data_2W99
# 
_entry.id   2W99 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.307 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2W99         
PDBE  EBI-38619    
WWPDB D_1290038619 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1LD2 unspecified 'THEORETICAL STRUCTURE OF HUMAN CYCLIN- DEPENDENT KINASE 4(CDK4)' 
PDB 2W96 unspecified 'CRYSTAL STRUCTURE OF CDK4 IN COMPLEX WITH A D-TYPE CYCLIN'       
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2W99 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2009-01-22 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Day, P.J.'       1  
'Cleasby, A.'     2  
'Tickle, I.J.'    3  
'Reilly, M.O.'    4  
'Coyle, J.E.'     5  
'Holding, F.P.'   6  
'McMenamin, R.L.' 7  
'Yon, J.'         8  
'Chopra, R.'      9  
'Lengauer, C.'    10 
'Jhoti, H.'       11 
# 
_citation.id                        primary 
_citation.title                     'Crystal Structure of Human Cdk4 in Complex with a D-Type Cyclin.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            106 
_citation.page_first                4166 
_citation.page_last                 ? 
_citation.year                      2009 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19237565 
_citation.pdbx_database_id_DOI      10.1073/PNAS.0809645106 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Day, P.J.'       1  ? 
primary 'Cleasby, A.'     2  ? 
primary 'Tickle, I.J.'    3  ? 
primary 
;O'Reilly, M.
;
4  ? 
primary 'Coyle, J.E.'     5  ? 
primary 'Holding, F.P.'   6  ? 
primary 'Mcmenamin, R.L.' 7  ? 
primary 'Yon, J.'         8  ? 
primary 'Chopra, R.'      9  ? 
primary 'Lengauer, C.'    10 ? 
primary 'Jhoti, H.'       11 ? 
# 
_cell.entry_id           2W99 
_cell.length_a           57.023 
_cell.length_b           64.684 
_cell.length_c           188.747 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2W99 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'G1/S-SPECIFIC CYCLIN-D1'        30990.307 1   ?         ?   ?                                     ? 
2 polymer man 'CELL DIVISION PROTEIN KINASE 4' 34544.625 1   2.7.11.22 YES 'KINASE DOMAIN, RESIDUES 1-44,48-303' ? 
3 water   nat water                            18.015    126 ?         ?   ?                                     ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'D-TYPE CYCLIN, PRAD1 ONCOGENE'           
2 'CDK4, CYCLIN-DEPENDENT KINASE 4, PSK-J3' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPL
AMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDF
IEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNMDPKAA
;
;MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPL
AMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDF
IEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNMDPKAA
;
A ? 
2 'polypeptide(L)' no no 
;MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGEEGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRT
DREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLAR
IYSYQMALAPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVS
LPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPEHHHHHH
;
;MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGEEGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRT
DREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLAR
IYSYQMALAPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVS
LPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPEHHHHHH
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   HIS n 
1 4   GLN n 
1 5   LEU n 
1 6   LEU n 
1 7   CYS n 
1 8   CYS n 
1 9   GLU n 
1 10  VAL n 
1 11  GLU n 
1 12  THR n 
1 13  ILE n 
1 14  ARG n 
1 15  ARG n 
1 16  ALA n 
1 17  TYR n 
1 18  PRO n 
1 19  ASP n 
1 20  ALA n 
1 21  ASN n 
1 22  LEU n 
1 23  LEU n 
1 24  ASN n 
1 25  ASP n 
1 26  ARG n 
1 27  VAL n 
1 28  LEU n 
1 29  ARG n 
1 30  ALA n 
1 31  MET n 
1 32  LEU n 
1 33  LYS n 
1 34  ALA n 
1 35  GLU n 
1 36  GLU n 
1 37  THR n 
1 38  CYS n 
1 39  ALA n 
1 40  PRO n 
1 41  SER n 
1 42  VAL n 
1 43  SER n 
1 44  TYR n 
1 45  PHE n 
1 46  LYS n 
1 47  CYS n 
1 48  VAL n 
1 49  GLN n 
1 50  LYS n 
1 51  GLU n 
1 52  VAL n 
1 53  LEU n 
1 54  PRO n 
1 55  SER n 
1 56  MET n 
1 57  ARG n 
1 58  LYS n 
1 59  ILE n 
1 60  VAL n 
1 61  ALA n 
1 62  THR n 
1 63  TRP n 
1 64  MET n 
1 65  LEU n 
1 66  GLU n 
1 67  VAL n 
1 68  CYS n 
1 69  GLU n 
1 70  GLU n 
1 71  GLN n 
1 72  LYS n 
1 73  CYS n 
1 74  GLU n 
1 75  GLU n 
1 76  GLU n 
1 77  VAL n 
1 78  PHE n 
1 79  PRO n 
1 80  LEU n 
1 81  ALA n 
1 82  MET n 
1 83  ASN n 
1 84  TYR n 
1 85  LEU n 
1 86  ASP n 
1 87  ARG n 
1 88  PHE n 
1 89  LEU n 
1 90  SER n 
1 91  LEU n 
1 92  GLU n 
1 93  PRO n 
1 94  VAL n 
1 95  LYS n 
1 96  LYS n 
1 97  SER n 
1 98  ARG n 
1 99  LEU n 
1 100 GLN n 
1 101 LEU n 
1 102 LEU n 
1 103 GLY n 
1 104 ALA n 
1 105 THR n 
1 106 CYS n 
1 107 MET n 
1 108 PHE n 
1 109 VAL n 
1 110 ALA n 
1 111 SER n 
1 112 LYS n 
1 113 MET n 
1 114 LYS n 
1 115 GLU n 
1 116 THR n 
1 117 ILE n 
1 118 PRO n 
1 119 LEU n 
1 120 THR n 
1 121 ALA n 
1 122 GLU n 
1 123 LYS n 
1 124 LEU n 
1 125 CYS n 
1 126 ILE n 
1 127 TYR n 
1 128 THR n 
1 129 ASP n 
1 130 ASN n 
1 131 SER n 
1 132 ILE n 
1 133 ARG n 
1 134 PRO n 
1 135 GLU n 
1 136 GLU n 
1 137 LEU n 
1 138 LEU n 
1 139 GLN n 
1 140 MET n 
1 141 GLU n 
1 142 LEU n 
1 143 LEU n 
1 144 LEU n 
1 145 VAL n 
1 146 ASN n 
1 147 LYS n 
1 148 LEU n 
1 149 LYS n 
1 150 TRP n 
1 151 ASN n 
1 152 LEU n 
1 153 ALA n 
1 154 ALA n 
1 155 MET n 
1 156 THR n 
1 157 PRO n 
1 158 HIS n 
1 159 ASP n 
1 160 PHE n 
1 161 ILE n 
1 162 GLU n 
1 163 HIS n 
1 164 PHE n 
1 165 LEU n 
1 166 SER n 
1 167 LYS n 
1 168 MET n 
1 169 PRO n 
1 170 GLU n 
1 171 ALA n 
1 172 GLU n 
1 173 GLU n 
1 174 ASN n 
1 175 LYS n 
1 176 GLN n 
1 177 ILE n 
1 178 ILE n 
1 179 ARG n 
1 180 LYS n 
1 181 HIS n 
1 182 ALA n 
1 183 GLN n 
1 184 THR n 
1 185 PHE n 
1 186 VAL n 
1 187 ALA n 
1 188 LEU n 
1 189 CYS n 
1 190 ALA n 
1 191 THR n 
1 192 ASP n 
1 193 VAL n 
1 194 LYS n 
1 195 PHE n 
1 196 ILE n 
1 197 SER n 
1 198 ASN n 
1 199 PRO n 
1 200 PRO n 
1 201 SER n 
1 202 MET n 
1 203 VAL n 
1 204 ALA n 
1 205 ALA n 
1 206 GLY n 
1 207 SER n 
1 208 VAL n 
1 209 VAL n 
1 210 ALA n 
1 211 ALA n 
1 212 VAL n 
1 213 GLN n 
1 214 GLY n 
1 215 LEU n 
1 216 ASN n 
1 217 LEU n 
1 218 ARG n 
1 219 SER n 
1 220 PRO n 
1 221 ASN n 
1 222 ASN n 
1 223 PHE n 
1 224 LEU n 
1 225 SER n 
1 226 TYR n 
1 227 TYR n 
1 228 ARG n 
1 229 LEU n 
1 230 THR n 
1 231 ARG n 
1 232 PHE n 
1 233 LEU n 
1 234 SER n 
1 235 ARG n 
1 236 VAL n 
1 237 ILE n 
1 238 LYS n 
1 239 CYS n 
1 240 ASP n 
1 241 PRO n 
1 242 ASP n 
1 243 CYS n 
1 244 LEU n 
1 245 ARG n 
1 246 ALA n 
1 247 CYS n 
1 248 GLN n 
1 249 GLU n 
1 250 GLN n 
1 251 ILE n 
1 252 GLU n 
1 253 ALA n 
1 254 LEU n 
1 255 LEU n 
1 256 GLU n 
1 257 SER n 
1 258 SER n 
1 259 LEU n 
1 260 ARG n 
1 261 GLN n 
1 262 ALA n 
1 263 GLN n 
1 264 GLN n 
1 265 ASN n 
1 266 MET n 
1 267 ASP n 
1 268 PRO n 
1 269 LYS n 
1 270 ALA n 
1 271 ALA n 
2 1   MET n 
2 2   ALA n 
2 3   THR n 
2 4   SER n 
2 5   ARG n 
2 6   TYR n 
2 7   GLU n 
2 8   PRO n 
2 9   VAL n 
2 10  ALA n 
2 11  GLU n 
2 12  ILE n 
2 13  GLY n 
2 14  VAL n 
2 15  GLY n 
2 16  ALA n 
2 17  TYR n 
2 18  GLY n 
2 19  THR n 
2 20  VAL n 
2 21  TYR n 
2 22  LYS n 
2 23  ALA n 
2 24  ARG n 
2 25  ASP n 
2 26  PRO n 
2 27  HIS n 
2 28  SER n 
2 29  GLY n 
2 30  HIS n 
2 31  PHE n 
2 32  VAL n 
2 33  ALA n 
2 34  LEU n 
2 35  LYS n 
2 36  SER n 
2 37  VAL n 
2 38  ARG n 
2 39  VAL n 
2 40  PRO n 
2 41  ASN n 
2 42  GLY n 
2 43  GLU n 
2 44  GLU n 
2 45  GLY n 
2 46  LEU n 
2 47  PRO n 
2 48  ILE n 
2 49  SER n 
2 50  THR n 
2 51  VAL n 
2 52  ARG n 
2 53  GLU n 
2 54  VAL n 
2 55  ALA n 
2 56  LEU n 
2 57  LEU n 
2 58  ARG n 
2 59  ARG n 
2 60  LEU n 
2 61  GLU n 
2 62  ALA n 
2 63  PHE n 
2 64  GLU n 
2 65  HIS n 
2 66  PRO n 
2 67  ASN n 
2 68  VAL n 
2 69  VAL n 
2 70  ARG n 
2 71  LEU n 
2 72  MET n 
2 73  ASP n 
2 74  VAL n 
2 75  CYS n 
2 76  ALA n 
2 77  THR n 
2 78  SER n 
2 79  ARG n 
2 80  THR n 
2 81  ASP n 
2 82  ARG n 
2 83  GLU n 
2 84  ILE n 
2 85  LYS n 
2 86  VAL n 
2 87  THR n 
2 88  LEU n 
2 89  VAL n 
2 90  PHE n 
2 91  GLU n 
2 92  HIS n 
2 93  VAL n 
2 94  ASP n 
2 95  GLN n 
2 96  ASP n 
2 97  LEU n 
2 98  ARG n 
2 99  THR n 
2 100 TYR n 
2 101 LEU n 
2 102 ASP n 
2 103 LYS n 
2 104 ALA n 
2 105 PRO n 
2 106 PRO n 
2 107 PRO n 
2 108 GLY n 
2 109 LEU n 
2 110 PRO n 
2 111 ALA n 
2 112 GLU n 
2 113 THR n 
2 114 ILE n 
2 115 LYS n 
2 116 ASP n 
2 117 LEU n 
2 118 MET n 
2 119 ARG n 
2 120 GLN n 
2 121 PHE n 
2 122 LEU n 
2 123 ARG n 
2 124 GLY n 
2 125 LEU n 
2 126 ASP n 
2 127 PHE n 
2 128 LEU n 
2 129 HIS n 
2 130 ALA n 
2 131 ASN n 
2 132 CYS n 
2 133 ILE n 
2 134 VAL n 
2 135 HIS n 
2 136 ARG n 
2 137 ASP n 
2 138 LEU n 
2 139 LYS n 
2 140 PRO n 
2 141 GLU n 
2 142 ASN n 
2 143 ILE n 
2 144 LEU n 
2 145 VAL n 
2 146 THR n 
2 147 SER n 
2 148 GLY n 
2 149 GLY n 
2 150 THR n 
2 151 VAL n 
2 152 LYS n 
2 153 LEU n 
2 154 ALA n 
2 155 ASP n 
2 156 PHE n 
2 157 GLY n 
2 158 LEU n 
2 159 ALA n 
2 160 ARG n 
2 161 ILE n 
2 162 TYR n 
2 163 SER n 
2 164 TYR n 
2 165 GLN n 
2 166 MET n 
2 167 ALA n 
2 168 LEU n 
2 169 ALA n 
2 170 PRO n 
2 171 VAL n 
2 172 VAL n 
2 173 VAL n 
2 174 THR n 
2 175 LEU n 
2 176 TRP n 
2 177 TYR n 
2 178 ARG n 
2 179 ALA n 
2 180 PRO n 
2 181 GLU n 
2 182 VAL n 
2 183 LEU n 
2 184 LEU n 
2 185 GLN n 
2 186 SER n 
2 187 THR n 
2 188 TYR n 
2 189 ALA n 
2 190 THR n 
2 191 PRO n 
2 192 VAL n 
2 193 ASP n 
2 194 MET n 
2 195 TRP n 
2 196 SER n 
2 197 VAL n 
2 198 GLY n 
2 199 CYS n 
2 200 ILE n 
2 201 PHE n 
2 202 ALA n 
2 203 GLU n 
2 204 MET n 
2 205 PHE n 
2 206 ARG n 
2 207 ARG n 
2 208 LYS n 
2 209 PRO n 
2 210 LEU n 
2 211 PHE n 
2 212 CYS n 
2 213 GLY n 
2 214 ASN n 
2 215 SER n 
2 216 GLU n 
2 217 ALA n 
2 218 ASP n 
2 219 GLN n 
2 220 LEU n 
2 221 GLY n 
2 222 LYS n 
2 223 ILE n 
2 224 PHE n 
2 225 ASP n 
2 226 LEU n 
2 227 ILE n 
2 228 GLY n 
2 229 LEU n 
2 230 PRO n 
2 231 PRO n 
2 232 GLU n 
2 233 ASP n 
2 234 ASP n 
2 235 TRP n 
2 236 PRO n 
2 237 ARG n 
2 238 ASP n 
2 239 VAL n 
2 240 SER n 
2 241 LEU n 
2 242 PRO n 
2 243 ARG n 
2 244 GLY n 
2 245 ALA n 
2 246 PHE n 
2 247 PRO n 
2 248 PRO n 
2 249 ARG n 
2 250 GLY n 
2 251 PRO n 
2 252 ARG n 
2 253 PRO n 
2 254 VAL n 
2 255 GLN n 
2 256 SER n 
2 257 VAL n 
2 258 VAL n 
2 259 PRO n 
2 260 GLU n 
2 261 MET n 
2 262 GLU n 
2 263 GLU n 
2 264 SER n 
2 265 GLY n 
2 266 ALA n 
2 267 GLN n 
2 268 LEU n 
2 269 LEU n 
2 270 LEU n 
2 271 GLU n 
2 272 MET n 
2 273 LEU n 
2 274 THR n 
2 275 PHE n 
2 276 ASN n 
2 277 PRO n 
2 278 HIS n 
2 279 LYS n 
2 280 ARG n 
2 281 ILE n 
2 282 SER n 
2 283 ALA n 
2 284 PHE n 
2 285 ARG n 
2 286 ALA n 
2 287 LEU n 
2 288 GLN n 
2 289 HIS n 
2 290 SER n 
2 291 TYR n 
2 292 LEU n 
2 293 HIS n 
2 294 LYS n 
2 295 ASP n 
2 296 GLU n 
2 297 GLY n 
2 298 ASN n 
2 299 PRO n 
2 300 GLU n 
2 301 HIS n 
2 302 HIS n 
2 303 HIS n 
2 304 HIS n 
2 305 HIS n 
2 306 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? Sf21 ? ? ? 
? ? BACULOVIRUS ? ? ? ? ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? Sf21 ? ? ? 
? ? BACULOVIRUS ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP CCND1_HUMAN 1 ? ? P24385 ? 
2 UNP CDK4_HUMAN  2 ? ? P11802 ? 
3 PDB 2W99        2 ? ? 2W99   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2W99 A 1   ? 271 ? P24385 1   ? 271 ? 1   271 
2 2 2W99 B 1   ? 44  ? P11802 1   ? 44  ? 1   44  
3 2 2W99 B 45  ? 300 ? P11802 48  ? 303 ? 48  303 
4 3 2W99 B 301 ? 306 ? 2W99   304 ? 309 ? 304 309 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 2W99 GLU B 43  ? UNP P11802 GLY 43  'engineered mutation' 43  1 
2 2W99 GLU B 44  ? UNP P11802 GLY 44  'engineered mutation' 44  2 
2 2W99 ALA B 169 ? UNP P11802 THR 172 'engineered mutation' 172 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2W99 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.84 
_exptl_crystal.density_percent_sol   56.28 
_exptl_crystal.description           NONE 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2006-12-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.94 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_wavelength             0.94 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2W99 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             94.50 
_reflns.d_resolution_high            2.80 
_reflns.number_obs                   17640 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.6 
_reflns.pdbx_Rmerge_I_obs            0.09 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        6.00 
_reflns.B_iso_Wilson_estimate        78.76 
_reflns.pdbx_redundancy              4.5 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.91 
_reflns_shell.percent_possible_all   94.8 
_reflns_shell.Rmerge_I_obs           0.54 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.50 
_reflns_shell.pdbx_redundancy        4.5 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2W99 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     17640 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             94.49 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    98.3 
_refine.ls_R_factor_obs                          0.216 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.213 
_refine.ls_R_factor_R_free                       0.270 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.790 
_refine.ls_number_reflns_R_free                  845 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               86.21 
_refine.aniso_B[1][1]                            -4.53183 
_refine.aniso_B[2][2]                            10.15250 
_refine.aniso_B[3][3]                            -5.62067 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. DISORDERED REGIONS WERE MODELLED STEREOCHEMICALLY WHERE THE DENSITY WAS NOT CLEAR. IN REGIONS WHERE THE DENSITY WAS UNINTERPRETABLE OR ABSENT, RESIDUES WERE OMITTED.
;
_refine.pdbx_starting_model                      'PDB ENTRY 1BLX' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4259 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             126 
_refine_hist.number_atoms_total               4385 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        94.49 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   9 
_refine_ls_shell.d_res_high                       2.80 
_refine_ls_shell.d_res_low                        2.97 
_refine_ls_shell.number_reflns_R_work             2524 
_refine_ls_shell.R_factor_R_work                  0.2142 
_refine_ls_shell.percent_reflns_obs               98.27 
_refine_ls_shell.R_factor_R_free                  0.2633 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            4.97 
_refine_ls_shell.number_reflns_R_free             132 
_refine_ls_shell.number_reflns_all                2656 
_refine_ls_shell.R_factor_all                     0.2166 
# 
_struct.entry_id                  2W99 
_struct.title                     'Crystal Structure of CDK4 in complex with a D-type cyclin' 
_struct.pdbx_descriptor           'G1/S-SPECIFIC CYCLIN-D1, CELL DIVISION PROTEIN KINASE 4 (E.C.2.7.11.22)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2W99 
_struct_keywords.pdbx_keywords   'CELL CYCLE' 
_struct_keywords.text            
;SERINE/THREONINE-PROTEIN KINASE, CHROMOSOMAL REARRANGEMENT, ATP-BINDING, TRANSFERASE, POLYMORPHISM, CELL DIVISION, PROTO-ONCOGENE, PHOSPHOPROTEIN, DISEASE MUTATION, NUCLEOTIDE-BINDING, CYCLIN DEPENDENT KINASE, KINASE, CYCLIN, ONCOLOGY, CELL CYCLE, DRUG DESGN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 22  ? CYS A 38  ? LEU A 22  CYS A 38  1 ? 17 
HELX_P HELX_P2  2  SER A 43  ? VAL A 48  ? SER A 43  VAL A 48  1 ? 6  
HELX_P HELX_P3  3  LEU A 53  ? GLN A 71  ? LEU A 53  GLN A 71  1 ? 19 
HELX_P HELX_P4  4  GLU A 76  ? SER A 90  ? GLU A 76  SER A 90  1 ? 15 
HELX_P HELX_P5  5  LYS A 95  ? SER A 97  ? LYS A 95  SER A 97  5 ? 3  
HELX_P HELX_P6  6  ARG A 98  ? GLU A 115 ? ARG A 98  GLU A 115 1 ? 18 
HELX_P HELX_P7  7  THR A 120 ? TYR A 127 ? THR A 120 TYR A 127 1 ? 8  
HELX_P HELX_P8  8  ARG A 133 ? LEU A 148 ? ARG A 133 LEU A 148 1 ? 16 
HELX_P HELX_P9  9  THR A 156 ? MET A 168 ? THR A 156 MET A 168 1 ? 13 
HELX_P HELX_P10 10 ALA A 171 ? THR A 191 ? ALA A 171 THR A 191 1 ? 21 
HELX_P HELX_P11 11 VAL A 193 ? ASN A 198 ? VAL A 193 ASN A 198 1 ? 6  
HELX_P HELX_P12 12 PRO A 199 ? SER A 219 ? PRO A 199 SER A 219 1 ? 21 
HELX_P HELX_P13 13 ARG A 228 ? LYS A 238 ? ARG A 228 LYS A 238 1 ? 11 
HELX_P HELX_P14 14 ASP A 240 ? ALA A 262 ? ASP A 240 ALA A 262 1 ? 23 
HELX_P HELX_P15 15 PRO B 47  ? ARG B 59  ? PRO B 50  ARG B 62  1 ? 13 
HELX_P HELX_P16 16 LEU B 97  ? LYS B 103 ? LEU B 100 LYS B 106 1 ? 7  
HELX_P HELX_P17 17 ILE B 114 ? ASN B 131 ? ILE B 117 ASN B 134 1 ? 18 
HELX_P HELX_P18 18 TYR B 162 ? LEU B 168 ? TYR B 165 LEU B 171 5 ? 7  
HELX_P HELX_P19 19 THR B 190 ? MET B 204 ? THR B 193 MET B 207 1 ? 15 
HELX_P HELX_P20 20 SER B 215 ? GLY B 228 ? SER B 218 GLY B 231 1 ? 14 
HELX_P HELX_P21 21 PRO B 253 ? VAL B 258 ? PRO B 256 VAL B 261 1 ? 6  
HELX_P HELX_P22 22 GLU B 262 ? LEU B 273 ? GLU B 265 LEU B 276 1 ? 12 
HELX_P HELX_P23 23 ARG B 285 ? HIS B 289 ? ARG B 288 HIS B 292 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 2   B . ? ALA 2   B THR 3   B ? THR 3   B 1 -2.61 
2 LEU 109 B . ? LEU 112 B PRO 110 B ? PRO 113 B 1 -5.37 
3 PRO 170 B . ? PRO 173 B VAL 171 B ? VAL 174 B 1 -8.85 
4 PHE 205 B . ? PHE 208 B ARG 206 B ? ARG 209 B 1 -7.60 
5 GLU 232 B . ? GLU 235 B ASP 233 B ? ASP 236 B 1 11.58 
6 ARG 237 B . ? ARG 240 B ASP 238 B ? ASP 241 B 1 7.71  
7 PRO 259 B . ? PRO 262 B GLU 260 B ? GLU 263 B 1 -5.94 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
BA ? 3 ? 
BB ? 2 ? 
BC ? 3 ? 
BD ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BB 1 2 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BD 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
BA 1 GLU B 7   ? PRO B 8   ? GLU B 7   PRO B 8   
BA 2 ALA B 23  ? ARG B 24  ? ALA B 23  ARG B 24  
BA 3 PHE B 31  ? VAL B 32  ? PHE B 31  VAL B 32  
BB 1 VAL B 14  ? GLY B 15  ? VAL B 14  GLY B 15  
BB 2 GLY B 18  ? THR B 19  ? GLY B 18  THR B 19  
BC 1 ARG B 38  ? VAL B 39  ? ARG B 38  VAL B 39  
BC 2 GLU B 83  ? PHE B 90  ? GLU B 86  PHE B 93  
BC 3 LEU B 71  ? THR B 80  ? LEU B 74  THR B 83  
BD 1 GLN B 95  ? ASP B 96  ? GLN B 98  ASP B 99  
BD 2 LEU B 144 ? VAL B 145 ? LEU B 147 VAL B 148 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
BA 1 2 N GLU B 7  ? N GLU B 7  O ARG B 24  ? O ARG B 24  
BA 2 3 N ALA B 23 ? N ALA B 23 O VAL B 32  ? O VAL B 32  
BB 1 2 N GLY B 15 ? N GLY B 15 O GLY B 18  ? O GLY B 18  
BC 1 2 N VAL B 39 ? N VAL B 39 O ILE B 84  ? O ILE B 87  
BC 2 3 N VAL B 89 ? N VAL B 92 O ASP B 73  ? O ASP B 76  
BD 1 2 N GLN B 95 ? N GLN B 98 O VAL B 145 ? O VAL B 148 
# 
_database_PDB_matrix.entry_id          2W99 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2W99 
_atom_sites.fract_transf_matrix[1][1]   0.017537 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015460 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005298 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LEU A 1 22  ? 39.477  38.203 35.000 1.00 116.24 ? 22   LEU A N   1 
ATOM   2    C CA  . LEU A 1 22  ? 39.260  36.794 35.299 1.00 115.93 ? 22   LEU A CA  1 
ATOM   3    C C   . LEU A 1 22  ? 38.008  36.285 34.583 1.00 119.20 ? 22   LEU A C   1 
ATOM   4    O O   . LEU A 1 22  ? 37.448  36.972 33.726 1.00 118.61 ? 22   LEU A O   1 
ATOM   5    C CB  . LEU A 1 22  ? 39.115  36.589 36.810 1.00 116.00 ? 22   LEU A CB  1 
ATOM   6    C CG  . LEU A 1 22  ? 40.019  37.436 37.711 1.00 120.67 ? 22   LEU A CG  1 
ATOM   7    C CD1 . LEU A 1 22  ? 39.860  37.042 39.175 1.00 120.76 ? 22   LEU A CD1 1 
ATOM   8    C CD2 . LEU A 1 22  ? 41.472  37.340 37.273 1.00 123.13 ? 22   LEU A CD2 1 
ATOM   9    N N   . LEU A 1 23  ? 37.593  35.068 34.922 1.00 115.31 ? 23   LEU A N   1 
ATOM   10   C CA  . LEU A 1 23  ? 36.318  34.537 34.455 1.00 114.80 ? 23   LEU A CA  1 
ATOM   11   C C   . LEU A 1 23  ? 35.203  34.803 35.464 1.00 117.86 ? 23   LEU A C   1 
ATOM   12   O O   . LEU A 1 23  ? 34.032  34.555 35.183 1.00 117.49 ? 23   LEU A O   1 
ATOM   13   C CB  . LEU A 1 23  ? 36.423  33.041 34.150 1.00 114.86 ? 23   LEU A CB  1 
ATOM   14   C CG  . LEU A 1 23  ? 37.021  32.669 32.792 1.00 119.58 ? 23   LEU A CG  1 
ATOM   15   C CD1 . LEU A 1 23  ? 36.940  31.166 32.554 1.00 119.70 ? 23   LEU A CD1 1 
ATOM   16   C CD2 . LEU A 1 23  ? 36.329  33.436 31.670 1.00 121.85 ? 23   LEU A CD2 1 
ATOM   17   N N   . ASN A 1 24  ? 35.574  35.303 36.640 1.00 113.57 ? 24   ASN A N   1 
ATOM   18   C CA  . ASN A 1 24  ? 34.594  35.770 37.618 1.00 112.91 ? 24   ASN A CA  1 
ATOM   19   C C   . ASN A 1 24  ? 33.582  36.716 36.977 1.00 115.50 ? 24   ASN A C   1 
ATOM   20   O O   . ASN A 1 24  ? 32.374  36.472 37.019 1.00 115.40 ? 24   ASN A O   1 
ATOM   21   C CB  . ASN A 1 24  ? 35.288  36.480 38.783 1.00 113.47 ? 24   ASN A CB  1 
ATOM   22   C CG  . ASN A 1 24  ? 35.596  35.548 39.938 1.00 135.61 ? 24   ASN A CG  1 
ATOM   23   O OD1 . ASN A 1 24  ? 36.019  35.988 41.008 1.00 129.01 ? 24   ASN A OD1 1 
ATOM   24   N ND2 . ASN A 1 24  ? 35.358  34.256 39.738 1.00 128.04 ? 24   ASN A ND2 1 
ATOM   25   N N   . ASP A 1 25  ? 34.084  37.798 36.386 1.00 110.25 ? 25   ASP A N   1 
ATOM   26   C CA  . ASP A 1 25  ? 33.227  38.822 35.801 1.00 109.08 ? 25   ASP A CA  1 
ATOM   27   C C   . ASP A 1 25  ? 32.453  38.340 34.576 1.00 109.71 ? 25   ASP A C   1 
ATOM   28   O O   . ASP A 1 25  ? 31.272  38.652 34.420 1.00 109.50 ? 25   ASP A O   1 
ATOM   29   C CB  . ASP A 1 25  ? 34.028  40.088 35.472 1.00 111.09 ? 25   ASP A CB  1 
ATOM   30   C CG  . ASP A 1 25  ? 35.048  39.870 34.368 1.00 121.72 ? 25   ASP A CG  1 
ATOM   31   O OD1 . ASP A 1 25  ? 35.675  40.860 33.935 1.00 122.07 ? 25   ASP A OD1 1 
ATOM   32   O OD2 . ASP A 1 25  ? 35.223  38.713 33.929 1.00 128.15 ? 25   ASP A OD2 1 
ATOM   33   N N   . ARG A 1 26  ? 33.113  37.579 33.710 1.00 103.44 ? 26   ARG A N   1 
ATOM   34   C CA  . ARG A 1 26  ? 32.472  37.099 32.491 1.00 101.86 ? 26   ARG A CA  1 
ATOM   35   C C   . ARG A 1 26  ? 31.270  36.201 32.785 1.00 101.77 ? 26   ARG A C   1 
ATOM   36   O O   . ARG A 1 26  ? 30.199  36.373 32.200 1.00 101.32 ? 26   ARG A O   1 
ATOM   37   C CB  . ARG A 1 26  ? 33.476  36.381 31.588 1.00 102.51 ? 26   ARG A CB  1 
ATOM   38   C CG  . ARG A 1 26  ? 32.861  35.803 30.321 1.00 113.61 ? 26   ARG A CG  1 
ATOM   39   C CD  . ARG A 1 26  ? 33.922  35.262 29.370 1.00 122.23 ? 26   ARG A CD  1 
ATOM   40   N NE  . ARG A 1 26  ? 34.615  36.328 28.653 1.00 128.05 ? 26   ARG A NE  1 
ATOM   41   C CZ  . ARG A 1 26  ? 35.746  36.896 29.062 1.00 140.91 ? 26   ARG A CZ  1 
ATOM   42   N NH1 . ARG A 1 26  ? 36.322  36.503 30.190 1.00 127.79 ? 26   ARG A NH1 1 
ATOM   43   N NH2 . ARG A 1 26  ? 36.301  37.859 28.340 1.00 128.27 ? 26   ARG A NH2 1 
ATOM   44   N N   . VAL A 1 27  ? 31.452  35.242 33.688 1.00 94.92  ? 27   VAL A N   1 
ATOM   45   C CA  . VAL A 1 27  ? 30.346  34.411 34.149 1.00 92.90  ? 27   VAL A CA  1 
ATOM   46   C C   . VAL A 1 27  ? 29.309  35.266 34.870 1.00 92.41  ? 27   VAL A C   1 
ATOM   47   O O   . VAL A 1 27  ? 28.123  35.234 34.539 1.00 91.96  ? 27   VAL A O   1 
ATOM   48   C CB  . VAL A 1 27  ? 30.836  33.264 35.052 1.00 96.66  ? 27   VAL A CB  1 
ATOM   49   C CG1 . VAL A 1 27  ? 31.702  32.297 34.265 1.00 96.52  ? 27   VAL A CG1 1 
ATOM   50   C CG2 . VAL A 1 27  ? 31.587  33.813 36.260 1.00 96.38  ? 27   VAL A CG2 1 
ATOM   51   N N   . LEU A 1 28  ? 29.773  36.040 35.846 1.00 85.30  ? 28   LEU A N   1 
ATOM   52   C CA  . LEU A 1 28  ? 28.902  36.899 36.637 1.00 83.18  ? 28   LEU A CA  1 
ATOM   53   C C   . LEU A 1 28  ? 28.062  37.813 35.758 1.00 83.72  ? 28   LEU A C   1 
ATOM   54   O O   . LEU A 1 28  ? 26.860  37.951 35.969 1.00 83.07  ? 28   LEU A O   1 
ATOM   55   C CB  . LEU A 1 28  ? 29.721  37.718 37.629 1.00 82.98  ? 28   LEU A CB  1 
ATOM   56   C CG  . LEU A 1 28  ? 28.935  38.690 38.502 1.00 87.51  ? 28   LEU A CG  1 
ATOM   57   C CD1 . LEU A 1 28  ? 27.606  38.086 38.925 1.00 87.63  ? 28   LEU A CD1 1 
ATOM   58   C CD2 . LEU A 1 28  ? 29.760  39.103 39.711 1.00 89.80  ? 28   LEU A CD2 1 
ATOM   59   N N   . ARG A 1 29  ? 28.697  38.432 34.769 1.00 78.15  ? 29   ARG A N   1 
ATOM   60   C CA  . ARG A 1 29  ? 27.971  39.238 33.797 1.00 77.07  ? 29   ARG A CA  1 
ATOM   61   C C   . ARG A 1 29  ? 26.857  38.419 33.164 1.00 78.38  ? 29   ARG A C   1 
ATOM   62   O O   . ARG A 1 29  ? 25.743  38.905 32.986 1.00 78.01  ? 29   ARG A O   1 
ATOM   63   C CB  . ARG A 1 29  ? 28.912  39.751 32.707 1.00 78.62  ? 29   ARG A CB  1 
ATOM   64   C CG  . ARG A 1 29  ? 29.528  41.117 32.979 1.00 92.29  ? 29   ARG A CG  1 
ATOM   65   C CD  . ARG A 1 29  ? 30.311  41.602 31.760 1.00 104.27 ? 29   ARG A CD  1 
ATOM   66   N NE  . ARG A 1 29  ? 30.969  42.888 31.983 1.00 112.69 ? 29   ARG A NE  1 
ATOM   67   C CZ  . ARG A 1 29  ? 32.185  43.027 32.504 1.00 125.94 ? 29   ARG A CZ  1 
ATOM   68   N NH1 . ARG A 1 29  ? 32.878  41.956 32.871 1.00 113.59 ? 29   ARG A NH1 1 
ATOM   69   N NH2 . ARG A 1 29  ? 32.706  44.237 32.665 1.00 111.70 ? 29   ARG A NH2 1 
ATOM   70   N N   . ALA A 1 30  ? 27.171  37.174 32.820 1.00 73.11  ? 30   ALA A N   1 
ATOM   71   C CA  . ALA A 1 30  ? 26.218  36.292 32.156 1.00 71.97  ? 30   ALA A CA  1 
ATOM   72   C C   . ALA A 1 30  ? 25.116  35.849 33.106 1.00 72.66  ? 30   ALA A C   1 
ATOM   73   O O   . ALA A 1 30  ? 23.946  35.800 32.730 1.00 71.79  ? 30   ALA A O   1 
ATOM   74   C CB  . ALA A 1 30  ? 26.930  35.087 31.577 1.00 72.88  ? 30   ALA A CB  1 
ATOM   75   N N   . MET A 1 31  ? 25.512  35.477 34.320 1.00 67.18  ? 31   MET A N   1 
ATOM   76   C CA  . MET A 1 31  ? 24.569  35.195 35.400 1.00 65.74  ? 31   MET A CA  1 
ATOM   77   C C   . MET A 1 31  ? 23.520  36.298 35.512 1.00 67.29  ? 31   MET A C   1 
ATOM   78   O O   . MET A 1 31  ? 22.326  36.028 35.628 1.00 66.86  ? 31   MET A O   1 
ATOM   79   C CB  . MET A 1 31  ? 25.310  35.090 36.736 1.00 67.92  ? 31   MET A CB  1 
ATOM   80   C CG  . MET A 1 31  ? 26.135  33.828 36.931 1.00 71.37  ? 31   MET A CG  1 
ATOM   81   S SD  . MET A 1 31  ? 26.826  33.758 38.601 1.00 75.49  ? 31   MET A SD  1 
ATOM   82   C CE  . MET A 1 31  ? 27.554  32.126 38.615 1.00 72.54  ? 31   MET A CE  1 
ATOM   83   N N   . LEU A 1 32  ? 23.976  37.544 35.516 1.00 62.05  ? 32   LEU A N   1 
ATOM   84   C CA  . LEU A 1 32  ? 23.075  38.670 35.694 1.00 61.30  ? 32   LEU A CA  1 
ATOM   85   C C   . LEU A 1 32  ? 22.142  38.863 34.502 1.00 65.25  ? 32   LEU A C   1 
ATOM   86   O O   . LEU A 1 32  ? 20.963  39.166 34.686 1.00 65.34  ? 32   LEU A O   1 
ATOM   87   C CB  . LEU A 1 32  ? 23.853  39.951 36.013 1.00 61.13  ? 32   LEU A CB  1 
ATOM   88   C CG  . LEU A 1 32  ? 24.635  39.974 37.337 1.00 65.06  ? 32   LEU A CG  1 
ATOM   89   C CD1 . LEU A 1 32  ? 25.566  41.167 37.416 1.00 64.66  ? 32   LEU A CD1 1 
ATOM   90   C CD2 . LEU A 1 32  ? 23.702  39.949 38.538 1.00 66.84  ? 32   LEU A CD2 1 
ATOM   91   N N   . LYS A 1 33  ? 22.665  38.678 33.289 1.00 61.27  ? 33   LYS A N   1 
ATOM   92   C CA  . LYS A 1 33  ? 21.849  38.734 32.070 1.00 60.72  ? 33   LYS A CA  1 
ATOM   93   C C   . LYS A 1 33  ? 20.719  37.728 32.181 1.00 63.55  ? 33   LYS A C   1 
ATOM   94   O O   . LYS A 1 33  ? 19.547  38.063 32.023 1.00 62.77  ? 33   LYS A O   1 
ATOM   95   C CB  . LYS A 1 33  ? 22.685  38.367 30.834 1.00 63.38  ? 33   LYS A CB  1 
ATOM   96   C CG  . LYS A 1 33  ? 23.684  39.418 30.364 1.00 76.21  ? 33   LYS A CG  1 
ATOM   97   C CD  . LYS A 1 33  ? 24.526  38.882 29.206 1.00 82.06  ? 33   LYS A CD  1 
ATOM   98   C CE  . LYS A 1 33  ? 25.611  39.867 28.774 1.00 86.52  ? 33   LYS A CE  1 
ATOM   99   N NZ  . LYS A 1 33  ? 26.483  39.311 27.694 1.00 88.77  ? 33   LYS A NZ  1 
ATOM   100  N N   . ALA A 1 34  ? 21.107  36.474 32.392 1.00 60.06  ? 34   ALA A N   1 
ATOM   101  C CA  . ALA A 1 34  ? 20.179  35.357 32.528 1.00 59.88  ? 34   ALA A CA  1 
ATOM   102  C C   . ALA A 1 34  ? 19.176  35.579 33.652 1.00 63.01  ? 34   ALA A C   1 
ATOM   103  O O   . ALA A 1 34  ? 18.015  35.188 33.544 1.00 62.48  ? 34   ALA A O   1 
ATOM   104  C CB  . ALA A 1 34  ? 20.955  34.073 32.773 1.00 60.80  ? 34   ALA A CB  1 
ATOM   105  N N   . GLU A 1 35  ? 19.665  36.131 34.759 1.00 58.87  ? 35   GLU A N   1 
ATOM   106  C CA  . GLU A 1 35  ? 18.826  36.535 35.883 1.00 57.93  ? 35   GLU A CA  1 
ATOM   107  C C   . GLU A 1 35  ? 17.635  37.365 35.410 1.00 60.97  ? 35   GLU A C   1 
ATOM   108  O O   . GLU A 1 35  ? 16.513  37.203 35.892 1.00 59.83  ? 35   GLU A O   1 
ATOM   109  C CB  . GLU A 1 35  ? 19.665  37.350 36.872 1.00 59.03  ? 35   GLU A CB  1 
ATOM   110  C CG  . GLU A 1 35  ? 18.918  37.822 38.104 1.00 65.18  ? 35   GLU A CG  1 
ATOM   111  C CD  . GLU A 1 35  ? 19.841  38.430 39.140 1.00 74.09  ? 35   GLU A CD  1 
ATOM   112  O OE1 . GLU A 1 35  ? 20.198  37.721 40.102 1.00 63.37  ? 35   GLU A OE1 1 
ATOM   113  O OE2 . GLU A 1 35  ? 20.247  39.598 38.971 1.00 65.20  ? 35   GLU A OE2 1 
ATOM   114  N N   . GLU A 1 36  ? 17.889  38.252 34.456 1.00 57.96  ? 36   GLU A N   1 
ATOM   115  C CA  . GLU A 1 36  ? 16.876  39.182 33.983 1.00 58.18  ? 36   GLU A CA  1 
ATOM   116  C C   . GLU A 1 36  ? 15.957  38.541 32.948 1.00 61.27  ? 36   GLU A C   1 
ATOM   117  O O   . GLU A 1 36  ? 14.846  39.013 32.720 1.00 60.72  ? 36   GLU A O   1 
ATOM   118  C CB  . GLU A 1 36  ? 17.542  40.428 33.395 1.00 59.85  ? 36   GLU A CB  1 
ATOM   119  C CG  . GLU A 1 36  ? 18.675  40.991 34.244 1.00 71.07  ? 36   GLU A CG  1 
ATOM   120  C CD  . GLU A 1 36  ? 19.800  41.562 33.401 1.00 94.83  ? 36   GLU A CD  1 
ATOM   121  O OE1 . GLU A 1 36  ? 20.910  41.756 33.940 1.00 93.50  ? 36   GLU A OE1 1 
ATOM   122  O OE2 . GLU A 1 36  ? 19.586  41.778 32.188 1.00 89.90  ? 36   GLU A OE2 1 
ATOM   123  N N   . THR A 1 37  ? 16.427  37.474 32.311 1.00 57.63  ? 37   THR A N   1 
ATOM   124  C CA  . THR A 1 37  ? 15.597  36.759 31.346 1.00 57.73  ? 37   THR A CA  1 
ATOM   125  C C   . THR A 1 37  ? 14.604  35.817 32.038 1.00 60.98  ? 37   THR A C   1 
ATOM   126  O O   . THR A 1 37  ? 13.675  35.310 31.408 1.00 61.43  ? 37   THR A O   1 
ATOM   127  C CB  . THR A 1 37  ? 16.438  36.034 30.261 1.00 68.78  ? 37   THR A CB  1 
ATOM   128  O OG1 . THR A 1 37  ? 16.968  34.811 30.788 1.00 71.36  ? 37   THR A OG1 1 
ATOM   129  C CG2 . THR A 1 37  ? 17.586  36.922 29.785 1.00 66.34  ? 37   THR A CG2 1 
ATOM   130  N N   . CYS A 1 38  ? 14.782  35.625 33.343 1.00 55.62  ? 38   CYS A N   1 
ATOM   131  C CA  . CYS A 1 38  ? 13.897  34.771 34.127 1.00 54.62  ? 38   CYS A CA  1 
ATOM   132  C C   . CYS A 1 38  ? 13.101  35.547 35.173 1.00 56.69  ? 38   CYS A C   1 
ATOM   133  O O   . CYS A 1 38  ? 12.475  34.949 36.045 1.00 55.85  ? 38   CYS A O   1 
ATOM   134  C CB  . CYS A 1 38  ? 14.700  33.679 34.827 1.00 55.30  ? 38   CYS A CB  1 
ATOM   135  S SG  . CYS A 1 38  ? 15.499  32.482 33.724 1.00 59.47  ? 38   CYS A SG  1 
ATOM   136  N N   . ALA A 1 39  ? 13.139  36.875 35.100 1.00 52.22  ? 39   ALA A N   1 
ATOM   137  C CA  . ALA A 1 39  ? 12.489  37.713 36.107 1.00 51.22  ? 39   ALA A CA  1 
ATOM   138  C C   . ALA A 1 39  ? 10.966  37.618 36.030 1.00 53.28  ? 39   ALA A C   1 
ATOM   139  O O   . ALA A 1 39  ? 10.389  37.657 34.944 1.00 53.38  ? 39   ALA A O   1 
ATOM   140  C CB  . ALA A 1 39  ? 12.944  39.162 35.967 1.00 51.94  ? 39   ALA A CB  1 
ATOM   141  N N   . PRO A 1 40  ? 10.298  37.460 37.186 1.00 47.86  ? 40   PRO A N   1 
ATOM   142  C CA  . PRO A 1 40  ? 8.832   37.498 37.149 1.00 47.08  ? 40   PRO A CA  1 
ATOM   143  C C   . PRO A 1 40  ? 8.317   38.933 37.156 1.00 50.43  ? 40   PRO A C   1 
ATOM   144  O O   . PRO A 1 40  ? 9.102   39.881 37.211 1.00 49.69  ? 40   PRO A O   1 
ATOM   145  C CB  . PRO A 1 40  ? 8.428   36.777 38.441 1.00 48.61  ? 40   PRO A CB  1 
ATOM   146  C CG  . PRO A 1 40  ? 9.576   36.942 39.354 1.00 52.81  ? 40   PRO A CG  1 
ATOM   147  C CD  . PRO A 1 40  ? 10.812  37.067 38.512 1.00 48.71  ? 40   PRO A CD  1 
ATOM   148  N N   . SER A 1 41  ? 6.998   39.088 37.075 1.00 46.75  ? 41   SER A N   1 
ATOM   149  C CA  . SER A 1 41  ? 6.372   40.408 37.131 1.00 45.91  ? 41   SER A CA  1 
ATOM   150  C C   . SER A 1 41  ? 5.916   40.735 38.539 1.00 47.99  ? 41   SER A C   1 
ATOM   151  O O   . SER A 1 41  ? 5.206   39.955 39.172 1.00 47.76  ? 41   SER A O   1 
ATOM   152  C CB  . SER A 1 41  ? 5.178   40.492 36.182 1.00 49.54  ? 41   SER A CB  1 
ATOM   153  O OG  . SER A 1 41  ? 4.539   41.753 36.297 1.00 58.59  ? 41   SER A OG  1 
ATOM   154  N N   . VAL A 1 42  ? 6.304   41.905 39.020 1.00 43.23  ? 42   VAL A N   1 
ATOM   155  C CA  . VAL A 1 42  ? 5.952   42.308 40.367 1.00 42.34  ? 42   VAL A CA  1 
ATOM   156  C C   . VAL A 1 42  ? 4.462   42.636 40.445 1.00 45.33  ? 42   VAL A C   1 
ATOM   157  O O   . VAL A 1 42  ? 3.914   42.819 41.533 1.00 44.97  ? 42   VAL A O   1 
ATOM   158  C CB  . VAL A 1 42  ? 6.816   43.481 40.824 1.00 45.98  ? 42   VAL A CB  1 
ATOM   159  C CG1 . VAL A 1 42  ? 6.450   44.736 40.051 1.00 45.40  ? 42   VAL A CG1 1 
ATOM   160  C CG2 . VAL A 1 42  ? 6.665   43.690 42.319 1.00 46.13  ? 42   VAL A CG2 1 
ATOM   161  N N   . SER A 1 43  ? 3.803   42.618 39.288 1.00 41.10  ? 43   SER A N   1 
ATOM   162  C CA  . SER A 1 43  ? 2.421   43.071 39.156 1.00 40.51  ? 43   SER A CA  1 
ATOM   163  C C   . SER A 1 43  ? 1.406   41.949 38.942 1.00 43.95  ? 43   SER A C   1 
ATOM   164  O O   . SER A 1 43  ? 0.229   42.218 38.734 1.00 43.95  ? 43   SER A O   1 
ATOM   165  C CB  . SER A 1 43  ? 2.309   44.039 37.979 1.00 44.08  ? 43   SER A CB  1 
ATOM   166  O OG  . SER A 1 43  ? 3.218   45.112 38.112 1.00 54.44  ? 43   SER A OG  1 
ATOM   167  N N   . TYR A 1 44  ? 1.850   40.698 38.961 1.00 39.88  ? 44   TYR A N   1 
ATOM   168  C CA  . TYR A 1 44  ? 1.008   39.618 38.472 1.00 39.27  ? 44   TYR A CA  1 
ATOM   169  C C   . TYR A 1 44  ? -0.279  39.371 39.240 1.00 43.40  ? 44   TYR A C   1 
ATOM   170  O O   . TYR A 1 44  ? -1.245  38.866 38.676 1.00 42.61  ? 44   TYR A O   1 
ATOM   171  C CB  . TYR A 1 44  ? 1.795   38.327 38.226 1.00 40.06  ? 44   TYR A CB  1 
ATOM   172  C CG  . TYR A 1 44  ? 2.237   37.552 39.454 1.00 41.12  ? 44   TYR A CG  1 
ATOM   173  C CD1 . TYR A 1 44  ? 3.589   37.436 39.764 1.00 42.91  ? 44   TYR A CD1 1 
ATOM   174  C CD2 . TYR A 1 44  ? 1.331   36.809 40.209 1.00 41.22  ? 44   TYR A CD2 1 
ATOM   175  C CE1 . TYR A 1 44  ? 4.024   36.675 40.837 1.00 41.95  ? 44   TYR A CE1 1 
ATOM   176  C CE2 . TYR A 1 44  ? 1.763   36.050 41.298 1.00 41.58  ? 44   TYR A CE2 1 
ATOM   177  C CZ  . TYR A 1 44  ? 3.117   35.987 41.594 1.00 45.95  ? 44   TYR A CZ  1 
ATOM   178  O OH  . TYR A 1 44  ? 3.581   35.234 42.644 1.00 45.70  ? 44   TYR A OH  1 
ATOM   179  N N   . PHE A 1 45  ? -0.299  39.757 40.512 1.00 40.66  ? 45   PHE A N   1 
ATOM   180  C CA  . PHE A 1 45  ? -1.486  39.593 41.344 1.00 40.79  ? 45   PHE A CA  1 
ATOM   181  C C   . PHE A 1 45  ? -2.559  40.575 40.891 1.00 47.12  ? 45   PHE A C   1 
ATOM   182  O O   . PHE A 1 45  ? -3.753  40.276 40.916 1.00 46.83  ? 45   PHE A O   1 
ATOM   183  C CB  . PHE A 1 45  ? -1.152  39.855 42.818 1.00 42.24  ? 45   PHE A CB  1 
ATOM   184  C CG  . PHE A 1 45  ? -0.324  38.776 43.470 1.00 43.31  ? 45   PHE A CG  1 
ATOM   185  C CD1 . PHE A 1 45  ? 0.945   39.057 43.958 1.00 45.74  ? 45   PHE A CD1 1 
ATOM   186  C CD2 . PHE A 1 45  ? -0.835  37.501 43.657 1.00 45.12  ? 45   PHE A CD2 1 
ATOM   187  C CE1 . PHE A 1 45  ? 1.699   38.080 44.600 1.00 46.32  ? 45   PHE A CE1 1 
ATOM   188  C CE2 . PHE A 1 45  ? -0.082  36.519 44.291 1.00 47.57  ? 45   PHE A CE2 1 
ATOM   189  C CZ  . PHE A 1 45  ? 1.185   36.813 44.765 1.00 45.35  ? 45   PHE A CZ  1 
ATOM   190  N N   . LYS A 1 46  ? -2.118  41.766 40.511 1.00 45.88  ? 46   LYS A N   1 
ATOM   191  C CA  . LYS A 1 46  ? -3.009  42.804 40.013 1.00 46.90  ? 46   LYS A CA  1 
ATOM   192  C C   . LYS A 1 46  ? -3.465  42.459 38.598 1.00 53.72  ? 46   LYS A C   1 
ATOM   193  O O   . LYS A 1 46  ? -4.662  42.351 38.330 1.00 53.81  ? 46   LYS A O   1 
ATOM   194  C CB  . LYS A 1 46  ? -2.274  44.146 40.010 1.00 49.44  ? 46   LYS A CB  1 
ATOM   195  C CG  . LYS A 1 46  ? -3.165  45.370 39.882 1.00 60.66  ? 46   LYS A CG  1 
ATOM   196  C CD  . LYS A 1 46  ? -2.356  46.654 40.053 1.00 66.14  ? 46   LYS A CD  1 
ATOM   197  C CE  . LYS A 1 46  ? -1.246  46.766 39.008 1.00 71.51  ? 46   LYS A CE  1 
ATOM   198  N NZ  . LYS A 1 46  ? -0.292  47.880 39.294 1.00 78.98  ? 46   LYS A NZ  1 
ATOM   199  N N   . CYS A 1 47  ? -2.501  42.157 37.736 1.00 51.55  ? 47   CYS A N   1 
ATOM   200  C CA  . CYS A 1 47  ? -2.748  42.062 36.305 1.00 51.80  ? 47   CYS A CA  1 
ATOM   201  C C   . CYS A 1 47  ? -3.146  40.694 35.781 1.00 54.64  ? 47   CYS A C   1 
ATOM   202  O O   . CYS A 1 47  ? -4.020  40.599 34.925 1.00 54.80  ? 47   CYS A O   1 
ATOM   203  C CB  . CYS A 1 47  ? -1.541  42.578 35.536 1.00 52.98  ? 47   CYS A CB  1 
ATOM   204  S SG  . CYS A 1 47  ? -1.101  44.253 35.999 1.00 57.41  ? 47   CYS A SG  1 
ATOM   205  N N   . VAL A 1 48  ? -2.462  39.643 36.227 1.00 49.85  ? 48   VAL A N   1 
ATOM   206  C CA  . VAL A 1 48  ? -2.713  38.310 35.684 1.00 48.79  ? 48   VAL A CA  1 
ATOM   207  C C   . VAL A 1 48  ? -3.658  37.461 36.522 1.00 52.09  ? 48   VAL A C   1 
ATOM   208  O O   . VAL A 1 48  ? -4.550  36.803 35.988 1.00 51.84  ? 48   VAL A O   1 
ATOM   209  C CB  . VAL A 1 48  ? -1.418  37.544 35.362 1.00 52.02  ? 48   VAL A CB  1 
ATOM   210  C CG1 . VAL A 1 48  ? -1.749  36.281 34.577 1.00 51.51  ? 48   VAL A CG1 1 
ATOM   211  C CG2 . VAL A 1 48  ? -0.443  38.425 34.589 1.00 51.74  ? 48   VAL A CG2 1 
ATOM   212  N N   . GLN A 1 49  ? -3.438  37.456 37.831 1.00 48.20  ? 49   GLN A N   1 
ATOM   213  C CA  . GLN A 1 49  ? -4.193  36.594 38.729 1.00 47.74  ? 49   GLN A CA  1 
ATOM   214  C C   . GLN A 1 49  ? -5.515  37.233 39.106 1.00 54.24  ? 49   GLN A C   1 
ATOM   215  O O   . GLN A 1 49  ? -5.612  38.454 39.217 1.00 54.61  ? 49   GLN A O   1 
ATOM   216  C CB  . GLN A 1 49  ? -3.382  36.281 39.988 1.00 48.24  ? 49   GLN A CB  1 
ATOM   217  C CG  . GLN A 1 49  ? -2.112  35.496 39.717 1.00 44.59  ? 49   GLN A CG  1 
ATOM   218  C CD  . GLN A 1 49  ? -2.364  34.252 38.892 1.00 46.01  ? 49   GLN A CD  1 
ATOM   219  O OE1 . GLN A 1 49  ? -3.334  33.536 39.119 1.00 40.16  ? 49   GLN A OE1 1 
ATOM   220  N NE2 . GLN A 1 49  ? -1.503  34.001 37.911 1.00 32.24  ? 49   GLN A NE2 1 
ATOM   221  N N   . LYS A 1 50  ? -6.543  36.407 39.268 1.00 51.78  ? 50   LYS A N   1 
ATOM   222  C CA  . LYS A 1 50  ? -7.816  36.885 39.784 1.00 51.72  ? 50   LYS A CA  1 
ATOM   223  C C   . LYS A 1 50  ? -8.075  36.298 41.164 1.00 55.42  ? 50   LYS A C   1 
ATOM   224  O O   . LYS A 1 50  ? -8.296  37.029 42.129 1.00 55.52  ? 50   LYS A O   1 
ATOM   225  C CB  . LYS A 1 50  ? -8.956  36.522 38.835 1.00 54.34  ? 50   LYS A CB  1 
ATOM   226  C CG  . LYS A 1 50  ? -8.609  36.651 37.361 1.00 71.98  ? 50   LYS A CG  1 
ATOM   227  C CD  . LYS A 1 50  ? -8.120  35.321 36.795 1.00 84.36  ? 50   LYS A CD  1 
ATOM   228  C CE  . LYS A 1 50  ? -8.074  35.347 35.270 1.00 95.66  ? 50   LYS A CE  1 
ATOM   229  N NZ  . LYS A 1 50  ? -9.416  35.567 34.654 1.00 103.94 ? 50   LYS A NZ  1 
ATOM   230  N N   . GLU A 1 51  ? -8.017  34.972 41.251 1.00 51.56  ? 51   GLU A N   1 
ATOM   231  C CA  . GLU A 1 51  ? -8.277  34.254 42.498 1.00 50.90  ? 51   GLU A CA  1 
ATOM   232  C C   . GLU A 1 51  ? -7.092  34.312 43.454 1.00 52.42  ? 51   GLU A C   1 
ATOM   233  O O   . GLU A 1 51  ? -7.257  34.559 44.649 1.00 51.23  ? 51   GLU A O   1 
ATOM   234  C CB  . GLU A 1 51  ? -8.606  32.787 42.207 1.00 52.34  ? 51   GLU A CB  1 
ATOM   235  C CG  . GLU A 1 51  ? -9.976  32.549 41.608 1.00 63.07  ? 51   GLU A CG  1 
ATOM   236  C CD  . GLU A 1 51  ? -10.249 31.080 41.368 1.00 87.88  ? 51   GLU A CD  1 
ATOM   237  O OE1 . GLU A 1 51  ? -9.797  30.245 42.180 1.00 80.29  ? 51   GLU A OE1 1 
ATOM   238  O OE2 . GLU A 1 51  ? -10.915 30.759 40.365 1.00 88.65  ? 51   GLU A OE2 1 
ATOM   239  N N   . VAL A 1 52  ? -5.905  34.041 42.921 1.00 47.76  ? 52   VAL A N   1 
ATOM   240  C CA  . VAL A 1 52  ? -4.715  33.862 43.740 1.00 46.78  ? 52   VAL A CA  1 
ATOM   241  C C   . VAL A 1 52  ? -4.176  35.138 44.393 1.00 50.49  ? 52   VAL A C   1 
ATOM   242  O O   . VAL A 1 52  ? -4.017  36.176 43.738 1.00 49.64  ? 52   VAL A O   1 
ATOM   243  C CB  . VAL A 1 52  ? -3.639  33.051 43.000 1.00 49.74  ? 52   VAL A CB  1 
ATOM   244  C CG1 . VAL A 1 52  ? -2.313  33.085 43.753 1.00 49.17  ? 52   VAL A CG1 1 
ATOM   245  C CG2 . VAL A 1 52  ? -4.118  31.622 42.808 1.00 49.35  ? 52   VAL A CG2 1 
ATOM   246  N N   . LEU A 1 53  ? -3.914  35.038 45.697 1.00 47.03  ? 53   LEU A N   1 
ATOM   247  C CA  . LEU A 1 53  ? -3.422  36.146 46.507 1.00 46.82  ? 53   LEU A CA  1 
ATOM   248  C C   . LEU A 1 53  ? -2.130  35.767 47.223 1.00 50.08  ? 53   LEU A C   1 
ATOM   249  O O   . LEU A 1 53  ? -1.874  34.594 47.491 1.00 49.81  ? 53   LEU A O   1 
ATOM   250  C CB  . LEU A 1 53  ? -4.464  36.531 47.556 1.00 47.07  ? 53   LEU A CB  1 
ATOM   251  C CG  . LEU A 1 53  ? -5.876  36.835 47.065 1.00 51.97  ? 53   LEU A CG  1 
ATOM   252  C CD1 . LEU A 1 53  ? -6.784  37.155 48.241 1.00 51.98  ? 53   LEU A CD1 1 
ATOM   253  C CD2 . LEU A 1 53  ? -5.868  37.964 46.043 1.00 54.75  ? 53   LEU A CD2 1 
ATOM   254  N N   . PRO A 1 54  ? -1.353  36.776 47.641 1.00 45.84  ? 54   PRO A N   1 
ATOM   255  C CA  . PRO A 1 54  ? -0.053  36.575 48.282 1.00 45.16  ? 54   PRO A CA  1 
ATOM   256  C C   . PRO A 1 54  ? -0.090  35.574 49.430 1.00 47.89  ? 54   PRO A C   1 
ATOM   257  O O   . PRO A 1 54  ? 0.896   34.879 49.684 1.00 47.64  ? 54   PRO A O   1 
ATOM   258  C CB  . PRO A 1 54  ? 0.285   37.970 48.800 1.00 46.86  ? 54   PRO A CB  1 
ATOM   259  C CG  . PRO A 1 54  ? -0.386  38.888 47.846 1.00 50.91  ? 54   PRO A CG  1 
ATOM   260  C CD  . PRO A 1 54  ? -1.658  38.206 47.452 1.00 46.77  ? 54   PRO A CD  1 
ATOM   261  N N   . SER A 1 55  ? -1.230  35.495 50.114 1.00 43.29  ? 55   SER A N   1 
ATOM   262  C CA  . SER A 1 55  ? -1.369  34.641 51.296 1.00 42.22  ? 55   SER A CA  1 
ATOM   263  C C   . SER A 1 55  ? -1.450  33.175 50.896 1.00 45.48  ? 55   SER A C   1 
ATOM   264  O O   . SER A 1 55  ? -1.038  32.286 51.642 1.00 45.14  ? 55   SER A O   1 
ATOM   265  C CB  . SER A 1 55  ? -2.621  35.016 52.080 1.00 44.33  ? 55   SER A CB  1 
ATOM   266  O OG  . SER A 1 55  ? -3.782  34.650 51.360 1.00 52.18  ? 55   SER A OG  1 
ATOM   267  N N   . MET A 1 56  ? -2.002  32.931 49.715 1.00 41.16  ? 56   MET A N   1 
ATOM   268  C CA  . MET A 1 56  ? -2.062  31.590 49.166 1.00 40.44  ? 56   MET A CA  1 
ATOM   269  C C   . MET A 1 56  ? -0.689  31.119 48.706 1.00 43.74  ? 56   MET A C   1 
ATOM   270  O O   . MET A 1 56  ? -0.263  30.013 49.045 1.00 43.71  ? 56   MET A O   1 
ATOM   271  C CB  . MET A 1 56  ? -3.085  31.533 48.037 1.00 42.69  ? 56   MET A CB  1 
ATOM   272  C CG  . MET A 1 56  ? -4.464  31.937 48.514 1.00 46.38  ? 56   MET A CG  1 
ATOM   273  S SD  . MET A 1 56  ? -5.669  32.102 47.209 1.00 50.79  ? 56   MET A SD  1 
ATOM   274  C CE  . MET A 1 56  ? -6.755  33.369 47.940 1.00 47.38  ? 56   MET A CE  1 
ATOM   275  N N   . ARG A 1 57  ? 0.026   31.987 47.996 1.00 39.35  ? 57   ARG A N   1 
ATOM   276  C CA  . ARG A 1 57  ? 1.424   31.737 47.643 1.00 38.68  ? 57   ARG A CA  1 
ATOM   277  C C   . ARG A 1 57  ? 2.285   31.519 48.903 1.00 42.18  ? 57   ARG A C   1 
ATOM   278  O O   . ARG A 1 57  ? 3.225   30.716 48.908 1.00 41.28  ? 57   ARG A O   1 
ATOM   279  C CB  . ARG A 1 57  ? 1.972   32.900 46.803 1.00 37.62  ? 57   ARG A CB  1 
ATOM   280  C CG  . ARG A 1 57  ? 3.453   32.785 46.427 1.00 45.35  ? 57   ARG A CG  1 
ATOM   281  C CD  . ARG A 1 57  ? 4.066   34.152 46.088 1.00 44.20  ? 57   ARG A CD  1 
ATOM   282  N NE  . ARG A 1 57  ? 5.467   34.059 45.681 1.00 38.95  ? 57   ARG A NE  1 
ATOM   283  C CZ  . ARG A 1 57  ? 6.497   34.016 46.525 1.00 47.18  ? 57   ARG A CZ  1 
ATOM   284  N NH1 . ARG A 1 57  ? 6.287   34.051 47.833 1.00 38.14  ? 57   ARG A NH1 1 
ATOM   285  N NH2 . ARG A 1 57  ? 7.739   33.935 46.062 1.00 25.51  ? 57   ARG A NH2 1 
ATOM   286  N N   . LYS A 1 58  ? 1.952   32.225 49.977 1.00 38.24  ? 58   LYS A N   1 
ATOM   287  C CA  . LYS A 1 58  ? 2.638   32.019 51.245 1.00 38.14  ? 58   LYS A CA  1 
ATOM   288  C C   . LYS A 1 58  ? 2.479   30.564 51.681 1.00 42.66  ? 58   LYS A C   1 
ATOM   289  O O   . LYS A 1 58  ? 3.409   29.947 52.199 1.00 42.11  ? 58   LYS A O   1 
ATOM   290  C CB  . LYS A 1 58  ? 2.047   32.942 52.314 1.00 40.31  ? 58   LYS A CB  1 
ATOM   291  C CG  . LYS A 1 58  ? 2.821   32.974 53.625 1.00 47.24  ? 58   LYS A CG  1 
ATOM   292  C CD  . LYS A 1 58  ? 4.143   33.699 53.457 1.00 55.64  ? 58   LYS A CD  1 
ATOM   293  C CE  . LYS A 1 58  ? 4.763   34.042 54.800 1.00 64.23  ? 58   LYS A CE  1 
ATOM   294  N NZ  . LYS A 1 58  ? 4.934   32.825 55.638 1.00 74.43  ? 58   LYS A NZ  1 
ATOM   295  N N   . ILE A 1 59  ? 1.281   30.030 51.481 1.00 39.76  ? 59   ILE A N   1 
ATOM   296  C CA  . ILE A 1 59  ? 0.940   28.695 51.949 1.00 39.38  ? 59   ILE A CA  1 
ATOM   297  C C   . ILE A 1 59  ? 1.579   27.612 51.086 1.00 41.55  ? 59   ILE A C   1 
ATOM   298  O O   . ILE A 1 59  ? 2.069   26.612 51.606 1.00 40.43  ? 59   ILE A O   1 
ATOM   299  C CB  . ILE A 1 59  ? -0.590  28.524 52.054 1.00 42.56  ? 59   ILE A CB  1 
ATOM   300  C CG1 . ILE A 1 59  ? -1.152  29.484 53.107 1.00 42.71  ? 59   ILE A CG1 1 
ATOM   301  C CG2 . ILE A 1 59  ? -0.948  27.079 52.379 1.00 43.03  ? 59   ILE A CG2 1 
ATOM   302  C CD1 . ILE A 1 59  ? -2.639  29.689 53.006 1.00 47.97  ? 59   ILE A CD1 1 
ATOM   303  N N   . VAL A 1 60  ? 1.599   27.827 49.775 1.00 37.62  ? 60   VAL A N   1 
ATOM   304  C CA  . VAL A 1 60  ? 2.237   26.880 48.866 1.00 37.86  ? 60   VAL A CA  1 
ATOM   305  C C   . VAL A 1 60  ? 3.758   26.897 49.044 1.00 41.36  ? 60   VAL A C   1 
ATOM   306  O O   . VAL A 1 60  ? 4.407   25.850 49.001 1.00 40.55  ? 60   VAL A O   1 
ATOM   307  C CB  . VAL A 1 60  ? 1.852   27.145 47.386 1.00 41.92  ? 60   VAL A CB  1 
ATOM   308  C CG1 . VAL A 1 60  ? 1.770   25.839 46.598 1.00 41.20  ? 60   VAL A CG1 1 
ATOM   309  C CG2 . VAL A 1 60  ? 0.553   27.908 47.306 1.00 42.24  ? 60   VAL A CG2 1 
ATOM   310  N N   . ALA A 1 61  ? 4.329   28.090 49.187 1.00 37.70  ? 61   ALA A N   1 
ATOM   311  C CA  . ALA A 1 61  ? 5.775   28.216 49.293 1.00 37.64  ? 61   ALA A CA  1 
ATOM   312  C C   . ALA A 1 61  ? 6.247   27.492 50.538 1.00 43.70  ? 61   ALA A C   1 
ATOM   313  O O   . ALA A 1 61  ? 7.193   26.701 50.490 1.00 43.41  ? 61   ALA A O   1 
ATOM   314  C CB  . ALA A 1 61  ? 6.191   29.669 49.333 1.00 38.19  ? 61   ALA A CB  1 
ATOM   315  N N   . THR A 1 62  ? 5.535   27.711 51.641 1.00 41.50  ? 62   THR A N   1 
ATOM   316  C CA  . THR A 1 62  ? 5.900   27.101 52.914 1.00 41.52  ? 62   THR A CA  1 
ATOM   317  C C   . THR A 1 62  ? 5.625   25.599 52.926 1.00 44.33  ? 62   THR A C   1 
ATOM   318  O O   . THR A 1 62  ? 6.358   24.831 53.548 1.00 45.02  ? 62   THR A O   1 
ATOM   319  C CB  . THR A 1 62  ? 5.267   27.843 54.112 1.00 52.74  ? 62   THR A CB  1 
ATOM   320  O OG1 . THR A 1 62  ? 3.865   27.569 54.163 1.00 55.69  ? 62   THR A OG1 1 
ATOM   321  C CG2 . THR A 1 62  ? 5.476   29.357 53.974 1.00 50.64  ? 62   THR A CG2 1 
ATOM   322  N N   . TRP A 1 63  ? 4.592   25.185 52.200 1.00 39.00  ? 63   TRP A N   1 
ATOM   323  C CA  . TRP A 1 63  ? 4.345   23.773 51.933 1.00 38.33  ? 63   TRP A CA  1 
ATOM   324  C C   . TRP A 1 63  ? 5.497   23.147 51.142 1.00 41.55  ? 63   TRP A C   1 
ATOM   325  O O   . TRP A 1 63  ? 5.922   22.028 51.421 1.00 41.83  ? 63   TRP A O   1 
ATOM   326  C CB  . TRP A 1 63  ? 3.047   23.613 51.141 1.00 37.26  ? 63   TRP A CB  1 
ATOM   327  C CG  . TRP A 1 63  ? 2.775   22.207 50.731 1.00 38.60  ? 63   TRP A CG  1 
ATOM   328  C CD1 . TRP A 1 63  ? 2.315   21.194 51.525 1.00 41.44  ? 63   TRP A CD1 1 
ATOM   329  C CD2 . TRP A 1 63  ? 2.991   21.632 49.436 1.00 38.45  ? 63   TRP A CD2 1 
ATOM   330  N NE1 . TRP A 1 63  ? 2.193   20.037 50.796 1.00 40.53  ? 63   TRP A NE1 1 
ATOM   331  C CE2 . TRP A 1 63  ? 2.614   20.273 49.516 1.00 41.97  ? 63   TRP A CE2 1 
ATOM   332  C CE3 . TRP A 1 63  ? 3.468   22.133 48.219 1.00 40.07  ? 63   TRP A CE3 1 
ATOM   333  C CZ2 . TRP A 1 63  ? 2.704   19.410 48.429 1.00 41.20  ? 63   TRP A CZ2 1 
ATOM   334  C CZ3 . TRP A 1 63  ? 3.548   21.274 47.137 1.00 41.36  ? 63   TRP A CZ3 1 
ATOM   335  C CH2 . TRP A 1 63  ? 3.164   19.926 47.250 1.00 42.17  ? 63   TRP A CH2 1 
ATOM   336  N N   . MET A 1 64  ? 5.973   23.861 50.127 1.00 36.58  ? 64   MET A N   1 
ATOM   337  C CA  . MET A 1 64  ? 7.075   23.384 49.297 1.00 35.11  ? 64   MET A CA  1 
ATOM   338  C C   . MET A 1 64  ? 8.344   23.250 50.114 1.00 40.36  ? 64   MET A C   1 
ATOM   339  O O   . MET A 1 64  ? 9.093   22.295 49.945 1.00 40.63  ? 64   MET A O   1 
ATOM   340  C CB  . MET A 1 64  ? 7.305   24.333 48.119 1.00 36.64  ? 64   MET A CB  1 
ATOM   341  C CG  . MET A 1 64  ? 6.265   24.187 47.018 1.00 39.39  ? 64   MET A CG  1 
ATOM   342  S SD  . MET A 1 64  ? 6.069   25.637 45.941 1.00 42.39  ? 64   MET A SD  1 
ATOM   343  C CE  . MET A 1 64  ? 7.587   25.556 44.992 1.00 38.72  ? 64   MET A CE  1 
ATOM   344  N N   . LEU A 1 65  ? 8.558   24.197 51.022 1.00 37.53  ? 65   LEU A N   1 
ATOM   345  C CA  . LEU A 1 65  ? 9.759   24.233 51.855 1.00 37.53  ? 65   LEU A CA  1 
ATOM   346  C C   . LEU A 1 65  ? 9.813   23.021 52.765 1.00 43.38  ? 65   LEU A C   1 
ATOM   347  O O   . LEU A 1 65  ? 10.880  22.451 52.991 1.00 43.17  ? 65   LEU A O   1 
ATOM   348  C CB  . LEU A 1 65  ? 9.775   25.504 52.714 1.00 37.30  ? 65   LEU A CB  1 
ATOM   349  C CG  . LEU A 1 65  ? 11.143  26.099 53.046 1.00 40.82  ? 65   LEU A CG  1 
ATOM   350  C CD1 . LEU A 1 65  ? 11.029  27.089 54.171 1.00 41.43  ? 65   LEU A CD1 1 
ATOM   351  C CD2 . LEU A 1 65  ? 12.104  25.004 53.407 1.00 40.62  ? 65   LEU A CD2 1 
ATOM   352  N N   . GLU A 1 66  ? 8.664   22.653 53.319 1.00 41.71  ? 66   GLU A N   1 
ATOM   353  C CA  . GLU A 1 66  ? 8.589   21.493 54.201 1.00 42.18  ? 66   GLU A CA  1 
ATOM   354  C C   . GLU A 1 66  ? 8.906   20.221 53.431 1.00 45.13  ? 66   GLU A C   1 
ATOM   355  O O   . GLU A 1 66  ? 9.571   19.327 53.947 1.00 45.47  ? 66   GLU A O   1 
ATOM   356  C CB  . GLU A 1 66  ? 7.208   21.393 54.856 1.00 44.00  ? 66   GLU A CB  1 
ATOM   357  C CG  . GLU A 1 66  ? 6.847   22.591 55.732 1.00 59.81  ? 66   GLU A CG  1 
ATOM   358  C CD  . GLU A 1 66  ? 5.488   22.450 56.403 1.00 90.21  ? 66   GLU A CD  1 
ATOM   359  O OE1 . GLU A 1 66  ? 4.735   21.511 56.055 1.00 91.04  ? 66   GLU A OE1 1 
ATOM   360  O OE2 . GLU A 1 66  ? 5.171   23.291 57.273 1.00 86.70  ? 66   GLU A OE2 1 
ATOM   361  N N   . VAL A 1 67  ? 8.422   20.140 52.197 1.00 40.42  ? 67   VAL A N   1 
ATOM   362  C CA  . VAL A 1 67  ? 8.703   18.992 51.342 1.00 40.01  ? 67   VAL A CA  1 
ATOM   363  C C   . VAL A 1 67  ? 10.203  18.850 51.092 1.00 45.74  ? 67   VAL A C   1 
ATOM   364  O O   . VAL A 1 67  ? 10.776  17.775 51.280 1.00 45.10  ? 67   VAL A O   1 
ATOM   365  C CB  . VAL A 1 67  ? 7.916   19.064 50.020 1.00 42.80  ? 67   VAL A CB  1 
ATOM   366  C CG1 . VAL A 1 67  ? 8.431   18.037 49.054 1.00 42.36  ? 67   VAL A CG1 1 
ATOM   367  C CG2 . VAL A 1 67  ? 6.427   18.865 50.267 1.00 42.32  ? 67   VAL A CG2 1 
ATOM   368  N N   . CYS A 1 68  ? 10.831  19.950 50.681 1.00 43.51  ? 68   CYS A N   1 
ATOM   369  C CA  . CYS A 1 68  ? 12.270  19.990 50.452 1.00 43.80  ? 68   CYS A CA  1 
ATOM   370  C C   . CYS A 1 68  ? 13.081  19.670 51.705 1.00 48.47  ? 68   CYS A C   1 
ATOM   371  O O   . CYS A 1 68  ? 14.155  19.072 51.631 1.00 48.15  ? 68   CYS A O   1 
ATOM   372  C CB  . CYS A 1 68  ? 12.672  21.356 49.909 1.00 44.37  ? 68   CYS A CB  1 
ATOM   373  S SG  . CYS A 1 68  ? 11.860  21.746 48.356 1.00 48.50  ? 68   CYS A SG  1 
ATOM   374  N N   . GLU A 1 69  ? 12.589  20.116 52.851 1.00 45.77  ? 69   GLU A N   1 
ATOM   375  C CA  . GLU A 1 69  ? 13.226  19.789 54.116 1.00 46.16  ? 69   GLU A CA  1 
ATOM   376  C C   . GLU A 1 69  ? 12.985  18.329 54.495 1.00 50.41  ? 69   GLU A C   1 
ATOM   377  O O   . GLU A 1 69  ? 13.930  17.569 54.709 1.00 49.69  ? 69   GLU A O   1 
ATOM   378  C CB  . GLU A 1 69  ? 12.744  20.737 55.218 1.00 47.62  ? 69   GLU A CB  1 
ATOM   379  C CG  . GLU A 1 69  ? 13.271  22.158 55.051 1.00 58.52  ? 69   GLU A CG  1 
ATOM   380  C CD  . GLU A 1 69  ? 12.699  23.130 56.064 1.00 82.95  ? 69   GLU A CD  1 
ATOM   381  O OE1 . GLU A 1 69  ? 13.406  24.101 56.408 1.00 75.95  ? 69   GLU A OE1 1 
ATOM   382  O OE2 . GLU A 1 69  ? 11.541  22.941 56.501 1.00 81.25  ? 69   GLU A OE2 1 
ATOM   383  N N   . GLU A 1 70  ? 11.717  17.933 54.522 1.00 47.40  ? 70   GLU A N   1 
ATOM   384  C CA  . GLU A 1 70  ? 11.346  16.564 54.849 1.00 47.20  ? 70   GLU A CA  1 
ATOM   385  C C   . GLU A 1 70  ? 12.066  15.578 53.932 1.00 50.21  ? 70   GLU A C   1 
ATOM   386  O O   . GLU A 1 70  ? 12.559  14.548 54.384 1.00 50.42  ? 70   GLU A O   1 
ATOM   387  C CB  . GLU A 1 70  ? 9.822   16.389 54.766 1.00 48.75  ? 70   GLU A CB  1 
ATOM   388  C CG  . GLU A 1 70  ? 9.300   15.055 55.286 1.00 61.09  ? 70   GLU A CG  1 
ATOM   389  C CD  . GLU A 1 70  ? 9.724   14.775 56.717 1.00 92.33  ? 70   GLU A CD  1 
ATOM   390  O OE1 . GLU A 1 70  ? 9.374   15.576 57.612 1.00 95.94  ? 70   GLU A OE1 1 
ATOM   391  O OE2 . GLU A 1 70  ? 10.385  13.737 56.950 1.00 89.78  ? 70   GLU A OE2 1 
ATOM   392  N N   . GLN A 1 71  ? 12.188  15.933 52.659 1.00 45.54  ? 71   GLN A N   1 
ATOM   393  C CA  . GLN A 1 71  ? 12.806  15.051 51.676 1.00 44.57  ? 71   GLN A CA  1 
ATOM   394  C C   . GLN A 1 71  ? 14.300  15.285 51.524 1.00 48.43  ? 71   GLN A C   1 
ATOM   395  O O   . GLN A 1 71  ? 14.916  14.763 50.591 1.00 48.92  ? 71   GLN A O   1 
ATOM   396  C CB  . GLN A 1 71  ? 12.138  15.216 50.313 1.00 45.57  ? 71   GLN A CB  1 
ATOM   397  C CG  . GLN A 1 71  ? 10.780  14.571 50.211 1.00 55.32  ? 71   GLN A CG  1 
ATOM   398  C CD  . GLN A 1 71  ? 10.831  13.083 50.480 1.00 66.27  ? 71   GLN A CD  1 
ATOM   399  O OE1 . GLN A 1 71  ? 11.425  12.320 49.714 1.00 61.72  ? 71   GLN A OE1 1 
ATOM   400  N NE2 . GLN A 1 71  ? 10.218  12.662 51.580 1.00 51.85  ? 71   GLN A NE2 1 
ATOM   401  N N   . LYS A 1 72  ? 14.874  16.071 52.431 1.00 44.18  ? 72   LYS A N   1 
ATOM   402  C CA  . LYS A 1 72  ? 16.277  16.481 52.340 1.00 43.78  ? 72   LYS A CA  1 
ATOM   403  C C   . LYS A 1 72  ? 16.740  16.778 50.915 1.00 47.45  ? 72   LYS A C   1 
