 ? -17.200 37.608 17.362  1.00 16.40 ? 165  TYR B O   1 
ATOM   2763 C  CB  . TYR B 1 165 ? -15.260 35.556 15.887  1.00 14.41 ? 165  TYR B CB  1 
ATOM   2764 C  CG  . TYR B 1 165 ? -14.434 35.712 17.146  1.00 15.54 ? 165  TYR B CG  1 
ATOM   2765 C  CD1 . TYR B 1 165 ? -14.310 34.652 18.033  1.00 15.74 ? 165  TYR B CD1 1 
ATOM   2766 C  CD2 . TYR B 1 165 ? -13.861 36.936 17.499  1.00 16.24 ? 165  TYR B CD2 1 
ATOM   2767 C  CE1 . TYR B 1 165 ? -13.600 34.790 19.225  1.00 14.85 ? 165  TYR B CE1 1 
ATOM   2768 C  CE2 . TYR B 1 165 ? -13.156 37.080 18.725  1.00 13.45 ? 165  TYR B CE2 1 
ATOM   2769 C  CZ  . TYR B 1 165 ? -13.049 36.006 19.557  1.00 10.84 ? 165  TYR B CZ  1 
ATOM   2770 O  OH  . TYR B 1 165 ? -12.383 36.124 20.746  1.00 14.74 ? 165  TYR B OH  1 
ATOM   2771 N  N   . ILE B 1 166 ? -17.987 37.299 15.242  1.00 15.81 ? 166  ILE B N   1 
ATOM   2772 C  CA  . ILE B 1 166 ? -18.543 38.643 15.167  1.00 15.32 ? 166  ILE B CA  1 
ATOM   2773 C  C   . ILE B 1 166 ? -19.742 38.773 16.098  1.00 16.60 ? 166  ILE B C   1 
ATOM   2774 O  O   . ILE B 1 166 ? -19.949 39.818 16.713  1.00 18.69 ? 166  ILE B O   1 
ATOM   2775 C  CB  . ILE B 1 166 ? -18.902 39.049 13.704  1.00 15.75 ? 166  ILE B CB  1 
ATOM   2776 C  CG1 . ILE B 1 166 ? -17.634 39.336 12.882  1.00 14.48 ? 166  ILE B CG1 1 
ATOM   2777 C  CG2 . ILE B 1 166 ? -19.710 40.319 13.659  1.00 16.12 ? 166  ILE B CG2 1 
ATOM   2778 C  CD1 . ILE B 1 166 ? -17.906 39.418 11.332  1.00 15.87 ? 166  ILE B CD1 1 
ATOM   2779 N  N   . ASP B 1 167 ? -20.554 37.740 16.191  1.00 15.68 ? 167  ASP B N   1 
ATOM   2780 C  CA  . ASP B 1 167 ? -21.788 37.849 16.940  1.00 14.63 ? 167  ASP B CA  1 
ATOM   2781 C  C   . ASP B 1 167 ? -21.633 37.314 18.356  1.00 15.03 ? 167  ASP B C   1 
ATOM   2782 O  O   . ASP B 1 167 ? -22.363 37.727 19.245  1.00 15.33 ? 167  ASP B O   1 
ATOM   2783 C  CB  . ASP B 1 167 ? -22.887 37.080 16.221  1.00 14.11 ? 167  ASP B CB  1 
ATOM   2784 C  CG  . ASP B 1 167 ? -23.180 37.625 14.833  1.00 15.57 ? 167  ASP B CG  1 
ATOM   2785 O  OD1 . ASP B 1 167 ? -23.162 38.863 14.648  1.00 16.85 ? 167  ASP B OD1 1 
ATOM   2786 O  OD2 . ASP B 1 167 ? -23.458 36.814 13.923  1.00 17.09 ? 167  ASP B OD2 1 
ATOM   2787 N  N   . PHE B 1 168 ? -20.710 36.364 18.565  1.00 15.04 ? 168  PHE B N   1 
ATOM   2788 C  CA  . PHE B 1 168 ? -20.716 35.598 19.799  1.00 14.40 ? 168  PHE B CA  1 
ATOM   2789 C  C   . PHE B 1 168 ? -19.378 35.547 20.465  1.00 13.78 ? 168  PHE B C   1 
ATOM   2790 O  O   . PHE B 1 168 ? -19.279 35.066 21.578  1.00 13.28 ? 168  PHE B O   1 
ATOM   2791 C  CB  . PHE B 1 168 ? -21.233 34.162 19.591  1.00 14.59 ? 168  PHE B CB  1 
ATOM   2792 C  CG  . PHE B 1 168 ? -22.645 34.100 19.103  1.00 12.77 ? 168  PHE B CG  1 
ATOM   2793 C  CD1 . PHE B 1 168 ? -23.685 34.394 19.954  1.00 14.72 ? 168  PHE B CD1 1 
ATOM   2794 C  CD2 . PHE B 1 168 ? -22.923 33.821 17.778  1.00 12.10 ? 168  PHE B CD2 1 
ATOM   2795 C  CE1 . PHE B 1 168 ? -25.001 34.353 19.513  1.00 16.84 ? 168  PHE B CE1 1 
ATOM   2796 C  CE2 . PHE B 1 168 ? -24.228 33.769 17.333  1.00 17.28 ? 168  PHE B CE2 1 
ATOM   2797 C  CZ  . PHE B 1 168 ? -25.268 34.072 18.203  1.00 14.66 ? 168  PHE B CZ  1 
ATOM   2798 N  N   . ARG B 1 169 ? -18.378 36.122 19.810  1.00 14.86 ? 169  ARG B N   1 
ATOM   2799 C  CA  . ARG B 1 169 ? -16.999 36.065 20.262  1.00 14.76 ? 169  ARG B CA  1 
ATOM   2800 C  C   . ARG B 1 169 ? -16.664 34.632 20.621  1.00 15.60 ? 169  ARG B C   1 
ATOM   2801 O  O   . ARG B 1 169 ? -16.881 33.734 19.809  1.00 16.04 ? 169  ARG B O   1 
ATOM   2802 C  CB  . ARG B 1 169 ? -16.725 37.045 21.430  1.00 15.56 ? 169  ARG B CB  1 
ATOM   2803 C  CG  . ARG B 1 169 ? -17.010 38.527 21.095  1.00 15.11 ? 169  ARG B CG  1 
ATOM   2804 C  CD  . ARG B 1 169 ? -15.780 39.100 20.412  1.00 17.17 ? 169  ARG B CD  1 
ATOM   2805 N  NE  . ARG B 1 169 ? -15.846 40.533 20.212  1.00 20.41 ? 169  ARG B NE  1 
ATOM   2806 C  CZ  . ARG B 1 169 ? -16.341 41.110 19.133  1.00 22.10 ? 169  ARG B CZ  1 
ATOM   2807 N  NH1 . ARG B 1 169 ? -16.839 40.377 18.144  1.00 24.72 ? 169  ARG B NH1 1 
ATOM   2808 N  NH2 . ARG B 1 169 ? -16.341 42.417 19.041  1.00 21.56 ? 169  ARG B NH2 1 
ATOM   2809 N  N   . ASN B 1 170 ? -16.154 34.423 21.834  1.00 16.23 ? 170  ASN B N   1 
ATOM   2810 C  CA  . ASN B 1 170 ? -15.593 33.145 22.244  1.00 15.12 ? 170  ASN B CA  1 
ATOM   2811 C  C   . ASN B 1 170 ? -16.633 32.139 22.681  1.00 14.79 ? 170  ASN B C   1 
ATOM   2812 O  O   . ASN B 1 170 ? -16.289 31.015 22.974  1.00 16.33 ? 170  ASN B O   1 
ATOM   2813 C  CB  . ASN B 1 170 ? -14.568 33.356 23.395  1.00 16.01 ? 170  ASN B CB  1 
ATOM   2814 C  CG  . ASN B 1 170 ? -15.221 33.899 24.648  1.00 17.53 ? 170  ASN B CG  1 
ATOM   2815 O  OD1 . ASN B 1 170 ? -15.750 35.008 24.649  1.00 18.21 ? 170  ASN B OD1 1 
ATOM   2816 N  ND2 . ASN B 1 170 ? -15.217 33.100 25.714  1.00 21.03 ? 170  ASN B ND2 1 
ATOM   2817 N  N   . VAL B 1 171 ? -17.905 32.512 22.734  1.00 15.78 ? 171  VAL B N   1 
ATOM   2818 C  CA  . VAL B 1 171 ? -18.859 31.624 23.364  1.00 15.63 ? 171  VAL B CA  1 
ATOM   2819 C  C   . VAL B 1 171 ? -19.629 30.773 22.364  1.00 15.85 ? 171  VAL B C   1 
ATOM   2820 O  O   . VAL B 1 171 ? -20.675 31.172 21.901  1.00 15.12 ? 171  VAL B O   1 
ATOM   2821 C  CB  . VAL B 1 171 ? -19.884 32.414 24.229  1.00 15.23 ? 171  VAL B CB  1 
ATOM   2822 C  CG1 . VAL B 1 171 ? -20.618 31.457 25.131  1.00 15.44 ? 171  VAL B CG1 1 
ATOM   2823 C  CG2 . VAL B 1 171 ? -19.183 33.414 25.086  1.00 15.85 ? 171  VAL B CG2 1 
ATOM   2824 N  N   . ARG B 1 172 ? -19.134 29.561 22.109  1.00 16.65 ? 172  ARG B N   1 
ATOM   2825 C  CA  . ARG B 1 172 ? -19.817 28.616 21.214  1.00 16.30 ? 172  ARG B CA  1 
ATOM   2826 C  C   . ARG B 1 172 ? -21.203 28.191 21.677  1.00 17.04 ? 172  ARG B C   1 
ATOM   2827 O  O   . ARG B 1 172 ? -22.092 28.002 20.828  1.00 15.58 ? 172  ARG B O   1 
ATOM   2828 C  CB  . ARG B 1 172 ? -18.983 27.347 21.020  1.00 16.26 ? 172  ARG B CB  1 
ATOM   2829 C  CG  . ARG B 1 172 ? -17.709 27.545 20.241  1.00 15.98 ? 172  ARG B CG  1 
ATOM   2830 C  CD  . ARG B 1 172 ? -17.276 26.217 19.623  1.00 13.62 ? 172  ARG B CD  1 
ATOM   2831 N  NE  . ARG B 1 172 ? -16.074 26.335 18.803  1.00 12.97 ? 172  ARG B NE  1 
ATOM   2832 C  CZ  . ARG B 1 172 ? -15.289 25.323 18.449  1.00 17.24 ? 172  ARG B CZ  1 
ATOM   2833 N  NH1 . ARG B 1 172 ? -15.599 24.091 18.806  1.00 14.75 ? 172  ARG B NH1 1 
ATOM   2834 N  NH2 . ARG B 1 172 ? -14.167 25.550 17.740  1.00 14.87 ? 172  ARG B NH2 1 
ATOM   2835 N  N   . PRO B 1 173 ? -21.395 27.957 23.005  1.00 16.22 ? 173  PRO B N   1 
ATOM   2836 C  CA  . PRO B 1 173 ? -22.752 27.610 23.400  1.00 15.85 ? 173  PRO B CA  1 
ATOM   2837 C  C   . PRO B 1 173 ? -23.780 28.644 22.993  1.00 15.82 ? 173  PRO B C   1 
ATOM   2838 O  O   . PRO B 1 173 ? -24.922 28.290 22.700  1.00 15.72 ? 173  PRO B O   1 
ATOM   2839 C  CB  . PRO B 1 173 ? -22.655 27.534 24.927  1.00 16.55 ? 173  PRO B CB  1 
ATOM   2840 C  CG  . PRO B 1 173 ? -21.233 27.088 25.155  1.00 15.29 ? 173  PRO B CG  1 
ATOM   2841 C  CD  . PRO B 1 173 ? -20.467 27.874 24.154  1.00 15.98 ? 173  PRO B CD  1 
ATOM   2842 N  N   . ASP B 1 174 ? -23.398 29.911 22.964  1.00 15.02 ? 174  ASP B N   1 
ATOM   2843 C  CA  . ASP B 1 174 ? -24.342 30.949 22.509  1.00 14.87 ? 174  ASP B CA  1 
ATOM   2844 C  C   . ASP B 1 174 ? -24.622 30.857 20.995  1.00 14.86 ? 174  ASP B C   1 
ATOM   2845 O  O   . ASP B 1 174 ? -25.725 31.162 20.507  1.00 14.37 ? 174  ASP B O   1 
ATOM   2846 C  CB  . ASP B 1 174 ? -23.810 32.347 22.814  1.00 15.98 ? 174  ASP B CB  1 
ATOM   2847 C  CG  . ASP B 1 174 ? -23.873 32.694 24.304  1.00 20.31 ? 174  ASP B CG  1 
ATOM   2848 O  OD1 . ASP B 1 174 ? -24.323 31.843 25.123  1.00 19.94 ? 174  ASP B OD1 1 
ATOM   2849 O  OD2 . ASP B 1 174 ? -23.438 33.821 24.658  1.00 18.89 ? 174  ASP B OD2 1 
ATOM   2850 N  N   . TYR B 1 175 ? -23.601 30.443 20.246  1.00 13.03 ? 175  TYR B N   1 
ATOM   2851 C  CA  . TYR B 1 175 ? -23.742 30.298 18.808  1.00 13.30 ? 175  TYR B CA  1 
ATOM   2852 C  C   . TYR B 1 175 ? -24.615 29.102 18.550  1.00 12.67 ? 175  TYR B C   1 
ATOM   2853 O  O   . TYR B 1 175 ? -25.440 29.120 17.650  1.00 15.13 ? 175  TYR B O   1 
ATOM   2854 C  CB  . TYR B 1 175 ? -22.393 30.019 18.214  1.00 13.01 ? 175  TYR B CB  1 
ATOM   2855 C  CG  . TYR B 1 175 ? -22.332 29.518 16.786  1.00 13.37 ? 175  TYR B CG  1 
ATOM   2856 C  CD1 . TYR B 1 175 ? -22.956 30.191 15.735  1.00 12.65 ? 175  TYR B CD1 1 
