data_2W9A
# 
_entry.id   2W9A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2W9A         
PDBE  EBI-38627    
WWPDB D_1290038627 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1S0M unspecified 'CRYSTAL STRUCTURE OF A BENZO[A]PYRENE DIOL EPOXIDE ADDUCTIN A TERNARY COMPLEX WITH A DNA POLYMERASE' 
PDB 2ASL unspecified 'OXOG-MODIFIED POSTINSERTION BINARY COMPLEX' 
PDB 2JEG unspecified 
;THE MOLECULAR BASIS OF SELECTIVITY OF NUCLEOSIDE TRIPHOSPHATE INCORPORATION OPPOSITE O6-BENZYLGUANINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE IV: STEADY-STATE AND PRE- STEADY-STATE KINETICS AND X-RAY CRYSTALLOGRAPHY OF CORRECT AND INCORRECT PAIRING
;
PDB 1RYS unspecified 'REPLICATION OF A CIS-SYN THYMINE DIMER AT ATOMIC RESOLUTION' 
PDB 2V4S unspecified 'Y-FAMILY DNA POLYMERASE DPO4 BYPASSING N2- NAPHTHYL-GUANINE ADDUCT IN SYN ORIENTATION' 
PDB 2J6T unspecified 'TERNARY COMPLEX OF SULFOLOBUS SOLFATARICUS DPO4 DNA POLYMERASE, O6-METHYLGUANINE MODIFIED DNA, AND DATP.' 
PDB 1N56 unspecified 'Y-FAMILY DNA POLYMERASE DPO4 IN COMPLEX WITH DNA CONTAININGABASIC LESION' 
PDB 2W9B unspecified 'BINARY COMPLEX OF DPO4 BOUND TO N2,N2- DIMETHYL-DEOXYGUANOSINE MODIFIED DNA' 
PDB 1JX4 unspecified 
'CRYSTAL STRUCTURE OF A Y-FAMILY DNA POLYMERASE IN A TERNARYCOMPLEX WITH DNA SUBSTRATES AND AN INCOMING NUCLEOTIDE' 
PDB 2ATL unspecified 'UNMODIFIED INSERTION TERNARY COMPLEX' 
PDB 2C22 unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2VA2 unspecified 
;COMPLEX STRUCTURE OF SULFOLOBUS SOLFATARICUS DPO4 AND DNA DUPLEX CONTAINING A HYDROPHOBIC THYMINE ISOSTERE 2,4-DIFLUOROTOLUENE NUCLEOTIDE IN THE TEMPLATE STRAND
;
PDB 1S97 unspecified 'DPO4 WITH GT MISMATCH' 
PDB 2AGQ unspecified 'FIDELITY OF DPO4: EFFECT OF METAL IONS, NUCLEOTIDESELECTION AND PYROPHOSPHOROLYSIS' 
PDB 2AGO unspecified 'FIDELITY OF DPO4: EFFECT OF METAL IONS, NUCLEOTIDESELECTION AND PYROPHOSPHOROLYSIS' 
PDB 2JEJ unspecified 
;THE MOLECULAR BASIS OF SELECTIVITY OF NUCLEOSIDE TRIPHOSPHATE INCORPORATION OPPOSITE O6-BENZYLGUANINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE IV: STEADY-STATE AND PRE- STEADY-STATE KINETICS AND X-RAY CRYSTALLOGRAPHY OF CORRECT AND INCORRECT PAIRING
;
PDB 2ASJ unspecified 'OXOG-MODIFIED PREINSERTION BINARY COMPLEX' 
PDB 2W9C unspecified 'TERNARY COMPLEX OF DPO4 BOUND TO N2,N2- DIMETHYL-DEOXYGUANOSINE MODIFIED DNA WITH INCOMING DTTP' 
PDB 2ASD unspecified 'OXOG-MODIFIED INSERTION TERNARY COMPLEX' 
PDB 1JXL unspecified 
'CRYSTAL STRUCTURE OF A Y-FAMILY DNA POLYMERASE IN A TERNARYCOMPLEX WITH DNA SUBSTRATES AND AN INCOMING NUCLEOTIDE' 
PDB 1N48 unspecified 'Y-FAMILY DNA POLYMERASE DPO4 IN COMPLEX WITH DNA CONTAININGABASIC LESION' 
PDB 2BQ3 unspecified 
;DNA ADDUCT BYPASS POLYMERIZATION BY SULFOLOBUS SOLFATARICUS DPO4. ANALYSIS AND CRYSTAL STRUCTURES OF MULTIPLE BASE-PAIR SUBSTITUTION AND FRAMESHIFT PRODUCTS WITH THE ADDUCT 1 ,N2-ETHENOGUANINE
;
PDB 2J6U unspecified 'TERNARY COMPLEX OF SULFOLOBUS SOLFATARICUS DPO4 DNA POLYMERASE, O6-METHYLGUANINE MODIFIED DNA, AND DGTP.' 
PDB 2UVU unspecified 'CRYSTAL STRUCTURES OF MUTANT DPO4 DNA POLYMERASES WITH 8-OXOG CONTAINING DNA TEMPLATE-PRIMER CONSTRUCTS' 
PDB 2AGP unspecified 'FIDELITY OF DPO4: EFFECT OF METAL IONS, NUCLEOTIDESELECTION AND PYROPHOSPHOROLYSIS' 
PDB 1S0N unspecified 'SNAPSHOTS OF REPLICATION THROUGH AN ABASIC LESION:STRUCTURAL BASIS FOR BASE SUBSTITUTION AND FRAMESHIFT' 
PDB 2C2R unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2W8L unspecified 'Y-FAMILY DNA POLYMERASE DPO4 BYPASSING N2- NAPHTHYL-GUANINE ADDUCT IN ANTI ORIENTATION' 
PDB 2JEF unspecified 
;THE MOLECULAR BASIS OF SELECTIVITY OF NUCLEOTIDE TRIPHOSPHATE INCORPORATION OPPOSITE O6-BENZYLGUANINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE IV: STEADY-STATE AND PRE- STEADY-STATE AND X-RAY CRYSTALLOGRAPHY OF CORRECT AND INCORRECT PAIRING
;
PDB 1S0O unspecified 'SNAPSHOTS OF REPLICATION THROUGH AN ABASIC LESION:STRUCTURAL BASIS FOR BASE SUBSTITUTION AND FRAMESHIFT' 
PDB 2UVW unspecified 'CRYSTAL STRUCTURES OF MUTANT DPO4 DNA POLYMERASES WITH 8-OXOG CONTAINING DNA TEMPLATE-PRIMER CONSTRUCTS' 
PDB 2BQR unspecified 
;DNA ADDUCT BYPASS POLYMERIZATION BY SULFOLOBUS SOLFATARICUS DPO4. ANALYSIS AND CRYSTAL STRUCTURES OF MULTIPLE BASE-PAIR SUBSTITUTION AND FRAMESHIFT PRODUCTS WITH THE ADDUCT 1 ,N2-ETHENOGUANINE
;
PDB 2JEI unspecified 
;THE MOLECULAR BASIS OF SELECTIVITY OF NUCLEOSIDE TRIPHOSPHATE INCORPORATION OPPOSITE O6-BENZYLGUANINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE IV: STEADY-STATE AND PRE- STEADY-STATE KINETICS AND X-RAY CRYSTALLOGRAPHY OF CORRECT AND INCORRECT PAIRING
;
PDB 2BQU unspecified 
;DNA ADDUCT BYPASS POLYMERIZATION BY SULFOLOBUS SOLFATARICUS DPO4. ANALYSIS AND CRYSTAL STRUCTURES OF MULTIPLE BASE-PAIR SUBSTITUTION AND FRAMESHIFT PRODUCTS WITH THE ADDUCT 1 ,N2-ETHENOGUANINE
;
PDB 2AU0 unspecified 'UNMODIFIED PREINSERTION BINARY COMPLEX' 
PDB 1S9F unspecified 'DPO WITH AT MATCHED' 
PDB 2C28 unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2V9W unspecified 
;COMPLEX STRUCTURE OF SULFOLOBUS SOLFATARICUS DPO4 AND DNA DUPLEX CONTAINING A HYDROPHOBIC THYMINE ISOSTERE 2,4-DIFLUOROTOLUENE NUCLEOTIDE IN THE TEMPLATE STRAND
;
PDB 2V4R unspecified 
;NON-PRODUCTIVE COMPLEX OF THE Y-FAMILY DNA POLYMERASE DPO4 WITH DGTP SKIPPING THE M1DG ADDUCT TO PAIR WITH THE NEXT TEMPLATE CYTOSINE
;
PDB 2C2E unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 1RYR unspecified 'REPLICATION OF A CIS-SYN THYMINE DIMER AT ATOMIC RESOLUTION' 
PDB 2UVV unspecified 'CRYSTAL STRUCTURES OF MUTANT DPO4 DNA POLYMERASES WITH 8-OXOG CONTAINING DNA TEMPLATE-PRIMER CONSTRUCTS' 
PDB 2C2D unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2V4Q unspecified 'POST-INSERTION COMPLEX OF THE Y-FAMILY DNA POLYMERASE DPO4 WITH M1DG CONTAINING TEMPLATE DNA' 
PDB 1S10 unspecified 'SNAPSHOTS OF REPLICATION THROUGH AN ABASIC LESION:STRUCTURAL BASIS FOR BASE SUBSTITUTION AND FRAMESHIFT' 
PDB 2J6S unspecified 'TERNARY COMPLEX OF SULFOLOBUS SOLFATARICUS DPO4 DNA POLYMERASE, O6-METHYLGUANINE MODIFIED DNA, AND DATP.' 