ATOM   404  O O   . LYS A 1 72  ? 17.772  16.270 50.473 1.00 46.68  ? 72   LYS A O   1 
ATOM   405  C CB  . LYS A 1 72  ? 17.209  15.462 53.006 1.00 46.07  ? 72   LYS A CB  1 
ATOM   406  C CG  . LYS A 1 72  ? 17.444  15.695 54.502 1.00 58.08  ? 72   LYS A CG  1 
ATOM   407  C CD  . LYS A 1 72  ? 16.636  14.747 55.379 1.00 66.51  ? 72   LYS A CD  1 
ATOM   408  C CE  . LYS A 1 72  ? 17.301  13.377 55.458 1.00 80.56  ? 72   LYS A CE  1 
ATOM   409  N NZ  . LYS A 1 72  ? 16.647  12.473 56.452 1.00 91.42  ? 72   LYS A NZ  1 
ATOM   410  N N   . CYS A 1 73  ? 15.961  17.584 50.196 1.00 44.03  ? 73   CYS A N   1 
ATOM   411  C CA  . CYS A 1 73  ? 16.297  17.961 48.823 1.00 43.75  ? 73   CYS A CA  1 
ATOM   412  C C   . CYS A 1 73  ? 17.523  18.855 48.787 1.00 51.01  ? 73   CYS A C   1 
ATOM   413  O O   . CYS A 1 73  ? 17.836  19.532 49.764 1.00 51.55  ? 73   CYS A O   1 
ATOM   414  C CB  . CYS A 1 73  ? 15.131  18.696 48.161 1.00 43.16  ? 73   CYS A CB  1 
ATOM   415  S SG  . CYS A 1 73  ? 13.798  17.635 47.609 1.00 46.70  ? 73   CYS A SG  1 
ATOM   416  N N   . GLU A 1 74  ? 18.199  18.888 47.645 1.00 48.93  ? 74   GLU A N   1 
ATOM   417  C CA  . GLU A 1 74  ? 19.271  19.852 47.453 1.00 49.06  ? 74   GLU A CA  1 
ATOM   418  C C   . GLU A 1 74  ? 18.648  21.229 47.648 1.00 52.40  ? 74   GLU A C   1 
ATOM   419  O O   . GLU A 1 74  ? 17.631  21.543 47.040 1.00 51.64  ? 74   GLU A O   1 
ATOM   420  C CB  . GLU A 1 74  ? 19.870  19.720 46.050 1.00 50.74  ? 74   GLU A CB  1 
ATOM   421  C CG  . GLU A 1 74  ? 21.314  20.209 45.937 1.00 65.87  ? 74   GLU A CG  1 
ATOM   422  C CD  . GLU A 1 74  ? 22.332  19.131 46.285 1.00 92.44  ? 74   GLU A CD  1 
ATOM   423  O OE1 . GLU A 1 74  ? 23.413  19.478 46.812 1.00 91.20  ? 74   GLU A OE1 1 
ATOM   424  O OE2 . GLU A 1 74  ? 22.056  17.940 46.019 1.00 88.06  ? 74   GLU A OE2 1 
ATOM   425  N N   . GLU A 1 75  ? 19.254  22.035 48.514 1.00 49.64  ? 75   GLU A N   1 
ATOM   426  C CA  . GLU A 1 75  ? 18.660  23.295 48.965 1.00 49.54  ? 75   GLU A CA  1 
ATOM   427  C C   . GLU A 1 75  ? 18.284  24.281 47.860 1.00 51.60  ? 75   GLU A C   1 
ATOM   428  O O   . GLU A 1 75  ? 17.430  25.144 48.063 1.00 52.19  ? 75   GLU A O   1 
ATOM   429  C CB  . GLU A 1 75  ? 19.557  23.980 50.003 1.00 51.19  ? 75   GLU A CB  1 
ATOM   430  C CG  . GLU A 1 75  ? 20.856  24.531 49.440 1.00 64.25  ? 75   GLU A CG  1 
ATOM   431  C CD  . GLU A 1 75  ? 21.776  23.443 48.915 1.00 93.50  ? 75   GLU A CD  1 
ATOM   432  O OE1 . GLU A 1 75  ? 21.506  22.252 49.181 1.00 89.08  ? 75   GLU A OE1 1 
ATOM   433  O OE2 . GLU A 1 75  ? 22.780  23.781 48.249 1.00 94.24  ? 75   GLU A OE2 1 
ATOM   434  N N   . GLU A 1 76  ? 18.930  24.169 46.703 1.00 45.47  ? 76   GLU A N   1 
ATOM   435  C CA  . GLU A 1 76  ? 18.659  25.074 45.591 1.00 43.94  ? 76   GLU A CA  1 
ATOM   436  C C   . GLU A 1 76  ? 17.371  24.725 44.866 1.00 45.78  ? 76   GLU A C   1 
ATOM   437  O O   . GLU A 1 76  ? 16.886  25.503 44.042 1.00 46.21  ? 76   GLU A O   1 
ATOM   438  C CB  . GLU A 1 76  ? 19.831  25.093 44.618 1.00 45.17  ? 76   GLU A CB  1 
ATOM   439  C CG  . GLU A 1 76  ? 20.685  23.852 44.679 1.00 55.77  ? 76   GLU A CG  1 
ATOM   440  C CD  . GLU A 1 76  ? 21.961  24.004 43.894 1.00 81.16  ? 76   GLU A CD  1 
ATOM   441  O OE1 . GLU A 1 76  ? 22.221  25.123 43.399 1.00 80.24  ? 76   GLU A OE1 1 
ATOM   442  O OE2 . GLU A 1 76  ? 22.703  23.006 43.775 1.00 77.45  ? 76   GLU A OE2 1 
ATOM   443  N N   . VAL A 1 77  ? 16.788  23.585 45.231 1.00 39.72  ? 77   VAL A N   1 
ATOM   444  C CA  . VAL A 1 77  ? 15.527  23.124 44.654 1.00 37.84  ? 77   VAL A CA  1 
ATOM   445  C C   . VAL A 1 77  ? 14.343  24.019 44.971 1.00 38.25  ? 77   VAL A C   1 
ATOM   446  O O   . VAL A 1 77  ? 13.535  24.319 44.095 1.00 37.77  ? 77   VAL A O   1 
ATOM   447  C CB  . VAL A 1 77  ? 15.217  21.678 45.050 1.00 41.56  ? 77   VAL A CB  1 
ATOM   448  C CG1 . VAL A 1 77  ? 13.880  21.242 44.447 1.00 41.29  ? 77   VAL A CG1 1 
ATOM   449  C CG2 . VAL A 1 77  ? 16.354  20.751 44.623 1.00 41.27  ? 77   VAL A CG2 1 
ATOM   450  N N   . PHE A 1 78  ? 14.212  24.403 46.235 1.00 33.21  ? 78   PHE A N   1 
ATOM   451  C CA  . PHE A 1 78  ? 13.075  25.214 46.674 1.00 32.53  ? 78   PHE A CA  1 
ATOM   452  C C   . PHE A 1 78  ? 13.028  26.593 46.006 1.00 36.84  ? 78   PHE A C   1 
ATOM   453  O O   . PHE A 1 78  ? 12.079  26.910 45.293 1.00 35.99  ? 78   PHE A O   1 
ATOM   454  C CB  . PHE A 1 78  ? 13.058  25.332 48.199 1.00 33.96  ? 78   PHE A CB  1 
ATOM   455  C CG  . PHE A 1 78  ? 12.046  26.306 48.725 1.00 35.28  ? 78   PHE A CG  1 
ATOM   456  C CD1 . PHE A 1 78  ? 10.708  26.186 48.396 1.00 38.08  ? 78   PHE A CD1 1 
ATOM   457  C CD2 . PHE A 1 78  ? 12.431  27.325 49.584 1.00 37.02  ? 78   PHE A CD2 1 
ATOM   458  C CE1 . PHE A 1 78  ? 9.776   27.081 48.895 1.00 38.51  ? 78   PHE A CE1 1 
ATOM   459  C CE2 . PHE A 1 78  ? 11.505  28.222 50.081 1.00 39.22  ? 78   PHE A CE2 1 
ATOM   460  C CZ  . PHE A 1 78  ? 10.176  28.096 49.740 1.00 37.10  ? 78   PHE A CZ  1 
ATOM   461  N N   . PRO A 1 79  ? 14.089  27.404 46.180 1.00 34.34  ? 79   PRO A N   1 
ATOM   462  C CA  . PRO A 1 79  ? 14.156  28.719 45.535 1.00 33.70  ? 79   PRO A CA  1 
ATOM   463  C C   . PRO A 1 79  ? 14.097  28.652 44.018 1.00 36.35  ? 79   PRO A C   1 
ATOM   464  O O   . PRO A 1 79  ? 13.748  29.632 43.370 1.00 36.39  ? 79   PRO A O   1 
ATOM   465  C CB  . PRO A 1 79  ? 15.518  29.261 45.980 1.00 35.43  ? 79   PRO A CB  1 
ATOM   466  C CG  . PRO A 1 79  ? 16.302  28.063 46.340 1.00 40.44  ? 79   PRO A CG  1 
ATOM   467  C CD  . PRO A 1 79  ? 15.308  27.130 46.959 1.00 36.18  ? 79   PRO A CD  1 
ATOM   468  N N   . LEU A 1 80  ? 14.459  27.512 43.444 1.00 32.31  ? 80   LEU A N   1 
ATOM   469  C CA  . LEU A 1 80  ? 14.336  27.345 41.996 1.00 32.00  ? 80   LEU A CA  1 
ATOM   470  C C   . LEU A 1 80  ? 12.878  27.133 41.588 1.00 35.91  ? 80   LEU A C   1 
ATOM   471  O O   . LEU A 1 80  ? 12.418  27.688 40.594 1.00 34.99  ? 80   LEU A O   1 
ATOM   472  C CB  . LEU A 1 80  ? 15.221  26.201 41.484 1.00 31.73  ? 80   LEU A CB  1 
ATOM   473  C CG  . LEU A 1 80  ? 15.178  25.928 39.974 1.00 35.80  ? 80   LEU A CG  1 
ATOM   474  C CD1 . LEU A 1 80  ? 15.376  27.207 39.182 1.00 35.47  ? 80   LEU A CD1 1 
ATOM   475  C CD2 . LEU A 1 80  ? 16.222  24.887 39.571 1.00 37.58  ? 80   LEU A CD2 1 
ATOM   476  N N   . ALA A 1 81  ? 12.142  26.379 42.399 1.00 32.86  ? 81   ALA A N   1 
ATOM   477  C CA  . ALA A 1 81  ? 10.738  26.110 42.117 1.00 33.16  ? 81   ALA A CA  1 
ATOM   478  C C   . ALA A 1 81  ? 9.888   27.371 42.253 1.00 36.51  ? 81   ALA A C   1 
ATOM   479  O O   . ALA A 1 81  ? 8.949   27.591 41.485 1.00 35.68  ? 81   ALA A O   1 
ATOM   480  C CB  . ALA A 1 81  ? 10.216  25.005 43.027 1.00 34.23  ? 81   ALA A CB  1 
ATOM   481  N N   . MET A 1 82  ? 10.229  28.192 43.241 1.00 33.22  ? 82   MET A N   1 
ATOM   482  C CA  . MET A 1 82  ? 9.515   29.437 43.504 1.00 32.89  ? 82   MET A CA  1 
ATOM   483  C C   . MET A 1 82  ? 9.682   30.433 42.363 1.00 37.20  ? 82   MET A C   1 
ATOM   484  O O   . MET A 1 82  ? 8.756   31.169 42.025 1.00 36.96  ? 82   MET A O   1 
ATOM   485  C CB  . MET A 1 82  ? 9.996   30.047 44.820 1.00 35.05  ? 82   MET A CB  1 
ATOM   486  C CG  . MET A 1 82  ? 9.616   29.223 46.033 1.00 38.60  ? 82   MET A CG  1 
ATOM   487  S SD  . MET A 1 82  ? 7.832   28.923 46.108 1.00 42.93  ? 82   MET A SD  1 
ATOM   488  C CE  . MET A 1 82  ? 7.230   30.548 46.562 1.00 40.07  ? 82   MET A CE  1 
ATOM   489  N N   . ASN A 1 83  ? 10.887  30.482 41.809 1.00 33.70  ? 83   ASN A N   1 
ATOM   490  C CA  . ASN A 1 83  ? 11.149  31.215 40.575 1.00 33.29  ? 83   ASN A CA  1 
ATOM   491  C C   . ASN A 1 83  ? 10.180  30.779 39.469 1.00 35.85  ? 83   ASN A C   1 
ATOM   492  O O   . ASN A 1 83  ? 9.498   31.607 38.858 1.00 34.45  ? 83   ASN A O   1 
ATOM   493  C CB  . ASN A 1 83  ? 12.587  30.946 40.132 1.00 33.55  ? 83   ASN A CB  1 
ATOM   494  C CG  . ASN A 1 83  ? 12.971  31.731 38.913 1.00 57.01  ? 83   ASN A CG  1 
ATOM   495  O OD1 . ASN A 1 83  ? 13.275  31.160 37.865 1.00 49.47  ? 83   ASN A OD1 1 
ATOM   496  N ND2 . ASN A 1 83  ? 12.948  33.055 39.033 1.00 53.24  ? 83   ASN A ND2 1 
ATOM   497  N N   . TYR A 1 84  ? 10.137  29.471 39.218 1.00 31.73  ? 84   TYR A N   1 
ATOM   498  C CA  . TYR A 1 84  ? 9.219   28.895 38.245 1.00 30.81  ? 84   TYR A CA  1 
ATOM   499  C C   . TYR A 1 84  ? 7.782   29.304 38.550 1.00 36.72  ? 84   TYR A C   1 
ATOM   500  O O   . TYR A 1 84  ? 7.043   29.694 37.653 1.00 37.63  ? 84   TYR A O   1 
ATOM   501  C CB  . TYR A 1 84  ? 9.310   27.370 38.251 1.00 31.07  ? 84   TYR A CB  1 
ATOM   502  C CG  . TYR A 1 84  ? 10.615  26.769 37.750 1.00 31.38  ? 84   TYR A CG  1 
ATOM   503  C CD1 . TYR A 1 84  ? 11.600  27.548 37.157 1.00 32.49  ? 84   TYR A CD1 1 
ATOM   504  C CD2 . TYR A 1 84  ? 10.853  25.405 37.877 1.00 32.22  ? 84   TYR A CD2 1 
ATOM   505  C CE1 . TYR A 1 84  ? 12.782  26.982 36.705 1.00 32.02  ? 84   TYR A CE1 1 
ATOM   506  C CE2 . TYR A 1 84  ? 12.031  24.833 37.436 1.00 33.16  ? 84   TYR A CE2 1 
ATOM   507  C CZ  . TYR A 1 84  ? 12.985  25.620 36.838 1.00 39.83  ? 84   TYR A CZ  1 
ATOM   508  O OH  . TYR A 1 84  ? 14.148  25.029 36.394 1.00 41.25  ? 84   TYR A OH  1 
ATOM   509  N N   . LEU A 1 85  ? 7.380   29.200 39.812 1.00 34.07  ? 85   LEU A N   1 
ATOM   510  C CA  . LEU A 1 85  ? 6.008   29.537 40.210 1.00 34.56  ? 85   LEU A CA  1 
ATOM   511  C C   . LEU A 1 85  ? 5.633   31.003 39.978 1.00 39.27  ? 85   LEU A C   1 
ATOM   512  O O   . LEU A 1 85  ? 4.590   31.303 39.409 1.00 39.75  ? 85   LEU A O   1 
ATOM   513  C CB  . LEU A 1 85  ? 5.753   29.125 41.661 1.00 34.90  ? 85   LEU A CB  1 
ATOM   514  C CG  . LEU A 1 85  ? 4.462   29.562 42.356 1.00 39.85  ? 85   LEU A CG  1 
ATOM   515  C CD1 . LEU A 1 85  ? 3.987   28.455 43.283 1.00 39.82  ? 85   LEU A CD1 1 
ATOM   516  C CD2 . LEU A 1 85  ? 4.713   30.823 43.166 1.00 42.01  ? 85   LEU A CD2 1 
ATOM   517  N N   . ASP A 1 86  ? 6.514   31.910 40.378 1.00 35.59  ? 86   ASP A N   1 
ATOM   518  C CA  . ASP A 1 86  ? 6.330   33.334 40.136 1.00 34.83  ? 86   ASP A CA  1 
ATOM   519  C C   . ASP A 1 86  ? 6.337   33.707 38.651 1.00 39.21  ? 86   ASP A C   1 
ATOM   520  O O   . ASP A 1 86  ? 5.548   34.545 38.207 1.00 40.34  ? 86   ASP A O   1 
ATOM   521  C CB  . ASP A 1 86  ? 7.398   34.125 40.889 1.00 36.32  ? 86   ASP A CB  1 
ATOM   522  C CG  . ASP A 1 86  ? 7.233   34.029 42.392 1.00 43.19  ? 86   ASP A CG  1 
ATOM   523  O OD1 . ASP A 1 86  ? 8.241   34.153 43.119 1.00 43.61  ? 86   ASP A OD1 1 
ATOM   524  O OD2 . ASP A 1 86  ? 6.085   33.824 42.844 1.00 45.78  ? 86   ASP A OD2 1 
ATOM   525  N N   . ARG A 1 87  ? 7.254   33.126 37.887 1.00 34.22  ? 87   ARG A N   1 
ATOM   526  C CA  . ARG A 1 87  ? 7.305   33.394 36.457 1.00 33.27  ? 87   ARG A CA  1 
ATOM   527  C C   . ARG A 1 87  ? 6.092   32.822 35.730 1.00 38.62  ? 87   ARG A C   1 
ATOM   528  O O   . ARG A 1 87  ? 5.779   33.238 34.620 1.00 39.20  ? 87   ARG A O   1 
ATOM   529  C CB  . ARG A 1 87  ? 8.572   32.811 35.855 1.00 31.26  ? 87   ARG A CB  1 
ATOM   530  C CG  . ARG A 1 87  ? 9.851   33.467 36.314 1.00 33.25  ? 87   ARG A CG  1 
ATOM   531  C CD  . ARG A 1 87  ? 11.032  32.537 36.054 1.00 35.74  ? 87   ARG A CD  1 
ATOM   532  N NE  . ARG A 1 87  ? 11.222  32.230 34.638 1.00 32.80  ? 87   ARG A NE  1 
ATOM   533  C CZ  . ARG A 1 87  ? 12.023  31.270 34.190 1.00 48.20  ? 87   ARG A CZ  1 
ATOM   534  N NH1 . ARG A 1 87  ? 12.678  30.508 35.049 1.00 36.75  ? 87   ARG A NH1 1 
ATOM   535  N NH2 . ARG A 1 87  ? 12.163  31.062 32.889 1.00 39.87  ? 87   ARG A NH2 1 
ATOM   536  N N   . PHE A 1 88  ? 5.430   31.839 36.332 1.00 35.23  ? 88   PHE A N   1 
ATOM   537  C CA  . PHE A 1 88  ? 4.268   31.234 35.692 1.00 34.87  ? 88   PHE A CA  1 
ATOM   538  C C   . PHE A 1 88  ? 3.006   32.015 36.020 1.00 38.40  ? 88   PHE A C   1 
ATOM   539  O O   . PHE A 1 88  ? 2.176   32.289 35.146 1.00 37.25  ? 88   PHE A O   1 
ATOM   540  C CB  . PHE A 1 88  ? 4.108   29.772 36.101 1.00 36.38  ? 88   PHE A CB  1 
ATOM   541  C CG  . PHE A 1 88  ? 3.057   29.039 35.316 1.00 37.48  ? 88   PHE A CG  1 
ATOM   542  C CD1 . PHE A 1 88  ? 3.360   28.473 34.088 1.00 39.75  ? 88   PHE A CD1 1 
ATOM   543  C CD2 . PHE A 1 88  ? 1.758   28.932 35.799 1.00 39.18  ? 88   PHE A CD2 1 
ATOM   544  C CE1 . PHE A 1 88  ? 2.387   27.813 33.357 1.00 40.50  ? 88   PHE A CE1 1 
ATOM   545  C CE2 . PHE A 1 88  ? 0.783   28.270 35.075 1.00 41.14  ? 88   PHE A CE2 1 
ATOM   546  C CZ  . PHE A 1 88  ? 1.096   27.716 33.853 1.00 39.23  ? 88   PHE A CZ  1 
ATOM   547  N N   . LEU A 1 89  ? 2.869   32.371 37.289 1.00 35.15  ? 89   LEU A N   1 
ATOM   548  C CA  . LEU A 1 89  ? 1.785   33.243 37.709 1.00 35.22  ? 89   LEU A CA  1 
ATOM   549  C C   . LEU A 1 89  ? 1.899   34.579 36.998 1.00 42.31  ? 89   LEU A C   1 
ATOM   550  O O   . LEU A 1 89  ? 0.911   35.295 36.837 1.00 43.19  ? 89   LEU A O   1 
ATOM   551  C CB  . LEU A 1 89  ? 1.822   33.445 39.217 1.00 34.76  ? 89   LEU A CB  1 
ATOM   552  C CG  . LEU A 1 89  ? 1.024   32.442 40.046 1.00 38.34  ? 89   LEU A CG  1 
ATOM   553  C CD1 . LEU A 1 89  ? 0.775   31.172 39.238 1.00 38.72  ? 89   LEU A CD1 1 
ATOM   554  C CD2 . LEU A 1 89  ? 1.777   32.138 41.336 1.00 37.67  ? 89   LEU A CD2 1 
ATOM   555  N N   . SER A 1 90  ? 3.109   34.910 36.564 1.00 39.77  ? 90   SER A N   1 
ATOM   556  C CA  . SER A 1 90  ? 3.321   36.119 35.779 1.00 39.67  ? 90   SER A CA  1 
ATOM   557  C C   . SER A 1 90  ? 2.747   35.960 34.376 1.00 45.85  ? 90   SER A C   1 
ATOM   558  O O   . SER A 1 90  ? 2.342   36.935 33.757 1.00 46.70  ? 90   SER A O   1 
ATOM   559  C CB  . SER A 1 90  ? 4.808   36.466 35.711 1.00 40.96  ? 90   SER A CB  1 
ATOM   560  O OG  . SER A 1 90  ? 5.318   36.761 37.000 1.00 43.03  ? 90   SER A OG  1 
ATOM   561  N N   . LEU A 1 91  ? 2.643   34.718 33.912 1.00 43.01  ? 91   LEU A N   1 
ATOM   562  C CA  . LEU A 1 91  ? 2.211   34.433 32.545 1.00 42.77  ? 91   LEU A CA  1 
ATOM   563  C C   . LEU A 1 91  ? 0.815   33.815 32.456 1.00 48.74  ? 91   LEU A C   1 
ATOM   564  O O   . LEU A 1 91  ? 0.122   33.997 31.459 1.00 49.04  ? 91   LEU A O   1 
ATOM   565  C CB  . LEU A 1 91  ? 3.229   33.525 31.841 1.00 42.36  ? 91   LEU A CB  1 
ATOM   566  C CG  . LEU A 1 91  ? 4.598   34.154 31.568 1.00 46.18  ? 91   LEU A CG  1 
ATOM   567  C CD1 . LEU A 1 91  ? 5.691   33.110 31.428 1.00 46.46  ? 91   LEU A CD1 1 
ATOM   568  C CD2 . LEU A 1 91  ? 4.548   35.038 30.342 1.00 47.00  ? 91   LEU A CD2 1 
ATOM   569  N N   . GLU A 1 92  ? 0.410   33.066 33.479 1.00 45.99  ? 92   GLU A N   1 
ATOM   570  C CA  . GLU A 1 92  ? -0.878  32.377 33.440 1.00 46.17  ? 92   GLU A CA  1 
ATOM   571  C C   . GLU A 1 92  ? -1.769  32.645 34.642 1.00 50.95  ? 92   GLU A C   1 
ATOM   572  O O   . GLU A 1 92  ? -1.322  32.583 35.786 1.00 50.66  ? 92   GLU A O   1 
ATOM   573  C CB  . GLU A 1 92  ? -0.685  30.868 33.258 1.00 47.69  ? 92   GLU A CB  1 
ATOM   574  C CG  . GLU A 1 92  ? -0.949  30.371 31.841 1.00 58.84  ? 92   GLU A CG  1 
ATOM   575  C CD  . GLU A 1 92  ? -2.433  30.252 31.533 1.00 80.96  ? 92   GLU A CD  1 
ATOM   576  O OE1 . GLU A 1 92  ? -3.096  29.369 32.121 1.00 84.46  ? 92   GLU A OE1 1 
ATOM   577  O OE2 . GLU A 1 92  ? -2.933  31.024 30.689 1.00 70.98  ? 92   GLU A OE2 1 
ATOM   578  N N   . PRO A 1 93  ? -3.056  32.944 34.393 1.00 47.98  ? 93   PRO A N   1 
ATOM   579  C CA  . PRO A 1 93  ? -3.998  32.972 35.519 1.00 47.49  ? 93   PRO A CA  1 
ATOM   580  C C   . PRO A 1 93  ? -4.257  31.543 35.984 1.00 51.69  ? 93   PRO A C   1 
ATOM   581  O O   . PRO A 1 93  ? -4.245  30.613 35.178 1.00 51.24  ? 93   PRO A O   1 
ATOM   582  C CB  . PRO A 1 93  ? -5.269  33.565 34.903 1.00 48.83  ? 93   PRO A CB  1 
ATOM   583  C CG  . PRO A 1 93  ? -4.825  34.237 33.660 1.00 53.19  ? 93   PRO A CG  1 
ATOM   584  C CD  . PRO A 1 93  ? -3.672  33.445 33.154 1.00 49.02  ? 93   PRO A CD  1 
ATOM   585  N N   . VAL A 1 94  ? -4.474  31.372 37.283 1.00 48.32  ? 94   VAL A N   1 
ATOM   586  C CA  . VAL A 1 94  ? -4.584  30.042 37.872 1.00 48.04  ? 94   VAL A CA  1 
ATOM   587  C C   . VAL A 1 94  ? -5.665  30.024 38.947 1.00 52.57  ? 94   VAL A C   1 
ATOM   588  O O   . VAL A 1 94  ? -5.690  30.889 39.819 1.00 52.14  ? 94   VAL A O   1 
ATOM   589  C CB  . VAL A 1 94  ? -3.225  29.581 38.469 1.00 51.32  ? 94   VAL A CB  1 
ATOM   590  C CG1 . VAL A 1 94  ? -3.427  28.410 39.425 1.00 51.02  ? 94   VAL A CG1 1 
ATOM   591  C CG2 . VAL A 1 94  ? -2.237  29.222 37.371 1.00 50.81  ? 94   VAL A CG2 1 
ATOM   592  N N   . LYS A 1 95  ? -6.525  29.011 38.918 1.00 49.75  ? 95   LYS A N   1 
ATOM   593  C CA  . LYS A 1 95  ? -7.510  28.843 39.980 1.00 49.79  ? 95   LYS A CA  1 
ATOM   594  C C   . LYS A 1 95  ? -6.796  28.418 41.258 1.00 52.63  ? 95   LYS A C   1 
ATOM   595  O O   . LYS A 1 95  ? -5.921  27.553 41.226 1.00 52.56  ? 95   LYS A O   1 
ATOM   596  C CB  . LYS A 1 95  ? -8.562  27.793 39.603 1.00 52.83  ? 95   LYS A CB  1 
ATOM   597  C CG  . LYS A 1 95  ? -9.140  27.918 38.207 1.00 69.58  ? 95   LYS A CG  1 
ATOM   598  C CD  . LYS A 1 95  ? -8.643  26.805 37.288 1.00 83.92  ? 95   LYS A CD  1 
ATOM   599  C CE  . LYS A 1 95  ? -7.296  27.131 36.646 1.00 96.85  ? 95   LYS A CE  1 
ATOM   600  N NZ  . LYS A 1 95  ? -6.138  26.869 37.547 1.00 104.02 ? 95   LYS A NZ  1 
ATOM   601  N N   . LYS A 1 96  ? -7.166  29.015 42.383 1.00 48.17  ? 96   LYS A N   1 
ATOM   602  C CA  . LYS A 1 96  ? -6.504  28.679 43.635 1.00 48.10  ? 96   LYS A CA  1 
ATOM   603  C C   . LYS A 1 96  ? -6.523  27.178 43.915 1.00 53.09  ? 96   LYS A C   1 
ATOM   604  O O   . LYS A 1 96  ? -5.537  26.612 44.392 1.00 52.79  ? 96   LYS A O   1 
ATOM   605  C CB  . LYS A 1 96  ? -7.087  29.468 44.806 1.00 50.04  ? 96   LYS A CB  1 
ATOM   606  C CG  . LYS A 1 96  ? -8.585  29.399 44.942 1.00 59.56  ? 96   LYS A CG  1 
ATOM   607  C CD  . LYS A 1 96  ? -9.061  30.458 45.916 1.00 67.91  ? 96   LYS A CD  1 
ATOM   608  C CE  . LYS A 1 96  ? -10.546 30.721 45.785 1.00 78.67  ? 96   LYS A CE  1 
ATOM   609  N NZ  . LYS A 1 96  ? -10.927 31.983 46.482 1.00 89.47  ? 96   LYS A NZ  1 
ATOM   610  N N   . SER A 1 97  ? -7.636  26.533 43.586 1.00 49.79  ? 97   SER A N   1 
ATOM   611  C CA  . SER A 1 97  ? -7.762  25.095 43.777 1.00 49.54  ? 97   SER A CA  1 
ATOM   612  C C   . SER A 1 97  ? -6.598  24.389 43.088 1.00 52.89  ? 97   SER A C   1 
ATOM   613  O O   . SER A 1 97  ? -6.221  23.268 43.447 1.00 52.30  ? 97   SER A O   1 
ATOM   614  C CB  . SER A 1 97  ? -9.087  24.603 43.189 1.00 52.53  ? 97   SER A CB  1 
ATOM   615  O OG  . SER A 1 97  ? -9.126  24.819 41.788 1.00 58.94  ? 97   SER A OG  1 
ATOM   616  N N   . ARG A 1 98  ? -5.994  25.089 42.134 1.00 48.46  ? 98   ARG A N   1 
ATOM   617  C CA  . ARG A 1 98  ? -5.007  24.487 41.252 1.00 47.42  ? 98   ARG A CA  1 
ATOM   618  C C   . ARG A 1 98  ? -3.603  25.027 41.534 1.00 48.60  ? 98   ARG A C   1 
ATOM   619  O O   . ARG A 1 98  ? -2.646  24.689 40.839 1.00 47.98  ? 98   ARG A O   1 
ATOM   620  C CB  . ARG A 1 98  ? -5.412  24.737 39.800 1.00 48.03  ? 98   ARG A CB  1 
ATOM   621  C CG  . ARG A 1 98  ? -5.064  23.612 38.857 1.00 61.80  ? 98   ARG A CG  1 
ATOM   622  C CD  . ARG A 1 98  ? -6.222  23.310 37.927 1.00 70.34  ? 98   ARG A CD  1 
ATOM   623  N NE  . ARG A 1 98  ? -5.792  22.569 36.746 1.00 80.16  ? 98   ARG A NE  1 
ATOM   624  C CZ  . ARG A 1 98  ? -5.220  23.132 35.687 1.00 101.70 ? 98   ARG A CZ  1 
ATOM   625  N NH1 . ARG A 1 98  ? -4.989  24.439 35.674 1.00 93.94  ? 98   ARG A NH1 1 
ATOM   626  N NH2 . ARG A 1 98  ? -4.869  22.391 34.645 1.00 92.67  ? 98   ARG A NH2 1 
ATOM   627  N N   . LEU A 1 99  ? -3.484  25.826 42.593 1.00 43.09  ? 99   LEU A N   1 
ATOM   628  C CA  . LEU A 1 99  ? -2.200  26.388 43.003 1.00 41.82  ? 99   LEU A CA  1 
ATOM   629  C C   . LEU A 1 99  ? -1.238  25.331 43.528 1.00 44.59  ? 99   LEU A C   1 
ATOM   630  O O   . LEU A 1 99  ? -0.112  25.220 43.033 1.00 45.15  ? 99   LEU A O   1 
ATOM   631  C CB  . LEU A 1 99  ? -2.394  27.480 44.058 1.00 41.49  ? 99   LEU A CB  1 
ATOM   632  C CG  . LEU A 1 99  ? -1.169  28.323 44.433 1.00 44.55  ? 99   LEU A CG  1 
ATOM   633  C CD1 . LEU A 1 99  ? -0.633  29.067 43.224 1.00 43.86  ? 99   LEU A CD1 1 
ATOM   634  C CD2 . LEU A 1 99  ? -1.500  29.286 45.553 1.00 45.82  ? 99   LEU A CD2 1 
ATOM   635  N N   . GLN A 1 100 ? -1.664  24.585 44.548 1.00 38.77  ? 100  GLN A N   1 
ATOM   636  C CA  . GLN A 1 100 ? -0.826  23.525 45.114 1.00 38.02  ? 100  GLN A CA  1 
ATOM   637  C C   . GLN A 1 100 ? -0.268  22.634 44.016 1.00 42.32  ? 100  GLN A C   1 
ATOM   638  O O   . GLN A 1 100 ? 0.878   22.199 44.074 1.00 42.63  ? 100  GLN A O   1 
ATOM   639  C CB  . GLN A 1 100 ? -1.602  22.675 46.122 1.00 39.02  ? 100  GLN A CB  1 
ATOM   640  C CG  . GLN A 1 100 ? -0.737  21.699 46.917 1.00 42.20  ? 100  GLN A CG  1 
ATOM   641  C CD  . GLN A 1 100 ? -1.546  20.810 47.870 1.00 55.79  ? 100  GLN A CD  1 
ATOM   642  O OE1 . GLN A 1 100 ? -1.354  20.844 49.085 1.00 46.76  ? 100  GLN A OE1 1 
ATOM   643  N NE2 . GLN A 1 100 ? -2.426  19.986 47.313 1.00 51.42  ? 100  GLN A NE2 1 
ATOM   644  N N   . LEU A 1 101 ? -1.083  22.380 43.001 1.00 38.20  ? 101  LEU A N   1 
ATOM   645  C CA  . LEU A 1 101 ? -0.663  21.562 41.878 1.00 37.50  ? 101  LEU A CA  1 
ATOM   646  C C   . LEU A 1 101 ? 0.509   22.224 41.175 1.00 40.56  ? 101  LEU A C   1 
ATOM   647  O O   . LEU A 1 101 ? 1.454   21.549 40.769 1.00 40.54  ? 101  LEU A O   1 
ATOM   648  C CB  . LEU A 1 101 ? -1.830  21.370 40.911 1.00 37.60  ? 101  LEU A CB  1 
ATOM   649  C CG  . LEU A 1 101 ? -1.560  20.683 39.575 1.00 42.30  ? 101  LEU A CG  1 
ATOM   650  C CD1 . LEU A 1 101 ? -0.961  19.302 39.780 1.00 42.52  ? 101  LEU A CD1 1 
ATOM   651  C CD2 . LEU A 1 101 ? -2.862  20.585 38.815 1.00 45.23  ? 101  LEU A CD2 1 
ATOM   652  N N   . LEU A 1 102 ? 0.453   23.550 41.056 1.00 36.17  ? 102  LEU A N   1 
ATOM   653  C CA  . LEU A 1 102 ? 1.547   24.322 40.461 1.00 35.24  ? 102  LEU A CA  1 
ATOM   654  C C   . LEU A 1 102 ? 2.810   24.245 41.314 1.00 37.43  ? 102  LEU A C   1 
ATOM   655  O O   . LEU A 1 102 ? 3.907   24.042 40.796 1.00 36.53  ? 102  LEU A O   1 
ATOM   656  C CB  . LEU A 1 102 ? 1.138   25.786 40.251 1.00 35.10  ? 102  LEU A CB  1 
ATOM   657  C CG  . LEU A 1 102 ? 2.121   26.700 39.505 1.00 39.08  ? 102  LEU A CG  1 
ATOM   658  C CD1 . LEU A 1 102 ? 2.466   26.157 38.129 1.00 38.87  ? 102  LEU A CD1 1 
ATOM   659  C CD2 . LEU A 1 102 ? 1.569   28.110 39.401 1.00 40.75  ? 102  LEU A CD2 1 
ATOM   660  N N   . GLY A 1 103 ? 2.658   24.411 42.622 1.00 33.75  ? 103  GLY A N   1 
ATOM   661  C CA  . GLY A 1 103 ? 3.773   24.219 43.529 1.00 33.98  ? 103  GLY A CA  1 
ATOM   662  C C   . GLY A 1 103 ? 4.459   22.900 43.234 1.00 39.68  ? 103  GLY A C   1 
ATOM   663  O O   . GLY A 1 103 ? 5.614   22.872 42.810 1.00 40.04  ? 103  GLY A O   1 
ATOM   664  N N   . ALA A 1 104 ? 3.703   21.815 43.370 1.00 36.47  ? 104  ALA A N   1 
ATOM   665  C CA  . ALA A 1 104 ? 4.186   20.474 43.072 1.00 36.06  ? 104  ALA A CA  1 
ATOM   666  C C   . ALA A 1 104 ? 4.960   20.409 41.761 1.00 40.08  ? 104  ALA A C   1 
ATOM   667  O O   . ALA A 1 104 ? 6.090   19.930 41.723 1.00 40.87  ? 104  ALA A O   1 
ATOM   668  C CB  . ALA A 1 104 ? 3.036   19.504 43.050 1.00 36.79  ? 104  ALA A CB  1 
ATOM   669  N N   . THR A 1 105 ? 4.358   20.885 40.681 1.00 35.65  ? 105  THR A N   1 
ATOM   670  C CA  . THR A 1 105 ? 5.021   20.811 39.385 1.00 35.24  ? 105  THR A CA  1 
ATOM   671  C C   . THR A 1 105 ? 6.361   21.554 39.396 1.00 39.95  ? 105  THR A C   1 
ATOM   672  O O   . THR A 1 105 ? 7.376   21.046 38.916 1.00 39.82  ? 105  THR A O   1 
ATOM   673  C CB  . THR A 1 105 ? 4.100   21.285 38.253 1.00 39.44  ? 105  THR A CB  1 
ATOM   674  O OG1 . THR A 1 105 ? 2.861   20.573 38.326 1.00 38.22  ? 105  THR A OG1 1 
ATOM   675  C CG2 . THR A 1 105 ? 4.741   21.021 36.898 1.00 37.54  ? 105  THR A CG2 1 
ATOM   676  N N   . CYS A 1 106 ? 6.371   22.750 39.971 1.00 36.15  ? 106  CYS A N   1 
ATOM   677  C CA  . CYS A 1 106 ? 7.589   23.542 40.008 1.00 35.71  ? 106  CYS A CA  1 
ATOM   678  C C   . CYS A 1 106 ? 8.711   22.810 40.731 1.00 40.62  ? 106  CYS A C   1 
ATOM   679  O O   . CYS A 1 106 ? 9.842   22.776 40.251 1.00 41.24  ? 106  CYS A O   1 
ATOM   680  C CB  . CYS A 1 106 ? 7.328   24.912 40.629 1.00 35.41  ? 106  CYS A CB  1 
ATOM   681  S SG  . CYS A 1 106 ? 6.186   25.911 39.663 1.00 38.86  ? 106  CYS A SG  1 
ATOM   682  N N   . MET A 1 107 ? 8.390   22.193 41.865 1.00 36.45  ? 107  MET A N   1 
ATOM   683  C CA  . MET A 1 107 ? 9.329   21.286 42.516 1.00 36.25  ? 107  MET A CA  1 
ATOM   684  C C   . MET A 1 107 ? 9.702   20.067 41.670 1.00 38.99  ? 107  MET A C   1 
ATOM   685  O O   . MET A 1 107 ? 10.858  19.650 41.646 1.00 38.51  ? 107  MET A O   1 
ATOM   686  C CB  . MET A 1 107 ? 8.802   20.837 43.867 1.00 38.76  ? 107  MET A CB  1 
ATOM   687  C CG  . MET A 1 107 ? 9.087   21.828 44.960 1.00 43.14  ? 107  MET A CG  1 
ATOM   688  S SD  . MET A 1 107 ? 8.497   21.184 46.503 1.00 48.20  ? 107  MET A SD  1 
ATOM   689  C CE  . MET A 1 107 ? 6.883   20.493 45.991 1.00 44.68  ? 107  MET A CE  1 
ATOM   690  N N   . PHE A 1 108 ? 8.721   19.489 40.987 1.00 34.29  ? 108  PHE A N   1 
ATOM   691  C CA  . PHE A 1 108 ? 8.994   18.372 40.098 1.00 33.45  ? 108  PHE A CA  1 
ATOM   692  C C   . PHE A 1 108 ? 10.105  18.727 39.120 1.00 35.31  ? 108  PHE A C   1 
ATOM   693  O O   . PHE A 1 108 ? 11.071  17.995 38.980 1.00 34.17  ? 108  PHE A O   1 
ATOM   694  C CB  . PHE A 1 108 ? 7.736   17.968 39.334 1.00 35.32  ? 108  PHE A CB  1 
ATOM   695  C CG  . PHE A 1 108 ? 7.840   16.627 38.678 1.00 37.02  ? 108  PHE A CG  1 
ATOM   696  C CD1 . PHE A 1 108 ? 8.241   15.515 39.405 1.00 39.66  ? 108  PHE A CD1 1 
ATOM   697  C CD2 . PHE A 1 108 ? 7.541   16.474 37.335 1.00 39.92  ? 108  PHE A CD2 1 
ATOM   698  C CE1 . PHE A 1 108 ? 8.338   14.276 38.810 1.00 40.64  ? 108  PHE A CE1 1 
ATOM   699  C CE2 . PHE A 1 108 ? 7.633   15.229 36.725 1.00 42.84  ? 108  PHE A CE2 1 
ATOM   700  C CZ  . PHE A 1 108 ? 8.032   14.129 37.469 1.00 40.69  ? 108  PHE A CZ  1 
ATOM   701  N N   . VAL A 1 109 ? 9.986   19.881 38.478 1.00 31.88  ? 109  VAL A N   1 
ATOM   702  C CA  . VAL A 1 109 ? 10.952  20.280 37.463 1.00 31.47  ? 109  VAL A CA  1 
ATOM   703  C C   . VAL A 1 109 ? 12.231  20.813 38.095 1.00 33.77  ? 109  VAL A C   1 
ATOM   704  O O   . VAL A 1 109 ? 13.329  20.531 37.622 1.00 32.61  ? 109  VAL A O   1 
ATOM   705  C CB  . VAL A 1 109 ? 10.331  21.258 36.429 1.00 35.56  ? 109  VAL A CB  1 
ATOM   706  C CG1 . VAL A 1 109 ? 11.413  21.896 35.582 1.00 35.30  ? 109  VAL A CG1 1 
ATOM   707  C CG2 . VAL A 1 109 ? 9.336   20.523 35.532 1.00 35.48  ? 109  VAL A CG2 1 
ATOM   708  N N   . ALA A 1 110 ? 12.084  21.556 39.186 1.00 30.31  ? 110  ALA A N   1 
ATOM   709  C CA  . ALA A 1 110 ? 13.233  22.072 39.910 1.00 30.38  ? 110  ALA A CA  1 
ATOM   710  C C   . ALA A 1 110 ? 14.137  20.909 40.315 1.00 36.58  ? 110  ALA A C   1 
ATOM   711  O O   . ALA A 1 110 ? 15.334  20.913 40.041 1.00 36.69  ? 110  ALA A O   1 
ATOM   712  C CB  . ALA A 1 110 ? 12.780  22.846 41.130 1.00 30.84  ? 110  ALA A CB  1 
ATOM   713  N N   . SER A 1 111 ? 13.537  19.876 40.894 1.00 34.17  ? 111  SER A N   1 
ATOM   714  C CA  . SER A 1 111 ? 14.275  18.701 41.346 1.00 33.80  ? 111  SER A CA  1 
ATOM   715  C C   . SER A 1 111 ? 14.949  17.975 40.188 1.00 38.24  ? 111  SER A C   1 
ATOM   716  O O   . SER A 1 111 ? 16.131  17.645 40.253 1.00 38.12  ? 111  SER A O   1 
ATOM   717  C CB  . SER A 1 111 ? 13.343  17.748 42.089 1.00 36.98  ? 111  SER A CB  1 
ATOM   718  O OG  . SER A 1 111 ? 14.050  16.624 42.567 1.00 46.59  ? 111  SER A OG  1 
ATOM   719  N N   . LYS A 1 112 ? 14.198  17.728 39.122 1.00 34.96  ? 112  LYS A N   1 
ATOM   720  C CA  . LYS A 1 112 ? 14.777  17.084 37.953 1.00 34.51  ? 112  LYS A CA  1 
ATOM   721  C C   . LYS A 1 112 ? 15.989  17.852 37.472 1.00 40.89  ? 112  LYS A C   1 
ATOM   722  O O   . LYS A 1 112 ? 16.940  17.250 36.995 1.00 42.04  ? 112  LYS A O   1 
ATOM   723  C CB  . LYS A 1 112 ? 13.754  16.927 36.824 1.00 35.52  ? 112  LYS A CB  1 
ATOM   724  C CG  . LYS A 1 112 ? 12.455  16.302 37.287 1.00 36.15  ? 112  LYS A CG  1 
ATOM   725  C CD  . LYS A 1 112 ? 11.912  15.294 36.300 1.00 35.94  ? 112  LYS A CD  1 
ATOM   726  C CE  . LYS A 1 112 ? 11.476  15.940 35.013 1.00 29.24  ? 112  LYS A CE  1 
ATOM   727  N NZ  . LYS A 1 112 ? 10.482  15.058 34.340 1.00 32.23  ? 112  LYS A NZ  1 
ATOM   728  N N   . MET A 1 113 ? 15.980  19.173 37.650 1.00 37.69  ? 113  MET A N   1 
ATOM   729  C CA  . MET A 1 113 ? 17.076  20.018 37.168 1.00 37.48  ? 113  MET A CA  1 
ATOM   730  C C   . MET A 1 113 ? 18.301  20.006 38.083 1.00 42.72  ? 113  MET A C   1 
ATOM   731  O O   . MET A 1 113 ? 19.429  20.159 37.616 1.00 43.00  ? 113  MET A O   1 
ATOM   732  C CB  . MET A 1 113 ? 16.613  21.462 36.958 1.00 39.50  ? 113  MET A CB  1 
ATOM   733  C CG  . MET A 1 113 ? 15.718  21.683 35.757 1.00 43.08  ? 113  MET A CG  1 
ATOM   734  S SD  . MET A 1 113 ? 16.594  21.626 34.177 1.00 47.57  ? 113  MET A SD  1 
ATOM   735  C CE  . MET A 1 113 ? 18.002  22.685 34.507 1.00 44.46  ? 113  MET A CE  1 
ATOM   736  N N   . LYS A 1 114 ? 18.077  19.801 39.377 1.00 39.34  ? 114  LYS A N   1 
ATOM   737  C CA  . LYS A 1 114 ? 19.118  20.009 40.382 1.00 39.27  ? 114  LYS A CA  1 
ATOM   738  C C   . LYS A 1 114 ? 19.543  18.757 41.162 1.00 44.71  ? 114  LYS A C   1 
ATOM   739  O O   . LYS A 1 114 ? 20.520  18.796 41.916 1.00 45.05  ? 114  LYS A O   1 
ATOM   740  C CB  . LYS A 1 114 ? 18.694  21.109 41.360 1.00 40.73  ? 114  LYS A CB  1 
ATOM   741  C CG  . LYS A 1 114 ? 18.780  22.507 40.792 1.00 45.85  ? 114  LYS A CG  1 
ATOM   742  C CD  . LYS A 1 114 ? 20.223  22.988 40.763 1.00 50.29  ? 114  LYS A CD  1 
ATOM   743  C CE  . LYS A 1 114 ? 20.330  24.431 40.304 1.00 50.48  ? 114  LYS A CE  1 
ATOM   744  N NZ  . LYS A 1 114 ? 20.173  24.557 38.837 1.00 57.70  ? 114  LYS A NZ  1 
ATOM   745  N N   . GLU A 1 115 ? 18.817  17.655 40.989 1.00 40.87  ? 115  GLU A N   1 
ATOM   746  C CA  . GLU A 1 115 ? 19.032  16.468 41.817 1.00 40.07  ? 115  GLU A CA  1 
ATOM   747  C C   . GLU A 1 115 ? 19.487  15.222 41.063 1.00 44.30  ? 115  GLU A C   1 
ATOM   748  O O   . GLU A 1 115 ? 18.942  14.876 40.017 1.00 42.82  ? 115  GLU A O   1 
ATOM   749  C CB  . GLU A 1 115 ? 17.781  16.151 42.634 1.00 41.05  ? 115  GLU A CB  1 
ATOM   750  C CG  . GLU A 1 115 ? 17.327  17.281 43.528 1.00 48.71  ? 115  GLU A CG  1 
ATOM   751  C CD  . GLU A 1 115 ? 16.743  16.777 44.826 1.00 70.21  ? 115  GLU A CD  1 
ATOM   752  O OE1 . GLU A 1 115 ? 15.504  16.829 44.981 1.00 66.91  ? 115  GLU A OE1 1 
ATOM   753  O OE2 . GLU A 1 115 ? 17.521  16.261 45.661 1.00 64.04  ? 115  GLU A OE2 1 
ATOM   754  N N   . THR A 1 116 ? 20.457  14.516 41.632 1.00 42.74  ? 116  THR A N   1 
ATOM   755  C CA  . THR A 1 116 ? 20.855  13.230 41.087 1.00 42.91  ? 116  THR A CA  1 
ATOM   756  C C   . THR A 1 116 ? 19.734  12.208 41.232 1.00 47.11  ? 116  THR A C   1 
ATOM   757  O O   . THR A 1 116 ? 19.497  11.411 40.330 1.00 46.88  ? 116  THR A O   1 
ATOM   758  C CB  . THR A 1 116 ? 22.241  12.755 41.606 1.00 51.85  ? 116  THR A CB  1 
ATOM   759  O OG1 . THR A 1 116 ? 22.195  11.368 41.954 1.00 53.60  ? 116  THR A OG1 1 
ATOM   760  C CG2 . THR A 1 116 ? 22.716  13.586 42.788 1.00 50.08  ? 116  THR A CG2 1 
ATOM   761  N N   . ILE A 1 117 ? 18.977  12.299 42.321 1.00 44.23  ? 117  ILE A N   1 
ATOM   762  C CA  . ILE A 1 117 ? 17.755  11.499 42.465 1.00 43.94  ? 117  ILE A CA  1 
ATOM   763  C C   . ILE A 1 117 ? 16.532  12.405 42.541 1.00 46.28  ? 117  ILE A C   1 
ATOM   764  O O   . ILE A 1 117 ? 16.128  12.835 43.620 1.00 44.71  ? 117  ILE A O   1 
ATOM   765  C CB  . ILE A 1 117 ? 17.816  10.525 43.672 1.00 47.33  ? 117  ILE A CB  1 
ATOM   766  C CG1 . ILE A 1 117 ? 19.206  9.884  43.790 1.00 47.98  ? 117  ILE A CG1 1 
ATOM   767  C CG2 . ILE A 1 117 ? 16.738  9.449  43.541 1.00 47.74  ? 117  ILE A CG2 1 
ATOM   768  C CD1 . ILE A 1 117 ? 19.312  8.842  44.881 1.00 55.86  ? 117  ILE A CD1 1 
ATOM   769  N N   . PRO A 1 118 ? 15.948  12.734 41.380 1.00 43.41  ? 118  PRO A N   1 
ATOM   770  C CA  . PRO A 1 118 ? 14.836  13.686 41.359 1.00 43.08  ? 118  PRO A CA  1 
ATOM   771  C C   . PRO A 1 118 ? 13.663  13.198 42.200 1.00 48.15  ? 118  PRO A C   1 
ATOM   772  O O   . PRO A 1 118 ? 13.534  12.004 42.475 1.00 47.31  ? 118  PRO A O   1 
ATOM   773  C CB  . PRO A 1 118 ? 14.444  13.733 39.877 1.00 44.49  ? 118  PRO A CB  1 
ATOM   774  C CG  . PRO A 1 118 ? 15.639  13.263 39.140 1.00 48.58  ? 118  PRO A CG  1 
ATOM   775  C CD  . PRO A 1 118 ? 16.270  12.241 40.029 1.00 44.60  ? 118  PRO A CD  1 
ATOM   776  N N   . LEU A 1 119 ? 12.837  14.141 42.644 1.00 45.92  ? 119  LEU A N   1 
ATOM   777  C CA  . LEU A 1 119 ? 11.590  13.815 43.333 1.00 45.43  ? 119  LEU A CA  1 
ATOM   778  C C   . LEU A 1 119 ? 10.679  13.017 42.419 1.00 48.18  ? 119  LEU A C   1 
ATOM   779  O O   . LEU A 1 119 ? 10.622  13.259 41.212 1.00 47.52  ? 119  LEU A O   1 
ATOM   780  C CB  . LEU A 1 119 ? 10.868  15.086 43.785 1.00 45.19  ? 119  LEU A CB  1 
ATOM   781  C CG  . LEU A 1 119 ? 11.436  15.745 45.035 1.00 49.53  ? 119  LEU A CG  1 
ATOM   782  C CD1 . LEU A 1 119 ? 10.961  17.183 45.134 1.00 49.49  ? 119  LEU A CD1 1 
ATOM   783  C CD2 . LEU A 1 119 ? 11.028  14.946 46.267 1.00 51.69  ? 119  LEU A CD2 1 
ATOM   784  N N   . THR A 1 120 ? 9.942   12.092 43.016 1.00 44.02  ? 120  THR A N   1 
ATOM   785  C CA  . THR A 1 120 ? 8.973   11.290 42.290 1.00 43.31  ? 120  THR A CA  1 
ATOM   786  C C   . THR A 1 120 ? 7.621   11.994 42.229 1.00 45.56  ? 120  THR A C   1 
ATOM   787  O O   . THR A 1 120 ? 7.204   12.634 43.193 1.00 45.35  ? 120  THR A O   1 
ATOM   788  C CB  . THR A 1 120 ? 8.865   9.897  42.915 1.00 52.52  ? 120  THR A CB  1 
ATOM   789  O OG1 . THR A 1 120 ? 9.966   9.096  42.471 1.00 52.74  ? 120  THR A OG1 1 
ATOM   790  C CG2 . THR A 1 120 ? 7.570   9.232  42.527 1.00 53.39  ? 120  THR A CG2 1 
ATOM   791  N N   . ALA A 1 121 ? 6.949   11.896 41.085 1.00 41.06  ? 121  ALA A N   1 
ATOM   792  C CA  . ALA A 1 121 ? 5.613   12.475 40.932 1.00 40.69  ? 121  ALA A CA  1 
ATOM   793  C C   . ALA A 1 121 ? 4.662   11.886 41.963 1.00 43.69  ? 121  ALA A C   1 
ATOM   794  O O   . ALA A 1 121 ? 3.881   12.600 42.598 1.00 42.33  ? 121  ALA A O   1 
ATOM   795  C CB  . ALA A 1 121 ? 5.082   12.233 39.528 1.00 41.51  ? 121  ALA A CB  1 
ATOM   796  N N   . GLU A 1 122 ? 4.730   10.570 42.115 1.00 40.22  ? 122  GLU A N   1 
ATOM   797  C CA  . GLU A 1 122 ? 3.955   9.886  43.133 1.00 39.84  ? 122  GLU A CA  1 
ATOM   798  C C   . GLU A 1 122 ? 4.314   10.365 44.539 1.00 43.70  ? 122  GLU A C   1 
ATOM   799  O O   . GLU A 1 122 ? 3.434   10.592 45.371 1.00 43.24  ? 122  GLU A O   1 
ATOM   800  C CB  . GLU A 1 122 ? 4.148   8.384  43.008 1.00 41.10  ? 122  GLU A CB  1 
ATOM   801  C CG  . GLU A 1 122 ? 3.789   7.606  44.248 1.00 50.46  ? 122  GLU A CG  1 
ATOM   802  C CD  . GLU A 1 122 ? 3.744   6.127  43.978 1.00 63.79  ? 122  GLU A CD  1 
ATOM   803  O OE1 . GLU A 1 122 ? 4.710   5.432  44.356 1.00 49.18  ? 122  GLU A OE1 1 
ATOM   804  O OE2 . GLU A 1 122 ? 2.803   5.686  43.281 1.00 56.44  ? 122  GLU A OE2 1 
ATOM   805  N N   . LYS A 1 123 ? 5.603   10.542 44.801 1.00 40.46  ? 123  LYS A N   1 
ATOM   806  C CA  . LYS A 1 123 ? 6.023   10.997 46.121 1.00 40.51  ? 123  LYS A CA  1 
ATOM   807  C C   . LYS A 1 123 ? 5.544   12.417 46.365 1.00 43.72  ? 123  LYS A C   1 
ATOM   808  O O   . LYS A 1 123 ? 5.225   12.792 47.492 1.00 43.28  ? 123  LYS A O   1 
ATOM   809  C CB  . LYS A 1 123 ? 7.540   10.906 46.285 1.00 43.41  ? 123  LYS A CB  1 
ATOM   810  C CG  . LYS A 1 123 ? 7.995   10.833 47.736 1.00 59.82  ? 123  LYS A CG  1 
ATOM   811  C CD  . LYS A 1 123 ? 9.385   10.224 47.836 1.00 74.20  ? 123  LYS A CD  1 
ATOM   812  C CE  . LYS A 1 123 ? 9.389   8.789  47.321 1.00 89.09  ? 123  LYS A CE  1 
ATOM   813  N NZ  . LYS A 1 123 ? 10.735  8.358  46.840 1.00 100.05 ? 123  LYS A NZ  1 
ATOM   814  N N   . LEU A 1 124 ? 5.471   13.198 45.293 1.00 39.84  ? 124  LEU A N   1 
ATOM   815  C CA  . LEU A 1 124 ? 4.981   14.562 45.390 1.00 39.37  ? 124  LEU A CA  1 
ATOM   816  C C   . LEU A 1 124 ? 3.485   14.618 45.714 1.00 43.69  ? 124  LEU A C   1 
ATOM   817  O O   . LEU A 1 124 ? 3.060   15.394 46.564 1.00 43.36  ? 124  LEU A O   1 
ATOM   818  C CB  . LEU A 1 124 ? 5.310   15.342 44.119 1.00 39.20  ? 124  LEU A CB  1 
ATOM   819  C CG  . LEU A 1 124 ? 6.657   16.073 44.104 1.00 43.49  ? 124  LEU A CG  1 
ATOM   820  C CD1 . LEU A 1 124 ? 7.059   16.451 42.690 1.00 43.44  ? 124  LEU A CD1 1 
ATOM   821  C CD2 . LEU A 1 124 ? 6.582   17.314 44.971 1.00 45.34  ? 124  LEU A CD2 1 
ATOM   822  N N   . CYS A 1 125 ? 2.700   13.742 45.094 1.00 40.49  ? 125  CYS A N   1 
ATOM   823  C CA  . CYS A 1 125 ? 1.261   13.703 45.338 1.00 40.44  ? 125  CYS A CA  1 
ATOM   824  C C   . CYS A 1 125 ? 0.968   13.175 46.728 1.00 44.33  ? 125  CYS A C   1 
ATOM   825  O O   . CYS A 1 125 ? -0.013  13.565 47.357 1.00 44.92  ? 125  CYS A O   1 
ATOM   826  C CB  . CYS A 1 125 ? 0.550   12.834 44.299 1.00 41.09  ? 125  CYS A CB  1 
ATOM   827  S SG  . CYS A 1 125 ? 0.876   13.280 42.570 1.00 45.22  ? 125  CYS A SG  1 
ATOM   828  N N   . ILE A 1 126 ? 1.790   12.241 47.184 1.00 39.96  ? 126  ILE A N   1 
ATOM   829  C CA  . ILE A 1 126 ? 1.696   11.767 48.553 1.00 39.32  ? 126  ILE A CA  1 
ATOM   830  C C   . ILE A 1 126 ? 1.704   12.948 49.521 1.00 43.55  ? 126  ILE A C   1 
ATOM   831  O O   . ILE A 1 126 ? 0.942   12.982 50.481 1.00 42.76  ? 126  ILE A O   1 
ATOM   832  C CB  . ILE A 1 126 ? 2.812   10.757 48.864 1.00 42.20  ? 126  ILE A CB  1 
ATOM   833  C CG1 . ILE A 1 126 ? 2.453   9.383  48.279 1.00 42.17  ? 126  ILE A CG1 1 
ATOM   834  C CG2 . ILE A 1 126 ? 3.072   10.701 50.363 1.00 42.79  ? 126  ILE A CG2 1 
ATOM   835  C CD1 . ILE A 1 126 ? 3.618   8.419  48.158 1.00 44.39  ? 126  ILE A CD1 1 
ATOM   836  N N   . TYR A 1 127 ? 2.512   13.957 49.210 1.00 41.86  ? 127  TYR A N   1 
ATOM   837  C CA  . TYR A 1 127 ? 2.643   15.137 50.059 1.00 42.06  ? 127  TYR A CA  1 
ATOM   838  C C   . TYR A 1 127 ? 1.434   16.054 50.036 1.00 45.93  ? 127  TYR A C   1 
ATOM   839  O O   . TYR A 1 127 ? 1.298   16.927 50.888 1.00 45.92  ? 127  TYR A O   1 
ATOM   840  C CB  . TYR A 1 127 ? 3.898   15.916 49.695 1.00 43.78  ? 127  TYR A CB  1 
ATOM   841  C CG  . TYR A 1 127 ? 5.135   15.411 50.398 1.00 46.67  ? 127  TYR A CG  1 
ATOM   842  C CD1 . TYR A 1 127 ? 5.324   15.638 51.754 1.00 48.96  ? 127  TYR A CD1 1 
ATOM   843  C CD2 . TYR A 1 127 ? 6.107   14.700 49.712 1.00 47.52  ? 127  TYR A CD2 1 
ATOM   844  C CE1 . TYR A 1 127 ? 6.449   15.183 52.405 1.00 50.17  ? 127  TYR A CE1 1 
ATOM   845  C CE2 . TYR A 1 127 ? 7.237   14.244 50.353 1.00 48.63  ? 127  TYR A CE2 1 
ATOM   846  C CZ  . TYR A 1 127 ? 7.405   14.488 51.700 1.00 58.13  ? 127  TYR A CZ  1 
ATOM   847  O OH  . TYR A 1 127 ? 8.535   14.034 52.346 1.00 62.35  ? 127  TYR A OH  1 
ATOM   848  N N   . THR A 1 128 ? 0.571   15.868 49.045 1.00 42.22  ? 128  THR A N   1 
ATOM   849  C CA  . THR A 1 128 ? -0.694  16.585 48.982 1.00 42.01  ? 128  THR A CA  1 
ATOM   850  C C   . THR A 1 128 ? -1.779  15.745 49.647 1.00 48.80  ? 128  THR A C   1 
ATOM   851  O O   . THR A 1 128 ? -2.970  16.042 49.511 1.00 48.92  ? 128  THR A O   1 
ATOM   852  C CB  . THR A 1 128 ? -1.094  16.824 47.537 1.00 45.11  ? 128  THR A CB  1 
ATOM   853  O OG1 . THR A 1 128 ? -1.594  15.599 46.994 1.00 39.38  ? 128  THR A OG1 1 
ATOM   854  C CG2 . THR A 1 128 ? 0.099   17.292 46.716 1.00 44.33  ? 128  THR A CG2 1 
ATOM   855  N N   . ASP A 1 129 ? -1.360  14.686 50.345 1.00 46.21  ? 129  ASP A N   1 
ATOM   856  C CA  . ASP A 1 129 ? -2.272  13.646 50.814 1.00 45.65  ? 129  ASP A CA  1 
ATOM   857  C C   . ASP A 1 129 ? -3.055  13.103 49.625 1.00 49.75  ? 129  ASP A C   1 
ATOM   858  O O   . ASP A 1 129 ? -4.259  12.856 49.708 1.00 49.79  ? 129  ASP A O   1 
ATOM   859  C CB  . ASP A 1 129 ? -3.206  14.186 51.895 1.00 47.37  ? 129  ASP A CB  1 
ATOM   860  C CG  . ASP A 1 129 ? -2.500  14.385 53.216 1.00 57.27  ? 129  ASP A CG  1 
ATOM   861  O OD1 . ASP A 1 129 ? -1.279  14.135 53.264 1.00 58.87  ? 129  ASP A OD1 1 
ATOM   862  O OD2 . ASP A 1 129 ? -3.158  14.776 54.204 1.00 61.57  ? 129  ASP A OD2 1 
ATOM   863  N N   . ASN A 1 130 ? -2.346  12.939 48.512 1.00 45.87  ? 130  ASN A N   1 
ATOM   864  C CA  . ASN A 1 130 ? -2.933  12.491 47.255 1.00 45.40  ? 130  ASN A CA  1 
ATOM   865  C C   . ASN A 1 130 ? -4.154  13.297 46.844 1.00 50.03  ? 130  ASN A C   1 
ATOM   866  O O   . ASN A 1 130 ? -5.083  12.769 46.234 1.00 50.15  ? 130  ASN A O   1 
ATOM   867  C CB  . ASN A 1 130 ? -3.241  10.998 47.289 1.00 42.75  ? 130  ASN A CB  1 
ATOM   868  C CG  . ASN A 1 130 ? -1.993  10.157 47.419 1.00 53.72  ? 130  ASN A CG  1 
ATOM   869  O OD1 . ASN A 1 130 ? -1.108  10.202 46.565 1.00 46.13  ? 130  ASN A OD1 1 
ATOM   870  N ND2 . ASN A 1 130 ? -1.900  9.408  48.510 1.00 45.10  ? 130  ASN A ND2 1 
ATOM   871  N N   . SER A 1 131 ? -4.143  14.582 47.183 1.00 46.42  ? 131  SER A N   1 
ATOM   872  C CA  . SER A 1 131 ? -5.128  15.514 46.653 1.00 45.80  ? 131  SER A CA  1 
ATOM   873  C C   . SER A 1 131 ? -4.981  15.603 45.142 1.00 49.07  ? 131  SER A C   1 
ATOM   874  O O   . SER A 1 131 ? -5.971  15.588 44.413 1.00 48.56  ? 131  SER A O   1 
ATOM   875  C CB  . SER A 1 131 ? -4.942  16.895 47.272 1.00 49.49  ? 131  SER A CB  1 
ATOM   876  O OG  . SER A 1 131 ? -5.464  17.895 46.416 1.00 61.16  ? 131  SER A OG  1 
ATOM   877  N N   . ILE A 1 132 ? -3.736  15.689 44.677 1.00 45.51  ? 132  ILE A N   1 
ATOM   878  C CA  . ILE A 1 132 ? -3.446  15.710 43.249 1.00 45.14  ? 132  ILE A CA  1 
ATOM   879  C C   . ILE A 1 132 ? -2.918  14.351 42.814 1.00 49.39  ? 132  ILE A C   1 
ATOM   880  O O   . ILE A 1 132 ? -2.617  13.504 43.653 1.00 49.31  ? 132  ILE A O   1 
ATOM   881  C CB  . ILE A 1 132 ? -2.478  16.856 42.870 1.00 48.11  ? 132  ILE A CB  1 
ATOM   882  C CG1 . ILE A 1 132 ? -1.033  16.457 43.157 1.00 48.31  ? 132  ILE A CG1 1 
ATOM   883  C CG2 . ILE A 1 132 ? -2.829  18.137 43.622 1.00 49.23  ? 132  ILE A CG2 1 
ATOM   884  C CD1 . ILE A 1 132 ? -0.018  17.343 42.485 1.00 54.71  ? 132  ILE A CD1 1 
ATOM   885  N N   . ARG A 1 133 ? -2.784  14.159 41.504 1.00 46.02  ? 133  ARG A N   1 
ATOM   886  C CA  . ARG A 1 133 ? -2.417  12.865 40.940 1.00 46.00  ? 133  ARG A CA  1 
ATOM   887  C C   . ARG A 1 133 ? -1.308  12.997 39.908 1.00 51.31  ? 133  ARG A C   1 
ATOM   888  O O   . ARG A 1 133 ? -1.240  13.991 39.179 1.00 51.36  ? 133  ARG A O   1 
ATOM   889  C CB  . ARG A 1 133 ? -3.624  12.236 40.256 1.00 46.27  ? 133  ARG A CB  1 
ATOM   890  C CG  . ARG A 1 133 ? -4.809  12.018 41.164 1.00 53.88  ? 133  ARG A CG  1 
ATOM   891  C CD  . ARG A 1 133 ? -6.057  11.813 40.343 1.00 57.03  ? 133  ARG A CD  1 
ATOM   892  N NE  . ARG A 1 133 ? -7.035  10.995 41.042 1.00 62.02  ? 133  ARG A NE  1 
ATOM   893  C CZ  . ARG A 1 133 ? -7.162  9.685  40.872 1.00 73.34  ? 133  ARG A CZ  1 
ATOM   894  N NH1 . ARG A 1 133 ? -6.376  9.046  40.021 1.00 60.14  ? 133  ARG A NH1 1 
ATOM   895  N NH2 . ARG A 1 133 ? -8.084  9.017  41.546 1.00 63.90  ? 133  ARG A NH2 1 
ATOM   896  N N   . PRO A 1 134 ? -0.500  11.933 39.750 1.00 47.75  ? 134  PRO A N   1 
ATOM   897  C CA  . PRO A 1 134 ? 0.631   11.957 38.818 1.00 47.35  ? 134  PRO A CA  1 
ATOM   898  C C   . PRO A 1 134 ? 0.228   12.442 37.432 1.00 52.07  ? 134  PRO A C   1 
ATOM   899  O O   . PRO A 1 134 ? 0.930   13.252 36.828 1.00 52.91  ? 134  PRO A O   1 
ATOM   900  C CB  . PRO A 1 134 ? 1.073   10.493 38.769 1.00 48.72  ? 134  PRO A CB  1 
ATOM   901  C CG  . PRO A 1 134 ? 0.682   9.945  40.097 1.00 52.80  ? 134  PRO A CG  1 
ATOM   902  C CD  . PRO A 1 134 ? -0.556  10.678 40.526 1.00 48.48  ? 134  PRO A CD  1 
ATOM   903  N N   . GLU A 1 135 ? -0.931  11.993 36.957 1.00 48.23  ? 135  GLU A N   1 
ATOM   904  C CA  . GLU A 1 135 ? -1.383  12.331 35.606 1.00 47.89  ? 135  GLU A CA  1 
ATOM   905  C C   . GLU A 1 135 ? -1.559  13.833 35.469 1.00 50.25  ? 135  GLU A C   1 
ATOM   906  O O   . GLU A 1 135 ? -1.209  14.411 34.442 1.00 49.58  ? 135  GLU A O   1 
ATOM   907  C CB  . GLU A 1 135 ? -2.702  11.627 35.260 1.00 49.44  ? 135  GLU A CB  1 
ATOM   908  C CG  . GLU A 1 135 ? -2.831  10.201 35.780 1.00 60.64  ? 135  GLU A CG  1 
ATOM   909  C CD  . GLU A 1 135 ? -3.365  10.141 37.202 1.00 80.52  ? 135  GLU A CD  1 
ATOM   910  O OE1 . GLU A 1 135 ? -4.092  11.078 37.614 1.00 64.38  ? 135  GLU A OE1 1 
ATOM   911  O OE2 . GLU A 1 135 ? -3.067  9.147  37.901 1.00 76.76  ? 135  GLU A OE2 1 
ATOM   912  N N   . GLU A 1 136 ? -2.121  14.450 36.505 1.00 46.56  ? 136  GLU A N   1 
ATOM   913  C CA  . GLU A 1 136 ? -2.302  15.896 36.550 1.00 46.61  ? 136  GLU A CA  1 
ATOM   914  C C   . GLU A 1 136 ? -0.941  16.576 36.570 1.00 52.02  ? 136  GLU A C   1 
ATOM   915  O O   . GLU A 1 136 ? -0.655  17.455 35.749 1.00 52.40  ? 136  GLU A O   1 
ATOM   916  C CB  . GLU A 1 136 ? -3.077  16.297 37.803 1.00 47.82  ? 136  GLU A CB  1 
ATOM   917  C CG  . GLU A 1 136 ? -4.390  15.563 38.004 1.00 56.57  ? 136  GLU A CG  1 
ATOM   918  C CD  . GLU A 1 136 ? -5.089  15.972 39.290 1.00 74.98  ? 136  GLU A CD  1 
ATOM   919  O OE1 . GLU A 1 136 ? -4.910  17.129 39.726 1.00 75.28  ? 136  GLU A OE1 1 
ATOM   920  O OE2 . GLU A 1 136 ? -5.821  15.141 39.866 1.00 65.00  ? 136  GLU A OE2 1 
ATOM   921  N N   . LEU A 1 137 ? -0.108  16.158 37.519 1.00 48.16  ? 137  LEU A N   1 
ATOM   922  C CA  . LEU A 1 137 ? 1.259   16.649 37.617 1.00 47.66  ? 137  LEU A CA  1 
ATOM   923  C C   . LEU A 1 137 ? 1.935   16.695 36.250 1.00 51.39  ? 137  LEU A C   1 
ATOM   924  O O   . LEU A 1 137 ? 2.491   17.726 35.869 1.00 52.22  ? 137  LEU A O   1 
ATOM   925  C CB  . LEU A 1 137 ? 2.077   15.772 38.563 1.00 47.49  ? 137  LEU A CB  1 
ATOM   926  C CG  . LEU A 1 137 ? 3.263   16.467 39.230 1.00 51.72  ? 137  LEU A CG  1 
ATOM   927  C CD1 . LEU A 1 137 ? 2.829   17.104 40.539 1.00 51.53  ? 137  LEU A CD1 1 
ATOM   928  C CD2 . LEU A 1 137 ? 4.421   15.502 39.456 1.00 54.17  ? 137  LEU A CD2 1 
ATOM   929  N N   . LEU A 1 138 ? 1.853   15.600 35.496 1.00 45.84  ? 138  LEU A N   1 
ATOM   930  C CA  . LEU A 1 138 ? 2.555   15.524 34.218 1.00 44.89  ? 138  LEU A CA  1 
ATOM   931  C C   . LEU A 1 138 ? 1.956   16.438 33.155 1.00 48.16  ? 138  LEU A C   1 
ATOM   932  O O   . LEU A 1 138 ? 2.654   16.872 32.246 1.00 47.95  ? 138  LEU A O   1 
ATOM   933  C CB  . LEU A 1 138 ? 2.643   14.087 33.701 1.00 44.81  ? 138  LEU A CB  1 
ATOM   934  C CG  . LEU A 1 138 ? 3.253   13.019 34.607 1.00 49.34  ? 138  LEU A CG  1 
ATOM   935  C CD1 . LEU A 1 138 ? 3.790   11.859 33.776 1.00 49.17  ? 138  LEU A CD1 1 
ATOM   936  C CD2 . LEU A 1 138 ? 4.335   13.597 35.508 1.00 52.51  ? 138  LEU A CD2 1 
ATOM   937  N N   . GLN A 1 139 ? 0.660   16.714 33.255 1.00 44.51  ? 139  GLN A N   1 
ATOM   938  C CA  . GLN A 1 139 ? 0.027   17.660 32.344 1.00 44.66  ? 139  GLN A CA  1 
ATOM   939  C C   . GLN A 1 139 ? 0.563   19.053 32.629 1.00 48.28  ? 139  GLN A C   1 
ATOM   940  O O   . GLN A 1 139 ? 0.850   19.822 31.711 1.00 47.77  ? 139  GLN A O   1 
ATOM   941  C CB  . GLN A 1 139 ? -1.489  17.667 32.534 1.00 46.51  ? 139  GLN A CB  1 
ATOM   942  C CG  . GLN A 1 139 ? -2.222  16.484 31.928 1.00 67.44  ? 139  GLN A CG  1 
ATOM   943  C CD  . GLN A 1 139 ? -3.713  16.538 32.199 1.00 91.14  ? 139  GLN A CD  1 
ATOM   944  O OE1 . GLN A 1 139 ? -4.376  15.505 32.303 1.00 87.27  ? 139  GLN A OE1 1 
ATOM   945  N NE2 . GLN A 1 139 ? -4.247  17.750 32.330 1.00 85.91  ? 139  GLN A NE2 1 
ATOM   946  N N   . MET A 1 140 ? 0.636   19.383 33.916 1.00 44.46  ? 140  MET A N   1 
ATOM   947  C CA  . MET A 1 140 ? 1.189   20.653 34.373 1.00 43.71  ? 140  MET A CA  1 
ATOM   948  C C   . MET A 1 140 ? 2.633   20.868 33.942 1.00 48.70  ? 140  MET A C   1 
ATOM   949  O O   . MET A 1 140 ? 3.005   21.965 33.522 1.00 48.44  ? 140  MET A O   1 
ATOM   950  C CB  . MET A 1 140 ? 1.091   20.754 35.889 1.00 45.56  ? 140  MET A CB  1 
ATOM   951  C CG  . MET A 1 140 ? -0.087  21.568 36.356 1.00 49.08  ? 140  MET A CG  1 
ATOM   952  S SD  . MET A 1 140 ? -0.016  23.240 35.705 1.00 53.40  ? 140  MET A SD  1 
ATOM   953  C CE  . MET A 1 140 ? -1.034  24.115 36.934 1.00 50.62  ? 140  MET A CE  1 
ATOM   954  N N   . GLU A 1 141 ? 3.447   19.824 34.072 1.00 45.27  ? 141  GLU A N   1 
ATOM   955  C CA  . GLU A 1 141 ? 4.857   19.916 33.737 1.00 44.72  ? 141  GLU A CA  1 
ATOM   956  C C   . GLU A 1 141 ? 5.074   20.525 32.367 1.00 48.37  ? 141  GLU A C   1 
ATOM   957  O O   . GLU A 1 141 ? 5.979   21.332 32.185 1.00 48.20  ? 141  GLU A O   1 
ATOM   958  C CB  . GLU A 1 141 ? 5.537   18.552 33.800 1.00 46.08  ? 141  GLU A CB  1 
ATOM   959  C CG  . GLU A 1 141 ? 7.045   18.644 33.609 1.00 55.22  ? 141  GLU A CG  1 
ATOM   960  C CD  . GLU A 1 141 ? 7.714   17.296 33.500 1.00 70.09  ? 141  GLU A CD  1 
ATOM   961  O OE1 . GLU A 1 141 ? 8.875   17.183 33.940 1.00 61.43  ? 141  GLU A OE1 1 
ATOM   962  O OE2 . GLU A 1 141 ? 7.089   16.357 32.966 1.00 63.10  ? 141  GLU A OE2 1 
ATOM   963  N N   . LEU A 1 142 ? 4.255   20.126 31.400 1.00 45.06  ? 142  LEU A N   1 
ATOM   964  C CA  . LEU A 1 142 ? 4.362   20.682 30.057 1.00 45.21  ? 142  LEU A CA  1 
ATOM   965  C C   . LEU A 1 142 ? 3.811   22.096 30.018 1.00 49.97  ? 142  LEU A C   1 
ATOM   966  O O   . LEU A 1 142 ? 4.379   22.965 29.363 1.00 50.04  ? 142  LEU A O   1 
ATOM   967  C CB  . LEU A 1 142 ? 3.643   19.807 29.033 1.00 45.35  ? 142  LEU A CB  1 
ATOM   968  C CG  . LEU A 1 142 ? 4.220   18.409 28.814 1.00 50.11  ? 142  LEU A CG  1 
ATOM   969  C CD1 . LEU A 1 142 ? 3.527   17.755 27.644 1.00 50.32  ? 142  LEU A CD1 1 
ATOM   970  C CD2 . LEU A 1 142 ? 5.729   18.457 28.599 1.00 52.14  ? 142  LEU A CD2 1 
ATOM   971  N N   . LEU A 1 143 ? 2.683   22.311 30.688 1.00 46.89  ? 143  LEU A N   1 
ATOM   972  C CA  . LEU A 1 143 ? 2.186   23.658 30.926 1.00 47.02  ? 143  LEU A CA  1 
ATOM   973  C C   . LEU A 1 143 ? 3.328   24.545 31.408 1.00 49.56  ? 143  LEU A C   1 
ATOM   974  O O   . LEU A 1 143 ? 3.784   25.445 30.693 1.00 49.78  ? 143  LEU A O   1 
ATOM   975  C CB  . LEU A 1 143 ? 1.080   23.632 31.986 1.00 47.67  ? 143  LEU A CB  1 
ATOM   976  C CG  . LEU A 1 143 ? -0.364  23.846 31.522 1.00 53.64  ? 143  LEU A CG  1 
ATOM   977  C CD1 . LEU A 1 143 ? -0.603  25.321 31.197 1.00 54.27  ? 143  LEU A CD1 1 
ATOM   978  C CD2 . LEU A 1 143 ? -0.686  22.967 30.318 1.00 57.01  ? 143  LEU A CD2 1 
ATOM   979  N N   . LEU A 1 144 ? 3.807   24.252 32.614 1.00 43.77  ? 144  LEU A N   1 
ATOM   980  C CA  . LEU A 1 144 ? 4.894   25.001 33.228 1.00 42.63  ? 144  LEU A CA  1 
ATOM   981  C C   . LEU A 1 144 ? 6.114   25.139 32.312 1.00 44.58  ? 144  LEU A C   1 
ATOM   982  O O   . LEU A 1 144 ? 6.512   26.250 31.968 1.00 44.69  ? 144  LEU A O   1 
ATOM   983  C CB  . LEU A 1 144 ? 5.284   24.355 34.559 1.00 42.59  ? 144  LEU A CB  1 
ATOM   984  C CG  . LEU A 1 144 ? 6.545   24.877 35.246 1.00 47.16  ? 144  LEU A CG  1 
ATOM   985  C CD1 . LEU A 1 144 ? 6.317   26.275 35.765 1.00 47.67  ? 144  LEU A CD1 1 
ATOM   986  C CD2 . LEU A 1 144 ? 6.978   23.954 36.368 1.00 49.31  ? 144  LEU A CD2 1 
ATOM   987  N N   . VAL A 1 145 ? 6.688   24.014 31.903 1.00 39.19  ? 145  VAL A N   1 
ATOM   988  C CA  . VAL A 1 145 ? 7.871   24.014 31.042 1.00 38.71  ? 145  VAL A CA  1 
ATOM   989  C C   . VAL A 1 145 ? 7.715   24.834 29.754 1.00 44.52  ? 145  VAL A C   1 
ATOM   990  O O   . VAL A 1 145 ? 8.633   25.543 29.341 1.00 44.15  ? 145  VAL A O   1 
ATOM   991  C CB  . VAL A 1 145 ? 8.355   22.574 30.754 1.00 41.58  ? 145  VAL A CB  1 
ATOM   992  C CG1 . VAL A 1 145 ? 9.040   22.505 29.413 1.00 41.32  ? 145  VAL A CG1 1 
ATOM   993  C CG2 . VAL A 1 145 ? 9.291   22.107 31.844 1.00 41.00  ? 145  VAL A CG2 1 
ATOM   994  N N   . ASN A 1 146 ? 6.561   24.713 29.108 1.00 42.46  ? 146  ASN A N   1 
ATOM   995  C CA  . ASN A 1 146 ? 6.292   25.436 27.869 1.00 42.29  ? 146  ASN A CA  1 
ATOM   996  C C   . ASN A 1 146 ? 6.095   26.928 28.094 1.00 45.16  ? 146  ASN A C   1 
ATOM   997  O O   . ASN A 1 146 ? 6.597   27.745 27.326 1.00 44.26  ? 146  ASN A O   1 
ATOM   998  C CB  . ASN A 1 146 ? 5.069   24.854 27.169 1.00 44.30  ? 146  ASN A CB  1 
ATOM   999  C CG  . ASN A 1 146 ? 5.360   23.535 26.503 1.00 70.10  ? 146  ASN A CG  1 
ATOM   1000 O OD1 . ASN A 1 146 ? 6.455   23.315 25.993 1.00 66.36  ? 146  ASN A OD1 1 
ATOM   1001 N ND2 . ASN A 1 146 ? 4.375   22.651 26.492 1.00 64.80  ? 146  ASN A ND2 1 
ATOM   1002 N N   . LYS A 1 147 ? 5.312   27.281 29.108 1.00 41.30  ? 147  LYS A N   1 
ATOM   1003 C CA  . LYS A 1 147 ? 5.152   28.684 29.469 1.00 41.00  ? 147  LYS A CA  1 
ATOM   1004 C C   . LYS A 1 147 ? 6.511   29.351 29.699 1.00 45.46  ? 147  LYS A C   1 
ATOM   1005 O O   . LYS A 1 147 ? 6.729   30.488 29.279 1.00 45.49  ? 147  LYS A O   1 
ATOM   1006 C CB  . LYS A 1 147 ? 4.253   28.833 30.700 1.00 42.91  ? 147  LYS A CB  1 
ATOM   1007 C CG  . LYS A 1 147 ? 2.762   28.785 30.395 1.00 52.22  ? 147  LYS A CG  1 
ATOM   1008 C CD  . LYS A 1 147 ? 2.251   30.120 29.873 1.00 62.40  ? 147  LYS A CD  1 
ATOM   1009 C CE  . LYS A 1 147 ? 0.874   29.979 29.234 1.00 74.47  ? 147  LYS A CE  1 
ATOM   1010 N NZ  . LYS A 1 147 ? 0.254   31.300 28.930 1.00 84.21  ? 147  LYS A NZ  1 
ATOM   1011 N N   . LEU A 1 148 ? 7.432   28.623 30.329 1.00 41.38  ? 148  LEU A N   1 
ATOM   1012 C CA  . LEU A 1 148 ? 8.761   29.146 30.636 1.00 40.51  ? 148  LEU A CA  1 
ATOM   1013 C C   . LEU A 1 148 ? 9.710   28.986 29.455 1.00 44.53  ? 148  LEU A C   1 
ATOM   1014 O O   . LEU A 1 148 ? 10.899  29.303 29.548 1.00 44.06  ? 148  LEU A O   1 
ATOM   1015 C CB  . LEU A 1 148 ? 9.354   28.442 31.858 1.00 40.22  ? 148  LEU A CB  1 
ATOM   1016 C CG  . LEU A 1 148 ? 8.603   28.539 33.185 1.00 44.29  ? 148  LEU A CG  1 
ATOM   1017 C CD1 . LEU A 1 148 ? 9.522   28.152 34.327 1.00 43.98  ? 148  LEU A CD1 1 
ATOM   1018 C CD2 . LEU A 1 148 ? 8.036   29.932 33.392 1.00 46.44  ? 148  LEU A CD2 1 
ATOM   1019 N N   . LYS A 1 149 ? 9.188   28.457 28.355 1.00 40.93  ? 149  LYS A N   1 
ATOM   1020 C CA  . LYS A 1 149 ? 9.988   28.260 27.152 1.00 40.62  ? 149  LYS A CA  1 
ATOM   1021 C C   . LYS A 1 149 ? 11.266  27.473 27.456 1.00 44.50  ? 149  LYS A C   1 
ATOM   1022 O O   . LYS A 1 149 ? 12.333  27.764 26.904 1.00 44.22  ? 149  LYS A O   1 
