data_2W96
# 
_entry.id   2W96 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.307 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2W96         
PDBE  EBI-38600    
WWPDB D_1290038600 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1LD2 unspecified 'THEORETICAL STRUCTURE OF HUMAN CYCLIN- DEPENDENT KINASE 4(CDK4)' 
PDB 2W99 unspecified 'CRYSTAL STRUCTURE OF CDK4 IN COMPLEX WITH A D-TYPE CYCLIN'       
PDB 2W9Z unspecified 'CRYSTAL STRUCTURE OF CDK4 IN COMPLEX WITH A D-TYPE CYCLIN'       
PDB 2W9F unspecified 'CRYSTAL STRUCTURE OF CDK4 IN COMPLEX WITH A D-TYPE CYCLIN'       
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2W96 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2009-01-21 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Day, P.J.'       1  
'Cleasby, A.'     2  
'Tickle, I.J.'    3  
'Reilly, M.O.'    4  
'Coyle, J.E.'     5  
'Holding, F.P.'   6  
'McMenamin, R.L.' 7  
'Yon, J.'         8  
'Chopra, R.'      9  
'Lengauer, C.'    10 
'Jhoti, H.'       11 
# 
_citation.id                        primary 
_citation.title                     'Crystal Structure of Human Cdk4 in Complex with a D-Type Cyclin.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            106 
_citation.page_first                4166 
_citation.page_last                 ? 
_citation.year                      2009 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19237565 
_citation.pdbx_database_id_DOI      10.1073/PNAS.0809645106 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Day, P.J.'       1  ? 
primary 'Cleasby, A.'     2  ? 
primary 'Tickle, I.J.'    3  ? 
primary 
;O'Reilly, M.
;
4  ? 
primary 'Coyle, J.E.'     5  ? 
primary 'Holding, F.P.'   6  ? 
primary 'Mcmenamin, R.L.' 7  ? 
primary 'Yon, J.'         8  ? 
primary 'Chopra, R.'      9  ? 
primary 'Lengauer, C.'    10 ? 
primary 'Jhoti, H.'       11 ? 
# 
_cell.entry_id           2W96 
_cell.length_a           55.906 
_cell.length_b           64.685 
_cell.length_c           168.686 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2W96 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'G1/S-SPECIFIC CYCLIN-D1'        30990.307 1   ?         ?   ?                                     ? 
2 polymer     man 'CELL DIVISION PROTEIN KINASE 4' 34588.637 1   2.7.11.22 YES 'KINASE DOMAIN, RESIDUES 1-44,48-303' ? 
3 non-polymer syn GLYCEROL                         92.094    1   ?         ?   ?                                     ? 
4 water       nat water                            18.015    190 ?         ?   ?                                     ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'D-TYPE CYCLIN, PRAD1 ONCOGENE'           
2 'CDK4, CYCLIN-DEPENDENT KINASE 4, PSK-J3' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPL
AMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDF
IEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNMDPKAA
;
;MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPL
AMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDF
IEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNMDPKAA
;
A ? 
2 'polypeptide(L)' no no 
;MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGEEGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRT
DREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLAR
IYSYQMALDPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVS
LPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPEHHHHHH
;
;MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGEEGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRT
DREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLAR
IYSYQMALDPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVS
LPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPEHHHHHH
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   HIS n 
1 4   GLN n 
1 5   LEU n 
1 6   LEU n 
1 7   CYS n 
1 8   CYS n 
1 9   GLU n 
1 10  VAL n 
1 11  GLU n 
1 12  THR n 
1 13  ILE n 
1 14  ARG n 
1 15  ARG n 
1 16  ALA n 
1 17  TYR n 
1 18  PRO n 
1 19  ASP n 
1 20  ALA n 
1 21  ASN n 
1 22  LEU n 
1 23  LEU n 
1 24  ASN n 
1 25  ASP n 
1 26  ARG n 
1 27  VAL n 
1 28  LEU n 
1 29  ARG n 
1 30  ALA n 
1 31  MET n 
1 32  LEU n 
1 33  LYS n 
1 34  ALA n 
1 35  GLU n 
1 36  GLU n 
1 37  THR n 
1 38  CYS n 
1 39  ALA n 
1 40  PRO n 
1 41  SER n 
1 42  VAL n 
1 43  SER n 
1 44  TYR n 
1 45  PHE n 
1 46  LYS n 
1 47  CYS n 
1 48  VAL n 
1 49  GLN n 
1 50  LYS n 
1 51  GLU n 
1 52  VAL n 
1 53  LEU n 
1 54  PRO n 
1 55  SER n 
1 56  MET n 
1 57  ARG n 
1 58  LYS n 
1 59  ILE n 
1 60  VAL n 
1 61  ALA n 
1 62  THR n 
1 63  TRP n 
1 64  MET n 
1 65  LEU n 
1 66  GLU n 
1 67  VAL n 
1 68  CYS n 
1 69  GLU n 
1 70  GLU n 
1 71  GLN n 
1 72  LYS n 
1 73  CYS n 
1 74  GLU n 
1 75  GLU n 
1 76  GLU n 
1 77  VAL n 
1 78  PHE n 
1 79  PRO n 
1 80  LEU n 
1 81  ALA n 
1 82  MET n 
1 83  ASN n 
1 84  TYR n 
1 85  LEU n 
1 86  ASP n 
1 87  ARG n 
1 88  PHE n 
1 89  LEU n 
1 90  SER n 
1 91  LEU n 
1 92  GLU n 
1 93  PRO n 
1 94  VAL n 
1 95  LYS n 
1 96  LYS n 
1 97  SER n 
1 98  ARG n 
1 99  LEU n 
1 100 GLN n 
1 101 LEU n 
1 102 LEU n 
1 103 GLY n 
1 104 ALA n 
1 105 THR n 
1 106 CYS n 
1 107 MET n 
1 108 PHE n 
1 109 VAL n 
1 110 ALA n 
1 111 SER n 
1 112 LYS n 
1 113 MET n 
1 114 LYS n 
1 115 GLU n 
1 116 THR n 
1 117 ILE n 
1 118 PRO n 
1 119 LEU n 
1 120 THR n 
1 121 ALA n 
1 122 GLU n 
1 123 LYS n 
1 124 LEU n 
1 125 CYS n 
1 126 ILE n 
1 127 TYR n 
1 128 THR n 
1 129 ASP n 
1 130 ASN n 
1 131 SER n 
1 132 ILE n 
1 133 ARG n 
1 134 PRO n 
1 135 GLU n 
1 136 GLU n 
1 137 LEU n 
1 138 LEU n 
1 139 GLN n 
1 140 MET n 
1 141 GLU n 
1 142 LEU n 
1 143 LEU n 
1 144 LEU n 
1 145 VAL n 
1 146 ASN n 
1 147 LYS n 
1 148 LEU n 
1 149 LYS n 
1 150 TRP n 
1 151 ASN n 
1 152 LEU n 
1 153 ALA n 
1 154 ALA n 
1 155 MET n 
1 156 THR n 
1 157 PRO n 
1 158 HIS n 
1 159 ASP n 
1 160 PHE n 
1 161 ILE n 
1 162 GLU n 
1 163 HIS n 
1 164 PHE n 
1 165 LEU n 
1 166 SER n 
1 167 LYS n 
1 168 MET n 
1 169 PRO n 
1 170 GLU n 
1 171 ALA n 
1 172 GLU n 
1 173 GLU n 
1 174 ASN n 
1 175 LYS n 
1 176 GLN n 
1 177 ILE n 
1 178 ILE n 
1 179 ARG n 
1 180 LYS n 
1 181 HIS n 
1 182 ALA n 
1 183 GLN n 
1 184 THR n 
1 185 PHE n 
1 186 VAL n 
1 187 ALA n 
1 188 LEU n 
1 189 CYS n 
1 190 ALA n 
1 191 THR n 
1 192 ASP n 
1 193 VAL n 
1 194 LYS n 
1 195 PHE n 
1 196 ILE n 
1 197 SER n 
1 198 ASN n 
1 199 PRO n 
1 200 PRO n 
1 201 SER n 
1 202 MET n 
1 203 VAL n 
1 204 ALA n 
1 205 ALA n 
1 206 GLY n 
1 207 SER n 
1 208 VAL n 
1 209 VAL n 
1 210 ALA n 
1 211 ALA n 
1 212 VAL n 
1 213 GLN n 
1 214 GLY n 
1 215 LEU n 
1 216 ASN n 
1 217 LEU n 
1 218 ARG n 
1 219 SER n 
1 220 PRO n 
1 221 ASN n 
1 222 ASN n 
1 223 PHE n 
1 224 LEU n 
1 225 SER n 
1 226 TYR n 
1 227 TYR n 
1 228 ARG n 
1 229 LEU n 
1 230 THR n 
1 231 ARG n 
1 232 PHE n 
1 233 LEU n 
1 234 SER n 
1 235 ARG n 
1 236 VAL n 
1 237 ILE n 
1 238 LYS n 
1 239 CYS n 
1 240 ASP n 
1 241 PRO n 
1 242 ASP n 
1 243 CYS n 
1 244 LEU n 
1 245 ARG n 
1 246 ALA n 
1 247 CYS n 
1 248 GLN n 
1 249 GLU n 
1 250 GLN n 
1 251 ILE n 
1 252 GLU n 
1 253 ALA n 
1 254 LEU n 
1 255 LEU n 
1 256 GLU n 
1 257 SER n 
1 258 SER n 
1 259 LEU n 
1 260 ARG n 
1 261 GLN n 
1 262 ALA n 
1 263 GLN n 
1 264 GLN n 
1 265 ASN n 
1 266 MET n 
1 267 ASP n 
1 268 PRO n 
1 269 LYS n 
1 270 ALA n 
1 271 ALA n 
2 1   MET n 
2 2   ALA n 
2 3   THR n 
2 4   SER n 
2 5   ARG n 
2 6   TYR n 
2 7   GLU n 
2 8   PRO n 
2 9   VAL n 
2 10  ALA n 
2 11  GLU n 
2 12  ILE n 
2 13  GLY n 
2 14  VAL n 
2 15  GLY n 
2 16  ALA n 
2 17  TYR n 
2 18  GLY n 
2 19  THR n 
2 20  VAL n 
2 21  TYR n 
2 22  LYS n 
2 23  ALA n 
2 24  ARG n 
2 25  ASP n 
2 26  PRO n 
2 27  HIS n 
2 28  SER n 
2 29  GLY n 
2 30  HIS n 
2 31  PHE n 
2 32  VAL n 
2 33  ALA n 
2 34  LEU n 
2 35  LYS n 
2 36  SER n 
2 37  VAL n 
2 38  ARG n 
2 39  VAL n 
2 40  PRO n 
2 41  ASN n 
2 42  GLY n 
2 43  GLU n 
2 44  GLU n 
2 45  GLY n 
2 46  LEU n 
2 47  PRO n 
2 48  ILE n 
2 49  SER n 
2 50  THR n 
2 51  VAL n 
2 52  ARG n 
2 53  GLU n 
2 54  VAL n 
2 55  ALA n 
2 56  LEU n 
2 57  LEU n 
2 58  ARG n 
2 59  ARG n 
2 60  LEU n 
2 61  GLU n 
2 62  ALA n 
2 63  PHE n 
2 64  GLU n 
2 65  HIS n 
2 66  PRO n 
2 67  ASN n 
2 68  VAL n 
2 69  VAL n 
2 70  ARG n 
2 71  LEU n 
2 72  MET n 
2 73  ASP n 
2 74  VAL n 
2 75  CYS n 
2 76  ALA n 
2 77  THR n 
2 78  SER n 
2 79  ARG n 
2 80  THR n 
2 81  ASP n 
2 82  ARG n 
2 83  GLU n 
2 84  ILE n 
2 85  LYS n 
2 86  VAL n 
2 87  THR n 
2 88  LEU n 
2 89  VAL n 
2 90  PHE n 
2 91  GLU n 
2 92  HIS n 
2 93  VAL n 
2 94  ASP n 
2 95  GLN n 
2 96  ASP n 
2 97  LEU n 
2 98  ARG n 
2 99  THR n 
2 100 TYR n 
2 101 LEU n 
2 102 ASP n 
2 103 LYS n 
2 104 ALA n 
2 105 PRO n 
2 106 PRO n 
2 107 PRO n 
2 108 GLY n 
2 109 LEU n 
2 110 PRO n 
2 111 ALA n 
2 112 GLU n 
2 113 THR n 
2 114 ILE n 
2 115 LYS n 
2 116 ASP n 
2 117 LEU n 
2 118 MET n 
2 119 ARG n 
2 120 GLN n 
2 121 PHE n 
2 122 LEU n 
2 123 ARG n 
2 124 GLY n 
2 125 LEU n 
2 126 ASP n 
2 127 PHE n 
2 128 LEU n 
2 129 HIS n 
2 130 ALA n 
2 131 ASN n 
2 132 CYS n 
2 133 ILE n 
2 134 VAL n 
2 135 HIS n 
2 136 ARG n 
2 137 ASP n 
2 138 LEU n 
2 139 LYS n 
2 140 PRO n 
2 141 GLU n 
2 142 ASN n 
2 143 ILE n 
2 144 LEU n 
2 145 VAL n 
2 146 THR n 
2 147 SER n 
2 148 GLY n 
2 149 GLY n 
2 150 THR n 
2 151 VAL n 
2 152 LYS n 
2 153 LEU n 
2 154 ALA n 
2 155 ASP n 
2 156 PHE n 
2 157 GLY n 
2 158 LEU n 
2 159 ALA n 
2 160 ARG n 
2 161 ILE n 
2 162 TYR n 
2 163 SER n 
2 164 TYR n 
2 165 GLN n 
2 166 MET n 
2 167 ALA n 
2 168 LEU n 
2 169 ASP n 
2 170 PRO n 
2 171 VAL n 
2 172 VAL n 
2 173 VAL n 
2 174 THR n 
2 175 LEU n 
2 176 TRP n 
2 177 TYR n 
2 178 ARG n 
2 179 ALA n 
2 180 PRO n 
2 181 GLU n 
2 182 VAL n 
2 183 LEU n 
2 184 LEU n 
2 185 GLN n 
2 186 SER n 
2 187 THR n 
2 188 TYR n 
2 189 ALA n 
2 190 THR n 
2 191 PRO n 
2 192 VAL n 
2 193 ASP n 
2 194 MET n 
2 195 TRP n 
2 196 SER n 
2 197 VAL n 
2 198 GLY n 
2 199 CYS n 
2 200 ILE n 
2 201 PHE n 
2 202 ALA n 
2 203 GLU n 
2 204 MET n 
2 205 PHE n 
2 206 ARG n 
2 207 ARG n 
2 208 LYS n 
2 209 PRO n 
2 210 LEU n 
2 211 PHE n 
2 212 CYS n 
2 213 GLY n 
2 214 ASN n 
2 215 SER n 
2 216 GLU n 
2 217 ALA n 
2 218 ASP n 
2 219 GLN n 
2 220 LEU n 
2 221 GLY n 
2 222 LYS n 
2 223 ILE n 
2 224 PHE n 
2 225 ASP n 
2 226 LEU n 
2 227 ILE n 
2 228 GLY n 
2 229 LEU n 
2 230 PRO n 
2 231 PRO n 
2 232 GLU n 
2 233 ASP n 
2 234 ASP n 
2 235 TRP n 
2 236 PRO n 
2 237 ARG n 
2 238 ASP n 
2 239 VAL n 
2 240 SER n 
2 241 LEU n 
2 242 PRO n 
2 243 ARG n 
2 244 GLY n 
2 245 ALA n 
2 246 PHE n 
2 247 PRO n 
2 248 PRO n 
2 249 ARG n 
2 250 GLY n 
2 251 PRO n 
2 252 ARG n 
2 253 PRO n 
2 254 VAL n 
2 255 GLN n 
2 256 SER n 
2 257 VAL n 
2 258 VAL n 
2 259 PRO n 
2 260 GLU n 
2 261 MET n 
2 262 GLU n 
2 263 GLU n 
2 264 SER n 
2 265 GLY n 
2 266 ALA n 
2 267 GLN n 
2 268 LEU n 
2 269 LEU n 
2 270 LEU n 
2 271 GLU n 
2 272 MET n 
2 273 LEU n 
2 274 THR n 
2 275 PHE n 
2 276 ASN n 
2 277 PRO n 
2 278 HIS n 
2 279 LYS n 
2 280 ARG n 
2 281 ILE n 
2 282 SER n 
2 283 ALA n 
2 284 PHE n 
2 285 ARG n 
2 286 ALA n 
2 287 LEU n 
2 288 GLN n 
2 289 HIS n 
2 290 SER n 
2 291 TYR n 
2 292 LEU n 
2 293 HIS n 
2 294 LYS n 
2 295 ASP n 
2 296 GLU n 
2 297 GLY n 
2 298 ASN n 
2 299 PRO n 
2 300 GLU n 
2 301 HIS n 
2 302 HIS n 
2 303 HIS n 
2 304 HIS n 
2 305 HIS n 
2 306 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? Sf21 ? ? ? 
? ? BACULOVIRUS ? ? ? ? ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? Sf21 ? ? ? 
? ? BACULOVIRUS ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP CCND1_HUMAN 1 ? ? P24385 ? 
2 UNP CDK4_HUMAN  2 ? ? P11802 ? 
3 PDB 2W96        2 ? ? 2W96   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2W96 A 1   ? 271 ? P24385 1   ? 271 ? 1   271 
2 2 2W96 B 1   ? 44  ? P11802 1   ? 44  ? 1   44  
3 2 2W96 B 45  ? 300 ? P11802 48  ? 303 ? 48  303 
4 3 2W96 B 301 ? 306 ? 2W96   304 ? 309 ? 304 309 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 2W96 GLU B 43  ? UNP P11802 GLY 43  'engineered mutation' 43  1 
2 2W96 GLU B 44  ? UNP P11802 GLY 44  'engineered mutation' 44  2 
2 2W96 ASP B 169 ? UNP P11802 THR 172 'engineered mutation' 172 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2W96 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.53 
_exptl_crystal.density_percent_sol   40 
_exptl_crystal.description           NONE 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2007-10-07 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.931 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_wavelength             0.931 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2W96 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             84.20 
_reflns.d_resolution_high            2.30 
_reflns.number_obs                   27793 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            0.09 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        5.20 
_reflns.B_iso_Wilson_estimate        52.34 
_reflns.pdbx_redundancy              4.7 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.42 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.50 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.50 
_reflns_shell.pdbx_redundancy        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2W96 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     27793 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             84.22 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    99.1 
_refine.ls_R_factor_obs                          0.205 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.203 
_refine.ls_R_factor_R_free                       0.259 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.880 
_refine.ls_number_reflns_R_free                  1356 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               65.43 
_refine.aniso_B[1][1]                            2.27212 
_refine.aniso_B[2][2]                            7.59665 
_refine.aniso_B[3][3]                            -9.86877 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. RESIDUES A6-A13 WERE BUILT INTO A STRETCH OF PROTEIN LIKE DENSITY, CLOSE TO THE N-TERMINAL REGION OF CYCLIN D. THEY ARE POORLY DEFINED. THE N AND C-TERMINI OF BOTH MOLECULE A AND MOLECULE B ARE NOT VISIBLE IN THE ELECTRON DENSITY. RESIDUES 236 TO 257 IN MOLECULE B CANNOT BE SEEN IN THE ELECTRON DENSITY. DISORDERED REGIONS WERE MODELLED STEREOCHEMICALLY WHERE THE DENSITY WAS NOT CLEAR. IN REGIONS WHERE THE DENSITY WAS UNINTERPRETABLE OR ABSENT, RESIDUES WERE OMITTED.
;
_refine.pdbx_starting_model                      'PDB ENTRY 1BLX' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4099 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             190 
_refine_hist.number_atoms_total               4295 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        84.22 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   9 
_refine_ls_shell.d_res_high                       2.30 
_refine_ls_shell.d_res_low                        2.44 
_refine_ls_shell.number_reflns_R_work             4217 
_refine_ls_shell.R_factor_R_work                  0.2122 
_refine_ls_shell.percent_reflns_obs               99.06 
_refine_ls_shell.R_factor_R_free                  0.2486 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            5.07 
_refine_ls_shell.number_reflns_R_free             225 
_refine_ls_shell.number_reflns_all                4442 
_refine_ls_shell.R_factor_all                     0.2140 
# 
_struct.entry_id                  2W96 
_struct.title                     'Crystal Structure of CDK4 in complex with a D-type cyclin' 
_struct.pdbx_descriptor           'G1/S-SPECIFIC CYCLIN-D1, CELL DIVISION PROTEIN KINASE 4 (E.C.2.7.11.22)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2W96 
_struct_keywords.pdbx_keywords   'CELL CYCLE' 
_struct_keywords.text            
;SERINE/THREONINE-PROTEIN KINASE, CHROMOSOMAL REARRANGEMENT, ATP-BINDING, TRANSFERASE, POLYMORPHISM, CELL DIVISION, PROTO-ONCOGENE, PHOSPHOPROTEIN, DISEASE MUTATION, NUCLEOTIDE-BINDING, CYCLIN DEPENDENT KINASE, KINASE, CYCLIN, ONCOLOGY, CELL CYCLE, DRUG DESGN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 25  ? CYS A 38  ? ASP A 25  CYS A 38  1 ? 14 
HELX_P HELX_P2  2  SER A 43  ? VAL A 48  ? SER A 43  VAL A 48  1 ? 6  
HELX_P HELX_P3  3  LEU A 53  ? GLN A 71  ? LEU A 53  GLN A 71  1 ? 19 
HELX_P HELX_P4  4  GLU A 76  ? SER A 90  ? GLU A 76  SER A 90  1 ? 15 
HELX_P HELX_P5  5  ARG A 98  ? GLU A 115 ? ARG A 98  GLU A 115 1 ? 18 
HELX_P HELX_P6  6  THR A 120 ? THR A 128 ? THR A 120 THR A 128 1 ? 9  
HELX_P HELX_P7  7  ARG A 133 ? LEU A 148 ? ARG A 133 LEU A 148 1 ? 16 
HELX_P HELX_P8  8  THR A 156 ? LYS A 167 ? THR A 156 LYS A 167 1 ? 12 
HELX_P HELX_P9  9  ALA A 171 ? THR A 191 ? ALA A 171 THR A 191 1 ? 21 
HELX_P HELX_P10 10 VAL A 193 ? ASN A 198 ? VAL A 193 ASN A 198 1 ? 6  
HELX_P HELX_P11 11 PRO A 199 ? SER A 219 ? PRO A 199 SER A 219 1 ? 21 
HELX_P HELX_P12 12 PHE A 223 ? TYR A 227 ? PHE A 223 TYR A 227 5 ? 5  
HELX_P HELX_P13 13 ARG A 228 ? LYS A 238 ? ARG A 228 LYS A 238 1 ? 11 
HELX_P HELX_P14 14 ASP A 240 ? GLU A 256 ? ASP A 240 GLU A 256 1 ? 17 
HELX_P HELX_P15 15 PRO B 47  ? GLU B 61  ? PRO B 50  GLU B 64  1 ? 15 
HELX_P HELX_P16 16 ALA B 62  ? GLU B 64  ? ALA B 65  GLU B 67  5 ? 3  
HELX_P HELX_P17 17 ASP B 96  ? LYS B 103 ? ASP B 99  LYS B 106 1 ? 8  
HELX_P HELX_P18 18 PRO B 110 ? ASN B 131 ? PRO B 113 ASN B 134 1 ? 22 
HELX_P HELX_P19 19 LEU B 158 ? ALA B 167 ? LEU B 161 ALA B 170 1 ? 10 
HELX_P HELX_P20 20 PRO B 191 ? ARG B 206 ? PRO B 194 ARG B 209 1 ? 16 
HELX_P HELX_P21 21 SER B 215 ? GLY B 228 ? SER B 218 GLY B 231 1 ? 14 
HELX_P HELX_P22 22 GLU B 262 ? LEU B 273 ? GLU B 265 LEU B 276 1 ? 12 
HELX_P HELX_P23 23 ASN B 276 ? ARG B 280 ? ASN B 279 ARG B 283 5 ? 5  
HELX_P HELX_P24 24 SER B 282 ? GLN B 288 ? SER B 285 GLN B 291 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 106 B . ? PRO 109 B PRO 107 B ? PRO 110 B 1 1.59  
2 GLY 108 B . ? GLY 111 B LEU 109 B ? LEU 112 B 1 -0.99 
3 LEU 109 B . ? LEU 112 B PRO 110 B ? PRO 113 B 1 -2.46 
4 LEU 168 B . ? LEU 171 B ASP 169 B ? ASP 172 B 1 2.15  
5 PRO 170 B . ? PRO 173 B VAL 171 B ? VAL 174 B 1 -5.62 
6 LEU 184 B . ? LEU 187 B GLN 185 B ? GLN 188 B 1 0.70  
7 GLN 185 B . ? GLN 188 B SER 186 B ? SER 189 B 1 -6.57 
8 THR 187 B . ? THR 190 B TYR 188 B ? TYR 191 B 1 2.63  
9 GLU 232 B . ? GLU 235 B ASP 233 B ? ASP 236 B 1 4.10  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
BA ? 5 ? 
BB ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BB 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
BA 1 GLU B 7   ? GLY B 13  ? GLU B 7   GLY B 13  
BA 2 VAL B 20  ? ARG B 24  ? VAL B 20  ARG B 24  
BA 3 PHE B 31  ? PRO B 40  ? PHE B 31  PRO B 40  
BA 4 GLU B 83  ? GLU B 91  ? GLU B 86  GLU B 94  
BA 5 LEU B 71  ? ARG B 79  ? LEU B 74  ARG B 82  
BB 1 ILE B 143 ? VAL B 145 ? ILE B 146 VAL B 148 
BB 2 VAL B 151 ? LEU B 153 ? VAL B 154 LEU B 156 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
BA 1 2 N GLY B 13  ? N GLY B 13  O VAL B 20  ? O VAL B 20  
BA 2 3 N ALA B 23  ? N ALA B 23  O VAL B 32  ? O VAL B 32  
BA 3 4 N VAL B 39  ? N VAL B 39  O ILE B 84  ? O ILE B 87  
BA 4 5 O VAL B 89  ? O VAL B 92  N MET B 72  ? N MET B 75  
BB 1 2 N LEU B 144 ? N LEU B 147 O LYS B 152 ? O LYS B 155 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'BINDING SITE FOR RESIDUE GOL A 1266' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 THR A 37  ? THR A 37  . ? 1_555 ? 
2 AC1 6 ARG A 87  ? ARG A 87  . ? 1_555 ? 
3 AC1 6 LEU A 148 ? LEU A 148 . ? 1_555 ? 
4 AC1 6 LYS A 149 ? LYS A 149 . ? 1_555 ? 
5 AC1 6 ASN A 151 ? ASN A 151 . ? 1_555 ? 
6 AC1 6 ARG B 58  ? ARG B 61  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2W96 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2W96 
_atom_sites.fract_transf_matrix[1][1]   0.017887 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015460 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005928 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LEU A 1 6   ? -3.270  4.250   54.200 1.00 78.20  ? 6    LEU A N   1 
ATOM   2    C CA  . LEU A 1 6   ? -3.459  4.573   55.610 1.00 77.90  ? 6    LEU A CA  1 
ATOM   3    C C   . LEU A 1 6   ? -4.952  4.579   55.882 1.00 87.63  ? 6    LEU A C   1 
ATOM   4    O O   . LEU A 1 6   ? -5.619  5.601   55.729 1.00 86.97  ? 6    LEU A O   1 
ATOM   5    C CB  . LEU A 1 6   ? -2.844  5.936   55.940 1.00 76.66  ? 6    LEU A CB  1 
ATOM   6    C CG  . LEU A 1 6   ? -1.760  6.399   54.966 1.00 79.37  ? 6    LEU A CG  1 
ATOM   7    C CD1 . LEU A 1 6   ? -2.396  7.019   53.739 1.00 78.60  ? 6    LEU A CD1 1 
ATOM   8    C CD2 . LEU A 1 6   ? -0.773  7.358   55.600 1.00 80.55  ? 6    LEU A CD2 1 
ATOM   9    N N   . CYS A 1 7   ? -5.464  3.438   56.324 1.00 88.58  ? 7    CYS A N   1 
ATOM   10   C CA  . CYS A 1 7   ? -6.887  3.164   56.226 1.00 89.64  ? 7    CYS A CA  1 
ATOM   11   C C   . CYS A 1 7   ? -7.762  3.472   57.447 1.00 94.08  ? 7    CYS A C   1 
ATOM   12   O O   . CYS A 1 7   ? -8.097  2.578   58.226 1.00 93.90  ? 7    CYS A O   1 
ATOM   13   C CB  . CYS A 1 7   ? -7.105  1.755   55.682 1.00 90.94  ? 7    CYS A CB  1 
ATOM   14   S SG  . CYS A 1 7   ? -6.183  1.479   54.149 1.00 94.68  ? 7    CYS A SG  1 
ATOM   15   N N   . CYS A 1 8   ? -8.179  4.736   57.546 1.00 91.44  ? 8    CYS A N   1 
ATOM   16   C CA  . CYS A 1 8   ? -9.307  5.172   58.377 1.00 91.20  ? 8    CYS A CA  1 
ATOM   17   C C   . CYS A 1 8   ? -10.401 4.118   58.488 1.00 95.41  ? 8    CYS A C   1 
ATOM   18   O O   . CYS A 1 8   ? -10.488 3.211   57.663 1.00 95.16  ? 8    CYS A O   1 
ATOM   19   C CB  . CYS A 1 8   ? -9.932  6.453   57.800 1.00 91.24  ? 8    CYS A CB  1 
ATOM   20   S SG  . CYS A 1 8   ? -9.059  7.994   58.144 1.00 94.84  ? 8    CYS A SG  1 
ATOM   21   N N   . GLU A 1 9   ? -11.289 4.295   59.459 1.00 92.05  ? 9    GLU A N   1 
ATOM   22   C CA  . GLU A 1 9   ? -12.493 3.478   59.527 1.00 92.23  ? 9    GLU A CA  1 
ATOM   23   C C   . GLU A 1 9   ? -13.716 4.168   58.934 1.00 94.91  ? 9    GLU A C   1 
ATOM   24   O O   . GLU A 1 9   ? -14.731 3.524   58.671 1.00 94.74  ? 9    GLU A O   1 
ATOM   25   C CB  . GLU A 1 9   ? -12.783 3.021   60.955 1.00 93.98  ? 9    GLU A CB  1 
ATOM   26   C CG  . GLU A 1 9   ? -14.101 2.280   61.087 1.00 106.92 ? 9    GLU A CG  1 
ATOM   27   C CD  . GLU A 1 9   ? -13.991 1.046   61.958 1.00 127.54 ? 9    GLU A CD  1 
ATOM   28   O OE1 . GLU A 1 9   ? -12.914 0.412   61.963 1.00 128.72 ? 9    GLU A OE1 1 
ATOM   29   O OE2 . GLU A 1 9   ? -14.999 0.679   62.594 1.00 124.14 ? 9    GLU A OE2 1 
ATOM   30   N N   . VAL A 1 10  ? -13.616 5.470   58.697 1.00 89.84  ? 10   VAL A N   1 
ATOM   31   C CA  . VAL A 1 10  ? -14.745 6.206   58.146 1.00 88.69  ? 10   VAL A CA  1 
ATOM   32   C C   . VAL A 1 10  ? -14.493 6.844   56.775 1.00 92.10  ? 10   VAL A C   1 
ATOM   33   O O   . VAL A 1 10  ? -14.185 6.161   55.793 1.00 91.40  ? 10   VAL A O   1 
ATOM   34   C CB  . VAL A 1 10  ? -15.303 7.225   59.164 1.00 91.97  ? 10   VAL A CB  1 
ATOM   35   C CG1 . VAL A 1 10  ? -16.538 7.927   58.617 1.00 91.67  ? 10   VAL A CG1 1 
ATOM   36   C CG2 . VAL A 1 10  ? -15.624 6.537   60.486 1.00 91.63  ? 10   VAL A CG2 1 
ATOM   37   N N   . GLU A 1 11  ? -14.527 8.171   56.756 1.00 88.98  ? 11   GLU A N   1 
ATOM   38   C CA  . GLU A 1 11  ? -14.914 8.928   55.572 1.00 88.99  ? 11   GLU A CA  1 
ATOM   39   C C   . GLU A 1 11  ? -15.311 10.298  56.121 1.00 94.76  ? 11   GLU A C   1 
ATOM   40   O O   . GLU A 1 11  ? -15.925 11.116  55.433 1.00 94.58  ? 11   GLU A O   1 
ATOM   41   C CB  . GLU A 1 11  ? -16.109 8.236   54.908 1.00 90.11  ? 11   GLU A CB  1 
ATOM   42   C CG  . GLU A 1 11  ? -16.791 8.995   53.785 1.00 98.60  ? 11   GLU A CG  1 
ATOM   43   C CD  . GLU A 1 11  ? -18.230 8.551   53.613 1.00 113.94 ? 11   GLU A CD  1 
ATOM   44   O OE1 . GLU A 1 11  ? -18.800 8.037   54.600 1.00 101.95 ? 11   GLU A OE1 1 
ATOM   45   O OE2 . GLU A 1 11  ? -18.792 8.716   52.509 1.00 104.68 ? 11   GLU A OE2 1 
ATOM   46   N N   . THR A 1 12  ? -15.117 10.431  57.430 1.00 92.45  ? 12   THR A N   1 
ATOM   47   C CA  . THR A 1 12  ? -14.957 11.715  58.104 1.00 92.65  ? 12   THR A CA  1 
ATOM   48   C C   . THR A 1 12  ? -13.615 11.577  58.824 1.00 96.69  ? 12   THR A C   1 
ATOM   49   O O   . THR A 1 12  ? -12.965 12.571  59.157 1.00 96.73  ? 12   THR A O   1 
ATOM   50   C CB  . THR A 1 12  ? -16.092 11.967  59.126 1.00 101.76 ? 12   THR A CB  1 
ATOM   51   O OG1 . THR A 1 12  ? -17.227 11.151  58.805 1.00 100.68 ? 12   THR A OG1 1 
ATOM   52   C CG2 . THR A 1 12  ? -16.499 13.441  59.122 1.00 100.53 ? 12   THR A CG2 1 
ATOM   53   N N   . ILE A 1 13  ? -13.233 10.315  59.042 1.00 92.52  ? 13   ILE A N   1 
ATOM   54   C CA  . ILE A 1 13  ? -11.958 9.889   59.627 1.00 113.61 ? 13   ILE A CA  1 
ATOM   55   C C   . ILE A 1 13  ? -12.053 9.480   61.089 1.00 129.79 ? 13   ILE A C   1 
ATOM   56   O O   . ILE A 1 13  ? -11.200 8.744   61.587 1.00 87.39  ? 13   ILE A O   1 
ATOM   57   C CB  . ILE A 1 13  ? -10.830 10.897  59.415 1.00 114.98 ? 13   ILE A CB  1 
ATOM   58   N N   . ASP A 1 25  ? -6.074  14.775  51.503 1.00 74.38  ? 25   ASP A N   1 
ATOM   59   C CA  . ASP A 1 25  ? -5.668  16.050  52.082 1.00 74.07  ? 25   ASP A CA  1 
ATOM   60   C C   . ASP A 1 25  ? -5.099  15.916  53.490 1.00 76.90  ? 25   ASP A C   1 
ATOM   61   O O   . ASP A 1 25  ? -4.085  16.533  53.814 1.00 76.68  ? 25   ASP A O   1 
ATOM   62   C CB  . ASP A 1 25  ? -6.814  17.059  52.053 1.00 76.10  ? 25   ASP A CB  1 
ATOM   63   C CG  . ASP A 1 25  ? -7.106  17.561  50.655 1.00 89.44  ? 25   ASP A CG  1 
ATOM   64   O OD1 . ASP A 1 25  ? -6.500  17.025  49.700 1.00 90.65  ? 25   ASP A OD1 1 
ATOM   65   O OD2 . ASP A 1 25  ? -7.933  18.490  50.511 1.00 95.64  ? 25   ASP A OD2 1 
ATOM   66   N N   . ARG A 1 26  ? -5.760  15.135  54.334 1.00 72.51  ? 26   ARG A N   1 
ATOM   67   C CA  . ARG A 1 26  ? -5.212  14.843  55.653 1.00 72.01  ? 26   ARG A CA  1 
ATOM   68   C C   . ARG A 1 26  ? -4.071  13.850  55.465 1.00 74.70  ? 26   ARG A C   1 
ATOM   69   O O   . ARG A 1 26  ? -3.085  13.863  56.206 1.00 74.37  ? 26   ARG A O   1 
ATOM   70   C CB  . ARG A 1 26  ? -6.286  14.248  56.569 1.00 72.60  ? 26   ARG A CB  1 
ATOM   71   C CG  . ARG A 1 26  ? -7.620  14.989  56.550 1.00 84.94  ? 26   ARG A CG  1 
ATOM   72   C CD  . ARG A 1 26  ? -7.505  16.430  57.041 1.00 98.55  ? 26   ARG A CD  1 
ATOM   73   N NE  . ARG A 1 26  ? -7.062  16.526  58.431 1.00 108.76 ? 26   ARG A NE  1 
ATOM   74   C CZ  . ARG A 1 26  ? -5.942  17.131  58.820 1.00 122.18 ? 26   ARG A CZ  1 
ATOM   75   N NH1 . ARG A 1 26  ? -5.153  17.712  57.926 1.00 106.97 ? 26   ARG A NH1 1 
ATOM   76   N NH2 . ARG A 1 26  ? -5.618  17.171  60.106 1.00 109.95 ? 26   ARG A NH2 1 
ATOM   77   N N   . VAL A 1 27  ? -4.205  13.019  54.433 1.00 69.88  ? 27   VAL A N   1 
ATOM   78   C CA  . VAL A 1 27  ? -3.187  12.036  54.065 1.00 68.63  ? 27   VAL A CA  1 
ATOM   79   C C   . VAL A 1 27  ? -1.961  12.723  53.474 1.00 70.08  ? 27   VAL A C   1 
ATOM   80   O O   . VAL A 1 27  ? -0.847  12.580  53.986 1.00 69.72  ? 27   VAL A O   1 
ATOM   81   C CB  . VAL A 1 27  ? -3.758  10.990  53.077 1.00 72.21  ? 27   VAL A CB  1 
ATOM   82   C CG1 . VAL A 1 27  ? -4.571  11.678  51.991 1.00 72.01  ? 27   VAL A CG1 1 
ATOM   83   C CG2 . VAL A 1 27  ? -2.636  10.167  52.462 1.00 71.90  ? 27   VAL A CG2 1 
ATOM   84   N N   . LEU A 1 28  ? -2.181  13.472  52.397 1.00 64.18  ? 28   LEU A N   1 
ATOM   85   C CA  . LEU A 1 28  ? -1.112  14.211  51.738 1.00 62.78  ? 28   LEU A CA  1 
ATOM   86   C C   . LEU A 1 28  ? -0.298  15.058  52.710 1.00 63.06  ? 28   LEU A C   1 
ATOM   87   O O   . LEU A 1 28  ? 0.927   15.111  52.620 1.00 62.53  ? 28   LEU A O   1 
ATOM   88   C CB  . LEU A 1 28  ? -1.675  15.084  50.622 1.00 62.87  ? 28   LEU A CB  1 
ATOM   89   C CG  . LEU A 1 28  ? -0.649  15.962  49.906 1.00 67.71  ? 28   LEU A CG  1 
ATOM   90   C CD1 . LEU A 1 28  ? 0.531   15.144  49.395 1.00 67.96  ? 28   LEU A CD1 1 
ATOM   91   C CD2 . LEU A 1 28  ? -1.315  16.714  48.774 1.00 69.40  ? 28   LEU A CD2 1 
ATOM   92   N N   . ARG A 1 29  ? -0.978  15.708  53.647 1.00 57.30  ? 29   ARG A N   1 
ATOM   93   C CA  . ARG A 1 29  ? -0.293  16.519  54.643 1.00 56.45  ? 29   ARG A CA  1 
ATOM   94   C C   . ARG A 1 29  ? 0.682   15.664  55.432 1.00 57.40  ? 29   ARG A C   1 
ATOM   95   O O   . ARG A 1 29  ? 1.722   16.145  55.883 1.00 57.37  ? 29   ARG A O   1 
ATOM   96   C CB  . ARG A 1 29  ? -1.298  17.173  55.599 1.00 58.29  ? 29   ARG A CB  1 
ATOM   97   C CG  . ARG A 1 29  ? -0.658  18.102  56.625 1.00 73.01  ? 29   ARG A CG  1 
ATOM   98   C CD  . ARG A 1 29  ? -1.601  18.405  57.786 1.00 90.63  ? 29   ARG A CD  1 
ATOM   99   N NE  . ARG A 1 29  ? -0.877  18.883  58.964 1.00 106.20 ? 29   ARG A NE  1 
ATOM   100  C CZ  . ARG A 1 29  ? -1.420  19.040  60.169 1.00 123.30 ? 29   ARG A CZ  1 
ATOM   101  N NH1 . ARG A 1 29  ? -2.702  18.759  60.367 1.00 111.41 ? 29   ARG A NH1 1 
ATOM   102  N NH2 . ARG A 1 29  ? -0.679  19.475  61.181 1.00 110.67 ? 29   ARG A NH2 1 
ATOM   103  N N   . ALA A 1 30  ? 0.332   14.394  55.607 1.00 51.55  ? 30   ALA A N   1 
ATOM   104  C CA  . ALA A 1 30  ? 1.169   13.467  56.363 1.00 50.31  ? 30   ALA A CA  1 
ATOM   105  C C   . ALA A 1 30  ? 2.389   13.066  55.536 1.00 51.15  ? 30   ALA A C   1 
ATOM   106  O O   . ALA A 1 30  ? 3.506   12.999  56.050 1.00 50.55  ? 30   ALA A O   1 
ATOM   107  C CB  . ALA A 1 30  ? 0.360   12.231  56.762 1.00 50.97  ? 30   ALA A CB  1 
ATOM   108  N N   . MET A 1 31  ? 2.159   12.815  54.251 1.00 45.58  ? 31   MET A N   1 
ATOM   109  C CA  . MET A 1 31  ? 3.222   12.458  53.317 1.00 44.58  ? 31   MET A CA  1 
ATOM   110  C C   . MET A 1 31  ? 4.277   13.556  53.288 1.00 48.84  ? 31   MET A C   1 
ATOM   111  O O   . MET A 1 31  ? 5.478   13.277  53.312 1.00 48.21  ? 31   MET A O   1 
ATOM   112  C CB  . MET A 1 31  ? 2.647   12.247  51.908 1.00 46.43  ? 31   MET A CB  1 
ATOM   113  C CG  . MET A 1 31  ? 1.643   11.113  51.797 1.00 49.24  ? 31   MET A CG  1 
ATOM   114  S SD  . MET A 1 31  ? 0.787   11.100  50.206 1.00 53.25  ? 31   MET A SD  1 
ATOM   115  C CE  . MET A 1 31  ? 2.090   10.555  49.093 1.00 50.05  ? 31   MET A CE  1 
ATOM   116  N N   . LEU A 1 32  ? 3.816   14.806  53.278 1.00 45.86  ? 32   LEU A N   1 
ATOM   117  C CA  . LEU A 1 32  ? 4.701   15.966  53.286 1.00 45.55  ? 32   LEU A CA  1 
ATOM   118  C C   . LEU A 1 32  ? 5.545   16.049  54.548 1.00 49.84  ? 32   LEU A C   1 
ATOM   119  O O   . LEU A 1 32  ? 6.673   16.529  54.509 1.00 49.80  ? 32   LEU A O   1 
ATOM   120  C CB  . LEU A 1 32  ? 3.905   17.265  53.107 1.00 45.57  ? 32   LEU A CB  1 
ATOM   121  C CG  . LEU A 1 32  ? 3.275   17.505  51.729 1.00 50.30  ? 32   LEU A CG  1 
ATOM   122  C CD1 . LEU A 1 32  ? 2.587   18.865  51.704 1.00 50.49  ? 32   LEU A CD1 1 
ATOM   123  C CD2 . LEU A 1 32  ? 4.317   17.402  50.608 1.00 51.51  ? 32   LEU A CD2 1 
ATOM   124  N N   . LYS A 1 33  ? 4.985   15.609  55.671 1.00 47.37  ? 33   LYS A N   1 
ATOM   125  C CA  . LYS A 1 33  ? 5.692   15.650  56.952 1.00 47.02  ? 33   LYS A CA  1 
ATOM   126  C C   . LYS A 1 33  ? 6.790   14.595  56.985 1.00 49.99  ? 33   LYS A C   1 
ATOM   127  O O   . LYS A 1 33  ? 7.941   14.879  57.324 1.00 48.89  ? 33   LYS A O   1 
ATOM   128  C CB  . LYS A 1 33  ? 4.717   15.397  58.107 1.00 50.12  ? 33   LYS A CB  1 
ATOM   129  C CG  . LYS A 1 33  ? 3.718   16.515  58.383 1.00 64.37  ? 33   LYS A CG  1 
ATOM   130  C CD  . LYS A 1 33  ? 2.926   16.222  59.660 1.00 74.09  ? 33   LYS A CD  1 
ATOM   131  C CE  . LYS A 1 33  ? 1.891   17.300  59.946 1.00 84.73  ? 33   LYS A CE  1 
ATOM   132  N NZ  . LYS A 1 33  ? 1.094   17.001  61.168 1.00 94.87  ? 33   LYS A NZ  1 
ATOM   133  N N   . ALA A 1 34  ? 6.407   13.367  56.652 1.00 46.51  ? 34   ALA A N   1 
ATOM   134  C CA  . ALA A 1 34  ? 7.339   12.251  56.539 1.00 45.77  ? 34   ALA A CA  1 
ATOM   135  C C   . ALA A 1 34  ? 8.564   12.587  55.677 1.00 50.33  ? 34   ALA A C   1 
ATOM   136  O O   . ALA A 1 34  ? 9.705   12.420  56.118 1.00 50.03  ? 34   ALA A O   1 
ATOM   137  C CB  . ALA A 1 34  ? 6.616   11.039  55.981 1.00 46.16  ? 34   ALA A CB  1 
ATOM   138  N N   . GLU A 1 35  ? 8.323   13.088  54.464 1.00 46.72  ? 35   GLU A N   1 
ATOM   139  C CA  . GLU A 1 35  ? 9.400   13.372  53.522 1.00 45.75  ? 35   GLU A CA  1 
ATOM   140  C C   . GLU A 1 35  ? 10.415  14.367  54.060 1.00 48.40  ? 35   GLU A C   1 
ATOM   141  O O   . GLU A 1 35  ? 11.611  14.217  53.842 1.00 48.53  ? 35   GLU A O   1 
ATOM   142  C CB  . GLU A 1 35  ? 8.855   13.817  52.160 1.00 47.04  ? 35   GLU A CB  1 
ATOM   143  C CG  . GLU A 1 35  ? 8.716   15.315  51.992 1.00 57.40  ? 35   GLU A CG  1 
ATOM   144  C CD  . GLU A 1 35  ? 8.340   15.716  50.575 1.00 70.56  ? 35   GLU A CD  1 
ATOM   145  O OE1 . GLU A 1 35  ? 7.790   16.823  50.398 1.00 60.25  ? 35   GLU A OE1 1 
ATOM   146  O OE2 . GLU A 1 35  ? 8.596   14.929  49.637 1.00 57.82  ? 35   GLU A OE2 1 
ATOM   147  N N   . GLU A 1 36  ? 9.948   15.358  54.807 1.00 44.76  ? 36   GLU A N   1 
ATOM   148  C CA  . GLU A 1 36  ? 10.854  16.310  55.454 1.00 44.37  ? 36   GLU A CA  1 
ATOM   149  C C   . GLU A 1 36  ? 11.888  15.636  56.364 1.00 46.98  ? 36   GLU A C   1 
ATOM   150  O O   . GLU A 1 36  ? 12.996  16.149  56.533 1.00 47.61  ? 36   GLU A O   1 
ATOM   151  C CB  . GLU A 1 36  ? 10.054  17.337  56.263 1.00 46.06  ? 36   GLU A CB  1 
ATOM   152  C CG  . GLU A 1 36  ? 9.066   18.151  55.440 1.00 59.23  ? 36   GLU A CG  1 
ATOM   153  C CD  . GLU A 1 36  ? 8.010   18.823  56.295 1.00 85.81  ? 36   GLU A CD  1 
ATOM   154  O OE1 . GLU A 1 36  ? 8.060   18.669  57.534 1.00 84.06  ? 36   GLU A OE1 1 
ATOM   155  O OE2 . GLU A 1 36  ? 7.119   19.490  55.726 1.00 82.34  ? 36   GLU A OE2 1 
ATOM   156  N N   . THR A 1 37  ? 11.505  14.530  57.001 1.00 41.88  ? 37   THR A N   1 
ATOM   157  C CA  . THR A 1 37  ? 12.394  13.832  57.931 1.00 40.96  ? 37   THR A CA  1 
ATOM   158  C C   . THR A 1 37  ? 13.444  12.966  57.231 1.00 43.61  ? 37   THR A C   1 
ATOM   159  O O   . THR A 1 37  ? 14.386  12.491  57.867 1.00 43.94  ? 37   THR A O   1 
ATOM   160  C CB  . THR A 1 37  ? 11.609  13.007  58.981 1.00 44.95  ? 37   THR A CB  1 
ATOM   161  O OG1 . THR A 1 37  ? 11.178  11.769  58.403 1.00 44.73  ? 37   THR A OG1 1 
ATOM   162  C CG2 . THR A 1 37  ? 10.401  13.779  59.474 1.00 39.52  ? 37   THR A CG2 1 
ATOM   163  N N   . CYS A 1 38  ? 13.286  12.772  55.927 1.00 38.78  ? 38   CYS A N   1 
ATOM   164  C CA  . CYS A 1 38  ? 14.224  11.961  55.153 1.00 38.45  ? 38   CYS A CA  1 
ATOM   165  C C   . CYS A 1 38  ? 14.973  12.742  54.081 1.00 40.70  ? 38   CYS A C   1 
ATOM   166  O O   . CYS A 1 38  ? 15.325  12.185  53.048 1.00 39.55  ? 38   CYS A O   1 
ATOM   167  C CB  . CYS A 1 38  ? 13.488  10.806  54.469 1.00 38.56  ? 38   CYS A CB  1 
ATOM   168  S SG  . CYS A 1 38  ? 12.721  9.682   55.592 1.00 42.21  ? 38   CYS A SG  1 
ATOM   169  N N   . ALA A 1 39  ? 15.178  14.031  54.298 1.00 38.49  ? 39   ALA A N   1 
ATOM   170  C CA  . ALA A 1 39  ? 15.886  14.848  53.318 1.00 38.54  ? 39   ALA A CA  1 
ATOM   171  C C   . ALA A 1 39  ? 17.395  14.717  53.470 1.00 42.38  ? 39   ALA A C   1 
ATOM   172  O O   . ALA A 1 39  ? 17.932  14.839  54.569 1.00 41.27  ? 39   ALA A O   1 
ATOM   173  C CB  . ALA A 1 39  ? 15.469  16.297  53.432 1.00 39.27  ? 39   ALA A CB  1 
ATOM   174  N N   . PRO A 1 40  ? 18.099  14.450  52.358 1.00 39.01  ? 40   PRO A N   1 
ATOM   175  C CA  . PRO A 1 40  ? 19.564  14.545  52.356 1.00 38.02  ? 40   PRO A CA  1 
ATOM   176  C C   . PRO A 1 40  ? 20.015  15.998  52.488 1.00 41.13  ? 40   PRO A C   1 
ATOM   177  O O   . PRO A 1 40  ? 19.194  16.910  52.553 1.00 41.01  ? 40   PRO A O   1 
ATOM   178  C CB  . PRO A 1 40  ? 19.939  14.023  50.970 1.00 39.53  ? 40   PRO A CB  1 
ATOM   179  C CG  . PRO A 1 40  ? 18.789  14.393  50.112 1.00 44.45  ? 40   PRO A CG  1 
ATOM   180  C CD  . PRO A 1 40  ? 17.553  14.313  50.996 1.00 40.22  ? 40   PRO A CD  1 
ATOM   181  N N   . SER A 1 41  ? 21.328  16.200  52.491 1.00 36.71  ? 41   SER A N   1 
ATOM   182  C CA  . SER A 1 41  ? 21.923  17.531  52.522 1.00 36.42  ? 41   SER A CA  1 
ATOM   183  C C   . SER A 1 41  ? 22.297  17.947  51.100 1.00 40.26  ? 41   SER A C   1 
ATOM   184  O O   . SER A 1 41  ? 22.852  17.155  50.351 1.00 39.18  ? 41   SER A O   1 
ATOM   185  C CB  . SER A 1 41  ? 23.179  17.498  53.403 1.00 39.94  ? 41   SER A CB  1 
ATOM   186  O OG  . SER A 1 41  ? 23.640  18.799  53.692 1.00 50.83  ? 41   SER A OG  1 
ATOM   187  N N   . VAL A 1 42  ? 21.992  19.187  50.729 1.00 38.12  ? 42   VAL A N   1 
ATOM   188  C CA  . VAL A 1 42  ? 22.278  19.681  49.376 1.00 37.87  ? 42   VAL A CA  1 
ATOM   189  C C   . VAL A 1 42  ? 23.782  19.927  49.180 1.00 41.56  ? 42   VAL A C   1 
ATOM   190  O O   . VAL A 1 42  ? 24.288  19.931  48.048 1.00 40.58  ? 42   VAL A O   1 
ATOM   191  C CB  . VAL A 1 42  ? 21.480  20.964  49.083 1.00 42.41  ? 42   VAL A CB  1 
ATOM   192  C CG1 . VAL A 1 42  ? 22.081  22.143  49.837 1.00 42.09  ? 42   VAL A CG1 1 
ATOM   193  C CG2 . VAL A 1 42  ? 21.457  21.255  47.597 1.00 42.67  ? 42   VAL A CG2 1 
ATOM   194  N N   . SER A 1 43  ? 24.501  20.070  50.292 1.00 37.68  ? 43   SER A N   1 
ATOM   195  C CA  . SER A 1 43  ? 25.914  20.422  50.250 1.00 37.14  ? 43   SER A CA  1 
ATOM   196  C C   . SER A 1 43  ? 26.824  19.302  50.693 1.00 40.54  ? 43   SER A C   1 
ATOM   197  O O   . SER A 1 43  ? 27.923  19.566  51.184 1.00 41.45  ? 43   SER A O   1 
ATOM   198  C CB  . SER A 1 43  ? 26.191  21.645  51.131 1.00 39.78  ? 43   SER A CB  1 
ATOM   199  O OG  . SER A 1 43  ? 26.039  21.316  52.498 1.00 44.33  ? 43   SER A OG  1 
ATOM   200  N N   . TYR A 1 44  ? 26.399  18.055  50.523 1.00 34.66  ? 44   TYR A N   1 
ATOM   201  C CA  . TYR A 1 44  ? 27.204  16.959  51.040 1.00 32.97  ? 44   TYR A CA  1 
ATOM   202  C C   . TYR A 1 44  ? 28.467  16.622  50.260 1.00 36.77  ? 44   TYR A C   1 
ATOM   203  O O   . TYR A 1 44  ? 29.414  16.077  50.828 1.00 36.80  ? 44   TYR A O   1 
ATOM   204  C CB  . TYR A 1 44  ? 26.361  15.718  51.354 1.00 33.73  ? 44   TYR A CB  1 
ATOM   205  C CG  . TYR A 1 44  ? 25.945  14.870  50.162 1.00 33.44  ? 44   TYR A CG  1 
ATOM   206  C CD1 . TYR A 1 44  ? 24.604  14.592  49.924 1.00 35.09  ? 44   TYR A CD1 1 
ATOM   207  C CD2 . TYR A 1 44  ? 26.893  14.237  49.365 1.00 33.62  ? 44   TYR A CD2 1 
ATOM   208  C CE1 . TYR A 1 44  ? 24.216  13.769  48.879 1.00 35.19  ? 44   TYR A CE1 1 
ATOM   209  C CE2 . TYR A 1 44  ? 26.513  13.427  48.306 1.00 34.12  ? 44   TYR A CE2 1 
ATOM   210  C CZ  . TYR A 1 44  ? 25.174  13.188  48.079 1.00 37.05  ? 44   TYR A CZ  1 
ATOM   211  O OH  . TYR A 1 44  ? 24.784  12.380  47.038 1.00 35.24  ? 44   TYR A OH  1 
ATOM   212  N N   . PHE A 1 45  ? 28.488  16.924  48.962 1.00 33.62  ? 45   PHE A N   1 
ATOM   213  C CA  . PHE A 1 45  ? 29.684  16.668  48.150 1.00 34.12  ? 45   PHE A CA  1 
ATOM   214  C C   . PHE A 1 45  ? 30.827  17.597  48.587 1.00 41.60  ? 45   PHE A C   1 
ATOM   215  O O   . PHE A 1 45  ? 32.015  17.258  48.476 1.00 41.05  ? 45   PHE A O   1 
ATOM   216  C CB  . PHE A 1 45  ? 29.395  16.888  46.657 1.00 35.52  ? 45   PHE A CB  1 
ATOM   217  C CG  . PHE A 1 45  ? 28.602  15.779  46.006 1.00 36.21  ? 45   PHE A CG  1 
ATOM   218  C CD1 . PHE A 1 45  ? 27.255  15.954  45.710 1.00 38.79  ? 45   PHE A CD1 1 
ATOM   219  C CD2 . PHE A 1 45  ? 29.221  14.600  45.609 1.00 37.17  ? 45   PHE A CD2 1 
ATOM   220  C CE1 . PHE A 1 45  ? 26.528  14.951  45.073 1.00 39.32  ? 45   PHE A CE1 1 
ATOM   221  C CE2 . PHE A 1 45  ? 28.502  13.595  44.982 1.00 40.06  ? 45   PHE A CE2 1 
ATOM   222  C CZ  . PHE A 1 45  ? 27.153  13.774  44.702 1.00 38.13  ? 45   PHE A CZ  1 
ATOM   223  N N   . LYS A 1 46  ? 30.454  18.771  49.087 1.00 40.82  ? 46   LYS A N   1 
ATOM   224  C CA  . LYS A 1 46  ? 31.413  19.745  49.595 1.00 41.79  ? 46   LYS A CA  1 
ATOM   225  C C   . LYS A 1 46  ? 31.770  19.476  51.059 1.00 48.25  ? 46   LYS A C   1 
ATOM   226  O O   . LYS A 1 46  ? 32.933  19.278  51.398 1.00 48.45  ? 46   LYS A O   1 
ATOM   227  C CB  . LYS A 1 46  ? 30.852  21.161  49.438 1.00 44.03  ? 46   LYS A CB  1 
ATOM   228  C CG  . LYS A 1 46  ? 31.845  22.274  49.765 1.00 55.16  ? 46   LYS A CG  1 
ATOM   229  C CD  . LYS A 1 46  ? 31.188  23.661  49.681 1.00 60.60  ? 46   LYS A CD  1 
ATOM   230  C CE  . LYS A 1 46  ? 30.016  23.818  50.668 1.00 60.37  ? 46   LYS A CE  1 
ATOM   231  N NZ  . LYS A 1 46  ? 29.208  25.064  50.434 1.00 50.11  ? 46   LYS A NZ  1 
ATOM   232  N N   . CYS A 1 47  ? 30.758  19.407  51.914 1.00 46.19  ? 47   CYS A N   1 
ATOM   233  C CA  . CYS A 1 47  ? 30.977  19.370  53.356 1.00 46.28  ? 47   CYS A CA  1 
ATOM   234  C C   . CYS A 1 47  ? 31.257  17.991  53.931 1.00 49.41  ? 47   CYS A C   1 
ATOM   235  O O   . CYS A 1 47  ? 31.777  17.879  55.039 1.00 49.54  ? 47   CYS A O   1 
ATOM   236  C CB  . CYS A 1 47  ? 29.797  20.002  54.088 1.00 46.97  ? 47   CYS A CB  1 
ATOM   237  S SG  . CYS A 1 47  ? 29.379  21.652  53.497 1.00 51.18  ? 47   CYS A SG  1 
ATOM   238  N N   . VAL A 1 48  ? 30.901  16.939  53.199 1.00 44.75  ? 48   VAL A N   1 
ATOM   239  C CA  . VAL A 1 48  ? 31.021  15.588  53.737 1.00 43.25  ? 48   VAL A CA  1 
ATOM   240  C C   . VAL A 1 48  ? 31.894  14.631  52.923 1.00 45.61  ? 48   VAL A C   1 
ATOM   241  O O   . VAL A 1 48  ? 32.727  13.919  53.479 1.00 45.31  ? 48   VAL A O   1 
ATOM   242  C CB  . VAL A 1 48  ? 29.646  14.996  54.093 1.00 46.02  ? 48   VAL A CB  1 
ATOM   243  C CG1 . VAL A 1 48  ? 29.802  13.635  54.769 1.00 45.26  ? 48   VAL A CG1 1 
ATOM   244  C CG2 . VAL A 1 48  ? 28.888  15.960  54.989 1.00 45.38  ? 48   VAL A CG2 1 
ATOM   245  N N   . GLN A 1 49  ? 31.721  14.629  51.607 1.00 41.30  ? 49   GLN A N   1 
ATOM   246  C CA  . GLN A 1 49  ? 32.482  13.720  50.760 1.00 40.96  ? 49   GLN A CA  1 
ATOM   247  C C   . GLN A 1 49  ? 33.818  14.329  50.337 1.00 47.90  ? 49   GLN A C   1 
ATOM   248  O O   . GLN A 1 49  ? 33.897  15.520  50.035 1.00 47.62  ? 49   GLN A O   1 
ATOM   249  C CB  . GLN A 1 49  ? 31.665  13.316  49.533 1.00 41.23  ? 49   GLN A CB  1 
ATOM   250  C CG  . GLN A 1 49  ? 30.357  12.607  49.865 1.00 35.13  ? 49   GLN A CG  1 
ATOM   251  C CD  . GLN A 1 49  ? 30.537  11.465  50.843 1.00 42.67  ? 49   GLN A CD  1 
ATOM   252  O OE1 . GLN A 1 49  ? 31.447  10.647  50.706 1.00 37.45  ? 49   GLN A OE1 1 
ATOM   253  N NE2 . GLN A 1 49  ? 29.667  11.404  51.840 1.00 34.39  ? 49   GLN A NE2 1 
ATOM   254  N N   . LYS A 1 50  ? 34.864  13.507  50.323 1.00 47.18  ? 50   LYS A N   1 
ATOM   255  C CA  . LYS A 1 50  ? 36.177  13.951  49.867 1.00 48.02  ? 50   LYS A CA  1 
ATOM   256  C C   . LYS A 1 50  ? 36.576  13.337  48.531 1.00 51.97  ? 50   LYS A C   1 
ATOM   257  O O   . LYS A 1 50  ? 37.442  13.866  47.838 1.00 52.34  ? 50   LYS A O   1 
ATOM   258  C CB  . LYS A 1 50  ? 37.260  13.655  50.910 1.00 51.06  ? 50   LYS A CB  1 
ATOM   259  C CG  . LYS A 1 50  ? 36.993  14.212  52.297 1.00 66.37  ? 50   LYS A CG  1 
ATOM   260  C CD  . LYS A 1 50  ? 36.275  13.188  53.158 1.00 79.21  ? 50   LYS A CD  1 
ATOM   261  C CE  . LYS A 1 50  ? 36.516  13.444  54.638 1.00 92.23  ? 50   LYS A CE  1 
ATOM   262  N NZ  . LYS A 1 50  ? 37.950  13.283  55.007 1.00 100.86 ? 50   LYS A NZ  1 
ATOM   263  N N   . GLU A 1 51  ? 35.984  12.193  48.198 1.00 47.55  ? 51   GLU A N   1 
ATOM   264  C CA  . GLU A 1 51  ? 36.335  11.478  46.970 1.00 46.32  ? 51   GLU A CA  1 
ATOM   265  C C   . GLU A 1 51  ? 35.143  11.388  46.035 1.00 49.05  ? 51   GLU A C   1 
ATOM   266  O O   . GLU A 1 51  ? 35.278  11.555  44.818 1.00 49.06  ? 51   GLU A O   1 
ATOM   267  C CB  . GLU A 1 51  ? 36.799  10.058  47.282 1.00 47.15  ? 51   GLU A CB  1 
ATOM   268  C CG  . GLU A 1 51  ? 37.956  9.962   48.238 1.00 56.14  ? 51   GLU A CG  1 
ATOM   269  C CD  . GLU A 1 51  ? 38.560  8.573   48.256 1.00 75.80  ? 51   GLU A CD  1 
ATOM   270  O OE1 . GLU A 1 51  ? 38.301  7.797   47.312 1.00 59.41  ? 51   GLU A OE1 1 
ATOM   271  O OE2 . GLU A 1 51  ? 39.305  8.260   49.207 1.00 75.18  ? 51   GLU A OE2 1 
ATOM   272  N N   . VAL A 1 52  ? 33.987  11.055  46.606 1.00 43.13  ? 52   VAL A N   1 
ATOM   273  C CA  . VAL A 1 52  ? 32.783  10.832  45.814 1.00 41.04  ? 52   VAL A CA  1 
ATOM   274  C C   . VAL A 1 52  ? 32.323  12.108  45.125 1.00 41.47  ? 52   VAL A C   1 
ATOM   275  O O   . VAL A 1 52  ? 32.145  13.133  45.767 1.00 40.02  ? 52   VAL A O   1 
ATOM   276  C CB  . VAL A 1 52  ? 31.661  10.170  46.648 1.00 43.65  ? 52   VAL A CB  1 
ATOM   277  C CG1 . VAL A 1 52  ? 30.319  10.364  45.977 1.00 43.29  ? 52   VAL A CG1 1 
ATOM   278  C CG2 . VAL A 1 52  ? 31.951  8.701   46.831 1.00 42.85  ? 52   VAL A CG2 1 
ATOM   279  N N   . LEU A 1 53  ? 32.174  12.045  43.807 1.00 38.04  ? 53   LEU A N   1 
ATOM   280  C CA  . LEU A 1 53  ? 31.749  13.202  43.034 1.00 38.11  ? 53   LEU A CA  1 
ATOM   281  C C   . LEU A 1 53  ? 30.438  12.902  42.334 1.00 39.01  ? 53   LEU A C   1 
ATOM   282  O O   . LEU A 1 53  ? 30.108  11.747  42.079 1.00 38.15  ? 53   LEU A O   1 
ATOM   283  C CB  . LEU A 1 53  ? 32.815  13.582  41.993 1.00 38.96  ? 53   LEU A CB  1 
ATOM   284  C CG  . LEU A 1 53  ? 34.207  14.005  42.475 1.00 44.02  ? 53   LEU A CG  1 
ATOM   285  C CD1 . LEU A 1 53  ? 35.175  14.163  41.293 1.00 44.28  ? 53   LEU A CD1 1 
ATOM   286  C CD2 . LEU A 1 53  ? 34.128  15.279  43.279 1.00 46.95  ? 53   LEU A CD2 1 
ATOM   287  N N   . PRO A 1 54  ? 29.707  13.951  41.947 1.00 34.40  ? 54   PRO A N   1 
ATOM   288  C CA  . PRO A 1 54  ? 28.397  13.808  41.303 1.00 33.86  ? 54   PRO A CA  1 
ATOM   289  C C   . PRO A 1 54  ? 28.384  12.844  40.113 1.00 38.83  ? 54   PRO A C   1 
ATOM   290  O O   . PRO A 1 54  ? 27.418  12.100  39.930 1.00 39.77  ? 54   PRO A O   1 
ATOM   291  C CB  . PRO A 1 54  ? 28.072  15.237  40.859 1.00 35.52  ? 54   PRO A CB  1 
ATOM   292  C CG  . PRO A 1 54  ? 28.758  16.108  41.893 1.00 40.07  ? 54   PRO A CG  1 
ATOM   293  C CD  . PRO A 1 54  ? 30.026  15.358  42.266 1.00 36.09  ? 54   PRO A CD  1 
ATOM   294  N N   . SER A 1 55  ? 29.440  12.854  39.303 1.00 35.44  ? 55   SER A N   1 
ATOM   295  C CA  . SER A 1 55  ? 29.533  11.944  38.154 1.00 35.43  ? 55   SER A CA  1 
ATOM   296  C C   . SER A 1 55  ? 29.699  10.478  38.559 1.00 39.54  ? 55   SER A C   1 
ATOM   297  O O   . SER A 1 55  ? 29.358  9.579   37.798 1.00 39.80  ? 55   SER A O   1 
ATOM   298  C CB  . SER A 1 55  ? 30.670  12.349  37.220 1.00 39.58  ? 55   SER A CB  1 
ATOM   299  O OG  . SER A 1 55  ? 31.918  12.190  37.869 1.00 49.87  ? 55   SER A OG  1 
ATOM   300  N N   . MET A 1 56  ? 30.251  10.237  39.744 1.00 35.96  ? 56   MET A N   1 
ATOM   301  C CA  . MET A 1 56  ? 30.293  8.884   40.293 1.00 35.24  ? 56   MET A CA  1 
ATOM   302  C C   . MET A 1 56  ? 28.911  8.463   40.812 1.00 38.24  ? 56   MET A C   1 
ATOM   303  O O   . MET A 1 56  ? 28.469  7.332   40.585 1.00 38.10  ? 56   MET A O   1 
ATOM   304  C CB  . MET A 1 56  ? 31.331  8.792   41.410 1.00 37.58  ? 56   MET A CB  1 
ATOM   305  C CG  . MET A 1 56  ? 32.727  9.210   40.984 1.00 41.42  ? 56   MET A CG  1 
ATOM   306  S SD  . MET A 1 56  ? 33.849  9.391   42.381 1.00 46.44  ? 56   MET A SD  1 
ATOM   307  C CE  . MET A 1 56  ? 35.173  10.443  41.609 1.00 43.50  ? 56   MET A CE  1 
ATOM   308  N N   . ARG A 1 57  ? 28.248  9.366   41.536 1.00 32.71  ? 57   ARG A N   1 
ATOM   309  C CA  . ARG A 1 57  ? 26.857  9.160   41.919 1.00 31.48  ? 57   ARG A CA  1 
ATOM   310  C C   . ARG A 1 57  ? 26.022  8.817   40.687 1.00 34.90  ? 57   ARG A C   1 
ATOM   311  O O   . ARG A 1 57  ? 25.191  7.915   40.724 1.00 33.98  ? 57   ARG A O   1 
ATOM   312  C CB  . ARG A 1 57  ? 26.300  10.412  42.595 1.00 30.39  ? 57   ARG A CB  1 
ATOM   313  C CG  . ARG A 1 57  ? 24.935  10.239  43.249 1.00 35.90  ? 57   ARG A CG  1 
ATOM   314  C CD  . ARG A 1 57  ? 24.189  11.571  43.336 1.00 39.46  ? 57   ARG A CD  1 
ATOM   315  N NE  . ARG A 1 57  ? 22.826  11.395  43.828 1.00 37.10  ? 57   ARG A NE  1 
ATOM   316  C CZ  . ARG A 1 57  ? 21.751  11.368  43.053 1.00 44.79  ? 57   ARG A CZ  1 
ATOM   317  N NH1 . ARG A 1 57  ? 21.879  11.538  41.747 1.00 35.26  ? 57   ARG A NH1 1 
ATOM   318  N NH2 . ARG A 1 57  ? 20.550  11.184  43.584 1.00 31.04  ? 57   ARG A NH2 1 
ATOM   319  N N   . LYS A 1 58  ? 26.200  9.583   39.614 1.00 32.76  ? 58   LYS A N   1 
ATOM   320  C CA  . LYS A 1 58  ? 25.511  9.308   38.354 1.00 32.52  ? 58   LYS A CA  1 
ATOM   321  C C   . LYS A 1 58  ? 25.774  7.883   37.909 1.00 36.36  ? 58   LYS A C   1 
ATOM   322  O O   . LYS A 1 58  ? 24.877  7.189   37.446 1.00 35.53  ? 58   LYS A O   1 
ATOM   323  C CB  . LYS A 1 58  ? 26.006  10.259  37.263 1.00 35.29  ? 58   LYS A CB  1 
ATOM   324  C CG  . LYS A 1 58  ? 25.498  9.942   35.864 1.00 44.29  ? 58   LYS A CG  1 
ATOM   325  C CD  . LYS A 1 58  ? 24.184  10.657  35.592 1.00 59.27  ? 58   LYS A CD  1 
ATOM   326  C CE  . LYS A 1 58  ? 23.856  10.703  34.107 1.00 71.91  ? 58   LYS A CE  1 
ATOM   327  N NZ  . LYS A 1 58  ? 23.382  9.384   33.598 1.00 86.28  ? 58   LYS A NZ  1 
ATOM   328  N N   . ILE A 1 59  ? 27.023  7.456   38.020 1.00 33.99  ? 59   ILE A N   1 
ATOM   329  C CA  . ILE A 1 59  ? 27.408  6.135   37.548 1.00 33.53  ? 59   ILE A CA  1 
ATOM   330  C C   . ILE A 1 59  ? 26.733  5.027   38.346 1.00 35.10  ? 59   ILE A C   1 
ATOM   331  O O   . ILE A 1 59  ? 26.132  4.109   37.775 1.00 33.14  ? 59   ILE A O   1 
ATOM   332  C CB  . ILE A 1 59  ? 28.945  5.984   37.491 1.00 36.82  ? 59   ILE A CB  1 
ATOM   333  C CG1 . ILE A 1 59  ? 29.496  6.727   36.268 1.00 37.46  ? 59   ILE A CG1 1 
ATOM   334  C CG2 . ILE A 1 59  ? 29.330  4.509   37.420 1.00 38.12  ? 59   ILE A CG2 1 
ATOM   335  C CD1 . ILE A 1 59  ? 31.019  6.830   36.238 1.00 45.84  ? 59   ILE A CD1 1 
ATOM   336  N N   . VAL A 1 60  ? 26.832  5.127   39.670 1.00 31.40  ? 60   VAL A N   1 
ATOM   337  C CA  . VAL A 1 60  ? 26.185  4.178   40.565 1.00 30.86  ? 60   VAL A CA  1 
ATOM   338  C C   . VAL A 1 60  ? 24.679  4.185   40.412 1.00 32.86  ? 60   VAL A C   1 
ATOM   339  O O   . VAL A 1 60  ? 24.046  3.129   40.461 1.00 32.54  ? 60   VAL A O   1 
ATOM   340  C CB  . VAL A 1 60  ? 26.596  4.395   42.033 1.00 35.85  ? 60   VAL A CB  1 
ATOM   341  C CG1 . VAL A 1 60  ? 25.959  3.328   42.910 1.00 35.92  ? 60   VAL A CG1 1 
ATOM   342  C CG2 . VAL A 1 60  ? 28.107  4.340   42.161 1.00 35.95  ? 60   VAL A CG2 1 
ATOM   343  N N   . ALA A 1 61  ? 24.108  5.376   40.248 1.00 28.07  ? 61   ALA A N   1 
ATOM   344  C CA  . ALA A 1 61  ? 22.673  5.523   40.056 1.00 27.73  ? 61   ALA A CA  1 
ATOM   345  C C   . ALA A 1 61  ? 22.147  4.885   38.766 1.00 33.64  ? 61   ALA A C   1 
ATOM   346  O O   . ALA A 1 61  ? 21.096  4.225   38.782 1.00 35.18  ? 61   ALA A O   1 
ATOM   347  C CB  . ALA A 1 61  ? 22.270  6.985   40.142 1.00 28.39  ? 61   ALA A CB  1 
ATOM   348  N N   . THR A 1 62  ? 22.855  5.079   37.653 1.00 29.85  ? 62   THR A N   1 
ATOM   349  C CA  . THR A 1 62  ? 22.498  4.413   36.393 1.00 30.05  ? 62   THR A CA  1 
ATOM   350  C C   . THR A 1 62  ? 22.741  2.896   36.469 1.00 34.21  ? 62   THR A C   1 
ATOM   351  O O   . THR A 1 62  ? 21.975  2.091   35.936 1.00 32.48  ? 62   THR A O   1 
ATOM   352  C CB  . THR A 1 62  ? 23.150  5.094   35.128 1.00 43.86  ? 62   THR A CB  1 
ATOM   353  O OG1 . THR A 1 62  ? 23.084  4.215   33.993 1.00 43.99  ? 62   THR A OG1 1 
ATOM   354  C CG2 . THR A 1 62  ? 24.585  5.426   35.366 1.00 49.43  ? 62   THR A CG2 1 
ATOM   355  N N   . TRP A 1 63  ? 23.763  2.497   37.211 1.00 33.00  ? 63   TRP A N   1 
ATOM   356  C CA  . TRP A 1 63  ? 23.901  1.084   37.517 1.00 33.41  ? 63   TRP A CA  1 
ATOM   357  C C   . TRP A 1 63  ? 22.633  0.584   38.234 1.00 36.66  ? 63   TRP A C   1 
ATOM   358  O O   . TRP A 1 63  ? 21.986  -0.370  37.778 1.00 35.38  ? 63   TRP A O   1 
ATOM   359  C CB  . TRP A 1 63  ? 25.169  0.807   38.343 1.00 32.38  ? 63   TRP A CB  1 
ATOM   360  C CG  . TRP A 1 63  ? 25.278  -0.628  38.723 1.00 33.59  ? 63   TRP A CG  1 
ATOM   361  C CD1 . TRP A 1 63  ? 25.534  -1.682  37.887 1.00 36.38  ? 63   TRP A CD1 1 
ATOM   362  C CD2 . TRP A 1 63  ? 24.986  -1.196  40.007 1.00 33.86  ? 63   TRP A CD2 1 
ATOM   363  N NE1 . TRP A 1 63  ? 25.437  -2.867  38.577 1.00 35.54  ? 63   TRP A NE1 1 
ATOM   364  C CE2 . TRP A 1 63  ? 25.123  -2.599  39.881 1.00 37.29  ? 63   TRP A CE2 1 
ATOM   365  C CE3 . TRP A 1 63  ? 24.652  -0.654  41.256 1.00 35.71  ? 63   TRP A CE3 1 
ATOM   366  C CZ2 . TRP A 1 63  ? 24.925  -3.468  40.959 1.00 36.39  ? 63   TRP A CZ2 1 
ATOM   367  C CZ3 . TRP A 1 63  ? 24.444  -1.522  42.321 1.00 36.80  ? 63   TRP A CZ3 1 
ATOM   368  C CH2 . TRP A 1 63  ? 24.584  -2.917  42.162 1.00 37.56  ? 63   TRP A CH2 1 
ATOM   369  N N   . MET A 1 64  ? 22.246  1.281   39.306 1.00 32.87  ? 64   MET A N   1 
ATOM   370  C CA  . MET A 1 64  ? 21.117  0.868   40.152 1.00 31.98  ? 64   MET A CA  1 
ATOM   371  C C   . MET A 1 64  ? 19.798  0.776   39.388 1.00 35.61  ? 64   MET A C   1 
ATOM   372  O O   . MET A 1 64  ? 18.979  -0.103  39.637 1.00 35.28  ? 64   MET A O   1 
ATOM   373  C CB  . MET A 1 64  ? 20.970  1.802   41.363 1.00 34.06  ? 64   MET A CB  1 
ATOM   374  C CG  . MET A 1 64  ? 22.139  1.745   42.339 1.00 37.48  ? 64   MET A CG  1 
ATOM   375  S SD  . MET A 1 64  ? 22.240  3.126   43.529 1.00 41.98  ? 64   MET A SD  1 
ATOM   376  C CE  . MET A 1 64  ? 20.858  2.730   44.621 1.00 38.10  ? 64   MET A CE  1 
ATOM   377  N N   . LEU A 1 65  ? 19.607  1.691   38.450 1.00 31.63  ? 65   LEU A N   1 
ATOM   378  C CA  . LEU A 1 65  ? 18.396  1.743   37.645 1.00 30.91  ? 65   LEU A CA  1 
ATOM   379  C C   . LEU A 1 65  ? 18.318  0.562   36.661 1.00 36.71  ? 65   LEU A C   1 
ATOM   380  O O   . LEU A 1 65  ? 17.251  -0.030  36.471 1.00 35.72  ? 65   LEU A O   1 
ATOM   381  C CB  . LEU A 1 65  ? 18.346  3.102   36.922 1.00 30.56  ? 65   LEU A CB  1 
ATOM   382  C CG  . LEU A 1 65  ? 17.203  3.560   36.010 1.00 34.77  ? 65   LEU A CG  1 
ATOM   383  C CD1 . LEU A 1 65  ? 17.566  3.458   34.543 1.00 34.45  ? 65   LEU A CD1 1 
ATOM   384  C CD2 . LEU A 1 65  ? 15.866  2.900   36.322 1.00 37.99  ? 65   LEU A CD2 1 
ATOM   385  N N   . GLU A 1 66  ? 19.450  0.214   36.047 1.00 34.91  ? 66   GLU A N   1 
ATOM   386  C CA  . GLU A 1 66  ? 19.513  -0.943  35.143 1.00 35.07  ? 66   GLU A CA  1 
ATOM   387  C C   . GLU A 1 66  ? 19.209  -2.264  35.853 1.00 38.13  ? 66   GLU A C   1 
ATOM   388  O O   . GLU A 1 66  ? 18.521  -3.132  35.305 1.00 38.56  ? 66   GLU A O   1 
ATOM   389  C CB  . GLU A 1 66  ? 20.873  -1.019  34.446 1.00 36.49  ? 66   GLU A CB  1 
ATOM   390  C CG  . GLU A 1 66  ? 21.122  0.122   33.470 1.00 49.68  ? 66   GLU A CG  1 