PDB 2BR0 unspecified 
;DNA ADDUCT BYPASS POLYMERIZATION BY SULFOLOBUS SOLFATARICUS DPO4. ANALYSIS AND CRYSTAL STRUCTURES OF MULTIPLE BASE-PAIR SUBSTITUTION AND FRAMESHIFT PRODUCTS WITH THE ADDUCT 1 ,N2-ETHENOGUANINE
;
PDB 2UVR unspecified 'CRYSTAL STRUCTURES OF MUTANT DPO4 DNA POLYMERASES WITH 8-OXOG CONTAINING DNA TEMPLATE-PRIMER CONSTRUCTS' 
PDB 2VA3 unspecified 
;COMPLEX STRUCTURE OF SULFOLOBUS SOLFATARICUS DPO4 AND DNA DUPLEX CONTAINING A HYDROPHOBIC THYMINE ISOSTERE 2,4-DIFLUOROTOLUENE NUCLEOTIDE IN THE TEMPLATE STRAND
;
PDB 2W8K unspecified 'Y-FAMILY DNA POLYMERASE DPO4 BYPASSING N2- NAPHTHYL-GUANINE ADDUCT IN SYN ORIENTATION' 
PDB 2V4T unspecified 'Y-FAMILY DNA POLYMERASE DPO4 BYPASSING N2- NAPHTHYL-GUANINE ADDUCT IN ANTI ORIENTATION' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2W9A 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2009-01-22 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Eoff, R.L.'       1 
'Zhang, H.'        2 
'Kosekov, I.D.'    3 
'Rizzo, C.J.'      4 
'Egli, M.'         5 
'Guengerich, F.P.' 6 
# 
_citation.id                        primary 
_citation.title                     
;Structure-Function Relationships in Miscoding by Sulfolobus Solfataricus DNA Polymerase Dpo4: Guanine N2,N2-Dimethyl Substitution Produces Inactive and Miscoding Polymerase Complexes.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            284 
_citation.page_first                17687 
_citation.page_last                 ? 
_citation.year                      2009 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19542237 
_citation.pdbx_database_id_DOI      10.1074/JBC.M109014274 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhang, H.'        1 
primary 'Eoff, R.L.'       2 
primary 'Kozekov, I.D.'    3 
primary 'Rizzo, C.J.'      4 
primary 'Egli, M.'         5 
primary 'Guengerich, F.P.' 6 
# 
_cell.entry_id           2W9A 
_cell.length_a           94.670 
_cell.length_b           103.757 
_cell.length_c           52.750 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2W9A 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA POLYMERASE IV'                                                 41086.754 1  2.7.7.7 ? ? 
'Y-FAMILY DNA POLYMERASE FROM SULFOLOBUS SOLFATARICUS'   
2 polymer     syn 
;5'-D(*GP*GP*GP*GP*GP*AP*AP*GP*GP*AP *TP*TP*CP*DOC)-3'
;
4369.854  1  ?       ? ? 
;14 BASE PRIMER DNA 5'-GGG GGA AGG ATT C(DOC) -3'
;
3 polymer     syn 
;5'-D(*TP*CP*AP*CP*O2GP*GP*AP*AP*TP*CP *CP*TP*TP*CP*CP*CP*CP*C)-3'
;
5400.534  1  ?       ? ? 
;18 BASE TEMPLATE DNA 5'-TCA C(O2G)G AAT CCT TCC CCC-3'
;
4 non-polymer syn "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE"                                 507.181   1  ?       ? ? ? 
5 non-polymer syn 'MAGNESIUM ION'                                                     24.305    4  ?       ? ? ? 
6 water       nat water                                                               18.015    65 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'POL IV, DPO4' 
2 'PRIMER DNA'   
3 'TEMPLATE DNA' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;HHHHHHMIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYL
PMRKEVYQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIA
ADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYN
EPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSE
SVKLLQKILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
;
;HHHHHHMIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYL
PMRKEVYQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIA
ADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYN
EPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSE
SVKLLQKILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
;
A ? 
2 polydeoxyribonucleotide no yes '(DG)(DG)(DG)(DG)(DG)(DA)(DA)(DG)(DG)(DA)(DT)(DT)(DC)(DOC)' GGGGGAAGGATTCC P ? 
3 polydeoxyribonucleotide no yes '(DT)(DC)(DA)(DC)(O2G)(DG)(DA)(DA)(DT)(DC)(DC)(DT)(DT)(DC)(DC)(DC)(DC)(DC)' TCACGGAATCCTTCCCCC T 
? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   MET n 
1 8   ILE n 
1 9   VAL n 
1 10  LEU n 
1 11  PHE n 
1 12  VAL n 
1 13  ASP n 
1 14  PHE n 
1 15  ASP n 
1 16  TYR n 
1 17  PHE n 
1 18  TYR n 
1 19  ALA n 
1 20  GLN n 
1 21  VAL n 
1 22  GLU n 
1 23  GLU n 
1 24  VAL n 
1 25  LEU n 
1 26  ASN n 
1 27  PRO n 
1 28  SER n 
1 29  LEU n 
1 30  LYS n 
1 31  GLY n 
1 32  LYS n 
1 33  PRO n 
1 34  VAL n 
1 35  VAL n 
1 36  VAL n 
1 37  CYS n 
1 38  VAL n 
1 39  PHE n 
1 40  SER n 
1 41  GLY n 
1 42  ARG n 
1 43  PHE n 
1 44  GLU n 
1 45  ASP n 
1 46  SER n 
1 47  GLY n 
1 48  ALA n 
1 49  VAL n 
1 50  ALA n 
1 51  THR n 
1 52  ALA n 
1 53  ASN n 
1 54  TYR n 
1 55  GLU n 
1 56  ALA n 
1 57  ARG n 
1 58  LYS n 
1 59  PHE n 
1 60  GLY n 
1 61  VAL n 
1 62  LYS n 
1 63  ALA n 
1 64  GLY n 
1 65  ILE n 
1 66  PRO n 
1 67  ILE n 
1 68  VAL n 
1 69  GLU n 
1 70  ALA n 
1 71  LYS n 
1 72  LYS n 
1 73  ILE n 
1 74  LEU n 
1 75  PRO n 
1 76  ASN n 
1 77  ALA n 
1 78  VAL n 
1 79  TYR n 
1 80  LEU n 
1 81  PRO n 
1 82  MET n 
1 83  ARG n 
1 84  LYS n 
1 85  GLU n 
1 86  VAL n 
1 87  TYR n 
1 88  GLN n 
1 89  GLN n 
1 90  VAL n 
1 91  SER n 
1 92  SER n 
1 93  ARG n 
1 94  ILE n 
1 95  MET n 
1 96  ASN n 
1 97  LEU n 
1 98  LEU n 
1 99  ARG n 
1 100 GLU n 
1 101 TYR n 
1 102 SER n 
1 103 GLU n 
1 104 LYS n 
1 105 ILE n 
1 106 GLU n 
1 107 ILE n 
1 108 ALA n 
1 109 SER n 
1 110 ILE n 
1 111 ASP n 
1 112 GLU n 
1 113 ALA n 
1 114 TYR n 
1 115 LEU n 
1 116 ASP n 
1 117 ILE n 
1 118 SER n 
1 119 ASP n 
1 120 LYS n 
1 121 VAL n 
1 122 ARG n 
1 123 ASP n 
1 124 TYR n 
1 125 ARG n 
1 126 GLU n 
1 127 ALA n 
1 128 TYR n 
1 129 ASN n 
1 130 LEU n 
1 131 GLY n 
1 132 LEU n 
1 133 GLU n 
1 134 ILE n 
1 135 LYS n 
1 136 ASN n 
1 137 LYS n 
1 138 ILE n 
1 139 LEU n 
1 140 GLU n 
1 141 LYS n 
1 142 GLU n 
1 143 LYS n 
1 144 ILE n 
1 145 THR n 
1 146 VAL n 
1 147 THR n 
1 148 VAL n 
1 149 GLY n 
1 150 ILE n 
1 151 SER n 
1 152 LYS n 
1 153 ASN n 
1 154 LYS n 
1 155 VAL n 
1 156 PHE n 
1 157 ALA n 
1 158 LYS n 
1 159 ILE n 
1 160 ALA n 
1 161 ALA n 
1 162 ASP n 
1 163 MET n 
1 164 ALA n 
1 165 LYS n 
1 166 PRO n 
1 167 ASN n 
1 168 GLY n 
1 169 ILE n 
1 170 LYS n 
1 171 VAL n 
1 172 ILE n 
1 173 ASP n 
1 174 ASP n 
1 175 GLU n 
1 176 GLU n 
1 177 VAL n 
1 178 LYS n 
1 179 ARG n 
1 180 LEU n 
1 181 ILE n 
1 182 ARG n 
1 183 GLU n 
1 184 LEU n 
1 185 ASP n 
1 186 ILE n 
1 187 ALA n 
1 188 ASP n 
1 189 VAL n 
1 190 PRO n 
1 191 GLY n 
1 192 ILE n 
1 193 GLY n 
1 194 ASN n 
1 195 ILE n 
1 196 THR n 
1 197 ALA n 
1 198 GLU n 
1 199 LYS n 
1 200 LEU n 
1 201 LYS n 
1 202 LYS n 
1 203 LEU n 
1 204 GLY n 
1 205 ILE n 
1 206 ASN n 
1 207 LYS n 
1 208 LEU n 
1 209 VAL n 
1 210 ASP n 
1 211 THR n 
1 212 LEU n 
1 213 SER n 
1 214 ILE n 
1 215 GLU n 
1 216 PHE n 
1 217 ASP n 
1 218 LYS n 
1 219 LEU n 
1 220 LYS n 
1 221 GLY n 
1 222 MET n 
1 223 ILE n 
1 224 GLY n 
1 225 GLU n 
1 226 ALA n 
1 227 LYS n 
1 228 ALA n 
1 229 LYS n 
1 230 TYR n 
1 231 LEU n 
1 232 ILE n 
1 233 SER n 
1 234 LEU n 
1 235 ALA n 
1 236 ARG n 
1 237 ASP n 
1 238 GLU n 
1 239 TYR n 
1 240 ASN n 
1 241 GLU n 
1 242 PRO n 
1 243 ILE n 
1 244 ARG n 
1 245 THR n 
1 246 ARG n 
1 247 VAL n 
1 248 ARG n 
1 249 LYS n 
1 250 SER n 
1 251 ILE n 
1 252 GLY n 
1 253 ARG n 
1 254 ILE n 
1 255 VAL n 
1 256 THR n 
1 257 MET n 
1 258 LYS n 
1 259 ARG n 
1 260 ASN n 
1 261 SER n 
1 262 ARG n 
1 263 ASN n 
1 264 LEU n 
1 265 GLU n 
1 266 GLU n 
1 267 ILE n 
1 268 LYS n 
1 269 PRO n 
1 270 TYR n 
1 271 LEU n 
1 272 PHE n 
1 273 ARG n 
1 274 ALA n 
1 275 ILE n 
1 276 GLU n 
1 277 GLU n 
1 278 SER n 
1 279 TYR n 
1 280 TYR n 
1 281 LYS n 
1 282 LEU n 
1 283 ASP n 
1 284 LYS n 
1 285 ARG n 
1 286 ILE n 
1 287 PRO n 
1 288 LYS n 
1 289 ALA n 
1 290 ILE n 
1 291 HIS n 
1 292 VAL n 
1 293 VAL n 
1 294 ALA n 
1 295 VAL n 
1 296 THR n 
1 297 GLU n 
1 298 ASP n 
1 299 LEU n 
1 300 ASP n 
1 301 ILE n 
1 302 VAL n 
1 303 SER n 
1 304 ARG n 
1 305 GLY n 
1 306 ARG n 
1 307 THR n 
1 308 PHE n 
1 309 PRO n 
1 310 HIS n 
1 311 GLY n 
1 312 ILE n 
1 313 SER n 
1 314 LYS n 
1 315 GLU n 
1 316 THR n 
1 317 ALA n 
1 318 TYR n 
1 319 SER n 
1 320 GLU n 
1 321 SER n 
1 322 VAL n 
1 323 LYS n 
1 324 LEU n 
1 325 LEU n 
1 326 GLN n 
1 327 LYS n 
1 328 ILE n 
1 329 LEU n 
1 330 GLU n 
1 331 GLU n 
1 332 ASP n 
1 333 GLU n 
1 334 ARG n 
1 335 LYS n 
1 336 ILE n 
1 337 ARG n 
1 338 ARG n 
1 339 ILE n 
1 340 GLY n 
1 341 VAL n 
1 342 ARG n 
1 343 PHE n 
1 344 SER n 
1 345 LYS n 