ATOM   1023 C CB  . LYS A 1 149 ? 10.318  29.608 26.510 1.00 42.94  ? 149  LYS A CB  1 
ATOM   1024 C CG  . LYS A 1 149 ? 9.268   30.681 26.779 1.00 56.03  ? 149  LYS A CG  1 
ATOM   1025 C CD  . LYS A 1 149 ? 9.392   31.866 25.832 1.00 66.43  ? 149  LYS A CD  1 
ATOM   1026 C CE  . LYS A 1 149 ? 8.395   31.772 24.684 1.00 80.09  ? 149  LYS A CE  1 
ATOM   1027 N NZ  . LYS A 1 149 ? 8.376   33.015 23.849 1.00 90.89  ? 149  LYS A NZ  1 
ATOM   1028 N N   . TRP A 1 150 ? 11.132  26.453 28.306 1.00 40.70  ? 150  TRP A N   1 
ATOM   1029 C CA  . TRP A 1 150 ? 12.233  25.549 28.653 1.00 40.63  ? 150  TRP A CA  1 
ATOM   1030 C C   . TRP A 1 150 ? 13.490  26.284 29.100 1.00 44.13  ? 150  TRP A C   1 
ATOM   1031 O O   . TRP A 1 150 ? 14.603  25.757 29.002 1.00 43.62  ? 150  TRP A O   1 
ATOM   1032 C CB  . TRP A 1 150 ? 12.561  24.604 27.497 1.00 39.70  ? 150  TRP A CB  1 
ATOM   1033 C CG  . TRP A 1 150 ? 11.446  23.659 27.159 1.00 40.75  ? 150  TRP A CG  1 
ATOM   1034 C CD1 . TRP A 1 150 ? 10.177  23.989 26.769 1.00 43.81  ? 150  TRP A CD1 1 
ATOM   1035 C CD2 . TRP A 1 150 ? 11.496  22.226 27.186 1.00 40.84  ? 150  TRP A CD2 1 
ATOM   1036 N NE1 . TRP A 1 150 ? 9.442   22.851 26.538 1.00 43.12  ? 150  TRP A NE1 1 
ATOM   1037 C CE2 . TRP A 1 150 ? 10.229  21.755 26.784 1.00 44.42  ? 150  TRP A CE2 1 
ATOM   1038 C CE3 . TRP A 1 150 ? 12.491  21.296 27.510 1.00 42.08  ? 150  TRP A CE3 1 
ATOM   1039 C CZ2 . TRP A 1 150 ? 9.927   20.398 26.701 1.00 43.62  ? 150  TRP A CZ2 1 
ATOM   1040 C CZ3 . TRP A 1 150 ? 12.191  19.945 27.419 1.00 43.55  ? 150  TRP A CZ3 1 
ATOM   1041 C CH2 . TRP A 1 150 ? 10.923  19.511 27.008 1.00 44.01  ? 150  TRP A CH2 1 
ATOM   1042 N N   . ASN A 1 151 ? 13.296  27.508 29.579 1.00 40.08  ? 151  ASN A N   1 
ATOM   1043 C CA  . ASN A 1 151 ? 14.371  28.327 30.130 1.00 39.43  ? 151  ASN A CA  1 
ATOM   1044 C C   . ASN A 1 151 ? 14.415  28.082 31.643 1.00 41.66  ? 151  ASN A C   1 
ATOM   1045 O O   . ASN A 1 151 ? 13.876  28.862 32.438 1.00 40.64  ? 151  ASN A O   1 
ATOM   1046 C CB  . ASN A 1 151 ? 14.069  29.797 29.824 1.00 41.73  ? 151  ASN A CB  1 
ATOM   1047 C CG  . ASN A 1 151 ? 15.284  30.688 29.933 1.00 63.15  ? 151  ASN A CG  1 
ATOM   1048 O OD1 . ASN A 1 151 ? 16.364  30.253 30.341 1.00 55.45  ? 151  ASN A OD1 1 
ATOM   1049 N ND2 . ASN A 1 151 ? 15.107  31.959 29.584 1.00 55.34  ? 151  ASN A ND2 1 
ATOM   1050 N N   . LEU A 1 152 ? 15.046  26.979 32.030 1.00 37.82  ? 152  LEU A N   1 
ATOM   1051 C CA  . LEU A 1 152 ? 14.876  26.437 33.367 1.00 37.76  ? 152  LEU A CA  1 
ATOM   1052 C C   . LEU A 1 152 ? 16.155  26.361 34.193 1.00 44.44  ? 152  LEU A C   1 
ATOM   1053 O O   . LEU A 1 152 ? 16.095  26.251 35.415 1.00 43.26  ? 152  LEU A O   1 
ATOM   1054 C CB  . LEU A 1 152 ? 14.243  25.054 33.283 1.00 37.41  ? 152  LEU A CB  1 
ATOM   1055 C CG  . LEU A 1 152 ? 13.056  24.899 32.338 1.00 41.11  ? 152  LEU A CG  1 
ATOM   1056 C CD1 . LEU A 1 152 ? 12.900  23.424 31.994 1.00 41.03  ? 152  LEU A CD1 1 
ATOM   1057 C CD2 . LEU A 1 152 ? 11.784  25.458 32.969 1.00 41.74  ? 152  LEU A CD2 1 
ATOM   1058 N N   . ALA A 1 153 ? 17.305  26.319 33.527 1.00 44.59  ? 153  ALA A N   1 
ATOM   1059 C CA  . ALA A 1 153 ? 18.584  26.379 34.233 1.00 45.66  ? 153  ALA A CA  1 
ATOM   1060 C C   . ALA A 1 153 ? 18.773  27.787 34.766 1.00 51.55  ? 153  ALA A C   1 
ATOM   1061 O O   . ALA A 1 153 ? 19.789  28.432 34.514 1.00 51.17  ? 153  ALA A O   1 
ATOM   1062 C CB  . ALA A 1 153 ? 19.729  26.002 33.309 1.00 46.56  ? 153  ALA A CB  1 
ATOM   1063 N N   . ALA A 1 154 ? 17.754  28.276 35.463 1.00 49.85  ? 154  ALA A N   1 
ATOM   1064 C CA  . ALA A 1 154 ? 17.754  29.638 35.966 1.00 50.27  ? 154  ALA A CA  1 
ATOM   1065 C C   . ALA A 1 154 ? 18.752  29.775 37.104 1.00 54.88  ? 154  ALA A C   1 
ATOM   1066 O O   . ALA A 1 154 ? 19.310  28.783 37.571 1.00 54.60  ? 154  ALA A O   1 
ATOM   1067 C CB  . ALA A 1 154 ? 16.351  30.029 36.427 1.00 51.07  ? 154  ALA A CB  1 
ATOM   1068 N N   . MET A 1 155 ? 18.985  31.011 37.530 1.00 52.00  ? 155  MET A N   1 
ATOM   1069 C CA  . MET A 1 155 ? 19.841  31.288 38.682 1.00 51.78  ? 155  MET A CA  1 
ATOM   1070 C C   . MET A 1 155 ? 19.088  31.102 39.992 1.00 54.86  ? 155  MET A C   1 
ATOM   1071 O O   . MET A 1 155 ? 17.860  31.195 40.042 1.00 55.19  ? 155  MET A O   1 
ATOM   1072 C CB  . MET A 1 155 ? 20.371  32.720 38.613 1.00 54.14  ? 155  MET A CB  1 
ATOM   1073 C CG  . MET A 1 155 ? 21.251  32.968 37.420 1.00 57.74  ? 155  MET A CG  1 
ATOM   1074 S SD  . MET A 1 155 ? 22.592  31.795 37.444 1.00 61.95  ? 155  MET A SD  1 
ATOM   1075 C CE  . MET A 1 155 ? 23.476  32.355 38.908 1.00 58.93  ? 155  MET A CE  1 
ATOM   1076 N N   . THR A 1 156 ? 19.836  30.850 41.057 1.00 49.71  ? 156  THR A N   1 
ATOM   1077 C CA  . THR A 1 156 ? 19.274  30.873 42.398 1.00 48.77  ? 156  THR A CA  1 
ATOM   1078 C C   . THR A 1 156 ? 20.106  31.797 43.279 1.00 50.31  ? 156  THR A C   1 
ATOM   1079 O O   . THR A 1 156 ? 21.204  32.205 42.900 1.00 49.80  ? 156  THR A O   1 
ATOM   1080 C CB  . THR A 1 156 ? 19.131  29.453 42.992 1.00 56.37  ? 156  THR A CB  1 
ATOM   1081 O OG1 . THR A 1 156 ? 20.245  28.645 42.590 1.00 57.08  ? 156  THR A OG1 1 
ATOM   1082 C CG2 . THR A 1 156 ? 17.849  28.806 42.505 1.00 54.23  ? 156  THR A CG2 1 
ATOM   1083 N N   . PRO A 1 157 ? 19.558  32.201 44.434 1.00 44.96  ? 157  PRO A N   1 
ATOM   1084 C CA  . PRO A 1 157 ? 20.375  32.972 45.376 1.00 44.32  ? 157  PRO A CA  1 
ATOM   1085 C C   . PRO A 1 157 ? 21.677  32.243 45.726 1.00 47.37  ? 157  PRO A C   1 
ATOM   1086 O O   . PRO A 1 157 ? 22.727  32.861 45.864 1.00 45.51  ? 157  PRO A O   1 
ATOM   1087 C CB  . PRO A 1 157 ? 19.467  33.071 46.604 1.00 45.91  ? 157  PRO A CB  1 
ATOM   1088 C CG  . PRO A 1 157 ? 18.094  33.027 46.044 1.00 49.84  ? 157  PRO A CG  1 
ATOM   1089 C CD  . PRO A 1 157 ? 18.157  32.094 44.877 1.00 45.58  ? 157  PRO A CD  1 
ATOM   1090 N N   . HIS A 1 158 ? 21.595  30.919 45.819 1.00 45.67  ? 158  HIS A N   1 
ATOM   1091 C CA  . HIS A 1 158 ? 22.722  30.065 46.187 1.00 46.23  ? 158  HIS A CA  1 
ATOM   1092 C C   . HIS A 1 158 ? 23.881  30.161 45.202 1.00 49.30  ? 158  HIS A C   1 
ATOM   1093 O O   . HIS A 1 158 ? 25.044  30.087 45.594 1.00 48.68  ? 158  HIS A O   1 
ATOM   1094 C CB  . HIS A 1 158 ? 22.256  28.609 46.312 1.00 47.87  ? 158  HIS A CB  1 
ATOM   1095 C CG  . HIS A 1 158 ? 21.118  28.417 47.273 1.00 52.02  ? 158  HIS A CG  1 
ATOM   1096 N ND1 . HIS A 1 158 ? 19.851  28.906 47.037 1.00 54.01  ? 158  HIS A ND1 1 
ATOM   1097 C CD2 . HIS A 1 158 ? 21.063  27.806 48.483 1.00 54.10  ? 158  HIS A CD2 1 
ATOM   1098 C CE1 . HIS A 1 158 ? 19.065  28.606 48.057 1.00 53.40  ? 158  HIS A CE1 1 
ATOM   1099 N NE2 . HIS A 1 158 ? 19.776  27.940 48.947 1.00 53.88  ? 158  HIS A NE2 1 
ATOM   1100 N N   . ASP A 1 159 ? 23.557  30.320 43.923 1.00 46.10  ? 159  ASP A N   1 
ATOM   1101 C CA  . ASP A 1 159 ? 24.571  30.496 42.887 1.00 46.09  ? 159  ASP A CA  1 
ATOM   1102 C C   . ASP A 1 159 ? 25.423  31.729 43.157 1.00 49.03  ? 159  ASP A C   1 
ATOM   1103 O O   . ASP A 1 159 ? 26.615  31.753 42.847 1.00 49.43  ? 159  ASP A O   1 
ATOM   1104 C CB  . ASP A 1 159 ? 23.919  30.622 41.507 1.00 48.26  ? 159  ASP A CB  1 
ATOM   1105 C CG  . ASP A 1 159 ? 23.415  29.300 40.980 1.00 62.64  ? 159  ASP A CG  1 
ATOM   1106 O OD1 . ASP A 1 159 ? 24.110  28.285 41.180 1.00 65.05  ? 159  ASP A OD1 1 
ATOM   1107 O OD2 . ASP A 1 159 ? 22.331  29.273 40.360 1.00 70.34  ? 159  ASP A OD2 1 
ATOM   1108 N N   . PHE A 1 160 ? 24.790  32.771 43.686 1.00 43.16  ? 160  PHE A N   1 
ATOM   1109 C CA  . PHE A 1 160 ? 25.480  34.015 43.972 1.00 41.38  ? 160  PHE A CA  1 
ATOM   1110 C C   . PHE A 1 160 ? 26.211  33.970 45.309 1.00 44.56  ? 160  PHE A C   1 
ATOM   1111 O O   . PHE A 1 160 ? 27.376  34.364 45.400 1.00 44.25  ? 160  PHE A O   1 
ATOM   1112 C CB  . PHE A 1 160 ? 24.509  35.190 43.893 1.00 42.30  ? 160  PHE A CB  1 
ATOM   1113 C CG  . PHE A 1 160 ? 24.001  35.450 42.504 1.00 43.20  ? 160  PHE A CG  1 
ATOM   1114 C CD1 . PHE A 1 160 ? 22.876  34.797 42.028 1.00 45.75  ? 160  PHE A CD1 1 
ATOM   1115 C CD2 . PHE A 1 160 ? 24.683  36.304 41.651 1.00 44.87  ? 160  PHE A CD2 1 
ATOM   1116 C CE1 . PHE A 1 160 ? 22.415  35.028 40.741 1.00 46.45  ? 160  PHE A CE1 1 
ATOM   1117 C CE2 . PHE A 1 160 ? 24.228  36.532 40.361 1.00 47.43  ? 160  PHE A CE2 1 
ATOM   1118 C CZ  . PHE A 1 160 ? 23.090  35.898 39.909 1.00 45.28  ? 160  PHE A CZ  1 
ATOM   1119 N N   . ILE A 1 161 ? 25.536  33.442 46.326 1.00 40.25  ? 161  ILE A N   1 
ATOM   1120 C CA  . ILE A 1 161 ? 26.116  33.257 47.652 1.00 39.83  ? 161  ILE A CA  1 
ATOM   1121 C C   . ILE A 1 161 ? 27.526  32.666 47.556 1.00 47.74  ? 161  ILE A C   1 
ATOM   1122 O O   . ILE A 1 161 ? 28.488  33.221 48.097 1.00 47.37  ? 161  ILE A O   1 
ATOM   1123 C CB  . ILE A 1 161 ? 25.193  32.378 48.529 1.00 41.62  ? 161  ILE A CB  1 
ATOM   1124 C CG1 . ILE A 1 161 ? 23.905  33.128 48.865 1.00 41.12  ? 161  ILE A CG1 1 
ATOM   1125 C CG2 . ILE A 1 161 ? 25.902  31.939 49.791 1.00 41.56  ? 161  ILE A CG2 1 
ATOM   1126 C CD1 . ILE A 1 161 ? 22.832  32.259 49.466 1.00 41.34  ? 161  ILE A CD1 1 
ATOM   1127 N N   . GLU A 1 162 ? 27.652  31.573 46.810 1.00 46.51  ? 162  GLU A N   1 
ATOM   1128 C CA  . GLU A 1 162 ? 28.945  30.934 46.607 1.00 46.83  ? 162  GLU A CA  1 
ATOM   1129 C C   . GLU A 1 162 ? 29.942  31.878 45.947 1.00 53.40  ? 162  GLU A C   1 
ATOM   1130 O O   . GLU A 1 162 ? 31.091  31.986 46.381 1.00 53.27  ? 162  GLU A O   1 
ATOM   1131 C CB  . GLU A 1 162 ? 28.782  29.662 45.780 1.00 47.90  ? 162  GLU A CB  1 
ATOM   1132 C CG  . GLU A 1 162 ? 28.005  28.577 46.501 1.00 54.43  ? 162  GLU A CG  1 
ATOM   1133 C CD  . GLU A 1 162 ? 28.628  28.207 47.834 1.00 66.18  ? 162  GLU A CD  1 
ATOM   1134 O OE1 . GLU A 1 162 ? 29.855  27.959 47.875 1.00 52.71  ? 162  GLU A OE1 1 
ATOM   1135 O OE2 . GLU A 1 162 ? 27.885  28.148 48.838 1.00 54.67  ? 162  GLU A OE2 1 
ATOM   1136 N N   . HIS A 1 163 ? 29.489  32.583 44.916 1.00 51.62  ? 163  HIS A N   1 
ATOM   1137 C CA  . HIS A 1 163 ? 30.330  33.560 44.233 1.00 52.26  ? 163  HIS A CA  1 
ATOM   1138 C C   . HIS A 1 163 ? 30.863  34.612 45.207 1.00 55.80  ? 163  HIS A C   1 
ATOM   1139 O O   . HIS A 1 163 ? 32.071  34.721 45.407 1.00 56.12  ? 163  HIS A O   1 
ATOM   1140 C CB  . HIS A 1 163 ? 29.563  34.230 43.094 1.00 53.58  ? 163  HIS A CB  1 
ATOM   1141 C CG  . HIS A 1 163 ? 30.430  35.019 42.166 1.00 57.47  ? 163  HIS A CG  1 
ATOM   1142 N ND1 . HIS A 1 163 ? 31.277  34.426 41.252 1.00 59.51  ? 163  HIS A ND1 1 
ATOM   1143 C CD2 . HIS A 1 163 ? 30.577  36.354 42.000 1.00 59.66  ? 163  HIS A CD2 1 
ATOM   1144 C CE1 . HIS A 1 163 ? 31.908  35.362 40.569 1.00 59.19  ? 163  HIS A CE1 1 
ATOM   1145 N NE2 . HIS A 1 163 ? 31.502  36.543 41.004 1.00 59.52  ? 163  HIS A NE2 1 
ATOM   1146 N N   . PHE A 1 164 ? 29.958  35.377 45.811 1.00 50.88  ? 164  PHE A N   1 
ATOM   1147 C CA  . PHE A 1 164 ? 30.330  36.337 46.845 1.00 50.14  ? 164  PHE A CA  1 
ATOM   1148 C C   . PHE A 1 164 ? 31.259  35.694 47.866 1.00 54.24  ? 164  PHE A C   1 
ATOM   1149 O O   . PHE A 1 164 ? 32.202  36.321 48.345 1.00 54.00  ? 164  PHE A O   1 
ATOM   1150 C CB  . PHE A 1 164 ? 29.086  36.854 47.574 1.00 51.64  ? 164  PHE A CB  1 
ATOM   1151 C CG  . PHE A 1 164 ? 28.049  37.445 46.668 1.00 52.76  ? 164  PHE A CG  1 
ATOM   1152 C CD1 . PHE A 1 164 ? 26.745  37.592 47.101 1.00 55.24  ? 164  PHE A CD1 1 
ATOM   1153 C CD2 . PHE A 1 164 ? 28.378  37.855 45.387 1.00 54.98  ? 164  PHE A CD2 1 
ATOM   1154 C CE1 . PHE A 1 164 ? 25.784  38.135 46.272 1.00 56.35  ? 164  PHE A CE1 1 
ATOM   1155 C CE2 . PHE A 1 164 ? 27.424  38.410 44.553 1.00 57.76  ? 164  PHE A CE2 1 
ATOM   1156 C CZ  . PHE A 1 164 ? 26.123  38.549 44.995 1.00 55.66  ? 164  PHE A CZ  1 
ATOM   1157 N N   . LEU A 1 165 ? 30.956  34.459 48.244 1.00 50.90  ? 165  LEU A N   1 
ATOM   1158 C CA  . LEU A 1 165 ? 31.767  33.777 49.244 1.00 50.52  ? 165  LEU A CA  1 
ATOM   1159 C C   . LEU A 1 165 ? 33.199  33.574 48.778 1.00 55.19  ? 165  LEU A C   1 
ATOM   1160 O O   . LEU A 1 165 ? 34.136  33.717 49.563 1.00 54.87  ? 165  LEU A O   1 
ATOM   1161 C CB  . LEU A 1 165 ? 31.132  32.458 49.685 1.00 50.06  ? 165  LEU A CB  1 
ATOM   1162 C CG  . LEU A 1 165 ? 30.530  32.506 51.088 1.00 53.76  ? 165  LEU A CG  1 
ATOM   1163 C CD1 . LEU A 1 165 ? 29.767  33.797 51.303 1.00 53.40  ? 165  LEU A CD1 1 
ATOM   1164 C CD2 . LEU A 1 165 ? 29.650  31.302 51.361 1.00 55.54  ? 165  LEU A CD2 1 
ATOM   1165 N N   . SER A 1 166 ? 33.369  33.302 47.488 1.00 51.84  ? 166  SER A N   1 
ATOM   1166 C CA  . SER A 1 166 ? 34.698  33.092 46.936 1.00 51.81  ? 166  SER A CA  1 
ATOM   1167 C C   . SER A 1 166 ? 35.528  34.375 46.960 1.00 57.51  ? 166  SER A C   1 
ATOM   1168 O O   . SER A 1 166 ? 36.739  34.334 47.172 1.00 57.64  ? 166  SER A O   1 
ATOM   1169 C CB  . SER A 1 166 ? 34.613  32.515 45.524 1.00 54.41  ? 166  SER A CB  1 
ATOM   1170 O OG  . SER A 1 166 ? 33.872  33.364 44.672 1.00 61.59  ? 166  SER A OG  1 
ATOM   1171 N N   . LYS A 1 167 ? 34.863  35.515 46.795 1.00 54.93  ? 167  LYS A N   1 
ATOM   1172 C CA  . LYS A 1 167 ? 35.532  36.813 46.792 1.00 55.05  ? 167  LYS A CA  1 
ATOM   1173 C C   . LYS A 1 167 ? 35.935  37.268 48.195 1.00 61.50  ? 167  LYS A C   1 
ATOM   1174 O O   . LYS A 1 167 ? 36.675  38.242 48.350 1.00 61.33  ? 167  LYS A O   1 
ATOM   1175 C CB  . LYS A 1 167 ? 34.637  37.879 46.153 1.00 56.68  ? 167  LYS A CB  1 
ATOM   1176 C CG  . LYS A 1 167 ? 34.412  37.706 44.661 1.00 63.73  ? 167  LYS A CG  1 
ATOM   1177 C CD  . LYS A 1 167 ? 33.965  39.013 44.018 1.00 68.89  ? 167  LYS A CD  1 
ATOM   1178 C CE  . LYS A 1 167 ? 33.864  38.895 42.503 1.00 73.84  ? 167  LYS A CE  1 
ATOM   1179 N NZ  . LYS A 1 167 ? 33.792  40.236 41.850 1.00 78.48  ? 167  LYS A NZ  1 
ATOM   1180 N N   . MET A 1 168 ? 35.448  36.565 49.213 1.00 59.52  ? 168  MET A N   1 
ATOM   1181 C CA  . MET A 1 168 ? 35.607  37.023 50.588 1.00 59.95  ? 168  MET A CA  1 
ATOM   1182 C C   . MET A 1 168 ? 36.758  36.366 51.341 1.00 65.40  ? 168  MET A C   1 
ATOM   1183 O O   . MET A 1 168 ? 37.000  35.165 51.217 1.00 64.79  ? 168  MET A O   1 
ATOM   1184 C CB  . MET A 1 168 ? 34.300  36.872 51.360 1.00 62.28  ? 168  MET A CB  1 
ATOM   1185 C CG  . MET A 1 168 ? 33.191  37.783 50.862 1.00 65.93  ? 168  MET A CG  1 
ATOM   1186 S SD  . MET A 1 168 ? 31.579  37.303 51.506 1.00 70.15  ? 168  MET A SD  1 
ATOM   1187 C CE  . MET A 1 168 ? 30.552  38.618 50.844 1.00 67.00  ? 168  MET A CE  1 
ATOM   1188 N N   . PRO A 1 169 ? 37.489  37.162 52.134 1.00 63.19  ? 169  PRO A N   1 
ATOM   1189 C CA  . PRO A 1 169 ? 38.614  36.651 52.915 1.00 63.32  ? 169  PRO A CA  1 
ATOM   1190 C C   . PRO A 1 169 ? 38.097  36.116 54.236 1.00 67.21  ? 169  PRO A C   1 
ATOM   1191 O O   . PRO A 1 169 ? 38.030  36.849 55.222 1.00 67.14  ? 169  PRO A O   1 
ATOM   1192 C CB  . PRO A 1 169 ? 39.421  37.914 53.180 1.00 65.23  ? 169  PRO A CB  1 
ATOM   1193 C CG  . PRO A 1 169 ? 38.348  38.966 53.369 1.00 69.57  ? 169  PRO A CG  1 
ATOM   1194 C CD  . PRO A 1 169 ? 37.175  38.556 52.494 1.00 64.89  ? 169  PRO A CD  1 
ATOM   1195 N N   . GLU A 1 170 ? 37.669  34.860 54.237 1.00 63.28  ? 170  GLU A N   1 
ATOM   1196 C CA  . GLU A 1 170 ? 37.163  34.249 55.451 1.00 62.94  ? 170  GLU A CA  1 
ATOM   1197 C C   . GLU A 1 170 ? 37.555  32.781 55.466 1.00 67.30  ? 170  GLU A C   1 
ATOM   1198 O O   . GLU A 1 170 ? 37.591  32.133 54.421 1.00 66.96  ? 170  GLU A O   1 
ATOM   1199 C CB  . GLU A 1 170 ? 35.644  34.396 55.521 1.00 64.22  ? 170  GLU A CB  1 
ATOM   1200 C CG  . GLU A 1 170 ? 35.148  35.037 56.808 1.00 74.61  ? 170  GLU A CG  1 
ATOM   1201 C CD  . GLU A 1 170 ? 35.244  36.551 56.773 1.00 93.73  ? 170  GLU A CD  1 
ATOM   1202 O OE1 . GLU A 1 170 ? 35.359  37.115 55.664 1.00 89.29  ? 170  GLU A OE1 1 
ATOM   1203 O OE2 . GLU A 1 170 ? 35.175  37.181 57.848 1.00 87.79  ? 170  GLU A OE2 1 
ATOM   1204 N N   . ALA A 1 171 ? 37.893  32.269 56.646 1.00 64.12  ? 171  ALA A N   1 
ATOM   1205 C CA  . ALA A 1 171 ? 38.289  30.872 56.779 1.00 64.04  ? 171  ALA A CA  1 
ATOM   1206 C C   . ALA A 1 171 ? 37.123  29.953 56.433 1.00 67.99  ? 171  ALA A C   1 
ATOM   1207 O O   . ALA A 1 171 ? 35.974  30.246 56.771 1.00 68.02  ? 171  ALA A O   1 
ATOM   1208 C CB  . ALA A 1 171 ? 38.780  30.594 58.185 1.00 64.82  ? 171  ALA A CB  1 
ATOM   1209 N N   . GLU A 1 172 ? 37.420  28.847 55.757 1.00 63.69  ? 172  GLU A N   1 
ATOM   1210 C CA  . GLU A 1 172 ? 36.391  27.880 55.404 1.00 63.04  ? 172  GLU A CA  1 
ATOM   1211 C C   . GLU A 1 172 ? 35.434  27.546 56.542 1.00 65.85  ? 172  GLU A C   1 
ATOM   1212 O O   . GLU A 1 172 ? 34.248  27.319 56.307 1.00 66.26  ? 172  GLU A O   1 
ATOM   1213 C CB  . GLU A 1 172 ? 36.994  26.611 54.809 1.00 64.50  ? 172  GLU A CB  1 
ATOM   1214 C CG  . GLU A 1 172 ? 36.956  26.575 53.290 1.00 76.18  ? 172  GLU A CG  1 
ATOM   1215 C CD  . GLU A 1 172 ? 35.544  26.716 52.742 1.00 95.19  ? 172  GLU A CD  1 
ATOM   1216 O OE1 . GLU A 1 172 ? 34.597  26.219 53.394 1.00 83.29  ? 172  GLU A OE1 1 
ATOM   1217 O OE2 . GLU A 1 172 ? 35.383  27.314 51.653 1.00 88.03  ? 172  GLU A OE2 1 
ATOM   1218 N N   . GLU A 1 173 ? 35.920  27.564 57.776 1.00 60.70  ? 173  GLU A N   1 
ATOM   1219 C CA  . GLU A 1 173 ? 35.027  27.328 58.903 1.00 60.24  ? 173  GLU A CA  1 
ATOM   1220 C C   . GLU A 1 173 ? 33.970  28.421 58.934 1.00 62.11  ? 173  GLU A C   1 
ATOM   1221 O O   . GLU A 1 173 ? 32.780  28.151 59.104 1.00 61.34  ? 173  GLU A O   1 
ATOM   1222 C CB  . GLU A 1 173 ? 35.793  27.305 60.226 1.00 61.94  ? 173  GLU A CB  1 
ATOM   1223 C CG  . GLU A 1 173 ? 37.138  26.600 60.157 1.00 76.28  ? 173  GLU A CG  1 
ATOM   1224 C CD  . GLU A 1 173 ? 38.256  27.528 59.716 1.00 104.30 ? 173  GLU A CD  1 
ATOM   1225 O OE1 . GLU A 1 173 ? 38.347  28.650 60.266 1.00 99.21  ? 173  GLU A OE1 1 
ATOM   1226 O OE2 . GLU A 1 173 ? 39.057  27.127 58.843 1.00 101.60 ? 173  GLU A OE2 1 
ATOM   1227 N N   . ASN A 1 174 ? 34.417  29.655 58.728 1.00 57.34  ? 174  ASN A N   1 
ATOM   1228 C CA  . ASN A 1 174 ? 33.530  30.812 58.748 1.00 56.21  ? 174  ASN A CA  1 
ATOM   1229 C C   . ASN A 1 174 ? 32.555  30.813 57.576 1.00 57.14  ? 174  ASN A C   1 
ATOM   1230 O O   . ASN A 1 174 ? 31.360  31.058 57.754 1.00 55.95  ? 174  ASN A O   1 
ATOM   1231 C CB  . ASN A 1 174 ? 34.339  32.111 58.771 1.00 56.59  ? 174  ASN A CB  1 
ATOM   1232 C CG  . ASN A 1 174 ? 34.973  32.378 60.122 1.00 74.23  ? 174  ASN A CG  1 
ATOM   1233 O OD1 . ASN A 1 174 ? 34.903  31.546 61.026 1.00 65.75  ? 174  ASN A OD1 1 
ATOM   1234 N ND2 . ASN A 1 174 ? 35.575  33.552 60.273 1.00 66.02  ? 174  ASN A ND2 1 
ATOM   1235 N N   . LYS A 1 175 ? 33.067  30.544 56.379 1.00 51.84  ? 175  LYS A N   1 
ATOM   1236 C CA  . LYS A 1 175 ? 32.223  30.523 55.196 1.00 51.11  ? 175  LYS A CA  1 
ATOM   1237 C C   . LYS A 1 175 ? 31.097  29.504 55.336 1.00 56.92  ? 175  LYS A C   1 
ATOM   1238 O O   . LYS A 1 175 ? 30.003  29.700 54.805 1.00 57.74  ? 175  LYS A O   1 
ATOM   1239 C CB  . LYS A 1 175 ? 33.042  30.241 53.943 1.00 52.25  ? 175  LYS A CB  1 
ATOM   1240 C CG  . LYS A 1 175 ? 34.062  31.314 53.624 1.00 57.55  ? 175  LYS A CG  1 
ATOM   1241 C CD  . LYS A 1 175 ? 34.711  31.059 52.275 1.00 60.76  ? 175  LYS A CD  1 
ATOM   1242 C CE  . LYS A 1 175 ? 35.699  32.148 51.915 1.00 61.20  ? 175  LYS A CE  1 
ATOM   1243 N NZ  . LYS A 1 175 ? 36.376  31.862 50.620 1.00 64.25  ? 175  LYS A NZ  1 
ATOM   1244 N N   . GLN A 1 176 ? 31.358  28.425 56.067 1.00 53.05  ? 176  GLN A N   1 
ATOM   1245 C CA  . GLN A 1 176 ? 30.337  27.413 56.306 1.00 52.63  ? 176  GLN A CA  1 
ATOM   1246 C C   . GLN A 1 176 ? 29.162  27.968 57.104 1.00 55.66  ? 176  GLN A C   1 
ATOM   1247 O O   . GLN A 1 176 ? 28.008  27.697 56.791 1.00 55.26  ? 176  GLN A O   1 
ATOM   1248 C CB  . GLN A 1 176 ? 30.937  26.202 57.015 1.00 54.26  ? 176  GLN A CB  1 
ATOM   1249 C CG  . GLN A 1 176 ? 31.784  25.312 56.119 1.00 74.85  ? 176  GLN A CG  1 
ATOM   1250 C CD  . GLN A 1 176 ? 30.959  24.582 55.071 1.00 96.63  ? 176  GLN A CD  1 
ATOM   1251 O OE1 . GLN A 1 176 ? 31.503  23.896 54.199 1.00 92.10  ? 176  GLN A OE1 1 
ATOM   1252 N NE2 . GLN A 1 176 ? 29.638  24.721 55.155 1.00 88.99  ? 176  GLN A NE2 1 
ATOM   1253 N N   . ILE A 1 177 ? 29.460  28.755 58.130 1.00 52.12  ? 177  ILE A N   1 
ATOM   1254 C CA  . ILE A 1 177 ? 28.419  29.337 58.972 1.00 52.02  ? 177  ILE A CA  1 
ATOM   1255 C C   . ILE A 1 177 ? 27.640  30.427 58.241 1.00 56.74  ? 177  ILE A C   1 
ATOM   1256 O O   . ILE A 1 177 ? 26.442  30.605 58.472 1.00 56.83  ? 177  ILE A O   1 
ATOM   1257 C CB  . ILE A 1 177 ? 29.000  29.879 60.287 1.00 54.85  ? 177  ILE A CB  1 
ATOM   1258 C CG1 . ILE A 1 177 ? 29.838  28.809 60.983 1.00 55.15  ? 177  ILE A CG1 1 
ATOM   1259 C CG2 . ILE A 1 177 ? 27.890  30.393 61.188 1.00 55.33  ? 177  ILE A CG2 1 
ATOM   1260 C CD1 . ILE A 1 177 ? 30.361  29.229 62.335 1.00 63.42  ? 177  ILE A CD1 1 
ATOM   1261 N N   . ILE A 1 178 ? 28.349  31.214 57.437 1.00 52.77  ? 178  ILE A N   1 
ATOM   1262 C CA  . ILE A 1 178 ? 27.719  32.253 56.635 1.00 52.38  ? 178  ILE A CA  1 
ATOM   1263 C C   . ILE A 1 178 ? 26.795  31.564 55.645 1.00 55.40  ? 178  ILE A C   1 
ATOM   1264 O O   . ILE A 1 178 ? 25.646  31.964 55.460 1.00 55.20  ? 178  ILE A O   1 
ATOM   1265 C CB  . ILE A 1 178 ? 28.775  33.108 55.886 1.00 55.53  ? 178  ILE A CB  1 
ATOM   1266 C CG1 . ILE A 1 178 ? 29.588  33.959 56.864 1.00 55.74  ? 178  ILE A CG1 1 
ATOM   1267 C CG2 . ILE A 1 178 ? 28.112  33.990 54.840 1.00 56.13  ? 178  ILE A CG2 1 
ATOM   1268 C CD1 . ILE A 1 178 ? 30.818  34.582 56.244 1.00 57.79  ? 178  ILE A CD1 1 
ATOM   1269 N N   . ARG A 1 179 ? 27.306  30.504 55.031 1.00 51.04  ? 179  ARG A N   1 
ATOM   1270 C CA  . ARG A 1 179 ? 26.577  29.796 53.989 1.00 50.53  ? 179  ARG A CA  1 
ATOM   1271 C C   . ARG A 1 179 ? 25.282  29.233 54.561 1.00 53.99  ? 179  ARG A C   1 
ATOM   1272 O O   . ARG A 1 179 ? 24.231  29.301 53.928 1.00 53.98  ? 179  ARG A O   1 
ATOM   1273 C CB  . ARG A 1 179 ? 27.437  28.666 53.424 1.00 50.19  ? 179  ARG A CB  1 
ATOM   1274 C CG  . ARG A 1 179 ? 27.209  28.383 51.951 1.00 59.10  ? 179  ARG A CG  1 
ATOM   1275 C CD  . ARG A 1 179 ? 27.908  27.108 51.538 1.00 65.31  ? 179  ARG A CD  1 
ATOM   1276 N NE  . ARG A 1 179 ? 29.204  26.964 52.195 1.00 71.10  ? 179  ARG A NE  1 
ATOM   1277 C CZ  . ARG A 1 179 ? 30.361  27.337 51.659 1.00 81.50  ? 179  ARG A CZ  1 
ATOM   1278 N NH1 . ARG A 1 179 ? 30.389  27.880 50.450 1.00 65.76  ? 179  ARG A NH1 1 
ATOM   1279 N NH2 . ARG A 1 179 ? 31.491  27.163 52.332 1.00 67.37  ? 179  ARG A NH2 1 
ATOM   1280 N N   . LYS A 1 180 ? 25.368  28.715 55.781 1.00 49.80  ? 180  LYS A N   1 
ATOM   1281 C CA  . LYS A 1 180 ? 24.223  28.153 56.482 1.00 49.63  ? 180  LYS A CA  1 
ATOM   1282 C C   . LYS A 1 180 ? 23.135  29.202 56.688 1.00 53.97  ? 180  LYS A C   1 
ATOM   1283 O O   . LYS A 1 180 ? 21.984  29.008 56.296 1.00 53.49  ? 180  LYS A O   1 
ATOM   1284 C CB  . LYS A 1 180 ? 24.677  27.614 57.842 1.00 52.49  ? 180  LYS A CB  1 
ATOM   1285 C CG  . LYS A 1 180 ? 23.831  26.477 58.396 1.00 70.92  ? 180  LYS A CG  1 
ATOM   1286 C CD  . LYS A 1 180 ? 24.361  26.009 59.748 1.00 81.27  ? 180  LYS A CD  1 
ATOM   1287 C CE  . LYS A 1 180 ? 23.789  24.649 60.142 1.00 90.59  ? 180  LYS A CE  1 
ATOM   1288 N NZ  . LYS A 1 180 ? 24.262  23.551 59.248 1.00 94.51  ? 180  LYS A NZ  1 
ATOM   1289 N N   . HIS A 1 181 ? 23.511  30.310 57.320 1.00 51.20  ? 181  HIS A N   1 
ATOM   1290 C CA  . HIS A 1 181 ? 22.575  31.374 57.668 1.00 50.93  ? 181  HIS A CA  1 
ATOM   1291 C C   . HIS A 1 181 ? 21.971  32.069 56.455 1.00 52.37  ? 181  HIS A C   1 
ATOM   1292 O O   . HIS A 1 181 ? 20.776  32.363 56.431 1.00 51.50  ? 181  HIS A O   1 
ATOM   1293 C CB  . HIS A 1 181 ? 23.263  32.399 58.561 1.00 52.17  ? 181  HIS A CB  1 
ATOM   1294 C CG  . HIS A 1 181 ? 23.685  31.851 59.883 1.00 56.07  ? 181  HIS A CG  1 
ATOM   1295 N ND1 . HIS A 1 181 ? 24.443  30.705 60.004 1.00 58.24  ? 181  HIS A ND1 1 
ATOM   1296 C CD2 . HIS A 1 181 ? 23.435  32.270 61.145 1.00 58.23  ? 181  HIS A CD2 1 
ATOM   1297 C CE1 . HIS A 1 181 ? 24.644  30.447 61.282 1.00 58.00  ? 181  HIS A CE1 1 
ATOM   1298 N NE2 . HIS A 1 181 ? 24.045  31.383 61.998 1.00 58.13  ? 181  HIS A NE2 1 
ATOM   1299 N N   . ALA A 1 182 ? 22.808  32.380 55.472 1.00 47.53  ? 182  ALA A N   1 
ATOM   1300 C CA  . ALA A 1 182 ? 22.322  33.003 54.250 1.00 46.75  ? 182  ALA A CA  1 
ATOM   1301 C C   . ALA A 1 182 ? 21.159  32.198 53.668 1.00 50.02  ? 182  ALA A C   1 
ATOM   1302 O O   . ALA A 1 182 ? 20.113  32.755 53.332 1.00 49.89  ? 182  ALA A O   1 
ATOM   1303 C CB  . ALA A 1 182 ? 23.450  33.138 53.232 1.00 47.17  ? 182  ALA A CB  1 
ATOM   1304 N N   . GLN A 1 183 ? 21.321  30.879 53.628 1.00 45.32  ? 183  GLN A N   1 
ATOM   1305 C CA  . GLN A 1 183 ? 20.352  30.003 52.982 1.00 44.65  ? 183  GLN A CA  1 
ATOM   1306 C C   . GLN A 1 183 ? 19.060  29.874 53.778 1.00 45.80  ? 183  GLN A C   1 
ATOM   1307 O O   . GLN A 1 183 ? 18.006  29.564 53.224 1.00 45.14  ? 183  GLN A O   1 
ATOM   1308 C CB  . GLN A 1 183 ? 20.973  28.632 52.705 1.00 46.44  ? 183  GLN A CB  1 
ATOM   1309 C CG  . GLN A 1 183 ? 22.094  28.681 51.668 1.00 66.41  ? 183  GLN A CG  1 
ATOM   1310 C CD  . GLN A 1 183 ? 22.901  27.399 51.596 1.00 90.42  ? 183  GLN A CD  1 
ATOM   1311 O OE1 . GLN A 1 183 ? 23.991  27.375 51.022 1.00 88.21  ? 183  GLN A OE1 1 
ATOM   1312 N NE2 . GLN A 1 183 ? 22.372  26.327 52.179 1.00 82.49  ? 183  GLN A NE2 1 
ATOM   1313 N N   . THR A 1 184 ? 19.152  30.107 55.080 1.00 40.78  ? 184  THR A N   1 
ATOM   1314 C CA  . THR A 1 184 ? 17.973  30.313 55.907 1.00 40.13  ? 184  THR A CA  1 
ATOM   1315 C C   . THR A 1 184 ? 17.203  31.535 55.420 1.00 44.18  ? 184  THR A C   1 
ATOM   1316 O O   . THR A 1 184 ? 16.046  31.430 55.021 1.00 43.89  ? 184  THR A O   1 
ATOM   1317 C CB  . THR A 1 184 ? 18.368  30.473 57.368 1.00 49.32  ? 184  THR A CB  1 
ATOM   1318 O OG1 . THR A 1 184 ? 19.058  29.294 57.802 1.00 53.28  ? 184  THR A OG1 1 
ATOM   1319 C CG2 . THR A 1 184 ? 17.143  30.699 58.223 1.00 47.32  ? 184  THR A CG2 1 
ATOM   1320 N N   . PHE A 1 185 ? 17.868  32.687 55.423 1.00 40.55  ? 185  PHE A N   1 
ATOM   1321 C CA  . PHE A 1 185 ? 17.278  33.923 54.929 1.00 40.31  ? 185  PHE A CA  1 
ATOM   1322 C C   . PHE A 1 185 ? 16.657  33.764 53.546 1.00 42.95  ? 185  PHE A C   1 
ATOM   1323 O O   . PHE A 1 185 ? 15.579  34.290 53.278 1.00 42.96  ? 185  PHE A O   1 
ATOM   1324 C CB  . PHE A 1 185 ? 18.324  35.039 54.884 1.00 42.64  ? 185  PHE A CB  1 
ATOM   1325 C CG  . PHE A 1 185 ? 18.785  35.500 56.236 1.00 44.93  ? 185  PHE A CG  1 
ATOM   1326 C CD1 . PHE A 1 185 ? 20.108  35.359 56.614 1.00 48.75  ? 185  PHE A CD1 1 
ATOM   1327 C CD2 . PHE A 1 185 ? 17.907  36.114 57.112 1.00 48.06  ? 185  PHE A CD2 1 
ATOM   1328 C CE1 . PHE A 1 185 ? 20.544  35.799 57.848 1.00 50.05  ? 185  PHE A CE1 1 
ATOM   1329 C CE2 . PHE A 1 185 ? 18.338  36.559 58.352 1.00 51.29  ? 185  PHE A CE2 1 
ATOM   1330 C CZ  . PHE A 1 185 ? 19.657  36.392 58.721 1.00 49.42  ? 185  PHE A CZ  1 
ATOM   1331 N N   . VAL A 1 186 ? 17.384  33.127 52.638 1.00 38.47  ? 186  VAL A N   1 
ATOM   1332 C CA  . VAL A 1 186 ? 16.893  32.951 51.278 1.00 37.79  ? 186  VAL A CA  1 
ATOM   1333 C C   . VAL A 1 186 ? 15.551  32.235 51.280 1.00 42.88  ? 186  VAL A C   1 
ATOM   1334 O O   . VAL A 1 186 ? 14.652  32.572 50.509 1.00 42.38  ? 186  VAL A O   1 
ATOM   1335 C CB  . VAL A 1 186 ? 17.914  32.223 50.405 1.00 40.85  ? 186  VAL A CB  1 
ATOM   1336 C CG1 . VAL A 1 186 ? 17.348  31.986 49.026 1.00 40.44  ? 186  VAL A CG1 1 
ATOM   1337 C CG2 . VAL A 1 186 ? 19.201  33.023 50.324 1.00 40.50  ? 186  VAL A CG2 1 
ATOM   1338 N N   . ALA A 1 187 ? 15.414  31.257 52.168 1.00 40.08  ? 187  ALA A N   1 
ATOM   1339 C CA  . ALA A 1 187 ? 14.158  30.540 52.323 1.00 39.81  ? 187  ALA A CA  1 
ATOM   1340 C C   . ALA A 1 187 ? 13.074  31.475 52.854 1.00 44.46  ? 187  ALA A C   1 
ATOM   1341 O O   . ALA A 1 187 ? 11.974  31.528 52.315 1.00 45.50  ? 187  ALA A O   1 
ATOM   1342 C CB  . ALA A 1 187 ? 14.341  29.346 53.237 1.00 40.46  ? 187  ALA A CB  1 
ATOM   1343 N N   . LEU A 1 188 ? 13.393  32.233 53.894 1.00 40.65  ? 188  LEU A N   1 
ATOM   1344 C CA  . LEU A 1 188 ? 12.487  33.262 54.390 1.00 40.71  ? 188  LEU A CA  1 
ATOM   1345 C C   . LEU A 1 188 ? 11.993  34.151 53.266 1.00 45.30  ? 188  LEU A C   1 
ATOM   1346 O O   . LEU A 1 188 ? 10.820  34.508 53.227 1.00 45.82  ? 188  LEU A O   1 
ATOM   1347 C CB  . LEU A 1 188 ? 13.179  34.143 55.431 1.00 40.95  ? 188  LEU A CB  1 
ATOM   1348 C CG  . LEU A 1 188 ? 13.381  33.560 56.825 1.00 46.00  ? 188  LEU A CG  1 
ATOM   1349 C CD1 . LEU A 1 188 ? 13.922  34.633 57.752 1.00 46.58  ? 188  LEU A CD1 1 
ATOM   1350 C CD2 . LEU A 1 188 ? 12.072  32.999 57.342 1.00 47.65  ? 188  LEU A CD2 1 
ATOM   1351 N N   . CYS A 1 189 ? 12.911  34.588 52.410 1.00 41.57  ? 189  CYS A N   1 
ATOM   1352 C CA  . CYS A 1 189 ? 12.567  35.484 51.312 1.00 41.01  ? 189  CYS A CA  1 
ATOM   1353 C C   . CYS A 1 189 ? 11.645  34.799 50.327 1.00 42.69  ? 189  CYS A C   1 
ATOM   1354 O O   . CYS A 1 189 ? 10.724  35.421 49.803 1.00 42.81  ? 189  CYS A O   1 
ATOM   1355 C CB  . CYS A 1 189 ? 13.820  35.954 50.571 1.00 41.59  ? 189  CYS A CB  1 
ATOM   1356 S SG  . CYS A 1 189 ? 14.937  36.971 51.545 1.00 45.76  ? 189  CYS A SG  1 
ATOM   1357 N N   . ALA A 1 190 ? 11.914  33.525 50.058 1.00 36.69  ? 190  ALA A N   1 
ATOM   1358 C CA  . ALA A 1 190 ? 11.221  32.809 49.000 1.00 35.55  ? 190  ALA A CA  1 
ATOM   1359 C C   . ALA A 1 190 ? 9.737   32.635 49.303 1.00 38.89  ? 190  ALA A C   1 
ATOM   1360 O O   . ALA A 1 190 ? 8.906   32.568 48.391 1.00 38.62  ? 190  ALA A O   1 
ATOM   1361 C CB  . ALA A 1 190 ? 11.882  31.473 48.736 1.00 36.13  ? 190  ALA A CB  1 
ATOM   1362 N N   . THR A 1 191 ? 9.402   32.594 50.588 1.00 34.58  ? 191  THR A N   1 
ATOM   1363 C CA  . THR A 1 191 ? 8.007   32.514 50.997 1.00 33.91  ? 191  THR A CA  1 
ATOM   1364 C C   . THR A 1 191 ? 7.411   33.897 51.133 1.00 38.13  ? 191  THR A C   1 
ATOM   1365 O O   . THR A 1 191 ? 6.300   34.051 51.619 1.00 39.01  ? 191  THR A O   1 
ATOM   1366 C CB  . THR A 1 191 ? 7.838   31.733 52.295 1.00 40.33  ? 191  THR A CB  1 
ATOM   1367 O OG1 . THR A 1 191 ? 8.521   32.414 53.354 1.00 38.25  ? 191  THR A OG1 1 
ATOM   1368 C CG2 . THR A 1 191 ? 8.389   30.333 52.143 1.00 40.07  ? 191  THR A CG2 1 
ATOM   1369 N N   . ASP A 1 192 ? 8.143   34.904 50.681 1.00 34.40  ? 192  ASP A N   1 
ATOM   1370 C CA  . ASP A 1 192 ? 7.658   36.270 50.752 1.00 34.60  ? 192  ASP A CA  1 
ATOM   1371 C C   . ASP A 1 192 ? 7.566   36.888 49.363 1.00 39.69  ? 192  ASP A C   1 
ATOM   1372 O O   . ASP A 1 192 ? 8.194   36.405 48.418 1.00 39.44  ? 192  ASP A O   1 
ATOM   1373 C CB  . ASP A 1 192 ? 8.579   37.103 51.631 1.00 36.50  ? 192  ASP A CB  1 
ATOM   1374 C CG  . ASP A 1 192 ? 8.042   38.491 51.875 1.00 46.66  ? 192  ASP A CG  1 
ATOM   1375 O OD1 . ASP A 1 192 ? 8.623   39.443 51.309 1.00 47.86  ? 192  ASP A OD1 1 
ATOM   1376 O OD2 . ASP A 1 192 ? 7.023   38.623 52.594 1.00 49.24  ? 192  ASP A OD2 1 
ATOM   1377 N N   . VAL A 1 193 ? 6.794   37.963 49.240 1.00 37.05  ? 193  VAL A N   1 
ATOM   1378 C CA  . VAL A 1 193 ? 6.621   38.622 47.944 1.00 37.22  ? 193  VAL A CA  1 
ATOM   1379 C C   . VAL A 1 193 ? 7.902   39.283 47.473 1.00 40.32  ? 193  VAL A C   1 
ATOM   1380 O O   . VAL A 1 193 ? 8.074   39.515 46.278 1.00 39.92  ? 193  VAL A O   1 
ATOM   1381 C CB  . VAL A 1 193 ? 5.447   39.623 47.934 1.00 40.93  ? 193  VAL A CB  1 
ATOM   1382 C CG1 . VAL A 1 193 ? 4.107   38.884 48.014 1.00 40.64  ? 193  VAL A CG1 1 
ATOM   1383 C CG2 . VAL A 1 193 ? 5.600   40.625 49.063 1.00 40.50  ? 193  VAL A CG2 1 
ATOM   1384 N N   . LYS A 1 194 ? 8.775   39.615 48.422 1.00 36.17  ? 194  LYS A N   1 
ATOM   1385 C CA  . LYS A 1 194 ? 10.092  40.177 48.113 1.00 35.51  ? 194  LYS A CA  1 
ATOM   1386 C C   . LYS A 1 194 ? 10.762  39.401 46.985 1.00 38.84  ? 194  LYS A C   1 
ATOM   1387 O O   . LYS A 1 194 ? 11.261  39.978 46.026 1.00 39.84  ? 194  LYS A O   1 
ATOM   1388 C CB  . LYS A 1 194 ? 10.988  40.127 49.348 1.00 37.33  ? 194  LYS A CB  1 
ATOM   1389 C CG  . LYS A 1 194 ? 12.365  40.697 49.120 1.00 43.99  ? 194  LYS A CG  1 
ATOM   1390 C CD  . LYS A 1 194 ? 13.305  40.375 50.277 1.00 47.24  ? 194  LYS A CD  1 
ATOM   1391 C CE  . LYS A 1 194 ? 14.574  41.193 50.168 1.00 41.12  ? 194  LYS A CE  1 
ATOM   1392 N NZ  . LYS A 1 194 ? 14.996  41.312 48.744 1.00 41.59  ? 194  LYS A NZ  1 
ATOM   1393 N N   . PHE A 1 195 ? 10.731  38.080 47.099 1.00 32.90  ? 195  PHE A N   1 
ATOM   1394 C CA  . PHE A 1 195 ? 11.330  37.194 46.123 1.00 31.36  ? 195  PHE A CA  1 
ATOM   1395 C C   . PHE A 1 195 ? 10.854  37.497 44.698 1.00 34.50  ? 195  PHE A C   1 
ATOM   1396 O O   . PHE A 1 195 ? 11.504  37.122 43.727 1.00 35.07  ? 195  PHE A O   1 
ATOM   1397 C CB  . PHE A 1 195 ? 10.999  35.752 46.513 1.00 33.02  ? 195  PHE A CB  1 
ATOM   1398 C CG  . PHE A 1 195 ? 11.956  34.734 45.971 1.00 34.50  ? 195  PHE A CG  1 
ATOM   1399 C CD1 . PHE A 1 195 ? 13.193  34.535 46.568 1.00 37.92  ? 195  PHE A CD1 1 
ATOM   1400 C CD2 . PHE A 1 195 ? 11.602  33.942 44.898 1.00 36.51  ? 195  PHE A CD2 1 
ATOM   1401 C CE1 . PHE A 1 195 ? 14.075  33.590 46.080 1.00 38.69  ? 195  PHE A CE1 1 
ATOM   1402 C CE2 . PHE A 1 195 ? 12.476  32.987 44.410 1.00 39.93  ? 195  PHE A CE2 1 
ATOM   1403 C CZ  . PHE A 1 195 ? 13.717  32.814 45.000 1.00 38.01  ? 195  PHE A CZ  1 
ATOM   1404 N N   . ILE A 1 196 ? 9.714   38.163 44.566 1.00 30.35  ? 196  ILE A N   1 
ATOM   1405 C CA  . ILE A 1 196 ? 9.159   38.480 43.240 1.00 29.73  ? 196  ILE A CA  1 
ATOM   1406 C C   . ILE A 1 196 ? 9.782   39.761 42.719 1.00 34.28  ? 196  ILE A C   1 
ATOM   1407 O O   . ILE A 1 196 ? 9.941   39.949 41.514 1.00 33.10  ? 196  ILE A O   1 
ATOM   1408 C CB  . ILE A 1 196 ? 7.625   38.657 43.297 1.00 32.36  ? 196  ILE A CB  1 
ATOM   1409 C CG1 . ILE A 1 196 ? 6.952   37.463 43.973 1.00 32.06  ? 196  ILE A CG1 1 
ATOM   1410 C CG2 . ILE A 1 196 ? 7.066   38.901 41.918 1.00 33.16  ? 196  ILE A CG2 1 
ATOM   1411 C CD1 . ILE A 1 196 ? 5.473   37.645 44.190 1.00 33.48  ? 196  ILE A CD1 1 
ATOM   1412 N N   . SER A 1 197 ? 10.084  40.656 43.653 1.00 32.61  ? 197  SER A N   1 
ATOM   1413 C CA  . SER A 1 197 ? 10.605  41.980 43.347 1.00 33.02  ? 197  SER A CA  1 
ATOM   1414 C C   . SER A 1 197 ? 12.108  41.954 43.132 1.00 37.49  ? 197  SER A C   1 
ATOM   1415 O O   . SER A 1 197 ? 12.637  42.720 42.335 1.00 38.22  ? 197  SER A O   1 
ATOM   1416 C CB  . SER A 1 197 ? 10.280  42.940 44.492 1.00 36.86  ? 197  SER A CB  1 
ATOM   1417 O OG  . SER A 1 197 ? 8.935   42.789 44.905 1.00 47.21  ? 197  SER A OG  1 
ATOM   1418 N N   . ASN A 1 198 ? 12.793  41.079 43.858 1.00 33.50  ? 198  ASN A N   1 
ATOM   1419 C CA  . ASN A 1 198 ? 14.246  41.087 43.881 1.00 33.60  ? 198  ASN A CA  1 
ATOM   1420 C C   . ASN A 1 198 ? 14.845  39.836 43.258 1.00 38.82  ? 198  ASN A C   1 
ATOM   1421 O O   . ASN A 1 198 ? 14.455  38.702 43.573 1.00 38.59  ? 198  ASN A O   1 
ATOM   1422 C CB  . ASN A 1 198 ? 14.758  41.260 45.310 1.00 34.20  ? 198  ASN A CB  1 
ATOM   1423 C CG  . ASN A 1 198 ? 14.157  42.460 45.994 1.00 51.74  ? 198  ASN A CG  1 
ATOM   1424 O OD1 . ASN A 1 198 ? 14.778  43.516 46.078 1.00 52.85  ? 198  ASN A OD1 1 
ATOM   1425 N ND2 . ASN A 1 198 ? 12.928  42.316 46.460 1.00 39.96  ? 198  ASN A ND2 1 
ATOM   1426 N N   . PRO A 1 199 ? 15.829  40.030 42.378 1.00 35.60  ? 199  PRO A N   1 
ATOM   1427 C CA  . PRO A 1 199 ? 16.457  38.906 41.685 1.00 35.39  ? 199  PRO A CA  1 
ATOM   1428 C C   . PRO A 1 199 ? 17.404  38.198 42.627 1.00 40.36  ? 199  PRO A C   1 
ATOM   1429 O O   . PRO A 1 199 ? 17.851  38.779 43.619 1.00 40.93  ? 199  PRO A O   1 
ATOM   1430 C CB  . PRO A 1 199 ? 17.226  39.587 40.556 1.00 37.33  ? 199  PRO A CB  1 
ATOM   1431 C CG  . PRO A 1 199 ? 17.547  40.958 41.085 1.00 41.58  ? 199  PRO A CG  1 
ATOM   1432 C CD  . PRO A 1 199 ? 16.477  41.319 42.076 1.00 37.14  ? 199  PRO A CD  1 
ATOM   1433 N N   . PRO A 1 200 ? 17.714  36.925 42.341 1.00 36.60  ? 200  PRO A N   1 
ATOM   1434 C CA  . PRO A 1 200 ? 18.504  36.120 43.277 1.00 36.34  ? 200  PRO A CA  1 
ATOM   1435 C C   . PRO A 1 200 ? 19.804  36.797 43.702 1.00 39.98  ? 200  PRO A C   1 
ATOM   1436 O O   . PRO A 1 200 ? 20.316  36.539 44.792 1.00 40.17  ? 200  PRO A O   1 
ATOM   1437 C CB  . PRO A 1 200 ? 18.803  34.854 42.475 1.00 38.22  ? 200  PRO A CB  1 
ATOM   1438 C CG  . PRO A 1 200 ? 17.690  34.767 41.485 1.00 42.26  ? 200  PRO A CG  1 
ATOM   1439 C CD  . PRO A 1 200 ? 17.385  36.179 41.114 1.00 37.78  ? 200  PRO A CD  1 
ATOM   1440 N N   . SER A 1 201 ? 20.341  37.657 42.842 1.00 35.51  ? 201  SER A N   1 
ATOM   1441 C CA  . SER A 1 201 ? 21.569  38.367 43.166 1.00 35.29  ? 201  SER A CA  1 
ATOM   1442 C C   . SER A 1 201 ? 21.370  39.246 44.394 1.00 40.79  ? 201  SER A C   1 
ATOM   1443 O O   . SER A 1 201 ? 22.141  39.170 45.352 1.00 41.28  ? 201  SER A O   1 
ATOM   1444 C CB  . SER A 1 201 ? 22.080  39.180 41.968 1.00 38.90  ? 201  SER A CB  1 
ATOM   1445 O OG  . SER A 1 201 ? 21.081  40.031 41.423 1.00 48.39  ? 201  SER A OG  1 
ATOM   1446 N N   . MET A 1 202 ? 20.319  40.059 44.372 1.00 37.78  ? 202  MET A N   1 
ATOM   1447 C CA  . MET A 1 202 ? 19.930  40.838 45.538 1.00 38.22  ? 202  MET A CA  1 
ATOM   1448 C C   . MET A 1 202 ? 19.640  39.924 46.729 1.00 40.73  ? 202  MET A C   1 
ATOM   1449 O O   . MET A 1 202 ? 20.202  40.099 47.811 1.00 41.07  ? 202  MET A O   1 
ATOM   1450 C CB  . MET A 1 202 ? 18.696  41.686 45.227 1.00 41.46  ? 202  MET A CB  1 
ATOM   1451 C CG  . MET A 1 202 ? 18.990  43.013 44.551 1.00 46.34  ? 202  MET A CG  1 
ATOM   1452 S SD  . MET A 1 202 ? 19.655  44.241 45.703 1.00 51.66  ? 202  MET A SD  1 
ATOM   1453 C CE  . MET A 1 202 ? 18.554  44.018 47.101 1.00 48.36  ? 202  MET A CE  1 
ATOM   1454 N N   . VAL A 1 203 ? 18.749  38.958 46.533 1.00 35.21  ? 203  VAL A N   1 
ATOM   1455 C CA  . VAL A 1 203 ? 18.391  38.037 47.609 1.00 34.13  ? 203  VAL A CA  1 
ATOM   1456 C C   . VAL A 1 203 ? 19.634  37.399 48.244 1.00 37.19  ? 203  VAL A C   1 
ATOM   1457 O O   . VAL A 1 203 ? 19.738  37.308 49.468 1.00 36.06  ? 203  VAL A O   1 
ATOM   1458 C CB  . VAL A 1 203 ? 17.324  36.994 47.145 1.00 36.94  ? 203  VAL A CB  1 
ATOM   1459 C CG1 . VAL A 1 203 ? 16.928  36.060 48.283 1.00 36.61  ? 203  VAL A CG1 1 
ATOM   1460 C CG2 . VAL A 1 203 ? 16.092  37.705 46.584 1.00 36.03  ? 203  VAL A CG2 1 
ATOM   1461 N N   . ALA A 1 204 ? 20.597  37.007 47.414 1.00 34.33  ? 204  ALA A N   1 
ATOM   1462 C CA  . ALA A 1 204 ? 21.838  36.404 47.906 1.00 34.67  ? 204  ALA A CA  1 
ATOM   1463 C C   . ALA A 1 204 ? 22.673  37.395 48.726 1.00 39.18  ? 204  ALA A C   1 
ATOM   1464 O O   . ALA A 1 204 ? 23.121  37.089 49.837 1.00 38.54  ? 204  ALA A O   1 
ATOM   1465 C CB  . ALA A 1 204 ? 22.652  35.850 46.750 1.00 35.31  ? 204  ALA A CB  1 
ATOM   1466 N N   . ALA A 1 205 ? 22.840  38.594 48.180 1.00 35.98  ? 205  ALA A N   1 
ATOM   1467 C CA  . ALA A 1 205 ? 23.615  39.650 48.815 1.00 36.20  ? 205  ALA A CA  1 
ATOM   1468 C C   . ALA A 1 205 ? 22.976  40.154 50.114 1.00 40.42  ? 205  ALA A C   1 
ATOM   1469 O O   . ALA A 1 205 ? 23.652  40.296 51.136 1.00 40.36  ? 205  ALA A O   1 
ATOM   1470 C CB  . ALA A 1 205 ? 23.826  40.801 47.836 1.00 37.12  ? 205  ALA A CB  1 
ATOM   1471 N N   . GLY A 1 206 ? 21.686  40.464 50.074 1.00 36.61  ? 206  GLY A N   1 
ATOM   1472 C CA  . GLY A 1 206 ? 20.968  40.800 51.292 1.00 36.16  ? 206  GLY A CA  1 
ATOM   1473 C C   . GLY A 1 206 ? 21.115  39.735 52.373 1.00 39.06  ? 206  GLY A C   1 
ATOM   1474 O O   . GLY A 1 206 ? 21.259  40.040 53.554 1.00 38.36  ? 206  GLY A O   1 
ATOM   1475 N N   . SER A 1 207 ? 21.060  38.472 51.970 1.00 35.54  ? 207  SER A N   1 
ATOM   1476 C CA  . SER A 1 207 ? 21.185  37.368 52.915 1.00 35.06  ? 207  SER A CA  1 
ATOM   1477 C C   . SER A 1 207 ? 22.609  37.253 53.457 1.00 39.18  ? 207  SER A C   1 
ATOM   1478 O O   . SER A 1 207 ? 22.804  37.097 54.665 1.00 38.82  ? 207  SER A O   1 
ATOM   1479 C CB  . SER A 1 207 ? 20.739  36.049 52.273 1.00 37.31  ? 207  SER A CB  1 
ATOM   1480 O OG  . SER A 1 207 ? 19.426  36.156 51.741 1.00 40.84  ? 207  SER A OG  1 
ATOM   1481 N N   . VAL A 1 208 ? 23.603  37.329 52.573 1.00 35.68  ? 208  VAL A N   1 
ATOM   1482 C CA  . VAL A 1 208 ? 24.999  37.320 53.014 1.00 35.67  ? 208  VAL A CA  1 
ATOM   1483 C C   . VAL A 1 208 ? 25.282  38.504 53.930 1.00 40.46  ? 208  VAL A C   1 
ATOM   1484 O O   . VAL A 1 208 ? 25.853  38.352 55.011 1.00 39.55  ? 208  VAL A O   1 
ATOM   1485 C CB  . VAL A 1 208 ? 25.988  37.269 51.833 1.00 39.41  ? 208  VAL A CB  1 
ATOM   1486 C CG1 . VAL A 1 208 ? 27.392  37.607 52.302 1.00 39.04  ? 208  VAL A CG1 1 
ATOM   1487 C CG2 . VAL A 1 208 ? 25.969  35.896 51.185 1.00 39.17  ? 208  VAL A CG2 1 
ATOM   1488 N N   . VAL A 1 209 ? 24.825  39.679 53.517 1.00 38.50  ? 209  VAL A N   1 
ATOM   1489 C CA  . VAL A 1 209 ? 24.943  40.869 54.351 1.00 38.91  ? 209  VAL A CA  1 
ATOM   1490 C C   . VAL A 1 209 ? 24.282  40.751 55.730 1.00 44.42  ? 209  VAL A C   1 
ATOM   1491 O O   . VAL A 1 209 ? 24.871  41.141 56.730 1.00 44.68  ? 209  VAL A O   1 
ATOM   1492 C CB  . VAL A 1 209 ? 24.532  42.148 53.600 1.00 42.36  ? 209  VAL A CB  1 
ATOM   1493 C CG1 . VAL A 1 209 ? 24.395  43.298 54.568 1.00 41.96  ? 209  VAL A CG1 1 
ATOM   1494 C CG2 . VAL A 1 209 ? 25.559  42.484 52.526 1.00 42.13  ? 209  VAL A CG2 1 
ATOM   1495 N N   . ALA A 1 210 ? 23.064  40.222 55.792 1.00 41.74  ? 210  ALA A N   1 
ATOM   1496 C CA  . ALA A 1 210 ? 22.408  40.025 57.079 1.00 42.18  ? 210  ALA A CA  1 
ATOM   1497 C C   . ALA A 1 210 ? 23.121  38.947 57.892 1.00 49.07  ? 210  ALA A C   1 
ATOM   1498 O O   . ALA A 1 210 ? 23.311  39.093 59.101 1.00 48.63  ? 210  ALA A O   1 
ATOM   1499 C CB  . ALA A 1 210 ? 20.946  39.675 56.890 1.00 42.79  ? 210  ALA A CB  1 
ATOM   1500 N N   . ALA A 1 211 ? 23.542  37.879 57.216 1.00 47.69  ? 211  ALA A N   1 
ATOM   1501 C CA  . ALA A 1 211 ? 24.274  36.796 57.869 1.00 47.95  ? 211  ALA A CA  1 
ATOM   1502 C C   . ALA A 1 211 ? 25.608  37.271 58.455 1.00 53.41  ? 211  ALA A C   1 
ATOM   1503 O O   . ALA A 1 211 ? 25.803  37.235 59.665 1.00 53.33  ? 211  ALA A O   1 
ATOM   1504 C CB  . ALA A 1 211 ? 24.485  35.630 56.908 1.00 48.47  ? 211  ALA A CB  1 
ATOM   1505 N N   . VAL A 1 212 ? 26.507  37.753 57.603 1.00 51.07  ? 212  VAL A N   1 
ATOM   1506 C CA  . VAL A 1 212 ? 27.841  38.152 58.042 1.00 51.80  ? 212  VAL A CA  1 
ATOM   1507 C C   . VAL A 1 212 ? 27.822  39.235 59.110 1.00 58.93  ? 212  VAL A C   1 
ATOM   1508 O O   . VAL A 1 212 ? 28.638  39.231 60.030 1.00 58.78  ? 212  VAL A O   1 
ATOM   1509 C CB  . VAL A 1 212 ? 28.711  38.578 56.864 1.00 55.57  ? 212  VAL A CB  1 
ATOM   1510 C CG1 . VAL A 1 212 ? 29.977  39.249 57.363 1.00 55.25  ? 212  VAL A CG1 1 
ATOM   1511 C CG2 . VAL A 1 212 ? 29.031  37.379 55.988 1.00 55.40  ? 212  VAL A CG2 1 
ATOM   1512 N N   . GLN A 1 213 ? 26.908  40.182 58.959 1.00 58.01  ? 213  GLN A N   1 
ATOM   1513 C CA  . GLN A 1 213 ? 26.744  41.268 59.917 1.00 58.95  ? 213  GLN A CA  1 
ATOM   1514 C C   . GLN A 1 213 ? 26.326  40.751 61.297 1.00 64.18  ? 213  GLN A C   1 
ATOM   1515 O O   . GLN A 1 213 ? 26.905  41.133 62.316 1.00 64.13  ? 213  GLN A O   1 
ATOM   1516 C CB  . GLN A 1 213 ? 25.707  42.260 59.390 1.00 60.59  ? 213  GLN A CB  1 
ATOM   1517 C CG  . GLN A 1 213 ? 25.720  43.608 60.077 1.00 82.50  ? 213  GLN A CG  1 
ATOM   1518 C CD  . GLN A 1 213 ? 24.702  44.555 59.486 1.00 103.65 ? 213  GLN A CD  1 
ATOM   1519 O OE1 . GLN A 1 213 ? 24.968  45.226 58.487 1.00 99.79  ? 213  GLN A OE1 1 
ATOM   1520 N NE2 . GLN A 1 213 ? 23.512  44.590 60.079 1.00 96.67  ? 213  GLN A NE2 1 
ATOM   1521 N N   . GLY A 1 214 ? 25.313  39.892 61.326 1.00 61.15  ? 214  GLY A N   1 
ATOM   1522 C CA  . GLY A 1 214 ? 24.834  39.302 62.561 1.00 61.37  ? 214  GLY A CA  1 
ATOM   1523 C C   . GLY A 1 214 ? 25.847  38.371 63.195 1.00 66.71  ? 214  GLY A C   1 
ATOM   1524 O O   . GLY A 1 214 ? 25.755  38.049 64.377 1.00 66.55  ? 214  GLY A O   1 
ATOM   1525 N N   . LEU A 1 215 ? 26.811  37.923 62.403 1.00 64.65  ? 215  LEU A N   1 
ATOM   1526 C CA  . LEU A 1 215 ? 27.881  37.079 62.917 1.00 65.25  ? 215  LEU A CA  1 
ATOM   1527 C C   . LEU A 1 215 ? 29.006  37.937 63.485 1.00 72.22  ? 215  LEU A C   1 
ATOM   1528 O O   . LEU A 1 215 ? 29.665  37.555 64.454 1.00 71.58  ? 215  LEU A O   1 
ATOM   1529 C CB  . LEU A 1 215 ? 28.413  36.157 61.818 1.00 64.88  ? 215  LEU A CB  1 
ATOM   1530 C CG  . LEU A 1 215 ? 27.448  35.065 61.361 1.00 68.63  ? 215  LEU A CG  1 
ATOM   1531 C CD1 . LEU A 1 215 ? 27.921  34.441 60.056 1.00 68.54  ? 215  LEU A CD1 1 
ATOM   1532 C CD2 . LEU A 1 215 ? 27.295  34.013 62.447 1.00 69.62  ? 215  LEU A CD2 1 
ATOM   1533 N N   . ASN A 1 216 ? 29.210  39.106 62.885 1.00 71.16  ? 216  ASN A N   1 
ATOM   1534 C CA  . ASN A 1 216 ? 30.206  40.049 63.377 1.00 72.21  ? 216  ASN A CA  1 
ATOM   1535 C C   . ASN A 1 216 ? 29.836  40.556 64.767 1.00 78.90  ? 216  ASN A C   1 
ATOM   1536 O O   . ASN A 1 216 ? 30.711  40.832 65.585 1.00 78.73  ? 216  ASN A O   1 
ATOM   1537 C CB  . ASN A 1 216 ? 30.365  41.229 62.417 1.00 73.55  ? 216  ASN A CB  1 
ATOM   1538 C CG  . ASN A 1 216 ? 31.477  42.175 62.836 1.00 95.34  ? 216  ASN A CG  1 
ATOM   1539 O OD1 . ASN A 1 216 ? 31.228  43.332 63.171 1.00 93.10  ? 216  ASN A OD1 1 
ATOM   1540 N ND2 . ASN A 1 216 ? 32.712  41.682 62.826 1.00 84.28  ? 216  ASN A ND2 1 
ATOM   1541 N N   . LEU A 1 217 ? 28.538  40.684 65.028 1.00 77.20  ? 217  LEU A N   1 
ATOM   1542 C CA  . LEU A 1 217 ? 28.072  41.089 66.348 1.00 77.87  ? 217  LEU A CA  1 
ATOM   1543 C C   . LEU A 1 217 ? 28.428  40.065 67.421 1.00 83.00  ? 217  LEU A C   1 
ATOM   1544 O O   . LEU A 1 217 ? 29.179  40.366 68.349 1.00 82.48  ? 217  LEU A O   1 
ATOM   1545 C CB  . LEU A 1 217 ? 26.567  41.360 66.340 1.00 78.20  ? 217  LEU A CB  1 
ATOM   1546 C CG  . LEU A 1 217 ? 26.151  42.774 65.928 1.00 83.40  ? 217  LEU A CG  1 
ATOM   1547 C CD1 . LEU A 1 217 ? 26.765  43.154 64.585 1.00 83.78  ? 217  LEU A CD1 1 
ATOM   1548 C CD2 . LEU A 1 217 ? 24.634  42.910 65.895 1.00 86.06  ? 217  LEU A CD2 1 
ATOM   1549 N N   . ARG A 1 218 ? 27.902  38.851 67.277 1.00 80.73  ? 218  ARG A N   1 
ATOM   1550 C CA  . ARG A 1 218 ? 28.136  37.793 68.256 1.00 81.12  ? 218  ARG A CA  1 
ATOM   1551 C C   . ARG A 1 218 ? 29.619  37.534 68.457 1.00 86.08  ? 218  ARG A C   1 
ATOM   1552 O O   . ARG A 1 218 ? 30.055  37.210 69.558 1.00 85.85  ? 218  ARG A O   1 
ATOM   1553 C CB  . ARG A 1 218 ? 27.466  36.490 67.824 1.00 82.26  ? 218  ARG A CB  1 
ATOM   1554 C CG  . ARG A 1 218 ? 25.949  36.520 67.799 1.00 93.89  ? 218  ARG A CG  1 
ATOM   1555 C CD  . ARG A 1 218 ? 25.396  35.136 68.109 1.00 103.73 ? 218  ARG A CD  1 
ATOM   1556 N NE  . ARG A 1 218 ? 26.355  34.086 67.767 1.00 110.08 ? 218  ARG A NE  1 
ATOM   1557 C CZ  . ARG A 1 218 ? 26.505  33.575 66.549 1.00 120.57 ? 218  ARG A CZ  1 
ATOM   1558 N NH1 . ARG A 1 218 ? 25.756  34.015 65.546 1.00 109.38 ? 218  ARG A NH1 1 
ATOM   1559 N NH2 . ARG A 1 218 ? 27.407  32.625 66.333 1.00 102.97 ? 218  ARG A NH2 1 
ATOM   1560 N N   . SER A 1 219 ? 30.377  37.610 67.370 1.00 83.54  ? 219  SER A N   1 
ATOM   1561 C CA  . SER A 1 219 ? 31.811  37.340 67.404 1.00 83.63  ? 219  SER A CA  1 
ATOM   1562 C C   . SER A 1 219 ? 32.592  38.467 66.737 1.00 87.38  ? 219  SER A C   1 
ATOM   1563 O O   . SER A 1 219 ? 33.045  38.336 65.597 1.00 86.60  ? 219  SER A O   1 
ATOM   1564 C CB  . SER A 1 219 ? 32.117  36.010 66.712 1.00 87.54  ? 219  SER A CB  1 
ATOM   1565 O OG  . SER A 1 219 ? 33.509  35.858 66.493 1.00 96.39  ? 219  SER A OG  1 
ATOM   1566 N N   . PRO A 1 220 ? 32.741  39.600 67.439 1.00 84.16  ? 220  PRO A N   1 
ATOM   1567 C CA  . PRO A 1 220 ? 33.478  40.749 66.905 1.00 83.93  ? 220  PRO A CA  1 
ATOM   1568 C C   . PRO A 1 220 ? 34.892  40.349 66.522 1.00 88.02  ? 220  PRO A C   1 
ATOM   1569 O O   . PRO A 1 220 ? 35.434  39.375 67.051 1.00 87.54  ? 220  PRO A O   1 
ATOM   1570 C CB  . PRO A 1 220 ? 33.513  41.719 68.087 1.00 85.65  ? 220  PRO A CB  1 
ATOM   1571 C CG  . PRO A 1 220 ? 32.304  41.374 68.888 1.00 90.17  ? 220  PRO A CG  1 
ATOM   1572 C CD  . PRO A 1 220 ? 32.152  39.884 68.760 1.00 85.73  ? 220  PRO A CD  1 
ATOM   1573 N N   . ASN A 1 221 ? 35.475  41.081 65.578 1.00 84.83  ? 221  ASN A N   1 
ATOM   1574 C CA  . ASN A 1 221 ? 36.868  40.868 65.201 1.00 84.69  ? 221  ASN A CA  1 
ATOM   1575 C C   . ASN A 1 221 ? 37.068  39.462 64.626 1.00 87.69  ? 221  ASN A C   1 
ATOM   1576 O O   . ASN A 1 221 ? 38.118  38.846 64.815 1.00 86.89  ? 221  ASN A O   1 
ATOM   1577 C CB  . ASN A 1 221 ? 37.770  41.066 66.425 1.00 87.09  ? 221  ASN A CB  1 
ATOM   1578 C CG  . ASN A 1 221 ? 39.105  41.692 66.074 1.00 115.86 ? 221  ASN A CG  1 
ATOM   1579 O OD1 . ASN A 1 221 ? 39.483  41.765 64.903 1.00 113.81 ? 221  ASN A OD1 1 
ATOM   1580 N ND2 . ASN A 1 221 ? 39.817  42.171 67.090 1.00 107.69 ? 221  ASN A ND2 1 
ATOM   1581 N N   . ASN A 1 222 ? 36.050  38.959 63.929 1.00 83.72  ? 222  ASN A N   1 
ATOM   1582 C CA  . ASN A 1 222 ? 36.108  37.623 63.338 1.00 82.99  ? 222  ASN A CA  1 
ATOM   1583 C C   . ASN A 1 222 ? 35.533  37.589 61.919 1.00 84.96  ? 222  ASN A C   1 
ATOM   1584 O O   . ASN A 1 222 ? 36.205  37.171 60.973 1.00 84.45  ? 222  ASN A O   1 
ATOM   1585 C CB  . ASN A 1 222 ? 35.389  36.605 64.229 1.00 83.80  ? 222  ASN A CB  1 
ATOM   1586 C CG  . ASN A 1 222 ? 35.581  35.172 63.756 1.00 108.01 ? 222  ASN A CG  1 
ATOM   1587 O OD1 . ASN A 1 222 ? 35.997  34.929 62.621 1.00 104.68 ? 222  ASN A OD1 1 
ATOM   1588 N ND2 . ASN A 1 222 ? 35.278  34.215 64.627 1.00 99.29  ? 222  ASN A ND2 1 
ATOM   1589 N N   . PHE A 1 223 ? 34.273  37.985 61.781 1.00 79.61  ? 223  PHE A N   1 
ATOM   1590 C CA  . PHE A 1 223 ? 33.645  38.019 60.469 1.00 78.42  ? 223  PHE A CA  1 
ATOM   1591 C C   . PHE A 1 223 ? 33.790  39.412 59.900 1.00 80.71  ? 223  PHE A C   1 
ATOM   1592 O O   . PHE A 1 223 ? 32.825  39.993 59.396 1.00 80.19  ? 223  PHE A O   1 
ATOM   1593 C CB  . PHE A 1 223 ? 32.173  37.625 60.563 1.00 79.94  ? 223  PHE A CB  1 
ATOM   1594 C CG  . PHE A 1 223 ? 31.958  36.197 60.980 1.00 81.05  ? 223  PHE A CG  1 
ATOM   1595 C CD1 . PHE A 1 223 ? 31.863  35.858 62.321 1.00 83.41  ? 223  PHE A CD1 1 
ATOM   1596 C CD2 . PHE A 1 223 ? 31.901  35.185 60.032 1.00 82.81  ? 223  PHE A CD2 1 
ATOM   1597 C CE1 . PHE A 1 223 ? 31.693  34.546 62.704 1.00 84.11  ? 223  PHE A CE1 1 
ATOM   1598 C CE2 . PHE A 1 223 ? 31.726  33.868 60.413 1.00 85.20  ? 223  PHE A CE2 1 
ATOM   1599 C CZ  . PHE A 1 223 ? 31.627  33.548 61.750 1.00 83.00  ? 223  PHE A CZ  1 
ATOM   1600 N N   . LEU A 1 224 ? 35.004  39.947 60.010 1.00 76.03  ? 224  LEU A N   1 
ATOM   1601 C CA  . LEU A 1 224 ? 35.298  41.321 59.604 1.00 74.92  ? 224  LEU A CA  1 
ATOM   1602 C C   . LEU A 1 224 ? 35.278  41.519 58.088 1.00 75.75  ? 224  LEU A C   1 
ATOM   1603 O O   . LEU A 1 224 ? 35.875  42.458 57.564 1.00 74.81  ? 224  LEU A O   1 
ATOM   1604 C CB  . LEU A 1 224 ? 36.615  41.811 60.226 1.00 75.00  ? 224  LEU A CB  1 
ATOM   1605 C CG  . LEU A 1 224 ? 37.798  40.840 60.237 1.00 79.80  ? 224  LEU A CG  1 
ATOM   1606 C CD1 . LEU A 1 224 ? 38.408  40.703 58.842 1.00 79.98  ? 224  LEU A CD1 1 
ATOM   1607 C CD2 . LEU A 1 224 ? 38.839  41.282 61.254 1.00 82.07  ? 224  LEU A CD2 1 
ATOM   1608 N N   . SER A 1 225 ? 34.560  40.644 57.393 1.00 70.87  ? 225  SER A N   1 
ATOM   1609 C CA  . SER A 1 225 ? 34.224  40.878 55.996 1.00 69.89  ? 225  SER A CA  1 
ATOM   1610 C C   . SER A 1 225 ? 32.950  41.706 55.963 1.00 71.15  ? 225  SER A C   1 
ATOM   1611 O O   . SER A 1 225 ? 32.593  42.283 54.937 1.00 70.41  ? 225  SER A O   1 
ATOM   1612 C CB  . SER A 1 225 ? 33.998  39.561 55.259 1.00 73.77  ? 225  SER A CB  1 
ATOM   1613 O OG  . SER A 1 225 ? 33.641  39.801 53.907 1.00 83.52  ? 225  SER A OG  1 
ATOM   1614 N N   . TYR A 1 226 ? 32.302  41.800 57.118 1.00 66.14  ? 226  TYR A N   1 
ATOM   1615 C CA  . TYR A 1 226 ? 31.085  42.582 57.271 1.00 65.49  ? 226  TYR A CA  1 
ATOM   1616 C C   . TYR A 1 226 ? 31.342  44.029 56.897 1.00 66.99  ? 226  TYR A C   1 
ATOM   1617 O O   . TYR A 1 226 ? 30.435  44.731 56.453 1.00 66.88  ? 226  TYR A O   1 
ATOM   1618 C CB  . TYR A 1 226 ? 30.639  42.560 58.728 1.00 67.40  ? 226  TYR A CB  1 
ATOM   1619 C CG  . TYR A 1 226 ? 31.385  43.566 59.576 1.00 70.34  ? 226  TYR A CG  1 
ATOM   1620 C CD1 . TYR A 1 226 ? 32.575  43.225 60.212 1.00 72.63  ? 226  TYR A CD1 1 
ATOM   1621 C CD2 . TYR A 1 226 ? 30.923  44.871 59.707 1.00 71.38  ? 226  TYR A CD2 1 
ATOM   1622 C CE1 . TYR A 1 226 ? 33.269  44.149 60.980 1.00 73.60  ? 226  TYR A CE1 1 
ATOM   1623 C CE2 . TYR A 1 226 ? 31.611  45.801 60.467 1.00 72.46  ? 226  TYR A CE2 1 
ATOM   1624 C CZ  . TYR A 1 226 ? 32.781  45.435 61.104 1.00 80.34  ? 226  TYR A CZ  1 
ATOM   1625 O OH  . TYR A 1 226 ? 33.461  46.356 61.869 1.00 81.85  ? 226  TYR A OH  1 
ATOM   1626 N N   . TYR A 1 227 ? 32.550  44.500 57.192 1.00 61.23  ? 227  TYR A N   1 
ATOM   1627 C CA  . TYR A 1 227 ? 32.870  45.918 57.079 1.00 59.77  ? 227  TYR A CA  1 
ATOM   1628 C C   . TYR A 1 227 ? 32.546  46.526 55.718 1.00 60.86  ? 227  TYR A C   1 
ATOM   1629 O O   . TYR A 1 227 ? 33.209  46.241 54.728 1.00 60.15  ? 227  TYR A O   1 
ATOM   1630 C CB  . TYR A 1 227 ? 34.319  46.188 57.461 1.00 61.07  ? 227  TYR A CB  1 
ATOM   1631 C CG  . TYR A 1 227 ? 34.607  47.657 57.617 1.00 63.42  ? 227  TYR A CG  1 
ATOM   1632 C CD1 . TYR A 1 227 ? 35.408  48.325 56.707 1.00 65.61  ? 227  TYR A CD1 1 
ATOM   1633 C CD2 . TYR A 1 227 ? 34.005  48.393 58.624 1.00 64.46  ? 227  TYR A CD2 1 
ATOM   1634 C CE1 . TYR A 1 227 ? 35.648  49.676 56.829 1.00 67.25  ? 227  TYR A CE1 1 
ATOM   1635 C CE2 . TYR A 1 227 ? 34.237  49.745 58.754 1.00 65.69  ? 227  TYR A CE2 1 
ATOM   1636 C CZ  . TYR A 1 227 ? 35.068  50.382 57.860 1.00 75.06  ? 227  TYR A CZ  1 
ATOM   1637 O OH  . TYR A 1 227 ? 35.309  51.733 57.987 1.00 78.22  ? 227  TYR A OH  1 
ATOM   1638 N N   . ARG A 1 228 ? 31.598  47.458 55.713 1.00 56.05  ? 228  ARG A N   1 
ATOM   1639 C CA  . ARG A 1 228 ? 30.967  47.955 54.491 1.00 55.16  ? 228  ARG A CA  1 
ATOM   1640 C C   . ARG A 1 228 ? 30.747  46.902 53.413 1.00 56.00  ? 228  ARG A C   1 
ATOM   1641 O O   . ARG A 1 228 ? 31.074  47.109 52.241 1.00 55.78  ? 228  ARG A O   1 