ATOM   391  C CD  . GLU A 1 66  ? 22.587  0.297   33.118 1.00 69.88  ? 66   GLU A CD  1 
ATOM   392  O OE1 . GLU A 1 66  ? 23.437  -0.368  33.748 1.00 62.73  ? 66   GLU A OE1 1 
ATOM   393  O OE2 . GLU A 1 66  ? 22.889  1.130   32.235 1.00 66.01  ? 66   GLU A OE2 1 
ATOM   394  N N   . VAL A 1 67  ? 19.722  -2.406  37.072 1.00 31.85  ? 67   VAL A N   1 
ATOM   395  C CA  . VAL A 1 67  ? 19.372  -3.524  37.936 1.00 30.58  ? 67   VAL A CA  1 
ATOM   396  C C   . VAL A 1 67  ? 17.873  -3.614  38.223 1.00 34.38  ? 67   VAL A C   1 
ATOM   397  O O   . VAL A 1 67  ? 17.270  -4.668  38.046 1.00 33.71  ? 67   VAL A O   1 
ATOM   398  C CB  . VAL A 1 67  ? 20.192  -3.507  39.233 1.00 33.69  ? 67   VAL A CB  1 
ATOM   399  C CG1 . VAL A 1 67  ? 19.646  -4.534  40.221 1.00 33.69  ? 67   VAL A CG1 1 
ATOM   400  C CG2 . VAL A 1 67  ? 21.651  -3.767  38.927 1.00 32.97  ? 67   VAL A CG2 1 
ATOM   401  N N   . CYS A 1 68  ? 17.273  -2.515  38.674 1.00 31.42  ? 68   CYS A N   1 
ATOM   402  C CA  . CYS A 1 68  ? 15.824  -2.480  38.889 1.00 31.72  ? 68   CYS A CA  1 
ATOM   403  C C   . CYS A 1 68  ? 15.027  -2.790  37.621 1.00 36.74  ? 68   CYS A C   1 
ATOM   404  O O   . CYS A 1 68  ? 13.992  -3.461  37.673 1.00 36.77  ? 68   CYS A O   1 
ATOM   405  C CB  . CYS A 1 68  ? 15.390  -1.121  39.452 1.00 31.98  ? 68   CYS A CB  1 
ATOM   406  S SG  . CYS A 1 68  ? 16.213  -0.703  40.999 1.00 35.95  ? 68   CYS A SG  1 
ATOM   407  N N   . GLU A 1 69  ? 15.461  -2.219  36.505 1.00 34.72  ? 69   GLU A N   1 
ATOM   408  C CA  . GLU A 1 69  ? 14.863  -2.501  35.204 1.00 35.81  ? 69   GLU A CA  1 
ATOM   409  C C   . GLU A 1 69  ? 15.034  -3.959  34.798 1.00 42.56  ? 69   GLU A C   1 
ATOM   410  O O   . GLU A 1 69  ? 14.095  -4.605  34.343 1.00 42.26  ? 69   GLU A O   1 
ATOM   411  C CB  . GLU A 1 69  ? 15.477  -1.606  34.130 1.00 37.34  ? 69   GLU A CB  1 
ATOM   412  C CG  . GLU A 1 69  ? 14.902  -0.202  34.071 1.00 50.00  ? 69   GLU A CG  1 
ATOM   413  C CD  . GLU A 1 69  ? 15.496  0.611   32.934 1.00 72.71  ? 69   GLU A CD  1 
ATOM   414  O OE1 . GLU A 1 69  ? 16.546  0.197   32.392 1.00 63.03  ? 69   GLU A OE1 1 
ATOM   415  O OE2 . GLU A 1 69  ? 14.924  1.667   32.592 1.00 69.79  ? 69   GLU A OE2 1 
ATOM   416  N N   . GLU A 1 70  ? 16.256  -4.457  34.909 1.00 41.71  ? 70   GLU A N   1 
ATOM   417  C CA  . GLU A 1 70  ? 16.538  -5.848  34.584 1.00 42.52  ? 70   GLU A CA  1 
ATOM   418  C C   . GLU A 1 70  ? 15.726  -6.799  35.461 1.00 45.69  ? 70   GLU A C   1 
ATOM   419  O O   . GLU A 1 70  ? 15.171  -7.784  34.978 1.00 45.84  ? 70   GLU A O   1 
ATOM   420  C CB  . GLU A 1 70  ? 18.032  -6.130  34.744 1.00 44.45  ? 70   GLU A CB  1 
ATOM   421  C CG  . GLU A 1 70  ? 18.491  -7.380  34.019 1.00 57.68  ? 70   GLU A CG  1 
ATOM   422  C CD  . GLU A 1 70  ? 18.327  -7.256  32.523 1.00 80.08  ? 70   GLU A CD  1 
ATOM   423  O OE1 . GLU A 1 70  ? 18.877  -6.288  31.951 1.00 78.70  ? 70   GLU A OE1 1 
ATOM   424  O OE2 . GLU A 1 70  ? 17.637  -8.114  31.925 1.00 69.38  ? 70   GLU A OE2 1 
ATOM   425  N N   . GLN A 1 71  ? 15.612  -6.471  36.743 1.00 41.30  ? 71   GLN A N   1 
ATOM   426  C CA  . GLN A 1 71  ? 14.915  -7.336  37.690 1.00 40.56  ? 71   GLN A CA  1 
ATOM   427  C C   . GLN A 1 71  ? 13.421  -7.070  37.744 1.00 44.35  ? 71   GLN A C   1 
ATOM   428  O O   . GLN A 1 71  ? 12.693  -7.749  38.470 1.00 43.77  ? 71   GLN A O   1 
ATOM   429  C CB  . GLN A 1 71  ? 15.510  -7.194  39.093 1.00 41.54  ? 71   GLN A CB  1 
ATOM   430  C CG  . GLN A 1 71  ? 16.894  -7.771  39.226 1.00 44.98  ? 71   GLN A CG  1 
ATOM   431  C CD  . GLN A 1 71  ? 16.943  -9.220  38.802 1.00 58.29  ? 71   GLN A CD  1 
ATOM   432  O OE1 . GLN A 1 71  ? 16.236  -10.069 39.349 1.00 52.13  ? 71   GLN A OE1 1 
ATOM   433  N NE2 . GLN A 1 71  ? 17.727  -9.501  37.777 1.00 47.98  ? 71   GLN A NE2 1 
ATOM   434  N N   . LYS A 1 72  ? 12.968  -6.078  36.983 1.00 40.58  ? 72   LYS A N   1 
ATOM   435  C CA  . LYS A 1 72  ? 11.574  -5.659  37.035 1.00 39.51  ? 72   LYS A CA  1 
ATOM   436  C C   . LYS A 1 72  ? 11.144  -5.438  38.482 1.00 40.12  ? 72   LYS A C   1 
ATOM   437  O O   . LYS A 1 72  ? 10.170  -6.017  38.953 1.00 38.84  ? 72   LYS A O   1 
ATOM   438  C CB  . LYS A 1 72  ? 10.678  -6.681  36.336 1.00 42.41  ? 72   LYS A CB  1 
ATOM   439  C CG  . LYS A 1 72  ? 10.977  -6.812  34.853 1.00 61.84  ? 72   LYS A CG  1 
ATOM   440  C CD  . LYS A 1 72  ? 10.240  -7.977  34.220 1.00 75.61  ? 72   LYS A CD  1 
ATOM   441  C CE  . LYS A 1 72  ? 10.630  -8.138  32.757 1.00 92.42  ? 72   LYS A CE  1 
ATOM   442  N NZ  . LYS A 1 72  ? 10.011  -9.345  32.135 1.00 104.43 ? 72   LYS A NZ  1 
ATOM   443  N N   . CYS A 1 73  ? 11.897  -4.601  39.185 1.00 36.59  ? 73   CYS A N   1 
ATOM   444  C CA  . CYS A 1 73  ? 11.568  -4.233  40.560 1.00 35.32  ? 73   CYS A CA  1 
ATOM   445  C C   . CYS A 1 73  ? 10.312  -3.383  40.628 1.00 37.94  ? 73   CYS A C   1 
ATOM   446  O O   . CYS A 1 73  ? 9.922   -2.762  39.640 1.00 37.27  ? 73   CYS A O   1 
ATOM   447  C CB  . CYS A 1 73  ? 12.733  -3.479  41.192 1.00 34.82  ? 73   CYS A CB  1 
ATOM   448  S SG  . CYS A 1 73  ? 14.151  -4.511  41.474 1.00 38.84  ? 73   CYS A SG  1 
ATOM   449  N N   . GLU A 1 74  ? 9.661   -3.380  41.788 1.00 34.61  ? 74   GLU A N   1 
ATOM   450  C CA  . GLU A 1 74  ? 8.635   -2.378  42.056 1.00 35.23  ? 74   GLU A CA  1 
ATOM   451  C C   . GLU A 1 74  ? 9.211   -0.994  41.746 1.00 39.56  ? 74   GLU A C   1 
ATOM   452  O O   . GLU A 1 74  ? 10.349  -0.691  42.109 1.00 38.09  ? 74   GLU A O   1 
ATOM   453  C CB  . GLU A 1 74  ? 8.186   -2.441  43.518 1.00 36.46  ? 74   GLU A CB  1 
ATOM   454  C CG  . GLU A 1 74  ? 7.483   -3.728  43.885 1.00 47.40  ? 74   GLU A CG  1 
ATOM   455  C CD  . GLU A 1 74  ? 6.256   -3.973  43.041 1.00 67.39  ? 74   GLU A CD  1 
ATOM   456  O OE1 . GLU A 1 74  ? 5.594   -2.986  42.665 1.00 52.29  ? 74   GLU A OE1 1 
ATOM   457  O OE2 . GLU A 1 74  ? 5.944   -5.152  42.763 1.00 72.89  ? 74   GLU A OE2 1 
ATOM   458  N N   . GLU A 1 75  ? 8.431   -0.176  41.045 1.00 37.14  ? 75   GLU A N   1 
ATOM   459  C CA  . GLU A 1 75  ? 8.878   1.148   40.618 1.00 37.08  ? 75   GLU A CA  1 
ATOM   460  C C   . GLU A 1 75  ? 9.560   1.981   41.714 1.00 40.79  ? 75   GLU A C   1 
ATOM   461  O O   . GLU A 1 75  ? 10.456  2.770   41.412 1.00 41.32  ? 75   GLU A O   1 
ATOM   462  C CB  . GLU A 1 75  ? 7.723   1.939   39.997 1.00 38.30  ? 75   GLU A CB  1 
ATOM   463  C CG  . GLU A 1 75  ? 7.502   1.664   38.515 1.00 48.69  ? 75   GLU A CG  1 
ATOM   464  C CD  . GLU A 1 75  ? 6.873   0.303   38.253 1.00 74.81  ? 75   GLU A CD  1 
ATOM   465  O OE1 . GLU A 1 75  ? 6.577   -0.423  39.234 1.00 58.24  ? 75   GLU A OE1 1 
ATOM   466  O OE2 . GLU A 1 75  ? 6.656   -0.028  37.064 1.00 72.37  ? 75   GLU A OE2 1 
ATOM   467  N N   . GLU A 1 76  ? 9.121   1.824   42.966 1.00 34.85  ? 76   GLU A N   1 
ATOM   468  C CA  . GLU A 1 76  ? 9.601   2.658   44.068 1.00 33.91  ? 76   GLU A CA  1 
ATOM   469  C C   . GLU A 1 76  ? 11.024  2.339   44.493 1.00 34.66  ? 76   GLU A C   1 
ATOM   470  O O   . GLU A 1 76  ? 11.629  3.097   45.237 1.00 35.44  ? 76   GLU A O   1 
ATOM   471  C CB  . GLU A 1 76  ? 8.712   2.508   45.305 1.00 35.71  ? 76   GLU A CB  1 
ATOM   472  C CG  . GLU A 1 76  ? 7.234   2.764   45.098 1.00 47.80  ? 76   GLU A CG  1 
ATOM   473  C CD  . GLU A 1 76  ? 6.439   1.489   44.921 1.00 66.59  ? 76   GLU A CD  1 
ATOM   474  O OE1 . GLU A 1 76  ? 6.906   0.586   44.199 1.00 54.49  ? 76   GLU A OE1 1 
ATOM   475  O OE2 . GLU A 1 76  ? 5.327   1.407   45.482 1.00 62.10  ? 76   GLU A OE2 1 
ATOM   476  N N   . VAL A 1 77  ? 11.497  1.151   44.138 1.00 28.94  ? 77   VAL A N   1 
ATOM   477  C CA  . VAL A 1 77  ? 12.774  0.646   44.639 1.00 27.13  ? 77   VAL A CA  1 
ATOM   478  C C   . VAL A 1 77  ? 13.953  1.560   44.303 1.00 28.59  ? 77   VAL A C   1 
ATOM   479  O O   . VAL A 1 77  ? 14.752  1.895   45.169 1.00 27.79  ? 77   VAL A O   1 
ATOM   480  C CB  . VAL A 1 77  ? 12.994  -0.822  44.218 1.00 30.40  ? 77   VAL A CB  1 
ATOM   481  C CG1 . VAL A 1 77  ? 14.415  -1.267  44.502 1.00 29.70  ? 77   VAL A CG1 1 
ATOM   482  C CG2 . VAL A 1 77  ? 11.981  -1.733  44.936 1.00 30.36  ? 77   VAL A CG2 1 
ATOM   483  N N   . PHE A 1 78  ? 13.982  2.064   43.077 1.00 23.94  ? 78   PHE A N   1 
ATOM   484  C CA  . PHE A 1 78  ? 15.100  2.876   42.622 1.00 23.74  ? 78   PHE A CA  1 
ATOM   485  C C   . PHE A 1 78  ? 15.142  4.265   43.294 1.00 26.73  ? 78   PHE A C   1 
ATOM   486  O O   . PHE A 1 78  ? 16.121  4.624   43.928 1.00 26.78  ? 78   PHE A O   1 
ATOM   487  C CB  . PHE A 1 78  ? 15.099  2.950   41.081 1.00 25.63  ? 78   PHE A CB  1 
ATOM   488  C CG  . PHE A 1 78  ? 16.129  3.882   40.518 1.00 26.98  ? 78   PHE A CG  1 
ATOM   489  C CD1 . PHE A 1 78  ? 17.451  3.801   40.926 1.00 29.44  ? 78   PHE A CD1 1 
ATOM   490  C CD2 . PHE A 1 78  ? 15.766  4.866   39.607 1.00 28.40  ? 78   PHE A CD2 1 
ATOM   491  C CE1 . PHE A 1 78  ? 18.403  4.686   40.428 1.00 30.36  ? 78   PHE A CE1 1 
ATOM   492  C CE2 . PHE A 1 78  ? 16.710  5.748   39.104 1.00 30.86  ? 78   PHE A CE2 1 
ATOM   493  C CZ  . PHE A 1 78  ? 18.029  5.658   39.511 1.00 28.76  ? 78   PHE A CZ  1 
ATOM   494  N N   . PRO A 1 79  ? 14.021  5.000   43.277 1.00 23.35  ? 79   PRO A N   1 
ATOM   495  C CA  . PRO A 1 79  ? 13.993  6.279   44.004 1.00 22.16  ? 79   PRO A CA  1 
ATOM   496  C C   . PRO A 1 79  ? 14.220  6.140   45.512 1.00 26.22  ? 79   PRO A C   1 
ATOM   497  O O   . PRO A 1 79  ? 14.816  7.023   46.135 1.00 25.27  ? 79   PRO A O   1 
ATOM   498  C CB  . PRO A 1 79  ? 12.579  6.819   43.742 1.00 23.70  ? 79   PRO A CB  1 
ATOM   499  C CG  . PRO A 1 79  ? 12.022  6.001   42.629 1.00 28.66  ? 79   PRO A CG  1 
ATOM   500  C CD  . PRO A 1 79  ? 12.725  4.678   42.651 1.00 24.39  ? 79   PRO A CD  1 
ATOM   501  N N   . LEU A 1 80  ? 13.668  5.088   46.118 1.00 23.07  ? 80   LEU A N   1 
ATOM   502  C CA  . LEU A 1 80  ? 13.883  4.848   47.543 1.00 23.18  ? 80   LEU A CA  1 
ATOM   503  C C   . LEU A 1 80  ? 15.347  4.546   47.854 1.00 27.16  ? 80   LEU A C   1 
ATOM   504  O O   . LEU A 1 80  ? 15.916  5.066   48.812 1.00 25.48  ? 80   LEU A O   1 
ATOM   505  C CB  . LEU A 1 80  ? 12.996  3.701   48.035 1.00 23.48  ? 80   LEU A CB  1 
ATOM   506  C CG  . LEU A 1 80  ? 13.043  3.358   49.529 1.00 27.67  ? 80   LEU A CG  1 
ATOM   507  C CD1 . LEU A 1 80  ? 12.654  4.544   50.418 1.00 26.93  ? 80   LEU A CD1 1 
ATOM   508  C CD2 . LEU A 1 80  ? 12.160  2.155   49.824 1.00 29.66  ? 80   LEU A CD2 1 
ATOM   509  N N   . ALA A 1 81  ? 15.965  3.716   47.024 1.00 25.23  ? 81   ALA A N   1 
ATOM   510  C CA  . ALA A 1 81  ? 17.381  3.395   47.197 1.00 25.54  ? 81   ALA A CA  1 
ATOM   511  C C   . ALA A 1 81  ? 18.310  4.617   47.033 1.00 28.71  ? 81   ALA A C   1 
ATOM   512  O O   . ALA A 1 81  ? 19.290  4.754   47.763 1.00 27.74  ? 81   ALA A O   1 
ATOM   513  C CB  . ALA A 1 81  ? 17.792  2.249   46.259 1.00 26.30  ? 81   ALA A CB  1 
ATOM   514  N N   . MET A 1 82  ? 17.964  5.533   46.128 1.00 25.51  ? 82   MET A N   1 
ATOM   515  C CA  . MET A 1 82  ? 18.712  6.797   45.990 1.00 24.83  ? 82   MET A CA  1 
ATOM   516  C C   . MET A 1 82  ? 18.562  7.752   47.177 1.00 28.04  ? 82   MET A C   1 
ATOM   517  O O   . MET A 1 82  ? 19.517  8.411   47.582 1.00 26.49  ? 82   MET A O   1 
ATOM   518  C CB  . MET A 1 82  ? 18.357  7.508   44.683 1.00 27.09  ? 82   MET A CB  1 
ATOM   519  C CG  . MET A 1 82  ? 18.809  6.749   43.430 1.00 30.03  ? 82   MET A CG  1 
ATOM   520  S SD  . MET A 1 82  ? 20.606  6.433   43.440 1.00 33.24  ? 82   MET A SD  1 
ATOM   521  C CE  . MET A 1 82  ? 21.226  8.064   43.309 1.00 30.32  ? 82   MET A CE  1 
ATOM   522  N N   . ASN A 1 83  ? 17.361  7.805   47.744 1.00 25.57  ? 83   ASN A N   1 
ATOM   523  C CA  . ASN A 1 83  ? 17.110  8.558   48.969 1.00 24.66  ? 83   ASN A CA  1 
ATOM   524  C C   . ASN A 1 83  ? 18.054  8.037   50.046 1.00 27.67  ? 83   ASN A C   1 
ATOM   525  O O   . ASN A 1 83  ? 18.718  8.801   50.753 1.00 28.67  ? 83   ASN A O   1 
ATOM   526  C CB  . ASN A 1 83  ? 15.635  8.369   49.385 1.00 26.08  ? 83   ASN A CB  1 
ATOM   527  C CG  . ASN A 1 83  ? 15.302  9.014   50.730 1.00 41.28  ? 83   ASN A CG  1 
ATOM   528  O OD1 . ASN A 1 83  ? 15.402  8.377   51.778 1.00 35.58  ? 83   ASN A OD1 1 
ATOM   529  N ND2 . ASN A 1 83  ? 14.815  10.245  50.691 1.00 33.81  ? 83   ASN A ND2 1 
ATOM   530  N N   . TYR A 1 84  ? 18.144  6.720   50.137 1.00 24.28  ? 84   TYR A N   1 
ATOM   531  C CA  . TYR A 1 84  ? 19.052  6.073   51.067 1.00 24.09  ? 84   TYR A CA  1 
ATOM   532  C C   . TYR A 1 84  ? 20.487  6.523   50.802 1.00 28.49  ? 84   TYR A C   1 
ATOM   533  O O   . TYR A 1 84  ? 21.232  6.868   51.730 1.00 26.29  ? 84   TYR A O   1 
ATOM   534  C CB  . TYR A 1 84  ? 18.953  4.552   50.908 1.00 24.94  ? 84   TYR A CB  1 
ATOM   535  C CG  . TYR A 1 84  ? 17.675  3.936   51.450 1.00 24.72  ? 84   TYR A CG  1 
ATOM   536  C CD1 . TYR A 1 84  ? 16.777  4.681   52.204 1.00 25.89  ? 84   TYR A CD1 1 
ATOM   537  C CD2 . TYR A 1 84  ? 17.372  2.606   51.212 1.00 24.99  ? 84   TYR A CD2 1 
ATOM   538  C CE1 . TYR A 1 84  ? 15.618  4.114   52.701 1.00 24.23  ? 84   TYR A CE1 1 
ATOM   539  C CE2 . TYR A 1 84  ? 16.185  2.046   51.674 1.00 25.45  ? 84   TYR A CE2 1 
ATOM   540  C CZ  . TYR A 1 84  ? 15.322  2.804   52.426 1.00 28.20  ? 84   TYR A CZ  1 
ATOM   541  O OH  . TYR A 1 84  ? 14.170  2.230   52.926 1.00 26.05  ? 84   TYR A OH  1 
ATOM   542  N N   . LEU A 1 85  ? 20.871  6.482   49.525 1.00 26.92  ? 85   LEU A N   1 
ATOM   543  C CA  . LEU A 1 85  ? 22.242  6.772   49.115 1.00 27.45  ? 85   LEU A CA  1 
ATOM   544  C C   . LEU A 1 85  ? 22.628  8.204   49.414 1.00 32.11  ? 85   LEU A C   1 
ATOM   545  O O   . LEU A 1 85  ? 23.649  8.451   50.045 1.00 32.61  ? 85   LEU A O   1 
ATOM   546  C CB  . LEU A 1 85  ? 22.473  6.431   47.633 1.00 27.71  ? 85   LEU A CB  1 
ATOM   547  C CG  . LEU A 1 85  ? 23.892  6.673   47.093 1.00 33.39  ? 85   LEU A CG  1 
ATOM   548  C CD1 . LEU A 1 85  ? 24.389  5.520   46.219 1.00 32.41  ? 85   LEU A CD1 1 
ATOM   549  C CD2 . LEU A 1 85  ? 23.976  8.000   46.324 1.00 37.52  ? 85   LEU A CD2 1 
ATOM   550  N N   . ASP A 1 86  ? 21.778  9.142   49.008 1.00 28.43  ? 86   ASP A N   1 
ATOM   551  C CA  . ASP A 1 86  ? 22.015  10.550  49.280 1.00 27.99  ? 86   ASP A CA  1 
ATOM   552  C C   . ASP A 1 86  ? 21.997  10.834  50.780 1.00 32.32  ? 86   ASP A C   1 
ATOM   553  O O   . ASP A 1 86  ? 22.754  11.670  51.268 1.00 32.46  ? 86   ASP A O   1 
ATOM   554  C CB  . ASP A 1 86  ? 20.975  11.414  48.559 1.00 28.96  ? 86   ASP A CB  1 
ATOM   555  C CG  . ASP A 1 86  ? 21.133  11.371  47.049 1.00 32.19  ? 86   ASP A CG  1 
ATOM   556  O OD1 . ASP A 1 86  ? 22.272  11.176  46.582 1.00 32.28  ? 86   ASP A OD1 1 
ATOM   557  O OD2 . ASP A 1 86  ? 20.135  11.581  46.327 1.00 30.91  ? 86   ASP A OD2 1 
ATOM   558  N N   . ARG A 1 87  ? 21.118  10.154  51.507 1.00 29.14  ? 87   ARG A N   1 
ATOM   559  C CA  . ARG A 1 87  ? 21.048  10.323  52.961 1.00 28.93  ? 87   ARG A CA  1 
ATOM   560  C C   . ARG A 1 87  ? 22.294  9.857   53.684 1.00 31.67  ? 87   ARG A C   1 
ATOM   561  O O   . ARG A 1 87  ? 22.799  10.552  54.558 1.00 31.32  ? 87   ARG A O   1 
ATOM   562  C CB  . ARG A 1 87  ? 19.795  9.668   53.560 1.00 27.95  ? 87   ARG A CB  1 
ATOM   563  C CG  . ARG A 1 87  ? 18.543  10.524  53.411 1.00 35.03  ? 87   ARG A CG  1 
ATOM   564  C CD  . ARG A 1 87  ? 17.288  9.690   53.555 1.00 35.50  ? 87   ARG A CD  1 
ATOM   565  N NE  . ARG A 1 87  ? 17.025  9.362   54.944 1.00 31.69  ? 87   ARG A NE  1 
ATOM   566  C CZ  . ARG A 1 87  ? 16.232  8.377   55.336 1.00 39.40  ? 87   ARG A CZ  1 
ATOM   567  N NH1 . ARG A 1 87  ? 15.613  7.628   54.439 1.00 28.30  ? 87   ARG A NH1 1 
ATOM   568  N NH2 . ARG A 1 87  ? 16.043  8.155   56.627 1.00 34.16  ? 87   ARG A NH2 1 
ATOM   569  N N   . PHE A 1 88  ? 22.805  8.692   53.306 1.00 28.42  ? 88   PHE A N   1 
ATOM   570  C CA  . PHE A 1 88  ? 24.018  8.165   53.924 1.00 28.64  ? 88   PHE A CA  1 
ATOM   571  C C   . PHE A 1 88  ? 25.197  9.084   53.606 1.00 33.55  ? 88   PHE A C   1 
ATOM   572  O O   . PHE A 1 88  ? 26.058  9.344   54.450 1.00 33.61  ? 88   PHE A O   1 
ATOM   573  C CB  . PHE A 1 88  ? 24.306  6.750   53.397 1.00 30.57  ? 88   PHE A CB  1 
ATOM   574  C CG  . PHE A 1 88  ? 25.394  6.030   54.144 1.00 31.92  ? 88   PHE A CG  1 
ATOM   575  C CD1 . PHE A 1 88  ? 25.162  5.526   55.424 1.00 35.27  ? 88   PHE A CD1 1 
ATOM   576  C CD2 . PHE A 1 88  ? 26.642  5.859   53.579 1.00 33.63  ? 88   PHE A CD2 1 
ATOM   577  C CE1 . PHE A 1 88  ? 26.157  4.863   56.118 1.00 35.58  ? 88   PHE A CE1 1 
ATOM   578  C CE2 . PHE A 1 88  ? 27.642  5.182   54.264 1.00 36.19  ? 88   PHE A CE2 1 
ATOM   579  C CZ  . PHE A 1 88  ? 27.405  4.691   55.532 1.00 34.24  ? 88   PHE A CZ  1 
ATOM   580  N N   . LEU A 1 89  ? 25.255  9.511   52.353 1.00 30.38  ? 89   LEU A N   1 
ATOM   581  C CA  . LEU A 1 89  ? 26.340  10.329  51.854 1.00 30.95  ? 89   LEU A CA  1 
ATOM   582  C C   . LEU A 1 89  ? 26.314  11.701  52.527 1.00 36.38  ? 89   LEU A C   1 
ATOM   583  O O   . LEU A 1 89  ? 27.305  12.429  52.521 1.00 36.81  ? 89   LEU A O   1 
ATOM   584  C CB  . LEU A 1 89  ? 26.222  10.452  50.330 1.00 30.91  ? 89   LEU A CB  1 
ATOM   585  C CG  . LEU A 1 89  ? 27.154  9.652   49.403 1.00 34.79  ? 89   LEU A CG  1 
ATOM   586  C CD1 . LEU A 1 89  ? 27.639  8.341   49.980 1.00 34.43  ? 89   LEU A CD1 1 
ATOM   587  C CD2 . LEU A 1 89  ? 26.513  9.448   48.048 1.00 37.04  ? 89   LEU A CD2 1 
ATOM   588  N N   . SER A 1 90  ? 25.176  12.033  53.126 1.00 33.50  ? 90   SER A N   1 
ATOM   589  C CA  . SER A 1 90  ? 25.038  13.246  53.933 1.00 32.76  ? 90   SER A CA  1 
ATOM   590  C C   . SER A 1 90  ? 25.632  13.099  55.328 1.00 37.72  ? 90   SER A C   1 
ATOM   591  O O   . SER A 1 90  ? 25.808  14.085  56.025 1.00 37.77  ? 90   SER A O   1 
ATOM   592  C CB  . SER A 1 90  ? 23.561  13.635  54.073 1.00 34.21  ? 90   SER A CB  1 
ATOM   593  O OG  . SER A 1 90  ? 23.020  14.078  52.846 1.00 37.83  ? 90   SER A OG  1 
ATOM   594  N N   . LEU A 1 91  ? 25.933  11.870  55.736 1.00 36.82  ? 91   LEU A N   1 
ATOM   595  C CA  . LEU A 1 91  ? 26.296  11.583  57.126 1.00 37.45  ? 91   LEU A CA  1 
ATOM   596  C C   . LEU A 1 91  ? 27.682  10.958  57.304 1.00 44.15  ? 91   LEU A C   1 
ATOM   597  O O   . LEU A 1 91  ? 28.246  10.981  58.401 1.00 44.06  ? 91   LEU A O   1 
ATOM   598  C CB  . LEU A 1 91  ? 25.247  10.660  57.754 1.00 37.32  ? 91   LEU A CB  1 
ATOM   599  C CG  . LEU A 1 91  ? 23.845  11.240  57.948 1.00 41.66  ? 91   LEU A CG  1 
ATOM   600  C CD1 . LEU A 1 91  ? 22.987  10.252  58.710 1.00 41.78  ? 91   LEU A CD1 1 
ATOM   601  C CD2 . LEU A 1 91  ? 23.910  12.570  58.691 1.00 42.66  ? 91   LEU A CD2 1 
ATOM   602  N N   . GLU A 1 92  ? 28.181  10.325  56.248 1.00 42.22  ? 92   GLU A N   1 
ATOM   603  C CA  . GLU A 1 92  ? 29.432  9.578   56.299 1.00 42.27  ? 92   GLU A CA  1 
ATOM   604  C C   . GLU A 1 92  ? 30.226  9.835   55.032 1.00 46.82  ? 92   GLU A C   1 
ATOM   605  O O   . GLU A 1 92  ? 29.656  9.891   53.943 1.00 46.11  ? 92   GLU A O   1 
ATOM   606  C CB  . GLU A 1 92  ? 29.139  8.081   56.392 1.00 43.87  ? 92   GLU A CB  1 
ATOM   607  C CG  . GLU A 1 92  ? 28.792  7.601   57.778 1.00 56.58  ? 92   GLU A CG  1 
ATOM   608  C CD  . GLU A 1 92  ? 30.017  7.478   58.660 1.00 83.29  ? 92   GLU A CD  1 
ATOM   609  O OE1 . GLU A 1 92  ? 31.008  6.860   58.212 1.00 82.51  ? 92   GLU A OE1 1 
ATOM   610  O OE2 . GLU A 1 92  ? 29.988  7.993   59.798 1.00 77.88  ? 92   GLU A OE2 1 
ATOM   611  N N   . PRO A 1 93  ? 31.550  10.047  55.163 1.00 44.08  ? 93   PRO A N   1 
ATOM   612  C CA  . PRO A 1 93  ? 32.366  10.060  53.948 1.00 43.16  ? 93   PRO A CA  1 
ATOM   613  C C   . PRO A 1 93  ? 32.580  8.627   53.478 1.00 45.39  ? 93   PRO A C   1 
ATOM   614  O O   . PRO A 1 93  ? 32.804  7.730   54.287 1.00 44.22  ? 93   PRO A O   1 
ATOM   615  C CB  . PRO A 1 93  ? 33.695  10.661  54.420 1.00 45.07  ? 93   PRO A CB  1 
ATOM   616  C CG  . PRO A 1 93  ? 33.428  11.230  55.775 1.00 49.62  ? 93   PRO A CG  1 
ATOM   617  C CD  . PRO A 1 93  ? 32.343  10.405  56.351 1.00 45.41  ? 93   PRO A CD  1 
ATOM   618  N N   . VAL A 1 94  ? 32.450  8.415   52.174 1.00 41.89  ? 94   VAL A N   1 
ATOM   619  C CA  . VAL A 1 94  ? 32.618  7.098   51.575 1.00 41.62  ? 94   VAL A CA  1 
ATOM   620  C C   . VAL A 1 94  ? 33.734  7.160   50.528 1.00 45.86  ? 94   VAL A C   1 
ATOM   621  O O   . VAL A 1 94  ? 33.906  8.178   49.845 1.00 44.90  ? 94   VAL A O   1 
ATOM   622  C CB  . VAL A 1 94  ? 31.277  6.605   50.959 1.00 45.34  ? 94   VAL A CB  1 
ATOM   623  C CG1 . VAL A 1 94  ? 31.446  5.259   50.262 1.00 44.54  ? 94   VAL A CG1 1 
ATOM   624  C CG2 . VAL A 1 94  ? 30.192  6.529   52.033 1.00 45.15  ? 94   VAL A CG2 1 
ATOM   625  N N   . LYS A 1 95  ? 34.542  6.105   50.461 1.00 43.28  ? 95   LYS A N   1 
ATOM   626  C CA  . LYS A 1 95  ? 35.594  6.018   49.451 1.00 43.52  ? 95   LYS A CA  1 
ATOM   627  C C   . LYS A 1 95  ? 34.937  5.660   48.131 1.00 47.52  ? 95   LYS A C   1 
ATOM   628  O O   . LYS A 1 95  ? 33.985  4.885   48.107 1.00 47.96  ? 95   LYS A O   1 
ATOM   629  C CB  . LYS A 1 95  ? 36.609  4.934   49.819 1.00 46.57  ? 95   LYS A CB  1 
ATOM   630  C CG  . LYS A 1 95  ? 37.134  5.013   51.241 1.00 62.68  ? 95   LYS A CG  1 
ATOM   631  C CD  . LYS A 1 95  ? 38.272  4.032   51.447 1.00 71.39  ? 95   LYS A CD  1 
ATOM   632  C CE  . LYS A 1 95  ? 39.449  4.389   50.555 1.00 85.07  ? 95   LYS A CE  1 
ATOM   633  N NZ  . LYS A 1 95  ? 40.557  3.400   50.669 1.00 98.41  ? 95   LYS A NZ  1 
ATOM   634  N N   . LYS A 1 96  ? 35.424  6.225   47.033 1.00 43.68  ? 96   LYS A N   1 
ATOM   635  C CA  . LYS A 1 96  ? 34.816  5.938   45.741 1.00 44.13  ? 96   LYS A CA  1 
ATOM   636  C C   . LYS A 1 96  ? 34.821  4.455   45.384 1.00 50.64  ? 96   LYS A C   1 
ATOM   637  O O   . LYS A 1 96  ? 33.985  4.002   44.602 1.00 51.55  ? 96   LYS A O   1 
ATOM   638  C CB  . LYS A 1 96  ? 35.418  6.787   44.619 1.00 46.64  ? 96   LYS A CB  1 
ATOM   639  C CG  . LYS A 1 96  ? 36.916  6.981   44.691 1.00 61.24  ? 96   LYS A CG  1 
ATOM   640  C CD  . LYS A 1 96  ? 37.433  7.584   43.390 1.00 74.81  ? 96   LYS A CD  1 
ATOM   641  C CE  . LYS A 1 96  ? 38.824  8.167   43.550 1.00 85.99  ? 96   LYS A CE  1 
ATOM   642  N NZ  . LYS A 1 96  ? 38.807  9.388   44.400 1.00 96.88  ? 96   LYS A NZ  1 
ATOM   643  N N   . SER A 1 97  ? 35.722  3.690   45.994 1.00 47.51  ? 97   SER A N   1 
ATOM   644  C CA  . SER A 1 97  ? 35.755  2.249   45.766 1.00 47.65  ? 97   SER A CA  1 
ATOM   645  C C   . SER A 1 97  ? 34.611  1.534   46.486 1.00 51.29  ? 97   SER A C   1 
ATOM   646  O O   . SER A 1 97  ? 34.211  0.438   46.095 1.00 51.21  ? 97   SER A O   1 
ATOM   647  C CB  . SER A 1 97  ? 37.111  1.646   46.168 1.00 51.73  ? 97   SER A CB  1 
ATOM   648  O OG  . SER A 1 97  ? 37.217  1.474   47.575 1.00 61.72  ? 97   SER A OG  1 
ATOM   649  N N   . ARG A 1 98  ? 34.090  2.156   47.539 1.00 47.07  ? 98   ARG A N   1 
ATOM   650  C CA  . ARG A 1 98  ? 32.964  1.587   48.280 1.00 46.45  ? 98   ARG A CA  1 
ATOM   651  C C   . ARG A 1 98  ? 31.584  2.058   47.781 1.00 47.34  ? 98   ARG A C   1 
ATOM   652  O O   . ARG A 1 98  ? 30.565  1.521   48.185 1.00 48.05  ? 98   ARG A O   1 
ATOM   653  C CB  . ARG A 1 98  ? 33.104  1.884   49.773 1.00 47.53  ? 98   ARG A CB  1 
ATOM   654  C CG  . ARG A 1 98  ? 34.479  1.585   50.354 1.00 59.15  ? 98   ARG A CG  1 
ATOM   655  C CD  . ARG A 1 98  ? 34.546  0.228   51.041 1.00 70.19  ? 98   ARG A CD  1 
ATOM   656  N NE  . ARG A 1 98  ? 34.689  -0.879  50.099 1.00 78.34  ? 98   ARG A NE  1 
ATOM   657  C CZ  . ARG A 1 98  ? 34.733  -2.162  50.454 1.00 91.22  ? 98   ARG A CZ  1 
ATOM   658  N NH1 . ARG A 1 98  ? 34.648  -2.508  51.735 1.00 80.11  ? 98   ARG A NH1 1 
ATOM   659  N NH2 . ARG A 1 98  ? 34.856  -3.102  49.528 1.00 74.10  ? 98   ARG A NH2 1 
ATOM   660  N N   . LEU A 1 99  ? 31.558  3.031   46.880 1.00 41.44  ? 99   LEU A N   1 
ATOM   661  C CA  . LEU A 1 99  ? 30.301  3.606   46.391 1.00 40.03  ? 99   LEU A CA  1 
ATOM   662  C C   . LEU A 1 99  ? 29.352  2.562   45.802 1.00 43.04  ? 99   LEU A C   1 
ATOM   663  O O   . LEU A 1 99  ? 28.150  2.589   46.064 1.00 42.31  ? 99   LEU A O   1 
ATOM   664  C CB  . LEU A 1 99  ? 30.571  4.712   45.359 1.00 39.68  ? 99   LEU A CB  1 
ATOM   665  C CG  . LEU A 1 99  ? 29.405  5.640   44.980 1.00 43.67  ? 99   LEU A CG  1 
ATOM   666  C CD1 . LEU A 1 99  ? 28.730  6.229   46.209 1.00 43.36  ? 99   LEU A CD1 1 
ATOM   667  C CD2 . LEU A 1 99  ? 29.860  6.741   44.050 1.00 44.07  ? 99   LEU A CD2 1 
ATOM   668  N N   . GLN A 1 100 ? 29.883  1.664   44.974 1.00 38.73  ? 100  GLN A N   1 
ATOM   669  C CA  . GLN A 1 100 ? 29.053  0.639   44.369 1.00 37.47  ? 100  GLN A CA  1 
ATOM   670  C C   . GLN A 1 100 ? 28.500  -0.283  45.450 1.00 39.54  ? 100  GLN A C   1 
ATOM   671  O O   . GLN A 1 100 ? 27.348  -0.720  45.385 1.00 38.78  ? 100  GLN A O   1 
ATOM   672  C CB  . GLN A 1 100 ? 29.821  -0.158  43.308 1.00 38.41  ? 100  GLN A CB  1 
ATOM   673  C CG  . GLN A 1 100 ? 29.016  -1.348  42.782 1.00 53.06  ? 100  GLN A CG  1 
ATOM   674  C CD  . GLN A 1 100 ? 29.515  -1.885  41.450 1.00 66.40  ? 100  GLN A CD  1 
ATOM   675  O OE1 . GLN A 1 100 ? 28.849  -1.747  40.421 1.00 51.61  ? 100  GLN A OE1 1 
ATOM   676  N NE2 . GLN A 1 100 ? 30.652  -2.568  41.479 1.00 65.87  ? 100  GLN A NE2 1 
ATOM   677  N N   . LEU A 1 101 ? 29.315  -0.546  46.465 1.00 34.55  ? 101  LEU A N   1 
ATOM   678  C CA  . LEU A 1 101 ? 28.873  -1.343  47.596 1.00 33.54  ? 101  LEU A CA  1 
ATOM   679  C C   . LEU A 1 101 ? 27.716  -0.655  48.296 1.00 35.95  ? 101  LEU A C   1 
ATOM   680  O O   . LEU A 1 101 ? 26.794  -1.311  48.762 1.00 35.89  ? 101  LEU A O   1 
ATOM   681  C CB  . LEU A 1 101 ? 30.017  -1.545  48.584 1.00 33.48  ? 101  LEU A CB  1 
ATOM   682  C CG  . LEU A 1 101 ? 29.663  -2.180  49.932 1.00 37.67  ? 101  LEU A CG  1 
ATOM   683  C CD1 . LEU A 1 101 ? 28.991  -3.552  49.762 1.00 37.66  ? 101  LEU A CD1 1 
ATOM   684  C CD2 . LEU A 1 101 ? 30.913  -2.287  50.788 1.00 39.08  ? 101  LEU A CD2 1 
ATOM   685  N N   . LEU A 1 102 ? 27.819  0.662   48.442 1.00 32.27  ? 102  LEU A N   1 
ATOM   686  C CA  . LEU A 1 102 ? 26.765  1.463   49.061 1.00 31.78  ? 102  LEU A CA  1 
ATOM   687  C C   . LEU A 1 102 ? 25.474  1.441   48.235 1.00 34.19  ? 102  LEU A C   1 
ATOM   688  O O   . LEU A 1 102 ? 24.390  1.268   48.775 1.00 34.38  ? 102  LEU A O   1 
ATOM   689  C CB  . LEU A 1 102 ? 27.223  2.912   49.248 1.00 31.64  ? 102  LEU A CB  1 
ATOM   690  C CG  . LEU A 1 102 ? 26.099  3.832   49.740 1.00 35.73  ? 102  LEU A CG  1 
ATOM   691  C CD1 . LEU A 1 102 ? 25.649  3.402   51.144 1.00 36.43  ? 102  LEU A CD1 1 
ATOM   692  C CD2 . LEU A 1 102 ? 26.490  5.293   49.715 1.00 35.82  ? 102  LEU A CD2 1 
ATOM   693  N N   . GLY A 1 103 ? 25.597  1.639   46.929 1.00 29.47  ? 103  GLY A N   1 
ATOM   694  C CA  . GLY A 1 103 ? 24.456  1.643   46.044 1.00 28.58  ? 103  GLY A CA  1 
ATOM   695  C C   . GLY A 1 103 ? 23.710  0.327   46.061 1.00 33.90  ? 103  GLY A C   1 
ATOM   696  O O   . GLY A 1 103 ? 22.476  0.306   45.960 1.00 34.94  ? 103  GLY A O   1 
ATOM   697  N N   . ALA A 1 104 ? 24.451  -0.777  46.144 1.00 28.94  ? 104  ALA A N   1 
ATOM   698  C CA  . ALA A 1 104 ? 23.848  -2.102  46.166 1.00 27.81  ? 104  ALA A CA  1 
ATOM   699  C C   . ALA A 1 104 ? 23.143  -2.372  47.471 1.00 29.08  ? 104  ALA A C   1 
ATOM   700  O O   . ALA A 1 104 ? 22.186  -3.126  47.508 1.00 28.71  ? 104  ALA A O   1 
ATOM   701  C CB  . ALA A 1 104 ? 24.897  -3.180  45.916 1.00 28.92  ? 104  ALA A CB  1 
ATOM   702  N N   . THR A 1 105 ? 23.695  -1.847  48.559 1.00 25.81  ? 105  THR A N   1 
ATOM   703  C CA  . THR A 1 105 ? 23.102  -2.012  49.882 1.00 25.80  ? 105  THR A CA  1 
ATOM   704  C C   . THR A 1 105 ? 21.839  -1.155  49.984 1.00 30.05  ? 105  THR A C   1 
ATOM   705  O O   . THR A 1 105 ? 20.872  -1.517  50.658 1.00 29.69  ? 105  THR A O   1 
ATOM   706  C CB  . THR A 1 105 ? 24.112  -1.631  50.996 1.00 33.93  ? 105  THR A CB  1 
ATOM   707  O OG1 . THR A 1 105 ? 25.337  -2.343  50.799 1.00 35.78  ? 105  THR A OG1 1 
ATOM   708  C CG2 . THR A 1 105 ? 23.557  -1.962  52.369 1.00 28.99  ? 105  THR A CG2 1 
ATOM   709  N N   . CYS A 1 106 ? 21.852  -0.006  49.326 1.00 26.34  ? 106  CYS A N   1 
ATOM   710  C CA  . CYS A 1 106 ? 20.659  0.829   49.278 1.00 26.43  ? 106  CYS A CA  1 
ATOM   711  C C   . CYS A 1 106 ? 19.516  0.146   48.528 1.00 32.37  ? 106  CYS A C   1 
ATOM   712  O O   . CYS A 1 106 ? 18.346  0.242   48.923 1.00 31.72  ? 106  CYS A O   1 
ATOM   713  C CB  . CYS A 1 106 ? 20.989  2.197   48.669 1.00 26.54  ? 106  CYS A CB  1 
ATOM   714  S SG  . CYS A 1 106 ? 22.090  3.158   49.722 1.00 29.70  ? 106  CYS A SG  1 
ATOM   715  N N   . MET A 1 107 ? 19.866  -0.568  47.463 1.00 30.70  ? 107  MET A N   1 
ATOM   716  C CA  . MET A 1 107 ? 18.875  -1.280  46.660 1.00 31.58  ? 107  MET A CA  1 
ATOM   717  C C   . MET A 1 107 ? 18.336  -2.457  47.445 1.00 33.79  ? 107  MET A C   1 
ATOM   718  O O   . MET A 1 107 ? 17.149  -2.752  47.405 1.00 32.86  ? 107  MET A O   1 
ATOM   719  C CB  . MET A 1 107 ? 19.493  -1.774  45.350 1.00 34.72  ? 107  MET A CB  1 
ATOM   720  C CG  . MET A 1 107 ? 19.495  -0.760  44.232 1.00 39.98  ? 107  MET A CG  1 
ATOM   721  S SD  . MET A 1 107 ? 19.932  -1.570  42.688 1.00 47.57  ? 107  MET A SD  1 
ATOM   722  C CE  . MET A 1 107 ? 21.607  -2.180  43.024 1.00 44.28  ? 107  MET A CE  1 
ATOM   723  N N   . PHE A 1 108 ? 19.233  -3.104  48.181 1.00 30.38  ? 108  PHE A N   1 
ATOM   724  C CA  . PHE A 1 108 ? 18.915  -4.263  49.009 1.00 29.64  ? 108  PHE A CA  1 
ATOM   725  C C   . PHE A 1 108 ? 17.891  -3.907  50.096 1.00 31.34  ? 108  PHE A C   1 
ATOM   726  O O   . PHE A 1 108 ? 16.851  -4.553  50.216 1.00 31.16  ? 108  PHE A O   1 
ATOM   727  C CB  . PHE A 1 108 ? 20.212  -4.772  49.641 1.00 31.38  ? 108  PHE A CB  1 
ATOM   728  C CG  . PHE A 1 108 ? 20.068  -6.062  50.392 1.00 32.63  ? 108  PHE A CG  1 
ATOM   729  C CD1 . PHE A 1 108 ? 19.743  -7.243  49.725 1.00 35.09  ? 108  PHE A CD1 1 
ATOM   730  C CD2 . PHE A 1 108 ? 20.316  -6.110  51.758 1.00 33.71  ? 108  PHE A CD2 1 
ATOM   731  C CE1 . PHE A 1 108 ? 19.648  -8.445  50.420 1.00 35.61  ? 108  PHE A CE1 1 
ATOM   732  C CE2 . PHE A 1 108 ? 20.234  -7.307  52.449 1.00 36.24  ? 108  PHE A CE2 1 
ATOM   733  C CZ  . PHE A 1 108 ? 19.887  -8.476  51.781 1.00 34.29  ? 108  PHE A CZ  1 
ATOM   734  N N   . VAL A 1 109 ? 18.163  -2.841  50.842 1.00 25.58  ? 109  VAL A N   1 
ATOM   735  C CA  . VAL A 1 109 ? 17.217  -2.324  51.827 1.00 24.55  ? 109  VAL A CA  1 
ATOM   736  C C   . VAL A 1 109 ? 15.919  -1.787  51.206 1.00 29.00  ? 109  VAL A C   1 
ATOM   737  O O   . VAL A 1 109 ? 14.832  -2.060  51.695 1.00 28.34  ? 109  VAL A O   1 
ATOM   738  C CB  . VAL A 1 109 ? 17.885  -1.295  52.768 1.00 27.40  ? 109  VAL A CB  1 
ATOM   739  C CG1 . VAL A 1 109 ? 16.954  -0.940  53.898 1.00 27.34  ? 109  VAL A CG1 1 
ATOM   740  C CG2 . VAL A 1 109 ? 19.180  -1.852  53.322 1.00 26.63  ? 109  VAL A CG2 1 
ATOM   741  N N   . ALA A 1 110 ? 16.035  -1.043  50.111 1.00 26.71  ? 110  ALA A N   1 
ATOM   742  C CA  . ALA A 1 110 ? 14.863  -0.527  49.408 1.00 25.69  ? 110  ALA A CA  1 
ATOM   743  C C   . ALA A 1 110 ? 13.974  -1.645  48.875 1.00 30.30  ? 110  ALA A C   1 
ATOM   744  O O   . ALA A 1 110 ? 12.751  -1.525  48.848 1.00 30.19  ? 110  ALA A O   1 
ATOM   745  C CB  . ALA A 1 110 ? 15.291  0.396   48.278 1.00 25.83  ? 110  ALA A CB  1 
ATOM   746  N N   . SER A 1 111 ? 14.588  -2.719  48.400 1.00 27.98  ? 111  SER A N   1 
ATOM   747  C CA  . SER A 1 111 ? 13.819  -3.874  47.939 1.00 28.43  ? 111  SER A CA  1 
ATOM   748  C C   . SER A 1 111 ? 13.099  -4.589  49.082 1.00 31.94  ? 111  SER A C   1 
ATOM   749  O O   . SER A 1 111 ? 11.941  -4.991  48.950 1.00 32.35  ? 111  SER A O   1 
ATOM   750  C CB  . SER A 1 111 ? 14.710  -4.853  47.183 1.00 32.25  ? 111  SER A CB  1 
ATOM   751  O OG  . SER A 1 111 ? 13.924  -5.888  46.639 1.00 45.79  ? 111  SER A OG  1 
ATOM   752  N N   . LYS A 1 112 ? 13.778  -4.740  50.210 1.00 28.44  ? 112  LYS A N   1 
ATOM   753  C CA  . LYS A 1 112 ? 13.154  -5.373  51.363 1.00 28.90  ? 112  LYS A CA  1 
ATOM   754  C C   . LYS A 1 112 ? 11.916  -4.616  51.782 1.00 32.49  ? 112  LYS A C   1 
ATOM   755  O O   . LYS A 1 112 ? 10.912  -5.216  52.153 1.00 31.81  ? 112  LYS A O   1 
ATOM   756  C CB  . LYS A 1 112 ? 14.120  -5.449  52.541 1.00 32.18  ? 112  LYS A CB  1 
ATOM   757  C CG  . LYS A 1 112 ? 15.238  -6.450  52.389 1.00 31.62  ? 112  LYS A CG  1 
ATOM   758  C CD  . LYS A 1 112 ? 16.021  -6.488  53.685 1.00 37.82  ? 112  LYS A CD  1 
ATOM   759  C CE  . LYS A 1 112 ? 17.114  -7.520  53.657 1.00 36.69  ? 112  LYS A CE  1 
ATOM   760  N NZ  . LYS A 1 112 ? 17.462  -7.885  55.043 1.00 33.87  ? 112  LYS A NZ  1 
ATOM   761  N N   . MET A 1 113 ? 11.989  -3.289  51.685 1.00 28.64  ? 113  MET A N   1 
ATOM   762  C CA  . MET A 1 113 ? 10.898  -2.403  52.087 1.00 27.00  ? 113  MET A CA  1 
ATOM   763  C C   . MET A 1 113 ? 9.709   -2.422  51.139 1.00 31.87  ? 113  MET A C   1 
ATOM   764  O O   . MET A 1 113 ? 8.571   -2.257  51.560 1.00 32.51  ? 113  MET A O   1 
ATOM   765  C CB  . MET A 1 113 ? 11.410  -0.965  52.207 1.00 28.80  ? 113  MET A CB  1 
ATOM   766  C CG  . MET A 1 113 ? 12.336  -0.744  53.377 1.00 31.75  ? 113  MET A CG  1 
ATOM   767  S SD  . MET A 1 113 ? 11.493  -0.916  54.963 1.00 35.37  ? 113  MET A SD  1 
ATOM   768  C CE  . MET A 1 113 ? 10.253  0.309   54.832 1.00 31.12  ? 113  MET A CE  1 
ATOM   769  N N   . LYS A 1 114 ? 9.974   -2.556  49.848 1.00 29.16  ? 114  LYS A N   1 
ATOM   770  C CA  . LYS A 1 114 ? 8.938   -2.329  48.849 1.00 28.89  ? 114  LYS A CA  1 
ATOM   771  C C   . LYS A 1 114 ? 8.504   -3.554  48.028 1.00 33.71  ? 114  LYS A C   1 
ATOM   772  O O   . LYS A 1 114 ? 7.556   -3.464  47.251 1.00 33.58  ? 114  LYS A O   1 
ATOM   773  C CB  . LYS A 1 114 ? 9.364   -1.197  47.915 1.00 31.41  ? 114  LYS A CB  1 
ATOM   774  C CG  . LYS A 1 114 ? 9.461   0.160   48.600 1.00 32.37  ? 114  LYS A CG  1 
ATOM   775  C CD  . LYS A 1 114 ? 8.080   0.756   48.813 1.00 31.83  ? 114  LYS A CD  1 
ATOM   776  C CE  . LYS A 1 114 ? 8.119   1.882   49.819 1.00 41.96  ? 114  LYS A CE  1 
ATOM   777  N NZ  . LYS A 1 114 ? 6.788   2.534   49.959 1.00 53.51  ? 114  LYS A NZ  1 
ATOM   778  N N   . GLU A 1 115 ? 9.205   -4.680  48.154 1.00 29.98  ? 115  GLU A N   1 
ATOM   779  C CA  . GLU A 1 115 ? 8.896   -5.824  47.290 1.00 30.07  ? 115  GLU A CA  1 
ATOM   780  C C   . GLU A 1 115 ? 8.343   -7.044  48.018 1.00 35.43  ? 115  GLU A C   1 
ATOM   781  O O   . GLU A 1 115 ? 8.720   -7.333  49.161 1.00 35.48  ? 115  GLU A O   1 
ATOM   782  C CB  . GLU A 1 115 ? 10.093  -6.204  46.418 1.00 30.96  ? 115  GLU A CB  1 
ATOM   783  C CG  . GLU A 1 115 ? 10.791  -5.003  45.816 1.00 38.08  ? 115  GLU A CG  1 
ATOM   784  C CD  . GLU A 1 115 ? 11.490  -5.309  44.516 1.00 49.28  ? 115  GLU A CD  1 
ATOM   785  O OE1 . GLU A 1 115 ? 12.708  -5.582  44.543 1.00 34.91  ? 115  GLU A OE1 1 
ATOM   786  O OE2 . GLU A 1 115 ? 10.830  -5.242  43.462 1.00 39.66  ? 115  GLU A OE2 1 
ATOM   787  N N   . THR A 1 116 ? 7.429   -7.751  47.368 1.00 33.07  ? 116  THR A N   1 
ATOM   788  C CA  . THR A 1 116 ? 6.933   -8.997  47.941 1.00 34.03  ? 116  THR A CA  1 
ATOM   789  C C   . THR A 1 116 ? 8.033   -10.044 47.930 1.00 37.71  ? 116  THR A C   1 
ATOM   790  O O   . THR A 1 116 ? 8.229   -10.756 48.909 1.00 37.64  ? 116  THR A O   1 
ATOM   791  C CB  . THR A 1 116 ? 5.603   -9.487  47.282 1.00 47.12  ? 116  THR A CB  1 
ATOM   792  O OG1 . THR A 1 116 ? 5.488   -10.912 47.406 1.00 47.25  ? 116  THR A OG1 1 
ATOM   793  C CG2 . THR A 1 116 ? 5.528   -9.095  45.828 1.00 46.27  ? 116  THR A CG2 1 
ATOM   794  N N   . ILE A 1 117 ? 8.799   -10.073 46.844 1.00 35.38  ? 117  ILE A N   1 
ATOM   795  C CA  . ILE A 1 117 ? 10.002  -10.908 46.752 1.00 34.96  ? 117  ILE A CA  1 
ATOM   796  C C   . ILE A 1 117 ? 11.234  -10.030 46.552 1.00 38.10  ? 117  ILE A C   1 
ATOM   797  O O   . ILE A 1 117 ? 11.613  -9.751  45.419 1.00 38.31  ? 117  ILE A O   1 
ATOM   798  C CB  . ILE A 1 117 ? 9.896   -11.916 45.585 1.00 38.19  ? 117  ILE A CB  1 
ATOM   799  C CG1 . ILE A 1 117 ? 8.591   -12.718 45.658 1.00 38.70  ? 117  ILE A CG1 1 
ATOM   800  C CG2 . ILE A 1 117 ? 11.106  -12.842 45.563 1.00 38.87  ? 117  ILE A CG2 1 
ATOM   801  C CD1 . ILE A 1 117 ? 8.182   -13.327 44.323 1.00 45.47  ? 117  ILE A CD1 1 
ATOM   802  N N   . PRO A 1 118 ? 11.910  -9.638  47.649 1.00 34.48  ? 118  PRO A N   1 
ATOM   803  C CA  . PRO A 1 118 ? 13.053  -8.713  47.555 1.00 34.17  ? 118  PRO A CA  1 
ATOM   804  C C   . PRO A 1 118 ? 14.237  -9.316  46.812 1.00 39.70  ? 118  PRO A C   1 
ATOM   805  O O   . PRO A 1 118 ? 14.365  -10.535 46.730 1.00 40.37  ? 118  PRO A O   1 
ATOM   806  C CB  . PRO A 1 118 ? 13.443  -8.471  49.024 1.00 35.40  ? 118  PRO A CB  1 
ATOM   807  C CG  . PRO A 1 118 ? 12.378  -9.132  49.859 1.00 39.51  ? 118  PRO A CG  1 
ATOM   808  C CD  . PRO A 1 118 ? 11.774  -10.197 49.005 1.00 35.00  ? 118  PRO A CD  1 
ATOM   809  N N   . LEU A 1 119 ? 15.132  -8.457  46.325 1.00 36.46  ? 119  LEU A N   1 
ATOM   810  C CA  . LEU A 1 119 ? 16.402  -8.900  45.742 1.00 35.83  ? 119  LEU A CA  1 
ATOM   811  C C   . LEU A 1 119 ? 17.252  -9.609  46.794 1.00 40.06  ? 119  LEU A C   1 
ATOM   812  O O   . LEU A 1 119 ? 17.284  -9.209  47.959 1.00 39.30  ? 119  LEU A O   1 
ATOM   813  C CB  . LEU A 1 119 ? 17.193  -7.697  45.215 1.00 35.83  ? 119  LEU A CB  1 
ATOM   814  C CG  . LEU A 1 119 ? 16.541  -6.775  44.182 1.00 39.18  ? 119  LEU A CG  1 
ATOM   815  C CD1 . LEU A 1 119 ? 17.398  -5.540  44.020 1.00 38.82  ? 119  LEU A CD1 1 
ATOM   816  C CD2 . LEU A 1 119 ? 16.358  -7.488  42.844 1.00 39.35  ? 119  LEU A CD2 1 
ATOM   817  N N   . THR A 1 120 ? 17.992  -10.626 46.372 1.00 36.78  ? 120  THR A N   1 
ATOM   818  C CA  . THR A 1 120 ? 18.842  -11.356 47.303 1.00 35.91  ? 120  THR A CA  1 
ATOM   819  C C   . THR A 1 120 ? 20.220  -10.706 47.312 1.00 39.49  ? 120  THR A C   1 
ATOM   820  O O   . THR A 1 120 ? 20.620  -10.083 46.324 1.00 38.26  ? 120  THR A O   1 
ATOM   821  C CB  . THR A 1 120 ? 18.905  -12.856 46.938 1.00 41.11  ? 120  THR A CB  1 
ATOM   822  O OG1 . THR A 1 120 ? 19.520  -13.013 45.657 1.00 40.25  ? 120  THR A OG1 1 
ATOM   823  C CG2 . THR A 1 120 ? 17.507  -13.441 46.875 1.00 39.95  ? 120  THR A CG2 1 
ATOM   824  N N   . ALA A 1 121 ? 20.930  -10.817 48.433 1.00 37.05  ? 121  ALA A N   1 
ATOM   825  C CA  . ALA A 1 121 ? 22.294  -10.298 48.517 1.00 38.01  ? 121  ALA A CA  1 
ATOM   826  C C   . ALA A 1 121 ? 23.163  -10.834 47.372 1.00 43.36  ? 121  ALA A C   1 
ATOM   827  O O   . ALA A 1 121 ? 24.004  -10.125 46.815 1.00 43.21  ? 121  ALA A O   1 
ATOM   828  C CB  . ALA A 1 121 ? 22.910  -10.654 49.865 1.00 38.92  ? 121  ALA A CB  1 
ATOM   829  N N   . GLU A 1 122 ? 22.933  -12.090 47.021 1.00 40.86  ? 122  GLU A N   1 
ATOM   830  C CA  . GLU A 1 122 ? 23.700  -12.776 45.988 1.00 41.02  ? 122  GLU A CA  1 
ATOM   831  C C   . GLU A 1 122 ? 23.397  -12.231 44.600 1.00 44.19  ? 122  GLU A C   1 
ATOM   832  O O   . GLU A 1 122 ? 24.300  -12.015 43.797 1.00 44.63  ? 122  GLU A O   1 
ATOM   833  C CB  . GLU A 1 122 ? 23.378  -14.272 46.027 1.00 42.57  ? 122  GLU A CB  1 
ATOM   834  C CG  . GLU A 1 122 ? 24.154  -15.113 45.035 1.00 51.41  ? 122  GLU A CG  1 
ATOM   835  C CD  . GLU A 1 122 ? 24.127  -16.581 45.390 1.00 64.24  ? 122  GLU A CD  1 
ATOM   836  O OE1 . GLU A 1 122 ? 23.031  -17.110 45.673 1.00 60.25  ? 122  GLU A OE1 1 
ATOM   837  O OE2 . GLU A 1 122 ? 25.207  -17.201 45.399 1.00 53.63  ? 122  GLU A OE2 1 
ATOM   838  N N   . LYS A 1 123 ? 22.119  -12.061 44.298 1.00 39.26  ? 123  LYS A N   1 
ATOM   839  C CA  A LYS A 1 123 ? 21.719  -11.565 42.992 0.50 39.02  ? 123  LYS A CA  1 
ATOM   840  C CA  B LYS A 1 123 ? 21.711  -11.555 42.995 0.50 38.82  ? 123  LYS A CA  1 
ATOM   841  C C   . LYS A 1 123 ? 22.304  -10.173 42.731 1.00 42.03  ? 123  LYS A C   1 
ATOM   842  O O   . LYS A 1 123 ? 22.727  -9.861  41.615 1.00 40.92  ? 123  LYS A O   1 
ATOM   843  C CB  A LYS A 1 123 ? 20.193  -11.559 42.879 0.50 41.89  ? 123  LYS A CB  1 
ATOM   844  C CB  B LYS A 1 123 ? 20.186  -11.498 42.894 0.50 41.23  ? 123  LYS A CB  1 
ATOM   845  C CG  A LYS A 1 123 ? 19.670  -11.947 41.500 0.50 58.54  ? 123  LYS A CG  1 
ATOM   846  C CG  B LYS A 1 123 ? 19.677  -11.295 41.473 0.50 52.11  ? 123  LYS A CG  1 
ATOM   847  C CD  A LYS A 1 123 ? 18.372  -12.737 41.601 0.50 66.63  ? 123  LYS A CD  1 
ATOM   848  C CD  B LYS A 1 123 ? 20.159  -12.413 40.556 0.50 55.60  ? 123  LYS A CD  1 
ATOM   849  C CE  A LYS A 1 123 ? 18.586  -14.039 42.360 0.50 74.01  ? 123  LYS A CE  1 
ATOM   850  C CE  B LYS A 1 123 ? 19.824  -12.124 39.103 0.50 59.46  ? 123  LYS A CE  1 
ATOM   851  N NZ  A LYS A 1 123 ? 17.364  -14.886 42.389 0.50 81.76  ? 123  LYS A NZ  1 
ATOM   852  N NZ  B LYS A 1 123 ? 20.268  -13.227 38.211 0.50 66.34  ? 123  LYS A NZ  1 
ATOM   853  N N   . LEU A 1 124 ? 22.342  -9.349  43.770 1.00 38.44  ? 124  LEU A N   1 
ATOM   854  C CA  . LEU A 1 124 ? 22.902  -8.005  43.672 1.00 38.44  ? 124  LEU A CA  1 
ATOM   855  C C   . LEU A 1 124 ? 24.408  -8.040  43.395 1.00 40.77  ? 124  LEU A C   1 
ATOM   856  O O   . LEU A 1 124 ? 24.932  -7.211  42.651 1.00 38.35  ? 124  LEU A O   1 
ATOM   857  C CB  . LEU A 1 124 ? 22.609  -7.214  44.959 1.00 38.55  ? 124  LEU A CB  1 
ATOM   858  C CG  . LEU A 1 124 ? 21.223  -6.573  45.058 1.00 43.36  ? 124  LEU A CG  1 
ATOM   859  C CD1 . LEU A 1 124 ? 20.920  -6.120  46.481 1.00 43.79  ? 124  LEU A CD1 1 
ATOM   860  C CD2 . LEU A 1 124 ? 21.133  -5.399  44.096 1.00 44.87  ? 124  LEU A CD2 1 
ATOM   861  N N   . CYS A 1 125 ? 25.099  -8.994  44.013 1.00 38.30  ? 125  CYS A N   1 
ATOM   862  C CA  . CYS A 1 125 ? 26.533  -9.164  43.802 1.00 38.45  ? 125  CYS A CA  1 
ATOM   863  C C   . CYS A 1 125 ? 26.828  -9.632  42.379 1.00 40.27  ? 125  CYS A C   1 
ATOM   864  O O   . CYS A 1 125 ? 27.795  -9.200  41.755 1.00 39.28  ? 125  CYS A O   1 
ATOM   865  C CB  . CYS A 1 125 ? 27.106  -10.140 44.828 1.00 39.87  ? 125  CYS A CB  1 
ATOM   866  S SG  . CYS A 1 125 ? 26.957  -9.559  46.544 1.00 44.32  ? 125  CYS A SG  1 
ATOM   867  N N   . ILE A 1 126 ? 25.957  -10.484 41.853 1.00 36.15  ? 126  ILE A N   1 
ATOM   868  C CA  . ILE A 1 126 ? 26.038  -10.902 40.459 1.00 35.82  ? 126  ILE A CA  1 
ATOM   869  C C   . ILE A 1 126 ? 26.023  -9.705  39.509 1.00 41.62  ? 126  ILE A C   1 
ATOM   870  O O   . ILE A 1 126 ? 26.734  -9.684  38.513 1.00 41.86  ? 126  ILE A O   1 
ATOM   871  C CB  . ILE A 1 126 ? 24.913  -11.884 40.118 1.00 38.47  ? 126  ILE A CB  1 
ATOM   872  C CG1 . ILE A 1 126 ? 25.171  -13.245 40.769 1.00 38.71  ? 126  ILE A CG1 1 
ATOM   873  C CG2 . ILE A 1 126 ? 24.739  -11.991 38.619 1.00 38.64  ? 126  ILE A CG2 1 
ATOM   874  C CD1 . ILE A 1 126 ? 24.025  -14.229 40.601 1.00 44.27  ? 126  ILE A CD1 1 
ATOM   875  N N   . TYR A 1 127 ? 25.201  -8.710  39.818 1.00 39.53  ? 127  TYR A N   1 
ATOM   876  C CA  . TYR A 1 127 ? 25.146  -7.494  39.017 1.00 39.86  ? 127  TYR A CA  1 
ATOM   877  C C   . TYR A 1 127 ? 26.383  -6.625  39.145 1.00 44.35  ? 127  TYR A C   1 
ATOM   878  O O   . TYR A 1 127 ? 26.619  -5.749  38.320 1.00 44.74  ? 127  TYR A O   1 
ATOM   879  C CB  . TYR A 1 127 ? 23.894  -6.691  39.349 1.00 41.27  ? 127  TYR A CB  1 
ATOM   880  C CG  . TYR A 1 127 ? 22.670  -7.176  38.620 1.00 43.35  ? 127  TYR A CG  1 
ATOM   881  C CD1 . TYR A 1 127 ? 22.439  -6.803  37.308 1.00 45.33  ? 127  TYR A CD1 1 
ATOM   882  C CD2 . TYR A 1 127 ? 21.754  -8.018  39.236 1.00 44.61  ? 127  TYR A CD2 1 
ATOM   883  C CE1 . TYR A 1 127 ? 21.321  -7.234  36.627 1.00 45.88  ? 127  TYR A CE1 1 
ATOM   884  C CE2 . TYR A 1 127 ? 20.628  -8.456  38.563 1.00 45.87  ? 127  TYR A CE2 1 
ATOM   885  C CZ  . TYR A 1 127 ? 20.415  -8.049  37.257 1.00 53.81  ? 127  TYR A CZ  1 
ATOM   886  O OH  . TYR A 1 127 ? 19.306  -8.468  36.559 1.00 56.81  ? 127  TYR A OH  1 
ATOM   887  N N   . THR A 1 128 ? 27.169  -6.864  40.188 1.00 41.50  ? 128  THR A N   1 
ATOM   888  C CA  . THR A 1 128 ? 28.466  -6.215  40.335 1.00 41.11  ? 128  THR A CA  1 
ATOM   889  C C   . THR A 1 128 ? 29.566  -7.062  39.687 1.00 46.09  ? 128  THR A C   1 
ATOM   890  O O   . THR A 1 128 ? 30.756  -6.767  39.824 1.00 45.27  ? 128  THR A O   1 
ATOM   891  C CB  . THR A 1 128 ? 28.781  -5.937  41.815 1.00 44.99  ? 128  THR A CB  1 
ATOM   892  O OG1 . THR A 1 128 ? 29.222  -7.144  42.446 1.00 43.16  ? 128  THR A OG1 1 
ATOM   893  C CG2 . THR A 1 128 ? 27.539  -5.434  42.540 1.00 41.51  ? 128  THR A CG2 1 
ATOM   894  N N   . ASP A 1 129 ? 29.159  -8.099  38.958 1.00 43.29  ? 129  ASP A N   1 
ATOM   895  C CA  . ASP A 1 129 ? 30.106  -9.065  38.397 1.00 43.13  ? 129  ASP A CA  1 
ATOM   896  C C   . ASP A 1 129 ? 30.861  -9.758  39.518 1.00 46.70  ? 129  ASP A C   1 
ATOM   897  O O   . ASP A 1 129 ? 31.952  -10.285 39.312 1.00 46.92  ? 129  ASP A O   1 
ATOM   898  C CB  . ASP A 1 129 ? 31.087  -8.392  37.429 1.00 44.37  ? 129  ASP A CB  1 
ATOM   899  C CG  . ASP A 1 129 ? 30.524  -8.270  36.031 1.00 49.57  ? 129  ASP A CG  1 
ATOM   900  O OD1 . ASP A 1 129 ? 29.405  -8.773  35.810 1.00 52.23  ? 129  ASP A OD1 1 
ATOM   901  O OD2 . ASP A 1 129 ? 31.191  -7.682  35.157 1.00 50.65  ? 129  ASP A OD2 1 
ATOM   902  N N   . ASN A 1 130 ? 30.240  -9.778  40.692 1.00 42.56  ? 130  ASN A N   1 
ATOM   903  C CA  . ASN A 1 130 ? 30.814  -10.374 41.892 1.00 42.40  ? 130  ASN A CA  1 
ATOM   904  C C   . ASN A 1 130 ? 32.048  -9.634  42.327 1.00 47.29  ? 130  ASN A C   1 
ATOM   905  O O   . ASN A 1 130 ? 32.963  -10.228 42.887 1.00 47.83  ? 130  ASN A O   1 
ATOM   906  C CB  . ASN A 1 130 ? 31.123  -11.853 41.696 1.00 41.52  ? 130  ASN A CB  1 
ATOM   907  C CG  . ASN A 1 130 ? 29.878  -12.670 41.483 1.00 55.00  ? 130  ASN A CG  1 
ATOM   908  O OD1 . ASN A 1 130 ? 28.936  -12.598 42.277 1.00 48.82  ? 130  ASN A OD1 1 
ATOM   909  N ND2 . ASN A 1 130 ? 29.830  -13.398 40.371 1.00 42.70  ? 130  ASN A ND2 1 
ATOM   910  N N   . SER A 1 131 ? 32.085  -8.343  42.009 1.00 44.11  ? 131  SER A N   1 
ATOM   911  C CA  . SER A 1 131 ? 33.092  -7.437  42.547 1.00 43.71  ? 131  SER A CA  1 
ATOM   912  C C   . SER A 1 131 ? 32.893  -7.242  44.049 1.00 46.97  ? 131  SER A C   1 
ATOM   913  O O   . SER A 1 131 ? 33.857  -7.117  44.801 1.00 46.86  ? 131  SER A O   1 
ATOM   914  C CB  . SER A 1 131 ? 33.018  -6.095  41.829 1.00 47.67  ? 131  SER A CB  1 
ATOM   915  O OG  . SER A 1 131 ? 33.378  -5.046  42.699 1.00 58.21  ? 131  SER A OG  1 
ATOM   916  N N   . ILE A 1 132 ? 31.639  -7.237  44.487 1.00 43.23  ? 132  ILE A N   1 
ATOM   917  C CA  . ILE A 1 132 ? 31.339  -7.234  45.915 1.00 42.68  ? 132  ILE A CA  1 
ATOM   918  C C   . ILE A 1 132 ? 30.760  -8.582  46.321 1.00 46.69  ? 132  ILE A C   1 
ATOM   919  O O   . ILE A 1 132 ? 30.292  -9.348  45.474 1.00 46.63  ? 132  ILE A O   1 
ATOM   920  C CB  . ILE A 1 132 ? 30.397  -6.075  46.310 1.00 45.71  ? 132  ILE A CB  1 
ATOM   921  C CG1 . ILE A 1 132 ? 28.936  -6.491  46.110 1.00 46.47  ? 132  ILE A CG1 1 
ATOM   922  C CG2 . ILE A 1 132 ? 30.725  -4.818  45.500 1.00 45.56  ? 132  ILE A CG2 1 
ATOM   923  C CD1 . ILE A 1 132 ? 27.929  -5.605  46.828 1.00 53.34  ? 132  ILE A CD1 1 
ATOM   924  N N   . ARG A 1 133 ? 30.716  -8.828  47.626 1.00 43.06  ? 133  ARG A N   1 
ATOM   925  C CA  . ARG A 1 133 ? 30.345  -10.134 48.148 1.00 43.40  ? 133  ARG A CA  1 
ATOM   926  C C   . ARG A 1 133 ? 29.248  -10.020 49.204 1.00 46.53  ? 133  ARG A C   1 
ATOM   927  O O   . ARG A 1 133 ? 29.125  -9.000  49.876 1.00 46.93  ? 133  ARG A O   1 
ATOM   928  C CB  . ARG A 1 133 ? 31.595  -10.805 48.726 1.00 46.41  ? 133  ARG A CB  1 
ATOM   929  C CG  . ARG A 1 133 ? 32.824  -10.561 47.848 1.00 58.56  ? 133  ARG A CG  1 
ATOM   930  C CD  . ARG A 1 133 ? 34.117  -10.969 48.522 1.00 67.13  ? 133  ARG A CD  1 
ATOM   931  N NE  . ARG A 1 133 ? 34.423  -12.374 48.288 1.00 70.20  ? 133  ARG A NE  1 
ATOM   932  C CZ  . ARG A 1 133 ? 34.283  -13.324 49.201 1.00 86.76  ? 133  ARG A CZ  1 
ATOM   933  N NH1 . ARG A 1 133 ? 33.859  -13.015 50.419 1.00 77.46  ? 133  ARG A NH1 1 
ATOM   934  N NH2 . ARG A 1 133 ? 34.584  -14.578 48.899 1.00 77.04  ? 133  ARG A NH2 1 
ATOM   935  N N   . PRO A 1 134 ? 28.437  -11.074 49.363 1.00 42.61  ? 134  PRO A N   1 
ATOM   936  C CA  . PRO A 1 134 ? 27.267  -10.951 50.241 1.00 42.52  ? 134  PRO A CA  1 
ATOM   937  C C   . PRO A 1 134 ? 27.589  -10.463 51.653 1.00 47.31  ? 134  PRO A C   1 
ATOM   938  O O   . PRO A 1 134 ? 26.878  -9.614  52.191 1.00 47.77  ? 134  PRO A O   1 
ATOM   939  C CB  . PRO A 1 134 ? 26.703  -12.373 50.269 1.00 43.59  ? 134  PRO A CB  1 
ATOM   940  C CG  . PRO A 1 134 ? 27.061  -12.921 48.936 1.00 47.66  ? 134  PRO A CG  1 
ATOM   941  C CD  . PRO A 1 134 ? 28.403  -12.322 48.581 1.00 43.43  ? 134  PRO A CD  1 
ATOM   942  N N   . GLU A 1 135 ? 28.652  -10.989 52.255 1.00 43.50  ? 135  GLU A N   1 
ATOM   943  C CA  . GLU A 1 135 ? 28.983  -10.612 53.626 1.00 43.38  ? 135  GLU A CA  1 
ATOM   944  C C   . GLU A 1 135 ? 29.329  -9.128  53.695 1.00 46.43  ? 135  GLU A C   1 
ATOM   945  O O   . GLU A 1 135 ? 29.078  -8.466  54.702 1.00 45.78  ? 135  GLU A O   1 
ATOM   946  C CB  . GLU A 1 135 ? 30.133  -11.452 54.170 1.00 44.88  ? 135  GLU A CB  1 
ATOM   947  C CG  . GLU A 1 135 ? 30.149  -12.876 53.644 1.00 58.76  ? 135  GLU A CG  1 
ATOM   948  C CD  . GLU A 1 135 ? 30.994  -13.023 52.390 1.00 79.79  ? 135  GLU A CD  1 
ATOM   949  O OE1 . GLU A 1 135 ? 32.143  -12.529 52.389 1.00 72.26  ? 135  GLU A OE1 1 
ATOM   950  O OE2 . GLU A 1 135 ? 30.525  -13.667 51.426 1.00 72.25  ? 135  GLU A OE2 1 
ATOM   951  N N   . GLU A 1 136 ? 29.902  -8.607  52.615 1.00 42.06  ? 136  GLU A N   1 
ATOM   952  C CA  . GLU A 1 136 ? 30.169  -7.181  52.525 1.00 41.69  ? 136  GLU A CA  1 
ATOM   953  C C   . GLU A 1 136 ? 28.855  -6.406  52.519 1.00 44.19  ? 136  GLU A C   1 
ATOM   954  O O   . GLU A 1 136 ? 28.712  -5.388  53.194 1.00 43.17  ? 136  GLU A O   1 
ATOM   955  C CB  . GLU A 1 136 ? 30.949  -6.873  51.250 1.00 43.18  ? 136  GLU A CB  1 
ATOM   956  C CG  . GLU A 1 136 ? 32.422  -7.229  51.316 1.00 53.63  ? 136  GLU A CG  1 
ATOM   957  C CD  . GLU A 1 136 ? 33.146  -6.855  50.050 1.00 74.24  ? 136  GLU A CD  1 
ATOM   958  O OE1 . GLU A 1 136 ? 32.722  -7.315  48.970 1.00 68.73  ? 136  GLU A OE1 1 
ATOM   959  O OE2 . GLU A 1 136 ? 34.117  -6.077  50.131 1.00 75.19  ? 136  GLU A OE2 1 
ATOM   960  N N   . LEU A 1 137 ? 27.910  -6.894  51.726 1.00 40.95  ? 137  LEU A N   1 
ATOM   961  C CA  . LEU A 1 137 ? 26.589  -6.293  51.622 1.00 40.71  ? 137  LEU A CA  1 
ATOM   962  C C   . LEU A 1 137 ? 25.877  -6.345  52.980 1.00 43.80  ? 137  LEU A C   1 
ATOM   963  O O   . LEU A 1 137 ? 25.308  -5.355  53.431 1.00 43.39  ? 137  LEU A O   1 
ATOM   964  C CB  . LEU A 1 137 ? 25.772  -7.046  50.571 1.00 40.64  ? 137  LEU A CB  1 
ATOM   965  C CG  . LEU A 1 137 ? 24.514  -6.384  50.010 1.00 45.20  ? 137  LEU A CG  1 
ATOM   966  C CD1 . LEU A 1 137 ? 24.858  -5.582  48.768 1.00 44.88  ? 137  LEU A CD1 1 
ATOM   967  C CD2 . LEU A 1 137 ? 23.502  -7.453  49.683 1.00 48.54  ? 137  LEU A CD2 1 
ATOM   968  N N   . LEU A 1 138 ? 25.934  -7.498  53.636 1.00 40.65  ? 138  LEU A N   1 
ATOM   969  C CA  . LEU A 1 138 ? 25.246  -7.680  54.909 1.00 41.27  ? 138  LEU A CA  1 
ATOM   970  C C   . LEU A 1 138 ? 25.800  -6.767  55.990 1.00 45.80  ? 138  LEU A C   1 
ATOM   971  O O   . LEU A 1 138 ? 25.066  -6.313  56.870 1.00 46.23  ? 138  LEU A O   1 
ATOM   972  C CB  . LEU A 1 138 ? 25.312  -9.138  55.364 1.00 41.48  ? 138  LEU A CB  1 
ATOM   973  C CG  . LEU A 1 138 ? 24.689  -10.164 54.417 1.00 46.09  ? 138  LEU A CG  1 
ATOM   974  C CD1 . LEU A 1 138 ? 24.467  -11.486 55.143 1.00 45.46  ? 138  LEU A CD1 1 
ATOM   975  C CD2 . LEU A 1 138 ? 23.380  -9.626  53.816 1.00 47.55  ? 138  LEU A CD2 1 
ATOM   976  N N   . GLN A 1 139 ? 27.101  -6.516  55.931 1.00 41.72  ? 139  GLN A N   1 
ATOM   977  C CA  . GLN A 1 139 ? 27.741  -5.607  56.869 1.00 41.39  ? 139  GLN A CA  1 
ATOM   978  C C   . GLN A 1 139 ? 27.410  -4.142  56.595 1.00 43.82  ? 139  GLN A C   1 
ATOM   979  O O   . GLN A 1 139 ? 27.152  -3.382  57.530 1.00 42.57  ? 139  GLN A O   1 
ATOM   980  C CB  . GLN A 1 139 ? 29.254  -5.833  56.903 1.00 42.98  ? 139  GLN A CB  1 
ATOM   981  C CG  . GLN A 1 139 ? 29.667  -7.126  57.605 1.00 65.60  ? 139  GLN A CG  1 
ATOM   982  C CD  . GLN A 1 139 ? 31.162  -7.401  57.503 1.00 84.43  ? 139  GLN A CD  1 
ATOM   983  O OE1 . GLN A 1 139 ? 31.608  -8.539  57.655 1.00 78.84  ? 139  GLN A OE1 1 
ATOM   984  N NE2 . GLN A 1 139 ? 31.940  -6.356  57.241 1.00 76.34  ? 139  GLN A NE2 1 
ATOM   985  N N   . MET A 1 140 ? 27.416  -3.747  55.320 1.00 40.30  ? 140  MET A N   1 
ATOM   986  C CA  . MET A 1 140 ? 26.945  -2.408  54.938 1.00 39.38  ? 140  MET A CA  1 
ATOM   987  C C   . MET A 1 140 ? 25.495  -2.163  55.347 1.00 41.50  ? 140  MET A C   1 
ATOM   988  O O   . MET A 1 140 ? 25.156  -1.078  55.821 1.00 42.37  ? 140  MET A O   1 
ATOM   989  C CB  . MET A 1 140 ? 27.113  -2.152  53.440 1.00 41.59  ? 140  MET A CB  1 
ATOM   990  C CG  . MET A 1 140 ? 28.352  -1.380  53.060 1.00 45.03  ? 140  MET A CG  1 
ATOM   991  S SD  . MET A 1 140 ? 28.382  0.312   53.689 1.00 49.47  ? 140  MET A SD  1 
ATOM   992  C CE  . MET A 1 140 ? 29.514  1.098   52.458 1.00 45.98  ? 140  MET A CE  1 
ATOM   993  N N   . GLU A 1 141 ? 24.641  -3.167  55.181 1.00 35.96  ? 141  GLU A N   1 
ATOM   994  C CA  . GLU A 1 141 ? 23.221  -2.984  55.496 1.00 34.79  ? 141  GLU A CA  1 
ATOM   995  C C   . GLU A 1 141 ? 23.008  -2.479  56.919 1.00 39.54  ? 141  GLU A C   1 
ATOM   996  O O   . GLU A 1 141 ? 22.165  -1.620  57.164 1.00 39.61  ? 141  GLU A O   1 
ATOM   997  C CB  . GLU A 1 141 ? 22.389  -4.258  55.262 1.00 35.19  ? 141  GLU A CB  1 
ATOM   998  C CG  . GLU A 1 141 ? 20.942  -4.060  55.684 1.00 39.41  ? 141  GLU A CG  1 
ATOM   999  C CD  . GLU A 1 141 ? 20.109  -5.325  55.726 1.00 50.42  ? 141  GLU A CD  1 
ATOM   1000 O OE1 . GLU A 1 141 ? 20.597  -6.363  56.214 1.00 42.22  ? 141  GLU A OE1 1 
ATOM   1001 O OE2 . GLU A 1 141 ? 18.909  -5.238  55.389 1.00 39.98  ? 141  GLU A OE2 1 
ATOM   1002 N N   . LEU A 1 142 ? 23.739  -3.052  57.863 1.00 36.99  ? 142  LEU A N   1 
ATOM   1003 C CA  . LEU A 1 142 ? 23.636  -2.637  59.250 1.00 37.59  ? 142  LEU A CA  1 
ATOM   1004 C C   . LEU A 1 142 ? 24.142  -1.212  59.472 1.00 41.56  ? 142  LEU A C   1 