1 346 PHE n 
1 347 ILE n 
1 348 GLU n 
1 349 ALA n 
1 350 ILE n 
1 351 GLY n 
1 352 LEU n 
1 353 ASP n 
1 354 LYS n 
1 355 PHE n 
1 356 PHE n 
1 357 ASP n 
1 358 THR n 
2 1   DG  n 
2 2   DG  n 
2 3   DG  n 
2 4   DG  n 
2 5   DG  n 
2 6   DA  n 
2 7   DA  n 
2 8   DG  n 
2 9   DG  n 
2 10  DA  n 
2 11  DT  n 
2 12  DT  n 
2 13  DC  n 
2 14  DOC n 
3 1   DT  n 
3 2   DC  n 
3 3   DA  n 
3 4   DC  n 
3 5   O2G n 
3 6   DG  n 
3 7   DA  n 
3 8   DA  n 
3 9   DT  n 
3 10  DC  n 
3 11  DC  n 
3 12  DT  n 
3 13  DT  n 
3 14  DC  n 
3 15  DC  n 
3 16  DC  n 
3 17  DC  n 
3 18  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    P2 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'SULFOLOBUS SOLFATARICUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     273057 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 35092 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET22B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2W9A        1 ? ? 2W9A   ? 
2 UNP DPO42_SULSO 1 ? ? Q97W02 ? 
3 PDB 2W9A        2 ? ? 2W9A   ? 
4 PDB 2W9A        3 ? ? 2W9A   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2W9A A 1 ? 6   ? 2W9A   -5 ? 0   ? -5 0   
2 2 2W9A A 7 ? 358 ? Q97W02 1  ? 352 ? 1  352 
3 3 2W9A P 1 ? 14  ? 2W9A   1  ? 14  ? 1  14  
4 4 2W9A T 1 ? 18  ? 2W9A   1  ? 18  ? 1  18  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                      ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                                     ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                   ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                              ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                                     ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                         ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                          ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                         ? 'C10 H14 N5 O7 P'   347.221 
DGT non-polymer         . "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE"                          ? 'C10 H16 N5 O13 P3' 507.181 
DOC 'DNA linking'       n "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE"                     ? 'C9 H14 N3 O6 P'    291.198 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                 ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                    ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                              ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                      ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                                    ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                        ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                   ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                      ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                       ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                   ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                              ? 'Mg 2'              24.305  
O2G 'RNA linking'       n "2'-DEOXY-N,N-DIMETHYL-5'-O-[OXIDO(OXO)PHOSPHONIO]GUANOSINE" ? 'C12 H18 N5 O7 P'   375.274 
PHE 'L-peptide linking' y PHENYLALANINE                                                ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                      ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                       ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                                    ? 'C4 H9 N O3'        119.119 
TYR 'L-peptide linking' y TYROSINE                                                     ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                                       ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          2W9A 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.44 
_exptl_crystal.density_percent_sol   53.74 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;DPO4\: DNA COMPLEX (1\:1.2 MOLAR RATIO, 150 MICROMOLAR), 20 MM TRIS HCL (PH 7.4), 15% POLYETHYLENE GLYCOL 3350 (W/V), 60 MM SODIUM CHLORIDE, 5 MM MAGNESIUM CHLORIDE, 1 MM DGTP.
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2008-06-22 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97857 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 21-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   21-ID 
_diffrn_source.pdbx_wavelength             0.97857 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2W9A 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             19.94 
_reflns.d_resolution_high            2.55 
_reflns.number_obs                   16285 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.2 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        23.30 
_reflns.B_iso_Wilson_estimate        42.40 
_reflns.pdbx_redundancy              6.8 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.55 
_reflns_shell.d_res_low              2.69 
_reflns_shell.percent_possible_all   97.4 
_reflns_shell.Rmerge_I_obs           0.20 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.30 
_reflns_shell.pdbx_redundancy        6.2 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2W9A 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     16285 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               68406.280 
_refine.pdbx_data_cutoff_low_absF                0.0000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.94 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    98.3 
_refine.ls_R_factor_obs                          0.213 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.213 
_refine.ls_R_factor_R_free                       0.246 
_refine.ls_R_factor_R_free_error                 0.009 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.900 
_refine.ls_number_reflns_R_free                  790 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               42.70 
_refine.aniso_B[1][1]                            5.69000 
_refine.aniso_B[2][2]                            -3.13000 
_refine.aniso_B[3][3]                            -2.56000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.35 
_refine.solvent_model_param_bsol                 31.36 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      'PDB ENTRY 2JEF' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        2W9A 
_refine_analyze.Luzzati_coordinate_error_obs    0.33 
_refine_analyze.Luzzati_sigma_a_obs             0.35 
_refine_analyze.Luzzati_d_res_low_obs           30.00 
_refine_analyze.Luzzati_coordinate_error_free   0.40 
_refine_analyze.Luzzati_sigma_a_free            0.40 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2754 
_refine_hist.pdbx_number_atoms_nucleic_acid   609 
_refine_hist.pdbx_number_atoms_ligand         35 
_refine_hist.number_atoms_solvent             65 
_refine_hist.number_atoms_total               3463 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        19.94 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.009 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.40  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      21.90 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.83  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.230 1.500 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.120 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.850 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.950 2.500 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   NONE 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.55 
_refine_ls_shell.d_res_low                        2.71 
_refine_ls_shell.number_reflns_R_work             1767 
_refine_ls_shell.R_factor_R_work                  0.2800 
_refine_ls_shell.percent_reflns_obs               64.60 
_refine_ls_shell.R_factor_R_free                  0.3360 
_refine_ls_shell.R_factor_R_free_error            0.036 
_refine_ls_shell.percent_reflns_R_free            4.60 
_refine_ls_shell.number_reflns_R_free             85 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP 
'X-RAY DIFFRACTION' 2 DNA-RNA_REP.PARAM DNA-RNA.TOP 
'X-RAY DIFFRACTION' 3 DGTP.PARAM        DGTP.TOP    
'X-RAY DIFFRACTION' 4 ION.PARAM         ION.TOP     
'X-RAY DIFFRACTION' 5 WATER_REP.PARAM   WATER.TOP   
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.details       ? 