ATOM   2857 C  CD2 . TYR B 1 175 ? -21.520 28.443 16.490  1.00 13.93 ? 175  TYR B CD2 1 
ATOM   2858 C  CE1 . TYR B 1 175 ? -22.778 29.782 14.417  1.00 10.23 ? 175  TYR B CE1 1 
ATOM   2859 C  CE2 . TYR B 1 175 ? -21.364 28.004 15.183  1.00 14.40 ? 175  TYR B CE2 1 
ATOM   2860 C  CZ  . TYR B 1 175 ? -21.980 28.677 14.167  1.00 13.02 ? 175  TYR B CZ  1 
ATOM   2861 O  OH  . TYR B 1 175 ? -21.799 28.244 12.895  1.00 12.23 ? 175  TYR B OH  1 
ATOM   2862 N  N   . MET B 1 176 ? -24.439 28.060 19.352  1.00 13.56 ? 176  MET B N   1 
ATOM   2863 C  CA  . MET B 1 176 ? -25.272 26.880 19.163  1.00 13.45 ? 176  MET B CA  1 
ATOM   2864 C  C   . MET B 1 176 ? -26.730 27.188 19.383  1.00 14.72 ? 176  MET B C   1 
ATOM   2865 O  O   . MET B 1 176 ? -27.597 26.584 18.737  1.00 14.34 ? 176  MET B O   1 
ATOM   2866 C  CB  . MET B 1 176 ? -24.805 25.759 20.054  1.00 13.68 ? 176  MET B CB  1 
ATOM   2867 C  CG  . MET B 1 176 ? -23.493 25.131 19.570  1.00 14.36 ? 176  MET B CG  1 
ATOM   2868 S  SD  . MET B 1 176 ? -23.489 24.675 17.794  1.00 13.52 ? 176  MET B SD  1 
ATOM   2869 C  CE  . MET B 1 176 ? -24.731 23.365 17.806  1.00 10.04 ? 176  MET B CE  1 
ATOM   2870 N  N   . GLY B 1 177 ? -27.017 28.126 20.286  1.00 15.84 ? 177  GLY B N   1 
ATOM   2871 C  CA  . GLY B 1 177 ? -28.386 28.561 20.503  1.00 14.23 ? 177  GLY B CA  1 
ATOM   2872 C  C   . GLY B 1 177 ? -28.971 29.200 19.262  1.00 15.42 ? 177  GLY B C   1 
ATOM   2873 O  O   . GLY B 1 177 ? -30.176 28.959 18.902  1.00 14.85 ? 177  GLY B O   1 
ATOM   2874 N  N   . ALA B 1 178 ? -28.133 29.985 18.580  1.00 13.86 ? 178  ALA B N   1 
ATOM   2875 C  CA  . ALA B 1 178 ? -28.495 30.608 17.293  1.00 14.43 ? 178  ALA B CA  1 
ATOM   2876 C  C   . ALA B 1 178 ? -28.707 29.565 16.187  1.00 15.26 ? 178  ALA B C   1 
ATOM   2877 O  O   . ALA B 1 178 ? -29.738 29.605 15.494  1.00 15.96 ? 178  ALA B O   1 
ATOM   2878 C  CB  . ALA B 1 178 ? -27.464 31.702 16.885  1.00 13.84 ? 178  ALA B CB  1 
ATOM   2879 N  N   . PHE B 1 179 ? -27.770 28.610 16.062  1.00 15.17 ? 179  PHE B N   1 
ATOM   2880 C  CA  . PHE B 1 179 ? -27.909 27.470 15.177  1.00 14.23 ? 179  PHE B CA  1 
ATOM   2881 C  C   . PHE B 1 179 ? -29.290 26.790 15.312  1.00 14.99 ? 179  PHE B C   1 
ATOM   2882 O  O   . PHE B 1 179 ? -30.007 26.615 14.309  1.00 14.01 ? 179  PHE B O   1 
ATOM   2883 C  CB  . PHE B 1 179 ? -26.736 26.483 15.388  1.00 14.88 ? 179  PHE B CB  1 
ATOM   2884 C  CG  . PHE B 1 179 ? -26.796 25.260 14.504  1.00 11.20 ? 179  PHE B CG  1 
ATOM   2885 C  CD1 . PHE B 1 179 ? -26.446 25.350 13.153  1.00 15.76 ? 179  PHE B CD1 1 
ATOM   2886 C  CD2 . PHE B 1 179 ? -27.174 24.035 15.020  1.00 13.65 ? 179  PHE B CD2 1 
ATOM   2887 C  CE1 . PHE B 1 179 ? -26.477 24.259 12.319  1.00 11.18 ? 179  PHE B CE1 1 
ATOM   2888 C  CE2 . PHE B 1 179 ? -27.212 22.907 14.188  1.00 16.97 ? 179  PHE B CE2 1 
ATOM   2889 C  CZ  . PHE B 1 179 ? -26.851 23.018 12.837  1.00 12.12 ? 179  PHE B CZ  1 
ATOM   2890 N  N   . TRP B 1 180 ? -29.704 26.450 16.539  1.00 14.17 ? 180  TRP B N   1 
ATOM   2891 C  CA  . TRP B 1 180 ? -30.908 25.619 16.680  1.00 14.83 ? 180  TRP B CA  1 
ATOM   2892 C  C   . TRP B 1 180 ? -32.163 26.366 16.318  1.00 15.12 ? 180  TRP B C   1 
ATOM   2893 O  O   . TRP B 1 180 ? -33.182 25.732 15.959  1.00 16.58 ? 180  TRP B O   1 
ATOM   2894 C  CB  . TRP B 1 180 ? -31.048 25.036 18.086  1.00 15.01 ? 180  TRP B CB  1 
ATOM   2895 C  CG  . TRP B 1 180 ? -29.989 24.072 18.385  1.00 13.58 ? 180  TRP B CG  1 
ATOM   2896 C  CD1 . TRP B 1 180 ? -28.999 24.197 19.315  1.00 17.29 ? 180  TRP B CD1 1 
ATOM   2897 C  CD2 . TRP B 1 180 ? -29.783 22.812 17.740  1.00 13.50 ? 180  TRP B CD2 1 
ATOM   2898 N  NE1 . TRP B 1 180 ? -28.187 23.088 19.288  1.00 13.59 ? 180  TRP B NE1 1 
ATOM   2899 C  CE2 . TRP B 1 180 ? -28.649 22.229 18.326  1.00 14.34 ? 180  TRP B CE2 1 
ATOM   2900 C  CE3 . TRP B 1 180 ? -30.452 22.118 16.712  1.00 15.88 ? 180  TRP B CE3 1 
ATOM   2901 C  CZ2 . TRP B 1 180 ? -28.163 20.977 17.932  1.00 13.87 ? 180  TRP B CZ2 1 
ATOM   2902 C  CZ3 . TRP B 1 180 ? -29.959 20.867 16.309  1.00 15.02 ? 180  TRP B CZ3 1 
ATOM   2903 C  CH2 . TRP B 1 180 ? -28.844 20.312 16.934  1.00 16.09 ? 180  TRP B CH2 1 
ATOM   2904 N  N   . SER B 1 181 ? -32.071 27.689 16.380  1.00 15.42 ? 181  SER B N   1 
ATOM   2905 C  CA  . SER B 1 181 ? -33.149 28.609 16.002  1.00 16.23 ? 181  SER B CA  1 
ATOM   2906 C  C   . SER B 1 181 ? -33.283 28.758 14.482  1.00 15.85 ? 181  SER B C   1 
ATOM   2907 O  O   . SER B 1 181 ? -34.253 29.349 13.980  1.00 14.94 ? 181  SER B O   1 
ATOM   2908 C  CB  . SER B 1 181 ? -32.823 30.020 16.522  1.00 15.96 ? 181  SER B CB  1 
ATOM   2909 O  OG  . SER B 1 181 ? -32.738 30.113 17.946  1.00 19.05 ? 181  SER B OG  1 
ATOM   2910 N  N   . LEU B 1 182 ? -32.269 28.288 13.756  1.00 15.27 ? 182  LEU B N   1 
ATOM   2911 C  CA  . LEU B 1 182 ? -32.190 28.497 12.318  1.00 15.51 ? 182  LEU B CA  1 
ATOM   2912 C  C   . LEU B 1 182 ? -32.167 27.223 11.477  1.00 15.07 ? 182  LEU B C   1 
ATOM   2913 O  O   . LEU B 1 182 ? -32.083 27.307 10.260  1.00 15.75 ? 182  LEU B O   1 
ATOM   2914 C  CB  . LEU B 1 182 ? -30.935 29.303 11.970  1.00 14.67 ? 182  LEU B CB  1 
ATOM   2915 C  CG  . LEU B 1 182 ? -30.747 30.703 12.560  1.00 15.26 ? 182  LEU B CG  1 
ATOM   2916 C  CD1 . LEU B 1 182 ? -29.320 31.071 12.307  1.00 14.14 ? 182  LEU B CD1 1 
ATOM   2917 C  CD2 . LEU B 1 182 ? -31.698 31.717 11.929  1.00 13.21 ? 182  LEU B CD2 1 
ATOM   2918 N  N   . VAL B 1 183 ? -32.232 26.043 12.086  1.00 15.79 ? 183  VAL B N   1 
ATOM   2919 C  CA  . VAL B 1 183 ? -31.994 24.820 11.318  1.00 14.57 ? 183  VAL B CA  1 
ATOM   2920 C  C   . VAL B 1 183 ? -33.090 24.641 10.295  1.00 15.84 ? 183  VAL B C   1 
ATOM   2921 O  O   . VAL B 1 183 ? -34.269 24.727 10.611  1.00 15.53 ? 183  VAL B O   1 
ATOM   2922 C  CB  . VAL B 1 183 ? -31.888 23.594 12.225  1.00 15.69 ? 183  VAL B CB  1 
ATOM   2923 C  CG1 . VAL B 1 183 ? -31.718 22.324 11.406  1.00 14.75 ? 183  VAL B CG1 1 
ATOM   2924 C  CG2 . VAL B 1 183 ? -30.696 23.776 13.162  1.00 14.70 ? 183  VAL B CG2 1 
ATOM   2925 N  N   . ASN B 1 184 ? -32.696 24.443 9.043   1.00 16.21 ? 184  ASN B N   1 
ATOM   2926 C  CA  . ASN B 1 184 ? -33.657 24.267 7.964   1.00 16.19 ? 184  ASN B CA  1 
ATOM   2927 C  C   . ASN B 1 184 ? -33.962 22.794 7.857   1.00 16.03 ? 184  ASN B C   1 
ATOM   2928 O  O   . ASN B 1 184 ? -33.278 22.079 7.127   1.00 16.34 ? 184  ASN B O   1 
ATOM   2929 C  CB  . ASN B 1 184 ? -33.016 24.782 6.669   1.00 16.46 ? 184  ASN B CB  1 
ATOM   2930 C  CG  . ASN B 1 184 ? -33.955 24.761 5.482   1.00 18.46 ? 184  ASN B CG  1 
ATOM   2931 O  OD1 . ASN B 1 184 ? -35.176 24.613 5.616   1.00 18.98 ? 184  ASN B OD1 1 
ATOM   2932 N  ND2 . ASN B 1 184 ? -33.381 24.939 4.296   1.00 19.45 ? 184  ASN B ND2 1 
ATOM   2933 N  N   . TRP B 1 185 ? -34.964 22.327 8.605   1.00 15.72 ? 185  TRP B N   1 
ATOM   2934 C  CA  . TRP B 1 185 ? -35.353 20.882 8.580   1.00 14.65 ? 185  TRP B CA  1 
ATOM   2935 C  C   . TRP B 1 185 ? -35.844 20.405 7.201   1.00 15.36 ? 185  TRP B C   1 
ATOM   2936 O  O   . TRP B 1 185 ? -35.691 19.236 6.884   1.00 16.06 ? 185  TRP B O   1 
ATOM   2937 C  CB  . TRP B 1 185 ? -36.419 20.582 9.648   1.00 13.85 ? 185  TRP B CB  1 
ATOM   2938 C  CG  . TRP B 1 185 ? -35.868 20.784 11.067  1.00 14.34 ? 185  TRP B CG  1 
ATOM   2939 C  CD1 . TRP B 1 185 ? -36.284 21.704 11.992  1.00 14.51 ? 185  TRP B CD1 1 
ATOM   2940 C  CD2 . TRP B 1 185 ? -34.798 20.067 11.669  1.00 13.97 ? 185  TRP B CD2 1 
ATOM   2941 N  NE1 . TRP B 1 185 ? -35.516 21.612 13.143  1.00 16.33 ? 185  TRP B NE1 1 
ATOM   2942 C  CE2 . TRP B 1 185 ? -34.616 20.591 12.974  1.00 15.16 ? 185  TRP B CE2 1 
ATOM   2943 C  CE3 . TRP B 1 185 ? -33.971 19.005 11.243  1.00 12.94 ? 185  TRP B CE3 1 
ATOM   2944 C  CZ2 . TRP B 1 185 ? -33.632 20.109 13.841  1.00 17.29 ? 185  TRP B CZ2 1 
ATOM   2945 C  CZ3 . TRP B 1 185 ? -33.012 18.534 12.093  1.00 15.76 ? 185  TRP B CZ3 1 
ATOM   2946 C  CH2 . TRP B 1 185 ? -32.852 19.067 13.397  1.00 16.12 ? 185  TRP B CH2 1 
ATOM   2947 N  N   . SER B 1 186 ? -36.447 21.299 6.411   1.00 15.77 ? 186  SER B N   1 
ATOM   2948 C  CA  . SER B 1 186 ? -36.762 21.031 4.989   1.00 17.37 ? 186  SER B CA  1 
ATOM   2949 C  C   . SER B 1 186 ? -35.567 20.495 4.229   1.00 16.69 ? 186  SER B C   1 
ATOM   2950 O  O   . SER B 1 186 ? -35.693 19.528 3.467   1.00 17.28 ? 186  SER B O   1 