ATOM   1005 O O   . LEU A 1 142 ? 23.505  -0.415  60.172 1.00 40.86  ? 142  LEU A O   1 
ATOM   1006 C CB  . LEU A 1 142 ? 24.371  -3.634  60.134 1.00 38.32  ? 142  LEU A CB  1 
ATOM   1007 C CG  . LEU A 1 142 ? 23.632  -4.972  60.151 1.00 44.79  ? 142  LEU A CG  1 
ATOM   1008 C CD1 . LEU A 1 142 ? 24.604  -6.150  60.152 1.00 46.04  ? 142  LEU A CD1 1 
ATOM   1009 C CD2 . LEU A 1 142 ? 22.687  -5.039  61.343 1.00 47.81  ? 142  LEU A CD2 1 
ATOM   1010 N N   . LEU A 1 143 ? 25.281  -0.896  58.863 1.00 39.34  ? 143  LEU A N   1 
ATOM   1011 C CA  . LEU A 1 143 ? 25.798  0.469   58.829 1.00 39.84  ? 143  LEU A CA  1 
ATOM   1012 C C   . LEU A 1 143 ? 24.769  1.466   58.297 1.00 40.43  ? 143  LEU A C   1 
ATOM   1013 O O   . LEU A 1 143 ? 24.605  2.553   58.849 1.00 40.65  ? 143  LEU A O   1 
ATOM   1014 C CB  . LEU A 1 143 ? 27.055  0.538   57.952 1.00 40.89  ? 143  LEU A CB  1 
ATOM   1015 C CG  . LEU A 1 143 ? 28.446  0.609   58.590 1.00 47.23  ? 143  LEU A CG  1 
ATOM   1016 C CD1 . LEU A 1 143 ? 28.832  -0.707  59.271 1.00 48.47  ? 143  LEU A CD1 1 
ATOM   1017 C CD2 . LEU A 1 143 ? 29.473  0.995   57.535 1.00 49.65  ? 143  LEU A CD2 1 
ATOM   1018 N N   . LEU A 1 144 ? 24.154  1.132   57.168 1.00 33.86  ? 144  LEU A N   1 
ATOM   1019 C CA  . LEU A 1 144 ? 23.207  2.034   56.512 1.00 32.50  ? 144  LEU A CA  1 
ATOM   1020 C C   . LEU A 1 144 ? 21.937  2.254   57.323 1.00 36.23  ? 144  LEU A C   1 
ATOM   1021 O O   . LEU A 1 144 ? 21.564  3.381   57.606 1.00 36.43  ? 144  LEU A O   1 
ATOM   1022 C CB  . LEU A 1 144 ? 22.855  1.516   55.117 1.00 32.38  ? 144  LEU A CB  1 
ATOM   1023 C CG  . LEU A 1 144 ? 21.761  2.254   54.336 1.00 36.68  ? 144  LEU A CG  1 
ATOM   1024 C CD1 . LEU A 1 144 ? 22.189  3.671   53.933 1.00 35.52  ? 144  LEU A CD1 1 
ATOM   1025 C CD2 . LEU A 1 144 ? 21.316  1.445   53.124 1.00 37.38  ? 144  LEU A CD2 1 
ATOM   1026 N N   . VAL A 1 145 ? 21.267  1.170   57.694 1.00 32.41  ? 145  VAL A N   1 
ATOM   1027 C CA  . VAL A 1 145 ? 20.059  1.258   58.512 1.00 31.71  ? 145  VAL A CA  1 
ATOM   1028 C C   . VAL A 1 145 ? 20.299  2.002   59.817 1.00 34.21  ? 145  VAL A C   1 
ATOM   1029 O O   . VAL A 1 145 ? 19.528  2.875   60.194 1.00 34.08  ? 145  VAL A O   1 
ATOM   1030 C CB  . VAL A 1 145 ? 19.460  -0.144  58.760 1.00 36.04  ? 145  VAL A CB  1 
ATOM   1031 C CG1 . VAL A 1 145 ? 18.229  -0.044  59.623 1.00 35.96  ? 145  VAL A CG1 1 
ATOM   1032 C CG2 . VAL A 1 145 ? 19.130  -0.809  57.425 1.00 35.83  ? 145  VAL A CG2 1 
ATOM   1033 N N   . ASN A 1 146 ? 21.365  1.638   60.519 1.00 31.14  ? 146  ASN A N   1 
ATOM   1034 C CA  . ASN A 1 146 ? 21.709  2.300   61.773 1.00 31.12  ? 146  ASN A CA  1 
ATOM   1035 C C   . ASN A 1 146 ? 21.930  3.790   61.569 1.00 34.05  ? 146  ASN A C   1 
ATOM   1036 O O   . ASN A 1 146 ? 21.490  4.591   62.376 1.00 33.30  ? 146  ASN A O   1 
ATOM   1037 C CB  . ASN A 1 146 ? 22.959  1.665   62.403 1.00 31.78  ? 146  ASN A CB  1 
ATOM   1038 C CG  . ASN A 1 146 ? 22.653  0.378   63.134 1.00 51.63  ? 146  ASN A CG  1 
ATOM   1039 O OD1 . ASN A 1 146 ? 21.516  0.136   63.544 1.00 37.62  ? 146  ASN A OD1 1 
ATOM   1040 N ND2 . ASN A 1 146 ? 23.672  -0.459  63.310 1.00 46.02  ? 146  ASN A ND2 1 
ATOM   1041 N N   . LYS A 1 147 ? 22.622  4.153   60.490 1.00 30.70  ? 147  LYS A N   1 
ATOM   1042 C CA  . LYS A 1 147 ? 22.919  5.555   60.198 1.00 30.46  ? 147  LYS A CA  1 
ATOM   1043 C C   . LYS A 1 147 ? 21.685  6.380   59.831 1.00 32.07  ? 147  LYS A C   1 
ATOM   1044 O O   . LYS A 1 147 ? 21.631  7.589   60.075 1.00 30.74  ? 147  LYS A O   1 
ATOM   1045 C CB  . LYS A 1 147 ? 23.965  5.657   59.085 1.00 33.82  ? 147  LYS A CB  1 
ATOM   1046 C CG  . LYS A 1 147 ? 25.397  5.707   59.582 1.00 52.79  ? 147  LYS A CG  1 
ATOM   1047 C CD  . LYS A 1 147 ? 25.863  7.138   59.794 1.00 61.46  ? 147  LYS A CD  1 
ATOM   1048 C CE  . LYS A 1 147 ? 27.047  7.184   60.744 1.00 81.07  ? 147  LYS A CE  1 
ATOM   1049 N NZ  . LYS A 1 147 ? 27.995  6.064   60.492 1.00 95.00  ? 147  LYS A NZ  1 
ATOM   1050 N N   . LEU A 1 148 ? 20.726  5.744   59.175 1.00 27.62  ? 148  LEU A N   1 
ATOM   1051 C CA  . LEU A 1 148 ? 19.479  6.421   58.839 1.00 26.97  ? 148  LEU A CA  1 
ATOM   1052 C C   . LEU A 1 148 ? 18.520  6.268   59.999 1.00 31.73  ? 148  LEU A C   1 
ATOM   1053 O O   . LEU A 1 148 ? 17.376  6.682   59.919 1.00 30.60  ? 148  LEU A O   1 
ATOM   1054 C CB  . LEU A 1 148 ? 18.864  5.827   57.579 1.00 26.58  ? 148  LEU A CB  1 
ATOM   1055 C CG  . LEU A 1 148 ? 19.776  5.747   56.351 1.00 29.94  ? 148  LEU A CG  1 
ATOM   1056 C CD1 . LEU A 1 148 ? 18.987  5.289   55.129 1.00 29.43  ? 148  LEU A CD1 1 
ATOM   1057 C CD2 . LEU A 1 148 ? 20.432  7.074   56.095 1.00 29.57  ? 148  LEU A CD2 1 
ATOM   1058 N N   . LYS A 1 149 ? 18.999  5.620   61.059 1.00 31.16  ? 149  LYS A N   1 
ATOM   1059 C CA  . LYS A 1 149 ? 18.233  5.419   62.285 1.00 31.59  ? 149  LYS A CA  1 
ATOM   1060 C C   . LYS A 1 149 ? 16.977  4.581   62.025 1.00 36.13  ? 149  LYS A C   1 
ATOM   1061 O O   . LYS A 1 149 ? 15.956  4.755   62.694 1.00 35.37  ? 149  LYS A O   1 
ATOM   1062 C CB  . LYS A 1 149 ? 17.857  6.766   62.897 1.00 34.32  ? 149  LYS A CB  1 
ATOM   1063 C CG  . LYS A 1 149 ? 19.047  7.603   63.373 1.00 37.18  ? 149  LYS A CG  1 
ATOM   1064 C CD  . LYS A 1 149 ? 18.586  9.006   63.713 1.00 41.87  ? 149  LYS A CD  1 
ATOM   1065 C CE  . LYS A 1 149 ? 19.671  9.816   64.375 1.00 61.08  ? 149  LYS A CE  1 
ATOM   1066 N NZ  . LYS A 1 149 ? 19.166  11.182  64.707 1.00 73.30  ? 149  LYS A NZ  1 
ATOM   1067 N N   . TRP A 1 150 ? 17.071  3.673   61.053 1.00 32.44  ? 150  TRP A N   1 
ATOM   1068 C CA  . TRP A 1 150 ? 15.963  2.782   60.678 1.00 31.97  ? 150  TRP A CA  1 
ATOM   1069 C C   . TRP A 1 150 ? 14.722  3.517   60.172 1.00 36.29  ? 150  TRP A C   1 
ATOM   1070 O O   . TRP A 1 150 ? 13.655  2.919   60.030 1.00 35.95  ? 150  TRP A O   1 
ATOM   1071 C CB  . TRP A 1 150 ? 15.588  1.833   61.815 1.00 30.25  ? 150  TRP A CB  1 
ATOM   1072 C CG  . TRP A 1 150 ? 16.645  0.790   62.146 1.00 31.05  ? 150  TRP A CG  1 
ATOM   1073 C CD1 . TRP A 1 150 ? 17.900  1.019   62.640 1.00 33.50  ? 150  TRP A CD1 1 
ATOM   1074 C CD2 . TRP A 1 150 ? 16.489  -0.636  62.101 1.00 30.75  ? 150  TRP A CD2 1 
ATOM   1075 N NE1 . TRP A 1 150 ? 18.545  -0.171  62.870 1.00 33.02  ? 150  TRP A NE1 1 
ATOM   1076 C CE2 . TRP A 1 150 ? 17.699  -1.205  62.561 1.00 34.64  ? 150  TRP A CE2 1 
ATOM   1077 C CE3 . TRP A 1 150 ? 15.433  -1.490  61.738 1.00 32.27  ? 150  TRP A CE3 1 
ATOM   1078 C CZ2 . TRP A 1 150 ? 17.892  -2.588  62.662 1.00 33.96  ? 150  TRP A CZ2 1 
ATOM   1079 C CZ3 . TRP A 1 150 ? 15.633  -2.867  61.812 1.00 33.68  ? 150  TRP A CZ3 1 
ATOM   1080 C CH2 . TRP A 1 150 ? 16.853  -3.400  62.280 1.00 34.61  ? 150  TRP A CH2 1 
ATOM   1081 N N   . ASN A 1 151 ? 14.871  4.805   59.871 1.00 31.90  ? 151  ASN A N   1 
ATOM   1082 C CA  . ASN A 1 151 ? 13.791  5.553   59.243 1.00 31.33  ? 151  ASN A CA  1 
ATOM   1083 C C   . ASN A 1 151 ? 13.792  5.295   57.730 1.00 34.69  ? 151  ASN A C   1 
ATOM   1084 O O   . ASN A 1 151 ? 14.143  6.168   56.932 1.00 33.66  ? 151  ASN A O   1 
ATOM   1085 C CB  . ASN A 1 151 ? 13.927  7.044   59.555 1.00 29.70  ? 151  ASN A CB  1 
ATOM   1086 C CG  . ASN A 1 151 ? 12.696  7.842   59.164 1.00 49.39  ? 151  ASN A CG  1 
ATOM   1087 O OD1 . ASN A 1 151 ? 11.666  7.283   58.787 1.00 39.74  ? 151  ASN A OD1 1 
ATOM   1088 N ND2 . ASN A 1 151 ? 12.808  9.162   59.231 1.00 44.58  ? 151  ASN A ND2 1 
ATOM   1089 N N   . LEU A 1 152 ? 13.399  4.078   57.355 1.00 30.26  ? 152  LEU A N   1 
ATOM   1090 C CA  . LEU A 1 152 ? 13.526  3.587   55.988 1.00 28.67  ? 152  LEU A CA  1 
ATOM   1091 C C   . LEU A 1 152 ? 12.245  3.771   55.183 1.00 33.64  ? 152  LEU A C   1 
ATOM   1092 O O   . LEU A 1 152 ? 12.235  3.592   53.968 1.00 31.82  ? 152  LEU A O   1 
ATOM   1093 C CB  . LEU A 1 152 ? 13.887  2.104   56.014 1.00 28.49  ? 152  LEU A CB  1 
ATOM   1094 C CG  . LEU A 1 152 ? 15.026  1.703   56.950 1.00 33.37  ? 152  LEU A CG  1 
ATOM   1095 C CD1 . LEU A 1 152 ? 15.225  0.194   56.973 1.00 33.07  ? 152  LEU A CD1 1 
ATOM   1096 C CD2 . LEU A 1 152 ? 16.323  2.425   56.597 1.00 35.65  ? 152  LEU A CD2 1 
ATOM   1097 N N   . ALA A 1 153 ? 11.155  4.085   55.876 1.00 33.97  ? 153  ALA A N   1 
ATOM   1098 C CA  . ALA A 1 153 ? 9.844   4.203   55.245 1.00 35.20  ? 153  ALA A CA  1 
ATOM   1099 C C   . ALA A 1 153 ? 9.668   5.590   54.638 1.00 39.87  ? 153  ALA A C   1 
ATOM   1100 O O   . ALA A 1 153 ? 8.718   6.311   54.950 1.00 39.65  ? 153  ALA A O   1 
ATOM   1101 C CB  . ALA A 1 153 ? 8.747   3.914   56.259 1.00 36.37  ? 153  ALA A CB  1 
ATOM   1102 N N   . ALA A 1 154 ? 10.613  5.963   53.781 1.00 35.80  ? 154  ALA A N   1 
ATOM   1103 C CA  . ALA A 1 154 ? 10.597  7.265   53.156 1.00 34.67  ? 154  ALA A CA  1 
ATOM   1104 C C   . ALA A 1 154 ? 9.578   7.310   52.028 1.00 39.34  ? 154  ALA A C   1 
ATOM   1105 O O   . ALA A 1 154 ? 9.233   6.280   51.454 1.00 38.98  ? 154  ALA A O   1 
ATOM   1106 C CB  . ALA A 1 154 ? 11.975  7.614   52.651 1.00 34.96  ? 154  ALA A CB  1 
ATOM   1107 N N   . MET A 1 155 ? 9.082   8.512   51.739 1.00 36.30  ? 155  MET A N   1 
ATOM   1108 C CA  . MET A 1 155 ? 8.229   8.763   50.584 1.00 36.16  ? 155  MET A CA  1 
ATOM   1109 C C   . MET A 1 155 ? 9.040   8.697   49.305 1.00 39.95  ? 155  MET A C   1 
ATOM   1110 O O   . MET A 1 155 ? 10.229  9.035   49.299 1.00 39.84  ? 155  MET A O   1 
ATOM   1111 C CB  . MET A 1 155 ? 7.608   10.162  50.687 1.00 38.89  ? 155  MET A CB  1 
ATOM   1112 C CG  . MET A 1 155 ? 6.805   10.397  51.959 1.00 42.55  ? 155  MET A CG  1 
ATOM   1113 S SD  . MET A 1 155 ? 5.429   9.253   52.050 1.00 46.91  ? 155  MET A SD  1 
ATOM   1114 C CE  . MET A 1 155 ? 4.699   9.541   50.483 1.00 43.86  ? 155  MET A CE  1 
ATOM   1115 N N   . THR A 1 156 ? 8.392   8.291   48.213 1.00 35.53  ? 156  THR A N   1 
ATOM   1116 C CA  . THR A 1 156 ? 9.016   8.365   46.895 1.00 34.15  ? 156  THR A CA  1 
ATOM   1117 C C   . THR A 1 156 ? 8.185   9.265   45.989 1.00 36.96  ? 156  THR A C   1 
ATOM   1118 O O   . THR A 1 156 ? 7.062   9.639   46.333 1.00 37.27  ? 156  THR A O   1 
ATOM   1119 C CB  . THR A 1 156 ? 9.286   6.969   46.278 1.00 38.13  ? 156  THR A CB  1 
ATOM   1120 O OG1 . THR A 1 156 ? 8.058   6.361   45.861 1.00 38.68  ? 156  THR A OG1 1 
ATOM   1121 C CG2 . THR A 1 156 ? 9.951   6.059   47.292 1.00 35.22  ? 156  THR A CG2 1 
ATOM   1122 N N   . PRO A 1 157 ? 8.755   9.682   44.851 1.00 31.57  ? 157  PRO A N   1 
ATOM   1123 C CA  . PRO A 1 157 ? 7.924   10.493  43.958 1.00 31.45  ? 157  PRO A CA  1 
ATOM   1124 C C   . PRO A 1 157 ? 6.656   9.744   43.535 1.00 37.03  ? 157  PRO A C   1 
ATOM   1125 O O   . PRO A 1 157 ? 5.610   10.344  43.304 1.00 36.38  ? 157  PRO A O   1 
ATOM   1126 C CB  . PRO A 1 157 ? 8.843   10.733  42.760 1.00 32.98  ? 157  PRO A CB  1 
ATOM   1127 C CG  . PRO A 1 157 ? 10.223  10.689  43.345 1.00 36.88  ? 157  PRO A CG  1 
ATOM   1128 C CD  . PRO A 1 157 ? 10.162  9.637   44.410 1.00 32.33  ? 157  PRO A CD  1 
ATOM   1129 N N   . HIS A 1 158 ? 6.747   8.422   43.515 1.00 36.05  ? 158  HIS A N   1 
ATOM   1130 C CA  . HIS A 1 158 ? 5.651   7.561   43.090 1.00 36.59  ? 158  HIS A CA  1 
ATOM   1131 C C   . HIS A 1 158 ? 4.476   7.630   44.047 1.00 39.50  ? 158  HIS A C   1 
ATOM   1132 O O   . HIS A 1 158 ? 3.329   7.456   43.642 1.00 38.61  ? 158  HIS A O   1 
ATOM   1133 C CB  . HIS A 1 158 ? 6.141   6.119   42.979 1.00 38.29  ? 158  HIS A CB  1 
ATOM   1134 C CG  . HIS A 1 158 ? 7.269   5.945   42.015 1.00 42.69  ? 158  HIS A CG  1 
ATOM   1135 N ND1 . HIS A 1 158 ? 8.569   6.286   42.323 1.00 45.31  ? 158  HIS A ND1 1 
ATOM   1136 C CD2 . HIS A 1 158 ? 7.286   5.519   40.731 1.00 45.10  ? 158  HIS A CD2 1 
ATOM   1137 C CE1 . HIS A 1 158 ? 9.344   6.048   41.280 1.00 44.91  ? 158  HIS A CE1 1 
ATOM   1138 N NE2 . HIS A 1 158 ? 8.589   5.581   40.300 1.00 45.07  ? 158  HIS A NE2 1 
ATOM   1139 N N   . ASP A 1 159 ? 4.773   7.802   45.330 1.00 36.37  ? 159  ASP A N   1 
ATOM   1140 C CA  . ASP A 1 159 ? 3.728   7.992   46.325 1.00 36.58  ? 159  ASP A CA  1 
ATOM   1141 C C   . ASP A 1 159 ? 2.843   9.183   45.989 1.00 40.04  ? 159  ASP A C   1 
ATOM   1142 O O   . ASP A 1 159 ? 1.617   9.081   46.030 1.00 39.66  ? 159  ASP A O   1 
ATOM   1143 C CB  . ASP A 1 159 ? 4.333   8.154   47.722 1.00 38.63  ? 159  ASP A CB  1 
ATOM   1144 C CG  . ASP A 1 159 ? 4.930   6.856   48.244 1.00 43.37  ? 159  ASP A CG  1 
ATOM   1145 O OD1 . ASP A 1 159 ? 4.297   5.800   48.039 1.00 43.64  ? 159  ASP A OD1 1 
ATOM   1146 O OD2 . ASP A 1 159 ? 6.041   6.884   48.812 1.00 44.72  ? 159  ASP A OD2 1 
ATOM   1147 N N   . PHE A 1 160 ? 3.480   10.298  45.639 1.00 35.95  ? 160  PHE A N   1 
ATOM   1148 C CA  . PHE A 1 160 ? 2.791   11.546  45.350 1.00 35.24  ? 160  PHE A CA  1 
ATOM   1149 C C   . PHE A 1 160 ? 2.111   11.520  43.988 1.00 40.74  ? 160  PHE A C   1 
ATOM   1150 O O   . PHE A 1 160 ? 0.976   11.959  43.859 1.00 41.45  ? 160  PHE A O   1 
ATOM   1151 C CB  . PHE A 1 160 ? 3.759   12.720  45.447 1.00 36.37  ? 160  PHE A CB  1 
ATOM   1152 C CG  . PHE A 1 160 ? 4.170   13.045  46.853 1.00 37.19  ? 160  PHE A CG  1 
ATOM   1153 C CD1 . PHE A 1 160 ? 5.295   12.468  47.411 1.00 38.88  ? 160  PHE A CD1 1 
ATOM   1154 C CD2 . PHE A 1 160 ? 3.417   13.919  47.625 1.00 38.25  ? 160  PHE A CD2 1 
ATOM   1155 C CE1 . PHE A 1 160 ? 5.661   12.755  48.708 1.00 39.23  ? 160  PHE A CE1 1 
ATOM   1156 C CE2 . PHE A 1 160 ? 3.788   14.212  48.918 1.00 39.89  ? 160  PHE A CE2 1 
ATOM   1157 C CZ  . PHE A 1 160 ? 4.911   13.635  49.457 1.00 37.72  ? 160  PHE A CZ  1 
ATOM   1158 N N   . ILE A 1 161 ? 2.803   10.987  42.984 1.00 37.09  ? 161  ILE A N   1 
ATOM   1159 C CA  . ILE A 1 161 ? 2.231   10.810  41.649 1.00 36.74  ? 161  ILE A CA  1 
ATOM   1160 C C   . ILE A 1 161 ? 0.836   10.190  41.725 1.00 44.73  ? 161  ILE A C   1 
ATOM   1161 O O   . ILE A 1 161 ? -0.154  10.797  41.324 1.00 44.50  ? 161  ILE A O   1 
ATOM   1162 C CB  . ILE A 1 161 ? 3.163   9.975   40.752 1.00 38.68  ? 161  ILE A CB  1 
ATOM   1163 C CG1 . ILE A 1 161 ? 4.418   10.777  40.390 1.00 39.19  ? 161  ILE A CG1 1 
ATOM   1164 C CG2 . ILE A 1 161 ? 2.448   9.541   39.492 1.00 38.37  ? 161  ILE A CG2 1 
ATOM   1165 C CD1 . ILE A 1 161 ? 5.456   9.996   39.577 1.00 37.79  ? 161  ILE A CD1 1 
ATOM   1166 N N   . GLU A 1 162 ? 0.762   8.989   42.286 1.00 44.30  ? 162  GLU A N   1 
ATOM   1167 C CA  . GLU A 1 162 ? -0.504  8.285   42.474 1.00 44.16  ? 162  GLU A CA  1 
ATOM   1168 C C   . GLU A 1 162 ? -1.506  9.086   43.289 1.00 49.19  ? 162  GLU A C   1 
ATOM   1169 O O   . GLU A 1 162 ? -2.711  9.017   43.041 1.00 50.43  ? 162  GLU A O   1 
ATOM   1170 C CB  . GLU A 1 162 ? -0.254  6.930   43.133 1.00 45.54  ? 162  GLU A CB  1 
ATOM   1171 C CG  . GLU A 1 162 ? 0.646   6.041   42.306 1.00 51.24  ? 162  GLU A CG  1 
ATOM   1172 C CD  . GLU A 1 162 ? 0.104   5.854   40.907 1.00 66.23  ? 162  GLU A CD  1 
ATOM   1173 O OE1 . GLU A 1 162 ? -1.097  5.524   40.780 1.00 60.20  ? 162  GLU A OE1 1 
ATOM   1174 O OE2 . GLU A 1 162 ? 0.866   6.060   39.939 1.00 57.74  ? 162  GLU A OE2 1 
ATOM   1175 N N   . HIS A 1 163 ? -1.020  9.839   44.268 1.00 44.77  ? 163  HIS A N   1 
ATOM   1176 C CA  . HIS A 1 163 ? -1.913  10.694  45.035 1.00 44.45  ? 163  HIS A CA  1 
ATOM   1177 C C   . HIS A 1 163 ? -2.496  11.811  44.164 1.00 46.72  ? 163  HIS A C   1 
ATOM   1178 O O   . HIS A 1 163 ? -3.714  11.983  44.100 1.00 45.51  ? 163  HIS A O   1 
ATOM   1179 C CB  . HIS A 1 163 ? -1.222  11.285  46.260 1.00 45.39  ? 163  HIS A CB  1 
ATOM   1180 C CG  . HIS A 1 163 ? -2.160  11.999  47.180 1.00 49.25  ? 163  HIS A CG  1 
ATOM   1181 N ND1 . HIS A 1 163 ? -2.969  11.335  48.078 1.00 51.25  ? 163  HIS A ND1 1 
ATOM   1182 C CD2 . HIS A 1 163 ? -2.461  13.314  47.305 1.00 51.44  ? 163  HIS A CD2 1 
ATOM   1183 C CE1 . HIS A 1 163 ? -3.702  12.212  48.741 1.00 50.84  ? 163  HIS A CE1 1 
ATOM   1184 N NE2 . HIS A 1 163 ? -3.415  13.421  48.288 1.00 51.26  ? 163  HIS A NE2 1 
ATOM   1185 N N   . PHE A 1 164 ? -1.620  12.577  43.514 1.00 41.33  ? 164  PHE A N   1 
ATOM   1186 C CA  . PHE A 1 164 ? -2.059  13.614  42.594 1.00 40.14  ? 164  PHE A CA  1 
ATOM   1187 C C   . PHE A 1 164 ? -3.048  13.025  41.603 1.00 48.03  ? 164  PHE A C   1 
ATOM   1188 O O   . PHE A 1 164 ? -4.159  13.524  41.459 1.00 48.63  ? 164  PHE A O   1 
ATOM   1189 C CB  . PHE A 1 164 ? -0.873  14.224  41.848 1.00 40.68  ? 164  PHE A CB  1 
ATOM   1190 C CG  . PHE A 1 164 ? 0.161   14.842  42.750 1.00 40.59  ? 164  PHE A CG  1 
ATOM   1191 C CD1 . PHE A 1 164 ? -0.175  15.255  44.031 1.00 42.48  ? 164  PHE A CD1 1 
ATOM   1192 C CD2 . PHE A 1 164 ? 1.473   14.982  42.327 1.00 40.86  ? 164  PHE A CD2 1 
ATOM   1193 C CE1 . PHE A 1 164 ? 0.775   15.793  44.868 1.00 42.51  ? 164  PHE A CE1 1 
ATOM   1194 C CE2 . PHE A 1 164 ? 2.427   15.529  43.159 1.00 42.71  ? 164  PHE A CE2 1 
ATOM   1195 C CZ  . PHE A 1 164 ? 2.081   15.934  44.428 1.00 40.73  ? 164  PHE A CZ  1 
ATOM   1196 N N   . LEU A 1 165 ? -2.655  11.936  40.951 1.00 46.84  ? 165  LEU A N   1 
ATOM   1197 C CA  . LEU A 1 165 ? -3.511  11.273  39.968 1.00 47.54  ? 165  LEU A CA  1 
ATOM   1198 C C   . LEU A 1 165 ? -4.934  10.981  40.464 1.00 55.00  ? 165  LEU A C   1 
ATOM   1199 O O   . LEU A 1 165 ? -5.893  11.074  39.696 1.00 55.09  ? 165  LEU A O   1 
ATOM   1200 C CB  . LEU A 1 165 ? -2.847  10.004  39.431 1.00 47.15  ? 165  LEU A CB  1 
ATOM   1201 C CG  . LEU A 1 165 ? -1.951  10.194  38.205 1.00 51.32  ? 165  LEU A CG  1 
ATOM   1202 C CD1 . LEU A 1 165 ? -1.156  11.478  38.327 1.00 51.75  ? 165  LEU A CD1 1 
ATOM   1203 C CD2 . LEU A 1 165 ? -1.021  9.005   38.014 1.00 51.75  ? 165  LEU A CD2 1 
ATOM   1204 N N   . SER A 1 166 ? -5.076  10.667  41.749 1.00 53.34  ? 166  SER A N   1 
ATOM   1205 C CA  . SER A 1 166 ? -6.391  10.358  42.314 1.00 53.62  ? 166  SER A CA  1 
ATOM   1206 C C   . SER A 1 166 ? -7.262  11.602  42.454 1.00 59.61  ? 166  SER A C   1 
ATOM   1207 O O   . SER A 1 166 ? -8.462  11.501  42.703 1.00 60.43  ? 166  SER A O   1 
ATOM   1208 C CB  . SER A 1 166 ? -6.257  9.654   43.669 1.00 55.43  ? 166  SER A CB  1 
ATOM   1209 O OG  . SER A 1 166 ? -5.880  10.565  44.687 1.00 59.08  ? 166  SER A OG  1 
ATOM   1210 N N   . LYS A 1 167 ? -6.647  12.771  42.316 1.00 56.54  ? 167  LYS A N   1 
ATOM   1211 C CA  . LYS A 1 167 ? -7.362  14.043  42.414 1.00 56.81  ? 167  LYS A CA  1 
ATOM   1212 C C   . LYS A 1 167 ? -7.733  14.576  41.033 1.00 59.88  ? 167  LYS A C   1 
ATOM   1213 O O   . LYS A 1 167 ? -8.414  15.591  40.914 1.00 59.74  ? 167  LYS A O   1 
ATOM   1214 C CB  . LYS A 1 167 ? -6.500  15.100  43.133 1.00 59.95  ? 167  LYS A CB  1 
ATOM   1215 C CG  . LYS A 1 167 ? -6.058  14.728  44.549 1.00 72.00  ? 167  LYS A CG  1 
ATOM   1216 C CD  . LYS A 1 167 ? -5.305  15.878  45.220 1.00 76.89  ? 167  LYS A CD  1 
ATOM   1217 C CE  . LYS A 1 167 ? -6.209  17.082  45.450 1.00 79.88  ? 167  LYS A CE  1 
ATOM   1218 N NZ  . LYS A 1 167 ? -5.566  18.116  46.305 1.00 85.54  ? 167  LYS A NZ  1 
ATOM   1219 N N   . MET A 1 168 ? -7.269  13.900  39.991 1.00 56.24  ? 168  MET A N   1 
ATOM   1220 C CA  . MET A 1 168 ? -7.353  14.446  38.644 1.00 56.18  ? 168  MET A CA  1 
ATOM   1221 C C   . MET A 1 168 ? -8.448  13.791  37.815 1.00 61.11  ? 168  MET A C   1 
ATOM   1222 O O   . MET A 1 168 ? -8.475  12.573  37.661 1.00 60.48  ? 168  MET A O   1 
ATOM   1223 C CB  . MET A 1 168 ? -6.004  14.319  37.940 1.00 58.35  ? 168  MET A CB  1 
ATOM   1224 C CG  . MET A 1 168 ? -4.874  15.021  38.659 1.00 61.86  ? 168  MET A CG  1 
ATOM   1225 S SD  . MET A 1 168 ? -3.339  14.976  37.721 1.00 66.29  ? 168  MET A SD  1 
ATOM   1226 C CE  . MET A 1 168 ? -2.194  15.585  38.955 1.00 62.93  ? 168  MET A CE  1 
ATOM   1227 N N   . PRO A 1 169 ? -9.348  14.605  37.240 1.00 58.79  ? 169  PRO A N   1 
ATOM   1228 C CA  . PRO A 1 169 ? -10.480 14.135  36.430 1.00 58.45  ? 169  PRO A CA  1 
ATOM   1229 C C   . PRO A 1 169 ? -10.012 13.513  35.115 1.00 62.02  ? 169  PRO A C   1 
ATOM   1230 O O   . PRO A 1 169 ? -10.596 13.748  34.056 1.00 61.66  ? 169  PRO A O   1 
ATOM   1231 C CB  . PRO A 1 169 ? -11.251 15.422  36.151 1.00 59.94  ? 169  PRO A CB  1 
ATOM   1232 C CG  . PRO A 1 169 ? -10.183 16.465  36.080 1.00 64.48  ? 169  PRO A CG  1 
ATOM   1233 C CD  . PRO A 1 169 ? -9.092  16.043  37.043 1.00 60.22  ? 169  PRO A CD  1 
ATOM   1234 N N   . GLU A 1 170 ? -8.933  12.743  35.186 1.00 58.04  ? 170  GLU A N   1 
ATOM   1235 C CA  . GLU A 1 170 ? -8.449  12.003  34.029 1.00 57.28  ? 170  GLU A CA  1 
ATOM   1236 C C   . GLU A 1 170 ? -9.041  10.600  33.992 1.00 59.30  ? 170  GLU A C   1 
ATOM   1237 O O   . GLU A 1 170 ? -9.093  9.914   35.010 1.00 58.80  ? 170  GLU A O   1 
ATOM   1238 C CB  . GLU A 1 170 ? -6.926  11.912  34.063 1.00 58.61  ? 170  GLU A CB  1 
ATOM   1239 C CG  . GLU A 1 170 ? -6.249  13.250  34.105 1.00 67.80  ? 170  GLU A CG  1 
ATOM   1240 C CD  . GLU A 1 170 ? -6.602  14.083  32.909 1.00 79.43  ? 170  GLU A CD  1 
ATOM   1241 O OE1 . GLU A 1 170 ? -7.042  13.489  31.901 1.00 73.12  ? 170  GLU A OE1 1 
ATOM   1242 O OE2 . GLU A 1 170 ? -6.436  15.320  32.978 1.00 65.21  ? 170  GLU A OE2 1 
ATOM   1243 N N   . ALA A 1 171 ? -9.476  10.175  32.810 1.00 55.09  ? 171  ALA A N   1 
ATOM   1244 C CA  . ALA A 1 171 ? -9.864  8.785   32.597 1.00 54.36  ? 171  ALA A CA  1 
ATOM   1245 C C   . ALA A 1 171 ? -8.671  7.891   32.923 1.00 58.19  ? 171  ALA A C   1 
ATOM   1246 O O   . ALA A 1 171 ? -7.520  8.289   32.738 1.00 56.73  ? 171  ALA A O   1 
ATOM   1247 C CB  . ALA A 1 171 ? -10.311 8.576   31.154 1.00 54.83  ? 171  ALA A CB  1 
ATOM   1248 N N   . GLU A 1 172 ? -8.949  6.688   33.418 1.00 55.86  ? 172  GLU A N   1 
ATOM   1249 C CA  . GLU A 1 172 ? -7.890  5.739   33.744 1.00 55.90  ? 172  GLU A CA  1 
ATOM   1250 C C   . GLU A 1 172 ? -6.915  5.432   32.605 1.00 58.57  ? 172  GLU A C   1 
ATOM   1251 O O   . GLU A 1 172 ? -5.740  5.170   32.853 1.00 59.07  ? 172  GLU A O   1 
ATOM   1252 C CB  . GLU A 1 172 ? -8.452  4.462   34.365 1.00 57.68  ? 172  GLU A CB  1 
ATOM   1253 C CG  . GLU A 1 172 ? -8.288  4.399   35.874 1.00 70.56  ? 172  GLU A CG  1 
ATOM   1254 C CD  . GLU A 1 172 ? -6.828  4.461   36.298 1.00 98.20  ? 172  GLU A CD  1 
ATOM   1255 O OE1 . GLU A 1 172 ? -5.950  4.505   35.407 1.00 93.67  ? 172  GLU A OE1 1 
ATOM   1256 O OE2 . GLU A 1 172 ? -6.557  4.469   37.519 1.00 95.09  ? 172  GLU A OE2 1 
ATOM   1257 N N   . GLU A 1 173 ? -7.376  5.508   31.361 1.00 53.42  ? 173  GLU A N   1 
ATOM   1258 C CA  . GLU A 1 173 ? -6.470  5.322   30.228 1.00 52.49  ? 173  GLU A CA  1 
ATOM   1259 C C   . GLU A 1 173 ? -5.494  6.485   30.126 1.00 55.19  ? 173  GLU A C   1 
ATOM   1260 O O   . GLU A 1 173 ? -4.331  6.303   29.753 1.00 54.78  ? 173  GLU A O   1 
ATOM   1261 C CB  . GLU A 1 173 ? -7.234  5.163   28.913 1.00 53.83  ? 173  GLU A CB  1 
ATOM   1262 C CG  . GLU A 1 173 ? -8.444  4.252   29.005 1.00 68.08  ? 173  GLU A CG  1 
ATOM   1263 C CD  . GLU A 1 173 ? -9.710  5.003   29.387 1.00 90.31  ? 173  GLU A CD  1 
ATOM   1264 O OE1 . GLU A 1 173 ? -10.221 5.766   28.537 1.00 88.86  ? 173  GLU A OE1 1 
ATOM   1265 O OE2 . GLU A 1 173 ? -10.209 4.807   30.518 1.00 77.90  ? 173  GLU A OE2 1 
ATOM   1266 N N   . ASN A 1 174 ? -5.990  7.689   30.406 1.00 50.32  ? 174  ASN A N   1 
ATOM   1267 C CA  . ASN A 1 174 ? -5.133  8.874   30.494 1.00 49.08  ? 174  ASN A CA  1 
ATOM   1268 C C   . ASN A 1 174 ? -4.141  8.721   31.640 1.00 49.52  ? 174  ASN A C   1 
ATOM   1269 O O   . ASN A 1 174 ? -2.948  8.948   31.475 1.00 48.66  ? 174  ASN A O   1 
ATOM   1270 C CB  . ASN A 1 174 ? -5.972  10.130  30.744 1.00 50.06  ? 174  ASN A CB  1 
ATOM   1271 C CG  . ASN A 1 174 ? -6.736  10.576  29.520 1.00 69.42  ? 174  ASN A CG  1 
ATOM   1272 O OD1 . ASN A 1 174 ? -6.608  9.988   28.447 1.00 61.17  ? 174  ASN A OD1 1 
ATOM   1273 N ND2 . ASN A 1 174 ? -7.523  11.639  29.670 1.00 62.17  ? 174  ASN A ND2 1 
ATOM   1274 N N   . LYS A 1 175 ? -4.664  8.382   32.813 1.00 44.83  ? 175  LYS A N   1 
ATOM   1275 C CA  . LYS A 1 175 ? -3.861  8.270   34.018 1.00 44.02  ? 175  LYS A CA  1 
ATOM   1276 C C   . LYS A 1 175 ? -2.701  7.306   33.825 1.00 49.46  ? 175  LYS A C   1 
ATOM   1277 O O   . LYS A 1 175 ? -1.584  7.556   34.284 1.00 49.79  ? 175  LYS A O   1 
ATOM   1278 C CB  . LYS A 1 175 ? -4.723  7.809   35.186 1.00 45.30  ? 175  LYS A CB  1 
ATOM   1279 C CG  . LYS A 1 175 ? -5.649  8.866   35.731 1.00 49.00  ? 175  LYS A CG  1 
ATOM   1280 C CD  . LYS A 1 175 ? -6.347  8.358   36.977 1.00 53.58  ? 175  LYS A CD  1 
ATOM   1281 C CE  . LYS A 1 175 ? -7.376  9.353   37.476 1.00 58.07  ? 175  LYS A CE  1 
ATOM   1282 N NZ  . LYS A 1 175 ? -8.141  8.781   38.611 1.00 62.29  ? 175  LYS A NZ  1 
ATOM   1283 N N   . GLN A 1 176 ? -2.966  6.203   33.138 1.00 46.24  ? 176  GLN A N   1 
ATOM   1284 C CA  . GLN A 1 176 ? -1.946  5.185   32.949 1.00 45.73  ? 176  GLN A CA  1 
ATOM   1285 C C   . GLN A 1 176 ? -0.830  5.682   32.047 1.00 48.47  ? 176  GLN A C   1 
ATOM   1286 O O   . GLN A 1 176 ? 0.339   5.378   32.262 1.00 48.25  ? 176  GLN A O   1 
ATOM   1287 C CB  . GLN A 1 176 ? -2.550  3.901   32.396 1.00 47.09  ? 176  GLN A CB  1 
ATOM   1288 C CG  . GLN A 1 176 ? -1.620  2.719   32.574 1.00 71.30  ? 176  GLN A CG  1 
ATOM   1289 C CD  . GLN A 1 176 ? -0.871  2.781   33.898 1.00 87.39  ? 176  GLN A CD  1 
ATOM   1290 O OE1 . GLN A 1 176 ? -1.468  2.993   34.956 1.00 83.30  ? 176  GLN A OE1 1 
ATOM   1291 N NE2 . GLN A 1 176 ? 0.447   2.641   33.836 1.00 75.05  ? 176  GLN A NE2 1 
ATOM   1292 N N   . ILE A 1 177 ? -1.195  6.450   31.031 1.00 43.96  ? 177  ILE A N   1 
ATOM   1293 C CA  . ILE A 1 177 ? -0.205  7.035   30.144 1.00 43.49  ? 177  ILE A CA  1 
ATOM   1294 C C   . ILE A 1 177 ? 0.615   8.092   30.894 1.00 47.14  ? 177  ILE A C   1 
ATOM   1295 O O   . ILE A 1 177 ? 1.839   8.152   30.764 1.00 47.24  ? 177  ILE A O   1 
ATOM   1296 C CB  . ILE A 1 177 ? -0.869  7.607   28.878 1.00 46.33  ? 177  ILE A CB  1 
ATOM   1297 C CG1 . ILE A 1 177 ? -1.752  6.538   28.222 1.00 46.74  ? 177  ILE A CG1 1 
ATOM   1298 C CG2 . ILE A 1 177 ? 0.182   8.143   27.917 1.00 46.08  ? 177  ILE A CG2 1 
ATOM   1299 C CD1 . ILE A 1 177 ? -2.553  7.035   27.036 1.00 53.23  ? 177  ILE A CD1 1 
ATOM   1300 N N   . ILE A 1 178 ? -0.076  8.929   31.664 1.00 42.29  ? 178  ILE A N   1 
ATOM   1301 C CA  . ILE A 1 178 ? 0.574   9.944   32.491 1.00 41.34  ? 178  ILE A CA  1 
ATOM   1302 C C   . ILE A 1 178 ? 1.540   9.239   33.442 1.00 45.62  ? 178  ILE A C   1 
ATOM   1303 O O   . ILE A 1 178 ? 2.679   9.663   33.634 1.00 45.02  ? 178  ILE A O   1 
ATOM   1304 C CB  . ILE A 1 178 ? -0.482  10.776  33.282 1.00 43.37  ? 178  ILE A CB  1 
ATOM   1305 C CG1 . ILE A 1 178 ? -1.176  11.794  32.366 1.00 43.49  ? 178  ILE A CG1 1 
ATOM   1306 C CG2 . ILE A 1 178 ? 0.154   11.469  34.469 1.00 42.35  ? 178  ILE A CG2 1 
ATOM   1307 C CD1 . ILE A 1 178 ? -2.342  12.519  33.019 1.00 46.36  ? 178  ILE A CD1 1 
ATOM   1308 N N   . ARG A 1 179 ? 1.073   8.138   34.017 1.00 42.14  ? 179  ARG A N   1 
ATOM   1309 C CA  . ARG A 1 179 ? 1.839   7.420   35.018 1.00 41.73  ? 179  ARG A CA  1 
ATOM   1310 C C   . ARG A 1 179 ? 3.143   6.919   34.394 1.00 45.05  ? 179  ARG A C   1 
ATOM   1311 O O   . ARG A 1 179 ? 4.217   7.042   34.979 1.00 45.11  ? 179  ARG A O   1 
ATOM   1312 C CB  . ARG A 1 179 ? 1.010   6.249   35.553 1.00 40.77  ? 179  ARG A CB  1 
ATOM   1313 C CG  . ARG A 1 179 ? 1.118   6.050   37.050 1.00 49.40  ? 179  ARG A CG  1 
ATOM   1314 C CD  . ARG A 1 179 ? 0.394   4.792   37.494 1.00 55.94  ? 179  ARG A CD  1 
ATOM   1315 N NE  . ARG A 1 179 ? -0.928  4.658   36.881 1.00 61.49  ? 179  ARG A NE  1 
ATOM   1316 C CZ  . ARG A 1 179 ? -2.070  5.002   37.468 1.00 69.39  ? 179  ARG A CZ  1 
ATOM   1317 N NH1 . ARG A 1 179 ? -2.067  5.512   38.691 1.00 49.73  ? 179  ARG A NH1 1 
ATOM   1318 N NH2 . ARG A 1 179 ? -3.220  4.835   36.830 1.00 59.03  ? 179  ARG A NH2 1 
ATOM   1319 N N   . LYS A 1 180 ? 3.045   6.415   33.171 1.00 40.89  ? 180  LYS A N   1 
ATOM   1320 C CA  . LYS A 1 180 ? 4.188   5.833   32.484 1.00 40.33  ? 180  LYS A CA  1 
ATOM   1321 C C   . LYS A 1 180 ? 5.249   6.891   32.186 1.00 44.83  ? 180  LYS A C   1 
ATOM   1322 O O   . LYS A 1 180 ? 6.417   6.725   32.527 1.00 44.58  ? 180  LYS A O   1 
ATOM   1323 C CB  . LYS A 1 180 ? 3.729   5.134   31.199 1.00 42.52  ? 180  LYS A CB  1 
ATOM   1324 C CG  . LYS A 1 180 ? 4.789   4.272   30.535 1.00 61.05  ? 180  LYS A CG  1 
ATOM   1325 C CD  . LYS A 1 180 ? 4.281   3.654   29.235 1.00 74.27  ? 180  LYS A CD  1 
ATOM   1326 C CE  . LYS A 1 180 ? 3.894   4.721   28.214 1.00 81.24  ? 180  LYS A CE  1 
ATOM   1327 N NZ  . LYS A 1 180 ? 3.430   4.122   26.931 1.00 84.47  ? 180  LYS A NZ  1 
ATOM   1328 N N   . HIS A 1 181 ? 4.833   7.992   31.567 1.00 41.77  ? 181  HIS A N   1 
ATOM   1329 C CA  . HIS A 1 181 ? 5.724   9.119   31.317 1.00 41.26  ? 181  HIS A CA  1 
ATOM   1330 C C   . HIS A 1 181 ? 6.326   9.732   32.597 1.00 43.60  ? 181  HIS A C   1 
ATOM   1331 O O   . HIS A 1 181 ? 7.505   10.074  32.634 1.00 43.13  ? 181  HIS A O   1 
ATOM   1332 C CB  . HIS A 1 181 ? 5.007   10.188  30.492 1.00 42.22  ? 181  HIS A CB  1 
ATOM   1333 C CG  . HIS A 1 181 ? 4.648   9.746   29.107 1.00 45.82  ? 181  HIS A CG  1 
ATOM   1334 N ND1 . HIS A 1 181 ? 3.864   8.639   28.856 1.00 47.70  ? 181  HIS A ND1 1 
ATOM   1335 C CD2 . HIS A 1 181 ? 4.940   10.277  27.895 1.00 47.24  ? 181  HIS A CD2 1 
ATOM   1336 C CE1 . HIS A 1 181 ? 3.705   8.500   27.553 1.00 46.64  ? 181  HIS A CE1 1 
ATOM   1337 N NE2 . HIS A 1 181 ? 4.345   9.483   26.946 1.00 46.85  ? 181  HIS A NE2 1 
ATOM   1338 N N   . ALA A 1 182 ? 5.511   9.876   33.636 1.00 38.77  ? 182  ALA A N   1 
ATOM   1339 C CA  . ALA A 1 182 ? 5.949   10.513  34.875 1.00 38.15  ? 182  ALA A CA  1 
ATOM   1340 C C   . ALA A 1 182 ? 6.977   9.665   35.635 1.00 42.26  ? 182  ALA A C   1 
ATOM   1341 O O   . ALA A 1 182 ? 7.857   10.192  36.320 1.00 40.99  ? 182  ALA A O   1 
ATOM   1342 C CB  . ALA A 1 182 ? 4.749   10.809  35.767 1.00 38.66  ? 182  ALA A CB  1 
ATOM   1343 N N   . GLN A 1 183 ? 6.828   8.348   35.553 1.00 39.62  ? 183  GLN A N   1 
ATOM   1344 C CA  . GLN A 1 183 ? 7.771   7.431   36.184 1.00 39.27  ? 183  GLN A CA  1 
ATOM   1345 C C   . GLN A 1 183 ? 9.144   7.442   35.493 1.00 41.95  ? 183  GLN A C   1 
ATOM   1346 O O   . GLN A 1 183 ? 10.181  7.276   36.141 1.00 41.50  ? 183  GLN A O   1 
ATOM   1347 C CB  . GLN A 1 183 ? 7.169   6.023   36.253 1.00 40.57  ? 183  GLN A CB  1 
ATOM   1348 C CG  . GLN A 1 183 ? 6.009   5.928   37.247 1.00 51.28  ? 183  GLN A CG  1 
ATOM   1349 C CD  . GLN A 1 183 ? 5.269   4.600   37.186 1.00 67.32  ? 183  GLN A CD  1 
ATOM   1350 O OE1 . GLN A 1 183 ? 4.675   4.166   38.174 1.00 63.69  ? 183  GLN A OE1 1 
ATOM   1351 N NE2 . GLN A 1 183 ? 5.283   3.961   36.019 1.00 53.18  ? 183  GLN A NE2 1 
ATOM   1352 N N   . THR A 1 184 ? 9.130   7.686   34.186 1.00 37.35  ? 184  THR A N   1 
ATOM   1353 C CA  . THR A 1 184 ? 10.331  7.893   33.388 1.00 36.78  ? 184  THR A CA  1 
ATOM   1354 C C   . THR A 1 184 ? 11.091  9.142   33.841 1.00 40.69  ? 184  THR A C   1 
ATOM   1355 O O   . THR A 1 184 ? 12.314  9.113   33.994 1.00 39.89  ? 184  THR A O   1 
ATOM   1356 C CB  . THR A 1 184 ? 9.956   8.035   31.900 1.00 44.71  ? 184  THR A CB  1 
ATOM   1357 O OG1 . THR A 1 184 ? 9.526   6.771   31.384 1.00 43.26  ? 184  THR A OG1 1 
ATOM   1358 C CG2 . THR A 1 184 ? 11.136  8.569   31.091 1.00 42.79  ? 184  THR A CG2 1 
ATOM   1359 N N   . PHE A 1 185 ? 10.363  10.250  33.992 1.00 36.41  ? 185  PHE A N   1 
ATOM   1360 C CA  . PHE A 1 185 ? 10.943  11.504  34.469 1.00 35.27  ? 185  PHE A CA  1 
ATOM   1361 C C   . PHE A 1 185 ? 11.555  11.358  35.861 1.00 36.97  ? 185  PHE A C   1 
ATOM   1362 O O   . PHE A 1 185 ? 12.619  11.898  36.129 1.00 37.36  ? 185  PHE A O   1 
ATOM   1363 C CB  . PHE A 1 185 ? 9.902   12.630  34.471 1.00 36.88  ? 185  PHE A CB  1 
ATOM   1364 C CG  . PHE A 1 185 ? 9.481   13.075  33.102 1.00 38.54  ? 185  PHE A CG  1 
ATOM   1365 C CD1 . PHE A 1 185 ? 10.427  13.350  32.126 1.00 43.49  ? 185  PHE A CD1 1 
ATOM   1366 C CD2 . PHE A 1 185 ? 8.144   13.270  32.805 1.00 40.22  ? 185  PHE A CD2 1 
ATOM   1367 C CE1 . PHE A 1 185 ? 10.040  13.788  30.862 1.00 44.88  ? 185  PHE A CE1 1 
ATOM   1368 C CE2 . PHE A 1 185 ? 7.747   13.677  31.546 1.00 44.00  ? 185  PHE A CE2 1 
ATOM   1369 C CZ  . PHE A 1 185 ? 8.693   13.937  30.569 1.00 42.91  ? 185  PHE A CZ  1 
ATOM   1370 N N   . VAL A 1 186 ? 10.864  10.657  36.753 1.00 31.29  ? 186  VAL A N   1 
ATOM   1371 C CA  . VAL A 1 186 ? 11.387  10.398  38.089 1.00 30.65  ? 186  VAL A CA  1 
ATOM   1372 C C   . VAL A 1 186 ? 12.740  9.669   38.070 1.00 35.47  ? 186  VAL A C   1 
ATOM   1373 O O   . VAL A 1 186 ? 13.660  10.018  38.825 1.00 33.39  ? 186  VAL A O   1 
ATOM   1374 C CB  . VAL A 1 186 ? 10.360  9.630   38.948 1.00 33.88  ? 186  VAL A CB  1 
ATOM   1375 C CG1 . VAL A 1 186 ? 10.931  9.335   40.339 1.00 33.60  ? 186  VAL A CG1 1 
ATOM   1376 C CG2 . VAL A 1 186 ? 9.070   10.416  39.057 1.00 33.57  ? 186  VAL A CG2 1 
ATOM   1377 N N   . ALA A 1 187 ? 12.831  8.609   37.267 1.00 33.59  ? 187  ALA A N   1 
ATOM   1378 C CA  . ALA A 1 187 ? 14.062  7.826   37.186 1.00 34.27  ? 187  ALA A CA  1 
ATOM   1379 C C   . ALA A 1 187 ? 15.208  8.687   36.640 1.00 40.56  ? 187  ALA A C   1 
ATOM   1380 O O   . ALA A 1 187 ? 16.339  8.612   37.116 1.00 40.33  ? 187  ALA A O   1 
ATOM   1381 C CB  . ALA A 1 187 ? 13.849  6.594   36.324 1.00 35.00  ? 187  ALA A CB  1 
ATOM   1382 N N   . LEU A 1 188 ? 14.885  9.552   35.684 1.00 38.28  ? 188  LEU A N   1 
ATOM   1383 C CA  . LEU A 1 188 ? 15.822  10.550  35.193 1.00 38.75  ? 188  LEU A CA  1 
ATOM   1384 C C   . LEU A 1 188 ? 16.340  11.476  36.295 1.00 42.49  ? 188  LEU A C   1 
ATOM   1385 O O   . LEU A 1 188 ? 17.543  11.716  36.390 1.00 42.73  ? 188  LEU A O   1 
ATOM   1386 C CB  . LEU A 1 188 ? 15.178  11.378  34.080 1.00 39.33  ? 188  LEU A CB  1 
ATOM   1387 C CG  . LEU A 1 188 ? 15.437  10.949  32.634 1.00 45.00  ? 188  LEU A CG  1 
ATOM   1388 C CD1 . LEU A 1 188 ? 14.626  11.824  31.678 1.00 45.31  ? 188  LEU A CD1 1 
ATOM   1389 C CD2 . LEU A 1 188 ? 16.929  11.071  32.331 1.00 47.05  ? 188  LEU A CD2 1 
ATOM   1390 N N   . CYS A 1 189 ? 15.426  12.043  37.079 1.00 38.40  ? 189  CYS A N   1 
ATOM   1391 C CA  . CYS A 1 189 ? 15.792  12.911  38.200 1.00 38.45  ? 189  CYS A CA  1 
ATOM   1392 C C   . CYS A 1 189 ? 16.676  12.197  39.219 1.00 36.60  ? 189  CYS A C   1 
ATOM   1393 O O   . CYS A 1 189 ? 17.563  12.795  39.805 1.00 35.10  ? 189  CYS A O   1 
ATOM   1394 C CB  . CYS A 1 189 ? 14.538  13.416  38.925 1.00 40.47  ? 189  CYS A CB  1 
ATOM   1395 S SG  . CYS A 1 189 ? 13.626  14.709  38.103 1.00 45.68  ? 189  CYS A SG  1 
ATOM   1396 N N   . ALA A 1 190 ? 16.322  10.960  39.534 1.00 31.79  ? 190  ALA A N   1 
ATOM   1397 C CA  . ALA A 1 190 ? 17.036  10.178  40.547 1.00 30.89  ? 190  ALA A CA  1 
ATOM   1398 C C   . ALA A 1 190 ? 18.507  9.945   40.187 1.00 34.89  ? 190  ALA A C   1 
ATOM   1399 O O   . ALA A 1 190 ? 19.347  9.806   41.074 1.00 34.87  ? 190  ALA A O   1 
ATOM   1400 C CB  . ALA A 1 190 ? 16.309  8.837   40.813 1.00 30.85  ? 190  ALA A CB  1 
ATOM   1401 N N   . THR A 1 191 ? 18.823  9.904   38.893 1.00 31.05  ? 191  THR A N   1 
ATOM   1402 C CA  . THR A 1 191 ? 20.222  9.801   38.473 1.00 30.52  ? 191  THR A CA  1 
ATOM   1403 C C   . THR A 1 191 ? 20.945  11.144  38.570 1.00 33.73  ? 191  THR A C   1 
ATOM   1404 O O   . THR A 1 191 ? 22.176  11.196  38.509 1.00 33.26  ? 191  THR A O   1 
ATOM   1405 C CB  . THR A 1 191 ? 20.380  9.208   37.063 1.00 32.93  ? 191  THR A CB  1 
ATOM   1406 O OG1 . THR A 1 191 ? 19.940  10.164  36.101 1.00 35.57  ? 191  THR A OG1 1 
ATOM   1407 C CG2 . THR A 1 191 ? 19.563  7.936   36.915 1.00 30.71  ? 191  THR A CG2 1 
ATOM   1408 N N   . ASP A 1 192 ? 20.177  12.224  38.712 1.00 29.07  ? 192  ASP A N   1 
ATOM   1409 C CA  . ASP A 1 192 ? 20.727  13.577  38.686 1.00 28.11  ? 192  ASP A CA  1 
ATOM   1410 C C   . ASP A 1 192 ? 20.795  14.215  40.096 1.00 33.40  ? 192  ASP A C   1 
ATOM   1411 O O   . ASP A 1 192 ? 20.111  13.776  41.024 1.00 31.33  ? 192  ASP A O   1 
ATOM   1412 C CB  . ASP A 1 192 ? 19.920  14.427  37.696 1.00 29.25  ? 192  ASP A CB  1 
ATOM   1413 C CG  . ASP A 1 192 ? 20.467  15.836  37.532 1.00 39.02  ? 192  ASP A CG  1 
ATOM   1414 O OD1 . ASP A 1 192 ? 21.527  16.004  36.908 1.00 41.37  ? 192  ASP A OD1 1 
ATOM   1415 O OD2 . ASP A 1 192 ? 19.775  16.788  37.930 1.00 45.33  ? 192  ASP A OD2 1 
ATOM   1416 N N   . VAL A 1 193 ? 21.659  15.216  40.258 1.00 33.60  ? 193  VAL A N   1 
ATOM   1417 C CA  . VAL A 1 193 ? 21.842  15.893  41.548 1.00 34.90  ? 193  VAL A CA  1 
ATOM   1418 C C   . VAL A 1 193 ? 20.567  16.572  42.039 1.00 40.31  ? 193  VAL A C   1 
ATOM   1419 O O   . VAL A 1 193 ? 20.399  16.830  43.239 1.00 41.73  ? 193  VAL A O   1 
ATOM   1420 C CB  . VAL A 1 193 ? 23.035  16.896  41.529 1.00 39.31  ? 193  VAL A CB  1 
ATOM   1421 C CG1 . VAL A 1 193 ? 24.364  16.154  41.456 1.00 39.30  ? 193  VAL A CG1 1 
ATOM   1422 C CG2 . VAL A 1 193 ? 22.894  17.903  40.382 1.00 38.96  ? 193  VAL A CG2 1 
ATOM   1423 N N   . LYS A 1 194 ? 19.675  16.862  41.103 1.00 35.50  ? 194  LYS A N   1 
ATOM   1424 C CA  . LYS A 1 194 ? 18.391  17.475  41.419 1.00 35.33  ? 194  LYS A CA  1 
ATOM   1425 C C   . LYS A 1 194 ? 17.615  16.643  42.451 1.00 38.97  ? 194  LYS A C   1 
ATOM   1426 O O   . LYS A 1 194 ? 16.945  17.179  43.327 1.00 38.67  ? 194  LYS A O   1 
ATOM   1427 C CB  . LYS A 1 194 ? 17.579  17.641  40.126 1.00 37.61  ? 194  LYS A CB  1 
ATOM   1428 C CG  . LYS A 1 194 ? 16.161  18.107  40.325 1.00 55.07  ? 194  LYS A CG  1 
ATOM   1429 C CD  . LYS A 1 194 ? 15.453  18.309  38.991 1.00 62.64  ? 194  LYS A CD  1 
ATOM   1430 C CE  . LYS A 1 194 ? 13.951  18.410  39.194 1.00 70.09  ? 194  LYS A CE  1 
ATOM   1431 N NZ  . LYS A 1 194 ? 13.632  19.034  40.507 1.00 77.13  ? 194  LYS A NZ  1 
ATOM   1432 N N   . PHE A 1 195 ? 17.708  15.326  42.352 1.00 35.39  ? 195  PHE A N   1 
ATOM   1433 C CA  . PHE A 1 195 ? 17.034  14.464  43.315 1.00 34.71  ? 195  PHE A CA  1 
ATOM   1434 C C   . PHE A 1 195 ? 17.473  14.803  44.735 1.00 40.54  ? 195  PHE A C   1 
ATOM   1435 O O   . PHE A 1 195 ? 16.805  14.439  45.702 1.00 40.85  ? 195  PHE A O   1 
ATOM   1436 C CB  . PHE A 1 195 ? 17.346  12.997  43.022 1.00 35.53  ? 195  PHE A CB  1 
ATOM   1437 C CG  . PHE A 1 195 ? 16.280  12.035  43.493 1.00 35.27  ? 195  PHE A CG  1 
ATOM   1438 C CD1 . PHE A 1 195 ? 15.040  11.989  42.865 1.00 36.85  ? 195  PHE A CD1 1 
ATOM   1439 C CD2 . PHE A 1 195 ? 16.539  11.139  44.523 1.00 35.63  ? 195  PHE A CD2 1 
ATOM   1440 C CE1 . PHE A 1 195 ? 14.066  11.074  43.273 1.00 37.13  ? 195  PHE A CE1 1 
ATOM   1441 C CE2 . PHE A 1 195 ? 15.567  10.222  44.931 1.00 37.84  ? 195  PHE A CE2 1 
ATOM   1442 C CZ  . PHE A 1 195 ? 14.323  10.208  44.315 1.00 35.29  ? 195  PHE A CZ  1 
ATOM   1443 N N   . ILE A 1 196 ? 18.618  15.470  44.858 1.00 37.47  ? 196  ILE A N   1 
ATOM   1444 C CA  . ILE A 1 196 ? 19.179  15.787  46.176 1.00 36.33  ? 196  ILE A CA  1 
ATOM   1445 C C   . ILE A 1 196 ? 18.571  17.067  46.728 1.00 39.21  ? 196  ILE A C   1 
ATOM   1446 O O   . ILE A 1 196 ? 18.311  17.169  47.927 1.00 38.52  ? 196  ILE A O   1 
ATOM   1447 C CB  . ILE A 1 196 ? 20.717  15.908  46.123 1.00 38.17  ? 196  ILE A CB  1 
ATOM   1448 C CG1 . ILE A 1 196 ? 21.343  14.682  45.461 1.00 37.06  ? 196  ILE A CG1 1 
ATOM   1449 C CG2 . ILE A 1 196 ? 21.279  16.135  47.507 1.00 37.93  ? 196  ILE A CG2 1 
ATOM   1450 C CD1 . ILE A 1 196 ? 22.827  14.826  45.229 1.00 33.92  ? 196  ILE A CD1 1 
ATOM   1451 N N   . SER A 1 197 ? 18.369  18.039  45.837 1.00 35.60  ? 197  SER A N   1 
ATOM   1452 C CA  . SER A 1 197 ? 17.865  19.365  46.190 1.00 35.81  ? 197  SER A CA  1 
ATOM   1453 C C   . SER A 1 197 ? 16.362  19.367  46.431 1.00 39.61  ? 197  SER A C   1 
ATOM   1454 O O   . SER A 1 197 ? 15.852  20.163  47.213 1.00 39.93  ? 197  SER A O   1 
ATOM   1455 C CB  . SER A 1 197 ? 18.170  20.361  45.060 1.00 41.04  ? 197  SER A CB  1 
ATOM   1456 O OG  . SER A 1 197 ? 19.531  20.316  44.667 1.00 55.08  ? 197  SER A OG  1 
ATOM   1457 N N   . ASN A 1 198 ? 15.645  18.542  45.680 1.00 34.97  ? 198  ASN A N   1 
ATOM   1458 C CA  . ASN A 1 198 ? 14.197  18.600  45.687 1.00 34.26  ? 198  ASN A CA  1 
ATOM   1459 C C   . ASN A 1 198 ? 13.614  17.368  46.340 1.00 37.44  ? 198  ASN A C   1 
ATOM   1460 O O   . ASN A 1 198 ? 13.972  16.239  45.997 1.00 37.63  ? 198  ASN A O   1 
ATOM   1461 C CB  . ASN A 1 198 ? 13.655  18.733  44.263 1.00 34.05  ? 198  ASN A CB  1 
ATOM   1462 C CG  . ASN A 1 198 ? 14.175  19.965  43.554 1.00 50.97  ? 198  ASN A CG  1 
ATOM   1463 O OD1 . ASN A 1 198 ? 15.166  19.903  42.831 1.00 40.82  ? 198  ASN A OD1 1 
ATOM   1464 N ND2 . ASN A 1 198 ? 13.491  21.090  43.736 1.00 46.34  ? 198  ASN A ND2 1 
ATOM   1465 N N   . PRO A 1 199 ? 12.690  17.575  47.287 1.00 32.20  ? 199  PRO A N   1 
ATOM   1466 C CA  . PRO A 1 199 ? 11.907  16.520  47.927 1.00 31.24  ? 199  PRO A CA  1 
ATOM   1467 C C   . PRO A 1 199 ? 11.125  15.728  46.881 1.00 34.35  ? 199  PRO A C   1 
ATOM   1468 O O   . PRO A 1 199 ? 10.847  16.218  45.786 1.00 34.62  ? 199  PRO A O   1 
ATOM   1469 C CB  . PRO A 1 199 ? 10.932  17.299  48.835 1.00 32.53  ? 199  PRO A CB  1 
ATOM   1470 C CG  . PRO A 1 199 ? 11.327  18.746  48.740 1.00 36.27  ? 199  PRO A CG  1 
ATOM   1471 C CD  . PRO A 1 199 ? 12.063  18.898  47.455 1.00 32.58  ? 199  PRO A CD  1 
ATOM   1472 N N   . PRO A 1 200 ? 10.741  14.497  47.223 1.00 30.04  ? 200  PRO A N   1 
ATOM   1473 C CA  . PRO A 1 200 ? 9.950   13.602  46.376 1.00 29.46  ? 200  PRO A CA  1 
ATOM   1474 C C   . PRO A 1 200 ? 8.663   14.243  45.839 1.00 33.54  ? 200  PRO A C   1 
ATOM   1475 O O   . PRO A 1 200 ? 8.248   13.946  44.717 1.00 31.94  ? 200  PRO A O   1 
ATOM   1476 C CB  . PRO A 1 200 ? 9.624   12.442  47.313 1.00 31.46  ? 200  PRO A CB  1 
ATOM   1477 C CG  . PRO A 1 200 ? 10.741  12.439  48.318 1.00 36.46  ? 200  PRO A CG  1 
ATOM   1478 C CD  . PRO A 1 200 ? 11.126  13.877  48.506 1.00 31.91  ? 200  PRO A CD  1 
ATOM   1479 N N   . SER A 1 201 ? 8.037   15.114  46.636 1.00 31.25  ? 201  SER A N   1 
ATOM   1480 C CA  . SER A 1 201 ? 6.812   15.813  46.215 1.00 31.32  ? 201  SER A CA  1 
ATOM   1481 C C   . SER A 1 201 ? 7.056   16.718  45.025 1.00 36.27  ? 201  SER A C   1 
ATOM   1482 O O   . SER A 1 201 ? 6.306   16.688  44.042 1.00 34.97  ? 201  SER A O   1 
ATOM   1483 C CB  . SER A 1 201 ? 6.182   16.630  47.364 1.00 32.76  ? 201  SER A CB  1 
ATOM   1484 O OG  . SER A 1 201 ? 7.109   17.528  47.953 1.00 36.58  ? 201  SER A OG  1 
ATOM   1485 N N   . MET A 1 202 ? 8.074   17.563  45.158 1.00 35.12  ? 202  MET A N   1 
ATOM   1486 C CA  . MET A 1 202 ? 8.532   18.412  44.070 1.00 36.91  ? 202  MET A CA  1 
ATOM   1487 C C   . MET A 1 202 ? 8.861   17.593  42.839 1.00 37.83  ? 202  MET A C   1 
ATOM   1488 O O   . MET A 1 202 ? 8.434   17.920  41.730 1.00 37.84  ? 202  MET A O   1 
ATOM   1489 C CB  . MET A 1 202 ? 9.773   19.190  44.504 1.00 41.15  ? 202  MET A CB  1 
ATOM   1490 C CG  . MET A 1 202 ? 9.472   20.456  45.288 1.00 47.55  ? 202  MET A CG  1 
ATOM   1491 S SD  . MET A 1 202 ? 8.946   21.773  44.173 1.00 55.00  ? 202  MET A SD  1 
ATOM   1492 C CE  . MET A 1 202 ? 10.497  22.276  43.471 1.00 51.47  ? 202  MET A CE  1 
ATOM   1493 N N   . VAL A 1 203 ? 9.684   16.566  43.027 1.00 32.30  ? 203  VAL A N   1 
ATOM   1494 C CA  . VAL A 1 203 ? 10.084  15.696  41.922 1.00 30.32  ? 203  VAL A CA  1 
ATOM   1495 C C   . VAL A 1 203 ? 8.882   15.083  41.214 1.00 30.53  ? 203  VAL A C   1 
ATOM   1496 O O   . VAL A 1 203 ? 8.823   15.068  39.992 1.00 30.23  ? 203  VAL A O   1 
ATOM   1497 C CB  . VAL A 1 203 ? 11.115  14.615  42.377 1.00 32.92  ? 203  VAL A CB  1 
ATOM   1498 C CG1 . VAL A 1 203 ? 11.286  13.550  41.308 1.00 32.01  ? 203  VAL A CG1 1 
ATOM   1499 C CG2 . VAL A 1 203 ? 12.441  15.251  42.712 1.00 32.36  ? 203  VAL A CG2 1 
ATOM   1500 N N   . ALA A 1 204 ? 7.957   14.527  41.987 1.00 26.83  ? 204  ALA A N   1 
ATOM   1501 C CA  . ALA A 1 204 ? 6.723   13.950  41.443 1.00 27.04  ? 204  ALA A CA  1 
ATOM   1502 C C   . ALA A 1 204 ? 5.875   14.985  40.708 1.00 31.73  ? 204  ALA A C   1 
ATOM   1503 O O   . ALA A 1 204 ? 5.226   14.665  39.700 1.00 30.35  ? 204  ALA A O   1 
ATOM   1504 C CB  . ALA A 1 204 ? 5.910   13.313  42.547 1.00 27.75  ? 204  ALA A CB  1 
ATOM   1505 N N   . ALA A 1 205 ? 5.905   16.228  41.189 1.00 29.04  ? 205  ALA A N   1 
ATOM   1506 C CA  . ALA A 1 205 ? 5.060   17.281  40.615 1.00 29.66  ? 205  ALA A CA  1 
ATOM   1507 C C   . ALA A 1 205 ? 5.615   17.762  39.285 1.00 34.77  ? 205  ALA A C   1 
ATOM   1508 O O   . ALA A 1 205 ? 4.873   17.908  38.316 1.00 34.27  ? 205  ALA A O   1 
ATOM   1509 C CB  . ALA A 1 205 ? 4.908   18.445  41.580 1.00 30.45  ? 205  ALA A CB  1 
ATOM   1510 N N   . GLY A 1 206 ? 6.924   17.998  39.237 1.00 31.64  ? 206  GLY A N   1 
ATOM   1511 C CA  . GLY A 1 206 ? 7.584   18.393  38.006 1.00 31.42  ? 206  GLY A CA  1 
ATOM   1512 C C   . GLY A 1 206 ? 7.385   17.365  36.915 1.00 36.46  ? 206  GLY A C   1 
ATOM   1513 O O   . GLY A 1 206 ? 7.087   17.712  35.766 1.00 36.66  ? 206  GLY A O   1 
ATOM   1514 N N   . SER A 1 207 ? 7.513   16.094  37.290 1.00 33.09  ? 207  SER A N   1 
ATOM   1515 C CA  . SER A 1 207 ? 7.336   14.970  36.359 1.00 32.92  ? 207  SER A CA  1 
ATOM   1516 C C   . SER A 1 207 ? 5.887   14.804  35.891 1.00 36.96  ? 207  SER A C   1 
ATOM   1517 O O   . SER A 1 207 ? 5.634   14.448  34.738 1.00 36.65  ? 207  SER A O   1 
ATOM   1518 C CB  . SER A 1 207 ? 7.832   13.660  36.996 1.00 35.33  ? 207  SER A CB  1 
ATOM   1519 O OG  . SER A 1 207 ? 9.181   13.772  37.431 1.00 41.01  ? 207  SER A OG  1 
ATOM   1520 N N   . VAL A 1 208 ? 4.944   14.966  36.810 1.00 34.04  ? 208  VAL A N   1 
ATOM   1521 C CA  . VAL A 1 208 ? 3.531   14.992  36.439 1.00 34.54  ? 208  VAL A CA  1 
ATOM   1522 C C   . VAL A 1 208 ? 3.263   16.154  35.487 1.00 38.08  ? 208  VAL A C   1 
ATOM   1523 O O   . VAL A 1 208 ? 2.678   15.975  34.417 1.00 35.95  ? 208  VAL A O   1 
ATOM   1524 C CB  . VAL A 1 208 ? 2.613   15.078  37.672 1.00 38.49  ? 208  VAL A CB  1 
ATOM   1525 C CG1 . VAL A 1 208 ? 1.154   15.252  37.228 1.00 38.24  ? 208  VAL A CG1 1 
ATOM   1526 C CG2 . VAL A 1 208 ? 2.778   13.833  38.545 1.00 38.13  ? 208  VAL A CG2 1 
ATOM   1527 N N   . VAL A 1 209 ? 3.748   17.336  35.863 1.00 35.08  ? 209  VAL A N   1 
ATOM   1528 C CA  . VAL A 1 209 ? 3.578   18.516  35.029 1.00 34.35  ? 209  VAL A CA  1 
ATOM   1529 C C   . VAL A 1 209 ? 4.177   18.278  33.650 1.00 39.43  ? 209  VAL A C   1 
ATOM   1530 O O   . VAL A 1 209 ? 3.498   18.440  32.647 1.00 38.91  ? 209  VAL A O   1 
ATOM   1531 C CB  . VAL A 1 209 ? 4.145   19.795  35.688 1.00 36.57  ? 209  VAL A CB  1 
ATOM   1532 C CG1 . VAL A 1 209 ? 4.150   20.937  34.688 1.00 35.99  ? 209  VAL A CG1 1 
ATOM   1533 C CG2 . VAL A 1 209 ? 3.326   20.176  36.920 1.00 35.87  ? 209  VAL A CG2 1 
ATOM   1534 N N   . ALA A 1 210 ? 5.455   17.907  33.606 1.00 37.31  ? 210  ALA A N   1 
ATOM   1535 C CA  . ALA A 1 210 ? 6.130   17.668  32.337 1.00 37.35  ? 210  ALA A CA  1 
ATOM   1536 C C   . ALA A 1 210 ? 5.380   16.631  31.512 1.00 42.00  ? 210  ALA A C   1 
ATOM   1537 O O   . ALA A 1 210 ? 5.218   16.787  30.311 1.00 42.14  ? 210  ALA A O   1 
ATOM   1538 C CB  . ALA A 1 210 ? 7.555   17.234  32.575 1.00 38.20  ? 210  ALA A CB  1 
ATOM   1539 N N   . ALA A 1 211 ? 4.876   15.600  32.181 1.00 39.39  ? 211  ALA A N   1 
ATOM   1540 C CA  . ALA A 1 211 ? 4.084   14.563  31.543 1.00 39.33  ? 211  ALA A CA  1 
ATOM   1541 C C   . ALA A 1 211 ? 2.740   15.054  30.994 1.00 43.62  ? 211  ALA A C   1 
ATOM   1542 O O   . ALA A 1 211 ? 2.444   14.866  29.820 1.00 43.08  ? 211  ALA A O   1 
ATOM   1543 C CB  . ALA A 1 211 ? 3.876   13.402  32.501 1.00 40.26  ? 211  ALA A CB  1 
ATOM   1544 N N   . VAL A 1 212 ? 1.895   15.621  31.849 1.00 41.64  ? 212  VAL A N   1 
ATOM   1545 C CA  . VAL A 1 212 ? 0.566   16.044  31.399 1.00 41.88  ? 212  VAL A CA  1 
ATOM   1546 C C   . VAL A 1 212 ? 0.623   17.082  30.278 1.00 45.81  ? 212  VAL A C   1 
ATOM   1547 O O   . VAL A 1 212 ? -0.180  17.042  29.338 1.00 45.15  ? 212  VAL A O   1 
ATOM   1548 C CB  . VAL A 1 212 ? -0.328  16.513  32.552 1.00 45.64  ? 212  VAL A CB  1 
ATOM   1549 C CG1 . VAL A 1 212 ? -1.700  16.887  32.021 1.00 45.67  ? 212  VAL A CG1 1 
ATOM   1550 C CG2 . VAL A 1 212 ? -0.443  15.437  33.608 1.00 45.14  ? 212  VAL A CG2 1 
ATOM   1551 N N   . GLN A 1 213 ? 1.588   17.992  30.376 1.00 42.03  ? 213  GLN A N   1 
ATOM   1552 C CA  . GLN A 1 213 ? 1.774   19.025  29.371 1.00 42.40  ? 213  GLN A CA  1 
ATOM   1553 C C   . GLN A 1 213 ? 2.164   18.456  28.015 1.00 48.38  ? 213  GLN A C   1 
ATOM   1554 O O   . GLN A 1 213 ? 1.546   18.786  27.001 1.00 48.37  ? 213  GLN A O   1 
ATOM   1555 C CB  . GLN A 1 213 ? 2.824   20.038  29.819 1.00 43.67  ? 213  GLN A CB  1 
ATOM   1556 C CG  . GLN A 1 213 ? 2.250   21.347  30.327 1.00 62.24  ? 213  GLN A CG  1 
ATOM   1557 C CD  . GLN A 1 213 ? 3.302   22.433  30.445 1.00 77.65  ? 213  GLN A CD  1 
ATOM   1558 O OE1 . GLN A 1 213 ? 3.432   23.080  31.487 1.00 69.18  ? 213  GLN A OE1 1 
ATOM   1559 N NE2 . GLN A 1 213 ? 4.065   22.633  29.375 1.00 71.27  ? 213  GLN A NE2 1 
ATOM   1560 N N   . GLY A 1 214 ? 3.242   17.675  27.985 1.00 45.25  ? 214  GLY A N   1 
ATOM   1561 C CA  . GLY A 1 214 ? 3.701   17.051  26.760 1.00 45.19  ? 214  GLY A CA  1 
ATOM   1562 C C   . GLY A 1 214 ? 2.600   16.237  26.110 1.00 49.25  ? 214  GLY A C   1 
ATOM   1563 O O   . GLY A 1 214 ? 2.394   16.294  24.895 1.00 49.23  ? 214  GLY A O   1 
ATOM   1564 N N   . LEU A 1 215 ? 1.888   15.474  26.929 1.00 45.12  ? 215  LEU A N   1 
ATOM   1565 C CA  . LEU A 1 215 ? 0.753   14.704  26.453 1.00 45.02  ? 215  LEU A CA  1 
ATOM   1566 C C   . LEU A 1 215 ? -0.322  15.605  25.845 1.00 51.54  ? 215  LEU A C   1 
ATOM   1567 O O   . LEU A 1 215 ? -0.659  15.468  24.668 1.00 51.92  ? 215  LEU A O   1 
ATOM   1568 C CB  . LEU A 1 215 ? 0.185   13.837  27.583 1.00 44.74  ? 215  LEU A CB  1 
ATOM   1569 C CG  . LEU A 1 215 ? 1.080   12.656  27.997 1.00 48.96  ? 215  LEU A CG  1 
ATOM   1570 C CD1 . LEU A 1 215 ? 0.617   12.022  29.306 1.00 49.07  ? 215  LEU A CD1 1 
ATOM   1571 C CD2 . LEU A 1 215 ? 1.134   11.613  26.894 1.00 49.87  ? 215  LEU A CD2 1 
ATOM   1572 N N   . ASN A 1 216 ? -0.821  16.556  26.634 1.00 48.90  ? 216  ASN A N   1 
ATOM   1573 C CA  . ASN A 1 216 ? -1.853  17.474  26.166 1.00 48.90  ? 216  ASN A CA  1 
ATOM   1574 C C   . ASN A 1 216 ? -1.459  18.155  24.866 1.00 53.80  ? 216  ASN A C   1 
ATOM   1575 O O   . ASN A 1 216 ? -2.290  18.349  23.982 1.00 53.34  ? 216  ASN A O   1 
ATOM   1576 C CB  . ASN A 1 216 ? -2.171  18.532  27.223 1.00 50.12  ? 216  ASN A CB  1 
ATOM   1577 C CG  . ASN A 1 216 ? -2.965  19.704  26.657 1.00 66.90  ? 216  ASN A CG  1 
ATOM   1578 O OD1 . ASN A 1 216 ? -2.403  20.755  26.335 1.00 56.12  ? 216  ASN A OD1 1 
ATOM   1579 N ND2 . ASN A 1 216 ? -4.278  19.523  26.525 1.00 57.04  ? 216  ASN A ND2 1 
ATOM   1580 N N   . LEU A 1 217 ? -0.187  18.521  24.753 1.00 51.69  ? 217  LEU A N   1 
ATOM   1581 C CA  . LEU A 1 217 ? 0.288   19.225  23.571 1.00 52.04  ? 217  LEU A CA  1 
ATOM   1582 C C   . LEU A 1 217 ? -0.039  18.427  22.307 1.00 57.98  ? 217  LEU A C   1 
ATOM   1583 O O   . LEU A 1 217 ? -0.484  18.986  21.300 1.00 58.32  ? 217  LEU A O   1 
ATOM   1584 C CB  . LEU A 1 217 ? 1.786   19.495  23.681 1.00 51.98  ? 217  LEU A CB  1 
ATOM   1585 C CG  . LEU A 1 217 ? 2.309   20.740  22.965 1.00 56.48  ? 217  LEU A CG  1 
ATOM   1586 C CD1 . LEU A 1 217 ? 1.328   21.891  23.157 1.00 56.90  ? 217  LEU A CD1 1 
ATOM   1587 C CD2 . LEU A 1 217 ? 3.686   21.125  23.502 1.00 57.56  ? 217  LEU A CD2 1 
ATOM   1588 N N   . ARG A 1 218 ? 0.101   17.108  22.398 1.00 54.94  ? 218  ARG A N   1 
ATOM   1589 C CA  . ARG A 1 218 ? -0.205  16.219  21.283 1.00 54.88  ? 218  ARG A CA  1 
ATOM   1590 C C   . ARG A 1 218 ? -1.668  15.754  21.295 1.00 59.31  ? 218  ARG A C   1 
ATOM   1591 O O   . ARG A 1 218 ? -2.111  15.057  20.381 1.00 59.36  ? 218  ARG A O   1 
ATOM   1592 C CB  . ARG A 1 218 ? 0.747   15.017  21.295 1.00 55.41  ? 218  ARG A CB  1 
ATOM   1593 C CG  . ARG A 1 218 ? 2.226   15.398  21.270 1.00 66.97  ? 218  ARG A CG  1 
ATOM   1594 C CD  . ARG A 1 218 ? 3.129   14.189  21.489 1.00 81.34  ? 218  ARG A CD  1 
ATOM   1595 N NE  . ARG A 1 218 ? 3.125   13.277  20.348 1.00 96.39  ? 218  ARG A NE  1 
ATOM   1596 C CZ  . ARG A 1 218 ? 3.783   12.121  20.309 1.00 113.39 ? 218  ARG A CZ  1 
ATOM   1597 N NH1 . ARG A 1 218 ? 4.495   11.726  21.356 1.00 100.95 ? 218  ARG A NH1 1 
ATOM   1598 N NH2 . ARG A 1 218 ? 3.721   11.355  19.227 1.00 101.35 ? 218  ARG A NH2 1 
ATOM   1599 N N   . SER A 1 219 ? -2.416  16.153  22.322 1.00 55.45  ? 219  SER A N   1 
ATOM   1600 C CA  . SER A 1 219 ? -3.845  15.849  22.409 1.00 54.91  ? 219  SER A CA  1 
ATOM   1601 C C   . SER A 1 219 ? -4.584  16.926  23.218 1.00 58.23  ? 219  SER A C   1 
ATOM   1602 O O   . SER A 1 219 ? -4.866  16.750  24.407 1.00 58.01  ? 219  SER A O   1 
ATOM   1603 C CB  . SER A 1 219 ? -4.054  14.461  23.025 1.00 58.92  ? 219  SER A CB  1 
ATOM   1604 O OG  . SER A 1 219 ? -5.373  13.979  22.815 1.00 68.81  ? 219  SER A OG  1 
ATOM   1605 N N   . PRO A 1 220 ? -4.962  18.031  22.554 1.00 53.99  ? 220  PRO A N   1 
ATOM   1606 C CA  . PRO A 1 220 ? -5.436  19.308  23.099 1.00 53.42  ? 220  PRO A CA  1 
ATOM   1607 C C   . PRO A 1 220 ? -6.739  19.262  23.898 1.00 56.25  ? 220  PRO A C   1 
ATOM   1608 O O   . PRO A 1 220 ? -6.941  20.061  24.812 1.00 55.04  ? 220  PRO A O   1 
ATOM   1609 C CB  . PRO A 1 220 ? -5.607  20.167  21.847 1.00 55.18  ? 220  PRO A CB  1 
ATOM   1610 C CG  . PRO A 1 220 ? -4.621  19.611  20.891 1.00 59.55  ? 220  PRO A CG  1 
ATOM   1611 C CD  . PRO A 1 220 ? -4.678  18.131  21.113 1.00 55.38  ? 220  PRO A CD  1 
ATOM   1612 N N   . ASN A 1 221 ? -7.642  18.363  23.526 1.00 52.81  ? 221  ASN A N   1 
ATOM   1613 C CA  . ASN A 1 221 ? -8.922  18.243  24.217 1.00 52.31  ? 221  ASN A CA  1 
ATOM   1614 C C   . ASN A 1 221 ? -8.838  17.146  25.267 1.00 55.53  ? 221  ASN A C   1 
ATOM   1615 O O   . ASN A 1 221 ? -9.809  16.849  25.965 1.00 55.16  ? 221  ASN A O   1 
ATOM   1616 C CB  . ASN A 1 221 ? -10.053 17.975  23.217 1.00 51.20  ? 221  ASN A CB  1 
ATOM   1617 C CG  . ASN A 1 221 ? -10.272 19.143  22.267 1.00 64.28  ? 221  ASN A CG  1 