_struct_ncs_dom.pdbx_ens_id   1 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  2W9A 
_struct.title                     'Ternary complex of Dpo4 bound to N2,N2-dimethyl-deoxyguanosine modified DNA with incoming dGTP' 
_struct.pdbx_descriptor           'DNA POLYMERASE IV (E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2W9A 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            
;TRANSFERASE DNA COMPLEX, N2-DIMETHYL-G, METAL-BINDING, MUTATOR PROTEIN, NUCLEOTIDYLTRANSFERASE, DNA-DIRECTED DNA POLYMERASE, DNA DAMAGE, DNA REPAIR, DNA-BINDING, TRANSFERASE, DNA REPLICATION, DNA, DPO4, ADDUCT, CYTOPLASM, MAGNESIUM, POLYMERASE, TRANSFERASE-DNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 6 ? 
J N N 6 ? 
K N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 16  ? ASN A 26  ? TYR A 10  ASN A 20  1 ? 11 
HELX_P HELX_P2  2  PRO A 27  ? LYS A 30  ? PRO A 21  LYS A 24  5 ? 4  
HELX_P HELX_P3  3  ASN A 53  ? LYS A 58  ? ASN A 47  LYS A 52  1 ? 6  
HELX_P HELX_P4  4  PRO A 66  ? LEU A 74  ? PRO A 60  LEU A 68  1 ? 9  
HELX_P HELX_P5  5  ARG A 83  ? ARG A 99  ? ARG A 77  ARG A 93  1 ? 17 
HELX_P HELX_P6  6  GLU A 100 ? SER A 102 ? GLU A 94  SER A 96  5 ? 3  
HELX_P HELX_P7  7  SER A 118 ? VAL A 121 ? SER A 112 VAL A 115 5 ? 4  
HELX_P HELX_P8  8  ASP A 123 ? GLU A 142 ? ASP A 117 GLU A 136 1 ? 20 
HELX_P HELX_P9  9  ASN A 153 ? LYS A 165 ? ASN A 147 LYS A 159 1 ? 13 
HELX_P HELX_P10 10 ASP A 173 ? LEU A 184 ? ASP A 167 LEU A 178 1 ? 12 
HELX_P HELX_P11 11 ILE A 186 ? VAL A 189 ? ILE A 180 VAL A 183 5 ? 4  
HELX_P HELX_P12 12 GLY A 193 ? LYS A 202 ? GLY A 187 LYS A 196 1 ? 10 
HELX_P HELX_P13 13 LEU A 208 ? ILE A 214 ? LEU A 202 ILE A 208 5 ? 7  
HELX_P HELX_P14 14 GLU A 215 ? GLY A 224 ? GLU A 209 GLY A 218 1 ? 10 
HELX_P HELX_P15 15 GLY A 224 ? ARG A 236 ? GLY A 218 ARG A 230 1 ? 13 
HELX_P HELX_P16 16 ASN A 263 ? ASP A 283 ? ASN A 257 ASP A 277 1 ? 21 
HELX_P HELX_P17 17 SER A 313 ? ASP A 332 ? SER A 307 ASP A 326 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E MG  .  MG    ? ? ? 1_555 I HOH .   O   ? ? A MG  1000 A HOH 2040 1_555 ? ? ? ? ? ? ?            2.157 ? 
metalc2  metalc ? ? E MG  .  MG    ? ? ? 1_555 A GLU 112 OE1 ? ? A MG  1000 A GLU 106  1_555 ? ? ? ? ? ? ?            2.597 ? 
metalc3  metalc ? ? E MG  .  MG    ? ? ? 1_555 J HOH .   O   ? ? A MG  1000 P HOH 2009 1_555 ? ? ? ? ? ? ?            2.595 ? 
metalc4  metalc ? ? E MG  .  MG    ? ? ? 1_555 A ASP 13  OD1 ? ? A MG  1000 A ASP 7    1_555 ? ? ? ? ? ? ?            2.122 ? 
metalc5  metalc ? ? E MG  .  MG    ? ? ? 1_555 D DGT .   O2A ? ? A MG  1000 A DGT 594  1_555 ? ? ? ? ? ? ?            2.305 ? 
metalc6  metalc ? ? E MG  .  MG    ? ? ? 1_555 A ASP 111 OD1 ? ? A MG  1000 A ASP 105  1_555 ? ? ? ? ? ? ?            2.304 ? 
metalc7  metalc ? ? F MG  .  MG    ? ? ? 1_555 D DGT .   O2A ? ? A MG  1001 A DGT 594  1_555 ? ? ? ? ? ? ?            2.752 ? 
metalc8  metalc ? ? F MG  .  MG    ? ? ? 1_555 D DGT .   O1B ? ? A MG  1001 A DGT 594  1_555 ? ? ? ? ? ? ?            1.827 ? 
metalc9  metalc ? ? F MG  .  MG    ? ? ? 1_555 D DGT .   O3G ? ? A MG  1001 A DGT 594  1_555 ? ? ? ? ? ? ?            2.387 ? 
metalc10 metalc ? ? F MG  .  MG    ? ? ? 1_555 A ASP 111 OD2 ? ? A MG  1001 A ASP 105  1_555 ? ? ? ? ? ? ?            2.308 ? 
metalc11 metalc ? ? F MG  .  MG    ? ? ? 1_555 A PHE 14  O   ? ? A MG  1001 A PHE 8    1_555 ? ? ? ? ? ? ?            2.255 ? 
metalc12 metalc ? ? F MG  .  MG    ? ? ? 1_555 A ASP 13  OD2 ? ? A MG  1001 A ASP 7    1_555 ? ? ? ? ? ? ?            2.105 ? 
metalc13 metalc ? ? G MG  .  MG    ? ? ? 1_555 A ALA 187 O   ? ? A MG  1002 A ALA 181  1_555 ? ? ? ? ? ? ?            2.393 ? 
metalc14 metalc ? ? G MG  .  MG    ? ? ? 1_555 A ILE 192 O   ? ? A MG  1002 A ILE 186  1_555 ? ? ? ? ? ? ?            2.460 ? 
metalc15 metalc ? ? G MG  .  MG    ? ? ? 1_555 J HOH .   O   ? ? A MG  1002 P HOH 2006 1_555 ? ? ? ? ? ? ?            2.397 ? 
metalc16 metalc ? ? G MG  .  MG    ? ? ? 1_555 I HOH .   O   ? ? A MG  1002 A HOH 2023 1_555 ? ? ? ? ? ? ?            2.190 ? 
metalc17 metalc ? ? G MG  .  MG    ? ? ? 1_555 I HOH .   O   ? ? A MG  1002 A HOH 2020 1_555 ? ? ? ? ? ? ?            2.182 ? 
metalc18 metalc ? ? H MG  .  MG    ? ? ? 1_555 I HOH .   O   ? ? A MG  1003 A HOH 2042 1_555 ? ? ? ? ? ? ?            2.213 ? 
metalc19 metalc ? ? H MG  .  MG    ? ? ? 1_555 I HOH .   O   ? ? A MG  1003 A HOH 2041 1_555 ? ? ? ? ? ? ?            2.733 ? 
metalc20 metalc ? ? H MG  .  MG    ? ? ? 1_555 I HOH .   O   ? ? A MG  1003 A HOH 2039 1_555 ? ? ? ? ? ? ?            2.385 ? 
metalc21 metalc ? ? H MG  .  MG    ? ? ? 1_555 D DGT .   O1A ? ? A MG  1003 A DGT 594  1_555 ? ? ? ? ? ? ?            2.059 ? 
metalc22 metalc ? ? H MG  .  MG    ? ? ? 1_555 B DOC 14  OP2 ? ? A MG  1003 P DOC 14   1_555 ? ? ? ? ? ? ?            2.523 ? 
covale1  covale ? ? B DC  13 "O3'" ? ? ? 1_555 B DOC 14  P   ? ? P DC  13   P DOC 14   1_555 ? ? ? ? ? ? ?            1.579 ? 