ATOM   2951 C  CB  . SER B 1 186 ? -37.230 22.291 4.260   1.00 18.68 ? 186  SER B CB  1 
ATOM   2952 O  OG  . SER B 1 186 ? -38.549 22.587 4.676   1.00 24.24 ? 186  SER B OG  1 
ATOM   2953 N  N   . PHE B 1 187 ? -34.411 21.121 4.417   1.00 15.51 ? 187  PHE B N   1 
ATOM   2954 C  CA  . PHE B 1 187 ? -33.207 20.682 3.732   1.00 15.55 ? 187  PHE B CA  1 
ATOM   2955 C  C   . PHE B 1 187 ? -32.679 19.372 4.312   1.00 15.70 ? 187  PHE B C   1 
ATOM   2956 O  O   . PHE B 1 187 ? -32.164 18.507 3.573   1.00 15.23 ? 187  PHE B O   1 
ATOM   2957 C  CB  . PHE B 1 187 ? -32.152 21.801 3.758   1.00 15.48 ? 187  PHE B CB  1 
ATOM   2958 C  CG  . PHE B 1 187 ? -30.830 21.431 3.114   1.00 14.69 ? 187  PHE B CG  1 
ATOM   2959 C  CD1 . PHE B 1 187 ? -30.737 21.191 1.745   1.00 13.86 ? 187  PHE B CD1 1 
ATOM   2960 C  CD2 . PHE B 1 187 ? -29.683 21.384 3.882   1.00 13.77 ? 187  PHE B CD2 1 
ATOM   2961 C  CE1 . PHE B 1 187 ? -29.503 20.856 1.171   1.00 13.82 ? 187  PHE B CE1 1 
ATOM   2962 C  CE2 . PHE B 1 187 ? -28.445 21.074 3.312   1.00 8.68  ? 187  PHE B CE2 1 
ATOM   2963 C  CZ  . PHE B 1 187 ? -28.368 20.810 1.966   1.00 11.96 ? 187  PHE B CZ  1 
ATOM   2964 N  N   . VAL B 1 188 ? -32.826 19.199 5.625   1.00 14.10 ? 188  VAL B N   1 
ATOM   2965 C  CA  . VAL B 1 188 ? -32.410 17.945 6.260   1.00 13.15 ? 188  VAL B CA  1 
ATOM   2966 C  C   . VAL B 1 188 ? -33.266 16.815 5.693   1.00 13.13 ? 188  VAL B C   1 
ATOM   2967 O  O   . VAL B 1 188 ? -32.791 15.720 5.435   1.00 13.92 ? 188  VAL B O   1 
ATOM   2968 C  CB  . VAL B 1 188 ? -32.501 18.031 7.799   1.00 12.40 ? 188  VAL B CB  1 
ATOM   2969 C  CG1 . VAL B 1 188 ? -32.162 16.648 8.400   1.00 11.82 ? 188  VAL B CG1 1 
ATOM   2970 C  CG2 . VAL B 1 188 ? -31.588 19.201 8.337   1.00 11.85 ? 188  VAL B CG2 1 
ATOM   2971 N  N   . GLU B 1 189 ? -34.541 17.078 5.513   1.00 14.07 ? 189  GLU B N   1 
ATOM   2972 C  CA  . GLU B 1 189 ? -35.417 16.022 4.983   1.00 15.32 ? 189  GLU B CA  1 
ATOM   2973 C  C   . GLU B 1 189 ? -35.063 15.626 3.550   1.00 15.37 ? 189  GLU B C   1 
ATOM   2974 O  O   . GLU B 1 189 ? -34.971 14.441 3.242   1.00 16.97 ? 189  GLU B O   1 
ATOM   2975 C  CB  . GLU B 1 189 ? -36.878 16.452 5.087   1.00 15.07 ? 189  GLU B CB  1 
ATOM   2976 C  CG  . GLU B 1 189 ? -37.891 15.353 4.782   0.50 17.95 ? 189  GLU B CG  1 
ATOM   2977 C  CD  . GLU B 1 189 ? -39.293 15.900 4.719   0.50 21.76 ? 189  GLU B CD  1 
ATOM   2978 O  OE1 . GLU B 1 189 ? -39.756 16.247 3.625   0.50 25.40 ? 189  GLU B OE1 1 
ATOM   2979 O  OE2 . GLU B 1 189 ? -39.933 16.034 5.769   0.50 25.73 ? 189  GLU B OE2 1 
ATOM   2980 N  N   . GLU B 1 190 ? -34.876 16.607 2.677   1.00 15.99 ? 190  GLU B N   1 
ATOM   2981 C  CA  . GLU B 1 190 ? -34.337 16.344 1.337   1.00 16.28 ? 190  GLU B CA  1 
ATOM   2982 C  C   . GLU B 1 190 ? -33.094 15.485 1.426   1.00 17.13 ? 190  GLU B C   1 
ATOM   2983 O  O   . GLU B 1 190 ? -32.993 14.503 0.699   1.00 17.31 ? 190  GLU B O   1 
ATOM   2984 C  CB  . GLU B 1 190 ? -34.064 17.647 0.537   1.00 16.76 ? 190  GLU B CB  1 
ATOM   2985 C  CG  . GLU B 1 190 ? -35.281 18.501 0.413   0.70 15.70 ? 190  GLU B CG  1 
ATOM   2986 C  CD  . GLU B 1 190 ? -35.208 19.529 -0.688  0.70 16.88 ? 190  GLU B CD  1 
ATOM   2987 O  OE1 . GLU B 1 190 ? -34.088 19.999 -1.053  0.70 10.55 ? 190  GLU B OE1 1 
ATOM   2988 O  OE2 . GLU B 1 190 ? -36.319 19.858 -1.183  0.70 16.76 ? 190  GLU B OE2 1 
ATOM   2989 N  N   . ASN B 1 191 ? -32.172 15.798 2.341   1.00 17.26 ? 191  ASN B N   1 
ATOM   2990 C  CA  . ASN B 1 191 ? -30.920 14.996 2.434   1.00 16.74 ? 191  ASN B CA  1 
ATOM   2991 C  C   . ASN B 1 191 ? -31.133 13.550 2.840   1.00 18.48 ? 191  ASN B C   1 
ATOM   2992 O  O   . ASN B 1 191 ? -30.337 12.684 2.507   1.00 16.95 ? 191  ASN B O   1 
ATOM   2993 C  CB  . ASN B 1 191 ? -29.844 15.617 3.357   1.00 16.34 ? 191  ASN B CB  1 
ATOM   2994 C  CG  . ASN B 1 191 ? -29.377 16.976 2.894   1.00 14.82 ? 191  ASN B CG  1 
ATOM   2995 O  OD1 . ASN B 1 191 ? -29.191 17.224 1.706   1.00 13.12 ? 191  ASN B OD1 1 
ATOM   2996 N  ND2 . ASN B 1 191 ? -29.193 17.867 3.845   1.00 13.33 ? 191  ASN B ND2 1 
ATOM   2997 N  N   . LEU B 1 192 ? -32.215 13.282 3.569   1.00 20.68 ? 192  LEU B N   1 
ATOM   2998 C  CA  . LEU B 1 192 ? -32.477 11.951 4.069   1.00 22.34 ? 192  LEU B CA  1 
ATOM   2999 C  C   . LEU B 1 192 ? -32.839 10.998 2.915   1.00 23.54 ? 192  LEU B C   1 
ATOM   3000 O  O   . LEU B 1 192 ? -32.702 9.789  3.051   1.00 23.27 ? 192  LEU B O   1 
ATOM   3001 C  CB  . LEU B 1 192 ? -33.608 12.028 5.092   1.00 22.86 ? 192  LEU B CB  1 
ATOM   3002 C  CG  . LEU B 1 192 ? -33.744 11.220 6.373   1.00 23.36 ? 192  LEU B CG  1 
ATOM   3003 C  CD1 . LEU B 1 192 ? -32.435 10.810 7.034   1.00 24.08 ? 192  LEU B CD1 1 
ATOM   3004 C  CD2 . LEU B 1 192 ? -34.583 12.091 7.243   1.00 21.25 ? 192  LEU B CD2 1 
ATOM   3005 N  N   . ALA B 1 193 ? -33.275 11.568 1.786   1.00 25.61 ? 193  ALA B N   1 
ATOM   3006 C  CA  . ALA B 1 193 ? -33.584 10.814 0.528   1.00 26.56 ? 193  ALA B CA  1 
ATOM   3007 C  C   . ALA B 1 193 ? -32.438 10.744 -0.501  1.00 27.06 ? 193  ALA B C   1 
ATOM   3008 O  O   . ALA B 1 193 ? -32.436 9.889  -1.388  1.00 28.99 ? 193  ALA B O   1 
ATOM   3009 C  CB  . ALA B 1 193 ? -34.831 11.344 -0.111  1.00 26.43 ? 193  ALA B CB  1 
ATOM   3010 N  N   . LYS B 1 194 ? -31.470 11.633 -0.394  1.00 27.28 ? 194  LYS B N   1 
ATOM   3011 C  CA  . LYS B 1 194 ? -30.204 11.470 -1.095  1.00 26.64 ? 194  LYS B CA  1 
ATOM   3012 C  C   . LYS B 1 194 ? -29.455 10.375 -0.361  1.00 27.47 ? 194  LYS B C   1 
ATOM   3013 O  O   . LYS B 1 194 ? -28.249 10.219 -0.520  1.00 28.75 ? 194  LYS B O   1 
ATOM   3014 C  CB  . LYS B 1 194 ? -29.379 12.770 -1.078  1.00 26.78 ? 194  LYS B CB  1 
ATOM   3015 C  CG  . LYS B 1 194 ? -30.156 14.023 -1.489  1.00 25.68 ? 194  LYS B CG  1 
ATOM   3016 C  CD  . LYS B 1 194 ? -29.320 15.280 -1.383  1.00 25.30 ? 194  LYS B CD  1 
ATOM   3017 C  CE  . LYS B 1 194 ? -30.257 16.479 -1.493  1.00 26.22 ? 194  LYS B CE  1 
ATOM   3018 N  NZ  . LYS B 1 194 ? -29.749 17.832 -1.043  1.00 29.65 ? 194  LYS B NZ  1 
HETATM 3019 FE FE  . FE  C 2 .   ? -5.060  32.376 20.736  1.00 12.57 ? 1195 FE  A FE  1 
HETATM 3020 FE FE  . FE  D 2 .   ? -16.794 28.962 7.515   1.00 11.36 ? 1195 FE  B FE  1 
HETATM 3021 O  O   . HOH E 3 .   ? -0.877  22.277 39.299  1.00 37.54 ? 2001 HOH A O   1 
HETATM 3022 O  O   . HOH E 3 .   ? 1.023   37.049 37.068  1.00 23.01 ? 2002 HOH A O   1 
HETATM 3023 O  O   . HOH E 3 .   ? 0.850   29.208 37.154  1.00 28.70 ? 2003 HOH A O   1 
HETATM 3024 O  O   . HOH E 3 .   ? -1.786  32.555 40.557  1.00 34.60 ? 2004 HOH A O   1 
HETATM 3025 O  O   . HOH E 3 .   ? -5.539  32.978 37.423  1.00 20.48 ? 2005 HOH A O   1 
HETATM 3026 O  O   . HOH E 3 .   ? 0.358   35.166 30.106  1.00 21.10 ? 2006 HOH A O   1 
HETATM 3027 O  O   . HOH E 3 .   ? -8.352  38.866 32.918  1.00 30.95 ? 2007 HOH A O   1 
HETATM 3028 O  O   . HOH E 3 .   ? 3.043   48.338 28.696  1.00 23.07 ? 2008 HOH A O   1 
HETATM 3029 O  O   . HOH E 3 .   ? -7.240  40.166 30.609  1.00 20.55 ? 2009 HOH A O   1 
HETATM 3030 O  O   . HOH E 3 .   ? -3.282  47.316 23.073  1.00 19.32 ? 2010 HOH A O   1 
HETATM 3031 O  O   . HOH E 3 .   ? -6.040  49.820 18.717  1.00 39.80 ? 2011 HOH A O   1 
HETATM 3032 O  O   . HOH E 3 .   ? 1.955   50.224 20.480  1.00 21.41 ? 2012 HOH A O   1 
HETATM 3033 O  O   . HOH E 3 .   ? -12.069 47.278 19.405  1.00 27.59 ? 2013 HOH A O   1 
HETATM 3034 O  O   . HOH E 3 .   ? -10.576 48.237 21.836  1.00 24.47 ? 2014 HOH A O   1 
HETATM 3035 O  O   . HOH E 3 .   ? -8.400  41.213 16.779  1.00 31.78 ? 2015 HOH A O   1 
HETATM 3036 O  O   . HOH E 3 .   ? -17.295 42.972 22.716  1.00 34.52 ? 2016 HOH A O   1 
HETATM 3037 O  O   . HOH E 3 .   ? 4.136   29.580 30.400  1.00 31.01 ? 2017 HOH A O   1 
HETATM 3038 O  O   . HOH E 3 .   ? -9.840  36.749 33.014  1.00 30.07 ? 2018 HOH A O   1 
HETATM 3039 O  O   . HOH E 3 .   ? -10.548 29.338 21.676  1.00 32.82 ? 2019 HOH A O   1 
HETATM 3040 O  O   . HOH E 3 .   ? -10.263 29.064 24.955  1.00 24.15 ? 2020 HOH A O   1 
HETATM 3041 O  O   . HOH E 3 .   ? -12.747 30.185 24.896  1.00 27.86 ? 2021 HOH A O   1 
HETATM 3042 O  O   . HOH E 3 .   ? -9.785  26.496 22.033  1.00 15.49 ? 2022 HOH A O   1 
HETATM 3043 O  O   . HOH E 3 .   ? -11.826 20.759 32.411  1.00 32.54 ? 2023 HOH A O   1 
HETATM 3044 O  O   . HOH E 3 .   ? -8.737  27.870 37.454  1.00 25.90 ? 2024 HOH A O   1 
HETATM 3045 O  O   . HOH E 3 .   ? 7.200   46.802 10.683  1.00 26.73 ? 2025 HOH A O   1 