ATOM   1618 O OD1 . ASN A 1 221 ? -10.604 20.245  22.692 1.00 62.59  ? 221  ASN A OD1 1 
ATOM   1619 N ND2 . ASN A 1 221 ? -10.020 18.921  20.985 1.00 51.79  ? 221  ASN A ND2 1 
ATOM   1620 N N   . ASN A 1 222 ? -7.630  16.619  25.422 1.00 51.55  ? 222  ASN A N   1 
ATOM   1621 C CA  . ASN A 1 222 ? -7.351  15.546  26.367 1.00 51.01  ? 222  ASN A CA  1 
ATOM   1622 C C   . ASN A 1 222 ? -6.305  16.022  27.389 1.00 52.57  ? 222  ASN A C   1 
ATOM   1623 O O   . ASN A 1 222 ? -5.565  16.980  27.143 1.00 51.33  ? 222  ASN A O   1 
ATOM   1624 C CB  . ASN A 1 222 ? -6.815  14.327  25.603 1.00 51.52  ? 222  ASN A CB  1 
ATOM   1625 C CG  . ASN A 1 222 ? -7.473  13.040  26.025 1.00 72.74  ? 222  ASN A CG  1 
ATOM   1626 O OD1 . ASN A 1 222 ? -7.842  12.863  27.186 1.00 66.49  ? 222  ASN A OD1 1 
ATOM   1627 N ND2 . ASN A 1 222 ? -7.647  12.136  25.073 1.00 69.00  ? 222  ASN A ND2 1 
ATOM   1628 N N   . PHE A 1 223 ? -6.232  15.327  28.518 1.00 48.15  ? 223  PHE A N   1 
ATOM   1629 C CA  . PHE A 1 223 ? -5.253  15.651  29.546 1.00 47.64  ? 223  PHE A CA  1 
ATOM   1630 C C   . PHE A 1 223 ? -5.421  17.112  29.931 1.00 51.30  ? 223  PHE A C   1 
ATOM   1631 O O   . PHE A 1 223 ? -4.456  17.875  29.929 1.00 52.27  ? 223  PHE A O   1 
ATOM   1632 C CB  . PHE A 1 223 ? -3.829  15.413  29.026 1.00 49.18  ? 223  PHE A CB  1 
ATOM   1633 C CG  . PHE A 1 223 ? -3.585  14.018  28.526 1.00 50.53  ? 223  PHE A CG  1 
ATOM   1634 C CD1 . PHE A 1 223 ? -3.503  13.759  27.166 1.00 53.47  ? 223  PHE A CD1 1 
ATOM   1635 C CD2 . PHE A 1 223 ? -3.403  12.969  29.414 1.00 52.60  ? 223  PHE A CD2 1 
ATOM   1636 C CE1 . PHE A 1 223 ? -3.273  12.472  26.703 1.00 54.22  ? 223  PHE A CE1 1 
ATOM   1637 C CE2 . PHE A 1 223 ? -3.171  11.679  28.954 1.00 55.10  ? 223  PHE A CE2 1 
ATOM   1638 C CZ  . PHE A 1 223 ? -3.111  11.431  27.601 1.00 52.95  ? 223  PHE A CZ  1 
ATOM   1639 N N   . LEU A 1 224 ? -6.649  17.491  30.267 1.00 46.27  ? 224  LEU A N   1 
ATOM   1640 C CA  . LEU A 1 224 ? -7.001  18.894  30.463 1.00 45.68  ? 224  LEU A CA  1 
ATOM   1641 C C   . LEU A 1 224 ? -6.474  19.465  31.774 1.00 47.56  ? 224  LEU A C   1 
ATOM   1642 O O   . LEU A 1 224 ? -6.454  20.689  31.972 1.00 45.94  ? 224  LEU A O   1 
ATOM   1643 C CB  . LEU A 1 224 ? -8.519  19.073  30.365 1.00 45.95  ? 224  LEU A CB  1 
ATOM   1644 C CG  . LEU A 1 224 ? -9.089  18.608  29.022 1.00 50.86  ? 224  LEU A CG  1 
ATOM   1645 C CD1 . LEU A 1 224 ? -10.593 18.790  28.965 1.00 51.13  ? 224  LEU A CD1 1 
ATOM   1646 C CD2 . LEU A 1 224 ? -8.405  19.326  27.873 1.00 52.86  ? 224  LEU A CD2 1 
ATOM   1647 N N   . SER A 1 225 ? -6.034  18.570  32.656 1.00 43.11  ? 225  SER A N   1 
ATOM   1648 C CA  . SER A 1 225 ? -5.458  18.956  33.939 1.00 42.10  ? 225  SER A CA  1 
ATOM   1649 C C   . SER A 1 225 ? -4.121  19.668  33.776 1.00 43.79  ? 225  SER A C   1 
ATOM   1650 O O   . SER A 1 225 ? -3.546  20.138  34.751 1.00 42.80  ? 225  SER A O   1 
ATOM   1651 C CB  . SER A 1 225 ? -5.283  17.729  34.839 1.00 45.92  ? 225  SER A CB  1 
ATOM   1652 O OG  . SER A 1 225 ? -6.531  17.165  35.197 1.00 54.62  ? 225  SER A OG  1 
ATOM   1653 N N   . TYR A 1 226 ? -3.618  19.722  32.547 1.00 40.70  ? 226  TYR A N   1 
ATOM   1654 C CA  . TYR A 1 226 ? -2.365  20.419  32.259 1.00 41.42  ? 226  TYR A CA  1 
ATOM   1655 C C   . TYR A 1 226 ? -2.463  21.915  32.588 1.00 45.65  ? 226  TYR A C   1 
ATOM   1656 O O   . TYR A 1 226 ? -1.470  22.550  32.956 1.00 45.15  ? 226  TYR A O   1 
ATOM   1657 C CB  . TYR A 1 226 ? -2.006  20.271  30.781 1.00 43.29  ? 226  TYR A CB  1 
ATOM   1658 C CG  . TYR A 1 226 ? -2.732  21.274  29.930 1.00 46.17  ? 226  TYR A CG  1 
ATOM   1659 C CD1 . TYR A 1 226 ? -4.047  21.051  29.533 1.00 48.52  ? 226  TYR A CD1 1 
ATOM   1660 C CD2 . TYR A 1 226 ? -2.152  22.500  29.628 1.00 47.35  ? 226  TYR A CD2 1 
ATOM   1661 C CE1 . TYR A 1 226 ? -4.749  22.003  28.808 1.00 50.11  ? 226  TYR A CE1 1 
ATOM   1662 C CE2 . TYR A 1 226 ? -2.838  23.456  28.895 1.00 48.67  ? 226  TYR A CE2 1 
ATOM   1663 C CZ  . TYR A 1 226 ? -4.137  23.203  28.492 1.00 57.47  ? 226  TYR A CZ  1 
ATOM   1664 O OH  . TYR A 1 226 ? -4.826  24.151  27.773 1.00 59.94  ? 226  TYR A OH  1 
ATOM   1665 N N   . TYR A 1 227 ? -3.668  22.465  32.449 1.00 42.12  ? 227  TYR A N   1 
ATOM   1666 C CA  . TYR A 1 227 ? -3.901  23.902  32.569 1.00 41.48  ? 227  TYR A CA  1 
ATOM   1667 C C   . TYR A 1 227 ? -3.634  24.421  33.976 1.00 42.44  ? 227  TYR A C   1 
ATOM   1668 O O   . TYR A 1 227 ? -4.335  24.063  34.911 1.00 42.11  ? 227  TYR A O   1 
ATOM   1669 C CB  . TYR A 1 227 ? -5.334  24.221  32.176 1.00 43.60  ? 227  TYR A CB  1 
ATOM   1670 C CG  . TYR A 1 227 ? -5.606  25.698  32.055 1.00 47.43  ? 227  TYR A CG  1 
ATOM   1671 C CD1 . TYR A 1 227 ? -6.503  26.331  32.908 1.00 49.30  ? 227  TYR A CD1 1 
ATOM   1672 C CD2 . TYR A 1 227 ? -4.949  26.466  31.094 1.00 49.10  ? 227  TYR A CD2 1 
ATOM   1673 C CE1 . TYR A 1 227 ? -6.746  27.687  32.806 1.00 51.41  ? 227  TYR A CE1 1 
ATOM   1674 C CE2 . TYR A 1 227 ? -5.187  27.823  30.982 1.00 50.55  ? 227  TYR A CE2 1 
ATOM   1675 C CZ  . TYR A 1 227 ? -6.095  28.427  31.833 1.00 58.97  ? 227  TYR A CZ  1 
ATOM   1676 O OH  . TYR A 1 227 ? -6.336  29.773  31.724 1.00 60.01  ? 227  TYR A OH  1 
ATOM   1677 N N   . ARG A 1 228 ? -2.652  25.308  34.106 1.00 37.48  ? 228  ARG A N   1 
ATOM   1678 C CA  . ARG A 1 228 ? -2.224  25.822  35.412 1.00 36.96  ? 228  ARG A CA  1 
ATOM   1679 C C   . ARG A 1 228 ? -1.856  24.733  36.421 1.00 39.68  ? 228  ARG A C   1 
ATOM   1680 O O   . ARG A 1 228 ? -1.940  24.950  37.625 1.00 39.00  ? 228  ARG A O   1 
ATOM   1681 C CB  . ARG A 1 228 ? -3.279  26.754  36.022 1.00 36.61  ? 228  ARG A CB  1 
ATOM   1682 C CG  . ARG A 1 228 ? -3.823  27.812  35.075 1.00 43.76  ? 228  ARG A CG  1 
ATOM   1683 C CD  . ARG A 1 228 ? -4.696  28.800  35.818 1.00 46.28  ? 228  ARG A CD  1 
ATOM   1684 N NE  . ARG A 1 228 ? -3.886  29.711  36.620 1.00 48.60  ? 228  ARG A NE  1 
ATOM   1685 C CZ  . ARG A 1 228 ? -4.370  30.540  37.538 1.00 51.44  ? 228  ARG A CZ  1 
ATOM   1686 N NH1 . ARG A 1 228 ? -3.547  31.336  38.204 1.00 38.39  ? 228  ARG A NH1 1 
ATOM   1687 N NH2 . ARG A 1 228 ? -5.670  30.561  37.801 1.00 30.08  ? 228  ARG A NH2 1 
ATOM   1688 N N   . LEU A 1 229 ? -1.368  23.594  35.938 1.00 36.74  ? 229  LEU A N   1 
ATOM   1689 C CA  . LEU A 1 229 ? -1.046  22.473  36.823 1.00 36.42  ? 229  LEU A CA  1 
ATOM   1690 C C   . LEU A 1 229 ? 0.026   22.827  37.855 1.00 39.55  ? 229  LEU A C   1 
ATOM   1691 O O   . LEU A 1 229 ? -0.052  22.403  39.014 1.00 38.38  ? 229  LEU A O   1 
ATOM   1692 C CB  . LEU A 1 229 ? -0.648  21.232  36.013 1.00 36.42  ? 229  LEU A CB  1 
ATOM   1693 C CG  . LEU A 1 229 ? -0.710  19.886  36.748 1.00 40.24  ? 229  LEU A CG  1 
ATOM   1694 C CD1 . LEU A 1 229 ? -2.086  19.635  37.354 1.00 39.49  ? 229  LEU A CD1 1 
ATOM   1695 C CD2 . LEU A 1 229 ? -0.296  18.745  35.826 1.00 41.96  ? 229  LEU A CD2 1 
ATOM   1696 N N   . THR A 1 230 ? 0.957   23.694  37.458 1.00 36.20  ? 230  THR A N   1 
ATOM   1697 C CA  . THR A 1 230 ? 2.070   24.103  38.316 1.00 36.05  ? 230  THR A CA  1 
ATOM   1698 C C   . THR A 1 230 ? 1.597   24.804  39.587 1.00 41.33  ? 230  THR A C   1 
ATOM   1699 O O   . THR A 1 230 ? 2.025   24.461  40.690 1.00 41.41  ? 230  THR A O   1 
ATOM   1700 C CB  . THR A 1 230 ? 3.085   24.985  37.549 1.00 43.43  ? 230  THR A CB  1 
ATOM   1701 O OG1 . THR A 1 230 ? 3.701   24.224  36.500 1.00 43.59  ? 230  THR A OG1 1 
ATOM   1702 C CG2 . THR A 1 230 ? 4.170   25.491  38.495 1.00 41.46  ? 230  THR A CG2 1 
ATOM   1703 N N   . ARG A 1 231 ? 0.792   25.849  39.418 1.00 38.03  ? 231  ARG A N   1 
ATOM   1704 C CA  . ARG A 1 231 ? 0.178   26.535  40.547 1.00 37.89  ? 231  ARG A CA  1 
ATOM   1705 C C   . ARG A 1 231 ? -0.672  25.574  41.374 1.00 41.56  ? 231  ARG A C   1 
ATOM   1706 O O   . ARG A 1 231 ? -0.542  25.509  42.599 1.00 42.33  ? 231  ARG A O   1 
ATOM   1707 C CB  . ARG A 1 231 ? -0.673  27.723  40.068 1.00 40.11  ? 231  ARG A CB  1 
ATOM   1708 C CG  . ARG A 1 231 ? -1.864  28.027  40.971 1.00 53.57  ? 231  ARG A CG  1 
ATOM   1709 C CD  . ARG A 1 231 ? -2.547  29.336  40.617 1.00 68.91  ? 231  ARG A CD  1 
ATOM   1710 N NE  . ARG A 1 231 ? -1.967  30.465  41.339 1.00 83.89  ? 231  ARG A NE  1 
ATOM   1711 C CZ  . ARG A 1 231 ? -2.533  31.665  41.432 1.00 99.18  ? 231  ARG A CZ  1 
ATOM   1712 N NH1 . ARG A 1 231 ? -3.705  31.897  40.855 1.00 87.07  ? 231  ARG A NH1 1 
ATOM   1713 N NH2 . ARG A 1 231 ? -1.932  32.632  42.113 1.00 85.71  ? 231  ARG A NH2 1 
ATOM   1714 N N   . PHE A 1 232 ? -1.520  24.805  40.699 1.00 36.56  ? 232  PHE A N   1 
ATOM   1715 C CA  . PHE A 1 232 ? -2.349  23.811  41.370 1.00 36.14  ? 232  PHE A CA  1 
ATOM   1716 C C   . PHE A 1 232 ? -1.543  22.881  42.289 1.00 42.68  ? 232  PHE A C   1 
ATOM   1717 O O   . PHE A 1 232 ? -1.797  22.800  43.500 1.00 42.98  ? 232  PHE A O   1 
ATOM   1718 C CB  . PHE A 1 232 ? -3.137  23.001  40.338 1.00 37.72  ? 232  PHE A CB  1 
ATOM   1719 C CG  . PHE A 1 232 ? -4.099  22.017  40.945 1.00 38.97  ? 232  PHE A CG  1 
ATOM   1720 C CD1 . PHE A 1 232 ? -5.268  22.451  41.548 1.00 40.93  ? 232  PHE A CD1 1 
ATOM   1721 C CD2 . PHE A 1 232 ? -3.824  20.656  40.929 1.00 40.85  ? 232  PHE A CD2 1 
ATOM   1722 C CE1 . PHE A 1 232 ? -6.150  21.550  42.120 1.00 41.90  ? 232  PHE A CE1 1 
ATOM   1723 C CE2 . PHE A 1 232 ? -4.700  19.748  41.503 1.00 43.49  ? 232  PHE A CE2 1 
ATOM   1724 C CZ  . PHE A 1 232 ? -5.863  20.198  42.102 1.00 41.51  ? 232  PHE A CZ  1 
ATOM   1725 N N   . LEU A 1 233 ? -0.577  22.171  41.713 1.00 39.89  ? 233  LEU A N   1 
ATOM   1726 C CA  . LEU A 1 233 ? 0.257   21.268  42.499 1.00 39.60  ? 233  LEU A CA  1 
ATOM   1727 C C   . LEU A 1 233 ? 1.080   22.043  43.523 1.00 46.75  ? 233  LEU A C   1 
ATOM   1728 O O   . LEU A 1 233 ? 1.245   21.598  44.661 1.00 45.77  ? 233  LEU A O   1 
ATOM   1729 C CB  . LEU A 1 233 ? 1.148   20.410  41.594 1.00 38.90  ? 233  LEU A CB  1 
ATOM   1730 C CG  . LEU A 1 233 ? 0.437   19.366  40.714 1.00 42.09  ? 233  LEU A CG  1 
ATOM   1731 C CD1 . LEU A 1 233 ? 1.426   18.554  39.902 1.00 41.06  ? 233  LEU A CD1 1 
ATOM   1732 C CD2 . LEU A 1 233 ? -0.481  18.452  41.514 1.00 42.28  ? 233  LEU A CD2 1 
ATOM   1733 N N   . SER A 1 234 ? 1.544   23.231  43.136 1.00 46.21  ? 234  SER A N   1 
ATOM   1734 C CA  . SER A 1 234 ? 2.190   24.143  44.083 1.00 47.43  ? 234  SER A CA  1 
ATOM   1735 C C   . SER A 1 234 ? 1.356   24.317  45.351 1.00 53.42  ? 234  SER A C   1 
ATOM   1736 O O   . SER A 1 234 ? 1.887   24.308  46.460 1.00 52.66  ? 234  SER A O   1 
ATOM   1737 C CB  . SER A 1 234 ? 2.433   25.514  43.445 1.00 51.09  ? 234  SER A CB  1 
ATOM   1738 O OG  . SER A 1 234 ? 3.642   25.532  42.713 1.00 58.65  ? 234  SER A OG  1 
ATOM   1739 N N   . ARG A 1 235 ? 0.055   24.517  45.165 1.00 52.38  ? 235  ARG A N   1 
ATOM   1740 C CA  . ARG A 1 235 ? -0.891  24.674  46.271 1.00 53.09  ? 235  ARG A CA  1 
ATOM   1741 C C   . ARG A 1 235 ? -1.079  23.367  47.043 1.00 57.15  ? 235  ARG A C   1 
ATOM   1742 O O   . ARG A 1 235 ? -1.108  23.355  48.274 1.00 56.27  ? 235  ARG A O   1 
ATOM   1743 C CB  . ARG A 1 235 ? -2.249  25.148  45.739 1.00 54.41  ? 235  ARG A CB  1 
ATOM   1744 C CG  . ARG A 1 235 ? -2.293  26.614  45.330 1.00 66.07  ? 235  ARG A CG  1 
ATOM   1745 C CD  . ARG A 1 235 ? -3.520  26.915  44.481 1.00 75.42  ? 235  ARG A CD  1 
ATOM   1746 N NE  . ARG A 1 235 ? -4.077  28.231  44.780 1.00 87.59  ? 235  ARG A NE  1 
ATOM   1747 C CZ  . ARG A 1 235 ? -3.496  29.386  44.469 1.00 102.49 ? 235  ARG A CZ  1 
ATOM   1748 N NH1 . ARG A 1 235 ? -2.319  29.399  43.855 1.00 90.66  ? 235  ARG A NH1 1 
ATOM   1749 N NH2 . ARG A 1 235 ? -4.086  30.531  44.787 1.00 87.94  ? 235  ARG A NH2 1 
ATOM   1750 N N   . VAL A 1 236 ? -1.271  22.279  46.307 1.00 54.14  ? 236  VAL A N   1 
ATOM   1751 C CA  . VAL A 1 236 ? -1.294  20.948  46.904 1.00 54.30  ? 236  VAL A CA  1 
ATOM   1752 C C   . VAL A 1 236 ? 0.015   20.664  47.655 1.00 58.48  ? 236  VAL A C   1 
ATOM   1753 O O   . VAL A 1 236 ? 0.001   20.304  48.829 1.00 58.05  ? 236  VAL A O   1 
ATOM   1754 C CB  . VAL A 1 236 ? -1.570  19.883  45.833 1.00 58.58  ? 236  VAL A CB  1 
ATOM   1755 C CG1 . VAL A 1 236 ? -1.619  18.504  46.450 1.00 58.24  ? 236  VAL A CG1 1 
ATOM   1756 C CG2 . VAL A 1 236 ? -2.867  20.199  45.090 1.00 58.52  ? 236  VAL A CG2 1 
ATOM   1757 N N   . ILE A 1 237 ? 1.141   20.881  46.979 1.00 55.35  ? 237  ILE A N   1 
ATOM   1758 C CA  . ILE A 1 237 ? 2.472   20.678  47.556 1.00 54.95  ? 237  ILE A CA  1 
ATOM   1759 C C   . ILE A 1 237 ? 2.767   21.645  48.706 1.00 58.57  ? 237  ILE A C   1 
ATOM   1760 O O   . ILE A 1 237 ? 3.484   21.305  49.641 1.00 57.18  ? 237  ILE A O   1 
ATOM   1761 C CB  . ILE A 1 237 ? 3.564   20.861  46.475 1.00 57.87  ? 237  ILE A CB  1 
ATOM   1762 C CG1 . ILE A 1 237 ? 3.893   19.547  45.786 1.00 57.42  ? 237  ILE A CG1 1 
ATOM   1763 C CG2 . ILE A 1 237 ? 4.831   21.427  47.093 1.00 59.38  ? 237  ILE A CG2 1 
ATOM   1764 C CD1 . ILE A 1 237 ? 5.129   19.647  44.933 1.00 57.29  ? 237  ILE A CD1 1 
ATOM   1765 N N   . LYS A 1 238 ? 2.324   22.889  48.554 1.00 56.85  ? 238  LYS A N   1 
ATOM   1766 C CA  . LYS A 1 238 ? 2.737   23.989  49.430 1.00 57.22  ? 238  LYS A CA  1 
ATOM   1767 C C   . LYS A 1 238 ? 4.188   24.393  49.170 1.00 61.10  ? 238  LYS A C   1 
ATOM   1768 O O   . LYS A 1 238 ? 4.919   24.745  50.103 1.00 60.99  ? 238  LYS A O   1 
ATOM   1769 C CB  . LYS A 1 238 ? 2.554   23.645  50.915 1.00 59.99  ? 238  LYS A CB  1 
ATOM   1770 C CG  . LYS A 1 238 ? 1.110   23.642  51.410 1.00 71.48  ? 238  LYS A CG  1 
ATOM   1771 C CD  . LYS A 1 238 ? 0.470   22.280  51.200 1.00 81.94  ? 238  LYS A CD  1 
ATOM   1772 C CE  . LYS A 1 238 ? -0.821  22.137  51.992 1.00 89.37  ? 238  LYS A CE  1 
ATOM   1773 N NZ  . LYS A 1 238 ? -1.362  20.751  51.912 1.00 93.17  ? 238  LYS A NZ  1 
ATOM   1774 N N   . CYS A 1 239 ? 4.604   24.316  47.909 1.00 56.66  ? 239  CYS A N   1 
ATOM   1775 C CA  . CYS A 1 239 ? 5.931   24.780  47.507 1.00 56.08  ? 239  CYS A CA  1 
ATOM   1776 C C   . CYS A 1 239 ? 5.814   26.126  46.810 1.00 61.96  ? 239  CYS A C   1 
ATOM   1777 O O   . CYS A 1 239 ? 4.722   26.685  46.704 1.00 61.73  ? 239  CYS A O   1 
ATOM   1778 C CB  . CYS A 1 239 ? 6.593   23.777  46.553 1.00 55.51  ? 239  CYS A CB  1 
ATOM   1779 S SG  . CYS A 1 239 ? 6.031   23.889  44.829 1.00 58.85  ? 239  CYS A SG  1 
ATOM   1780 N N   . ASP A 1 240 ? 6.940   26.625  46.309 1.00 60.08  ? 240  ASP A N   1 
ATOM   1781 C CA  . ASP A 1 240 ? 6.951   27.819  45.472 1.00 60.77  ? 240  ASP A CA  1 
ATOM   1782 C C   . ASP A 1 240 ? 6.715   27.439  44.006 1.00 66.04  ? 240  ASP A C   1 
ATOM   1783 O O   . ASP A 1 240 ? 7.442   26.626  43.437 1.00 65.74  ? 240  ASP A O   1 
ATOM   1784 C CB  . ASP A 1 240 ? 8.284   28.552  45.628 1.00 62.99  ? 240  ASP A CB  1 
ATOM   1785 C CG  . ASP A 1 240 ? 8.276   29.926  44.984 1.00 77.55  ? 240  ASP A CG  1 
ATOM   1786 O OD1 . ASP A 1 240 ? 7.418   30.174  44.107 1.00 78.99  ? 240  ASP A OD1 1 
ATOM   1787 O OD2 . ASP A 1 240 ? 9.136   30.756  45.349 1.00 83.83  ? 240  ASP A OD2 1 
ATOM   1788 N N   . PRO A 1 241 ? 5.694   28.036  43.374 1.00 64.05  ? 241  PRO A N   1 
ATOM   1789 C CA  . PRO A 1 241 ? 5.280   27.679  42.009 1.00 64.40  ? 241  PRO A CA  1 
ATOM   1790 C C   . PRO A 1 241 ? 6.350   27.918  40.942 1.00 69.66  ? 241  PRO A C   1 
ATOM   1791 O O   . PRO A 1 241 ? 6.300   27.333  39.858 1.00 69.35  ? 241  PRO A O   1 
ATOM   1792 C CB  . PRO A 1 241 ? 4.052   28.572  41.760 1.00 66.08  ? 241  PRO A CB  1 
ATOM   1793 C CG  . PRO A 1 241 ? 4.081   29.614  42.833 1.00 70.47  ? 241  PRO A CG  1 
ATOM   1794 C CD  . PRO A 1 241 ? 4.756   28.977  44.007 1.00 65.91  ? 241  PRO A CD  1 
ATOM   1795 N N   . ASP A 1 242 ? 7.312   28.781  41.250 1.00 66.77  ? 242  ASP A N   1 
ATOM   1796 C CA  . ASP A 1 242 ? 8.429   29.038  40.350 1.00 66.63  ? 242  ASP A CA  1 
ATOM   1797 C C   . ASP A 1 242 ? 9.547   28.023  40.584 1.00 68.47  ? 242  ASP A C   1 
ATOM   1798 O O   . ASP A 1 242 ? 10.366  27.771  39.701 1.00 67.73  ? 242  ASP A O   1 
ATOM   1799 C CB  . ASP A 1 242 ? 8.953   30.460  40.560 1.00 69.36  ? 242  ASP A CB  1 
ATOM   1800 C CG  . ASP A 1 242 ? 7.846   31.500  40.522 1.00 84.96  ? 242  ASP A CG  1 
ATOM   1801 O OD1 . ASP A 1 242 ? 7.106   31.547  39.513 1.00 86.29  ? 242  ASP A OD1 1 
ATOM   1802 O OD2 . ASP A 1 242 ? 7.721   32.275  41.497 1.00 92.16  ? 242  ASP A OD2 1 
ATOM   1803 N N   . CYS A 1 243 ? 9.585   27.458  41.788 1.00 63.83  ? 243  CYS A N   1 
ATOM   1804 C CA  . CYS A 1 243 ? 10.484  26.352  42.089 1.00 63.18  ? 243  CYS A CA  1 
ATOM   1805 C C   . CYS A 1 243 ? 10.047  25.099  41.333 1.00 64.03  ? 243  CYS A C   1 
ATOM   1806 O O   . CYS A 1 243 ? 10.875  24.359  40.793 1.00 63.20  ? 243  CYS A O   1 
ATOM   1807 C CB  . CYS A 1 243 ? 10.502  26.074  43.594 1.00 64.13  ? 243  CYS A CB  1 
ATOM   1808 S SG  . CYS A 1 243 ? 11.288  27.368  44.602 1.00 68.40  ? 243  CYS A SG  1 
ATOM   1809 N N   . LEU A 1 244 ? 8.739   24.859  41.317 1.00 57.91  ? 244  LEU A N   1 
ATOM   1810 C CA  . LEU A 1 244 ? 8.168   23.769  40.541 1.00 56.16  ? 244  LEU A CA  1 
ATOM   1811 C C   . LEU A 1 244 ? 8.443   23.987  39.060 1.00 58.10  ? 244  LEU A C   1 
ATOM   1812 O O   . LEU A 1 244 ? 8.879   23.075  38.356 1.00 57.72  ? 244  LEU A O   1 
ATOM   1813 C CB  . LEU A 1 244 ? 6.664   23.664  40.796 1.00 55.83  ? 244  LEU A CB  1 
ATOM   1814 C CG  . LEU A 1 244 ? 5.976   22.408  40.261 1.00 60.19  ? 244  LEU A CG  1 
ATOM   1815 C CD1 . LEU A 1 244 ? 6.677   21.164  40.782 1.00 60.54  ? 244  LEU A CD1 1 
ATOM   1816 C CD2 . LEU A 1 244 ? 4.503   22.401  40.639 1.00 61.08  ? 244  LEU A CD2 1 
ATOM   1817 N N   . ARG A 1 245 ? 8.242   25.218  38.605 1.00 53.34  ? 245  ARG A N   1 
ATOM   1818 C CA  . ARG A 1 245 ? 8.521   25.570  37.220 1.00 52.49  ? 245  ARG A CA  1 
ATOM   1819 C C   . ARG A 1 245 ? 9.959   25.243  36.840 1.00 53.41  ? 245  ARG A C   1 
ATOM   1820 O O   . ARG A 1 245 ? 10.204  24.566  35.849 1.00 52.41  ? 245  ARG A O   1 
ATOM   1821 C CB  . ARG A 1 245 ? 8.228   27.053  36.979 1.00 54.28  ? 245  ARG A CB  1 
ATOM   1822 C CG  . ARG A 1 245 ? 8.275   27.481  35.520 1.00 65.49  ? 245  ARG A CG  1 
ATOM   1823 C CD  . ARG A 1 245 ? 7.503   28.774  35.314 1.00 77.78  ? 245  ARG A CD  1 
ATOM   1824 N NE  . ARG A 1 245 ? 6.071   28.599  35.559 1.00 90.79  ? 245  ARG A NE  1 
ATOM   1825 C CZ  . ARG A 1 245 ? 5.449   28.954  36.681 1.00 105.88 ? 245  ARG A CZ  1 
ATOM   1826 N NH1 . ARG A 1 245 ? 6.129   29.517  37.672 1.00 97.76  ? 245  ARG A NH1 1 
ATOM   1827 N NH2 . ARG A 1 245 ? 4.144   28.755  36.812 1.00 87.89  ? 245  ARG A NH2 1 
ATOM   1828 N N   . ALA A 1 246 ? 10.910  25.734  37.627 1.00 49.46  ? 246  ALA A N   1 
ATOM   1829 C CA  . ALA A 1 246 ? 12.321  25.428  37.398 1.00 48.95  ? 246  ALA A CA  1 
ATOM   1830 C C   . ALA A 1 246 ? 12.527  23.922  37.358 1.00 53.00  ? 246  ALA A C   1 
ATOM   1831 O O   . ALA A 1 246 ? 13.077  23.377  36.399 1.00 52.83  ? 246  ALA A O   1 
ATOM   1832 C CB  . ALA A 1 246 ? 13.178  26.049  38.481 1.00 49.44  ? 246  ALA A CB  1 
ATOM   1833 N N   . CYS A 1 247 ? 12.034  23.253  38.392 1.00 49.33  ? 247  CYS A N   1 
ATOM   1834 C CA  . CYS A 1 247 ? 12.064  21.798  38.464 1.00 49.02  ? 247  CYS A CA  1 
ATOM   1835 C C   . CYS A 1 247 ? 11.618  21.123  37.164 1.00 51.00  ? 247  CYS A C   1 
ATOM   1836 O O   . CYS A 1 247 ? 12.332  20.289  36.618 1.00 51.11  ? 247  CYS A O   1 
ATOM   1837 C CB  . CYS A 1 247 ? 11.217  21.323  39.647 1.00 49.60  ? 247  CYS A CB  1 
ATOM   1838 S SG  . CYS A 1 247 ? 10.956  19.554  39.744 1.00 53.75  ? 247  CYS A SG  1 
ATOM   1839 N N   . GLN A 1 248 ? 10.429  21.465  36.683 1.00 46.77  ? 248  GLN A N   1 
ATOM   1840 C CA  . GLN A 1 248 ? 9.900   20.855  35.465 1.00 46.52  ? 248  GLN A CA  1 
ATOM   1841 C C   . GLN A 1 248 ? 10.846  21.061  34.287 1.00 51.46  ? 248  GLN A C   1 
ATOM   1842 O O   . GLN A 1 248 ? 11.084  20.150  33.496 1.00 50.50  ? 248  GLN A O   1 
ATOM   1843 C CB  . GLN A 1 248 ? 8.531   21.440  35.118 1.00 47.63  ? 248  GLN A CB  1 
ATOM   1844 C CG  . GLN A 1 248 ? 7.984   20.935  33.792 1.00 60.07  ? 248  GLN A CG  1 
ATOM   1845 C CD  . GLN A 1 248 ? 6.952   21.865  33.189 1.00 76.58  ? 248  GLN A CD  1 
ATOM   1846 O OE1 . GLN A 1 248 ? 6.552   22.847  33.809 1.00 76.03  ? 248  GLN A OE1 1 
ATOM   1847 N NE2 . GLN A 1 248 ? 6.536   21.575  31.961 1.00 62.34  ? 248  GLN A NE2 1 
ATOM   1848 N N   . GLU A 1 249 ? 11.350  22.282  34.155 1.00 49.36  ? 249  GLU A N   1 
ATOM   1849 C CA  . GLU A 1 249 ? 12.218  22.623  33.041 1.00 49.49  ? 249  GLU A CA  1 
ATOM   1850 C C   . GLU A 1 249 ? 13.557  21.925  33.155 1.00 53.89  ? 249  GLU A C   1 
ATOM   1851 O O   . GLU A 1 249 ? 14.132  21.526  32.148 1.00 54.32  ? 249  GLU A O   1 
ATOM   1852 C CB  . GLU A 1 249 ? 12.378  24.139  32.922 1.00 51.02  ? 249  GLU A CB  1 
ATOM   1853 C CG  . GLU A 1 249 ? 11.096  24.821  32.456 1.00 61.93  ? 249  GLU A CG  1 
ATOM   1854 C CD  . GLU A 1 249 ? 11.124  26.318  32.636 1.00 85.06  ? 249  GLU A CD  1 
ATOM   1855 O OE1 . GLU A 1 249 ? 12.182  26.855  33.023 1.00 76.39  ? 249  GLU A OE1 1 
ATOM   1856 O OE2 . GLU A 1 249 ? 10.076  26.955  32.405 1.00 85.39  ? 249  GLU A OE2 1 
ATOM   1857 N N   . GLN A 1 250 ? 14.022  21.734  34.385 1.00 50.39  ? 250  GLN A N   1 
ATOM   1858 C CA  . GLN A 1 250 ? 15.176  20.879  34.644 1.00 50.57  ? 250  GLN A CA  1 
ATOM   1859 C C   . GLN A 1 250 ? 14.921  19.431  34.209 1.00 54.96  ? 250  GLN A C   1 
ATOM   1860 O O   . GLN A 1 250 ? 15.812  18.773  33.659 1.00 55.13  ? 250  GLN A O   1 
ATOM   1861 C CB  . GLN A 1 250 ? 15.573  20.941  36.119 1.00 52.00  ? 250  GLN A CB  1 
ATOM   1862 C CG  . GLN A 1 250 ? 16.005  22.328  36.576 1.00 70.47  ? 250  GLN A CG  1 
ATOM   1863 C CD  . GLN A 1 250 ? 16.106  22.458  38.091 1.00 87.13  ? 250  GLN A CD  1 
ATOM   1864 O OE1 . GLN A 1 250 ? 16.150  21.463  38.815 1.00 79.99  ? 250  GLN A OE1 1 
ATOM   1865 N NE2 . GLN A 1 250 ? 16.145  23.695  38.573 1.00 79.85  ? 250  GLN A NE2 1 
ATOM   1866 N N   . ILE A 1 251 ? 13.697  18.954  34.427 1.00 51.09  ? 251  ILE A N   1 
ATOM   1867 C CA  . ILE A 1 251 ? 13.279  17.629  33.953 1.00 50.97  ? 251  ILE A CA  1 
ATOM   1868 C C   . ILE A 1 251 ? 13.245  17.547  32.424 1.00 55.74  ? 251  ILE A C   1 
ATOM   1869 O O   . ILE A 1 251 ? 13.695  16.568  31.837 1.00 55.36  ? 251  ILE A O   1 
ATOM   1870 C CB  . ILE A 1 251 ? 11.912  17.234  34.532 1.00 54.02  ? 251  ILE A CB  1 
ATOM   1871 C CG1 . ILE A 1 251 ? 12.047  16.708  35.959 1.00 54.39  ? 251  ILE A CG1 1 
ATOM   1872 C CG2 . ILE A 1 251 ? 11.226  16.221  33.639 1.00 55.18  ? 251  ILE A CG2 1 
ATOM   1873 C CD1 . ILE A 1 251 ? 10.722  16.598  36.680 1.00 61.78  ? 251  ILE A CD1 1 
ATOM   1874 N N   . GLU A 1 252 ? 12.665  18.556  31.783 1.00 53.10  ? 252  GLU A N   1 
ATOM   1875 C CA  . GLU A 1 252 ? 12.596  18.584  30.328 1.00 53.52  ? 252  GLU A CA  1 
ATOM   1876 C C   . GLU A 1 252 ? 13.989  18.670  29.709 1.00 58.52  ? 252  GLU A C   1 
ATOM   1877 O O   . GLU A 1 252 ? 14.255  18.072  28.670 1.00 58.10  ? 252  GLU A O   1 
ATOM   1878 C CB  . GLU A 1 252 ? 11.718  19.742  29.852 1.00 54.96  ? 252  GLU A CB  1 
ATOM   1879 C CG  . GLU A 1 252 ? 10.276  19.655  30.340 1.00 66.06  ? 252  GLU A CG  1 
ATOM   1880 C CD  . GLU A 1 252 ? 9.546   20.984  30.263 1.00 87.80  ? 252  GLU A CD  1 
ATOM   1881 O OE1 . GLU A 1 252 ? 10.150  21.970  29.788 1.00 91.50  ? 252  GLU A OE1 1 
ATOM   1882 O OE2 . GLU A 1 252 ? 8.370   21.042  30.686 1.00 75.82  ? 252  GLU A OE2 1 
ATOM   1883 N N   . ALA A 1 253 ? 14.882  19.397  30.369 1.00 55.85  ? 253  ALA A N   1 
ATOM   1884 C CA  . ALA A 1 253 ? 16.266  19.484  29.930 1.00 56.15  ? 253  ALA A CA  1 
ATOM   1885 C C   . ALA A 1 253 ? 16.917  18.115  30.025 1.00 63.36  ? 253  ALA A C   1 
ATOM   1886 O O   . ALA A 1 253 ? 17.633  17.686  29.118 1.00 63.10  ? 253  ALA A O   1 
ATOM   1887 C CB  . ALA A 1 253 ? 17.019  20.478  30.786 1.00 56.65  ? 253  ALA A CB  1 
ATOM   1888 N N   . LEU A 1 254 ? 16.628  17.424  31.124 1.00 62.08  ? 254  LEU A N   1 
ATOM   1889 C CA  . LEU A 1 254 ? 17.262  16.151  31.450 1.00 62.57  ? 254  LEU A CA  1 
ATOM   1890 C C   . LEU A 1 254 ? 16.838  15.071  30.459 1.00 70.61  ? 254  LEU A C   1 
ATOM   1891 O O   . LEU A 1 254 ? 17.602  14.153  30.162 1.00 70.27  ? 254  LEU A O   1 
ATOM   1892 C CB  . LEU A 1 254 ? 16.868  15.741  32.870 1.00 62.17  ? 254  LEU A CB  1 
ATOM   1893 C CG  . LEU A 1 254 ? 17.912  15.115  33.791 1.00 65.97  ? 254  LEU A CG  1 
ATOM   1894 C CD1 . LEU A 1 254 ? 19.155  15.984  33.841 1.00 65.69  ? 254  LEU A CD1 1 
ATOM   1895 C CD2 . LEU A 1 254 ? 17.321  14.949  35.185 1.00 67.40  ? 254  LEU A CD2 1 
ATOM   1896 N N   . LEU A 1 255 ? 15.616  15.187  29.950 1.00 70.65  ? 255  LEU A N   1 
ATOM   1897 C CA  . LEU A 1 255 ? 15.103  14.241  28.966 1.00 72.70  ? 255  LEU A CA  1 
ATOM   1898 C C   . LEU A 1 255 ? 15.707  14.513  27.590 1.00 81.68  ? 255  LEU A C   1 
ATOM   1899 O O   . LEU A 1 255 ? 15.950  13.588  26.808 1.00 80.46  ? 255  LEU A O   1 
ATOM   1900 C CB  . LEU A 1 255 ? 13.575  14.319  28.897 1.00 72.89  ? 255  LEU A CB  1 
ATOM   1901 C CG  . LEU A 1 255 ? 12.860  13.402  27.900 1.00 77.78  ? 255  LEU A CG  1 
ATOM   1902 C CD1 . LEU A 1 255 ? 13.058  11.931  28.254 1.00 77.74  ? 255  LEU A CD1 1 
ATOM   1903 C CD2 . LEU A 1 255 ? 11.378  13.747  27.821 1.00 80.76  ? 255  LEU A CD2 1 
ATOM   1904 N N   . GLU A 1 256 ? 15.954  15.791  27.311 1.00 83.13  ? 256  GLU A N   1 
ATOM   1905 C CA  . GLU A 1 256 ? 16.529  16.214  26.038 1.00 85.31  ? 256  GLU A CA  1 
ATOM   1906 C C   . GLU A 1 256 ? 18.009  15.856  25.941 1.00 93.47  ? 256  GLU A C   1 
ATOM   1907 O O   . GLU A 1 256 ? 18.633  16.030  24.893 1.00 93.14  ? 256  GLU A O   1 
ATOM   1908 C CB  . GLU A 1 256 ? 16.331  17.719  25.836 1.00 86.98  ? 256  GLU A CB  1 
ATOM   1909 C CG  . GLU A 1 256 ? 14.887  18.123  25.560 1.00 100.78 ? 256  GLU A CG  1 
ATOM   1910 C CD  . GLU A 1 256 ? 14.679  19.630  25.583 1.00 127.53 ? 256  GLU A CD  1 
ATOM   1911 O OE1 . GLU A 1 256 ? 15.655  20.367  25.846 1.00 123.75 ? 256  GLU A OE1 1 
ATOM   1912 O OE2 . GLU A 1 256 ? 13.533  20.075  25.351 1.00 122.45 ? 256  GLU A OE2 1 
ATOM   1913 N N   . SER A 1 257 ? 18.571  15.394  27.054 1.00 93.13  ? 257  SER A N   1 
ATOM   1914 C CA  . SER A 1 257 ? 19.922  14.843  27.068 1.00 94.30  ? 257  SER A CA  1 
ATOM   1915 C C   . SER A 1 257 ? 19.843  13.323  27.151 1.00 102.30 ? 257  SER A C   1 
ATOM   1916 O O   . SER A 1 257 ? 20.836  12.652  27.424 1.00 101.97 ? 257  SER A O   1 
ATOM   1917 C CB  . SER A 1 257 ? 20.708  15.388  28.259 1.00 97.20  ? 257  SER A CB  1 
ATOM   1918 O OG  . SER A 1 257 ? 20.696  16.803  28.263 1.00 105.78 ? 257  SER A OG  1 
ATOM   1919 N N   . SER A 1 258 ? 18.635  12.796  26.971 1.00 101.90 ? 258  SER A N   1 
ATOM   1920 C CA  . SER A 1 258 ? 18.415  11.356  26.935 1.00 103.05 ? 258  SER A CA  1 
ATOM   1921 C C   . SER A 1 258 ? 18.645  10.830  25.523 1.00 110.27 ? 258  SER A C   1 
ATOM   1922 O O   . SER A 1 258 ? 18.632  9.620   25.288 1.00 109.89 ? 258  SER A O   1 
ATOM   1923 C CB  . SER A 1 258 ? 16.994  11.023  27.394 1.00 106.36 ? 258  SER A CB  1 
ATOM   1924 O OG  . SER A 1 258 ? 16.777  11.450  28.725 1.00 114.32 ? 258  SER A OG  1 
ATOM   1925 N N   . LEU A 1 259 ? 18.819  11.751  24.581 1.00 109.41 ? 259  LEU A N   1 
ATOM   1926 C CA  . LEU A 1 259 ? 19.188  11.390  23.218 1.00 110.45 ? 259  LEU A CA  1 
ATOM   1927 C C   . LEU A 1 259 ? 20.700  11.503  23.035 1.00 117.19 ? 259  LEU A C   1 
ATOM   1928 O O   . LEU A 1 259 ? 21.217  11.375  21.923 1.00 116.75 ? 259  LEU A O   1 
ATOM   1929 C CB  . LEU A 1 259 ? 18.439  12.257  22.205 1.00 110.53 ? 259  LEU A CB  1 
ATOM   1930 C CG  . LEU A 1 259 ? 18.555  13.776  22.344 1.00 115.15 ? 259  LEU A CG  1 
ATOM   1931 C CD1 . LEU A 1 259 ? 19.835  14.285  21.698 1.00 115.16 ? 259  LEU A CD1 1 
ATOM   1932 C CD2 . LEU A 1 259 ? 17.331  14.461  21.753 1.00 117.74 ? 259  LEU A CD2 1 
ATOM   1933 N N   . ARG A 1 260 ? 21.395  11.757  24.141 1.00 115.86 ? 260  ARG A N   1 
ATOM   1934 C CA  . ARG A 1 260 ? 22.851  11.672  24.189 1.00 116.67 ? 260  ARG A CA  1 
ATOM   1935 C C   . ARG A 1 260 ? 23.266  10.418  24.957 1.00 122.43 ? 260  ARG A C   1 
ATOM   1936 O O   . ARG A 1 260 ? 24.335  9.856   24.717 1.00 122.02 ? 260  ARG A O   1 
ATOM   1937 C CB  . ARG A 1 260 ? 23.443  12.908  24.867 1.00 117.84 ? 260  ARG A CB  1 
ATOM   1938 C CG  . ARG A 1 260 ? 23.281  14.201  24.084 1.00 131.55 ? 260  ARG A CG  1 
ATOM   1939 C CD  . ARG A 1 260 ? 23.925  15.359  24.836 1.00 145.80 ? 260  ARG A CD  1 
ATOM   1940 N NE  . ARG A 1 260 ? 23.809  16.628  24.123 1.00 157.07 ? 260  ARG A NE  1 
ATOM   1941 C CZ  . ARG A 1 260 ? 24.239  17.792  24.599 1.00 172.72 ? 260  ARG A CZ  1 
ATOM   1942 N NH1 . ARG A 1 260 ? 24.812  17.851  25.794 1.00 160.71 ? 260  ARG A NH1 1 
ATOM   1943 N NH2 . ARG A 1 260 ? 24.094  18.899  23.883 1.00 159.77 ? 260  ARG A NH2 1 
ATOM   1944 N N   . GLN A 1 261 ? 22.435  10.014  25.914 1.00 120.40 ? 261  GLN A N   1 
ATOM   1945 C CA  . GLN A 1 261 ? 22.613  8.735   26.596 1.00 120.83 ? 261  GLN A CA  1 
ATOM   1946 C C   . GLN A 1 261 ? 22.173  7.612   25.661 1.00 125.75 ? 261  GLN A C   1 
ATOM   1947 O O   . GLN A 1 261 ? 22.479  6.439   25.883 1.00 125.17 ? 261  GLN A O   1 
ATOM   1948 C CB  . GLN A 1 261 ? 21.794  8.696   27.892 1.00 122.25 ? 261  GLN A CB  1 
ATOM   1949 C CG  . GLN A 1 261 ? 22.226  9.717   28.939 1.00 138.34 ? 261  GLN A CG  1 
ATOM   1950 C CD  . GLN A 1 261 ? 21.351  9.692   30.181 1.00 157.62 ? 261  GLN A CD  1 
ATOM   1951 O OE1 . GLN A 1 261 ? 21.441  10.573  31.038 1.00 152.35 ? 261  GLN A OE1 1 
ATOM   1952 N NE2 . GLN A 1 261 ? 20.496  8.681   30.282 1.00 150.37 ? 261  GLN A NE2 1 
ATOM   1953 N N   . ALA A 1 262 ? 21.448  7.990   24.612 1.00 123.20 ? 262  ALA A N   1 
ATOM   1954 C CA  . ALA A 1 262 ? 21.048  7.057   23.567 1.00 123.38 ? 262  ALA A CA  1 
ATOM   1955 C C   . ALA A 1 262 ? 22.146  6.957   22.514 1.00 127.76 ? 262  ALA A C   1 
ATOM   1956 O O   . ALA A 1 262 ? 22.320  5.917   21.876 1.00 127.50 ? 262  ALA A O   1 
ATOM   1957 C CB  . ALA A 1 262 ? 19.741  7.511   22.929 1.00 124.15 ? 262  ALA A CB  1 
ATOM   1958 N N   . GLN A 1 263 ? 22.881  8.050   22.335 1.00 124.42 ? 263  GLN A N   1 
ATOM   1959 C CA  . GLN A 1 263 ? 23.987  8.080   21.386 1.00 124.27 ? 263  GLN A CA  1 
ATOM   1960 C C   . GLN A 1 263 ? 25.301  8.490   22.052 1.00 128.15 ? 263  GLN A C   1 
ATOM   1961 O O   . GLN A 1 263 ? 26.133  9.176   21.454 1.00 127.63 ? 263  GLN A O   1 
ATOM   1962 C CB  . GLN A 1 263 ? 23.649  8.978   20.193 1.00 125.60 ? 263  GLN A CB  1 
ATOM   1963 C CG  . GLN A 1 263 ? 22.480  8.455   19.366 1.00 139.42 ? 263  GLN A CG  1 
ATOM   1964 C CD  . GLN A 1 263 ? 21.922  9.485   18.405 1.00 157.40 ? 263  GLN A CD  1 
ATOM   1965 O OE1 . GLN A 1 263 ? 22.213  10.676  18.512 1.00 152.27 ? 263  GLN A OE1 1 
ATOM   1966 N NE2 . GLN A 1 263 ? 21.094  9.032   17.469 1.00 149.34 ? 263  GLN A NE2 1 
ATOM   1967 N N   . GLN A 1 264 ? 25.455  8.090   23.312 1.00 124.71 ? 264  GLN A N   1 
ATOM   1968 C CA  . GLN A 1 264 ? 26.752  8.106   23.975 1.00 124.37 ? 264  GLN A CA  1 
ATOM   1969 C C   . GLN A 1 264 ? 27.547  6.906   23.471 1.00 128.16 ? 264  GLN A C   1 
ATOM   1970 O O   . GLN A 1 264 ? 28.765  6.831   23.634 1.00 127.68 ? 264  GLN A O   1 
ATOM   1971 C CB  . GLN A 1 264 ? 26.581  8.074   25.499 1.00 125.60 ? 264  GLN A CB  1 
ATOM   1972 C CG  . GLN A 1 264 ? 25.623  7.008   26.017 1.00 137.30 ? 264  GLN A CG  1 
ATOM   1973 C CD  . GLN A 1 264 ? 26.317  5.950   26.853 1.00 153.39 ? 264  GLN A CD  1 
ATOM   1974 O OE1 . GLN A 1 264 ? 26.692  6.199   27.999 1.00 148.36 ? 264  GLN A OE1 1 
ATOM   1975 N NE2 . GLN A 1 264 ? 26.472  4.756   26.292 1.00 144.19 ? 264  GLN A NE2 1 
ATOM   1976 N N   . ASN A 1 265 ? 26.828  5.971   22.855 1.00 124.70 ? 265  ASN A N   1 
ATOM   1977 C CA  . ASN A 1 265 ? 27.420  4.964   21.982 1.00 157.48 ? 265  ASN A CA  1 
ATOM   1978 C C   . ASN A 1 265 ? 26.789  5.030   20.595 1.00 183.64 ? 265  ASN A C   1 
ATOM   1979 O O   . ASN A 1 265 ? 26.295  6.077   20.175 1.00 143.62 ? 265  ASN A O   1 
ATOM   1980 C CB  . ASN A 1 265 ? 27.255  3.560   22.566 1.00 158.69 ? 265  ASN A CB  1 
ATOM   1981 C CG  . ASN A 1 265 ? 28.582  2.921   22.927 1.00 183.52 ? 265  ASN A CG  1 
ATOM   1982 O OD1 . ASN A 1 265 ? 29.630  3.565   22.869 1.00 178.59 ? 265  ASN A OD1 1 
ATOM   1983 N ND2 . ASN A 1 265 ? 28.549  1.633   23.251 1.00 175.48 ? 265  ASN A ND2 1 
ATOM   1984 N N   . SER B 2 4   ? 24.316  9.880   69.089 1.00 76.10  ? 4    SER B N   1 
ATOM   1985 C CA  . SER B 2 4   ? 23.661  9.547   70.351 1.00 75.80  ? 4    SER B CA  1 
ATOM   1986 C C   . SER B 2 4   ? 24.073  8.167   70.858 1.00 80.08  ? 4    SER B C   1 
ATOM   1987 O O   . SER B 2 4   ? 23.606  7.149   70.347 1.00 80.28  ? 4    SER B O   1 
ATOM   1988 C CB  . SER B 2 4   ? 22.135  9.602   70.209 1.00 78.40  ? 4    SER B CB  1 
ATOM   1989 O OG  . SER B 2 4   ? 21.673  10.919  69.965 1.00 85.36  ? 4    SER B OG  1 
ATOM   1990 N N   . ARG B 2 5   ? 24.992  8.136   71.819 1.00 75.97  ? 5    ARG B N   1 
ATOM   1991 C CA  . ARG B 2 5   ? 25.199  6.943   72.629 1.00 75.62  ? 5    ARG B CA  1 
ATOM   1992 C C   . ARG B 2 5   ? 24.443  7.225   73.918 1.00 79.42  ? 5    ARG B C   1 
ATOM   1993 O O   . ARG B 2 5   ? 24.592  8.295   74.504 1.00 78.88  ? 5    ARG B O   1 
ATOM   1994 C CB  . ARG B 2 5   ? 26.688  6.738   72.938 1.00 75.72  ? 5    ARG B CB  1 
ATOM   1995 C CG  . ARG B 2 5   ? 27.137  5.274   73.038 1.00 83.68  ? 5    ARG B CG  1 
ATOM   1996 C CD  . ARG B 2 5   ? 25.969  4.319   73.263 1.00 92.69  ? 5    ARG B CD  1 
ATOM   1997 N NE  . ARG B 2 5   ? 25.396  3.857   72.000 1.00 99.06  ? 5    ARG B NE  1 
ATOM   1998 C CZ  . ARG B 2 5   ? 24.191  3.311   71.873 1.00 109.28 ? 5    ARG B CZ  1 
ATOM   1999 N NH1 . ARG B 2 5   ? 23.409  3.168   72.934 1.00 95.44  ? 5    ARG B NH1 1 
ATOM   2000 N NH2 . ARG B 2 5   ? 23.760  2.924   70.680 1.00 93.09  ? 5    ARG B NH2 1 
ATOM   2001 N N   . TYR B 2 6   ? 23.576  6.305   74.319 1.00 76.00  ? 6    TYR B N   1 
ATOM   2002 C CA  . TYR B 2 6   ? 22.724  6.542   75.475 1.00 75.87  ? 6    TYR B CA  1 
ATOM   2003 C C   . TYR B 2 6   ? 23.263  5.851   76.720 1.00 81.74  ? 6    TYR B C   1 
ATOM   2004 O O   . TYR B 2 6   ? 23.863  4.779   76.636 1.00 81.58  ? 6    TYR B O   1 
ATOM   2005 C CB  . TYR B 2 6   ? 21.285  6.114   75.179 1.00 76.05  ? 6    TYR B CB  1 
ATOM   2006 C CG  . TYR B 2 6   ? 20.725  6.746   73.923 1.00 76.23  ? 6    TYR B CG  1 
ATOM   2007 C CD1 . TYR B 2 6   ? 20.980  6.196   72.671 1.00 77.69  ? 6    TYR B CD1 1 
ATOM   2008 C CD2 . TYR B 2 6   ? 19.986  7.920   73.983 1.00 76.54  ? 6    TYR B CD2 1 
ATOM   2009 C CE1 . TYR B 2 6   ? 20.482  6.777   71.520 1.00 77.50  ? 6    TYR B CE1 1 
ATOM   2010 C CE2 . TYR B 2 6   ? 19.491  8.513   72.833 1.00 77.07  ? 6    TYR B CE2 1 
ATOM   2011 C CZ  . TYR B 2 6   ? 19.741  7.936   71.607 1.00 82.67  ? 6    TYR B CZ  1 
ATOM   2012 O OH  . TYR B 2 6   ? 19.244  8.519   70.465 1.00 81.76  ? 6    TYR B OH  1 
ATOM   2013 N N   . GLU B 2 7   ? 23.093  6.498   77.867 1.00 79.48  ? 7    GLU B N   1 
ATOM   2014 C CA  . GLU B 2 7   ? 23.568  5.943   79.126 1.00 80.03  ? 7    GLU B CA  1 
ATOM   2015 C C   . GLU B 2 7   ? 22.480  5.865   80.189 1.00 84.79  ? 7    GLU B C   1 
ATOM   2016 O O   . GLU B 2 7   ? 21.863  6.871   80.542 1.00 84.20  ? 7    GLU B O   1 
ATOM   2017 C CB  . GLU B 2 7   ? 24.777  6.721   79.639 1.00 81.65  ? 7    GLU B CB  1 
ATOM   2018 C CG  . GLU B 2 7   ? 26.052  6.431   78.862 1.00 94.61  ? 7    GLU B CG  1 
ATOM   2019 C CD  . GLU B 2 7   ? 26.443  4.965   78.921 1.00 118.74 ? 7    GLU B CD  1 
ATOM   2020 O OE1 . GLU B 2 7   ? 26.577  4.429   80.043 1.00 114.04 ? 7    GLU B OE1 1 
ATOM   2021 O OE2 . GLU B 2 7   ? 26.626  4.353   77.846 1.00 113.50 ? 7    GLU B OE2 1 
ATOM   2022 N N   . PRO B 2 8   ? 22.228  4.651   80.703 1.00 82.05  ? 8    PRO B N   1 
ATOM   2023 C CA  . PRO B 2 8   ? 21.233  4.285   81.713 1.00 82.10  ? 8    PRO B CA  1 
ATOM   2024 C C   . PRO B 2 8   ? 21.234  5.199   82.934 1.00 86.89  ? 8    PRO B C   1 
ATOM   2025 O O   . PRO B 2 8   ? 22.207  5.902   83.209 1.00 86.52  ? 8    PRO B O   1 
ATOM   2026 C CB  . PRO B 2 8   ? 21.646  2.867   82.096 1.00 83.79  ? 8    PRO B CB  1 
ATOM   2027 C CG  . PRO B 2 8   ? 22.210  2.306   80.828 1.00 88.15  ? 8    PRO B CG  1 
ATOM   2028 C CD  . PRO B 2 8   ? 22.814  3.463   80.056 1.00 83.66  ? 8    PRO B CD  1 
ATOM   2029 N N   . VAL B 2 9   ? 20.150  5.125   83.695 1.00 84.00  ? 9    VAL B N   1 
ATOM   2030 C CA  . VAL B 2 9   ? 19.834  6.115   84.715 1.00 83.93  ? 9    VAL B CA  1 
ATOM   2031 C C   . VAL B 2 9   ? 18.743  5.510   85.599 1.00 88.27  ? 9    VAL B C   1 
ATOM   2032 O O   . VAL B 2 9   ? 18.316  6.102   86.591 1.00 88.52  ? 9    VAL B O   1 
ATOM   2033 C CB  . VAL B 2 9   ? 19.392  7.445   84.049 1.00 87.64  ? 9    VAL B CB  1 
ATOM   2034 C CG1 . VAL B 2 9   ? 18.640  8.339   85.021 1.00 87.51  ? 9    VAL B CG1 1 
ATOM   2035 C CG2 . VAL B 2 9   ? 20.598  8.173   83.476 1.00 87.36  ? 9    VAL B CG2 1 
ATOM   2036 N N   . ALA B 2 10  ? 18.353  4.285   85.257 1.00 84.15  ? 10   ALA B N   1 
ATOM   2037 C CA  . ALA B 2 10  ? 17.352  3.541   86.012 1.00 83.57  ? 10   ALA B CA  1 
ATOM   2038 C C   . ALA B 2 10  ? 16.978  2.272   85.252 1.00 87.01  ? 10   ALA B C   1 
ATOM   2039 O O   . ALA B 2 10  ? 17.439  2.053   84.131 1.00 87.06  ? 10   ALA B O   1 
ATOM   2040 C CB  . ALA B 2 10  ? 16.122  4.401   86.253 1.00 84.28  ? 10   ALA B CB  1 
ATOM   2041 N N   . GLU B 2 11  ? 16.159  1.430   85.872 1.00 82.78  ? 11   GLU B N   1 
ATOM   2042 C CA  . GLU B 2 11  ? 15.683  0.212   85.230 1.00 82.44  ? 11   GLU B CA  1 
ATOM   2043 C C   . GLU B 2 11  ? 14.161  0.159   85.341 1.00 86.71  ? 11   GLU B C   1 
ATOM   2044 O O   . GLU B 2 11  ? 13.600  -0.722  85.997 1.00 86.71  ? 11   GLU B O   1 
ATOM   2045 C CB  . GLU B 2 11  ? 16.316  -1.013  85.889 1.00 83.75  ? 11   GLU B CB  1 
ATOM   2046 C CG  . GLU B 2 11  ? 16.076  -2.319  85.152 1.00 93.97  ? 11   GLU B CG  1 
ATOM   2047 C CD  . GLU B 2 11  ? 16.704  -3.504  85.858 1.00 113.82 ? 11   GLU B CD  1 
ATOM   2048 O OE1 . GLU B 2 11  ? 17.538  -3.286  86.760 1.00 109.37 ? 11   GLU B OE1 1 
ATOM   2049 O OE2 . GLU B 2 11  ? 16.369  -4.654  85.509 1.00 109.10 ? 11   GLU B OE2 1 
ATOM   2050 N N   . ILE B 2 12  ? 13.508  1.090   84.648 1.00 82.72  ? 12   ILE B N   1 
ATOM   2051 C CA  . ILE B 2 12  ? 12.100  1.412   84.869 1.00 81.94  ? 12   ILE B CA  1 
ATOM   2052 C C   . ILE B 2 12  ? 11.174  0.208   85.005 1.00 84.70  ? 12   ILE B C   1 
ATOM   2053 O O   . ILE B 2 12  ? 10.137  0.282   85.669 1.00 84.65  ? 12   ILE B O   1 
ATOM   2054 C CB  . ILE B 2 12  ? 11.584  2.426   83.827 1.00 85.08  ? 12   ILE B CB  1 
ATOM   2055 C CG1 . ILE B 2 12  ? 12.581  3.577   83.666 1.00 85.55  ? 12   ILE B CG1 1 
ATOM   2056 C CG2 . ILE B 2 12  ? 10.214  2.957   84.227 1.00 85.82  ? 12   ILE B CG2 1 
ATOM   2057 C CD1 . ILE B 2 12  ? 12.776  4.406   84.924 1.00 92.03  ? 12   ILE B CD1 1 
ATOM   2058 N N   . GLY B 2 13  ? 11.553  -0.909  84.398 1.00 79.91  ? 13   GLY B N   1 
ATOM   2059 C CA  . GLY B 2 13  ? 10.736  -2.104  84.456 1.00 79.08  ? 13   GLY B CA  1 
ATOM   2060 C C   . GLY B 2 13  ? 11.348  -3.255  83.693 1.00 81.59  ? 13   GLY B C   1 
ATOM   2061 O O   . GLY B 2 13  ? 12.257  -3.064  82.885 1.00 81.11  ? 13   GLY B O   1 
ATOM   2062 N N   . VAL B 2 14  ? 10.854  -4.458  83.959 1.00 77.28  ? 14   VAL B N   1 
ATOM   2063 C CA  . VAL B 2 14  ? 11.331  -5.648  83.269 1.00 76.69  ? 14   VAL B CA  1 
ATOM   2064 C C   . VAL B 2 14  ? 10.152  -6.511  82.830 1.00 79.13  ? 14   VAL B C   1 
ATOM   2065 O O   . VAL B 2 14  ? 10.168  -7.732  82.984 1.00 79.00  ? 14   VAL B O   1 
ATOM   2066 C CB  . VAL B 2 14  ? 12.355  -6.427  84.125 1.00 80.61  ? 14   VAL B CB  1 
ATOM   2067 C CG1 . VAL B 2 14  ? 12.914  -7.619  83.359 1.00 80.44  ? 14   VAL B CG1 1 
ATOM   2068 C CG2 . VAL B 2 14  ? 13.483  -5.503  84.558 1.00 80.42  ? 14   VAL B CG2 1 
ATOM   2069 N N   . GLY B 2 15  ? 9.145   -5.864  82.248 1.00 74.02  ? 15   GLY B N   1 
ATOM   2070 C CA  . GLY B 2 15  ? 7.936   -6.528  81.799 1.00 73.04  ? 15   GLY B CA  1 
ATOM   2071 C C   . GLY B 2 15  ? 8.092   -7.377  80.550 1.00 75.10  ? 15   GLY B C   1 
ATOM   2072 O O   . GLY B 2 15  ? 9.143   -7.978  80.315 1.00 74.39  ? 15   GLY B O   1 
ATOM   2073 N N   . ALA B 2 16  ? 7.050   -7.376  79.722 1.00 70.56  ? 16   ALA B N   1 
ATOM   2074 C CA  . ALA B 2 16  ? 6.920   -8.309  78.600 1.00 69.68  ? 16   ALA B CA  1 
ATOM   2075 C C   . ALA B 2 16  ? 8.051   -8.268  77.568 1.00 71.60  ? 16   ALA B C   1 
ATOM   2076 O O   . ALA B 2 16  ? 8.372   -9.285  76.950 1.00 71.45  ? 16   ALA B O   1 
ATOM   2077 C CB  . ALA B 2 16  ? 5.563   -8.130  77.914 1.00 70.33  ? 16   ALA B CB  1 
ATOM   2078 N N   . TYR B 2 17  ? 8.630   -7.091  77.354 1.00 65.55  ? 17   TYR B N   1 
ATOM   2079 C CA  . TYR B 2 17  ? 9.618   -6.926  76.296 1.00 63.97  ? 17   TYR B CA  1 
ATOM   2080 C C   . TYR B 2 17  ? 11.035  -6.763  76.832 1.00 67.23  ? 17   TYR B C   1 
ATOM   2081 O O   . TYR B 2 17  ? 11.850  -6.041  76.257 1.00 66.85  ? 17   TYR B O   1 
ATOM   2082 C CB  . TYR B 2 17  ? 9.231   -5.757  75.395 1.00 64.29  ? 17   TYR B CB  1 
ATOM   2083 C CG  . TYR B 2 17  ? 7.958   -5.998  74.610 1.00 64.72  ? 17   TYR B CG  1 
ATOM   2084 C CD1 . TYR B 2 17  ? 6.877   -5.138  74.720 1.00 66.66  ? 17   TYR B CD1 1 
ATOM   2085 C CD2 . TYR B 2 17  ? 7.839   -7.091  73.763 1.00 64.97  ? 17   TYR B CD2 1 
ATOM   2086 C CE1 . TYR B 2 17  ? 5.713   -5.356  74.001 1.00 67.46  ? 17   TYR B CE1 1 
ATOM   2087 C CE2 . TYR B 2 17  ? 6.680   -7.320  73.044 1.00 65.57  ? 17   TYR B CE2 1 
ATOM   2088 C CZ  . TYR B 2 17  ? 5.619   -6.450  73.166 1.00 72.34  ? 17   TYR B CZ  1 
ATOM   2089 O OH  . TYR B 2 17  ? 4.465   -6.668  72.446 1.00 72.94  ? 17   TYR B OH  1 
ATOM   2090 N N   . GLY B 2 18  ? 11.327  -7.463  77.926 1.00 63.36  ? 18   GLY B N   1 
ATOM   2091 C CA  . GLY B 2 18  ? 12.630  -7.438  78.565 1.00 62.54  ? 18   GLY B CA  1 
ATOM   2092 C C   . GLY B 2 18  ? 12.775  -6.264  79.512 1.00 65.28  ? 18   GLY B C   1 
ATOM   2093 O O   . GLY B 2 18  ? 11.787  -5.648  79.904 1.00 63.80  ? 18   GLY B O   1 
ATOM   2094 N N   . THR B 2 19  ? 14.017  -5.937  79.850 1.00 62.90  ? 19   THR B N   1 
ATOM   2095 C CA  . THR B 2 19  ? 14.317  -4.803  80.720 1.00 63.35  ? 19   THR B CA  1 
ATOM   2096 C C   . THR B 2 19  ? 14.311  -3.471  79.967 1.00 67.81  ? 19   THR B C   1 
ATOM   2097 O O   . THR B 2 19  ? 15.098  -3.269  79.039 1.00 67.60  ? 19   THR B O   1 
ATOM   2098 C CB  . THR B 2 19  ? 15.663  -5.008  81.458 1.00 73.45  ? 19   THR B CB  1 
ATOM   2099 O OG1 . THR B 2 19  ? 15.599  -6.199  82.251 1.00 74.75  ? 19   THR B OG1 1 
ATOM   2100 C CG2 . THR B 2 19  ? 15.969  -3.817  82.358 1.00 71.97  ? 19   THR B CG2 1 
ATOM   2101 N N   . VAL B 2 20  ? 13.452  -2.551  80.398 1.00 64.71  ? 20   VAL B N   1 
ATOM   2102 C CA  . VAL B 2 20  ? 13.466  -1.194  79.862 1.00 64.98  ? 20   VAL B CA  1 
ATOM   2103 C C   . VAL B 2 20  ? 14.243  -0.236  80.760 1.00 70.29  ? 20   VAL B C   1 
ATOM   2104 O O   . VAL B 2 20  ? 13.849  0.019   81.899 1.00 70.35  ? 20   VAL B O   1 
ATOM   2105 C CB  . VAL B 2 20  ? 12.046  -0.670  79.564 1.00 68.57  ? 20   VAL B CB  1 
ATOM   2106 C CG1 . VAL B 2 20  ? 11.094  -1.052  80.677 1.00 68.52  ? 20   VAL B CG1 1 
ATOM   2107 C CG2 . VAL B 2 20  ? 12.070  0.840   79.386 1.00 68.11  ? 20   VAL B CG2 1 
ATOM   2108 N N   . TYR B 2 21  ? 15.350  0.286   80.241 1.00 67.38  ? 21   TYR B N   1 
ATOM   2109 C CA  . TYR B 2 21  ? 16.165  1.242   80.982 1.00 67.65  ? 21   TYR B CA  1 
ATOM   2110 C C   . TYR B 2 21  ? 15.817  2.671   80.600 1.00 71.29  ? 21   TYR B C   1 
ATOM   2111 O O   . TYR B 2 21  ? 15.558  2.970   79.432 1.00 70.96  ? 21   TYR B O   1 
ATOM   2112 C CB  . TYR B 2 21  ? 17.654  1.019   80.707 1.00 69.33  ? 21   TYR B CB  1 
ATOM   2113 C CG  . TYR B 2 21  ? 18.165  -0.343  81.089 1.00 71.57  ? 21   TYR B CG  1 
ATOM   2114 C CD1 . TYR B 2 21  ? 18.770  -0.557  82.318 1.00 73.55  ? 21   TYR B CD1 1 
ATOM   2115 C CD2 . TYR B 2 21  ? 18.077  -1.407  80.206 1.00 72.90  ? 21   TYR B CD2 1 
ATOM   2116 C CE1 . TYR B 2 21  ? 19.256  -1.806  82.667 1.00 74.88  ? 21   TYR B CE1 1 
ATOM   2117 C CE2 . TYR B 2 21  ? 18.552  -2.660  80.546 1.00 74.25  ? 21   TYR B CE2 1 
ATOM   2118 C CZ  . TYR B 2 21  ? 19.147  -2.853  81.775 1.00 83.00  ? 21   TYR B CZ  1 
ATOM   2119 O OH  . TYR B 2 21  ? 19.625  -4.100  82.111 1.00 85.74  ? 21   TYR B OH  1 
ATOM   2120 N N   . LYS B 2 22  ? 15.851  3.558   81.587 1.00 67.36  ? 22   LYS B N   1 
ATOM   2121 C CA  . LYS B 2 22  ? 15.786  4.990   81.335 1.00 66.85  ? 22   LYS B CA  1 
ATOM   2122 C C   . LYS B 2 22  ? 17.202  5.504   81.084 1.00 71.22  ? 22   LYS B C   1 
ATOM   2123 O O   . LYS B 2 22  ? 18.135  5.149   81.803 1.00 70.67  ? 22   LYS B O   1 
ATOM   2124 C CB  . LYS B 2 22  ? 15.144  5.699   82.527 1.00 68.65  ? 22   LYS B CB  1 
ATOM   2125 C CG  . LYS B 2 22  ? 15.201  7.212   82.493 1.00 73.48  ? 22   LYS B CG  1 
ATOM   2126 C CD  . LYS B 2 22  ? 14.262  7.775   83.539 1.00 82.09  ? 22   LYS B CD  1 
ATOM   2127 C CE  . LYS B 2 22  ? 14.651  9.178   83.958 1.00 95.13  ? 22   LYS B CE  1 
ATOM   2128 N NZ  . LYS B 2 22  ? 13.771  9.668   85.055 1.00 103.68 ? 22   LYS B NZ  1 
ATOM   2129 N N   . ALA B 2 23  ? 17.373  6.256   80.002 1.00 68.49  ? 23   ALA B N   1 
ATOM   2130 C CA  . ALA B 2 23  ? 18.694  6.726   79.600 1.00 68.69  ? 23   ALA B CA  1 
ATOM   2131 C C   . ALA B 2 23  ? 18.637  8.198   79.233 1.00 73.36  ? 23   ALA B C   1 
ATOM   2132 O O   . ALA B 2 23  ? 17.558  8.750   79.035 1.00 72.48  ? 23   ALA B O   1 
ATOM   2133 C CB  . ALA B 2 23  ? 19.216  5.905   78.427 1.00 69.36  ? 23   ALA B CB  1 
ATOM   2134 N N   . ARG B 2 24  ? 19.799  8.837   79.162 1.00 71.57  ? 24   ARG B N   1 
ATOM   2135 C CA  . ARG B 2 24  ? 19.854  10.245  78.791 1.00 72.34  ? 24   ARG B CA  1 
ATOM   2136 C C   . ARG B 2 24  ? 20.466  10.467  77.409 1.00 77.57  ? 24   ARG B C   1 
ATOM   2137 O O   . ARG B 2 24  ? 21.498  9.882   77.075 1.00 76.67  ? 24   ARG B O   1 
ATOM   2138 C CB  . ARG B 2 24  ? 20.585  11.077  79.852 1.00 73.19  ? 24   ARG B CB  1 
ATOM   2139 C CG  . ARG B 2 24  ? 20.575  12.571  79.551 1.00 88.07  ? 24   ARG B CG  1 
ATOM   2140 C CD  . ARG B 2 24  ? 21.061  13.405  80.727 1.00 105.42 ? 24   ARG B CD  1 
ATOM   2141 N NE  . ARG B 2 24  ? 20.994  14.834  80.430 1.00 119.34 ? 24   ARG B NE  1 
ATOM   2142 C CZ  . ARG B 2 24  ? 21.353  15.795  81.276 1.00 135.97 ? 24   ARG B CZ  1 
ATOM   2143 N NH1 . ARG B 2 24  ? 21.810  15.483  82.482 1.00 126.34 ? 24   ARG B NH1 1 
ATOM   2144 N NH2 . ARG B 2 24  ? 21.256  17.069  80.915 1.00 120.69 ? 24   ARG B NH2 1 
ATOM   2145 N N   . ASP B 2 25  ? 19.789  11.278  76.598 1.00 75.73  ? 25   ASP B N   1 
ATOM   2146 C CA  . ASP B 2 25  ? 20.315  11.697  75.304 1.00 76.28  ? 25   ASP B CA  1 
ATOM   2147 C C   . ASP B 2 25  ? 21.391  12.757  75.531 1.00 82.86  ? 25   ASP B C   1 
ATOM   2148 O O   . ASP B 2 25  ? 21.107  13.854  76.019 1.00 82.21  ? 25   ASP B O   1 
ATOM   2149 C CB  . ASP B 2 25  ? 19.191  12.257  74.430 1.00 77.89  ? 25   ASP B CB  1 
ATOM   2150 C CG  . ASP B 2 25  ? 19.637  12.524  73.004 1.00 85.40  ? 25   ASP B CG  1 
ATOM   2151 O OD1 . ASP B 2 25  ? 20.787  12.176  72.660 1.00 85.53  ? 25   ASP B OD1 1 
ATOM   2152 O OD2 . ASP B 2 25  ? 18.834  13.077  72.225 1.00 90.31  ? 25   ASP B OD2 1 
ATOM   2153 N N   . PRO B 2 26  ? 22.643  12.439  75.165 1.00 81.55  ? 26   PRO B N   1 
ATOM   2154 C CA  . PRO B 2 26  ? 23.837  13.192  75.560 1.00 81.96  ? 26   PRO B CA  1 
ATOM   2155 C C   . PRO B 2 26  ? 24.059  14.498  74.804 1.00 87.07  ? 26   PRO B C   1 
ATOM   2156 O O   . PRO B 2 26  ? 25.006  15.233  75.095 1.00 87.01  ? 26   PRO B O   1 
ATOM   2157 C CB  . PRO B 2 26  ? 24.971  12.207  75.279 1.00 83.70  ? 26   PRO B CB  1 
ATOM   2158 C CG  . PRO B 2 26  ? 24.345  10.875  75.485 1.00 87.96  ? 26   PRO B CG  1 
ATOM   2159 C CD  . PRO B 2 26  ? 22.937  11.009  74.966 1.00 83.42  ? 26   PRO B CD  1 
ATOM   2160 N N   . HIS B 2 27  ? 23.194  14.796  73.842 1.00 83.88  ? 27   HIS B N   1 
ATOM   2161 C CA  . HIS B 2 27  ? 23.225  16.110  73.213 1.00 83.94  ? 27   HIS B CA  1 
ATOM   2162 C C   . HIS B 2 27  ? 21.884  16.835  73.298 1.00 86.79  ? 27   HIS B C   1 
ATOM   2163 O O   . HIS B 2 27  ? 21.824  18.064  73.201 1.00 86.90  ? 27   HIS B O   1 
ATOM   2164 C CB  . HIS B 2 27  ? 23.748  16.039  71.773 1.00 85.10  ? 27   HIS B CB  1 
ATOM   2165 C CG  . HIS B 2 27  ? 22.838  15.321  70.826 1.00 88.73  ? 27   HIS B CG  1 
ATOM   2166 N ND1 . HIS B 2 27  ? 23.195  14.147  70.198 1.00 90.61  ? 27   HIS B ND1 1 
ATOM   2167 C CD2 . HIS B 2 27  ? 21.606  15.635  70.359 1.00 90.71  ? 27   HIS B CD2 1 
ATOM   2168 C CE1 . HIS B 2 27  ? 22.214  13.756  69.405 1.00 90.18  ? 27   HIS B CE1 1 
ATOM   2169 N NE2 . HIS B 2 27  ? 21.237  14.645  69.482 1.00 90.56  ? 27   HIS B NE2 1 
ATOM   2170 N N   . SER B 2 28  ? 20.823  16.072  73.542 1.00 81.71  ? 28   SER B N   1 
ATOM   2171 C CA  . SER B 2 28  ? 19.487  16.637  73.710 1.00 80.56  ? 28   SER B CA  1 
ATOM   2172 C C   . SER B 2 28  ? 19.209  16.891  75.190 1.00 82.63  ? 28   SER B C   1 
ATOM   2173 O O   . SER B 2 28  ? 18.370  17.722  75.544 1.00 82.36  ? 28   SER B O   1 
ATOM   2174 C CB  . SER B 2 28  ? 18.434  15.689  73.126 1.00 83.36  ? 28   SER B CB  1 
ATOM   2175 O OG  . SER B 2 28  ? 17.139  16.259  73.177 1.00 90.41  ? 28   SER B OG  1 
ATOM   2176 N N   . GLY B 2 29  ? 19.927  16.178  76.052 1.00 77.37  ? 29   GLY B N   1 
ATOM   2177 C CA  . GLY B 2 29  ? 19.768  16.314  77.487 1.00 76.34  ? 29   GLY B CA  1 
ATOM   2178 C C   . GLY B 2 29  ? 18.493  15.666  77.994 1.00 77.88  ? 29   GLY B C   1 
ATOM   2179 O O   . GLY B 2 29  ? 18.320  15.473  79.197 1.00 76.93  ? 29   GLY B O   1 
ATOM   2180 N N   . HIS B 2 30  ? 17.604  15.316  77.070 1.00 73.12  ? 30   HIS B N   1 
ATOM   2181 C CA  . HIS B 2 30  ? 16.338  14.687  77.428 1.00 72.25  ? 30   HIS B CA  1 
ATOM   2182 C C   . HIS B 2 30  ? 16.492  13.219  77.808 1.00 73.67  ? 30   HIS B C   1 
ATOM   2183 O O   . HIS B 2 30  ? 17.421  12.539  77.363 1.00 73.19  ? 30   HIS B O   1 
ATOM   2184 C CB  . HIS B 2 30  ? 15.327  14.824  76.288 1.00 73.00  ? 30   HIS B CB  1 
ATOM   2185 C CG  . HIS B 2 30  ? 14.776  16.207  76.134 1.00 76.41  ? 30   HIS B CG  1 
ATOM   2186 N ND1 . HIS B 2 30  ? 13.623  16.622  76.765 1.00 78.15  ? 30   HIS B ND1 1 
ATOM   2187 C CD2 . HIS B 2 30  ? 15.217  17.267  75.417 1.00 78.27  ? 30   HIS B CD2 1 
ATOM   2188 C CE1 . HIS B 2 30  ? 13.377  17.880  76.443 1.00 77.56  ? 30   HIS B CE1 1 
ATOM   2189 N NE2 . HIS B 2 30  ? 14.329  18.296  75.629 1.00 77.97  ? 30   HIS B NE2 1 
ATOM   2190 N N   . PHE B 2 31  ? 15.560  12.732  78.620 1.00 68.24  ? 31   PHE B N   1 
ATOM   2191 C CA  . PHE B 2 31  ? 15.502  11.316  78.957 1.00 67.16  ? 31   PHE B CA  1 
ATOM   2192 C C   . PHE B 2 31  ? 14.837  10.488  77.856 1.00 66.68  ? 31   PHE B C   1 
ATOM   2193 O O   . PHE B 2 31  ? 14.064  11.006  77.045 1.00 65.26  ? 31   PHE B O   1 
ATOM   2194 C CB  . PHE B 2 31  ? 14.763  11.109  80.276 1.00 69.49  ? 31   PHE B CB  1 
ATOM   2195 C CG  . PHE B 2 31  ? 15.597  11.398  81.487 1.00 71.83  ? 31   PHE B CG  1 
ATOM   2196 C CD1 . PHE B 2 31  ? 15.156  12.291  82.450 1.00 75.54  ? 31   PHE B CD1 1 
ATOM   2197 C CD2 . PHE B 2 31  ? 16.813  10.762  81.673 1.00 74.23  ? 31   PHE B CD2 1 
ATOM   2198 C CE1 . PHE B 2 31  ? 15.921  12.558  83.566 1.00 76.61  ? 31   PHE B CE1 1 
ATOM   2199 C CE2 . PHE B 2 31  ? 17.579  11.021  82.787 1.00 77.34  ? 31   PHE B CE2 1 
ATOM   2200 C CZ  . PHE B 2 31  ? 17.134  11.920  83.735 1.00 75.70  ? 31   PHE B CZ  1 
ATOM   2201 N N   . VAL B 2 32  ? 15.097  9.186   77.888 1.00 60.74  ? 32   VAL B N   1 
ATOM   2202 C CA  . VAL B 2 32  ? 14.590  8.265   76.882 1.00 59.38  ? 32   VAL B CA  1 
ATOM   2203 C C   . VAL B 2 32  ? 14.347  6.911   77.530 1.00 59.89  ? 32   VAL B C   1 
ATOM   2204 O O   . VAL B 2 32  ? 14.987  6.570   78.524 1.00 59.07  ? 32   VAL B O   1 
ATOM   2205 C CB  . VAL B 2 32  ? 15.580  8.139   75.703 1.00 63.75  ? 32   VAL B CB  1 
ATOM   2206 C CG1 . VAL B 2 32  ? 15.310  6.869   74.924 1.00 63.93  ? 32   VAL B CG1 1 
ATOM   2207 C CG2 . VAL B 2 32  ? 15.492  9.366   74.789 1.00 63.41  ? 32   VAL B CG2 1 
ATOM   2208 N N   . ALA B 2 33  ? 13.417  6.144   76.970 1.00 54.27  ? 33   ALA B N   1 
ATOM   2209 C CA  . ALA B 2 33  ? 13.171  4.785   77.444 1.00 53.10  ? 33   ALA B CA  1 
ATOM   2210 C C   . ALA B 2 33  ? 13.672  3.740   76.445 1.00 55.68  ? 33   ALA B C   1 
ATOM   2211 O O   . ALA B 2 33  ? 13.105  3.583   75.368 1.00 55.67  ? 33   ALA B O   1 
ATOM   2212 C CB  . ALA B 2 33  ? 11.698  4.580   77.748 1.00 53.55  ? 33   ALA B CB  1 
ATOM   2213 N N   . LEU B 2 34  ? 14.727  3.023   76.826 1.00 50.76  ? 34   LEU B N   1 
ATOM   2214 C CA  . LEU B 2 34  ? 15.360  2.021   75.971 1.00 49.70  ? 34   LEU B CA  1 
ATOM   2215 C C   . LEU B 2 34  ? 14.787  0.619   76.195 1.00 52.70  ? 34   LEU B C   1 
ATOM   2216 O O   . LEU B 2 34  ? 14.572  0.195   77.331 1.00 53.20  ? 34   LEU B O   1 
ATOM   2217 C CB  . LEU B 2 34  ? 16.872  1.986   76.226 1.00 49.51  ? 34   LEU B CB  1 
ATOM   2218 C CG  . LEU B 2 34  ? 17.701  3.261   76.005 1.00 54.03  ? 34   LEU B CG  1 
ATOM   2219 C CD1 . LEU B 2 34  ? 19.173  3.001   76.287 1.00 53.93  ? 34   LEU B CD1 1 
ATOM   2220 C CD2 . LEU B 2 34  ? 17.532  3.799   74.595 1.00 56.50  ? 34   LEU B CD2 1 
ATOM   2221 N N   . LYS B 2 35  ? 14.567  -0.109  75.106 1.00 47.35  ? 35   LYS B N   1 
ATOM   2222 C CA  . LYS B 2 35  ? 14.276  -1.535  75.187 1.00 46.34  ? 35   LYS B CA  1 
ATOM   2223 C C   . LYS B 2 35  ? 15.086  -2.268  74.129 1.00 49.30  ? 35   LYS B C   1 
ATOM   2224 O O   . LYS B 2 35  ? 15.429  -1.704  73.093 1.00 49.33  ? 35   LYS B O   1 
ATOM   2225 C CB  . LYS B 2 35  ? 12.786  -1.803  74.973 1.00 49.23  ? 35   LYS B CB  1 
ATOM   2226 C CG  . LYS B 2 35  ? 11.879  -1.135  75.987 1.00 64.90  ? 35   LYS B CG  1 
ATOM   2227 C CD  . LYS B 2 35  ? 10.414  -1.398  75.675 1.00 72.04  ? 35   LYS B CD  1 
ATOM   2228 C CE  . LYS B 2 35  ? 9.520   -0.491  76.501 1.00 80.99  ? 35   LYS B CE  1 
ATOM   2229 N NZ  . LYS B 2 35  ? 8.149   -1.046  76.638 1.00 92.24  ? 35   LYS B NZ  1 
ATOM   2230 N N   . SER B 2 36  ? 15.413  -3.521  74.403 1.00 45.25  ? 36   SER B N   1 
ATOM   2231 C CA  . SER B 2 36  ? 16.119  -4.340  73.437 1.00 44.90  ? 36   SER B CA  1 