covale2  covale ? ? C DC  4  "O3'" ? ? ? 1_555 C O2G 5   P   ? ? T DC  4    T O2G 5    1_555 ? ? ? ? ? ? ?            1.578 ? 
covale3  covale ? ? C O2G 5  "O3'" ? ? ? 1_555 C DG  6   P   ? ? T O2G 5    T DG  6    1_555 ? ? ? ? ? ? ?            1.603 ? 
hydrog1  hydrog ? ? B DG  1  N1    ? ? ? 1_555 C DC  18  N3  ? ? P DG  1    T DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DG  1  N2    ? ? ? 1_555 C DC  18  O2  ? ? P DG  1    T DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  1  O6    ? ? ? 1_555 C DC  18  N4  ? ? P DG  1    T DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DG  2  N1    ? ? ? 1_555 C DC  17  N3  ? ? P DG  2    T DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  2  N2    ? ? ? 1_555 C DC  17  O2  ? ? P DG  2    T DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  2  O6    ? ? ? 1_555 C DC  17  N4  ? ? P DG  2    T DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  3  N1    ? ? ? 1_555 C DC  16  N3  ? ? P DG  3    T DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DG  3  N2    ? ? ? 1_555 C DC  16  O2  ? ? P DG  3    T DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DG  3  O6    ? ? ? 1_555 C DC  16  N4  ? ? P DG  3    T DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DG  4  N1    ? ? ? 1_555 C DC  15  N3  ? ? P DG  4    T DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DG  4  N2    ? ? ? 1_555 C DC  15  O2  ? ? P DG  4    T DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DG  4  O6    ? ? ? 1_555 C DC  15  N4  ? ? P DG  4    T DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  5  N1    ? ? ? 1_555 C DC  14  N3  ? ? P DG  5    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  5  N2    ? ? ? 1_555 C DC  14  O2  ? ? P DG  5    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  5  O6    ? ? ? 1_555 C DC  14  N4  ? ? P DG  5    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DA  6  N1    ? ? ? 1_555 C DT  13  N3  ? ? P DA  6    T DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DA  6  N6    ? ? ? 1_555 C DT  13  O4  ? ? P DA  6    T DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DA  7  N1    ? ? ? 1_555 C DT  12  N3  ? ? P DA  7    T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DA  7  N6    ? ? ? 1_555 C DT  12  O4  ? ? P DA  7    T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DG  8  N1    ? ? ? 1_555 C DC  11  N3  ? ? P DG  8    T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DG  8  N2    ? ? ? 1_555 C DC  11  O2  ? ? P DG  8    T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DG  8  O6    ? ? ? 1_555 C DC  11  N4  ? ? P DG  8    T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DG  9  N1    ? ? ? 1_555 C DC  10  N3  ? ? P DG  9    T DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DG  9  N2    ? ? ? 1_555 C DC  10  O2  ? ? P DG  9    T DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DG  9  O6    ? ? ? 1_555 C DC  10  N4  ? ? P DG  9    T DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DA  10 N1    ? ? ? 1_555 C DT  9   N3  ? ? P DA  10   T DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DA  10 N6    ? ? ? 1_555 C DT  9   O4  ? ? P DA  10   T DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DT  11 N3    ? ? ? 1_555 C DA  8   N1  ? ? P DT  11   T DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DT  11 O4    ? ? ? 1_555 C DA  8   N6  ? ? P DT  11   T DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DT  12 N3    ? ? ? 1_555 C DA  7   N1  ? ? P DT  12   T DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DT  12 O4    ? ? ? 1_555 C DA  7   N6  ? ? P DT  12   T DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DC  13 N3    ? ? ? 1_555 C DG  6   N1  ? ? P DC  13   T DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DC  13 N4    ? ? ? 1_555 C DG  6   O6  ? ? P DC  13   T DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? B DC  13 O2    ? ? ? 1_555 C DG  6   N2  ? ? P DC  13   T DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           165 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            159 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    166 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     160 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.14 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 3 ? 
AC ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? parallel      
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ILE A 105 ? ILE A 107 ? ILE A 99  ILE A 101 
AA 2 GLU A 112 ? ASP A 116 ? GLU A 106 ASP A 110 
AA 3 VAL A 9   ? PHE A 14  ? VAL A 3   PHE A 8   
AA 4 VAL A 146 ? SER A 151 ? VAL A 140 SER A 145 
AA 5 ILE A 169 ? VAL A 171 ? ILE A 163 VAL A 165 
AB 1 GLY A 47  ? ALA A 52  ? GLY A 41  ALA A 46  
AB 2 VAL A 34  ? PHE A 39  ? VAL A 28  PHE A 33  
AB 3 VAL A 78  ? PRO A 81  ? VAL A 72  PRO A 75  
AC 1 SER A 250 ? SER A 261 ? SER A 244 SER A 255 
AC 2 ILE A 336 ? PHE A 346 ? ILE A 330 PHE A 340 
AC 3 PRO A 287 ? THR A 296 ? PRO A 281 THR A 290 
AC 4 ILE A 301 ? THR A 307 ? ILE A 295 THR A 301 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLU A 106 ? N GLU A 100 O TYR A 114 ? O TYR A 108 
AA 2 3 N LEU A 115 ? N LEU A 109 O LEU A 10  ? O LEU A 4   
AA 3 4 N ASP A 13  ? N ASP A 7   O THR A 147 ? O THR A 141 
AA 4 5 N ILE A 150 ? N ILE A 144 O LYS A 170 ? O LYS A 164 
AB 1 2 N ALA A 50  ? N ALA A 44  O VAL A 36  ? O VAL A 30  
AB 2 3 N VAL A 35  ? N VAL A 29  O VAL A 78  ? O VAL A 72  
AC 1 2 N SER A 261 ? N SER A 255 O ILE A 336 ? O ILE A 330 
AC 2 3 O SER A 344 ? O SER A 338 N LYS A 288 ? N LYS A 282 
AC 3 4 N ALA A 294 ? N ALA A 288 O VAL A 302 ? O VAL A 296 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE DGT A 594' 
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 1000' 
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 1001' 
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 1002' 
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 1003' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 25 ASP A 13  ? ASP A 7    . ? 1_555 ? 