HETATM 3046 O  O   . HOH E 3 .   ? 3.700   42.355 6.463   1.00 30.69 ? 2026 HOH A O   1 
HETATM 3047 O  O   . HOH E 3 .   ? 4.488   24.984 35.576  1.00 33.42 ? 2027 HOH A O   1 
HETATM 3048 O  O   . HOH E 3 .   ? 9.119   27.577 29.614  1.00 35.30 ? 2028 HOH A O   1 
HETATM 3049 O  O   . HOH E 3 .   ? 6.567   24.546 33.117  1.00 43.64 ? 2029 HOH A O   1 
HETATM 3050 O  O   . HOH E 3 .   ? 1.403   17.359 19.597  1.00 36.94 ? 2030 HOH A O   1 
HETATM 3051 O  O   . HOH E 3 .   ? 3.628   13.391 33.804  1.00 41.49 ? 2031 HOH A O   1 
HETATM 3052 O  O   . HOH E 3 .   ? 2.902   15.103 24.576  1.00 28.05 ? 2032 HOH A O   1 
HETATM 3053 O  O   . HOH E 3 .   ? -2.734  12.173 28.428  1.00 35.63 ? 2033 HOH A O   1 
HETATM 3054 O  O   . HOH E 3 .   ? -7.642  35.097 2.710   1.00 32.96 ? 2034 HOH A O   1 
HETATM 3055 O  O   . HOH E 3 .   ? -6.930  14.141 27.924  1.00 38.73 ? 2035 HOH A O   1 
HETATM 3056 O  O   . HOH E 3 .   ? -4.016  19.908 19.129  1.00 27.71 ? 2036 HOH A O   1 
HETATM 3057 O  O   . HOH E 3 .   ? -7.709  17.529 19.348  1.00 30.65 ? 2037 HOH A O   1 
HETATM 3058 O  O   . HOH E 3 .   ? -10.068 23.726 25.110  1.00 28.93 ? 2038 HOH A O   1 
HETATM 3059 O  O   . HOH E 3 .   ? 5.153   30.196 27.941  1.00 21.80 ? 2039 HOH A O   1 
HETATM 3060 O  O   . HOH E 3 .   ? 1.843   30.040 31.197  1.00 31.25 ? 2040 HOH A O   1 
HETATM 3061 O  O   . HOH E 3 .   ? 6.650   32.429 27.642  1.00 31.49 ? 2041 HOH A O   1 
HETATM 3062 O  O   . HOH E 3 .   ? 6.663   41.802 26.028  1.00 29.02 ? 2042 HOH A O   1 
HETATM 3063 O  O   . HOH E 3 .   ? 5.536   48.073 19.190  1.00 19.80 ? 2043 HOH A O   1 
HETATM 3064 O  O   . HOH E 3 .   ? 9.467   43.695 12.467  1.00 25.73 ? 2044 HOH A O   1 
HETATM 3065 O  O   . HOH E 3 .   ? 18.661  40.485 10.664  1.00 30.01 ? 2045 HOH A O   1 
HETATM 3066 O  O   . HOH E 3 .   ? 19.029  41.870 7.323   1.00 34.20 ? 2046 HOH A O   1 
HETATM 3067 O  O   . HOH E 3 .   ? 16.968  43.131 5.223   1.00 39.15 ? 2047 HOH A O   1 
HETATM 3068 O  O   . HOH E 3 .   ? 12.532  35.005 1.104   1.00 44.84 ? 2048 HOH A O   1 
HETATM 3069 O  O   . HOH E 3 .   ? 5.017   44.807 7.618   1.00 33.63 ? 2049 HOH A O   1 
HETATM 3070 O  O   . HOH E 3 .   ? 9.181   45.369 10.231  1.00 28.54 ? 2050 HOH A O   1 
HETATM 3071 O  O   . HOH E 3 .   ? 5.476   37.014 1.794   1.00 33.20 ? 2051 HOH A O   1 
HETATM 3072 O  O   . HOH E 3 .   ? 7.466   30.552 3.482   1.00 24.90 ? 2052 HOH A O   1 
HETATM 3073 O  O   . HOH E 3 .   ? -5.001  29.409 5.315   1.00 21.55 ? 2053 HOH A O   1 
HETATM 3074 O  O   . HOH E 3 .   ? -0.303  23.834 10.486  1.00 33.75 ? 2054 HOH A O   1 
HETATM 3075 O  O   . HOH E 3 .   ? -1.031  24.434 6.072   1.00 31.40 ? 2055 HOH A O   1 
HETATM 3076 O  O   . HOH E 3 .   ? -6.969  29.153 7.021   1.00 15.70 ? 2056 HOH A O   1 
HETATM 3077 O  O   . HOH E 3 .   ? -9.348  29.557 14.788  1.00 12.80 ? 2057 HOH A O   1 
HETATM 3078 O  O   . HOH E 3 .   ? 13.127  27.301 7.601   1.00 20.21 ? 2058 HOH A O   1 
HETATM 3079 O  O   . HOH E 3 .   ? 6.387   23.298 8.967   1.00 25.67 ? 2059 HOH A O   1 
HETATM 3080 O  O   . HOH E 3 .   ? 1.078   20.278 13.929  1.00 17.14 ? 2060 HOH A O   1 
HETATM 3081 O  O   . HOH E 3 .   ? -2.035  19.544 15.872  1.00 27.39 ? 2061 HOH A O   1 
HETATM 3082 O  O   . HOH E 3 .   ? -4.892  23.613 11.648  1.00 15.96 ? 2062 HOH A O   1 
HETATM 3083 O  O   . HOH E 3 .   ? -5.966  18.742 17.713  1.00 29.17 ? 2063 HOH A O   1 
HETATM 3084 O  O   . HOH E 3 .   ? -7.886  24.121 13.181  1.00 21.57 ? 2064 HOH A O   1 
HETATM 3085 O  O   . HOH E 3 .   ? 3.261   19.281 19.859  1.00 25.41 ? 2065 HOH A O   1 
HETATM 3086 O  O   . HOH E 3 .   ? 6.812   21.662 16.023  1.00 32.88 ? 2066 HOH A O   1 
HETATM 3087 O  O   . HOH E 3 .   ? 6.046   19.766 17.408  1.00 31.97 ? 2067 HOH A O   1 
HETATM 3088 O  O   . HOH E 3 .   ? 11.473  21.672 22.721  1.00 35.86 ? 2068 HOH A O   1 
HETATM 3089 O  O   . HOH E 3 .   ? -4.801  30.392 19.910  1.00 17.50 ? 2069 HOH A O   1 
HETATM 3090 O  O   . HOH E 3 .   ? -9.606  39.251 17.558  1.00 20.92 ? 2070 HOH A O   1 
HETATM 3091 O  O   . HOH E 3 .   ? -9.711  37.200 20.934  1.00 21.86 ? 2071 HOH A O   1 
HETATM 3092 O  O   . HOH E 3 .   ? -4.011  38.631 19.502  1.00 16.25 ? 2072 HOH A O   1 
HETATM 3093 O  O   . HOH E 3 .   ? -9.485  34.157 8.928   1.00 16.28 ? 2073 HOH A O   1 
HETATM 3094 O  O   . HOH E 3 .   ? -17.203 35.644 9.003   1.00 24.74 ? 2074 HOH A O   1 
HETATM 3095 O  O   . HOH E 3 .   ? -5.647  41.776 16.109  1.00 22.39 ? 2075 HOH A O   1 
HETATM 3096 O  O   . HOH E 3 .   ? -8.803  44.069 7.918   1.00 28.44 ? 2076 HOH A O   1 
HETATM 3097 O  O   . HOH E 3 .   ? -17.660 42.778 16.009  1.00 29.95 ? 2077 HOH A O   1 
HETATM 3098 O  O   . HOH E 3 .   ? -15.209 44.017 15.840  1.00 25.65 ? 2078 HOH A O   1 
HETATM 3099 O  O   . HOH E 3 .   ? -7.591  37.855 3.370   1.00 18.82 ? 2079 HOH A O   1 
HETATM 3100 O  O   . HOH E 3 .   ? -12.264 42.094 4.603   1.00 20.71 ? 2080 HOH A O   1 
HETATM 3101 O  O   . HOH E 3 .   ? -9.275  34.296 6.316   1.00 20.20 ? 2081 HOH A O   1 
HETATM 3102 O  O   . HOH E 3 .   ? -7.036  32.804 6.664   1.00 26.02 ? 2082 HOH A O   1 
HETATM 3103 O  O   . HOH E 3 .   ? -1.559  46.372 9.280   1.00 28.41 ? 2083 HOH A O   1 
HETATM 3104 O  O   . HOH E 3 .   ? 4.645   46.317 9.902   1.00 31.46 ? 2084 HOH A O   1 
HETATM 3105 O  O   . HOH E 3 .   ? 11.049  40.164 27.469  1.00 33.32 ? 2085 HOH A O   1 
HETATM 3106 O  O   . HOH E 3 .   ? 14.392  31.962 29.115  1.00 26.72 ? 2086 HOH A O   1 
HETATM 3107 O  O   . HOH E 3 .   ? 16.832  37.524 28.884  1.00 51.48 ? 2087 HOH A O   1 
HETATM 3108 O  O   . HOH E 3 .   ? 21.806  25.992 24.893  1.00 34.46 ? 2088 HOH A O   1 
HETATM 3109 O  O   . HOH F 3 .   ? -13.694 24.402 -12.964 1.00 36.72 ? 2001 HOH B O   1 
HETATM 3110 O  O   . HOH F 3 .   ? -23.958 36.281 -4.255  1.00 32.88 ? 2002 HOH B O   1 
HETATM 3111 O  O   . HOH F 3 .   ? -19.755 27.211 -10.177 1.00 33.57 ? 2003 HOH B O   1 
HETATM 3112 O  O   . HOH F 3 .   ? -22.201 34.765 -6.255  1.00 26.93 ? 2004 HOH B O   1 
HETATM 3113 O  O   . HOH F 3 .   ? -25.924 35.963 -2.439  1.00 25.03 ? 2005 HOH B O   1 
HETATM 3114 O  O   . HOH F 3 .   ? -28.396 35.770 19.782  1.00 24.03 ? 2006 HOH B O   1 
HETATM 3115 O  O   . HOH F 3 .   ? -30.185 31.998 20.993  1.00 25.76 ? 2007 HOH B O   1 
HETATM 3116 O  O   . HOH F 3 .   ? -34.707 35.603 2.714   1.00 21.99 ? 2008 HOH B O   1 
HETATM 3117 O  O   . HOH F 3 .   ? -29.129 37.703 8.851   1.00 13.74 ? 2009 HOH B O   1 
HETATM 3118 O  O   . HOH F 3 .   ? -8.669  30.507 2.964   1.00 18.59 ? 2010 HOH B O   1 
HETATM 3119 O  O   . HOH F 3 .   ? -13.121 34.870 -8.891  1.00 31.35 ? 2011 HOH B O   1 
HETATM 3120 O  O   . HOH F 3 .   ? -4.086  36.716 1.479   1.00 23.17 ? 2012 HOH B O   1 
HETATM 3121 O  O   . HOH F 3 .   ? -26.789 37.107 17.589  1.00 21.88 ? 2013 HOH B O   1 
HETATM 3122 O  O   . HOH F 3 .   ? -29.622 33.457 18.903  1.00 25.61 ? 2014 HOH B O   1 
HETATM 3123 O  O   . HOH F 3 .   ? -24.469 43.393 10.827  1.00 19.44 ? 2015 HOH B O   1 
HETATM 3124 O  O   . HOH F 3 .   ? -22.859 43.552 12.915  1.00 29.95 ? 2016 HOH B O   1 
HETATM 3125 O  O   . HOH F 3 .   ? -20.759 23.033 -8.186  1.00 27.59 ? 2017 HOH B O   1 
HETATM 3126 O  O   . HOH F 3 .   ? -22.109 22.295 -3.761  1.00 18.65 ? 2018 HOH B O   1 
HETATM 3127 O  O   . HOH F 3 .   ? -20.185 35.796 13.419  1.00 35.14 ? 2019 HOH B O   1 
HETATM 3128 O  O   . HOH F 3 .   ? -24.553 44.452 5.976   1.00 27.31 ? 2020 HOH B O   1 
HETATM 3129 O  O   . HOH F 3 .   ? -22.367 38.050 0.220   1.00 28.85 ? 2021 HOH B O   1 
HETATM 3130 O  O   . HOH F 3 .   ? -24.949 19.713 -1.108  1.00 37.59 ? 2022 HOH B O   1 
HETATM 3131 O  O   . HOH F 3 .   ? -23.481 25.485 -5.736  1.00 27.58 ? 2023 HOH B O   1 
HETATM 3132 O  O   . HOH F 3 .   ? -16.087 40.112 -1.834  1.00 28.64 ? 2024 HOH B O   1 
HETATM 3133 O  O   . HOH F 3 .   ? -11.362 31.799 3.153   1.00 26.81 ? 2025 HOH B O   1 
HETATM 3134 O  O   . HOH F 3 .   ? -15.760 33.917 -7.203  1.00 26.49 ? 2026 HOH B O   1 
HETATM 3135 O  O   . HOH F 3 .   ? -10.617 34.674 3.468   1.00 10.89 ? 2027 HOH B O   1 
HETATM 3136 O  O   . HOH F 3 .   ? -12.640 36.584 -1.506  1.00 17.50 ? 2028 HOH B O   1 
HETATM 3137 O  O   . HOH F 3 .   ? -9.374  29.073 5.392   1.00 10.95 ? 2029 HOH B O   1 
HETATM 3138 O  O   . HOH F 3 .   ? -5.670  34.656 0.763   1.00 36.68 ? 2030 HOH B O   1 
HETATM 3139 O  O   . HOH F 3 .   ? -4.744  29.432 -5.954  1.00 19.03 ? 2031 HOH B O   1 