ATOM   2232 C C   . SER B 2 36  ? 15.296  -5.520  72.949 1.00 47.26  ? 36   SER B C   1 
ATOM   2233 O O   . SER B 2 36  ? 14.289  -5.899  73.557 1.00 46.36  ? 36   SER B O   1 
ATOM   2234 C CB  . SER B 2 36  ? 17.464  -4.808  73.986 1.00 49.60  ? 36   SER B CB  1 
ATOM   2235 O OG  . SER B 2 36  ? 18.455  -3.817  73.758 1.00 63.80  ? 36   SER B OG  1 
ATOM   2236 N N   . VAL B 2 37  ? 15.741  -6.087  71.834 1.00 42.64  ? 37   VAL B N   1 
ATOM   2237 C CA  . VAL B 2 37  ? 15.076  -7.216  71.208 1.00 41.77  ? 37   VAL B CA  1 
ATOM   2238 C C   . VAL B 2 37  ? 16.120  -8.020  70.423 1.00 46.43  ? 37   VAL B C   1 
ATOM   2239 O O   . VAL B 2 37  ? 17.002  -7.449  69.778 1.00 45.96  ? 37   VAL B O   1 
ATOM   2240 C CB  . VAL B 2 37  ? 13.919  -6.723  70.318 1.00 44.89  ? 37   VAL B CB  1 
ATOM   2241 C CG1 . VAL B 2 37  ? 14.436  -5.774  69.250 1.00 44.65  ? 37   VAL B CG1 1 
ATOM   2242 C CG2 . VAL B 2 37  ? 13.161  -7.882  69.710 1.00 44.56  ? 37   VAL B CG2 1 
ATOM   2243 N N   . ARG B 2 38  ? 16.082  -9.340  70.557 1.00 44.09  ? 38   ARG B N   1 
ATOM   2244 C CA  . ARG B 2 38  ? 16.975  -10.203 69.787 1.00 44.08  ? 38   ARG B CA  1 
ATOM   2245 C C   . ARG B 2 38  ? 16.296  -10.632 68.496 1.00 46.24  ? 38   ARG B C   1 
ATOM   2246 O O   . ARG B 2 38  ? 15.147  -11.067 68.505 1.00 44.26  ? 38   ARG B O   1 
ATOM   2247 C CB  . ARG B 2 38  ? 17.371  -11.445 70.587 1.00 45.55  ? 38   ARG B CB  1 
ATOM   2248 C CG  . ARG B 2 38  ? 18.223  -11.170 71.816 1.00 60.70  ? 38   ARG B CG  1 
ATOM   2249 C CD  . ARG B 2 38  ? 18.673  -12.482 72.455 1.00 73.41  ? 38   ARG B CD  1 
ATOM   2250 N NE  . ARG B 2 38  ? 17.546  -13.382 72.683 1.00 83.45  ? 38   ARG B NE  1 
ATOM   2251 C CZ  . ARG B 2 38  ? 17.642  -14.704 72.767 1.00 96.48  ? 38   ARG B CZ  1 
ATOM   2252 N NH1 . ARG B 2 38  ? 18.819  -15.299 72.630 1.00 84.04  ? 38   ARG B NH1 1 
ATOM   2253 N NH2 . ARG B 2 38  ? 16.556  -15.435 72.972 1.00 83.90  ? 38   ARG B NH2 1 
ATOM   2254 N N   . VAL B 2 39  ? 17.020  -10.519 67.387 1.00 43.87  ? 39   VAL B N   1 
ATOM   2255 C CA  . VAL B 2 39  ? 16.479  -10.894 66.087 1.00 44.01  ? 39   VAL B CA  1 
ATOM   2256 C C   . VAL B 2 39  ? 17.435  -11.858 65.400 1.00 49.78  ? 39   VAL B C   1 
ATOM   2257 O O   . VAL B 2 39  ? 18.651  -11.785 65.589 1.00 48.69  ? 39   VAL B O   1 
ATOM   2258 C CB  . VAL B 2 39  ? 16.206  -9.652  65.206 1.00 47.47  ? 39   VAL B CB  1 
ATOM   2259 C CG1 . VAL B 2 39  ? 15.283  -8.674  65.921 1.00 46.72  ? 39   VAL B CG1 1 
ATOM   2260 C CG2 . VAL B 2 39  ? 17.519  -8.980  64.815 1.00 47.35  ? 39   VAL B CG2 1 
ATOM   2261 N N   . PRO B 2 40  ? 16.895  -12.757 64.562 1.00 48.41  ? 40   PRO B N   1 
ATOM   2262 C CA  . PRO B 2 40  ? 17.722  -13.746 63.865 1.00 48.91  ? 40   PRO B CA  1 
ATOM   2263 C C   . PRO B 2 40  ? 18.451  -13.148 62.669 1.00 56.11  ? 40   PRO B C   1 
ATOM   2264 O O   . PRO B 2 40  ? 17.835  -12.525 61.805 1.00 56.73  ? 40   PRO B O   1 
ATOM   2265 C CB  . PRO B 2 40  ? 16.706  -14.801 63.418 1.00 50.45  ? 40   PRO B CB  1 
ATOM   2266 C CG  . PRO B 2 40  ? 15.400  -14.102 63.366 1.00 54.22  ? 40   PRO B CG  1 
ATOM   2267 C CD  . PRO B 2 40  ? 15.452  -12.970 64.347 1.00 49.75  ? 40   PRO B CD  1 
ATOM   2268 N N   . ASN B 2 41  ? 19.769  -13.323 62.635 1.00 54.16  ? 41   ASN B N   1 
ATOM   2269 C CA  . ASN B 2 41  ? 20.585  -12.838 61.531 1.00 55.20  ? 41   ASN B CA  1 
ATOM   2270 C C   . ASN B 2 41  ? 20.623  -13.817 60.357 1.00 62.48  ? 41   ASN B C   1 
ATOM   2271 O O   . ASN B 2 41  ? 21.562  -14.599 60.223 1.00 63.47  ? 41   ASN B O   1 
ATOM   2272 C CB  . ASN B 2 41  ? 22.007  -12.567 62.007 1.00 56.23  ? 41   ASN B CB  1 
ATOM   2273 C CG  . ASN B 2 41  ? 22.909  -12.117 60.890 1.00 78.39  ? 41   ASN B CG  1 
ATOM   2274 O OD1 . ASN B 2 41  ? 22.438  -11.700 59.834 1.00 73.04  ? 41   ASN B OD1 1 
ATOM   2275 N ND2 . ASN B 2 41  ? 24.215  -12.212 61.104 1.00 71.37  ? 41   ASN B ND2 1 
ATOM   2276 N N   . GLY B 2 42  ? 19.645  -13.719 59.465 1.00 59.61  ? 42   GLY B N   1 
ATOM   2277 C CA  . GLY B 2 42  ? 19.526  -14.634 58.346 1.00 59.24  ? 42   GLY B CA  1 
ATOM   2278 C C   . GLY B 2 42  ? 20.588  -14.523 57.265 1.00 62.21  ? 42   GLY B C   1 
ATOM   2279 O O   . GLY B 2 42  ? 21.629  -13.885 57.442 1.00 61.37  ? 42   GLY B O   1 
ATOM   2280 N N   . GLU B 2 43  ? 20.311  -15.188 56.145 1.00 58.26  ? 43   GLU B N   1 
ATOM   2281 C CA  . GLU B 2 43  ? 21.197  -15.242 54.985 1.00 57.47  ? 43   GLU B CA  1 
ATOM   2282 C C   . GLU B 2 43  ? 21.021  -13.962 54.170 1.00 59.36  ? 43   GLU B C   1 
ATOM   2283 O O   . GLU B 2 43  ? 21.862  -13.603 53.342 1.00 58.71  ? 43   GLU B O   1 
ATOM   2284 C CB  . GLU B 2 43  ? 20.818  -16.460 54.126 1.00 58.75  ? 43   GLU B CB  1 
ATOM   2285 C CG  . GLU B 2 43  ? 21.539  -16.572 52.792 1.00 69.33  ? 43   GLU B CG  1 
ATOM   2286 C CD  . GLU B 2 43  ? 20.997  -17.707 51.936 1.00 94.34  ? 43   GLU B CD  1 
ATOM   2287 O OE1 . GLU B 2 43  ? 20.242  -18.548 52.472 1.00 88.12  ? 43   GLU B OE1 1 
ATOM   2288 O OE2 . GLU B 2 43  ? 21.324  -17.759 50.728 1.00 89.83  ? 43   GLU B OE2 1 
ATOM   2289 N N   . GLU B 2 44  ? 19.911  -13.279 54.424 1.00 54.03  ? 44   GLU B N   1 
ATOM   2290 C CA  . GLU B 2 44  ? 19.606  -12.023 53.767 1.00 52.56  ? 44   GLU B CA  1 
ATOM   2291 C C   . GLU B 2 44  ? 19.746  -10.854 54.743 1.00 55.79  ? 44   GLU B C   1 
ATOM   2292 O O   . GLU B 2 44  ? 19.125  -9.805  54.567 1.00 56.46  ? 44   GLU B O   1 
ATOM   2293 C CB  . GLU B 2 44  ? 18.203  -12.081 53.172 1.00 53.60  ? 44   GLU B CB  1 
ATOM   2294 C CG  . GLU B 2 44  ? 18.084  -13.070 52.025 1.00 62.90  ? 44   GLU B CG  1 
ATOM   2295 C CD  . GLU B 2 44  ? 19.079  -12.782 50.912 1.00 90.22  ? 44   GLU B CD  1 
ATOM   2296 O OE1 . GLU B 2 44  ? 19.274  -11.594 50.573 1.00 85.07  ? 44   GLU B OE1 1 
ATOM   2297 O OE2 . GLU B 2 44  ? 19.662  -13.746 50.369 1.00 89.41  ? 44   GLU B OE2 1 
ATOM   2298 N N   . GLY B 2 45  ? 20.593  -11.032 55.754 1.00 50.17  ? 48   GLY B N   1 
ATOM   2299 C CA  . GLY B 2 45  ? 20.881  -9.999  56.724 1.00 49.14  ? 48   GLY B CA  1 
ATOM   2300 C C   . GLY B 2 45  ? 19.732  -9.800  57.683 1.00 52.50  ? 48   GLY B C   1 
ATOM   2301 O O   . GLY B 2 45  ? 19.250  -10.747 58.297 1.00 52.91  ? 48   GLY B O   1 
ATOM   2302 N N   . LEU B 2 46  ? 19.244  -8.569  57.758 1.00 48.37  ? 49   LEU B N   1 
ATOM   2303 C CA  . LEU B 2 46  ? 18.201  -8.207  58.710 1.00 46.79  ? 49   LEU B CA  1 
ATOM   2304 C C   . LEU B 2 46  ? 16.859  -8.801  58.334 1.00 50.40  ? 49   LEU B C   1 
ATOM   2305 O O   . LEU B 2 46  ? 16.453  -8.763  57.175 1.00 50.29  ? 49   LEU B O   1 
ATOM   2306 C CB  . LEU B 2 46  ? 18.099  -6.689  58.820 1.00 45.99  ? 49   LEU B CB  1 
ATOM   2307 C CG  . LEU B 2 46  ? 19.369  -6.071  59.387 1.00 49.32  ? 49   LEU B CG  1 
ATOM   2308 C CD1 . LEU B 2 46  ? 19.311  -4.566  59.289 1.00 49.10  ? 49   LEU B CD1 1 
ATOM   2309 C CD2 . LEU B 2 46  ? 19.561  -6.528  60.827 1.00 51.10  ? 49   LEU B CD2 1 
ATOM   2310 N N   . PRO B 2 47  ? 16.143  -9.351  59.324 1.00 46.83  ? 50   PRO B N   1 
ATOM   2311 C CA  . PRO B 2 47  ? 14.842  -9.960  59.024 1.00 46.29  ? 50   PRO B CA  1 
ATOM   2312 C C   . PRO B 2 47  ? 13.863  -8.905  58.527 1.00 49.15  ? 50   PRO B C   1 
ATOM   2313 O O   . PRO B 2 47  ? 13.600  -7.918  59.222 1.00 48.64  ? 50   PRO B O   1 
ATOM   2314 C CB  . PRO B 2 47  ? 14.389  -10.517 60.380 1.00 47.69  ? 50   PRO B CB  1 
ATOM   2315 C CG  . PRO B 2 47  ? 15.633  -10.614 61.194 1.00 52.36  ? 50   PRO B CG  1 
ATOM   2316 C CD  . PRO B 2 47  ? 16.495  -9.480  60.746 1.00 47.92  ? 50   PRO B CD  1 
ATOM   2317 N N   . ILE B 2 48  ? 13.286  -9.153  57.353 1.00 44.55  ? 51   ILE B N   1 
ATOM   2318 C CA  . ILE B 2 48  ? 12.475  -8.157  56.661 1.00 43.91  ? 51   ILE B CA  1 
ATOM   2319 C C   . ILE B 2 48  ? 11.321  -7.604  57.476 1.00 47.01  ? 51   ILE B C   1 
ATOM   2320 O O   . ILE B 2 48  ? 10.997  -6.432  57.374 1.00 46.97  ? 51   ILE B O   1 
ATOM   2321 C CB  . ILE B 2 48  ? 11.980  -8.661  55.295 1.00 47.35  ? 51   ILE B CB  1 
ATOM   2322 C CG1 . ILE B 2 48  ? 13.133  -9.239  54.483 1.00 47.96  ? 51   ILE B CG1 1 
ATOM   2323 C CG2 . ILE B 2 48  ? 11.333  -7.517  54.516 1.00 49.01  ? 51   ILE B CG2 1 
ATOM   2324 C CD1 . ILE B 2 48  ? 12.858  -9.244  52.983 1.00 60.67  ? 51   ILE B CD1 1 
ATOM   2325 N N   . SER B 2 49  ? 10.646  -8.466  58.220 1.00 44.26  ? 52   SER B N   1 
ATOM   2326 C CA  . SER B 2 49  ? 9.474   -8.043  58.980 1.00 44.22  ? 52   SER B CA  1 
ATOM   2327 C C   . SER B 2 49  ? 9.857   -7.069  60.082 1.00 45.52  ? 52   SER B C   1 
ATOM   2328 O O   . SER B 2 49  ? 9.113   -6.136  60.393 1.00 46.35  ? 52   SER B O   1 
ATOM   2329 C CB  . SER B 2 49  ? 8.750   -9.257  59.570 1.00 49.07  ? 52   SER B CB  1 
ATOM   2330 O OG  . SER B 2 49  ? 8.251   -10.089 58.535 1.00 61.79  ? 52   SER B OG  1 
ATOM   2331 N N   . THR B 2 50  ? 11.027  -7.290  60.661 1.00 39.94  ? 53   THR B N   1 
ATOM   2332 C CA  . THR B 2 50  ? 11.608  -6.358  61.622 1.00 39.59  ? 53   THR B CA  1 
ATOM   2333 C C   . THR B 2 50  ? 11.916  -5.014  60.949 1.00 41.61  ? 53   THR B C   1 
ATOM   2334 O O   . THR B 2 50  ? 11.461  -3.963  61.403 1.00 40.78  ? 53   THR B O   1 
ATOM   2335 C CB  . THR B 2 50  ? 12.863  -6.968  62.269 1.00 48.63  ? 53   THR B CB  1 
ATOM   2336 O OG1 . THR B 2 50  ? 12.522  -8.231  62.844 1.00 50.24  ? 53   THR B OG1 1 
ATOM   2337 C CG2 . THR B 2 50  ? 13.418  -6.059  63.354 1.00 46.72  ? 53   THR B CG2 1 
ATOM   2338 N N   . VAL B 2 51  ? 12.627  -5.060  59.824 1.00 36.69  ? 54   VAL B N   1 
ATOM   2339 C CA  . VAL B 2 51  ? 12.920  -3.843  59.078 1.00 34.90  ? 54   VAL B CA  1 
ATOM   2340 C C   . VAL B 2 51  ? 11.663  -3.064  58.732 1.00 35.75  ? 54   VAL B C   1 
ATOM   2341 O O   . VAL B 2 51  ? 11.598  -1.854  58.968 1.00 35.01  ? 54   VAL B O   1 
ATOM   2342 C CB  . VAL B 2 51  ? 13.809  -4.095  57.840 1.00 38.91  ? 54   VAL B CB  1 
ATOM   2343 C CG1 . VAL B 2 51  ? 14.939  -5.041  58.167 1.00 38.09  ? 54   VAL B CG1 1 
ATOM   2344 C CG2 . VAL B 2 51  ? 12.986  -4.601  56.679 1.00 39.49  ? 54   VAL B CG2 1 
ATOM   2345 N N   . ARG B 2 52  ? 10.654  -3.758  58.212 1.00 30.91  ? 55   ARG B N   1 
ATOM   2346 C CA  . ARG B 2 52  ? 9.409   -3.107  57.796 1.00 31.06  ? 55   ARG B CA  1 
ATOM   2347 C C   . ARG B 2 52  ? 8.579   -2.587  58.975 1.00 35.12  ? 55   ARG B C   1 
ATOM   2348 O O   . ARG B 2 52  ? 8.121   -1.450  58.970 1.00 34.56  ? 55   ARG B O   1 
ATOM   2349 C CB  . ARG B 2 52  ? 8.581   -4.029  56.878 1.00 32.51  ? 55   ARG B CB  1 
ATOM   2350 C CG  . ARG B 2 52  ? 9.364   -4.510  55.637 1.00 44.90  ? 55   ARG B CG  1 
ATOM   2351 C CD  . ARG B 2 52  ? 8.470   -4.928  54.453 1.00 53.58  ? 55   ARG B CD  1 
ATOM   2352 N NE  . ARG B 2 52  ? 8.154   -6.353  54.483 1.00 60.83  ? 55   ARG B NE  1 
ATOM   2353 C CZ  . ARG B 2 52  ? 8.509   -7.246  53.560 1.00 66.59  ? 55   ARG B CZ  1 
ATOM   2354 N NH1 . ARG B 2 52  ? 9.167   -6.885  52.466 1.00 43.03  ? 55   ARG B NH1 1 
ATOM   2355 N NH2 . ARG B 2 52  ? 8.165   -8.516  53.721 1.00 55.43  ? 55   ARG B NH2 1 
ATOM   2356 N N   . GLU B 2 53  ? 8.453   -3.395  60.020 1.00 32.91  ? 56   GLU B N   1 
ATOM   2357 C CA  . GLU B 2 53  ? 7.700   -2.989  61.201 1.00 32.40  ? 56   GLU B CA  1 
ATOM   2358 C C   . GLU B 2 53  ? 8.405   -1.897  61.992 1.00 35.18  ? 56   GLU B C   1 
ATOM   2359 O O   . GLU B 2 53  ? 7.772   -0.931  62.419 1.00 34.31  ? 56   GLU B O   1 
ATOM   2360 C CB  . GLU B 2 53  ? 7.421   -4.188  62.109 1.00 33.89  ? 56   GLU B CB  1 
ATOM   2361 C CG  . GLU B 2 53  ? 6.528   -5.245  61.499 1.00 44.31  ? 56   GLU B CG  1 
ATOM   2362 C CD  . GLU B 2 53  ? 5.065   -4.880  61.585 1.00 74.30  ? 56   GLU B CD  1 
ATOM   2363 O OE1 . GLU B 2 53  ? 4.581   -4.630  62.712 1.00 74.94  ? 56   GLU B OE1 1 
ATOM   2364 O OE2 . GLU B 2 53  ? 4.397   -4.858  60.528 1.00 74.77  ? 56   GLU B OE2 1 
ATOM   2365 N N   . VAL B 2 54  ? 9.706   -2.053  62.224 1.00 32.12  ? 57   VAL B N   1 
ATOM   2366 C CA  . VAL B 2 54  ? 10.456  -0.990  62.905 1.00 31.88  ? 57   VAL B CA  1 
ATOM   2367 C C   . VAL B 2 54  ? 10.412  0.325   62.122 1.00 38.48  ? 57   VAL B C   1 
ATOM   2368 O O   . VAL B 2 54  ? 10.252  1.399   62.710 1.00 39.00  ? 57   VAL B O   1 
ATOM   2369 C CB  . VAL B 2 54  ? 11.893  -1.380  63.218 1.00 34.18  ? 57   VAL B CB  1 
ATOM   2370 C CG1 . VAL B 2 54  ? 12.687  -0.139  63.551 1.00 33.90  ? 57   VAL B CG1 1 
ATOM   2371 C CG2 . VAL B 2 54  ? 11.942  -2.372  64.365 1.00 33.48  ? 57   VAL B CG2 1 
ATOM   2372 N N   . ALA B 2 55  ? 10.521  0.229   60.796 1.00 34.41  ? 58   ALA B N   1 
ATOM   2373 C CA  . ALA B 2 55  ? 10.483  1.402   59.931 1.00 33.90  ? 58   ALA B CA  1 
ATOM   2374 C C   . ALA B 2 55  ? 9.136   2.096   59.986 1.00 38.76  ? 58   ALA B C   1 
ATOM   2375 O O   . ALA B 2 55  ? 9.050   3.320   59.884 1.00 37.67  ? 58   ALA B O   1 
ATOM   2376 C CB  . ALA B 2 55  ? 10.819  1.018   58.489 1.00 34.49  ? 58   ALA B CB  1 
ATOM   2377 N N   . LEU B 2 56  ? 8.075   1.306   60.064 1.00 37.12  ? 59   LEU B N   1 
ATOM   2378 C CA  . LEU B 2 56  ? 6.727   1.861   60.133 1.00 37.89  ? 59   LEU B CA  1 
ATOM   2379 C C   . LEU B 2 56  ? 6.482   2.612   61.439 1.00 40.20  ? 59   LEU B C   1 
ATOM   2380 O O   . LEU B 2 56  ? 5.700   3.557   61.469 1.00 40.38  ? 59   LEU B O   1 
ATOM   2381 C CB  . LEU B 2 56  ? 5.680   0.756   59.948 1.00 38.94  ? 59   LEU B CB  1 
ATOM   2382 C CG  . LEU B 2 56  ? 5.356   0.292   58.521 1.00 45.15  ? 59   LEU B CG  1 
ATOM   2383 C CD1 . LEU B 2 56  ? 6.542   0.430   57.535 1.00 45.36  ? 59   LEU B CD1 1 
ATOM   2384 C CD2 . LEU B 2 56  ? 4.886   -1.154  58.589 1.00 49.40  ? 59   LEU B CD2 1 
ATOM   2385 N N   . LEU B 2 57  ? 7.113   2.165   62.523 1.00 36.06  ? 60   LEU B N   1 
ATOM   2386 C CA  . LEU B 2 57  ? 7.040   2.870   63.806 1.00 36.14  ? 60   LEU B CA  1 
ATOM   2387 C C   . LEU B 2 57  ? 7.871   4.144   63.794 1.00 40.76  ? 60   LEU B C   1 
ATOM   2388 O O   . LEU B 2 57  ? 7.448   5.170   64.326 1.00 41.11  ? 60   LEU B O   1 
ATOM   2389 C CB  . LEU B 2 57  ? 7.511   1.975   64.956 1.00 36.09  ? 60   LEU B CB  1 
ATOM   2390 C CG  . LEU B 2 57  ? 6.756   0.663   65.157 1.00 40.57  ? 60   LEU B CG  1 
ATOM   2391 C CD1 . LEU B 2 57  ? 7.416   -0.164  66.255 1.00 40.62  ? 60   LEU B CD1 1 
ATOM   2392 C CD2 . LEU B 2 57  ? 5.294   0.936   65.462 1.00 42.80  ? 60   LEU B CD2 1 
ATOM   2393 N N   . ARG B 2 58  ? 9.065   4.074   63.210 1.00 36.90  ? 61   ARG B N   1 
ATOM   2394 C CA  . ARG B 2 58  ? 9.908   5.262   63.069 1.00 36.06  ? 61   ARG B CA  1 
ATOM   2395 C C   . ARG B 2 58  ? 9.190   6.392   62.343 1.00 41.06  ? 61   ARG B C   1 
ATOM   2396 O O   . ARG B 2 58  ? 9.375   7.566   62.667 1.00 40.80  ? 61   ARG B O   1 
ATOM   2397 C CB  . ARG B 2 58  ? 11.224  4.928   62.365 1.00 32.62  ? 61   ARG B CB  1 
ATOM   2398 C CG  . ARG B 2 58  ? 12.249  4.282   63.276 1.00 38.40  ? 61   ARG B CG  1 
ATOM   2399 C CD  . ARG B 2 58  ? 12.738  5.253   64.352 1.00 45.54  ? 61   ARG B CD  1 
ATOM   2400 N NE  . ARG B 2 58  ? 13.773  6.153   63.849 1.00 45.15  ? 61   ARG B NE  1 
ATOM   2401 C CZ  . ARG B 2 58  ? 13.637  7.468   63.735 1.00 52.19  ? 61   ARG B CZ  1 
ATOM   2402 N NH1 . ARG B 2 58  ? 12.518  8.056   64.120 1.00 38.73  ? 61   ARG B NH1 1 
ATOM   2403 N NH2 . ARG B 2 58  ? 14.634  8.197   63.256 1.00 41.12  ? 61   ARG B NH2 1 
ATOM   2404 N N   . ARG B 2 59  ? 8.354   6.033   61.375 1.00 38.42  ? 62   ARG B N   1 
ATOM   2405 C CA  . ARG B 2 59  ? 7.685   7.024   60.548 1.00 39.10  ? 62   ARG B CA  1 
ATOM   2406 C C   . ARG B 2 59  ? 6.539   7.736   61.261 1.00 46.07  ? 62   ARG B C   1 
ATOM   2407 O O   . ARG B 2 59  ? 6.195   8.861   60.904 1.00 46.11  ? 62   ARG B O   1 
ATOM   2408 C CB  . ARG B 2 59  ? 7.180   6.397   59.252 1.00 39.03  ? 62   ARG B CB  1 
ATOM   2409 C CG  . ARG B 2 59  ? 6.517   7.414   58.322 1.00 50.84  ? 62   ARG B CG  1 
ATOM   2410 C CD  . ARG B 2 59  ? 5.389   6.775   57.529 1.00 59.61  ? 62   ARG B CD  1 
ATOM   2411 N NE  . ARG B 2 59  ? 5.841   6.169   56.286 1.00 59.04  ? 62   ARG B NE  1 
ATOM   2412 C CZ  . ARG B 2 59  ? 5.221   5.161   55.682 1.00 66.30  ? 62   ARG B CZ  1 
ATOM   2413 N NH1 . ARG B 2 59  ? 4.142   4.621   56.235 1.00 40.78  ? 62   ARG B NH1 1 
ATOM   2414 N NH2 . ARG B 2 59  ? 5.694   4.677   54.538 1.00 57.05  ? 62   ARG B NH2 1 
ATOM   2415 N N   . LEU B 2 60  ? 5.910   7.053   62.217 1.00 44.25  ? 63   LEU B N   1 
ATOM   2416 C CA  . LEU B 2 60  ? 4.838   7.642   63.025 1.00 44.26  ? 63   LEU B CA  1 
ATOM   2417 C C   . LEU B 2 60  ? 5.219   8.995   63.611 1.00 50.50  ? 63   LEU B C   1 
ATOM   2418 O O   . LEU B 2 60  ? 4.422   9.931   63.596 1.00 50.23  ? 63   LEU B O   1 
ATOM   2419 C CB  . LEU B 2 60  ? 4.447   6.706   64.169 1.00 44.07  ? 63   LEU B CB  1 
ATOM   2420 C CG  . LEU B 2 60  ? 3.530   5.527   63.860 1.00 48.98  ? 63   LEU B CG  1 
ATOM   2421 C CD1 . LEU B 2 60  ? 3.140   4.830   65.153 1.00 49.05  ? 63   LEU B CD1 1 
ATOM   2422 C CD2 . LEU B 2 60  ? 2.294   5.984   63.102 1.00 52.63  ? 63   LEU B CD2 1 
ATOM   2423 N N   . GLU B 2 61  ? 6.395   9.052   64.229 1.00 49.12  ? 64   GLU B N   1 
ATOM   2424 C CA  . GLU B 2 61  ? 6.905   10.275  64.839 1.00 49.92  ? 64   GLU B CA  1 
ATOM   2425 C C   . GLU B 2 61  ? 6.673   11.521  63.972 1.00 56.07  ? 64   GLU B C   1 
ATOM   2426 O O   . GLU B 2 61  ? 6.478   12.620  64.491 1.00 55.87  ? 64   GLU B O   1 
ATOM   2427 C CB  . GLU B 2 61  ? 8.394   10.109  65.166 1.00 51.42  ? 64   GLU B CB  1 
ATOM   2428 C CG  . GLU B 2 61  ? 9.013   11.257  65.944 1.00 60.85  ? 64   GLU B CG  1 
ATOM   2429 C CD  . GLU B 2 61  ? 10.510  11.087  66.136 1.00 86.74  ? 64   GLU B CD  1 
ATOM   2430 O OE1 . GLU B 2 61  ? 10.993  9.937   66.068 1.00 77.84  ? 64   GLU B OE1 1 
ATOM   2431 O OE2 . GLU B 2 61  ? 11.204  12.100  66.366 1.00 89.93  ? 64   GLU B OE2 1 
ATOM   2432 N N   . ALA B 2 62  ? 6.667   11.343  62.654 1.00 54.18  ? 65   ALA B N   1 
ATOM   2433 C CA  . ALA B 2 62  ? 6.407   12.451  61.734 1.00 54.81  ? 65   ALA B CA  1 
ATOM   2434 C C   . ALA B 2 62  ? 5.053   13.115  61.988 1.00 60.64  ? 65   ALA B C   1 
ATOM   2435 O O   . ALA B 2 62  ? 4.926   14.337  61.900 1.00 60.55  ? 65   ALA B O   1 
ATOM   2436 C CB  . ALA B 2 62  ? 6.501   11.984  60.287 1.00 55.47  ? 65   ALA B CB  1 
ATOM   2437 N N   . PHE B 2 63  ? 4.042   12.300  62.270 1.00 58.51  ? 66   PHE B N   1 
ATOM   2438 C CA  . PHE B 2 63  ? 2.692   12.792  62.510 1.00 59.08  ? 66   PHE B CA  1 
ATOM   2439 C C   . PHE B 2 63  ? 2.577   13.666  63.761 1.00 63.28  ? 66   PHE B C   1 
ATOM   2440 O O   . PHE B 2 63  ? 1.601   14.390  63.923 1.00 62.46  ? 66   PHE B O   1 
ATOM   2441 C CB  . PHE B 2 63  ? 1.707   11.625  62.610 1.00 61.53  ? 66   PHE B CB  1 
ATOM   2442 C CG  . PHE B 2 63  ? 1.549   10.847  61.335 1.00 63.79  ? 66   PHE B CG  1 
ATOM   2443 C CD1 . PHE B 2 63  ? 2.648   10.275  60.713 1.00 67.12  ? 66   PHE B CD1 1 
ATOM   2444 C CD2 . PHE B 2 63  ? 0.293   10.662  60.773 1.00 66.76  ? 66   PHE B CD2 1 
ATOM   2445 C CE1 . PHE B 2 63  ? 2.505   9.549   59.542 1.00 68.30  ? 66   PHE B CE1 1 
ATOM   2446 C CE2 . PHE B 2 63  ? 0.138   9.931   59.601 1.00 69.87  ? 66   PHE B CE2 1 
ATOM   2447 C CZ  . PHE B 2 63  ? 1.249   9.377   58.984 1.00 68.01  ? 66   PHE B CZ  1 
ATOM   2448 N N   . GLU B 2 64  ? 3.557   13.575  64.654 1.00 61.29  ? 67   GLU B N   1 
ATOM   2449 C CA  . GLU B 2 64  ? 3.549   14.362  65.887 1.00 61.58  ? 67   GLU B CA  1 
ATOM   2450 C C   . GLU B 2 64  ? 2.206   14.283  66.616 1.00 64.68  ? 67   GLU B C   1 
ATOM   2451 O O   . GLU B 2 64  ? 1.648   15.306  67.020 1.00 65.02  ? 67   GLU B O   1 
ATOM   2452 C CB  . GLU B 2 64  ? 3.893   15.827  65.594 1.00 63.27  ? 67   GLU B CB  1 
ATOM   2453 C CG  . GLU B 2 64  ? 5.357   16.079  65.254 1.00 75.02  ? 67   GLU B CG  1 
ATOM   2454 C CD  . GLU B 2 64  ? 5.573   17.420  64.571 1.00 96.22  ? 67   GLU B CD  1 
ATOM   2455 O OE1 . GLU B 2 64  ? 4.842   17.719  63.601 1.00 87.18  ? 67   GLU B OE1 1 
ATOM   2456 O OE2 . GLU B 2 64  ? 6.495   18.159  64.981 1.00 89.88  ? 67   GLU B OE2 1 
ATOM   2457 N N   . HIS B 2 65  ? 1.672   13.073  66.750 1.00 59.47  ? 68   HIS B N   1 
ATOM   2458 C CA  . HIS B 2 65  ? 0.425   12.873  67.476 1.00 58.46  ? 68   HIS B CA  1 
ATOM   2459 C C   . HIS B 2 65  ? 0.667   12.883  68.987 1.00 61.79  ? 68   HIS B C   1 
ATOM   2460 O O   . HIS B 2 65  ? 1.637   12.296  69.480 1.00 62.35  ? 68   HIS B O   1 
ATOM   2461 C CB  . HIS B 2 65  ? -0.252  11.572  67.045 1.00 58.81  ? 68   HIS B CB  1 
ATOM   2462 C CG  . HIS B 2 65  ? -1.677  11.463  67.491 1.00 61.92  ? 68   HIS B CG  1 
ATOM   2463 N ND1 . HIS B 2 65  ? -2.031  11.170  68.791 1.00 63.44  ? 68   HIS B ND1 1 
ATOM   2464 C CD2 . HIS B 2 65  ? -2.836  11.622  66.812 1.00 63.16  ? 68   HIS B CD2 1 
ATOM   2465 C CE1 . HIS B 2 65  ? -3.347  11.140  68.890 1.00 62.62  ? 68   HIS B CE1 1 
ATOM   2466 N NE2 . HIS B 2 65  ? -3.860  11.411  67.703 1.00 62.91  ? 68   HIS B NE2 1 
ATOM   2467 N N   . PRO B 2 66  ? -0.226  13.539  69.745 1.00 56.11  ? 69   PRO B N   1 
ATOM   2468 C CA  . PRO B 2 66  ? 0.079   13.781  71.159 1.00 55.04  ? 69   PRO B CA  1 
ATOM   2469 C C   . PRO B 2 66  ? -0.168  12.582  72.071 1.00 56.33  ? 69   PRO B C   1 
ATOM   2470 O O   . PRO B 2 66  ? 0.271   12.583  73.219 1.00 55.86  ? 69   PRO B O   1 
ATOM   2471 C CB  . PRO B 2 66  ? -0.862  14.933  71.527 1.00 56.81  ? 69   PRO B CB  1 
ATOM   2472 C CG  . PRO B 2 66  ? -2.004  14.797  70.576 1.00 61.49  ? 69   PRO B CG  1 
ATOM   2473 C CD  . PRO B 2 66  ? -1.405  14.301  69.293 1.00 57.24  ? 69   PRO B CD  1 
ATOM   2474 N N   . ASN B 2 67  ? -0.821  11.546  71.548 1.00 51.09  ? 70   ASN B N   1 
ATOM   2475 C CA  . ASN B 2 67  ? -1.265  10.424  72.379 1.00 49.97  ? 70   ASN B CA  1 
ATOM   2476 C C   . ASN B 2 67  ? -0.540  9.106   72.118 1.00 53.01  ? 70   ASN B C   1 
ATOM   2477 O O   . ASN B 2 67  ? -1.047  8.032   72.444 1.00 51.47  ? 70   ASN B O   1 
ATOM   2478 C CB  . ASN B 2 67  ? -2.775  10.228  72.240 1.00 46.99  ? 70   ASN B CB  1 
ATOM   2479 C CG  . ASN B 2 67  ? -3.547  11.474  72.594 1.00 57.78  ? 70   ASN B CG  1 
ATOM   2480 O OD1 . ASN B 2 67  ? -4.319  11.993  71.784 1.00 51.81  ? 70   ASN B OD1 1 
ATOM   2481 N ND2 . ASN B 2 67  ? -3.297  12.000  73.787 1.00 45.72  ? 70   ASN B ND2 1 
ATOM   2482 N N   . VAL B 2 68  ? 0.644   9.195   71.523 1.00 50.48  ? 71   VAL B N   1 
ATOM   2483 C CA  . VAL B 2 68  ? 1.471   8.020   71.254 1.00 49.96  ? 71   VAL B CA  1 
ATOM   2484 C C   . VAL B 2 68  ? 2.926   8.387   71.524 1.00 51.18  ? 71   VAL B C   1 
ATOM   2485 O O   . VAL B 2 68  ? 3.345   9.499   71.222 1.00 49.33  ? 71   VAL B O   1 
ATOM   2486 C CB  . VAL B 2 68  ? 1.276   7.528   69.803 1.00 54.35  ? 71   VAL B CB  1 
ATOM   2487 C CG1 . VAL B 2 68  ? 2.311   6.491   69.450 1.00 54.36  ? 71   VAL B CG1 1 
ATOM   2488 C CG2 . VAL B 2 68  ? -0.127  6.968   69.608 1.00 54.16  ? 71   VAL B CG2 1 
ATOM   2489 N N   . VAL B 2 69  ? 3.673   7.479   72.150 1.00 48.04  ? 72   VAL B N   1 
ATOM   2490 C CA  . VAL B 2 69  ? 5.098   7.710   72.393 1.00 47.37  ? 72   VAL B CA  1 
ATOM   2491 C C   . VAL B 2 69  ? 5.875   7.559   71.092 1.00 51.31  ? 72   VAL B C   1 
ATOM   2492 O O   . VAL B 2 69  ? 5.624   6.640   70.305 1.00 51.18  ? 72   VAL B O   1 
ATOM   2493 C CB  . VAL B 2 69  ? 5.682   6.803   73.514 1.00 50.75  ? 72   VAL B CB  1 
ATOM   2494 C CG1 . VAL B 2 69  ? 4.729   6.714   74.704 1.00 50.59  ? 72   VAL B CG1 1 
ATOM   2495 C CG2 . VAL B 2 69  ? 6.026   5.425   72.980 1.00 50.36  ? 72   VAL B CG2 1 
ATOM   2496 N N   . ARG B 2 70  ? 6.776   8.503   70.844 1.00 47.07  ? 73   ARG B N   1 
ATOM   2497 C CA  . ARG B 2 70  ? 7.621   8.461   69.663 1.00 46.24  ? 73   ARG B CA  1 
ATOM   2498 C C   . ARG B 2 70  ? 8.751   7.458   69.824 1.00 49.02  ? 73   ARG B C   1 
ATOM   2499 O O   . ARG B 2 70  ? 9.394   7.391   70.877 1.00 48.59  ? 73   ARG B O   1 
ATOM   2500 C CB  . ARG B 2 70  ? 8.207   9.841   69.399 1.00 46.59  ? 73   ARG B CB  1 
ATOM   2501 C CG  . ARG B 2 70  ? 7.166   10.937  69.291 1.00 55.92  ? 73   ARG B CG  1 
ATOM   2502 C CD  . ARG B 2 70  ? 7.822   12.250  68.930 1.00 64.88  ? 73   ARG B CD  1 
ATOM   2503 N NE  . ARG B 2 70  ? 8.807   12.653  69.926 1.00 72.11  ? 73   ARG B NE  1 
ATOM   2504 C CZ  . ARG B 2 70  ? 9.879   13.390  69.655 1.00 86.36  ? 73   ARG B CZ  1 
ATOM   2505 N NH1 . ARG B 2 70  ? 10.723  13.720  70.623 1.00 72.06  ? 73   ARG B NH1 1 
ATOM   2506 N NH2 . ARG B 2 70  ? 10.118  13.776  68.410 1.00 72.91  ? 73   ARG B NH2 1 
ATOM   2507 N N   . LEU B 2 71  ? 8.932   6.625   68.807 1.00 44.94  ? 74   LEU B N   1 
ATOM   2508 C CA  . LEU B 2 71  ? 10.167  5.864   68.656 1.00 44.33  ? 74   LEU B CA  1 
ATOM   2509 C C   . LEU B 2 71  ? 11.134  6.790   67.949 1.00 48.50  ? 74   LEU B C   1 
ATOM   2510 O O   . LEU B 2 71  ? 10.879  7.216   66.819 1.00 48.06  ? 74   LEU B O   1 
ATOM   2511 C CB  . LEU B 2 71  ? 9.947   4.611   67.803 1.00 44.09  ? 74   LEU B CB  1 
ATOM   2512 C CG  . LEU B 2 71  ? 11.223  3.809   67.514 1.00 48.13  ? 74   LEU B CG  1 
ATOM   2513 C CD1 . LEU B 2 71  ? 11.834  3.262   68.791 1.00 48.54  ? 74   LEU B CD1 1 
ATOM   2514 C CD2 . LEU B 2 71  ? 10.949  2.693   66.527 1.00 47.57  ? 74   LEU B CD2 1 
ATOM   2515 N N   . MET B 2 72  ? 12.233  7.117   68.616 1.00 45.79  ? 75   MET B N   1 
ATOM   2516 C CA  . MET B 2 72  ? 13.107  8.178   68.136 1.00 46.52  ? 75   MET B CA  1 
ATOM   2517 C C   . MET B 2 72  ? 14.429  7.695   67.570 1.00 49.91  ? 75   MET B C   1 
ATOM   2518 O O   . MET B 2 72  ? 15.079  8.405   66.809 1.00 50.25  ? 75   MET B O   1 
ATOM   2519 C CB  . MET B 2 72  ? 13.335  9.211   69.234 1.00 49.18  ? 75   MET B CB  1 
ATOM   2520 C CG  . MET B 2 72  ? 12.073  9.965   69.607 1.00 53.18  ? 75   MET B CG  1 
ATOM   2521 S SD  . MET B 2 72  ? 12.402  11.084  70.942 1.00 57.73  ? 75   MET B SD  1 
ATOM   2522 C CE  . MET B 2 72  ? 13.175  9.945   72.118 1.00 53.88  ? 75   MET B CE  1 
ATOM   2523 N N   . ASP B 2 73  ? 14.820  6.482   67.931 1.00 45.71  ? 76   ASP B N   1 
ATOM   2524 C CA  . ASP B 2 73  ? 16.080  5.934   67.455 1.00 44.88  ? 76   ASP B CA  1 
ATOM   2525 C C   . ASP B 2 73  ? 16.070  4.415   67.499 1.00 45.42  ? 76   ASP B C   1 
ATOM   2526 O O   . ASP B 2 73  ? 15.346  3.804   68.283 1.00 42.91  ? 76   ASP B O   1 
ATOM   2527 C CB  . ASP B 2 73  ? 17.256  6.481   68.275 1.00 47.05  ? 76   ASP B CB  1 
ATOM   2528 C CG  . ASP B 2 73  ? 18.575  6.463   67.499 1.00 58.53  ? 76   ASP B CG  1 
ATOM   2529 O OD1 . ASP B 2 73  ? 18.595  5.965   66.351 1.00 59.28  ? 76   ASP B OD1 1 
ATOM   2530 O OD2 . ASP B 2 73  ? 19.587  6.975   68.027 1.00 63.20  ? 76   ASP B OD2 1 
ATOM   2531 N N   . VAL B 2 74  ? 16.852  3.820   66.609 1.00 42.38  ? 77   VAL B N   1 
ATOM   2532 C CA  . VAL B 2 74  ? 17.043  2.381   66.581 1.00 41.76  ? 77   VAL B CA  1 
ATOM   2533 C C   . VAL B 2 74  ? 18.494  2.065   66.251 1.00 47.24  ? 77   VAL B C   1 
ATOM   2534 O O   . VAL B 2 74  ? 19.113  2.733   65.426 1.00 46.46  ? 77   VAL B O   1 
ATOM   2535 C CB  . VAL B 2 74  ? 16.083  1.697   65.595 1.00 43.90  ? 77   VAL B CB  1 
ATOM   2536 C CG1 . VAL B 2 74  ? 16.307  0.186   65.600 1.00 43.07  ? 77   VAL B CG1 1 
ATOM   2537 C CG2 . VAL B 2 74  ? 14.637  2.048   65.938 1.00 43.48  ? 77   VAL B CG2 1 
ATOM   2538 N N   . CYS B 2 75  ? 19.037  1.060   66.921 1.00 46.15  ? 78   CYS B N   1 
ATOM   2539 C CA  . CYS B 2 75  ? 20.398  0.627   66.658 1.00 47.56  ? 78   CYS B CA  1 
ATOM   2540 C C   . CYS B 2 75  ? 20.500  -0.886  66.752 1.00 53.56  ? 78   CYS B C   1 
ATOM   2541 O O   . CYS B 2 75  ? 20.096  -1.481  67.750 1.00 53.38  ? 78   CYS B O   1 
ATOM   2542 C CB  . CYS B 2 75  ? 21.362  1.268   67.658 1.00 48.31  ? 78   CYS B CB  1 
ATOM   2543 S SG  . CYS B 2 75  ? 23.087  1.192   67.135 1.00 52.51  ? 78   CYS B SG  1 
ATOM   2544 N N   . ALA B 2 76  ? 20.971  -1.514  65.683 1.00 52.32  ? 79   ALA B N   1 
ATOM   2545 C CA  . ALA B 2 76  ? 21.383  -2.907  65.758 1.00 53.12  ? 79   ALA B CA  1 
ATOM   2546 C C   . ALA B 2 76  ? 22.779  -2.896  66.363 1.00 60.50  ? 79   ALA B C   1 
ATOM   2547 O O   . ALA B 2 76  ? 23.720  -2.416  65.741 1.00 59.91  ? 79   ALA B O   1 
ATOM   2548 C CB  . ALA B 2 76  ? 21.397  -3.535  64.374 1.00 53.61  ? 79   ALA B CB  1 
ATOM   2549 N N   . THR B 2 77  ? 22.886  -3.329  67.615 1.00 60.86  ? 80   THR B N   1 
ATOM   2550 C CA  . THR B 2 77  ? 24.121  -3.167  68.386 1.00 62.35  ? 80   THR B CA  1 
ATOM   2551 C C   . THR B 2 77  ? 25.047  -4.368  68.249 1.00 69.40  ? 80   THR B C   1 
ATOM   2552 O O   . THR B 2 77  ? 26.160  -4.249  67.748 1.00 69.26  ? 80   THR B O   1 
ATOM   2553 C CB  . THR B 2 77  ? 23.826  -2.865  69.874 1.00 71.81  ? 80   THR B CB  1 
ATOM   2554 O OG1 . THR B 2 77  ? 23.332  -4.048  70.518 1.00 72.46  ? 80   THR B OG1 1 
ATOM   2555 C CG2 . THR B 2 77  ? 22.786  -1.753  70.003 1.00 69.08  ? 80   THR B CG2 1 
ATOM   2556 N N   . SER B 2 78  ? 24.604  -5.508  68.762 1.00 68.73  ? 81   SER B N   1 
ATOM   2557 C CA  . SER B 2 78  ? 25.359  -6.751  68.641 1.00 69.58  ? 81   SER B CA  1 
ATOM   2558 C C   . SER B 2 78  ? 25.067  -7.397  67.287 1.00 75.85  ? 81   SER B C   1 
ATOM   2559 O O   . SER B 2 78  ? 24.281  -6.870  66.505 1.00 74.75  ? 81   SER B O   1 
ATOM   2560 C CB  . SER B 2 78  ? 24.991  -7.707  69.781 1.00 72.29  ? 81   SER B CB  1 
ATOM   2561 O OG  . SER B 2 78  ? 25.418  -9.029  69.497 1.00 80.52  ? 81   SER B OG  1 
ATOM   2562 N N   . ARG B 2 79  ? 25.690  -8.543  67.029 1.00 74.84  ? 82   ARG B N   1 
ATOM   2563 C CA  . ARG B 2 79  ? 25.501  -9.269  65.777 1.00 75.51  ? 82   ARG B CA  1 
ATOM   2564 C C   . ARG B 2 79  ? 26.189  -10.629 65.815 1.00 80.43  ? 82   ARG B C   1 
ATOM   2565 O O   . ARG B 2 79  ? 27.418  -10.708 65.884 1.00 80.42  ? 82   ARG B O   1 
ATOM   2566 C CB  . ARG B 2 79  ? 26.068  -8.466  64.604 1.00 77.70  ? 82   ARG B CB  1 
ATOM   2567 C CG  . ARG B 2 79  ? 25.096  -7.507  63.949 1.00 94.38  ? 82   ARG B CG  1 
ATOM   2568 C CD  . ARG B 2 79  ? 25.773  -6.750  62.820 1.00 111.89 ? 82   ARG B CD  1 
ATOM   2569 N NE  . ARG B 2 79  ? 26.948  -6.012  63.277 1.00 125.42 ? 82   ARG B NE  1 
ATOM   2570 C CZ  . ARG B 2 79  ? 27.766  -5.337  62.476 1.00 140.86 ? 82   ARG B CZ  1 
ATOM   2571 N NH1 . ARG B 2 79  ? 27.546  -5.311  61.168 1.00 128.23 ? 82   ARG B NH1 1 
ATOM   2572 N NH2 . ARG B 2 79  ? 28.809  -4.693  62.980 1.00 127.66 ? 82   ARG B NH2 1 
ATOM   2573 N N   . THR B 2 80  ? 25.403  -11.697 65.724 1.00 77.24  ? 83   THR B N   1 
ATOM   2574 C CA  . THR B 2 80  ? 25.955  -13.040 65.555 1.00 77.01  ? 83   THR B CA  1 
ATOM   2575 C C   . THR B 2 80  ? 25.323  -13.744 64.357 1.00 80.57  ? 83   THR B C   1 
ATOM   2576 O O   . THR B 2 80  ? 24.295  -13.302 63.838 1.00 80.33  ? 83   THR B O   1 
ATOM   2577 C CB  . THR B 2 80  ? 25.822  -13.883 66.833 1.00 85.39  ? 83   THR B CB  1 
ATOM   2578 O OG1 . THR B 2 80  ? 24.459  -14.301 66.994 1.00 86.39  ? 83   THR B OG1 1 
ATOM   2579 C CG2 . THR B 2 80  ? 26.259  -13.080 68.048 1.00 83.65  ? 83   THR B CG2 1 
ATOM   2580 N N   . ASP B 2 81  ? 25.938  -14.844 63.931 1.00 76.30  ? 84   ASP B N   1 
ATOM   2581 C CA  . ASP B 2 81  ? 25.483  -15.575 62.753 1.00 75.83  ? 84   ASP B CA  1 
ATOM   2582 C C   . ASP B 2 81  ? 24.034  -16.030 62.882 1.00 77.25  ? 84   ASP B C   1 
ATOM   2583 O O   . ASP B 2 81  ? 23.392  -16.384 61.889 1.00 76.63  ? 84   ASP B O   1 
ATOM   2584 C CB  . ASP B 2 81  ? 26.394  -16.772 62.469 1.00 78.14  ? 84   ASP B CB  1 
ATOM   2585 C CG  . ASP B 2 81  ? 27.797  -16.355 62.074 1.00 93.40  ? 84   ASP B CG  1 
ATOM   2586 O OD1 . ASP B 2 81  ? 28.008  -15.149 61.810 1.00 94.85  ? 84   ASP B OD1 1 
ATOM   2587 O OD2 . ASP B 2 81  ? 28.685  -17.233 62.017 1.00 100.85 ? 84   ASP B OD2 1 
ATOM   2588 N N   . ARG B 2 82  ? 23.520  -16.011 64.109 1.00 71.49  ? 85   ARG B N   1 
ATOM   2589 C CA  . ARG B 2 82  ? 22.123  -16.350 64.347 1.00 69.95  ? 85   ARG B CA  1 
ATOM   2590 C C   . ARG B 2 82  ? 21.314  -15.153 64.824 1.00 69.35  ? 85   ARG B C   1 
ATOM   2591 O O   . ARG B 2 82  ? 20.092  -15.134 64.688 1.00 69.16  ? 85   ARG B O   1 
ATOM   2592 C CB  . ARG B 2 82  ? 22.003  -17.476 65.373 1.00 71.66  ? 85   ARG B CB  1 
ATOM   2593 C CG  . ARG B 2 82  ? 20.566  -17.898 65.643 1.00 85.10  ? 85   ARG B CG  1 
ATOM   2594 C CD  . ARG B 2 82  ? 20.510  -19.121 66.542 1.00 100.51 ? 85   ARG B CD  1 
ATOM   2595 N NE  . ARG B 2 82  ? 19.423  -20.015 66.157 1.00 112.39 ? 85   ARG B NE  1 
ATOM   2596 C CZ  . ARG B 2 82  ? 19.501  -20.890 65.159 1.00 128.25 ? 85   ARG B CZ  1 
ATOM   2597 N NH1 . ARG B 2 82  ? 18.465  -21.666 64.870 1.00 115.94 ? 85   ARG B NH1 1 
ATOM   2598 N NH2 . ARG B 2 82  ? 20.617  -20.985 64.446 1.00 115.05 ? 85   ARG B NH2 1 
ATOM   2599 N N   . GLU B 2 83  ? 21.986  -14.171 65.414 1.00 62.49  ? 86   GLU B N   1 
ATOM   2600 C CA  . GLU B 2 83  ? 21.272  -13.065 66.041 1.00 60.84  ? 86   GLU B CA  1 
ATOM   2601 C C   . GLU B 2 83  ? 21.822  -11.665 65.802 1.00 60.88  ? 86   GLU B C   1 
ATOM   2602 O O   . GLU B 2 83  ? 23.020  -11.465 65.611 1.00 60.45  ? 86   GLU B O   1 
ATOM   2603 C CB  . GLU B 2 83  ? 21.066  -13.315 67.536 1.00 62.02  ? 86   GLU B CB  1 
ATOM   2604 C CG  . GLU B 2 83  ? 20.007  -14.369 67.834 1.00 72.47  ? 86   GLU B CG  1 
ATOM   2605 C CD  . GLU B 2 83  ? 19.748  -14.543 69.318 1.00 87.21  ? 86   GLU B CD  1 
ATOM   2606 O OE1 . GLU B 2 83  ? 20.355  -13.805 70.124 1.00 72.77  ? 86   GLU B OE1 1 
ATOM   2607 O OE2 . GLU B 2 83  ? 18.926  -15.413 69.676 1.00 79.07  ? 86   GLU B OE2 1 
ATOM   2608 N N   . ILE B 2 84  ? 20.906  -10.706 65.766 1.00 54.39  ? 87   ILE B N   1 
ATOM   2609 C CA  . ILE B 2 84  ? 21.242  -9.292  65.847 1.00 52.56  ? 87   ILE B CA  1 
ATOM   2610 C C   . ILE B 2 84  ? 20.450  -8.684  67.005 1.00 54.02  ? 87   ILE B C   1 
ATOM   2611 O O   . ILE B 2 84  ? 19.256  -8.941  67.163 1.00 53.30  ? 87   ILE B O   1 
ATOM   2612 C CB  . ILE B 2 84  ? 20.943  -8.564  64.518 1.00 54.83  ? 87   ILE B CB  1 
ATOM   2613 C CG1 . ILE B 2 84  ? 21.655  -9.262  63.358 1.00 54.69  ? 87   ILE B CG1 1 
ATOM   2614 C CG2 . ILE B 2 84  ? 21.360  -7.106  64.605 1.00 54.38  ? 87   ILE B CG2 1 
ATOM   2615 C CD1 . ILE B 2 84  ? 20.997  -9.039  62.023 1.00 58.36  ? 87   ILE B CD1 1 
ATOM   2616 N N   . LYS B 2 85  ? 21.133  -7.919  67.844 1.00 49.32  ? 88   LYS B N   1 
ATOM   2617 C CA  . LYS B 2 85  ? 20.475  -7.261  68.956 1.00 48.10  ? 88   LYS B CA  1 
ATOM   2618 C C   . LYS B 2 85  ? 20.170  -5.821  68.571 1.00 49.26  ? 88   LYS B C   1 
ATOM   2619 O O   . LYS B 2 85  ? 21.041  -5.095  68.091 1.00 47.20  ? 88   LYS B O   1 
ATOM   2620 C CB  . LYS B 2 85  ? 21.339  -7.340  70.214 1.00 50.40  ? 88   LYS B CB  1 
ATOM   2621 C CG  . LYS B 2 85  ? 20.684  -6.791  71.475 1.00 64.50  ? 88   LYS B CG  1 
ATOM   2622 C CD  . LYS B 2 85  ? 20.990  -5.317  71.661 1.00 74.85  ? 88   LYS B CD  1 
ATOM   2623 C CE  . LYS B 2 85  ? 20.928  -4.937  73.130 1.00 90.47  ? 88   LYS B CE  1 
ATOM   2624 N NZ  . LYS B 2 85  ? 21.501  -3.586  73.388 1.00 102.02 ? 88   LYS B NZ  1 
ATOM   2625 N N   . VAL B 2 86  ? 18.897  -5.456  68.680 1.00 45.26  ? 89   VAL B N   1 
ATOM   2626 C CA  . VAL B 2 86  ? 18.442  -4.127  68.292 1.00 44.40  ? 89   VAL B CA  1 
ATOM   2627 C C   . VAL B 2 86  ? 17.892  -3.415  69.517 1.00 46.99  ? 89   VAL B C   1 
ATOM   2628 O O   . VAL B 2 86  ? 16.995  -3.923  70.185 1.00 47.06  ? 89   VAL B O   1 
ATOM   2629 C CB  . VAL B 2 86  ? 17.361  -4.206  67.179 1.00 47.53  ? 89   VAL B CB  1 
ATOM   2630 C CG1 . VAL B 2 86  ? 16.748  -2.830  66.929 1.00 47.10  ? 89   VAL B CG1 1 
ATOM   2631 C CG2 . VAL B 2 86  ? 17.940  -4.790  65.900 1.00 47.01  ? 89   VAL B CG2 1 
ATOM   2632 N N   . THR B 2 87  ? 18.403  -2.226  69.805 1.00 42.42  ? 90   THR B N   1 
ATOM   2633 C CA  . THR B 2 87  ? 17.786  -1.437  70.857 1.00 41.74  ? 90   THR B CA  1 
ATOM   2634 C C   . THR B 2 87  ? 16.844  -0.389  70.290 1.00 43.74  ? 90   THR B C   1 
ATOM   2635 O O   . THR B 2 87  ? 17.140  0.263   69.290 1.00 42.34  ? 90   THR B O   1 
ATOM   2636 C CB  . THR B 2 87  ? 18.804  -0.864  71.868 1.00 49.69  ? 90   THR B CB  1 
ATOM   2637 O OG1 . THR B 2 87  ? 19.171  0.465   71.491 1.00 54.95  ? 90   THR B OG1 1 
ATOM   2638 C CG2 . THR B 2 87  ? 20.040  -1.725  71.908 1.00 46.38  ? 90   THR B CG2 1 
ATOM   2639 N N   . LEU B 2 88  ? 15.674  -0.290  70.905 1.00 40.22  ? 91   LEU B N   1 
ATOM   2640 C CA  . LEU B 2 88  ? 14.664  0.669   70.502 1.00 39.84  ? 91   LEU B CA  1 
ATOM   2641 C C   . LEU B 2 88  ? 14.655  1.826   71.487 1.00 43.56  ? 91   LEU B C   1 
ATOM   2642 O O   . LEU B 2 88  ? 14.602  1.627   72.702 1.00 42.34  ? 91   LEU B O   1 
ATOM   2643 C CB  . LEU B 2 88  ? 13.288  -0.002  70.441 1.00 39.60  ? 91   LEU B CB  1 
ATOM   2644 C CG  . LEU B 2 88  ? 13.199  -1.172  69.460 1.00 43.45  ? 91   LEU B CG  1 
ATOM   2645 C CD1 . LEU B 2 88  ? 11.906  -1.939  69.664 1.00 43.76  ? 91   LEU B CD1 1 
ATOM   2646 C CD2 . LEU B 2 88  ? 13.301  -0.662  68.028 1.00 44.24  ? 91   LEU B CD2 1 
ATOM   2647 N N   . VAL B 2 89  ? 14.761  3.033   70.947 1.00 40.72  ? 92   VAL B N   1 
ATOM   2648 C CA  . VAL B 2 89  ? 14.860  4.235   71.749 1.00 40.27  ? 92   VAL B CA  1 
ATOM   2649 C C   . VAL B 2 89  ? 13.540  4.984   71.696 1.00 44.60  ? 92   VAL B C   1 
ATOM   2650 O O   . VAL B 2 89  ? 13.196  5.578   70.682 1.00 43.37  ? 92   VAL B O   1 
ATOM   2651 C CB  . VAL B 2 89  ? 16.037  5.114   71.271 1.00 43.71  ? 92   VAL B CB  1 
ATOM   2652 C CG1 . VAL B 2 89  ? 16.169  6.370   72.133 1.00 43.10  ? 92   VAL B CG1 1 
ATOM   2653 C CG2 . VAL B 2 89  ? 17.332  4.311   71.271 1.00 43.36  ? 92   VAL B CG2 1 
ATOM   2654 N N   . PHE B 2 90  ? 12.792  4.930   72.789 1.00 42.69  ? 93   PHE B N   1 
ATOM   2655 C CA  . PHE B 2 90  ? 11.503  5.602   72.863 1.00 43.17  ? 93   PHE B CA  1 
ATOM   2656 C C   . PHE B 2 90  ? 11.569  6.861   73.714 1.00 50.10  ? 93   PHE B C   1 
ATOM   2657 O O   . PHE B 2 90  ? 12.399  6.981   74.618 1.00 50.15  ? 93   PHE B O   1 
ATOM   2658 C CB  . PHE B 2 90  ? 10.440  4.668   73.453 1.00 44.60  ? 93   PHE B CB  1 
ATOM   2659 C CG  . PHE B 2 90  ? 10.084  3.510   72.570 1.00 45.40  ? 93   PHE B CG  1 
ATOM   2660 C CD1 . PHE B 2 90  ? 10.710  2.284   72.726 1.00 48.03  ? 93   PHE B CD1 1 
ATOM   2661 C CD2 . PHE B 2 90  ? 9.093   3.636   71.610 1.00 47.48  ? 93   PHE B CD2 1 
ATOM   2662 C CE1 . PHE B 2 90  ? 10.370  1.209   71.928 1.00 48.94  ? 93   PHE B CE1 1 
ATOM   2663 C CE2 . PHE B 2 90  ? 8.741   2.563   70.807 1.00 50.25  ? 93   PHE B CE2 1 
ATOM   2664 C CZ  . PHE B 2 90  ? 9.382   1.346   70.968 1.00 48.17  ? 93   PHE B CZ  1 
ATOM   2665 N N   . GLU B 2 91  ? 10.655  7.782   73.429 1.00 48.38  ? 94   GLU B N   1 
ATOM   2666 C CA  . GLU B 2 91  ? 10.367  8.921   74.296 1.00 48.49  ? 94   GLU B CA  1 
ATOM   2667 C C   . GLU B 2 91  ? 10.021  8.402   75.689 1.00 53.38  ? 94   GLU B C   1 
ATOM   2668 O O   . GLU B 2 91  ? 9.234   7.464   75.828 1.00 52.01  ? 94   GLU B O   1 
ATOM   2669 C CB  . GLU B 2 91  ? 9.167   9.668   73.716 1.00 49.66  ? 94   GLU B CB  1 
ATOM   2670 C CG  . GLU B 2 91  ? 8.876   11.012  74.323 1.00 58.69  ? 94   GLU B CG  1 
ATOM   2671 C CD  . GLU B 2 91  ? 7.749   11.717  73.600 1.00 75.08  ? 94   GLU B CD  1 
ATOM   2672 O OE1 . GLU B 2 91  ? 7.031   11.043  72.828 1.00 51.59  ? 94   GLU B OE1 1 
ATOM   2673 O OE2 . GLU B 2 91  ? 7.588   12.941  73.786 1.00 77.97  ? 94   GLU B OE2 1 
ATOM   2674 N N   . HIS B 2 92  ? 10.622  8.986   76.721 1.00 51.98  ? 95   HIS B N   1 
ATOM   2675 C CA  . HIS B 2 92  ? 10.327  8.561   78.089 1.00 52.93  ? 95   HIS B CA  1 
ATOM   2676 C C   . HIS B 2 92  ? 9.124   9.279   78.704 1.00 58.78  ? 95   HIS B C   1 
ATOM   2677 O O   . HIS B 2 92  ? 8.964   10.489  78.548 1.00 57.90  ? 95   HIS B O   1 
ATOM   2678 C CB  . HIS B 2 92  ? 11.551  8.690   79.000 1.00 53.94  ? 95   HIS B CB  1 
ATOM   2679 C CG  . HIS B 2 92  ? 11.262  8.371   80.436 1.00 57.44  ? 95   HIS B CG  1 
ATOM   2680 N ND1 . HIS B 2 92  ? 10.942  7.100   80.866 1.00 59.21  ? 95   HIS B ND1 1 
ATOM   2681 C CD2 . HIS B 2 92  ? 11.173  9.170   81.526 1.00 58.91  ? 95   HIS B CD2 1 
ATOM   2682 C CE1 . HIS B 2 92  ? 10.694  7.126   82.163 1.00 58.47  ? 95   HIS B CE1 1 
ATOM   2683 N NE2 . HIS B 2 92  ? 10.831  8.369   82.589 1.00 58.78  ? 95   HIS B NE2 1 
ATOM   2684 N N   . VAL B 2 93  ? 8.273   8.514   79.384 1.00 57.98  ? 96   VAL B N   1 
ATOM   2685 C CA  . VAL B 2 93  ? 7.136   9.057   80.133 1.00 59.21  ? 96   VAL B CA  1 
ATOM   2686 C C   . VAL B 2 93  ? 7.125   8.406   81.515 1.00 65.68  ? 96   VAL B C   1 
ATOM   2687 O O   . VAL B 2 93  ? 6.911   7.201   81.640 1.00 64.79  ? 96   VAL B O   1 
ATOM   2688 C CB  . VAL B 2 93  ? 5.803   8.800   79.395 1.00 63.50  ? 96   VAL B CB  1 
ATOM   2689 C CG1 . VAL B 2 93  ? 4.641   9.374   80.178 1.00 63.34  ? 96   VAL B CG1 1 
ATOM   2690 C CG2 . VAL B 2 93  ? 5.847   9.388   77.995 1.00 63.51  ? 96   VAL B CG2 1 
ATOM   2691 N N   . ASP B 2 94  ? 7.338   9.208   82.554 1.00 65.11  ? 97   ASP B N   1 
ATOM   2692 C CA  . ASP B 2 94  ? 7.760   8.667   83.847 1.00 66.14  ? 97   ASP B CA  1 
ATOM   2693 C C   . ASP B 2 94  ? 6.732   7.866   84.644 1.00 71.93  ? 97   ASP B C   1 
ATOM   2694 O O   . ASP B 2 94  ? 7.101   7.124   85.553 1.00 72.13  ? 97   ASP B O   1 
ATOM   2695 C CB  . ASP B 2 94  ? 8.413   9.736   84.722 1.00 68.33  ? 97   ASP B CB  1 
ATOM   2696 C CG  . ASP B 2 94  ? 9.293   9.140   85.805 1.00 80.25  ? 97   ASP B CG  1 
ATOM   2697 O OD1 . ASP B 2 94  ? 9.240   7.907   86.004 1.00 80.71  ? 97   ASP B OD1 1 
ATOM   2698 O OD2 . ASP B 2 94  ? 10.050  9.900   86.444 1.00 88.02  ? 97   ASP B OD2 1 
ATOM   2699 N N   . GLN B 2 95  ? 5.451   8.015   84.323 1.00 69.16  ? 98   GLN B N   1 
ATOM   2700 C CA  . GLN B 2 95  ? 4.429   7.210   84.983 1.00 69.44  ? 98   GLN B CA  1 
ATOM   2701 C C   . GLN B 2 95  ? 3.408   6.625   84.016 1.00 73.68  ? 98   GLN B C   1 
ATOM   2702 O O   . GLN B 2 95  ? 3.148   7.186   82.953 1.00 73.37  ? 98   GLN B O   1 
ATOM   2703 C CB  . GLN B 2 95  ? 3.726   8.005   86.084 1.00 71.05  ? 98   GLN B CB  1 
ATOM   2704 C CG  . GLN B 2 95  ? 2.849   9.133   85.578 1.00 90.13  ? 98   GLN B CG  1 
ATOM   2705 C CD  . GLN B 2 95  ? 2.012   9.742   86.682 1.00 113.53 ? 98   GLN B CD  1 
ATOM   2706 O OE1 . GLN B 2 95  ? 0.995   10.386  86.424 1.00 110.95 ? 98   GLN B OE1 1 
ATOM   2707 N NE2 . GLN B 2 95  ? 2.430   9.529   87.925 1.00 105.17 ? 98   GLN B NE2 1 
ATOM   2708 N N   . ASP B 2 96  ? 2.827   5.494   84.399 1.00 70.49  ? 99   ASP B N   1 
ATOM   2709 C CA  . ASP B 2 96  ? 1.807   4.841   83.590 1.00 70.26  ? 99   ASP B CA  1 
ATOM   2710 C C   . ASP B 2 96  ? 0.403   5.115   84.136 1.00 74.06  ? 99   ASP B C   1 
ATOM   2711 O O   . ASP B 2 96  ? 0.222   5.946   85.025 1.00 72.89  ? 99   ASP B O   1 
ATOM   2712 C CB  . ASP B 2 96  ? 2.072   3.334   83.507 1.00 72.07  ? 99   ASP B CB  1 
ATOM   2713 C CG  . ASP B 2 96  ? 1.987   2.649   84.860 1.00 82.92  ? 99   ASP B CG  1 
ATOM   2714 O OD1 . ASP B 2 96  ? 2.486   3.223   85.851 1.00 84.60  ? 99   ASP B OD1 1 
ATOM   2715 O OD2 . ASP B 2 96  ? 1.434   1.531   84.931 1.00 86.99  ? 99   ASP B OD2 1 
ATOM   2716 N N   . LEU B 2 97  ? -0.591  4.432   83.576 1.00 71.53  ? 100  LEU B N   1 
ATOM   2717 C CA  . LEU B 2 97  ? -1.974  4.605   84.001 1.00 71.92  ? 100  LEU B CA  1 
ATOM   2718 C C   . LEU B 2 97  ? -2.199  4.035   85.398 1.00 78.51  ? 100  LEU B C   1 
ATOM   2719 O O   . LEU B 2 97  ? -3.054  4.514   86.139 1.00 77.79  ? 100  LEU B O   1 
ATOM   2720 C CB  . LEU B 2 97  ? -2.930  3.947   83.000 1.00 71.65  ? 100  LEU B CB  1 
ATOM   2721 C CG  . LEU B 2 97  ? -4.428  4.107   83.261 1.00 75.50  ? 100  LEU B CG  1 
ATOM   2722 C CD1 . LEU B 2 97  ? -4.786  5.576   83.431 1.00 75.41  ? 100  LEU B CD1 1 
ATOM   2723 C CD2 . LEU B 2 97  ? -5.233  3.485   82.134 1.00 77.08  ? 100  LEU B CD2 1 
ATOM   2724 N N   . ARG B 2 98  ? -1.445  2.996   85.743 1.00 77.58  ? 101  ARG B N   1 
ATOM   2725 C CA  . ARG B 2 98  ? -1.518  2.416   87.080 1.00 78.58  ? 101  ARG B CA  1 
ATOM   2726 C C   . ARG B 2 98  ? -1.196  3.469   88.132 1.00 83.89  ? 101  ARG B C   1 
ATOM   2727 O O   . ARG B 2 98  ? -2.075  3.912   88.870 1.00 83.73  ? 101  ARG B O   1 
ATOM   2728 C CB  . ARG B 2 98  ? -0.543  1.245   87.216 1.00 80.51  ? 101  ARG B CB  1 
ATOM   2729 C CG  . ARG B 2 98  ? -0.960  -0.009  86.471 1.00 95.56  ? 101  ARG B CG  1 
ATOM   2730 C CD  . ARG B 2 98  ? 0.065   -1.117  86.664 1.00 112.04 ? 101  ARG B CD  1 
ATOM   2731 N NE  . ARG B 2 98  ? 1.401   -0.704  86.241 1.00 125.97 ? 101  ARG B NE  1 
ATOM   2732 C CZ  . ARG B 2 98  ? 2.498   -1.440  86.395 1.00 141.73 ? 101  ARG B CZ  1 
ATOM   2733 N NH1 . ARG B 2 98  ? 2.426   -2.634  86.967 1.00 129.38 ? 101  ARG B NH1 1 
ATOM   2734 N NH2 . ARG B 2 98  ? 3.671   -0.982  85.977 1.00 128.70 ? 101  ARG B NH2 1 
ATOM   2735 N N   . THR B 2 99  ? 0.077   3.850   88.194 1.00 81.16  ? 102  THR B N   1 
ATOM   2736 C CA  . THR B 2 99  ? 0.553   4.859   89.133 1.00 81.19  ? 102  THR B CA  1 
ATOM   2737 C C   . THR B 2 99  ? -0.367  6.081   89.169 1.00 86.00  ? 102  THR B C   1 
ATOM   2738 O O   . THR B 2 99  ? -0.516  6.729   90.205 1.00 85.19  ? 102  THR B O   1 
ATOM   2739 C CB  . THR B 2 99  ? 2.016   5.254   88.826 1.00 87.71  ? 102  THR B CB  1 
ATOM   2740 O OG1 . THR B 2 99  ? 2.800   4.073   88.620 1.00 85.61  ? 102  THR B OG1 1 
ATOM   2741 C CG2 . THR B 2 99  ? 2.611   6.044   89.979 1.00 86.65  ? 102  THR B CG2 1 
ATOM   2742 N N   . TYR B 2 100 ? -1.003  6.372   88.039 1.00 83.63  ? 103  TYR B N   1 
ATOM   2743 C CA  . TYR B 2 100 ? -1.938  7.488   87.953 1.00 83.99  ? 103  TYR B CA  1 
ATOM   2744 C C   . TYR B 2 100 ? -3.238  7.150   88.677 1.00 89.41  ? 103  TYR B C   1 
ATOM   2745 O O   . TYR B 2 100 ? -3.875  8.021   89.273 1.00 88.64  ? 103  TYR B O   1 
ATOM   2746 C CB  . TYR B 2 100 ? -2.225  7.821   86.489 1.00 85.30  ? 103  TYR B CB  1 
ATOM   2747 C CG  . TYR B 2 100 ? -3.058  9.066   86.283 1.00 87.37  ? 103  TYR B CG  1 
ATOM   2748 C CD1 . TYR B 2 100 ? -2.459  10.313  86.145 1.00 89.43  ? 103  TYR B CD1 1 
ATOM   2749 C CD2 . TYR B 2 100 ? -4.443  8.993   86.200 1.00 88.24  ? 103  TYR B CD2 1 
ATOM   2750 C CE1 . TYR B 2 100 ? -3.216  11.454  85.945 1.00 90.52  ? 103  TYR B CE1 1 
ATOM   2751 C CE2 . TYR B 2 100 ? -5.209  10.128  85.994 1.00 89.22  ? 103  TYR B CE2 1 
ATOM   2752 C CZ  . TYR B 2 100 ? -4.591  11.356  85.868 1.00 97.47  ? 103  TYR B CZ  1 
ATOM   2753 O OH  . TYR B 2 100 ? -5.350  12.490  85.670 1.00 99.49  ? 103  TYR B OH  1 
ATOM   2754 N N   . LEU B 2 101 ? -3.607  5.871   88.636 1.00 87.54  ? 104  LEU B N   1 
ATOM   2755 C CA  . LEU B 2 101 ? -4.837  5.386   89.257 1.00 87.81  ? 104  LEU B CA  1 
ATOM   2756 C C   . LEU B 2 101 ? -4.622  4.970   90.710 1.00 93.04  ? 104  LEU B C   1 
ATOM   2757 O O   . LEU B 2 101 ? -5.580  4.796   91.464 1.00 92.66  ? 104  LEU B O   1 
ATOM   2758 C CB  . LEU B 2 101 ? -5.412  4.207   88.464 1.00 87.81  ? 104  LEU B CB  1 
ATOM   2759 C CG  . LEU B 2 101 ? -6.213  4.502   87.193 1.00 92.40  ? 104  LEU B CG  1 
ATOM   2760 C CD1 . LEU B 2 101 ? -6.618  3.204   86.513 1.00 92.48  ? 104  LEU B CD1 1 
ATOM   2761 C CD2 . LEU B 2 101 ? -7.445  5.331   87.516 1.00 94.85  ? 104  LEU B CD2 1 
ATOM   2762 N N   . ASP B 2 102 ? -3.363  4.794   91.094 1.00 90.72  ? 105  ASP B N   1 
ATOM   2763 C CA  . ASP B 2 102 ? -3.037  4.371   92.450 1.00 90.94  ? 105  ASP B CA  1 
ATOM   2764 C C   . ASP B 2 102 ? -2.886  5.560   93.395 1.00 95.56  ? 105  ASP B C   1 
ATOM   2765 O O   . ASP B 2 102 ? -3.322  5.507   94.545 1.00 95.16  ? 105  ASP B O   1 
ATOM   2766 C CB  . ASP B 2 102 ? -1.770  3.513   92.458 1.00 92.83  ? 105  ASP B CB  1 
ATOM   2767 C CG  . ASP B 2 102 ? -1.963  2.182   91.751 1.00 103.45 ? 105  ASP B CG  1 
ATOM   2768 O OD1 . ASP B 2 102 ? -3.128  1.774   91.552 1.00 103.70 ? 105  ASP B OD1 1 
ATOM   2769 O OD2 . ASP B 2 102 ? -0.949  1.541   91.402 1.00 109.91 ? 105  ASP B OD2 1 
ATOM   2770 N N   . LYS B 2 103 ? -2.273  6.631   92.904 1.00 92.71  ? 106  LYS B N   1 
ATOM   2771 C CA  . LYS B 2 103 ? -2.126  7.852   93.688 1.00 92.82  ? 106  LYS B CA  1 
ATOM   2772 C C   . LYS B 2 103 ? -3.337  8.773   93.529 1.00 97.68  ? 106  LYS B C   1 
ATOM   2773 O O   . LYS B 2 103 ? -3.258  9.973   93.795 1.00 97.52  ? 106  LYS B O   1 
ATOM   2774 C CB  . LYS B 2 103 ? -0.840  8.589   93.305 1.00 95.06  ? 106  LYS B CB  1 
ATOM   2775 C CG  . LYS B 2 103 ? -0.821  9.111   91.880 1.00 108.85 ? 106  LYS B CG  1 
ATOM   2776 C CD  . LYS B 2 103 ? 0.499   9.793   91.561 1.00 118.68 ? 106  LYS B CD  1 
ATOM   2777 C CE  . LYS B 2 103 ? 1.660   8.817   91.657 1.00 128.91 ? 106  LYS B CE  1 
ATOM   2778 N NZ  . LYS B 2 103 ? 2.964   9.472   91.359 1.00 137.11 ? 106  LYS B NZ  1 
ATOM   2779 N N   . ALA B 2 104 ? -4.456  8.201   93.096 1.00 94.59  ? 107  ALA B N   1 
ATOM   2780 C CA  . ALA B 2 104 ? -5.703  8.945   92.964 1.00 94.58  ? 107  ALA B CA  1 
ATOM   2781 C C   . ALA B 2 104 ? -6.659  8.594   94.102 1.00 99.09  ? 107  ALA B C   1 
ATOM   2782 O O   . ALA B 2 104 ? -7.387  7.602   94.034 1.00 98.60  ? 107  ALA B O   1 
ATOM   2783 C CB  . ALA B 2 104 ? -6.348  8.657   91.620 1.00 95.34  ? 107  ALA B CB  1 
ATOM   2784 N N   . PRO B 2 105 ? -6.668  9.416   95.163 1.00 96.13  ? 108  PRO B N   1 
ATOM   2785 C CA  . PRO B 2 105 ? -7.428  9.239   96.408 1.00 95.90  ? 108  PRO B CA  1 
ATOM   2786 C C   . PRO B 2 105 ? -8.884  8.843   96.187 1.00 99.25  ? 108  PRO B C   1 
ATOM   2787 O O   . PRO B 2 105 ? -9.391  8.888   95.065 1.00 98.94  ? 108  PRO B O   1 
ATOM   2788 C CB  . PRO B 2 105 ? -7.348  10.620  97.071 1.00 97.72  ? 108  PRO B CB  1 
ATOM   2789 C CG  . PRO B 2 105 ? -7.056  11.568  95.957 1.00 102.27 ? 108  PRO B CG  1 
ATOM   2790 C CD  . PRO B 2 105 ? -6.205  10.804  94.990 1.00 97.85  ? 108  PRO B CD  1 
ATOM   2791 N N   . PRO B 2 106 ? -9.576  8.451   97.269 1.00 95.27  ? 109  PRO B N   1 
ATOM   2792 C CA  . PRO B 2 106 ? -10.991 8.062   97.291 1.00 94.84  ? 109  PRO B CA  1 
ATOM   2793 C C   . PRO B 2 106 ? -11.909 9.204   96.856 1.00 98.11  ? 109  PRO B C   1 
ATOM   2794 O O   . PRO B 2 106 ? -11.745 10.347  97.286 1.00 97.49  ? 109  PRO B O   1 
ATOM   2795 C CB  . PRO B 2 106 ? -11.233 7.726   98.763 1.00 96.58  ? 109  PRO B CB  1 
ATOM   2796 C CG  . PRO B 2 106 ? -9.898  7.324   99.279 1.00 100.94 ? 109  PRO B CG  1 
ATOM   2797 C CD  . PRO B 2 106 ? -8.913  8.192   98.558 1.00 96.59  ? 109  PRO B CD  1 
ATOM   2798 N N   . PRO B 2 107 ? -12.907 8.897   96.012 1.00 94.39  ? 110  PRO B N   1 
ATOM   2799 C CA  . PRO B 2 107 ? -13.171 7.538   95.526 1.00 94.06  ? 110  PRO B CA  1 
ATOM   2800 C C   . PRO B 2 107 ? -12.982 7.387   94.013 1.00 97.63  ? 110  PRO B C   1 
ATOM   2801 O O   . PRO B 2 107 ? -12.484 6.362   93.545 1.00 97.51  ? 110  PRO B O   1 
ATOM   2802 C CB  . PRO B 2 107 ? -14.638 7.325   95.895 1.00 95.76  ? 110  PRO B CB  1 
ATOM   2803 C CG  . PRO B 2 107 ? -15.235 8.692   95.814 1.00 100.24 ? 110  PRO B CG  1 
ATOM   2804 C CD  . PRO B 2 107 ? -14.149 9.669   96.198 1.00 95.82  ? 110  PRO B CD  1 
ATOM   2805 N N   . GLY B 2 108 ? -13.378 8.406   93.254 1.00 93.39  ? 111  GLY B N   1 
ATOM   2806 C CA  . GLY B 2 108 ? -13.373 8.349   91.800 1.00 92.90  ? 111  GLY B CA  1 
ATOM   2807 C C   . GLY B 2 108 ? -11.992 8.245   91.172 1.00 95.76  ? 111  GLY B C   1 
ATOM   2808 O O   . GLY B 2 108 ? -11.395 7.165   91.145 1.00 95.93  ? 111  GLY B O   1 
ATOM   2809 N N   . LEU B 2 109 ? -11.498 9.352   90.621 1.00 90.33  ? 112  LEU B N   1 
ATOM   2810 C CA  . LEU B 2 109 ? -12.232 10.615  90.586 1.00 89.23  ? 112  LEU B CA  1 
ATOM   2811 C C   . LEU B 2 109 ? -11.472 11.649  89.756 1.00 89.92  ? 112  LEU B C   1 
ATOM   2812 O O   . LEU B 2 109 ? -10.245 11.728  89.823 1.00 89.57  ? 112  LEU B O   1 
ATOM   2813 C CB  . LEU B 2 109 ? -12.458 11.150  92.006 1.00 89.38  ? 112  LEU B CB  1 
ATOM   2814 C CG  . LEU B 2 109 ? -11.383 10.858  93.058 1.00 94.14  ? 112  LEU B CG  1 
ATOM   2815 C CD1 . LEU B 2 109 ? -10.001 11.254  92.565 1.00 94.24  ? 112  LEU B CD1 1 
ATOM   2816 C CD2 . LEU B 2 109 ? -11.711 11.571  94.365 1.00 96.94  ? 112  LEU B CD2 1 
ATOM   2817 N N   . PRO B 2 110 ? -12.191 12.448  88.951 1.00 83.66  ? 113  PRO B N   1 
ATOM   2818 C CA  . PRO B 2 110 ? -13.636 12.448  88.704 1.00 82.52  ? 113  PRO B CA  1 
ATOM   2819 C C   . PRO B 2 110 ? -13.973 12.013  87.279 1.00 84.16  ? 113  PRO B C   1 
ATOM   2820 O O   . PRO B 2 110 ? -13.101 11.572  86.529 1.00 83.78  ? 113  PRO B O   1 
ATOM   2821 C CB  . PRO B 2 110 ? -14.022 13.916  88.907 1.00 84.35  ? 113  PRO B CB  1 
ATOM   2822 C CG  . PRO B 2 110 ? -12.772 14.681  88.652 1.00 88.95  ? 113  PRO B CG  1 
ATOM   2823 C CD  . PRO B 2 110 ? -11.665 13.808  89.157 1.00 84.77  ? 113  PRO B CD  1 
ATOM   2824 N N   . ALA B 2 111 ? -15.234 12.188  86.898 1.00 78.89  ? 114  ALA B N   1 
ATOM   2825 C CA  . ALA B 2 111 ? -15.729 11.705  85.616 1.00 77.91  ? 114  ALA B CA  1 
ATOM   2826 C C   . ALA B 2 111 ? -15.180 12.493  84.427 1.00 80.21  ? 114  ALA B C   1 
ATOM   2827 O O   . ALA B 2 111 ? -14.669 11.908  83.471 1.00 79.68  ? 114  ALA B O   1 
ATOM   2828 C CB  . ALA B 2 111 ? -17.251 11.700  85.604 1.00 78.54  ? 114  ALA B CB  1 
ATOM   2829 N N   . GLU B 2 112 ? -15.292 13.818  84.483 1.00 75.40  ? 115  GLU B N   1 
ATOM   2830 C CA  . GLU B 2 112 ? -14.800 14.669  83.402 1.00 74.53  ? 115  GLU B CA  1 
ATOM   2831 C C   . GLU B 2 112 ? -13.318 14.421  83.127 1.00 76.41  ? 115  GLU B C   1 
ATOM   2832 O O   . GLU B 2 112 ? -12.822 14.697  82.034 1.00 75.42  ? 115  GLU B O   1 
ATOM   2833 C CB  . GLU B 2 112 ? -15.029 16.147  83.723 1.00 75.97  ? 115  GLU B CB  1 
ATOM   2834 C CG  . GLU B 2 112 ? -16.484 16.528  83.968 1.00 89.43  ? 115  GLU B CG  1 
ATOM   2835 C CD  . GLU B 2 112 ? -17.407 16.122  82.830 1.00 115.60 ? 115  GLU B CD  1 
ATOM   2836 O OE1 . GLU B 2 112 ? -17.506 14.909  82.543 1.00 112.41 ? 115  GLU B OE1 1 
ATOM   2837 O OE2 . GLU B 2 112 ? -18.082 17.010  82.264 1.00 111.61 ? 115  GLU B OE2 1 
ATOM   2838 N N   . THR B 2 113 ? -12.615 13.922  84.139 1.00 71.91  ? 116  THR B N   1 
ATOM   2839 C CA  . THR B 2 113 ? -11.196 13.604  84.017 1.00 71.08  ? 116  THR B CA  1 
ATOM   2840 C C   . THR B 2 113 ? -11.022 12.217  83.406 1.00 73.98  ? 116  THR B C   1 
ATOM   2841 O O   . THR B 2 113 ? -10.105 11.983  82.618 1.00 73.32  ? 116  THR B O   1 
ATOM   2842 C CB  . THR B 2 113 ? -10.475 13.733  85.378 1.00 75.96  ? 116  THR B CB  1 
ATOM   2843 O OG1 . THR B 2 113 ? -10.448 15.110  85.776 1.00 73.51  ? 116  THR B OG1 1 
ATOM   2844 C CG2 . THR B 2 113 ? -9.050  13.206  85.291 1.00 73.99  ? 116  THR B CG2 1 