2  AC1 25 PHE A 14  ? PHE A 8    . ? 1_555 ? 
3  AC1 25 ASP A 15  ? ASP A 9    . ? 1_555 ? 
4  AC1 25 TYR A 16  ? TYR A 10   . ? 1_555 ? 
5  AC1 25 PHE A 17  ? PHE A 11   . ? 1_555 ? 
6  AC1 25 TYR A 18  ? TYR A 12   . ? 1_555 ? 
7  AC1 25 ALA A 50  ? ALA A 44   . ? 1_555 ? 
8  AC1 25 THR A 51  ? THR A 45   . ? 1_555 ? 
9  AC1 25 TYR A 54  ? TYR A 48   . ? 1_555 ? 
10 AC1 25 ARG A 57  ? ARG A 51   . ? 1_555 ? 
11 AC1 25 MET A 82  ? MET A 76   . ? 1_555 ? 
12 AC1 25 ASP A 111 ? ASP A 105  . ? 1_555 ? 
13 AC1 25 LYS A 165 ? LYS A 159  . ? 1_555 ? 
14 AC1 25 MG  E .   ? MG  A 1000 . ? 1_555 ? 
15 AC1 25 MG  F .   ? MG  A 1001 . ? 1_555 ? 
16 AC1 25 MG  H .   ? MG  A 1003 . ? 1_555 ? 
17 AC1 25 HOH I .   ? HOH A 2002 . ? 1_555 ? 
18 AC1 25 HOH I .   ? HOH A 2038 . ? 1_555 ? 
19 AC1 25 HOH I .   ? HOH A 2039 . ? 1_555 ? 
20 AC1 25 HOH I .   ? HOH A 2040 . ? 1_555 ? 
21 AC1 25 HOH I .   ? HOH A 2042 . ? 1_555 ? 
22 AC1 25 DOC B 14  ? DOC P 14   . ? 1_555 ? 
23 AC1 25 HOH J .   ? HOH P 2009 . ? 1_555 ? 
24 AC1 25 DC  C 4   ? DC  T 4    . ? 1_555 ? 
25 AC1 25 O2G C 5   ? O2G T 5    . ? 1_555 ? 
26 AC2 6  ASP A 13  ? ASP A 7    . ? 1_555 ? 
27 AC2 6  ASP A 111 ? ASP A 105  . ? 1_555 ? 
28 AC2 6  GLU A 112 ? GLU A 106  . ? 1_555 ? 
29 AC2 6  DGT D .   ? DGT A 594  . ? 1_555 ? 
30 AC2 6  HOH I .   ? HOH A 2040 . ? 1_555 ? 
31 AC2 6  HOH J .   ? HOH P 2009 . ? 1_555 ? 
32 AC3 4  ASP A 13  ? ASP A 7    . ? 1_555 ? 
33 AC3 4  PHE A 14  ? PHE A 8    . ? 1_555 ? 
34 AC3 4  ASP A 111 ? ASP A 105  . ? 1_555 ? 
35 AC3 4  DGT D .   ? DGT A 594  . ? 1_555 ? 
36 AC4 5  ALA A 187 ? ALA A 181  . ? 1_555 ? 
37 AC4 5  ILE A 192 ? ILE A 186  . ? 1_555 ? 
38 AC4 5  HOH I .   ? HOH A 2020 . ? 1_555 ? 
39 AC4 5  HOH I .   ? HOH A 2023 . ? 1_555 ? 
40 AC4 5  HOH J .   ? HOH P 2006 . ? 1_555 ? 
41 AC5 6  DGT D .   ? DGT A 594  . ? 1_555 ? 
42 AC5 6  HOH I .   ? HOH A 2039 . ? 1_555 ? 
43 AC5 6  HOH I .   ? HOH A 2041 . ? 1_555 ? 
44 AC5 6  HOH I .   ? HOH A 2042 . ? 1_555 ? 
45 AC5 6  DC  B 13  ? DC  P 13   . ? 1_555 ? 
46 AC5 6  DOC B 14  ? DOC P 14   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2W9A 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2W9A 
_atom_sites.fract_transf_matrix[1][1]   0.010563 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009638 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018957 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . HIS A 1 6   ? -3.852 33.261 12.684  1.00  74.98 ? 0    HIS A N     1 
ATOM   2    C  CA    . HIS A 1 6   ? -2.889 32.363 13.366  1.00  74.72 ? 0    HIS A CA    1 
ATOM   3    C  C     . HIS A 1 6   ? -1.669 33.138 13.896  1.00  72.68 ? 0    HIS A C     1 
ATOM   4    O  O     . HIS A 1 6   ? -1.409 33.191 15.081  1.00  73.87 ? 0    HIS A O     1 
ATOM   5    C  CB    . HIS A 1 6   ? -2.464 31.241 12.381  1.00  76.48 ? 0    HIS A CB    1 
ATOM   6    C  CG    . HIS A 1 6   ? -1.809 31.737 11.120  1.00  78.89 ? 0    HIS A CG    1 
ATOM   7    N  ND1   . HIS A 1 6   ? -1.933 31.102 9.901   1.00  79.52 ? 0    HIS A ND1   1 
ATOM   8    C  CD2   . HIS A 1 6   ? -1.024 32.816 10.897  1.00  79.79 ? 0    HIS A CD2   1 
ATOM   9    C  CE1   . HIS A 1 6   ? -1.254 31.774 8.986   1.00  79.90 ? 0    HIS A CE1   1 
ATOM   10   N  NE2   . HIS A 1 6   ? -0.692 32.818 9.566   1.00  80.21 ? 0    HIS A NE2   1 
ATOM   11   N  N     . MET A 1 7   ? -0.945 33.756 12.979  1.00  68.11 ? 1    MET A N     1 
ATOM   12   C  CA    . MET A 1 7   ? 0.278  34.507 13.236  1.00  63.54 ? 1    MET A CA    1 
ATOM   13   C  C     . MET A 1 7   ? 0.980  34.905 11.920  1.00  60.24 ? 1    MET A C     1 
ATOM   14   O  O     . MET A 1 7   ? 1.172  34.094 11.010  1.00  61.00 ? 1    MET A O     1 
ATOM   15   C  CB    . MET A 1 7   ? 1.237  33.681 14.091  1.00  62.64 ? 1    MET A CB    1 
ATOM   16   C  CG    . MET A 1 7   ? 2.543  34.365 14.358  1.00  63.18 ? 1    MET A CG    1 
ATOM   17   S  SD    . MET A 1 7   ? 3.573  33.520 15.593  1.00  67.84 ? 1    MET A SD    1 
ATOM   18   C  CE    . MET A 1 7   ? 4.278  32.153 14.627  1.00  64.43 ? 1    MET A CE    1 
ATOM   19   N  N     . ILE A 1 8   ? 1.356  36.172 11.831  1.00  55.37 ? 2    ILE A N     1 
ATOM   20   C  CA    . ILE A 1 8   ? 2.038  36.694 10.654  1.00  51.28 ? 2    ILE A CA    1 
ATOM   21   C  C     . ILE A 1 8   ? 3.416  37.153 11.114  1.00  48.24 ? 2    ILE A C     1 
ATOM   22   O  O     . ILE A 1 8   ? 3.539  37.851 12.111  1.00  48.49 ? 2    ILE A O     1 
ATOM   23   C  CB    . ILE A 1 8   ? 1.267  37.890 10.049  1.00  51.56 ? 2    ILE A CB    1 
ATOM   24   C  CG1   . ILE A 1 8   ? -0.148 37.452 9.655   1.00  50.47 ? 2    ILE A CG1   1 
ATOM   25   C  CG2   . ILE A 1 8   ? 2.020  38.438 8.852   1.00  52.01 ? 2    ILE A CG2   1 
ATOM   26   C  CD1   . ILE A 1 8   ? -0.987 38.553 9.021   1.00  50.62 ? 2    ILE A CD1   1 
ATOM   27   N  N     . VAL A 1 9   ? 4.464  36.760 10.406  1.00  44.68 ? 3    VAL A N     1 
ATOM   28   C  CA    . VAL A 1 9   ? 5.795  37.160 10.831  1.00  41.66 ? 3    VAL A CA    1 
ATOM   29   C  C     . VAL A 1 9   ? 6.546  37.912 9.762   1.00  40.10 ? 3    VAL A C     1 
ATOM   30   O  O     . VAL A 1 9   ? 6.613  37.497 8.604   1.00  39.69 ? 3    VAL A O     1 
ATOM   31   C  CB    . VAL A 1 9   ? 6.653  35.953 11.247  1.00  41.27 ? 3    VAL A CB    1 
ATOM   32   C  CG1   . VAL A 1 9   ? 7.965  36.438 11.821  1.00  39.38 ? 3    VAL A CG1   1 
ATOM   33   C  CG2   . VAL A 1 9   ? 5.904  35.100 12.249  1.00  40.53 ? 3    VAL A CG2   1 
ATOM   34   N  N     . LEU A 1 10  ? 7.132  39.022 10.183  1.00  38.27 ? 4    LEU A N     1 
ATOM   35   C  CA    . LEU A 1 10  ? 7.909  39.884 9.301   1.00  36.48 ? 4    LEU A CA    1 
ATOM   36   C  C     . LEU A 1 10  ? 9.376  39.868 9.775   1.00  35.27 ? 4    LEU A C     1 
ATOM   37   O  O     . LEU A 1 10  ? 9.699  40.320 10.879  1.00  34.18 ? 4    LEU A O     1 
ATOM   38   C  CB    . LEU A 1 10  ? 7.321  41.308 9.332   1.00  35.96 ? 4    LEU A CB    1 
ATOM   39   C  CG    . LEU A 1 10  ? 7.884  42.420 8.443   1.00  35.96 ? 4    LEU A CG    1 
ATOM   40   C  CD1   . LEU A 1 10  ? 6.746  43.264 7.873   1.00  37.49 ? 4    LEU A CD1   1 
ATOM   41   C  CD2   . LEU A 1 10  ? 8.837  43.275 9.264   1.00  35.36 ? 4    LEU A CD2   1 
ATOM   42   N  N     . PHE A 1 11  ? 10.247 39.314 8.933   1.00  33.37 ? 5    PHE A N     1 