ATOM   1642 C CB  . ARG A 1 228 ? 31.670  49.189 53.930 1.00 57.77  ? 228  ARG A CB  1 
ATOM   1643 C CG  . ARG A 1 228 ? 30.801  49.977 52.938 1.00 75.19  ? 228  ARG A CG  1 
ATOM   1644 C CD  . ARG A 1 228 ? 29.466  50.430 53.560 1.00 89.87  ? 228  ARG A CD  1 
ATOM   1645 N NE  . ARG A 1 228 ? 28.605  49.306 53.930 1.00 100.14 ? 228  ARG A NE  1 
ATOM   1646 C CZ  . ARG A 1 228 ? 27.458  49.419 54.595 1.00 114.76 ? 228  ARG A CZ  1 
ATOM   1647 N NH1 . ARG A 1 228 ? 26.753  48.334 54.891 1.00 102.21 ? 228  ARG A NH1 1 
ATOM   1648 N NH2 . ARG A 1 228 ? 27.015  50.615 54.965 1.00 102.29 ? 228  ARG A NH2 1 
ATOM   1649 N N   . LEU A 1 229 ? 30.094  45.814 53.804 1.00 49.84  ? 229  LEU A N   1 
ATOM   1650 C CA  . LEU A 1 229 ? 29.836  44.699 52.910 1.00 48.56  ? 229  LEU A CA  1 
ATOM   1651 C C   . LEU A 1 229 ? 28.744  45.033 51.902 1.00 52.18  ? 229  LEU A C   1 
ATOM   1652 O O   . LEU A 1 229 ? 28.715  44.483 50.799 1.00 51.90  ? 229  LEU A O   1 
ATOM   1653 C CB  . LEU A 1 229 ? 29.453  43.464 53.723 1.00 48.32  ? 229  LEU A CB  1 
ATOM   1654 C CG  . LEU A 1 229 ? 29.451  42.119 53.003 1.00 52.42  ? 229  LEU A CG  1 
ATOM   1655 C CD1 . LEU A 1 229 ? 30.768  41.924 52.259 1.00 52.46  ? 229  LEU A CD1 1 
ATOM   1656 C CD2 . LEU A 1 229 ? 29.226  41.009 54.008 1.00 53.62  ? 229  LEU A CD2 1 
ATOM   1657 N N   . THR A 1 230 ? 27.832  45.922 52.287 1.00 48.69  ? 230  THR A N   1 
ATOM   1658 C CA  . THR A 1 230 ? 26.799  46.389 51.365 1.00 48.23  ? 230  THR A CA  1 
ATOM   1659 C C   . THR A 1 230 ? 27.424  46.964 50.109 1.00 52.24  ? 230  THR A C   1 
ATOM   1660 O O   . THR A 1 230 ? 27.163  46.484 49.009 1.00 51.74  ? 230  THR A O   1 
ATOM   1661 C CB  . THR A 1 230 ? 25.851  47.405 52.017 1.00 52.83  ? 230  THR A CB  1 
ATOM   1662 O OG1 . THR A 1 230 ? 25.067  46.753 53.021 1.00 53.95  ? 230  THR A OG1 1 
ATOM   1663 C CG2 . THR A 1 230 ? 24.926  48.004 50.974 1.00 49.22  ? 230  THR A CG2 1 
ATOM   1664 N N   . ARG A 1 231 ? 28.261  47.983 50.283 1.00 49.35  ? 231  ARG A N   1 
ATOM   1665 C CA  . ARG A 1 231 ? 28.920  48.626 49.154 1.00 49.76  ? 231  ARG A CA  1 
ATOM   1666 C C   . ARG A 1 231 ? 29.722  47.608 48.352 1.00 52.39  ? 231  ARG A C   1 
ATOM   1667 O O   . ARG A 1 231 ? 29.653  47.572 47.120 1.00 51.60  ? 231  ARG A O   1 
ATOM   1668 C CB  . ARG A 1 231 ? 29.825  49.772 49.623 1.00 53.42  ? 231  ARG A CB  1 
ATOM   1669 C CG  . ARG A 1 231 ? 29.112  50.819 50.473 1.00 71.30  ? 231  ARG A CG  1 
ATOM   1670 C CD  . ARG A 1 231 ? 29.902  52.121 50.566 1.00 84.84  ? 231  ARG A CD  1 
ATOM   1671 N NE  . ARG A 1 231 ? 29.477  52.921 51.713 1.00 94.91  ? 231  ARG A NE  1 
ATOM   1672 C CZ  . ARG A 1 231 ? 30.275  53.290 52.709 1.00 111.51 ? 231  ARG A CZ  1 
ATOM   1673 N NH1 . ARG A 1 231 ? 31.565  52.976 52.684 1.00 99.28  ? 231  ARG A NH1 1 
ATOM   1674 N NH2 . ARG A 1 231 ? 29.790  54.002 53.718 1.00 102.36 ? 231  ARG A NH2 1 
ATOM   1675 N N   . PHE A 1 232 ? 30.462  46.763 49.060 1.00 48.18  ? 232  PHE A N   1 
ATOM   1676 C CA  . PHE A 1 232 ? 31.215  45.703 48.413 1.00 47.94  ? 232  PHE A CA  1 
ATOM   1677 C C   . PHE A 1 232 ? 30.332  44.888 47.476 1.00 52.05  ? 232  PHE A C   1 
ATOM   1678 O O   . PHE A 1 232 ? 30.564  44.848 46.268 1.00 52.06  ? 232  PHE A O   1 
ATOM   1679 C CB  . PHE A 1 232 ? 31.855  44.792 49.455 1.00 49.88  ? 232  PHE A CB  1 
ATOM   1680 C CG  . PHE A 1 232 ? 32.789  43.775 48.874 1.00 51.62  ? 232  PHE A CG  1 
ATOM   1681 C CD1 . PHE A 1 232 ? 34.046  44.145 48.436 1.00 54.83  ? 232  PHE A CD1 1 
ATOM   1682 C CD2 . PHE A 1 232 ? 32.407  42.452 48.757 1.00 54.26  ? 232  PHE A CD2 1 
ATOM   1683 C CE1 . PHE A 1 232 ? 34.910  43.211 47.902 1.00 56.20  ? 232  PHE A CE1 1 
ATOM   1684 C CE2 . PHE A 1 232 ? 33.266  41.510 48.224 1.00 57.29  ? 232  PHE A CE2 1 
ATOM   1685 C CZ  . PHE A 1 232 ? 34.522  41.889 47.801 1.00 55.51  ? 232  PHE A CZ  1 
ATOM   1686 N N   . LEU A 1 233 ? 29.297  44.264 48.026 1.00 48.72  ? 233  LEU A N   1 
ATOM   1687 C CA  . LEU A 1 233 ? 28.463  43.360 47.241 1.00 48.56  ? 233  LEU A CA  1 
ATOM   1688 C C   . LEU A 1 233 ? 27.645  44.070 46.165 1.00 54.15  ? 233  LEU A C   1 
ATOM   1689 O O   . LEU A 1 233 ? 27.428  43.522 45.081 1.00 53.34  ? 233  LEU A O   1 
ATOM   1690 C CB  . LEU A 1 233 ? 27.578  42.499 48.144 1.00 48.07  ? 233  LEU A CB  1 
ATOM   1691 C CG  . LEU A 1 233 ? 28.334  41.478 48.994 1.00 51.48  ? 233  LEU A CG  1 
ATOM   1692 C CD1 . LEU A 1 233 ? 27.404  40.790 49.960 1.00 51.37  ? 233  LEU A CD1 1 
ATOM   1693 C CD2 . LEU A 1 233 ? 29.022  40.466 48.106 1.00 52.55  ? 233  LEU A CD2 1 
ATOM   1694 N N   . SER A 1 234 ? 27.233  45.304 46.447 1.00 52.34  ? 234  SER A N   1 
ATOM   1695 C CA  . SER A 1 234 ? 26.540  46.118 45.447 1.00 52.94  ? 234  SER A CA  1 
ATOM   1696 C C   . SER A 1 234 ? 27.494  46.568 44.343 1.00 59.18  ? 234  SER A C   1 
ATOM   1697 O O   . SER A 1 234 ? 27.084  46.784 43.200 1.00 58.56  ? 234  SER A O   1 
ATOM   1698 C CB  . SER A 1 234 ? 25.850  47.317 46.097 1.00 55.86  ? 234  SER A CB  1 
ATOM   1699 O OG  . SER A 1 234 ? 26.583  47.781 47.212 1.00 63.57  ? 234  SER A OG  1 
ATOM   1700 N N   . ARG A 1 235 ? 28.775  46.672 44.687 1.00 57.24  ? 235  ARG A N   1 
ATOM   1701 C CA  . ARG A 1 235 ? 29.818  46.911 43.699 1.00 57.13  ? 235  ARG A CA  1 
ATOM   1702 C C   . ARG A 1 235 ? 29.888  45.715 42.753 1.00 60.70  ? 235  ARG A C   1 
ATOM   1703 O O   . ARG A 1 235 ? 30.022  45.877 41.543 1.00 60.66  ? 235  ARG A O   1 
ATOM   1704 C CB  . ARG A 1 235 ? 31.171  47.120 44.387 1.00 58.71  ? 235  ARG A CB  1 
ATOM   1705 C CG  . ARG A 1 235 ? 32.022  48.233 43.769 1.00 72.51  ? 235  ARG A CG  1 
ATOM   1706 C CD  . ARG A 1 235 ? 31.865  49.553 44.526 1.00 83.10  ? 235  ARG A CD  1 
ATOM   1707 N NE  . ARG A 1 235 ? 31.883  50.712 43.635 1.00 88.00  ? 235  ARG A NE  1 
ATOM   1708 C CZ  . ARG A 1 235 ? 30.846  51.526 43.447 1.00 98.22  ? 235  ARG A CZ  1 
ATOM   1709 N NH1 . ARG A 1 235 ? 29.716  51.327 44.113 1.00 87.67  ? 235  ARG A NH1 1 
ATOM   1710 N NH2 . ARG A 1 235 ? 30.943  52.552 42.610 1.00 79.45  ? 235  ARG A NH2 1 
ATOM   1711 N N   . VAL A 1 236 ? 29.768  44.510 43.302 1.00 57.11  ? 236  VAL A N   1 
ATOM   1712 C CA  . VAL A 1 236 ? 29.757  43.303 42.474 1.00 56.69  ? 236  VAL A CA  1 
ATOM   1713 C C   . VAL A 1 236 ? 28.494  43.204 41.621 1.00 61.71  ? 236  VAL A C   1 
ATOM   1714 O O   . VAL A 1 236 ? 28.568  43.184 40.397 1.00 61.11  ? 236  VAL A O   1 
ATOM   1715 C CB  . VAL A 1 236 ? 29.985  42.032 43.309 1.00 59.77  ? 236  VAL A CB  1 
ATOM   1716 C CG1 . VAL A 1 236 ? 29.654  40.798 42.502 1.00 59.48  ? 236  VAL A CG1 1 
ATOM   1717 C CG2 . VAL A 1 236 ? 31.414  41.977 43.805 1.00 59.37  ? 236  VAL A CG2 1 
ATOM   1718 N N   . ILE A 1 237 ? 27.336  43.194 42.274 1.00 59.52  ? 237  ILE A N   1 
ATOM   1719 C CA  . ILE A 1 237 ? 26.052  43.094 41.583 1.00 59.85  ? 237  ILE A CA  1 
ATOM   1720 C C   . ILE A 1 237 ? 25.824  44.249 40.603 1.00 65.10  ? 237  ILE A C   1 
ATOM   1721 O O   . ILE A 1 237 ? 24.958  44.169 39.725 1.00 63.90  ? 237  ILE A O   1 
ATOM   1722 C CB  . ILE A 1 237 ? 24.893  43.058 42.594 1.00 62.82  ? 237  ILE A CB  1 
ATOM   1723 C CG1 . ILE A 1 237 ? 24.926  41.789 43.429 1.00 62.72  ? 237  ILE A CG1 1 
ATOM   1724 C CG2 . ILE A 1 237 ? 23.562  43.154 41.886 1.00 64.31  ? 237  ILE A CG2 1 
ATOM   1725 C CD1 . ILE A 1 237 ? 23.780  41.732 44.404 1.00 68.38  ? 237  ILE A CD1 1 
ATOM   1726 N N   . LYS A 1 238 ? 26.581  45.331 40.780 1.00 63.36  ? 238  LYS A N   1 
ATOM   1727 C CA  . LYS A 1 238 ? 26.265  46.612 40.144 1.00 63.56  ? 238  LYS A CA  1 
ATOM   1728 C C   . LYS A 1 238 ? 24.820  47.004 40.469 1.00 67.30  ? 238  LYS A C   1 
ATOM   1729 O O   . LYS A 1 238 ? 23.936  46.935 39.610 1.00 67.70  ? 238  LYS A O   1 
ATOM   1730 C CB  . LYS A 1 238 ? 26.483  46.558 38.623 1.00 66.42  ? 238  LYS A CB  1 
ATOM   1731 C CG  . LYS A 1 238 ? 27.947  46.596 38.178 1.00 80.44  ? 238  LYS A CG  1 
ATOM   1732 C CD  . LYS A 1 238 ? 28.541  45.193 38.070 1.00 91.27  ? 238  LYS A CD  1 
ATOM   1733 C CE  . LYS A 1 238 ? 29.968  45.224 37.533 1.00 98.97  ? 238  LYS A CE  1 
ATOM   1734 N NZ  . LYS A 1 238 ? 30.566  43.860 37.454 1.00 103.33 ? 238  LYS A NZ  1 
ATOM   1735 N N   . CYS A 1 239 ? 24.584  47.382 41.723 1.00 62.57  ? 239  CYS A N   1 
ATOM   1736 C CA  . CYS A 1 239 ? 23.251  47.770 42.174 1.00 61.70  ? 239  CYS A CA  1 
ATOM   1737 C C   . CYS A 1 239 ? 23.303  48.949 43.150 1.00 66.05  ? 239  CYS A C   1 
ATOM   1738 O O   . CYS A 1 239 ? 24.322  49.188 43.802 1.00 65.07  ? 239  CYS A O   1 
ATOM   1739 C CB  . CYS A 1 239 ? 22.538  46.580 42.827 1.00 61.39  ? 239  CYS A CB  1 
ATOM   1740 S SG  . CYS A 1 239 ? 22.956  46.281 44.576 1.00 64.88  ? 239  CYS A SG  1 
ATOM   1741 N N   . ASP A 1 240 ? 22.207  49.696 43.227 1.00 63.43  ? 240  ASP A N   1 
ATOM   1742 C CA  . ASP A 1 240 ? 22.072  50.752 44.222 1.00 63.47  ? 240  ASP A CA  1 
ATOM   1743 C C   . ASP A 1 240 ? 22.204  50.126 45.609 1.00 67.75  ? 240  ASP A C   1 
ATOM   1744 O O   . ASP A 1 240 ? 21.416  49.256 45.981 1.00 67.32  ? 240  ASP A O   1 
ATOM   1745 C CB  . ASP A 1 240 ? 20.709  51.437 44.079 1.00 65.36  ? 240  ASP A CB  1 
ATOM   1746 C CG  . ASP A 1 240 ? 20.572  52.664 44.964 1.00 75.83  ? 240  ASP A CG  1 
ATOM   1747 O OD1 . ASP A 1 240 ? 21.577  53.378 45.159 1.00 77.02  ? 240  ASP A OD1 1 
ATOM   1748 O OD2 . ASP A 1 240 ? 19.451  52.928 45.446 1.00 81.44  ? 240  ASP A OD2 1 
ATOM   1749 N N   . PRO A 1 241 ? 23.213  50.554 46.387 1.00 64.55  ? 241  PRO A N   1 
ATOM   1750 C CA  . PRO A 1 241 ? 23.486  49.973 47.708 1.00 64.19  ? 241  PRO A CA  1 
ATOM   1751 C C   . PRO A 1 241 ? 22.427  50.290 48.755 1.00 66.94  ? 241  PRO A C   1 
ATOM   1752 O O   . PRO A 1 241 ? 22.475  49.762 49.863 1.00 66.05  ? 241  PRO A O   1 
ATOM   1753 C CB  . PRO A 1 241 ? 24.827  50.601 48.105 1.00 66.13  ? 241  PRO A CB  1 
ATOM   1754 C CG  . PRO A 1 241 ? 24.945  51.829 47.276 1.00 70.72  ? 241  PRO A CG  1 
ATOM   1755 C CD  . PRO A 1 241 ? 24.255  51.513 45.982 1.00 66.34  ? 241  PRO A CD  1 
ATOM   1756 N N   . ASP A 1 242 ? 21.494  51.174 48.415 1.00 63.56  ? 242  ASP A N   1 
ATOM   1757 C CA  . ASP A 1 242 ? 20.350  51.450 49.282 1.00 63.27  ? 242  ASP A CA  1 
ATOM   1758 C C   . ASP A 1 242 ? 19.331  50.329 49.153 1.00 65.58  ? 242  ASP A C   1 
ATOM   1759 O O   . ASP A 1 242 ? 18.632  50.000 50.110 1.00 64.69  ? 242  ASP A O   1 
ATOM   1760 C CB  . ASP A 1 242 ? 19.691  52.775 48.901 1.00 65.59  ? 242  ASP A CB  1 
ATOM   1761 C CG  . ASP A 1 242 ? 20.616  53.960 49.081 1.00 77.29  ? 242  ASP A CG  1 
ATOM   1762 O OD1 . ASP A 1 242 ? 21.397  53.957 50.056 1.00 77.41  ? 242  ASP A OD1 1 
ATOM   1763 O OD2 . ASP A 1 242 ? 20.543  54.901 48.259 1.00 84.07  ? 242  ASP A OD2 1 
ATOM   1764 N N   . CYS A 1 243 ? 19.224  49.779 47.948 1.00 61.56  ? 243  CYS A N   1 
ATOM   1765 C CA  . CYS A 1 243 ? 18.382  48.614 47.705 1.00 61.14  ? 243  CYS A CA  1 
ATOM   1766 C C   . CYS A 1 243 ? 18.890  47.410 48.493 1.00 61.43  ? 243  CYS A C   1 
ATOM   1767 O O   . CYS A 1 243 ? 18.104  46.666 49.082 1.00 61.04  ? 243  CYS A O   1 
ATOM   1768 C CB  . CYS A 1 243 ? 18.347  48.282 46.212 1.00 62.21  ? 243  CYS A CB  1 
ATOM   1769 S SG  . CYS A 1 243 ? 17.792  49.643 45.155 1.00 66.47  ? 243  CYS A SG  1 
ATOM   1770 N N   . LEU A 1 244 ? 20.207  47.226 48.502 1.00 54.74  ? 244  LEU A N   1 
ATOM   1771 C CA  . LEU A 1 244 ? 20.820  46.151 49.268 1.00 53.05  ? 244  LEU A CA  1 
ATOM   1772 C C   . LEU A 1 244 ? 20.623  46.403 50.755 1.00 55.29  ? 244  LEU A C   1 
ATOM   1773 O O   . LEU A 1 244 ? 20.419  45.472 51.535 1.00 55.30  ? 244  LEU A O   1 
ATOM   1774 C CB  . LEU A 1 244 ? 22.307  46.021 48.929 1.00 52.68  ? 244  LEU A CB  1 
ATOM   1775 C CG  . LEU A 1 244 ? 23.031  44.768 49.433 1.00 56.78  ? 244  LEU A CG  1 
ATOM   1776 C CD1 . LEU A 1 244 ? 22.085  43.577 49.498 1.00 57.33  ? 244  LEU A CD1 1 
ATOM   1777 C CD2 . LEU A 1 244 ? 24.203  44.446 48.528 1.00 57.17  ? 244  LEU A CD2 1 
ATOM   1778 N N   . ARG A 1 245 ? 20.642  47.673 51.137 1.00 50.19  ? 245  ARG A N   1 
ATOM   1779 C CA  . ARG A 1 245 ? 20.369  48.055 52.514 1.00 49.30  ? 245  ARG A CA  1 
ATOM   1780 C C   . ARG A 1 245 ? 18.886  47.816 52.790 1.00 52.14  ? 245  ARG A C   1 
ATOM   1781 O O   . ARG A 1 245 ? 18.517  47.197 53.791 1.00 51.61  ? 245  ARG A O   1 
ATOM   1782 C CB  . ARG A 1 245 ? 20.722  49.529 52.714 1.00 49.42  ? 245  ARG A CB  1 
ATOM   1783 C CG  . ARG A 1 245 ? 20.983  49.940 54.151 1.00 58.92  ? 245  ARG A CG  1 
ATOM   1784 C CD  . ARG A 1 245 ? 21.719  51.282 54.207 1.00 67.98  ? 245  ARG A CD  1 
ATOM   1785 N NE  . ARG A 1 245 ? 23.127  51.171 53.814 1.00 75.72  ? 245  ARG A NE  1 
ATOM   1786 C CZ  . ARG A 1 245 ? 23.631  51.619 52.666 1.00 85.26  ? 245  ARG A CZ  1 
ATOM   1787 N NH1 . ARG A 1 245 ? 22.843  52.218 51.784 1.00 75.20  ? 245  ARG A NH1 1 
ATOM   1788 N NH2 . ARG A 1 245 ? 24.925  51.476 52.401 1.00 66.28  ? 245  ARG A NH2 1 
ATOM   1789 N N   . ALA A 1 246 ? 18.044  48.255 51.861 1.00 47.77  ? 246  ALA A N   1 
ATOM   1790 C CA  . ALA A 1 246 ? 16.606  48.053 51.974 1.00 47.03  ? 246  ALA A CA  1 
ATOM   1791 C C   . ALA A 1 246 ? 16.294  46.564 52.039 1.00 50.57  ? 246  ALA A C   1 
ATOM   1792 O O   . ALA A 1 246 ? 15.530  46.111 52.888 1.00 50.21  ? 246  ALA A O   1 
ATOM   1793 C CB  . ALA A 1 246 ? 15.899  48.686 50.797 1.00 47.64  ? 246  ALA A CB  1 
ATOM   1794 N N   . CYS A 1 247 ? 16.903  45.808 51.136 1.00 46.59  ? 247  CYS A N   1 
ATOM   1795 C CA  . CYS A 1 247 ? 16.699  44.369 51.074 1.00 45.77  ? 247  CYS A CA  1 
ATOM   1796 C C   . CYS A 1 247 ? 17.098  43.729 52.396 1.00 49.24  ? 247  CYS A C   1 
ATOM   1797 O O   . CYS A 1 247 ? 16.325  42.991 53.006 1.00 48.73  ? 247  CYS A O   1 
ATOM   1798 C CB  . CYS A 1 247 ? 17.525  43.787 49.930 1.00 45.92  ? 247  CYS A CB  1 
ATOM   1799 S SG  . CYS A 1 247 ? 17.513  41.996 49.812 1.00 49.79  ? 247  CYS A SG  1 
ATOM   1800 N N   . GLN A 1 248 ? 18.300  44.055 52.853 1.00 45.58  ? 248  GLN A N   1 
ATOM   1801 C CA  . GLN A 1 248 ? 18.824  43.522 54.102 1.00 44.86  ? 248  GLN A CA  1 
ATOM   1802 C C   . GLN A 1 248 ? 17.828  43.717 55.246 1.00 48.01  ? 248  GLN A C   1 
ATOM   1803 O O   . GLN A 1 248 ? 17.579  42.802 56.021 1.00 47.28  ? 248  GLN A O   1 
ATOM   1804 C CB  . GLN A 1 248 ? 20.149  44.208 54.433 1.00 46.13  ? 248  GLN A CB  1 
ATOM   1805 C CG  . GLN A 1 248 ? 20.919  43.575 55.570 1.00 57.87  ? 248  GLN A CG  1 
ATOM   1806 C CD  . GLN A 1 248 ? 21.631  44.605 56.423 1.00 73.02  ? 248  GLN A CD  1 
ATOM   1807 O OE1 . GLN A 1 248 ? 21.549  44.565 57.646 1.00 68.01  ? 248  GLN A OE1 1 
ATOM   1808 N NE2 . GLN A 1 248 ? 22.299  45.558 55.778 1.00 65.98  ? 248  GLN A NE2 1 
ATOM   1809 N N   . GLU A 1 249 ? 17.267  44.918 55.351 1.00 44.85  ? 249  GLU A N   1 
ATOM   1810 C CA  . GLU A 1 249 ? 16.307  45.227 56.412 1.00 44.52  ? 249  GLU A CA  1 
ATOM   1811 C C   . GLU A 1 249 ? 15.038  44.399 56.270 1.00 47.91  ? 249  GLU A C   1 
ATOM   1812 O O   . GLU A 1 249 ? 14.571  43.794 57.233 1.00 47.22  ? 249  GLU A O   1 
ATOM   1813 C CB  . GLU A 1 249 ? 15.969  46.719 56.418 1.00 45.89  ? 249  GLU A CB  1 
ATOM   1814 C CG  . GLU A 1 249 ? 17.122  47.610 56.863 1.00 57.35  ? 249  GLU A CG  1 
ATOM   1815 C CD  . GLU A 1 249 ? 16.934  49.061 56.459 1.00 82.86  ? 249  GLU A CD  1 
ATOM   1816 O OE1 . GLU A 1 249 ? 15.797  49.568 56.548 1.00 81.48  ? 249  GLU A OE1 1 
ATOM   1817 O OE2 . GLU A 1 249 ? 17.930  49.699 56.057 1.00 80.93  ? 249  GLU A OE2 1 
ATOM   1818 N N   . GLN A 1 250 ? 14.478  44.393 55.068 1.00 44.90  ? 250  GLN A N   1 
ATOM   1819 C CA  . GLN A 1 250 ? 13.348  43.535 54.751 1.00 45.32  ? 250  GLN A CA  1 
ATOM   1820 C C   . GLN A 1 250 ? 13.564  42.118 55.275 1.00 50.17  ? 250  GLN A C   1 
ATOM   1821 O O   . GLN A 1 250 ? 12.674  41.535 55.895 1.00 49.44  ? 250  GLN A O   1 
ATOM   1822 C CB  . GLN A 1 250 ? 13.116  43.505 53.238 1.00 46.87  ? 250  GLN A CB  1 
ATOM   1823 C CG  . GLN A 1 250 ? 12.681  44.838 52.641 1.00 63.12  ? 250  GLN A CG  1 
ATOM   1824 C CD  . GLN A 1 250 ? 12.691  44.832 51.121 1.00 84.30  ? 250  GLN A CD  1 
ATOM   1825 O OE1 . GLN A 1 250 ? 12.019  44.019 50.484 1.00 78.66  ? 250  GLN A OE1 1 
ATOM   1826 N NE2 . GLN A 1 250 ? 13.455  45.744 50.533 1.00 80.05  ? 250  GLN A NE2 1 
ATOM   1827 N N   . ILE A 1 251 ? 14.757  41.576 55.040 1.00 47.73  ? 251  ILE A N   1 
ATOM   1828 C CA  . ILE A 1 251 ? 15.091  40.229 55.496 1.00 47.62  ? 251  ILE A CA  1 
ATOM   1829 C C   . ILE A 1 251 ? 15.085  40.201 57.013 1.00 53.55  ? 251  ILE A C   1 
ATOM   1830 O O   . ILE A 1 251 ? 14.393  39.392 57.623 1.00 54.44  ? 251  ILE A O   1 
ATOM   1831 C CB  . ILE A 1 251 ? 16.449  39.756 54.945 1.00 50.41  ? 251  ILE A CB  1 
ATOM   1832 C CG1 . ILE A 1 251 ? 16.411  39.665 53.419 1.00 50.87  ? 251  ILE A CG1 1 
ATOM   1833 C CG2 . ILE A 1 251 ? 16.816  38.414 55.528 1.00 50.85  ? 251  ILE A CG2 1 
ATOM   1834 C CD1 . ILE A 1 251 ? 17.776  39.496 52.780 1.00 56.88  ? 251  ILE A CD1 1 
ATOM   1835 N N   . GLU A 1 252 ? 15.836  41.112 57.619 1.00 50.53  ? 252  GLU A N   1 
ATOM   1836 C CA  . GLU A 1 252 ? 15.902  41.200 59.068 1.00 50.93  ? 252  GLU A CA  1 
ATOM   1837 C C   . GLU A 1 252 ? 14.533  41.238 59.737 1.00 55.62  ? 252  GLU A C   1 
ATOM   1838 O O   . GLU A 1 252 ? 14.360  40.720 60.840 1.00 55.00  ? 252  GLU A O   1 
ATOM   1839 C CB  . GLU A 1 252 ? 16.778  42.378 59.495 1.00 52.70  ? 252  GLU A CB  1 
ATOM   1840 C CG  . GLU A 1 252 ? 18.111  41.937 60.093 1.00 67.34  ? 252  GLU A CG  1 
ATOM   1841 C CD  . GLU A 1 252 ? 19.294  42.754 59.610 1.00 91.06  ? 252  GLU A CD  1 
ATOM   1842 O OE1 . GLU A 1 252 ? 19.207  44.001 59.608 1.00 83.54  ? 252  GLU A OE1 1 
ATOM   1843 O OE2 . GLU A 1 252 ? 20.331  42.138 59.273 1.00 87.79  ? 252  GLU A OE2 1 
ATOM   1844 N N   . ALA A 1 253 ? 13.553  41.803 59.035 1.00 53.12  ? 253  ALA A N   1 
ATOM   1845 C CA  . ALA A 1 253 ? 12.174  41.877 59.518 1.00 52.78  ? 253  ALA A CA  1 
ATOM   1846 C C   . ALA A 1 253 ? 11.446  40.544 59.355 1.00 56.85  ? 253  ALA A C   1 
ATOM   1847 O O   . ALA A 1 253 ? 10.773  40.078 60.271 1.00 55.50  ? 253  ALA A O   1 
ATOM   1848 C CB  . ALA A 1 253 ? 11.424  42.979 58.785 1.00 53.44  ? 253  ALA A CB  1 
ATOM   1849 N N   . LEU A 1 254 ? 11.533  39.972 58.158 1.00 55.28  ? 254  LEU A N   1 
ATOM   1850 C CA  . LEU A 1 254 ? 11.039  38.619 57.901 1.00 55.89  ? 254  LEU A CA  1 
ATOM   1851 C C   . LEU A 1 254 ? 11.448  37.670 59.022 1.00 64.10  ? 254  LEU A C   1 
ATOM   1852 O O   . LEU A 1 254 ? 10.635  36.890 59.525 1.00 64.27  ? 254  LEU A O   1 
ATOM   1853 C CB  . LEU A 1 254 ? 11.586  38.099 56.569 1.00 55.25  ? 254  LEU A CB  1 
ATOM   1854 C CG  . LEU A 1 254 ? 10.678  38.153 55.341 1.00 58.80  ? 254  LEU A CG  1 
ATOM   1855 C CD1 . LEU A 1 254 ? 9.906   39.456 55.272 1.00 58.57  ? 254  LEU A CD1 1 
ATOM   1856 C CD2 . LEU A 1 254 ? 11.488  37.928 54.072 1.00 59.84  ? 254  LEU A CD2 1 
ATOM   1857 N N   . LEU A 1 255 ? 12.722  37.732 59.391 1.00 62.90  ? 255  LEU A N   1 
ATOM   1858 C CA  . LEU A 1 255 ? 13.258  36.903 60.457 1.00 64.14  ? 255  LEU A CA  1 
ATOM   1859 C C   . LEU A 1 255 ? 12.489  37.110 61.761 1.00 72.07  ? 255  LEU A C   1 
ATOM   1860 O O   . LEU A 1 255 ? 12.040  36.146 62.383 1.00 71.50  ? 255  LEU A O   1 
ATOM   1861 C CB  . LEU A 1 255 ? 14.742  37.214 60.651 1.00 64.19  ? 255  LEU A CB  1 
ATOM   1862 C CG  . LEU A 1 255 ? 15.513  36.417 61.700 1.00 68.71  ? 255  LEU A CG  1 
ATOM   1863 C CD1 . LEU A 1 255 ? 15.377  34.931 61.433 1.00 68.96  ? 255  LEU A CD1 1 
ATOM   1864 C CD2 . LEU A 1 255 ? 16.972  36.835 61.695 1.00 70.90  ? 255  LEU A CD2 1 
ATOM   1865 N N   . GLU A 1 256 ? 12.341  38.366 62.177 1.00 72.19  ? 256  GLU A N   1 
ATOM   1866 C CA  . GLU A 1 256 ? 11.550  38.677 63.363 1.00 73.80  ? 256  GLU A CA  1 
ATOM   1867 C C   . GLU A 1 256 ? 10.151  38.082 63.288 1.00 82.03  ? 256  GLU A C   1 
ATOM   1868 O O   . GLU A 1 256 ? 9.687   37.464 64.242 1.00 81.86  ? 256  GLU A O   1 
ATOM   1869 C CB  . GLU A 1 256 ? 11.479  40.184 63.617 1.00 75.19  ? 256  GLU A CB  1 
ATOM   1870 C CG  . GLU A 1 256 ? 12.216  40.642 64.875 1.00 86.41  ? 256  GLU A CG  1 
ATOM   1871 C CD  . GLU A 1 256 ? 11.546  40.168 66.164 1.00 107.28 ? 256  GLU A CD  1 
ATOM   1872 O OE1 . GLU A 1 256 ? 10.770  39.189 66.117 1.00 100.22 ? 256  GLU A OE1 1 
ATOM   1873 O OE2 . GLU A 1 256 ? 11.809  40.767 67.230 1.00 100.35 ? 256  GLU A OE2 1 
ATOM   1874 N N   . SER A 1 257 ? 9.494   38.252 62.144 1.00 81.81  ? 257  SER A N   1 
ATOM   1875 C CA  . SER A 1 257 ? 8.161   37.696 61.916 1.00 83.14  ? 257  SER A CA  1 
ATOM   1876 C C   . SER A 1 257 ? 8.111   36.179 62.105 1.00 90.36  ? 257  SER A C   1 
ATOM   1877 O O   . SER A 1 257 ? 7.047   35.569 61.999 1.00 89.66  ? 257  SER A O   1 
ATOM   1878 C CB  . SER A 1 257 ? 7.666   38.056 60.513 1.00 87.23  ? 257  SER A CB  1 
ATOM   1879 O OG  . SER A 1 257 ? 7.801   39.444 60.259 1.00 96.82  ? 257  SER A OG  1 
ATOM   1880 N N   . SER A 1 258 ? 9.271   35.570 62.338 1.00 90.19  ? 258  SER A N   1 
ATOM   1881 C CA  . SER A 1 258 ? 9.342   34.154 62.677 1.00 91.68  ? 258  SER A CA  1 
ATOM   1882 C C   . SER A 1 258 ? 9.219   33.960 64.186 1.00 100.81 ? 258  SER A C   1 
ATOM   1883 O O   . SER A 1 258 ? 9.070   32.838 64.669 1.00 100.40 ? 258  SER A O   1 
ATOM   1884 C CB  . SER A 1 258 ? 10.648  33.552 62.170 1.00 94.66  ? 258  SER A CB  1 
ATOM   1885 O OG  . SER A 1 258 ? 10.825  33.837 60.796 1.00 102.21 ? 258  SER A OG  1 
ATOM   1886 N N   . LEU A 1 259 ? 9.282   35.065 64.924 1.00 101.70 ? 259  LEU A N   1 
ATOM   1887 C CA  . LEU A 1 259 ? 8.992   35.053 66.353 1.00 103.52 ? 259  LEU A CA  1 
ATOM   1888 C C   . LEU A 1 259 ? 7.528   34.685 66.570 1.00 111.78 ? 259  LEU A C   1 
ATOM   1889 O O   . LEU A 1 259 ? 7.201   33.906 67.465 1.00 111.44 ? 259  LEU A O   1 
ATOM   1890 C CB  . LEU A 1 259 ? 9.309   36.417 66.987 1.00 103.75 ? 259  LEU A CB  1 
ATOM   1891 C CG  . LEU A 1 259 ? 8.234   37.499 67.176 1.00 108.72 ? 259  LEU A CG  1 
ATOM   1892 C CD1 . LEU A 1 259 ? 7.490   37.864 65.899 1.00 108.93 ? 259  LEU A CD1 1 
ATOM   1893 C CD2 . LEU A 1 259 ? 7.264   37.146 68.291 1.00 111.60 ? 259  LEU A CD2 1 
ATOM   1894 N N   . ARG A 1 260 ? 6.658   35.220 65.717 1.00 111.81 ? 260  ARG A N   1 
ATOM   1895 C CA  . ARG A 1 260 ? 5.235   34.898 65.753 1.00 113.30 ? 260  ARG A CA  1 
ATOM   1896 C C   . ARG A 1 260 ? 4.991   33.425 65.448 1.00 120.83 ? 260  ARG A C   1 
ATOM   1897 O O   . ARG A 1 260 ? 4.467   32.688 66.282 1.00 120.59 ? 260  ARG A O   1 
ATOM   1898 C CB  . ARG A 1 260 ? 4.451   35.783 64.772 1.00 114.02 ? 260  ARG A CB  1 
ATOM   1899 C CG  . ARG A 1 260 ? 3.036   35.286 64.458 1.00 124.22 ? 260  ARG A CG  1 
ATOM   1900 C CD  . ARG A 1 260 ? 3.008   34.395 63.215 1.00 131.53 ? 260  ARG A CD  1 
ATOM   1901 N NE  . ARG A 1 260 ? 1.824   33.536 63.162 1.00 134.96 ? 260  ARG A NE  1 
ATOM   1902 C CZ  . ARG A 1 260 ? 0.716   33.812 62.478 1.00 144.18 ? 260  ARG A CZ  1 
ATOM   1903 N NH1 . ARG A 1 260 ? 0.620   34.936 61.780 1.00 128.90 ? 260  ARG A NH1 1 
ATOM   1904 N NH2 . ARG A 1 260 ? -0.300  32.960 62.493 1.00 129.67 ? 260  ARG A NH2 1 
ATOM   1905 N N   . GLN A 1 261 ? 5.399   32.998 64.259 1.00 120.19 ? 261  GLN A N   1 
ATOM   1906 C CA  . GLN A 1 261 ? 5.169   31.628 63.816 1.00 121.43 ? 261  GLN A CA  1 
ATOM   1907 C C   . GLN A 1 261 ? 5.728   30.585 64.783 1.00 128.00 ? 261  GLN A C   1 
ATOM   1908 O O   . GLN A 1 261 ? 5.057   29.604 65.108 1.00 127.31 ? 261  GLN A O   1 
ATOM   1909 C CB  . GLN A 1 261 ? 5.754   31.415 62.418 1.00 122.89 ? 261  GLN A CB  1 
ATOM   1910 C CG  . GLN A 1 261 ? 5.180   32.342 61.357 1.00 137.12 ? 261  GLN A CG  1 
ATOM   1911 C CD  . GLN A 1 261 ? 5.713   32.038 59.971 1.00 154.44 ? 261  GLN A CD  1 
ATOM   1912 O OE1 . GLN A 1 261 ? 5.002   32.180 58.975 1.00 149.64 ? 261  GLN A OE1 1 
ATOM   1913 N NE2 . GLN A 1 261 ? 6.969   31.609 59.900 1.00 146.29 ? 261  GLN A NE2 1 
ATOM   1914 N N   . ALA A 1 262 ? 6.954   30.809 65.244 1.00 126.93 ? 262  ALA A N   1 
ATOM   1915 C CA  . ALA A 1 262 ? 7.662   29.829 66.058 1.00 127.94 ? 262  ALA A CA  1 
ATOM   1916 C C   . ALA A 1 262 ? 6.929   29.414 67.339 1.00 134.75 ? 262  ALA A C   1 
ATOM   1917 O O   . ALA A 1 262 ? 7.281   28.407 67.959 1.00 134.55 ? 262  ALA A O   1 
ATOM   1918 C CB  . ALA A 1 262 ? 9.066   30.323 66.382 1.00 128.65 ? 262  ALA A CB  1 
ATOM   1919 N N   . GLN A 1 263 ? 5.894   30.163 67.717 1.00 133.06 ? 263  GLN A N   1 
ATOM   1920 C CA  . GLN A 1 263 ? 5.250   29.952 69.013 1.00 133.62 ? 263  GLN A CA  1 
ATOM   1921 C C   . GLN A 1 263 ? 3.732   29.748 68.968 1.00 139.47 ? 263  GLN A C   1 
ATOM   1922 O O   . GLN A 1 263 ? 3.194   28.900 69.684 1.00 139.11 ? 263  GLN A O   1 
ATOM   1923 C CB  . GLN A 1 263 ? 5.603   31.089 69.977 1.00 134.85 ? 263  GLN A CB  1 
ATOM   1924 C CG  . GLN A 1 263 ? 7.083   31.444 70.012 1.00 146.01 ? 263  GLN A CG  1 
ATOM   1925 C CD  . GLN A 1 263 ? 7.965   30.264 70.376 1.00 162.50 ? 263  GLN A CD  1 
ATOM   1926 O OE1 . GLN A 1 263 ? 7.541   29.351 71.085 1.00 157.51 ? 263  GLN A OE1 1 
ATOM   1927 N NE2 . GLN A 1 263 ? 9.203   30.279 69.893 1.00 154.60 ? 263  GLN A NE2 1 
ATOM   1928 N N   . GLN A 1 264 ? 3.045   30.532 68.141 1.00 137.37 ? 264  GLN A N   1 
ATOM   1929 C CA  . GLN A 1 264 ? 1.581   30.547 68.130 1.00 137.79 ? 264  GLN A CA  1 
ATOM   1930 C C   . GLN A 1 264 ? 0.924   29.249 67.652 1.00 143.23 ? 264  GLN A C   1 
ATOM   1931 O O   . GLN A 1 264 ? -0.297  29.185 67.503 1.00 142.72 ? 264  GLN A O   1 
ATOM   1932 C CB  . GLN A 1 264 ? 1.059   31.736 67.315 1.00 139.04 ? 264  GLN A CB  1 
ATOM   1933 C CG  . GLN A 1 264 ? 1.569   31.795 65.878 1.00 150.39 ? 264  GLN A CG  1 
ATOM   1934 C CD  . GLN A 1 264 ? 1.063   30.647 65.021 1.00 164.62 ? 264  GLN A CD  1 
ATOM   1935 O OE1 . GLN A 1 264 ? 1.849   29.920 64.410 1.00 158.69 ? 264  GLN A OE1 1 
ATOM   1936 N NE2 . GLN A 1 264 ? -0.254  30.481 64.972 1.00 155.85 ? 264  GLN A NE2 1 
ATOM   1937 N N   . ASN A 1 265 ? 1.731   28.212 67.443 1.00 140.87 ? 265  ASN A N   1 
ATOM   1938 C CA  . ASN A 1 265 ? 1.245   26.959 66.868 1.00 141.06 ? 265  ASN A CA  1 
ATOM   1939 C C   . ASN A 1 265 ? 0.086   26.327 67.637 1.00 145.96 ? 265  ASN A C   1 
ATOM   1940 O O   . ASN A 1 265 ? -0.610  25.456 67.113 1.00 145.60 ? 265  ASN A O   1 
ATOM   1941 C CB  . ASN A 1 265 ? 2.390   25.956 66.712 1.00 141.39 ? 265  ASN A CB  1 
ATOM   1942 C CG  . ASN A 1 265 ? 3.480   26.456 65.784 1.00 161.35 ? 265  ASN A CG  1 
ATOM   1943 O OD1 . ASN A 1 265 ? 3.248   27.333 64.950 1.00 155.15 ? 265  ASN A OD1 1 
ATOM   1944 N ND2 . ASN A 1 265 ? 4.677   25.900 65.924 1.00 152.49 ? 265  ASN A ND2 1 
ATOM   1945 N N   . MET A 1 266 ? -0.116  26.761 68.878 1.00 143.16 ? 266  MET A N   1 
ATOM   1946 C CA  . MET A 1 266 ? -1.207  26.246 69.703 1.00 143.20 ? 266  MET A CA  1 
ATOM   1947 C C   . MET A 1 266 ? -2.584  26.670 69.194 1.00 146.47 ? 266  MET A C   1 
ATOM   1948 O O   . MET A 1 266 ? -3.343  25.853 68.669 1.00 146.06 ? 266  MET A O   1 
ATOM   1949 C CB  . MET A 1 266 ? -1.033  26.678 71.162 1.00 145.73 ? 266  MET A CB  1 
ATOM   1950 C CG  . MET A 1 266 ? -2.308  26.583 71.996 1.00 149.63 ? 266  MET A CG  1 
ATOM   1951 S SD  . MET A 1 266 ? -3.004  24.913 72.087 1.00 154.01 ? 266  MET A SD  1 
ATOM   1952 C CE  . MET A 1 266 ? -4.565  25.239 72.932 1.00 150.72 ? 266  MET A CE  1 
ATOM   1953 N N   . ASP A 1 267 ? -2.907  27.947 69.377 1.00 142.29 ? 267  ASP A N   1 
ATOM   1954 C CA  . ASP A 1 267 ? -4.211  28.476 68.990 1.00 154.45 ? 267  ASP A CA  1 
ATOM   1955 C C   . ASP A 1 267 ? -4.071  29.641 68.014 1.00 177.76 ? 267  ASP A C   1 
ATOM   1956 O O   . ASP A 1 267 ? -5.010  29.977 67.292 1.00 140.41 ? 267  ASP A O   1 
ATOM   1957 C CB  . ASP A 1 267 ? -4.991  28.923 70.228 1.00 155.88 ? 267  ASP A CB  1 
ATOM   1958 C CG  . ASP A 1 267 ? -4.247  29.964 71.042 1.00 161.68 ? 267  ASP A CG  1 
ATOM   1959 O OD1 . ASP A 1 267 ? -4.826  31.038 71.304 1.00 161.63 ? 267  ASP A OD1 1 
ATOM   1960 O OD2 . ASP A 1 267 ? -3.073  29.723 71.396 1.00 165.60 ? 267  ASP A OD2 1 
ATOM   1961 N N   . ALA B 2 2   ? 3.918   20.781 13.838 1.00 137.73 ? 2    ALA B N   1 
ATOM   1962 C CA  . ALA B 2 2   ? 2.919   21.663 14.435 1.00 137.58 ? 2    ALA B CA  1 
ATOM   1963 C C   . ALA B 2 2   ? 2.420   21.105 15.766 1.00 141.37 ? 2    ALA B C   1 
ATOM   1964 O O   . ALA B 2 2   ? 2.709   19.959 16.112 1.00 141.07 ? 2    ALA B O   1 
ATOM   1965 C CB  . ALA B 2 2   ? 1.756   21.870 13.474 1.00 138.32 ? 2    ALA B CB  1 
ATOM   1966 N N   . THR B 2 3   ? 1.686   21.922 16.519 1.00 137.65 ? 3    THR B N   1 
ATOM   1967 C CA  . THR B 2 3   ? 1.411   23.303 16.135 1.00 137.33 ? 3    THR B CA  1 
ATOM   1968 C C   . THR B 2 3   ? 2.256   24.264 16.968 1.00 141.03 ? 3    THR B C   1 
ATOM   1969 O O   . THR B 2 3   ? 2.717   23.917 18.056 1.00 140.52 ? 3    THR B O   1 
ATOM   1970 C CB  . THR B 2 3   ? -0.092  23.632 16.261 1.00 144.63 ? 3    THR B CB  1 
ATOM   1971 O OG1 . THR B 2 3   ? -0.339  24.956 15.770 1.00 143.58 ? 3    THR B OG1 1 
ATOM   1972 C CG2 . THR B 2 3   ? -0.535  23.548 17.714 1.00 143.31 ? 3    THR B CG2 1 
ATOM   1973 N N   . SER B 2 4   ? 2.462   25.470 16.447 1.00 137.44 ? 4    SER B N   1 
ATOM   1974 C CA  . SER B 2 4   ? 3.218   26.494 17.160 1.00 137.09 ? 4    SER B CA  1 
ATOM   1975 C C   . SER B 2 4   ? 2.870   27.885 16.643 1.00 141.21 ? 4    SER B C   1 
ATOM   1976 O O   . SER B 2 4   ? 2.564   28.057 15.464 1.00 140.70 ? 4    SER B O   1 
ATOM   1977 C CB  . SER B 2 4   ? 4.722   26.247 17.019 1.00 139.92 ? 4    SER B CB  1 
ATOM   1978 O OG  . SER B 2 4   ? 5.118   25.080 17.717 1.00 146.95 ? 4    SER B OG  1 
ATOM   1979 N N   . ARG B 2 5   ? 2.927   28.877 17.526 1.00 138.04 ? 5    ARG B N   1 
ATOM   1980 C CA  . ARG B 2 5   ? 2.750   30.266 17.118 1.00 137.95 ? 5    ARG B CA  1 
ATOM   1981 C C   . ARG B 2 5   ? 3.866   30.683 16.167 1.00 142.04 ? 5    ARG B C   1 
ATOM   1982 O O   . ARG B 2 5   ? 4.543   31.689 16.382 1.00 141.63 ? 5    ARG B O   1 
ATOM   1983 C CB  . ARG B 2 5   ? 2.707   31.196 18.333 1.00 138.21 ? 5    ARG B CB  1 
ATOM   1984 C CG  . ARG B 2 5   ? 3.845   30.990 19.313 1.00 147.80 ? 5    ARG B CG  1 
ATOM   1985 C CD  . ARG B 2 5   ? 3.671   31.849 20.554 1.00 155.63 ? 5    ARG B CD  1 
ATOM   1986 N NE  . ARG B 2 5   ? 4.226   31.195 21.736 1.00 163.09 ? 5    ARG B NE  1 
ATOM   1987 C CZ  . ARG B 2 5   ? 5.522   31.146 22.028 1.00 175.82 ? 5    ARG B CZ  1 
ATOM   1988 N NH1 . ARG B 2 5   ? 5.933   30.522 23.125 1.00 161.95 ? 5    ARG B NH1 1 
ATOM   1989 N NH2 . ARG B 2 5   ? 6.408   31.716 21.221 1.00 162.74 ? 5    ARG B NH2 1 
ATOM   1990 N N   . TYR B 2 6   ? 4.070   29.869 15.137 1.00 138.69 ? 6    TYR B N   1 
ATOM   1991 C CA  . TYR B 2 6   ? 5.028   30.154 14.078 1.00 138.51 ? 6    TYR B CA  1 
ATOM   1992 C C   . TYR B 2 6   ? 4.441   29.631 12.768 1.00 142.21 ? 6    TYR B C   1 
ATOM   1993 O O   . TYR B 2 6   ? 3.781   28.592 12.751 1.00 141.85 ? 6    TYR B O   1 
ATOM   1994 C CB  . TYR B 2 6   ? 6.359   29.451 14.360 1.00 139.73 ? 6    TYR B CB  1 
ATOM   1995 C CG  . TYR B 2 6   ? 7.100   29.958 15.582 1.00 141.51 ? 6    TYR B CG  1 
ATOM   1996 C CD1 . TYR B 2 6   ? 7.652   31.233 15.606 1.00 143.51 ? 6    TYR B CD1 1 
ATOM   1997 C CD2 . TYR B 2 6   ? 7.291   29.142 16.691 1.00 142.25 ? 6    TYR B CD2 1 
ATOM   1998 C CE1 . TYR B 2 6   ? 8.350   31.691 16.712 1.00 144.23 ? 6    TYR B CE1 1 
ATOM   1999 C CE2 . TYR B 2 6   ? 7.988   29.592 17.800 1.00 143.09 ? 6    TYR B CE2 1 
ATOM   2000 C CZ  . TYR B 2 6   ? 8.514   30.866 17.804 1.00 149.80 ? 6    TYR B CZ  1 
ATOM   2001 O OH  . TYR B 2 6   ? 9.206   31.319 18.904 1.00 149.96 ? 6    TYR B OH  1 
ATOM   2002 N N   . GLU B 2 7   ? 4.659   30.362 11.679 1.00 138.41 ? 7    GLU B N   1 
ATOM   2003 C CA  . GLU B 2 7   ? 4.165   29.942 10.371 1.00 137.85 ? 7    GLU B CA  1 
ATOM   2004 C C   . GLU B 2 7   ? 5.306   29.509 9.459  1.00 139.73 ? 7    GLU B C   1 
ATOM   2005 O O   . GLU B 2 7   ? 6.124   30.326 9.038  1.00 139.87 ? 7    GLU B O   1 
ATOM   2006 C CB  . GLU B 2 7   ? 3.354   31.060 9.714  1.00 139.36 ? 7    GLU B CB  1 
ATOM   2007 C CG  . GLU B 2 7   ? 2.030   31.349 10.405 1.00 150.53 ? 7    GLU B CG  1 
ATOM   2008 C CD  . GLU B 2 7   ? 1.094   30.152 10.401 1.00 170.48 ? 7    GLU B CD  1 
ATOM   2009 O OE1 . GLU B 2 7   ? 1.318   29.221 9.598  1.00 164.78 ? 7    GLU B OE1 1 
ATOM   2010 O OE2 . GLU B 2 7   ? 0.128   30.147 11.194 1.00 164.36 ? 7    GLU B OE2 1 
ATOM   2011 N N   . PRO B 2 8   ? 5.359   28.211 9.126  1.00 133.50 ? 8    PRO B N   1 
ATOM   2012 C CA  . PRO B 2 8   ? 6.478   27.674 8.345  1.00 131.55 ? 8    PRO B CA  1 
ATOM   2013 C C   . PRO B 2 8   ? 6.443   28.105 6.886  1.00 128.22 ? 8    PRO B C   1 
ATOM   2014 O O   . PRO B 2 8   ? 5.444   28.646 6.410  1.00 127.51 ? 8    PRO B O   1 
ATOM   2015 C CB  . PRO B 2 8   ? 6.281   26.159 8.451  1.00 133.91 ? 8    PRO B CB  1 
ATOM   2016 C CG  . PRO B 2 8   ? 4.817   25.989 8.667  1.00 139.24 ? 8    PRO B CG  1 
ATOM   2017 C CD  . PRO B 2 8   ? 4.399   27.161 9.510  1.00 135.09 ? 8    PRO B CD  1 
ATOM   2018 N N   . VAL B 2 9   ? 7.561   27.910 6.194  1.00 119.99 ? 9    VAL B N   1 
ATOM   2019 C CA  . VAL B 2 9   ? 7.605   28.091 4.748  1.00 117.90 ? 9    VAL B CA  1 
ATOM   2020 C C   . VAL B 2 9   ? 8.465   26.986 4.117  1.00 124.97 ? 9    VAL B C   1 
ATOM   2021 O O   . VAL B 2 9   ? 8.191   25.803 4.300  1.00 124.97 ? 9    VAL B O   1 
ATOM   2022 C CB  . VAL B 2 9   ? 8.016   29.533 4.343  1.00 118.73 ? 9    VAL B CB  1 
ATOM   2023 C CG1 . VAL B 2 9   ? 7.093   30.575 5.014  1.00 117.66 ? 9    VAL B CG1 1 
ATOM   2024 C CG2 . VAL B 2 9   ? 9.484   29.809 4.656  1.00 117.90 ? 9    VAL B CG2 1 
ATOM   2025 N N   . ALA B 2 10  ? 9.510   27.365 3.394  1.00 121.56 ? 10   ALA B N   1 
ATOM   2026 C CA  . ALA B 2 10  ? 10.500  26.417 2.885  1.00 120.01 ? 10   ALA B CA  1 
ATOM   2027 C C   . ALA B 2 10  ? 10.914  25.324 3.873  1.00 118.63 ? 10   ALA B C   1 
ATOM   2028 O O   . ALA B 2 10  ? 10.471  25.300 5.026  1.00 116.66 ? 10   ALA B O   1 
ATOM   2029 C CB  . ALA B 2 10  ? 11.724  27.165 2.389  1.00 120.92 ? 10   ALA B CB  1 
ATOM   2030 N N   . GLU B 2 11  ? 11.811  24.451 3.418  1.00 114.58 ? 11   GLU B N   1 
ATOM   2031 C CA  . GLU B 2 11  ? 12.234  23.281 4.187  1.00 114.57 ? 11   GLU B CA  1 
ATOM   2032 C C   . GLU B 2 11  ? 13.723  23.031 3.963  1.00 110.01 ? 11   GLU B C   1 
ATOM   2033 O O   . GLU B 2 11  ? 14.122  22.122 3.231  1.00 104.51 ? 11   GLU B O   1 
ATOM   2034 C CB  . GLU B 2 11  ? 11.408  22.060 3.785  1.00 117.10 ? 11   GLU B CB  1 
ATOM   2035 C CG  . GLU B 2 11  ? 9.899   22.274 3.992  1.00 127.51 ? 11   GLU B CG  1 
ATOM   2036 C CD  . GLU B 2 11  ? 9.073   21.103 3.504  1.00 140.52 ? 11   GLU B CD  1 
ATOM   2037 O OE1 . GLU B 2 11  ? 9.652   20.170 2.898  1.00 104.92 ? 11   GLU B OE1 1 
ATOM   2038 O OE2 . GLU B 2 11  ? 7.842   21.116 3.719  1.00 116.54 ? 11   GLU B OE2 1 
ATOM   2039 N N   . ILE B 2 12  ? 14.531  23.867 4.608  1.00 107.28 ? 12   ILE B N   1 
ATOM   2040 C CA  . ILE B 2 12  ? 15.965  23.966 4.350  1.00 106.99 ? 12   ILE B CA  1 
ATOM   2041 C C   . ILE B 2 12  ? 16.751  22.662 4.502  1.00 108.50 ? 12   ILE B C   1 
ATOM   2042 O O   . ILE B 2 12  ? 17.934  22.614 4.162  1.00 108.33 ? 12   ILE B O   1 
ATOM   2043 C CB  . ILE B 2 12  ? 16.602  25.188 5.085  1.00 110.33 ? 12   ILE B CB  1 
ATOM   2044 C CG1 . ILE B 2 12  ? 18.119  25.276 4.886  1.00 112.32 ? 12   ILE B CG1 1 
ATOM   2045 C CG2 . ILE B 2 12  ? 16.168  25.255 6.525  1.00 105.71 ? 12   ILE B CG2 1 
ATOM   2046 C CD1 . ILE B 2 12  ? 18.724  26.593 5.363  1.00 100.09 ? 12   ILE B CD1 1 
ATOM   2047 N N   . GLY B 2 13  ? 16.106  21.584 4.942  1.00 103.93 ? 13   GLY B N   1 
ATOM   2048 C CA  . GLY B 2 13  ? 16.831  20.329 5.024  1.00 103.33 ? 13   GLY B CA  1 
ATOM   2049 C C   . GLY B 2 13  ? 16.154  19.164 5.709  1.00 105.52 ? 13   GLY B C   1 
ATOM   2050 O O   . GLY B 2 13  ? 15.336  19.327 6.614  1.00 104.00 ? 13   GLY B O   1 
ATOM   2051 N N   . VAL B 2 14  ? 16.488  17.972 5.235  1.00 102.46 ? 14   VAL B N   1 
ATOM   2052 C CA  . VAL B 2 14  ? 16.195  16.750 5.955  1.00 102.79 ? 14   VAL B CA  1 
ATOM   2053 C C   . VAL B 2 14  ? 17.516  16.041 6.196  1.00 108.17 ? 14   VAL B C   1 
ATOM   2054 O O   . VAL B 2 14  ? 18.406  16.062 5.342  1.00 107.92 ? 14   VAL B O   1 
ATOM   2055 C CB  . VAL B 2 14  ? 15.213  15.869 5.182  1.00 106.81 ? 14   VAL B CB  1 
ATOM   2056 C CG1 . VAL B 2 14  ? 13.889  16.590 5.012  1.00 106.62 ? 14   VAL B CG1 1 
ATOM   2057 C CG2 . VAL B 2 14  ? 15.795  15.505 3.833  1.00 106.75 ? 14   VAL B CG2 1 
ATOM   2058 N N   . GLY B 2 15  ? 17.669  15.487 7.392  1.00 105.18 ? 15   GLY B N   1 
ATOM   2059 C CA  . GLY B 2 15  ? 18.890  14.816 7.793  1.00 104.89 ? 15   GLY B CA  1 
ATOM   2060 C C   . GLY B 2 15  ? 18.841  14.439 9.258  1.00 107.83 ? 15   GLY B C   1 
ATOM   2061 O O   . GLY B 2 15  ? 17.921  14.848 9.968  1.00 107.68 ? 15   GLY B O   1 
ATOM   2062 N N   . ALA B 2 16  ? 19.866  13.707 9.697  1.00 102.95 ? 16   ALA B N   1 
ATOM   2063 C CA  . ALA B 2 16  ? 19.975  13.133 11.044 1.00 101.90 ? 16   ALA B CA  1 
ATOM   2064 C C   . ALA B 2 16  ? 18.975  13.625 12.086 1.00 103.09 ? 16   ALA B C   1 
ATOM   2065 O O   . ALA B 2 16  ? 18.276  12.830 12.715 1.00 102.56 ? 16   ALA B O   1 
ATOM   2066 C CB  . ALA B 2 16  ? 21.397  13.270 11.562 1.00 102.68 ? 16   ALA B CB  1 
ATOM   2067 N N   . TYR B 2 17  ? 18.890  14.942 12.232 1.00 97.72  ? 17   TYR B N   1 
ATOM   2068 C CA  . TYR B 2 17  ? 17.966  15.562 13.175 1.00 96.55  ? 17   TYR B CA  1 
ATOM   2069 C C   . TYR B 2 17  ? 16.602  15.786 12.533 1.00 99.90  ? 17   TYR B C   1 
ATOM   2070 O O   . TYR B 2 17  ? 15.863  16.702 12.909 1.00 99.07  ? 17   TYR B O   1 
ATOM   2071 C CB  . TYR B 2 17  ? 18.549  16.875 13.695 1.00 96.94  ? 17   TYR B CB  1 
ATOM   2072 C CG  . TYR B 2 17  ? 19.891  16.693 14.364 1.00 97.64  ? 17   TYR B CG  1 
ATOM   2073 C CD1 . TYR B 2 17  ? 20.980  17.480 14.018 1.00 99.39  ? 17   TYR B CD1 1 
ATOM   2074 C CD2 . TYR B 2 17  ? 20.078  15.699 15.311 1.00 98.22  ? 17   TYR B CD2 1 
ATOM   2075 C CE1 . TYR B 2 17  ? 22.213  17.300 14.624 1.00 99.83  ? 17   TYR B CE1 1 
ATOM   2076 C CE2 . TYR B 2 17  ? 21.304  15.508 15.918 1.00 98.97  ? 17   TYR B CE2 1 
ATOM   2077 C CZ  . TYR B 2 17  ? 22.367  16.312 15.575 1.00 105.02 ? 17   TYR B CZ  1 
ATOM   2078 O OH  . TYR B 2 17  ? 23.585  16.123 16.187 1.00 104.61 ? 17   TYR B OH  1 
ATOM   2079 N N   . GLY B 2 18  ? 16.275  14.933 11.566 1.00 96.43  ? 18   GLY B N   1 
ATOM   2080 C CA  . GLY B 2 18  ? 14.992  14.962 10.892 1.00 96.38  ? 18   GLY B CA  1 
ATOM   2081 C C   . GLY B 2 18  ? 14.852  16.121 9.925  1.00 100.62 ? 18   GLY B C   1 
ATOM   2082 O O   . GLY B 2 18  ? 15.848  16.673 9.447  1.00 100.20 ? 18   GLY B O   1 
ATOM   2083 N N   . THR B 2 19  ? 13.606  16.479 9.630  1.00 97.34  ? 19   THR B N   1 
ATOM   2084 C CA  . THR B 2 19  ? 13.303  17.613 8.765  1.00 97.34  ? 19   THR B CA  1 
ATOM   2085 C C   . THR B 2 19  ? 13.577  18.932 9.489  1.00 102.28 ? 19   THR B C   1 
ATOM   2086 O O   . THR B 2 19  ? 13.137  19.127 10.623 1.00 101.90 ? 19   THR B O   1 
ATOM   2087 C CB  . THR B 2 19  ? 11.843  17.547 8.277  1.00 103.72 ? 19   THR B CB  1 
ATOM   2088 O OG1 . THR B 2 19  ? 11.595  16.267 7.685  1.00 103.74 ? 19   THR B OG1 1 
ATOM   2089 C CG2 . THR B 2 19  ? 11.560  18.643 7.260  1.00 101.11 ? 19   THR B CG2 1 
ATOM   2090 N N   . VAL B 2 20  ? 14.311  19.829 8.833  1.00 99.52  ? 20   VAL B N   1 
ATOM   2091 C CA  . VAL B 2 20  ? 14.569  21.161 9.377  1.00 99.60  ? 20   VAL B CA  1 
ATOM   2092 C C   . VAL B 2 20  ? 13.838  22.251 8.589  1.00 104.58 ? 20   VAL B C   1 
ATOM   2093 O O   . VAL B 2 20  ? 14.457  23.008 7.844  1.00 104.33 ? 20   VAL B O   1 
ATOM   2094 C CB  . VAL B 2 20  ? 16.090  21.459 9.501  1.00 103.35 ? 20   VAL B CB  1 
ATOM   2095 C CG1 . VAL B 2 20  ? 16.770  20.428 10.382 1.00 103.17 ? 20   VAL B CG1 1 
ATOM   2096 C CG2 . VAL B 2 20  ? 16.757  21.502 8.137  1.00 103.13 ? 20   VAL B CG2 1 
ATOM   2097 N N   . TYR B 2 21  ? 12.522  22.334 8.758  1.00 102.11 ? 21   TYR B N   1 
ATOM   2098 C CA  . TYR B 2 21  ? 11.734  23.357 8.075  1.00 102.62 ? 21   TYR B CA  1 
ATOM   2099 C C   . TYR B 2 21  ? 12.069  24.780 8.534  1.00 106.77 ? 21   TYR B C   1 
ATOM   2100 O O   . TYR B 2 21  ? 12.897  24.971 9.423  1.00 106.34 ? 21   TYR B O   1 
ATOM   2101 C CB  . TYR B 2 21  ? 10.232  23.065 8.176  1.00 104.46 ? 21   TYR B CB  1 
ATOM   2102 C CG  . TYR B 2 21  ? 9.807   22.380 9.456  1.00 107.23 ? 21   TYR B CG  1 
ATOM   2103 C CD1 . TYR B 2 21  ? 9.315   23.114 10.531 1.00 109.53 ? 21   TYR B CD1 1 
ATOM   2104 C CD2 . TYR B 2 21  ? 9.867   20.997 9.581  1.00 108.19 ? 21   TYR B CD2 1 
ATOM   2105 C CE1 . TYR B 2 21  ? 8.915   22.490 11.706 1.00 110.72 ? 21   TYR B CE1 1 
ATOM   2106 C CE2 . TYR B 2 21  ? 9.474   20.364 10.752 1.00 109.26 ? 21   TYR B CE2 1 
ATOM   2107 C CZ  . TYR B 2 21  ? 8.999   21.116 11.812 1.00 116.83 ? 21   TYR B CZ  1 
ATOM   2108 O OH  . TYR B 2 21  ? 8.609   20.500 12.980 1.00 117.30 ? 21   TYR B OH  1 
ATOM   2109 N N   . LYS B 2 22  ? 11.458  25.774 7.891  1.00 103.46 ? 22   LYS B N   1 
ATOM   2110 C CA  . LYS B 2 22  ? 11.747  27.180 8.178  1.00 103.27 ? 22   LYS B CA  1 
ATOM   2111 C C   . LYS B 2 22  ? 10.480  28.033 8.252  1.00 108.21 ? 22   LYS B C   1 
ATOM   2112 O O   . LYS B 2 22  ? 9.630   27.970 7.367  1.00 107.49 ? 22   LYS B O   1 
ATOM   2113 C CB  . LYS B 2 22  ? 12.702  27.753 7.129  1.00 105.27 ? 22   LYS B CB  1 
ATOM   2114 C CG  . LYS B 2 22  ? 12.782  29.272 7.128  1.00 114.12 ? 22   LYS B CG  1 
ATOM   2115 C CD  . LYS B 2 22  ? 13.651  29.786 5.990  1.00 121.03 ? 22   LYS B CD  1 
ATOM   2116 C CE  . LYS B 2 22  ? 13.599  31.305 5.893  1.00 126.93 ? 22   LYS B CE  1 
ATOM   2117 N NZ  . LYS B 2 22  ? 14.453  31.832 4.789  1.00 132.31 ? 22   LYS B NZ  1 
ATOM   2118 N N   . ALA B 2 23  ? 10.384  28.863 9.288  1.00 106.21 ? 23   ALA B N   1 
ATOM   2119 C CA  . ALA B 2 23  ? 9.183   29.663 9.527  1.00 106.67 ? 23   ALA B CA  1 
ATOM   2120 C C   . ALA B 2 23  ? 9.489   31.109 9.916  1.00 112.22 ? 23   ALA B C   1 
ATOM   2121 O O   . ALA B 2 23  ? 10.643  31.477 10.138 1.00 111.61 ? 23   ALA B O   1 
ATOM   2122 C CB  . ALA B 2 23  ? 8.314   29.007 10.590 1.00 107.37 ? 23   ALA B CB  1 
ATOM   2123 N N   . ARG B 2 24  ? 8.439   31.922 10.001 1.00 110.35 ? 24   ARG B N   1 
ATOM   2124 C CA  . ARG B 2 24  ? 8.568   33.300 10.460 1.00 111.10 ? 24   ARG B CA  1 
ATOM   2125 C C   . ARG B 2 24  ? 7.990   33.440 11.863 1.00 117.42 ? 24   ARG B C   1 
ATOM   2126 O O   . ARG B 2 24  ? 7.179   32.620 12.293 1.00 117.15 ? 24   ARG B O   1 
ATOM   2127 C CB  . ARG B 2 24  ? 7.841   34.260 9.513  1.00 111.34 ? 24   ARG B CB  1 
ATOM   2128 C CG  . ARG B 2 24  ? 6.318   34.169 9.578  1.00 120.88 ? 24   ARG B CG  1 
ATOM   2129 C CD  . ARG B 2 24  ? 5.653   35.336 8.855  1.00 129.39 ? 24   ARG B CD  1 
ATOM   2130 N NE  . ARG B 2 24  ? 5.813   36.597 9.576  1.00 137.04 ? 24   ARG B NE  1 
ATOM   2131 C CZ  . ARG B 2 24  ? 5.326   37.765 9.165  1.00 149.52 ? 24   ARG B CZ  1 
ATOM   2132 N NH1 . ARG B 2 24  ? 4.645   37.841 8.029  1.00 137.31 ? 24   ARG B NH1 1 
ATOM   2133 N NH2 . ARG B 2 24  ? 5.521   38.860 9.890  1.00 134.60 ? 24   ARG B NH2 1 
ATOM   2134 N N   . ASP B 2 25  ? 8.416   34.480 12.573 1.00 115.58 ? 25   ASP B N   1 
ATOM   2135 C CA  . ASP B 2 25  ? 7.839   34.815 13.870 1.00 116.04 ? 25   ASP B CA  1 
ATOM   2136 C C   . ASP B 2 25  ? 6.819   35.933 13.675 1.00 121.36 ? 25   ASP B C   1 
ATOM   2137 O O   . ASP B 2 25  ? 7.181   37.102 13.557 1.00 121.03 ? 25   ASP B O   1 
ATOM   2138 C CB  . ASP B 2 25  ? 8.939   35.262 14.838 1.00 117.85 ? 25   ASP B CB  1 
ATOM   2139 C CG  . ASP B 2 25  ? 8.450   35.370 16.270 1.00 127.30 ? 25   ASP B CG  1 
ATOM   2140 O OD1 . ASP B 2 25  ? 9.260   35.142 17.194 1.00 127.56 ? 25   ASP B OD1 1 
ATOM   2141 O OD2 . ASP B 2 25  ? 7.253   35.662 16.472 1.00 133.25 ? 25   ASP B OD2 1 
ATOM   2142 N N   . PRO B 2 26  ? 5.526   35.577 13.601 1.00 118.76 ? 26   PRO B N   1 
ATOM   2143 C CA  . PRO B 2 26  ? 4.468   36.531 13.251 1.00 118.83 ? 26   PRO B CA  1 
ATOM   2144 C C   . PRO B 2 26  ? 4.533   37.848 14.022 1.00 123.14 ? 26   PRO B C   1 
ATOM   2145 O O   . PRO B 2 26  ? 4.639   38.919 13.420 1.00 122.71 ? 26   PRO B O   1 
ATOM   2146 C CB  . PRO B 2 26  ? 3.190   35.766 13.589 1.00 120.57 ? 26   PRO B CB  1 
ATOM   2147 C CG  . PRO B 2 26  ? 3.557   34.338 13.366 1.00 124.85 ? 26   PRO B CG  1 
ATOM   2148 C CD  . PRO B 2 26  ? 4.997   34.215 13.794 1.00 120.33 ? 26   PRO B CD  1 
ATOM   2149 N N   . HIS B 2 27  ? 4.483   37.770 15.349 1.00 119.97 ? 27   HIS B N   1 
ATOM   2150 C CA  . HIS B 2 27  ? 4.460   38.976 16.174 1.00 119.84 ? 27   HIS B CA  1 
ATOM   2151 C C   . HIS B 2 27  ? 5.855   39.520 16.488 1.00 122.48 ? 27   HIS B C   1 
ATOM   2152 O O   . HIS B 2 27  ? 6.010   40.430 17.305 1.00 122.10 ? 27   HIS B O   1 
ATOM   2153 C CB  . HIS B 2 27  ? 3.646   38.760 17.453 1.00 120.90 ? 27   HIS B CB  1 
ATOM   2154 C CG  . HIS B 2 27  ? 4.460   38.318 18.627 1.00 124.53 ? 27   HIS B CG  1 
ATOM   2155 N ND1 . HIS B 2 27  ? 5.414   37.325 18.543 1.00 126.40 ? 27   HIS B ND1 1 
ATOM   2156 C CD2 . HIS B 2 27  ? 4.462   38.733 19.916 1.00 126.46 ? 27   HIS B CD2 1 
ATOM   2157 C CE1 . HIS B 2 27  ? 5.966   37.148 19.729 1.00 125.94 ? 27   HIS B CE1 1 
ATOM   2158 N NE2 . HIS B 2 27  ? 5.407   37.991 20.581 1.00 126.27 ? 27   HIS B NE2 1 
ATOM   2159 N N   . SER B 2 28  ? 6.863   38.961 15.825 1.00 117.89 ? 28   SER B N   1 
ATOM   2160 C CA  . SER B 2 28  ? 8.207   39.528 15.828 1.00 117.14 ? 28   SER B CA  1 
ATOM   2161 C C   . SER B 2 28  ? 8.599   39.935 14.412 1.00 119.98 ? 28   SER B C   1 
ATOM   2162 O O   . SER B 2 28  ? 9.312   40.918 14.211 1.00 119.62 ? 28   SER B O   1 
ATOM   2163 C CB  . SER B 2 28  ? 9.219   38.515 16.368 1.00 120.29 ? 28   SER B CB  1 
ATOM   2164 O OG  . SER B 2 28  ? 10.525  38.808 15.903 1.00 128.09 ? 28   SER B OG  1 
ATOM   2165 N N   . GLY B 2 29  ? 8.116   39.176 13.434 1.00 115.49 ? 29   GLY B N   1 
ATOM   2166 C CA  . GLY B 2 29  ? 8.451   39.388 12.039 1.00 114.73 ? 29   GLY B CA  1 
ATOM   2167 C C   . GLY B 2 29  ? 9.898   39.046 11.743 1.00 117.07 ? 29   GLY B C   1 
ATOM   2168 O O   . GLY B 2 29  ? 10.636  39.864 11.197 1.00 116.85 ? 29   GLY B O   1 
ATOM   2169 N N   . HIS B 2 30  ? 10.309  37.840 12.123 1.00 112.18 ? 30   HIS B N   1 
ATOM   2170 C CA  . HIS B 2 30  ? 11.663  37.362 11.851 1.00 111.23 ? 30   HIS B CA  1 
ATOM   2171 C C   . HIS B 2 30  ? 11.643  35.924 11.340 1.00 111.96 ? 30   HIS B C   1 
ATOM   2172 O O   . HIS B 2 30  ? 10.599  35.272 11.347 1.00 111.47 ? 30   HIS B O   1 
ATOM   2173 C CB  . HIS B 2 30  ? 12.538  37.462 13.107 1.00 112.22 ? 30   HIS B CB  1 
ATOM   2174 C CG  . HIS B 2 30  ? 13.277  38.761 13.232 1.00 115.72 ? 30   HIS B CG  1 
ATOM   2175 N ND1 . HIS B 2 30  ? 14.651  38.841 13.174 1.00 117.50 ? 30   HIS B ND1 1 
ATOM   2176 C CD2 . HIS B 2 30  ? 12.832  40.027 13.417 1.00 117.48 ? 30   HIS B CD2 1 
ATOM   2177 C CE1 . HIS B 2 30  ? 15.023  40.103 13.313 1.00 116.90 ? 30   HIS B CE1 1 
ATOM   2178 N NE2 . HIS B 2 30  ? 13.939  40.842 13.461 1.00 117.23 ? 30   HIS B NE2 1 
ATOM   2179 N N   . PHE B 2 31  ? 12.798  35.439 10.893 1.00 106.05 ? 31   PHE B N   1 
ATOM   2180 C CA  . PHE B 2 31  ? 12.929  34.058 10.430 1.00 104.70 ? 31   PHE B CA  1 
ATOM   2181 C C   . PHE B 2 31  ? 13.331  33.118 11.560 1.00 104.64 ? 31   PHE B C   1 
ATOM   2182 O O   . PHE B 2 31  ? 14.152  33.468 12.407 1.00 104.21 ? 31   PHE B O   1 
ATOM   2183 C CB  . PHE B 2 31  ? 13.952  33.963 9.296  1.00 106.74 ? 31   PHE B CB  1 
ATOM   2184 C CG  . PHE B 2 31  ? 13.428  34.416 7.965  1.00 108.57 ? 31   PHE B CG  1 
ATOM   2185 C CD1 . PHE B 2 31  ? 14.063  35.428 7.263  1.00 111.89 ? 31   PHE B CD1 1 
ATOM   2186 C CD2 . PHE B 2 31  ? 12.308  33.820 7.408  1.00 110.88 ? 31   PHE B CD2 1 
ATOM   2187 C CE1 . PHE B 2 31  ? 13.589  35.842 6.033  1.00 112.86 ? 31   PHE B CE1 1 
ATOM   2188 C CE2 . PHE B 2 31  ? 11.828  34.231 6.179  1.00 113.84 ? 31   PHE B CE2 1 
ATOM   2189 C CZ  . PHE B 2 31  ? 12.470  35.242 5.490  1.00 111.97 ? 31   PHE B CZ  1 
ATOM   2190 N N   . VAL B 2 32  ? 12.794  31.902 11.529 1.00 98.09  ? 32   VAL B N   1 
ATOM   2191 C CA  . VAL B 2 32  ? 13.074  30.904 12.559 1.00 96.23  ? 32   VAL B CA  1 
ATOM   2192 C C   . VAL B 2 32  ? 13.252  29.507 11.964 1.00 96.02  ? 32   VAL B C   1 
ATOM   2193 O O   . VAL B 2 32  ? 12.479  29.092 11.103 1.00 95.25  ? 32   VAL B O   1 
ATOM   2194 C CB  . VAL B 2 32  ? 11.979  30.903 13.637 1.00 100.05 ? 32   VAL B CB  1 
ATOM   2195 C CG1 . VAL B 2 32  ? 11.897  29.545 14.295 1.00 99.98  ? 32   VAL B CG1 1 
ATOM   2196 C CG2 . VAL B 2 32  ? 12.238  31.989 14.669 1.00 99.78  ? 32   VAL B CG2 1 
ATOM   2197 N N   . ALA B 2 33  ? 14.238  28.768 12.466 1.00 89.77  ? 33   ALA B N   1 
ATOM   2198 C CA  . ALA B 2 33  ? 14.522  27.416 11.981 1.00 88.13  ? 33   ALA B CA  1 
ATOM   2199 C C   . ALA B 2 33  ? 13.912  26.318 12.858 1.00 88.26  ? 33   ALA B C   1 
ATOM   2200 O O   . ALA B 2 33  ? 14.604  25.712 13.673 1.00 87.54  ? 33   ALA B O   1 
ATOM   2201 C CB  . ALA B 2 33  ? 16.025  27.208 11.844 1.00 88.83  ? 33   ALA B CB  1 
ATOM   2202 N N   . LEU B 2 34  ? 12.634  26.026 12.634 1.00 82.36  ? 34   LEU B N   1 
ATOM   2203 C CA  . LEU B 2 34  ? 11.920  25.006 13.399 1.00 80.98  ? 34   LEU B CA  1 
ATOM   2204 C C   . LEU B 2 34  ? 12.449  23.596 13.148 1.00 83.22  ? 34   LEU B C   1 
ATOM   2205 O O   . LEU B 2 34  ? 12.069  22.950 12.175 1.00 82.86  ? 34   LEU B O   1 
ATOM   2206 C CB  . LEU B 2 34  ? 10.425  25.039 13.071 1.00 80.81  ? 34   LEU B CB  1 
ATOM   2207 C CG  . LEU B 2 34  ? 9.679   26.357 13.266 1.00 85.33  ? 34   LEU B CG  1 
ATOM   2208 C CD1 . LEU B 2 34  ? 8.189   26.163 13.039 1.00 85.34  ? 34   LEU B CD1 1 
ATOM   2209 C CD2 . LEU B 2 34  ? 9.942   26.913 14.650 1.00 88.15  ? 34   LEU B CD2 1 
ATOM   2210 N N   . LYS B 2 35  ? 13.286  23.105 14.053 1.00 78.44  ? 35   LYS B N   1 
ATOM   2211 C CA  . LYS B 2 35  ? 13.700  21.704 14.038 1.00 77.52  ? 35   LYS B CA  1 
ATOM   2212 C C   . LYS B 2 35  ? 12.718  20.905 14.903 1.00 80.58  ? 35   LYS B C   1 
ATOM   2213 O O   . LYS B 2 35  ? 11.673  21.425 15.301 1.00 80.10  ? 35   LYS B O   1 
ATOM   2214 C CB  . LYS B 2 35  ? 15.123  21.579 14.585 1.00 79.63  ? 35   LYS B CB  1 
ATOM   2215 C CG  . LYS B 2 35  ? 15.910  20.401 14.045 1.00 88.41  ? 35   LYS B CG  1 
ATOM   2216 C CD  . LYS B 2 35  ? 17.379  20.482 14.455 1.00 91.46  ? 35   LYS B CD  1 
ATOM   2217 C CE  . LYS B 2 35  ? 18.198  21.326 13.486 1.00 92.21  ? 35   LYS B CE  1 
ATOM   2218 N NZ  . LYS B 2 35  ? 17.636  22.691 13.298 1.00 96.74  ? 35   LYS B NZ  1 
ATOM   2219 N N   . SER B 2 36  ? 13.029  19.643 15.184 1.00 76.44  ? 36   SER B N   1 
ATOM   2220 C CA  . SER B 2 36  ? 12.128  18.829 16.001 1.00 75.86  ? 36   SER B CA  1 
ATOM   2221 C C   . SER B 2 36  ? 12.720  17.501 16.468 1.00 78.62  ? 36   SER B C   1 
ATOM   2222 O O   . SER B 2 36  ? 13.770  17.076 15.988 1.00 78.56  ? 36   SER B O   1 
ATOM   2223 C CB  . SER B 2 36  ? 10.795  18.599 15.288 1.00 78.98  ? 36   SER B CB  1 
ATOM   2224 O OG  . SER B 2 36  ? 9.873   17.954 16.149 1.00 86.82  ? 36   SER B OG  1 
ATOM   2225 N N   . VAL B 2 37  ? 12.042  16.860 17.417 1.00 73.74  ? 37   VAL B N   1 
ATOM   2226 C CA  . VAL B 2 37  ? 12.515  15.599 17.981 1.00 72.99  ? 37   VAL B CA  1 
ATOM   2227 C C   . VAL B 2 37  ? 11.422  14.850 18.743 1.00 75.69  ? 37   VAL B C   1 
ATOM   2228 O O   . VAL B 2 37  ? 10.480  15.455 19.261 1.00 74.99  ? 37   VAL B O   1 
ATOM   2229 C CB  . VAL B 2 37  ? 13.761  15.806 18.861 1.00 76.89  ? 37   VAL B CB  1 
ATOM   2230 C CG1 . VAL B 2 37  ? 13.398  16.566 20.127 1.00 76.61  ? 37   VAL B CG1 1 
ATOM   2231 C CG2 . VAL B 2 37  ? 14.406  14.467 19.196 1.00 76.75  ? 37   VAL B CG2 1 
ATOM   2232 N N   . ARG B 2 38  ? 11.546  13.525 18.785 1.00 71.68  ? 38   ARG B N   1 
ATOM   2233 C CA  . ARG B 2 38  ? 10.644  12.683 19.570 1.00 70.90  ? 38   ARG B CA  1 
ATOM   2234 C C   . ARG B 2 38  ? 11.388  12.143 20.785 1.00 71.55  ? 38   ARG B C   1 
ATOM   2235 O O   . ARG B 2 38  ? 12.537  11.706 20.682 1.00 70.96  ? 38   ARG B O   1 
ATOM   2236 C CB  . ARG B 2 38  ? 10.115  11.506 18.734 1.00 72.57  ? 38   ARG B CB  1 
ATOM   2237 C CG  . ARG B 2 38  ? 9.549   11.888 17.366 1.00 86.26  ? 38   ARG B CG  1 
ATOM   2238 C CD  . ARG B 2 38  ? 8.132   12.452 17.457 1.00 99.01  ? 38   ARG B CD  1 
ATOM   2239 N NE  . ARG B 2 38  ? 7.107   11.408 17.455 1.00 109.60 ? 38   ARG B NE  1 
ATOM   2240 C CZ  . ARG B 2 38  ? 6.517   10.938 16.357 1.00 123.82 ? 38   ARG B CZ  1 
ATOM   2241 N NH1 . ARG B 2 38  ? 6.854   11.410 15.164 1.00 108.97 ? 38   ARG B NH1 1 
ATOM   2242 N NH2 . ARG B 2 38  ? 5.592   9.990  16.451 1.00 112.96 ? 38   ARG B NH2 1 
ATOM   2243 N N   . VAL B 2 39  ? 10.739  12.215 21.939 1.00 65.73  ? 39   VAL B N   1 
ATOM   2244 C CA  . VAL B 2 39  ? 11.282  11.651 23.164 1.00 64.50  ? 39   VAL B CA  1 
ATOM   2245 C C   . VAL B 2 39  ? 10.167  10.863 23.827 1.00 66.84  ? 39   VAL B C   1 
ATOM   2246 O O   . VAL B 2 39  ? 8.989   11.137 23.599 1.00 66.47  ? 39   VAL B O   1 
ATOM   2247 C CB  . VAL B 2 39  ? 11.838  12.751 24.101 1.00 68.28  ? 39   VAL B CB  1 
ATOM   2248 C CG1 . VAL B 2 39  ? 13.055  13.430 23.479 1.00 68.02  ? 39   VAL B CG1 1 
ATOM   2249 C CG2 . VAL B 2 39  ? 10.757  13.778 24.427 1.00 68.05  ? 39   VAL B CG2 1 
ATOM   2250 N N   . PRO B 2 40  ? 10.522  9.871  24.656 1.00 62.50  ? 40   PRO B N   1 
ATOM   2251 C CA  . PRO B 2 40  ? 9.541   8.996  25.309 1.00 61.99  ? 40   PRO B CA  1 
ATOM   2252 C C   . PRO B 2 40  ? 8.839   9.636  26.504 1.00 64.37  ? 40   PRO B C   1 
ATOM   2253 O O   . PRO B 2 40  ? 9.471   10.263 27.353 1.00 63.35  ? 40   PRO B O   1 
ATOM   2254 C CB  . PRO B 2 40  ? 10.387  7.810  25.771 1.00 63.84  ? 40   PRO B CB  1 
ATOM   2255 C CG  . PRO B 2 40  ? 11.749  8.377  25.964 1.00 68.29  ? 40   PRO B CG  1 
ATOM   2256 C CD  . PRO B 2 40  ? 11.909  9.474  24.952 1.00 63.88  ? 40   PRO B CD  1 
ATOM   2257 N N   . ASN B 2 41  ? 7.530   9.429  26.585 1.00 60.58  ? 41   ASN B N   1 
ATOM   2258 C CA  . ASN B 2 41  ? 6.742   9.929  27.702 1.00 60.27  ? 41   ASN B CA  1 
ATOM   2259 C C   . ASN B 2 41  ? 6.748   8.944  28.869 1.00 66.05  ? 41   ASN B C   1 
ATOM   2260 O O   . ASN B 2 41  ? 5.814   8.157  29.030 1.00 66.12  ? 41   ASN B O   1 
ATOM   2261 C CB  . ASN B 2 41  ? 5.304   10.198 27.258 1.00 57.41  ? 41   ASN B CB  1 