ATOM   2845 N N   . ILE B 2 114 ? -11.927 11.311  83.762 1.00 69.86  ? 117  ILE B N   1 
ATOM   2846 C CA  . ILE B 2 114 ? -11.962 9.972   83.180 1.00 69.02  ? 117  ILE B CA  1 
ATOM   2847 C C   . ILE B 2 114 ? -12.410 10.039  81.720 1.00 71.31  ? 117  ILE B C   1 
ATOM   2848 O O   . ILE B 2 114 ? -11.837 9.378   80.854 1.00 70.84  ? 117  ILE B O   1 
ATOM   2849 C CB  . ILE B 2 114 ? -12.854 9.024   84.015 1.00 71.85  ? 117  ILE B CB  1 
ATOM   2850 C CG1 . ILE B 2 114 ? -12.106 8.561   85.271 1.00 72.05  ? 117  ILE B CG1 1 
ATOM   2851 C CG2 . ILE B 2 114 ? -13.320 7.843   83.178 1.00 72.17  ? 117  ILE B CG2 1 
ATOM   2852 C CD1 . ILE B 2 114 ? -12.960 7.801   86.260 1.00 77.04  ? 117  ILE B CD1 1 
ATOM   2853 N N   . LYS B 2 115 ? -13.417 10.867  81.455 1.00 66.80  ? 118  LYS B N   1 
ATOM   2854 C CA  . LYS B 2 115 ? -13.875 11.134  80.094 1.00 66.20  ? 118  LYS B CA  1 
ATOM   2855 C C   . LYS B 2 115 ? -12.734 11.661  79.226 1.00 69.53  ? 118  LYS B C   1 
ATOM   2856 O O   . LYS B 2 115 ? -12.622 11.305  78.053 1.00 69.07  ? 118  LYS B O   1 
ATOM   2857 C CB  . LYS B 2 115 ? -15.015 12.157  80.107 1.00 68.34  ? 118  LYS B CB  1 
ATOM   2858 C CG  . LYS B 2 115 ? -16.234 11.726  80.908 1.00 81.40  ? 118  LYS B CG  1 
ATOM   2859 C CD  . LYS B 2 115 ? -17.365 12.738  80.792 1.00 88.53  ? 118  LYS B CD  1 
ATOM   2860 C CE  . LYS B 2 115 ? -18.597 12.282  81.561 1.00 95.54  ? 118  LYS B CE  1 
ATOM   2861 N NZ  . LYS B 2 115 ? -19.698 13.284  81.505 1.00 102.19 ? 118  LYS B NZ  1 
ATOM   2862 N N   . ASP B 2 116 ? -11.922 12.544  79.808 1.00 65.38  ? 119  ASP B N   1 
ATOM   2863 C CA  . ASP B 2 116 ? -10.782 13.161  79.128 1.00 64.71  ? 119  ASP B CA  1 
ATOM   2864 C C   . ASP B 2 116 ? -9.704  12.134  78.782 1.00 65.16  ? 119  ASP B C   1 
ATOM   2865 O O   . ASP B 2 116 ? -9.219  12.087  77.652 1.00 63.59  ? 119  ASP B O   1 
ATOM   2866 C CB  . ASP B 2 116 ? -10.190 14.269  80.010 1.00 67.21  ? 119  ASP B CB  1 
ATOM   2867 C CG  . ASP B 2 116 ? -8.873  14.813  79.474 1.00 80.74  ? 119  ASP B CG  1 
ATOM   2868 O OD1 . ASP B 2 116 ? -8.883  15.488  78.417 1.00 80.92  ? 119  ASP B OD1 1 
ATOM   2869 O OD2 . ASP B 2 116 ? -7.839  14.627  80.156 1.00 87.84  ? 119  ASP B OD2 1 
ATOM   2870 N N   . LEU B 2 117 ? -9.311  11.343  79.777 1.00 60.25  ? 120  LEU B N   1 
ATOM   2871 C CA  . LEU B 2 117 ? -8.423  10.206  79.569 1.00 59.28  ? 120  LEU B CA  1 
ATOM   2872 C C   . LEU B 2 117 ? -8.910  9.317   78.427 1.00 61.64  ? 120  LEU B C   1 
ATOM   2873 O O   . LEU B 2 117 ? -8.180  9.067   77.465 1.00 60.79  ? 120  LEU B O   1 
ATOM   2874 C CB  . LEU B 2 117 ? -8.311  9.386   80.856 1.00 59.31  ? 120  LEU B CB  1 
ATOM   2875 C CG  . LEU B 2 117 ? -7.125  9.696   81.774 1.00 64.10  ? 120  LEU B CG  1 
ATOM   2876 C CD1 . LEU B 2 117 ? -6.760  11.172  81.712 1.00 64.54  ? 120  LEU B CD1 1 
ATOM   2877 C CD2 . LEU B 2 117 ? -7.420  9.266   83.207 1.00 65.71  ? 120  LEU B CD2 1 
ATOM   2878 N N   . MET B 2 118 ? -10.149 8.848   78.541 1.00 57.01  ? 121  MET B N   1 
ATOM   2879 C CA  . MET B 2 118 ? -10.744 7.975   77.538 1.00 56.30  ? 121  MET B CA  1 
ATOM   2880 C C   . MET B 2 118 ? -10.728 8.599   76.146 1.00 60.55  ? 121  MET B C   1 
ATOM   2881 O O   . MET B 2 118 ? -10.615 7.899   75.135 1.00 60.11  ? 121  MET B O   1 
ATOM   2882 C CB  . MET B 2 118 ? -12.178 7.620   77.933 1.00 58.36  ? 121  MET B CB  1 
ATOM   2883 C CG  . MET B 2 118 ? -12.273 6.598   79.055 1.00 61.54  ? 121  MET B CG  1 
ATOM   2884 S SD  . MET B 2 118 ? -11.609 4.979   78.598 1.00 64.90  ? 121  MET B SD  1 
ATOM   2885 C CE  . MET B 2 118 ? -12.799 4.473   77.368 1.00 61.59  ? 121  MET B CE  1 
ATOM   2886 N N   . ARG B 2 119 ? -10.812 9.923   76.112 1.00 57.05  ? 122  ARG B N   1 
ATOM   2887 C CA  . ARG B 2 119 ? -10.920 10.676  74.868 1.00 56.85  ? 122  ARG B CA  1 
ATOM   2888 C C   . ARG B 2 119 ? -9.560  10.815  74.170 1.00 60.36  ? 122  ARG B C   1 
ATOM   2889 O O   . ARG B 2 119 ? -9.478  10.806  72.940 1.00 60.05  ? 122  ARG B O   1 
ATOM   2890 C CB  . ARG B 2 119 ? -11.515 12.054  75.169 1.00 56.97  ? 122  ARG B CB  1 
ATOM   2891 C CG  . ARG B 2 119 ? -12.320 12.672  74.042 1.00 65.00  ? 122  ARG B CG  1 
ATOM   2892 C CD  . ARG B 2 119 ? -13.426 13.532  74.622 1.00 72.01  ? 122  ARG B CD  1 
ATOM   2893 N NE  . ARG B 2 119 ? -12.976 14.253  75.810 1.00 78.39  ? 122  ARG B NE  1 
ATOM   2894 C CZ  . ARG B 2 119 ? -13.752 14.543  76.851 1.00 90.48  ? 122  ARG B CZ  1 
ATOM   2895 N NH1 . ARG B 2 119 ? -13.250 15.204  77.887 1.00 80.22  ? 122  ARG B NH1 1 
ATOM   2896 N NH2 . ARG B 2 119 ? -15.021 14.152  76.869 1.00 70.73  ? 122  ARG B NH2 1 
ATOM   2897 N N   . GLN B 2 120 ? -8.497  10.933  74.959 1.00 56.01  ? 123  GLN B N   1 
ATOM   2898 C CA  . GLN B 2 120 ? -7.143  10.901  74.422 1.00 55.76  ? 123  GLN B CA  1 
ATOM   2899 C C   . GLN B 2 120 ? -6.760  9.478   74.015 1.00 59.82  ? 123  GLN B C   1 
ATOM   2900 O O   . GLN B 2 120 ? -6.101  9.258   72.996 1.00 58.95  ? 123  GLN B O   1 
ATOM   2901 C CB  . GLN B 2 120 ? -6.150  11.422  75.458 1.00 56.95  ? 123  GLN B CB  1 
ATOM   2902 C CG  . GLN B 2 120 ? -6.390  12.854  75.882 1.00 61.73  ? 123  GLN B CG  1 
ATOM   2903 C CD  . GLN B 2 120 ? -5.285  13.378  76.762 1.00 74.48  ? 123  GLN B CD  1 
ATOM   2904 O OE1 . GLN B 2 120 ? -5.486  13.624  77.949 1.00 71.75  ? 123  GLN B OE1 1 
ATOM   2905 N NE2 . GLN B 2 120 ? -4.103  13.541  76.189 1.00 64.22  ? 123  GLN B NE2 1 
ATOM   2906 N N   . PHE B 2 121 ? -7.181  8.520   74.835 1.00 56.66  ? 124  PHE B N   1 
ATOM   2907 C CA  . PHE B 2 121 ? -6.904  7.104   74.618 1.00 55.99  ? 124  PHE B CA  1 
ATOM   2908 C C   . PHE B 2 121 ? -7.459  6.624   73.275 1.00 58.69  ? 124  PHE B C   1 
ATOM   2909 O O   . PHE B 2 121 ? -6.781  5.908   72.535 1.00 58.10  ? 124  PHE B O   1 
ATOM   2910 C CB  . PHE B 2 121 ? -7.509  6.290   75.765 1.00 57.74  ? 124  PHE B CB  1 
ATOM   2911 C CG  . PHE B 2 121 ? -7.202  4.823   75.702 1.00 59.50  ? 124  PHE B CG  1 
ATOM   2912 C CD1 . PHE B 2 121 ? -6.113  4.357   74.984 1.00 62.79  ? 124  PHE B CD1 1 
ATOM   2913 C CD2 . PHE B 2 121 ? -7.998  3.909   76.376 1.00 61.91  ? 124  PHE B CD2 1 
ATOM   2914 C CE1 . PHE B 2 121 ? -5.825  3.003   74.933 1.00 63.83  ? 124  PHE B CE1 1 
ATOM   2915 C CE2 . PHE B 2 121 ? -7.714  2.557   76.340 1.00 64.96  ? 124  PHE B CE2 1 
ATOM   2916 C CZ  . PHE B 2 121 ? -6.626  2.101   75.614 1.00 63.12  ? 124  PHE B CZ  1 
ATOM   2917 N N   . LEU B 2 122 ? -8.698  7.009   72.976 1.00 54.23  ? 125  LEU B N   1 
ATOM   2918 C CA  . LEU B 2 122 ? -9.334  6.642   71.715 1.00 53.68  ? 125  LEU B CA  1 
ATOM   2919 C C   . LEU B 2 122 ? -8.747  7.422   70.539 1.00 57.11  ? 125  LEU B C   1 
ATOM   2920 O O   . LEU B 2 122 ? -8.685  6.912   69.424 1.00 57.18  ? 125  LEU B O   1 
ATOM   2921 C CB  . LEU B 2 122 ? -10.849 6.864   71.778 1.00 53.70  ? 125  LEU B CB  1 
ATOM   2922 C CG  . LEU B 2 122 ? -11.682 6.001   72.730 1.00 58.05  ? 125  LEU B CG  1 
ATOM   2923 C CD1 . LEU B 2 122 ? -13.152 6.364   72.627 1.00 57.58  ? 125  LEU B CD1 1 
ATOM   2924 C CD2 . LEU B 2 122 ? -11.475 4.522   72.441 1.00 60.69  ? 125  LEU B CD2 1 
ATOM   2925 N N   . ARG B 2 123 ? -8.377  8.678   70.774 1.00 52.67  ? 126  ARG B N   1 
ATOM   2926 C CA  . ARG B 2 123 ? -7.693  9.459   69.752 1.00 52.11  ? 126  ARG B CA  1 
ATOM   2927 C C   . ARG B 2 123 ? -6.388  8.768   69.370 1.00 55.50  ? 126  ARG B C   1 
ATOM   2928 O O   . ARG B 2 123 ? -6.163  8.442   68.197 1.00 55.20  ? 126  ARG B O   1 
ATOM   2929 C CB  . ARG B 2 123 ? -7.405  10.877  70.244 1.00 52.35  ? 126  ARG B CB  1 
ATOM   2930 C CG  . ARG B 2 123 ? -8.640  11.741  70.445 1.00 62.44  ? 126  ARG B CG  1 
ATOM   2931 C CD  . ARG B 2 123 ? -8.266  13.212  70.584 1.00 69.47  ? 126  ARG B CD  1 
ATOM   2932 N NE  . ARG B 2 123 ? -9.376  14.015  71.089 1.00 77.54  ? 126  ARG B NE  1 
ATOM   2933 C CZ  . ARG B 2 123 ? -9.371  14.657  72.254 1.00 89.24  ? 126  ARG B CZ  1 
ATOM   2934 N NH1 . ARG B 2 123 ? -8.296  14.623  73.035 1.00 69.21  ? 126  ARG B NH1 1 
ATOM   2935 N NH2 . ARG B 2 123 ? -10.436 15.352  72.628 1.00 78.56  ? 126  ARG B NH2 1 
ATOM   2936 N N   . GLY B 2 124 ? -5.544  8.522   70.368 1.00 50.86  ? 127  GLY B N   1 
ATOM   2937 C CA  . GLY B 2 124 ? -4.302  7.797   70.169 1.00 50.47  ? 127  GLY B CA  1 
ATOM   2938 C C   . GLY B 2 124 ? -4.500  6.499   69.403 1.00 52.89  ? 127  GLY B C   1 
ATOM   2939 O O   . GLY B 2 124 ? -3.864  6.270   68.374 1.00 51.81  ? 127  GLY B O   1 
ATOM   2940 N N   . LEU B 2 125 ? -5.410  5.666   69.902 1.00 49.17  ? 128  LEU B N   1 
ATOM   2941 C CA  . LEU B 2 125 ? -5.707  4.363   69.313 1.00 49.17  ? 128  LEU B CA  1 
ATOM   2942 C C   . LEU B 2 125 ? -6.244  4.470   67.884 1.00 53.56  ? 128  LEU B C   1 
ATOM   2943 O O   . LEU B 2 125 ? -5.890  3.668   67.017 1.00 53.29  ? 128  LEU B O   1 
ATOM   2944 C CB  . LEU B 2 125 ? -6.711  3.621   70.194 1.00 49.17  ? 128  LEU B CB  1 
ATOM   2945 C CG  . LEU B 2 125 ? -6.841  2.108   70.017 1.00 53.90  ? 128  LEU B CG  1 
ATOM   2946 C CD1 . LEU B 2 125 ? -5.459  1.453   69.943 1.00 54.01  ? 128  LEU B CD1 1 
ATOM   2947 C CD2 . LEU B 2 125 ? -7.652  1.522   71.165 1.00 54.38  ? 128  LEU B CD2 1 
ATOM   2948 N N   . ASP B 2 126 ? -7.108  5.457   67.653 1.00 49.84  ? 129  ASP B N   1 
ATOM   2949 C CA  . ASP B 2 126 ? -7.655  5.744   66.327 1.00 49.43  ? 129  ASP B CA  1 
ATOM   2950 C C   . ASP B 2 126 ? -6.531  6.060   65.328 1.00 53.92  ? 129  ASP B C   1 
ATOM   2951 O O   . ASP B 2 126 ? -6.535  5.579   64.193 1.00 53.19  ? 129  ASP B O   1 
ATOM   2952 C CB  . ASP B 2 126 ? -8.635  6.923   66.431 1.00 50.90  ? 129  ASP B CB  1 
ATOM   2953 C CG  . ASP B 2 126 ? -9.269  7.291   65.096 1.00 56.01  ? 129  ASP B CG  1 
ATOM   2954 O OD1 . ASP B 2 126 ? -9.746  6.387   64.384 1.00 56.56  ? 129  ASP B OD1 1 
ATOM   2955 O OD2 . ASP B 2 126 ? -9.357  8.497   64.796 1.00 59.21  ? 129  ASP B OD2 1 
ATOM   2956 N N   . PHE B 2 127 ? -5.589  6.895   65.761 1.00 51.01  ? 130  PHE B N   1 
ATOM   2957 C CA  . PHE B 2 127 ? -4.355  7.168   65.028 1.00 50.77  ? 130  PHE B CA  1 
ATOM   2958 C C   . PHE B 2 127 ? -3.638  5.866   64.659 1.00 52.87  ? 130  PHE B C   1 
ATOM   2959 O O   . PHE B 2 127 ? -3.432  5.566   63.481 1.00 52.29  ? 130  PHE B O   1 
ATOM   2960 C CB  . PHE B 2 127 ? -3.447  8.040   65.906 1.00 53.07  ? 130  PHE B CB  1 
ATOM   2961 C CG  . PHE B 2 127 ? -2.144  8.435   65.256 1.00 54.92  ? 130  PHE B CG  1 
ATOM   2962 C CD1 . PHE B 2 127 ? -2.124  9.066   64.020 1.00 58.10  ? 130  PHE B CD1 1 
ATOM   2963 C CD2 . PHE B 2 127 ? -0.942  8.240   65.922 1.00 57.45  ? 130  PHE B CD2 1 
ATOM   2964 C CE1 . PHE B 2 127 ? -0.930  9.461   63.444 1.00 59.02  ? 130  PHE B CE1 1 
ATOM   2965 C CE2 . PHE B 2 127 ? 0.259   8.636   65.352 1.00 60.28  ? 130  PHE B CE2 1 
ATOM   2966 C CZ  . PHE B 2 127 ? 0.263   9.245   64.110 1.00 58.31  ? 130  PHE B CZ  1 
ATOM   2967 N N   . LEU B 2 128 ? -3.254  5.103   65.678 1.00 48.44  ? 131  LEU B N   1 
ATOM   2968 C CA  . LEU B 2 128 ? -2.618  3.807   65.483 1.00 47.63  ? 131  LEU B CA  1 
ATOM   2969 C C   . LEU B 2 128 ? -3.365  2.954   64.471 1.00 51.23  ? 131  LEU B C   1 
ATOM   2970 O O   . LEU B 2 128 ? -2.843  2.637   63.407 1.00 50.86  ? 131  LEU B O   1 
ATOM   2971 C CB  . LEU B 2 128 ? -2.489  3.065   66.812 1.00 47.57  ? 131  LEU B CB  1 
ATOM   2972 C CG  . LEU B 2 128 ? -1.138  3.135   67.534 1.00 52.80  ? 131  LEU B CG  1 
ATOM   2973 C CD1 . LEU B 2 128 ? -0.522  4.515   67.460 1.00 53.11  ? 131  LEU B CD1 1 
ATOM   2974 C CD2 . LEU B 2 128 ? -1.266  2.684   68.987 1.00 55.06  ? 131  LEU B CD2 1 
ATOM   2975 N N   . HIS B 2 129 ? -4.600  2.602   64.804 1.00 47.98  ? 132  HIS B N   1 
ATOM   2976 C CA  . HIS B 2 129 ? -5.443  1.801   63.929 1.00 47.66  ? 132  HIS B CA  1 
ATOM   2977 C C   . HIS B 2 129 ? -5.512  2.299   62.481 1.00 51.28  ? 132  HIS B C   1 
ATOM   2978 O O   . HIS B 2 129 ? -5.422  1.511   61.548 1.00 50.93  ? 132  HIS B O   1 
ATOM   2979 C CB  . HIS B 2 129 ? -6.840  1.657   64.533 1.00 48.49  ? 132  HIS B CB  1 
ATOM   2980 C CG  . HIS B 2 129 ? -6.868  0.841   65.786 1.00 52.03  ? 132  HIS B CG  1 
ATOM   2981 N ND1 . HIS B 2 129 ? -8.044  0.412   66.375 1.00 53.80  ? 132  HIS B ND1 1 
ATOM   2982 C CD2 . HIS B 2 129 ? -5.871  0.343   66.554 1.00 53.93  ? 132  HIS B CD2 1 
ATOM   2983 C CE1 . HIS B 2 129 ? -7.766  -0.300  67.446 1.00 53.22  ? 132  HIS B CE1 1 
ATOM   2984 N NE2 . HIS B 2 129 ? -6.448  -0.360  67.579 1.00 53.59  ? 132  HIS B NE2 1 
ATOM   2985 N N   . ALA B 2 130 ? -5.681  3.602   62.292 1.00 48.57  ? 133  ALA B N   1 
ATOM   2986 C CA  . ALA B 2 130 ? -5.671  4.174   60.949 1.00 49.39  ? 133  ALA B CA  1 
ATOM   2987 C C   . ALA B 2 130 ? -4.385  3.849   60.175 1.00 55.58  ? 133  ALA B C   1 
ATOM   2988 O O   . ALA B 2 130 ? -4.434  3.507   58.993 1.00 55.12  ? 133  ALA B O   1 
ATOM   2989 C CB  . ALA B 2 130 ? -5.891  5.678   61.005 1.00 50.05  ? 133  ALA B CB  1 
ATOM   2990 N N   . ASN B 2 131 ? -3.244  3.944   60.856 1.00 53.09  ? 134  ASN B N   1 
ATOM   2991 C CA  . ASN B 2 131 ? -1.947  3.627   60.265 1.00 52.73  ? 134  ASN B CA  1 
ATOM   2992 C C   . ASN B 2 131 ? -1.642  2.127   60.266 1.00 57.29  ? 134  ASN B C   1 
ATOM   2993 O O   . ASN B 2 131 ? -0.491  1.710   60.065 1.00 55.70  ? 134  ASN B O   1 
ATOM   2994 C CB  . ASN B 2 131 ? -0.836  4.402   60.967 1.00 51.29  ? 134  ASN B CB  1 
ATOM   2995 C CG  . ASN B 2 131 ? -0.926  5.894   60.722 1.00 69.16  ? 134  ASN B CG  1 
ATOM   2996 O OD1 . ASN B 2 131 ? -1.483  6.636   61.529 1.00 60.67  ? 134  ASN B OD1 1 
ATOM   2997 N ND2 . ASN B 2 131 ? -0.379  6.343   59.597 1.00 62.98  ? 134  ASN B ND2 1 
ATOM   2998 N N   . CYS B 2 132 ? -2.679  1.319   60.477 1.00 55.75  ? 135  CYS B N   1 
ATOM   2999 C CA  . CYS B 2 132 ? -2.590  -0.125  60.271 1.00 56.43  ? 135  CYS B CA  1 
ATOM   3000 C C   . CYS B 2 132 ? -1.751  -0.822  61.355 1.00 59.89  ? 135  CYS B C   1 
ATOM   3001 O O   . CYS B 2 132 ? -1.224  -1.923  61.154 1.00 59.41  ? 135  CYS B O   1 
ATOM   3002 C CB  . CYS B 2 132 ? -2.093  -0.428  58.854 1.00 57.49  ? 135  CYS B CB  1 
ATOM   3003 S SG  . CYS B 2 132 ? -3.207  0.159   57.512 1.00 61.82  ? 135  CYS B SG  1 
ATOM   3004 N N   . ILE B 2 133 ? -1.617  -0.158  62.500 1.00 55.73  ? 136  ILE B N   1 
ATOM   3005 C CA  A ILE B 2 133 ? -0.905  -0.729  63.620 0.50 55.71  ? 136  ILE B CA  1 
ATOM   3006 C CA  B ILE B 2 133 ? -0.885  -0.688  63.653 0.50 54.87  ? 136  ILE B CA  1 
ATOM   3007 C C   . ILE B 2 133 ? -1.844  -1.123  64.756 1.00 58.98  ? 136  ILE B C   1 
ATOM   3008 O O   . ILE B 2 133 ? -2.691  -0.332  65.175 1.00 58.46  ? 136  ILE B O   1 
ATOM   3009 C CB  A ILE B 2 133 ? 0.346   0.103   64.027 0.50 59.02  ? 136  ILE B CB  1 
ATOM   3010 C CB  B ILE B 2 133 ? 0.103   0.380   64.199 0.50 57.31  ? 136  ILE B CB  1 
ATOM   3011 C CG1 A ILE B 2 133 ? 0.258   0.654   65.455 0.50 59.64  ? 136  ILE B CG1 1 
ATOM   3012 C CG1 B ILE B 2 133 ? 1.237   0.665   63.200 0.50 56.81  ? 136  ILE B CG1 1 
ATOM   3013 C CG2 A ILE B 2 133 ? 0.652   1.192   62.990 0.50 59.81  ? 136  ILE B CG2 1 
ATOM   3014 C CG2 B ILE B 2 133 ? 0.662   -0.036  65.538 0.50 58.07  ? 136  ILE B CG2 1 
ATOM   3015 C CD1 A ILE B 2 133 ? 0.470   -0.382  66.545 0.50 68.67  ? 136  ILE B CD1 1 
ATOM   3016 C CD1 B ILE B 2 133 ? 2.022   1.921   63.501 0.50 58.41  ? 136  ILE B CD1 1 
ATOM   3017 N N   . VAL B 2 134 ? -1.809  -2.405  65.126 1.00 56.13  ? 137  VAL B N   1 
ATOM   3018 C CA  . VAL B 2 134 ? -2.613  -2.921  66.225 1.00 56.19  ? 137  VAL B CA  1 
ATOM   3019 C C   . VAL B 2 134 ? -1.673  -3.021  67.416 1.00 61.51  ? 137  VAL B C   1 
ATOM   3020 O O   . VAL B 2 134 ? -0.507  -3.391  67.261 1.00 61.79  ? 137  VAL B O   1 
ATOM   3021 C CB  . VAL B 2 134 ? -3.170  -4.329  65.860 1.00 59.98  ? 137  VAL B CB  1 
ATOM   3022 C CG1 . VAL B 2 134 ? -4.066  -4.869  66.988 1.00 59.87  ? 137  VAL B CG1 1 
ATOM   3023 C CG2 . VAL B 2 134 ? -3.916  -4.304  64.553 1.00 59.75  ? 137  VAL B CG2 1 
ATOM   3024 N N   . HIS B 2 135 ? -2.158  -2.647  68.594 1.00 57.52  ? 138  HIS B N   1 
ATOM   3025 C CA  . HIS B 2 135 ? -1.351  -2.760  69.798 1.00 56.75  ? 138  HIS B CA  1 
ATOM   3026 C C   . HIS B 2 135 ? -1.232  -4.225  70.220 1.00 62.63  ? 138  HIS B C   1 
ATOM   3027 O O   . HIS B 2 135 ? -0.127  -4.775  70.291 1.00 62.81  ? 138  HIS B O   1 
ATOM   3028 C CB  . HIS B 2 135 ? -1.934  -1.912  70.931 1.00 56.71  ? 138  HIS B CB  1 
ATOM   3029 C CG  . HIS B 2 135 ? -0.961  -1.638  72.036 1.00 59.30  ? 138  HIS B CG  1 
ATOM   3030 N ND1 . HIS B 2 135 ? -0.307  -2.643  72.718 1.00 60.73  ? 138  HIS B ND1 1 
ATOM   3031 C CD2 . HIS B 2 135 ? -0.499  -0.474  72.549 1.00 60.58  ? 138  HIS B CD2 1 
ATOM   3032 C CE1 . HIS B 2 135 ? 0.504   -2.109  73.614 1.00 59.97  ? 138  HIS B CE1 1 
ATOM   3033 N NE2 . HIS B 2 135 ? 0.403   -0.794  73.535 1.00 60.29  ? 138  HIS B NE2 1 
ATOM   3034 N N   . ARG B 2 136 ? -2.381  -4.852  70.467 1.00 59.70  ? 139  ARG B N   1 
ATOM   3035 C CA  . ARG B 2 136 ? -2.470  -6.289  70.728 1.00 60.00  ? 139  ARG B CA  1 
ATOM   3036 C C   . ARG B 2 136 ? -2.209  -6.639  72.191 1.00 64.72  ? 139  ARG B C   1 
ATOM   3037 O O   . ARG B 2 136 ? -2.719  -7.638  72.698 1.00 64.45  ? 139  ARG B O   1 
ATOM   3038 C CB  . ARG B 2 136 ? -1.528  -7.088  69.819 1.00 60.81  ? 139  ARG B CB  1 
ATOM   3039 C CG  . ARG B 2 136 ? -2.188  -8.276  69.133 1.00 71.52  ? 139  ARG B CG  1 
ATOM   3040 C CD  . ARG B 2 136 ? -1.191  -9.369  68.771 1.00 82.67  ? 139  ARG B CD  1 
ATOM   3041 N NE  . ARG B 2 136 ? -1.414  -10.593 69.539 1.00 95.06  ? 139  ARG B NE  1 
ATOM   3042 C CZ  . ARG B 2 136 ? -0.644  -11.013 70.540 1.00 110.85 ? 139  ARG B CZ  1 
ATOM   3043 N NH1 . ARG B 2 136 ? 0.425   -10.314 70.903 1.00 98.58  ? 139  ARG B NH1 1 
ATOM   3044 N NH2 . ARG B 2 136 ? -0.939  -12.143 71.172 1.00 96.56  ? 139  ARG B NH2 1 
ATOM   3045 N N   . ASP B 2 137 ? -1.405  -5.822  72.863 1.00 61.71  ? 140  ASP B N   1 
ATOM   3046 C CA  . ASP B 2 137 ? -1.051  -6.082  74.253 1.00 61.76  ? 140  ASP B CA  1 
ATOM   3047 C C   . ASP B 2 137 ? -1.298  -4.847  75.109 1.00 65.61  ? 140  ASP B C   1 
ATOM   3048 O O   . ASP B 2 137 ? -0.479  -4.488  75.958 1.00 65.23  ? 140  ASP B O   1 
ATOM   3049 C CB  . ASP B 2 137 ? 0.416   -6.498  74.357 1.00 63.82  ? 140  ASP B CB  1 
ATOM   3050 C CG  . ASP B 2 137 ? 0.791   -6.960  75.747 1.00 76.29  ? 140  ASP B CG  1 
ATOM   3051 O OD1 . ASP B 2 137 ? -0.120  -7.345  76.508 1.00 77.07  ? 140  ASP B OD1 1 
ATOM   3052 O OD2 . ASP B 2 137 ? 1.997   -6.944  76.077 1.00 84.78  ? 140  ASP B OD2 1 
ATOM   3053 N N   . LEU B 2 138 ? -2.431  -4.196  74.875 1.00 61.66  ? 141  LEU B N   1 
ATOM   3054 C CA  . LEU B 2 138 ? -2.771  -2.970  75.581 1.00 61.39  ? 141  LEU B CA  1 
ATOM   3055 C C   . LEU B 2 138 ? -2.923  -3.222  77.090 1.00 64.14  ? 141  LEU B C   1 
ATOM   3056 O O   . LEU B 2 138 ? -3.588  -4.167  77.514 1.00 62.05  ? 141  LEU B O   1 
ATOM   3057 C CB  . LEU B 2 138 ? -4.048  -2.376  74.987 1.00 61.69  ? 141  LEU B CB  1 
ATOM   3058 C CG  . LEU B 2 138 ? -4.235  -0.862  75.045 1.00 66.99  ? 141  LEU B CG  1 
ATOM   3059 C CD1 . LEU B 2 138 ? -2.908  -0.159  74.806 1.00 67.59  ? 141  LEU B CD1 1 
ATOM   3060 C CD2 . LEU B 2 138 ? -5.256  -0.438  73.998 1.00 69.01  ? 141  LEU B CD2 1 
ATOM   3061 N N   . LYS B 2 139 ? -2.248  -2.397  77.888 1.00 61.47  ? 142  LYS B N   1 
ATOM   3062 C CA  . LYS B 2 139 ? -2.278  -2.502  79.346 1.00 61.04  ? 142  LYS B CA  1 
ATOM   3063 C C   . LYS B 2 139 ? -2.249  -1.106  79.946 1.00 64.96  ? 142  LYS B C   1 
ATOM   3064 O O   . LYS B 2 139 ? -1.772  -0.160  79.317 1.00 64.26  ? 142  LYS B O   1 
ATOM   3065 C CB  . LYS B 2 139 ? -1.054  -3.270  79.855 1.00 63.08  ? 142  LYS B CB  1 
ATOM   3066 C CG  . LYS B 2 139 ? -0.947  -4.702  79.371 1.00 76.20  ? 142  LYS B CG  1 
ATOM   3067 C CD  . LYS B 2 139 ? 0.438   -5.259  79.665 1.00 85.69  ? 142  LYS B CD  1 
ATOM   3068 C CE  . LYS B 2 139 ? 0.609   -6.665  79.117 1.00 96.14  ? 142  LYS B CE  1 
ATOM   3069 N NZ  . LYS B 2 139 ? 2.006   -7.153  79.283 1.00 105.67 ? 142  LYS B NZ  1 
ATOM   3070 N N   . PRO B 2 140 ? -2.716  -0.970  81.196 1.00 62.32  ? 143  PRO B N   1 
ATOM   3071 C CA  . PRO B 2 140 ? -2.585  0.291   81.936 1.00 62.19  ? 143  PRO B CA  1 
ATOM   3072 C C   . PRO B 2 140 ? -1.118  0.688   82.101 1.00 65.36  ? 143  PRO B C   1 
ATOM   3073 O O   . PRO B 2 140 ? -0.796  1.859   82.294 1.00 64.48  ? 143  PRO B O   1 
ATOM   3074 C CB  . PRO B 2 140 ? -3.208  -0.040  83.293 1.00 63.91  ? 143  PRO B CB  1 
ATOM   3075 C CG  . PRO B 2 140 ? -4.208  -1.096  82.982 1.00 68.42  ? 143  PRO B CG  1 
ATOM   3076 C CD  . PRO B 2 140 ? -3.607  -1.922  81.883 1.00 63.95  ? 143  PRO B CD  1 
ATOM   3077 N N   . GLU B 2 141 ? -0.236  -0.300  82.012 1.00 62.30  ? 144  GLU B N   1 
ATOM   3078 C CA  . GLU B 2 141 ? 1.201   -0.060  81.990 1.00 62.24  ? 144  GLU B CA  1 
ATOM   3079 C C   . GLU B 2 141 ? 1.633   0.540   80.651 1.00 65.44  ? 144  GLU B C   1 
ATOM   3080 O O   . GLU B 2 141 ? 2.475   1.438   80.610 1.00 65.42  ? 144  GLU B O   1 
ATOM   3081 C CB  . GLU B 2 141 ? 1.957   -1.364  82.249 1.00 63.83  ? 144  GLU B CB  1 
ATOM   3082 C CG  . GLU B 2 141 ? 1.632   -2.017  83.586 1.00 77.06  ? 144  GLU B CG  1 
ATOM   3083 C CD  . GLU B 2 141 ? 0.222   -2.590  83.645 1.00 101.40 ? 144  GLU B CD  1 
ATOM   3084 O OE1 . GLU B 2 141 ? -0.520  -2.471  82.647 1.00 96.54  ? 144  GLU B OE1 1 
ATOM   3085 O OE2 . GLU B 2 141 ? -0.139  -3.176  84.688 1.00 96.96  ? 144  GLU B OE2 1 
ATOM   3086 N N   . ASN B 2 142 ? 1.044   0.049   79.564 1.00 61.15  ? 145  ASN B N   1 
ATOM   3087 C CA  . ASN B 2 142 ? 1.303   0.588   78.225 1.00 60.71  ? 145  ASN B CA  1 
ATOM   3088 C C   . ASN B 2 142 ? 0.743   1.995   78.070 1.00 64.07  ? 145  ASN B C   1 
ATOM   3089 O O   . ASN B 2 142 ? 1.047   2.691   77.097 1.00 63.35  ? 145  ASN B O   1 
ATOM   3090 C CB  . ASN B 2 142 ? 0.669   -0.302  77.155 1.00 59.69  ? 145  ASN B CB  1 
ATOM   3091 C CG  . ASN B 2 142 ? 1.268   -1.684  77.118 1.00 77.12  ? 145  ASN B CG  1 
ATOM   3092 O OD1 . ASN B 2 142 ? 2.487   -1.844  77.089 1.00 72.72  ? 145  ASN B OD1 1 
ATOM   3093 N ND2 . ASN B 2 142 ? 0.411   -2.695  77.087 1.00 66.58  ? 145  ASN B ND2 1 
ATOM   3094 N N   . ILE B 2 143 ? -0.150  2.369   78.981 1.00 60.03  ? 146  ILE B N   1 
ATOM   3095 C CA  . ILE B 2 143 ? -0.806  3.668   78.922 1.00 59.28  ? 146  ILE B CA  1 
ATOM   3096 C C   . ILE B 2 143 ? -0.109  4.671   79.836 1.00 62.82  ? 146  ILE B C   1 
ATOM   3097 O O   . ILE B 2 143 ? -0.341  4.698   81.042 1.00 62.67  ? 146  ILE B O   1 
ATOM   3098 C CB  . ILE B 2 143 ? -2.316  3.546   79.198 1.00 62.25  ? 146  ILE B CB  1 
ATOM   3099 C CG1 . ILE B 2 143 ? -2.919  2.461   78.303 1.00 62.80  ? 146  ILE B CG1 1 
ATOM   3100 C CG2 . ILE B 2 143 ? -3.013  4.876   78.967 1.00 62.68  ? 146  ILE B CG2 1 
ATOM   3101 C CD1 . ILE B 2 143 ? -4.409  2.300   78.449 1.00 72.49  ? 146  ILE B CD1 1 
ATOM   3102 N N   . LEU B 2 144 ? 0.771   5.474   79.246 1.00 59.37  ? 147  LEU B N   1 
ATOM   3103 C CA  . LEU B 2 144 ? 1.588   6.422   79.995 1.00 58.93  ? 147  LEU B CA  1 
ATOM   3104 C C   . LEU B 2 144 ? 0.913   7.784   80.127 1.00 62.85  ? 147  LEU B C   1 
ATOM   3105 O O   . LEU B 2 144 ? 0.115   8.184   79.276 1.00 61.95  ? 147  LEU B O   1 
ATOM   3106 C CB  . LEU B 2 144 ? 2.974   6.562   79.357 1.00 58.71  ? 147  LEU B CB  1 
ATOM   3107 C CG  . LEU B 2 144 ? 3.758   5.252   79.236 1.00 63.28  ? 147  LEU B CG  1 
ATOM   3108 C CD1 . LEU B 2 144 ? 5.221   5.493   78.886 1.00 63.02  ? 147  LEU B CD1 1 
ATOM   3109 C CD2 . LEU B 2 144 ? 3.624   4.438   80.514 1.00 66.29  ? 147  LEU B CD2 1 
ATOM   3110 N N   . VAL B 2 145 ? 1.241   8.488   81.205 1.00 59.96  ? 148  VAL B N   1 
ATOM   3111 C CA  . VAL B 2 145 ? 0.573   9.734   81.543 1.00 60.33  ? 148  VAL B CA  1 
ATOM   3112 C C   . VAL B 2 145 ? 1.599   10.801  81.905 1.00 66.04  ? 148  VAL B C   1 
ATOM   3113 O O   . VAL B 2 145 ? 2.336   10.670  82.883 1.00 66.18  ? 148  VAL B O   1 
ATOM   3114 C CB  . VAL B 2 145 ? -0.463  9.528   82.683 1.00 63.99  ? 148  VAL B CB  1 
ATOM   3115 C CG1 . VAL B 2 145 ? -1.329  10.772  82.864 1.00 63.66  ? 148  VAL B CG1 1 
ATOM   3116 C CG2 . VAL B 2 145 ? -1.329  8.306   82.410 1.00 63.71  ? 148  VAL B CG2 1 
ATOM   3117 N N   . THR B 2 146 ? 1.671   11.840  81.085 1.00 63.32  ? 149  THR B N   1 
ATOM   3118 C CA  . THR B 2 146 ? 2.551   12.961  81.363 1.00 63.57  ? 149  THR B CA  1 
ATOM   3119 C C   . THR B 2 146 ? 2.066   13.702  82.599 1.00 68.12  ? 149  THR B C   1 
ATOM   3120 O O   . THR B 2 146 ? 0.939   13.499  83.054 1.00 67.06  ? 149  THR B O   1 
ATOM   3121 C CB  . THR B 2 146 ? 2.633   13.919  80.159 1.00 72.48  ? 149  THR B CB  1 
ATOM   3122 O OG1 . THR B 2 146 ? 3.507   15.009  80.473 1.00 75.09  ? 149  THR B OG1 1 
ATOM   3123 C CG2 . THR B 2 146 ? 1.260   14.475  79.837 1.00 70.31  ? 149  THR B CG2 1 
ATOM   3124 N N   . SER B 2 147 ? 2.944   14.521  83.168 1.00 65.98  ? 150  SER B N   1 
ATOM   3125 C CA  . SER B 2 147 ? 2.520   15.542  84.115 1.00 66.32  ? 150  SER B CA  1 
ATOM   3126 C C   . SER B 2 147 ? 1.925   16.671  83.279 1.00 71.03  ? 150  SER B C   1 
ATOM   3127 O O   . SER B 2 147 ? 2.611   17.267  82.444 1.00 71.60  ? 150  SER B O   1 
ATOM   3128 C CB  . SER B 2 147 ? 3.706   16.046  84.943 1.00 69.72  ? 150  SER B CB  1 
ATOM   3129 O OG  . SER B 2 147 ? 4.677   16.679  84.126 1.00 78.65  ? 150  SER B OG  1 
ATOM   3130 N N   . GLY B 2 148 ? 0.626   16.893  83.432 1.00 66.62  ? 151  GLY B N   1 
ATOM   3131 C CA  . GLY B 2 148 ? -0.115  17.751  82.526 1.00 65.83  ? 151  GLY B CA  1 
ATOM   3132 C C   . GLY B 2 148 ? -1.270  16.979  81.915 1.00 67.93  ? 151  GLY B C   1 
ATOM   3133 O O   . GLY B 2 148 ? -2.083  17.537  81.180 1.00 67.58  ? 151  GLY B O   1 
ATOM   3134 N N   . GLY B 2 149 ? -1.303  15.675  82.179 1.00 62.88  ? 152  GLY B N   1 
ATOM   3135 C CA  . GLY B 2 149 ? -2.458  14.845  81.895 1.00 62.20  ? 152  GLY B CA  1 
ATOM   3136 C C   . GLY B 2 149 ? -2.584  14.333  80.471 1.00 65.09  ? 152  GLY B C   1 
ATOM   3137 O O   . GLY B 2 149 ? -3.640  13.829  80.091 1.00 64.74  ? 152  GLY B O   1 
ATOM   3138 N N   . THR B 2 150 ? -1.522  14.454  79.677 1.00 60.56  ? 153  THR B N   1 
ATOM   3139 C CA  . THR B 2 150 ? -1.525  13.877  78.332 1.00 59.82  ? 153  THR B CA  1 
ATOM   3140 C C   . THR B 2 150 ? -1.265  12.379  78.393 1.00 62.25  ? 153  THR B C   1 
ATOM   3141 O O   . THR B 2 150 ? -0.204  11.951  78.836 1.00 61.92  ? 153  THR B O   1 
ATOM   3142 C CB  . THR B 2 150 ? -0.515  14.568  77.391 1.00 66.30  ? 153  THR B CB  1 
ATOM   3143 O OG1 . THR B 2 150 ? -0.769  15.978  77.356 1.00 67.17  ? 153  THR B OG1 1 
ATOM   3144 C CG2 . THR B 2 150 ? -0.647  14.012  75.985 1.00 63.25  ? 153  THR B CG2 1 
ATOM   3145 N N   . VAL B 2 151 ? -2.240  11.582  77.964 1.00 57.86  ? 154  VAL B N   1 
ATOM   3146 C CA  . VAL B 2 151 ? -2.026  10.148  77.828 1.00 57.32  ? 154  VAL B CA  1 
ATOM   3147 C C   . VAL B 2 151 ? -1.250  9.855   76.541 1.00 59.46  ? 154  VAL B C   1 
ATOM   3148 O O   . VAL B 2 151 ? -1.519  10.443  75.491 1.00 57.90  ? 154  VAL B O   1 
ATOM   3149 C CB  . VAL B 2 151 ? -3.347  9.340   77.921 1.00 61.71  ? 154  VAL B CB  1 
ATOM   3150 C CG1 . VAL B 2 151 ? -4.443  10.162  78.577 1.00 61.62  ? 154  VAL B CG1 1 
ATOM   3151 C CG2 . VAL B 2 151 ? -3.776  8.802   76.562 1.00 61.65  ? 154  VAL B CG2 1 
ATOM   3152 N N   . LYS B 2 152 ? -0.224  9.017   76.666 1.00 56.11  ? 155  LYS B N   1 
ATOM   3153 C CA  . LYS B 2 152 ? 0.605   8.605   75.533 1.00 55.61  ? 155  LYS B CA  1 
ATOM   3154 C C   . LYS B 2 152 ? 0.595   7.087   75.482 1.00 57.62  ? 155  LYS B C   1 
ATOM   3155 O O   . LYS B 2 152 ? 0.981   6.431   76.446 1.00 57.20  ? 155  LYS B O   1 
ATOM   3156 C CB  . LYS B 2 152 ? 2.056   9.070   75.732 1.00 57.98  ? 155  LYS B CB  1 
ATOM   3157 C CG  . LYS B 2 152 ? 2.249   10.570  75.873 1.00 65.04  ? 155  LYS B CG  1 
ATOM   3158 C CD  . LYS B 2 152 ? 2.460   11.212  74.529 1.00 72.54  ? 155  LYS B CD  1 
ATOM   3159 C CE  . LYS B 2 152 ? 2.832   12.671  74.664 1.00 74.88  ? 155  LYS B CE  1 
ATOM   3160 N NZ  . LYS B 2 152 ? 3.063   13.285  73.329 1.00 81.80  ? 155  LYS B NZ  1 
ATOM   3161 N N   . LEU B 2 153 ? 0.159   6.531   74.359 1.00 53.19  ? 156  LEU B N   1 
ATOM   3162 C CA  . LEU B 2 153 ? 0.195   5.084   74.167 1.00 52.83  ? 156  LEU B CA  1 
ATOM   3163 C C   . LEU B 2 153 ? 1.614   4.604   73.848 1.00 55.92  ? 156  LEU B C   1 
ATOM   3164 O O   . LEU B 2 153 ? 2.312   5.192   73.014 1.00 54.77  ? 156  LEU B O   1 
ATOM   3165 C CB  . LEU B 2 153 ? -0.772  4.665   73.053 1.00 52.96  ? 156  LEU B CB  1 
ATOM   3166 C CG  . LEU B 2 153 ? -2.247  5.043   73.228 1.00 57.31  ? 156  LEU B CG  1 
ATOM   3167 C CD1 . LEU B 2 153 ? -3.060  4.699   71.981 1.00 56.82  ? 156  LEU B CD1 1 
ATOM   3168 C CD2 . LEU B 2 153 ? -2.833  4.375   74.464 1.00 59.18  ? 156  LEU B CD2 1 
ATOM   3169 N N   . ALA B 2 154 ? 2.019   3.510   74.491 1.00 52.59  ? 157  ALA B N   1 
ATOM   3170 C CA  . ALA B 2 154 ? 3.349   2.946   74.302 1.00 51.62  ? 157  ALA B CA  1 
ATOM   3171 C C   . ALA B 2 154 ? 3.293   1.450   74.026 1.00 54.30  ? 157  ALA B C   1 
ATOM   3172 O O   . ALA B 2 154 ? 2.276   0.804   74.281 1.00 53.44  ? 157  ALA B O   1 
ATOM   3173 C CB  . ALA B 2 154 ? 4.209   3.223   75.513 1.00 52.35  ? 157  ALA B CB  1 
ATOM   3174 N N   . ASP B 2 155 ? 4.368   0.927   73.436 1.00 50.74  ? 158  ASP B N   1 
ATOM   3175 C CA  . ASP B 2 155 ? 4.548   -0.512  73.226 1.00 50.30  ? 158  ASP B CA  1 
ATOM   3176 C C   . ASP B 2 155 ? 3.632   -1.125  72.178 1.00 53.06  ? 158  ASP B C   1 
ATOM   3177 O O   . ASP B 2 155 ? 3.441   -2.343  72.138 1.00 52.18  ? 158  ASP B O   1 
ATOM   3178 C CB  . ASP B 2 155 ? 4.441   -1.267  74.543 1.00 52.30  ? 158  ASP B CB  1 
ATOM   3179 C CG  . ASP B 2 155 ? 5.625   -1.013  75.442 1.00 63.02  ? 158  ASP B CG  1 
ATOM   3180 O OD1 . ASP B 2 155 ? 6.697   -0.659  74.906 1.00 62.08  ? 158  ASP B OD1 1 
ATOM   3181 O OD2 . ASP B 2 155 ? 5.481   -1.149  76.675 1.00 71.51  ? 158  ASP B OD2 1 
ATOM   3182 N N   . PHE B 2 156 ? 3.099   -0.267  71.317 1.00 49.41  ? 159  PHE B N   1 
ATOM   3183 C CA  . PHE B 2 156 ? 2.246   -0.665  70.203 1.00 49.39  ? 159  PHE B CA  1 
ATOM   3184 C C   . PHE B 2 156 ? 3.132   -1.064  69.031 1.00 53.31  ? 159  PHE B C   1 
ATOM   3185 O O   . PHE B 2 156 ? 4.108   -0.375  68.723 1.00 53.71  ? 159  PHE B O   1 
ATOM   3186 C CB  . PHE B 2 156 ? 1.419   0.547   69.780 1.00 51.35  ? 159  PHE B CB  1 
ATOM   3187 C CG  . PHE B 2 156 ? 2.250   1.782   69.576 1.00 53.19  ? 159  PHE B CG  1 
ATOM   3188 C CD1 . PHE B 2 156 ? 2.784   2.075   68.328 1.00 56.31  ? 159  PHE B CD1 1 
ATOM   3189 C CD2 . PHE B 2 156 ? 2.589   2.590   70.651 1.00 55.38  ? 159  PHE B CD2 1 
ATOM   3190 C CE1 . PHE B 2 156 ? 3.589   3.185   68.145 1.00 57.17  ? 159  PHE B CE1 1 
ATOM   3191 C CE2 . PHE B 2 156 ? 3.398   3.698   70.475 1.00 58.28  ? 159  PHE B CE2 1 
ATOM   3192 C CZ  . PHE B 2 156 ? 3.901   3.993   69.219 1.00 56.40  ? 159  PHE B CZ  1 
ATOM   3193 N N   . GLY B 2 157 ? 2.772   -2.140  68.344 1.00 49.18  ? 160  GLY B N   1 
ATOM   3194 C CA  . GLY B 2 157 ? 3.472   -2.529  67.130 1.00 48.48  ? 160  GLY B CA  1 
ATOM   3195 C C   . GLY B 2 157 ? 4.750   -3.306  67.388 1.00 51.85  ? 160  GLY B C   1 
ATOM   3196 O O   . GLY B 2 157 ? 5.592   -3.442  66.503 1.00 52.00  ? 160  GLY B O   1 
ATOM   3197 N N   . LEU B 2 158 ? 4.893   -3.828  68.601 1.00 47.34  ? 161  LEU B N   1 
ATOM   3198 C CA  . LEU B 2 158 ? 6.081   -4.585  68.963 1.00 46.48  ? 161  LEU B CA  1 
ATOM   3199 C C   . LEU B 2 158 ? 5.799   -6.083  69.012 1.00 50.75  ? 161  LEU B C   1 
ATOM   3200 O O   . LEU B 2 158 ? 6.704   -6.891  69.225 1.00 51.37  ? 161  LEU B O   1 
ATOM   3201 C CB  . LEU B 2 158 ? 6.634   -4.103  70.303 1.00 46.13  ? 161  LEU B CB  1 
ATOM   3202 C CG  . LEU B 2 158 ? 7.046   -2.633  70.374 1.00 49.89  ? 161  LEU B CG  1 
ATOM   3203 C CD1 . LEU B 2 158 ? 7.636   -2.326  71.739 1.00 49.75  ? 161  LEU B CD1 1 
ATOM   3204 C CD2 . LEU B 2 158 ? 8.037   -2.296  69.271 1.00 51.20  ? 161  LEU B CD2 1 
ATOM   3205 N N   . ALA B 2 159 ? 4.549   -6.455  68.769 1.00 46.56  ? 162  ALA B N   1 
ATOM   3206 C CA  . ALA B 2 159 ? 4.160   -7.857  68.845 1.00 45.76  ? 162  ALA B CA  1 
ATOM   3207 C C   . ALA B 2 159 ? 4.952   -8.691  67.855 1.00 46.81  ? 162  ALA B C   1 
ATOM   3208 O O   . ALA B 2 159 ? 5.587   -9.673  68.233 1.00 47.36  ? 162  ALA B O   1 
ATOM   3209 C CB  . ALA B 2 159 ? 2.661   -8.013  68.605 1.00 46.66  ? 162  ALA B CB  1 
ATOM   3210 N N   . ARG B 2 160 ? 4.947   -8.271  66.595 1.00 40.95  ? 163  ARG B N   1 
ATOM   3211 C CA  . ARG B 2 160 ? 5.645   -8.995  65.538 1.00 39.89  ? 163  ARG B CA  1 
ATOM   3212 C C   . ARG B 2 160 ? 7.161   -8.856  65.621 1.00 43.65  ? 163  ARG B C   1 
ATOM   3213 O O   . ARG B 2 160 ? 7.894   -9.782  65.289 1.00 43.69  ? 163  ARG B O   1 
ATOM   3214 C CB  . ARG B 2 160 ? 5.131   -8.558  64.166 1.00 38.46  ? 163  ARG B CB  1 
ATOM   3215 C CG  . ARG B 2 160 ? 3.636   -8.826  63.962 1.00 42.50  ? 163  ARG B CG  1 
ATOM   3216 C CD  . ARG B 2 160 ? 3.079   -8.078  62.761 1.00 35.45  ? 163  ARG B CD  1 
ATOM   3217 N NE  . ARG B 2 160 ? 3.843   -8.342  61.540 1.00 44.29  ? 163  ARG B NE  1 
ATOM   3218 C CZ  . ARG B 2 160 ? 3.593   -9.337  60.689 1.00 55.63  ? 163  ARG B CZ  1 
ATOM   3219 N NH1 . ARG B 2 160 ? 4.334   -9.477  59.601 1.00 37.82  ? 163  ARG B NH1 1 
ATOM   3220 N NH2 . ARG B 2 160 ? 2.611   -10.200 60.927 1.00 44.38  ? 163  ARG B NH2 1 
ATOM   3221 N N   . ILE B 2 161 ? 7.626   -7.691  66.059 1.00 40.66  ? 164  ILE B N   1 
ATOM   3222 C CA  . ILE B 2 161 ? 9.047   -7.458  66.279 1.00 40.78  ? 164  ILE B CA  1 
ATOM   3223 C C   . ILE B 2 161 ? 9.583   -8.403  67.351 1.00 45.48  ? 164  ILE B C   1 
ATOM   3224 O O   . ILE B 2 161 ? 10.689  -8.935  67.238 1.00 43.34  ? 164  ILE B O   1 
ATOM   3225 C CB  . ILE B 2 161 ? 9.306   -5.993  66.657 1.00 43.85  ? 164  ILE B CB  1 
ATOM   3226 C CG1 . ILE B 2 161 ? 9.199   -5.097  65.420 1.00 43.52  ? 164  ILE B CG1 1 
ATOM   3227 C CG2 . ILE B 2 161 ? 10.664  -5.850  67.346 1.00 45.18  ? 164  ILE B CG2 1 
ATOM   3228 C CD1 . ILE B 2 161 ? 9.001   -3.633  65.747 1.00 44.47  ? 164  ILE B CD1 1 
ATOM   3229 N N   . TYR B 2 162 ? 8.766   -8.642  68.371 1.00 44.69  ? 165  TYR B N   1 
ATOM   3230 C CA  . TYR B 2 162 ? 9.168   -9.476  69.499 1.00 45.23  ? 165  TYR B CA  1 
ATOM   3231 C C   . TYR B 2 162 ? 8.822   -10.956 69.365 1.00 51.37  ? 165  TYR B C   1 
ATOM   3232 O O   . TYR B 2 162 ? 9.241   -11.763 70.191 1.00 51.29  ? 165  TYR B O   1 
ATOM   3233 C CB  . TYR B 2 162 ? 8.622   -8.907  70.803 1.00 46.00  ? 165  TYR B CB  1 
ATOM   3234 C CG  . TYR B 2 162 ? 9.507   -7.839  71.395 1.00 47.00  ? 165  TYR B CG  1 
ATOM   3235 C CD1 . TYR B 2 162 ? 9.463   -6.527  70.925 1.00 48.17  ? 165  TYR B CD1 1 
ATOM   3236 C CD2 . TYR B 2 162 ? 10.421  -8.151  72.401 1.00 47.44  ? 165  TYR B CD2 1 
ATOM   3237 C CE1 . TYR B 2 162 ? 10.288  -5.545  71.470 1.00 47.43  ? 165  TYR B CE1 1 
ATOM   3238 C CE2 . TYR B 2 162 ? 11.240  -7.180  72.947 1.00 48.02  ? 165  TYR B CE2 1 
ATOM   3239 C CZ  . TYR B 2 162 ? 11.172  -5.881  72.475 1.00 52.08  ? 165  TYR B CZ  1 
ATOM   3240 O OH  . TYR B 2 162 ? 11.995  -4.926  73.016 1.00 50.68  ? 165  TYR B OH  1 
ATOM   3241 N N   . SER B 2 163 ? 8.087   -11.306 68.312 1.00 48.77  ? 166  SER B N   1 
ATOM   3242 C CA  . SER B 2 163 ? 7.693   -12.692 68.048 1.00 48.72  ? 166  SER B CA  1 
ATOM   3243 C C   . SER B 2 163 ? 8.785   -13.737 68.307 1.00 53.77  ? 166  SER B C   1 
ATOM   3244 O O   . SER B 2 163 ? 8.574   -14.695 69.049 1.00 53.04  ? 166  SER B O   1 
ATOM   3245 C CB  . SER B 2 163 ? 7.170   -12.831 66.613 1.00 51.46  ? 166  SER B CB  1 
ATOM   3246 O OG  . SER B 2 163 ? 6.741   -14.156 66.350 1.00 58.44  ? 166  SER B OG  1 
ATOM   3247 N N   . TYR B 2 164 ? 9.941   -13.552 67.677 1.00 51.95  ? 167  TYR B N   1 
ATOM   3248 C CA  . TYR B 2 164 ? 11.047  -14.509 67.743 1.00 51.90  ? 167  TYR B CA  1 
ATOM   3249 C C   . TYR B 2 164 ? 11.587  -14.686 69.155 1.00 57.29  ? 167  TYR B C   1 
ATOM   3250 O O   . TYR B 2 164 ? 11.758  -15.805 69.634 1.00 57.39  ? 167  TYR B O   1 
ATOM   3251 C CB  . TYR B 2 164 ? 12.178  -14.044 66.824 1.00 52.90  ? 167  TYR B CB  1 
ATOM   3252 C CG  . TYR B 2 164 ? 13.513  -14.718 67.063 1.00 54.68  ? 167  TYR B CG  1 
ATOM   3253 C CD1 . TYR B 2 164 ? 14.489  -14.110 67.842 1.00 56.83  ? 167  TYR B CD1 1 
ATOM   3254 C CD2 . TYR B 2 164 ? 13.821  -15.929 66.457 1.00 55.28  ? 167  TYR B CD2 1 
ATOM   3255 C CE1 . TYR B 2 164 ? 15.723  -14.705 68.038 1.00 57.66  ? 167  TYR B CE1 1 
ATOM   3256 C CE2 . TYR B 2 164 ? 15.047  -16.537 66.654 1.00 56.13  ? 167  TYR B CE2 1 
ATOM   3257 C CZ  . TYR B 2 164 ? 15.999  -15.918 67.439 1.00 64.78  ? 167  TYR B CZ  1 
ATOM   3258 O OH  . TYR B 2 164 ? 17.229  -16.517 67.629 1.00 66.91  ? 167  TYR B OH  1 
ATOM   3259 N N   . GLN B 2 165 ? 11.934  -13.571 69.781 1.00 54.64  ? 168  GLN B N   1 
ATOM   3260 C CA  . GLN B 2 165 ? 12.470  -13.578 71.134 1.00 54.74  ? 168  GLN B CA  1 
ATOM   3261 C C   . GLN B 2 165 ? 11.481  -14.239 72.097 1.00 60.42  ? 168  GLN B C   1 
ATOM   3262 O O   . GLN B 2 165 ? 11.838  -15.149 72.845 1.00 59.86  ? 168  GLN B O   1 
ATOM   3263 C CB  . GLN B 2 165 ? 12.779  -12.142 71.571 1.00 55.65  ? 168  GLN B CB  1 
ATOM   3264 C CG  . GLN B 2 165 ? 13.571  -12.025 72.864 1.00 61.42  ? 168  GLN B CG  1 
ATOM   3265 C CD  . GLN B 2 165 ? 14.044  -10.605 73.126 1.00 70.39  ? 168  GLN B CD  1 
ATOM   3266 O OE1 . GLN B 2 165 ? 15.151  -10.227 72.741 1.00 65.85  ? 168  GLN B OE1 1 
ATOM   3267 N NE2 . GLN B 2 165 ? 13.198  -9.806  73.767 1.00 54.12  ? 168  GLN B NE2 1 
ATOM   3268 N N   . MET B 2 166 ? 10.223  -13.821 72.023 1.00 58.63  ? 169  MET B N   1 
ATOM   3269 C CA  . MET B 2 166 ? 9.183   -14.342 72.898 1.00 59.62  ? 169  MET B CA  1 
ATOM   3270 C C   . MET B 2 166 ? 8.908   -15.837 72.722 1.00 68.13  ? 169  MET B C   1 
ATOM   3271 O O   . MET B 2 166 ? 8.305   -16.474 73.592 1.00 67.52  ? 169  MET B O   1 
ATOM   3272 C CB  . MET B 2 166 ? 7.896   -13.543 72.718 1.00 61.67  ? 169  MET B CB  1 
ATOM   3273 C CG  . MET B 2 166 ? 8.059   -12.063 73.004 1.00 64.89  ? 169  MET B CG  1 
ATOM   3274 S SD  . MET B 2 166 ? 6.501   -11.163 72.966 1.00 68.68  ? 169  MET B SD  1 
ATOM   3275 C CE  . MET B 2 166 ? 5.953   -11.482 71.277 1.00 65.33  ? 169  MET B CE  1 
ATOM   3276 N N   . ALA B 2 167 ? 9.318   -16.390 71.585 1.00 67.91  ? 170  ALA B N   1 
ATOM   3277 C CA  . ALA B 2 167 ? 9.155   -17.818 71.346 1.00 69.06  ? 170  ALA B CA  1 
ATOM   3278 C C   . ALA B 2 167 ? 10.399  -18.580 71.792 1.00 76.58  ? 170  ALA B C   1 
ATOM   3279 O O   . ALA B 2 167 ? 10.679  -19.672 71.304 1.00 75.97  ? 170  ALA B O   1 
ATOM   3280 C CB  . ALA B 2 167 ? 8.846   -18.087 69.878 1.00 69.75  ? 170  ALA B CB  1 
ATOM   3281 N N   . LEU B 2 168 ? 11.139  -17.984 72.724 1.00 76.54  ? 171  LEU B N   1 
ATOM   3282 C CA  . LEU B 2 168 ? 12.330  -18.598 73.303 1.00 77.96  ? 171  LEU B CA  1 
ATOM   3283 C C   . LEU B 2 168 ? 12.564  -18.071 74.720 1.00 86.97  ? 171  LEU B C   1 
ATOM   3284 O O   . LEU B 2 168 ? 13.618  -17.496 75.001 1.00 86.98  ? 171  LEU B O   1 
ATOM   3285 C CB  . LEU B 2 168 ? 13.565  -18.270 72.455 1.00 77.93  ? 171  LEU B CB  1 
ATOM   3286 C CG  . LEU B 2 168 ? 13.783  -18.922 71.086 1.00 82.45  ? 171  LEU B CG  1 
ATOM   3287 C CD1 . LEU B 2 168 ? 12.809  -18.375 70.048 1.00 82.10  ? 171  LEU B CD1 1 
ATOM   3288 C CD2 . LEU B 2 168 ? 15.214  -18.689 70.636 1.00 85.71  ? 171  LEU B CD2 1 
ATOM   3289 N N   . ASP B 2 169 ? 11.600  -18.271 75.617 1.00 86.88  ? 172  ASP B N   1 
ATOM   3290 C CA  . ASP B 2 169 ? 10.372  -18.999 75.322 1.00 88.12  ? 172  ASP B CA  1 
ATOM   3291 C C   . ASP B 2 169 ? 9.139   -18.472 76.076 1.00 94.35  ? 172  ASP B C   1 
ATOM   3292 O O   . ASP B 2 169 ? 8.037   -18.993 75.906 1.00 93.78  ? 172  ASP B O   1 
ATOM   3293 C CB  . ASP B 2 169 ? 10.564  -20.492 75.613 1.00 90.33  ? 172  ASP B CB  1 
ATOM   3294 C CG  . ASP B 2 169 ? 9.417   -21.345 75.094 1.00 103.24 ? 172  ASP B CG  1 
ATOM   3295 O OD1 . ASP B 2 169 ? 8.460   -20.776 74.527 1.00 104.28 ? 172  ASP B OD1 1 
ATOM   3296 O OD2 . ASP B 2 169 ? 9.480   -22.587 75.243 1.00 109.65 ? 172  ASP B OD2 1 
ATOM   3297 N N   . PRO B 2 170 ? 9.309   -17.447 76.936 1.00 92.90  ? 173  PRO B N   1 
ATOM   3298 C CA  . PRO B 2 170 ? 8.039   -17.001 77.528 1.00 93.46  ? 173  PRO B CA  1 
ATOM   3299 C C   . PRO B 2 170 ? 7.350   -15.971 76.638 1.00 99.52  ? 173  PRO B C   1 
ATOM   3300 O O   . PRO B 2 170 ? 7.974   -15.444 75.716 1.00 99.23  ? 173  PRO B O   1 
ATOM   3301 C CB  . PRO B 2 170 ? 8.481   -16.348 78.840 1.00 95.09  ? 173  PRO B CB  1 
ATOM   3302 C CG  . PRO B 2 170 ? 9.844   -15.849 78.561 1.00 99.19  ? 173  PRO B CG  1 
ATOM   3303 C CD  . PRO B 2 170 ? 10.467  -16.847 77.626 1.00 94.57  ? 173  PRO B CD  1 
ATOM   3304 N N   . VAL B 2 171 ? 6.066   -15.697 76.877 1.00 97.58  ? 174  VAL B N   1 
ATOM   3305 C CA  . VAL B 2 171 ? 5.231   -16.397 77.858 1.00 97.90  ? 174  VAL B CA  1 
ATOM   3306 C C   . VAL B 2 171 ? 5.333   -15.965 79.324 1.00 102.19 ? 174  VAL B C   1 
ATOM   3307 O O   . VAL B 2 171 ? 6.012   -16.603 80.128 1.00 101.70 ? 174  VAL B O   1 
ATOM   3308 C CB  . VAL B 2 171 ? 5.216   -17.926 77.668 1.00 102.17 ? 174  VAL B CB  1 
ATOM   3309 C CG1 . VAL B 2 171 ? 4.442   -18.592 78.798 1.00 102.04 ? 174  VAL B CG1 1 
ATOM   3310 C CG2 . VAL B 2 171 ? 4.602   -18.285 76.320 1.00 102.03 ? 174  VAL B CG2 1 
ATOM   3311 N N   . VAL B 2 172 ? 4.631   -14.887 79.661 1.00 99.39  ? 175  VAL B N   1 
ATOM   3312 C CA  . VAL B 2 172 ? 4.375   -14.518 81.052 1.00 99.56  ? 175  VAL B CA  1 
ATOM   3313 C C   . VAL B 2 172 ? 2.949   -13.979 81.143 1.00 103.10 ? 175  VAL B C   1 
ATOM   3314 O O   . VAL B 2 172 ? 2.487   -13.581 82.214 1.00 102.99 ? 175  VAL B O   1 
ATOM   3315 C CB  . VAL B 2 172 ? 5.404   -13.495 81.581 1.00 103.95 ? 175  VAL B CB  1 
ATOM   3316 C CG1 . VAL B 2 172 ? 5.000   -12.075 81.194 1.00 103.89 ? 175  VAL B CG1 1 
ATOM   3317 C CG2 . VAL B 2 172 ? 5.566   -13.628 83.090 1.00 103.76 ? 175  VAL B CG2 1 
ATOM   3318 N N   . VAL B 2 173 ? 2.323   -13.858 79.975 1.00 98.97  ? 176  VAL B N   1 
ATOM   3319 C CA  . VAL B 2 173 ? 0.880   -13.666 79.818 1.00 98.32  ? 176  VAL B CA  1 
ATOM   3320 C C   . VAL B 2 173 ? 0.071   -13.090 80.984 1.00 100.64 ? 176  VAL B C   1 
ATOM   3321 O O   . VAL B 2 173 ? -0.752  -13.787 81.579 1.00 99.93  ? 176  VAL B O   1 
ATOM   3322 C CB  . VAL B 2 173 ? 0.207   -14.925 79.232 1.00 102.18 ? 176  VAL B CB  1 
ATOM   3323 C CG1 . VAL B 2 173 ? 0.627   -15.128 77.784 1.00 102.03 ? 176  VAL B CG1 1 
ATOM   3324 C CG2 . VAL B 2 173 ? 0.557   -16.149 80.068 1.00 101.95 ? 176  VAL B CG2 1 
ATOM   3325 N N   . THR B 2 174 ? 0.267   -11.806 81.270 1.00 96.19  ? 177  THR B N   1 
ATOM   3326 C CA  . THR B 2 174 ? -0.691  -11.052 82.076 1.00 95.43  ? 177  THR B CA  1 
ATOM   3327 C C   . THR B 2 174 ? -1.933  -10.827 81.214 1.00 97.81  ? 177  THR B C   1 
ATOM   3328 O O   . THR B 2 174 ? -1.928  -9.993  80.305 1.00 97.32  ? 177  THR B O   1 
ATOM   3329 C CB  . THR B 2 174 ? -0.093  -9.720  82.561 1.00 103.71 ? 177  THR B CB  1 
ATOM   3330 O OG1 . THR B 2 174 ? 1.094   -9.976  83.322 1.00 103.84 ? 177  THR B OG1 1 
ATOM   3331 C CG2 . THR B 2 174 ? -1.093  -8.972  83.426 1.00 101.78 ? 177  THR B CG2 1 
ATOM   3332 N N   . LEU B 2 175 ? -3.002  -11.555 81.525 1.00 93.07  ? 178  LEU B N   1 
ATOM   3333 C CA  . LEU B 2 175 ? -4.047  -11.838 80.548 1.00 92.21  ? 178  LEU B CA  1 
ATOM   3334 C C   . LEU B 2 175 ? -5.365  -11.118 80.815 1.00 94.26  ? 178  LEU B C   1 
ATOM   3335 O O   . LEU B 2 175 ? -6.342  -11.329 80.101 1.00 93.28  ? 178  LEU B O   1 
ATOM   3336 C CB  . LEU B 2 175 ? -4.299  -13.346 80.506 1.00 92.39  ? 178  LEU B CB  1 
ATOM   3337 C CG  . LEU B 2 175 ? -4.497  -14.018 79.148 1.00 97.41  ? 178  LEU B CG  1 
ATOM   3338 C CD1 . LEU B 2 175 ? -5.518  -13.279 78.299 1.00 97.53  ? 178  LEU B CD1 1 
ATOM   3339 C CD2 . LEU B 2 175 ? -3.165  -14.148 78.422 1.00 100.62 ? 178  LEU B CD2 1 
ATOM   3340 N N   . TRP B 2 176 ? -5.391  -10.250 81.820 1.00 90.47  ? 179  TRP B N   1 
ATOM   3341 C CA  . TRP B 2 176 ? -6.656  -9.698  82.291 1.00 90.33  ? 179  TRP B CA  1 
ATOM   3342 C C   . TRP B 2 176 ? -7.295  -8.753  81.271 1.00 93.94  ? 179  TRP B C   1 
ATOM   3343 O O   . TRP B 2 176 ? -8.451  -8.363  81.423 1.00 93.10  ? 179  TRP B O   1 
ATOM   3344 C CB  . TRP B 2 176 ? -6.501  -8.978  83.640 1.00 89.21  ? 179  TRP B CB  1 
ATOM   3345 C CG  . TRP B 2 176 ? -5.388  -9.468  84.549 1.00 90.40  ? 179  TRP B CG  1 
ATOM   3346 C CD1 . TRP B 2 176 ? -4.743  -8.734  85.506 1.00 93.15  ? 179  TRP B CD1 1 
ATOM   3347 C CD2 . TRP B 2 176 ? -4.815  -10.786 84.609 1.00 90.21  ? 179  TRP B CD2 1 
ATOM   3348 N NE1 . TRP B 2 176 ? -3.800  -9.502  86.143 1.00 92.63  ? 179  TRP B NE1 1 
ATOM   3349 C CE2 . TRP B 2 176 ? -3.822  -10.767 85.611 1.00 94.11  ? 179  TRP B CE2 1 
ATOM   3350 C CE3 . TRP B 2 176 ? -5.047  -11.982 83.918 1.00 91.65  ? 179  TRP B CE3 1 
ATOM   3351 C CZ2 . TRP B 2 176 ? -3.053  -11.885 85.926 1.00 93.46  ? 179  TRP B CZ2 1 
ATOM   3352 C CZ3 . TRP B 2 176 ? -4.268  -13.089 84.220 1.00 93.11  ? 179  TRP B CZ3 1 
ATOM   3353 C CH2 . TRP B 2 176 ? -3.295  -13.036 85.226 1.00 93.73  ? 179  TRP B CH2 1 
ATOM   3354 N N   . TYR B 2 177 ? -6.542  -8.383  80.238 1.00 90.82  ? 180  TYR B N   1 
ATOM   3355 C CA  . TYR B 2 177 ? -7.011  -7.392  79.267 1.00 90.44  ? 180  TYR B CA  1 
ATOM   3356 C C   . TYR B 2 177 ? -7.107  -7.917  77.835 1.00 94.11  ? 180  TYR B C   1 
ATOM   3357 O O   . TYR B 2 177 ? -7.775  -7.316  76.992 1.00 93.07  ? 180  TYR B O   1 
ATOM   3358 C CB  . TYR B 2 177 ? -6.137  -6.137  79.311 1.00 91.50  ? 180  TYR B CB  1 
ATOM   3359 C CG  . TYR B 2 177 ? -6.095  -5.478  80.669 1.00 93.12  ? 180  TYR B CG  1 
ATOM   3360 C CD1 . TYR B 2 177 ? -7.037  -4.520  81.029 1.00 95.10  ? 180  TYR B CD1 1 
ATOM   3361 C CD2 . TYR B 2 177 ? -5.130  -5.831  81.600 1.00 93.78  ? 180  TYR B CD2 1 
ATOM   3362 C CE1 . TYR B 2 177 ? -7.012  -3.928  82.277 1.00 95.70  ? 180  TYR B CE1 1 
ATOM   3363 C CE2 . TYR B 2 177 ? -5.093  -5.242  82.848 1.00 94.68  ? 180  TYR B CE2 1 
ATOM   3364 C CZ  . TYR B 2 177 ? -6.035  -4.292  83.181 1.00 102.15 ? 180  TYR B CZ  1 
ATOM   3365 O OH  . TYR B 2 177 ? -5.995  -3.707  84.425 1.00 103.52 ? 180  TYR B OH  1 
ATOM   3366 N N   . ARG B 2 178 ? -6.425  -9.025  77.561 1.00 91.38  ? 181  ARG B N   1 
ATOM   3367 C CA  . ARG B 2 178 ? -6.480  -9.651  76.243 1.00 91.50  ? 181  ARG B CA  1 
ATOM   3368 C C   . ARG B 2 178 ? -7.904  -9.781  75.706 1.00 96.47  ? 181  ARG B C   1 
ATOM   3369 O O   . ARG B 2 178 ? -8.812  -10.203 76.419 1.00 95.87  ? 181  ARG B O   1 
ATOM   3370 C CB  . ARG B 2 178 ? -5.804  -11.025 76.264 1.00 91.16  ? 181  ARG B CB  1 
ATOM   3371 C CG  . ARG B 2 178 ? -4.421  -11.058 75.633 1.00 99.91  ? 181  ARG B CG  1 
ATOM   3372 C CD  . ARG B 2 178 ? -3.388  -10.333 76.475 1.00 107.35 ? 181  ARG B CD  1 
ATOM   3373 N NE  . ARG B 2 178 ? -2.130  -10.173 75.752 1.00 112.65 ? 181  ARG B NE  1 
ATOM   3374 C CZ  . ARG B 2 178 ? -1.267  -11.158 75.525 1.00 126.21 ? 181  ARG B CZ  1 
ATOM   3375 N NH1 . ARG B 2 178 ? -1.524  -12.384 75.960 1.00 111.19 ? 181  ARG B NH1 1 
ATOM   3376 N NH2 . ARG B 2 178 ? -0.147  -10.919 74.856 1.00 115.24 ? 181  ARG B NH2 1 
ATOM   3377 N N   . ALA B 2 179 ? -8.095  -9.411  74.444 1.00 94.18  ? 182  ALA B N   1 
ATOM   3378 C CA  . ALA B 2 179 ? -9.365  -9.653  73.773 1.00 94.50  ? 182  ALA B CA  1 
ATOM   3379 C C   . ALA B 2 179 ? -9.640  -11.154 73.751 1.00 99.49  ? 182  ALA B C   1 
ATOM   3380 O O   . ALA B 2 179 ? -8.714  -11.964 73.824 1.00 98.93  ? 182  ALA B O   1 
ATOM   3381 C CB  . ALA B 2 179 ? -9.335  -9.094  72.358 1.00 95.21  ? 182  ALA B CB  1 
ATOM   3382 N N   . PRO B 2 180 ? -10.922 -11.541 73.673 1.00 96.85  ? 183  PRO B N   1 
ATOM   3383 C CA  . PRO B 2 180 ? -11.268 -12.965 73.649 1.00 96.90  ? 183  PRO B CA  1 
ATOM   3384 C C   . PRO B 2 180 ? -10.702 -13.668 72.418 1.00 101.68 ? 183  PRO B C   1 
ATOM   3385 O O   . PRO B 2 180 ? -10.349 -14.845 72.471 1.00 101.23 ? 183  PRO B O   1 
ATOM   3386 C CB  . PRO B 2 180 ? -12.798 -12.948 73.597 1.00 98.54  ? 183  PRO B CB  1 
ATOM   3387 C CG  . PRO B 2 180 ? -13.139 -11.646 72.975 1.00 102.83 ? 183  PRO B CG  1 
ATOM   3388 C CD  . PRO B 2 180 ? -12.099 -10.682 73.457 1.00 98.38  ? 183  PRO B CD  1 
ATOM   3389 N N   . GLU B 2 181 ? -10.603 -12.928 71.317 1.00 98.97  ? 184  GLU B N   1 
ATOM   3390 C CA  . GLU B 2 181 ? -10.075 -13.459 70.064 1.00 99.17  ? 184  GLU B CA  1 
ATOM   3391 C C   . GLU B 2 181 ? -8.631  -13.912 70.185 1.00 102.91 ? 184  GLU B C   1 
ATOM   3392 O O   . GLU B 2 181 ? -8.244  -14.928 69.606 1.00 102.23 ? 184  GLU B O   1 
ATOM   3393 C CB  . GLU B 2 181 ? -10.162 -12.402 68.966 1.00 100.83 ? 184  GLU B CB  1 
ATOM   3394 C CG  . GLU B 2 181 ? -11.568 -12.098 68.505 1.00 114.92 ? 184  GLU B CG  1 
ATOM   3395 C CD  . GLU B 2 181 ? -11.682 -10.717 67.905 1.00 143.19 ? 184  GLU B CD  1 
ATOM   3396 O OE1 . GLU B 2 181 ? -10.754 -10.298 67.179 1.00 140.31 ? 184  GLU B OE1 1 
ATOM   3397 O OE2 . GLU B 2 181 ? -12.685 -10.035 68.193 1.00 141.06 ? 184  GLU B OE2 1 
ATOM   3398 N N   . VAL B 2 182 ? -7.820  -13.092 70.849 1.00 99.90  ? 185  VAL B N   1 
ATOM   3399 C CA  . VAL B 2 182 ? -6.395  -13.358 71.000 1.00 99.87  ? 185  VAL B CA  1 
ATOM   3400 C C   . VAL B 2 182 ? -6.168  -14.809 71.395 1.00 103.87 ? 185  VAL B C   1 
ATOM   3401 O O   . VAL B 2 182 ? -5.255  -15.463 70.893 1.00 103.24 ? 185  VAL B O   1 
ATOM   3402 C CB  . VAL B 2 182 ? -5.735  -12.381 71.993 1.00 103.91 ? 185  VAL B CB  1 
ATOM   3403 C CG1 . VAL B 2 182 ? -4.217  -12.446 71.881 1.00 103.76 ? 185  VAL B CG1 1 
ATOM   3404 C CG2 . VAL B 2 182 ? -6.230  -10.963 71.753 1.00 103.74 ? 185  VAL B CG2 1 
ATOM   3405 N N   . LEU B 2 183 ? -7.045  -15.324 72.251 1.00 100.83 ? 186  LEU B N   1 
ATOM   3406 C CA  . LEU B 2 183 ? -7.077  -16.755 72.521 1.00 100.78 ? 186  LEU B CA  1 
ATOM   3407 C C   . LEU B 2 183 ? -7.559  -17.456 71.257 1.00 104.53 ? 186  LEU B C   1 
ATOM   3408 O O   . LEU B 2 183 ? -8.679  -17.970 71.206 1.00 104.07 ? 186  LEU B O   1 
ATOM   3409 C CB  . LEU B 2 183 ? -8.005  -17.072 73.694 1.00 100.90 ? 186  LEU B CB  1 
ATOM   3410 C CG  . LEU B 2 183 ? -7.676  -18.362 74.452 1.00 105.67 ? 186  LEU B CG  1 
ATOM   3411 C CD1 . LEU B 2 183 ? -8.768  -18.709 75.451 1.00 105.90 ? 186  LEU B CD1 1 
ATOM   3412 C CD2 . LEU B 2 183 ? -7.427  -19.514 73.493 1.00 108.17 ? 186  LEU B CD2 1 
ATOM   3413 N N   . LEU B 2 184 ? -6.724  -17.383 70.222 1.00 100.92 ? 187  LEU B N   1 
ATOM   3414 C CA  . LEU B 2 184 ? -6.996  -17.944 68.900 1.00 100.61 ? 187  LEU B CA  1 
ATOM   3415 C C   . LEU B 2 184 ? -7.784  -19.251 68.969 1.00 104.05 ? 187  LEU B C   1 
ATOM   3416 O O   . LEU B 2 184 ? -7.717  -19.964 69.971 1.00 103.38 ? 187  LEU B O   1 
ATOM   3417 C CB  . LEU B 2 184 ? -5.673  -18.153 68.158 1.00 100.66 ? 187  LEU B CB  1 
ATOM   3418 C CG  . LEU B 2 184 ? -5.673  -18.218 66.630 1.00 105.35 ? 187  LEU B CG  1 
ATOM   3419 C CD1 . LEU B 2 184 ? -4.339  -17.712 66.103 1.00 105.40 ? 187  LEU B CD1 1 
ATOM   3420 C CD2 . LEU B 2 184 ? -5.923  -19.642 66.158 1.00 107.91 ? 187  LEU B CD2 1 
ATOM   3421 N N   . GLN B 2 185 ? -8.567  -19.544 67.932 1.00 100.46 ? 188  GLN B N   1 
ATOM   3422 C CA  . GLN B 2 185 ? -8.690  -18.692 66.748 1.00 100.07 ? 188  GLN B CA  1 
ATOM   3423 C C   . GLN B 2 185 ? -9.285  -17.325 67.093 1.00 103.43 ? 188  GLN B C   1 
ATOM   3424 O O   . GLN B 2 185 ? -9.792  -17.133 68.197 1.00 103.30 ? 188  GLN B O   1 
ATOM   3425 C CB  . GLN B 2 185 ? -9.575  -19.385 65.706 1.00 101.36 ? 188  GLN B CB  1 
ATOM   3426 C CG  . GLN B 2 185 ? -9.148  -20.801 65.341 1.00 112.32 ? 188  GLN B CG  1 
ATOM   3427 C CD  . GLN B 2 185 ? -10.009 -21.404 64.243 1.00 128.00 ? 188  GLN B CD  1 
ATOM   3428 O OE1 . GLN B 2 185 ? -11.210 -21.608 64.421 1.00 122.72 ? 188  GLN B OE1 1 
ATOM   3429 N NE2 . GLN B 2 185 ? -9.398  -21.685 63.098 1.00 118.53 ? 188  GLN B NE2 1 
ATOM   3430 N N   . SER B 2 186 ? -9.188  -16.365 66.175 1.00 99.21  ? 189  SER B N   1 
ATOM   3431 C CA  . SER B 2 186 ? -8.432  -16.509 64.934 1.00 98.74  ? 189  SER B CA  1 
ATOM   3432 C C   . SER B 2 186 ? -7.452  -15.345 64.815 1.00 102.26 ? 189  SER B C   1 
ATOM   3433 O O   . SER B 2 186 ? -6.237  -15.540 64.771 1.00 101.56 ? 189  SER B O   1 
ATOM   3434 C CB  . SER B 2 186 ? -9.375  -16.491 63.725 1.00 102.25 ? 189  SER B CB  1 
ATOM   3435 O OG  . SER B 2 186 ? -9.965  -17.757 63.491 1.00 110.59 ? 189  SER B OG  1 
ATOM   3436 N N   . THR B 2 187 ? -8.003  -14.138 64.711 1.00 98.69  ? 190  THR B N   1 
ATOM   3437 C CA  . THR B 2 187 ? -7.218  -12.907 64.704 1.00 98.17  ? 190  THR B CA  1 
ATOM   3438 C C   . THR B 2 187 ? -7.468  -12.178 66.024 1.00 100.70 ? 190  THR B C   1 
ATOM   3439 O O   . THR B 2 187 ? -8.456  -12.475 66.695 1.00 100.34 ? 190  THR B O   1 
ATOM   3440 C CB  . THR B 2 187 ? -7.590  -12.025 63.499 1.00 107.24 ? 190  THR B CB  1 
ATOM   3441 O OG1 . THR B 2 187 ? -8.964  -11.630 63.603 1.00 108.28 ? 190  THR B OG1 1 
ATOM   3442 C CG2 . THR B 2 187 ? -7.387  -12.792 62.198 1.00 105.36 ? 190  THR B CG2 1 
ATOM   3443 N N   . TYR B 2 188 ? -6.613  -11.229 66.417 1.00 96.19  ? 191  TYR B N   1 
ATOM   3444 C CA  . TYR B 2 188 ? -5.442  -10.751 65.671 1.00 95.40  ? 191  TYR B CA  1 
ATOM   3445 C C   . TYR B 2 188 ? -5.737  -9.681  64.612 1.00 96.99  ? 191  TYR B C   1 
ATOM   3446 O O   . TYR B 2 188 ? -5.039  -9.572  63.601 1.00 96.51  ? 191  TYR B O   1 
ATOM   3447 C CB  . TYR B 2 188 ? -4.548  -11.886 65.154 1.00 96.80  ? 191  TYR B CB  1 
ATOM   3448 C CG  . TYR B 2 188 ? -4.104  -12.857 66.231 1.00 99.01  ? 191  TYR B CG  1 
ATOM   3449 C CD1 . TYR B 2 188 ? -2.890  -12.692 66.884 1.00 101.15 ? 191  TYR B CD1 1 
ATOM   3450 C CD2 . TYR B 2 188 ? -4.901  -13.937 66.597 1.00 99.72  ? 191  TYR B CD2 1 
ATOM   3451 C CE1 . TYR B 2 188 ? -2.480  -13.573 67.869 1.00 101.93 ? 191  TYR B CE1 1 
ATOM   3452 C CE2 . TYR B 2 188 ? -4.494  -14.828 67.575 1.00 100.54 ? 191  TYR B CE2 1 
ATOM   3453 C CZ  . TYR B 2 188 ? -3.284  -14.639 68.210 1.00 108.13 ? 191  TYR B CZ  1 
ATOM   3454 O OH  . TYR B 2 188 ? -2.870  -15.515 69.188 1.00 109.42 ? 191  TYR B OH  1 
ATOM   3455 N N   . ALA B 2 189 ? -6.742  -8.854  64.893 1.00 91.51  ? 192  ALA B N   1 
ATOM   3456 C CA  . ALA B 2 189 ? -7.079  -7.708  64.052 1.00 90.14  ? 192  ALA B CA  1 
ATOM   3457 C C   . ALA B 2 189 ? -7.114  -6.435  64.898 1.00 91.02  ? 192  ALA B C   1 
ATOM   3458 O O   . ALA B 2 189 ? -6.670  -6.434  66.045 1.00 90.91  ? 192  ALA B O   1 