ATOM   43   C  CA    . PHE A 1 11  ? 11.675 39.200 9.214   1.00  32.64 ? 5    PHE A CA    1 
ATOM   44   C  C     . PHE A 1 11  ? 12.451 40.258 8.422   1.00  32.42 ? 5    PHE A C     1 
ATOM   45   O  O     . PHE A 1 11  ? 12.128 40.536 7.264   1.00  31.54 ? 5    PHE A O     1 
ATOM   46   C  CB    . PHE A 1 11  ? 12.148 37.792 8.824   1.00  31.03 ? 5    PHE A CB    1 
ATOM   47   C  CG    . PHE A 1 11  ? 13.650 37.617 8.812   1.00  29.55 ? 5    PHE A CG    1 
ATOM   48   C  CD1   . PHE A 1 11  ? 14.370 37.538 9.999   1.00  29.36 ? 5    PHE A CD1   1 
ATOM   49   C  CD2   . PHE A 1 11  ? 14.338 37.497 7.612   1.00  26.93 ? 5    PHE A CD2   1 
ATOM   50   C  CE1   . PHE A 1 11  ? 15.753 37.340 9.983   1.00  26.90 ? 5    PHE A CE1   1 
ATOM   51   C  CE2   . PHE A 1 11  ? 15.712 37.301 7.593   1.00  26.33 ? 5    PHE A CE2   1 
ATOM   52   C  CZ    . PHE A 1 11  ? 16.422 37.220 8.771   1.00  24.29 ? 5    PHE A CZ    1 
ATOM   53   N  N     . VAL A 1 12  ? 13.474 40.841 9.043   1.00  31.55 ? 6    VAL A N     1 
ATOM   54   C  CA    . VAL A 1 12  ? 14.277 41.864 8.373   1.00  32.20 ? 6    VAL A CA    1 
ATOM   55   C  C     . VAL A 1 12  ? 15.779 41.575 8.431   1.00  32.78 ? 6    VAL A C     1 
ATOM   56   O  O     . VAL A 1 12  ? 16.329 41.323 9.496   1.00  32.02 ? 6    VAL A O     1 
ATOM   57   C  CB    . VAL A 1 12  ? 14.038 43.265 8.996   1.00  31.01 ? 6    VAL A CB    1 
ATOM   58   C  CG1   . VAL A 1 12  ? 14.828 44.310 8.235   1.00  28.22 ? 6    VAL A CG1   1 
ATOM   59   C  CG2   . VAL A 1 12  ? 12.548 43.600 8.995   1.00  30.14 ? 6    VAL A CG2   1 
ATOM   60   N  N     . ASP A 1 13  ? 16.438 41.629 7.280   1.00  33.44 ? 7    ASP A N     1 
ATOM   61   C  CA    . ASP A 1 13  ? 17.880 41.387 7.214   1.00  34.73 ? 7    ASP A CA    1 
ATOM   62   C  C     . ASP A 1 13  ? 18.524 42.481 6.374   1.00  34.32 ? 7    ASP A C     1 
ATOM   63   O  O     . ASP A 1 13  ? 18.238 42.596 5.176   1.00  36.52 ? 7    ASP A O     1 
ATOM   64   C  CB    . ASP A 1 13  ? 18.177 40.034 6.570   1.00  35.42 ? 7    ASP A CB    1 
ATOM   65   C  CG    . ASP A 1 13  ? 19.653 39.734 6.523   1.00  37.71 ? 7    ASP A CG    1 
ATOM   66   O  OD1   . ASP A 1 13  ? 20.211 39.233 7.514   1.00  38.86 ? 7    ASP A OD1   1 
ATOM   67   O  OD2   . ASP A 1 13  ? 20.261 40.018 5.484   1.00  40.98 ? 7    ASP A OD2   1 
ATOM   68   N  N     . PHE A 1 14  ? 19.392 43.275 6.993   1.00  31.07 ? 8    PHE A N     1 
ATOM   69   C  CA    . PHE A 1 14  ? 20.053 44.371 6.294   1.00  27.92 ? 8    PHE A CA    1 
ATOM   70   C  C     . PHE A 1 14  ? 20.932 43.814 5.170   1.00  26.85 ? 8    PHE A C     1 
ATOM   71   O  O     . PHE A 1 14  ? 21.458 42.718 5.295   1.00  26.73 ? 8    PHE A O     1 
ATOM   72   C  CB    . PHE A 1 14  ? 20.879 45.178 7.297   1.00  26.37 ? 8    PHE A CB    1 
ATOM   73   C  CG    . PHE A 1 14  ? 20.181 45.404 8.620   1.00  24.18 ? 8    PHE A CG    1 
ATOM   74   C  CD1   . PHE A 1 14  ? 18.792 45.386 8.710   1.00  22.04 ? 8    PHE A CD1   1 
ATOM   75   C  CD2   . PHE A 1 14  ? 20.915 45.666 9.770   1.00  23.39 ? 8    PHE A CD2   1 
ATOM   76   C  CE1   . PHE A 1 14  ? 18.143 45.625 9.928   1.00  22.66 ? 8    PHE A CE1   1 
ATOM   77   C  CE2   . PHE A 1 14  ? 20.276 45.910 11.004  1.00  22.27 ? 8    PHE A CE2   1 
ATOM   78   C  CZ    . PHE A 1 14  ? 18.889 45.889 11.082  1.00  21.15 ? 8    PHE A CZ    1 
ATOM   79   N  N     . ASP A 1 15  ? 21.084 44.566 4.080   1.00  26.88 ? 9    ASP A N     1 
ATOM   80   C  CA    . ASP A 1 15  ? 21.875 44.138 2.921   1.00  27.05 ? 9    ASP A CA    1 
ATOM   81   C  C     . ASP A 1 15  ? 23.390 44.346 3.032   1.00  26.87 ? 9    ASP A C     1 
ATOM   82   O  O     . ASP A 1 15  ? 23.861 45.429 3.369   1.00  26.38 ? 9    ASP A O     1 
ATOM   83   C  CB    . ASP A 1 15  ? 21.360 44.852 1.668   1.00  27.56 ? 9    ASP A CB    1 
ATOM   84   C  CG    . ASP A 1 15  ? 19.938 44.439 1.295   1.00  30.01 ? 9    ASP A CG    1 
ATOM   85   O  OD1   . ASP A 1 15  ? 19.353 43.592 1.990   1.00  29.96 ? 9    ASP A OD1   1 
ATOM   86   O  OD2   . ASP A 1 15  ? 19.401 44.953 0.292   1.00  32.27 ? 9    ASP A OD2   1 
ATOM   87   N  N     . TYR A 1 16  ? 24.152 43.309 2.706   1.00  26.13 ? 10   TYR A N     1 
ATOM   88   C  CA    . TYR A 1 16  ? 25.619 43.357 2.786   1.00  26.88 ? 10   TYR A CA    1 
ATOM   89   C  C     . TYR A 1 16  ? 26.030 44.324 3.884   1.00  26.49 ? 10   TYR A C     1 
ATOM   90   O  O     . TYR A 1 16  ? 26.964 45.098 3.745   1.00  25.12 ? 10   TYR A O     1 
ATOM   91   C  CB    . TYR A 1 16  ? 26.242 43.737 1.422   1.00  28.49 ? 10   TYR A CB    1 
ATOM   92   C  CG    . TYR A 1 16  ? 25.850 45.075 0.829   1.00  30.56 ? 10   TYR A CG    1 
ATOM   93   C  CD1   . TYR A 1 16  ? 26.657 46.199 0.995   1.00  31.91 ? 10   TYR A CD1   1 
ATOM   94   C  CD2   . TYR A 1 16  ? 24.699 45.203 0.059   1.00  29.56 ? 10   TYR A CD2   1 
ATOM   95   C  CE1   . TYR A 1 16  ? 26.322 47.417 0.398   1.00  31.49 ? 10   TYR A CE1   1 
ATOM   96   C  CE2   . TYR A 1 16  ? 24.358 46.406 -0.532  1.00  30.99 ? 10   TYR A CE2   1 
ATOM   97   C  CZ    . TYR A 1 16  ? 25.168 47.508 -0.361  1.00  31.18 ? 10   TYR A CZ    1 
ATOM   98   O  OH    . TYR A 1 16  ? 24.803 48.702 -0.927  1.00  31.05 ? 10   TYR A OH    1 
ATOM   99   N  N     . PHE A 1 17  ? 25.316 44.216 5.001   1.00  27.08 ? 11   PHE A N     1 
ATOM   100  C  CA    . PHE A 1 17  ? 25.469 45.085 6.158   1.00  26.47 ? 11   PHE A CA    1 
ATOM   101  C  C     . PHE A 1 17  ? 26.782 45.816 6.459   1.00  26.73 ? 11   PHE A C     1 
ATOM   102  O  O     . PHE A 1 17  ? 26.797 47.047 6.410   1.00  26.93 ? 11   PHE A O     1 
ATOM   103  C  CB    . PHE A 1 17  ? 24.972 44.375 7.425   1.00  25.87 ? 11   PHE A CB    1 
ATOM   104  C  CG    . PHE A 1 17  ? 24.680 45.320 8.555   1.00  26.15 ? 11   PHE A CG    1 
ATOM   105  C  CD1   . PHE A 1 17  ? 23.910 46.459 8.334   1.00  26.98 ? 11   PHE A CD1   1 
ATOM   106  C  CD2   . PHE A 1 17  ? 25.180 45.093 9.825   1.00  26.18 ? 11   PHE A CD2   1 
ATOM   107  C  CE1   . PHE A 1 17  ? 23.637 47.362 9.365   1.00  26.57 ? 11   PHE A CE1   1 
ATOM   108  C  CE2   . PHE A 1 17  ? 24.911 45.999 10.876  1.00  29.42 ? 11   PHE A CE2   1 
ATOM   109  C  CZ    . PHE A 1 17  ? 24.135 47.138 10.637  1.00  26.59 ? 11   PHE A CZ    1 
ATOM   110  N  N     . TYR A 1 18  ? 27.874 45.127 6.780   1.00  26.05 ? 12   TYR A N     1 