ATOM   2262 C CG  . ASN B 2 41  ? 4.435   10.705 28.386 1.00 73.48  ? 41   ASN B CG  1 
ATOM   2263 O OD1 . ASN B 2 41  ? 3.210   10.590 28.344 1.00 64.82  ? 41   ASN B OD1 1 
ATOM   2264 N ND2 . ASN B 2 41  ? 5.067   11.267 29.410 1.00 66.14  ? 41   ASN B ND2 1 
ATOM   2265 N N   . GLY B 2 42  ? 7.795   8.995  29.688 1.00 63.52  ? 42   GLY B N   1 
ATOM   2266 C CA  . GLY B 2 42  ? 7.910   8.143  30.860 1.00 63.71  ? 42   GLY B CA  1 
ATOM   2267 C C   . GLY B 2 42  ? 6.725   8.243  31.807 1.00 68.67  ? 42   GLY B C   1 
ATOM   2268 O O   . GLY B 2 42  ? 5.749   8.953  31.542 1.00 68.17  ? 42   GLY B O   1 
ATOM   2269 N N   . GLU B 2 43  ? 6.790   7.500  32.907 1.00 65.85  ? 43   GLU B N   1 
ATOM   2270 C CA  . GLU B 2 43  ? 5.771   7.614  33.942 1.00 65.68  ? 43   GLU B CA  1 
ATOM   2271 C C   . GLU B 2 43  ? 6.142   8.789  34.836 1.00 68.06  ? 43   GLU B C   1 
ATOM   2272 O O   . GLU B 2 43  ? 5.321   9.292  35.605 1.00 67.10  ? 43   GLU B O   1 
ATOM   2273 C CB  . GLU B 2 43  ? 5.682   6.323  34.758 1.00 67.26  ? 43   GLU B CB  1 
ATOM   2274 C CG  . GLU B 2 43  ? 4.333   6.108  35.440 1.00 78.52  ? 43   GLU B CG  1 
ATOM   2275 C CD  . GLU B 2 43  ? 4.069   4.646  35.765 1.00 103.60 ? 43   GLU B CD  1 
ATOM   2276 O OE1 . GLU B 2 43  ? 5.040   3.903  36.032 1.00 99.68  ? 43   GLU B OE1 1 
ATOM   2277 O OE2 . GLU B 2 43  ? 2.889   4.238  35.741 1.00 100.08 ? 43   GLU B OE2 1 
ATOM   2278 N N   . GLU B 2 44  ? 7.384   9.240  34.691 1.00 64.06  ? 44   GLU B N   1 
ATOM   2279 C CA  . GLU B 2 44  ? 7.885   10.388 35.431 1.00 63.50  ? 44   GLU B CA  1 
ATOM   2280 C C   . GLU B 2 44  ? 7.994   11.608 34.517 1.00 65.49  ? 44   GLU B C   1 
ATOM   2281 O O   . GLU B 2 44  ? 8.843   12.472 34.722 1.00 64.99  ? 44   GLU B O   1 
ATOM   2282 C CB  . GLU B 2 44  ? 9.243   10.060 36.052 1.00 65.03  ? 44   GLU B CB  1 
ATOM   2283 C CG  . GLU B 2 44  ? 9.425   10.604 37.458 1.00 76.45  ? 44   GLU B CG  1 
ATOM   2284 C CD  . GLU B 2 44  ? 8.389   10.068 38.433 1.00 96.73  ? 44   GLU B CD  1 
ATOM   2285 O OE1 . GLU B 2 44  ? 8.001   8.884  38.312 1.00 90.41  ? 44   GLU B OE1 1 
ATOM   2286 O OE2 . GLU B 2 44  ? 7.978   10.829 39.334 1.00 90.36  ? 44   GLU B OE2 1 
ATOM   2287 N N   . GLY B 2 45  ? 7.153   11.644 33.486 1.00 60.83  ? 48   GLY B N   1 
ATOM   2288 C CA  . GLY B 2 45  ? 6.998   12.791 32.608 1.00 60.09  ? 48   GLY B CA  1 
ATOM   2289 C C   . GLY B 2 45  ? 8.119   12.983 31.607 1.00 63.09  ? 48   GLY B C   1 
ATOM   2290 O O   . GLY B 2 45  ? 8.625   12.024 31.031 1.00 62.50  ? 48   GLY B O   1 
ATOM   2291 N N   . LEU B 2 46  ? 8.483   14.242 31.379 1.00 59.57  ? 49   LEU B N   1 
ATOM   2292 C CA  . LEU B 2 46  ? 9.596   14.587 30.500 1.00 59.22  ? 49   LEU B CA  1 
ATOM   2293 C C   . LEU B 2 46  ? 10.879  13.876 30.907 1.00 63.35  ? 49   LEU B C   1 
ATOM   2294 O O   . LEU B 2 46  ? 11.280  13.914 32.070 1.00 62.68  ? 49   LEU B O   1 
ATOM   2295 C CB  . LEU B 2 46  ? 9.834   16.094 30.520 1.00 59.03  ? 49   LEU B CB  1 
ATOM   2296 C CG  . LEU B 2 46  ? 8.725   16.933 29.900 1.00 63.28  ? 49   LEU B CG  1 
ATOM   2297 C CD1 . LEU B 2 46  ? 9.011   18.402 30.129 1.00 63.36  ? 49   LEU B CD1 1 
ATOM   2298 C CD2 . LEU B 2 46  ? 8.629   16.626 28.420 1.00 65.10  ? 49   LEU B CD2 1 
ATOM   2299 N N   . PRO B 2 47  ? 11.541  13.220 29.944 1.00 60.29  ? 50   PRO B N   1 
ATOM   2300 C CA  . PRO B 2 47  ? 12.840  12.597 30.206 1.00 60.16  ? 50   PRO B CA  1 
ATOM   2301 C C   . PRO B 2 47  ? 13.761  13.566 30.927 1.00 64.01  ? 50   PRO B C   1 
ATOM   2302 O O   . PRO B 2 47  ? 13.991  14.677 30.457 1.00 63.26  ? 50   PRO B O   1 
ATOM   2303 C CB  . PRO B 2 47  ? 13.371  12.309 28.803 1.00 61.92  ? 50   PRO B CB  1 
ATOM   2304 C CG  . PRO B 2 47  ? 12.147  12.097 27.982 1.00 66.20  ? 50   PRO B CG  1 
ATOM   2305 C CD  . PRO B 2 47  ? 11.077  12.981 28.565 1.00 61.77  ? 50   PRO B CD  1 
ATOM   2306 N N   . ILE B 2 48  ? 14.208  13.167 32.112 1.00 61.30  ? 51   ILE B N   1 
ATOM   2307 C CA  . ILE B 2 48  ? 15.086  13.994 32.933 1.00 61.25  ? 51   ILE B CA  1 
ATOM   2308 C C   . ILE B 2 48  ? 16.228  14.564 32.115 1.00 65.66  ? 51   ILE B C   1 
ATOM   2309 O O   . ILE B 2 48  ? 16.663  15.688 32.332 1.00 65.52  ? 51   ILE B O   1 
ATOM   2310 C CB  . ILE B 2 48  ? 15.635  13.203 34.125 1.00 64.45  ? 51   ILE B CB  1 
ATOM   2311 C CG1 . ILE B 2 48  ? 14.523  12.381 34.770 1.00 65.04  ? 51   ILE B CG1 1 
ATOM   2312 C CG2 . ILE B 2 48  ? 16.274  14.137 35.127 1.00 65.76  ? 51   ILE B CG2 1 
ATOM   2313 C CD1 . ILE B 2 48  ? 13.181  13.072 34.764 1.00 73.70  ? 51   ILE B CD1 1 
ATOM   2314 N N   . SER B 2 49  ? 16.694  13.781 31.154 1.00 62.65  ? 52   SER B N   1 
ATOM   2315 C CA  . SER B 2 49  ? 17.880  14.119 30.383 1.00 62.40  ? 52   SER B CA  1 
ATOM   2316 C C   . SER B 2 49  ? 17.533  15.082 29.254 1.00 65.26  ? 52   SER B C   1 
ATOM   2317 O O   . SER B 2 49  ? 18.404  15.743 28.699 1.00 64.97  ? 52   SER B O   1 
ATOM   2318 C CB  . SER B 2 49  ? 18.484  12.836 29.814 1.00 66.40  ? 52   SER B CB  1 
ATOM   2319 O OG  . SER B 2 49  ? 18.132  11.722 30.626 1.00 75.40  ? 52   SER B OG  1 
ATOM   2320 N N   . THR B 2 50  ? 16.251  15.143 28.912 1.00 61.10  ? 53   THR B N   1 
ATOM   2321 C CA  . THR B 2 50  ? 15.769  16.018 27.846 1.00 60.41  ? 53   THR B CA  1 
ATOM   2322 C C   . THR B 2 50  ? 15.531  17.424 28.379 1.00 62.26  ? 53   THR B C   1 
ATOM   2323 O O   . THR B 2 50  ? 15.901  18.415 27.750 1.00 61.93  ? 53   THR B O   1 
ATOM   2324 C CB  . THR B 2 50  ? 14.482  15.459 27.217 1.00 69.59  ? 53   THR B CB  1 
ATOM   2325 O OG1 . THR B 2 50  ? 14.788  14.293 26.438 1.00 71.45  ? 53   THR B OG1 1 
ATOM   2326 C CG2 . THR B 2 50  ? 13.815  16.509 26.345 1.00 66.96  ? 53   THR B CG2 1 
ATOM   2327 N N   . VAL B 2 51  ? 14.868  17.495 29.527 1.00 57.03  ? 54   VAL B N   1 
ATOM   2328 C CA  . VAL B 2 51  ? 14.671  18.752 30.218 1.00 56.15  ? 54   VAL B CA  1 
ATOM   2329 C C   . VAL B 2 51  ? 16.017  19.413 30.515 1.00 58.54  ? 54   VAL B C   1 
ATOM   2330 O O   . VAL B 2 51  ? 16.186  20.608 30.281 1.00 57.83  ? 54   VAL B O   1 
ATOM   2331 C CB  . VAL B 2 51  ? 13.836  18.556 31.500 1.00 60.12  ? 54   VAL B CB  1 
ATOM   2332 C CG1 . VAL B 2 51  ? 12.825  17.439 31.311 1.00 59.82  ? 54   VAL B CG1 1 
ATOM   2333 C CG2 . VAL B 2 51  ? 14.732  18.273 32.689 1.00 60.05  ? 54   VAL B CG2 1 
ATOM   2334 N N   . ARG B 2 52  ? 16.982  18.626 30.990 1.00 54.60  ? 55   ARG B N   1 
ATOM   2335 C CA  . ARG B 2 52  ? 18.293  19.158 31.374 1.00 54.36  ? 55   ARG B CA  1 
ATOM   2336 C C   . ARG B 2 52  ? 19.098  19.632 30.164 1.00 58.88  ? 55   ARG B C   1 
ATOM   2337 O O   . ARG B 2 52  ? 19.713  20.702 30.190 1.00 58.29  ? 55   ARG B O   1 
ATOM   2338 C CB  . ARG B 2 52  ? 19.109  18.129 32.169 1.00 54.12  ? 55   ARG B CB  1 
ATOM   2339 C CG  . ARG B 2 52  ? 18.420  17.524 33.400 1.00 62.02  ? 55   ARG B CG  1 
ATOM   2340 C CD  . ARG B 2 52  ? 19.451  17.003 34.405 1.00 67.93  ? 55   ARG B CD  1 
ATOM   2341 N NE  . ARG B 2 52  ? 19.201  15.624 34.831 1.00 78.56  ? 55   ARG B NE  1 
ATOM   2342 C CZ  . ARG B 2 52  ? 18.963  15.240 36.085 1.00 91.48  ? 55   ARG B CZ  1 
ATOM   2343 N NH1 . ARG B 2 52  ? 18.919  16.132 37.062 1.00 79.08  ? 55   ARG B NH1 1 
ATOM   2344 N NH2 . ARG B 2 52  ? 18.769  13.957 36.366 1.00 76.60  ? 55   ARG B NH2 1 
ATOM   2345 N N   . GLU B 2 53  ? 19.091  18.830 29.105 1.00 56.13  ? 56   GLU B N   1 
ATOM   2346 C CA  . GLU B 2 53  ? 19.822  19.160 27.887 1.00 56.21  ? 56   GLU B CA  1 
ATOM   2347 C C   . GLU B 2 53  ? 19.278  20.405 27.190 1.00 59.61  ? 56   GLU B C   1 
ATOM   2348 O O   . GLU B 2 53  ? 20.033  21.314 26.852 1.00 59.21  ? 56   GLU B O   1 
ATOM   2349 C CB  . GLU B 2 53  ? 19.812  17.975 26.921 1.00 57.77  ? 56   GLU B CB  1 
ATOM   2350 C CG  . GLU B 2 53  ? 20.607  16.779 27.405 1.00 69.32  ? 56   GLU B CG  1 
ATOM   2351 C CD  . GLU B 2 53  ? 22.075  17.092 27.585 1.00 95.43  ? 56   GLU B CD  1 
ATOM   2352 O OE1 . GLU B 2 53  ? 22.836  16.171 27.948 1.00 94.96  ? 56   GLU B OE1 1 
ATOM   2353 O OE2 . GLU B 2 53  ? 22.470  18.257 27.356 1.00 90.96  ? 56   GLU B OE2 1 
ATOM   2354 N N   . VAL B 2 54  ? 17.979  20.417 26.919 1.00 56.00  ? 57   VAL B N   1 
ATOM   2355 C CA  . VAL B 2 54  ? 17.344  21.578 26.306 1.00 55.96  ? 57   VAL B CA  1 
ATOM   2356 C C   . VAL B 2 54  ? 17.549  22.824 27.147 1.00 60.83  ? 57   VAL B C   1 
ATOM   2357 O O   . VAL B 2 54  ? 17.858  23.894 26.622 1.00 59.87  ? 57   VAL B O   1 
ATOM   2358 C CB  . VAL B 2 54  ? 15.853  21.347 26.083 1.00 59.77  ? 57   VAL B CB  1 
ATOM   2359 C CG1 . VAL B 2 54  ? 15.152  22.675 25.854 1.00 59.42  ? 57   VAL B CG1 1 
ATOM   2360 C CG2 . VAL B 2 54  ? 15.634  20.402 24.915 1.00 59.67  ? 57   VAL B CG2 1 
ATOM   2361 N N   . ALA B 2 55  ? 17.344  22.675 28.454 1.00 58.68  ? 58   ALA B N   1 
ATOM   2362 C CA  . ALA B 2 55  ? 17.441  23.786 29.392 1.00 58.75  ? 58   ALA B CA  1 
ATOM   2363 C C   . ALA B 2 55  ? 18.778  24.493 29.253 1.00 63.80  ? 58   ALA B C   1 
ATOM   2364 O O   . ALA B 2 55  ? 18.842  25.723 29.256 1.00 63.28  ? 58   ALA B O   1 
ATOM   2365 C CB  . ALA B 2 55  ? 17.251  23.292 30.814 1.00 59.46  ? 58   ALA B CB  1 
ATOM   2366 N N   . LEU B 2 56  ? 19.842  23.704 29.117 1.00 61.34  ? 59   LEU B N   1 
ATOM   2367 C CA  . LEU B 2 56  ? 21.192  24.241 28.996 1.00 61.58  ? 59   LEU B CA  1 
ATOM   2368 C C   . LEU B 2 56  ? 21.405  25.035 27.717 1.00 65.52  ? 59   LEU B C   1 
ATOM   2369 O O   . LEU B 2 56  ? 22.088  26.060 27.721 1.00 65.15  ? 59   LEU B O   1 
ATOM   2370 C CB  . LEU B 2 56  ? 22.227  23.126 29.106 1.00 61.90  ? 59   LEU B CB  1 
ATOM   2371 C CG  . LEU B 2 56  ? 22.343  22.524 30.506 1.00 67.62  ? 59   LEU B CG  1 
ATOM   2372 C CD1 . LEU B 2 56  ? 23.452  21.480 30.548 1.00 68.35  ? 59   LEU B CD1 1 
ATOM   2373 C CD2 . LEU B 2 56  ? 22.580  23.614 31.550 1.00 70.54  ? 59   LEU B CD2 1 
ATOM   2374 N N   . LEU B 2 57  ? 20.826  24.560 26.621 1.00 62.06  ? 60   LEU B N   1 
ATOM   2375 C CA  . LEU B 2 57  ? 20.932  25.267 25.352 1.00 61.90  ? 60   LEU B CA  1 
ATOM   2376 C C   . LEU B 2 57  ? 20.278  26.638 25.443 1.00 66.89  ? 60   LEU B C   1 
ATOM   2377 O O   . LEU B 2 57  ? 20.685  27.574 24.757 1.00 66.64  ? 60   LEU B O   1 
ATOM   2378 C CB  . LEU B 2 57  ? 20.307  24.458 24.216 1.00 61.75  ? 60   LEU B CB  1 
ATOM   2379 C CG  . LEU B 2 57  ? 20.998  23.148 23.828 1.00 65.73  ? 60   LEU B CG  1 
ATOM   2380 C CD1 . LEU B 2 57  ? 20.418  22.631 22.527 1.00 65.58  ? 60   LEU B CD1 1 
ATOM   2381 C CD2 . LEU B 2 57  ? 22.498  23.343 23.709 1.00 67.40  ? 60   LEU B CD2 1 
ATOM   2382 N N   . ARG B 2 58  ? 19.263  26.758 26.293 1.00 64.17  ? 61   ARG B N   1 
ATOM   2383 C CA  . ARG B 2 58  ? 18.644  28.056 26.541 1.00 64.32  ? 61   ARG B CA  1 
ATOM   2384 C C   . ARG B 2 58  ? 19.529  28.901 27.461 1.00 71.12  ? 61   ARG B C   1 
ATOM   2385 O O   . ARG B 2 58  ? 19.562  30.126 27.343 1.00 70.67  ? 61   ARG B O   1 
ATOM   2386 C CB  . ARG B 2 58  ? 17.251  27.886 27.143 1.00 62.20  ? 61   ARG B CB  1 
ATOM   2387 C CG  . ARG B 2 58  ? 16.350  26.937 26.380 1.00 63.86  ? 61   ARG B CG  1 
ATOM   2388 C CD  . ARG B 2 58  ? 15.689  27.596 25.183 1.00 61.94  ? 61   ARG B CD  1 
ATOM   2389 N NE  . ARG B 2 58  ? 14.622  28.522 25.559 1.00 60.95  ? 61   ARG B NE  1 
ATOM   2390 C CZ  . ARG B 2 58  ? 14.742  29.845 25.529 1.00 74.13  ? 61   ARG B CZ  1 
ATOM   2391 N NH1 . ARG B 2 58  ? 15.887  30.397 25.145 1.00 60.98  ? 61   ARG B NH1 1 
ATOM   2392 N NH2 . ARG B 2 58  ? 13.721  30.619 25.874 1.00 60.53  ? 61   ARG B NH2 1 
ATOM   2393 N N   . ARG B 2 59  ? 20.234  28.246 28.382 1.00 69.97  ? 62   ARG B N   1 
ATOM   2394 C CA  . ARG B 2 59  ? 21.299  28.905 29.137 1.00 70.97  ? 62   ARG B CA  1 
ATOM   2395 C C   . ARG B 2 59  ? 22.491  29.181 28.219 1.00 77.83  ? 62   ARG B C   1 
ATOM   2396 O O   . ARG B 2 59  ? 23.564  28.594 28.375 1.00 78.03  ? 62   ARG B O   1 
ATOM   2397 C CB  . ARG B 2 59  ? 21.752  28.055 30.334 1.00 71.13  ? 62   ARG B CB  1 
ATOM   2398 C CG  . ARG B 2 59  ? 22.914  28.680 31.117 1.00 80.23  ? 62   ARG B CG  1 
ATOM   2399 C CD  . ARG B 2 59  ? 23.589  27.697 32.068 1.00 89.25  ? 62   ARG B CD  1 
ATOM   2400 N NE  . ARG B 2 59  ? 22.935  27.641 33.373 1.00 100.60 ? 62   ARG B NE  1 
ATOM   2401 C CZ  . ARG B 2 59  ? 23.391  26.943 34.411 1.00 116.90 ? 62   ARG B CZ  1 
ATOM   2402 N NH1 . ARG B 2 59  ? 24.511  26.239 34.300 1.00 106.14 ? 62   ARG B NH1 1 
ATOM   2403 N NH2 . ARG B 2 59  ? 22.730  26.949 35.563 1.00 103.01 ? 62   ARG B NH2 1 
ATOM   2404 N N   . LEU B 2 60  ? 22.279  30.047 27.235 1.00 75.41  ? 63   LEU B N   1 
ATOM   2405 C CA  . LEU B 2 60  ? 23.320  30.407 26.283 1.00 75.60  ? 63   LEU B CA  1 
ATOM   2406 C C   . LEU B 2 60  ? 22.921  31.687 25.576 1.00 81.45  ? 63   LEU B C   1 
ATOM   2407 O O   . LEU B 2 60  ? 23.741  32.580 25.373 1.00 81.59  ? 63   LEU B O   1 
ATOM   2408 C CB  . LEU B 2 60  ? 23.511  29.302 25.248 1.00 75.48  ? 63   LEU B CB  1 
ATOM   2409 C CG  . LEU B 2 60  ? 24.377  28.119 25.663 1.00 80.19  ? 63   LEU B CG  1 
ATOM   2410 C CD1 . LEU B 2 60  ? 24.619  27.202 24.472 1.00 80.39  ? 63   LEU B CD1 1 
ATOM   2411 C CD2 . LEU B 2 60  ? 25.688  28.618 26.238 1.00 82.43  ? 63   LEU B CD2 1 
ATOM   2412 N N   . GLU B 2 61  ? 21.652  31.762 25.192 1.00 78.94  ? 64   GLU B N   1 
ATOM   2413 C CA  . GLU B 2 61  ? 21.131  32.931 24.501 1.00 79.35  ? 64   GLU B CA  1 
ATOM   2414 C C   . GLU B 2 61  ? 21.453  34.219 25.259 1.00 86.00  ? 64   GLU B C   1 
ATOM   2415 O O   . GLU B 2 61  ? 21.411  35.313 24.690 1.00 85.66  ? 64   GLU B O   1 
ATOM   2416 C CB  . GLU B 2 61  ? 19.624  32.796 24.300 1.00 80.48  ? 64   GLU B CB  1 
ATOM   2417 C CG  . GLU B 2 61  ? 19.032  33.854 23.402 1.00 89.00  ? 64   GLU B CG  1 
ATOM   2418 C CD  . GLU B 2 61  ? 17.556  33.643 23.159 1.00 105.70 ? 64   GLU B CD  1 
ATOM   2419 O OE1 . GLU B 2 61  ? 16.870  33.132 24.070 1.00 98.40  ? 64   GLU B OE1 1 
ATOM   2420 O OE2 . GLU B 2 61  ? 17.080  33.995 22.059 1.00 98.50  ? 64   GLU B OE2 1 
ATOM   2421 N N   . ALA B 2 62  ? 21.790  34.075 26.539 1.00 84.35  ? 65   ALA B N   1 
ATOM   2422 C CA  . ALA B 2 62  ? 22.148  35.211 27.383 1.00 84.73  ? 65   ALA B CA  1 
ATOM   2423 C C   . ALA B 2 62  ? 23.662  35.386 27.479 1.00 89.23  ? 65   ALA B C   1 
ATOM   2424 O O   . ALA B 2 62  ? 24.177  35.937 28.451 1.00 88.93  ? 65   ALA B O   1 
ATOM   2425 C CB  . ALA B 2 62  ? 21.535  35.059 28.769 1.00 85.56  ? 65   ALA B CB  1 
ATOM   2426 N N   . PHE B 2 63  ? 24.372  34.864 26.487 1.00 86.24  ? 66   PHE B N   1 
ATOM   2427 C CA  . PHE B 2 63  ? 25.782  35.177 26.304 1.00 86.47  ? 66   PHE B CA  1 
ATOM   2428 C C   . PHE B 2 63  ? 25.911  35.947 25.000 1.00 90.73  ? 66   PHE B C   1 
ATOM   2429 O O   . PHE B 2 63  ? 26.893  36.652 24.775 1.00 90.46  ? 66   PHE B O   1 
ATOM   2430 C CB  . PHE B 2 63  ? 26.616  33.898 26.219 1.00 88.49  ? 66   PHE B CB  1 
ATOM   2431 C CG  . PHE B 2 63  ? 26.915  33.271 27.550 1.00 90.22  ? 66   PHE B CG  1 
ATOM   2432 C CD1 . PHE B 2 63  ? 25.923  32.625 28.266 1.00 93.47  ? 66   PHE B CD1 1 
ATOM   2433 C CD2 . PHE B 2 63  ? 28.201  33.296 28.068 1.00 92.49  ? 66   PHE B CD2 1 
ATOM   2434 C CE1 . PHE B 2 63  ? 26.204  32.031 29.482 1.00 94.46  ? 66   PHE B CE1 1 
ATOM   2435 C CE2 . PHE B 2 63  ? 28.489  32.702 29.283 1.00 95.34  ? 66   PHE B CE2 1 
ATOM   2436 C CZ  . PHE B 2 63  ? 27.489  32.067 29.988 1.00 93.48  ? 66   PHE B CZ  1 
ATOM   2437 N N   . GLU B 2 64  ? 24.925  35.765 24.128 1.00 87.56  ? 67   GLU B N   1 
ATOM   2438 C CA  . GLU B 2 64  ? 24.882  36.463 22.850 1.00 87.55  ? 67   GLU B CA  1 
ATOM   2439 C C   . GLU B 2 64  ? 26.199  36.326 22.087 1.00 92.31  ? 67   GLU B C   1 
ATOM   2440 O O   . GLU B 2 64  ? 26.618  37.248 21.383 1.00 92.21  ? 67   GLU B O   1 
ATOM   2441 C CB  . GLU B 2 64  ? 24.557  37.936 23.077 1.00 88.80  ? 67   GLU B CB  1 
ATOM   2442 C CG  . GLU B 2 64  ? 23.570  38.169 24.201 1.00 97.32  ? 67   GLU B CG  1 
ATOM   2443 C CD  . GLU B 2 64  ? 23.282  39.634 24.419 1.00 114.21 ? 67   GLU B CD  1 
ATOM   2444 O OE1 . GLU B 2 64  ? 23.731  40.180 25.449 1.00 103.79 ? 67   GLU B OE1 1 
ATOM   2445 O OE2 . GLU B 2 64  ? 22.651  40.252 23.535 1.00 109.53 ? 67   GLU B OE2 1 
ATOM   2446 N N   . HIS B 2 65  ? 26.856  35.179 22.244 1.00 88.84  ? 68   HIS B N   1 
ATOM   2447 C CA  . HIS B 2 65  ? 28.097  34.904 21.528 1.00 88.33  ? 68   HIS B CA  1 
ATOM   2448 C C   . HIS B 2 65  ? 27.840  34.963 20.031 1.00 91.65  ? 68   HIS B C   1 
ATOM   2449 O O   . HIS B 2 65  ? 26.853  34.417 19.540 1.00 91.41  ? 68   HIS B O   1 
ATOM   2450 C CB  . HIS B 2 65  ? 28.652  33.531 21.907 1.00 88.93  ? 68   HIS B CB  1 
ATOM   2451 C CG  . HIS B 2 65  ? 30.103  33.360 21.581 1.00 92.20  ? 68   HIS B CG  1 
ATOM   2452 N ND1 . HIS B 2 65  ? 30.648  33.767 20.384 1.00 93.86  ? 68   HIS B ND1 1 
ATOM   2453 C CD2 . HIS B 2 65  ? 31.125  32.852 22.308 1.00 93.85  ? 68   HIS B CD2 1 
ATOM   2454 C CE1 . HIS B 2 65  ? 31.945  33.509 20.383 1.00 93.25  ? 68   HIS B CE1 1 
ATOM   2455 N NE2 . HIS B 2 65  ? 32.259  32.952 21.538 1.00 93.50  ? 68   HIS B NE2 1 
ATOM   2456 N N   . PRO B 2 66  ? 28.732  35.629 19.285 1.00 87.40  ? 69   PRO B N   1 
ATOM   2457 C CA  . PRO B 2 66  ? 28.484  35.842 17.856 1.00 86.80  ? 69   PRO B CA  1 
ATOM   2458 C C   . PRO B 2 66  ? 28.447  34.544 17.050 1.00 88.44  ? 69   PRO B C   1 
ATOM   2459 O O   . PRO B 2 66  ? 27.450  34.241 16.399 1.00 87.71  ? 69   PRO B O   1 
ATOM   2460 C CB  . PRO B 2 66  ? 29.666  36.712 17.421 1.00 88.68  ? 69   PRO B CB  1 
ATOM   2461 C CG  . PRO B 2 66  ? 30.133  37.374 18.672 1.00 93.20  ? 69   PRO B CG  1 
ATOM   2462 C CD  . PRO B 2 66  ? 29.918  36.364 19.753 1.00 88.79  ? 69   PRO B CD  1 
ATOM   2463 N N   . ASN B 2 67  ? 29.528  33.775 17.095 1.00 83.43  ? 70   ASN B N   1 
ATOM   2464 C CA  . ASN B 2 67  ? 29.613  32.586 16.262 1.00 82.74  ? 70   ASN B CA  1 
ATOM   2465 C C   . ASN B 2 67  ? 29.008  31.323 16.876 1.00 85.19  ? 70   ASN B C   1 
ATOM   2466 O O   . ASN B 2 67  ? 29.656  30.278 16.942 1.00 84.75  ? 70   ASN B O   1 
ATOM   2467 C CB  . ASN B 2 67  ? 31.035  32.360 15.736 1.00 83.47  ? 70   ASN B CB  1 
ATOM   2468 C CG  . ASN B 2 67  ? 32.099  32.724 16.749 1.00 100.44 ? 70   ASN B CG  1 
ATOM   2469 O OD1 . ASN B 2 67  ? 32.890  33.645 16.536 1.00 90.01  ? 70   ASN B OD1 1 
ATOM   2470 N ND2 . ASN B 2 67  ? 32.136  31.990 17.852 1.00 93.17  ? 70   ASN B ND2 1 
ATOM   2471 N N   . VAL B 2 68  ? 27.755  31.439 17.313 1.00 80.46  ? 71   VAL B N   1 
ATOM   2472 C CA  . VAL B 2 68  ? 26.921  30.292 17.681 1.00 79.35  ? 71   VAL B CA  1 
ATOM   2473 C C   . VAL B 2 68  ? 25.451  30.668 17.487 1.00 80.86  ? 71   VAL B C   1 
ATOM   2474 O O   . VAL B 2 68  ? 25.048  31.793 17.789 1.00 80.04  ? 71   VAL B O   1 
ATOM   2475 C CB  . VAL B 2 68  ? 27.158  29.835 19.140 1.00 83.33  ? 71   VAL B CB  1 
ATOM   2476 C CG1 . VAL B 2 68  ? 26.418  28.537 19.409 1.00 83.13  ? 71   VAL B CG1 1 
ATOM   2477 C CG2 . VAL B 2 68  ? 28.639  29.676 19.444 1.00 83.20  ? 71   VAL B CG2 1 
ATOM   2478 N N   . VAL B 2 69  ? 24.647  29.723 17.007 1.00 76.02  ? 72   VAL B N   1 
ATOM   2479 C CA  . VAL B 2 69  ? 23.213  29.958 16.826 1.00 74.87  ? 72   VAL B CA  1 
ATOM   2480 C C   . VAL B 2 69  ? 22.448  29.860 18.141 1.00 76.55  ? 72   VAL B C   1 
ATOM   2481 O O   . VAL B 2 69  ? 22.887  29.195 19.077 1.00 76.04  ? 72   VAL B O   1 
ATOM   2482 C CB  . VAL B 2 69  ? 22.601  29.044 15.750 1.00 78.55  ? 72   VAL B CB  1 
ATOM   2483 C CG1 . VAL B 2 69  ? 23.078  29.451 14.370 1.00 78.31  ? 72   VAL B CG1 1 
ATOM   2484 C CG2 . VAL B 2 69  ? 22.935  27.588 16.034 1.00 78.33  ? 72   VAL B CG2 1 
ATOM   2485 N N   . ARG B 2 70  ? 21.277  30.488 18.182 1.00 71.48  ? 73   ARG B N   1 
ATOM   2486 C CA  . ARG B 2 70  ? 20.509  30.615 19.413 1.00 70.57  ? 73   ARG B CA  1 
ATOM   2487 C C   . ARG B 2 70  ? 19.274  29.728 19.416 1.00 72.96  ? 73   ARG B C   1 
ATOM   2488 O O   . ARG B 2 70  ? 18.402  29.872 18.562 1.00 72.81  ? 73   ARG B O   1 
ATOM   2489 C CB  . ARG B 2 70  ? 20.029  32.054 19.585 1.00 70.78  ? 73   ARG B CB  1 
ATOM   2490 C CG  . ARG B 2 70  ? 21.103  33.091 19.798 1.00 81.38  ? 73   ARG B CG  1 
ATOM   2491 C CD  . ARG B 2 70  ? 20.445  34.458 19.817 1.00 93.54  ? 73   ARG B CD  1 
ATOM   2492 N NE  . ARG B 2 70  ? 21.369  35.541 20.130 1.00 106.64 ? 73   ARG B NE  1 
ATOM   2493 C CZ  . ARG B 2 70  ? 21.012  36.819 20.186 1.00 123.22 ? 73   ARG B CZ  1 
ATOM   2494 N NH1 . ARG B 2 70  ? 21.909  37.754 20.478 1.00 111.11 ? 73   ARG B NH1 1 
ATOM   2495 N NH2 . ARG B 2 70  ? 19.751  37.161 19.949 1.00 111.64 ? 73   ARG B NH2 1 
ATOM   2496 N N   . LEU B 2 71  ? 19.139  28.906 20.451 1.00 67.87  ? 74   LEU B N   1 
ATOM   2497 C CA  . LEU B 2 71  ? 17.866  28.257 20.726 1.00 66.78  ? 74   LEU B CA  1 
ATOM   2498 C C   . LEU B 2 71  ? 16.912  29.328 21.249 1.00 69.26  ? 74   LEU B C   1 
ATOM   2499 O O   . LEU B 2 71  ? 16.985  29.724 22.408 1.00 67.99  ? 74   LEU B O   1 
ATOM   2500 C CB  . LEU B 2 71  ? 18.045  27.144 21.760 1.00 66.65  ? 74   LEU B CB  1 
ATOM   2501 C CG  . LEU B 2 71  ? 17.103  25.939 21.679 1.00 70.86  ? 74   LEU B CG  1 
ATOM   2502 C CD1 . LEU B 2 71  ? 17.317  25.011 22.862 1.00 70.75  ? 74   LEU B CD1 1 
ATOM   2503 C CD2 . LEU B 2 71  ? 15.652  26.370 21.587 1.00 73.09  ? 74   LEU B CD2 1 
ATOM   2504 N N   . MET B 2 72  ? 16.055  29.826 20.363 1.00 66.21  ? 75   MET B N   1 
ATOM   2505 C CA  . MET B 2 72  ? 15.177  30.956 20.662 1.00 66.19  ? 75   MET B CA  1 
ATOM   2506 C C   . MET B 2 72  ? 13.964  30.556 21.493 1.00 66.84  ? 75   MET B C   1 
ATOM   2507 O O   . MET B 2 72  ? 13.473  31.334 22.308 1.00 66.14  ? 75   MET B O   1 
ATOM   2508 C CB  . MET B 2 72  ? 14.706  31.604 19.357 1.00 69.33  ? 75   MET B CB  1 
ATOM   2509 C CG  . MET B 2 72  ? 15.778  32.393 18.618 1.00 74.07  ? 75   MET B CG  1 
ATOM   2510 S SD  . MET B 2 72  ? 15.712  34.152 19.016 1.00 79.57  ? 75   MET B SD  1 
ATOM   2511 C CE  . MET B 2 72  ? 14.017  34.561 18.483 1.00 76.45  ? 75   MET B CE  1 
ATOM   2512 N N   . ASP B 2 73  ? 13.434  29.371 21.224 1.00 61.72  ? 76   ASP B N   1 
ATOM   2513 C CA  . ASP B 2 73  ? 12.271  28.870 21.944 1.00 60.67  ? 76   ASP B CA  1 
ATOM   2514 C C   . ASP B 2 73  ? 12.219  27.345 21.853 1.00 64.67  ? 76   ASP B C   1 
ATOM   2515 O O   . ASP B 2 73  ? 12.947  26.735 21.071 1.00 63.42  ? 76   ASP B O   1 
ATOM   2516 C CB  . ASP B 2 73  ? 10.984  29.490 21.387 1.00 61.63  ? 76   ASP B CB  1 
ATOM   2517 C CG  . ASP B 2 73  ? 9.773   29.191 22.246 1.00 65.91  ? 76   ASP B CG  1 
ATOM   2518 O OD1 . ASP B 2 73  ? 9.913   28.422 23.216 1.00 66.90  ? 76   ASP B OD1 1 
ATOM   2519 O OD2 . ASP B 2 73  ? 8.683   29.730 21.961 1.00 68.10  ? 76   ASP B OD2 1 
ATOM   2520 N N   . VAL B 2 74  ? 11.387  26.737 22.693 1.00 62.24  ? 77   VAL B N   1 
ATOM   2521 C CA  . VAL B 2 74  ? 11.184  25.295 22.681 1.00 62.49  ? 77   VAL B CA  1 
ATOM   2522 C C   . VAL B 2 74  ? 9.728   25.016 23.023 1.00 68.81  ? 77   VAL B C   1 
ATOM   2523 O O   . VAL B 2 74  ? 9.089   25.801 23.721 1.00 67.69  ? 77   VAL B O   1 
ATOM   2524 C CB  . VAL B 2 74  ? 12.135  24.583 23.663 1.00 66.02  ? 77   VAL B CB  1 
ATOM   2525 C CG1 . VAL B 2 74  ? 11.880  23.080 23.665 1.00 65.70  ? 77   VAL B CG1 1 
ATOM   2526 C CG2 . VAL B 2 74  ? 13.588  24.891 23.322 1.00 65.72  ? 77   VAL B CG2 1 
ATOM   2527 N N   . CYS B 2 75  ? 9.197   23.911 22.513 1.00 68.45  ? 78   CYS B N   1 
ATOM   2528 C CA  . CYS B 2 75  ? 7.804   23.564 22.764 1.00 69.53  ? 78   CYS B CA  1 
ATOM   2529 C C   . CYS B 2 75  ? 7.520   22.069 22.704 1.00 75.13  ? 78   CYS B C   1 
ATOM   2530 O O   . CYS B 2 75  ? 7.753   21.427 21.681 1.00 74.70  ? 78   CYS B O   1 
ATOM   2531 C CB  . CYS B 2 75  ? 6.883   24.298 21.799 1.00 70.17  ? 78   CYS B CB  1 
ATOM   2532 S SG  . CYS B 2 75  ? 5.144   24.156 22.244 1.00 74.27  ? 78   CYS B SG  1 
ATOM   2533 N N   . ALA B 2 76  ? 7.031   21.515 23.810 1.00 73.50  ? 79   ALA B N   1 
ATOM   2534 C CA  . ALA B 2 76  ? 6.568   20.129 23.831 1.00 74.39  ? 79   ALA B CA  1 
ATOM   2535 C C   . ALA B 2 76  ? 5.125   20.070 23.341 1.00 81.24  ? 79   ALA B C   1 
ATOM   2536 O O   . ALA B 2 76  ? 4.200   20.398 24.080 1.00 80.16  ? 79   ALA B O   1 
ATOM   2537 C CB  . ALA B 2 76  ? 6.687   19.545 25.230 1.00 75.02  ? 79   ALA B CB  1 
ATOM   2538 N N   . THR B 2 77  ? 4.942   19.659 22.089 1.00 81.04  ? 80   THR B N   1 
ATOM   2539 C CA  . THR B 2 77  ? 3.635   19.731 21.438 1.00 82.19  ? 80   THR B CA  1 
ATOM   2540 C C   . THR B 2 77  ? 2.751   18.521 21.729 1.00 89.49  ? 80   THR B C   1 
ATOM   2541 O O   . THR B 2 77  ? 1.726   18.635 22.399 1.00 89.10  ? 80   THR B O   1 
ATOM   2542 C CB  . THR B 2 77  ? 3.758   19.988 19.921 1.00 88.95  ? 80   THR B CB  1 
ATOM   2543 O OG1 . THR B 2 77  ? 4.516   18.936 19.311 1.00 88.60  ? 80   THR B OG1 1 
ATOM   2544 C CG2 . THR B 2 77  ? 4.439   21.321 19.658 1.00 86.85  ? 80   THR B CG2 1 
ATOM   2545 N N   . SER B 2 78  ? 3.138   17.362 21.212 1.00 88.61  ? 81   SER B N   1 
ATOM   2546 C CA  . SER B 2 78  ? 2.299   16.177 21.342 1.00 89.59  ? 81   SER B CA  1 
ATOM   2547 C C   . SER B 2 78  ? 2.642   15.338 22.564 1.00 95.71  ? 81   SER B C   1 
ATOM   2548 O O   . SER B 2 78  ? 3.718   14.755 22.635 1.00 95.31  ? 81   SER B O   1 
ATOM   2549 C CB  . SER B 2 78  ? 2.390   15.310 20.084 1.00 93.21  ? 81   SER B CB  1 
ATOM   2550 O OG  . SER B 2 78  ? 1.724   14.073 20.280 1.00 100.95 ? 81   SER B OG  1 
ATOM   2551 N N   . ARG B 2 79  ? 1.720   15.271 23.518 1.00 93.96  ? 82   ARG B N   1 
ATOM   2552 C CA  . ARG B 2 79  ? 1.808   14.273 24.570 1.00 94.50  ? 82   ARG B CA  1 
ATOM   2553 C C   . ARG B 2 79  ? 1.039   13.030 24.148 1.00 99.93  ? 82   ARG B C   1 
ATOM   2554 O O   . ARG B 2 79  ? -0.057  13.108 23.586 1.00 99.77  ? 82   ARG B O   1 
ATOM   2555 C CB  . ARG B 2 79  ? 1.248   14.797 25.893 1.00 95.15  ? 82   ARG B CB  1 
ATOM   2556 C CG  . ARG B 2 79  ? 1.415   13.807 27.051 1.00 107.21 ? 82   ARG B CG  1 
ATOM   2557 C CD  . ARG B 2 79  ? 0.561   14.178 28.255 1.00 117.85 ? 82   ARG B CD  1 
ATOM   2558 N NE  . ARG B 2 79  ? 0.554   13.100 29.243 1.00 127.70 ? 82   ARG B NE  1 
ATOM   2559 C CZ  . ARG B 2 79  ? -0.046  13.159 30.429 1.00 142.27 ? 82   ARG B CZ  1 
ATOM   2560 N NH1 . ARG B 2 79  ? -0.694  14.254 30.792 1.00 130.07 ? 82   ARG B NH1 1 
ATOM   2561 N NH2 . ARG B 2 79  ? 0.007   12.120 31.255 1.00 129.34 ? 82   ARG B NH2 1 
ATOM   2562 N N   . THR B 2 80  ? 1.670   11.885 24.344 1.00 97.32  ? 83   THR B N   1 
ATOM   2563 C CA  . THR B 2 80  ? 0.986   10.616 24.225 1.00 97.46  ? 83   THR B CA  1 
ATOM   2564 C C   . THR B 2 80  ? 1.882   9.572  24.852 1.00 101.80 ? 83   THR B C   1 
ATOM   2565 O O   . THR B 2 80  ? 3.095   9.590  24.624 1.00 101.55 ? 83   THR B O   1 
ATOM   2566 C CB  . THR B 2 80  ? 0.621   10.294 22.767 1.00 105.41 ? 83   THR B CB  1 
ATOM   2567 O OG1 . THR B 2 80  ? -0.688  9.712  22.722 1.00 105.50 ? 83   THR B OG1 1 
ATOM   2568 C CG2 . THR B 2 80  ? 1.614   9.310  22.176 1.00 103.54 ? 83   THR B CG2 1 
ATOM   2569 N N   . ASP B 2 81  ? 1.321   8.933  25.878 1.00 98.07  ? 84   ASP B N   1 
ATOM   2570 C CA  . ASP B 2 81  ? 1.757   7.632  26.369 1.00 97.62  ? 84   ASP B CA  1 
ATOM   2571 C C   . ASP B 2 81  ? 2.944   7.123  25.562 1.00 100.11 ? 84   ASP B C   1 
ATOM   2572 O O   . ASP B 2 81  ? 2.805   6.806  24.383 1.00 100.01 ? 84   ASP B O   1 
ATOM   2573 C CB  . ASP B 2 81  ? 0.600   6.626  26.237 1.00 99.77  ? 84   ASP B CB  1 
ATOM   2574 C CG  . ASP B 2 81  ? -0.557  6.923  27.183 1.00 111.17 ? 84   ASP B CG  1 
ATOM   2575 O OD1 . ASP B 2 81  ? -0.295  7.439  28.287 1.00 111.80 ? 84   ASP B OD1 1 
ATOM   2576 O OD2 . ASP B 2 81  ? -1.720  6.608  26.839 1.00 117.46 ? 84   ASP B OD2 1 
ATOM   2577 N N   . ARG B 2 82  ? 4.134   7.260  26.131 1.00 95.17  ? 85   ARG B N   1 
ATOM   2578 C CA  . ARG B 2 82  ? 5.346   6.730  25.518 1.00 94.14  ? 85   ARG B CA  1 
ATOM   2579 C C   . ARG B 2 82  ? 5.978   7.624  24.441 1.00 95.09  ? 85   ARG B C   1 
ATOM   2580 O O   . ARG B 2 82  ? 6.968   7.239  23.824 1.00 94.98  ? 85   ARG B O   1 
ATOM   2581 C CB  . ARG B 2 82  ? 5.101   5.321  24.980 1.00 95.14  ? 85   ARG B CB  1 
ATOM   2582 C CG  . ARG B 2 82  ? 6.367   4.561  24.659 1.00 106.27 ? 85   ARG B CG  1 
ATOM   2583 C CD  . ARG B 2 82  ? 6.101   3.070  24.530 1.00 115.19 ? 85   ARG B CD  1 
ATOM   2584 N NE  . ARG B 2 82  ? 7.350   2.333  24.396 1.00 122.29 ? 85   ARG B NE  1 
ATOM   2585 C CZ  . ARG B 2 82  ? 7.456   1.018  24.537 1.00 135.82 ? 85   ARG B CZ  1 
ATOM   2586 N NH1 . ARG B 2 82  ? 8.635   0.429  24.399 1.00 122.88 ? 85   ARG B NH1 1 
ATOM   2587 N NH2 . ARG B 2 82  ? 6.384   0.291  24.826 1.00 123.13 ? 85   ARG B NH2 1 
ATOM   2588 N N   . GLU B 2 83  ? 5.407   8.808  24.211 1.00 88.77  ? 86   GLU B N   1 
ATOM   2589 C CA  . GLU B 2 83  ? 6.032   9.818  23.342 1.00 87.03  ? 86   GLU B CA  1 
ATOM   2590 C C   . GLU B 2 83  ? 5.543   11.273 23.437 1.00 87.22  ? 86   GLU B C   1 
ATOM   2591 O O   . GLU B 2 83  ? 4.343   11.556 23.351 1.00 86.73  ? 86   GLU B O   1 
ATOM   2592 C CB  . GLU B 2 83  ? 6.127   9.359  21.883 1.00 88.27  ? 86   GLU B CB  1 
ATOM   2593 C CG  . GLU B 2 83  ? 7.474   8.758  21.529 1.00 97.19  ? 86   GLU B CG  1 
ATOM   2594 C CD  . GLU B 2 83  ? 7.592   8.348  20.073 1.00 116.91 ? 86   GLU B CD  1 
ATOM   2595 O OE1 . GLU B 2 83  ? 8.449   7.487  19.775 1.00 111.88 ? 86   GLU B OE1 1 
ATOM   2596 O OE2 . GLU B 2 83  ? 6.823   8.863  19.234 1.00 112.12 ? 86   GLU B OE2 1 
ATOM   2597 N N   . ILE B 2 84  ? 6.500   12.188 23.593 1.00 80.84  ? 87   ILE B N   1 
ATOM   2598 C CA  . ILE B 2 84  ? 6.243   13.628 23.511 1.00 79.17  ? 87   ILE B CA  1 
ATOM   2599 C C   . ILE B 2 84  ? 7.104   14.227 22.402 1.00 79.42  ? 87   ILE B C   1 
ATOM   2600 O O   . ILE B 2 84  ? 8.284   13.895 22.273 1.00 78.60  ? 87   ILE B O   1 
ATOM   2601 C CB  . ILE B 2 84  ? 6.501   14.340 24.864 1.00 81.93  ? 87   ILE B CB  1 
ATOM   2602 C CG1 . ILE B 2 84  ? 7.195   15.688 24.645 1.00 82.14  ? 87   ILE B CG1 1 
ATOM   2603 C CG2 . ILE B 2 84  ? 7.311   13.452 25.801 1.00 82.10  ? 87   ILE B CG2 1 
ATOM   2604 C CD1 . ILE B 2 84  ? 6.332   16.720 23.951 1.00 88.37  ? 87   ILE B CD1 1 
ATOM   2605 N N   . LYS B 2 85  ? 6.502   15.061 21.563 1.00 73.46  ? 88   LYS B N   1 
ATOM   2606 C CA  . LYS B 2 85  ? 7.270   15.725 20.524 1.00 72.21  ? 88   LYS B CA  1 
ATOM   2607 C C   . LYS B 2 85  ? 7.636   17.157 20.876 1.00 72.92  ? 88   LYS B C   1 
ATOM   2608 O O   . LYS B 2 85  ? 6.781   17.963 21.251 1.00 71.77  ? 88   LYS B O   1 
ATOM   2609 C CB  . LYS B 2 85  ? 6.550   15.693 19.187 1.00 74.94  ? 88   LYS B CB  1 
ATOM   2610 C CG  . LYS B 2 85  ? 7.296   16.477 18.124 1.00 90.30  ? 88   LYS B CG  1 
ATOM   2611 C CD  . LYS B 2 85  ? 6.533   16.536 16.803 1.00 101.30 ? 88   LYS B CD  1 
ATOM   2612 C CE  . LYS B 2 85  ? 6.656   15.226 16.023 1.00 112.35 ? 88   LYS B CE  1 
ATOM   2613 N NZ  . LYS B 2 85  ? 5.736   15.176 14.824 1.00 119.37 ? 88   LYS B NZ  1 
ATOM   2614 N N   . VAL B 2 86  ? 8.913   17.475 20.704 1.00 67.40  ? 89   VAL B N   1 
ATOM   2615 C CA  . VAL B 2 86  ? 9.445   18.753 21.140 1.00 66.13  ? 89   VAL B CA  1 
ATOM   2616 C C   . VAL B 2 86  ? 10.066  19.501 19.967 1.00 69.48  ? 89   VAL B C   1 
ATOM   2617 O O   . VAL B 2 86  ? 11.156  19.154 19.504 1.00 69.05  ? 89   VAL B O   1 
ATOM   2618 C CB  . VAL B 2 86  ? 10.464  18.560 22.276 1.00 69.20  ? 89   VAL B CB  1 
ATOM   2619 C CG1 . VAL B 2 86  ? 10.950  19.902 22.803 1.00 68.97  ? 89   VAL B CG1 1 
ATOM   2620 C CG2 . VAL B 2 86  ? 9.863   17.728 23.388 1.00 68.76  ? 89   VAL B CG2 1 
ATOM   2621 N N   . THR B 2 87  ? 9.367   20.525 19.488 1.00 65.16  ? 90   THR B N   1 
ATOM   2622 C CA  . THR B 2 87  ? 9.916   21.403 18.465 1.00 64.87  ? 90   THR B CA  1 
ATOM   2623 C C   . THR B 2 87  ? 10.939  22.359 19.060 1.00 68.18  ? 90   THR B C   1 
ATOM   2624 O O   . THR B 2 87  ? 10.616  23.134 19.957 1.00 68.02  ? 90   THR B O   1 
ATOM   2625 C CB  . THR B 2 87  ? 8.810   22.186 17.746 1.00 76.23  ? 90   THR B CB  1 
ATOM   2626 O OG1 . THR B 2 87  ? 9.379   23.348 17.127 1.00 77.58  ? 90   THR B OG1 1 
ATOM   2627 C CG2 . THR B 2 87  ? 7.737   22.619 18.731 1.00 75.77  ? 90   THR B CG2 1 
ATOM   2628 N N   . LEU B 2 88  ? 12.165  22.315 18.547 1.00 64.21  ? 91   LEU B N   1 
ATOM   2629 C CA  . LEU B 2 88  ? 13.187  23.287 18.927 1.00 63.88  ? 91   LEU B CA  1 
ATOM   2630 C C   . LEU B 2 88  ? 13.228  24.449 17.938 1.00 68.42  ? 91   LEU B C   1 
ATOM   2631 O O   . LEU B 2 88  ? 13.844  24.345 16.881 1.00 67.65  ? 91   LEU B O   1 
ATOM   2632 C CB  . LEU B 2 88  ? 14.569  22.634 18.992 1.00 63.70  ? 91   LEU B CB  1 
ATOM   2633 C CG  . LEU B 2 88  ? 14.731  21.351 19.804 1.00 68.14  ? 91   LEU B CG  1 
ATOM   2634 C CD1 . LEU B 2 88  ? 16.155  20.829 19.668 1.00 68.04  ? 91   LEU B CD1 1 
ATOM   2635 C CD2 . LEU B 2 88  ? 14.369  21.576 21.265 1.00 70.32  ? 91   LEU B CD2 1 
ATOM   2636 N N   . VAL B 2 89  ? 12.572  25.551 18.289 1.00 66.28  ? 92   VAL B N   1 
ATOM   2637 C CA  . VAL B 2 89  ? 12.654  26.786 17.514 1.00 66.89  ? 92   VAL B CA  1 
ATOM   2638 C C   . VAL B 2 89  ? 14.073  27.350 17.582 1.00 74.39  ? 92   VAL B C   1 
ATOM   2639 O O   . VAL B 2 89  ? 14.710  27.315 18.635 1.00 74.66  ? 92   VAL B O   1 
ATOM   2640 C CB  . VAL B 2 89  ? 11.619  27.811 18.000 1.00 70.15  ? 92   VAL B CB  1 
ATOM   2641 C CG1 . VAL B 2 89  ? 11.752  29.101 17.235 1.00 69.73  ? 92   VAL B CG1 1 
ATOM   2642 C CG2 . VAL B 2 89  ? 10.212  27.250 17.871 1.00 69.92  ? 92   VAL B CG2 1 
ATOM   2643 N N   . PHE B 2 90  ? 14.570  27.862 16.460 1.00 72.75  ? 93   PHE B N   1 
ATOM   2644 C CA  . PHE B 2 90  ? 15.970  28.263 16.365 1.00 73.55  ? 93   PHE B CA  1 
ATOM   2645 C C   . PHE B 2 90  ? 16.183  29.608 15.673 1.00 81.40  ? 93   PHE B C   1 
ATOM   2646 O O   . PHE B 2 90  ? 15.309  30.105 14.958 1.00 81.13  ? 93   PHE B O   1 
ATOM   2647 C CB  . PHE B 2 90  ? 16.770  27.195 15.617 1.00 75.10  ? 93   PHE B CB  1 
ATOM   2648 C CG  . PHE B 2 90  ? 17.386  26.152 16.505 1.00 76.33  ? 93   PHE B CG  1 
ATOM   2649 C CD1 . PHE B 2 90  ? 16.801  24.905 16.640 1.00 79.18  ? 93   PHE B CD1 1 
ATOM   2650 C CD2 . PHE B 2 90  ? 18.594  26.392 17.140 1.00 78.12  ? 93   PHE B CD2 1 
ATOM   2651 C CE1 . PHE B 2 90  ? 17.386  23.932 17.431 1.00 79.95  ? 93   PHE B CE1 1 
ATOM   2652 C CE2 . PHE B 2 90  ? 19.184  25.422 17.930 1.00 80.77  ? 93   PHE B CE2 1 
ATOM   2653 C CZ  . PHE B 2 90  ? 18.579  24.191 18.075 1.00 78.81  ? 93   PHE B CZ  1 
ATOM   2654 N N   . GLU B 2 91  ? 17.374  30.168 15.860 1.00 80.91  ? 94   GLU B N   1 
ATOM   2655 C CA  . GLU B 2 91  ? 17.832  31.308 15.075 1.00 82.11  ? 94   GLU B CA  1 
ATOM   2656 C C   . GLU B 2 91  ? 18.019  30.839 13.633 1.00 89.42  ? 94   GLU B C   1 
ATOM   2657 O O   . GLU B 2 91  ? 18.423  29.699 13.399 1.00 88.91  ? 94   GLU B O   1 
ATOM   2658 C CB  . GLU B 2 91  ? 19.164  31.824 15.632 1.00 83.45  ? 94   GLU B CB  1 
ATOM   2659 C CG  . GLU B 2 91  ? 19.570  33.201 15.123 1.00 92.43  ? 94   GLU B CG  1 
ATOM   2660 C CD  . GLU B 2 91  ? 20.896  33.675 15.694 1.00 106.01 ? 94   GLU B CD  1 
ATOM   2661 O OE1 . GLU B 2 91  ? 21.074  34.901 15.844 1.00 96.49  ? 94   GLU B OE1 1 
ATOM   2662 O OE2 . GLU B 2 91  ? 21.759  32.824 15.994 1.00 98.10  ? 94   GLU B OE2 1 
ATOM   2663 N N   . HIS B 2 92  ? 17.718  31.705 12.669 1.00 88.79  ? 95   HIS B N   1 
ATOM   2664 C CA  . HIS B 2 92  ? 17.791  31.309 11.266 1.00 89.85  ? 95   HIS B CA  1 
ATOM   2665 C C   . HIS B 2 92  ? 18.809  32.047 10.397 1.00 94.74  ? 95   HIS B C   1 
ATOM   2666 O O   . HIS B 2 92  ? 18.553  33.154 9.920  1.00 94.25  ? 95   HIS B O   1 
ATOM   2667 C CB  . HIS B 2 92  ? 16.418  31.343 10.605 1.00 91.17  ? 95   HIS B CB  1 
ATOM   2668 C CG  . HIS B 2 92  ? 16.440  30.928 9.168  1.00 95.05  ? 95   HIS B CG  1 
ATOM   2669 N ND1 . HIS B 2 92  ? 16.829  29.669 8.764  1.00 97.00  ? 95   HIS B ND1 1 
ATOM   2670 C CD2 . HIS B 2 92  ? 16.157  31.616 8.036  1.00 97.09  ? 95   HIS B CD2 1 
ATOM   2671 C CE1 . HIS B 2 92  ? 16.764  29.592 7.446  1.00 96.57  ? 95   HIS B CE1 1 
ATOM   2672 N NE2 . HIS B 2 92  ? 16.358  30.760 6.981  1.00 96.88  ? 95   HIS B NE2 1 
ATOM   2673 N N   . VAL B 2 93  ? 19.943  31.397 10.160 1.00 92.33  ? 96   VAL B N   1 
ATOM   2674 C CA  . VAL B 2 93  ? 20.878  31.806 9.119  1.00 92.75  ? 96   VAL B CA  1 
ATOM   2675 C C   . VAL B 2 93  ? 20.241  31.613 7.742  1.00 98.12  ? 96   VAL B C   1 
ATOM   2676 O O   . VAL B 2 93  ? 19.260  30.881 7.603  1.00 97.76  ? 96   VAL B O   1 
ATOM   2677 C CB  . VAL B 2 93  ? 22.203  31.024 9.236  1.00 96.74  ? 96   VAL B CB  1 
ATOM   2678 C CG1 . VAL B 2 93  ? 22.753  30.681 7.860  1.00 96.55  ? 96   VAL B CG1 1 
ATOM   2679 C CG2 . VAL B 2 93  ? 23.224  31.821 10.036 1.00 96.55  ? 96   VAL B CG2 1 
ATOM   2680 N N   . ASP B 2 94  ? 20.797  32.273 6.729  1.00 95.58  ? 97   ASP B N   1 
ATOM   2681 C CA  . ASP B 2 94  ? 20.265  32.188 5.369  1.00 95.62  ? 97   ASP B CA  1 
ATOM   2682 C C   . ASP B 2 94  ? 20.907  31.052 4.570  1.00 99.29  ? 97   ASP B C   1 
ATOM   2683 O O   . ASP B 2 94  ? 20.228  30.357 3.816  1.00 98.81  ? 97   ASP B O   1 
ATOM   2684 C CB  . ASP B 2 94  ? 20.448  33.520 4.638  1.00 97.57  ? 97   ASP B CB  1 
ATOM   2685 C CG  . ASP B 2 94  ? 19.309  33.823 3.684  1.00 108.29 ? 97   ASP B CG  1 
ATOM   2686 O OD1 . ASP B 2 94  ? 19.281  34.942 3.129  1.00 109.06 ? 97   ASP B OD1 1 
ATOM   2687 O OD2 . ASP B 2 94  ? 18.420  32.959 3.522  1.00 113.98 ? 97   ASP B OD2 1 
ATOM   2688 N N   . GLN B 2 95  ? 22.212  30.864 4.742  1.00 95.84  ? 98   GLN B N   1 
ATOM   2689 C CA  . GLN B 2 95  ? 22.930  29.813 4.028  1.00 95.73  ? 98   GLN B CA  1 
ATOM   2690 C C   . GLN B 2 95  ? 24.050  29.185 4.859  1.00 99.24  ? 98   GLN B C   1 
ATOM   2691 O O   . GLN B 2 95  ? 24.493  29.757 5.855  1.00 98.71  ? 98   GLN B O   1 
ATOM   2692 C CB  . GLN B 2 95  ? 23.482  30.340 2.704  1.00 97.25  ? 98   GLN B CB  1 
ATOM   2693 C CG  . GLN B 2 95  ? 24.550  31.411 2.855  1.00 111.92 ? 98   GLN B CG  1 
ATOM   2694 C CD  . GLN B 2 95  ? 25.312  31.657 1.566  1.00 129.96 ? 98   GLN B CD  1 
ATOM   2695 O OE1 . GLN B 2 95  ? 26.481  32.046 1.588  1.00 125.57 ? 98   GLN B OE1 1 
ATOM   2696 N NE2 . GLN B 2 95  ? 24.658  31.413 0.434  1.00 121.23 ? 98   GLN B NE2 1 
ATOM   2697 N N   . ASP B 2 96  ? 24.532  28.027 4.413  1.00 95.59  ? 99   ASP B N   1 
ATOM   2698 C CA  . ASP B 2 96  ? 25.520  27.253 5.162  1.00 95.32  ? 99   ASP B CA  1 
ATOM   2699 C C   . ASP B 2 96  ? 26.898  27.249 4.508  1.00 98.08  ? 99   ASP B C   1 
ATOM   2700 O O   . ASP B 2 96  ? 27.072  27.761 3.406  1.00 97.42  ? 99   ASP B O   1 
ATOM   2701 C CB  . ASP B 2 96  ? 25.037  25.814 5.340  1.00 97.50  ? 99   ASP B CB  1 
ATOM   2702 C CG  . ASP B 2 96  ? 24.732  25.135 4.018  1.00 109.37 ? 99   ASP B CG  1 
ATOM   2703 O OD1 . ASP B 2 96  ? 23.755  25.540 3.349  1.00 109.92 ? 99   ASP B OD1 1 
ATOM   2704 O OD2 . ASP B 2 96  ? 25.455  24.180 3.660  1.00 115.78 ? 99   ASP B OD2 1 
ATOM   2705 N N   . LEU B 2 97  ? 27.855  26.601 5.167  1.00 94.40  ? 100  LEU B N   1 
ATOM   2706 C CA  . LEU B 2 97  ? 29.241  26.568 4.701  1.00 94.23  ? 100  LEU B CA  1 
ATOM   2707 C C   . LEU B 2 97  ? 29.430  25.811 3.386  1.00 100.12 ? 100  LEU B C   1 
ATOM   2708 O O   . LEU B 2 97  ? 30.414  26.025 2.676  1.00 100.01 ? 100  LEU B O   1 
ATOM   2709 C CB  . LEU B 2 97  ? 30.165  25.987 5.775  1.00 93.76  ? 100  LEU B CB  1 
ATOM   2710 C CG  . LEU B 2 97  ? 31.658  25.982 5.437  1.00 97.39  ? 100  LEU B CG  1 
ATOM   2711 C CD1 . LEU B 2 97  ? 32.213  27.396 5.406  1.00 97.27  ? 100  LEU B CD1 1 
ATOM   2712 C CD2 . LEU B 2 97  ? 32.445  25.107 6.400  1.00 98.40  ? 100  LEU B CD2 1 
ATOM   2713 N N   . ARG B 2 98  ? 28.519  24.890 3.086  1.00 97.55  ? 101  ARG B N   1 
ATOM   2714 C CA  . ARG B 2 98  ? 28.544  24.210 1.797  1.00 97.55  ? 101  ARG B CA  1 
ATOM   2715 C C   . ARG B 2 98  ? 28.036  25.163 0.725  1.00 101.82 ? 101  ARG B C   1 
ATOM   2716 O O   . ARG B 2 98  ? 28.809  25.632 -0.109 1.00 101.60 ? 101  ARG B O   1 
ATOM   2717 C CB  . ARG B 2 98  ? 27.707  22.931 1.829  1.00 97.64  ? 101  ARG B CB  1 
ATOM   2718 C CG  . ARG B 2 98  ? 27.834  22.091 0.572  1.00 106.57 ? 101  ARG B CG  1 
ATOM   2719 C CD  . ARG B 2 98  ? 27.396  20.656 0.808  1.00 113.81 ? 101  ARG B CD  1 
ATOM   2720 N NE  . ARG B 2 98  ? 28.430  19.862 1.469  1.00 121.87 ? 101  ARG B NE  1 
ATOM   2721 C CZ  . ARG B 2 98  ? 28.407  19.516 2.753  1.00 136.62 ? 101  ARG B CZ  1 
ATOM   2722 N NH1 . ARG B 2 98  ? 27.397  19.891 3.527  1.00 124.71 ? 101  ARG B NH1 1 
ATOM   2723 N NH2 . ARG B 2 98  ? 29.392  18.786 3.262  1.00 123.08 ? 101  ARG B NH2 1 
ATOM   2724 N N   . THR B 2 99  ? 26.767  25.546 0.830  1.00 98.44  ? 102  THR B N   1 
ATOM   2725 C CA  . THR B 2 99  ? 26.201  26.603 -0.006 1.00 98.24  ? 102  THR B CA  1 
ATOM   2726 C C   . THR B 2 99  ? 27.105  27.836 -0.038 1.00 102.97 ? 102  THR B C   1 
ATOM   2727 O O   . THR B 2 99  ? 26.934  28.722 -0.870 1.00 102.55 ? 102  THR B O   1 
ATOM   2728 C CB  . THR B 2 99  ? 24.769  26.969 0.444  1.00 103.69 ? 102  THR B CB  1 
ATOM   2729 O OG1 . THR B 2 99  ? 23.883  25.877 0.171  1.00 102.64 ? 102  THR B OG1 1 
ATOM   2730 C CG2 . THR B 2 99  ? 24.272  28.212 -0.277 1.00 101.03 ? 102  THR B CG2 1 
ATOM   2731 N N   . TYR B 2 100 ? 28.066  27.890 0.878  1.00 100.34 ? 103  TYR B N   1 
ATOM   2732 C CA  . TYR B 2 100 ? 29.041  28.968 0.899  1.00 100.72 ? 103  TYR B CA  1 
ATOM   2733 C C   . TYR B 2 100 ? 30.249  28.640 0.030  1.00 106.60 ? 103  TYR B C   1 
ATOM   2734 O O   . TYR B 2 100 ? 30.715  29.481 -0.737 1.00 106.52 ? 103  TYR B O   1 
ATOM   2735 C CB  . TYR B 2 100 ? 29.492  29.247 2.329  1.00 101.73 ? 103  TYR B CB  1 
ATOM   2736 C CG  . TYR B 2 100 ? 30.531  30.337 2.441  1.00 103.19 ? 103  TYR B CG  1 
ATOM   2737 C CD1 . TYR B 2 100 ? 30.172  31.676 2.358  1.00 105.15 ? 103  TYR B CD1 1 
ATOM   2738 C CD2 . TYR B 2 100 ? 31.871  30.028 2.641  1.00 103.86 ? 103  TYR B CD2 1 
ATOM   2739 C CE1 . TYR B 2 100 ? 31.120  32.679 2.471  1.00 105.93 ? 103  TYR B CE1 1 
ATOM   2740 C CE2 . TYR B 2 100 ? 32.826  31.024 2.756  1.00 104.65 ? 103  TYR B CE2 1 
ATOM   2741 C CZ  . TYR B 2 100 ? 32.446  32.347 2.670  1.00 111.10 ? 103  TYR B CZ  1 
ATOM   2742 O OH  . TYR B 2 100 ? 33.392  33.339 2.785  1.00 110.64 ? 103  TYR B OH  1 
ATOM   2743 N N   . LEU B 2 101 ? 30.765  27.423 0.164  1.00 104.36 ? 104  LEU B N   1 
ATOM   2744 C CA  . LEU B 2 101 ? 31.926  26.999 -0.614 1.00 104.81 ? 104  LEU B CA  1 
ATOM   2745 C C   . LEU B 2 101 ? 31.536  26.486 -2.001 1.00 110.61 ? 104  LEU B C   1 
ATOM   2746 O O   . LEU B 2 101 ? 32.396  26.274 -2.860 1.00 109.92 ? 104  LEU B O   1 
ATOM   2747 C CB  . LEU B 2 101 ? 32.738  25.948 0.147  1.00 104.78 ? 104  LEU B CB  1 
ATOM   2748 C CG  . LEU B 2 101 ? 33.394  26.427 1.445  1.00 109.28 ? 104  LEU B CG  1 
ATOM   2749 C CD1 . LEU B 2 101 ? 34.415  25.419 1.948  1.00 109.45 ? 104  LEU B CD1 1 
ATOM   2750 C CD2 . LEU B 2 101 ? 34.034  27.791 1.253  1.00 111.25 ? 104  LEU B CD2 1 
ATOM   2751 N N   . ASP B 2 102 ? 30.235  26.295 -2.213 1.00 108.79 ? 105  ASP B N   1 
ATOM   2752 C CA  . ASP B 2 102 ? 29.713  25.902 -3.519 1.00 109.10 ? 105  ASP B CA  1 
ATOM   2753 C C   . ASP B 2 102 ? 29.483  27.119 -4.408 1.00 115.47 ? 105  ASP B C   1 
ATOM   2754 O O   . ASP B 2 102 ? 30.024  27.195 -5.512 1.00 115.08 ? 105  ASP B O   1 
ATOM   2755 C CB  . ASP B 2 102 ? 28.431  25.079 -3.379 1.00 110.47 ? 105  ASP B CB  1 
ATOM   2756 C CG  . ASP B 2 102 ? 28.704  23.644 -2.967 1.00 117.41 ? 105  ASP B CG  1 
ATOM   2757 O OD1 . ASP B 2 102 ? 27.735  22.868 -2.823 1.00 117.50 ? 105  ASP B OD1 1 
ATOM   2758 O OD2 . ASP B 2 102 ? 29.888  23.288 -2.798 1.00 122.10 ? 105  ASP B OD2 1 
ATOM   2759 N N   . LYS B 2 103 ? 28.706  28.084 -3.923 1.00 113.94 ? 106  LYS B N   1 
ATOM   2760 C CA  . LYS B 2 103 ? 28.640  29.381 -4.591 1.00 114.64 ? 106  LYS B CA  1 
ATOM   2761 C C   . LYS B 2 103 ? 29.990  30.079 -4.433 1.00 121.34 ? 106  LYS B C   1 
ATOM   2762 O O   . LYS B 2 103 ? 30.070  31.216 -3.963 1.00 121.19 ? 106  LYS B O   1 
ATOM   2763 C CB  . LYS B 2 103 ? 27.503  30.254 -4.039 1.00 116.67 ? 106  LYS B CB  1 
ATOM   2764 C CG  . LYS B 2 103 ? 27.698  30.746 -2.610 1.00 123.58 ? 106  LYS B CG  1 
ATOM   2765 C CD  . LYS B 2 103 ? 27.266  32.201 -2.454 1.00 128.47 ? 106  LYS B CD  1 
ATOM   2766 C CE  . LYS B 2 103 ? 25.831  32.426 -2.910 1.00 132.86 ? 106  LYS B CE  1 
ATOM   2767 N NZ  . LYS B 2 103 ? 25.506  33.877 -3.027 1.00 137.87 ? 106  LYS B NZ  1 
ATOM   2768 N N   . ALA B 2 104 ? 31.050  29.377 -4.822 1.00 119.68 ? 107  ALA B N   1 
ATOM   2769 C CA  . ALA B 2 104 ? 32.409  29.863 -4.631 1.00 120.32 ? 107  ALA B CA  1 
ATOM   2770 C C   . ALA B 2 104 ? 32.964  30.501 -5.898 1.00 126.19 ? 107  ALA B C   1 
ATOM   2771 O O   . ALA B 2 104 ? 33.308  29.809 -6.856 1.00 125.76 ? 107  ALA B O   1 
ATOM   2772 C CB  . ALA B 2 104 ? 33.314  28.732 -4.165 1.00 121.06 ? 107  ALA B CB  1 
ATOM   2773 N N   . PRO B 2 105 ? 33.022  31.841 -5.929 1.00 124.19 ? 108  PRO B N   1 
ATOM   2774 C CA  . PRO B 2 105 ? 33.740  32.493 -7.028 1.00 124.39 ? 108  PRO B CA  1 
ATOM   2775 C C   . PRO B 2 105 ? 35.215  32.088 -7.063 1.00 128.67 ? 108  PRO B C   1 
ATOM   2776 O O   . PRO B 2 105 ? 35.779  31.863 -8.136 1.00 128.44 ? 108  PRO B O   1 
ATOM   2777 C CB  . PRO B 2 105 ? 33.618  33.992 -6.703 1.00 126.18 ? 108  PRO B CB  1 
ATOM   2778 C CG  . PRO B 2 105 ? 32.740  34.100 -5.479 1.00 130.50 ? 108  PRO B CG  1 
ATOM   2779 C CD  . PRO B 2 105 ? 32.114  32.767 -5.233 1.00 125.92 ? 108  PRO B CD  1 
ATOM   2780 N N   . PRO B 2 106 ? 35.852  31.972 -5.883 1.00 125.03 ? 109  PRO B N   1 
ATOM   2781 C CA  . PRO B 2 106 ? 37.292  31.707 -5.816 1.00 124.69 ? 109  PRO B CA  1 
ATOM   2782 C C   . PRO B 2 106 ? 37.754  30.456 -6.554 1.00 127.76 ? 109  PRO B C   1 
ATOM   2783 O O   . PRO B 2 106 ? 37.217  29.363 -6.359 1.00 127.21 ? 109  PRO B O   1 
ATOM   2784 C CB  . PRO B 2 106 ? 37.538  31.534 -4.321 1.00 126.49 ? 109  PRO B CB  1 
ATOM   2785 C CG  . PRO B 2 106 ? 36.537  32.407 -3.683 1.00 131.00 ? 109  PRO B CG  1 
ATOM   2786 C CD  . PRO B 2 106 ? 35.321  32.394 -4.573 1.00 126.54 ? 109  PRO B CD  1 
ATOM   2787 N N   . PRO B 2 107 ? 38.792  30.603 -7.389 1.00 123.58 ? 110  PRO B N   1 
ATOM   2788 C CA  . PRO B 2 107 ? 39.542  29.452 -7.892 1.00 123.19 ? 110  PRO B CA  1 
ATOM   2789 C C   . PRO B 2 107 ? 40.712  29.162 -6.953 1.00 126.55 ? 110  PRO B C   1 
ATOM   2790 O O   . PRO B 2 107 ? 41.833  29.617 -7.188 1.00 125.91 ? 110  PRO B O   1 
ATOM   2791 C CB  . PRO B 2 107 ? 40.066  29.936 -9.253 1.00 124.90 ? 110  PRO B CB  1 
ATOM   2792 C CG  . PRO B 2 107 ? 39.446  31.295 -9.483 1.00 129.26 ? 110  PRO B CG  1 
ATOM   2793 C CD  . PRO B 2 107 ? 39.107  31.826 -8.139 1.00 124.85 ? 110  PRO B CD  1 
ATOM   2794 N N   . GLY B 2 108 ? 40.422  28.488 -5.842 1.00 122.72 ? 111  GLY B N   1 
ATOM   2795 C CA  . GLY B 2 108 ? 41.435  28.077 -4.884 1.00 122.15 ? 111  GLY B CA  1 
ATOM   2796 C C   . GLY B 2 108 ? 41.483  28.891 -3.600 1.00 124.88 ? 111  GLY B C   1 
ATOM   2797 O O   . GLY B 2 108 ? 41.675  28.336 -2.517 1.00 124.59 ? 111  GLY B O   1 
ATOM   2798 N N   . LEU B 2 109 ? 41.286  30.202 -3.716 1.00 120.29 ? 112  LEU B N   1 
ATOM   2799 C CA  . LEU B 2 109 ? 41.501  31.128 -2.601 1.00 119.51 ? 112  LEU B CA  1 
ATOM   2800 C C   . LEU B 2 109 ? 40.191  31.628 -1.964 1.00 121.92 ? 112  LEU B C   1 
ATOM   2801 O O   . LEU B 2 109 ? 39.143  31.001 -2.127 1.00 121.48 ? 112  LEU B O   1 
ATOM   2802 C CB  . LEU B 2 109 ? 42.379  32.292 -3.070 1.00 119.50 ? 112  LEU B CB  1 
ATOM   2803 C CG  . LEU B 2 109 ? 42.190  32.710 -4.529 1.00 124.12 ? 112  LEU B CG  1 
ATOM   2804 C CD1 . LEU B 2 109 ? 40.772  33.199 -4.770 1.00 124.32 ? 112  LEU B CD1 1 
ATOM   2805 C CD2 . LEU B 2 109 ? 43.206  33.767 -4.930 1.00 126.39 ? 112  LEU B CD2 1 
ATOM   2806 N N   . PRO B 2 110 ? 40.252  32.693 -1.138 1.00 117.02 ? 113  PRO B N   1 
ATOM   2807 C CA  . PRO B 2 110 ? 41.351  33.495 -0.585 1.00 116.30 ? 113  PRO B CA  1 
ATOM   2808 C C   . PRO B 2 110 ? 41.921  32.830 0.657  1.00 119.18 ? 113  PRO B C   1 
ATOM   2809 O O   . PRO B 2 110 ? 41.581  31.689 0.964  1.00 118.84 ? 113  PRO B O   1 
ATOM   2810 C CB  . PRO B 2 110 ? 40.666  34.814 -0.193 1.00 118.00 ? 113  PRO B CB  1 
ATOM   2811 C CG  . PRO B 2 110 ? 39.338  34.802 -0.884 1.00 122.50 ? 113  PRO B CG  1 
ATOM   2812 C CD  . PRO B 2 110 ? 38.953  33.365 -0.983 1.00 118.24 ? 113  PRO B CD  1 
ATOM   2813 N N   . ALA B 2 111 ? 42.763  33.556 1.384  1.00 115.01 ? 114  ALA B N   1 
ATOM   2814 C CA  . ALA B 2 111 ? 43.340  33.038 2.619  1.00 114.57 ? 114  ALA B CA  1 
ATOM   2815 C C   . ALA B 2 111 ? 42.942  33.884 3.823  1.00 118.12 ? 114  ALA B C   1 
ATOM   2816 O O   . ALA B 2 111 ? 42.885  33.390 4.949  1.00 117.82 ? 114  ALA B O   1 
ATOM   2817 C CB  . ALA B 2 111 ? 44.852  32.952 2.505  1.00 115.30 ? 114  ALA B CB  1 
ATOM   2818 N N   . GLU B 2 112 ? 42.684  35.166 3.586  1.00 114.29 ? 115  GLU B N   1 
ATOM   2819 C CA  . GLU B 2 112 ? 42.243  36.064 4.648  1.00 113.80 ? 115  GLU B CA  1 
ATOM   2820 C C   . GLU B 2 112 ? 40.722  36.055 4.746  1.00 117.11 ? 115  GLU B C   1 
ATOM   2821 O O   . GLU B 2 112 ? 40.136  36.702 5.617  1.00 116.75 ? 115  GLU B O   1 
ATOM   2822 C CB  . GLU B 2 112 ? 42.771  37.483 4.419  1.00 115.07 ? 115  GLU B CB  1 
ATOM   2823 C CG  . GLU B 2 112 ? 44.280  37.549 4.218  1.00 123.27 ? 115  GLU B CG  1 
ATOM   2824 C CD  . GLU B 2 112 ? 45.047  36.821 5.307  1.00 136.25 ? 115  GLU B CD  1 
ATOM   2825 O OE1 . GLU B 2 112 ? 45.719  35.817 4.990  1.00 125.15 ? 115  GLU B OE1 1 
ATOM   2826 O OE2 . GLU B 2 112 ? 44.947  37.228 6.484  1.00 127.82 ? 115  GLU B OE2 1 
ATOM   2827 N N   . THR B 2 113 ? 40.092  35.339 3.821  1.00 113.11 ? 116  THR B N   1 
ATOM   2828 C CA  . THR B 2 113 ? 38.685  34.982 3.946  1.00 112.76 ? 116  THR B CA  1 
ATOM   2829 C C   . THR B 2 113 ? 38.615  33.589 4.574  1.00 116.16 ? 116  THR B C   1 
ATOM   2830 O O   . THR B 2 113 ? 37.536  33.069 4.861  1.00 115.89 ? 116  THR B O   1 
ATOM   2831 C CB  . THR B 2 113 ? 37.957  35.060 2.578  1.00 120.47 ? 116  THR B CB  1 
ATOM   2832 O OG1 . THR B 2 113 ? 37.838  36.430 2.174  1.00 119.88 ? 116  THR B OG1 1 
ATOM   2833 C CG2 . THR B 2 113 ? 36.569  34.441 2.659  1.00 118.73 ? 116  THR B CG2 1 
ATOM   2834 N N   . ILE B 2 114 ? 39.789  33.021 4.840  1.00 111.99 ? 117  ILE B N   1 
ATOM   2835 C CA  . ILE B 2 114 ? 39.896  31.733 5.520  1.00 111.33 ? 117  ILE B CA  1 
ATOM   2836 C C   . ILE B 2 114 ? 40.474  31.897 6.926  1.00 113.91 ? 117  ILE B C   1 
ATOM   2837 O O   . ILE B 2 114 ? 39.845  31.512 7.912  1.00 113.45 ? 117  ILE B O   1 
ATOM   2838 C CB  . ILE B 2 114 ? 40.723  30.718 4.693  1.00 114.38 ? 117  ILE B CB  1 
ATOM   2839 C CG1 . ILE B 2 114 ? 39.929  30.246 3.471  1.00 114.63 ? 117  ILE B CG1 1 
ATOM   2840 C CG2 . ILE B 2 114 ? 41.144  29.535 5.559  1.00 115.11 ? 117  ILE B CG2 1 
ATOM   2841 C CD1 . ILE B 2 114 ? 40.630  29.176 2.659  1.00 120.20 ? 117  ILE B CD1 1 
ATOM   2842 N N   . LYS B 2 115 ? 41.672  32.468 7.009  1.00 109.57 ? 118  LYS B N   1 
ATOM   2843 C CA  . LYS B 2 115 ? 42.361  32.644 8.286  1.00 109.01 ? 118  LYS B CA  1 
ATOM   2844 C C   . LYS B 2 115 ? 41.480  33.289 9.359  1.00 112.77 ? 118  LYS B C   1 
ATOM   2845 O O   . LYS B 2 115 ? 41.519  32.894 10.528 1.00 112.15 ? 118  LYS B O   1 
ATOM   2846 C CB  . LYS B 2 115 ? 43.652  33.446 8.101  1.00 110.88 ? 118  LYS B CB  1 
ATOM   2847 C CG  . LYS B 2 115 ? 44.802  32.659 7.497  1.00 115.52 ? 118  LYS B CG  1 
ATOM   2848 C CD  . LYS B 2 115 ? 46.111  33.417 7.644  1.00 120.50 ? 118  LYS B CD  1 
ATOM   2849 C CE  . LYS B 2 115 ? 47.300  32.560 7.243  1.00 126.27 ? 118  LYS B CE  1 
ATOM   2850 N NZ  . LYS B 2 115 ? 48.592  33.283 7.414  1.00 131.33 ? 118  LYS B NZ  1 
ATOM   2851 N N   . ASP B 2 116 ? 40.731  34.316 8.968  1.00 108.98 ? 119  ASP B N   1 
ATOM   2852 C CA  . ASP B 2 116 ? 39.723  34.912 9.840  1.00 108.35 ? 119  ASP B CA  1 
ATOM   2853 C C   . ASP B 2 116 ? 38.604  33.905 10.077 1.00 110.98 ? 119  ASP B C   1 
ATOM   2854 O O   . ASP B 2 116 ? 38.318  33.524 11.213 1.00 110.74 ? 119  ASP B O   1 
ATOM   2855 C CB  . ASP B 2 116 ? 39.143  36.172 9.188  1.00 110.06 ? 119  ASP B CB  1 
ATOM   2856 C CG  . ASP B 2 116 ? 37.746  36.501 9.690  1.00 118.07 ? 119  ASP B CG  1 
ATOM   2857 O OD1 . ASP B 2 116 ? 37.614  36.944 10.851 1.00 118.44 ? 119  ASP B OD1 1 
ATOM   2858 O OD2 . ASP B 2 116 ? 36.783  36.346 8.907  1.00 122.48 ? 119  ASP B OD2 1 
ATOM   2859 N N   . LEU B 2 117 ? 38.001  33.462 8.980  1.00 106.14 ? 120  LEU B N   1 
ATOM   2860 C CA  . LEU B 2 117 ? 36.869  32.541 9.009  1.00 105.16 ? 120  LEU B CA  1 
ATOM   2861 C C   . LEU B 2 117 ? 37.098  31.307 9.884  1.00 107.41 ? 120  LEU B C   1 
ATOM   2862 O O   . LEU B 2 117 ? 36.153  30.764 10.457 1.00 107.11 ? 120  LEU B O   1 
ATOM   2863 C CB  . LEU B 2 117 ? 36.495  32.142 7.579  1.00 105.03 ? 120  LEU B CB  1 
ATOM   2864 C CG  . LEU B 2 117 ? 35.445  31.060 7.339  1.00 109.31 ? 120  LEU B CG  1 
ATOM   2865 C CD1 . LEU B 2 117 ? 34.968  31.143 5.899  1.00 109.33 ? 120  LEU B CD1 1 
ATOM   2866 C CD2 . LEU B 2 117 ? 36.029  29.684 7.622  1.00 111.40 ? 120  LEU B CD2 1 
ATOM   2867 N N   . MET B 2 118 ? 38.347  30.860 9.976  1.00 102.35 ? 121  MET B N   1 
ATOM   2868 C CA  . MET B 2 118 ? 38.696  29.744 10.851 1.00 101.44 ? 121  MET B CA  1 
ATOM   2869 C C   . MET B 2 118 ? 38.920  30.208 12.285 1.00 105.29 ? 121  MET B C   1 
ATOM   2870 O O   . MET B 2 118 ? 38.303  29.688 13.216 1.00 104.87 ? 121  MET B O   1 
ATOM   2871 C CB  . MET B 2 118 ? 39.937  29.015 10.335 1.00 103.46 ? 121  MET B CB  1 
ATOM   2872 C CG  . MET B 2 118 ? 39.657  28.033 9.211  1.00 106.72 ? 121  MET B CG  1 
ATOM   2873 S SD  . MET B 2 118 ? 38.842  26.531 9.784  1.00 110.38 ? 121  MET B SD  1 
ATOM   2874 C CE  . MET B 2 118 ? 40.080  25.881 10.925 1.00 106.99 ? 121  MET B CE  1 
ATOM   2875 N N   . ARG B 2 119 ? 39.801  31.192 12.458 1.00 101.85 ? 122  ARG B N   1 
ATOM   2876 C CA  . ARG B 2 119 ? 40.039  31.792 13.770 1.00 101.50 ? 122  ARG B CA  1 
ATOM   2877 C C   . ARG B 2 119 ? 38.708  32.174 14.407 1.00 104.73 ? 122  ARG B C   1 
ATOM   2878 O O   . ARG B 2 119 ? 38.601  32.312 15.627 1.00 104.24 ? 122  ARG B O   1 
ATOM   2879 C CB  . ARG B 2 119 ? 40.945  33.023 13.650 1.00 101.70 ? 122  ARG B CB  1 
ATOM   2880 C CG  . ARG B 2 119 ? 41.333  33.638 14.991 1.00 111.60 ? 122  ARG B CG  1 