HETATM 3140 O  O   . HOH F 3 .   ? -41.296 14.531 23.960  1.00 27.25 ? 2032 HOH B O   1 
HETATM 3141 O  O   . HOH F 3 .   ? -38.904 11.250 24.673  1.00 28.76 ? 2033 HOH B O   1 
HETATM 3142 O  O   . HOH F 3 .   ? -9.518  27.751 -13.005 1.00 20.85 ? 2034 HOH B O   1 
HETATM 3143 O  O   . HOH F 3 .   ? -11.519 32.910 -9.659  1.00 16.56 ? 2035 HOH B O   1 
HETATM 3144 O  O   . HOH F 3 .   ? -30.411 26.939 24.505  1.00 29.10 ? 2036 HOH B O   1 
HETATM 3145 O  O   . HOH F 3 .   ? -0.906  27.600 -8.741  1.00 23.17 ? 2037 HOH B O   1 
HETATM 3146 O  O   . HOH F 3 .   ? -20.385 15.207 -9.114  1.00 36.62 ? 2038 HOH B O   1 
HETATM 3147 O  O   . HOH F 3 .   ? -19.688 21.103 -9.631  1.00 21.94 ? 2039 HOH B O   1 
HETATM 3148 O  O   . HOH F 3 .   ? -20.276 18.496 -7.458  1.00 24.51 ? 2040 HOH B O   1 
HETATM 3149 O  O   . HOH F 3 .   ? -21.368 20.242 -5.555  1.00 24.69 ? 2041 HOH B O   1 
HETATM 3150 O  O   . HOH F 3 .   ? -18.529 12.203 -7.953  1.00 34.95 ? 2042 HOH B O   1 
HETATM 3151 O  O   . HOH F 3 .   ? -24.147 13.731 -0.427  1.00 33.71 ? 2043 HOH B O   1 
HETATM 3152 O  O   . HOH F 3 .   ? -10.071 13.066 -1.286  1.00 21.72 ? 2044 HOH B O   1 
HETATM 3153 O  O   . HOH F 3 .   ? -13.029 9.968  -1.343  1.00 34.42 ? 2045 HOH B O   1 
HETATM 3154 O  O   . HOH F 3 .   ? -4.340  16.550 -5.031  1.00 29.76 ? 2046 HOH B O   1 
HETATM 3155 O  O   . HOH F 3 .   ? -3.094  20.030 -3.786  1.00 26.34 ? 2047 HOH B O   1 
HETATM 3156 O  O   . HOH F 3 .   ? -17.513 25.787 24.162  1.00 41.83 ? 2048 HOH B O   1 
HETATM 3157 O  O   . HOH F 3 .   ? -3.419  21.255 5.392   1.00 33.75 ? 2049 HOH B O   1 
HETATM 3158 O  O   . HOH F 3 .   ? -4.447  24.594 2.159   1.00 21.07 ? 2050 HOH B O   1 
HETATM 3159 O  O   . HOH F 3 .   ? -8.209  19.991 5.999   1.00 16.49 ? 2051 HOH B O   1 
HETATM 3160 O  O   . HOH F 3 .   ? -7.677  28.234 1.891   1.00 22.84 ? 2052 HOH B O   1 
HETATM 3161 O  O   . HOH F 3 .   ? -4.113  26.912 -0.988  1.00 29.16 ? 2053 HOH B O   1 
HETATM 3162 O  O   . HOH F 3 .   ? -22.711 21.654 -1.006  1.00 17.35 ? 2054 HOH B O   1 
HETATM 3163 O  O   . HOH F 3 .   ? -21.296 24.718 -4.136  1.00 17.97 ? 2055 HOH B O   1 
HETATM 3164 O  O   . HOH F 3 .   ? -26.274 27.470 -0.160  1.00 21.66 ? 2056 HOH B O   1 
HETATM 3165 O  O   . HOH F 3 .   ? -26.986 24.077 -3.239  1.00 20.97 ? 2057 HOH B O   1 
HETATM 3166 O  O   . HOH F 3 .   ? -31.688 26.443 1.222   1.00 34.16 ? 2058 HOH B O   1 
HETATM 3167 O  O   . HOH F 3 .   ? -25.858 21.757 -0.566  1.00 21.58 ? 2059 HOH B O   1 
HETATM 3168 O  O   . HOH F 3 .   ? -31.843 27.881 3.225   1.00 24.97 ? 2060 HOH B O   1 
HETATM 3169 O  O   . HOH F 3 .   ? -38.769 24.319 11.356  1.00 28.01 ? 2061 HOH B O   1 
HETATM 3170 O  O   . HOH F 3 .   ? -33.968 23.202 17.229  1.00 26.07 ? 2062 HOH B O   1 
HETATM 3171 O  O   . HOH F 3 .   ? -40.480 23.653 18.097  1.00 28.64 ? 2063 HOH B O   1 
HETATM 3172 O  O   . HOH F 3 .   ? -39.637 21.727 22.153  1.00 28.05 ? 2064 HOH B O   1 
HETATM 3173 O  O   . HOH F 3 .   ? -39.463 15.857 16.909  1.00 28.66 ? 2065 HOH B O   1 
HETATM 3174 O  O   . HOH F 3 .   ? -38.626 18.206 9.959   1.00 37.72 ? 2066 HOH B O   1 
HETATM 3175 O  O   . HOH F 3 .   ? -42.738 11.882 12.923  1.00 28.18 ? 2067 HOH B O   1 
HETATM 3176 O  O   . HOH F 3 .   ? -38.311 8.690  9.078   1.00 16.57 ? 2068 HOH B O   1 
HETATM 3177 O  O   . HOH F 3 .   ? -39.195 6.675  14.875  1.00 27.38 ? 2069 HOH B O   1 
HETATM 3178 O  O   . HOH F 3 .   ? -37.301 13.737 16.705  1.00 22.61 ? 2070 HOH B O   1 
HETATM 3179 O  O   . HOH F 3 .   ? -33.293 2.180  14.334  1.00 34.85 ? 2071 HOH B O   1 
HETATM 3180 O  O   . HOH F 3 .   ? -31.472 18.955 23.726  1.00 23.18 ? 2072 HOH B O   1 
HETATM 3181 O  O   . HOH F 3 .   ? -38.462 14.343 20.778  1.00 37.02 ? 2073 HOH B O   1 
HETATM 3182 O  O   . HOH F 3 .   ? -38.351 20.100 24.374  1.00 17.52 ? 2074 HOH B O   1 
HETATM 3183 O  O   . HOH F 3 .   ? -39.030 14.458 24.788  1.00 28.97 ? 2075 HOH B O   1 
HETATM 3184 O  O   . HOH F 3 .   ? -28.206 13.133 24.889  1.00 22.56 ? 2076 HOH B O   1 
HETATM 3185 O  O   . HOH F 3 .   ? -36.314 9.204  25.034  1.00 27.99 ? 2077 HOH B O   1 
HETATM 3186 O  O   . HOH F 3 .   ? -31.081 25.855 21.994  1.00 18.80 ? 2078 HOH B O   1 
HETATM 3187 O  O   . HOH F 3 .   ? -25.241 19.377 25.275  1.00 24.43 ? 2079 HOH B O   1 
HETATM 3188 O  O   . HOH F 3 .   ? -23.813 9.022  16.917  1.00 20.24 ? 2080 HOH B O   1 
HETATM 3189 O  O   . HOH F 3 .   ? -22.974 20.559 25.508  1.00 30.87 ? 2081 HOH B O   1 
HETATM 3190 O  O   . HOH F 3 .   ? -21.697 14.318 22.341  1.00 30.64 ? 2082 HOH B O   1 
HETATM 3191 O  O   . HOH F 3 .   ? -12.972 23.299 21.549  1.00 24.28 ? 2083 HOH B O   1 
HETATM 3192 O  O   . HOH F 3 .   ? -11.330 18.869 15.766  1.00 34.44 ? 2084 HOH B O   1 
HETATM 3193 O  O   . HOH F 3 .   ? -11.104 17.429 19.099  1.00 31.68 ? 2085 HOH B O   1 
HETATM 3194 O  O   . HOH F 3 .   ? -11.393 25.140 20.101  1.00 12.84 ? 2086 HOH B O   1 
HETATM 3195 O  O   . HOH F 3 .   ? -11.192 28.944 13.060  1.00 11.61 ? 2087 HOH B O   1 
HETATM 3196 O  O   . HOH F 3 .   ? -30.008 7.074  1.490   1.00 39.04 ? 2088 HOH B O   1 
HETATM 3197 O  O   . HOH F 3 .   ? -23.084 1.607  7.109   1.00 35.74 ? 2089 HOH B O   1 
HETATM 3198 O  O   . HOH F 3 .   ? -32.167 6.549  6.730   1.00 24.66 ? 2090 HOH B O   1 
HETATM 3199 O  O   . HOH F 3 .   ? -30.408 5.037  12.897  1.00 29.03 ? 2091 HOH B O   1 
HETATM 3200 O  O   . HOH F 3 .   ? -8.753  17.151 8.659   1.00 19.73 ? 2092 HOH B O   1 
HETATM 3201 O  O   . HOH F 3 .   ? -11.332 15.159 10.407  1.00 25.75 ? 2093 HOH B O   1 
HETATM 3202 O  O   . HOH F 3 .   ? -9.341  21.189 14.057  1.00 13.59 ? 2094 HOH B O   1 
HETATM 3203 O  O   . HOH F 3 .   ? -5.999  20.336 7.580   1.00 20.34 ? 2095 HOH B O   1 
HETATM 3204 O  O   . HOH F 3 .   ? -14.106 12.350 6.668   1.00 28.61 ? 2096 HOH B O   1 
HETATM 3205 O  O   . HOH F 3 .   ? -12.720 14.360 4.475   1.00 21.61 ? 2097 HOH B O   1 
HETATM 3206 O  O   . HOH F 3 .   ? -16.147 11.945 8.270   1.00 28.45 ? 2098 HOH B O   1 
HETATM 3207 O  O   . HOH F 3 .   ? -25.735 15.638 1.288   1.00 15.83 ? 2099 HOH B O   1 
HETATM 3208 O  O   . HOH F 3 .   ? -15.359 27.364 7.696   1.00 11.63 ? 2100 HOH B O   1 
HETATM 3209 O  O   . HOH F 3 .   ? -18.234 36.002 12.725  1.00 23.10 ? 2101 HOH B O   1 
HETATM 3210 O  O   . HOH F 3 .   ? -21.822 31.958 10.142  1.00 12.65 ? 2102 HOH B O   1 
HETATM 3211 O  O   . HOH F 3 .   ? -13.966 30.524 19.866  1.00 20.59 ? 2103 HOH B O   1 
HETATM 3212 O  O   . HOH F 3 .   ? -22.769 33.959 14.246  1.00 18.84 ? 2104 HOH B O   1 
HETATM 3213 O  O   . HOH F 3 .   ? -17.521 36.542 26.258  1.00 18.23 ? 2105 HOH B O   1 
HETATM 3214 O  O   . HOH F 3 .   ? -16.886 33.929 28.309  1.00 35.94 ? 2106 HOH B O   1 
HETATM 3215 O  O   . HOH F 3 .   ? -14.187 29.702 22.399  1.00 27.99 ? 2107 HOH B O   1 
HETATM 3216 O  O   . HOH F 3 .   ? -16.993 28.026 23.619  1.00 30.18 ? 2108 HOH B O   1 
HETATM 3217 O  O   . HOH F 3 .   ? -26.412 26.527 23.491  1.00 29.56 ? 2109 HOH B O   1 
HETATM 3218 O  O   . HOH F 3 .   ? -27.829 32.122 21.802  1.00 24.02 ? 2110 HOH B O   1 
HETATM 3219 O  O   . HOH F 3 .   ? -21.628 35.654 23.262  1.00 30.15 ? 2111 HOH B O   1 
HETATM 3220 O  O   . HOH F 3 .   ? -32.091 27.873 20.505  1.00 18.44 ? 2112 HOH B O   1 
HETATM 3221 O  O   . HOH F 3 .   ? -31.757 29.804 22.055  1.00 32.10 ? 2113 HOH B O   1 
HETATM 3222 O  O   . HOH F 3 .   ? -35.282 30.351 11.712  1.00 22.82 ? 2114 HOH B O   1 
HETATM 3223 O  O   . HOH F 3 .   ? -37.718 23.952 8.671   1.00 23.29 ? 2115 HOH B O   1 
HETATM 3224 O  O   . HOH F 3 .   ? -41.726 14.347 6.495   1.00 21.66 ? 2116 HOH B O   1 
HETATM 3225 O  O   . HOH F 3 .   ? -39.044 15.625 7.899   1.00 27.19 ? 2117 HOH B O   1 
HETATM 3226 O  O   . HOH F 3 .   ? -34.158 14.546 -1.756  1.00 23.30 ? 2118 HOH B O   1 
HETATM 3227 O  O   . HOH F 3 .   ? -31.951 19.475 -1.522  1.00 35.57 ? 2119 HOH B O   1 
HETATM 3228 O  O   . HOH F 3 .   ? -26.910 17.720 0.049   1.00 31.41 ? 2120 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   2   SER SER A . n 
A 1 3   PHE 3   3   3   PHE PHE A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   LEU 5   5   5   LEU LEU A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   ALA 7   7   7   ALA ALA A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   PRO 9   9   9   PRO PRO A . n 
A 1 10  PHE 10  10  10  PHE PHE A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  LYS 12  12  12  LYS LYS A . n 
A 1 13  ASP 13  13  13  ASP ASP A . n 