ATOM   3459 C CB  . ALA B 2 189 ? -8.420  -7.930  63.365 1.00 90.93  ? 192  ALA B CB  1 
ATOM   3460 N N   . THR B 2 190 ? -7.670  -5.361  64.347 1.00 85.04  ? 193  THR B N   1 
ATOM   3461 C CA  . THR B 2 190 ? -7.687  -4.077  65.042 1.00 83.81  ? 193  THR B CA  1 
ATOM   3462 C C   . THR B 2 190 ? -8.630  -4.029  66.253 1.00 86.07  ? 193  THR B C   1 
ATOM   3463 O O   . THR B 2 190 ? -8.285  -3.474  67.300 1.00 85.51  ? 193  THR B O   1 
ATOM   3464 C CB  . THR B 2 190 ? -7.919  -2.898  64.072 1.00 88.46  ? 193  THR B CB  1 
ATOM   3465 O OG1 . THR B 2 190 ? -7.415  -1.693  64.656 1.00 86.87  ? 193  THR B OG1 1 
ATOM   3466 C CG2 . THR B 2 190 ? -9.398  -2.718  63.787 1.00 86.73  ? 193  THR B CG2 1 
ATOM   3467 N N   . PRO B 2 191 ? -9.831  -4.620  66.129 1.00 80.97  ? 194  PRO B N   1 
ATOM   3468 C CA  . PRO B 2 191 ? -10.807 -4.545  67.223 1.00 79.90  ? 194  PRO B CA  1 
ATOM   3469 C C   . PRO B 2 191 ? -10.247 -4.987  68.574 1.00 81.69  ? 194  PRO B C   1 
ATOM   3470 O O   . PRO B 2 191 ? -10.710 -4.531  69.623 1.00 81.21  ? 194  PRO B O   1 
ATOM   3471 C CB  . PRO B 2 191 ? -11.904 -5.510  66.768 1.00 81.66  ? 194  PRO B CB  1 
ATOM   3472 C CG  . PRO B 2 191 ? -11.853 -5.441  65.291 1.00 86.39  ? 194  PRO B CG  1 
ATOM   3473 C CD  . PRO B 2 191 ? -10.396 -5.282  64.939 1.00 82.17  ? 194  PRO B CD  1 
ATOM   3474 N N   . VAL B 2 192 ? -9.251  -5.868  68.545 1.00 76.12  ? 195  VAL B N   1 
ATOM   3475 C CA  . VAL B 2 192 ? -8.699  -6.438  69.768 1.00 75.02  ? 195  VAL B CA  1 
ATOM   3476 C C   . VAL B 2 192 ? -8.354  -5.371  70.802 1.00 76.58  ? 195  VAL B C   1 
ATOM   3477 O O   . VAL B 2 192 ? -8.454  -5.606  72.005 1.00 76.05  ? 195  VAL B O   1 
ATOM   3478 C CB  . VAL B 2 192 ? -7.496  -7.359  69.480 1.00 79.04  ? 195  VAL B CB  1 
ATOM   3479 C CG1 . VAL B 2 192 ? -7.918  -8.528  68.610 1.00 78.94  ? 195  VAL B CG1 1 
ATOM   3480 C CG2 . VAL B 2 192 ? -6.369  -6.578  68.823 1.00 78.93  ? 195  VAL B CG2 1 
ATOM   3481 N N   . ASP B 2 193 ? -7.992  -4.184  70.325 1.00 71.46  ? 196  ASP B N   1 
ATOM   3482 C CA  . ASP B 2 193 ? -7.564  -3.104  71.210 1.00 70.63  ? 196  ASP B CA  1 
ATOM   3483 C C   . ASP B 2 193 ? -8.739  -2.416  71.903 1.00 73.25  ? 196  ASP B C   1 
ATOM   3484 O O   . ASP B 2 193 ? -8.591  -1.867  72.993 1.00 71.78  ? 196  ASP B O   1 
ATOM   3485 C CB  . ASP B 2 193 ? -6.713  -2.080  70.450 1.00 72.04  ? 196  ASP B CB  1 
ATOM   3486 C CG  . ASP B 2 193 ? -5.339  -2.622  70.070 1.00 77.77  ? 196  ASP B CG  1 
ATOM   3487 O OD1 . ASP B 2 193 ? -4.750  -3.385  70.866 1.00 77.03  ? 196  ASP B OD1 1 
ATOM   3488 O OD2 . ASP B 2 193 ? -4.835  -2.252  68.988 1.00 82.25  ? 196  ASP B OD2 1 
ATOM   3489 N N   . MET B 2 194 ? -9.908  -2.468  71.273 1.00 70.10  ? 197  MET B N   1 
ATOM   3490 C CA  . MET B 2 194 ? -11.103 -1.839  71.823 1.00 69.87  ? 197  MET B CA  1 
ATOM   3491 C C   . MET B 2 194 ? -11.675 -2.623  73.003 1.00 74.83  ? 197  MET B C   1 
ATOM   3492 O O   . MET B 2 194 ? -12.195 -2.038  73.949 1.00 74.00  ? 197  MET B O   1 
ATOM   3493 C CB  . MET B 2 194 ? -12.160 -1.632  70.736 1.00 71.88  ? 197  MET B CB  1 
ATOM   3494 C CG  . MET B 2 194 ? -11.769 -0.594  69.698 1.00 75.19  ? 197  MET B CG  1 
ATOM   3495 S SD  . MET B 2 194 ? -11.337 0.999   70.432 1.00 79.18  ? 197  MET B SD  1 
ATOM   3496 C CE  . MET B 2 194 ? -12.924 1.507   71.166 1.00 75.56  ? 197  MET B CE  1 
ATOM   3497 N N   . TRP B 2 195 ? -11.561 -3.947  72.948 1.00 72.86  ? 198  TRP B N   1 
ATOM   3498 C CA  . TRP B 2 195 ? -11.876 -4.784  74.101 1.00 73.34  ? 198  TRP B CA  1 
ATOM   3499 C C   . TRP B 2 195 ? -11.017 -4.374  75.296 1.00 77.51  ? 198  TRP B C   1 
ATOM   3500 O O   . TRP B 2 195 ? -11.514 -4.239  76.420 1.00 76.95  ? 198  TRP B O   1 
ATOM   3501 C CB  . TRP B 2 195 ? -11.636 -6.264  73.786 1.00 72.30  ? 198  TRP B CB  1 
ATOM   3502 C CG  . TRP B 2 195 ? -11.984 -7.153  74.936 1.00 73.61  ? 198  TRP B CG  1 
ATOM   3503 C CD1 . TRP B 2 195 ? -11.164 -7.525  75.963 1.00 76.51  ? 198  TRP B CD1 1 
ATOM   3504 C CD2 . TRP B 2 195 ? -13.278 -7.690  75.240 1.00 73.60  ? 198  TRP B CD2 1 
ATOM   3505 N NE1 . TRP B 2 195 ? -11.861 -8.286  76.874 1.00 76.25  ? 198  TRP B NE1 1 
ATOM   3506 C CE2 . TRP B 2 195 ? -13.159 -8.410  76.447 1.00 77.79  ? 198  TRP B CE2 1 
ATOM   3507 C CE3 . TRP B 2 195 ? -14.518 -7.661  74.591 1.00 74.92  ? 198  TRP B CE3 1 
ATOM   3508 C CZ2 . TRP B 2 195 ? -14.234 -9.091  77.020 1.00 77.14  ? 198  TRP B CZ2 1 
ATOM   3509 C CZ3 . TRP B 2 195 ? -15.584 -8.337  75.159 1.00 76.45  ? 198  TRP B CZ3 1 
ATOM   3510 C CH2 . TRP B 2 195 ? -15.435 -9.041  76.362 1.00 77.15  ? 198  TRP B CH2 1 
ATOM   3511 N N   . SER B 2 196 ? -9.720  -4.216  75.048 1.00 73.79  ? 199  SER B N   1 
ATOM   3512 C CA  . SER B 2 196 ? -8.786  -3.778  76.074 1.00 73.57  ? 199  SER B CA  1 
ATOM   3513 C C   . SER B 2 196 ? -9.122  -2.366  76.547 1.00 76.74  ? 199  SER B C   1 
ATOM   3514 O O   . SER B 2 196 ? -8.913  -2.031  77.711 1.00 75.84  ? 199  SER B O   1 
ATOM   3515 C CB  . SER B 2 196 ? -7.355  -3.828  75.541 1.00 77.27  ? 199  SER B CB  1 
ATOM   3516 O OG  . SER B 2 196 ? -7.085  -5.085  74.947 1.00 86.80  ? 199  SER B OG  1 
ATOM   3517 N N   . VAL B 2 197 ? -9.635  -1.545  75.635 1.00 73.18  ? 200  VAL B N   1 
ATOM   3518 C CA  . VAL B 2 197 ? -10.095 -0.201  75.975 1.00 73.05  ? 200  VAL B CA  1 
ATOM   3519 C C   . VAL B 2 197 ? -11.195 -0.254  77.039 1.00 76.29  ? 200  VAL B C   1 
ATOM   3520 O O   . VAL B 2 197 ? -11.082 0.366   78.097 1.00 75.42  ? 200  VAL B O   1 
ATOM   3521 C CB  . VAL B 2 197 ? -10.579 0.558   74.722 1.00 77.23  ? 200  VAL B CB  1 
ATOM   3522 C CG1 . VAL B 2 197 ? -11.100 1.938   75.100 1.00 77.13  ? 200  VAL B CG1 1 
ATOM   3523 C CG2 . VAL B 2 197 ? -9.463  0.668   73.700 1.00 77.17  ? 200  VAL B CG2 1 
ATOM   3524 N N   . GLY B 2 198 ? -12.260 -0.996  76.740 1.00 72.41  ? 201  GLY B N   1 
ATOM   3525 C CA  . GLY B 2 198 ? -13.382 -1.177  77.643 1.00 71.98  ? 201  GLY B CA  1 
ATOM   3526 C C   . GLY B 2 198 ? -12.986 -1.758  78.987 1.00 75.41  ? 201  GLY B C   1 
ATOM   3527 O O   . GLY B 2 198 ? -13.530 -1.363  80.019 1.00 74.88  ? 201  GLY B O   1 
ATOM   3528 N N   . CYS B 2 199 ? -12.058 -2.713  78.975 1.00 71.58  ? 202  CYS B N   1 
ATOM   3529 C CA  . CYS B 2 199 ? -11.535 -3.295  80.209 1.00 71.02  ? 202  CYS B CA  1 
ATOM   3530 C C   . CYS B 2 199 ? -10.735 -2.277  81.009 1.00 75.60  ? 202  CYS B C   1 
ATOM   3531 O O   . CYS B 2 199 ? -10.678 -2.348  82.233 1.00 75.78  ? 202  CYS B O   1 
ATOM   3532 C CB  . CYS B 2 199 ? -10.674 -4.521  79.913 1.00 70.89  ? 202  CYS B CB  1 
ATOM   3533 S SG  . CYS B 2 199 ? -11.585 -5.904  79.216 1.00 74.55  ? 202  CYS B SG  1 
ATOM   3534 N N   . ILE B 2 200 ? -10.086 -1.355  80.306 1.00 72.40  ? 203  ILE B N   1 
ATOM   3535 C CA  . ILE B 2 200 ? -9.437  -0.220  80.952 1.00 72.40  ? 203  ILE B CA  1 
ATOM   3536 C C   . ILE B 2 200 ? -10.524 0.772   81.348 1.00 76.65  ? 203  ILE B C   1 
ATOM   3537 O O   . ILE B 2 200 ? -10.481 1.371   82.421 1.00 76.07  ? 203  ILE B O   1 
ATOM   3538 C CB  . ILE B 2 200 ? -8.395  0.447   80.015 1.00 75.50  ? 203  ILE B CB  1 
ATOM   3539 C CG1 . ILE B 2 200 ? -7.372  -0.577  79.508 1.00 75.80  ? 203  ILE B CG1 1 
ATOM   3540 C CG2 . ILE B 2 200 ? -7.689  1.594   80.728 1.00 76.42  ? 203  ILE B CG2 1 
ATOM   3541 C CD1 . ILE B 2 200 ? -6.383  -1.039  80.552 1.00 81.84  ? 203  ILE B CD1 1 
ATOM   3542 N N   . PHE B 2 201 ? -11.504 0.929   80.464 1.00 73.76  ? 204  PHE B N   1 
ATOM   3543 C CA  . PHE B 2 201 ? -12.632 1.822   80.699 1.00 73.85  ? 204  PHE B CA  1 
ATOM   3544 C C   . PHE B 2 201 ? -13.271 1.560   82.056 1.00 79.05  ? 204  PHE B C   1 
ATOM   3545 O O   . PHE B 2 201 ? -13.319 2.443   82.911 1.00 79.20  ? 204  PHE B O   1 
ATOM   3546 C CB  . PHE B 2 201 ? -13.679 1.646   79.599 1.00 75.47  ? 204  PHE B CB  1 
ATOM   3547 C CG  . PHE B 2 201 ? -14.791 2.651   79.655 1.00 76.89  ? 204  PHE B CG  1 
ATOM   3548 C CD1 . PHE B 2 201 ? -14.715 3.743   80.502 1.00 79.92  ? 204  PHE B CD1 1 
ATOM   3549 C CD2 . PHE B 2 201 ? -15.910 2.509   78.850 1.00 78.82  ? 204  PHE B CD2 1 
ATOM   3550 C CE1 . PHE B 2 201 ? -15.736 4.674   80.545 1.00 80.75  ? 204  PHE B CE1 1 
ATOM   3551 C CE2 . PHE B 2 201 ? -16.931 3.437   78.888 1.00 81.44  ? 204  PHE B CE2 1 
ATOM   3552 C CZ  . PHE B 2 201 ? -16.847 4.517   79.739 1.00 79.51  ? 204  PHE B CZ  1 
ATOM   3553 N N   . ALA B 2 202 ? -13.786 0.349   82.235 1.00 75.80  ? 205  ALA B N   1 
ATOM   3554 C CA  . ALA B 2 202 ? -14.418 -0.042  83.487 1.00 75.84  ? 205  ALA B CA  1 
ATOM   3555 C C   . ALA B 2 202 ? -13.493 0.162   84.683 1.00 80.20  ? 205  ALA B C   1 
ATOM   3556 O O   . ALA B 2 202 ? -13.848 0.849   85.641 1.00 79.61  ? 205  ALA B O   1 
ATOM   3557 C CB  . ALA B 2 202 ? -14.886 -1.491  83.417 1.00 76.55  ? 205  ALA B CB  1 
ATOM   3558 N N   . GLU B 2 203 ? -12.302 -0.423  84.611 1.00 77.40  ? 206  GLU B N   1 
ATOM   3559 C CA  . GLU B 2 203 ? -11.366 -0.430  85.733 1.00 77.42  ? 206  GLU B CA  1 
ATOM   3560 C C   . GLU B 2 203 ? -10.964 0.957   86.233 1.00 82.82  ? 206  GLU B C   1 
ATOM   3561 O O   . GLU B 2 203 ? -10.339 1.084   87.283 1.00 82.75  ? 206  GLU B O   1 
ATOM   3562 C CB  . GLU B 2 203 ? -10.126 -1.256  85.393 1.00 78.61  ? 206  GLU B CB  1 
ATOM   3563 C CG  . GLU B 2 203 ? -9.032  -1.200  86.445 1.00 87.09  ? 206  GLU B CG  1 
ATOM   3564 C CD  . GLU B 2 203 ? -7.874  -2.118  86.125 1.00 100.91 ? 206  GLU B CD  1 
ATOM   3565 O OE1 . GLU B 2 203 ? -8.003  -2.922  85.178 1.00 93.47  ? 206  GLU B OE1 1 
ATOM   3566 O OE2 . GLU B 2 203 ? -6.844  -2.049  86.829 1.00 90.12  ? 206  GLU B OE2 1 
ATOM   3567 N N   . MET B 2 204 ? -11.319 1.994   85.485 1.00 80.66  ? 207  MET B N   1 
ATOM   3568 C CA  . MET B 2 204 ? -11.063 3.362   85.927 1.00 81.28  ? 207  MET B CA  1 
ATOM   3569 C C   . MET B 2 204 ? -12.093 3.819   86.957 1.00 87.40  ? 207  MET B C   1 
ATOM   3570 O O   . MET B 2 204 ? -11.778 4.583   87.873 1.00 87.08  ? 207  MET B O   1 
ATOM   3571 C CB  . MET B 2 204 ? -11.011 4.322   84.738 1.00 83.53  ? 207  MET B CB  1 
ATOM   3572 C CG  . MET B 2 204 ? -9.665  4.337   84.025 1.00 87.05  ? 207  MET B CG  1 
ATOM   3573 S SD  . MET B 2 204 ? -9.660  5.319   82.517 1.00 91.12  ? 207  MET B SD  1 
ATOM   3574 C CE  . MET B 2 204 ? -10.622 4.260   81.439 1.00 87.78  ? 207  MET B CE  1 
ATOM   3575 N N   . PHE B 2 205 ? -13.320 3.329   86.811 1.00 85.52  ? 208  PHE B N   1 
ATOM   3576 C CA  . PHE B 2 205 ? -14.358 3.547   87.811 1.00 86.03  ? 208  PHE B CA  1 
ATOM   3577 C C   . PHE B 2 205 ? -14.287 2.486   88.911 1.00 91.49  ? 208  PHE B C   1 
ATOM   3578 O O   . PHE B 2 205 ? -14.460 2.794   90.093 1.00 90.91  ? 208  PHE B O   1 
ATOM   3579 C CB  . PHE B 2 205 ? -15.742 3.569   87.159 1.00 87.80  ? 208  PHE B CB  1 
ATOM   3580 C CG  . PHE B 2 205 ? -15.964 4.743   86.248 1.00 89.36  ? 208  PHE B CG  1 
ATOM   3581 C CD1 . PHE B 2 205 ? -16.144 4.558   84.885 1.00 92.56  ? 208  PHE B CD1 1 
ATOM   3582 C CD2 . PHE B 2 205 ? -15.997 6.032   86.753 1.00 91.51  ? 208  PHE B CD2 1 
ATOM   3583 C CE1 . PHE B 2 205 ? -16.355 5.637   84.044 1.00 93.42  ? 208  PHE B CE1 1 
ATOM   3584 C CE2 . PHE B 2 205 ? -16.208 7.116   85.917 1.00 94.39  ? 208  PHE B CE2 1 
ATOM   3585 C CZ  . PHE B 2 205 ? -16.388 6.917   84.560 1.00 92.53  ? 208  PHE B CZ  1 
ATOM   3586 N N   . ARG B 2 206 ? -14.012 1.242   88.521 1.00 89.29  ? 209  ARG B N   1 
ATOM   3587 C CA  . ARG B 2 206 ? -13.708 0.187   89.485 1.00 89.63  ? 209  ARG B CA  1 
ATOM   3588 C C   . ARG B 2 206 ? -12.420 0.541   90.217 1.00 94.74  ? 209  ARG B C   1 
ATOM   3589 O O   . ARG B 2 206 ? -12.158 1.702   90.522 1.00 93.95  ? 209  ARG B O   1 
ATOM   3590 C CB  . ARG B 2 206 ? -13.489 -1.153  88.777 1.00 90.36  ? 209  ARG B CB  1 
ATOM   3591 C CG  . ARG B 2 206 ? -14.644 -1.672  87.945 1.00 103.39 ? 209  ARG B CG  1 
ATOM   3592 C CD  . ARG B 2 206 ? -14.232 -2.981  87.277 1.00 119.65 ? 209  ARG B CD  1 
ATOM   3593 N NE  . ARG B 2 206 ? -15.150 -3.403  86.222 1.00 135.23 ? 209  ARG B NE  1 
ATOM   3594 C CZ  . ARG B 2 206 ? -16.028 -4.393  86.347 1.00 153.00 ? 209  ARG B CZ  1 
ATOM   3595 N NH1 . ARG B 2 206 ? -16.113 -5.065  87.488 1.00 141.53 ? 209  ARG B NH1 1 
ATOM   3596 N NH2 . ARG B 2 206 ? -16.819 -4.714  85.331 1.00 140.59 ? 209  ARG B NH2 1 
ATOM   3597 N N   . ARG B 2 207 ? -11.599 -0.475  90.449 1.00 93.11  ? 210  ARG B N   1 
ATOM   3598 C CA  . ARG B 2 207 ? -10.248 -0.292  90.968 1.00 93.85  ? 210  ARG B CA  1 
ATOM   3599 C C   . ARG B 2 207 ? -9.501  -1.620  90.979 1.00 99.88  ? 210  ARG B C   1 
ATOM   3600 O O   . ARG B 2 207 ? -8.458  -1.763  91.621 1.00 99.05  ? 210  ARG B O   1 
ATOM   3601 C CB  . ARG B 2 207 ? -10.270 0.351   92.354 1.00 94.23  ? 210  ARG B CB  1 
ATOM   3602 C CG  . ARG B 2 207 ? -10.055 1.858   92.330 1.00 104.81 ? 210  ARG B CG  1 
ATOM   3603 C CD  . ARG B 2 207 ? -10.715 2.537   93.517 1.00 116.19 ? 210  ARG B CD  1 
ATOM   3604 N NE  . ARG B 2 207 ? -12.173 2.496   93.423 1.00 125.21 ? 210  ARG B NE  1 
ATOM   3605 C CZ  . ARG B 2 207 ? -12.998 2.987   94.342 1.00 138.07 ? 210  ARG B CZ  1 
ATOM   3606 N NH1 . ARG B 2 207 ? -12.513 3.559   95.437 1.00 124.59 ? 210  ARG B NH1 1 
ATOM   3607 N NH2 . ARG B 2 207 ? -14.310 2.905   94.168 1.00 123.99 ? 210  ARG B NH2 1 
ATOM   3608 N N   . LYS B 2 208 ? -10.050 -2.588  90.255 1.00 98.64  ? 211  LYS B N   1 
ATOM   3609 C CA  . LYS B 2 208 ? -9.353  -3.837  89.987 1.00 99.39  ? 211  LYS B CA  1 
ATOM   3610 C C   . LYS B 2 208 ? -9.806  -4.483  88.682 1.00 105.27 ? 211  LYS B C   1 
ATOM   3611 O O   . LYS B 2 208 ? -11.000 -4.538  88.377 1.00 104.65 ? 211  LYS B O   1 
ATOM   3612 C CB  . LYS B 2 208 ? -9.490  -4.813  91.156 1.00 101.90 ? 211  LYS B CB  1 
ATOM   3613 C CG  . LYS B 2 208 ? -8.479  -4.584  92.266 1.00 114.89 ? 211  LYS B CG  1 
ATOM   3614 C CD  . LYS B 2 208 ? -8.397  -5.785  93.193 1.00 125.12 ? 211  LYS B CD  1 
ATOM   3615 C CE  . LYS B 2 208 ? -7.307  -5.601  94.237 1.00 136.08 ? 211  LYS B CE  1 
ATOM   3616 N NZ  . LYS B 2 208 ? -7.248  -6.742  95.193 1.00 145.06 ? 211  LYS B NZ  1 
ATOM   3617 N N   . PRO B 2 209 ? -8.841  -4.964  87.884 1.00 103.57 ? 212  PRO B N   1 
ATOM   3618 C CA  . PRO B 2 209 ? -9.018  -5.650  86.604 1.00 104.01 ? 212  PRO B CA  1 
ATOM   3619 C C   . PRO B 2 209 ? -10.189 -6.632  86.621 1.00 109.24 ? 212  PRO B C   1 
ATOM   3620 O O   . PRO B 2 209 ? -10.065 -7.746  87.133 1.00 109.06 ? 212  PRO B O   1 
ATOM   3621 C CB  . PRO B 2 209 ? -7.700  -6.419  86.446 1.00 105.64 ? 212  PRO B CB  1 
ATOM   3622 C CG  . PRO B 2 209 ? -6.692  -5.677  87.308 1.00 109.80 ? 212  PRO B CG  1 
ATOM   3623 C CD  . PRO B 2 209 ? -7.425  -4.663  88.150 1.00 105.25 ? 212  PRO B CD  1 
ATOM   3624 N N   . LEU B 2 210 ? -11.325 -6.218  86.067 1.00 106.36 ? 213  LEU B N   1 
ATOM   3625 C CA  . LEU B 2 210 ? -12.409 -7.157  85.803 1.00 106.45 ? 213  LEU B CA  1 
ATOM   3626 C C   . LEU B 2 210 ? -11.884 -8.226  84.852 1.00 111.29 ? 213  LEU B C   1 
ATOM   3627 O O   . LEU B 2 210 ? -11.162 -7.918  83.903 1.00 111.17 ? 213  LEU B O   1 
ATOM   3628 C CB  . LEU B 2 210 ? -13.614 -6.444  85.188 1.00 106.46 ? 213  LEU B CB  1 
ATOM   3629 C CG  . LEU B 2 210 ? -13.362 -5.646  83.909 1.00 111.13 ? 213  LEU B CG  1 
ATOM   3630 C CD1 . LEU B 2 210 ? -14.680 -5.219  83.275 1.00 111.14 ? 213  LEU B CD1 1 
ATOM   3631 C CD2 . LEU B 2 210 ? -12.487 -4.437  84.205 1.00 113.81 ? 213  LEU B CD2 1 
ATOM   3632 N N   . PHE B 2 211 ? -12.224 -9.483  85.120 1.00 108.23 ? 214  PHE B N   1 
ATOM   3633 C CA  . PHE B 2 211 ? -11.632 -10.604 84.397 1.00 108.15 ? 214  PHE B CA  1 
ATOM   3634 C C   . PHE B 2 211 ? -10.145 -10.663 84.740 1.00 113.12 ? 214  PHE B C   1 
ATOM   3635 O O   . PHE B 2 211 ? -9.343  -9.925  84.169 1.00 112.70 ? 214  PHE B O   1 
ATOM   3636 C CB  . PHE B 2 211 ? -11.810 -10.425 82.886 1.00 109.69 ? 214  PHE B CB  1 
ATOM   3637 C CG  . PHE B 2 211 ? -13.125 -9.812  82.497 1.00 111.01 ? 214  PHE B CG  1 
ATOM   3638 C CD1 . PHE B 2 211 ? -14.269 -10.060 83.238 1.00 113.93 ? 214  PHE B CD1 1 
ATOM   3639 C CD2 . PHE B 2 211 ? -13.215 -8.979  81.393 1.00 112.88 ? 214  PHE B CD2 1 
ATOM   3640 C CE1 . PHE B 2 211 ? -15.479 -9.494  82.882 1.00 114.75 ? 214  PHE B CE1 1 
ATOM   3641 C CE2 . PHE B 2 211 ? -14.420 -8.410  81.032 1.00 115.61 ? 214  PHE B CE2 1 
ATOM   3642 C CZ  . PHE B 2 211 ? -15.554 -8.668  81.778 1.00 113.75 ? 214  PHE B CZ  1 
ATOM   3643 N N   . CYS B 2 212 ? -9.785  -11.523 85.690 1.00 110.49 ? 215  CYS B N   1 
ATOM   3644 C CA  . CYS B 2 212 ? -8.414  -11.569 86.190 1.00 110.76 ? 215  CYS B CA  1 
ATOM   3645 C C   . CYS B 2 212 ? -7.639  -12.846 85.882 1.00 116.01 ? 215  CYS B C   1 
ATOM   3646 O O   . CYS B 2 212 ? -7.889  -13.516 84.879 1.00 115.63 ? 215  CYS B O   1 
ATOM   3647 C CB  . CYS B 2 212 ? -8.361  -11.267 87.689 1.00 111.02 ? 215  CYS B CB  1 
ATOM   3648 S SG  . CYS B 2 212 ? -8.134  -9.521  88.085 1.00 114.87 ? 215  CYS B SG  1 
ATOM   3649 N N   . GLY B 2 213 ? -6.714  -13.180 86.779 1.00 113.55 ? 216  GLY B N   1 
ATOM   3650 C CA  . GLY B 2 213 ? -5.702  -14.203 86.583 1.00 113.82 ? 216  GLY B CA  1 
ATOM   3651 C C   . GLY B 2 213 ? -6.149  -15.539 86.021 1.00 118.85 ? 216  GLY B C   1 
ATOM   3652 O O   . GLY B 2 213 ? -7.073  -15.617 85.211 1.00 118.52 ? 216  GLY B O   1 
ATOM   3653 N N   . ASN B 2 214 ? -5.443  -16.594 86.420 1.00 116.02 ? 217  ASN B N   1 
ATOM   3654 C CA  . ASN B 2 214 ? -5.707  -17.939 85.922 1.00 115.91 ? 217  ASN B CA  1 
ATOM   3655 C C   . ASN B 2 214 ? -5.467  -18.055 84.416 1.00 120.03 ? 217  ASN B C   1 
ATOM   3656 O O   . ASN B 2 214 ? -5.107  -17.079 83.760 1.00 119.56 ? 217  ASN B O   1 
ATOM   3657 C CB  . ASN B 2 214 ? -7.118  -18.391 86.300 1.00 116.06 ? 217  ASN B CB  1 
ATOM   3658 C CG  . ASN B 2 214 ? -7.277  -18.611 87.794 1.00 136.98 ? 217  ASN B CG  1 
ATOM   3659 O OD1 . ASN B 2 214 ? -6.552  -18.025 88.599 1.00 129.87 ? 217  ASN B OD1 1 
ATOM   3660 N ND2 . ASN B 2 214 ? -8.216  -19.472 88.170 1.00 128.63 ? 217  ASN B ND2 1 
ATOM   3661 N N   . SER B 2 215 ? -5.653  -19.256 83.878 1.00 116.89 ? 218  SER B N   1 
ATOM   3662 C CA  . SER B 2 215 ? -5.297  -19.540 82.489 1.00 116.71 ? 218  SER B CA  1 
ATOM   3663 C C   . SER B 2 215 ? -6.318  -19.007 81.485 1.00 120.49 ? 218  SER B C   1 
ATOM   3664 O O   . SER B 2 215 ? -7.271  -18.321 81.857 1.00 120.02 ? 218  SER B O   1 
ATOM   3665 C CB  . SER B 2 215 ? -5.080  -21.043 82.287 1.00 120.15 ? 218  SER B CB  1 
ATOM   3666 O OG  . SER B 2 215 ? -4.610  -21.324 80.980 1.00 128.57 ? 218  SER B OG  1 
ATOM   3667 N N   . GLU B 2 216 ? -6.109  -19.332 80.211 1.00 116.90 ? 219  GLU B N   1 
ATOM   3668 C CA  . GLU B 2 216 ? -6.981  -18.867 79.135 1.00 116.52 ? 219  GLU B CA  1 
ATOM   3669 C C   . GLU B 2 216 ? -8.445  -19.216 79.382 1.00 120.49 ? 219  GLU B C   1 
ATOM   3670 O O   . GLU B 2 216 ? -9.331  -18.383 79.193 1.00 119.80 ? 219  GLU B O   1 
ATOM   3671 C CB  . GLU B 2 216 ? -6.536  -19.440 77.784 1.00 117.75 ? 219  GLU B CB  1 
ATOM   3672 C CG  . GLU B 2 216 ? -5.199  -18.918 77.271 1.00 126.01 ? 219  GLU B CG  1 
ATOM   3673 C CD  . GLU B 2 216 ? -4.020  -19.748 77.744 1.00 140.24 ? 219  GLU B CD  1 
ATOM   3674 O OE1 . GLU B 2 216 ? -4.107  -20.353 78.832 1.00 132.11 ? 219  GLU B OE1 1 
ATOM   3675 O OE2 . GLU B 2 216 ? -3.002  -19.793 77.021 1.00 130.34 ? 219  GLU B OE2 1 
ATOM   3676 N N   . ALA B 2 217 ? -8.693  -20.462 79.770 1.00 117.56 ? 220  ALA B N   1 
ATOM   3677 C CA  . ALA B 2 217 ? -10.051 -20.933 80.022 1.00 117.58 ? 220  ALA B CA  1 
ATOM   3678 C C   . ALA B 2 217 ? -10.669 -20.217 81.216 1.00 121.85 ? 220  ALA B C   1 
ATOM   3679 O O   . ALA B 2 217 ? -11.839 -19.835 81.183 1.00 121.52 ? 220  ALA B O   1 
ATOM   3680 C CB  . ALA B 2 217 ? -10.059 -22.440 80.240 1.00 118.32 ? 220  ALA B CB  1 
ATOM   3681 N N   . ASP B 2 218 ? -9.884  -20.058 82.277 1.00 118.56 ? 221  ASP B N   1 
ATOM   3682 C CA  . ASP B 2 218 ? -10.325 -19.313 83.452 1.00 118.47 ? 221  ASP B CA  1 
ATOM   3683 C C   . ASP B 2 218 ? -10.515 -17.844 83.093 1.00 122.32 ? 221  ASP B C   1 
ATOM   3684 O O   . ASP B 2 218 ? -11.480 -17.207 83.517 1.00 121.90 ? 221  ASP B O   1 
ATOM   3685 C CB  . ASP B 2 218 ? -9.303  -19.445 84.584 1.00 120.33 ? 221  ASP B CB  1 
ATOM   3686 C CG  . ASP B 2 218 ? -9.241  -20.850 85.159 1.00 129.98 ? 221  ASP B CG  1 
ATOM   3687 O OD1 . ASP B 2 218 ? -10.305 -21.398 85.520 1.00 130.11 ? 221  ASP B OD1 1 
ATOM   3688 O OD2 . ASP B 2 218 ? -8.122  -21.392 85.282 1.00 135.89 ? 221  ASP B OD2 1 
ATOM   3689 N N   . GLN B 2 219 ? -9.583  -17.314 82.309 1.00 118.78 ? 222  GLN B N   1 
ATOM   3690 C CA  . GLN B 2 219 ? -9.672  -15.943 81.825 1.00 118.47 ? 222  GLN B CA  1 
ATOM   3691 C C   . GLN B 2 219 ? -10.874 -15.777 80.902 1.00 122.39 ? 222  GLN B C   1 
ATOM   3692 O O   . GLN B 2 219 ? -11.668 -14.851 81.060 1.00 121.85 ? 222  GLN B O   1 
ATOM   3693 C CB  . GLN B 2 219 ? -8.385  -15.555 81.091 1.00 119.65 ? 222  GLN B CB  1 
ATOM   3694 C CG  . GLN B 2 219 ? -8.402  -14.153 80.508 1.00 130.68 ? 222  GLN B CG  1 
ATOM   3695 C CD  . GLN B 2 219 ? -8.765  -13.101 81.535 1.00 147.17 ? 222  GLN B CD  1 
ATOM   3696 O OE1 . GLN B 2 219 ? -9.768  -12.402 81.396 1.00 142.38 ? 222  GLN B OE1 1 
ATOM   3697 N NE2 . GLN B 2 219 ? -7.952  -12.987 82.577 1.00 138.65 ? 222  GLN B NE2 1 
ATOM   3698 N N   . LEU B 2 220 ? -11.011 -16.696 79.952 1.00 119.19 ? 223  LEU B N   1 
ATOM   3699 C CA  . LEU B 2 220 ? -12.095 -16.639 78.978 1.00 119.11 ? 223  LEU B CA  1 
ATOM   3700 C C   . LEU B 2 220 ? -13.444 -16.917 79.640 1.00 123.30 ? 223  LEU B C   1 
ATOM   3701 O O   . LEU B 2 220 ? -14.486 -16.472 79.158 1.00 122.86 ? 223  LEU B O   1 
ATOM   3702 C CB  . LEU B 2 220 ? -11.840 -17.635 77.844 1.00 119.13 ? 223  LEU B CB  1 
ATOM   3703 C CG  . LEU B 2 220 ? -12.411 -17.274 76.471 1.00 123.76 ? 223  LEU B CG  1 
ATOM   3704 C CD1 . LEU B 2 220 ? -11.967 -18.281 75.423 1.00 123.90 ? 223  LEU B CD1 1 
ATOM   3705 C CD2 . LEU B 2 220 ? -13.926 -17.170 76.512 1.00 126.08 ? 223  LEU B CD2 1 
ATOM   3706 N N   . GLY B 2 221 ? -13.417 -17.641 80.753 1.00 120.06 ? 224  GLY B N   1 
ATOM   3707 C CA  . GLY B 2 221 ? -14.620 -17.934 81.510 1.00 119.94 ? 224  GLY B CA  1 
ATOM   3708 C C   . GLY B 2 221 ? -15.122 -16.729 82.281 1.00 123.81 ? 224  GLY B C   1 
ATOM   3709 O O   . GLY B 2 221 ? -16.317 -16.431 82.277 1.00 123.24 ? 224  GLY B O   1 
ATOM   3710 N N   . LYS B 2 222 ? -14.201 -16.024 82.933 1.00 120.46 ? 225  LYS B N   1 
ATOM   3711 C CA  . LYS B 2 222 ? -14.550 -14.855 83.731 1.00 120.23 ? 225  LYS B CA  1 
ATOM   3712 C C   . LYS B 2 222 ? -15.122 -13.730 82.872 1.00 124.46 ? 225  LYS B C   1 
ATOM   3713 O O   . LYS B 2 222 ? -15.711 -12.781 83.388 1.00 124.16 ? 225  LYS B O   1 
ATOM   3714 C CB  . LYS B 2 222 ? -13.338 -14.358 84.521 1.00 122.41 ? 225  LYS B CB  1 
ATOM   3715 C CG  . LYS B 2 222 ? -13.675 -13.321 85.579 1.00 134.24 ? 225  LYS B CG  1 
ATOM   3716 C CD  . LYS B 2 222 ? -12.491 -13.055 86.494 1.00 143.47 ? 225  LYS B CD  1 
ATOM   3717 C CE  . LYS B 2 222 ? -12.861 -12.085 87.607 1.00 153.14 ? 225  LYS B CE  1 
ATOM   3718 N NZ  . LYS B 2 222 ? -11.716 -11.816 88.522 1.00 161.35 ? 225  LYS B NZ  1 
ATOM   3719 N N   . ILE B 2 223 ? -14.957 -13.850 81.559 1.00 121.14 ? 226  ILE B N   1 
ATOM   3720 C CA  . ILE B 2 223 ? -15.495 -12.866 80.627 1.00 121.02 ? 226  ILE B CA  1 
ATOM   3721 C C   . ILE B 2 223 ? -16.990 -13.083 80.407 1.00 125.14 ? 226  ILE B C   1 
ATOM   3722 O O   . ILE B 2 223 ? -17.775 -12.135 80.430 1.00 124.70 ? 226  ILE B O   1 
ATOM   3723 C CB  . ILE B 2 223 ? -14.716 -12.869 79.295 1.00 124.09 ? 226  ILE B CB  1 
ATOM   3724 C CG1 . ILE B 2 223 ? -13.321 -12.270 79.493 1.00 124.47 ? 226  ILE B CG1 1 
ATOM   3725 C CG2 . ILE B 2 223 ? -15.487 -12.114 78.222 1.00 124.66 ? 226  ILE B CG2 1 
ATOM   3726 C CD1 . ILE B 2 223 ? -12.399 -12.456 78.310 1.00 130.95 ? 226  ILE B CD1 1 
ATOM   3727 N N   . PHE B 2 224 ? -17.381 -14.339 80.221 1.00 121.79 ? 227  PHE B N   1 
ATOM   3728 C CA  . PHE B 2 224 ? -18.780 -14.681 80.001 1.00 121.53 ? 227  PHE B CA  1 
ATOM   3729 C C   . PHE B 2 224 ? -19.634 -14.380 81.227 1.00 125.30 ? 227  PHE B C   1 
ATOM   3730 O O   . PHE B 2 224 ? -20.811 -14.044 81.105 1.00 124.79 ? 227  PHE B O   1 
ATOM   3731 C CB  . PHE B 2 224 ? -18.914 -16.152 79.612 1.00 123.35 ? 227  PHE B CB  1 
ATOM   3732 C CG  . PHE B 2 224 ? -18.247 -16.496 78.312 1.00 124.95 ? 227  PHE B CG  1 
ATOM   3733 C CD1 . PHE B 2 224 ? -17.389 -17.578 78.223 1.00 128.15 ? 227  PHE B CD1 1 
ATOM   3734 C CD2 . PHE B 2 224 ? -18.477 -15.736 77.176 1.00 127.10 ? 227  PHE B CD2 1 
ATOM   3735 C CE1 . PHE B 2 224 ? -16.777 -17.899 77.025 1.00 129.11 ? 227  PHE B CE1 1 
ATOM   3736 C CE2 . PHE B 2 224 ? -17.865 -16.050 75.977 1.00 129.93 ? 227  PHE B CE2 1 
ATOM   3737 C CZ  . PHE B 2 224 ? -17.013 -17.133 75.901 1.00 128.07 ? 227  PHE B CZ  1 
ATOM   3738 N N   . ASP B 2 225 ? -19.036 -14.505 82.408 1.00 122.04 ? 228  ASP B N   1 
ATOM   3739 C CA  . ASP B 2 225 ? -19.721 -14.179 83.657 1.00 121.92 ? 228  ASP B CA  1 
ATOM   3740 C C   . ASP B 2 225 ? -20.417 -12.821 83.589 1.00 126.43 ? 228  ASP B C   1 
ATOM   3741 O O   . ASP B 2 225 ? -21.569 -12.683 84.004 1.00 126.08 ? 228  ASP B O   1 
ATOM   3742 C CB  . ASP B 2 225 ? -18.743 -14.200 84.837 1.00 123.49 ? 228  ASP B CB  1 
ATOM   3743 C CG  . ASP B 2 225 ? -18.425 -15.605 85.311 1.00 130.57 ? 228  ASP B CG  1 
ATOM   3744 O OD1 . ASP B 2 225 ? -18.695 -16.566 84.562 1.00 130.88 ? 228  ASP B OD1 1 
ATOM   3745 O OD2 . ASP B 2 225 ? -17.904 -15.748 86.437 1.00 134.92 ? 228  ASP B OD2 1 
ATOM   3746 N N   . LEU B 2 226 ? -19.713 -11.823 83.062 1.00 123.25 ? 229  LEU B N   1 
ATOM   3747 C CA  . LEU B 2 226 ? -20.227 -10.459 83.028 1.00 123.22 ? 229  LEU B CA  1 
ATOM   3748 C C   . LEU B 2 226 ? -20.927 -10.139 81.709 1.00 127.45 ? 229  LEU B C   1 
ATOM   3749 O O   . LEU B 2 226 ? -21.923 -9.414  81.685 1.00 127.11 ? 229  LEU B O   1 
ATOM   3750 C CB  . LEU B 2 226 ? -19.100 -9.458  83.291 1.00 123.30 ? 229  LEU B CB  1 
ATOM   3751 C CG  . LEU B 2 226 ? -19.506 -8.060  83.764 1.00 128.03 ? 229  LEU B CG  1 
ATOM   3752 C CD1 . LEU B 2 226 ? -18.275 -7.232  84.107 1.00 128.18 ? 229  LEU B CD1 1 
ATOM   3753 C CD2 . LEU B 2 226 ? -20.356 -7.351  82.723 1.00 130.45 ? 229  LEU B CD2 1 
ATOM   3754 N N   . ILE B 2 227 ? -20.413 -10.694 80.616 1.00 124.20 ? 230  ILE B N   1 
ATOM   3755 C CA  . ILE B 2 227 ? -20.994 -10.461 79.297 1.00 124.21 ? 230  ILE B CA  1 
ATOM   3756 C C   . ILE B 2 227 ? -22.092 -11.472 78.976 1.00 128.33 ? 230  ILE B C   1 
ATOM   3757 O O   . ILE B 2 227 ? -22.972 -11.204 78.158 1.00 127.85 ? 230  ILE B O   1 
ATOM   3758 C CB  . ILE B 2 227 ? -19.910 -10.444 78.196 1.00 127.38 ? 230  ILE B CB  1 
ATOM   3759 C CG1 . ILE B 2 227 ? -20.512 -10.029 76.851 1.00 127.75 ? 230  ILE B CG1 1 
ATOM   3760 C CG2 . ILE B 2 227 ? -19.244 -11.807 78.081 1.00 128.26 ? 230  ILE B CG2 1 
ATOM   3761 C CD1 . ILE B 2 227 ? -20.933 -8.579  76.784 1.00 135.06 ? 230  ILE B CD1 1 
ATOM   3762 N N   . GLY B 2 228 ? -22.046 -12.625 79.635 1.00 125.21 ? 231  GLY B N   1 
ATOM   3763 C CA  . GLY B 2 228 ? -22.958 -13.718 79.346 1.00 125.13 ? 231  GLY B CA  1 
ATOM   3764 C C   . GLY B 2 228 ? -22.495 -14.502 78.133 1.00 129.23 ? 231  GLY B C   1 
ATOM   3765 O O   . GLY B 2 228 ? -22.054 -13.919 77.141 1.00 128.79 ? 231  GLY B O   1 
ATOM   3766 N N   . LEU B 2 229 ? -22.580 -15.827 78.215 1.00 125.96 ? 232  LEU B N   1 
ATOM   3767 C CA  . LEU B 2 229 ? -22.131 -16.691 77.128 1.00 125.80 ? 232  LEU B CA  1 
ATOM   3768 C C   . LEU B 2 229 ? -22.719 -16.259 75.789 1.00 129.82 ? 232  LEU B C   1 
ATOM   3769 O O   . LEU B 2 229 ? -23.837 -15.748 75.724 1.00 129.17 ? 232  LEU B O   1 
ATOM   3770 C CB  . LEU B 2 229 ? -22.486 -18.150 77.414 1.00 125.82 ? 232  LEU B CB  1 
ATOM   3771 C CG  . LEU B 2 229 ? -21.864 -19.178 76.468 1.00 130.46 ? 232  LEU B CG  1 
ATOM   3772 C CD1 . LEU B 2 229 ? -20.350 -19.199 76.622 1.00 130.53 ? 232  LEU B CD1 1 
ATOM   3773 C CD2 . LEU B 2 229 ? -22.454 -20.559 76.706 1.00 132.95 ? 232  LEU B CD2 1 
ATOM   3774 N N   . PRO B 2 230 ? -21.959 -16.449 74.700 1.00 126.81 ? 233  PRO B N   1 
ATOM   3775 C CA  . PRO B 2 230 ? -22.429 -16.052 73.371 1.00 126.85 ? 233  PRO B CA  1 
ATOM   3776 C C   . PRO B 2 230 ? -23.093 -17.208 72.630 1.00 131.38 ? 233  PRO B C   1 
ATOM   3777 O O   . PRO B 2 230 ? -22.416 -18.061 72.056 1.00 130.99 ? 233  PRO B O   1 
ATOM   3778 C CB  . PRO B 2 230 ? -21.138 -15.646 72.659 1.00 128.54 ? 233  PRO B CB  1 
ATOM   3779 C CG  . PRO B 2 230 ? -20.089 -16.489 73.291 1.00 132.80 ? 233  PRO B CG  1 
ATOM   3780 C CD  . PRO B 2 230 ? -20.504 -16.685 74.726 1.00 128.34 ? 233  PRO B CD  1 
ATOM   3781 N N   . PRO B 2 231 ? -24.433 -17.255 72.648 1.00 128.42 ? 234  PRO B N   1 
ATOM   3782 C CA  . PRO B 2 231 ? -25.129 -18.271 71.853 1.00 128.42 ? 234  PRO B CA  1 
ATOM   3783 C C   . PRO B 2 231 ? -24.657 -18.245 70.403 1.00 132.45 ? 234  PRO B C   1 
ATOM   3784 O O   . PRO B 2 231 ? -24.163 -17.225 69.919 1.00 132.02 ? 234  PRO B O   1 
ATOM   3785 C CB  . PRO B 2 231 ? -26.600 -17.845 71.943 1.00 130.22 ? 234  PRO B CB  1 
ATOM   3786 C CG  . PRO B 2 231 ? -26.564 -16.398 72.303 1.00 134.63 ? 234  PRO B CG  1 
ATOM   3787 C CD  . PRO B 2 231 ? -25.355 -16.232 73.169 1.00 130.12 ? 234  PRO B CD  1 
ATOM   3788 N N   . GLU B 2 232 ? -24.805 -19.372 69.717 1.00 129.03 ? 235  GLU B N   1 
ATOM   3789 C CA  . GLU B 2 232 ? -24.312 -19.507 68.351 1.00 128.83 ? 235  GLU B CA  1 
ATOM   3790 C C   . GLU B 2 232 ? -25.303 -18.960 67.328 1.00 132.28 ? 235  GLU B C   1 
ATOM   3791 O O   . GLU B 2 232 ? -26.511 -18.942 67.569 1.00 131.68 ? 235  GLU B O   1 
ATOM   3792 C CB  . GLU B 2 232 ? -23.975 -20.968 68.048 1.00 130.25 ? 235  GLU B CB  1 
ATOM   3793 C CG  . GLU B 2 232 ? -22.754 -21.486 68.797 1.00 140.44 ? 235  GLU B CG  1 
ATOM   3794 C CD  . GLU B 2 232 ? -22.842 -21.255 70.295 1.00 158.67 ? 235  GLU B CD  1 
ATOM   3795 O OE1 . GLU B 2 232 ? -23.925 -21.485 70.874 1.00 149.85 ? 235  GLU B OE1 1 
ATOM   3796 O OE2 . GLU B 2 232 ? -21.827 -20.843 70.892 1.00 152.68 ? 235  GLU B OE2 1 
ATOM   3797 N N   . ASP B 2 233 ? -24.790 -18.557 66.169 1.00 128.68 ? 236  ASP B N   1 
ATOM   3798 C CA  . ASP B 2 233 ? -23.371 -18.713 65.853 1.00 128.31 ? 236  ASP B CA  1 
ATOM   3799 C C   . ASP B 2 233 ? -22.558 -17.461 66.174 1.00 130.82 ? 236  ASP B C   1 
ATOM   3800 O O   . ASP B 2 233 ? -22.287 -16.647 65.291 1.00 130.25 ? 236  ASP B O   1 
ATOM   3801 C CB  . ASP B 2 233 ? -23.189 -19.072 64.376 1.00 130.43 ? 236  ASP B CB  1 
ATOM   3802 C CG  . ASP B 2 233 ? -24.088 -20.212 63.934 1.00 142.89 ? 236  ASP B CG  1 
ATOM   3803 O OD1 . ASP B 2 233 ? -24.917 -20.675 64.747 1.00 143.88 ? 236  ASP B OD1 1 
ATOM   3804 O OD2 . ASP B 2 233 ? -23.973 -20.637 62.765 1.00 149.31 ? 236  ASP B OD2 1 
ATOM   3805 N N   . ASP B 2 234 ? -22.161 -17.319 67.434 1.00 126.48 ? 237  ASP B N   1 
ATOM   3806 C CA  . ASP B 2 234 ? -21.244 -16.255 67.834 1.00 125.84 ? 237  ASP B CA  1 
ATOM   3807 C C   . ASP B 2 234 ? -19.869 -16.836 68.147 1.00 128.87 ? 237  ASP B C   1 
ATOM   3808 O O   . ASP B 2 234 ? -19.225 -16.442 69.120 1.00 128.37 ? 237  ASP B O   1 
ATOM   3809 C CB  . ASP B 2 234 ? -21.784 -15.506 69.053 1.00 127.51 ? 237  ASP B CB  1 
ATOM   3810 C CG  . ASP B 2 234 ? -22.834 -14.477 68.687 1.00 135.65 ? 237  ASP B CG  1 
ATOM   3811 O OD1 . ASP B 2 234 ? -22.544 -13.610 67.835 1.00 136.05 ? 237  ASP B OD1 1 
ATOM   3812 O OD2 . ASP B 2 234 ? -23.934 -14.513 69.277 1.00 140.42 ? 237  ASP B OD2 1 
ATOM   3813 N N   . TRP B 2 235 ? -19.418 -17.759 67.303 1.00 124.77 ? 238  TRP B N   1 
ATOM   3814 C CA  . TRP B 2 235 ? -18.178 -18.483 67.557 1.00 142.12 ? 238  TRP B CA  1 
ATOM   3815 C C   . TRP B 2 235 ? -17.386 -18.683 66.268 1.00 152.73 ? 238  TRP B C   1 
ATOM   3816 O O   . TRP B 2 235 ? -16.183 -18.425 66.219 1.00 106.48 ? 238  TRP B O   1 
ATOM   3817 C CB  . TRP B 2 235 ? -18.491 -19.837 68.193 1.00 140.80 ? 238  TRP B CB  1 
ATOM   3818 C CG  . TRP B 2 235 ? -17.579 -20.195 69.321 1.00 141.57 ? 238  TRP B CG  1 
ATOM   3819 C CD1 . TRP B 2 235 ? -16.318 -20.704 69.227 1.00 144.61 ? 238  TRP B CD1 1 
ATOM   3820 C CD2 . TRP B 2 235 ? -17.861 -20.069 70.723 1.00 141.31 ? 238  TRP B CD2 1 
ATOM   3821 N NE1 . TRP B 2 235 ? -15.796 -20.904 70.484 1.00 143.91 ? 238  TRP B NE1 1 
ATOM   3822 C CE2 . TRP B 2 235 ? -16.721 -20.525 71.414 1.00 145.35 ? 238  TRP B CE2 1 
ATOM   3823 C CE3 . TRP B 2 235 ? -18.963 -19.620 71.452 1.00 142.78 ? 238  TRP B CE3 1 
ATOM   3824 C CZ2 . TRP B 2 235 ? -16.657 -20.540 72.808 1.00 144.55 ? 238  TRP B CZ2 1 
ATOM   3825 C CZ3 . TRP B 2 235 ? -18.895 -19.636 72.833 1.00 143.82 ? 238  TRP B CZ3 1 
ATOM   3826 C CH2 . TRP B 2 235 ? -17.750 -20.093 73.496 1.00 144.82 ? 238  TRP B CH2 1 
ATOM   3827 N N   . VAL B 2 258 ? -23.166 -3.679  88.186 1.00 111.54 ? 261  VAL B N   1 
ATOM   3828 C CA  . VAL B 2 258 ? -23.106 -2.706  89.271 1.00 111.47 ? 261  VAL B CA  1 
ATOM   3829 C C   . VAL B 2 258 ? -22.276 -1.490  88.876 1.00 114.87 ? 261  VAL B C   1 
ATOM   3830 O O   . VAL B 2 258 ? -21.264 -1.184  89.505 1.00 114.44 ? 261  VAL B O   1 
ATOM   3831 C CB  . VAL B 2 258 ? -22.581 -3.343  90.577 1.00 115.67 ? 261  VAL B CB  1 
ATOM   3832 C CG1 . VAL B 2 258 ? -22.566 -2.318  91.708 1.00 115.43 ? 261  VAL B CG1 1 
ATOM   3833 C CG2 . VAL B 2 258 ? -23.421 -4.554  90.956 1.00 115.59 ? 261  VAL B CG2 1 
ATOM   3834 N N   . PRO B 2 259 ? -22.711 -0.769  87.833 1.00 111.11 ? 262  PRO B N   1 
ATOM   3835 C CA  . PRO B 2 259 ? -22.011 0.415   87.324 1.00 110.77 ? 262  PRO B CA  1 
ATOM   3836 C C   . PRO B 2 259 ? -21.715 1.450   88.412 1.00 113.89 ? 262  PRO B C   1 
ATOM   3837 O O   . PRO B 2 259 ? -22.403 1.508   89.433 1.00 113.32 ? 262  PRO B O   1 
ATOM   3838 C CB  . PRO B 2 259 ? -23.000 0.984   86.307 1.00 112.53 ? 262  PRO B CB  1 
ATOM   3839 C CG  . PRO B 2 259 ? -23.735 -0.216  85.797 1.00 116.99 ? 262  PRO B CG  1 
ATOM   3840 C CD  . PRO B 2 259 ? -23.775 -1.225  86.919 1.00 112.53 ? 262  PRO B CD  1 
ATOM   3841 N N   . GLU B 2 260 ? -20.668 2.242   88.196 1.00 109.81 ? 263  GLU B N   1 
ATOM   3842 C CA  . GLU B 2 260 ? -20.357 3.374   89.066 1.00 109.20 ? 263  GLU B CA  1 
ATOM   3843 C C   . GLU B 2 260 ? -20.263 4.663   88.252 1.00 111.79 ? 263  GLU B C   1 
ATOM   3844 O O   . GLU B 2 260 ? -20.012 5.738   88.798 1.00 111.31 ? 263  GLU B O   1 
ATOM   3845 C CB  . GLU B 2 260 ? -19.045 3.140   89.819 1.00 110.59 ? 263  GLU B CB  1 
ATOM   3846 C CG  . GLU B 2 260 ? -19.065 1.949   90.759 1.00 121.21 ? 263  GLU B CG  1 
ATOM   3847 C CD  . GLU B 2 260 ? -19.014 0.626   90.025 1.00 141.01 ? 263  GLU B CD  1 
ATOM   3848 O OE1 . GLU B 2 260 ? -18.761 0.632   88.801 1.00 134.35 ? 263  GLU B OE1 1 
ATOM   3849 O OE2 . GLU B 2 260 ? -19.213 -0.421  90.674 1.00 135.40 ? 263  GLU B OE2 1 
ATOM   3850 N N   . MET B 2 261 ? -20.458 4.539   86.942 1.00 107.23 ? 264  MET B N   1 
ATOM   3851 C CA  . MET B 2 261 ? -20.427 5.680   86.035 1.00 106.48 ? 264  MET B CA  1 
ATOM   3852 C C   . MET B 2 261 ? -21.836 5.991   85.544 1.00 108.53 ? 264  MET B C   1 
ATOM   3853 O O   . MET B 2 261 ? -22.782 5.265   85.850 1.00 108.08 ? 264  MET B O   1 
ATOM   3854 C CB  . MET B 2 261 ? -19.531 5.370   84.835 1.00 108.89 ? 264  MET B CB  1 
ATOM   3855 C CG  . MET B 2 261 ? -19.966 4.135   84.061 1.00 112.68 ? 264  MET B CG  1 
ATOM   3856 S SD  . MET B 2 261 ? -18.857 3.691   82.713 1.00 116.99 ? 264  MET B SD  1 
ATOM   3857 C CE  . MET B 2 261 ? -19.523 2.091   82.253 1.00 113.66 ? 264  MET B CE  1 
ATOM   3858 N N   . GLU B 2 262 ? -21.968 7.061   84.765 1.00 103.61 ? 265  GLU B N   1 
ATOM   3859 C CA  . GLU B 2 262 ? -23.251 7.408   84.165 1.00 102.62 ? 265  GLU B CA  1 
ATOM   3860 C C   . GLU B 2 262 ? -23.852 6.205   83.454 1.00 104.94 ? 265  GLU B C   1 
ATOM   3861 O O   . GLU B 2 262 ? -23.139 5.280   83.067 1.00 104.42 ? 265  GLU B O   1 
ATOM   3862 C CB  . GLU B 2 262 ? -23.101 8.569   83.178 1.00 103.93 ? 265  GLU B CB  1 
ATOM   3863 C CG  . GLU B 2 262 ? -23.092 9.947   83.819 1.00 113.93 ? 265  GLU B CG  1 
ATOM   3864 C CD  . GLU B 2 262 ? -23.236 11.065  82.799 1.00 132.67 ? 265  GLU B CD  1 
ATOM   3865 O OE1 . GLU B 2 262 ? -22.903 10.843  81.615 1.00 124.45 ? 265  GLU B OE1 1 
ATOM   3866 O OE2 . GLU B 2 262 ? -23.686 12.166  83.181 1.00 125.90 ? 265  GLU B OE2 1 
ATOM   3867 N N   . GLU B 2 263 ? -25.170 6.216   83.301 1.00 100.47 ? 266  GLU B N   1 
ATOM   3868 C CA  . GLU B 2 263 ? -25.858 5.170   82.563 1.00 99.71  ? 266  GLU B CA  1 
ATOM   3869 C C   . GLU B 2 263 ? -25.334 5.169   81.132 1.00 102.51 ? 266  GLU B C   1 
ATOM   3870 O O   . GLU B 2 263 ? -25.088 4.113   80.549 1.00 102.23 ? 266  GLU B O   1 
ATOM   3871 C CB  . GLU B 2 263 ? -27.366 5.425   82.570 1.00 101.04 ? 266  GLU B CB  1 
ATOM   3872 C CG  . GLU B 2 263 ? -27.884 6.043   83.864 1.00 110.92 ? 266  GLU B CG  1 
ATOM   3873 C CD  . GLU B 2 263 ? -27.537 5.222   85.094 1.00 127.78 ? 266  GLU B CD  1 
ATOM   3874 O OE1 . GLU B 2 263 ? -27.822 4.006   85.101 1.00 120.11 ? 266  GLU B OE1 1 
ATOM   3875 O OE2 . GLU B 2 263 ? -27.013 5.801   86.069 1.00 119.25 ? 266  GLU B OE2 1 
ATOM   3876 N N   . SER B 2 264 ? -25.124 6.366   80.592 1.00 97.97  ? 267  SER B N   1 
ATOM   3877 C CA  . SER B 2 264 ? -24.599 6.528   79.241 1.00 97.17  ? 267  SER B CA  1 
ATOM   3878 C C   . SER B 2 264 ? -23.214 5.901   79.114 1.00 99.38  ? 267  SER B C   1 
ATOM   3879 O O   . SER B 2 264 ? -22.877 5.319   78.081 1.00 98.77  ? 267  SER B O   1 
ATOM   3880 C CB  . SER B 2 264 ? -24.538 8.010   78.873 1.00 100.68 ? 267  SER B CB  1 
ATOM   3881 O OG  . SER B 2 264 ? -25.762 8.653   79.180 1.00 110.30 ? 267  SER B OG  1 
ATOM   3882 N N   . GLY B 2 265 ? -22.416 6.025   80.169 1.00 94.71  ? 268  GLY B N   1 
ATOM   3883 C CA  . GLY B 2 265 ? -21.097 5.427   80.217 1.00 94.02  ? 268  GLY B CA  1 
ATOM   3884 C C   . GLY B 2 265 ? -21.131 3.938   79.931 1.00 96.56  ? 268  GLY B C   1 
ATOM   3885 O O   . GLY B 2 265 ? -20.456 3.458   79.017 1.00 96.37  ? 268  GLY B O   1 
ATOM   3886 N N   . ALA B 2 266 ? -21.941 3.210   80.694 1.00 91.63  ? 269  ALA B N   1 
ATOM   3887 C CA  . ALA B 2 266 ? -22.016 1.757   80.574 1.00 90.74  ? 269  ALA B CA  1 
ATOM   3888 C C   . ALA B 2 266 ? -22.548 1.310   79.215 1.00 92.45  ? 269  ALA B C   1 
ATOM   3889 O O   . ALA B 2 266 ? -22.388 0.153   78.824 1.00 91.48  ? 269  ALA B O   1 
ATOM   3890 C CB  . ALA B 2 266 ? -22.863 1.177   81.696 1.00 91.55  ? 269  ALA B CB  1 
ATOM   3891 N N   . GLN B 2 267 ? -23.199 2.227   78.508 1.00 88.10  ? 270  GLN B N   1 
ATOM   3892 C CA  . GLN B 2 267 ? -23.674 1.956   77.157 1.00 87.52  ? 270  GLN B CA  1 
ATOM   3893 C C   . GLN B 2 267 ? -22.479 1.670   76.256 1.00 89.76  ? 270  GLN B C   1 
ATOM   3894 O O   . GLN B 2 267 ? -22.391 0.611   75.637 1.00 89.16  ? 270  GLN B O   1 
ATOM   3895 C CB  . GLN B 2 267 ? -24.446 3.161   76.610 1.00 89.07  ? 270  GLN B CB  1 
ATOM   3896 C CG  . GLN B 2 267 ? -25.438 3.773   77.589 1.00 107.42 ? 270  GLN B CG  1 
ATOM   3897 C CD  . GLN B 2 267 ? -26.517 2.798   78.025 1.00 129.23 ? 270  GLN B CD  1 
ATOM   3898 O OE1 . GLN B 2 267 ? -26.918 1.914   77.267 1.00 125.11 ? 270  GLN B OE1 1 
ATOM   3899 N NE2 . GLN B 2 267 ? -26.999 2.963   79.252 1.00 121.75 ? 270  GLN B NE2 1 
ATOM   3900 N N   . LEU B 2 268 ? -21.564 2.632   76.196 1.00 85.27  ? 271  LEU B N   1 
ATOM   3901 C CA  . LEU B 2 268 ? -20.334 2.511   75.420 1.00 84.37  ? 271  LEU B CA  1 
ATOM   3902 C C   . LEU B 2 268 ? -19.518 1.289   75.836 1.00 86.18  ? 271  LEU B C   1 
ATOM   3903 O O   . LEU B 2 268 ? -18.998 0.563   74.989 1.00 85.69  ? 271  LEU B O   1 
ATOM   3904 C CB  . LEU B 2 268 ? -19.486 3.776   75.588 1.00 84.40  ? 271  LEU B CB  1 
ATOM   3905 C CG  . LEU B 2 268 ? -18.204 3.887   74.765 1.00 88.95  ? 271  LEU B CG  1 
ATOM   3906 C CD1 . LEU B 2 268 ? -18.538 4.073   73.293 1.00 89.18  ? 271  LEU B CD1 1 
ATOM   3907 C CD2 . LEU B 2 268 ? -17.352 5.038   75.273 1.00 91.09  ? 271  LEU B CD2 1 
ATOM   3908 N N   . LEU B 2 269 ? -19.411 1.069   77.143 1.00 81.33  ? 272  LEU B N   1 
ATOM   3909 C CA  . LEU B 2 269 ? -18.603 -0.024  77.670 1.00 80.75  ? 272  LEU B CA  1 
ATOM   3910 C C   . LEU B 2 269 ? -18.983 -1.385  77.094 1.00 84.33  ? 272  LEU B C   1 
ATOM   3911 O O   . LEU B 2 269 ? -18.114 -2.160  76.706 1.00 84.04  ? 272  LEU B O   1 
ATOM   3912 C CB  . LEU B 2 269 ? -18.643 -0.053  79.199 1.00 80.74  ? 272  LEU B CB  1 
ATOM   3913 C CG  . LEU B 2 269 ? -17.776 -1.114  79.883 1.00 85.29  ? 272  LEU B CG  1 
ATOM   3914 C CD1 . LEU B 2 269 ? -16.352 -1.081  79.354 1.00 85.43  ? 272  LEU B CD1 1 
ATOM   3915 C CD2 . LEU B 2 269 ? -17.786 -0.926  81.390 1.00 87.53  ? 272  LEU B CD2 1 
ATOM   3916 N N   . LEU B 2 270 ? -20.276 -1.686  77.059 1.00 80.93  ? 273  LEU B N   1 
ATOM   3917 C CA  . LEU B 2 270 ? -20.732 -2.946  76.478 1.00 80.71  ? 273  LEU B CA  1 
ATOM   3918 C C   . LEU B 2 270 ? -20.354 -3.023  75.004 1.00 84.11  ? 273  LEU B C   1 
ATOM   3919 O O   . LEU B 2 270 ? -19.799 -4.021  74.547 1.00 84.15  ? 273  LEU B O   1 
ATOM   3920 C CB  . LEU B 2 270 ? -22.245 -3.121  76.643 1.00 80.80  ? 273  LEU B CB  1 
ATOM   3921 C CG  . LEU B 2 270 ? -22.794 -3.369  78.052 1.00 85.53  ? 273  LEU B CG  1 
ATOM   3922 C CD1 . LEU B 2 270 ? -24.220 -3.898  77.979 1.00 85.66  ? 273  LEU B CD1 1 
ATOM   3923 C CD2 . LEU B 2 270 ? -21.903 -4.315  78.851 1.00 87.67  ? 273  LEU B CD2 1 
ATOM   3924 N N   . GLU B 2 271 ? -20.655 -1.958  74.267 1.00 79.78  ? 274  GLU B N   1 
ATOM   3925 C CA  . GLU B 2 271 ? -20.307 -1.873  72.854 1.00 79.19  ? 274  GLU B CA  1 
ATOM   3926 C C   . GLU B 2 271 ? -18.842 -2.226  72.624 1.00 82.33  ? 274  GLU B C   1 
ATOM   3927 O O   . GLU B 2 271 ? -18.498 -2.873  71.634 1.00 81.83  ? 274  GLU B O   1 
ATOM   3928 C CB  . GLU B 2 271 ? -20.610 -0.474  72.318 1.00 80.58  ? 274  GLU B CB  1 
ATOM   3929 C CG  . GLU B 2 271 ? -22.085 -0.115  72.363 1.00 92.13  ? 274  GLU B CG  1 
ATOM   3930 C CD  . GLU B 2 271 ? -22.377 1.233   71.745 1.00 119.07 ? 274  GLU B CD  1 
ATOM   3931 O OE1 . GLU B 2 271 ? -21.418 1.928   71.348 1.00 120.98 ? 274  GLU B OE1 1 
ATOM   3932 O OE2 . GLU B 2 271 ? -23.567 1.601   71.661 1.00 115.90 ? 274  GLU B OE2 1 
ATOM   3933 N N   . MET B 2 272 ? -17.985 -1.790  73.542 1.00 78.33  ? 275  MET B N   1 
ATOM   3934 C CA  . MET B 2 272 ? -16.579 -2.170  73.523 1.00 77.93  ? 275  MET B CA  1 
ATOM   3935 C C   . MET B 2 272 ? -16.437 -3.637  73.900 1.00 83.56  ? 275  MET B C   1 
ATOM   3936 O O   . MET B 2 272 ? -15.655 -4.370  73.300 1.00 83.28  ? 275  MET B O   1 
ATOM   3937 C CB  . MET B 2 272 ? -15.782 -1.320  74.512 1.00 79.82  ? 275  MET B CB  1 
ATOM   3938 C CG  . MET B 2 272 ? -15.703 0.151   74.163 1.00 82.91  ? 275  MET B CG  1 
ATOM   3939 S SD  . MET B 2 272 ? -14.998 1.095   75.516 1.00 86.55  ? 275  MET B SD  1 
ATOM   3940 C CE  . MET B 2 272 ? -14.581 2.635   74.691 1.00 83.22  ? 275  MET B CE  1 
ATOM   3941 N N   . LEU B 2 273 ? -17.178 -4.052  74.921 1.00 81.23  ? 276  LEU B N   1 
ATOM   3942 C CA  . LEU B 2 273 ? -17.107 -5.424  75.402 1.00 81.32  ? 276  LEU B CA  1 
ATOM   3943 C C   . LEU B 2 273 ? -18.080 -6.329  74.654 1.00 86.37  ? 276  LEU B C   1 
ATOM   3944 O O   . LEU B 2 273 ? -18.655 -7.254  75.229 1.00 86.32  ? 276  LEU B O   1 
ATOM   3945 C CB  . LEU B 2 273 ? -17.329 -5.479  76.914 1.00 81.27  ? 276  LEU B CB  1 
ATOM   3946 C CG  . LEU B 2 273 ? -16.264 -4.714  77.705 1.00 86.02  ? 276  LEU B CG  1 
ATOM   3947 C CD1 . LEU B 2 273 ? -16.390 -4.933  79.208 1.00 85.87  ? 276  LEU B CD1 1 
ATOM   3948 C CD2 . LEU B 2 273 ? -14.868 -5.082  77.214 1.00 89.04  ? 276  LEU B CD2 1 
ATOM   3949 N N   . THR B 2 274 ? -18.249 -6.052  73.363 1.00 83.45  ? 277  THR B N   1 
ATOM   3950 C CA  . THR B 2 274 ? -19.031 -6.904  72.472 1.00 83.58  ? 277  THR B CA  1 
ATOM   3951 C C   . THR B 2 274 ? -18.172 -8.061  71.962 1.00 88.92  ? 277  THR B C   1 
ATOM   3952 O O   . THR B 2 274 ? -17.510 -7.940  70.933 1.00 88.29  ? 277  THR B O   1 
ATOM   3953 C CB  . THR B 2 274 ? -19.610 -6.095  71.292 1.00 90.78  ? 277  THR B CB  1 
ATOM   3954 O OG1 . THR B 2 274 ? -20.261 -4.918  71.785 1.00 90.71  ? 277  THR B OG1 1 
ATOM   3955 C CG2 . THR B 2 274 ? -20.611 -6.930  70.507 1.00 88.84  ? 277  THR B CG2 1 
ATOM   3956 N N   . PHE B 2 275 ? -18.194 -9.168  72.700 1.00 87.25  ? 278  PHE B N   1 
ATOM   3957 C CA  . PHE B 2 275 ? -17.442 -10.389 72.388 1.00 87.87  ? 278  PHE B CA  1 
ATOM   3958 C C   . PHE B 2 275 ? -17.166 -10.647 70.902 1.00 92.72  ? 278  PHE B C   1 
ATOM   3959 O O   . PHE B 2 275 ? -16.162 -11.271 70.550 1.00 92.32  ? 278  PHE B O   1 
ATOM   3960 C CB  . PHE B 2 275 ? -18.142 -11.600 73.019 1.00 89.84  ? 278  PHE B CB  1 
ATOM   3961 C CG  . PHE B 2 275 ? -17.517 -12.922 72.672 1.00 91.50  ? 278  PHE B CG  1 
ATOM   3962 C CD1 . PHE B 2 275 ? -16.564 -13.493 73.500 1.00 94.73  ? 278  PHE B CD1 1 
ATOM   3963 C CD2 . PHE B 2 275 ? -17.920 -13.619 71.543 1.00 93.67  ? 278  PHE B CD2 1 
ATOM   3964 C CE1 . PHE B 2 275 ? -16.002 -14.721 73.192 1.00 95.72  ? 278  PHE B CE1 1 
ATOM   3965 C CE2 . PHE B 2 275 ? -17.363 -14.844 71.229 1.00 96.52  ? 278  PHE B CE2 1 
ATOM   3966 C CZ  . PHE B 2 275 ? -16.401 -15.396 72.054 1.00 94.72  ? 278  PHE B CZ  1 
ATOM   3967 N N   . ASN B 2 276 ? -18.048 -10.151 70.038 1.00 89.88  ? 279  ASN B N   1 
ATOM   3968 C CA  . ASN B 2 276 ? -17.864 -10.272 68.593 1.00 89.97  ? 279  ASN B CA  1 
ATOM   3969 C C   . ASN B 2 276 ? -17.191 -9.035  67.996 1.00 94.72  ? 279  ASN B C   1 
ATOM   3970 O O   . ASN B 2 276 ? -17.696 -7.917  68.119 1.00 94.66  ? 279  ASN B O   1 
ATOM   3971 C CB  . ASN B 2 276 ? -19.202 -10.529 67.897 1.00 90.58  ? 279  ASN B CB  1 
ATOM   3972 C CG  . ASN B 2 276 ? -19.074 -10.571 66.386 1.00 112.16 ? 279  ASN B CG  1 
ATOM   3973 O OD1 . ASN B 2 276 ? -18.312 -11.367 65.837 1.00 103.68 ? 279  ASN B OD1 1 
ATOM   3974 N ND2 . ASN B 2 276 ? -19.809 -9.699  65.706 1.00 104.57 ? 279  ASN B ND2 1 
ATOM   3975 N N   . PRO B 2 277 ? -16.059 -9.233  67.302 1.00 91.30  ? 280  PRO B N   1 
ATOM   3976 C CA  . PRO B 2 277 ? -15.213 -8.186  66.716 1.00 91.04  ? 280  PRO B CA  1 
ATOM   3977 C C   . PRO B 2 277 ? -15.912 -7.372  65.641 1.00 94.85  ? 280  PRO B C   1 
ATOM   3978 O O   . PRO B 2 277 ? -15.752 -6.153  65.570 1.00 94.41  ? 280  PRO B O   1 
ATOM   3979 C CB  . PRO B 2 277 ? -14.068 -8.977  66.075 1.00 92.80  ? 280  PRO B CB  1 
ATOM   3980 C CG  . PRO B 2 277 ? -14.581 -10.366 65.927 1.00 97.36  ? 280  PRO B CG  1 
ATOM   3981 C CD  . PRO B 2 277 ? -15.507 -10.577 67.077 1.00 92.94  ? 280  PRO B CD  1 
ATOM   3982 N N   . HIS B 2 278 ? -16.638 -8.061  64.770 1.00 91.31  ? 281  HIS B N   1 
ATOM   3983 C CA  . HIS B 2 278 ? -17.171 -7.442  63.563 1.00 91.03  ? 281  HIS B CA  1 
ATOM   3984 C C   . HIS B 2 278 ? -18.266 -6.420  63.848 1.00 93.63  ? 281  HIS B C   1 
ATOM   3985 O O   . HIS B 2 278 ? -18.523 -5.529  63.036 1.00 93.29  ? 281  HIS B O   1 
ATOM   3986 C CB  . HIS B 2 278 ? -17.653 -8.512  62.583 1.00 92.05  ? 281  HIS B CB  1 
ATOM   3987 C CG  . HIS B 2 278 ? -16.589 -9.491  62.195 1.00 95.55  ? 281  HIS B CG  1 
ATOM   3988 N ND1 . HIS B 2 278 ? -15.478 -9.128  61.464 1.00 97.41  ? 281  HIS B ND1 1 
ATOM   3989 C CD2 . HIS B 2 278 ? -16.449 -10.810 62.464 1.00 97.38  ? 281  HIS B CD2 1 
ATOM   3990 C CE1 . HIS B 2 278 ? -14.708 -10.187 61.285 1.00 96.91  ? 281  HIS B CE1 1 
ATOM   3991 N NE2 . HIS B 2 278 ? -15.273 -11.220 61.884 1.00 97.22  ? 281  HIS B NE2 1 
ATOM   3992 N N   . LYS B 2 279 ? -18.904 -6.550  65.007 1.00 88.84  ? 282  LYS B N   1 
ATOM   3993 C CA  . LYS B 2 279 ? -19.877 -5.562  65.456 1.00 87.74  ? 282  LYS B CA  1 
ATOM   3994 C C   . LYS B 2 279 ? -19.534 -5.055  66.853 1.00 89.33  ? 282  LYS B C   1 
ATOM   3995 O O   . LYS B 2 279 ? -20.420 -4.720  67.640 1.00 89.15  ? 282  LYS B O   1 
ATOM   3996 C CB  . LYS B 2 279 ? -21.299 -6.128  65.414 1.00 90.21  ? 282  LYS B CB  1 
ATOM   3997 C CG  . LYS B 2 279 ? -21.531 -7.318  66.332 1.00 105.07 ? 282  LYS B CG  1 
ATOM   3998 C CD  . LYS B 2 279 ? -22.884 -7.966  66.064 1.00 114.70 ? 282  LYS B CD  1 
ATOM   3999 C CE  . LYS B 2 279 ? -22.962 -8.526  64.650 1.00 122.70 ? 282  LYS B CE  1 
ATOM   4000 N NZ  . LYS B 2 279 ? -24.242 -9.242  64.399 1.00 130.24 ? 282  LYS B NZ  1 
ATOM   4001 N N   . ARG B 2 280 ? -18.242 -5.039  67.164 1.00 83.58  ? 283  ARG B N   1 
ATOM   4002 C CA  . ARG B 2 280 ? -17.741 -4.373  68.362 1.00 82.15  ? 283  ARG B CA  1 
ATOM   4003 C C   . ARG B 2 280 ? -17.349 -2.942  68.003 1.00 83.21  ? 283  ARG B C   1 
ATOM   4004 O O   . ARG B 2 280 ? -16.863 -2.686  66.902 1.00 82.61  ? 283  ARG B O   1 
ATOM   4005 C CB  . ARG B 2 280 ? -16.538 -5.129  68.928 1.00 81.70  ? 283  ARG B CB  1 
ATOM   4006 C CG  . ARG B 2 280 ? -15.798 -4.394  70.033 1.00 88.38  ? 283  ARG B CG  1 
ATOM   4007 C CD  . ARG B 2 280 ? -14.910 -5.344  70.817 1.00 93.52  ? 283  ARG B CD  1 
ATOM   4008 N NE  . ARG B 2 280 ? -13.990 -6.079  69.957 1.00 100.86 ? 283  ARG B NE  1 
ATOM   4009 C CZ  . ARG B 2 280 ? -13.225 -7.082  70.373 1.00 116.17 ? 283  ARG B CZ  1 
ATOM   4010 N NH1 . ARG B 2 280 ? -12.413 -7.695  69.524 1.00 104.89 ? 283  ARG B NH1 1 
ATOM   4011 N NH2 . ARG B 2 280 ? -13.277 -7.475  71.637 1.00 104.07 ? 283  ARG B NH2 1 
ATOM   4012 N N   . ILE B 2 281 ? -17.595 -2.007  68.916 1.00 77.97  ? 284  ILE B N   1 
ATOM   4013 C CA  . ILE B 2 281 ? -17.381 -0.592  68.626 1.00 76.98  ? 284  ILE B CA  1 
ATOM   4014 C C   . ILE B 2 281 ? -15.922 -0.281  68.322 1.00 79.83  ? 284  ILE B C   1 
ATOM   4015 O O   . ILE B 2 281 ? -15.018 -0.870  68.916 1.00 79.72  ? 284  ILE B O   1 
ATOM   4016 C CB  . ILE B 2 281 ? -17.928 0.328   69.737 1.00 79.72  ? 284  ILE B CB  1 
ATOM   4017 C CG1 . ILE B 2 281 ? -18.283 1.699   69.151 1.00 79.87  ? 284  ILE B CG1 1 
ATOM   4018 C CG2 . ILE B 2 281 ? -16.904 0.483   70.858 1.00 79.84  ? 284  ILE B CG2 1 
ATOM   4019 C CD1 . ILE B 2 281 ? -18.680 2.725   70.182 1.00 84.66  ? 284  ILE B CD1 1 
ATOM   4020 N N   . SER B 2 282 ? -15.706 0.673   67.421 1.00 74.97  ? 285  SER B N   1 
ATOM   4021 C CA  . SER B 2 282 ? -14.364 1.112   67.055 1.00 74.01  ? 285  SER B CA  1 
ATOM   4022 C C   . SER B 2 282 ? -13.930 2.332   67.860 1.00 76.56  ? 285  SER B C   1 
ATOM   4023 O O   . SER B 2 282 ? -14.694 2.860   68.672 1.00 76.19  ? 285  SER B O   1 
ATOM   4024 C CB  . SER B 2 282 ? -14.302 1.422   65.564 1.00 77.46  ? 285  SER B CB  1 
ATOM   4025 O OG  . SER B 2 282 ? -14.678 0.284   64.812 1.00 87.39  ? 285  SER B OG  1 
ATOM   4026 N N   . ALA B 2 283 ? -12.697 2.774   67.638 1.00 71.78  ? 286  ALA B N   1 
ATOM   4027 C CA  . ALA B 2 283 ? -12.146 3.890   68.394 1.00 70.99  ? 286  ALA B CA  1 
ATOM   4028 C C   . ALA B 2 283 ? -12.694 5.222   67.895 1.00 74.12  ? 286  ALA B C   1 
ATOM   4029 O O   . ALA B 2 283 ? -12.688 6.216   68.620 1.00 73.05  ? 286  ALA B O   1 
ATOM   4030 C CB  . ALA B 2 283 ? -10.626 3.876   68.335 1.00 71.61  ? 286  ALA B CB  1 
ATOM   4031 N N   . PHE B 2 284 ? -13.170 5.234   66.654 1.00 71.00  ? 287  PHE B N   1 
ATOM   4032 C CA  . PHE B 2 284 ? -13.784 6.430   66.088 1.00 71.08  ? 287  PHE B CA  1 
ATOM   4033 C C   . PHE B 2 284 ? -15.280 6.502   66.394 1.00 75.38  ? 287  PHE B C   1 
ATOM   4034 O O   . PHE B 2 284 ? -15.801 7.572   66.706 1.00 74.52  ? 287  PHE B O   1 
ATOM   4035 C CB  . PHE B 2 284 ? -13.545 6.510   64.578 1.00 72.78  ? 287  PHE B CB  1 
ATOM   4036 C CG  . PHE B 2 284 ? -14.100 7.754   63.944 1.00 74.18  ? 287  PHE B CG  1 
ATOM   4037 C CD1 . PHE B 2 284 ? -13.380 8.935   63.958 1.00 76.96  ? 287  PHE B CD1 1 
ATOM   4038 C CD2 . PHE B 2 284 ? -15.352 7.746   63.349 1.00 76.61  ? 287  PHE B CD2 1 
ATOM   4039 C CE1 . PHE B 2 284 ? -13.891 10.084  63.380 1.00 77.91  ? 287  PHE B CE1 1 
ATOM   4040 C CE2 . PHE B 2 284 ? -15.867 8.893   62.766 1.00 79.34  ? 287  PHE B CE2 1 
ATOM   4041 C CZ  . PHE B 2 284 ? -15.134 10.064  62.783 1.00 77.17  ? 287  PHE B CZ  1 
ATOM   4042 N N   . ARG B 2 285 ? -15.963 5.364   66.285 1.00 73.01  ? 288  ARG B N   1 
ATOM   4043 C CA  . ARG B 2 285 ? -17.386 5.282   66.615 1.00 73.34  ? 288  ARG B CA  1 
ATOM   4044 C C   . ARG B 2 285 ? -17.566 5.535   68.104 1.00 78.38  ? 288  ARG B C   1 
ATOM   4045 O O   . ARG B 2 285 ? -18.562 6.126   68.529 1.00 78.51  ? 288  ARG B O   1 
ATOM   4046 C CB  . ARG B 2 285 ? -17.950 3.899   66.279 1.00 73.90  ? 288  ARG B CB  1 
ATOM   4047 C CG  . ARG B 2 285 ? -17.418 3.282   64.997 1.00 87.07  ? 288  ARG B CG  1 
ATOM   4048 C CD  . ARG B 2 285 ? -17.915 1.851   64.847 1.00 100.16 ? 288  ARG B CD  1 
ATOM   4049 N NE  . ARG B 2 285 ? -17.306 1.168   63.709 1.00 113.17 ? 288  ARG B NE  1 
ATOM   4050 C CZ  . ARG B 2 285 ? -17.512 -0.111  63.408 1.00 131.05 ? 288  ARG B CZ  1 
ATOM   4051 N NH1 . ARG B 2 285 ? -16.909 -0.650  62.356 1.00 119.42 ? 288  ARG B NH1 1 
ATOM   4052 N NH2 . ARG B 2 285 ? -18.310 -0.854  64.164 1.00 119.01 ? 288  ARG B NH2 1 
ATOM   4053 N N   . ALA B 2 286 ? -16.617 5.032   68.892 1.00 74.77  ? 289  ALA B N   1 
ATOM   4054 C CA  . ALA B 2 286 ? -16.598 5.255   70.334 1.00 74.22  ? 289  ALA B CA  1 
ATOM   4055 C C   . ALA B 2 286 ? -16.431 6.737   70.655 1.00 78.43  ? 289  ALA B C   1 
ATOM   4056 O O   . ALA B 2 286 ? -17.197 7.304   71.433 1.00 78.21  ? 289  ALA B O   1 
ATOM   4057 C CB  . ALA B 2 286 ? -15.489 4.444   70.973 1.00 74.76  ? 289  ALA B CB  1 
ATOM   4058 N N   . LEU B 2 287 ? -15.433 7.361   70.038 1.00 75.25  ? 290  LEU B N   1 
ATOM   4059 C CA  . LEU B 2 287 ? -15.181 8.789   70.217 1.00 75.06  ? 290  LEU B CA  1 
ATOM   4060 C C   . LEU B 2 287 ? -16.442 9.605   69.967 1.00 79.11  ? 290  LEU B C   1 
ATOM   4061 O O   . LEU B 2 287 ? -16.654 10.655  70.577 1.00 78.17  ? 290  LEU B O   1 
ATOM   4062 C CB  . LEU B 2 287 ? -14.064 9.252   69.280 1.00 75.04  ? 290  LEU B CB  1 
ATOM   4063 C CG  . LEU B 2 287 ? -12.632 8.970   69.731 1.00 79.72  ? 290  LEU B CG  1 
ATOM   4064 C CD1 . LEU B 2 287 ? -11.682 9.085   68.551 1.00 79.98  ? 290  LEU B CD1 1 
ATOM   4065 C CD2 . LEU B 2 287 ? -12.233 9.943   70.831 1.00 81.86  ? 290  LEU B CD2 1 
ATOM   4066 N N   . GLN B 2 288 ? -17.270 9.119   69.051 1.00 76.54  ? 291  GLN B N   1 
ATOM   4067 C CA  . GLN B 2 288 ? -18.525 9.782   68.729 1.00 76.79  ? 291  GLN B CA  1 
ATOM   4068 C C   . GLN B 2 288 ? -19.684 9.158   69.501 1.00 81.61  ? 291  GLN B C   1 
ATOM   4069 O O   . GLN B 2 288 ? -20.701 8.776   68.920 1.00 81.71  ? 291  GLN B O   1 
ATOM   4070 C CB  . GLN B 2 288 ? -18.780 9.730   67.224 1.00 78.02  ? 291  GLN B CB  1 
ATOM   4071 C CG  . GLN B 2 288 ? -17.711 10.426  66.401 1.00 91.16  ? 291  GLN B CG  1 
ATOM   4072 C CD  . GLN B 2 288 ? -18.110 10.580  64.951 1.00 113.05 ? 291  GLN B CD  1 