ATOM   2881 C CD  . ARG B 2 119 ? 42.440  34.673 14.845 1.00 120.47 ? 122  ARG B CD  1 
ATOM   2882 N NE  . ARG B 2 119 ? 42.735  35.341 16.113 1.00 129.20 ? 122  ARG B NE  1 
ATOM   2883 C CZ  . ARG B 2 119 ? 43.846  35.160 16.823 1.00 143.23 ? 122  ARG B CZ  1 
ATOM   2884 N NH1 . ARG B 2 119 ? 44.018  35.813 17.967 1.00 130.08 ? 122  ARG B NH1 1 
ATOM   2885 N NH2 . ARG B 2 119 ? 44.794  34.340 16.387 1.00 130.64 ? 122  ARG B NH2 1 
ATOM   2886 N N   . GLN B 2 120 ? 37.698  32.338 13.560 1.00 100.60 ? 123  GLN B N   1 
ATOM   2887 C CA  . GLN B 2 120 ? 36.326  32.551 13.993 1.00 99.93  ? 123  GLN B CA  1 
ATOM   2888 C C   . GLN B 2 120 ? 35.730  31.217 14.437 1.00 104.37 ? 123  GLN B C   1 
ATOM   2889 O O   . GLN B 2 120 ? 35.363  31.048 15.598 1.00 104.03 ? 123  GLN B O   1 
ATOM   2890 C CB  . GLN B 2 120 ? 35.516  33.113 12.823 1.00 100.72 ? 123  GLN B CB  1 
ATOM   2891 C CG  . GLN B 2 120 ? 34.393  34.045 13.206 1.00 100.11 ? 123  GLN B CG  1 
ATOM   2892 C CD  . GLN B 2 120 ? 34.015  34.958 12.064 1.00 106.48 ? 123  GLN B CD  1 
ATOM   2893 O OE1 . GLN B 2 120 ? 34.862  35.663 11.517 1.00 100.00 ? 123  GLN B OE1 1 
ATOM   2894 N NE2 . GLN B 2 120 ? 32.751  34.921 11.667 1.00 95.34  ? 123  GLN B NE2 1 
ATOM   2895 N N   . PHE B 2 121 ? 35.666  30.272 13.503 1.00 101.41 ? 124  PHE B N   1 
ATOM   2896 C CA  . PHE B 2 121 ? 35.125  28.936 13.748 1.00 101.46 ? 124  PHE B CA  1 
ATOM   2897 C C   . PHE B 2 121 ? 35.574  28.342 15.083 1.00 105.35 ? 124  PHE B C   1 
ATOM   2898 O O   . PHE B 2 121 ? 34.771  27.761 15.815 1.00 104.74 ? 124  PHE B O   1 
ATOM   2899 C CB  . PHE B 2 121 ? 35.501  28.004 12.592 1.00 103.42 ? 124  PHE B CB  1 
ATOM   2900 C CG  . PHE B 2 121 ? 35.241  26.548 12.865 1.00 105.20 ? 124  PHE B CG  1 
ATOM   2901 C CD1 . PHE B 2 121 ? 33.955  26.089 13.094 1.00 108.57 ? 124  PHE B CD1 1 
ATOM   2902 C CD2 . PHE B 2 121 ? 36.282  25.631 12.855 1.00 107.43 ? 124  PHE B CD2 1 
ATOM   2903 C CE1 . PHE B 2 121 ? 33.715  24.745 13.333 1.00 109.52 ? 124  PHE B CE1 1 
ATOM   2904 C CE2 . PHE B 2 121 ? 36.049  24.288 13.090 1.00 110.28 ? 124  PHE B CE2 1 
ATOM   2905 C CZ  . PHE B 2 121 ? 34.765  23.845 13.331 1.00 108.45 ? 124  PHE B CZ  1 
ATOM   2906 N N   . LEU B 2 122 ? 36.852  28.512 15.406 1.00 102.14 ? 125  LEU B N   1 
ATOM   2907 C CA  . LEU B 2 122 ? 37.384  28.033 16.677 1.00 101.98 ? 125  LEU B CA  1 
ATOM   2908 C C   . LEU B 2 122 ? 36.762  28.759 17.867 1.00 105.35 ? 125  LEU B C   1 
ATOM   2909 O O   . LEU B 2 122 ? 36.633  28.190 18.952 1.00 105.23 ? 125  LEU B O   1 
ATOM   2910 C CB  . LEU B 2 122 ? 38.911  28.162 16.721 1.00 102.11 ? 125  LEU B CB  1 
ATOM   2911 C CG  . LEU B 2 122 ? 39.752  27.087 16.026 1.00 106.91 ? 125  LEU B CG  1 
ATOM   2912 C CD1 . LEU B 2 122 ? 41.221  27.263 16.376 1.00 107.12 ? 125  LEU B CD1 1 
ATOM   2913 C CD2 . LEU B 2 122 ? 39.285  25.687 16.399 1.00 109.47 ? 125  LEU B CD2 1 
ATOM   2914 N N   . ARG B 2 123 ? 36.388  30.018 17.661 1.00 100.89 ? 126  ARG B N   1 
ATOM   2915 C CA  . ARG B 2 123 ? 35.788  30.825 18.721 1.00 99.99  ? 126  ARG B CA  1 
ATOM   2916 C C   . ARG B 2 123 ? 34.527  30.172 19.283 1.00 102.31 ? 126  ARG B C   1 
ATOM   2917 O O   . ARG B 2 123 ? 34.459  29.850 20.469 1.00 101.73 ? 126  ARG B O   1 
ATOM   2918 C CB  . ARG B 2 123 ? 35.466  32.233 18.212 1.00 99.68  ? 126  ARG B CB  1 
ATOM   2919 C CG  . ARG B 2 123 ? 36.683  33.089 17.873 1.00 107.22 ? 126  ARG B CG  1 
ATOM   2920 C CD  . ARG B 2 123 ? 36.247  34.434 17.297 1.00 112.80 ? 126  ARG B CD  1 
ATOM   2921 N NE  . ARG B 2 123 ? 37.353  35.192 16.714 1.00 115.30 ? 126  ARG B NE  1 
ATOM   2922 C CZ  . ARG B 2 123 ? 37.196  36.252 15.926 1.00 123.79 ? 126  ARG B CZ  1 
ATOM   2923 N NH1 . ARG B 2 123 ? 35.977  36.676 15.619 1.00 108.99 ? 126  ARG B NH1 1 
ATOM   2924 N NH2 . ARG B 2 123 ? 38.254  36.884 15.436 1.00 108.16 ? 126  ARG B NH2 1 
ATOM   2925 N N   . GLY B 2 124 ? 33.525  29.995 18.430 1.00 97.90  ? 127  GLY B N   1 
ATOM   2926 C CA  . GLY B 2 124 ? 32.274  29.386 18.837 1.00 97.45  ? 127  GLY B CA  1 
ATOM   2927 C C   . GLY B 2 124 ? 32.490  28.015 19.439 1.00 100.77 ? 127  GLY B C   1 
ATOM   2928 O O   . GLY B 2 124 ? 31.794  27.616 20.368 1.00 100.29 ? 127  GLY B O   1 
ATOM   2929 N N   . LEU B 2 125 ? 33.464  27.293 18.897 1.00 97.13  ? 128  LEU B N   1 
ATOM   2930 C CA  . LEU B 2 125 ? 33.795  25.959 19.380 1.00 96.81  ? 128  LEU B CA  1 
ATOM   2931 C C   . LEU B 2 125 ? 34.375  26.040 20.791 1.00 100.00 ? 128  LEU B C   1 
ATOM   2932 O O   . LEU B 2 125 ? 33.979  25.292 21.685 1.00 99.40  ? 128  LEU B O   1 
ATOM   2933 C CB  . LEU B 2 125 ? 34.789  25.292 18.421 1.00 96.89  ? 128  LEU B CB  1 
ATOM   2934 C CG  . LEU B 2 125 ? 35.249  23.852 18.669 1.00 101.47 ? 128  LEU B CG  1 
ATOM   2935 C CD1 . LEU B 2 125 ? 36.095  23.754 19.930 1.00 101.66 ? 128  LEU B CD1 1 
ATOM   2936 C CD2 . LEU B 2 125 ? 34.067  22.895 18.724 1.00 103.66 ? 128  LEU B CD2 1 
ATOM   2937 N N   . ASP B 2 126 ? 35.288  26.984 20.991 1.00 96.21  ? 129  ASP B N   1 
ATOM   2938 C CA  . ASP B 2 126 ? 35.906  27.199 22.296 1.00 95.76  ? 129  ASP B CA  1 
ATOM   2939 C C   . ASP B 2 126 ? 34.879  27.638 23.340 1.00 99.30  ? 129  ASP B C   1 
ATOM   2940 O O   . ASP B 2 126 ? 34.993  27.298 24.518 1.00 99.05  ? 129  ASP B O   1 
ATOM   2941 C CB  . ASP B 2 126 ? 37.015  28.244 22.184 1.00 97.28  ? 129  ASP B CB  1 
ATOM   2942 C CG  . ASP B 2 126 ? 37.635  28.578 23.518 1.00 103.96 ? 129  ASP B CG  1 
ATOM   2943 O OD1 . ASP B 2 126 ? 37.335  29.666 24.050 1.00 104.22 ? 129  ASP B OD1 1 
ATOM   2944 O OD2 . ASP B 2 126 ? 38.390  27.738 24.050 1.00 108.56 ? 129  ASP B OD2 1 
ATOM   2945 N N   . PHE B 2 127 ? 33.897  28.421 22.905 1.00 95.18  ? 130  PHE B N   1 
ATOM   2946 C CA  . PHE B 2 127 ? 32.785  28.814 23.763 1.00 94.60  ? 130  PHE B CA  1 
ATOM   2947 C C   . PHE B 2 127 ? 31.972  27.589 24.179 1.00 97.62  ? 130  PHE B C   1 
ATOM   2948 O O   . PHE B 2 127 ? 31.967  27.212 25.349 1.00 97.13  ? 130  PHE B O   1 
ATOM   2949 C CB  . PHE B 2 127 ? 31.895  29.818 23.030 1.00 96.44  ? 130  PHE B CB  1 
ATOM   2950 C CG  . PHE B 2 127 ? 30.674  30.222 23.798 1.00 98.10  ? 130  PHE B CG  1 
ATOM   2951 C CD1 . PHE B 2 127 ? 30.765  30.594 25.130 1.00 101.39 ? 130  PHE B CD1 1 
ATOM   2952 C CD2 . PHE B 2 127 ? 29.435  30.254 23.181 1.00 100.31 ? 130  PHE B CD2 1 
ATOM   2953 C CE1 . PHE B 2 127 ? 29.639  30.977 25.836 1.00 102.35 ? 130  PHE B CE1 1 
ATOM   2954 C CE2 . PHE B 2 127 ? 28.306  30.637 23.879 1.00 103.25 ? 130  PHE B CE2 1 
ATOM   2955 C CZ  . PHE B 2 127 ? 28.407  30.998 25.209 1.00 101.43 ? 130  PHE B CZ  1 
ATOM   2956 N N   . LEU B 2 128 ? 31.304  26.967 23.209 1.00 93.75  ? 131  LEU B N   1 
ATOM   2957 C CA  . LEU B 2 128 ? 30.536  25.741 23.435 1.00 93.28  ? 131  LEU B CA  1 
ATOM   2958 C C   . LEU B 2 128 ? 31.281  24.737 24.307 1.00 96.93  ? 131  LEU B C   1 
ATOM   2959 O O   . LEU B 2 128 ? 30.671  24.008 25.086 1.00 96.76  ? 131  LEU B O   1 
ATOM   2960 C CB  . LEU B 2 128 ? 30.168  25.079 22.104 1.00 93.27  ? 131  LEU B CB  1 
ATOM   2961 C CG  . LEU B 2 128 ? 28.938  25.578 21.343 1.00 97.96  ? 131  LEU B CG  1 
ATOM   2962 C CD1 . LEU B 2 128 ? 29.118  27.011 20.861 1.00 98.10  ? 131  LEU B CD1 1 
ATOM   2963 C CD2 . LEU B 2 128 ? 28.627  24.650 20.175 1.00 100.37 ? 131  LEU B CD2 1 
ATOM   2964 N N   . HIS B 2 129 ? 32.597  24.672 24.140 1.00 93.14  ? 132  HIS B N   1 
ATOM   2965 C CA  . HIS B 2 129 ? 33.425  23.790 24.953 1.00 92.87  ? 132  HIS B CA  1 
ATOM   2966 C C   . HIS B 2 129 ? 33.507  24.298 26.386 1.00 96.01  ? 132  HIS B C   1 
ATOM   2967 O O   . HIS B 2 129 ? 33.397  23.525 27.338 1.00 95.83  ? 132  HIS B O   1 
ATOM   2968 C CB  . HIS B 2 129 ? 34.833  23.683 24.364 1.00 93.81  ? 132  HIS B CB  1 
ATOM   2969 C CG  . HIS B 2 129 ? 34.933  22.743 23.205 1.00 97.24  ? 132  HIS B CG  1 
ATOM   2970 N ND1 . HIS B 2 129 ? 36.064  21.998 22.946 1.00 98.99  ? 132  HIS B ND1 1 
ATOM   2971 C CD2 . HIS B 2 129 ? 34.039  22.417 22.241 1.00 98.95  ? 132  HIS B CD2 1 
ATOM   2972 C CE1 . HIS B 2 129 ? 35.864  21.257 21.872 1.00 98.46  ? 132  HIS B CE1 1 
ATOM   2973 N NE2 . HIS B 2 129 ? 34.643  21.494 21.423 1.00 98.74  ? 132  HIS B NE2 1 
ATOM   2974 N N   . ALA B 2 130 ? 33.734  25.599 26.527 1.00 91.69  ? 133  ALA B N   1 
ATOM   2975 C CA  . ALA B 2 130 ? 33.809  26.232 27.838 1.00 90.91  ? 133  ALA B CA  1 
ATOM   2976 C C   . ALA B 2 130 ? 32.587  25.887 28.688 1.00 93.10  ? 133  ALA B C   1 
ATOM   2977 O O   . ALA B 2 130 ? 32.708  25.607 29.881 1.00 92.22  ? 133  ALA B O   1 
ATOM   2978 C CB  . ALA B 2 130 ? 33.939  27.739 27.683 1.00 91.66  ? 133  ALA B CB  1 
ATOM   2979 N N   . ASN B 2 131 ? 31.415  25.902 28.059 1.00 88.84  ? 134  ASN B N   1 
ATOM   2980 C CA  . ASN B 2 131 ? 30.160  25.605 28.742 1.00 88.28  ? 134  ASN B CA  1 
ATOM   2981 C C   . ASN B 2 131 ? 29.896  24.106 28.802 1.00 92.49  ? 134  ASN B C   1 
ATOM   2982 O O   . ASN B 2 131 ? 28.798  23.671 29.147 1.00 91.49  ? 134  ASN B O   1 
ATOM   2983 C CB  . ASN B 2 131 ? 28.997  26.314 28.052 1.00 86.80  ? 134  ASN B CB  1 
ATOM   2984 C CG  . ASN B 2 131 ? 29.143  27.820 28.071 1.00 97.78  ? 134  ASN B CG  1 
ATOM   2985 O OD1 . ASN B 2 131 ? 30.168  28.349 28.492 1.00 88.93  ? 134  ASN B OD1 1 
ATOM   2986 N ND2 . ASN B 2 131 ? 28.112  28.519 27.620 1.00 88.62  ? 134  ASN B ND2 1 
ATOM   2987 N N   . CYS B 2 132 ? 30.904  23.326 28.430 1.00 90.49  ? 135  CYS B N   1 
ATOM   2988 C CA  . CYS B 2 132 ? 30.856  21.875 28.565 1.00 91.00  ? 135  CYS B CA  1 
ATOM   2989 C C   . CYS B 2 132 ? 30.071  21.184 27.452 1.00 96.26  ? 135  CYS B C   1 
ATOM   2990 O O   . CYS B 2 132 ? 29.784  19.989 27.538 1.00 95.91  ? 135  CYS B O   1 
ATOM   2991 C CB  . CYS B 2 132 ? 30.322  21.478 29.942 1.00 91.40  ? 135  CYS B CB  1 
ATOM   2992 S SG  . CYS B 2 132 ? 31.340  22.079 31.318 1.00 95.32  ? 135  CYS B SG  1 
ATOM   2993 N N   . ILE B 2 133 ? 29.758  21.933 26.396 1.00 93.61  ? 136  ILE B N   1 
ATOM   2994 C CA  . ILE B 2 133 ? 29.117  21.371 25.211 1.00 93.66  ? 136  ILE B CA  1 
ATOM   2995 C C   . ILE B 2 133 ? 30.153  20.805 24.243 1.00 98.60  ? 136  ILE B C   1 
ATOM   2996 O O   . ILE B 2 133 ? 31.191  21.421 24.002 1.00 98.03  ? 136  ILE B O   1 
ATOM   2997 C CB  . ILE B 2 133 ? 28.223  22.408 24.503 1.00 96.70  ? 136  ILE B CB  1 
ATOM   2998 C CG1 . ILE B 2 133 ? 27.224  23.019 25.488 1.00 96.88  ? 136  ILE B CG1 1 
ATOM   2999 C CG2 . ILE B 2 133 ? 27.502  21.772 23.319 1.00 97.68  ? 136  ILE B CG2 1 
ATOM   3000 C CD1 . ILE B 2 133 ? 26.215  23.937 24.836 1.00 102.95 ? 136  ILE B CD1 1 
ATOM   3001 N N   . VAL B 2 134 ? 29.865  19.626 23.700 1.00 96.29  ? 137  VAL B N   1 
ATOM   3002 C CA  . VAL B 2 134 ? 30.691  19.031 22.652 1.00 96.54  ? 137  VAL B CA  1 
ATOM   3003 C C   . VAL B 2 134 ? 29.825  18.602 21.467 1.00 101.71 ? 137  VAL B C   1 
ATOM   3004 O O   . VAL B 2 134 ? 28.762  18.004 21.646 1.00 101.20 ? 137  VAL B O   1 
ATOM   3005 C CB  . VAL B 2 134 ? 31.563  17.876 23.195 1.00 100.36 ? 137  VAL B CB  1 
ATOM   3006 C CG1 . VAL B 2 134 ? 32.306  17.179 22.062 1.00 100.15 ? 137  VAL B CG1 1 
ATOM   3007 C CG2 . VAL B 2 134 ? 32.548  18.401 24.231 1.00 100.13 ? 137  VAL B CG2 1 
ATOM   3008 N N   . HIS B 2 135 ? 30.271  18.944 20.261 1.00 99.44  ? 138  HIS B N   1 
ATOM   3009 C CA  . HIS B 2 135 ? 29.500  18.692 19.044 1.00 99.60  ? 138  HIS B CA  1 
ATOM   3010 C C   . HIS B 2 135 ? 29.802  17.313 18.463 1.00 105.68 ? 138  HIS B C   1 
ATOM   3011 O O   . HIS B 2 135 ? 30.945  16.853 18.491 1.00 105.48 ? 138  HIS B O   1 
ATOM   3012 C CB  . HIS B 2 135 ? 29.805  19.770 17.997 1.00 99.88  ? 138  HIS B CB  1 
ATOM   3013 C CG  . HIS B 2 135 ? 28.688  20.010 17.029 1.00 102.85 ? 138  HIS B CG  1 
ATOM   3014 N ND1 . HIS B 2 135 ? 27.805  19.024 16.646 1.00 104.37 ? 138  HIS B ND1 1 
ATOM   3015 C CD2 . HIS B 2 135 ? 28.307  21.131 16.370 1.00 104.20 ? 138  HIS B CD2 1 
ATOM   3016 C CE1 . HIS B 2 135 ? 26.929  19.526 15.794 1.00 103.59 ? 138  HIS B CE1 1 
ATOM   3017 N NE2 . HIS B 2 135 ? 27.211  20.804 15.611 1.00 103.82 ? 138  HIS B NE2 1 
ATOM   3018 N N   . ARG B 2 136 ? 28.770  16.652 17.948 1.00 103.69 ? 139  ARG B N   1 
ATOM   3019 C CA  . ARG B 2 136 ? 28.961  15.428 17.177 1.00 104.23 ? 139  ARG B CA  1 
ATOM   3020 C C   . ARG B 2 136 ? 29.149  15.776 15.702 1.00 109.03 ? 139  ARG B C   1 
ATOM   3021 O O   . ARG B 2 136 ? 30.263  15.727 15.176 1.00 108.55 ? 139  ARG B O   1 
ATOM   3022 C CB  . ARG B 2 136 ? 27.753  14.498 17.334 1.00 105.16 ? 139  ARG B CB  1 
ATOM   3023 C CG  . ARG B 2 136 ? 27.937  13.123 16.701 1.00 115.29 ? 139  ARG B CG  1 
ATOM   3024 C CD  . ARG B 2 136 ? 28.583  12.140 17.669 1.00 124.02 ? 139  ARG B CD  1 
ATOM   3025 N NE  . ARG B 2 136 ? 27.624  11.613 18.639 1.00 131.55 ? 139  ARG B NE  1 
ATOM   3026 C CZ  . ARG B 2 136 ? 27.406  12.135 19.843 1.00 144.53 ? 139  ARG B CZ  1 
ATOM   3027 N NH1 . ARG B 2 136 ? 28.082  13.205 20.238 1.00 132.84 ? 139  ARG B NH1 1 
ATOM   3028 N NH2 . ARG B 2 136 ? 26.512  11.585 20.654 1.00 129.89 ? 139  ARG B NH2 1 
ATOM   3029 N N   . ASP B 2 137 ? 28.056  16.181 15.061 1.00 106.22 ? 140  ASP B N   1 
ATOM   3030 C CA  . ASP B 2 137 ? 28.048  16.496 13.637 1.00 106.26 ? 140  ASP B CA  1 
ATOM   3031 C C   . ASP B 2 137 ? 28.616  17.877 13.325 1.00 110.30 ? 140  ASP B C   1 
ATOM   3032 O O   . ASP B 2 137 ? 27.908  18.753 12.825 1.00 109.65 ? 140  ASP B O   1 
ATOM   3033 C CB  . ASP B 2 137 ? 26.629  16.382 13.077 1.00 108.18 ? 140  ASP B CB  1 
ATOM   3034 C CG  . ASP B 2 137 ? 26.161  14.946 12.963 1.00 118.25 ? 140  ASP B CG  1 
ATOM   3035 O OD1 . ASP B 2 137 ? 26.959  14.094 12.517 1.00 118.92 ? 140  ASP B OD1 1 
ATOM   3036 O OD2 . ASP B 2 137 ? 24.987  14.675 13.292 1.00 123.56 ? 140  ASP B OD2 1 
ATOM   3037 N N   . LEU B 2 138 ? 29.900  18.061 13.603 1.00 107.29 ? 141  LEU B N   1 
ATOM   3038 C CA  . LEU B 2 138 ? 30.600  19.261 13.168 1.00 107.36 ? 141  LEU B CA  1 
ATOM   3039 C C   . LEU B 2 138 ? 30.829  19.160 11.658 1.00 111.24 ? 141  LEU B C   1 
ATOM   3040 O O   . LEU B 2 138 ? 31.667  18.380 11.201 1.00 110.78 ? 141  LEU B O   1 
ATOM   3041 C CB  . LEU B 2 138 ? 31.932  19.388 13.913 1.00 107.52 ? 141  LEU B CB  1 
ATOM   3042 C CG  . LEU B 2 138 ? 32.621  20.755 13.922 1.00 112.34 ? 141  LEU B CG  1 
ATOM   3043 C CD1 . LEU B 2 138 ? 31.605  21.862 14.172 1.00 112.51 ? 141  LEU B CD1 1 
ATOM   3044 C CD2 . LEU B 2 138 ? 33.713  20.775 14.987 1.00 114.76 ? 141  LEU B CD2 1 
ATOM   3045 N N   . LYS B 2 139 ? 30.045  19.910 10.888 1.00 107.55 ? 142  LYS B N   1 
ATOM   3046 C CA  . LYS B 2 139 ? 30.070  19.800 9.429  1.00 107.02 ? 142  LYS B CA  1 
ATOM   3047 C C   . LYS B 2 139 ? 29.822  21.144 8.743  1.00 111.02 ? 142  LYS B C   1 
ATOM   3048 O O   . LYS B 2 139 ? 29.626  22.163 9.406  1.00 110.84 ? 142  LYS B O   1 
ATOM   3049 C CB  . LYS B 2 139 ? 29.032  18.775 8.966  1.00 108.92 ? 142  LYS B CB  1 
ATOM   3050 C CG  . LYS B 2 139 ? 29.238  17.388 9.551  1.00 116.31 ? 142  LYS B CG  1 
ATOM   3051 C CD  . LYS B 2 139 ? 28.094  16.451 9.202  1.00 121.99 ? 142  LYS B CD  1 
ATOM   3052 C CE  . LYS B 2 139 ? 28.366  15.045 9.712  1.00 127.51 ? 142  LYS B CE  1 
ATOM   3053 N NZ  . LYS B 2 139 ? 27.255  14.107 9.397  1.00 134.07 ? 142  LYS B NZ  1 
ATOM   3054 N N   . PRO B 2 140 ? 29.858  21.163 7.398  1.00 107.38 ? 143  PRO B N   1 
ATOM   3055 C CA  . PRO B 2 140 ? 29.498  22.336 6.590  1.00 106.97 ? 143  PRO B CA  1 
ATOM   3056 C C   . PRO B 2 140 ? 27.983  22.488 6.503  1.00 110.05 ? 143  PRO B C   1 
ATOM   3057 O O   . PRO B 2 140 ? 27.468  23.522 6.071  1.00 109.22 ? 143  PRO B O   1 
ATOM   3058 C CB  . PRO B 2 140 ? 30.072  22.001 5.210  1.00 108.77 ? 143  PRO B CB  1 
ATOM   3059 C CG  . PRO B 2 140 ? 31.151  21.011 5.475  1.00 113.32 ? 143  PRO B CG  1 
ATOM   3060 C CD  . PRO B 2 140 ? 30.666  20.198 6.633  1.00 108.96 ? 143  PRO B CD  1 
ATOM   3061 N N   . GLU B 2 141 ? 27.276  21.429 6.881  1.00 106.40 ? 144  GLU B N   1 
ATOM   3062 C CA  . GLU B 2 141 ? 25.836  21.496 7.091  1.00 106.05 ? 144  GLU B CA  1 
ATOM   3063 C C   . GLU B 2 141 ? 25.584  22.253 8.393  1.00 108.86 ? 144  GLU B C   1 
ATOM   3064 O O   . GLU B 2 141 ? 24.787  23.191 8.443  1.00 108.49 ? 144  GLU B O   1 
ATOM   3065 C CB  . GLU B 2 141 ? 25.261  20.082 7.218  1.00 107.50 ? 144  GLU B CB  1 
ATOM   3066 C CG  . GLU B 2 141 ? 25.689  19.117 6.120  1.00 118.13 ? 144  GLU B CG  1 
ATOM   3067 C CD  . GLU B 2 141 ? 25.348  17.676 6.453  1.00 136.67 ? 144  GLU B CD  1 
ATOM   3068 O OE1 . GLU B 2 141 ? 25.479  17.293 7.637  1.00 131.51 ? 144  GLU B OE1 1 
ATOM   3069 O OE2 . GLU B 2 141 ? 24.959  16.924 5.533  1.00 128.14 ? 144  GLU B OE2 1 
ATOM   3070 N N   . ASN B 2 142 ? 26.297  21.846 9.438  1.00 104.22 ? 145  ASN B N   1 
ATOM   3071 C CA  . ASN B 2 142 ? 26.149  22.433 10.761 1.00 103.38 ? 145  ASN B CA  1 
ATOM   3072 C C   . ASN B 2 142 ? 27.138  23.572 10.990 1.00 106.66 ? 145  ASN B C   1 
ATOM   3073 O O   . ASN B 2 142 ? 27.722  23.698 12.066 1.00 106.36 ? 145  ASN B O   1 
ATOM   3074 C CB  . ASN B 2 142 ? 26.312  21.358 11.833 1.00 102.42 ? 145  ASN B CB  1 
ATOM   3075 C CG  . ASN B 2 142 ? 25.244  20.287 11.744 1.00 117.87 ? 145  ASN B CG  1 
ATOM   3076 O OD1 . ASN B 2 142 ? 24.146  20.532 11.244 1.00 109.73 ? 145  ASN B OD1 1 
ATOM   3077 N ND2 . ASN B 2 142 ? 25.562  19.092 12.226 1.00 109.37 ? 145  ASN B ND2 1 
ATOM   3078 N N   . ILE B 2 143 ? 27.364  24.356 9.942  1.00 102.46 ? 146  ILE B N   1 
ATOM   3079 C CA  . ILE B 2 143 ? 28.082  25.621 10.042 1.00 101.84 ? 146  ILE B CA  1 
ATOM   3080 C C   . ILE B 2 143 ? 27.406  26.566 9.062  1.00 106.21 ? 146  ILE B C   1 
ATOM   3081 O O   . ILE B 2 143 ? 26.933  26.130 8.016  1.00 106.03 ? 146  ILE B O   1 
ATOM   3082 C CB  . ILE B 2 143 ? 29.573  25.460 9.709  1.00 104.42 ? 146  ILE B CB  1 
ATOM   3083 C CG1 . ILE B 2 143 ? 30.284  24.684 10.817 1.00 104.51 ? 146  ILE B CG1 1 
ATOM   3084 C CG2 . ILE B 2 143 ? 30.218  26.819 9.508  1.00 104.83 ? 146  ILE B CG2 1 
ATOM   3085 C CD1 . ILE B 2 143 ? 31.777  24.627 10.651 1.00 110.23 ? 146  ILE B CD1 1 
ATOM   3086 N N   . LEU B 2 144 ? 27.263  27.832 9.432  1.00 103.16 ? 147  LEU B N   1 
ATOM   3087 C CA  . LEU B 2 144 ? 26.503  28.743 8.588  1.00 103.36 ? 147  LEU B CA  1 
ATOM   3088 C C   . LEU B 2 144 ? 26.772  30.237 8.741  1.00 108.53 ? 147  LEU B C   1 
ATOM   3089 O O   . LEU B 2 144 ? 27.405  30.678 9.701  1.00 107.95 ? 147  LEU B O   1 
ATOM   3090 C CB  . LEU B 2 144 ? 25.000  28.434 8.640  1.00 103.30 ? 147  LEU B CB  1 
ATOM   3091 C CG  . LEU B 2 144 ? 24.345  27.862 9.904  1.00 107.63 ? 147  LEU B CG  1 
ATOM   3092 C CD1 . LEU B 2 144 ? 22.842  28.083 9.839  1.00 107.67 ? 147  LEU B CD1 1 
ATOM   3093 C CD2 . LEU B 2 144 ? 24.636  26.373 10.049 1.00 109.62 ? 147  LEU B CD2 1 
ATOM   3094 N N   . VAL B 2 145 ? 26.342  30.994 7.733  1.00 106.15 ? 148  VAL B N   1 
ATOM   3095 C CA  . VAL B 2 145 ? 26.394  32.452 7.753  1.00 106.37 ? 148  VAL B CA  1 
ATOM   3096 C C   . VAL B 2 145 ? 25.221  32.988 6.930  1.00 111.05 ? 148  VAL B C   1 
ATOM   3097 O O   . VAL B 2 145 ? 24.959  32.505 5.828  1.00 110.53 ? 148  VAL B O   1 
ATOM   3098 C CB  . VAL B 2 145 ? 27.740  32.977 7.207  1.00 110.25 ? 148  VAL B CB  1 
ATOM   3099 C CG1 . VAL B 2 145 ? 28.859  31.981 7.481  1.00 109.97 ? 148  VAL B CG1 1 
ATOM   3100 C CG2 . VAL B 2 145 ? 27.637  33.291 5.721  1.00 110.10 ? 148  VAL B CG2 1 
ATOM   3101 N N   . THR B 2 146 ? 24.497  33.958 7.482  1.00 108.27 ? 149  THR B N   1 
ATOM   3102 C CA  . THR B 2 146 ? 23.348  34.542 6.790  1.00 108.27 ? 149  THR B CA  1 
ATOM   3103 C C   . THR B 2 146 ? 23.831  35.455 5.676  1.00 112.15 ? 149  THR B C   1 
ATOM   3104 O O   . THR B 2 146 ? 23.334  35.411 4.551  1.00 111.87 ? 149  THR B O   1 
ATOM   3105 C CB  . THR B 2 146 ? 22.433  35.320 7.766  1.00 116.69 ? 149  THR B CB  1 
ATOM   3106 O OG1 . THR B 2 146 ? 21.164  35.570 7.146  1.00 114.76 ? 149  THR B OG1 1 
ATOM   3107 C CG2 . THR B 2 146 ? 23.069  36.654 8.143  1.00 115.79 ? 149  THR B CG2 1 
ATOM   3108 N N   . SER B 2 147 ? 24.823  36.271 6.004  1.00 108.63 ? 150  SER B N   1 
ATOM   3109 C CA  . SER B 2 147 ? 25.318  37.298 5.106  1.00 108.51 ? 150  SER B CA  1 
ATOM   3110 C C   . SER B 2 147 ? 26.416  38.035 5.856  1.00 112.21 ? 150  SER B C   1 
ATOM   3111 O O   . SER B 2 147 ? 26.804  37.618 6.947  1.00 111.86 ? 150  SER B O   1 
ATOM   3112 C CB  . SER B 2 147 ? 24.191  38.266 4.738  1.00 112.15 ? 150  SER B CB  1 
ATOM   3113 O OG  . SER B 2 147 ? 23.566  38.785 5.899  1.00 121.00 ? 150  SER B OG  1 
ATOM   3114 N N   . GLY B 2 148 ? 26.955  39.088 5.253  1.00 108.51 ? 151  GLY B N   1 
ATOM   3115 C CA  . GLY B 2 148 ? 27.985  39.902 5.875  1.00 108.33 ? 151  GLY B CA  1 
ATOM   3116 C C   . GLY B 2 148 ? 29.108  39.115 6.530  1.00 112.32 ? 151  GLY B C   1 
ATOM   3117 O O   . GLY B 2 148 ? 30.004  39.702 7.139  1.00 111.97 ? 151  GLY B O   1 
ATOM   3118 N N   . GLY B 2 149 ? 29.085  37.793 6.381  1.00 108.77 ? 152  GLY B N   1 
ATOM   3119 C CA  . GLY B 2 149 ? 30.038  36.918 7.040  1.00 108.52 ? 152  GLY B CA  1 
ATOM   3120 C C   . GLY B 2 149 ? 29.785  36.865 8.535  1.00 112.24 ? 152  GLY B C   1 
ATOM   3121 O O   . GLY B 2 149 ? 29.691  37.902 9.193  1.00 112.18 ? 152  GLY B O   1 
ATOM   3122 N N   . THR B 2 150 ? 29.687  35.656 9.080  1.00 107.90 ? 153  THR B N   1 
ATOM   3123 C CA  . THR B 2 150 ? 29.310  35.487 10.479 1.00 106.91 ? 153  THR B CA  1 
ATOM   3124 C C   . THR B 2 150 ? 29.864  34.218 11.132 1.00 108.87 ? 153  THR B C   1 
ATOM   3125 O O   . THR B 2 150 ? 30.588  34.298 12.122 1.00 108.63 ? 153  THR B O   1 
ATOM   3126 C CB  . THR B 2 150 ? 27.786  35.629 10.668 1.00 114.55 ? 153  THR B CB  1 
ATOM   3127 O OG1 . THR B 2 150 ? 27.106  35.146 9.500  1.00 113.03 ? 153  THR B OG1 1 
ATOM   3128 C CG2 . THR B 2 150 ? 27.412  37.088 10.901 1.00 113.12 ? 153  THR B CG2 1 
ATOM   3129 N N   . VAL B 2 151 ? 29.500  33.060 10.584 1.00 103.63 ? 154  VAL B N   1 
ATOM   3130 C CA  . VAL B 2 151 ? 29.936  31.748 11.084 1.00 102.43 ? 154  VAL B CA  1 
ATOM   3131 C C   . VAL B 2 151 ? 29.274  31.262 12.380 1.00 103.13 ? 154  VAL B C   1 
ATOM   3132 O O   . VAL B 2 151 ? 29.947  30.816 13.310 1.00 102.81 ? 154  VAL B O   1 
ATOM   3133 C CB  . VAL B 2 151 ? 31.477  31.537 11.036 1.00 106.47 ? 154  VAL B CB  1 
ATOM   3134 C CG1 . VAL B 2 151 ? 32.063  32.156 9.778  1.00 106.35 ? 154  VAL B CG1 1 
ATOM   3135 C CG2 . VAL B 2 151 ? 32.172  32.064 12.288 1.00 106.30 ? 154  VAL B CG2 1 
ATOM   3136 N N   . LYS B 2 152 ? 27.944  31.282 12.398 1.00 96.72  ? 155  LYS B N   1 
ATOM   3137 C CA  . LYS B 2 152 ? 27.172  30.785 13.534 1.00 95.01  ? 155  LYS B CA  1 
ATOM   3138 C C   . LYS B 2 152 ? 27.120  29.252 13.532 1.00 96.33  ? 155  LYS B C   1 
ATOM   3139 O O   . LYS B 2 152 ? 26.369  28.659 12.761 1.00 95.64  ? 155  LYS B O   1 
ATOM   3140 C CB  . LYS B 2 152 ? 25.742  31.332 13.462 1.00 96.93  ? 155  LYS B CB  1 
ATOM   3141 C CG  . LYS B 2 152 ? 25.632  32.847 13.320 1.00 103.79 ? 155  LYS B CG  1 
ATOM   3142 C CD  . LYS B 2 152 ? 25.413  33.521 14.667 1.00 109.63 ? 155  LYS B CD  1 
ATOM   3143 C CE  . LYS B 2 152 ? 25.154  35.015 14.517 1.00 113.57 ? 155  LYS B CE  1 
ATOM   3144 N NZ  . LYS B 2 152 ? 25.031  35.708 15.835 1.00 118.55 ? 155  LYS B NZ  1 
ATOM   3145 N N   . LEU B 2 153 ? 27.894  28.615 14.409 1.00 91.13  ? 156  LEU B N   1 
ATOM   3146 C CA  . LEU B 2 153 ? 27.851  27.158 14.550 1.00 89.95  ? 156  LEU B CA  1 
ATOM   3147 C C   . LEU B 2 153 ? 26.447  26.666 14.904 1.00 91.67  ? 156  LEU B C   1 
ATOM   3148 O O   . LEU B 2 153 ? 25.656  27.403 15.485 1.00 91.02  ? 156  LEU B O   1 
ATOM   3149 C CB  . LEU B 2 153 ? 28.858  26.684 15.597 1.00 89.93  ? 156  LEU B CB  1 
ATOM   3150 C CG  . LEU B 2 153 ? 30.321  26.962 15.247 1.00 94.69  ? 156  LEU B CG  1 
ATOM   3151 C CD1 . LEU B 2 153 ? 31.269  26.219 16.181 1.00 94.81  ? 156  LEU B CD1 1 
ATOM   3152 C CD2 . LEU B 2 153 ? 30.598  26.609 13.792 1.00 97.12  ? 156  LEU B CD2 1 
ATOM   3153 N N   . ALA B 2 154 ? 26.142  25.417 14.565 1.00 86.96  ? 157  ALA B N   1 
ATOM   3154 C CA  . ALA B 2 154 ? 24.774  24.925 14.692 1.00 86.20  ? 157  ALA B CA  1 
ATOM   3155 C C   . ALA B 2 154 ? 24.640  23.454 15.084 1.00 88.87  ? 157  ALA B C   1 
ATOM   3156 O O   . ALA B 2 154 ? 25.617  22.700 15.084 1.00 87.83  ? 157  ALA B O   1 
ATOM   3157 C CB  . ALA B 2 154 ? 23.989  25.213 13.428 1.00 86.92  ? 157  ALA B CB  1 
ATOM   3158 N N   . ASP B 2 155 ? 23.409  23.064 15.412 1.00 85.25  ? 158  ASP B N   1 
ATOM   3159 C CA  . ASP B 2 155 ? 23.084  21.701 15.831 1.00 85.02  ? 158  ASP B CA  1 
ATOM   3160 C C   . ASP B 2 155 ? 24.009  21.133 16.908 1.00 89.01  ? 158  ASP B C   1 
ATOM   3161 O O   . ASP B 2 155 ? 24.093  19.920 17.103 1.00 88.71  ? 158  ASP B O   1 
ATOM   3162 C CB  . ASP B 2 155 ? 22.963  20.769 14.626 1.00 86.71  ? 158  ASP B CB  1 
ATOM   3163 C CG  . ASP B 2 155 ? 21.814  21.154 13.710 1.00 94.80  ? 158  ASP B CG  1 
ATOM   3164 O OD1 . ASP B 2 155 ? 21.039  22.063 14.080 1.00 94.74  ? 158  ASP B OD1 1 
ATOM   3165 O OD2 . ASP B 2 155 ? 21.684  20.552 12.624 1.00 100.36 ? 158  ASP B OD2 1 
ATOM   3166 N N   . PHE B 2 156 ? 24.683  22.037 17.610 1.00 85.56  ? 159  PHE B N   1 
ATOM   3167 C CA  . PHE B 2 156 ? 25.440  21.733 18.824 1.00 85.30  ? 159  PHE B CA  1 
ATOM   3168 C C   . PHE B 2 156 ? 24.654  20.917 19.849 1.00 88.86  ? 159  PHE B C   1 
ATOM   3169 O O   . PHE B 2 156 ? 23.428  21.017 19.930 1.00 88.11  ? 159  PHE B O   1 
ATOM   3170 C CB  . PHE B 2 156 ? 25.902  23.040 19.475 1.00 87.16  ? 159  PHE B CB  1 
ATOM   3171 C CG  . PHE B 2 156 ? 24.853  24.124 19.475 1.00 88.90  ? 159  PHE B CG  1 
ATOM   3172 C CD1 . PHE B 2 156 ? 23.509  23.820 19.284 1.00 92.17  ? 159  PHE B CD1 1 
ATOM   3173 C CD2 . PHE B 2 156 ? 25.208  25.449 19.665 1.00 91.17  ? 159  PHE B CD2 1 
ATOM   3174 C CE1 . PHE B 2 156 ? 22.548  24.817 19.260 1.00 93.16  ? 159  PHE B CE1 1 
ATOM   3175 C CE2 . PHE B 2 156 ? 24.248  26.450 19.654 1.00 94.07  ? 159  PHE B CE2 1 
ATOM   3176 C CZ  . PHE B 2 156 ? 22.916  26.132 19.452 1.00 92.19  ? 159  PHE B CZ  1 
ATOM   3177 N N   . GLY B 2 157 ? 25.380  20.162 20.671 1.00 85.67  ? 160  GLY B N   1 
ATOM   3178 C CA  . GLY B 2 157 ? 24.810  19.412 21.780 1.00 85.53  ? 160  GLY B CA  1 
ATOM   3179 C C   . GLY B 2 157 ? 23.840  18.320 21.364 1.00 89.33  ? 160  GLY B C   1 
ATOM   3180 O O   . GLY B 2 157 ? 24.049  17.145 21.672 1.00 88.96  ? 160  GLY B O   1 
ATOM   3181 N N   . LEU B 2 158 ? 22.781  18.732 20.667 1.00 85.42  ? 161  LEU B N   1 
ATOM   3182 C CA  . LEU B 2 158 ? 21.693  17.870 20.185 1.00 84.77  ? 161  LEU B CA  1 
ATOM   3183 C C   . LEU B 2 158 ? 21.835  16.348 20.263 1.00 87.83  ? 161  LEU B C   1 
ATOM   3184 O O   . LEU B 2 158 ? 20.847  15.637 20.441 1.00 86.69  ? 161  LEU B O   1 
ATOM   3185 C CB  . LEU B 2 158 ? 21.273  18.289 18.777 1.00 84.66  ? 161  LEU B CB  1 
ATOM   3186 C CG  . LEU B 2 158 ? 20.722  19.710 18.672 1.00 89.03  ? 161  LEU B CG  1 
ATOM   3187 C CD1 . LEU B 2 158 ? 20.219  19.984 17.269 1.00 89.04  ? 161  LEU B CD1 1 
ATOM   3188 C CD2 . LEU B 2 158 ? 19.615  19.908 19.691 1.00 91.38  ? 161  LEU B CD2 1 
ATOM   3189 N N   . ALA B 2 159 ? 23.051  15.849 20.078 1.00 84.71  ? 162  ALA B N   1 
ATOM   3190 C CA  . ALA B 2 159 ? 23.297  14.409 20.082 1.00 84.47  ? 162  ALA B CA  1 
ATOM   3191 C C   . ALA B 2 159 ? 22.685  13.701 21.290 1.00 87.55  ? 162  ALA B C   1 
ATOM   3192 O O   . ALA B 2 159 ? 22.088  12.635 21.152 1.00 86.84  ? 162  ALA B O   1 
ATOM   3193 C CB  . ALA B 2 159 ? 24.791  14.122 19.993 1.00 85.28  ? 162  ALA B CB  1 
ATOM   3194 N N   . ARG B 2 160 ? 22.867  14.277 22.475 1.00 83.91  ? 163  ARG B N   1 
ATOM   3195 C CA  . ARG B 2 160 ? 22.286  13.720 23.695 1.00 83.43  ? 163  ARG B CA  1 
ATOM   3196 C C   . ARG B 2 160 ? 20.762  13.694 23.593 1.00 86.59  ? 163  ARG B C   1 
ATOM   3197 O O   . ARG B 2 160 ? 20.130  12.664 23.832 1.00 86.20  ? 163  ARG B O   1 
ATOM   3198 C CB  . ARG B 2 160 ? 22.707  14.544 24.918 1.00 83.17  ? 163  ARG B CB  1 
ATOM   3199 C CG  . ARG B 2 160 ? 24.212  14.653 25.126 1.00 89.80  ? 163  ARG B CG  1 
ATOM   3200 C CD  . ARG B 2 160 ? 24.759  13.498 25.948 1.00 91.55  ? 163  ARG B CD  1 
ATOM   3201 N NE  . ARG B 2 160 ? 24.440  13.635 27.367 1.00 93.01  ? 163  ARG B NE  1 
ATOM   3202 C CZ  . ARG B 2 160 ? 24.814  12.768 28.304 1.00 101.77 ? 163  ARG B CZ  1 
ATOM   3203 N NH1 . ARG B 2 160 ? 24.478  12.969 29.573 1.00 85.05  ? 163  ARG B NH1 1 
ATOM   3204 N NH2 . ARG B 2 160 ? 25.526  11.699 27.973 1.00 87.33  ? 163  ARG B NH2 1 
ATOM   3205 N N   . ILE B 2 161 ? 20.179  14.830 23.226 1.00 82.53  ? 164  ILE B N   1 
ATOM   3206 C CA  . ILE B 2 161 ? 18.729  14.950 23.121 1.00 82.14  ? 164  ILE B CA  1 
ATOM   3207 C C   . ILE B 2 161 ? 18.133  13.969 22.116 1.00 86.64  ? 164  ILE B C   1 
ATOM   3208 O O   . ILE B 2 161 ? 16.977  13.564 22.243 1.00 86.11  ? 164  ILE B O   1 
ATOM   3209 C CB  . ILE B 2 161 ? 18.305  16.394 22.789 1.00 84.80  ? 164  ILE B CB  1 
ATOM   3210 C CG1 . ILE B 2 161 ? 18.816  17.361 23.858 1.00 84.90  ? 164  ILE B CG1 1 
ATOM   3211 C CG2 . ILE B 2 161 ? 16.794  16.485 22.637 1.00 84.94  ? 164  ILE B CG2 1 
ATOM   3212 C CD1 . ILE B 2 161 ? 18.546  18.812 23.540 1.00 90.35  ? 164  ILE B CD1 1 
ATOM   3213 N N   . TYR B 2 162 ? 18.927  13.589 21.121 1.00 83.97  ? 165  TYR B N   1 
ATOM   3214 C CA  . TYR B 2 162 ? 18.429  12.789 20.006 1.00 84.07  ? 165  TYR B CA  1 
ATOM   3215 C C   . TYR B 2 162 ? 18.753  11.297 20.096 1.00 89.29  ? 165  TYR B C   1 
ATOM   3216 O O   . TYR B 2 162 ? 18.482  10.552 19.157 1.00 88.85  ? 165  TYR B O   1 
ATOM   3217 C CB  . TYR B 2 162 ? 18.924  13.355 18.671 1.00 84.82  ? 165  TYR B CB  1 
ATOM   3218 C CG  . TYR B 2 162 ? 18.116  14.523 18.145 1.00 85.74  ? 165  TYR B CG  1 
ATOM   3219 C CD1 . TYR B 2 162 ? 18.499  15.833 18.404 1.00 87.54  ? 165  TYR B CD1 1 
ATOM   3220 C CD2 . TYR B 2 162 ? 16.983  14.313 17.368 1.00 86.17  ? 165  TYR B CD2 1 
ATOM   3221 C CE1 . TYR B 2 162 ? 17.769  16.901 17.914 1.00 87.83  ? 165  TYR B CE1 1 
ATOM   3222 C CE2 . TYR B 2 162 ? 16.248  15.374 16.874 1.00 86.85  ? 165  TYR B CE2 1 
ATOM   3223 C CZ  . TYR B 2 162 ? 16.646  16.665 17.150 1.00 93.23  ? 165  TYR B CZ  1 
ATOM   3224 O OH  . TYR B 2 162 ? 15.919  17.724 16.662 1.00 93.49  ? 165  TYR B OH  1 
ATOM   3225 N N   . SER B 2 163 ? 19.329  10.868 21.216 1.00 87.29  ? 166  SER B N   1 
ATOM   3226 C CA  . SER B 2 163 ? 19.646  9.455  21.438 1.00 88.13  ? 166  SER B CA  1 
ATOM   3227 C C   . SER B 2 163 ? 18.486  8.546  21.043 1.00 94.08  ? 166  SER B C   1 
ATOM   3228 O O   . SER B 2 163 ? 18.680  7.392  20.668 1.00 93.63  ? 166  SER B O   1 
ATOM   3229 C CB  . SER B 2 163 ? 20.007  9.212  22.906 1.00 92.25  ? 166  SER B CB  1 
ATOM   3230 O OG  . SER B 2 163 ? 21.179  9.915  23.279 1.00 101.51 ? 166  SER B OG  1 
ATOM   3231 N N   . TYR B 2 164 ? 17.282  9.098  21.095 1.00 92.59  ? 167  TYR B N   1 
ATOM   3232 C CA  . TYR B 2 164 ? 16.068  8.363  20.768 1.00 93.36  ? 167  TYR B CA  1 
ATOM   3233 C C   . TYR B 2 164 ? 15.889  8.246  19.253 1.00 100.31 ? 167  TYR B C   1 
ATOM   3234 O O   . TYR B 2 164 ? 14.870  7.745  18.780 1.00 99.96  ? 167  TYR B O   1 
ATOM   3235 C CB  . TYR B 2 164 ? 14.865  9.092  21.373 1.00 94.15  ? 167  TYR B CB  1 
ATOM   3236 C CG  . TYR B 2 164 ? 13.621  8.249  21.557 1.00 94.94  ? 167  TYR B CG  1 
ATOM   3237 C CD1 . TYR B 2 164 ? 13.577  7.233  22.504 1.00 96.62  ? 167  TYR B CD1 1 
ATOM   3238 C CD2 . TYR B 2 164 ? 12.466  8.522  20.838 1.00 95.41  ? 167  TYR B CD2 1 
ATOM   3239 C CE1 . TYR B 2 164 ? 12.425  6.489  22.699 1.00 96.79  ? 167  TYR B CE1 1 
ATOM   3240 C CE2 . TYR B 2 164 ? 11.316  7.784  21.027 1.00 96.09  ? 167  TYR B CE2 1 
ATOM   3241 C CZ  . TYR B 2 164 ? 11.298  6.772  21.955 1.00 101.93 ? 167  TYR B CZ  1 
ATOM   3242 O OH  . TYR B 2 164 ? 10.140  6.050  22.131 1.00 101.69 ? 167  TYR B OH  1 
ATOM   3243 N N   . GLN B 2 165 ? 16.873  8.723  18.495 1.00 99.14  ? 168  GLN B N   1 
ATOM   3244 C CA  . GLN B 2 165 ? 16.806  8.669  17.036 1.00 99.98  ? 168  GLN B CA  1 
ATOM   3245 C C   . GLN B 2 165 ? 17.040  7.259  16.512 1.00 107.62 ? 168  GLN B C   1 
ATOM   3246 O O   . GLN B 2 165 ? 16.300  6.776  15.654 1.00 107.09 ? 168  GLN B O   1 
ATOM   3247 C CB  . GLN B 2 165 ? 17.796  9.652  16.401 1.00 100.99 ? 168  GLN B CB  1 
ATOM   3248 C CG  . GLN B 2 165 ? 19.263  9.277  16.547 1.00 105.53 ? 168  GLN B CG  1 
ATOM   3249 C CD  . GLN B 2 165 ? 20.193  10.404 16.123 1.00 115.34 ? 168  GLN B CD  1 
ATOM   3250 O OE1 . GLN B 2 165 ? 21.248  10.616 16.724 1.00 107.86 ? 168  GLN B OE1 1 
ATOM   3251 N NE2 . GLN B 2 165 ? 19.790  11.149 15.099 1.00 105.36 ? 168  GLN B NE2 1 
ATOM   3252 N N   . MET B 2 166 ? 18.058  6.597  17.053 1.00 107.37 ? 169  MET B N   1 
ATOM   3253 C CA  . MET B 2 166 ? 18.402  5.239  16.647 1.00 108.72 ? 169  MET B CA  1 
ATOM   3254 C C   . MET B 2 166 ? 17.326  4.216  17.017 1.00 114.90 ? 169  MET B C   1 
ATOM   3255 O O   . MET B 2 166 ? 17.586  3.011  17.037 1.00 114.54 ? 169  MET B O   1 
ATOM   3256 C CB  . MET B 2 166 ? 19.754  4.829  17.232 1.00 111.40 ? 169  MET B CB  1 
ATOM   3257 C CG  . MET B 2 166 ? 20.937  5.654  16.732 1.00 115.52 ? 169  MET B CG  1 
ATOM   3258 S SD  . MET B 2 166 ? 21.604  5.112  15.136 1.00 120.14 ? 169  MET B SD  1 
ATOM   3259 C CE  . MET B 2 166 ? 23.174  6.013  15.106 1.00 116.84 ? 169  MET B CE  1 
ATOM   3260 N N   . ALA B 2 167 ? 16.138  4.704  17.364 1.00 113.19 ? 170  ALA B N   1 
ATOM   3261 C CA  . ALA B 2 167 ? 14.944  3.862  17.394 1.00 113.85 ? 170  ALA B CA  1 
ATOM   3262 C C   . ALA B 2 167 ? 14.332  3.914  15.998 1.00 119.90 ? 170  ALA B C   1 
ATOM   3263 O O   . ALA B 2 167 ? 13.280  3.332  15.733 1.00 119.48 ? 170  ALA B O   1 
ATOM   3264 C CB  . ALA B 2 167 ? 13.954  4.368  18.436 1.00 114.56 ? 170  ALA B CB  1 
ATOM   3265 N N   . LEU B 2 168 ? 14.987  4.681  15.131 1.00 118.15 ? 171  LEU B N   1 
ATOM   3266 C CA  . LEU B 2 168 ? 14.699  4.698  13.703 1.00 118.72 ? 171  LEU B CA  1 
ATOM   3267 C C   . LEU B 2 168 ? 15.948  4.163  13.000 1.00 124.13 ? 171  LEU B C   1 
ATOM   3268 O O   . LEU B 2 168 ? 15.955  3.939  11.789 1.00 123.77 ? 171  LEU B O   1 
ATOM   3269 C CB  . LEU B 2 168 ? 14.409  6.134  13.253 1.00 118.82 ? 171  LEU B CB  1 
ATOM   3270 C CG  . LEU B 2 168 ? 13.597  6.365  11.976 1.00 123.68 ? 171  LEU B CG  1 
ATOM   3271 C CD1 . LEU B 2 168 ? 13.182  7.824  11.881 1.00 123.88 ? 171  LEU B CD1 1 
ATOM   3272 C CD2 . LEU B 2 168 ? 14.377  5.957  10.736 1.00 126.17 ? 171  LEU B CD2 1 
ATOM   3273 N N   . ALA B 2 169 ? 17.001  3.960  13.788 1.00 121.80 ? 172  ALA B N   1 
ATOM   3274 C CA  . ALA B 2 169 ? 18.269  3.405  13.314 1.00 122.16 ? 172  ALA B CA  1 
ATOM   3275 C C   . ALA B 2 169 ? 18.783  3.987  11.994 1.00 126.93 ? 172  ALA B C   1 
ATOM   3276 O O   . ALA B 2 169 ? 19.392  3.277  11.191 1.00 126.60 ? 172  ALA B O   1 
ATOM   3277 C CB  . ALA B 2 169 ? 18.187  1.885  13.236 1.00 122.97 ? 172  ALA B CB  1 
ATOM   3278 N N   . PRO B 2 170 ? 18.638  5.309  11.804 1.00 124.05 ? 173  PRO B N   1 
ATOM   3279 C CA  . PRO B 2 170 ? 18.952  5.960  10.530 1.00 123.94 ? 173  PRO B CA  1 
ATOM   3280 C C   . PRO B 2 170 ? 20.263  6.753  10.650 1.00 127.46 ? 173  PRO B C   1 
ATOM   3281 O O   . PRO B 2 170 ? 21.048  6.498  11.565 1.00 126.90 ? 173  PRO B O   1 
ATOM   3282 C CB  . PRO B 2 170 ? 17.761  6.902  10.364 1.00 125.73 ? 173  PRO B CB  1 
ATOM   3283 C CG  . PRO B 2 170 ? 17.383  7.283  11.805 1.00 130.19 ? 173  PRO B CG  1 
ATOM   3284 C CD  . PRO B 2 170 ? 18.033  6.274  12.736 1.00 125.71 ? 173  PRO B CD  1 
ATOM   3285 N N   . VAL B 2 171 ? 20.545  7.661  9.713  1.00 123.74 ? 174  VAL B N   1 
ATOM   3286 C CA  . VAL B 2 171 ? 19.790  7.837  8.472  1.00 123.33 ? 174  VAL B CA  1 
ATOM   3287 C C   . VAL B 2 171 ? 20.808  8.059  7.359  1.00 126.71 ? 174  VAL B C   1 
ATOM   3288 O O   . VAL B 2 171 ? 20.998  7.212  6.484  1.00 126.19 ? 174  VAL B O   1 
ATOM   3289 C CB  . VAL B 2 171 ? 18.850  9.068  8.543  1.00 127.11 ? 174  VAL B CB  1 
ATOM   3290 C CG1 . VAL B 2 171 ? 17.474  8.742  7.984  1.00 126.83 ? 174  VAL B CG1 1 
ATOM   3291 C CG2 . VAL B 2 171 ? 18.777  9.641  9.949  1.00 126.92 ? 174  VAL B CG2 1 
ATOM   3292 N N   . VAL B 2 172 ? 21.444  9.225  7.404  1.00 122.83 ? 175  VAL B N   1 
ATOM   3293 C CA  . VAL B 2 172 ? 22.492  9.588  6.460  1.00 122.27 ? 175  VAL B CA  1 
ATOM   3294 C C   . VAL B 2 172 ? 23.813  8.969  6.908  1.00 124.72 ? 175  VAL B C   1 
ATOM   3295 O O   . VAL B 2 172 ? 24.411  8.165  6.192  1.00 124.17 ? 175  VAL B O   1 
ATOM   3296 C CB  . VAL B 2 172 ? 22.616  11.123 6.339  1.00 126.29 ? 175  VAL B CB  1 
ATOM   3297 C CG1 . VAL B 2 172 ? 23.479  11.504 5.145  1.00 126.13 ? 175  VAL B CG1 1 
ATOM   3298 C CG2 . VAL B 2 172 ? 21.236  11.769 6.250  1.00 126.09 ? 175  VAL B CG2 1 
ATOM   3299 N N   . VAL B 2 173 ? 24.255  9.348  8.104  1.00 120.16 ? 176  VAL B N   1 
ATOM   3300 C CA  . VAL B 2 173 ? 25.465  8.790  8.700  1.00 119.20 ? 176  VAL B CA  1 
ATOM   3301 C C   . VAL B 2 173 ? 26.717  9.265  7.958  1.00 120.82 ? 176  VAL B C   1 
ATOM   3302 O O   . VAL B 2 173 ? 27.709  8.541  7.860  1.00 120.25 ? 176  VAL B O   1 
ATOM   3303 C CB  . VAL B 2 173 ? 25.391  7.251  8.782  1.00 123.10 ? 176  VAL B CB  1 
ATOM   3304 C CG1 . VAL B 2 173 ? 26.291  6.731  9.893  1.00 122.92 ? 176  VAL B CG1 1 
ATOM   3305 C CG2 . VAL B 2 173 ? 23.949  6.794  8.986  1.00 122.88 ? 176  VAL B CG2 1 
ATOM   3306 N N   . THR B 2 174 ? 26.669  10.504 7.476  1.00 115.69 ? 177  THR B N   1 
ATOM   3307 C CA  . THR B 2 174 ? 27.738  11.086 6.667  1.00 114.72 ? 177  THR B CA  1 
ATOM   3308 C C   . THR B 2 174 ? 29.082  11.094 7.393  1.00 117.43 ? 177  THR B C   1 
ATOM   3309 O O   . THR B 2 174 ? 29.707  12.142 7.548  1.00 116.98 ? 177  THR B O   1 
ATOM   3310 C CB  . THR B 2 174 ? 27.357  12.502 6.212  1.00 121.20 ? 177  THR B CB  1 
ATOM   3311 O OG1 . THR B 2 174 ? 25.961  12.539 5.894  1.00 119.88 ? 177  THR B OG1 1 
ATOM   3312 C CG2 . THR B 2 174 ? 28.158  12.903 4.986  1.00 119.72 ? 177  THR B CG2 1 
ATOM   3313 N N   . LEU B 2 175 ? 29.553  9.910  7.767  1.00 113.29 ? 178  LEU B N   1 
ATOM   3314 C CA  . LEU B 2 175 ? 30.751  9.766  8.589  1.00 112.81 ? 178  LEU B CA  1 
ATOM   3315 C C   . LEU B 2 175 ? 32.022  10.198 7.861  1.00 115.26 ? 178  LEU B C   1 
ATOM   3316 O O   . LEU B 2 175 ? 32.995  9.452  7.828  1.00 114.69 ? 178  LEU B O   1 
ATOM   3317 C CB  . LEU B 2 175 ? 30.890  8.306  9.041  1.00 113.06 ? 178  LEU B CB  1 
ATOM   3318 C CG  . LEU B 2 175 ? 31.609  7.957  10.350 1.00 118.08 ? 178  LEU B CG  1 
ATOM   3319 C CD1 . LEU B 2 175 ? 31.252  6.537  10.775 1.00 118.28 ? 178  LEU B CD1 1 
ATOM   3320 C CD2 . LEU B 2 175 ? 33.119  8.103  10.232 1.00 120.86 ? 178  LEU B CD2 1 
ATOM   3321 N N   . TRP B 2 176 ? 32.020  11.392 7.274  1.00 111.12 ? 179  TRP B N   1 
ATOM   3322 C CA  . TRP B 2 176 ? 33.233  11.898 6.633  1.00 110.71 ? 179  TRP B CA  1 
ATOM   3323 C C   . TRP B 2 176 ? 34.205  12.484 7.666  1.00 113.21 ? 179  TRP B C   1 
ATOM   3324 O O   . TRP B 2 176 ? 35.417  12.475 7.455  1.00 112.55 ? 179  TRP B O   1 
ATOM   3325 C CB  . TRP B 2 176 ? 32.923  12.971 5.576  1.00 109.63 ? 179  TRP B CB  1 
ATOM   3326 C CG  . TRP B 2 176 ? 32.027  12.576 4.404  1.00 110.85 ? 179  TRP B CG  1 
ATOM   3327 C CD1 . TRP B 2 176 ? 31.465  13.431 3.492  1.00 113.59 ? 179  TRP B CD1 1 
ATOM   3328 C CD2 . TRP B 2 176 ? 31.617  11.255 4.009  1.00 110.62 ? 179  TRP B CD2 1 
ATOM   3329 N NE1 . TRP B 2 176 ? 30.719  12.732 2.576  1.00 113.00 ? 179  TRP B NE1 1 
ATOM   3330 C CE2 . TRP B 2 176 ? 30.790  11.396 2.872  1.00 114.41 ? 179  TRP B CE2 1 
ATOM   3331 C CE3 . TRP B 2 176 ? 31.850  9.971  4.514  1.00 111.93 ? 179  TRP B CE3 1 
ATOM   3332 C CZ2 . TRP B 2 176 ? 30.197  10.306 2.235  1.00 113.72 ? 179  TRP B CZ2 1 
ATOM   3333 C CZ3 . TRP B 2 176 ? 31.256  8.888  3.879  1.00 113.44 ? 179  TRP B CZ3 1 
ATOM   3334 C CH2 . TRP B 2 176 ? 30.442  9.064  2.752  1.00 113.99 ? 179  TRP B CH2 1 
ATOM   3335 N N   . TYR B 2 177 ? 33.673  12.990 8.779  1.00 109.05 ? 180  TYR B N   1 
ATOM   3336 C CA  . TYR B 2 177 ? 34.472  13.797 9.707  1.00 108.43 ? 180  TYR B CA  1 
ATOM   3337 C C   . TYR B 2 177 ? 34.772  13.173 11.075 1.00 111.89 ? 180  TYR B C   1 
ATOM   3338 O O   . TYR B 2 177 ? 35.614  13.687 11.815 1.00 111.15 ? 180  TYR B O   1 
ATOM   3339 C CB  . TYR B 2 177 ? 33.840  15.175 9.914  1.00 109.21 ? 180  TYR B CB  1 
ATOM   3340 C CG  . TYR B 2 177 ? 33.430  15.884 8.643  1.00 110.39 ? 180  TYR B CG  1 
ATOM   3341 C CD1 . TYR B 2 177 ? 34.312  16.728 7.976  1.00 112.17 ? 180  TYR B CD1 1 
ATOM   3342 C CD2 . TYR B 2 177 ? 32.142  15.755 8.140  1.00 110.99 ? 180  TYR B CD2 1 
ATOM   3343 C CE1 . TYR B 2 177 ? 33.927  17.399 6.825  1.00 112.67 ? 180  TYR B CE1 1 
ATOM   3344 C CE2 . TYR B 2 177 ? 31.749  16.419 6.992  1.00 111.73 ? 180  TYR B CE2 1 
ATOM   3345 C CZ  . TYR B 2 177 ? 32.643  17.238 6.337  1.00 117.99 ? 180  TYR B CZ  1 
ATOM   3346 O OH  . TYR B 2 177 ? 32.248  17.893 5.193  1.00 117.39 ? 180  TYR B OH  1 
ATOM   3347 N N   . ARG B 2 178 ? 34.060  12.106 11.430 1.00 108.37 ? 181  ARG B N   1 
ATOM   3348 C CA  . ARG B 2 178 ? 34.210  11.491 12.752 1.00 108.10 ? 181  ARG B CA  1 
ATOM   3349 C C   . ARG B 2 178 ? 35.662  11.265 13.180 1.00 112.88 ? 181  ARG B C   1 
ATOM   3350 O O   . ARG B 2 178 ? 36.505  10.865 12.378 1.00 112.42 ? 181  ARG B O   1 
ATOM   3351 C CB  . ARG B 2 178 ? 33.402  10.194 12.861 1.00 106.64 ? 181  ARG B CB  1 
ATOM   3352 C CG  . ARG B 2 178 ? 31.969  10.394 13.331 1.00 112.37 ? 181  ARG B CG  1 
ATOM   3353 C CD  . ARG B 2 178 ? 31.195  11.302 12.391 1.00 117.08 ? 181  ARG B CD  1 
ATOM   3354 N NE  . ARG B 2 178 ? 29.941  11.766 12.978 1.00 119.75 ? 181  ARG B NE  1 
ATOM   3355 C CZ  . ARG B 2 178 ? 28.826  11.046 13.026 1.00 130.89 ? 181  ARG B CZ  1 
ATOM   3356 N NH1 . ARG B 2 178 ? 28.809  9.814  12.536 1.00 119.06 ? 181  ARG B NH1 1 
ATOM   3357 N NH2 . ARG B 2 178 ? 27.730  11.552 13.574 1.00 116.65 ? 181  ARG B NH2 1 
ATOM   3358 N N   . ALA B 2 179 ? 35.944  11.533 14.452 1.00 110.20 ? 182  ALA B N   1 
ATOM   3359 C CA  . ALA B 2 179 ? 37.288  11.378 14.996 1.00 110.36 ? 182  ALA B CA  1 
ATOM   3360 C C   . ALA B 2 179 ? 37.758  9.927  14.933 1.00 115.16 ? 182  ALA B C   1 
ATOM   3361 O O   . ALA B 2 179 ? 36.947  9.001  14.876 1.00 114.49 ? 182  ALA B O   1 
ATOM   3362 C CB  . ALA B 2 179 ? 37.342  11.893 16.429 1.00 111.07 ? 182  ALA B CB  1 
ATOM   3363 N N   . PRO B 2 180 ? 39.085  9.714  14.952 1.00 112.74 ? 183  PRO B N   1 
ATOM   3364 C CA  . PRO B 2 180 ? 39.688  8.377  14.945 1.00 113.08 ? 183  PRO B CA  1 
ATOM   3365 C C   . PRO B 2 180 ? 39.192  7.526  16.109 1.00 118.72 ? 183  PRO B C   1 
ATOM   3366 O O   . PRO B 2 180 ? 39.455  6.323  16.171 1.00 118.27 ? 183  PRO B O   1 
ATOM   3367 C CB  . PRO B 2 180 ? 41.192  8.658  15.105 1.00 114.65 ? 183  PRO B CB  1 
ATOM   3368 C CG  . PRO B 2 180 ? 41.349  10.162 15.126 1.00 118.80 ? 183  PRO B CG  1 
ATOM   3369 C CD  . PRO B 2 180 ? 40.071  10.758 14.635 1.00 114.25 ? 183  PRO B CD  1 
ATOM   3370 N N   . GLU B 2 181 ? 38.483  8.164  17.035 1.00 116.52 ? 184  GLU B N   1 
ATOM   3371 C CA  . GLU B 2 181 ? 37.926  7.473  18.190 1.00 116.80 ? 184  GLU B CA  1 
ATOM   3372 C C   . GLU B 2 181 ? 36.413  7.335  18.057 1.00 122.22 ? 184  GLU B C   1 
ATOM   3373 O O   . GLU B 2 181 ? 35.836  6.324  18.453 1.00 121.62 ? 184  GLU B O   1 
ATOM   3374 C CB  . GLU B 2 181 ? 38.263  8.232  19.476 1.00 118.06 ? 184  GLU B CB  1 
ATOM   3375 C CG  . GLU B 2 181 ? 39.745  8.508  19.673 1.00 126.81 ? 184  GLU B CG  1 
ATOM   3376 C CD  . GLU B 2 181 ? 40.253  9.655  18.818 1.00 141.31 ? 184  GLU B CD  1 
ATOM   3377 O OE1 . GLU B 2 181 ? 39.621  10.733 18.826 1.00 131.24 ? 184  GLU B OE1 1 
ATOM   3378 O OE2 . GLU B 2 181 ? 41.311  9.491  18.172 1.00 133.23 ? 184  GLU B OE2 1 
ATOM   3379 N N   . VAL B 2 182 ? 35.785  8.341  17.459 1.00 120.36 ? 185  VAL B N   1 
ATOM   3380 C CA  . VAL B 2 182 ? 34.329  8.429  17.413 1.00 121.01 ? 185  VAL B CA  1 
ATOM   3381 C C   . VAL B 2 182 ? 33.621  7.154  16.967 1.00 126.72 ? 185  VAL B C   1 
ATOM   3382 O O   . VAL B 2 182 ? 32.470  6.919  17.336 1.00 126.31 ? 185  VAL B O   1 
ATOM   3383 C CB  . VAL B 2 182 ? 33.852  9.656  16.619 1.00 125.02 ? 185  VAL B CB  1 
ATOM   3384 C CG1 . VAL B 2 182 ? 32.333  9.664  16.519 1.00 124.80 ? 185  VAL B CG1 1 
ATOM   3385 C CG2 . VAL B 2 182 ? 34.356  10.936 17.271 1.00 124.86 ? 185  VAL B CG2 1 
ATOM   3386 N N   . LEU B 2 183 ? 34.289  6.345  16.151 1.00 124.70 ? 186  LEU B N   1 
ATOM   3387 C CA  . LEU B 2 183 ? 33.733  5.047  15.787 1.00 125.21 ? 186  LEU B CA  1 
ATOM   3388 C C   . LEU B 2 183 ? 34.797  3.962  15.657 1.00 130.53 ? 186  LEU B C   1 
ATOM   3389 O O   . LEU B 2 183 ? 34.573  2.928  15.026 1.00 130.31 ? 186  LEU B O   1 
ATOM   3390 C CB  . LEU B 2 183 ? 32.860  5.140  14.534 1.00 125.29 ? 186  LEU B CB  1 
ATOM   3391 C CG  . LEU B 2 183 ? 31.585  4.295  14.604 1.00 129.98 ? 186  LEU B CG  1 
ATOM   3392 C CD1 . LEU B 2 183 ? 30.777  4.680  15.837 1.00 130.20 ? 186  LEU B CD1 1 
ATOM   3393 C CD2 . LEU B 2 183 ? 30.750  4.456  13.342 1.00 132.22 ? 186  LEU B CD2 1 
ATOM   3394 N N   . LEU B 2 184 ? 35.969  4.230  16.226 1.00 127.88 ? 187  LEU B N   1 
ATOM   3395 C CA  . LEU B 2 184 ? 36.917  3.177  16.569 1.00 128.08 ? 187  LEU B CA  1 
ATOM   3396 C C   . LEU B 2 184 ? 36.544  2.696  17.967 1.00 132.90 ? 187  LEU B C   1 
ATOM   3397 O O   . LEU B 2 184 ? 36.754  1.534  18.326 1.00 132.64 ? 187  LEU B O   1 
ATOM   3398 C CB  . LEU B 2 184 ? 38.345  3.722  16.568 1.00 128.15 ? 187  LEU B CB  1 
ATOM   3399 C CG  . LEU B 2 184 ? 39.402  2.862  17.264 1.00 132.97 ? 187  LEU B CG  1 
ATOM   3400 C CD1 . LEU B 2 184 ? 39.355  1.423  16.765 1.00 133.23 ? 187  LEU B CD1 1 
ATOM   3401 C CD2 . LEU B 2 184 ? 40.785  3.461  17.060 1.00 135.35 ? 187  LEU B CD2 1 
ATOM   3402 N N   . GLN B 2 185 ? 35.987  3.618  18.746 1.00 129.85 ? 188  GLN B N   1 
ATOM   3403 C CA  . GLN B 2 185 ? 35.371  3.309  20.031 1.00 129.71 ? 188  GLN B CA  1 
ATOM   3404 C C   . GLN B 2 185 ? 34.026  4.032  20.085 1.00 134.15 ? 188  GLN B C   1 
ATOM   3405 O O   . GLN B 2 185 ? 33.184  3.873  19.201 1.00 133.61 ? 188  GLN B O   1 
ATOM   3406 C CB  . GLN B 2 185 ? 36.257  3.806  21.178 1.00 130.88 ? 188  GLN B CB  1 
ATOM   3407 C CG  . GLN B 2 185 ? 37.742  3.528  20.996 1.00 139.98 ? 188  GLN B CG  1 
ATOM   3408 C CD  . GLN B 2 185 ? 38.582  4.117  22.112 1.00 152.60 ? 188  GLN B CD  1 
ATOM   3409 O OE1 . GLN B 2 185 ? 39.804  4.221  21.997 1.00 146.39 ? 188  GLN B OE1 1 
ATOM   3410 N NE2 . GLN B 2 185 ? 37.929  4.507  23.201 1.00 143.85 ? 188  GLN B NE2 1 
ATOM   3411 N N   . SER B 2 186 ? 33.853  4.853  21.115 1.00 131.30 ? 189  SER B N   1 
ATOM   3412 C CA  . SER B 2 186 ? 32.708  5.752  21.217 1.00 131.40 ? 189  SER B CA  1 
ATOM   3413 C C   . SER B 2 186 ? 32.959  6.715  22.372 1.00 135.55 ? 189  SER B C   1 
ATOM   3414 O O   . SER B 2 186 ? 32.153  6.823  23.297 1.00 135.23 ? 189  SER B O   1 
ATOM   3415 C CB  . SER B 2 186 ? 31.411  4.965  21.435 1.00 135.25 ? 189  SER B CB  1 
ATOM   3416 O OG  . SER B 2 186 ? 31.512  4.086  22.542 1.00 144.30 ? 189  SER B OG  1 
ATOM   3417 N N   . THR B 2 187 ? 34.080  7.426  22.296 1.00 132.10 ? 190  THR B N   1 
ATOM   3418 C CA  . THR B 2 187 ? 34.596  8.182  23.430 1.00 131.88 ? 190  THR B CA  1 
ATOM   3419 C C   . THR B 2 187 ? 33.837  9.474  23.733 1.00 135.71 ? 190  THR B C   1 
ATOM   3420 O O   . THR B 2 187 ? 33.775  9.900  24.888 1.00 135.39 ? 190  THR B O   1 
ATOM   3421 C CB  . THR B 2 187 ? 36.114  8.415  23.314 1.00 139.06 ? 190  THR B CB  1 
ATOM   3422 O OG1 . THR B 2 187 ? 36.378  9.355  22.266 1.00 138.77 ? 190  THR B OG1 1 
ATOM   3423 C CG2 . THR B 2 187 ? 36.828  7.104  23.005 1.00 136.87 ? 190  THR B CG2 1 
ATOM   3424 N N   . TYR B 2 188 ? 33.262  10.088 22.700 1.00 131.95 ? 191  TYR B N   1 
ATOM   3425 C CA  . TYR B 2 188 ? 32.475  11.313 22.859 1.00 131.55 ? 191  TYR B CA  1 
ATOM   3426 C C   . TYR B 2 188 ? 33.210  12.332 23.732 1.00 134.57 ? 191  TYR B C   1 
ATOM   3427 O O   . TYR B 2 188 ? 32.607  13.004 24.570 1.00 134.11 ? 191  TYR B O   1 
ATOM   3428 C CB  . TYR B 2 188 ? 31.093  10.991 23.444 1.00 132.72 ? 191  TYR B CB  1 
ATOM   3429 C CG  . TYR B 2 188 ? 30.092  12.134 23.410 1.00 134.38 ? 191  TYR B CG  1 
ATOM   3430 C CD1 . TYR B 2 188 ? 30.426  13.373 22.875 1.00 136.26 ? 191  TYR B CD1 1 
ATOM   3431 C CD2 . TYR B 2 188 ? 28.808  11.968 23.919 1.00 135.18 ? 191  TYR B CD2 1 
ATOM   3432 C CE1 . TYR B 2 188 ? 29.507  14.415 22.849 1.00 136.92 ? 191  TYR B CE1 1 
ATOM   3433 C CE2 . TYR B 2 188 ? 27.885  13.002 23.899 1.00 136.05 ? 191  TYR B CE2 1 
ATOM   3434 C CZ  . TYR B 2 188 ? 28.238  14.222 23.361 1.00 142.69 ? 191  TYR B CZ  1 
ATOM   3435 O OH  . TYR B 2 188 ? 27.318  15.247 23.338 1.00 142.51 ? 191  TYR B OH  1 
ATOM   3436 N N   . ALA B 2 189 ? 34.529  12.391 23.569 1.00 130.31 ? 192  ALA B N   1 
ATOM   3437 C CA  . ALA B 2 189 ? 35.351  13.359 24.284 1.00 129.63 ? 192  ALA B CA  1 
ATOM   3438 C C   . ALA B 2 189 ? 35.227  14.732 23.632 1.00 132.45 ? 192  ALA B C   1 
ATOM   3439 O O   . ALA B 2 189 ? 34.518  14.897 22.639 1.00 131.93 ? 192  ALA B O   1 
ATOM   3440 C CB  . ALA B 2 189 ? 36.804  12.908 24.302 1.00 130.31 ? 192  ALA B CB  1 
ATOM   3441 N N   . THR B 2 190 ? 35.899  15.722 24.207 1.00 128.27 ? 193  THR B N   1 
ATOM   3442 C CA  . THR B 2 190 ? 35.919  17.054 23.621 1.00 127.73 ? 193  THR B CA  1 
ATOM   3443 C C   . THR B 2 190 ? 36.929  17.147 22.480 1.00 130.82 ? 193  THR B C   1 
ATOM   3444 O O   . THR B 2 190 ? 36.692  17.835 21.487 1.00 130.47 ? 193  THR B O   1 
ATOM   3445 C CB  . THR B 2 190 ? 36.152  18.150 24.682 1.00 135.28 ? 193  THR B CB  1 
ATOM   3446 O OG1 . THR B 2 190 ? 35.601  19.389 24.218 1.00 134.32 ? 193  THR B OG1 1 
ATOM   3447 C CG2 . THR B 2 190 ? 37.639  18.339 24.942 1.00 133.85 ? 193  THR B CG2 1 
ATOM   3448 N N   . PRO B 2 191 ? 38.062  16.434 22.597 1.00 126.61 ? 194  PRO B N   1 
ATOM   3449 C CA  . PRO B 2 191 ? 39.043  16.503 21.509 1.00 126.15 ? 194  PRO B CA  1 
ATOM   3450 C C   . PRO B 2 191 ? 38.487  16.020 20.171 1.00 128.89 ? 194  PRO B C   1 
ATOM   3451 O O   . PRO B 2 191 ? 38.759  16.613 19.127 1.00 128.16 ? 194  PRO B O   1 
ATOM   3452 C CB  . PRO B 2 191 ? 40.156  15.569 21.987 1.00 127.95 ? 194  PRO B CB  1 
ATOM   3453 C CG  . PRO B 2 191 ? 40.082  15.640 23.462 1.00 132.41 ? 194  PRO B CG  1 
ATOM   3454 C CD  . PRO B 2 191 ? 38.623  15.779 23.793 1.00 128.02 ? 194  PRO B CD  1 
ATOM   3455 N N   . VAL B 2 192 ? 37.726  14.930 20.203 1.00 124.85 ? 195  VAL B N   1 
ATOM   3456 C CA  . VAL B 2 192 ? 37.113  14.398 18.991 1.00 124.32 ? 195  VAL B CA  1 
ATOM   3457 C C   . VAL B 2 192 ? 36.363  15.494 18.246 1.00 126.81 ? 195  VAL B C   1 
ATOM   3458 O O   . VAL B 2 192 ? 36.149  15.404 17.037 1.00 126.54 ? 195  VAL B O   1 
ATOM   3459 C CB  . VAL B 2 192 ? 36.193  13.199 19.292 1.00 128.40 ? 195  VAL B CB  1 
ATOM   3460 C CG1 . VAL B 2 192 ? 36.993  12.043 19.881 1.00 128.25 ? 195  VAL B CG1 1 
ATOM   3461 C CG2 . VAL B 2 192 ? 35.059  13.613 20.219 1.00 128.22 ? 195  VAL B CG2 1 
ATOM   3462 N N   . ASP B 2 193 ? 35.969  16.531 18.974 1.00 122.14 ? 196  ASP B N   1 
ATOM   3463 C CA  . ASP B 2 193 ? 35.287  17.666 18.371 1.00 121.40 ? 196  ASP B CA  1 
ATOM   3464 C C   . ASP B 2 193 ? 36.300  18.575 17.671 1.00 124.71 ? 196  ASP B C   1 
ATOM   3465 O O   . ASP B 2 193 ? 35.946  19.344 16.774 1.00 124.36 ? 196  ASP B O   1 
ATOM   3466 C CB  . ASP B 2 193 ? 34.509  18.441 19.436 1.00 122.87 ? 196  ASP B CB  1 
ATOM   3467 C CG  . ASP B 2 193 ? 33.314  19.173 18.866 1.00 129.94 ? 196  ASP B CG  1 
ATOM   3468 O OD1 . ASP B 2 193 ? 32.593  19.830 19.644 1.00 129.72 ? 196  ASP B OD1 1 
ATOM   3469 O OD2 . ASP B 2 193 ? 33.085  19.079 17.642 1.00 135.28 ? 196  ASP B OD2 1 
ATOM   3470 N N   . MET B 2 194 ? 37.566  18.451 18.063 1.00 120.64 ? 197  MET B N   1 
ATOM   3471 C CA  . MET B 2 194 ? 38.648  19.231 17.463 1.00 120.21 ? 197  MET B CA  1 
ATOM   3472 C C   . MET B 2 194 ? 39.112  18.612 16.142 1.00 123.54 ? 197  MET B C   1 
ATOM   3473 O O   . MET B 2 194 ? 39.476  19.325 15.205 1.00 123.32 ? 197  MET B O   1 
ATOM   3474 C CB  . MET B 2 194 ? 39.831  19.338 18.434 1.00 122.47 ? 197  MET B CB  1 
ATOM   3475 C CG  . MET B 2 194 ? 40.967  20.245 17.964 1.00 125.92 ? 197  MET B CG  1 
ATOM   3476 S SD  . MET B 2 194 ? 40.816  21.965 18.512 1.00 129.81 ? 197  MET B SD  1 
ATOM   3477 C CE  . MET B 2 194 ? 39.322  22.478 17.669 1.00 126.40 ? 197  MET B CE  1 
ATOM   3478 N N   . TRP B 2 195 ? 39.119  17.283 16.083 1.00 119.20 ? 198  TRP B N   1 
ATOM   3479 C CA  . TRP B 2 195 ? 39.445  16.576 14.849 1.00 118.45 ? 198  TRP B CA  1 
ATOM   3480 C C   . TRP B 2 195 ? 38.585  17.097 13.706 1.00 120.29 ? 198  TRP B C   1 
ATOM   3481 O O   . TRP B 2 195 ? 39.100  17.589 12.704 1.00 119.93 ? 198  TRP B O   1 
ATOM   3482 C CB  . TRP B 2 195 ? 39.223  15.071 15.016 1.00 117.32 ? 198  TRP B CB  1 
ATOM   3483 C CG  . TRP B 2 195 ? 39.608  14.271 13.807 1.00 118.43 ? 198  TRP B CG  1 
ATOM   3484 C CD1 . TRP B 2 195 ? 38.776  13.810 12.827 1.00 121.27 ? 198  TRP B CD1 1 
ATOM   3485 C CD2 . TRP B 2 195 ? 40.927  13.838 13.451 1.00 118.28 ? 198  TRP B CD2 1 
ATOM   3486 N NE1 . TRP B 2 195 ? 39.497  13.119 11.883 1.00 120.70 ? 198  TRP B NE1 1 
ATOM   3487 C CE2 . TRP B 2 195 ? 40.818  13.120 12.244 1.00 122.08 ? 198  TRP B CE2 1 
ATOM   3488 C CE3 . TRP B 2 195 ? 42.188  13.985 14.037 1.00 119.59 ? 198  TRP B CE3 1 
ATOM   3489 C CZ2 . TRP B 2 195 ? 41.923  12.555 11.612 1.00 121.36 ? 198  TRP B CZ2 1 
ATOM   3490 C CZ3 . TRP B 2 195 ? 43.283  13.423 13.408 1.00 121.01 ? 198  TRP B CZ3 1 
ATOM   3491 C CH2 . TRP B 2 195 ? 43.143  12.717 12.209 1.00 121.58 ? 198  TRP B CH2 1 
ATOM   3492 N N   . SER B 2 196 ? 37.271  17.008 13.881 1.00 115.27 ? 199  SER B N   1 
ATOM   3493 C CA  . SER B 2 196 ? 36.317  17.451 12.873 1.00 114.43 ? 199  SER B CA  1 
ATOM   3494 C C   . SER B 2 196 ? 36.638  18.850 12.352 1.00 117.06 ? 199  SER B C   1 
ATOM   3495 O O   . SER B 2 196 ? 36.131  19.264 11.308 1.00 116.59 ? 199  SER B O   1 
ATOM   3496 C CB  . SER B 2 196 ? 34.899  17.427 13.445 1.00 117.70 ? 199  SER B CB  1 
ATOM   3497 O OG  . SER B 2 196 ? 34.716  16.311 14.297 1.00 125.95 ? 199  SER B OG  1 
ATOM   3498 N N   . VAL B 2 197 ? 37.464  19.582 13.094 1.00 112.67 ? 200  VAL B N   1 
ATOM   3499 C CA  . VAL B 2 197 ? 37.855  20.934 12.705 1.00 111.96 ? 200  VAL B CA  1 