A 1 14  ALA 14  14  14  ALA ALA A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  GLU 16  16  16  GLU GLU A . n 
A 1 17  PRO 17  17  17  PRO PRO A . n 
A 1 18  HIS 18  18  18  HIS HIS A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  SER 20  20  20  SER SER A . n 
A 1 21  ALA 21  21  21  ALA ALA A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  THR 23  23  23  THR THR A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  ASP 25  25  25  ASP ASP A . n 
A 1 26  TYR 26  26  26  TYR TYR A . n 
A 1 27  HIS 27  27  27  HIS HIS A . n 
A 1 28  HIS 28  28  28  HIS HIS A . n 
A 1 29  GLY 29  29  29  GLY GLY A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  HIS 31  31  31  HIS HIS A . n 
A 1 32  HIS 32  32  32  HIS HIS A . n 
A 1 33  ASN 33  33  33  ASN ASN A . n 
A 1 34  THR 34  34  34  THR THR A . n 
A 1 35  TYR 35  35  35  TYR TYR A . n 
A 1 36  VAL 36  36  36  VAL VAL A . n 
A 1 37  VAL 37  37  37  VAL VAL A . n 
A 1 38  LYS 38  38  38  LYS LYS A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  ASN 40  40  40  ASN ASN A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  ILE 43  43  43  ILE ILE A . n 
A 1 44  PRO 44  44  44  PRO PRO A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  THR 46  46  46  THR THR A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  PHE 48  48  48  PHE PHE A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  THR 52  52  52  THR THR A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  ILE 57  57  57  ILE ILE A . n 
A 1 58  LYS 58  58  58  LYS LYS A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  SER 60  60  60  SER SER A . n 
A 1 61  THR 61  61  61  THR THR A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  VAL 64  64  64  VAL VAL A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  GLN 70  70  70  GLN GLN A . n 
A 1 71  ILE 71  71  71  ILE ILE A . n 
A 1 72  TRP 72  72  72  TRP TRP A . n 
A 1 73  ASN 73  73  73  ASN ASN A . n 
A 1 74  HIS 74  74  74  HIS HIS A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  PHE 76  76  76  PHE PHE A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  TRP 78  78  78  TRP TRP A . n 
A 1 79  ASN 79  79  79  ASN ASN A . n 
A 1 80  CYS 80  80  80  CYS CYS A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  ALA 82  82  82  ALA ALA A . n 
A 1 83  PRO 83  83  83  PRO PRO A . n 
A 1 84  ASN 84  84  84  ASN ASN A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  GLN 88  88  88  GLN GLN A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  THR 90  90  90  THR THR A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  ALA 92  92  92  ALA ALA A . n 
A 1 93  VAL 93  93  93  VAL VAL A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  ALA 99  99  99  ALA ALA A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 PHE 101 101 101 PHE PHE A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PHE 104 104 104 PHE PHE A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 GLU 106 106 106 GLU GLU A . n 
A 1 107 PHE 107 107 107 PHE PHE A . n 
A 1 108 LYS 108 108 108 LYS LYS A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 PHE 111 111 111 PHE PHE A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 SER 114 114 114 SER SER A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 ASN 118 118 118 ASN ASN A . n 
A 1 119 PHE 119 119 119 PHE PHE A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 TRP 123 123 123 TRP TRP A . n 
A 1 124 THR 124 124 124 THR THR A . n 
A 1 125 TRP 125 125 125 TRP TRP A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 LYS 128 128 128 LYS LYS A . n 
A 1 129 ASN 129 129 129 ASN ASN A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 SER 133 133 133 SER SER A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 ILE 136 136 136 ILE ILE A . n 
A 1 137 VAL 137 137 137 VAL VAL A . n 
A 1 138 ASN 138 138 138 ASN ASN A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 SER 140 140 140 SER SER A . n 
A 1 141 ASN 141 141 141 ASN ASN A . n 
A 1 142 ALA 142 142 142 ALA ALA A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 THR 144 144 144 THR THR A . n 
A 1 145 PRO 145 145 145 PRO PRO A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 THR 147 147 147 THR THR A . n 
A 1 148 ASP 148 148 148 ASP ASP A . n 
A 1 149 GLU 149 149 149 GLU GLU A . n 
A 1 150 GLY 150 150 150 GLY GLY A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 THR 152 152 152 THR THR A . n 
A 1 153 PRO 153 153 153 PRO PRO A . n 
A 1 154 LEU 154 154 154 LEU LEU A . n 
A 1 155 LEU 155 155 155 LEU LEU A . n 
A 1 156 THR 156 156 156 THR THR A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 ASP 158 158 158 ASP ASP A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 TRP 160 160 160 TRP TRP A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 HIS 162 162 162 HIS HIS A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 TYR 164 164 164 TYR TYR A . n 
A 1 165 TYR 165 165 165 TYR TYR A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 ASP 167 167 167 ASP ASP A . n 
A 1 168 PHE 168 168 168 PHE PHE A . n 
A 1 169 ARG 169 169 169 ARG ARG A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 ARG 172 172 172 ARG ARG A . n 
A 1 173 PRO 173 173 173 PRO PRO A . n 
A 1 174 ASP 174 174 174 ASP ASP A . n 
A 1 175 TYR 175 175 175 TYR TYR A . n 
A 1 176 MET 176 176 176 MET MET A . n 
A 1 177 GLY 177 177 177 GLY GLY A . n 
A 1 178 ALA 178 178 178 ALA ALA A . n 
A 1 179 PHE 179 179 179 PHE PHE A . n 
A 1 180 TRP 180 180 180 TRP TRP A . n 
A 1 181 SER 181 181 181 SER SER A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 ASN 184 184 184 ASN ASN A . n 
A 1 185 TRP 185 185 185 TRP TRP A . n 
A 1 186 SER 186 186 186 SER SER A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 VAL 188 188 188 VAL VAL A . n 
A 1 189 GLU 189 189 189 GLU GLU A . n 
A 1 190 GLU 190 190 190 GLU GLU A . n 
A 1 191 ASN 191 191 191 ASN ASN A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 ALA 193 193 193 ALA ALA A . n 
A 1 194 LYS 194 194 194 LYS LYS A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   SER 2   2   2   SER SER B . n 
B 1 3   PHE 3   3   3   PHE PHE B . n 
B 1 4   GLU 4   4   4   GLU GLU B . n 
B 1 5   LEU 5   5   5   LEU LEU B . n 
B 1 6   PRO 6   6   6   PRO PRO B . n 
B 1 7   ALA 7   7   7   ALA ALA B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   PRO 9   9   9   PRO PRO B . n 
B 1 10  PHE 10  10  10  PHE PHE B . n 
B 1 11  ALA 11  11  11  ALA ALA B . n 
B 1 12  LYS 12  12  12  LYS LYS B . n 
B 1 13  ASP 13  13  13  ASP ASP B . n 
B 1 14  ALA 14  14  14  ALA ALA B . n 
B 1 15  LEU 15  15  15  LEU LEU B . n 
B 1 16  GLU 16  16  16  GLU GLU B . n 
B 1 17  PRO 17  17  17  PRO PRO B . n 
B 1 18  HIS 18  18  18  HIS HIS B . n 
B 1 19  ILE 19  19  19  ILE ILE B . n 
B 1 20  SER 20  20  20  SER SER B . n 
B 1 21  ALA 21  21  21  ALA ALA B . n 
B 1 22  GLU 22  22  22  GLU GLU B . n 
B 1 23  THR 23  23  23  THR THR B . n 
B 1 24  LEU 24  24  24  LEU LEU B . n 
B 1 25  ASP 25  25  25  ASP ASP B . n 
B 1 26  TYR 26  26  26  TYR TYR B . n 
B 1 27  HIS 27  27  27  HIS HIS B . n 
B 1 28  HIS 28  28  28  HIS HIS B . n 
B 1 29  GLY 29  29  29  GLY GLY B . n 
B 1 30  LYS 30  30  30  LYS LYS B . n 
B 1 31  HIS 31  31  31  HIS HIS B . n 
B 1 32  HIS 32  32  32  HIS HIS B . n 
B 1 33  ASN 33  33  33  ASN ASN B . n 
B 1 34  THR 34  34  34  THR THR B . n 
B 1 35  TYR 35  35  35  TYR TYR B . n 
B 1 36  VAL 36  36  36  VAL VAL B . n 
B 1 37  VAL 37  37  37  VAL VAL B . n 
B 1 38  LYS 38  38  38  LYS LYS B . n 
B 1 39  LEU 39  39  39  LEU LEU B . n 
B 1 40  ASN 40  40  40  ASN ASN B . n 
B 1 41  GLY 41  41  41  GLY GLY B . n 
B 1 42  LEU 42  42  42  LEU LEU B . n 
B 1 43  ILE 43  43  43  ILE ILE B . n 
B 1 44  PRO 44  44  44  PRO PRO B . n 
B 1 45  GLY 45  45  45  GLY GLY B . n 
B 1 46  THR 46  46  46  THR THR B . n 
B 1 47  GLU 47  47  47  GLU GLU B . n 
B 1 48  PHE 48  48  48  PHE PHE B . n 
B 1 49  GLU 49  49  49  GLU GLU B . n 
B 1 50  GLY 50  50  50  GLY GLY B . n 
B 1 51  LYS 51  51  51  LYS LYS B . n 
B 1 52  THR 52  52  52  THR THR B . n 
B 1 53  LEU 53  53  53  LEU LEU B . n 
B 1 54  GLU 54  54  54  GLU GLU B . n 
B 1 55  GLU 55  55  55  GLU GLU B . n 
B 1 56  ILE 56  56  56  ILE ILE B . n 
B 1 57  ILE 57  57  57  ILE ILE B . n 
B 1 58  LYS 58  58  58  LYS LYS B . n 
B 1 59  THR 59  59  59  THR THR B . n 
B 1 60  SER 60  60  60  SER SER B . n 
B 1 61  THR 61  61  61  THR THR B . n 
B 1 62  GLY 62  62  62  GLY GLY B . n 