ATOM   4073 O OE1 . GLN B 2 288 ? -18.729 9.688   64.369 1.00 108.53 ? 291  GLN B OE1 1 
ATOM   4074 N NE2 . GLN B 2 288 ? -17.779 11.724  64.363 1.00 106.92 ? 291  GLN B NE2 1 
ATOM   4075 N N   . HIS B 2 289 ? -19.503 9.027   70.811 1.00 78.19  ? 292  HIS B N   1 
ATOM   4076 C CA  . HIS B 2 289 ? -20.540 8.497   71.687 1.00 78.05  ? 292  HIS B CA  1 
ATOM   4077 C C   . HIS B 2 289 ? -21.076 9.602   72.595 1.00 80.75  ? 292  HIS B C   1 
ATOM   4078 O O   . HIS B 2 289 ? -20.361 10.554  72.918 1.00 80.19  ? 292  HIS B O   1 
ATOM   4079 C CB  . HIS B 2 289 ? -19.994 7.335   72.527 1.00 78.93  ? 292  HIS B CB  1 
ATOM   4080 C CG  . HIS B 2 289 ? -21.051 6.574   73.267 1.00 82.43  ? 292  HIS B CG  1 
ATOM   4081 N ND1 . HIS B 2 289 ? -21.235 6.683   74.631 1.00 84.19  ? 292  HIS B ND1 1 
ATOM   4082 C CD2 . HIS B 2 289 ? -21.972 5.677   72.839 1.00 84.24  ? 292  HIS B CD2 1 
ATOM   4083 C CE1 . HIS B 2 289 ? -22.225 5.896   75.006 1.00 83.59  ? 292  HIS B CE1 1 
ATOM   4084 N NE2 . HIS B 2 289 ? -22.691 5.273   73.936 1.00 83.95  ? 292  HIS B NE2 1 
ATOM   4085 N N   . SER B 2 290 ? -22.335 9.465   73.001 1.00 76.15  ? 293  SER B N   1 
ATOM   4086 C CA  . SER B 2 290 ? -22.991 10.446  73.863 1.00 75.50  ? 293  SER B CA  1 
ATOM   4087 C C   . SER B 2 290 ? -22.120 10.800  75.066 1.00 77.27  ? 293  SER B C   1 
ATOM   4088 O O   . SER B 2 290 ? -21.892 11.971  75.357 1.00 76.27  ? 293  SER B O   1 
ATOM   4089 C CB  . SER B 2 290 ? -24.339 9.903   74.346 1.00 79.37  ? 293  SER B CB  1 
ATOM   4090 O OG  . SER B 2 290 ? -24.998 9.180   73.318 1.00 87.99  ? 293  SER B OG  1 
ATOM   4091 N N   . TYR B 2 291 ? -21.654 9.773   75.766 1.00 73.04  ? 294  TYR B N   1 
ATOM   4092 C CA  . TYR B 2 291 ? -20.781 9.940   76.919 1.00 72.84  ? 294  TYR B CA  1 
ATOM   4093 C C   . TYR B 2 291 ? -19.455 10.577  76.517 1.00 78.01  ? 294  TYR B C   1 
ATOM   4094 O O   . TYR B 2 291 ? -18.837 11.295  77.304 1.00 77.93  ? 294  TYR B O   1 
ATOM   4095 C CB  . TYR B 2 291 ? -20.525 8.579   77.567 1.00 73.77  ? 294  TYR B CB  1 
ATOM   4096 C CG  . TYR B 2 291 ? -19.736 8.632   78.856 1.00 75.11  ? 294  TYR B CG  1 
ATOM   4097 C CD1 . TYR B 2 291 ? -20.226 9.308   79.966 1.00 77.08  ? 294  TYR B CD1 1 
ATOM   4098 C CD2 . TYR B 2 291 ? -18.528 7.961   78.979 1.00 75.69  ? 294  TYR B CD2 1 
ATOM   4099 C CE1 . TYR B 2 291 ? -19.517 9.341   81.155 1.00 77.68  ? 294  TYR B CE1 1 
ATOM   4100 C CE2 . TYR B 2 291 ? -17.807 7.996   80.158 1.00 76.60  ? 294  TYR B CE2 1 
ATOM   4101 C CZ  . TYR B 2 291 ? -18.307 8.685   81.246 1.00 83.17  ? 294  TYR B CZ  1 
ATOM   4102 O OH  . TYR B 2 291 ? -17.596 8.716   82.427 1.00 81.42  ? 294  TYR B OH  1 
ATOM   4103 N N   . LEU B 2 292 ? -19.032 10.326  75.280 1.00 74.98  ? 295  LEU B N   1 
ATOM   4104 C CA  . LEU B 2 292 ? -17.728 10.778  74.798 1.00 104.16 ? 295  LEU B CA  1 
ATOM   4105 C C   . LEU B 2 292 ? -16.591 9.998   75.452 1.00 130.09 ? 295  LEU B C   1 
ATOM   4106 O O   . LEU B 2 292 ? -16.295 8.869   75.063 1.00 90.88  ? 295  LEU B O   1 
ATOM   4107 C CB  . LEU B 2 292 ? -17.541 12.281  75.030 1.00 104.17 ? 295  LEU B CB  1 
ATOM   4108 C CG  . LEU B 2 292 ? -18.222 13.230  74.041 1.00 108.83 ? 295  LEU B CG  1 
ATOM   4109 C CD1 . LEU B 2 292 ? -19.710 13.341  74.313 1.00 109.03 ? 295  LEU B CD1 1 
ATOM   4110 C CD2 . LEU B 2 292 ? -17.564 14.600  74.049 1.00 111.06 ? 295  LEU B CD2 1 
HETATM 4111 C C1  . GOL C 3 .   ? 18.549  10.151  58.967 1.00 63.13  ? 1266 GOL A C1  1 
HETATM 4112 O O1  . GOL C 3 .   ? 18.744  10.511  57.598 1.00 65.30  ? 1266 GOL A O1  1 
HETATM 4113 C C2  . GOL C 3 .   ? 17.138  9.588   59.139 1.00 62.35  ? 1266 GOL A C2  1 
HETATM 4114 O O2  . GOL C 3 .   ? 16.210  10.421  58.440 1.00 63.37  ? 1266 GOL A O2  1 
HETATM 4115 C C3  . GOL C 3 .   ? 16.775  9.547   60.625 1.00 60.63  ? 1266 GOL A C3  1 
HETATM 4116 O O3  . GOL C 3 .   ? 15.393  9.210   60.767 1.00 59.91  ? 1266 GOL A O3  1 
HETATM 4117 O O   . HOH D 4 .   ? -18.965 9.648   58.846 1.00 77.68  ? 2001 HOH A O   1 
HETATM 4118 O O   . HOH D 4 .   ? -1.054  14.797  58.864 1.00 57.56  ? 2002 HOH A O   1 
HETATM 4119 O O   . HOH D 4 .   ? 12.565  -17.023 36.076 1.00 72.49  ? 2003 HOH A O   1 
HETATM 4120 O O   . HOH D 4 .   ? 7.648   18.603  52.342 1.00 48.37  ? 2004 HOH A O   1 
HETATM 4121 O O   . HOH D 4 .   ? 28.479  12.477  34.558 1.00 54.78  ? 2005 HOH A O   1 
HETATM 4122 O O   . HOH D 4 .   ? 27.359  8.347   33.399 1.00 56.16  ? 2006 HOH A O   1 
HETATM 4123 O O   . HOH D 4 .   ? 31.831  10.155  33.746 1.00 69.31  ? 2007 HOH A O   1 
HETATM 4124 O O   . HOH D 4 .   ? 12.082  18.045  52.516 1.00 59.47  ? 2008 HOH A O   1 
HETATM 4125 O O   . HOH D 4 .   ? 13.051  12.778  51.572 1.00 50.42  ? 2009 HOH A O   1 
HETATM 4126 O O   . HOH D 4 .   ? 17.706  13.757  56.823 1.00 43.62  ? 2010 HOH A O   1 
HETATM 4127 O O   . HOH D 4 .   ? 17.962  17.893  50.730 1.00 49.85  ? 2011 HOH A O   1 
HETATM 4128 O O   . HOH D 4 .   ? 14.529  -14.271 36.965 1.00 75.22  ? 2012 HOH A O   1 
HETATM 4129 O O   . HOH D 4 .   ? 23.972  19.244  45.817 1.00 47.12  ? 2013 HOH A O   1 
HETATM 4130 O O   . HOH D 4 .   ? 20.040  20.471  52.640 1.00 47.81  ? 2014 HOH A O   1 
HETATM 4131 O O   . HOH D 4 .   ? 26.907  19.529  47.201 1.00 57.07  ? 2015 HOH A O   1 
HETATM 4132 O O   . HOH D 4 .   ? 12.173  0.993   38.327 1.00 54.18  ? 2016 HOH A O   1 
HETATM 4133 O O   . HOH D 4 .   ? 32.104  27.927  49.261 1.00 58.04  ? 2017 HOH A O   1 
HETATM 4134 O O   . HOH D 4 .   ? 33.910  14.146  55.419 1.00 62.14  ? 2018 HOH A O   1 
HETATM 4135 O O   . HOH D 4 .   ? 31.697  2.721   53.692 1.00 60.21  ? 2019 HOH A O   1 
HETATM 4136 O O   . HOH D 4 .   ? 36.804  3.052   54.237 1.00 71.31  ? 2020 HOH A O   1 
HETATM 4137 O O   . HOH D 4 .   ? 37.806  12.769  43.674 1.00 60.98  ? 2021 HOH A O   1 
HETATM 4138 O O   . HOH D 4 .   ? 25.222  13.827  38.389 1.00 40.60  ? 2022 HOH A O   1 
HETATM 4139 O O   . HOH D 4 .   ? 27.363  14.016  36.734 1.00 46.94  ? 2023 HOH A O   1 
HETATM 4140 O O   . HOH D 4 .   ? 29.067  10.094  35.207 1.00 49.94  ? 2024 HOH A O   1 
HETATM 4141 O O   . HOH D 4 .   ? 13.386  -15.030 45.819 1.00 56.67  ? 2025 HOH A O   1 
HETATM 4142 O O   . HOH D 4 .   ? 26.700  3.336   34.776 1.00 47.37  ? 2026 HOH A O   1 
HETATM 4143 O O   . HOH D 4 .   ? 19.976  2.898   33.153 1.00 66.85  ? 2027 HOH A O   1 
HETATM 4144 O O   . HOH D 4 .   ? 25.503  0.559   33.984 1.00 41.50  ? 2028 HOH A O   1 
HETATM 4145 O O   . HOH D 4 .   ? 12.862  -5.618  32.039 1.00 76.01  ? 2029 HOH A O   1 
HETATM 4146 O O   . HOH D 4 .   ? 15.456  3.432   31.105 1.00 61.41  ? 2030 HOH A O   1 
HETATM 4147 O O   . HOH D 4 .   ? 16.615  -11.032 33.427 1.00 68.43  ? 2031 HOH A O   1 
HETATM 4148 O O   . HOH D 4 .   ? 13.912  -8.738  32.303 1.00 70.96  ? 2032 HOH A O   1 
HETATM 4149 O O   . HOH D 4 .   ? 16.516  -13.273 37.385 1.00 52.89  ? 2033 HOH A O   1 
HETATM 4150 O O   . HOH D 4 .   ? 10.112  -8.671  29.388 1.00 65.89  ? 2034 HOH A O   1 
HETATM 4151 O O   . HOH D 4 .   ? 11.261  -1.639  37.518 1.00 50.29  ? 2035 HOH A O   1 
HETATM 4152 O O   . HOH D 4 .   ? 9.095   -2.905  36.605 1.00 54.37  ? 2036 HOH A O   1 
HETATM 4153 O O   . HOH D 4 .   ? 12.457  0.662   41.104 1.00 33.00  ? 2037 HOH A O   1 
HETATM 4154 O O   . HOH D 4 .   ? 5.776   -6.381  45.200 1.00 62.70  ? 2038 HOH A O   1 
HETATM 4155 O O   . HOH D 4 .   ? 6.471   -5.899  40.257 1.00 55.84  ? 2039 HOH A O   1 
HETATM 4156 O O   . HOH D 4 .   ? -4.837  6.901   46.306 1.00 67.51  ? 2040 HOH A O   1 
HETATM 4157 O O   . HOH D 4 .   ? 11.908  3.741   38.998 1.00 46.81  ? 2041 HOH A O   1 
HETATM 4158 O O   . HOH D 4 .   ? -9.806  20.694  46.104 1.00 57.36  ? 2042 HOH A O   1 
HETATM 4159 O O   . HOH D 4 .   ? 3.601   3.948   44.556 1.00 42.73  ? 2043 HOH A O   1 
HETATM 4160 O O   . HOH D 4 .   ? 12.708  9.265   47.154 1.00 45.55  ? 2044 HOH A O   1 
HETATM 4161 O O   . HOH D 4 .   ? 25.221  18.347  37.765 1.00 51.54  ? 2045 HOH A O   1 
HETATM 4162 O O   . HOH D 4 .   ? 18.081  12.263  47.548 0.50 18.76  ? 2046 HOH A O   1 
HETATM 4163 O O   . HOH D 4 .   ? 20.860  12.193  55.751 1.00 42.85  ? 2047 HOH A O   1 
HETATM 4164 O O   . HOH D 4 .   ? 31.681  4.665   54.901 0.50 36.69  ? 2048 HOH A O   1 
HETATM 4165 O O   . HOH D 4 .   ? 33.966  10.634  49.364 1.00 39.72  ? 2049 HOH A O   1 
HETATM 4166 O O   . HOH D 4 .   ? 34.220  4.144   52.442 1.00 46.10  ? 2050 HOH A O   1 
HETATM 4167 O O   . HOH D 4 .   ? 41.599  1.270   50.635 1.00 68.21  ? 2051 HOH A O   1 
HETATM 4168 O O   . HOH D 4 .   ? 32.538  2.416   43.695 1.00 49.24  ? 2052 HOH A O   1 
HETATM 4169 O O   . HOH D 4 .   ? -1.177  31.603  33.070 1.00 61.53  ? 2053 HOH A O   1 
HETATM 4170 O O   . HOH D 4 .   ? 34.085  -4.726  47.414 1.00 60.88  ? 2054 HOH A O   1 
HETATM 4171 O O   . HOH D 4 .   ? 29.688  -3.330  37.715 1.00 63.72  ? 2055 HOH A O   1 
HETATM 4172 O O   . HOH D 4 .   ? 4.132   2.143   48.508 1.00 70.24  ? 2056 HOH A O   1 
HETATM 4173 O O   . HOH D 4 .   ? 9.732   -7.501  41.897 1.00 40.24  ? 2057 HOH A O   1 
HETATM 4174 O O   . HOH D 4 .   ? 9.113   -13.397 48.954 1.00 44.03  ? 2058 HOH A O   1 
HETATM 4175 O O   . HOH D 4 .   ? 9.026   -8.869  43.601 1.00 59.85  ? 2059 HOH A O   1 
HETATM 4176 O O   . HOH D 4 .   ? 14.319  -12.560 48.349 1.00 45.24  ? 2060 HOH A O   1 
HETATM 4177 O O   . HOH D 4 .   ? 16.292  -7.546  49.558 1.00 50.00  ? 2061 HOH A O   1 
HETATM 4178 O O   . HOH D 4 .   ? 16.168  -11.634 43.865 1.00 61.06  ? 2062 HOH A O   1 
HETATM 4179 O O   . HOH D 4 .   ? 26.710  -16.337 46.883 1.00 50.91  ? 2063 HOH A O   1 
HETATM 4180 O O   . HOH D 4 .   ? 21.071  -12.219 36.328 1.00 60.23  ? 2064 HOH A O   1 
HETATM 4181 O O   . HOH D 4 .   ? 20.551  -15.697 38.407 1.00 71.63  ? 2065 HOH A O   1 
HETATM 4182 O O   . HOH D 4 .   ? 28.694  -5.459  35.967 1.00 71.71  ? 2066 HOH A O   1 
HETATM 4183 O O   . HOH D 4 .   ? 31.192  -7.238  32.822 1.00 76.27  ? 2067 HOH A O   1 
HETATM 4184 O O   . HOH D 4 .   ? 27.706  -10.816 36.244 1.00 60.33  ? 2068 HOH A O   1 
HETATM 4185 O O   . HOH D 4 .   ? 35.181  -11.424 44.607 1.00 67.07  ? 2069 HOH A O   1 
HETATM 4186 O O   . HOH D 4 .   ? 30.172  -12.440 44.933 1.00 55.37  ? 2070 HOH A O   1 
HETATM 4187 O O   . HOH D 4 .   ? 30.906  -15.389 49.666 1.00 54.12  ? 2071 HOH A O   1 
HETATM 4188 O O   . HOH D 4 .   ? 22.672  -7.349  57.689 1.00 42.29  ? 2072 HOH A O   1 
HETATM 4189 O O   . HOH D 4 .   ? 25.954  2.971   61.450 1.00 52.77  ? 2073 HOH A O   1 
HETATM 4190 O O   . HOH D 4 .   ? 26.477  1.019   62.899 1.00 49.11  ? 2074 HOH A O   1 
HETATM 4191 O O   . HOH D 4 .   ? 21.496  4.437   64.970 1.00 55.71  ? 2075 HOH A O   1 
HETATM 4192 O O   . HOH D 4 .   ? 22.570  8.694   62.231 1.00 39.13  ? 2076 HOH A O   1 
HETATM 4193 O O   . HOH D 4 .   ? 9.882   8.754   57.856 1.00 39.79  ? 2077 HOH A O   1 
HETATM 4194 O O   . HOH D 4 .   ? 8.649   8.847   55.821 1.00 52.98  ? 2078 HOH A O   1 
HETATM 4195 O O   . HOH D 4 .   ? 7.212   5.100   50.477 1.00 50.08  ? 2079 HOH A O   1 
HETATM 4196 O O   . HOH D 4 .   ? 11.374  11.011  51.628 1.00 39.60  ? 2080 HOH A O   1 
HETATM 4197 O O   . HOH D 4 .   ? 2.054   4.360   46.362 1.00 68.98  ? 2081 HOH A O   1 
HETATM 4198 O O   . HOH D 4 .   ? -0.149  7.517   47.149 1.00 42.55  ? 2082 HOH A O   1 
HETATM 4199 O O   . HOH D 4 .   ? 3.229   5.973   39.916 1.00 50.12  ? 2083 HOH A O   1 
HETATM 4200 O O   . HOH D 4 .   ? -3.329  8.143   48.380 1.00 96.41  ? 2084 HOH A O   1 
HETATM 4201 O O   . HOH D 4 .   ? -11.219 11.917  43.544 1.00 58.92  ? 2085 HOH A O   1 
HETATM 4202 O O   . HOH D 4 .   ? -7.227  13.000  46.589 1.00 70.95  ? 2086 HOH A O   1 
HETATM 4203 O O   . HOH D 4 .   ? -9.024  17.444  43.266 1.00 52.03  ? 2087 HOH A O   1 
HETATM 4204 O O   . HOH D 4 .   ? -6.632  20.496  48.190 1.00 55.79  ? 2088 HOH A O   1 
HETATM 4205 O O   . HOH D 4 .   ? -4.728  19.301  48.814 1.00 49.68  ? 2089 HOH A O   1 
HETATM 4206 O O   . HOH D 4 .   ? -12.989 12.253  34.177 1.00 61.43  ? 2090 HOH A O   1 
HETATM 4207 O O   . HOH D 4 .   ? -11.215 15.430  39.056 1.00 56.57  ? 2091 HOH A O   1 
HETATM 4208 O O   . HOH D 4 .   ? -11.952 12.421  31.757 1.00 55.58  ? 2092 HOH A O   1 
HETATM 4209 O O   . HOH D 4 .   ? -8.795  14.648  30.243 1.00 52.17  ? 2093 HOH A O   1 
HETATM 4210 O O   . HOH D 4 .   ? -9.498  10.693  39.694 1.00 66.90  ? 2094 HOH A O   1 
HETATM 4211 O O   . HOH D 4 .   ? 7.727   4.190   32.604 1.00 60.48  ? 2095 HOH A O   1 
HETATM 4212 O O   . HOH D 4 .   ? 5.810   8.008   24.128 1.00 58.34  ? 2096 HOH A O   1 
HETATM 4213 O O   . HOH D 4 .   ? 8.787   9.128   27.842 0.50 38.41  ? 2097 HOH A O   1 
HETATM 4214 O O   . HOH D 4 .   ? 8.097   3.269   34.790 1.00 57.06  ? 2098 HOH A O   1 
HETATM 4215 O O   . HOH D 4 .   ? 24.343  12.124  40.227 1.00 57.91  ? 2099 HOH A O   1 
HETATM 4216 O O   . HOH D 4 .   ? 23.686  15.610  37.770 1.00 51.32  ? 2100 HOH A O   1 
HETATM 4217 O O   . HOH D 4 .   ? 21.569  19.269  44.450 1.00 41.47  ? 2101 HOH A O   1 
HETATM 4218 O O   . HOH D 4 .   ? 15.614  18.451  50.148 1.00 49.57  ? 2102 HOH A O   1 
HETATM 4219 O O   . HOH D 4 .   ? 14.024  22.994  41.396 1.00 57.31  ? 2103 HOH A O   1 
HETATM 4220 O O   . HOH D 4 .   ? 15.568  15.308  48.620 1.00 56.08  ? 2104 HOH A O   1 
HETATM 4221 O O   . HOH D 4 .   ? 13.836  13.486  45.680 1.00 40.59  ? 2105 HOH A O   1 
HETATM 4222 O O   . HOH D 4 .   ? 7.124   20.118  48.647 1.00 48.75  ? 2106 HOH A O   1 
HETATM 4223 O O   . HOH D 4 .   ? 4.207   13.059  28.454 1.00 53.86  ? 2107 HOH A O   1 
HETATM 4224 O O   . HOH D 4 .   ? 5.649   20.152  27.290 1.00 72.46  ? 2108 HOH A O   1 
HETATM 4225 O O   . HOH D 4 .   ? -0.281  22.009  26.585 1.00 49.98  ? 2109 HOH A O   1 
HETATM 4226 O O   . HOH D 4 .   ? -1.818  21.089  21.224 1.00 50.79  ? 2110 HOH A O   1 
HETATM 4227 O O   . HOH D 4 .   ? -7.728  15.594  21.879 1.00 47.03  ? 2111 HOH A O   1 
HETATM 4228 O O   . HOH D 4 .   ? -10.299 20.674  19.012 1.00 41.31  ? 2112 HOH A O   1 
HETATM 4229 O O   . HOH D 4 .   ? -7.094  23.651  28.171 1.00 36.49  ? 2113 HOH A O   1 
HETATM 4230 O O   . HOH D 4 .   ? -6.874  32.852  31.353 1.00 60.76  ? 2114 HOH A O   1 
HETATM 4231 O O   . HOH D 4 .   ? -5.465  31.111  33.589 1.00 57.44  ? 2115 HOH A O   1 
HETATM 4232 O O   . HOH D 4 .   ? -1.156  30.244  36.423 1.00 45.22  ? 2116 HOH A O   1 
HETATM 4233 O O   . HOH D 4 .   ? 1.833   24.343  34.780 1.00 44.85  ? 2117 HOH A O   1 
HETATM 4234 O O   . HOH D 4 .   ? -6.852  28.500  46.542 1.00 68.23  ? 2118 HOH A O   1 
HETATM 4235 O O   . HOH D 4 .   ? 13.702  22.836  29.263 1.00 63.55  ? 2119 HOH A O   1 
HETATM 4236 O O   . HOH D 4 .   ? 17.968  19.963  34.373 1.00 52.70  ? 2120 HOH A O   1 
HETATM 4237 O O   . HOH D 4 .   ? 19.346  12.122  29.621 1.00 78.02  ? 2121 HOH A O   1 
HETATM 4238 O O   . HOH D 4 .   ? 24.287  12.459  29.924 1.00 79.72  ? 2122 HOH A O   1 
HETATM 4239 O O   . HOH E 4 .   ? 11.597  -5.253  89.822 1.00 70.75  ? 2001 HOH B O   1 
HETATM 4240 O O   . HOH E 4 .   ? 10.153  -4.524  87.687 1.00 67.73  ? 2002 HOH B O   1 
HETATM 4241 O O   . HOH E 4 .   ? 2.988   -8.555  72.989 1.00 64.52  ? 2003 HOH B O   1 
HETATM 4242 O O   . HOH E 4 .   ? 6.361   -5.013  77.642 1.00 70.49  ? 2004 HOH B O   1 
HETATM 4243 O O   . HOH E 4 .   ? 21.454  14.756  86.647 1.00 77.77  ? 2005 HOH B O   1 
HETATM 4244 O O   . HOH E 4 .   ? 19.910  11.733  85.613 1.00 57.41  ? 2006 HOH B O   1 
HETATM 4245 O O   . HOH E 4 .   ? 18.730  -19.902 45.873 1.00 55.54  ? 2007 HOH B O   1 
HETATM 4246 O O   . HOH E 4 .   ? 7.320   1.304   78.316 1.00 56.76  ? 2008 HOH B O   1 
HETATM 4247 O O   . HOH E 4 .   ? 4.207   -1.959  56.014 1.00 60.19  ? 2009 HOH B O   1 
HETATM 4248 O O   . HOH E 4 .   ? 24.059  -9.302  59.227 1.00 55.93  ? 2010 HOH B O   1 
HETATM 4249 O O   . HOH E 4 .   ? 23.986  -17.049 49.901 1.00 59.19  ? 2011 HOH B O   1 
HETATM 4250 O O   . HOH E 4 .   ? 17.687  -14.815 55.614 0.50 35.83  ? 2012 HOH B O   1 
HETATM 4251 O O   . HOH E 4 .   ? 21.611  -17.575 48.273 1.00 82.80  ? 2013 HOH B O   1 
HETATM 4252 O O   . HOH E 4 .   ? 18.525  -17.229 48.946 1.00 66.11  ? 2014 HOH B O   1 
HETATM 4253 O O   . HOH E 4 .   ? 21.686  -14.412 48.907 1.00 48.40  ? 2015 HOH B O   1 
HETATM 4254 O O   . HOH E 4 .   ? 16.908  -10.474 50.868 1.00 42.98  ? 2016 HOH B O   1 
HETATM 4255 O O   . HOH E 4 .   ? 17.139  -12.897 57.346 0.50 48.91  ? 2017 HOH B O   1 
HETATM 4256 O O   . HOH E 4 .   ? 11.017  -11.136 58.823 1.00 49.60  ? 2018 HOH B O   1 
HETATM 4257 O O   . HOH E 4 .   ? 10.490  4.914   58.335 1.00 30.81  ? 2019 HOH B O   1 
HETATM 4258 O O   . HOH E 4 .   ? 4.014   4.857   59.882 1.00 47.53  ? 2020 HOH B O   1 
HETATM 4259 O O   . HOH E 4 .   ? 8.351   10.309  59.040 1.00 60.38  ? 2021 HOH B O   1 
HETATM 4260 O O   . HOH E 4 .   ? 3.570   10.554  66.106 1.00 54.74  ? 2022 HOH B O   1 
HETATM 4261 O O   . HOH E 4 .   ? 7.680   7.383   65.975 1.00 68.53  ? 2023 HOH B O   1 
HETATM 4262 O O   . HOH E 4 .   ? 5.938   16.575  60.313 1.00 62.06  ? 2024 HOH B O   1 
HETATM 4263 O O   . HOH E 4 .   ? 1.623   -1.435  57.099 1.00 50.85  ? 2025 HOH B O   1 
HETATM 4264 O O   . HOH E 4 .   ? 1.129   2.148   54.084 1.00 68.94  ? 2026 HOH B O   1 
HETATM 4265 O O   . HOH E 4 .   ? 3.989   10.934  68.674 1.00 59.49  ? 2027 HOH B O   1 
HETATM 4266 O O   . HOH E 4 .   ? 12.495  13.726  73.576 1.00 53.12  ? 2028 HOH B O   1 
HETATM 4267 O O   . HOH E 4 .   ? 26.625  -8.403  59.915 1.00 65.64  ? 2029 HOH B O   1 
HETATM 4268 O O   . HOH E 4 .   ? 28.431  -3.395  60.262 1.00 46.66  ? 2030 HOH B O   1 
HETATM 4269 O O   . HOH E 4 .   ? 28.343  -10.831 68.382 1.00 69.09  ? 2031 HOH B O   1 
HETATM 4270 O O   . HOH E 4 .   ? 8.250   5.191   76.822 1.00 47.92  ? 2032 HOH B O   1 
HETATM 4271 O O   . HOH E 4 .   ? 9.087   5.975   79.529 1.00 50.47  ? 2033 HOH B O   1 
HETATM 4272 O O   . HOH E 4 .   ? 10.049  7.422   89.460 1.00 71.90  ? 2034 HOH B O   1 
HETATM 4273 O O   . HOH E 4 .   ? -14.346 -27.552 73.010 1.00 55.50  ? 2035 HOH B O   1 
HETATM 4274 O O   . HOH E 4 .   ? -16.918 -26.781 75.838 1.00 100.80 ? 2036 HOH B O   1 
HETATM 4275 O O   . HOH E 4 .   ? 0.233   4.650   95.583 1.00 72.40  ? 2037 HOH B O   1 
HETATM 4276 O O   . HOH E 4 .   ? -6.085  13.939  82.200 1.00 67.66  ? 2038 HOH B O   1 
HETATM 4277 O O   . HOH E 4 .   ? -17.224 17.290  74.674 1.00 63.39  ? 2039 HOH B O   1 
HETATM 4278 O O   . HOH E 4 .   ? -10.963 3.391   64.769 1.00 50.03  ? 2040 HOH B O   1 
HETATM 4279 O O   . HOH E 4 .   ? -10.766 0.228   65.955 1.00 60.47  ? 2041 HOH B O   1 
HETATM 4280 O O   . HOH E 4 .   ? 1.188   1.779   57.792 1.00 71.03  ? 2042 HOH B O   1 
HETATM 4281 O O   . HOH E 4 .   ? 1.197   -4.049  61.447 0.50 43.72  ? 2043 HOH B O   1 
HETATM 4282 O O   . HOH E 4 .   ? -2.788  -4.325  60.437 1.00 53.10  ? 2044 HOH B O   1 
HETATM 4283 O O   . HOH E 4 .   ? 0.908   -3.753  64.042 1.00 53.03  ? 2045 HOH B O   1 
HETATM 4284 O O   . HOH E 4 .   ? 1.121   -6.228  65.739 1.00 66.33  ? 2046 HOH B O   1 
HETATM 4285 O O   . HOH E 4 .   ? 1.529   -5.029  68.128 1.00 47.43  ? 2047 HOH B O   1 
HETATM 4286 O O   . HOH E 4 .   ? 2.183   -4.099  70.771 1.00 53.84  ? 2048 HOH B O   1 
HETATM 4287 O O   . HOH E 4 .   ? 3.897   -3.626  76.920 1.00 55.64  ? 2049 HOH B O   1 
HETATM 4288 O O   . HOH E 4 .   ? 4.991   11.323  83.883 1.00 69.07  ? 2050 HOH B O   1 
HETATM 4289 O O   . HOH E 4 .   ? 4.729   17.573  80.698 1.00 57.09  ? 2051 HOH B O   1 
HETATM 4290 O O   . HOH E 4 .   ? 0.552   18.420  79.335 1.00 64.96  ? 2052 HOH B O   1 
HETATM 4291 O O   . HOH E 4 .   ? 6.924   2.222   73.650 1.00 51.08  ? 2053 HOH B O   1 
HETATM 4292 O O   . HOH E 4 .   ? 5.637   1.610   70.183 1.00 53.61  ? 2054 HOH B O   1 
HETATM 4293 O O   . HOH E 4 .   ? 11.752  -10.897 68.269 1.00 53.28  ? 2055 HOH B O   1 
HETATM 4294 O O   . HOH E 4 .   ? 8.244   -15.616 64.818 1.00 51.97  ? 2056 HOH B O   1 
HETATM 4295 O O   . HOH E 4 .   ? 16.487  -8.892  74.690 1.00 54.58  ? 2057 HOH B O   1 
HETATM 4296 O O   . HOH E 4 .   ? 12.281  -24.915 76.299 1.00 67.34  ? 2058 HOH B O   1 
HETATM 4297 O O   . HOH E 4 .   ? -13.387 -10.596 70.289 1.00 69.40  ? 2059 HOH B O   1 
HETATM 4298 O O   . HOH E 4 .   ? -6.906  -22.370 67.143 1.00 69.54  ? 2060 HOH B O   1 
HETATM 4299 O O   . HOH E 4 .   ? -1.833  -7.808  63.518 1.00 68.04  ? 2061 HOH B O   1 
HETATM 4300 O O   . HOH E 4 .   ? -9.433  -6.222  83.054 1.00 68.31  ? 2062 HOH B O   1 
HETATM 4301 O O   . HOH E 4 .   ? -17.020 -24.677 73.247 1.00 77.00  ? 2063 HOH B O   1 
HETATM 4302 O O   . HOH E 4 .   ? -22.348 -6.433  89.195 1.00 77.76  ? 2064 HOH B O   1 
HETATM 4303 O O   . HOH E 4 .   ? -18.118 -2.153  88.839 1.00 51.71  ? 2065 HOH B O   1 
HETATM 4304 O O   . HOH E 4 .   ? -15.366 -3.974  64.805 1.00 71.02  ? 2066 HOH B O   1 
HETATM 4305 O O   . HOH E 4 .   ? -22.519 9.480   65.174 1.00 81.78  ? 2067 HOH B O   1 
HETATM 4306 O O   . HOH E 4 .   ? -24.186 8.139   71.444 1.00 71.15  ? 2068 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLU 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   GLN 4   4   ?   ?   ?   A . n 
A 1 5   LEU 5   5   ?   ?   ?   A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   CYS 7   7   7   CYS CYS A . n 
A 1 8   CYS 8   8   8   CYS CYS A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  GLU 11  11  11  GLU GLU A . n 
A 1 12  THR 12  12  12  THR THR A . n 
A 1 13  ILE 13  13  13  ILE ILE A . n 
A 1 14  ARG 14  14  ?   ?   ?   A . n 
A 1 15  ARG 15  15  ?   ?   ?   A . n 
A 1 16  ALA 16  16  ?   ?   ?   A . n 
A 1 17  TYR 17  17  ?   ?   ?   A . n 
A 1 18  PRO 18  18  ?   ?   ?   A . n 
A 1 19  ASP 19  19  ?   ?   ?   A . n 
A 1 20  ALA 20  20  ?   ?   ?   A . n 
A 1 21  ASN 21  21  ?   ?   ?   A . n 
A 1 22  LEU 22  22  ?   ?   ?   A . n 
A 1 23  LEU 23  23  ?   ?   ?   A . n 
A 1 24  ASN 24  24  ?   ?   ?   A . n 
A 1 25  ASP 25  25  25  ASP ASP A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  ARG 29  29  29  ARG ARG A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  MET 31  31  31  MET MET A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  LYS 33  33  33  LYS LYS A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  THR 37  37  37  THR THR A . n 
A 1 38  CYS 38  38  38  CYS CYS A . n 
A 1 39  ALA 39  39  39  ALA ALA A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  SER 41  41  41  SER SER A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  TYR 44  44  44  TYR TYR A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  CYS 47  47  47  CYS CYS A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  GLN 49  49  49  GLN GLN A . n 
A 1 50  LYS 50  50  50  LYS LYS A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  VAL 52  52  52  VAL VAL A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  MET 56  56  56  MET MET A . n 
A 1 57  ARG 57  57  57  ARG ARG A . n 
A 1 58  LYS 58  58  58  LYS LYS A . n 
A 1 59  ILE 59  59  59  ILE ILE A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TRP 63  63  63  TRP TRP A . n 
A 1 64  MET 64  64  64  MET MET A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  GLU 66  66  66  GLU GLU A . n 
A 1 67  VAL 67  67  67  VAL VAL A . n 
A 1 68  CYS 68  68  68  CYS CYS A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  GLU 70  70  70  GLU GLU A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  LYS 72  72  72  LYS LYS A . n 
A 1 73  CYS 73  73  73  CYS CYS A . n 
A 1 74  GLU 74  74  74  GLU GLU A . n 
A 1 75  GLU 75  75  75  GLU GLU A . n 
A 1 76  GLU 76  76  76  GLU GLU A . n 
A 1 77  VAL 77  77  77  VAL VAL A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  PRO 79  79  79  PRO PRO A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  MET 82  82  82  MET MET A . n 
A 1 83  ASN 83  83  83  ASN ASN A . n 
A 1 84  TYR 84  84  84  TYR TYR A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  ARG 87  87  87  ARG ARG A . n 
A 1 88  PHE 88  88  88  PHE PHE A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  PRO 93  93  93  PRO PRO A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  LYS 95  95  95  LYS LYS A . n 
A 1 96  LYS 96  96  96  LYS LYS A . n 
A 1 97  SER 97  97  97  SER SER A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 GLN 100 100 100 GLN GLN A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 GLY 103 103 103 GLY GLY A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 THR 105 105 105 THR THR A . n 
A 1 106 CYS 106 106 106 CYS CYS A . n 
A 1 107 MET 107 107 107 MET MET A . n 
A 1 108 PHE 108 108 108 PHE PHE A . n 
A 1 109 VAL 109 109 109 VAL VAL A . n 
A 1 110 ALA 110 110 110 ALA ALA A . n 
A 1 111 SER 111 111 111 SER SER A . n 
A 1 112 LYS 112 112 112 LYS LYS A . n 
A 1 113 MET 113 113 113 MET MET A . n 
A 1 114 LYS 114 114 114 LYS LYS A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 THR 116 116 116 THR THR A . n 
A 1 117 ILE 117 117 117 ILE ILE A . n 
A 1 118 PRO 118 118 118 PRO PRO A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 THR 120 120 120 THR THR A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 GLU 122 122 122 GLU GLU A . n 
A 1 123 LYS 123 123 123 LYS LYS A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 CYS 125 125 125 CYS CYS A . n 
A 1 126 ILE 126 126 126 ILE ILE A . n 
A 1 127 TYR 127 127 127 TYR TYR A . n 
A 1 128 THR 128 128 128 THR THR A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 ASN 130 130 130 ASN ASN A . n 
A 1 131 SER 131 131 131 SER SER A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 ARG 133 133 133 ARG ARG A . n 
A 1 134 PRO 134 134 134 PRO PRO A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 GLU 136 136 136 GLU GLU A . n 
A 1 137 LEU 137 137 137 LEU LEU A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 GLN 139 139 139 GLN GLN A . n 
A 1 140 MET 140 140 140 MET MET A . n 
A 1 141 GLU 141 141 141 GLU GLU A . n 
A 1 142 LEU 142 142 142 LEU LEU A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 LEU 144 144 144 LEU LEU A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 ASN 146 146 146 ASN ASN A . n 
A 1 147 LYS 147 147 147 LYS LYS A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 LYS 149 149 149 LYS LYS A . n 
A 1 150 TRP 150 150 150 TRP TRP A . n 
A 1 151 ASN 151 151 151 ASN ASN A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 MET 155 155 155 MET MET A . n 
A 1 156 THR 156 156 156 THR THR A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 HIS 158 158 158 HIS HIS A . n 
A 1 159 ASP 159 159 159 ASP ASP A . n 
A 1 160 PHE 160 160 160 PHE PHE A . n 
A 1 161 ILE 161 161 161 ILE ILE A . n 
A 1 162 GLU 162 162 162 GLU GLU A . n 
A 1 163 HIS 163 163 163 HIS HIS A . n 
A 1 164 PHE 164 164 164 PHE PHE A . n 
A 1 165 LEU 165 165 165 LEU LEU A . n 
A 1 166 SER 166 166 166 SER SER A . n 
A 1 167 LYS 167 167 167 LYS LYS A . n 
A 1 168 MET 168 168 168 MET MET A . n 
A 1 169 PRO 169 169 169 PRO PRO A . n 
A 1 170 GLU 170 170 170 GLU GLU A . n 
A 1 171 ALA 171 171 171 ALA ALA A . n 
A 1 172 GLU 172 172 172 GLU GLU A . n 
A 1 173 GLU 173 173 173 GLU GLU A . n 
A 1 174 ASN 174 174 174 ASN ASN A . n 
A 1 175 LYS 175 175 175 LYS LYS A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 ILE 177 177 177 ILE ILE A . n 
A 1 178 ILE 178 178 178 ILE ILE A . n 
A 1 179 ARG 179 179 179 ARG ARG A . n 
A 1 180 LYS 180 180 180 LYS LYS A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ALA 182 182 182 ALA ALA A . n 
A 1 183 GLN 183 183 183 GLN GLN A . n 
A 1 184 THR 184 184 184 THR THR A . n 
A 1 185 PHE 185 185 185 PHE PHE A . n 
A 1 186 VAL 186 186 186 VAL VAL A . n 
A 1 187 ALA 187 187 187 ALA ALA A . n 
A 1 188 LEU 188 188 188 LEU LEU A . n 
A 1 189 CYS 189 189 189 CYS CYS A . n 
A 1 190 ALA 190 190 190 ALA ALA A . n 
A 1 191 THR 191 191 191 THR THR A . n 
A 1 192 ASP 192 192 192 ASP ASP A . n 
A 1 193 VAL 193 193 193 VAL VAL A . n 
A 1 194 LYS 194 194 194 LYS LYS A . n 
A 1 195 PHE 195 195 195 PHE PHE A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 SER 197 197 197 SER SER A . n 
A 1 198 ASN 198 198 198 ASN ASN A . n 
A 1 199 PRO 199 199 199 PRO PRO A . n 
A 1 200 PRO 200 200 200 PRO PRO A . n 
A 1 201 SER 201 201 201 SER SER A . n 
A 1 202 MET 202 202 202 MET MET A . n 
A 1 203 VAL 203 203 203 VAL VAL A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 GLY 206 206 206 GLY GLY A . n 
A 1 207 SER 207 207 207 SER SER A . n 
A 1 208 VAL 208 208 208 VAL VAL A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 ALA 210 210 210 ALA ALA A . n 
A 1 211 ALA 211 211 211 ALA ALA A . n 
A 1 212 VAL 212 212 212 VAL VAL A . n 
A 1 213 GLN 213 213 213 GLN GLN A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 LEU 215 215 215 LEU LEU A . n 
A 1 216 ASN 216 216 216 ASN ASN A . n 
A 1 217 LEU 217 217 217 LEU LEU A . n 
A 1 218 ARG 218 218 218 ARG ARG A . n 
A 1 219 SER 219 219 219 SER SER A . n 
A 1 220 PRO 220 220 220 PRO PRO A . n 
A 1 221 ASN 221 221 221 ASN ASN A . n 
A 1 222 ASN 222 222 222 ASN ASN A . n 
A 1 223 PHE 223 223 223 PHE PHE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 SER 225 225 225 SER SER A . n 
A 1 226 TYR 226 226 226 TYR TYR A . n 
A 1 227 TYR 227 227 227 TYR TYR A . n 
A 1 228 ARG 228 228 228 ARG ARG A . n 
A 1 229 LEU 229 229 229 LEU LEU A . n 
A 1 230 THR 230 230 230 THR THR A . n 
A 1 231 ARG 231 231 231 ARG ARG A . n 
A 1 232 PHE 232 232 232 PHE PHE A . n 
A 1 233 LEU 233 233 233 LEU LEU A . n 
A 1 234 SER 234 234 234 SER SER A . n 
A 1 235 ARG 235 235 235 ARG ARG A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 ILE 237 237 237 ILE ILE A . n 
A 1 238 LYS 238 238 238 LYS LYS A . n 
A 1 239 CYS 239 239 239 CYS CYS A . n 
A 1 240 ASP 240 240 240 ASP ASP A . n 
A 1 241 PRO 241 241 241 PRO PRO A . n 
A 1 242 ASP 242 242 242 ASP ASP A . n 
A 1 243 CYS 243 243 243 CYS CYS A . n 
A 1 244 LEU 244 244 244 LEU LEU A . n 
A 1 245 ARG 245 245 245 ARG ARG A . n 
A 1 246 ALA 246 246 246 ALA ALA A . n 
A 1 247 CYS 247 247 247 CYS CYS A . n 
A 1 248 GLN 248 248 248 GLN GLN A . n 
A 1 249 GLU 249 249 249 GLU GLU A . n 
A 1 250 GLN 250 250 250 GLN GLN A . n 
A 1 251 ILE 251 251 251 ILE ILE A . n 
A 1 252 GLU 252 252 252 GLU GLU A . n 
A 1 253 ALA 253 253 253 ALA ALA A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 LEU 255 255 255 LEU LEU A . n 
A 1 256 GLU 256 256 256 GLU GLU A . n 
A 1 257 SER 257 257 257 SER SER A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 LEU 259 259 259 LEU LEU A . n 
A 1 260 ARG 260 260 260 ARG ARG A . n 
A 1 261 GLN 261 261 261 GLN GLN A . n 
A 1 262 ALA 262 262 262 ALA ALA A . n 
A 1 263 GLN 263 263 263 GLN GLN A . n 
A 1 264 GLN 264 264 264 GLN GLN A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 MET 266 266 ?   ?   ?   A . n 
A 1 267 ASP 267 267 ?   ?   ?   A . n 
A 1 268 PRO 268 268 ?   ?   ?   A . n 
A 1 269 LYS 269 269 ?   ?   ?   A . n 
A 1 270 ALA 270 270 ?   ?   ?   A . n 
A 1 271 ALA 271 271 ?   ?   ?   A . n 
B 2 1   MET 1   1   ?   ?   ?   B . n 
B 2 2   ALA 2   2   ?   ?   ?   B . n 
B 2 3   THR 3   3   ?   ?   ?   B . n 
B 2 4   SER 4   4   4   SER SER B . n 
B 2 5   ARG 5   5   5   ARG ARG B . n 
B 2 6   TYR 6   6   6   TYR TYR B . n 
B 2 7   GLU 7   7   7   GLU GLU B . n 
B 2 8   PRO 8   8   8   PRO PRO B . n 
B 2 9   VAL 9   9   9   VAL VAL B . n 
B 2 10  ALA 10  10  10  ALA ALA B . n 
B 2 11  GLU 11  11  11  GLU GLU B . n 
B 2 12  ILE 12  12  12  ILE ILE B . n 
B 2 13  GLY 13  13  13  GLY GLY B . n 
B 2 14  VAL 14  14  14  VAL VAL B . n 
B 2 15  GLY 15  15  15  GLY GLY B . n 
B 2 16  ALA 16  16  16  ALA ALA B . n 
B 2 17  TYR 17  17  17  TYR TYR B . n 
B 2 18  GLY 18  18  18  GLY GLY B . n 
B 2 19  THR 19  19  19  THR THR B . n 
B 2 20  VAL 20  20  20  VAL VAL B . n 
B 2 21  TYR 21  21  21  TYR TYR B . n 
B 2 22  LYS 22  22  22  LYS LYS B . n 
B 2 23  ALA 23  23  23  ALA ALA B . n 
B 2 24  ARG 24  24  24  ARG ARG B . n 
B 2 25  ASP 25  25  25  ASP ASP B . n 
B 2 26  PRO 26  26  26  PRO PRO B . n 
B 2 27  HIS 27  27  27  HIS HIS B . n 
B 2 28  SER 28  28  28  SER SER B . n 
B 2 29  GLY 29  29  29  GLY GLY B . n 
B 2 30  HIS 30  30  30  HIS HIS B . n 
B 2 31  PHE 31  31  31  PHE PHE B . n 
B 2 32  VAL 32  32  32  VAL VAL B . n 
B 2 33  ALA 33  33  33  ALA ALA B . n 
B 2 34  LEU 34  34  34  LEU LEU B . n 
B 2 35  LYS 35  35  35  LYS LYS B . n 
B 2 36  SER 36  36  36  SER SER B . n 
B 2 37  VAL 37  37  37  VAL VAL B . n 
B 2 38  ARG 38  38  38  ARG ARG B . n 
B 2 39  VAL 39  39  39  VAL VAL B . n 
B 2 40  PRO 40  40  40  PRO PRO B . n 
B 2 41  ASN 41  41  41  ASN ASN B . n 
B 2 42  GLY 42  42  42  GLY GLY B . n 
B 2 43  GLU 43  43  43  GLU GLU B . n 
B 2 44  GLU 44  44  44  GLU GLU B . n 
B 2 45  GLY 45  48  48  GLY GLY B . n 
B 2 46  LEU 46  49  49  LEU LEU B . n 
B 2 47  PRO 47  50  50  PRO PRO B . n 
B 2 48  ILE 48  51  51  ILE ILE B . n 
B 2 49  SER 49  52  52  SER SER B . n 
B 2 50  THR 50  53  53  THR THR B . n 
B 2 51  VAL 51  54  54  VAL VAL B . n 
B 2 52  ARG 52  55  55  ARG ARG B . n 
B 2 53  GLU 53  56  56  GLU GLU B . n 
B 2 54  VAL 54  57  57  VAL VAL B . n 
B 2 55  ALA 55  58  58  ALA ALA B . n 
B 2 56  LEU 56  59  59  LEU LEU B . n 
B 2 57  LEU 57  60  60  LEU LEU B . n 
B 2 58  ARG 58  61  61  ARG ARG B . n 
B 2 59  ARG 59  62  62  ARG ARG B . n 
B 2 60  LEU 60  63  63  LEU LEU B . n 
B 2 61  GLU 61  64  64  GLU GLU B . n 
B 2 62  ALA 62  65  65  ALA ALA B . n 
B 2 63  PHE 63  66  66  PHE PHE B . n 
B 2 64  GLU 64  67  67  GLU GLU B . n 
B 2 65  HIS 65  68  68  HIS HIS B . n 
B 2 66  PRO 66  69  69  PRO PRO B . n 
B 2 67  ASN 67  70  70  ASN ASN B . n 
B 2 68  VAL 68  71  71  VAL VAL B . n 
B 2 69  VAL 69  72  72  VAL VAL B . n 
B 2 70  ARG 70  73  73  ARG ARG B . n 
B 2 71  LEU 71  74  74  LEU LEU B . n 
B 2 72  MET 72  75  75  MET MET B . n 
B 2 73  ASP 73  76  76  ASP ASP B . n 
B 2 74  VAL 74  77  77  VAL VAL B . n 
B 2 75  CYS 75  78  78  CYS CYS B . n 
B 2 76  ALA 76  79  79  ALA ALA B . n 
B 2 77  THR 77  80  80  THR THR B . n 
B 2 78  SER 78  81  81  SER SER B . n 
B 2 79  ARG 79  82  82  ARG ARG B . n 
B 2 80  THR 80  83  83  THR THR B . n 
B 2 81  ASP 81  84  84  ASP ASP B . n 
B 2 82  ARG 82  85  85  ARG ARG B . n 
B 2 83  GLU 83  86  86  GLU GLU B . n 
B 2 84  ILE 84  87  87  ILE ILE B . n 
B 2 85  LYS 85  88  88  LYS LYS B . n 
B 2 86  VAL 86  89  89  VAL VAL B . n 
B 2 87  THR 87  90  90  THR THR B . n 
B 2 88  LEU 88  91  91  LEU LEU B . n 
B 2 89  VAL 89  92  92  VAL VAL B . n 
B 2 90  PHE 90  93  93  PHE PHE B . n 
B 2 91  GLU 91  94  94  GLU GLU B . n 
B 2 92  HIS 92  95  95  HIS HIS B . n 
B 2 93  VAL 93  96  96  VAL VAL B . n 
B 2 94  ASP 94  97  97  ASP ASP B . n 
B 2 95  GLN 95  98  98  GLN GLN B . n 
B 2 96  ASP 96  99  99  ASP ASP B . n 
B 2 97  LEU 97  100 100 LEU LEU B . n 
B 2 98  ARG 98  101 101 ARG ARG B . n 
B 2 99  THR 99  102 102 THR THR B . n 
B 2 100 TYR 100 103 103 TYR TYR B . n 
B 2 101 LEU 101 104 104 LEU LEU B . n 
B 2 102 ASP 102 105 105 ASP ASP B . n 
B 2 103 LYS 103 106 106 LYS LYS B . n 
B 2 104 ALA 104 107 107 ALA ALA B . n 
B 2 105 PRO 105 108 108 PRO PRO B . n 
B 2 106 PRO 106 109 109 PRO PRO B . n 
B 2 107 PRO 107 110 110 PRO PRO B . n 
B 2 108 GLY 108 111 111 GLY GLY B . n 
B 2 109 LEU 109 112 112 LEU LEU B . n 
B 2 110 PRO 110 113 113 PRO PRO B . n 
B 2 111 ALA 111 114 114 ALA ALA B . n 
B 2 112 GLU 112 115 115 GLU GLU B . n 
B 2 113 THR 113 116 116 THR THR B . n 
B 2 114 ILE 114 117 117 ILE ILE B . n 
B 2 115 LYS 115 118 118 LYS LYS B . n 
B 2 116 ASP 116 119 119 ASP ASP B . n 
B 2 117 LEU 117 120 120 LEU LEU B . n 
B 2 118 MET 118 121 121 MET MET B . n 
B 2 119 ARG 119 122 122 ARG ARG B . n 
B 2 120 GLN 120 123 123 GLN GLN B . n 
B 2 121 PHE 121 124 124 PHE PHE B . n 
B 2 122 LEU 122 125 125 LEU LEU B . n 
B 2 123 ARG 123 126 126 ARG ARG B . n 
B 2 124 GLY 124 127 127 GLY GLY B . n 
B 2 125 LEU 125 128 128 LEU LEU B . n 
B 2 126 ASP 126 129 129 ASP ASP B . n 
B 2 127 PHE 127 130 130 PHE PHE B . n 
B 2 128 LEU 128 131 131 LEU LEU B . n 
B 2 129 HIS 129 132 132 HIS HIS B . n 
B 2 130 ALA 130 133 133 ALA ALA B . n 
B 2 131 ASN 131 134 134 ASN ASN B . n 
B 2 132 CYS 132 135 135 CYS CYS B . n 
B 2 133 ILE 133 136 136 ILE ILE B . n 
B 2 134 VAL 134 137 137 VAL VAL B . n 
B 2 135 HIS 135 138 138 HIS HIS B . n 
B 2 136 ARG 136 139 139 ARG ARG B . n 
B 2 137 ASP 137 140 140 ASP ASP B . n 
B 2 138 LEU 138 141 141 LEU LEU B . n 
B 2 139 LYS 139 142 142 LYS LYS B . n 
B 2 140 PRO 140 143 143 PRO PRO B . n 
B 2 141 GLU 141 144 144 GLU GLU B . n 
B 2 142 ASN 142 145 145 ASN ASN B . n 
B 2 143 ILE 143 146 146 ILE ILE B . n 
B 2 144 LEU 144 147 147 LEU LEU B . n 
B 2 145 VAL 145 148 148 VAL VAL B . n 
B 2 146 THR 146 149 149 THR THR B . n 
B 2 147 SER 147 150 150 SER SER B . n 
B 2 148 GLY 148 151 151 GLY GLY B . n 
B 2 149 GLY 149 152 152 GLY GLY B . n 
B 2 150 THR 150 153 153 THR THR B . n 
B 2 151 VAL 151 154 154 VAL VAL B . n 
B 2 152 LYS 152 155 155 LYS LYS B . n 
B 2 153 LEU 153 156 156 LEU LEU B . n 
B 2 154 ALA 154 157 157 ALA ALA B . n 
B 2 155 ASP 155 158 158 ASP ASP B . n 
B 2 156 PHE 156 159 159 PHE PHE B . n 
B 2 157 GLY 157 160 160 GLY GLY B . n 
B 2 158 LEU 158 161 161 LEU LEU B . n 
B 2 159 ALA 159 162 162 ALA ALA B . n 
B 2 160 ARG 160 163 163 ARG ARG B . n 
B 2 161 ILE 161 164 164 ILE ILE B . n 
B 2 162 TYR 162 165 165 TYR TYR B . n 
B 2 163 SER 163 166 166 SER SER B . n 
B 2 164 TYR 164 167 167 TYR TYR B . n 
B 2 165 GLN 165 168 168 GLN GLN B . n 
B 2 166 MET 166 169 169 MET MET B . n 
B 2 167 ALA 167 170 170 ALA ALA B . n 
B 2 168 LEU 168 171 171 LEU LEU B . n 
B 2 169 ASP 169 172 172 ASP ASP B . n 
B 2 170 PRO 170 173 173 PRO PRO B . n 
B 2 171 VAL 171 174 174 VAL VAL B . n 
B 2 172 VAL 172 175 175 VAL VAL B . n 
B 2 173 VAL 173 176 176 VAL VAL B . n 
B 2 174 THR 174 177 177 THR THR B . n 
B 2 175 LEU 175 178 178 LEU LEU B . n 
B 2 176 TRP 176 179 179 TRP TRP B . n 
B 2 177 TYR 177 180 180 TYR TYR B . n 
B 2 178 ARG 178 181 181 ARG ARG B . n 
B 2 179 ALA 179 182 182 ALA ALA B . n 
B 2 180 PRO 180 183 183 PRO PRO B . n 
B 2 181 GLU 181 184 184 GLU GLU B . n 
B 2 182 VAL 182 185 185 VAL VAL B . n 
B 2 183 LEU 183 186 186 LEU LEU B . n 
B 2 184 LEU 184 187 187 LEU LEU B . n 
B 2 185 GLN 185 188 188 GLN GLN B . n 
B 2 186 SER 186 189 189 SER SER B . n 
B 2 187 THR 187 190 190 THR THR B . n 
B 2 188 TYR 188 191 191 TYR TYR B . n 
B 2 189 ALA 189 192 192 ALA ALA B . n 
B 2 190 THR 190 193 193 THR THR B . n 
B 2 191 PRO 191 194 194 PRO PRO B . n 
B 2 192 VAL 192 195 195 VAL VAL B . n 
B 2 193 ASP 193 196 196 ASP ASP B . n 
B 2 194 MET 194 197 197 MET MET B . n 
B 2 195 TRP 195 198 198 TRP TRP B . n 
B 2 196 SER 196 199 199 SER SER B . n 
B 2 197 VAL 197 200 200 VAL VAL B . n 
B 2 198 GLY 198 201 201 GLY GLY B . n 
B 2 199 CYS 199 202 202 CYS CYS B . n 
B 2 200 ILE 200 203 203 ILE ILE B . n 
B 2 201 PHE 201 204 204 PHE PHE B . n 
B 2 202 ALA 202 205 205 ALA ALA B . n 
B 2 203 GLU 203 206 206 GLU GLU B . n 
B 2 204 MET 204 207 207 MET MET B . n 
B 2 205 PHE 205 208 208 PHE PHE B . n 
B 2 206 ARG 206 209 209 ARG ARG B . n 
B 2 207 ARG 207 210 210 ARG ARG B . n 
B 2 208 LYS 208 211 211 LYS LYS B . n 
B 2 209 PRO 209 212 212 PRO PRO B . n 
B 2 210 LEU 210 213 213 LEU LEU B . n 
B 2 211 PHE 211 214 214 PHE PHE B . n 
B 2 212 CYS 212 215 215 CYS CYS B . n 
B 2 213 GLY 213 216 216 GLY GLY B . n 
B 2 214 ASN 214 217 217 ASN ASN B . n 
B 2 215 SER 215 218 218 SER SER B . n 
B 2 216 GLU 216 219 219 GLU GLU B . n 
B 2 217 ALA 217 220 220 ALA ALA B . n 
B 2 218 ASP 218 221 221 ASP ASP B . n 
B 2 219 GLN 219 222 222 GLN GLN B . n 
B 2 220 LEU 220 223 223 LEU LEU B . n 
B 2 221 GLY 221 224 224 GLY GLY B . n 
B 2 222 LYS 222 225 225 LYS LYS B . n 
B 2 223 ILE 223 226 226 ILE ILE B . n 
B 2 224 PHE 224 227 227 PHE PHE B . n 
B 2 225 ASP 225 228 228 ASP ASP B . n 
B 2 226 LEU 226 229 229 LEU LEU B . n 
B 2 227 ILE 227 230 230 ILE ILE B . n 
B 2 228 GLY 228 231 231 GLY GLY B . n 
B 2 229 LEU 229 232 232 LEU LEU B . n 
B 2 230 PRO 230 233 233 PRO PRO B . n 
B 2 231 PRO 231 234 234 PRO PRO B . n 
B 2 232 GLU 232 235 235 GLU GLU B . n 
B 2 233 ASP 233 236 236 ASP ASP B . n 
B 2 234 ASP 234 237 237 ASP ASP B . n 
B 2 235 TRP 235 238 238 TRP TRP B . n 
B 2 236 PRO 236 239 ?   ?   ?   B . n 
B 2 237 ARG 237 240 ?   ?   ?   B . n 
B 2 238 ASP 238 241 ?   ?   ?   B . n 
B 2 239 VAL 239 242 ?   ?   ?   B . n 
B 2 240 SER 240 243 ?   ?   ?   B . n 
B 2 241 LEU 241 244 ?   ?   ?   B . n 
B 2 242 PRO 242 245 ?   ?   ?   B . n 
B 2 243 ARG 243 246 ?   ?   ?   B . n 
B 2 244 GLY 244 247 ?   ?   ?   B . n 
B 2 245 ALA 245 248 ?   ?   ?   B . n 
B 2 246 PHE 246 249 ?   ?   ?   B . n 
B 2 247 PRO 247 250 ?   ?   ?   B . n 
B 2 248 PRO 248 251 ?   ?   ?   B . n 
B 2 249 ARG 249 252 ?   ?   ?   B . n 
B 2 250 GLY 250 253 ?   ?   ?   B . n 
B 2 251 PRO 251 254 ?   ?   ?   B . n 
B 2 252 ARG 252 255 ?   ?   ?   B . n 
B 2 253 PRO 253 256 ?   ?   ?   B . n 
B 2 254 VAL 254 257 ?   ?   ?   B . n 
B 2 255 GLN 255 258 ?   ?   ?   B . n 
B 2 256 SER 256 259 ?   ?   ?   B . n 
B 2 257 VAL 257 260 ?   ?   ?   B . n 
B 2 258 VAL 258 261 261 VAL VAL B . n 
B 2 259 PRO 259 262 262 PRO PRO B . n 
B 2 260 GLU 260 263 263 GLU GLU B . n 
B 2 261 MET 261 264 264 MET MET B . n 
B 2 262 GLU 262 265 265 GLU GLU B . n 
B 2 263 GLU 263 266 266 GLU GLU B . n 
B 2 264 SER 264 267 267 SER SER B . n 
B 2 265 GLY 265 268 268 GLY GLY B . n 
B 2 266 ALA 266 269 269 ALA ALA B . n 
B 2 267 GLN 267 270 270 GLN GLN B . n 
B 2 268 LEU 268 271 271 LEU LEU B . n 
B 2 269 LEU 269 272 272 LEU LEU B . n 
B 2 270 LEU 270 273 273 LEU LEU B . n 
B 2 271 GLU 271 274 274 GLU GLU B . n 
B 2 272 MET 272 275 275 MET MET B . n 
B 2 273 LEU 273 276 276 LEU LEU B . n 
B 2 274 THR 274 277 277 THR THR B . n 
B 2 275 PHE 275 278 278 PHE PHE B . n 
B 2 276 ASN 276 279 279 ASN ASN B . n 
B 2 277 PRO 277 280 280 PRO PRO B . n 
B 2 278 HIS 278 281 281 HIS HIS B . n 
B 2 279 LYS 279 282 282 LYS LYS B . n 
B 2 280 ARG 280 283 283 ARG ARG B . n 
B 2 281 ILE 281 284 284 ILE ILE B . n 
B 2 282 SER 282 285 285 SER SER B . n 
B 2 283 ALA 283 286 286 ALA ALA B . n 
B 2 284 PHE 284 287 287 PHE PHE B . n 
B 2 285 ARG 285 288 288 ARG ARG B . n 
B 2 286 ALA 286 289 289 ALA ALA B . n 
B 2 287 LEU 287 290 290 LEU LEU B . n 
B 2 288 GLN 288 291 291 GLN GLN B . n 
B 2 289 HIS 289 292 292 HIS HIS B . n 
B 2 290 SER 290 293 293 SER SER B . n 
B 2 291 TYR 291 294 294 TYR TYR B . n 
B 2 292 LEU 292 295 295 LEU LEU B . n 
B 2 293 HIS 293 296 ?   ?   ?   B . n 
B 2 294 LYS 294 297 ?   ?   ?   B . n 
B 2 295 ASP 295 298 ?   ?   ?   B . n 
B 2 296 GLU 296 299 ?   ?   ?   B . n 
B 2 297 GLY 297 300 ?   ?   ?   B . n 
B 2 298 ASN 298 301 ?   ?   ?   B . n 
B 2 299 PRO 299 302 ?   ?   ?   B . n 
B 2 300 GLU 300 303 ?   ?   ?   B . n 
B 2 301 HIS 301 304 ?   ?   ?   B . n 
B 2 302 HIS 302 305 ?   ?   ?   B . n 
B 2 303 HIS 303 306 ?   ?   ?   B . n 
B 2 304 HIS 304 307 ?   ?   ?   B . n 
B 2 305 HIS 305 308 ?   ?   ?   B . n 
B 2 306 HIS 306 309 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 GOL 1   1266 1266 GOL GOL A . 
D 4 HOH 1   2001 2001 HOH HOH A . 
D 4 HOH 2   2002 2002 HOH HOH A . 
D 4 HOH 3   2003 2003 HOH HOH A . 
D 4 HOH 4   2004 2004 HOH HOH A . 
D 4 HOH 5   2005 2005 HOH HOH A . 
D 4 HOH 6   2006 2006 HOH HOH A . 
D 4 HOH 7   2007 2007 HOH HOH A . 
D 4 HOH 8   2008 2008 HOH HOH A . 
D 4 HOH 9   2009 2009 HOH HOH A . 
D 4 HOH 10  2010 2010 HOH HOH A . 
D 4 HOH 11  2011 2011 HOH HOH A . 
D 4 HOH 12  2012 2012 HOH HOH A . 
D 4 HOH 13  2013 2013 HOH HOH A . 
D 4 HOH 14  2014 2014 HOH HOH A . 
D 4 HOH 15  2015 2015 HOH HOH A . 
D 4 HOH 16  2016 2016 HOH HOH A . 
D 4 HOH 17  2017 2017 HOH HOH A . 
D 4 HOH 18  2018 2018 HOH HOH A . 
D 4 HOH 19  2019 2019 HOH HOH A . 
D 4 HOH 20  2020 2020 HOH HOH A . 
D 4 HOH 21  2021 2021 HOH HOH A . 
D 4 HOH 22  2022 2022 HOH HOH A . 
D 4 HOH 23  2023 2023 HOH HOH A . 
D 4 HOH 24  2024 2024 HOH HOH A . 
D 4 HOH 25  2025 2025 HOH HOH A . 
D 4 HOH 26  2026 2026 HOH HOH A . 
D 4 HOH 27  2027 2027 HOH HOH A . 
D 4 HOH 28  2028 2028 HOH HOH A . 
D 4 HOH 29  2029 2029 HOH HOH A . 
D 4 HOH 30  2030 2030 HOH HOH A . 
D 4 HOH 31  2031 2031 HOH HOH A . 
D 4 HOH 32  2032 2032 HOH HOH A . 
D 4 HOH 33  2033 2033 HOH HOH A . 
D 4 HOH 34  2034 2034 HOH HOH A . 
D 4 HOH 35  2035 2035 HOH HOH A . 
D 4 HOH 36  2036 2036 HOH HOH A . 
D 4 HOH 37  2037 2037 HOH HOH A . 
D 4 HOH 38  2038 2038 HOH HOH A . 
D 4 HOH 39  2039 2039 HOH HOH A . 
D 4 HOH 40  2040 2040 HOH HOH A . 
D 4 HOH 41  2041 2041 HOH HOH A . 
D 4 HOH 42  2042 2042 HOH HOH A . 
D 4 HOH 43  2043 2043 HOH HOH A . 
D 4 HOH 44  2044 2044 HOH HOH A . 
D 4 HOH 45  2045 2045 HOH HOH A . 
D 4 HOH 46  2046 2046 HOH HOH A . 
D 4 HOH 47  2047 2047 HOH HOH A . 
D 4 HOH 48  2048 2048 HOH HOH A . 
D 4 HOH 49  2049 2049 HOH HOH A . 
D 4 HOH 50  2050 2050 HOH HOH A . 
D 4 HOH 51  2051 2051 HOH HOH A . 
D 4 HOH 52  2052 2052 HOH HOH A . 
D 4 HOH 53  2053 2053 HOH HOH A . 
D 4 HOH 54  2054 2054 HOH HOH A . 
D 4 HOH 55  2055 2055 HOH HOH A . 
D 4 HOH 56  2056 2056 HOH HOH A . 
D 4 HOH 57  2057 2057 HOH HOH A . 
D 4 HOH 58  2058 2058 HOH HOH A . 
D 4 HOH 59  2059 2059 HOH HOH A . 
D 4 HOH 60  2060 2060 HOH HOH A . 
D 4 HOH 61  2061 2061 HOH HOH A . 
D 4 HOH 62  2062 2062 HOH HOH A . 
D 4 HOH 63  2063 2063 HOH HOH A . 
D 4 HOH 64  2064 2064 HOH HOH A . 
D 4 HOH 65  2065 2065 HOH HOH A . 
D 4 HOH 66  2066 2066 HOH HOH A . 
D 4 HOH 67  2067 2067 HOH HOH A . 
D 4 HOH 68  2068 2068 HOH HOH A . 
D 4 HOH 69  2069 2069 HOH HOH A . 
D 4 HOH 70  2070 2070 HOH HOH A . 
D 4 HOH 71  2071 2071 HOH HOH A . 
D 4 HOH 72  2072 2072 HOH HOH A . 
D 4 HOH 73  2073 2073 HOH HOH A . 
D 4 HOH 74  2074 2074 HOH HOH A . 
D 4 HOH 75  2075 2075 HOH HOH A . 
D 4 HOH 76  2076 2076 HOH HOH A . 
D 4 HOH 77  2077 2077 HOH HOH A . 
D 4 HOH 78  2078 2078 HOH HOH A . 
D 4 HOH 79  2079 2079 HOH HOH A . 
D 4 HOH 80  2080 2080 HOH HOH A . 
D 4 HOH 81  2081 2081 HOH HOH A . 
D 4 HOH 82  2082 2082 HOH HOH A . 
D 4 HOH 83  2083 2083 HOH HOH A . 
D 4 HOH 84  2084 2084 HOH HOH A . 
D 4 HOH 85  2085 2085 HOH HOH A . 
D 4 HOH 86  2086 2086 HOH HOH A . 
D 4 HOH 87  2087 2087 HOH HOH A . 
D 4 HOH 88  2088 2088 HOH HOH A . 
D 4 HOH 89  2089 2089 HOH HOH A . 
D 4 HOH 90  2090 2090 HOH HOH A . 
D 4 HOH 91  2091 2091 HOH HOH A . 
D 4 HOH 92  2092 2092 HOH HOH A . 
D 4 HOH 93  2093 2093 HOH HOH A . 
D 4 HOH 94  2094 2094 HOH HOH A . 
D 4 HOH 95  2095 2095 HOH HOH A . 
D 4 HOH 96  2096 2096 HOH HOH A . 
D 4 HOH 97  2097 2097 HOH HOH A . 
D 4 HOH 98  2098 2098 HOH HOH A . 
D 4 HOH 99  2099 2099 HOH HOH A . 
D 4 HOH 100 2100 2100 HOH HOH A . 
D 4 HOH 101 2101 2101 HOH HOH A . 
D 4 HOH 102 2102 2102 HOH HOH A . 
D 4 HOH 103 2103 2103 HOH HOH A . 
D 4 HOH 104 2104 2104 HOH HOH A . 
D 4 HOH 105 2105 2105 HOH HOH A . 
D 4 HOH 106 2106 2106 HOH HOH A . 
D 4 HOH 107 2107 2107 HOH HOH A . 
D 4 HOH 108 2108 2108 HOH HOH A . 
D 4 HOH 109 2109 2109 HOH HOH A . 
D 4 HOH 110 2110 2110 HOH HOH A . 
D 4 HOH 111 2111 2111 HOH HOH A . 
D 4 HOH 112 2112 2112 HOH HOH A . 
D 4 HOH 113 2113 2113 HOH HOH A . 
D 4 HOH 114 2114 2114 HOH HOH A . 
D 4 HOH 115 2115 2115 HOH HOH A . 
D 4 HOH 116 2116 2116 HOH HOH A . 
D 4 HOH 117 2117 2117 HOH HOH A . 
D 4 HOH 118 2118 2118 HOH HOH A . 
D 4 HOH 119 2119 2119 HOH HOH A . 
D 4 HOH 120 2120 2120 HOH HOH A . 
D 4 HOH 121 2121 2121 HOH HOH A . 
D 4 HOH 122 2122 2122 HOH HOH A . 
E 4 HOH 1   2001 2001 HOH HOH B . 
E 4 HOH 2   2002 2002 HOH HOH B . 
E 4 HOH 3   2003 2003 HOH HOH B . 
E 4 HOH 4   2004 2004 HOH HOH B . 
E 4 HOH 5   2005 2005 HOH HOH B . 
E 4 HOH 6   2006 2006 HOH HOH B . 
E 4 HOH 7   2007 2007 HOH HOH B . 
E 4 HOH 8   2008 2008 HOH HOH B . 
E 4 HOH 9   2009 2009 HOH HOH B . 
E 4 HOH 10  2010 2010 HOH HOH B . 
E 4 HOH 11  2011 2011 HOH HOH B . 
E 4 HOH 12  2012 2012 HOH HOH B . 
E 4 HOH 13  2013 2013 HOH HOH B . 
E 4 HOH 14  2014 2014 HOH HOH B . 
E 4 HOH 15  2015 2015 HOH HOH B . 
E 4 HOH 16  2016 2016 HOH HOH B . 
E 4 HOH 17  2017 2017 HOH HOH B . 
E 4 HOH 18  2018 2018 HOH HOH B . 
E 4 HOH 19  2019 2019 HOH HOH B . 
E 4 HOH 20  2020 2020 HOH HOH B . 
E 4 HOH 21  2021 2021 HOH HOH B . 
E 4 HOH 22  2022 2022 HOH HOH B . 
E 4 HOH 23  2023 2023 HOH HOH B . 
E 4 HOH 24  2024 2024 HOH HOH B . 
E 4 HOH 25  2025 2025 HOH HOH B . 
E 4 HOH 26  2026 2026 HOH HOH B . 
E 4 HOH 27  2027 2027 HOH HOH B . 
E 4 HOH 28  2028 2028 HOH HOH B . 
E 4 HOH 29  2029 2029 HOH HOH B . 
E 4 HOH 30  2030 2030 HOH HOH B . 
E 4 HOH 31  2031 2031 HOH HOH B . 
E 4 HOH 32  2032 2032 HOH HOH B . 
E 4 HOH 33  2033 2033 HOH HOH B . 
E 4 HOH 34  2034 2034 HOH HOH B . 
E 4 HOH 35  2035 2035 HOH HOH B . 
E 4 HOH 36  2036 2036 HOH HOH B . 
E 4 HOH 37  2037 2037 HOH HOH B . 
E 4 HOH 38  2038 2038 HOH HOH B . 
E 4 HOH 39  2039 2039 HOH HOH B . 
E 4 HOH 40  2040 2040 HOH HOH B . 
E 4 HOH 41  2041 2041 HOH HOH B . 
E 4 HOH 42  2042 2042 HOH HOH B . 
E 4 HOH 43  2043 2043 HOH HOH B . 
E 4 HOH 44  2044 2044 HOH HOH B . 
E 4 HOH 45  2045 2045 HOH HOH B . 
E 4 HOH 46  2046 2046 HOH HOH B . 
E 4 HOH 47  2047 2047 HOH HOH B . 
E 4 HOH 48  2048 2048 HOH HOH B . 
E 4 HOH 49  2049 2049 HOH HOH B . 
E 4 HOH 50  2050 2050 HOH HOH B . 
E 4 HOH 51  2051 2051 HOH HOH B . 
E 4 HOH 52  2052 2052 HOH HOH B . 
E 4 HOH 53  2053 2053 HOH HOH B . 
E 4 HOH 54  2054 2054 HOH HOH B . 
E 4 HOH 55  2055 2055 HOH HOH B . 
E 4 HOH 56  2056 2056 HOH HOH B . 
E 4 HOH 57  2057 2057 HOH HOH B . 
E 4 HOH 58  2058 2058 HOH HOH B . 
E 4 HOH 59  2059 2059 HOH HOH B . 
E 4 HOH 60  2060 2060 HOH HOH B . 
E 4 HOH 61  2061 2061 HOH HOH B . 
E 4 HOH 62  2062 2062 HOH HOH B . 
E 4 HOH 63  2063 2063 HOH HOH B . 
E 4 HOH 64  2064 2064 HOH HOH B . 
E 4 HOH 65  2065 2065 HOH HOH B . 
E 4 HOH 66  2066 2066 HOH HOH B . 
E 4 HOH 67  2067 2067 HOH HOH B . 
E 4 HOH 68  2068 2068 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2950  ? 
1 MORE         -18.8 ? 
1 'SSA (A^2)'  29630 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-03-10 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-04-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' Other                       
5 4 'Structure model' 'Source and taxonomy'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' entity_src_gen       
2 4 'Structure model' pdbx_database_proc   
3 4 'Structure model' pdbx_database_status 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_entity_src_gen.pdbx_host_org_cell_line'     
2 4 'Structure model' '_pdbx_database_status.recvd_author_approval' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
BUSTER-TNT refinement       2.1.1 ? 1 
MOSFLM     'data reduction' .     ? 2 
SCALA      'data scaling'   .     ? 3 
PHASER     phasing          .     ? 4 
# 
_pdbx_entry_details.entry_id             2W96 
_pdbx_entry_details.compound_details     
;ENGINEERED RESIDUE IN CHAIN B, GLY 43 TO GLU
ENGINEERED RESIDUE IN CHAIN B, GLY 44 TO GLU
ENGINEERED RESIDUE IN CHAIN B, THR 172 TO ASP
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;RESIDUES 1-271 WERE EXPRESSED, BUT THE N AND C-TERMINAL
WERE DISORDERED AND THEREFORE NOT COMPLETE IN THE MODEL.
HIS TAG WAS ADDED AT THE C-TERMINAL. RESIDUES 45-47
IN CHAIN B HAVE BEEN DELETED.
;
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C A SER 219 ? ? N A PRO 220 ? ? CA A PRO 220 ? ? 128.55 119.30 9.25   1.50 Y 
2 1 C B LEU 112 ? ? N B PRO 113 ? ? CD B PRO 113 ? ? 105.92 120.60 -14.68 2.20 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 CYS A 8   ? ? -32.23  164.45  
2  1 VAL A 10  ? ? -118.01 -115.36 
3  1 GLU A 11  ? ? 159.66  4.05    
4  1 PRO A 40  ? ? -68.98  -179.71 
5  1 PRO A 169 ? ? -67.95  40.82   
6  1 SER A 219 ? ? -151.75 84.08   
7  1 LYS A 238 ? ? 71.68   35.08   
8  1 PRO B 8   ? ? -47.77  163.35  
9  1 VAL B 9   ? ? -165.66 0.09    
10 1 ALA B 10  ? ? 171.57  174.34  
11 1 THR B 80  ? ? -91.58  -65.90  
12 1 ARG B 82  ? ? -172.74 116.53  
13 1 ARG B 101 ? ? -58.20  -71.42  
14 1 PRO B 108 ? ? -46.07  169.34  
15 1 LEU B 112 ? ? -173.71 139.99  
16 1 PRO B 113 ? ? -112.19 -169.54 
17 1 ARG B 139 ? ? 84.56   -28.84  
18 1 LEU B 171 ? ? -152.63 59.64   
19 1 ASP B 172 ? ? -146.38 -1.73   
20 1 VAL B 174 ? ? 81.98   81.26   
21 1 VAL B 175 ? ? -141.55 -5.42   
22 1 VAL B 176 ? ? 22.28   70.45   
23 1 LEU B 186 ? ? -68.12  66.80   
24 1 LEU B 187 ? ? -35.26  151.61  
25 1 SER B 189 ? ? -126.72 -63.78  
26 1 TYR B 191 ? ? 83.55   32.23   
27 1 ALA B 192 ? ? -126.21 -166.47 
28 1 ARG B 209 ? ? -63.96  -140.34 
29 1 ARG B 210 ? ? -173.61 15.25   
30 1 PRO B 212 ? ? -40.76  100.41  
31 1 PHE B 214 ? ? 65.87   97.57   
32 1 CYS B 215 ? ? -113.65 -150.05 
33 1 ASN B 217 ? ? 63.21   178.49  
34 1 ASP B 237 ? ? -107.65 42.82   
35 1 LEU B 276 ? ? -88.08  35.66   
36 1 PHE B 278 ? ? -28.96  -28.31  
37 1 GLN B 291 ? ? -96.32  50.42   
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 2003 ? 8.21 . 
2 1 O ? B HOH 2001 ? 5.96 . 
3 1 O ? B HOH 2035 ? 7.26 . 
4 1 O ? B HOH 2036 ? 8.03 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ILE 13 ? CG1 ? A ILE 13 CG1 
2 1 Y 1 A ILE 13 ? CG2 ? A ILE 13 CG2 
3 1 Y 1 A ILE 13 ? CD1 ? A ILE 13 CD1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A GLU 2   ? A GLU 2   
3  1 Y 1 A HIS 3   ? A HIS 3   
4  1 Y 1 A GLN 4   ? A GLN 4   
5  1 Y 1 A LEU 5   ? A LEU 5   
6  1 Y 1 A ARG 14  ? A ARG 14  
7  1 Y 1 A ARG 15  ? A ARG 15  
8  1 Y 1 A ALA 16  ? A ALA 16  
9  1 Y 1 A TYR 17  ? A TYR 17  
10 1 Y 1 A PRO 18  ? A PRO 18  
11 1 Y 1 A ASP 19  ? A ASP 19  
12 1 Y 1 A ALA 20  ? A ALA 20  
13 1 Y 1 A ASN 21  ? A ASN 21  
14 1 Y 1 A LEU 22  ? A LEU 22  
15 1 Y 1 A LEU 23  ? A LEU 23  
16 1 Y 1 A ASN 24  ? A ASN 24  
17 1 Y 1 A MET 266 ? A MET 266 
18 1 Y 1 A ASP 267 ? A ASP 267 
19 1 Y 1 A PRO 268 ? A PRO 268 
20 1 Y 1 A LYS 269 ? A LYS 269 
21 1 Y 1 A ALA 270 ? A ALA 270 
22 1 Y 1 A ALA 271 ? A ALA 271 
23 1 Y 1 B MET 1   ? B MET 1   
24 1 Y 1 B ALA 2   ? B ALA 2   
25 1 Y 1 B THR 3   ? B THR 3   
26 1 Y 1 B PRO 239 ? B PRO 236 
27 1 Y 1 B ARG 240 ? B ARG 237 
28 1 Y 1 B ASP 241 ? B ASP 238 
29 1 Y 1 B VAL 242 ? B VAL 239 
30 1 Y 1 B SER 243 ? B SER 240 
31 1 Y 1 B LEU 244 ? B LEU 241 
32 1 Y 1 B PRO 245 ? B PRO 242 
33 1 Y 1 B ARG 246 ? B ARG 243 
34 1 Y 1 B GLY 247 ? B GLY 244 
35 1 Y 1 B ALA 248 ? B ALA 245 
36 1 Y 1 B PHE 249 ? B PHE 246 
37 1 Y 1 B PRO 250 ? B PRO 247 
38 1 Y 1 B PRO 251 ? B PRO 248 
39 1 Y 1 B ARG 252 ? B ARG 249 
40 1 Y 1 B GLY 253 ? B GLY 250 
41 1 Y 1 B PRO 254 ? B PRO 251 
42 1 Y 1 B ARG 255 ? B ARG 252 
43 1 Y 1 B PRO 256 ? B PRO 253 
44 1 Y 1 B VAL 257 ? B VAL 254 
45 1 Y 1 B GLN 258 ? B GLN 255 
46 1 Y 1 B SER 259 ? B SER 256 
47 1 Y 1 B VAL 260 ? B VAL 257 
48 1 Y 1 B HIS 296 ? B HIS 293 
49 1 Y 1 B LYS 297 ? B LYS 294 
50 1 Y 1 B ASP 298 ? B ASP 295 
51 1 Y 1 B GLU 299 ? B GLU 296 
52 1 Y 1 B GLY 300 ? B GLY 297 
53 1 Y 1 B ASN 301 ? B ASN 298 
54 1 Y 1 B PRO 302 ? B PRO 299 
55 1 Y 1 B GLU 303 ? B GLU 300 
56 1 Y 1 B HIS 304 ? B HIS 301 
57 1 Y 1 B HIS 305 ? B HIS 302 
58 1 Y 1 B HIS 306 ? B HIS 303 
59 1 Y 1 B HIS 307 ? B HIS 304 
60 1 Y 1 B HIS 308 ? B HIS 305 
61 1 Y 1 B HIS 309 ? B HIS 306 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 GLYCEROL GOL 
4 water    HOH 
#