ATOM   3500 C C   . VAL B 2 197 ? 38.826  20.928 11.529 1.00 114.16 ? 200  VAL B C   1 
ATOM   3501 O O   . VAL B 2 197 ? 38.583  21.577 10.511 1.00 113.59 ? 200  VAL B O   1 
ATOM   3502 C CB  . VAL B 2 197 ? 38.440  21.716 13.896 1.00 116.00 ? 200  VAL B CB  1 
ATOM   3503 C CG1 . VAL B 2 197 ? 38.956  23.074 13.438 1.00 115.86 ? 200  VAL B CG1 1 
ATOM   3504 C CG2 . VAL B 2 197 ? 37.400  21.871 14.997 1.00 115.80 ? 200  VAL B CG2 1 
ATOM   3505 N N   . GLY B 2 198 ? 39.933  20.207 11.684 1.00 109.52 ? 201  GLY B N   1 
ATOM   3506 C CA  . GLY B 2 198 ? 40.951  20.097 10.653 1.00 108.50 ? 201  GLY B CA  1 
ATOM   3507 C C   . GLY B 2 198 ? 40.418  19.496 9.368  1.00 110.07 ? 201  GLY B C   1 
ATOM   3508 O O   . GLY B 2 198 ? 40.921  19.782 8.282  1.00 109.50 ? 201  GLY B O   1 
ATOM   3509 N N   . CYS B 2 199 ? 39.393  18.662 9.496  1.00 105.06 ? 202  CYS B N   1 
ATOM   3510 C CA  . CYS B 2 199 ? 38.750  18.043 8.344  1.00 104.19 ? 202  CYS B CA  1 
ATOM   3511 C C   . CYS B 2 199 ? 37.954  19.070 7.537  1.00 106.20 ? 202  CYS B C   1 
ATOM   3512 O O   . CYS B 2 199 ? 37.768  18.920 6.327  1.00 105.97 ? 202  CYS B O   1 
ATOM   3513 C CB  . CYS B 2 199 ? 37.844  16.894 8.798  1.00 104.49 ? 202  CYS B CB  1 
ATOM   3514 S SG  . CYS B 2 199 ? 38.683  15.653 9.830  1.00 108.36 ? 202  CYS B SG  1 
ATOM   3515 N N   . ILE B 2 200 ? 37.475  20.103 8.222  1.00 100.98 ? 203  ILE B N   1 
ATOM   3516 C CA  . ILE B 2 200 ? 36.836  21.238 7.566  1.00 99.85  ? 203  ILE B CA  1 
ATOM   3517 C C   . ILE B 2 200 ? 37.914  22.240 7.176  1.00 102.04 ? 203  ILE B C   1 
ATOM   3518 O O   . ILE B 2 200 ? 37.801  22.940 6.170  1.00 101.49 ? 203  ILE B O   1 
ATOM   3519 C CB  . ILE B 2 200 ? 35.796  21.903 8.487  1.00 102.70 ? 203  ILE B CB  1 
ATOM   3520 C CG1 . ILE B 2 200 ? 34.624  20.959 8.743  1.00 102.85 ? 203  ILE B CG1 1 
ATOM   3521 C CG2 . ILE B 2 200 ? 35.305  23.204 7.875  1.00 103.32 ? 203  ILE B CG2 1 
ATOM   3522 C CD1 . ILE B 2 200 ? 33.745  20.751 7.535  1.00 109.12 ? 203  ILE B CD1 1 
ATOM   3523 N N   . PHE B 2 201 ? 38.950  22.315 8.004  1.00 97.45  ? 204  PHE B N   1 
ATOM   3524 C CA  . PHE B 2 201 ? 40.086  23.191 7.753  1.00 96.86  ? 204  PHE B CA  1 
ATOM   3525 C C   . PHE B 2 201 ? 40.708  22.899 6.393  1.00 101.97 ? 204  PHE B C   1 
ATOM   3526 O O   . PHE B 2 201 ? 41.033  23.816 5.638  1.00 101.75 ? 204  PHE B O   1 
ATOM   3527 C CB  . PHE B 2 201 ? 41.134  23.009 8.849  1.00 98.06  ? 204  PHE B CB  1 
ATOM   3528 C CG  . PHE B 2 201 ? 42.318  23.915 8.711  1.00 98.82  ? 204  PHE B CG  1 
ATOM   3529 C CD1 . PHE B 2 201 ? 42.197  25.140 8.082  1.00 101.31 ? 204  PHE B CD1 1 
ATOM   3530 C CD2 . PHE B 2 201 ? 43.550  23.546 9.222  1.00 100.47 ? 204  PHE B CD2 1 
ATOM   3531 C CE1 . PHE B 2 201 ? 43.283  25.980 7.966  1.00 102.10 ? 204  PHE B CE1 1 
ATOM   3532 C CE2 . PHE B 2 201 ? 44.641  24.378 9.107  1.00 103.07 ? 204  PHE B CE2 1 
ATOM   3533 C CZ  . PHE B 2 201 ? 44.509  25.598 8.479  1.00 101.16 ? 204  PHE B CZ  1 
ATOM   3534 N N   . ALA B 2 202 ? 40.869  21.613 6.089  1.00 99.06  ? 205  ALA B N   1 
ATOM   3535 C CA  . ALA B 2 202 ? 41.421  21.179 4.808  1.00 98.84  ? 205  ALA B CA  1 
ATOM   3536 C C   . ALA B 2 202 ? 40.407  21.334 3.676  1.00 102.59 ? 205  ALA B C   1 
ATOM   3537 O O   . ALA B 2 202 ? 40.687  21.979 2.666  1.00 102.19 ? 205  ALA B O   1 
ATOM   3538 C CB  . ALA B 2 202 ? 41.898  19.736 4.901  1.00 99.55  ? 205  ALA B CB  1 
ATOM   3539 N N   . GLU B 2 203 ? 39.230  20.740 3.857  1.00 99.05  ? 206  GLU B N   1 
ATOM   3540 C CA  . GLU B 2 203 ? 38.171  20.769 2.852  1.00 98.84  ? 206  GLU B CA  1 
ATOM   3541 C C   . GLU B 2 203 ? 37.954  22.158 2.257  1.00 104.09 ? 206  GLU B C   1 
ATOM   3542 O O   . GLU B 2 203 ? 37.443  22.295 1.146  1.00 103.00 ? 206  GLU B O   1 
ATOM   3543 C CB  . GLU B 2 203 ? 36.865  20.240 3.448  1.00 99.90  ? 206  GLU B CB  1 
ATOM   3544 C CG  . GLU B 2 203 ? 35.664  20.372 2.528  1.00 106.41 ? 206  GLU B CG  1 
ATOM   3545 C CD  . GLU B 2 203 ? 34.437  19.673 3.073  1.00 113.20 ? 206  GLU B CD  1 
ATOM   3546 O OE1 . GLU B 2 203 ? 34.592  18.811 3.966  1.00 102.60 ? 206  GLU B OE1 1 
ATOM   3547 O OE2 . GLU B 2 203 ? 33.320  19.977 2.602  1.00 99.69  ? 206  GLU B OE2 1 
ATOM   3548 N N   . MET B 2 204 ? 38.363  23.181 3.000  1.00 102.85 ? 207  MET B N   1 
ATOM   3549 C CA  . MET B 2 204 ? 38.232  24.561 2.549  1.00 103.80 ? 207  MET B CA  1 
ATOM   3550 C C   . MET B 2 204 ? 39.184  24.875 1.397  1.00 109.50 ? 207  MET B C   1 
ATOM   3551 O O   . MET B 2 204 ? 38.874  25.702 0.539  1.00 109.33 ? 207  MET B O   1 
ATOM   3552 C CB  . MET B 2 204 ? 38.464  25.531 3.711  1.00 106.32 ? 207  MET B CB  1 
ATOM   3553 C CG  . MET B 2 204 ? 37.425  25.443 4.821  1.00 110.13 ? 207  MET B CG  1 
ATOM   3554 S SD  . MET B 2 204 ? 37.712  26.657 6.127  1.00 114.47 ? 207  MET B SD  1 
ATOM   3555 C CE  . MET B 2 204 ? 39.458  26.397 6.449  1.00 111.16 ? 207  MET B CE  1 
ATOM   3556 N N   . PHE B 2 205 ? 40.351  24.232 1.401  1.00 107.08 ? 208  PHE B N   1 
ATOM   3557 C CA  . PHE B 2 205 ? 41.296  24.324 0.288  1.00 107.22 ? 208  PHE B CA  1 
ATOM   3558 C C   . PHE B 2 205 ? 41.172  23.095 -0.602 1.00 111.52 ? 208  PHE B C   1 
ATOM   3559 O O   . PHE B 2 205 ? 41.881  22.111 -0.391 1.00 111.12 ? 208  PHE B O   1 
ATOM   3560 C CB  . PHE B 2 205 ? 42.739  24.348 0.799  1.00 109.13 ? 208  PHE B CB  1 
ATOM   3561 C CG  . PHE B 2 205 ? 43.027  25.423 1.803  1.00 110.91 ? 208  PHE B CG  1 
ATOM   3562 C CD1 . PHE B 2 205 ? 43.803  26.515 1.456  1.00 114.15 ? 208  PHE B CD1 1 
ATOM   3563 C CD2 . PHE B 2 205 ? 42.615  25.291 3.119  1.00 113.31 ? 208  PHE B CD2 1 
ATOM   3564 C CE1 . PHE B 2 205 ? 44.114  27.485 2.386  1.00 115.14 ? 208  PHE B CE1 1 
ATOM   3565 C CE2 . PHE B 2 205 ? 42.923  26.260 4.055  1.00 116.17 ? 208  PHE B CE2 1 
ATOM   3566 C CZ  . PHE B 2 205 ? 43.674  27.357 3.688  1.00 114.27 ? 208  PHE B CZ  1 
ATOM   3567 N N   . ARG B 2 206 ? 40.285  23.125 -1.588 1.00 108.51 ? 209  ARG B N   1 
ATOM   3568 C CA  . ARG B 2 206 ? 39.305  24.185 -1.793 1.00 108.67 ? 209  ARG B CA  1 
ATOM   3569 C C   . ARG B 2 206 ? 38.146  23.400 -2.394 1.00 113.06 ? 209  ARG B C   1 
ATOM   3570 O O   . ARG B 2 206 ? 37.337  23.910 -3.172 1.00 112.72 ? 209  ARG B O   1 
ATOM   3571 C CB  . ARG B 2 206 ? 39.851  25.210 -2.800 1.00 109.34 ? 209  ARG B CB  1 
ATOM   3572 C CG  . ARG B 2 206 ? 38.838  26.216 -3.338 1.00 119.89 ? 209  ARG B CG  1 
ATOM   3573 C CD  . ARG B 2 206 ? 38.142  26.977 -2.223 1.00 129.63 ? 209  ARG B CD  1 
ATOM   3574 N NE  . ARG B 2 206 ? 37.138  27.901 -2.745 1.00 138.53 ? 209  ARG B NE  1 
ATOM   3575 C CZ  . ARG B 2 206 ? 36.371  28.677 -1.986 1.00 152.86 ? 209  ARG B CZ  1 
ATOM   3576 N NH1 . ARG B 2 206 ? 35.483  29.488 -2.546 1.00 139.51 ? 209  ARG B NH1 1 
ATOM   3577 N NH2 . ARG B 2 206 ? 36.492  28.641 -0.665 1.00 141.42 ? 209  ARG B NH2 1 
ATOM   3578 N N   . ARG B 2 207 ? 38.069  22.142 -1.977 1.00 109.77 ? 210  ARG B N   1 
ATOM   3579 C CA  . ARG B 2 207 ? 37.380  21.117 -2.739 1.00 109.77 ? 210  ARG B CA  1 
ATOM   3580 C C   . ARG B 2 207 ? 36.221  20.468 -1.996 1.00 114.86 ? 210  ARG B C   1 
ATOM   3581 O O   . ARG B 2 207 ? 35.232  21.120 -1.659 1.00 114.69 ? 210  ARG B O   1 
ATOM   3582 C CB  . ARG B 2 207 ? 38.392  20.051 -3.165 1.00 109.12 ? 210  ARG B CB  1 
ATOM   3583 C CG  . ARG B 2 207 ? 39.608  19.962 -2.247 1.00 114.34 ? 210  ARG B CG  1 
ATOM   3584 C CD  . ARG B 2 207 ? 39.248  19.351 -0.907 1.00 116.07 ? 210  ARG B CD  1 
ATOM   3585 N NE  . ARG B 2 207 ? 39.038  17.909 -0.998 1.00 118.90 ? 210  ARG B NE  1 
ATOM   3586 C CZ  . ARG B 2 207 ? 40.013  17.015 -0.885 1.00 129.00 ? 210  ARG B CZ  1 
ATOM   3587 N NH1 . ARG B 2 207 ? 41.256  17.431 -0.693 1.00 117.56 ? 210  ARG B NH1 1 
ATOM   3588 N NH2 . ARG B 2 207 ? 39.754  15.717 -0.973 1.00 111.26 ? 210  ARG B NH2 1 
ATOM   3589 N N   . LYS B 2 208 ? 36.344  19.164 -1.786 1.00 111.99 ? 211  LYS B N   1 
ATOM   3590 C CA  . LYS B 2 208 ? 35.303  18.366 -1.159 1.00 111.99 ? 211  LYS B CA  1 
ATOM   3591 C C   . LYS B 2 208 ? 35.904  17.667 0.068  1.00 116.23 ? 211  LYS B C   1 
ATOM   3592 O O   . LYS B 2 208 ? 36.996  18.031 0.511  1.00 115.70 ? 211  LYS B O   1 
ATOM   3593 C CB  . LYS B 2 208 ? 34.752  17.369 -2.183 1.00 114.45 ? 211  LYS B CB  1 
ATOM   3594 C CG  . LYS B 2 208 ? 34.253  18.039 -3.462 1.00 125.21 ? 211  LYS B CG  1 
ATOM   3595 C CD  . LYS B 2 208 ? 33.944  17.029 -4.558 1.00 132.48 ? 211  LYS B CD  1 
ATOM   3596 C CE  . LYS B 2 208 ? 35.215  16.407 -5.119 1.00 138.83 ? 211  LYS B CE  1 
ATOM   3597 N NZ  . LYS B 2 208 ? 34.951  15.615 -6.356 1.00 144.66 ? 211  LYS B NZ  1 
ATOM   3598 N N   . PRO B 2 209 ? 35.196  16.679 0.646  1.00 113.05 ? 212  PRO B N   1 
ATOM   3599 C CA  . PRO B 2 209 ? 35.721  16.134 1.907  1.00 112.95 ? 212  PRO B CA  1 
ATOM   3600 C C   . PRO B 2 209 ? 37.157  15.624 1.820  1.00 116.92 ? 212  PRO B C   1 
ATOM   3601 O O   . PRO B 2 209 ? 37.541  14.971 0.849  1.00 116.48 ? 212  PRO B O   1 
ATOM   3602 C CB  . PRO B 2 209 ? 34.770  14.976 2.209  1.00 114.74 ? 212  PRO B CB  1 
ATOM   3603 C CG  . PRO B 2 209 ? 33.493  15.368 1.565  1.00 119.14 ? 212  PRO B CG  1 
ATOM   3604 C CD  . PRO B 2 209 ? 33.875  16.110 0.317  1.00 114.63 ? 212  PRO B CD  1 
ATOM   3605 N N   . LEU B 2 210 ? 37.942  15.930 2.848  1.00 113.58 ? 213  LEU B N   1 
ATOM   3606 C CA  . LEU B 2 210 ? 39.336  15.506 2.918  1.00 113.27 ? 213  LEU B CA  1 
ATOM   3607 C C   . LEU B 2 210 ? 39.479  14.018 3.231  1.00 116.89 ? 213  LEU B C   1 
ATOM   3608 O O   . LEU B 2 210 ? 40.507  13.413 2.930  1.00 116.27 ? 213  LEU B O   1 
ATOM   3609 C CB  . LEU B 2 210 ? 40.095  16.351 3.948  1.00 113.27 ? 213  LEU B CB  1 
ATOM   3610 C CG  . LEU B 2 210 ? 41.552  16.003 4.261  1.00 117.90 ? 213  LEU B CG  1 
ATOM   3611 C CD1 . LEU B 2 210 ? 41.632  14.924 5.319  1.00 118.08 ? 213  LEU B CD1 1 
ATOM   3612 C CD2 . LEU B 2 210 ? 42.292  15.577 3.007  1.00 120.32 ? 213  LEU B CD2 1 
ATOM   3613 N N   . PHE B 2 211 ? 38.433  13.423 3.799  1.00 113.58 ? 214  PHE B N   1 
ATOM   3614 C CA  . PHE B 2 211 ? 38.465  12.011 4.171  1.00 113.46 ? 214  PHE B CA  1 
ATOM   3615 C C   . PHE B 2 211 ? 37.128  11.289 4.036  1.00 117.45 ? 214  PHE B C   1 
ATOM   3616 O O   . PHE B 2 211 ? 36.871  10.328 4.759  1.00 117.11 ? 214  PHE B O   1 
ATOM   3617 C CB  . PHE B 2 211 ? 38.983  11.841 5.600  1.00 115.30 ? 214  PHE B CB  1 
ATOM   3618 C CG  . PHE B 2 211 ? 40.475  11.725 5.697  1.00 117.00 ? 214  PHE B CG  1 
ATOM   3619 C CD1 . PHE B 2 211 ? 41.164  12.339 6.729  1.00 120.18 ? 214  PHE B CD1 1 
ATOM   3620 C CD2 . PHE B 2 211 ? 41.188  10.984 4.769  1.00 119.39 ? 214  PHE B CD2 1 
ATOM   3621 C CE1 . PHE B 2 211 ? 42.539  12.237 6.823  1.00 121.19 ? 214  PHE B CE1 1 
ATOM   3622 C CE2 . PHE B 2 211 ? 42.564  10.872 4.861  1.00 122.37 ? 214  PHE B CE2 1 
ATOM   3623 C CZ  . PHE B 2 211 ? 43.240  11.500 5.890  1.00 120.44 ? 214  PHE B CZ  1 
ATOM   3624 N N   . CYS B 2 212 ? 36.278  11.736 3.117  1.00 114.04 ? 215  CYS B N   1 
ATOM   3625 C CA  . CYS B 2 212 ? 35.001  11.063 2.909  1.00 113.94 ? 215  CYS B CA  1 
ATOM   3626 C C   . CYS B 2 212 ? 35.206  9.657  2.351  1.00 117.97 ? 215  CYS B C   1 
ATOM   3627 O O   . CYS B 2 212 ? 36.000  9.454  1.432  1.00 117.59 ? 215  CYS B O   1 
ATOM   3628 C CB  . CYS B 2 212 ? 34.084  11.881 1.996  1.00 114.23 ? 215  CYS B CB  1 
ATOM   3629 S SG  . CYS B 2 212 ? 34.730  12.177 0.336  1.00 118.11 ? 215  CYS B SG  1 
ATOM   3630 N N   . GLY B 2 213 ? 34.521  8.684  2.946  1.00 114.52 ? 216  GLY B N   1 
ATOM   3631 C CA  . GLY B 2 213 ? 34.581  7.297  2.520  1.00 114.30 ? 216  GLY B CA  1 
ATOM   3632 C C   . GLY B 2 213 ? 33.298  6.559  2.850  1.00 118.02 ? 216  GLY B C   1 
ATOM   3633 O O   . GLY B 2 213 ? 32.277  6.738  2.185  1.00 117.67 ? 216  GLY B O   1 
ATOM   3634 N N   . ASN B 2 214 ? 33.350  5.720  3.880  1.00 114.29 ? 217  ASN B N   1 
ATOM   3635 C CA  . ASN B 2 214 ? 32.151  5.074  4.403  1.00 113.90 ? 217  ASN B CA  1 
ATOM   3636 C C   . ASN B 2 214 ? 32.460  4.227  5.631  1.00 117.31 ? 217  ASN B C   1 
ATOM   3637 O O   . ASN B 2 214 ? 32.209  4.644  6.763  1.00 116.89 ? 217  ASN B O   1 
ATOM   3638 C CB  . ASN B 2 214 ? 31.472  4.219  3.333  1.00 114.24 ? 217  ASN B CB  1 
ATOM   3639 C CG  . ASN B 2 214 ? 30.234  3.514  3.854  1.00 133.49 ? 217  ASN B CG  1 
ATOM   3640 O OD1 . ASN B 2 214 ? 30.327  2.507  4.557  1.00 126.89 ? 217  ASN B OD1 1 
ATOM   3641 N ND2 . ASN B 2 214 ? 29.066  4.062  3.540  1.00 124.72 ? 217  ASN B ND2 1 
ATOM   3642 N N   . SER B 2 215 ? 32.985  3.028  5.396  1.00 113.46 ? 218  SER B N   1 
ATOM   3643 C CA  . SER B 2 215 ? 33.374  2.128  6.477  1.00 113.02 ? 218  SER B CA  1 
ATOM   3644 C C   . SER B 2 215 ? 34.158  2.849  7.567  1.00 116.56 ? 218  SER B C   1 
ATOM   3645 O O   . SER B 2 215 ? 34.975  3.727  7.286  1.00 116.03 ? 218  SER B O   1 
ATOM   3646 C CB  . SER B 2 215 ? 34.200  0.961  5.932  1.00 116.15 ? 218  SER B CB  1 
ATOM   3647 O OG  . SER B 2 215 ? 34.975  0.365  6.956  1.00 123.42 ? 218  SER B OG  1 
ATOM   3648 N N   . GLU B 2 216 ? 33.881  2.489  8.815  1.00 113.01 ? 219  GLU B N   1 
ATOM   3649 C CA  . GLU B 2 216 ? 34.627  3.021  9.946  1.00 112.78 ? 219  GLU B CA  1 
ATOM   3650 C C   . GLU B 2 216 ? 36.120  2.782  9.753  1.00 116.64 ? 219  GLU B C   1 
ATOM   3651 O O   . GLU B 2 216 ? 36.921  3.716  9.804  1.00 116.08 ? 219  GLU B O   1 
ATOM   3652 C CB  . GLU B 2 216 ? 34.153  2.377  11.251 1.00 114.13 ? 219  GLU B CB  1 
ATOM   3653 C CG  . GLU B 2 216 ? 32.760  2.808  11.689 1.00 123.93 ? 219  GLU B CG  1 
ATOM   3654 C CD  . GLU B 2 216 ? 31.699  2.505  10.649 1.00 143.33 ? 219  GLU B CD  1 
ATOM   3655 O OE1 . GLU B 2 216 ? 31.684  1.371  10.122 1.00 137.55 ? 219  GLU B OE1 1 
ATOM   3656 O OE2 . GLU B 2 216 ? 30.866  3.396  10.374 1.00 136.67 ? 219  GLU B OE2 1 
ATOM   3657 N N   . ALA B 2 217 ? 36.484  1.528  9.507  1.00 113.36 ? 220  ALA B N   1 
ATOM   3658 C CA  . ALA B 2 217 ? 37.879  1.163  9.283  1.00 113.11 ? 220  ALA B CA  1 
ATOM   3659 C C   . ALA B 2 217 ? 38.409  1.744  7.974  1.00 116.71 ? 220  ALA B C   1 
ATOM   3660 O O   . ALA B 2 217 ? 39.558  2.179  7.902  1.00 116.24 ? 220  ALA B O   1 
ATOM   3661 C CB  . ALA B 2 217 ? 38.044  -0.348 9.305  1.00 113.81 ? 220  ALA B CB  1 
ATOM   3662 N N   . ASP B 2 218 ? 37.567  1.756  6.945  1.00 113.01 ? 221  ASP B N   1 
ATOM   3663 C CA  . ASP B 2 218 ? 37.948  2.324  5.655  1.00 112.64 ? 221  ASP B CA  1 
ATOM   3664 C C   . ASP B 2 218 ? 38.421  3.763  5.826  1.00 115.32 ? 221  ASP B C   1 
ATOM   3665 O O   . ASP B 2 218 ? 39.471  4.150  5.310  1.00 114.83 ? 221  ASP B O   1 
ATOM   3666 C CB  . ASP B 2 218 ? 36.776  2.270  4.668  1.00 114.59 ? 221  ASP B CB  1 
ATOM   3667 C CG  . ASP B 2 218 ? 37.164  2.733  3.273  1.00 124.65 ? 221  ASP B CG  1 
ATOM   3668 O OD1 . ASP B 2 218 ? 38.320  2.498  2.861  1.00 125.28 ? 221  ASP B OD1 1 
ATOM   3669 O OD2 . ASP B 2 218 ? 36.305  3.316  2.579  1.00 130.33 ? 221  ASP B OD2 1 
ATOM   3670 N N   . GLN B 2 219 ? 37.636  4.551  6.553  1.00 110.96 ? 222  GLN B N   1 
ATOM   3671 C CA  . GLN B 2 219 ? 38.004  5.928  6.852  1.00 110.25 ? 222  GLN B CA  1 
ATOM   3672 C C   . GLN B 2 219 ? 39.194  5.966  7.803  1.00 112.70 ? 222  GLN B C   1 
ATOM   3673 O O   . GLN B 2 219 ? 40.091  6.798  7.665  1.00 111.84 ? 222  GLN B O   1 
ATOM   3674 C CB  . GLN B 2 219 ? 36.817  6.673  7.461  1.00 111.53 ? 222  GLN B CB  1 
ATOM   3675 C CG  . GLN B 2 219 ? 37.077  8.145  7.712  1.00 124.69 ? 222  GLN B CG  1 
ATOM   3676 C CD  . GLN B 2 219 ? 35.801  8.955  7.719  1.00 142.82 ? 222  GLN B CD  1 
ATOM   3677 O OE1 . GLN B 2 219 ? 35.661  9.911  8.482  1.00 138.47 ? 222  GLN B OE1 1 
ATOM   3678 N NE2 . GLN B 2 219 ? 34.860  8.578  6.861  1.00 135.21 ? 222  GLN B NE2 1 
ATOM   3679 N N   . LEU B 2 220 ? 39.200  5.040  8.754  1.00 108.76 ? 223  LEU B N   1 
ATOM   3680 C CA  . LEU B 2 220 ? 40.299  4.909  9.699  1.00 108.42 ? 223  LEU B CA  1 
ATOM   3681 C C   . LEU B 2 220 ? 41.614  4.686  8.960  1.00 112.61 ? 223  LEU B C   1 
ATOM   3682 O O   . LEU B 2 220 ? 42.621  5.326  9.262  1.00 112.19 ? 223  LEU B O   1 
ATOM   3683 C CB  . LEU B 2 220 ? 40.030  3.746  10.655 1.00 108.33 ? 223  LEU B CB  1 
ATOM   3684 C CG  . LEU B 2 220 ? 40.723  3.809  12.014 1.00 112.71 ? 223  LEU B CG  1 
ATOM   3685 C CD1 . LEU B 2 220 ? 40.318  2.619  12.867 1.00 112.77 ? 223  LEU B CD1 1 
ATOM   3686 C CD2 . LEU B 2 220 ? 42.232  3.876  11.849 1.00 114.68 ? 223  LEU B CD2 1 
ATOM   3687 N N   . GLY B 2 221 ? 41.601  3.773  7.994  1.00 109.50 ? 224  GLY B N   1 
ATOM   3688 C CA  . GLY B 2 221 ? 42.750  3.527  7.141  1.00 109.41 ? 224  GLY B CA  1 
ATOM   3689 C C   . GLY B 2 221 ? 42.994  4.679  6.184  1.00 113.33 ? 224  GLY B C   1 
ATOM   3690 O O   . GLY B 2 221 ? 44.137  5.064  5.932  1.00 112.68 ? 224  GLY B O   1 
ATOM   3691 N N   . LYS B 2 222 ? 41.909  5.225  5.645  1.00 110.13 ? 225  LYS B N   1 
ATOM   3692 C CA  . LYS B 2 222 ? 41.976  6.415  4.807  1.00 110.00 ? 225  LYS B CA  1 
ATOM   3693 C C   . LYS B 2 222 ? 42.780  7.481  5.551  1.00 115.27 ? 225  LYS B C   1 
ATOM   3694 O O   . LYS B 2 222 ? 43.702  8.086  5.001  1.00 114.64 ? 225  LYS B O   1 
ATOM   3695 C CB  . LYS B 2 222 ? 40.559  6.924  4.533  1.00 111.67 ? 225  LYS B CB  1 
ATOM   3696 C CG  . LYS B 2 222 ? 40.256  7.184  3.071  1.00 116.00 ? 225  LYS B CG  1 
ATOM   3697 C CD  . LYS B 2 222 ? 38.794  6.892  2.768  1.00 120.29 ? 225  LYS B CD  1 
ATOM   3698 C CE  . LYS B 2 222 ? 38.565  6.681  1.279  1.00 123.57 ? 225  LYS B CE  1 
ATOM   3699 N NZ  . LYS B 2 222 ? 37.210  6.136  0.987  1.00 126.59 ? 225  LYS B NZ  1 
ATOM   3700 N N   . ILE B 2 223 ? 42.459  7.648  6.829  1.00 113.11 ? 226  ILE B N   1 
ATOM   3701 C CA  . ILE B 2 223 ? 43.135  8.609  7.690  1.00 113.57 ? 226  ILE B CA  1 
ATOM   3702 C C   . ILE B 2 223 ? 44.625  8.302  7.847  1.00 118.95 ? 226  ILE B C   1 
ATOM   3703 O O   . ILE B 2 223 ? 45.468  9.188  7.696  1.00 118.36 ? 226  ILE B O   1 
ATOM   3704 C CB  . ILE B 2 223 ? 42.427  8.705  9.054  1.00 116.68 ? 226  ILE B CB  1 
ATOM   3705 C CG1 . ILE B 2 223 ? 41.006  9.245  8.870  1.00 117.08 ? 226  ILE B CG1 1 
ATOM   3706 C CG2 . ILE B 2 223 ? 43.227  9.571  10.016 1.00 117.37 ? 226  ILE B CG2 1 
ATOM   3707 C CD1 . ILE B 2 223 ? 40.022  8.759  9.908  1.00 123.85 ? 226  ILE B CD1 1 
ATOM   3708 N N   . PHE B 2 224 ? 44.941  7.044  8.146  1.00 116.84 ? 227  PHE B N   1 
ATOM   3709 C CA  . PHE B 2 224 ? 46.328  6.613  8.313  1.00 117.37 ? 227  PHE B CA  1 
ATOM   3710 C C   . PHE B 2 224 ? 47.182  6.910  7.084  1.00 122.84 ? 227  PHE B C   1 
ATOM   3711 O O   . PHE B 2 224 ? 48.398  7.083  7.191  1.00 122.50 ? 227  PHE B O   1 
ATOM   3712 C CB  . PHE B 2 224 ? 46.396  5.118  8.627  1.00 119.25 ? 227  PHE B CB  1 
ATOM   3713 C CG  . PHE B 2 224 ? 46.069  4.780  10.052 1.00 120.91 ? 227  PHE B CG  1 
ATOM   3714 C CD1 . PHE B 2 224 ? 45.529  3.547  10.374 1.00 124.12 ? 227  PHE B CD1 1 
ATOM   3715 C CD2 . PHE B 2 224 ? 46.319  5.683  11.070 1.00 123.11 ? 227  PHE B CD2 1 
ATOM   3716 C CE1 . PHE B 2 224 ? 45.233  3.226  11.685 1.00 125.08 ? 227  PHE B CE1 1 
ATOM   3717 C CE2 . PHE B 2 224 ? 46.026  5.366  12.385 1.00 125.94 ? 227  PHE B CE2 1 
ATOM   3718 C CZ  . PHE B 2 224 ? 45.482  4.137  12.692 1.00 124.06 ? 227  PHE B CZ  1 
ATOM   3719 N N   . ASP B 2 225 ? 46.553  6.906  5.913  1.00 120.46 ? 228  ASP B N   1 
ATOM   3720 C CA  . ASP B 2 225 ? 47.260  7.172  4.664  1.00 120.62 ? 228  ASP B CA  1 
ATOM   3721 C C   . ASP B 2 225 ? 48.035  8.485  4.742  1.00 125.21 ? 228  ASP B C   1 
ATOM   3722 O O   . ASP B 2 225 ? 49.193  8.563  4.324  1.00 124.58 ? 228  ASP B O   1 
ATOM   3723 C CB  . ASP B 2 225 ? 46.275  7.218  3.492  1.00 122.36 ? 228  ASP B CB  1 
ATOM   3724 C CG  . ASP B 2 225 ? 45.528  5.910  3.305  1.00 131.52 ? 228  ASP B CG  1 
ATOM   3725 O OD1 . ASP B 2 225 ? 45.733  4.983  4.116  1.00 132.00 ? 228  ASP B OD1 1 
ATOM   3726 O OD2 . ASP B 2 225 ? 44.736  5.808  2.345  1.00 136.91 ? 228  ASP B OD2 1 
ATOM   3727 N N   . LEU B 2 226 ? 47.399  9.500  5.322  1.00 122.44 ? 229  LEU B N   1 
ATOM   3728 C CA  . LEU B 2 226 ? 47.957  10.846 5.364  1.00 122.54 ? 229  LEU B CA  1 
ATOM   3729 C C   . LEU B 2 226 ? 48.825  11.073 6.602  1.00 128.11 ? 229  LEU B C   1 
ATOM   3730 O O   . LEU B 2 226 ? 49.954  11.556 6.501  1.00 127.55 ? 229  LEU B O   1 
ATOM   3731 C CB  . LEU B 2 226 ? 46.828  11.876 5.319  1.00 122.38 ? 229  LEU B CB  1 
ATOM   3732 C CG  . LEU B 2 226 ? 47.157  13.239 4.711  1.00 126.79 ? 229  LEU B CG  1 
ATOM   3733 C CD1 . LEU B 2 226 ? 45.912  14.112 4.666  1.00 126.94 ? 229  LEU B CD1 1 
ATOM   3734 C CD2 . LEU B 2 226 ? 48.277  13.924 5.477  1.00 128.76 ? 229  LEU B CD2 1 
ATOM   3735 N N   . ILE B 2 227 ? 48.295  10.712 7.766  1.00 126.17 ? 230  ILE B N   1 
ATOM   3736 C CA  . ILE B 2 227 ? 48.973  10.962 9.035  1.00 126.60 ? 230  ILE B CA  1 
ATOM   3737 C C   . ILE B 2 227 ? 50.100  9.969  9.306  1.00 132.63 ? 230  ILE B C   1 
ATOM   3738 O O   . ILE B 2 227 ? 51.180  10.354 9.755  1.00 132.17 ? 230  ILE B O   1 
ATOM   3739 C CB  . ILE B 2 227 ? 47.972  11.014 10.207 1.00 129.53 ? 230  ILE B CB  1 
ATOM   3740 C CG1 . ILE B 2 227 ? 48.471  11.962 11.300 1.00 129.91 ? 230  ILE B CG1 1 
ATOM   3741 C CG2 . ILE B 2 227 ? 47.723  9.620  10.763 1.00 130.01 ? 230  ILE B CG2 1 
ATOM   3742 C CD1 . ILE B 2 227 ? 48.487  13.420 10.890 1.00 136.53 ? 230  ILE B CD1 1 
ATOM   3743 N N   . GLY B 2 228 ? 49.847  8.693  9.031  1.00 130.96 ? 231  GLY B N   1 
ATOM   3744 C CA  . GLY B 2 228 ? 50.812  7.638  9.285  1.00 131.59 ? 231  GLY B CA  1 
ATOM   3745 C C   . GLY B 2 228 ? 50.417  6.804  10.488 1.00 137.48 ? 231  GLY B C   1 
ATOM   3746 O O   . GLY B 2 228 ? 50.152  7.340  11.563 1.00 137.20 ? 231  GLY B O   1 
ATOM   3747 N N   . LEU B 2 229 ? 50.377  5.489  10.305 1.00 135.60 ? 232  LEU B N   1 
ATOM   3748 C CA  . LEU B 2 229 ? 49.932  4.577  11.355 1.00 136.26 ? 232  LEU B CA  1 
ATOM   3749 C C   . LEU B 2 229 ? 50.784  4.712  12.616 1.00 142.24 ? 232  LEU B C   1 
ATOM   3750 O O   . LEU B 2 229 ? 51.993  4.475  12.590 1.00 141.87 ? 232  LEU B O   1 
ATOM   3751 C CB  . LEU B 2 229 ? 49.954  3.132  10.847 1.00 136.29 ? 232  LEU B CB  1 
ATOM   3752 C CG  . LEU B 2 229 ? 49.222  2.068  11.669 1.00 140.91 ? 232  LEU B CG  1 
ATOM   3753 C CD1 . LEU B 2 229 ? 49.203  0.749  10.916 1.00 141.00 ? 232  LEU B CD1 1 
ATOM   3754 C CD2 . LEU B 2 229 ? 49.863  1.894  13.039 1.00 143.48 ? 232  LEU B CD2 1 
ATOM   3755 N N   . PRO B 2 230 ? 50.154  5.088  13.741 1.00 140.29 ? 233  PRO B N   1 
ATOM   3756 C CA  . PRO B 2 230 ? 50.860  5.232  15.021 1.00 140.68 ? 233  PRO B CA  1 
ATOM   3757 C C   . PRO B 2 230 ? 51.263  3.887  15.624 1.00 146.07 ? 233  PRO B C   1 
ATOM   3758 O O   . PRO B 2 230 ? 50.456  2.961  15.705 1.00 145.41 ? 233  PRO B O   1 
ATOM   3759 C CB  . PRO B 2 230 ? 49.820  5.916  15.915 1.00 142.33 ? 233  PRO B CB  1 
ATOM   3760 C CG  . PRO B 2 230 ? 48.937  6.653  14.971 1.00 146.48 ? 233  PRO B CG  1 
ATOM   3761 C CD  . PRO B 2 230 ? 48.860  5.794  13.741 1.00 141.91 ? 233  PRO B CD  1 
ATOM   3762 N N   . PRO B 2 231 ? 52.533  3.758  16.040 1.00 144.08 ? 234  PRO B N   1 
ATOM   3763 C CA  . PRO B 2 231 ? 52.903  2.557  16.792 1.00 144.48 ? 234  PRO B CA  1 
ATOM   3764 C C   . PRO B 2 231 ? 52.451  2.690  18.242 1.00 150.04 ? 234  PRO B C   1 
ATOM   3765 O O   . PRO B 2 231 ? 52.103  3.782  18.690 1.00 149.62 ? 234  PRO B O   1 
ATOM   3766 C CB  . PRO B 2 231 ? 54.429  2.562  16.717 1.00 146.13 ? 234  PRO B CB  1 
ATOM   3767 C CG  . PRO B 2 231 ? 54.786  4.003  16.632 1.00 150.32 ? 234  PRO B CG  1 
ATOM   3768 C CD  . PRO B 2 231 ? 53.676  4.672  15.860 1.00 145.75 ? 234  PRO B CD  1 
ATOM   3769 N N   . GLU B 2 232 ? 52.430  1.576  18.965 1.00 147.91 ? 235  GLU B N   1 
ATOM   3770 C CA  . GLU B 2 232 ? 52.077  1.598  20.380 1.00 148.28 ? 235  GLU B CA  1 
ATOM   3771 C C   . GLU B 2 232 ? 53.117  2.392  21.166 1.00 153.85 ? 235  GLU B C   1 
ATOM   3772 O O   . GLU B 2 232 ? 54.273  2.484  20.748 1.00 153.22 ? 235  GLU B O   1 
ATOM   3773 C CB  . GLU B 2 232 ? 51.948  0.174  20.922 1.00 149.56 ? 235  GLU B CB  1 
ATOM   3774 C CG  . GLU B 2 232 ? 50.709  -0.557 20.425 1.00 158.63 ? 235  GLU B CG  1 
ATOM   3775 C CD  . GLU B 2 232 ? 50.587  -0.550 18.912 1.00 174.72 ? 235  GLU B CD  1 
ATOM   3776 O OE1 . GLU B 2 232 ? 51.625  -0.438 18.225 1.00 165.71 ? 235  GLU B OE1 1 
ATOM   3777 O OE2 . GLU B 2 232 ? 49.451  -0.673 18.408 1.00 168.34 ? 235  GLU B OE2 1 
ATOM   3778 N N   . ASP B 2 233 ? 52.735  2.900  22.336 1.00 151.93 ? 236  ASP B N   1 
ATOM   3779 C CA  . ASP B 2 233 ? 51.484  2.532  22.996 1.00 152.38 ? 236  ASP B CA  1 
ATOM   3780 C C   . ASP B 2 233 ? 50.276  3.402  22.630 1.00 158.05 ? 236  ASP B C   1 
ATOM   3781 O O   . ASP B 2 233 ? 49.261  3.373  23.327 1.00 157.67 ? 236  ASP B O   1 
ATOM   3782 C CB  . ASP B 2 233 ? 51.674  2.548  24.517 1.00 154.04 ? 236  ASP B CB  1 
ATOM   3783 C CG  . ASP B 2 233 ? 52.962  1.873  24.956 1.00 162.13 ? 236  ASP B CG  1 
ATOM   3784 O OD1 . ASP B 2 233 ? 53.399  0.920  24.278 1.00 162.32 ? 236  ASP B OD1 1 
ATOM   3785 O OD2 . ASP B 2 233 ? 53.528  2.284  25.992 1.00 167.24 ? 236  ASP B OD2 1 
ATOM   3786 N N   . ASP B 2 234 ? 50.384  4.183  21.559 1.00 155.90 ? 237  ASP B N   1 
ATOM   3787 C CA  . ASP B 2 234 ? 49.263  5.009  21.106 1.00 156.28 ? 237  ASP B CA  1 
ATOM   3788 C C   . ASP B 2 234 ? 48.205  4.173  20.389 1.00 161.47 ? 237  ASP B C   1 
ATOM   3789 O O   . ASP B 2 234 ? 47.912  4.407  19.217 1.00 161.06 ? 237  ASP B O   1 
ATOM   3790 C CB  . ASP B 2 234 ? 49.752  6.130  20.181 1.00 158.06 ? 237  ASP B CB  1 
ATOM   3791 C CG  . ASP B 2 234 ? 50.217  7.358  20.942 1.00 167.03 ? 237  ASP B CG  1 
ATOM   3792 O OD1 . ASP B 2 234 ? 49.455  7.851  21.801 1.00 167.63 ? 237  ASP B OD1 1 
ATOM   3793 O OD2 . ASP B 2 234 ? 51.319  7.863  20.641 1.00 171.98 ? 237  ASP B OD2 1 
ATOM   3794 N N   . TRP B 2 235 ? 47.611  3.219  21.102 1.00 159.18 ? 238  TRP B N   1 
ATOM   3795 C CA  . TRP B 2 235 ? 46.660  2.297  20.488 1.00 159.64 ? 238  TRP B CA  1 
ATOM   3796 C C   . TRP B 2 235 ? 45.651  1.763  21.507 1.00 164.17 ? 238  TRP B C   1 
ATOM   3797 O O   . TRP B 2 235 ? 45.994  0.952  22.368 1.00 163.76 ? 238  TRP B O   1 
ATOM   3798 C CB  . TRP B 2 235 ? 47.411  1.138  19.832 1.00 158.60 ? 238  TRP B CB  1 
ATOM   3799 C CG  . TRP B 2 235 ? 46.820  0.704  18.529 1.00 159.84 ? 238  TRP B CG  1 
ATOM   3800 C CD1 . TRP B 2 235 ? 45.996  -0.362 18.316 1.00 162.68 ? 238  TRP B CD1 1 
ATOM   3801 C CD2 . TRP B 2 235 ? 47.010  1.328  17.251 1.00 159.67 ? 238  TRP B CD2 1 
ATOM   3802 N NE1 . TRP B 2 235 ? 45.661  -0.441 16.985 1.00 162.20 ? 238  TRP B NE1 1 
ATOM   3803 C CE2 . TRP B 2 235 ? 46.268  0.583  16.312 1.00 163.60 ? 238  TRP B CE2 1 
ATOM   3804 C CE3 . TRP B 2 235 ? 47.732  2.442  16.814 1.00 160.99 ? 238  TRP B CE3 1 
ATOM   3805 C CZ2 . TRP B 2 235 ? 46.229  0.921  14.959 1.00 162.92 ? 238  TRP B CZ2 1 
ATOM   3806 C CZ3 . TRP B 2 235 ? 47.686  2.776  15.471 1.00 162.49 ? 238  TRP B CZ3 1 
ATOM   3807 C CH2 . TRP B 2 235 ? 46.944  2.017  14.560 1.00 163.09 ? 238  TRP B CH2 1 
ATOM   3808 N N   . PRO B 2 236 ? 44.374  2.158  21.371 1.00 161.19 ? 239  PRO B N   1 
ATOM   3809 C CA  . PRO B 2 236 ? 43.364  1.894  22.401 1.00 161.24 ? 239  PRO B CA  1 
ATOM   3810 C C   . PRO B 2 236 ? 42.494  0.660  22.158 1.00 165.57 ? 239  PRO B C   1 
ATOM   3811 O O   . PRO B 2 236 ? 42.819  -0.203 21.342 1.00 165.01 ? 239  PRO B O   1 
ATOM   3812 C CB  . PRO B 2 236 ? 42.503  3.156  22.365 1.00 162.95 ? 239  PRO B CB  1 
ATOM   3813 C CG  . PRO B 2 236 ? 42.579  3.609  20.947 1.00 167.18 ? 239  PRO B CG  1 
ATOM   3814 C CD  . PRO B 2 236 ? 43.936  3.197  20.421 1.00 162.66 ? 239  PRO B CD  1 
ATOM   3815 N N   . ARG B 2 237 ? 41.382  0.599  22.887 1.00 162.52 ? 240  ARG B N   1 
ATOM   3816 C CA  . ARG B 2 237 ? 40.442  -0.517 22.839 1.00 162.44 ? 240  ARG B CA  1 
ATOM   3817 C C   . ARG B 2 237 ? 39.083  0.096  22.450 1.00 167.15 ? 240  ARG B C   1 
ATOM   3818 O O   . ARG B 2 237 ? 39.030  1.294  22.176 1.00 166.78 ? 240  ARG B O   1 
ATOM   3819 C CB  . ARG B 2 237 ? 40.406  -1.178 24.221 1.00 161.88 ? 240  ARG B CB  1 
ATOM   3820 C CG  . ARG B 2 237 ? 41.632  -0.853 25.073 1.00 169.00 ? 240  ARG B CG  1 
ATOM   3821 C CD  . ARG B 2 237 ? 41.965  -1.952 26.071 1.00 173.96 ? 240  ARG B CD  1 
ATOM   3822 N NE  . ARG B 2 237 ? 42.839  -2.970 25.493 1.00 177.36 ? 240  ARG B NE  1 
ATOM   3823 C CZ  . ARG B 2 237 ? 43.495  -3.885 26.200 1.00 187.67 ? 240  ARG B CZ  1 
ATOM   3824 N NH1 . ARG B 2 237 ? 44.270  -4.770 25.587 1.00 172.53 ? 240  ARG B NH1 1 
ATOM   3825 N NH2 . ARG B 2 237 ? 43.384  -3.913 27.522 1.00 174.40 ? 240  ARG B NH2 1 
ATOM   3826 N N   . ASP B 2 238 ? 37.989  -0.671 22.424 1.00 164.30 ? 241  ASP B N   1 
ATOM   3827 C CA  . ASP B 2 238 ? 37.922  -2.051 22.893 1.00 164.40 ? 241  ASP B CA  1 
ATOM   3828 C C   . ASP B 2 238 ? 36.846  -2.851 22.143 1.00 168.16 ? 241  ASP B C   1 
ATOM   3829 O O   . ASP B 2 238 ? 36.911  -4.080 22.088 1.00 167.71 ? 241  ASP B O   1 
ATOM   3830 C CB  . ASP B 2 238 ? 37.594  -2.067 24.391 1.00 166.42 ? 241  ASP B CB  1 
ATOM   3831 C CG  . ASP B 2 238 ? 37.907  -3.399 25.047 1.00 177.34 ? 241  ASP B CG  1 
ATOM   3832 O OD1 . ASP B 2 238 ? 38.995  -3.955 24.785 1.00 177.77 ? 241  ASP B OD1 1 
ATOM   3833 O OD2 . ASP B 2 238 ? 37.085  -3.865 25.865 1.00 183.84 ? 241  ASP B OD2 1 
ATOM   3834 N N   . VAL B 2 239 ? 35.848  -2.163 21.589 1.00 164.54 ? 242  VAL B N   1 
ATOM   3835 C CA  . VAL B 2 239 ? 34.670  -2.847 21.048 1.00 164.17 ? 242  VAL B CA  1 
ATOM   3836 C C   . VAL B 2 239 ? 34.164  -2.334 19.694 1.00 166.96 ? 242  VAL B C   1 
ATOM   3837 O O   . VAL B 2 239 ? 34.578  -1.274 19.218 1.00 166.34 ? 242  VAL B O   1 
ATOM   3838 C CB  . VAL B 2 239 ? 33.526  -2.907 22.086 1.00 168.24 ? 242  VAL B CB  1 
ATOM   3839 C CG1 . VAL B 2 239 ? 32.789  -1.573 22.156 1.00 168.08 ? 242  VAL B CG1 1 
ATOM   3840 C CG2 . VAL B 2 239 ? 32.567  -4.049 21.770 1.00 168.07 ? 242  VAL B CG2 1 
ATOM   3841 N N   . SER B 2 240 ? 33.253  -3.100 19.093 1.00 162.72 ? 243  SER B N   1 
ATOM   3842 C CA  . SER B 2 240 ? 32.606  -2.739 17.830 1.00 162.01 ? 243  SER B CA  1 
ATOM   3843 C C   . SER B 2 240 ? 33.528  -2.928 16.629 1.00 164.50 ? 243  SER B C   1 
ATOM   3844 O O   . SER B 2 240 ? 33.901  -1.956 15.969 1.00 164.18 ? 243  SER B O   1 
ATOM   3845 C CB  . SER B 2 240 ? 32.074  -1.305 17.880 1.00 165.45 ? 243  SER B CB  1 
ATOM   3846 O OG  . SER B 2 240 ? 31.031  -1.181 18.832 1.00 173.93 ? 243  SER B OG  1 
ATOM   3847 N N   . LEU B 2 241 ? 33.822  -4.186 16.304 1.00 159.78 ? 244  LEU B N   1 
ATOM   3848 C CA  . LEU B 2 241 ? 34.868  -4.512 15.337 1.00 158.96 ? 244  LEU B CA  1 
ATOM   3849 C C   . LEU B 2 241 ? 36.077  -3.600 15.535 1.00 161.33 ? 244  LEU B C   1 
ATOM   3850 O O   . LEU B 2 241 ? 36.500  -2.893 14.619 1.00 160.82 ? 244  LEU B O   1 
ATOM   3851 C CB  . LEU B 2 241 ? 34.344  -4.445 13.897 1.00 158.97 ? 244  LEU B CB  1 
ATOM   3852 C CG  . LEU B 2 241 ? 33.770  -5.748 13.326 1.00 163.55 ? 244  LEU B CG  1 
ATOM   3853 C CD1 . LEU B 2 241 ? 32.894  -5.481 12.111 1.00 163.72 ? 244  LEU B CD1 1 
ATOM   3854 C CD2 . LEU B 2 241 ? 34.889  -6.717 12.969 1.00 165.70 ? 244  LEU B CD2 1 
ATOM   3855 N N   . PRO B 2 242 ? 36.610  -3.570 16.767 1.00 156.61 ? 245  PRO B N   1 
ATOM   3856 C CA  . PRO B 2 242 ? 37.737  -2.743 17.205 1.00 155.82 ? 245  PRO B CA  1 
ATOM   3857 C C   . PRO B 2 242 ? 39.062  -3.279 16.676 1.00 157.51 ? 245  PRO B C   1 
ATOM   3858 O O   . PRO B 2 242 ? 39.883  -3.798 17.432 1.00 156.98 ? 245  PRO B O   1 
ATOM   3859 C CB  . PRO B 2 242 ? 37.685  -2.880 18.726 1.00 157.70 ? 245  PRO B CB  1 
ATOM   3860 C CG  . PRO B 2 242 ? 37.132  -4.254 18.952 1.00 162.32 ? 245  PRO B CG  1 
ATOM   3861 C CD  . PRO B 2 242 ? 36.246  -4.586 17.771 1.00 157.98 ? 245  PRO B CD  1 
ATOM   3862 N N   . ARG B 2 243 ? 39.259  -3.150 15.370 1.00 152.35 ? 246  ARG B N   1 
ATOM   3863 C CA  . ARG B 2 243 ? 40.464  -3.646 14.721 1.00 151.28 ? 246  ARG B CA  1 
ATOM   3864 C C   . ARG B 2 243 ? 41.749  -3.124 15.351 1.00 153.77 ? 246  ARG B C   1 
ATOM   3865 O O   . ARG B 2 243 ? 41.833  -1.961 15.747 1.00 153.05 ? 246  ARG B O   1 
ATOM   3866 C CB  . ARG B 2 243 ? 40.440  -3.315 13.228 1.00 150.41 ? 246  ARG B CB  1 
ATOM   3867 C CG  . ARG B 2 243 ? 39.970  -4.458 12.348 1.00 156.29 ? 246  ARG B CG  1 
ATOM   3868 C CD  . ARG B 2 243 ? 41.111  -5.416 12.058 1.00 159.57 ? 246  ARG B CD  1 
ATOM   3869 N NE  . ARG B 2 243 ? 40.633  -6.731 11.644 1.00 162.09 ? 246  ARG B NE  1 
ATOM   3870 C CZ  . ARG B 2 243 ? 40.535  -7.777 12.458 1.00 171.59 ? 246  ARG B CZ  1 
ATOM   3871 N NH1 . ARG B 2 243 ? 40.089  -8.938 11.997 1.00 158.20 ? 246  ARG B NH1 1 
ATOM   3872 N NH2 . ARG B 2 243 ? 40.889  -7.664 13.731 1.00 155.54 ? 246  ARG B NH2 1 
ATOM   3873 N N   . GLY B 2 244 ? 42.737  -4.004 15.466 1.00 149.66 ? 247  GLY B N   1 
ATOM   3874 C CA  . GLY B 2 244 ? 44.100  -3.606 15.755 1.00 149.16 ? 247  GLY B CA  1 
ATOM   3875 C C   . GLY B 2 244 ? 44.764  -3.153 14.470 1.00 152.24 ? 247  GLY B C   1 
ATOM   3876 O O   . GLY B 2 244 ? 44.114  -3.081 13.428 1.00 151.83 ? 247  GLY B O   1 
ATOM   3877 N N   . ALA B 2 245 ? 46.059  -2.861 14.532 1.00 148.22 ? 248  ALA B N   1 
ATOM   3878 C CA  . ALA B 2 245 ? 46.790  -2.409 13.354 1.00 147.79 ? 248  ALA B CA  1 
ATOM   3879 C C   . ALA B 2 245 ? 46.922  -3.512 12.303 1.00 151.16 ? 248  ALA B C   1 
ATOM   3880 O O   . ALA B 2 245 ? 47.634  -4.496 12.509 1.00 150.59 ? 248  ALA B O   1 
ATOM   3881 C CB  . ALA B 2 245 ? 48.161  -1.882 13.750 1.00 148.49 ? 248  ALA B CB  1 
ATOM   3882 N N   . PHE B 2 246 ? 46.237  -3.342 11.176 1.00 147.53 ? 249  PHE B N   1 
ATOM   3883 C CA  . PHE B 2 246 ? 46.356  -4.281 10.064 1.00 147.26 ? 249  PHE B CA  1 
ATOM   3884 C C   . PHE B 2 246 ? 47.228  -3.775 8.908  1.00 150.47 ? 249  PHE B C   1 
ATOM   3885 O O   . PHE B 2 246 ? 48.281  -4.348 8.625  1.00 150.20 ? 249  PHE B O   1 
ATOM   3886 C CB  . PHE B 2 246 ? 44.982  -4.762 9.579  1.00 149.14 ? 249  PHE B CB  1 
ATOM   3887 C CG  . PHE B 2 246 ? 44.580  -6.106 10.130 1.00 150.82 ? 249  PHE B CG  1 
ATOM   3888 C CD1 . PHE B 2 246 ? 45.432  -6.813 10.966 1.00 154.02 ? 249  PHE B CD1 1 
ATOM   3889 C CD2 . PHE B 2 246 ? 43.365  -6.680 9.785  1.00 153.02 ? 249  PHE B CD2 1 
ATOM   3890 C CE1 . PHE B 2 246 ? 45.072  -8.058 11.462 1.00 154.92 ? 249  PHE B CE1 1 
ATOM   3891 C CE2 . PHE B 2 246 ? 43.000  -7.925 10.278 1.00 155.85 ? 249  PHE B CE2 1 
ATOM   3892 C CZ  . PHE B 2 246 ? 43.855  -8.613 11.118 1.00 153.92 ? 249  PHE B CZ  1 
ATOM   3893 N N   . PRO B 2 247 ? 46.811  -2.687 8.239  1.00 146.08 ? 250  PRO B N   1 
ATOM   3894 C CA  . PRO B 2 247 ? 47.659  -2.176 7.152  1.00 145.49 ? 250  PRO B CA  1 
ATOM   3895 C C   . PRO B 2 247 ? 48.728  -1.215 7.674  1.00 148.26 ? 250  PRO B C   1 
ATOM   3896 O O   . PRO B 2 247 ? 48.411  -0.158 8.218  1.00 147.82 ? 250  PRO B O   1 
ATOM   3897 C CB  . PRO B 2 247 ? 46.670  -1.423 6.248  1.00 147.24 ? 250  PRO B CB  1 
ATOM   3898 C CG  . PRO B 2 247 ? 45.294  -1.697 6.810  1.00 151.74 ? 250  PRO B CG  1 
ATOM   3899 C CD  . PRO B 2 247 ? 45.489  -2.044 8.246  1.00 147.40 ? 250  PRO B CD  1 
ATOM   3900 N N   . PRO B 2 248 ? 50.013  -1.560 7.486  1.00 143.99 ? 251  PRO B N   1 
ATOM   3901 C CA  . PRO B 2 248 ? 51.126  -0.790 8.052  1.00 143.53 ? 251  PRO B CA  1 
ATOM   3902 C C   . PRO B 2 248 ? 51.616  0.317  7.122  1.00 146.47 ? 251  PRO B C   1 
ATOM   3903 O O   . PRO B 2 248 ? 52.024  0.051  5.992  1.00 145.95 ? 251  PRO B O   1 
ATOM   3904 C CB  . PRO B 2 248 ? 52.214  -1.848 8.222  1.00 145.31 ? 251  PRO B CB  1 
ATOM   3905 C CG  . PRO B 2 248 ? 51.958  -2.824 7.112  1.00 149.76 ? 251  PRO B CG  1 
ATOM   3906 C CD  . PRO B 2 248 ? 50.485  -2.751 6.758  1.00 145.38 ? 251  PRO B CD  1 
ATOM   3907 N N   . ARG B 2 249 ? 51.641  1.548  7.628  1.00 142.38 ? 252  ARG B N   1 
ATOM   3908 C CA  . ARG B 2 249 ? 51.977  2.710  6.806  1.00 141.84 ? 252  ARG B CA  1 
ATOM   3909 C C   . ARG B 2 249 ? 52.933  3.680  7.506  1.00 145.07 ? 252  ARG B C   1 
ATOM   3910 O O   . ARG B 2 249 ? 53.441  3.391  8.590  1.00 144.58 ? 252  ARG B O   1 
ATOM   3911 C CB  . ARG B 2 249 ? 50.699  3.435  6.375  1.00 141.47 ? 252  ARG B CB  1 
ATOM   3912 C CG  . ARG B 2 249 ? 49.497  2.510  6.237  1.00 149.42 ? 252  ARG B CG  1 
ATOM   3913 C CD  . ARG B 2 249 ? 48.323  3.192  5.556  1.00 155.69 ? 252  ARG B CD  1 
ATOM   3914 N NE  . ARG B 2 249 ? 48.408  3.111  4.101  1.00 161.29 ? 252  ARG B NE  1 
ATOM   3915 C CZ  . ARG B 2 249 ? 48.114  2.022  3.396  1.00 172.96 ? 252  ARG B CZ  1 
ATOM   3916 N NH1 . ARG B 2 249 ? 48.211  2.037  2.073  1.00 158.52 ? 252  ARG B NH1 1 
ATOM   3917 N NH2 . ARG B 2 249 ? 47.733  0.913  4.016  1.00 159.77 ? 252  ARG B NH2 1 
ATOM   3918 N N   . GLY B 2 250 ? 53.174  4.830  6.880  1.00 141.19 ? 253  GLY B N   1 
ATOM   3919 C CA  . GLY B 2 250 ? 54.105  5.822  7.391  1.00 140.79 ? 253  GLY B CA  1 
ATOM   3920 C C   . GLY B 2 250 ? 53.610  7.251  7.247  1.00 144.07 ? 253  GLY B C   1 
ATOM   3921 O O   . GLY B 2 250 ? 52.558  7.500  6.655  1.00 143.50 ? 253  GLY B O   1 
ATOM   3922 N N   . PRO B 2 251 ? 54.386  8.221  7.759  1.00 140.26 ? 254  PRO B N   1 
ATOM   3923 C CA  . PRO B 2 251 ? 53.985  9.631  7.815  1.00 139.89 ? 254  PRO B CA  1 
ATOM   3924 C C   . PRO B 2 251 ? 54.126  10.355 6.479  1.00 142.84 ? 254  PRO B C   1 
ATOM   3925 O O   . PRO B 2 251 ? 55.234  10.545 5.975  1.00 142.24 ? 254  PRO B O   1 
ATOM   3926 C CB  . PRO B 2 251 ? 54.948  10.222 8.845  1.00 141.68 ? 254  PRO B CB  1 
ATOM   3927 C CG  . PRO B 2 251 ? 56.173  9.390  8.725  1.00 146.14 ? 254  PRO B CG  1 
ATOM   3928 C CD  . PRO B 2 251 ? 55.717  7.999  8.353  1.00 141.73 ? 254  PRO B CD  1 
ATOM   3929 N N   . ARG B 2 252 ? 52.996  10.802 5.940  1.00 138.82 ? 255  ARG B N   1 
ATOM   3930 C CA  . ARG B 2 252 ? 52.959  11.487 4.651  1.00 138.30 ? 255  ARG B CA  1 
ATOM   3931 C C   . ARG B 2 252 ? 52.804  12.996 4.826  1.00 142.03 ? 255  ARG B C   1 
ATOM   3932 O O   . ARG B 2 252 ? 52.074  13.457 5.704  1.00 141.62 ? 255  ARG B O   1 
ATOM   3933 C CB  . ARG B 2 252 ? 51.815  10.933 3.797  1.00 137.42 ? 255  ARG B CB  1 
ATOM   3934 C CG  . ARG B 2 252 ? 51.598  11.655 2.479  1.00 143.91 ? 255  ARG B CG  1 
ATOM   3935 C CD  . ARG B 2 252 ? 50.739  10.818 1.545  1.00 148.93 ? 255  ARG B CD  1 
ATOM   3936 N NE  . ARG B 2 252 ? 50.528  11.464 0.252  1.00 152.93 ? 255  ARG B NE  1 
ATOM   3937 C CZ  . ARG B 2 252 ? 49.395  12.057 -0.112 1.00 162.87 ? 255  ARG B CZ  1 
ATOM   3938 N NH1 . ARG B 2 252 ? 48.360  12.079 0.716  1.00 149.59 ? 255  ARG B NH1 1 
ATOM   3939 N NH2 . ARG B 2 252 ? 49.292  12.621 -1.308 1.00 146.90 ? 255  ARG B NH2 1 
ATOM   3940 N N   . PRO B 2 253 ? 53.497  13.784 3.988  1.00 138.39 ? 256  PRO B N   1 
ATOM   3941 C CA  . PRO B 2 253 ? 53.425  15.248 4.045  1.00 138.10 ? 256  PRO B CA  1 
ATOM   3942 C C   . PRO B 2 253 ? 51.999  15.773 3.901  1.00 141.33 ? 256  PRO B C   1 
ATOM   3943 O O   . PRO B 2 253 ? 51.182  15.197 3.181  1.00 140.84 ? 256  PRO B O   1 
ATOM   3944 C CB  . PRO B 2 253 ? 54.274  15.678 2.850  1.00 139.86 ? 256  PRO B CB  1 
ATOM   3945 C CG  . PRO B 2 253 ? 55.295  14.601 2.728  1.00 144.25 ? 256  PRO B CG  1 
ATOM   3946 C CD  . PRO B 2 253 ? 54.616  13.320 3.148  1.00 139.81 ? 256  PRO B CD  1 
ATOM   3947 N N   . VAL B 2 254 ? 51.713  16.878 4.584  1.00 137.32 ? 257  VAL B N   1 
ATOM   3948 C CA  . VAL B 2 254 ? 50.374  17.462 4.596  1.00 136.75 ? 257  VAL B CA  1 
ATOM   3949 C C   . VAL B 2 254 ? 50.042  18.175 3.290  1.00 139.60 ? 257  VAL B C   1 
ATOM   3950 O O   . VAL B 2 254 ? 49.132  17.771 2.563  1.00 139.07 ? 257  VAL B O   1 
ATOM   3951 C CB  . VAL B 2 254 ? 50.184  18.407 5.798  1.00 140.58 ? 257  VAL B CB  1 
ATOM   3952 C CG1 . VAL B 2 254 ? 48.836  19.108 5.715  1.00 140.38 ? 257  VAL B CG1 1 
ATOM   3953 C CG2 . VAL B 2 254 ? 50.319  17.643 7.106  1.00 140.36 ? 257  VAL B CG2 1 
ATOM   3954 N N   . GLN B 2 255 ? 50.764  19.258 3.017  1.00 135.36 ? 258  GLN B N   1 
ATOM   3955 C CA  . GLN B 2 255 ? 50.552  20.051 1.811  1.00 134.75 ? 258  GLN B CA  1 
ATOM   3956 C C   . GLN B 2 255 ? 50.480  19.178 0.565  1.00 138.32 ? 258  GLN B C   1 
ATOM   3957 O O   . GLN B 2 255 ? 49.997  19.616 -0.479 1.00 137.95 ? 258  GLN B O   1 
ATOM   3958 C CB  . GLN B 2 255 ? 51.665  21.087 1.651  1.00 135.86 ? 258  GLN B CB  1 
ATOM   3959 C CG  . GLN B 2 255 ? 53.064  20.495 1.664  1.00 144.58 ? 258  GLN B CG  1 
ATOM   3960 C CD  . GLN B 2 255 ? 53.497  20.059 3.050  1.00 158.93 ? 258  GLN B CD  1 
ATOM   3961 O OE1 . GLN B 2 255 ? 53.858  20.886 3.887  1.00 153.89 ? 258  GLN B OE1 1 
ATOM   3962 N NE2 . GLN B 2 255 ? 53.456  18.755 3.303  1.00 149.86 ? 258  GLN B NE2 1 
ATOM   3963 N N   . SER B 2 256 ? 50.996  17.957 0.676  1.00 134.51 ? 259  SER B N   1 
ATOM   3964 C CA  . SER B 2 256 ? 50.949  16.987 -0.412 1.00 134.07 ? 259  SER B CA  1 
ATOM   3965 C C   . SER B 2 256 ? 49.572  16.930 -1.057 1.00 137.44 ? 259  SER B C   1 
ATOM   3966 O O   . SER B 2 256 ? 49.363  17.490 -2.132 1.00 137.00 ? 259  SER B O   1 
ATOM   3967 C CB  . SER B 2 256 ? 51.341  15.602 0.093  1.00 137.44 ? 259  SER B CB  1 
ATOM   3968 O OG  . SER B 2 256 ? 50.372  15.129 1.006  1.00 145.68 ? 259  SER B OG  1 
ATOM   3969 N N   . VAL B 2 257 ? 48.628  16.274 -0.389 1.00 133.59 ? 260  VAL B N   1 
ATOM   3970 C CA  . VAL B 2 257 ? 47.278  16.139 -0.927 1.00 133.16 ? 260  VAL B CA  1 
ATOM   3971 C C   . VAL B 2 257 ? 46.364  17.346 -0.697 1.00 136.47 ? 260  VAL B C   1 
ATOM   3972 O O   . VAL B 2 257 ? 45.153  17.274 -0.942 1.00 135.92 ? 260  VAL B O   1 
ATOM   3973 C CB  . VAL B 2 257 ? 46.610  14.834 -0.470 1.00 136.99 ? 260  VAL B CB  1 
ATOM   3974 C CG1 . VAL B 2 257 ? 46.116  14.950 0.965  1.00 136.70 ? 260  VAL B CG1 1 
ATOM   3975 C CG2 . VAL B 2 257 ? 45.488  14.470 -1.411 1.00 136.81 ? 260  VAL B CG2 1 
ATOM   3976 N N   . VAL B 2 258 ? 46.948  18.453 -0.246 1.00 132.63 ? 261  VAL B N   1 
ATOM   3977 C CA  . VAL B 2 258 ? 46.210  19.703 -0.102 1.00 132.18 ? 261  VAL B CA  1 
ATOM   3978 C C   . VAL B 2 258 ? 46.928  20.882 -0.749 1.00 135.32 ? 261  VAL B C   1 
ATOM   3979 O O   . VAL B 2 258 ? 48.016  21.274 -0.327 1.00 134.71 ? 261  VAL B O   1 
ATOM   3980 C CB  . VAL B 2 258 ? 45.822  19.982 1.363  1.00 136.05 ? 261  VAL B CB  1 
ATOM   3981 C CG1 . VAL B 2 258 ? 44.630  19.128 1.764  1.00 135.83 ? 261  VAL B CG1 1 
ATOM   3982 C CG2 . VAL B 2 258 ? 47.014  19.719 2.284  1.00 135.85 ? 261  VAL B CG2 1 
ATOM   3983 N N   . PRO B 2 259 ? 46.291  21.500 -1.755 1.00 131.42 ? 262  PRO B N   1 
ATOM   3984 C CA  . PRO B 2 259 ? 46.972  22.553 -2.508 1.00 131.02 ? 262  PRO B CA  1 
ATOM   3985 C C   . PRO B 2 259 ? 46.461  23.948 -2.169 1.00 133.76 ? 262  PRO B C   1 
ATOM   3986 O O   . PRO B 2 259 ? 45.418  24.378 -2.663 1.00 133.18 ? 262  PRO B O   1 
ATOM   3987 C CB  . PRO B 2 259 ? 46.618  22.208 -3.952 1.00 132.89 ? 262  PRO B CB  1 
ATOM   3988 C CG  . PRO B 2 259 ? 45.250  21.577 -3.857 1.00 137.36 ? 262  PRO B CG  1 
ATOM   3989 C CD  . PRO B 2 259 ? 45.077  21.037 -2.450 1.00 132.92 ? 262  PRO B CD  1 
ATOM   3990 N N   . GLU B 2 260 ? 47.196  24.646 -1.312 1.00 129.59 ? 263  GLU B N   1 
ATOM   3991 C CA  . GLU B 2 260 ? 48.347  24.060 -0.636 1.00 129.06 ? 263  GLU B CA  1 
ATOM   3992 C C   . GLU B 2 260 ? 48.615  24.836 0.648  1.00 132.36 ? 263  GLU B C   1 
ATOM   3993 O O   . GLU B 2 260 ? 48.655  26.068 0.639  1.00 132.00 ? 263  GLU B O   1 
ATOM   3994 C CB  . GLU B 2 260 ? 49.579  24.081 -1.545 1.00 130.34 ? 263  GLU B CB  1 
ATOM   3995 C CG  . GLU B 2 260 ? 50.665  23.100 -1.138 1.00 139.65 ? 263  GLU B CG  1 
ATOM   3996 C CD  . GLU B 2 260 ? 51.756  22.971 -2.184 1.00 159.00 ? 263  GLU B CD  1 
ATOM   3997 O OE1 . GLU B 2 260 ? 52.136  24.000 -2.779 1.00 153.58 ? 263  GLU B OE1 1 
ATOM   3998 O OE2 . GLU B 2 260 ? 52.241  21.840 -2.403 1.00 153.21 ? 263  GLU B OE2 1 
ATOM   3999 N N   . MET B 2 261 ? 48.756  24.113 1.756  1.00 128.17 ? 264  MET B N   1 
ATOM   4000 C CA  . MET B 2 261 ? 48.905  24.742 3.064  1.00 127.57 ? 264  MET B CA  1 
ATOM   4001 C C   . MET B 2 261 ? 50.217  25.512 3.183  1.00 129.82 ? 264  MET B C   1 
ATOM   4002 O O   . MET B 2 261 ? 51.221  25.147 2.573  1.00 129.39 ? 264  MET B O   1 
ATOM   4003 C CB  . MET B 2 261 ? 48.779  23.710 4.191  1.00 129.97 ? 264  MET B CB  1 
ATOM   4004 C CG  . MET B 2 261 ? 47.431  22.995 4.245  1.00 133.66 ? 264  MET B CG  1 
ATOM   4005 S SD  . MET B 2 261 ? 46.014  24.115 4.360  1.00 137.92 ? 264  MET B SD  1 
ATOM   4006 C CE  . MET B 2 261 ? 46.391  24.995 5.873  1.00 134.66 ? 264  MET B CE  1 
ATOM   4007 N N   . GLU B 2 262 ? 50.194  26.580 3.974  1.00 124.96 ? 265  GLU B N   1 
ATOM   4008 C CA  . GLU B 2 262 ? 51.351  27.452 4.126  1.00 124.02 ? 265  GLU B CA  1 
ATOM   4009 C C   . GLU B 2 262 ? 52.454  26.753 4.915  1.00 126.32 ? 265  GLU B C   1 
ATOM   4010 O O   . GLU B 2 262 ? 52.428  25.535 5.092  1.00 125.69 ? 265  GLU B O   1 
ATOM   4011 C CB  . GLU B 2 262 ? 50.939  28.750 4.829  1.00 125.32 ? 265  GLU B CB  1 
ATOM   4012 C CG  . GLU B 2 262 ? 51.846  29.936 4.540  1.00 134.28 ? 265  GLU B CG  1 
ATOM   4013 C CD  . GLU B 2 262 ? 51.483  31.163 5.358  1.00 149.51 ? 265  GLU B CD  1 
ATOM   4014 O OE1 . GLU B 2 262 ? 50.355  31.215 5.893  1.00 139.89 ? 265  GLU B OE1 1 
ATOM   4015 O OE2 . GLU B 2 262 ? 52.327  32.076 5.469  1.00 143.00 ? 265  GLU B OE2 1 
ATOM   4016 N N   . GLU B 2 263 ? 53.434  27.527 5.366  1.00 121.99 ? 266  GLU B N   1 
ATOM   4017 C CA  . GLU B 2 263 ? 54.475  27.002 6.238  1.00 121.37 ? 266  GLU B CA  1 
ATOM   4018 C C   . GLU B 2 263 ? 53.808  26.317 7.425  1.00 124.12 ? 266  GLU B C   1 
ATOM   4019 O O   . GLU B 2 263 ? 53.991  25.121 7.656  1.00 123.54 ? 266  GLU B O   1 
ATOM   4020 C CB  . GLU B 2 263 ? 55.359  28.143 6.750  1.00 122.74 ? 266  GLU B CB  1 
ATOM   4021 C CG  . GLU B 2 263 ? 55.468  29.329 5.801  1.00 132.54 ? 266  GLU B CG  1 
ATOM   4022 C CD  . GLU B 2 263 ? 56.135  28.973 4.486  1.00 149.61 ? 266  GLU B CD  1 
ATOM   4023 O OE1 . GLU B 2 263 ? 57.315  28.562 4.507  1.00 140.30 ? 266  GLU B OE1 1 
ATOM   4024 O OE2 . GLU B 2 263 ? 55.493  29.147 3.428  1.00 142.79 ? 266  GLU B OE2 1 
ATOM   4025 N N   . SER B 2 264 ? 52.984  27.082 8.135  1.00 119.94 ? 267  SER B N   1 
ATOM   4026 C CA  . SER B 2 264 ? 52.356  26.625 9.369  1.00 119.26 ? 267  SER B CA  1 
ATOM   4027 C C   . SER B 2 264 ? 51.048  25.878 9.117  1.00 121.75 ? 267  SER B C   1 
ATOM   4028 O O   . SER B 2 264 ? 50.764  24.879 9.778  1.00 121.04 ? 267  SER B O   1 
ATOM   4029 C CB  . SER B 2 264 ? 52.109  27.813 10.305 1.00 122.58 ? 267  SER B CB  1 
ATOM   4030 O OG  . SER B 2 264 ? 53.283  28.591 10.470 1.00 130.29 ? 267  SER B OG  1 
ATOM   4031 N N   . GLY B 2 265 ? 50.244  26.387 8.186  1.00 117.60 ? 268  GLY B N   1 
ATOM   4032 C CA  . GLY B 2 265 ? 48.962  25.800 7.836  1.00 117.10 ? 268  GLY B CA  1 
ATOM   4033 C C   . GLY B 2 265 ? 49.018  24.288 7.729  1.00 120.07 ? 268  GLY B C   1 
ATOM   4034 O O   . GLY B 2 265 ? 48.045  23.592 8.020  1.00 119.66 ? 268  GLY B O   1 
ATOM   4035 N N   . ALA B 2 266 ? 50.176  23.782 7.321  1.00 115.82 ? 269  ALA B N   1 
ATOM   4036 C CA  . ALA B 2 266 ? 50.428  22.349 7.326  1.00 115.16 ? 269  ALA B CA  1 
ATOM   4037 C C   . ALA B 2 266 ? 50.695  21.875 8.751  1.00 117.53 ? 269  ALA B C   1 
ATOM   4038 O O   . ALA B 2 266 ? 50.065  20.933 9.232  1.00 117.22 ? 269  ALA B O   1 
ATOM   4039 C CB  . ALA B 2 266 ? 51.615  22.019 6.427  1.00 115.90 ? 269  ALA B CB  1 
ATOM   4040 N N   . GLN B 2 267 ? 51.603  22.566 9.434  1.00 112.66 ? 270  GLN B N   1 
ATOM   4041 C CA  . GLN B 2 267 ? 52.045  22.161 10.765 1.00 111.72 ? 270  GLN B CA  1 
ATOM   4042 C C   . GLN B 2 267 ? 50.926  22.250 11.803 1.00 113.92 ? 270  GLN B C   1 
ATOM   4043 O O   . GLN B 2 267 ? 50.879  21.457 12.748 1.00 113.44 ? 270  GLN B O   1 
ATOM   4044 C CB  . GLN B 2 267 ? 53.243  23.005 11.208 1.00 112.96 ? 270  GLN B CB  1 
ATOM   4045 C CG  . GLN B 2 267 ? 54.367  23.089 10.182 1.00 125.11 ? 270  GLN B CG  1 
ATOM   4046 C CD  . GLN B 2 267 ? 55.153  21.795 10.061 1.00 142.86 ? 270  GLN B CD  1 
ATOM   4047 O OE1 . GLN B 2 267 ? 56.379  21.787 10.189 1.00 137.76 ? 270  GLN B OE1 1 
ATOM   4048 N NE2 . GLN B 2 267 ? 54.452  20.696 9.804  1.00 135.50 ? 270  GLN B NE2 1 
ATOM   4049 N N   . LEU B 2 268 ? 50.037  23.225 11.632 1.00 108.91 ? 271  LEU B N   1 
ATOM   4050 C CA  . LEU B 2 268 ? 48.929  23.415 12.561 1.00 107.75 ? 271  LEU B CA  1 
ATOM   4051 C C   . LEU B 2 268 ? 47.877  22.335 12.371 1.00 108.96 ? 271  LEU B C   1 
ATOM   4052 O O   . LEU B 2 268 ? 47.464  21.682 13.326 1.00 108.34 ? 271  LEU B O   1 
ATOM   4053 C CB  . LEU B 2 268 ? 48.301  24.799 12.384 1.00 107.82 ? 271  LEU B CB  1 
ATOM   4054 C CG  . LEU B 2 268 ? 47.293  25.208 13.461 1.00 112.45 ? 271  LEU B CG  1 
ATOM   4055 C CD1 . LEU B 2 268 ? 47.899  25.040 14.846 1.00 112.52 ? 271  LEU B CD1 1 
ATOM   4056 C CD2 . LEU B 2 268 ? 46.828  26.642 13.248 1.00 114.80 ? 271  LEU B CD2 1 
ATOM   4057 N N   . LEU B 2 269 ? 47.445  22.151 11.130 1.00 103.94 ? 272  LEU B N   1 
ATOM   4058 C CA  . LEU B 2 269 ? 46.508  21.087 10.806 1.00 103.09 ? 272  LEU B CA  1 
ATOM   4059 C C   . LEU B 2 269 ? 47.036  19.726 11.256 1.00 106.18 ? 272  LEU B C   1 
ATOM   4060 O O   . LEU B 2 269 ? 46.265  18.785 11.447 1.00 105.45 ? 272  LEU B O   1 
ATOM   4061 C CB  . LEU B 2 269 ? 46.210  21.079 9.309  1.00 102.96 ? 272  LEU B CB  1 
ATOM   4062 C CG  . LEU B 2 269 ? 45.259  19.985 8.833  1.00 107.48 ? 272  LEU B CG  1 
ATOM   4063 C CD1 . LEU B 2 269 ? 44.130  19.805 9.833  1.00 107.54 ? 272  LEU B CD1 1 
ATOM   4064 C CD2 . LEU B 2 269 ? 44.707  20.350 7.465  1.00 110.00 ? 272  LEU B CD2 1 
ATOM   4065 N N   . LEU B 2 270 ? 48.353  19.628 11.422 1.00 102.58 ? 273  LEU B N   1 
ATOM   4066 C CA  . LEU B 2 270 ? 48.971  18.418 11.958 1.00 102.37 ? 273  LEU B CA  1 
ATOM   4067 C C   . LEU B 2 270 ? 48.750  18.317 13.460 1.00 105.86 ? 273  LEU B C   1 
ATOM   4068 O O   . LEU B 2 270 ? 48.357  17.267 13.967 1.00 105.56 ? 273  LEU B O   1 
ATOM   4069 C CB  . LEU B 2 270 ? 50.469  18.380 11.646 1.00 102.54 ? 273  LEU B CB  1 
ATOM   4070 C CG  . LEU B 2 270 ? 50.877  17.796 10.291 1.00 107.44 ? 273  LEU B CG  1 
ATOM   4071 C CD1 . LEU B 2 270 ? 52.390  17.838 10.128 1.00 107.73 ? 273  LEU B CD1 1 
ATOM   4072 C CD2 . LEU B 2 270 ? 50.357  16.371 10.139 1.00 109.71 ? 273  LEU B CD2 1 
ATOM   4073 N N   . GLU B 2 271 ? 49.034  19.405 14.169 1.00 101.94 ? 274  GLU B N   1 
ATOM   4074 C CA  . GLU B 2 271 ? 48.700  19.505 15.585 1.00 101.42 ? 274  GLU B CA  1 
ATOM   4075 C C   . GLU B 2 271 ? 47.222  19.199 15.799 1.00 105.42 ? 274  GLU B C   1 
ATOM   4076 O O   . GLU B 2 271 ? 46.864  18.409 16.671 1.00 105.06 ? 274  GLU B O   1 
ATOM   4077 C CB  . GLU B 2 271 ? 49.019  20.903 16.113 1.00 102.58 ? 274  GLU B CB  1 
ATOM   4078 C CG  . GLU B 2 271 ? 50.487  21.141 16.386 1.00 109.95 ? 274  GLU B CG  1 
ATOM   4079 C CD  . GLU B 2 271 ? 50.775  22.578 16.749 1.00 121.99 ? 274  GLU B CD  1 
ATOM   4080 O OE1 . GLU B 2 271 ? 50.250  23.477 16.059 1.00 115.21 ? 274  GLU B OE1 1 
ATOM   4081 O OE2 . GLU B 2 271 ? 51.530  22.810 17.715 1.00 110.96 ? 274  GLU B OE2 1 
ATOM   4082 N N   . MET B 2 272 ? 46.369  19.849 15.013 1.00 101.98 ? 275  MET B N   1 
ATOM   4083 C CA  . MET B 2 272 ? 44.945  19.539 15.004 1.00 101.78 ? 275  MET B CA  1 
ATOM   4084 C C   . MET B 2 272 ? 44.738  18.043 14.838 1.00 106.32 ? 275  MET B C   1 
ATOM   4085 O O   . MET B 2 272 ? 44.192  17.374 15.713 1.00 105.67 ? 275  MET B O   1 
ATOM   4086 C CB  . MET B 2 272 ? 44.246  20.258 13.850 1.00 103.99 ? 275  MET B CB  1 
ATOM   4087 C CG  . MET B 2 272 ? 44.104  21.753 14.025 1.00 107.41 ? 275  MET B CG  1 
ATOM   4088 S SD  . MET B 2 272 ? 42.723  22.373 13.057 1.00 111.44 ? 275  MET B SD  1 
ATOM   4089 C CE  . MET B 2 272 ? 42.610  24.044 13.675 1.00 108.15 ? 275  MET B CE  1 
ATOM   4090 N N   . LEU B 2 273 ? 45.178  17.528 13.696 1.00 103.96 ? 276  LEU B N   1 
ATOM   4091 C CA  . LEU B 2 273 ? 44.967  16.131 13.360 1.00 104.30 ? 276  LEU B CA  1 
ATOM   4092 C C   . LEU B 2 273 ? 46.114  15.234 13.814 1.00 109.48 ? 276  LEU B C   1 
ATOM   4093 O O   . LEU B 2 273 ? 46.830  14.648 12.998 1.00 108.84 ? 276  LEU B O   1 
ATOM   4094 C CB  . LEU B 2 273 ? 44.686  15.978 11.867 1.00 104.27 ? 276  LEU B CB  1 
ATOM   4095 C CG  . LEU B 2 273 ? 43.577  16.918 11.390 1.00 108.71 ? 276  LEU B CG  1 
ATOM   4096 C CD1 . LEU B 2 273 ? 43.079  16.536 10.005 1.00 108.68 ? 276  LEU B CD1 1 
ATOM   4097 C CD2 . LEU B 2 273 ? 42.435  16.956 12.398 1.00 110.81 ? 276  LEU B CD2 1 
ATOM   4098 N N   . THR B 2 274 ? 46.328  15.204 15.125 1.00 107.20 ? 277  THR B N   1 
ATOM   4099 C CA  . THR B 2 274 ? 47.093  14.139 15.757 1.00 107.60 ? 277  THR B CA  1 
ATOM   4100 C C   . THR B 2 274 ? 46.112  13.000 16.017 1.00 112.97 ? 277  THR B C   1 
ATOM   4101 O O   . THR B 2 274 ? 44.902  13.221 16.092 1.00 112.62 ? 277  THR B O   1 
ATOM   4102 C CB  . THR B 2 274 ? 47.757  14.611 17.078 1.00 114.56 ? 277  THR B CB  1 
ATOM   4103 O OG1 . THR B 2 274 ? 48.707  15.650 16.805 1.00 112.73 ? 277  THR B OG1 1 
ATOM   4104 C CG2 . THR B 2 274 ? 48.468  13.452 17.763 1.00 112.94 ? 277  THR B CG2 1 
ATOM   4105 N N   . PHE B 2 275 ? 46.625  11.780 16.105 1.00 110.54 ? 278  PHE B N   1 
ATOM   4106 C CA  . PHE B 2 275 ? 45.784  10.641 16.439 1.00 110.90 ? 278  PHE B CA  1 
ATOM   4107 C C   . PHE B 2 275 ? 45.478  10.650 17.935 1.00 115.23 ? 278  PHE B C   1 
ATOM   4108 O O   . PHE B 2 275 ? 44.317  10.571 18.346 1.00 114.84 ? 278  PHE B O   1 
ATOM   4109 C CB  . PHE B 2 275 ? 46.479  9.335  16.047 1.00 112.90 ? 278  PHE B CB  1 
ATOM   4110 C CG  . PHE B 2 275 ? 45.683  8.105  16.373 1.00 114.72 ? 278  PHE B CG  1 
ATOM   4111 C CD1 . PHE B 2 275 ? 44.337  8.026  16.048 1.00 117.92 ? 278  PHE B CD1 1 
ATOM   4112 C CD2 . PHE B 2 275 ? 46.279  7.029  17.011 1.00 117.09 ? 278  PHE B CD2 1 
ATOM   4113 C CE1 . PHE B 2 275 ? 43.602  6.894  16.349 1.00 118.91 ? 278  PHE B CE1 1 
ATOM   4114 C CE2 . PHE B 2 275 ? 45.550  5.894  17.314 1.00 119.98 ? 278  PHE B CE2 1 
ATOM   4115 C CZ  . PHE B 2 275 ? 44.210  5.826  16.982 1.00 118.06 ? 278  PHE B CZ  1 
ATOM   4116 N N   . ASN B 2 276 ? 46.532  10.796 18.735 1.00 111.86 ? 279  ASN B N   1 
ATOM   4117 C CA  . ASN B 2 276 ? 46.436  10.836 20.193 1.00 111.57 ? 279  ASN B CA  1 
ATOM   4118 C C   . ASN B 2 276 ? 45.695  12.088 20.663 1.00 115.24 ? 279  ASN B C   1 