B 1 63  GLY 63  63  63  GLY GLY B . n 
B 1 64  VAL 64  64  64  VAL VAL B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  ASN 66  66  66  ASN ASN B . n 
B 1 67  ASN 67  67  67  ASN ASN B . n 
B 1 68  ALA 68  68  68  ALA ALA B . n 
B 1 69  ALA 69  69  69  ALA ALA B . n 
B 1 70  GLN 70  70  70  GLN GLN B . n 
B 1 71  ILE 71  71  71  ILE ILE B . n 
B 1 72  TRP 72  72  72  TRP TRP B . n 
B 1 73  ASN 73  73  73  ASN ASN B . n 
B 1 74  HIS 74  74  74  HIS HIS B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  PHE 76  76  76  PHE PHE B . n 
B 1 77  TYR 77  77  77  TYR TYR B . n 
B 1 78  TRP 78  78  78  TRP TRP B . n 
B 1 79  ASN 79  79  79  ASN ASN B . n 
B 1 80  CYS 80  80  80  CYS CYS B . n 
B 1 81  LEU 81  81  81  LEU LEU B . n 
B 1 82  ALA 82  82  82  ALA ALA B . n 
B 1 83  PRO 83  83  83  PRO PRO B . n 
B 1 84  ASN 84  84  84  ASN ASN B . n 
B 1 85  ALA 85  85  85  ALA ALA B . n 
B 1 86  GLY 86  86  86  GLY GLY B . n 
B 1 87  GLY 87  87  87  GLY GLY B . n 
B 1 88  GLN 88  88  88  GLN GLN B . n 
B 1 89  PRO 89  89  89  PRO PRO B . n 
B 1 90  THR 90  90  90  THR THR B . n 
B 1 91  GLY 91  91  91  GLY GLY B . n 
B 1 92  ALA 92  92  92  ALA ALA B . n 
B 1 93  VAL 93  93  93  VAL VAL B . n 
B 1 94  ALA 94  94  94  ALA ALA B . n 
B 1 95  ALA 95  95  95  ALA ALA B . n 
B 1 96  ALA 96  96  96  ALA ALA B . n 
B 1 97  ILE 97  97  97  ILE ILE B . n 
B 1 98  ASP 98  98  98  ASP ASP B . n 
B 1 99  ALA 99  99  99  ALA ALA B . n 
B 1 100 ALA 100 100 100 ALA ALA B . n 
B 1 101 PHE 101 101 101 PHE PHE B . n 
B 1 102 GLY 102 102 102 GLY GLY B . n 
B 1 103 SER 103 103 103 SER SER B . n 
B 1 104 PHE 104 104 104 PHE PHE B . n 
B 1 105 GLU 105 105 105 GLU GLU B . n 
B 1 106 GLU 106 106 106 GLU GLU B . n 
B 1 107 PHE 107 107 107 PHE PHE B . n 
B 1 108 LYS 108 108 108 LYS LYS B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 LYS 110 110 110 LYS LYS B . n 
B 1 111 PHE 111 111 111 PHE PHE B . n 
B 1 112 THR 112 112 112 THR THR B . n 
B 1 113 ASP 113 113 113 ASP ASP B . n 
B 1 114 SER 114 114 114 SER SER B . n 
B 1 115 ALA 115 115 115 ALA ALA B . n 
B 1 116 ILE 116 116 116 ILE ILE B . n 
B 1 117 ASN 117 117 117 ASN ASN B . n 
B 1 118 ASN 118 118 118 ASN ASN B . n 
B 1 119 PHE 119 119 119 PHE PHE B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 SER 121 121 121 SER SER B . n 
B 1 122 SER 122 122 122 SER SER B . n 
B 1 123 TRP 123 123 123 TRP TRP B . n 
B 1 124 THR 124 124 124 THR THR B . n 
B 1 125 TRP 125 125 125 TRP TRP B . n 
B 1 126 LEU 126 126 126 LEU LEU B . n 
B 1 127 VAL 127 127 127 VAL VAL B . n 
B 1 128 LYS 128 128 128 LYS LYS B . n 
B 1 129 ASN 129 129 129 ASN ASN B . n 
B 1 130 ALA 130 130 130 ALA ALA B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 GLY 132 132 132 GLY GLY B . n 
B 1 133 SER 133 133 133 SER SER B . n 
B 1 134 LEU 134 134 134 LEU LEU B . n 
B 1 135 ALA 135 135 135 ALA ALA B . n 
B 1 136 ILE 136 136 136 ILE ILE B . n 
B 1 137 VAL 137 137 137 VAL VAL B . n 
B 1 138 ASN 138 138 138 ASN ASN B . n 
B 1 139 THR 139 139 139 THR THR B . n 
B 1 140 SER 140 140 140 SER SER B . n 
B 1 141 ASN 141 141 141 ASN ASN B . n 
B 1 142 ALA 142 142 142 ALA ALA B . n 
B 1 143 ALA 143 143 143 ALA ALA B . n 
B 1 144 THR 144 144 144 THR THR B . n 
B 1 145 PRO 145 145 145 PRO PRO B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 THR 147 147 147 THR THR B . n 
B 1 148 ASP 148 148 148 ASP ASP B . n 
B 1 149 GLU 149 149 149 GLU GLU B . n 
B 1 150 GLY 150 150 150 GLY GLY B . n 
B 1 151 VAL 151 151 151 VAL VAL B . n 
B 1 152 THR 152 152 152 THR THR B . n 
B 1 153 PRO 153 153 153 PRO PRO B . n 
B 1 154 LEU 154 154 154 LEU LEU B . n 
B 1 155 LEU 155 155 155 LEU LEU B . n 
B 1 156 THR 156 156 156 THR THR B . n 
B 1 157 VAL 157 157 157 VAL VAL B . n 
B 1 158 ASP 158 158 158 ASP ASP B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 TRP 160 160 160 TRP TRP B . n 
B 1 161 GLU 161 161 161 GLU GLU B . n 
B 1 162 HIS 162 162 162 HIS HIS B . n 
B 1 163 ALA 163 163 163 ALA ALA B . n 
B 1 164 TYR 164 164 164 TYR TYR B . n 
B 1 165 TYR 165 165 165 TYR TYR B . n 
B 1 166 ILE 166 166 166 ILE ILE B . n 
B 1 167 ASP 167 167 167 ASP ASP B . n 
B 1 168 PHE 168 168 168 PHE PHE B . n 
B 1 169 ARG 169 169 169 ARG ARG B . n 
B 1 170 ASN 170 170 170 ASN ASN B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 ARG 172 172 172 ARG ARG B . n 
B 1 173 PRO 173 173 173 PRO PRO B . n 
B 1 174 ASP 174 174 174 ASP ASP B . n 
B 1 175 TYR 175 175 175 TYR TYR B . n 
B 1 176 MET 176 176 176 MET MET B . n 
B 1 177 GLY 177 177 177 GLY GLY B . n 
B 1 178 ALA 178 178 178 ALA ALA B . n 
B 1 179 PHE 179 179 179 PHE PHE B . n 
B 1 180 TRP 180 180 180 TRP TRP B . n 
B 1 181 SER 181 181 181 SER SER B . n 
B 1 182 LEU 182 182 182 LEU LEU B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 ASN 184 184 184 ASN ASN B . n 
B 1 185 TRP 185 185 185 TRP TRP B . n 
B 1 186 SER 186 186 186 SER SER B . n 
B 1 187 PHE 187 187 187 PHE PHE B . n 
B 1 188 VAL 188 188 188 VAL VAL B . n 
B 1 189 GLU 189 189 189 GLU GLU B . n 
B 1 190 GLU 190 190 190 GLU GLU B . n 
B 1 191 ASN 191 191 191 ASN ASN B . n 
B 1 192 LEU 192 192 192 LEU LEU B . n 
B 1 193 ALA 193 193 193 ALA ALA B . n 
B 1 194 LYS 194 194 194 LYS LYS B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 FE  1   1195 1195 FE  FE  A . 
D 2 FE  1   1195 1195 FE  FE  B . 
E 3 HOH 1   2001 2001 HOH HOH A . 
E 3 HOH 2   2002 2002 HOH HOH A . 
E 3 HOH 3   2003 2003 HOH HOH A . 
E 3 HOH 4   2004 2004 HOH HOH A . 
E 3 HOH 5   2005 2005 HOH HOH A . 
E 3 HOH 6   2006 2006 HOH HOH A . 
E 3 HOH 7   2007 2007 HOH HOH A . 
E 3 HOH 8   2008 2008 HOH HOH A . 
E 3 HOH 9   2009 2009 HOH HOH A . 
E 3 HOH 10  2010 2010 HOH HOH A . 
E 3 HOH 11  2011 2011 HOH HOH A . 
E 3 HOH 12  2012 2012 HOH HOH A . 
E 3 HOH 13  2013 2013 HOH HOH A . 
E 3 HOH 14  2014 2014 HOH HOH A . 
E 3 HOH 15  2015 2015 HOH HOH A . 
E 3 HOH 16  2016 2016 HOH HOH A . 
E 3 HOH 17  2017 2017 HOH HOH A . 
E 3 HOH 18  2018 2018 HOH HOH A . 
E 3 HOH 19  2019 2019 HOH HOH A . 
E 3 HOH 20  2020 2020 HOH HOH A . 
E 3 HOH 21  2021 2021 HOH HOH A . 
E 3 HOH 22  2022 2022 HOH HOH A . 
E 3 HOH 23  2023 2023 HOH HOH A . 
E 3 HOH 24  2024 2024 HOH HOH A . 
E 3 HOH 25  2025 2025 HOH HOH A . 
E 3 HOH 26  2026 2026 HOH HOH A . 
E 3 HOH 27  2027 2027 HOH HOH A . 
E 3 HOH 28  2028 2028 HOH HOH A . 
E 3 HOH 29  2029 2029 HOH HOH A . 
E 3 HOH 30  2030 2030 HOH HOH A . 
E 3 HOH 31  2031 2031 HOH HOH A . 
E 3 HOH 32  2032 2032 HOH HOH A . 
E 3 HOH 33  2033 2033 HOH HOH A . 
E 3 HOH 34  2034 2034 HOH HOH A . 
E 3 HOH 35  2035 2035 HOH HOH A . 
E 3 HOH 36  2036 2036 HOH HOH A . 
E 3 HOH 37  2037 2037 HOH HOH A . 
E 3 HOH 38  2038 2038 HOH HOH A . 
E 3 HOH 39  2039 2039 HOH HOH A . 
E 3 HOH 40  2040 2040 HOH HOH A . 
E 3 HOH 41  2041 2041 HOH HOH A . 
E 3 HOH 42  2042 2042 HOH HOH A . 
E 3 HOH 43  2043 2043 HOH HOH A . 
E 3 HOH 44  2044 2044 HOH HOH A . 
E 3 HOH 45  2045 2045 HOH HOH A . 
E 3 HOH 46  2046 2046 HOH HOH A . 
E 3 HOH 47  2047 2047 HOH HOH A . 
E 3 HOH 48  2048 2048 HOH HOH A . 
E 3 HOH 49  2049 2049 HOH HOH A . 
E 3 HOH 50  2050 2050 HOH HOH A . 
E 3 HOH 51  2051 2051 HOH HOH A . 
E 3 HOH 52  2052 2052 HOH HOH A . 
E 3 HOH 53  2053 2053 HOH HOH A . 
E 3 HOH 54  2054 2054 HOH HOH A . 
E 3 HOH 55  2055 2055 HOH HOH A . 
E 3 HOH 56  2056 2056 HOH HOH A . 
E 3 HOH 57  2057 2057 HOH HOH A . 
E 3 HOH 58  2058 2058 HOH HOH A . 
E 3 HOH 59  2059 2059 HOH HOH A . 
E 3 HOH 60  2060 2060 HOH HOH A . 
E 3 HOH 61  2061 2061 HOH HOH A . 
E 3 HOH 62  2062 2062 HOH HOH A . 
E 3 HOH 63  2063 2063 HOH HOH A . 
E 3 HOH 64  2064 2064 HOH HOH A . 
E 3 HOH 65  2065 2065 HOH HOH A . 
E 3 HOH 66  2066 2066 HOH HOH A . 
E 3 HOH 67  2067 2067 HOH HOH A . 
E 3 HOH 68  2068 2068 HOH HOH A . 
E 3 HOH 69  2069 2069 HOH HOH A . 
E 3 HOH 70  2070 2070 HOH HOH A . 
E 3 HOH 71  2071 2071 HOH HOH A . 
E 3 HOH 72  2072 2072 HOH HOH A . 
E 3 HOH 73  2073 2073 HOH HOH A . 
E 3 HOH 74  2074 2074 HOH HOH A . 
E 3 HOH 75  2075 2075 HOH HOH A . 
E 3 HOH 76  2076 2076 HOH HOH A . 
E 3 HOH 77  2077 2077 HOH HOH A . 
E 3 HOH 78  2078 2078 HOH HOH A . 
E 3 HOH 79  2079 2079 HOH HOH A . 
E 3 HOH 80  2080 2080 HOH HOH A . 
E 3 HOH 81  2081 2081 HOH HOH A . 
E 3 HOH 82  2082 2082 HOH HOH A . 
E 3 HOH 83  2083 2083 HOH HOH A . 
E 3 HOH 84  2084 2084 HOH HOH A . 
E 3 HOH 85  2085 2085 HOH HOH A . 
E 3 HOH 86  2086 2086 HOH HOH A . 
E 3 HOH 87  2087 2087 HOH HOH A . 
E 3 HOH 88  2088 2088 HOH HOH A . 
F 3 HOH 1   2001 2001 HOH HOH B . 
F 3 HOH 2   2002 2002 HOH HOH B . 
F 3 HOH 3   2003 2003 HOH HOH B . 
F 3 HOH 4   2004 2004 HOH HOH B . 
F 3 HOH 5   2005 2005 HOH HOH B . 
F 3 HOH 6   2006 2006 HOH HOH B . 
F 3 HOH 7   2007 2007 HOH HOH B . 
F 3 HOH 8   2008 2008 HOH HOH B . 
F 3 HOH 9   2009 2009 HOH HOH B . 
F 3 HOH 10  2010 2010 HOH HOH B . 
F 3 HOH 11  2011 2011 HOH HOH B . 
F 3 HOH 12  2012 2012 HOH HOH B . 
F 3 HOH 13  2013 2013 HOH HOH B . 
F 3 HOH 14  2014 2014 HOH HOH B . 
F 3 HOH 15  2015 2015 HOH HOH B . 
F 3 HOH 16  2016 2016 HOH HOH B . 
F 3 HOH 17  2017 2017 HOH HOH B . 
F 3 HOH 18  2018 2018 HOH HOH B . 
F 3 HOH 19  2019 2019 HOH HOH B . 
F 3 HOH 20  2020 2020 HOH HOH B . 
F 3 HOH 21  2021 2021 HOH HOH B . 
F 3 HOH 22  2022 2022 HOH HOH B . 
F 3 HOH 23  2023 2023 HOH HOH B . 
F 3 HOH 24  2024 2024 HOH HOH B . 
F 3 HOH 25  2025 2025 HOH HOH B . 
F 3 HOH 26  2026 2026 HOH HOH B . 
F 3 HOH 27  2027 2027 HOH HOH B . 
F 3 HOH 28  2028 2028 HOH HOH B . 
F 3 HOH 29  2029 2029 HOH HOH B . 
F 3 HOH 30  2030 2030 HOH HOH B . 
F 3 HOH 31  2031 2031 HOH HOH B . 
F 3 HOH 32  2032 2032 HOH HOH B . 
F 3 HOH 33  2033 2033 HOH HOH B . 
F 3 HOH 34  2034 2034 HOH HOH B . 
F 3 HOH 35  2035 2035 HOH HOH B . 
F 3 HOH 36  2036 2036 HOH HOH B . 
F 3 HOH 37  2037 2037 HOH HOH B . 
F 3 HOH 38  2038 2038 HOH HOH B . 
F 3 HOH 39  2039 2039 HOH HOH B . 
F 3 HOH 40  2040 2040 HOH HOH B . 
F 3 HOH 41  2041 2041 HOH HOH B . 
F 3 HOH 42  2042 2042 HOH HOH B . 
F 3 HOH 43  2043 2043 HOH HOH B . 
F 3 HOH 44  2044 2044 HOH HOH B . 
F 3 HOH 45  2045 2045 HOH HOH B . 
F 3 HOH 46  2046 2046 HOH HOH B . 
F 3 HOH 47  2047 2047 HOH HOH B . 
F 3 HOH 48  2048 2048 HOH HOH B . 
F 3 HOH 49  2049 2049 HOH HOH B . 
F 3 HOH 50  2050 2050 HOH HOH B . 
F 3 HOH 51  2051 2051 HOH HOH B . 
F 3 HOH 52  2052 2052 HOH HOH B . 
F 3 HOH 53  2053 2053 HOH HOH B . 
F 3 HOH 54  2054 2054 HOH HOH B . 
F 3 HOH 55  2055 2055 HOH HOH B . 
F 3 HOH 56  2056 2056 HOH HOH B . 
F 3 HOH 57  2057 2057 HOH HOH B . 
F 3 HOH 58  2058 2058 HOH HOH B . 
F 3 HOH 59  2059 2059 HOH HOH B . 
F 3 HOH 60  2060 2060 HOH HOH B . 
F 3 HOH 61  2061 2061 HOH HOH B . 
F 3 HOH 62  2062 2062 HOH HOH B . 
F 3 HOH 63  2063 2063 HOH HOH B . 
F 3 HOH 64  2064 2064 HOH HOH B . 
F 3 HOH 65  2065 2065 HOH HOH B . 
F 3 HOH 66  2066 2066 HOH HOH B . 
F 3 HOH 67  2067 2067 HOH HOH B . 
F 3 HOH 68  2068 2068 HOH HOH B . 
F 3 HOH 69  2069 2069 HOH HOH B . 
F 3 HOH 70  2070 2070 HOH HOH B . 
F 3 HOH 71  2071 2071 HOH HOH B . 
F 3 HOH 72  2072 2072 HOH HOH B . 
F 3 HOH 73  2073 2073 HOH HOH B . 
F 3 HOH 74  2074 2074 HOH HOH B . 
F 3 HOH 75  2075 2075 HOH HOH B . 
F 3 HOH 76  2076 2076 HOH HOH B . 
F 3 HOH 77  2077 2077 HOH HOH B . 
F 3 HOH 78  2078 2078 HOH HOH B . 
F 3 HOH 79  2079 2079 HOH HOH B . 
F 3 HOH 80  2080 2080 HOH HOH B . 
F 3 HOH 81  2081 2081 HOH HOH B . 
F 3 HOH 82  2082 2082 HOH HOH B . 
F 3 HOH 83  2083 2083 HOH HOH B . 
F 3 HOH 84  2084 2084 HOH HOH B . 
F 3 HOH 85  2085 2085 HOH HOH B . 
F 3 HOH 86  2086 2086 HOH HOH B . 
F 3 HOH 87  2087 2087 HOH HOH B . 
F 3 HOH 88  2088 2088 HOH HOH B . 
F 3 HOH 89  2089 2089 HOH HOH B . 
F 3 HOH 90  2090 2090 HOH HOH B . 
F 3 HOH 91  2091 2091 HOH HOH B . 
F 3 HOH 92  2092 2092 HOH HOH B . 
F 3 HOH 93  2093 2093 HOH HOH B . 
F 3 HOH 94  2094 2094 HOH HOH B . 
F 3 HOH 95  2095 2095 HOH HOH B . 
F 3 HOH 96  2096 2096 HOH HOH B . 
F 3 HOH 97  2097 2097 HOH HOH B . 
F 3 HOH 98  2098 2098 HOH HOH B . 
F 3 HOH 99  2099 2099 HOH HOH B . 
F 3 HOH 100 2100 2100 HOH HOH B . 
F 3 HOH 101 2101 2101 HOH HOH B . 
F 3 HOH 102 2102 2102 HOH HOH B . 
F 3 HOH 103 2103 2103 HOH HOH B . 
F 3 HOH 104 2104 2104 HOH HOH B . 
F 3 HOH 105 2105 2105 HOH HOH B . 
F 3 HOH 106 2106 2106 HOH HOH B . 
F 3 HOH 107 2107 2107 HOH HOH B . 
F 3 HOH 108 2108 2108 HOH HOH B . 
F 3 HOH 109 2109 2109 HOH HOH B . 
F 3 HOH 110 2110 2110 HOH HOH B . 
F 3 HOH 111 2111 2111 HOH HOH B . 
F 3 HOH 112 2112 2112 HOH HOH B . 
F 3 HOH 113 2113 2113 HOH HOH B . 
F 3 HOH 114 2114 2114 HOH HOH B . 
F 3 HOH 115 2115 2115 HOH HOH B . 
F 3 HOH 116 2116 2116 HOH HOH B . 
F 3 HOH 117 2117 2117 HOH HOH B . 
F 3 HOH 118 2118 2118 HOH HOH B . 
F 3 HOH 119 2119 2119 HOH HOH B . 
F 3 HOH 120 2120 2120 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2260  ? 
1 MORE         -8.9  ? 
1 'SSA (A^2)'  19040 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 162 ? A HIS 162  ? 1_555 FE ? C FE . ? A FE 1195 ? 1_555 O   ? E HOH .   ? A HOH 2069 ? 1_555 85.6  ? 
2  NE2 ? A HIS 162 ? A HIS 162  ? 1_555 FE ? C FE . ? A FE 1195 ? 1_555 NE2 ? A HIS 74  ? A HIS 74   ? 1_555 122.3 ? 
3  O   ? E HOH .   ? A HOH 2069 ? 1_555 FE ? C FE . ? A FE 1195 ? 1_555 NE2 ? A HIS 74  ? A HIS 74   ? 1_555 87.1  ? 
4  NE2 ? A HIS 162 ? A HIS 162  ? 1_555 FE ? C FE . ? A FE 1195 ? 1_555 NE2 ? A HIS 27  ? A HIS 27   ? 1_555 101.4 ? 
5  O   ? E HOH .   ? A HOH 2069 ? 1_555 FE ? C FE . ? A FE 1195 ? 1_555 NE2 ? A HIS 27  ? A HIS 27   ? 1_555 172.0 ? 
6  NE2 ? A HIS 74  ? A HIS 74   ? 1_555 FE ? C FE . ? A FE 1195 ? 1_555 NE2 ? A HIS 27  ? A HIS 27   ? 1_555 92.4  ? 
7  NE2 ? A HIS 162 ? A HIS 162  ? 1_555 FE ? C FE . ? A FE 1195 ? 1_555 OD2 ? A ASP 158 ? A ASP 158  ? 1_555 128.9 ? 
8  O   ? E HOH .   ? A HOH 2069 ? 1_555 FE ? C FE . ? A FE 1195 ? 1_555 OD2 ? A ASP 158 ? A ASP 158  ? 1_555 82.4  ? 
9  NE2 ? A HIS 74  ? A HIS 74   ? 1_555 FE ? C FE . ? A FE 1195 ? 1_555 OD2 ? A ASP 158 ? A ASP 158  ? 1_555 106.5 ? 
10 NE2 ? A HIS 27  ? A HIS 27   ? 1_555 FE ? C FE . ? A FE 1195 ? 1_555 OD2 ? A ASP 158 ? A ASP 158  ? 1_555 90.1  ? 
11 NE2 ? B HIS 74  ? B HIS 74   ? 1_555 FE ? D FE . ? B FE 1195 ? 1_555 OD2 ? B ASP 158 ? B ASP 158  ? 1_555 105.7 ? 
12 NE2 ? B HIS 74  ? B HIS 74   ? 1_555 FE ? D FE . ? B FE 1195 ? 1_555 NE2 ? B HIS 162 ? B HIS 162  ? 1_555 126.8 ? 
13 OD2 ? B ASP 158 ? B ASP 158  ? 1_555 FE ? D FE . ? B FE 1195 ? 1_555 NE2 ? B HIS 162 ? B HIS 162  ? 1_555 126.5 ? 
14 NE2 ? B HIS 74  ? B HIS 74   ? 1_555 FE ? D FE . ? B FE 1195 ? 1_555 O   ? F HOH .   ? B HOH 2100 ? 1_555 87.2  ? 
15 OD2 ? B ASP 158 ? B ASP 158  ? 1_555 FE ? D FE . ? B FE 1195 ? 1_555 O   ? F HOH .   ? B HOH 2100 ? 1_555 87.7  ? 
16 NE2 ? B HIS 162 ? B HIS 162  ? 1_555 FE ? D FE . ? B FE 1195 ? 1_555 O   ? F HOH .   ? B HOH 2100 ? 1_555 85.5  ? 
17 NE2 ? B HIS 74  ? B HIS 74   ? 1_555 FE ? D FE . ? B FE 1195 ? 1_555 NE2 ? B HIS 27  ? B HIS 27   ? 1_555 93.9  ? 
18 OD2 ? B ASP 158 ? B ASP 158  ? 1_555 FE ? D FE . ? B FE 1195 ? 1_555 NE2 ? B HIS 27  ? B HIS 27   ? 1_555 88.7  ? 
19 NE2 ? B HIS 162 ? B HIS 162  ? 1_555 FE ? D FE . ? B FE 1195 ? 1_555 NE2 ? B HIS 27  ? B HIS 27   ? 1_555 96.5  ? 
20 O   ? F HOH .   ? B HOH 2100 ? 1_555 FE ? D FE . ? B FE 1195 ? 1_555 NE2 ? B HIS 27  ? B HIS 27   ? 1_555 176.4 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-02-17 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-02-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Experimental preparation'  
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' citation           
2 4 'Structure model' exptl_crystal_grow 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_citation.journal_abbrev'   
2 4 'Structure model' '_citation.page_last'        
3 4 'Structure model' '_citation.title'            
4 4 'Structure model' '_exptl_crystal_grow.method' 
5 4 'Structure model' '_exptl_crystal_grow.temp'   
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
REFMAC refinement       5.2.0019 ? 1 ? ? ? ? 
XDS    'data reduction' .        ? 2 ? ? ? ? 
XSCALE 'data scaling'   .        ? 3 ? ? ? ? 
MOLREP phasing          .        ? 4 ? ? ? ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    2019 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    2101 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.08 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 30  ? ? -109.45 -63.71  
2 1 ALA A 85  ? ? -133.94 -140.54 
3 1 ASN A 141 ? ? 63.59   -107.79 
4 1 PRO A 145 ? ? -69.78  5.08    
5 1 ARG A 169 ? ? 45.83   -134.46 
6 1 ALA B 85  ? ? -127.37 -135.71 
7 1 ASN B 141 ? ? 70.50   -113.44 
8 1 ARG B 169 ? ? 47.61   -126.97 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1 ? A MET 1 
2 1 Y 1 B MET 1 ? B MET 1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'FE (III) ION' FE  
3 water          HOH 
#