ATOM   4119 O O   . ASN B 2 276 ? 46.218  13.199 20.575 1.00 114.82 ? 279  ASN B O   1 
ATOM   4120 C CB  . ASN B 2 276 ? 47.846  10.808 20.792 1.00 112.04 ? 279  ASN B CB  1 
ATOM   4121 C CG  . ASN B 2 276 ? 47.841  10.698 22.302 1.00 133.90 ? 279  ASN B CG  1 
ATOM   4122 O OD1 . ASN B 2 276 ? 46.837  10.975 22.953 1.00 128.99 ? 279  ASN B OD1 1 
ATOM   4123 N ND2 . ASN B 2 276 ? 48.973  10.296 22.868 1.00 125.53 ? 279  ASN B ND2 1 
ATOM   4124 N N   . PRO B 2 277 ? 44.478  11.916 21.207 1.00 111.50 ? 280  PRO B N   1 
ATOM   4125 C CA  . PRO B 2 277 ? 43.650  13.068 21.588 1.00 111.20 ? 280  PRO B CA  1 
ATOM   4126 C C   . PRO B 2 277 ? 44.270  13.918 22.697 1.00 114.80 ? 280  PRO B C   1 
ATOM   4127 O O   . PRO B 2 277 ? 43.914  15.085 22.865 1.00 114.19 ? 280  PRO B O   1 
ATOM   4128 C CB  . PRO B 2 277 ? 42.348  12.423 22.079 1.00 112.88 ? 280  PRO B CB  1 
ATOM   4129 C CG  . PRO B 2 277 ? 42.325  11.073 21.451 1.00 117.25 ? 280  PRO B CG  1 
ATOM   4130 C CD  . PRO B 2 277 ? 43.757  10.641 21.373 1.00 112.84 ? 280  PRO B CD  1 
ATOM   4131 N N   . HIS B 2 278 ? 45.198  13.332 23.449 1.00 111.30 ? 281  HIS B N   1 
ATOM   4132 C CA  . HIS B 2 278 ? 45.860  14.044 24.538 1.00 111.06 ? 281  HIS B CA  1 
ATOM   4133 C C   . HIS B 2 278 ? 46.904  15.038 24.036 1.00 114.17 ? 281  HIS B C   1 
ATOM   4134 O O   . HIS B 2 278 ? 46.820  16.232 24.323 1.00 113.71 ? 281  HIS B O   1 
ATOM   4135 C CB  . HIS B 2 278 ? 46.474  13.067 25.542 1.00 111.95 ? 281  HIS B CB  1 
ATOM   4136 C CG  . HIS B 2 278 ? 45.462  12.352 26.382 1.00 115.47 ? 281  HIS B CG  1 
ATOM   4137 N ND1 . HIS B 2 278 ? 44.440  11.602 25.839 1.00 117.32 ? 281  HIS B ND1 1 
ATOM   4138 C CD2 . HIS B 2 278 ? 45.305  12.283 27.725 1.00 117.36 ? 281  HIS B CD2 1 
ATOM   4139 C CE1 . HIS B 2 278 ? 43.703  11.096 26.810 1.00 116.79 ? 281  HIS B CE1 1 
ATOM   4140 N NE2 . HIS B 2 278 ? 44.205  11.495 27.965 1.00 117.22 ? 281  HIS B NE2 1 
ATOM   4141 N N   . LYS B 2 279 ? 47.884  14.547 23.284 1.00 110.09 ? 282  LYS B N   1 
ATOM   4142 C CA  . LYS B 2 279 ? 48.865  15.431 22.664 1.00 109.58 ? 282  LYS B CA  1 
ATOM   4143 C C   . LYS B 2 279 ? 48.302  16.102 21.409 1.00 113.42 ? 282  LYS B C   1 
ATOM   4144 O O   . LYS B 2 279 ? 49.048  16.627 20.582 1.00 113.34 ? 282  LYS B O   1 
ATOM   4145 C CB  . LYS B 2 279 ? 50.172  14.687 22.367 1.00 111.70 ? 282  LYS B CB  1 
ATOM   4146 C CG  . LYS B 2 279 ? 49.999  13.381 21.611 1.00 121.83 ? 282  LYS B CG  1 
ATOM   4147 C CD  . LYS B 2 279 ? 51.341  12.713 21.324 1.00 128.45 ? 282  LYS B CD  1 
ATOM   4148 C CE  . LYS B 2 279 ? 51.966  12.131 22.583 1.00 133.60 ? 282  LYS B CE  1 
ATOM   4149 N NZ  . LYS B 2 279 ? 53.136  11.261 22.268 1.00 139.09 ? 282  LYS B NZ  1 
ATOM   4150 N N   . ARG B 2 280 ? 46.974  16.104 21.299 1.00 109.47 ? 283  ARG B N   1 
ATOM   4151 C CA  . ARG B 2 280 ? 46.256  16.795 20.227 1.00 108.98 ? 283  ARG B CA  1 
ATOM   4152 C C   . ARG B 2 280 ? 46.507  18.302 20.304 1.00 113.09 ? 283  ARG B C   1 
ATOM   4153 O O   . ARG B 2 280 ? 47.569  18.745 20.742 1.00 112.80 ? 283  ARG B O   1 
ATOM   4154 C CB  . ARG B 2 280 ? 44.755  16.539 20.380 1.00 108.07 ? 283  ARG B CB  1 
ATOM   4155 C CG  . ARG B 2 280 ? 43.936  16.646 19.106 1.00 114.51 ? 283  ARG B CG  1 
ATOM   4156 C CD  . ARG B 2 280 ? 43.662  15.268 18.529 1.00 119.88 ? 283  ARG B CD  1 
ATOM   4157 N NE  . ARG B 2 280 ? 42.235  15.058 18.297 1.00 125.38 ? 283  ARG B NE  1 
ATOM   4158 C CZ  . ARG B 2 280 ? 41.697  13.903 17.918 1.00 138.81 ? 283  ARG B CZ  1 
ATOM   4159 N NH1 . ARG B 2 280 ? 40.385  13.806 17.743 1.00 125.96 ? 283  ARG B NH1 1 
ATOM   4160 N NH2 . ARG B 2 280 ? 42.468  12.843 17.710 1.00 125.77 ? 283  ARG B NH2 1 
ATOM   4161 N N   . ILE B 2 281 ? 45.514  19.086 19.893 1.00 109.67 ? 284  ILE B N   1 
ATOM   4162 C CA  . ILE B 2 281 ? 45.569  20.538 20.040 1.00 109.49 ? 284  ILE B CA  1 
ATOM   4163 C C   . ILE B 2 281 ? 44.349  21.036 20.800 1.00 113.57 ? 284  ILE B C   1 
ATOM   4164 O O   . ILE B 2 281 ? 43.288  20.408 20.765 1.00 113.16 ? 284  ILE B O   1 
ATOM   4165 C CB  . ILE B 2 281 ? 45.686  21.255 18.678 1.00 112.54 ? 284  ILE B CB  1 
ATOM   4166 C CG1 . ILE B 2 281 ? 46.263  22.661 18.865 1.00 112.82 ? 284  ILE B CG1 1 
ATOM   4167 C CG2 . ILE B 2 281 ? 44.324  21.344 18.005 1.00 113.20 ? 284  ILE B CG2 1 
ATOM   4168 C CD1 . ILE B 2 281 ? 46.336  23.465 17.586 1.00 118.94 ? 284  ILE B CD1 1 
ATOM   4169 N N   . SER B 2 282 ? 44.499  22.181 21.459 1.00 110.11 ? 285  SER B N   1 
ATOM   4170 C CA  . SER B 2 282 ? 43.400  22.803 22.189 1.00 109.74 ? 285  SER B CA  1 
ATOM   4171 C C   . SER B 2 282 ? 42.590  23.727 21.285 1.00 113.27 ? 285  SER B C   1 
ATOM   4172 O O   . SER B 2 282 ? 43.129  24.339 20.362 1.00 112.71 ? 285  SER B O   1 
ATOM   4173 C CB  . SER B 2 282 ? 43.930  23.578 23.395 1.00 113.23 ? 285  SER B CB  1 
ATOM   4174 O OG  . SER B 2 282 ? 44.643  22.726 24.275 1.00 121.92 ? 285  SER B OG  1 
ATOM   4175 N N   . ALA B 2 283 ? 41.292  23.820 21.555 1.00 109.75 ? 286  ALA B N   1 
ATOM   4176 C CA  . ALA B 2 283 ? 40.397  24.661 20.768 1.00 109.40 ? 286  ALA B CA  1 
ATOM   4177 C C   . ALA B 2 283 ? 40.827  26.115 20.852 1.00 112.87 ? 286  ALA B C   1 
ATOM   4178 O O   . ALA B 2 283 ? 40.475  26.929 19.997 1.00 112.37 ? 286  ALA B O   1 
ATOM   4179 C CB  . ALA B 2 283 ? 38.965  24.508 21.259 1.00 110.13 ? 286  ALA B CB  1 
ATOM   4180 N N   . PHE B 2 284 ? 41.589  26.431 21.893 1.00 109.20 ? 287  PHE B N   1 
ATOM   4181 C CA  . PHE B 2 284 ? 42.026  27.797 22.145 1.00 108.83 ? 287  PHE B CA  1 
ATOM   4182 C C   . PHE B 2 284 ? 43.461  28.001 21.670 1.00 112.83 ? 287  PHE B C   1 
ATOM   4183 O O   . PHE B 2 284 ? 43.754  28.940 20.927 1.00 112.25 ? 287  PHE B O   1 
ATOM   4184 C CB  . PHE B 2 284 ? 41.914  28.113 23.639 1.00 110.45 ? 287  PHE B CB  1 
ATOM   4185 C CG  . PHE B 2 284 ? 42.136  29.560 23.971 1.00 111.81 ? 287  PHE B CG  1 
ATOM   4186 C CD1 . PHE B 2 284 ? 41.162  30.505 23.691 1.00 114.64 ? 287  PHE B CD1 1 
ATOM   4187 C CD2 . PHE B 2 284 ? 43.315  29.975 24.567 1.00 113.87 ? 287  PHE B CD2 1 
ATOM   4188 C CE1 . PHE B 2 284 ? 41.361  31.835 23.993 1.00 115.48 ? 287  PHE B CE1 1 
ATOM   4189 C CE2 . PHE B 2 284 ? 43.521  31.305 24.870 1.00 116.65 ? 287  PHE B CE2 1 
ATOM   4190 C CZ  . PHE B 2 284 ? 42.542  32.237 24.583 1.00 114.70 ? 287  PHE B CZ  1 
ATOM   4191 N N   . ARG B 2 285 ? 44.349  27.107 22.093 1.00 109.62 ? 288  ARG B N   1 
ATOM   4192 C CA  . ARG B 2 285 ? 45.758  27.188 21.724 1.00 109.40 ? 288  ARG B CA  1 
ATOM   4193 C C   . ARG B 2 285 ? 45.921  27.219 20.211 1.00 113.44 ? 288  ARG B C   1 
ATOM   4194 O O   . ARG B 2 285 ? 46.775  27.931 19.680 1.00 113.24 ? 288  ARG B O   1 
ATOM   4195 C CB  . ARG B 2 285 ? 46.541  26.032 22.348 1.00 108.98 ? 288  ARG B CB  1 
ATOM   4196 C CG  . ARG B 2 285 ? 46.493  26.046 23.868 1.00 116.77 ? 288  ARG B CG  1 
ATOM   4197 C CD  . ARG B 2 285 ? 46.925  24.728 24.485 1.00 121.72 ? 288  ARG B CD  1 
ATOM   4198 N NE  . ARG B 2 285 ? 46.449  24.617 25.862 1.00 126.57 ? 288  ARG B NE  1 
ATOM   4199 C CZ  . ARG B 2 285 ? 46.836  23.680 26.721 1.00 137.56 ? 288  ARG B CZ  1 
ATOM   4200 N NH1 . ARG B 2 285 ? 46.341  23.666 27.952 1.00 123.13 ? 288  ARG B NH1 1 
ATOM   4201 N NH2 . ARG B 2 285 ? 47.723  22.764 26.358 1.00 124.03 ? 288  ARG B NH2 1 
ATOM   4202 N N   . ALA B 2 286 ? 45.069  26.474 19.517 1.00 109.68 ? 289  ALA B N   1 
ATOM   4203 C CA  . ALA B 2 286 ? 44.965  26.601 18.072 1.00 109.22 ? 289  ALA B CA  1 
ATOM   4204 C C   . ALA B 2 286 ? 44.581  28.039 17.730 1.00 112.53 ? 289  ALA B C   1 
ATOM   4205 O O   . ALA B 2 286 ? 45.274  28.713 16.971 1.00 112.00 ? 289  ALA B O   1 
ATOM   4206 C CB  . ALA B 2 286 ? 43.922  25.630 17.532 1.00 109.93 ? 289  ALA B CB  1 
ATOM   4207 N N   . LEU B 2 287 ? 43.528  28.528 18.378 1.00 108.78 ? 290  LEU B N   1 
ATOM   4208 C CA  . LEU B 2 287 ? 42.927  29.813 18.032 1.00 108.29 ? 290  LEU B CA  1 
ATOM   4209 C C   . LEU B 2 287 ? 43.895  30.986 18.178 1.00 112.19 ? 290  LEU B C   1 
ATOM   4210 O O   . LEU B 2 287 ? 43.496  32.144 18.077 1.00 111.71 ? 290  LEU B O   1 
ATOM   4211 C CB  . LEU B 2 287 ? 41.657  30.049 18.859 1.00 108.12 ? 290  LEU B CB  1 
ATOM   4212 C CG  . LEU B 2 287 ? 40.483  30.767 18.183 1.00 112.39 ? 290  LEU B CG  1 
ATOM   4213 C CD1 . LEU B 2 287 ? 39.186  30.489 18.924 1.00 112.32 ? 290  LEU B CD1 1 
ATOM   4214 C CD2 . LEU B 2 287 ? 40.719  32.267 18.067 1.00 114.44 ? 290  LEU B CD2 1 
ATOM   4215 N N   . GLN B 2 288 ? 45.172  30.690 18.386 1.00 109.11 ? 291  GLN B N   1 
ATOM   4216 C CA  . GLN B 2 288 ? 46.177  31.742 18.463 1.00 109.41 ? 291  GLN B CA  1 
ATOM   4217 C C   . GLN B 2 288 ? 47.551  31.252 18.027 1.00 115.65 ? 291  GLN B C   1 
ATOM   4218 O O   . GLN B 2 288 ? 48.569  31.632 18.603 1.00 115.18 ? 291  GLN B O   1 
ATOM   4219 C CB  . GLN B 2 288 ? 46.233  32.325 19.872 1.00 110.48 ? 291  GLN B CB  1 
ATOM   4220 C CG  . GLN B 2 288 ? 46.326  31.280 20.963 1.00 117.62 ? 291  GLN B CG  1 
ATOM   4221 C CD  . GLN B 2 288 ? 46.073  31.861 22.336 1.00 129.08 ? 291  GLN B CD  1 
ATOM   4222 O OE1 . GLN B 2 288 ? 46.315  31.211 23.353 1.00 122.88 ? 291  GLN B OE1 1 
ATOM   4223 N NE2 . GLN B 2 288 ? 45.578  33.093 22.373 1.00 119.49 ? 291  GLN B NE2 1 
ATOM   4224 N N   . HIS B 2 289 ? 47.566  30.429 16.983 1.00 114.11 ? 292  HIS B N   1 
ATOM   4225 C CA  . HIS B 2 289 ? 48.801  29.884 16.425 1.00 114.59 ? 292  HIS B CA  1 
ATOM   4226 C C   . HIS B 2 289 ? 49.456  30.897 15.489 1.00 118.92 ? 292  HIS B C   1 
ATOM   4227 O O   . HIS B 2 289 ? 48.832  31.885 15.098 1.00 118.56 ? 292  HIS B O   1 
ATOM   4228 C CB  . HIS B 2 289 ? 48.494  28.595 15.657 1.00 115.63 ? 292  HIS B CB  1 
ATOM   4229 C CG  . HIS B 2 289 ? 49.710  27.807 15.278 1.00 119.22 ? 292  HIS B CG  1 
ATOM   4230 N ND1 . HIS B 2 289 ? 49.821  27.145 14.073 1.00 121.05 ? 292  HIS B ND1 1 
ATOM   4231 C CD2 . HIS B 2 289 ? 50.855  27.551 15.953 1.00 121.05 ? 292  HIS B CD2 1 
ATOM   4232 C CE1 . HIS B 2 289 ? 50.985  26.527 14.018 1.00 120.49 ? 292  HIS B CE1 1 
ATOM   4233 N NE2 . HIS B 2 289 ? 51.634  26.757 15.146 1.00 120.80 ? 292  HIS B NE2 1 
ATOM   4234 N N   . SER B 2 290 ? 50.716  30.650 15.144 1.00 115.71 ? 293  SER B N   1 
ATOM   4235 C CA  . SER B 2 290 ? 51.435  31.489 14.190 1.00 115.68 ? 293  SER B CA  1 
ATOM   4236 C C   . SER B 2 290 ? 50.579  31.741 12.953 1.00 119.59 ? 293  SER B C   1 
ATOM   4237 O O   . SER B 2 290 ? 50.590  32.835 12.384 1.00 119.23 ? 293  SER B O   1 
ATOM   4238 C CB  . SER B 2 290 ? 52.745  30.815 13.779 1.00 119.41 ? 293  SER B CB  1 
ATOM   4239 O OG  . SER B 2 290 ? 53.508  30.450 14.915 1.00 128.28 ? 293  SER B OG  1 
ATOM   4240 N N   . TYR B 2 291 ? 49.820  30.723 12.562 1.00 115.98 ? 294  TYR B N   1 
ATOM   4241 C CA  . TYR B 2 291 ? 48.948  30.804 11.398 1.00 115.68 ? 294  TYR B CA  1 
ATOM   4242 C C   . TYR B 2 291 ? 47.861  31.861 11.605 1.00 118.98 ? 294  TYR B C   1 
ATOM   4243 O O   . TYR B 2 291 ? 47.312  32.395 10.640 1.00 118.50 ? 294  TYR B O   1 
ATOM   4244 C CB  . TYR B 2 291 ? 48.313  29.437 11.132 1.00 117.00 ? 294  TYR B CB  1 
ATOM   4245 C CG  . TYR B 2 291 ? 47.864  29.222 9.703  1.00 119.00 ? 294  TYR B CG  1 
ATOM   4246 C CD1 . TYR B 2 291 ? 48.774  29.257 8.655  1.00 121.01 ? 294  TYR B CD1 1 
ATOM   4247 C CD2 . TYR B 2 291 ? 46.535  28.951 9.407  1.00 119.86 ? 294  TYR B CD2 1 
ATOM   4248 C CE1 . TYR B 2 291 ? 48.370  29.052 7.347  1.00 121.84 ? 294  TYR B CE1 1 
ATOM   4249 C CE2 . TYR B 2 291 ? 46.120  28.744 8.104  1.00 120.83 ? 294  TYR B CE2 1 
ATOM   4250 C CZ  . TYR B 2 291 ? 47.042  28.796 7.078  1.00 128.40 ? 294  TYR B CZ  1 
ATOM   4251 O OH  . TYR B 2 291 ? 46.635  28.590 5.779  1.00 129.70 ? 294  TYR B OH  1 
ATOM   4252 N N   . LEU B 2 292 ? 47.573  32.168 12.869 1.00 114.98 ? 295  LEU B N   1 
ATOM   4253 C CA  . LEU B 2 292 ? 46.556  33.158 13.233 1.00 127.25 ? 295  LEU B CA  1 
ATOM   4254 C C   . LEU B 2 292 ? 45.223  32.928 12.527 1.00 151.18 ? 295  LEU B C   1 
ATOM   4255 O O   . LEU B 2 292 ? 44.400  33.841 12.428 1.00 113.30 ? 295  LEU B O   1 
ATOM   4256 C CB  . LEU B 2 292 ? 47.047  34.585 12.966 1.00 127.07 ? 295  LEU B CB  1 
ATOM   4257 C CG  . LEU B 2 292 ? 48.174  35.141 13.839 1.00 131.34 ? 295  LEU B CG  1 
ATOM   4258 C CD1 . LEU B 2 292 ? 48.377  36.619 13.543 1.00 131.38 ? 295  LEU B CD1 1 
ATOM   4259 C CD2 . LEU B 2 292 ? 47.881  34.922 15.313 1.00 133.33 ? 295  LEU B CD2 1 
HETATM 4260 O O   . HOH C 3 .   ? 33.383  47.405 32.485 1.00 83.08  ? 2001 HOH A O   1 
HETATM 4261 O O   . HOH C 3 .   ? 17.866  45.213 29.681 1.00 70.21  ? 2002 HOH A O   1 
HETATM 4262 O O   . HOH C 3 .   ? 15.994  41.993 36.633 1.00 46.46  ? 2003 HOH A O   1 
HETATM 4263 O O   . HOH C 3 .   ? 18.752  45.002 34.057 1.00 86.29  ? 2004 HOH A O   1 
HETATM 4264 O O   . HOH C 3 .   ? 16.096  44.408 27.618 1.00 76.87  ? 2005 HOH A O   1 
HETATM 4265 O O   . HOH C 3 .   ? 16.203  43.616 31.570 1.00 79.60  ? 2006 HOH A O   1 
HETATM 4266 O O   . HOH C 3 .   ? 16.166  44.378 34.039 1.00 61.36  ? 2007 HOH A O   1 
HETATM 4267 O O   . HOH C 3 .   ? 20.852  41.414 36.850 1.00 80.45  ? 2008 HOH A O   1 
HETATM 4268 O O   . HOH C 3 .   ? 15.048  41.343 32.331 1.00 96.80  ? 2009 HOH A O   1 
HETATM 4269 O O   . HOH C 3 .   ? 16.932  40.194 30.013 1.00 88.29  ? 2010 HOH A O   1 
HETATM 4270 O O   . HOH C 3 .   ? 4.483   49.459 36.945 1.00 59.17  ? 2011 HOH A O   1 
HETATM 4271 O O   . HOH C 3 .   ? -8.404  39.241 36.225 1.00 69.27  ? 2012 HOH A O   1 
HETATM 4272 O O   . HOH C 3 .   ? 1.462   41.770 35.047 1.00 77.87  ? 2013 HOH A O   1 
HETATM 4273 O O   . HOH C 3 .   ? 1.673   41.761 42.199 1.00 54.93  ? 2014 HOH A O   1 
HETATM 4274 O O   . HOH C 3 .   ? 2.299   46.165 35.229 1.00 76.16  ? 2015 HOH A O   1 
HETATM 4275 O O   . HOH C 3 .   ? 1.605   48.319 37.673 1.00 95.01  ? 2016 HOH A O   1 
HETATM 4276 O O   . HOH C 3 .   ? -6.204  40.533 37.497 1.00 76.72  ? 2017 HOH A O   1 
HETATM 4277 O O   . HOH C 3 .   ? -6.821  42.159 33.558 1.00 61.51  ? 2018 HOH A O   1 
HETATM 4278 O O   . HOH C 3 .   ? 15.411  23.658 51.585 1.00 71.72  ? 2019 HOH A O   1 
HETATM 4279 O O   . HOH C 3 .   ? -7.370  39.485 42.270 1.00 58.25  ? 2020 HOH A O   1 
HETATM 4280 O O   . HOH C 3 .   ? -8.968  35.085 46.292 1.00 80.71  ? 2021 HOH A O   1 
HETATM 4281 O O   . HOH C 3 .   ? 3.491   35.896 49.869 1.00 61.03  ? 2022 HOH A O   1 
HETATM 4282 O O   . HOH C 3 .   ? -5.317  32.858 52.280 1.00 44.10  ? 2023 HOH A O   1 
HETATM 4283 O O   . HOH C 3 .   ? -0.881  33.127 54.157 1.00 54.76  ? 2024 HOH A O   1 
HETATM 4284 O O   . HOH C 3 .   ? 1.382   25.692 54.105 1.00 40.55  ? 2025 HOH A O   1 
HETATM 4285 O O   . HOH C 3 .   ? 13.592  11.677 46.283 1.00 76.69  ? 2026 HOH A O   1 
HETATM 4286 O O   . HOH C 3 .   ? 13.300  8.057  43.742 1.00 85.48  ? 2027 HOH A O   1 
HETATM 4287 O O   . HOH C 3 .   ? 16.781  8.711  39.350 1.00 56.95  ? 2028 HOH A O   1 
HETATM 4288 O O   . HOH C 3 .   ? 13.231  9.141  49.819 1.00 50.80  ? 2029 HOH A O   1 
HETATM 4289 O O   . HOH C 3 .   ? 14.229  14.498 57.469 1.00 75.63  ? 2030 HOH A O   1 
HETATM 4290 O O   . HOH C 3 .   ? 16.738  20.512 51.854 1.00 44.74  ? 2031 HOH A O   1 
HETATM 4291 O O   . HOH C 3 .   ? -2.039  29.047 26.837 1.00 82.54  ? 2032 HOH A O   1 
HETATM 4292 O O   . HOH C 3 .   ? 24.296  26.165 46.282 1.00 40.29  ? 2033 HOH A O   1 
HETATM 4293 O O   . HOH C 3 .   ? 16.329  25.907 50.000 1.00 39.66  ? 2034 HOH A O   1 
HETATM 4294 O O   . HOH C 3 .   ? 15.793  31.082 42.083 1.00 40.17  ? 2035 HOH A O   1 
HETATM 4295 O O   . HOH C 3 .   ? 41.688  38.289 55.876 1.00 47.88  ? 2036 HOH A O   1 
HETATM 4296 O O   . HOH C 3 .   ? 10.545  34.779 41.980 1.00 40.29  ? 2037 HOH A O   1 
HETATM 4297 O O   . HOH C 3 .   ? 10.275  33.510 31.773 1.00 38.25  ? 2038 HOH A O   1 
HETATM 4298 O O   . HOH C 3 .   ? 2.724   40.799 51.717 1.00 42.02  ? 2039 HOH A O   1 
HETATM 4299 O O   . HOH C 3 .   ? -5.082  34.081 28.964 1.00 55.62  ? 2040 HOH A O   1 
HETATM 4300 O O   . HOH C 3 .   ? -6.095  33.425 40.272 1.00 76.53  ? 2041 HOH A O   1 
HETATM 4301 O O   . HOH C 3 .   ? -10.546 27.186 41.848 1.00 65.94  ? 2042 HOH A O   1 
HETATM 4302 O O   . HOH C 3 .   ? -7.974  20.897 42.746 1.00 54.66  ? 2043 HOH A O   1 
HETATM 4303 O O   . HOH C 3 .   ? -4.218  21.691 43.569 1.00 52.43  ? 2044 HOH A O   1 
HETATM 4304 O O   . HOH C 3 .   ? -11.534 22.501 45.395 1.00 80.96  ? 2045 HOH A O   1 
HETATM 4305 O O   . HOH C 3 .   ? -7.220  20.708 39.341 1.00 81.19  ? 2046 HOH A O   1 
HETATM 4306 O O   . HOH C 3 .   ? -4.031  24.510 45.902 1.00 46.06  ? 2047 HOH A O   1 
HETATM 4307 O O   . HOH C 3 .   ? -0.411  23.443 49.340 1.00 60.08  ? 2048 HOH A O   1 
HETATM 4308 O O   . HOH C 3 .   ? -4.768  21.512 45.979 1.00 86.32  ? 2049 HOH A O   1 
HETATM 4309 O O   . HOH C 3 .   ? 28.719  55.607 57.373 1.00 85.54  ? 2050 HOH A O   1 
HETATM 4310 O O   . HOH C 3 .   ? 21.754  23.463 36.100 1.00 68.31  ? 2051 HOH A O   1 
HETATM 4311 O O   . HOH C 3 .   ? 15.074  14.038 46.987 1.00 41.94  ? 2052 HOH A O   1 
HETATM 4312 O O   . HOH C 3 .   ? 19.293  12.996 44.889 1.00 52.14  ? 2053 HOH A O   1 
HETATM 4313 O O   . HOH C 3 .   ? 14.465  9.695  41.203 1.00 64.87  ? 2054 HOH A O   1 
HETATM 4314 O O   . HOH C 3 .   ? 11.060  12.606 38.472 1.00 57.20  ? 2055 HOH A O   1 
HETATM 4315 O O   . HOH C 3 .   ? 11.580  10.638 44.731 1.00 74.93  ? 2056 HOH A O   1 
HETATM 4316 O O   . HOH C 3 .   ? 8.079   6.816  43.836 1.00 61.84  ? 2057 HOH A O   1 
HETATM 4317 O O   . HOH C 3 .   ? 6.122   5.486  42.247 1.00 67.88  ? 2058 HOH A O   1 
HETATM 4318 O O   . HOH C 3 .   ? -0.815  18.227 52.352 1.00 92.06  ? 2059 HOH A O   1 
HETATM 4319 O O   . HOH C 3 .   ? -6.058  19.317 41.341 1.00 40.73  ? 2060 HOH A O   1 
HETATM 4320 O O   . HOH C 3 .   ? -1.652  32.618 27.271 1.00 83.87  ? 2061 HOH A O   1 
HETATM 4321 O O   . HOH C 3 .   ? 5.286   31.471 27.152 1.00 59.65  ? 2062 HOH A O   1 
HETATM 4322 O O   . HOH C 3 .   ? 11.765  32.394 29.743 1.00 63.66  ? 2063 HOH A O   1 
HETATM 4323 O O   . HOH C 3 .   ? 16.944  33.750 37.793 1.00 40.38  ? 2064 HOH A O   1 
HETATM 4324 O O   . HOH C 3 .   ? 17.701  27.935 50.712 1.00 87.22  ? 2065 HOH A O   1 
HETATM 4325 O O   . HOH C 3 .   ? 32.305  29.485 47.576 1.00 30.45  ? 2066 HOH A O   1 
HETATM 4326 O O   . HOH C 3 .   ? 37.523  39.542 46.322 1.00 71.03  ? 2067 HOH A O   1 
HETATM 4327 O O   . HOH C 3 .   ? 38.173  33.663 49.722 1.00 48.84  ? 2068 HOH A O   1 
HETATM 4328 O O   . HOH C 3 .   ? 40.057  36.228 50.165 1.00 77.17  ? 2069 HOH A O   1 
HETATM 4329 O O   . HOH C 3 .   ? 38.410  38.311 57.415 1.00 55.18  ? 2070 HOH A O   1 
HETATM 4330 O O   . HOH C 3 .   ? 40.200  28.412 55.308 1.00 49.26  ? 2071 HOH A O   1 
HETATM 4331 O O   . HOH C 3 .   ? 34.712  29.654 48.831 1.00 82.41  ? 2072 HOH A O   1 
HETATM 4332 O O   . HOH C 3 .   ? 37.743  31.499 47.909 1.00 73.73  ? 2073 HOH A O   1 
HETATM 4333 O O   . HOH C 3 .   ? 33.601  23.006 51.875 1.00 58.19  ? 2074 HOH A O   1 
HETATM 4334 O O   . HOH C 3 .   ? 21.296  25.624 56.566 1.00 45.44  ? 2075 HOH A O   1 
HETATM 4335 O O   . HOH C 3 .   ? 20.619  29.321 61.131 1.00 71.85  ? 2076 HOH A O   1 
HETATM 4336 O O   . HOH C 3 .   ? 22.025  27.688 62.280 1.00 69.54  ? 2077 HOH A O   1 
HETATM 4337 O O   . HOH C 3 .   ? 24.515  28.281 48.887 1.00 62.34  ? 2078 HOH A O   1 
HETATM 4338 O O   . HOH C 3 .   ? 19.174  31.673 60.823 1.00 56.98  ? 2079 HOH A O   1 
HETATM 4339 O O   . HOH C 3 .   ? 4.601   38.942 51.167 1.00 53.00  ? 2080 HOH A O   1 
HETATM 4340 O O   . HOH C 3 .   ? 14.192  45.430 41.344 1.00 61.37  ? 2081 HOH A O   1 
HETATM 4341 O O   . HOH C 3 .   ? 6.390   41.833 45.101 1.00 57.84  ? 2082 HOH A O   1 
HETATM 4342 O O   . HOH C 3 .   ? 13.227  38.317 40.370 1.00 36.14  ? 2083 HOH A O   1 
HETATM 4343 O O   . HOH C 3 .   ? 15.550  45.941 47.162 1.00 42.58  ? 2084 HOH A O   1 
HETATM 4344 O O   . HOH C 3 .   ? 21.362  43.152 40.196 1.00 78.09  ? 2085 HOH A O   1 
HETATM 4345 O O   . HOH C 3 .   ? 27.537  44.848 62.186 1.00 83.61  ? 2086 HOH A O   1 
HETATM 4346 O O   . HOH C 3 .   ? 28.778  31.096 69.341 1.00 116.16 ? 2087 HOH A O   1 
HETATM 4347 O O   . HOH C 3 .   ? 36.712  44.497 56.607 1.00 72.40  ? 2088 HOH A O   1 
HETATM 4348 O O   . HOH C 3 .   ? 27.789  44.679 57.568 1.00 54.51  ? 2089 HOH A O   1 
HETATM 4349 O O   . HOH C 3 .   ? 33.939  54.089 55.690 1.00 53.23  ? 2090 HOH A O   1 
HETATM 4350 O O   . HOH C 3 .   ? 33.824  51.989 54.154 1.00 87.85  ? 2091 HOH A O   1 
HETATM 4351 O O   . HOH C 3 .   ? 31.165  54.826 55.906 1.00 84.10  ? 2092 HOH A O   1 
HETATM 4352 O O   . HOH C 3 .   ? 34.250  52.916 51.990 1.00 58.72  ? 2093 HOH A O   1 
HETATM 4353 O O   . HOH C 3 .   ? 27.327  50.597 45.297 1.00 59.34  ? 2094 HOH A O   1 
HETATM 4354 O O   . HOH C 3 .   ? 32.891  44.885 35.742 1.00 88.28  ? 2095 HOH A O   1 
HETATM 4355 O O   . HOH C 3 .   ? 23.847  54.620 47.217 1.00 56.99  ? 2096 HOH A O   1 
HETATM 4356 O O   . HOH C 3 .   ? 18.433  56.402 44.525 1.00 76.01  ? 2097 HOH A O   1 
HETATM 4357 O O   . HOH C 3 .   ? 10.098  42.776 54.943 1.00 56.48  ? 2098 HOH A O   1 
HETATM 4358 O O   . HOH C 3 .   ? 9.972   43.679 48.624 1.00 68.81  ? 2099 HOH A O   1 
HETATM 4359 O O   . HOH C 3 .   ? 13.376  33.519 64.854 1.00 57.58  ? 2100 HOH A O   1 
HETATM 4360 O O   . HOH D 3 .   ? 6.108   26.326 19.921 1.00 85.59  ? 2001 HOH B O   1 
HETATM 4361 O O   . HOH D 3 .   ? 6.745   27.855 24.256 1.00 61.44  ? 2002 HOH B O   1 
HETATM 4362 O O   . HOH D 3 .   ? 5.257   42.148 13.105 1.00 83.97  ? 2003 HOH B O   1 
HETATM 4363 O O   . HOH D 3 .   ? 2.987   6.327  30.941 1.00 72.06  ? 2004 HOH B O   1 
HETATM 4364 O O   . HOH D 3 .   ? 3.070   6.607  39.265 1.00 71.46  ? 2005 HOH B O   1 
HETATM 4365 O O   . HOH D 3 .   ? 15.133  11.918 20.935 1.00 81.36  ? 2006 HOH B O   1 
HETATM 4366 O O   . HOH D 3 .   ? 3.423   13.541 29.487 1.00 52.68  ? 2007 HOH B O   1 
HETATM 4367 O O   . HOH D 3 .   ? 1.893   9.288  31.151 1.00 76.05  ? 2008 HOH B O   1 
HETATM 4368 O O   . HOH D 3 .   ? 7.725   4.023  36.961 1.00 68.28  ? 2009 HOH B O   1 
HETATM 4369 O O   . HOH D 3 .   ? 6.255   0.411  35.680 1.00 69.82  ? 2010 HOH B O   1 
HETATM 4370 O O   . HOH D 3 .   ? 6.233   8.266  40.025 1.00 53.27  ? 2011 HOH B O   1 
HETATM 4371 O O   . HOH D 3 .   ? 10.368  9.960  31.432 1.00 60.93  ? 2012 HOH B O   1 
HETATM 4372 O O   . HOH D 3 .   ? 17.872  27.822 30.760 1.00 67.93  ? 2013 HOH B O   1 
HETATM 4373 O O   . HOH D 3 .   ? 25.760  24.268 35.029 1.00 84.96  ? 2014 HOH B O   1 
HETATM 4374 O O   . HOH D 3 .   ? -2.011  16.303 21.395 1.00 70.80  ? 2015 HOH B O   1 
HETATM 4375 O O   . HOH D 3 .   ? -0.341  11.284 27.091 1.00 73.46  ? 2016 HOH B O   1 
HETATM 4376 O O   . HOH D 3 .   ? 6.351   15.221 12.378 1.00 82.01  ? 2017 HOH B O   1 
HETATM 4377 O O   . HOH D 3 .   ? 16.618  35.701 9.303  1.00 64.33  ? 2018 HOH B O   1 
HETATM 4378 O O   . HOH D 3 .   ? 44.723  29.536 -1.334 1.00 77.89  ? 2019 HOH B O   1 
HETATM 4379 O O   . HOH D 3 .   ? 47.280  35.055 18.327 1.00 101.73 ? 2020 HOH B O   1 
HETATM 4380 O O   . HOH D 3 .   ? 31.991  31.881 28.929 1.00 86.67  ? 2021 HOH B O   1 
HETATM 4381 O O   . HOH D 3 .   ? 26.094  18.255 18.432 1.00 58.43  ? 2022 HOH B O   1 
HETATM 4382 O O   . HOH D 3 .   ? 25.347  38.949 9.198  1.00 92.95  ? 2023 HOH B O   1 
HETATM 4383 O O   . HOH D 3 .   ? 27.530  39.916 10.808 1.00 87.79  ? 2024 HOH B O   1 
HETATM 4384 O O   . HOH D 3 .   ? 43.244  16.981 0.315  1.00 95.65  ? 2025 HOH B O   1 
HETATM 4385 O O   . HOH D 3 .   ? 49.232  -5.996 6.734  1.00 66.23  ? 2026 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLU 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   GLN 4   4   ?   ?   ?   A . n 
A 1 5   LEU 5   5   ?   ?   ?   A . n 
A 1 6   LEU 6   6   ?   ?   ?   A . n 
A 1 7   CYS 7   7   ?   ?   ?   A . n 
A 1 8   CYS 8   8   ?   ?   ?   A . n 
A 1 9   GLU 9   9   ?   ?   ?   A . n 
A 1 10  VAL 10  10  ?   ?   ?   A . n 
A 1 11  GLU 11  11  ?   ?   ?   A . n 
A 1 12  THR 12  12  ?   ?   ?   A . n 
A 1 13  ILE 13  13  ?   ?   ?   A . n 
A 1 14  ARG 14  14  ?   ?   ?   A . n 
A 1 15  ARG 15  15  ?   ?   ?   A . n 
A 1 16  ALA 16  16  ?   ?   ?   A . n 
A 1 17  TYR 17  17  ?   ?   ?   A . n 
A 1 18  PRO 18  18  ?   ?   ?   A . n 
A 1 19  ASP 19  19  ?   ?   ?   A . n 
A 1 20  ALA 20  20  ?   ?   ?   A . n 
A 1 21  ASN 21  21  ?   ?   ?   A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  ASN 24  24  24  ASN ASN A . n 
A 1 25  ASP 25  25  25  ASP ASP A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  ARG 29  29  29  ARG ARG A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  MET 31  31  31  MET MET A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  LYS 33  33  33  LYS LYS A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  THR 37  37  37  THR THR A . n 
A 1 38  CYS 38  38  38  CYS CYS A . n 
A 1 39  ALA 39  39  39  ALA ALA A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  SER 41  41  41  SER SER A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  TYR 44  44  44  TYR TYR A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  CYS 47  47  47  CYS CYS A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  GLN 49  49  49  GLN GLN A . n 
A 1 50  LYS 50  50  50  LYS LYS A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  VAL 52  52  52  VAL VAL A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  MET 56  56  56  MET MET A . n 
A 1 57  ARG 57  57  57  ARG ARG A . n 
A 1 58  LYS 58  58  58  LYS LYS A . n 
A 1 59  ILE 59  59  59  ILE ILE A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TRP 63  63  63  TRP TRP A . n 
A 1 64  MET 64  64  64  MET MET A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  GLU 66  66  66  GLU GLU A . n 
A 1 67  VAL 67  67  67  VAL VAL A . n 
A 1 68  CYS 68  68  68  CYS CYS A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  GLU 70  70  70  GLU GLU A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  LYS 72  72  72  LYS LYS A . n 
A 1 73  CYS 73  73  73  CYS CYS A . n 
A 1 74  GLU 74  74  74  GLU GLU A . n 
A 1 75  GLU 75  75  75  GLU GLU A . n 
A 1 76  GLU 76  76  76  GLU GLU A . n 
A 1 77  VAL 77  77  77  VAL VAL A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  PRO 79  79  79  PRO PRO A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  MET 82  82  82  MET MET A . n 
A 1 83  ASN 83  83  83  ASN ASN A . n 
A 1 84  TYR 84  84  84  TYR TYR A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  ARG 87  87  87  ARG ARG A . n 
A 1 88  PHE 88  88  88  PHE PHE A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  PRO 93  93  93  PRO PRO A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  LYS 95  95  95  LYS LYS A . n 
A 1 96  LYS 96  96  96  LYS LYS A . n 
A 1 97  SER 97  97  97  SER SER A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 GLN 100 100 100 GLN GLN A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 GLY 103 103 103 GLY GLY A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 THR 105 105 105 THR THR A . n 
A 1 106 CYS 106 106 106 CYS CYS A . n 
A 1 107 MET 107 107 107 MET MET A . n 
A 1 108 PHE 108 108 108 PHE PHE A . n 
A 1 109 VAL 109 109 109 VAL VAL A . n 
A 1 110 ALA 110 110 110 ALA ALA A . n 
A 1 111 SER 111 111 111 SER SER A . n 
A 1 112 LYS 112 112 112 LYS LYS A . n 
A 1 113 MET 113 113 113 MET MET A . n 
A 1 114 LYS 114 114 114 LYS LYS A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 THR 116 116 116 THR THR A . n 
A 1 117 ILE 117 117 117 ILE ILE A . n 
A 1 118 PRO 118 118 118 PRO PRO A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 THR 120 120 120 THR THR A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 GLU 122 122 122 GLU GLU A . n 
A 1 123 LYS 123 123 123 LYS LYS A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 CYS 125 125 125 CYS CYS A . n 
A 1 126 ILE 126 126 126 ILE ILE A . n 
A 1 127 TYR 127 127 127 TYR TYR A . n 
A 1 128 THR 128 128 128 THR THR A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 ASN 130 130 130 ASN ASN A . n 
A 1 131 SER 131 131 131 SER SER A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 ARG 133 133 133 ARG ARG A . n 
A 1 134 PRO 134 134 134 PRO PRO A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 GLU 136 136 136 GLU GLU A . n 
A 1 137 LEU 137 137 137 LEU LEU A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 GLN 139 139 139 GLN GLN A . n 
A 1 140 MET 140 140 140 MET MET A . n 
A 1 141 GLU 141 141 141 GLU GLU A . n 
A 1 142 LEU 142 142 142 LEU LEU A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 LEU 144 144 144 LEU LEU A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 ASN 146 146 146 ASN ASN A . n 
A 1 147 LYS 147 147 147 LYS LYS A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 LYS 149 149 149 LYS LYS A . n 
A 1 150 TRP 150 150 150 TRP TRP A . n 
A 1 151 ASN 151 151 151 ASN ASN A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 MET 155 155 155 MET MET A . n 
A 1 156 THR 156 156 156 THR THR A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 HIS 158 158 158 HIS HIS A . n 
A 1 159 ASP 159 159 159 ASP ASP A . n 
A 1 160 PHE 160 160 160 PHE PHE A . n 
A 1 161 ILE 161 161 161 ILE ILE A . n 
A 1 162 GLU 162 162 162 GLU GLU A . n 
A 1 163 HIS 163 163 163 HIS HIS A . n 
A 1 164 PHE 164 164 164 PHE PHE A . n 
A 1 165 LEU 165 165 165 LEU LEU A . n 
A 1 166 SER 166 166 166 SER SER A . n 
A 1 167 LYS 167 167 167 LYS LYS A . n 
A 1 168 MET 168 168 168 MET MET A . n 
A 1 169 PRO 169 169 169 PRO PRO A . n 
A 1 170 GLU 170 170 170 GLU GLU A . n 
A 1 171 ALA 171 171 171 ALA ALA A . n 
A 1 172 GLU 172 172 172 GLU GLU A . n 
A 1 173 GLU 173 173 173 GLU GLU A . n 
A 1 174 ASN 174 174 174 ASN ASN A . n 
A 1 175 LYS 175 175 175 LYS LYS A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 ILE 177 177 177 ILE ILE A . n 
A 1 178 ILE 178 178 178 ILE ILE A . n 
A 1 179 ARG 179 179 179 ARG ARG A . n 
A 1 180 LYS 180 180 180 LYS LYS A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ALA 182 182 182 ALA ALA A . n 
A 1 183 GLN 183 183 183 GLN GLN A . n 
A 1 184 THR 184 184 184 THR THR A . n 
A 1 185 PHE 185 185 185 PHE PHE A . n 
A 1 186 VAL 186 186 186 VAL VAL A . n 
A 1 187 ALA 187 187 187 ALA ALA A . n 
A 1 188 LEU 188 188 188 LEU LEU A . n 
A 1 189 CYS 189 189 189 CYS CYS A . n 
A 1 190 ALA 190 190 190 ALA ALA A . n 
A 1 191 THR 191 191 191 THR THR A . n 
A 1 192 ASP 192 192 192 ASP ASP A . n 
A 1 193 VAL 193 193 193 VAL VAL A . n 
A 1 194 LYS 194 194 194 LYS LYS A . n 
A 1 195 PHE 195 195 195 PHE PHE A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 SER 197 197 197 SER SER A . n 
A 1 198 ASN 198 198 198 ASN ASN A . n 
A 1 199 PRO 199 199 199 PRO PRO A . n 
A 1 200 PRO 200 200 200 PRO PRO A . n 
A 1 201 SER 201 201 201 SER SER A . n 
A 1 202 MET 202 202 202 MET MET A . n 
A 1 203 VAL 203 203 203 VAL VAL A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 GLY 206 206 206 GLY GLY A . n 
A 1 207 SER 207 207 207 SER SER A . n 
A 1 208 VAL 208 208 208 VAL VAL A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 ALA 210 210 210 ALA ALA A . n 
A 1 211 ALA 211 211 211 ALA ALA A . n 
A 1 212 VAL 212 212 212 VAL VAL A . n 
A 1 213 GLN 213 213 213 GLN GLN A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 LEU 215 215 215 LEU LEU A . n 
A 1 216 ASN 216 216 216 ASN ASN A . n 
A 1 217 LEU 217 217 217 LEU LEU A . n 
A 1 218 ARG 218 218 218 ARG ARG A . n 
A 1 219 SER 219 219 219 SER SER A . n 
A 1 220 PRO 220 220 220 PRO PRO A . n 
A 1 221 ASN 221 221 221 ASN ASN A . n 
A 1 222 ASN 222 222 222 ASN ASN A . n 
A 1 223 PHE 223 223 223 PHE PHE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 SER 225 225 225 SER SER A . n 
A 1 226 TYR 226 226 226 TYR TYR A . n 
A 1 227 TYR 227 227 227 TYR TYR A . n 
A 1 228 ARG 228 228 228 ARG ARG A . n 
A 1 229 LEU 229 229 229 LEU LEU A . n 
A 1 230 THR 230 230 230 THR THR A . n 
A 1 231 ARG 231 231 231 ARG ARG A . n 
A 1 232 PHE 232 232 232 PHE PHE A . n 
A 1 233 LEU 233 233 233 LEU LEU A . n 
A 1 234 SER 234 234 234 SER SER A . n 
A 1 235 ARG 235 235 235 ARG ARG A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 ILE 237 237 237 ILE ILE A . n 
A 1 238 LYS 238 238 238 LYS LYS A . n 
A 1 239 CYS 239 239 239 CYS CYS A . n 
A 1 240 ASP 240 240 240 ASP ASP A . n 
A 1 241 PRO 241 241 241 PRO PRO A . n 
A 1 242 ASP 242 242 242 ASP ASP A . n 
A 1 243 CYS 243 243 243 CYS CYS A . n 
A 1 244 LEU 244 244 244 LEU LEU A . n 
A 1 245 ARG 245 245 245 ARG ARG A . n 
A 1 246 ALA 246 246 246 ALA ALA A . n 
A 1 247 CYS 247 247 247 CYS CYS A . n 
A 1 248 GLN 248 248 248 GLN GLN A . n 
A 1 249 GLU 249 249 249 GLU GLU A . n 
A 1 250 GLN 250 250 250 GLN GLN A . n 
A 1 251 ILE 251 251 251 ILE ILE A . n 
A 1 252 GLU 252 252 252 GLU GLU A . n 
A 1 253 ALA 253 253 253 ALA ALA A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 LEU 255 255 255 LEU LEU A . n 
A 1 256 GLU 256 256 256 GLU GLU A . n 
A 1 257 SER 257 257 257 SER SER A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 LEU 259 259 259 LEU LEU A . n 
A 1 260 ARG 260 260 260 ARG ARG A . n 
A 1 261 GLN 261 261 261 GLN GLN A . n 
A 1 262 ALA 262 262 262 ALA ALA A . n 
A 1 263 GLN 263 263 263 GLN GLN A . n 
A 1 264 GLN 264 264 264 GLN GLN A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 MET 266 266 266 MET MET A . n 
A 1 267 ASP 267 267 267 ASP ASP A . n 
A 1 268 PRO 268 268 ?   ?   ?   A . n 
A 1 269 LYS 269 269 ?   ?   ?   A . n 
A 1 270 ALA 270 270 ?   ?   ?   A . n 
A 1 271 ALA 271 271 ?   ?   ?   A . n 
B 2 1   MET 1   1   ?   ?   ?   B . n 
B 2 2   ALA 2   2   2   ALA ALA B . n 
B 2 3   THR 3   3   3   THR THR B . n 
B 2 4   SER 4   4   4   SER SER B . n 
B 2 5   ARG 5   5   5   ARG ARG B . n 
B 2 6   TYR 6   6   6   TYR TYR B . n 
B 2 7   GLU 7   7   7   GLU GLU B . n 
B 2 8   PRO 8   8   8   PRO PRO B . n 
B 2 9   VAL 9   9   9   VAL VAL B . n 
B 2 10  ALA 10  10  10  ALA ALA B . n 
B 2 11  GLU 11  11  11  GLU GLU B . n 
B 2 12  ILE 12  12  12  ILE ILE B . n 
B 2 13  GLY 13  13  13  GLY GLY B . n 
B 2 14  VAL 14  14  14  VAL VAL B . n 
B 2 15  GLY 15  15  15  GLY GLY B . n 
B 2 16  ALA 16  16  16  ALA ALA B . n 
B 2 17  TYR 17  17  17  TYR TYR B . n 
B 2 18  GLY 18  18  18  GLY GLY B . n 
B 2 19  THR 19  19  19  THR THR B . n 
B 2 20  VAL 20  20  20  VAL VAL B . n 
B 2 21  TYR 21  21  21  TYR TYR B . n 
B 2 22  LYS 22  22  22  LYS LYS B . n 
B 2 23  ALA 23  23  23  ALA ALA B . n 
B 2 24  ARG 24  24  24  ARG ARG B . n 
B 2 25  ASP 25  25  25  ASP ASP B . n 
B 2 26  PRO 26  26  26  PRO PRO B . n 
B 2 27  HIS 27  27  27  HIS HIS B . n 
B 2 28  SER 28  28  28  SER SER B . n 
B 2 29  GLY 29  29  29  GLY GLY B . n 
B 2 30  HIS 30  30  30  HIS HIS B . n 
B 2 31  PHE 31  31  31  PHE PHE B . n 
B 2 32  VAL 32  32  32  VAL VAL B . n 
B 2 33  ALA 33  33  33  ALA ALA B . n 
B 2 34  LEU 34  34  34  LEU LEU B . n 
B 2 35  LYS 35  35  35  LYS LYS B . n 
B 2 36  SER 36  36  36  SER SER B . n 
B 2 37  VAL 37  37  37  VAL VAL B . n 
B 2 38  ARG 38  38  38  ARG ARG B . n 
B 2 39  VAL 39  39  39  VAL VAL B . n 
B 2 40  PRO 40  40  40  PRO PRO B . n 
B 2 41  ASN 41  41  41  ASN ASN B . n 
B 2 42  GLY 42  42  42  GLY GLY B . n 
B 2 43  GLU 43  43  43  GLU GLU B . n 
B 2 44  GLU 44  44  44  GLU GLU B . n 
B 2 45  GLY 45  48  48  GLY GLY B . n 
B 2 46  LEU 46  49  49  LEU LEU B . n 
B 2 47  PRO 47  50  50  PRO PRO B . n 
B 2 48  ILE 48  51  51  ILE ILE B . n 
B 2 49  SER 49  52  52  SER SER B . n 
B 2 50  THR 50  53  53  THR THR B . n 
B 2 51  VAL 51  54  54  VAL VAL B . n 
B 2 52  ARG 52  55  55  ARG ARG B . n 
B 2 53  GLU 53  56  56  GLU GLU B . n 
B 2 54  VAL 54  57  57  VAL VAL B . n 
B 2 55  ALA 55  58  58  ALA ALA B . n 
B 2 56  LEU 56  59  59  LEU LEU B . n 
B 2 57  LEU 57  60  60  LEU LEU B . n 
B 2 58  ARG 58  61  61  ARG ARG B . n 
B 2 59  ARG 59  62  62  ARG ARG B . n 
B 2 60  LEU 60  63  63  LEU LEU B . n 
B 2 61  GLU 61  64  64  GLU GLU B . n 
B 2 62  ALA 62  65  65  ALA ALA B . n 
B 2 63  PHE 63  66  66  PHE PHE B . n 
B 2 64  GLU 64  67  67  GLU GLU B . n 
B 2 65  HIS 65  68  68  HIS HIS B . n 
B 2 66  PRO 66  69  69  PRO PRO B . n 
B 2 67  ASN 67  70  70  ASN ASN B . n 
B 2 68  VAL 68  71  71  VAL VAL B . n 
B 2 69  VAL 69  72  72  VAL VAL B . n 
B 2 70  ARG 70  73  73  ARG ARG B . n 
B 2 71  LEU 71  74  74  LEU LEU B . n 
B 2 72  MET 72  75  75  MET MET B . n 
B 2 73  ASP 73  76  76  ASP ASP B . n 
B 2 74  VAL 74  77  77  VAL VAL B . n 
B 2 75  CYS 75  78  78  CYS CYS B . n 
B 2 76  ALA 76  79  79  ALA ALA B . n 
B 2 77  THR 77  80  80  THR THR B . n 
B 2 78  SER 78  81  81  SER SER B . n 
B 2 79  ARG 79  82  82  ARG ARG B . n 
B 2 80  THR 80  83  83  THR THR B . n 
B 2 81  ASP 81  84  84  ASP ASP B . n 
B 2 82  ARG 82  85  85  ARG ARG B . n 
B 2 83  GLU 83  86  86  GLU GLU B . n 
B 2 84  ILE 84  87  87  ILE ILE B . n 
B 2 85  LYS 85  88  88  LYS LYS B . n 
B 2 86  VAL 86  89  89  VAL VAL B . n 
B 2 87  THR 87  90  90  THR THR B . n 
B 2 88  LEU 88  91  91  LEU LEU B . n 
B 2 89  VAL 89  92  92  VAL VAL B . n 
B 2 90  PHE 90  93  93  PHE PHE B . n 
B 2 91  GLU 91  94  94  GLU GLU B . n 
B 2 92  HIS 92  95  95  HIS HIS B . n 
B 2 93  VAL 93  96  96  VAL VAL B . n 
B 2 94  ASP 94  97  97  ASP ASP B . n 
B 2 95  GLN 95  98  98  GLN GLN B . n 
B 2 96  ASP 96  99  99  ASP ASP B . n 
B 2 97  LEU 97  100 100 LEU LEU B . n 
B 2 98  ARG 98  101 101 ARG ARG B . n 
B 2 99  THR 99  102 102 THR THR B . n 
B 2 100 TYR 100 103 103 TYR TYR B . n 
B 2 101 LEU 101 104 104 LEU LEU B . n 
B 2 102 ASP 102 105 105 ASP ASP B . n 
B 2 103 LYS 103 106 106 LYS LYS B . n 
B 2 104 ALA 104 107 107 ALA ALA B . n 
B 2 105 PRO 105 108 108 PRO PRO B . n 
B 2 106 PRO 106 109 109 PRO PRO B . n 
B 2 107 PRO 107 110 110 PRO PRO B . n 
B 2 108 GLY 108 111 111 GLY GLY B . n 
B 2 109 LEU 109 112 112 LEU LEU B . n 
B 2 110 PRO 110 113 113 PRO PRO B . n 
B 2 111 ALA 111 114 114 ALA ALA B . n 
B 2 112 GLU 112 115 115 GLU GLU B . n 
B 2 113 THR 113 116 116 THR THR B . n 
B 2 114 ILE 114 117 117 ILE ILE B . n 
B 2 115 LYS 115 118 118 LYS LYS B . n 
B 2 116 ASP 116 119 119 ASP ASP B . n 
B 2 117 LEU 117 120 120 LEU LEU B . n 
B 2 118 MET 118 121 121 MET MET B . n 
B 2 119 ARG 119 122 122 ARG ARG B . n 
B 2 120 GLN 120 123 123 GLN GLN B . n 
B 2 121 PHE 121 124 124 PHE PHE B . n 
B 2 122 LEU 122 125 125 LEU LEU B . n 
B 2 123 ARG 123 126 126 ARG ARG B . n 
B 2 124 GLY 124 127 127 GLY GLY B . n 
B 2 125 LEU 125 128 128 LEU LEU B . n 
B 2 126 ASP 126 129 129 ASP ASP B . n 
B 2 127 PHE 127 130 130 PHE PHE B . n 
B 2 128 LEU 128 131 131 LEU LEU B . n 
B 2 129 HIS 129 132 132 HIS HIS B . n 
B 2 130 ALA 130 133 133 ALA ALA B . n 
B 2 131 ASN 131 134 134 ASN ASN B . n 
B 2 132 CYS 132 135 135 CYS CYS B . n 
B 2 133 ILE 133 136 136 ILE ILE B . n 
B 2 134 VAL 134 137 137 VAL VAL B . n 
B 2 135 HIS 135 138 138 HIS HIS B . n 
B 2 136 ARG 136 139 139 ARG ARG B . n 
B 2 137 ASP 137 140 140 ASP ASP B . n 
B 2 138 LEU 138 141 141 LEU LEU B . n 
B 2 139 LYS 139 142 142 LYS LYS B . n 
B 2 140 PRO 140 143 143 PRO PRO B . n 
B 2 141 GLU 141 144 144 GLU GLU B . n 
B 2 142 ASN 142 145 145 ASN ASN B . n 
B 2 143 ILE 143 146 146 ILE ILE B . n 
B 2 144 LEU 144 147 147 LEU LEU B . n 
B 2 145 VAL 145 148 148 VAL VAL B . n 
B 2 146 THR 146 149 149 THR THR B . n 
B 2 147 SER 147 150 150 SER SER B . n 
B 2 148 GLY 148 151 151 GLY GLY B . n 
B 2 149 GLY 149 152 152 GLY GLY B . n 
B 2 150 THR 150 153 153 THR THR B . n 
B 2 151 VAL 151 154 154 VAL VAL B . n 
B 2 152 LYS 152 155 155 LYS LYS B . n 
B 2 153 LEU 153 156 156 LEU LEU B . n 
B 2 154 ALA 154 157 157 ALA ALA B . n 
B 2 155 ASP 155 158 158 ASP ASP B . n 
B 2 156 PHE 156 159 159 PHE PHE B . n 
B 2 157 GLY 157 160 160 GLY GLY B . n 
B 2 158 LEU 158 161 161 LEU LEU B . n 
B 2 159 ALA 159 162 162 ALA ALA B . n 
B 2 160 ARG 160 163 163 ARG ARG B . n 
B 2 161 ILE 161 164 164 ILE ILE B . n 
B 2 162 TYR 162 165 165 TYR TYR B . n 
B 2 163 SER 163 166 166 SER SER B . n 
B 2 164 TYR 164 167 167 TYR TYR B . n 
B 2 165 GLN 165 168 168 GLN GLN B . n 
B 2 166 MET 166 169 169 MET MET B . n 
B 2 167 ALA 167 170 170 ALA ALA B . n 
B 2 168 LEU 168 171 171 LEU LEU B . n 
B 2 169 ALA 169 172 172 ALA ALA B . n 
B 2 170 PRO 170 173 173 PRO PRO B . n 
B 2 171 VAL 171 174 174 VAL VAL B . n 
B 2 172 VAL 172 175 175 VAL VAL B . n 
B 2 173 VAL 173 176 176 VAL VAL B . n 
B 2 174 THR 174 177 177 THR THR B . n 
B 2 175 LEU 175 178 178 LEU LEU B . n 
B 2 176 TRP 176 179 179 TRP TRP B . n 
B 2 177 TYR 177 180 180 TYR TYR B . n 
B 2 178 ARG 178 181 181 ARG ARG B . n 
B 2 179 ALA 179 182 182 ALA ALA B . n 
B 2 180 PRO 180 183 183 PRO PRO B . n 
B 2 181 GLU 181 184 184 GLU GLU B . n 
B 2 182 VAL 182 185 185 VAL VAL B . n 
B 2 183 LEU 183 186 186 LEU LEU B . n 
B 2 184 LEU 184 187 187 LEU LEU B . n 
B 2 185 GLN 185 188 188 GLN GLN B . n 
B 2 186 SER 186 189 189 SER SER B . n 
B 2 187 THR 187 190 190 THR THR B . n 
B 2 188 TYR 188 191 191 TYR TYR B . n 
B 2 189 ALA 189 192 192 ALA ALA B . n 
B 2 190 THR 190 193 193 THR THR B . n 
B 2 191 PRO 191 194 194 PRO PRO B . n 
B 2 192 VAL 192 195 195 VAL VAL B . n 
B 2 193 ASP 193 196 196 ASP ASP B . n 
B 2 194 MET 194 197 197 MET MET B . n 
B 2 195 TRP 195 198 198 TRP TRP B . n 
B 2 196 SER 196 199 199 SER SER B . n 
B 2 197 VAL 197 200 200 VAL VAL B . n 
B 2 198 GLY 198 201 201 GLY GLY B . n 
B 2 199 CYS 199 202 202 CYS CYS B . n 
B 2 200 ILE 200 203 203 ILE ILE B . n 
B 2 201 PHE 201 204 204 PHE PHE B . n 
B 2 202 ALA 202 205 205 ALA ALA B . n 
B 2 203 GLU 203 206 206 GLU GLU B . n 
B 2 204 MET 204 207 207 MET MET B . n 
B 2 205 PHE 205 208 208 PHE PHE B . n 
B 2 206 ARG 206 209 209 ARG ARG B . n 
B 2 207 ARG 207 210 210 ARG ARG B . n 
B 2 208 LYS 208 211 211 LYS LYS B . n 
B 2 209 PRO 209 212 212 PRO PRO B . n 
B 2 210 LEU 210 213 213 LEU LEU B . n 
B 2 211 PHE 211 214 214 PHE PHE B . n 
B 2 212 CYS 212 215 215 CYS CYS B . n 
B 2 213 GLY 213 216 216 GLY GLY B . n 
B 2 214 ASN 214 217 217 ASN ASN B . n 
B 2 215 SER 215 218 218 SER SER B . n 
B 2 216 GLU 216 219 219 GLU GLU B . n 
B 2 217 ALA 217 220 220 ALA ALA B . n 
B 2 218 ASP 218 221 221 ASP ASP B . n 
B 2 219 GLN 219 222 222 GLN GLN B . n 
B 2 220 LEU 220 223 223 LEU LEU B . n 
B 2 221 GLY 221 224 224 GLY GLY B . n 
B 2 222 LYS 222 225 225 LYS LYS B . n 
B 2 223 ILE 223 226 226 ILE ILE B . n 
B 2 224 PHE 224 227 227 PHE PHE B . n 
B 2 225 ASP 225 228 228 ASP ASP B . n 
B 2 226 LEU 226 229 229 LEU LEU B . n 
B 2 227 ILE 227 230 230 ILE ILE B . n 
B 2 228 GLY 228 231 231 GLY GLY B . n 
B 2 229 LEU 229 232 232 LEU LEU B . n 
B 2 230 PRO 230 233 233 PRO PRO B . n 
B 2 231 PRO 231 234 234 PRO PRO B . n 
B 2 232 GLU 232 235 235 GLU GLU B . n 
B 2 233 ASP 233 236 236 ASP ASP B . n 
B 2 234 ASP 234 237 237 ASP ASP B . n 
B 2 235 TRP 235 238 238 TRP TRP B . n 
B 2 236 PRO 236 239 239 PRO PRO B . n 
B 2 237 ARG 237 240 240 ARG ARG B . n 
B 2 238 ASP 238 241 241 ASP ASP B . n 
B 2 239 VAL 239 242 242 VAL VAL B . n 
B 2 240 SER 240 243 243 SER SER B . n 
B 2 241 LEU 241 244 244 LEU LEU B . n 
B 2 242 PRO 242 245 245 PRO PRO B . n 
B 2 243 ARG 243 246 246 ARG ARG B . n 
B 2 244 GLY 244 247 247 GLY GLY B . n 
B 2 245 ALA 245 248 248 ALA ALA B . n 
B 2 246 PHE 246 249 249 PHE PHE B . n 
B 2 247 PRO 247 250 250 PRO PRO B . n 
B 2 248 PRO 248 251 251 PRO PRO B . n 
B 2 249 ARG 249 252 252 ARG ARG B . n 
B 2 250 GLY 250 253 253 GLY GLY B . n 
B 2 251 PRO 251 254 254 PRO PRO B . n 
B 2 252 ARG 252 255 255 ARG ARG B . n 
B 2 253 PRO 253 256 256 PRO PRO B . n 
B 2 254 VAL 254 257 257 VAL VAL B . n 
B 2 255 GLN 255 258 258 GLN GLN B . n 
B 2 256 SER 256 259 259 SER SER B . n 
B 2 257 VAL 257 260 260 VAL VAL B . n 
B 2 258 VAL 258 261 261 VAL VAL B . n 
B 2 259 PRO 259 262 262 PRO PRO B . n 
B 2 260 GLU 260 263 263 GLU GLU B . n 
B 2 261 MET 261 264 264 MET MET B . n 
B 2 262 GLU 262 265 265 GLU GLU B . n 
B 2 263 GLU 263 266 266 GLU GLU B . n 
B 2 264 SER 264 267 267 SER SER B . n 
B 2 265 GLY 265 268 268 GLY GLY B . n 
B 2 266 ALA 266 269 269 ALA ALA B . n 
B 2 267 GLN 267 270 270 GLN GLN B . n 
B 2 268 LEU 268 271 271 LEU LEU B . n 
B 2 269 LEU 269 272 272 LEU LEU B . n 
B 2 270 LEU 270 273 273 LEU LEU B . n 
B 2 271 GLU 271 274 274 GLU GLU B . n 
B 2 272 MET 272 275 275 MET MET B . n 
B 2 273 LEU 273 276 276 LEU LEU B . n 
B 2 274 THR 274 277 277 THR THR B . n 
B 2 275 PHE 275 278 278 PHE PHE B . n 
B 2 276 ASN 276 279 279 ASN ASN B . n 
B 2 277 PRO 277 280 280 PRO PRO B . n 
B 2 278 HIS 278 281 281 HIS HIS B . n 
B 2 279 LYS 279 282 282 LYS LYS B . n 
B 2 280 ARG 280 283 283 ARG ARG B . n 
B 2 281 ILE 281 284 284 ILE ILE B . n 
B 2 282 SER 282 285 285 SER SER B . n 
B 2 283 ALA 283 286 286 ALA ALA B . n 
B 2 284 PHE 284 287 287 PHE PHE B . n 
B 2 285 ARG 285 288 288 ARG ARG B . n 
B 2 286 ALA 286 289 289 ALA ALA B . n 
B 2 287 LEU 287 290 290 LEU LEU B . n 
B 2 288 GLN 288 291 291 GLN GLN B . n 
B 2 289 HIS 289 292 292 HIS HIS B . n 
B 2 290 SER 290 293 293 SER SER B . n 
B 2 291 TYR 291 294 294 TYR TYR B . n 
B 2 292 LEU 292 295 295 LEU LEU B . n 
B 2 293 HIS 293 296 ?   ?   ?   B . n 
B 2 294 LYS 294 297 ?   ?   ?   B . n 
B 2 295 ASP 295 298 ?   ?   ?   B . n 
B 2 296 GLU 296 299 ?   ?   ?   B . n 
B 2 297 GLY 297 300 ?   ?   ?   B . n 
B 2 298 ASN 298 301 ?   ?   ?   B . n 
B 2 299 PRO 299 302 ?   ?   ?   B . n 
B 2 300 GLU 300 303 ?   ?   ?   B . n 
B 2 301 HIS 301 304 ?   ?   ?   B . n 
B 2 302 HIS 302 305 ?   ?   ?   B . n 
B 2 303 HIS 303 306 ?   ?   ?   B . n 
B 2 304 HIS 304 307 ?   ?   ?   B . n 
B 2 305 HIS 305 308 ?   ?   ?   B . n 
B 2 306 HIS 306 309 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1   2001 2001 HOH HOH A . 
C 3 HOH 2   2002 2002 HOH HOH A . 
C 3 HOH 3   2003 2003 HOH HOH A . 
C 3 HOH 4   2004 2004 HOH HOH A . 
C 3 HOH 5   2005 2005 HOH HOH A . 
C 3 HOH 6   2006 2006 HOH HOH A . 
C 3 HOH 7   2007 2007 HOH HOH A . 
C 3 HOH 8   2008 2008 HOH HOH A . 
C 3 HOH 9   2009 2009 HOH HOH A . 
C 3 HOH 10  2010 2010 HOH HOH A . 
C 3 HOH 11  2011 2011 HOH HOH A . 
C 3 HOH 12  2012 2012 HOH HOH A . 
C 3 HOH 13  2013 2013 HOH HOH A . 
C 3 HOH 14  2014 2014 HOH HOH A . 
C 3 HOH 15  2015 2015 HOH HOH A . 
C 3 HOH 16  2016 2016 HOH HOH A . 
C 3 HOH 17  2017 2017 HOH HOH A . 
C 3 HOH 18  2018 2018 HOH HOH A . 
C 3 HOH 19  2019 2019 HOH HOH A . 
C 3 HOH 20  2020 2020 HOH HOH A . 
C 3 HOH 21  2021 2021 HOH HOH A . 
C 3 HOH 22  2022 2022 HOH HOH A . 
C 3 HOH 23  2023 2023 HOH HOH A . 
C 3 HOH 24  2024 2024 HOH HOH A . 
C 3 HOH 25  2025 2025 HOH HOH A . 
C 3 HOH 26  2026 2026 HOH HOH A . 
C 3 HOH 27  2027 2027 HOH HOH A . 
C 3 HOH 28  2028 2028 HOH HOH A . 
C 3 HOH 29  2029 2029 HOH HOH A . 
C 3 HOH 30  2030 2030 HOH HOH A . 
C 3 HOH 31  2031 2031 HOH HOH A . 
C 3 HOH 32  2032 2032 HOH HOH A . 
C 3 HOH 33  2033 2033 HOH HOH A . 
C 3 HOH 34  2034 2034 HOH HOH A . 
C 3 HOH 35  2035 2035 HOH HOH A . 
C 3 HOH 36  2036 2036 HOH HOH A . 
C 3 HOH 37  2037 2037 HOH HOH A . 
C 3 HOH 38  2038 2038 HOH HOH A . 
C 3 HOH 39  2039 2039 HOH HOH A . 
C 3 HOH 40  2040 2040 HOH HOH A . 
C 3 HOH 41  2041 2041 HOH HOH A . 
C 3 HOH 42  2042 2042 HOH HOH A . 
C 3 HOH 43  2043 2043 HOH HOH A . 
C 3 HOH 44  2044 2044 HOH HOH A . 
C 3 HOH 45  2045 2045 HOH HOH A . 
C 3 HOH 46  2046 2046 HOH HOH A . 
C 3 HOH 47  2047 2047 HOH HOH A . 
C 3 HOH 48  2048 2048 HOH HOH A . 
C 3 HOH 49  2049 2049 HOH HOH A . 
C 3 HOH 50  2050 2050 HOH HOH A . 
C 3 HOH 51  2051 2051 HOH HOH A . 
C 3 HOH 52  2052 2052 HOH HOH A . 
C 3 HOH 53  2053 2053 HOH HOH A . 
C 3 HOH 54  2054 2054 HOH HOH A . 
C 3 HOH 55  2055 2055 HOH HOH A . 
C 3 HOH 56  2056 2056 HOH HOH A . 
C 3 HOH 57  2057 2057 HOH HOH A . 
C 3 HOH 58  2058 2058 HOH HOH A . 
C 3 HOH 59  2059 2059 HOH HOH A . 
C 3 HOH 60  2060 2060 HOH HOH A . 
C 3 HOH 61  2061 2061 HOH HOH A . 
C 3 HOH 62  2062 2062 HOH HOH A . 
C 3 HOH 63  2063 2063 HOH HOH A . 
C 3 HOH 64  2064 2064 HOH HOH A . 
C 3 HOH 65  2065 2065 HOH HOH A . 
C 3 HOH 66  2066 2066 HOH HOH A . 
C 3 HOH 67  2067 2067 HOH HOH A . 
C 3 HOH 68  2068 2068 HOH HOH A . 
C 3 HOH 69  2069 2069 HOH HOH A . 
C 3 HOH 70  2070 2070 HOH HOH A . 
C 3 HOH 71  2071 2071 HOH HOH A . 
C 3 HOH 72  2072 2072 HOH HOH A . 
C 3 HOH 73  2073 2073 HOH HOH A . 
C 3 HOH 74  2074 2074 HOH HOH A . 
C 3 HOH 75  2075 2075 HOH HOH A . 
C 3 HOH 76  2076 2076 HOH HOH A . 
C 3 HOH 77  2077 2077 HOH HOH A . 
C 3 HOH 78  2078 2078 HOH HOH A . 
C 3 HOH 79  2079 2079 HOH HOH A . 
C 3 HOH 80  2080 2080 HOH HOH A . 
C 3 HOH 81  2081 2081 HOH HOH A . 
C 3 HOH 82  2082 2082 HOH HOH A . 
C 3 HOH 83  2083 2083 HOH HOH A . 
C 3 HOH 84  2084 2084 HOH HOH A . 
C 3 HOH 85  2085 2085 HOH HOH A . 
C 3 HOH 86  2086 2086 HOH HOH A . 
C 3 HOH 87  2087 2087 HOH HOH A . 
C 3 HOH 88  2088 2088 HOH HOH A . 
C 3 HOH 89  2089 2089 HOH HOH A . 
C 3 HOH 90  2090 2090 HOH HOH A . 
C 3 HOH 91  2091 2091 HOH HOH A . 
C 3 HOH 92  2092 2092 HOH HOH A . 
C 3 HOH 93  2093 2093 HOH HOH A . 
C 3 HOH 94  2094 2094 HOH HOH A . 
C 3 HOH 95  2095 2095 HOH HOH A . 
C 3 HOH 96  2096 2096 HOH HOH A . 
C 3 HOH 97  2097 2097 HOH HOH A . 
C 3 HOH 98  2098 2098 HOH HOH A . 
C 3 HOH 99  2099 2099 HOH HOH A . 
C 3 HOH 100 2100 2100 HOH HOH A . 
D 3 HOH 1   2001 2001 HOH HOH B . 
D 3 HOH 2   2002 2002 HOH HOH B . 
D 3 HOH 3   2003 2003 HOH HOH B . 
D 3 HOH 4   2004 2004 HOH HOH B . 
D 3 HOH 5   2005 2005 HOH HOH B . 
D 3 HOH 6   2006 2006 HOH HOH B . 
D 3 HOH 7   2007 2007 HOH HOH B . 
D 3 HOH 8   2008 2008 HOH HOH B . 
D 3 HOH 9   2009 2009 HOH HOH B . 
D 3 HOH 10  2010 2010 HOH HOH B . 
D 3 HOH 11  2011 2011 HOH HOH B . 
D 3 HOH 12  2012 2012 HOH HOH B . 
D 3 HOH 13  2013 2013 HOH HOH B . 
D 3 HOH 14  2014 2014 HOH HOH B . 
D 3 HOH 15  2015 2015 HOH HOH B . 
D 3 HOH 16  2016 2016 HOH HOH B . 
D 3 HOH 17  2017 2017 HOH HOH B . 
D 3 HOH 18  2018 2018 HOH HOH B . 
D 3 HOH 19  2019 2019 HOH HOH B . 
D 3 HOH 20  2020 2020 HOH HOH B . 
D 3 HOH 21  2021 2021 HOH HOH B . 
D 3 HOH 22  2022 2022 HOH HOH B . 
D 3 HOH 23  2023 2023 HOH HOH B . 
D 3 HOH 24  2024 2024 HOH HOH B . 
D 3 HOH 25  2025 2025 HOH HOH B . 
D 3 HOH 26  2026 2026 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2420  ? 
1 MORE         -11.9 ? 
1 'SSA (A^2)'  30860 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-03-10 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-04-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' Other                       
5 4 'Structure model' 'Source and taxonomy'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' entity_src_gen       
2 4 'Structure model' pdbx_database_proc   
3 4 'Structure model' pdbx_database_status 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_entity_src_gen.pdbx_host_org_cell_line'     
2 4 'Structure model' '_pdbx_database_status.recvd_author_approval' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
BUSTER-TNT refinement       2.1.1 ? 1 
MOSFLM     'data reduction' .     ? 2 
SCALA      'data scaling'   .     ? 3 
PHASER     phasing          .     ? 4 
# 
_pdbx_entry_details.entry_id             2W99 
_pdbx_entry_details.compound_details     
;ENGINEERED RESIDUE IN CHAIN B, GLY 43 TO GLU
ENGINEERED RESIDUE IN CHAIN B, GLY 44 TO GLU
ENGINEERED RESIDUE IN CHAIN B, THR 172 TO ALA
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;RESIDUES 1-271 WERE EXPRESSED, BUT THE N AND C-TERMINAL
WERE DISORDERED AND THEREFORE NOT COMPLETE IN THE MODEL.
HIS TAG WAS ADDED AT THE C-TERMINAL. RESIDUES 45, 46, 47
IN CHAIN B WERE DELETED.
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 72  ? ? 38.28   49.16   
2  1 ASN A 222 ? ? -137.51 -58.10  
3  1 PHE A 223 ? ? -94.21  46.02   
4  1 LEU A 224 ? ? -70.87  23.60   
5  1 ARG A 228 ? ? 36.63   53.13   
6  1 LYS A 238 ? ? 53.29   71.40   
7  1 SER A 257 ? ? -56.94  -5.12   
8  1 GLN A 264 ? ? -66.54  7.18    
9  1 MET A 266 ? ? -68.59  -72.48  
10 1 ARG B 5   ? ? -63.41  50.99   
11 1 VAL B 9   ? ? -140.01 -122.21 
12 1 ALA B 10  ? ? -41.81  179.71  
13 1 ILE B 12  ? ? -56.69  -4.76   
14 1 ALA B 16  ? ? -11.94  -52.45  
15 1 VAL B 20  ? ? -110.28 73.22   
16 1 LEU B 34  ? ? -66.48  99.27   
17 1 LEU B 63  ? ? -162.88 -43.13  
18 1 ASP B 84  ? ? 0.76    101.40  
19 1 ARG B 85  ? ? 82.82   2.91    
20 1 THR B 102 ? ? -47.84  -13.99  
21 1 LYS B 106 ? ? -67.95  53.44   
22 1 LEU B 112 ? ? -104.81 -165.72 
23 1 CYS B 135 ? ? 80.08   12.17   
24 1 ARG B 139 ? ? -89.35  -72.61  
25 1 ASN B 145 ? ? -92.75  38.24   
26 1 SER B 150 ? ? 178.48  -175.48 
27 1 THR B 153 ? ? -152.03 -60.07  
28 1 VAL B 154 ? ? 74.49   51.78   
29 1 ASP B 158 ? ? 48.57   20.39   
30 1 PHE B 159 ? ? -49.30  153.47  
31 1 LEU B 161 ? ? -10.45  -34.58  
32 1 MET B 169 ? ? -66.29  14.48   
33 1 PRO B 173 ? ? -106.11 -164.15 
34 1 VAL B 174 ? ? -138.18 -70.20  
35 1 VAL B 176 ? ? 70.09   34.59   
36 1 THR B 177 ? ? -58.25  59.54   
37 1 LEU B 178 ? ? -67.38  50.76   
38 1 PRO B 183 ? ? -56.65  -9.91   
39 1 LEU B 186 ? ? -143.54 17.57   
40 1 GLN B 188 ? ? -133.78 -123.66 
41 1 SER B 189 ? ? -169.69 56.57   
42 1 SER B 199 ? ? -48.67  -17.11  
43 1 ARG B 209 ? ? -147.60 30.40   
44 1 ARG B 210 ? ? -119.88 -118.47 
45 1 LYS B 211 ? ? -123.49 -167.28 
46 1 PHE B 214 ? ? -146.36 28.66   
47 1 ASN B 217 ? ? -176.63 -79.63  
48 1 ASP B 241 ? ? -151.74 -23.80  
49 1 SER B 243 ? ? 75.28   69.63   
50 1 PHE B 249 ? ? -103.01 -63.77  
51 1 GLN B 258 ? ? -48.27  -19.18  
52 1 SER B 259 ? ? -45.43  -76.80  
53 1 GLU B 265 ? ? -70.86  -166.05 
54 1 ARG B 283 ? ? -62.84  -148.49 
55 1 LEU B 290 ? ? -60.55  10.10   
56 1 GLN B 291 ? ? -151.99 39.58   
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2005 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.32 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A GLU 2   ? A GLU 2   
3  1 Y 1 A HIS 3   ? A HIS 3   
4  1 Y 1 A GLN 4   ? A GLN 4   
5  1 Y 1 A LEU 5   ? A LEU 5   
6  1 Y 1 A LEU 6   ? A LEU 6   
7  1 Y 1 A CYS 7   ? A CYS 7   
8  1 Y 1 A CYS 8   ? A CYS 8   
9  1 Y 1 A GLU 9   ? A GLU 9   
10 1 Y 1 A VAL 10  ? A VAL 10  
11 1 Y 1 A GLU 11  ? A GLU 11  
12 1 Y 1 A THR 12  ? A THR 12  
13 1 Y 1 A ILE 13  ? A ILE 13  
14 1 Y 1 A ARG 14  ? A ARG 14  
15 1 Y 1 A ARG 15  ? A ARG 15  
16 1 Y 1 A ALA 16  ? A ALA 16  
17 1 Y 1 A TYR 17  ? A TYR 17  
18 1 Y 1 A PRO 18  ? A PRO 18  
19 1 Y 1 A ASP 19  ? A ASP 19  
20 1 Y 1 A ALA 20  ? A ALA 20  
21 1 Y 1 A ASN 21  ? A ASN 21  
22 1 Y 1 A PRO 268 ? A PRO 268 
23 1 Y 1 A LYS 269 ? A LYS 269 
24 1 Y 1 A ALA 270 ? A ALA 270 
25 1 Y 1 A ALA 271 ? A ALA 271 
26 1 Y 1 B MET 1   ? B MET 1   
27 1 Y 1 B HIS 296 ? B HIS 293 
28 1 Y 1 B LYS 297 ? B LYS 294 
29 1 Y 1 B ASP 298 ? B ASP 295 
30 1 Y 1 B GLU 299 ? B GLU 296 
31 1 Y 1 B GLY 300 ? B GLY 297 
32 1 Y 1 B ASN 301 ? B ASN 298 
33 1 Y 1 B PRO 302 ? B PRO 299 
34 1 Y 1 B GLU 303 ? B GLU 300 
35 1 Y 1 B HIS 304 ? B HIS 301 
36 1 Y 1 B HIS 305 ? B HIS 302 
37 1 Y 1 B HIS 306 ? B HIS 303 
38 1 Y 1 B HIS 307 ? B HIS 304 
39 1 Y 1 B HIS 308 ? B HIS 305 
40 1 Y 1 B HIS 309 ? B HIS 306 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#