ATOM   111  C  CA    . TYR A 1 18  ? 29.088 45.893 7.086   1.00  27.63 ? 12   TYR A CA    1 
ATOM   112  C  C     . TYR A 1 18  ? 29.522 46.734 5.893   1.00  28.19 ? 12   TYR A C     1 
ATOM   113  O  O     . TYR A 1 18  ? 29.750 47.934 6.020   1.00  30.00 ? 12   TYR A O     1 
ATOM   114  C  CB    . TYR A 1 18  ? 30.250 44.995 7.526   1.00  26.58 ? 12   TYR A CB    1 
ATOM   115  C  CG    . TYR A 1 18  ? 30.030 44.217 8.808   1.00  26.15 ? 12   TYR A CG    1 
ATOM   116  C  CD1   . TYR A 1 18  ? 28.834 44.298 9.512   1.00  27.98 ? 12   TYR A CD1   1 
ATOM   117  C  CD2   . TYR A 1 18  ? 31.013 43.357 9.287   1.00  27.21 ? 12   TYR A CD2   1 
ATOM   118  C  CE1   . TYR A 1 18  ? 28.620 43.539 10.650  1.00  27.38 ? 12   TYR A CE1   1 
ATOM   119  C  CE2   . TYR A 1 18  ? 30.816 42.598 10.417  1.00  26.82 ? 12   TYR A CE2   1 
ATOM   120  C  CZ    . TYR A 1 18  ? 29.614 42.689 11.098  1.00  26.91 ? 12   TYR A CZ    1 
ATOM   121  O  OH    . TYR A 1 18  ? 29.398 41.923 12.222  1.00  26.44 ? 12   TYR A OH    1 
ATOM   122  N  N     . ALA A 1 19  ? 29.632 46.104 4.734   1.00  27.36 ? 13   ALA A N     1 
ATOM   123  C  CA    . ALA A 1 19  ? 30.023 46.828 3.546   1.00  27.96 ? 13   ALA A CA    1 
ATOM   124  C  C     . ALA A 1 19  ? 29.049 47.987 3.262   1.00  28.97 ? 13   ALA A C     1 
ATOM   125  O  O     . ALA A 1 19  ? 29.455 49.029 2.724   1.00  28.24 ? 13   ALA A O     1 
ATOM   126  C  CB    . ALA A 1 19  ? 30.084 45.876 2.357   1.00  27.68 ? 13   ALA A CB    1 
ATOM   127  N  N     . GLN A 1 20  ? 27.773 47.831 3.623   1.00  29.37 ? 14   GLN A N     1 
ATOM   128  C  CA    . GLN A 1 20  ? 26.824 48.920 3.354   1.00  30.58 ? 14   GLN A CA    1 
ATOM   129  C  C     . GLN A 1 20  ? 27.007 50.082 4.330   1.00  30.49 ? 14   GLN A C     1 
ATOM   130  O  O     . GLN A 1 20  ? 26.817 51.243 3.968   1.00  31.10 ? 14   GLN A O     1 
ATOM   131  C  CB    . GLN A 1 20  ? 25.356 48.447 3.384   1.00  28.60 ? 14   GLN A CB    1 
ATOM   132  C  CG    . GLN A 1 20  ? 24.415 49.518 2.792   1.00  31.47 ? 14   GLN A CG    1 
ATOM   133  C  CD    . GLN A 1 20  ? 22.925 49.170 2.771   1.00  33.82 ? 14   GLN A CD    1 
ATOM   134  O  OE1   . GLN A 1 20  ? 22.105 49.985 2.337   1.00  35.62 ? 14   GLN A OE1   1 
ATOM   135  N  NE2   . GLN A 1 20  ? 22.569 47.977 3.238   1.00  35.92 ? 14   GLN A NE2   1 
ATOM   136  N  N     . VAL A 1 21  ? 27.391 49.772 5.560   1.00  29.29 ? 15   VAL A N     1 
ATOM   137  C  CA    . VAL A 1 21  ? 27.597 50.817 6.537   1.00  30.30 ? 15   VAL A CA    1 
ATOM   138  C  C     . VAL A 1 21  ? 28.824 51.622 6.130   1.00  32.86 ? 15   VAL A C     1 
ATOM   139  O  O     . VAL A 1 21  ? 28.846 52.856 6.277   1.00  33.66 ? 15   VAL A O     1 
ATOM   140  C  CB    . VAL A 1 21  ? 27.795 50.228 7.944   1.00  28.75 ? 15   VAL A CB    1 
ATOM   141  C  CG1   . VAL A 1 21  ? 28.094 51.349 8.944   1.00  26.73 ? 15   VAL A CG1   1 
ATOM   142  C  CG2   . VAL A 1 21  ? 26.550 49.458 8.351   1.00  26.86 ? 15   VAL A CG2   1 
ATOM   143  N  N     . GLU A 1 22  ? 29.837 50.924 5.617   1.00  33.33 ? 16   GLU A N     1 
ATOM   144  C  CA    . GLU A 1 22  ? 31.068 51.572 5.181   1.00  34.93 ? 16   GLU A CA    1 
ATOM   145  C  C     . GLU A 1 22  ? 30.784 52.553 4.041   1.00  35.86 ? 16   GLU A C     1 
ATOM   146  O  O     . GLU A 1 22  ? 31.402 53.618 3.960   1.00  36.14 ? 16   GLU A O     1 
ATOM   147  C  CB    . GLU A 1 22  ? 32.103 50.525 4.743   1.00  34.27 ? 16   GLU A CB    1 
ATOM   148  C  CG    . GLU A 1 22  ? 32.748 49.725 5.896   1.00  33.24 ? 16   GLU A CG    1 
ATOM   149  C  CD    . GLU A 1 22  ? 33.519 50.596 6.858   1.00  32.57 ? 16   GLU A CD    1 
ATOM   150  O  OE1   . GLU A 1 22  ? 33.716 51.780 6.527   1.00  31.62 ? 16   GLU A OE1   1 
ATOM   151  O  OE2   . GLU A 1 22  ? 33.931 50.099 7.934   1.00  32.03 ? 16   GLU A OE2   1 
ATOM   152  N  N     . GLU A 1 23  ? 29.844 52.189 3.174   1.00  35.70 ? 17   GLU A N     1 
ATOM   153  C  CA    . GLU A 1 23  ? 29.452 53.040 2.057   1.00  36.44 ? 17   GLU A CA    1 
ATOM   154  C  C     . GLU A 1 23  ? 28.688 54.243 2.586   1.00  37.59 ? 17   GLU A C     1 
ATOM   155  O  O     . GLU A 1 23  ? 28.892 55.363 2.129   1.00  38.11 ? 17   GLU A O     1 
ATOM   156  C  CB    . GLU A 1 23  ? 28.558 52.275 1.080   1.00  37.88 ? 17   GLU A CB    1 
ATOM   157  C  CG    . GLU A 1 23  ? 29.256 51.152 0.328   1.00  40.81 ? 17   GLU A CG    1 
ATOM   158  C  CD    . GLU A 1 23  ? 28.336 50.455 -0.653  1.00  43.12 ? 17   GLU A CD    1 
ATOM   159  O  OE1   . GLU A 1 23  ? 28.804 49.552 -1.382  1.00  43.84 ? 17   GLU A OE1   1 
ATOM   160  O  OE2   . GLU A 1 23  ? 27.142 50.816 -0.690  1.00  43.84 ? 17   GLU A OE2   1 
ATOM   161  N  N     . VAL A 1 24  ? 27.789 54.010 3.539   1.00  36.60 ? 18   VAL A N     1 
ATOM   162  C  CA    . VAL A 1 24  ? 27.039 55.109 4.119   1.00  35.03 ? 18   VAL A CA    1 
ATOM   163  C  C     . VAL A 1 24  ? 28.023 56.134 4.714   1.00  35.79 ? 18   VAL A C     1 
ATOM   164  O  O     . VAL A 1 24  ? 27.911 57.330 4.435   1.00  37.50 ? 18   VAL A O     1 
ATOM   165  C  CB    . VAL A 1 24  ? 26.050 54.609 5.208   1.00  34.28 ? 18   VAL A CB    1 
ATOM   166  C  CG1   . VAL A 1 24  ? 25.713 55.738 6.189   1.00  31.06 ? 18   VAL A CG1   1 
ATOM   167  C  CG2   . VAL A 1 24  ? 24.767 54.129 4.551   1.00  31.23 ? 18   VAL A CG2   1 
ATOM   168  N  N     . LEU A 1 25  ? 28.989 55.672 5.508   1.00  35.43 ? 19   LEU A N     1 
ATOM   169  C  CA    . LEU A 1 25  ? 29.972 56.567 6.115   1.00  34.41 ? 19   LEU A CA    1 
ATOM   170  C  C     . LEU A 1 25  ? 30.883 57.259 5.098   1.00  35.83 ? 19   LEU A C     1 
ATOM   171  O  O     . LEU A 1 25  ? 31.478 58.291 5.403   1.00  36.12 ? 19   LEU A O     1 
ATOM   172  C  CB    . LEU A 1 25  ? 30.831 55.810 7.127   1.00  34.54 ? 19   LEU A CB    1 
ATOM   173  C  CG    . LEU A 1 25  ? 30.400 55.842 8.601   1.00  33.87 ? 19   LEU A CG    1 
ATOM   174  C  CD1   . LEU A 1 25  ? 28.975 55.322 8.758   1.00  33.57 ? 19   LEU A CD1   1 
ATOM   175  C  CD2   . LEU A 1 25  ? 31.373 55.020 9.427   1.00  32.93 ? 19   LEU A CD2   1 
ATOM   176  N  N     . ASN A 1 26  ? 31.007 56.690 3.899   1.00  35.84 ? 20   ASN A N     1 
ATOM   177  C  CA    . ASN A 1 26  ? 31.826 57.277 2.833   1.00  35.94 ? 20   ASN A CA    1 
ATOM   178  C  C     . ASN A 1 26  ? 31.186 56.861 1.509   1.00  36.75 ? 20   ASN A C     1 
ATOM   179  O  O     . ASN A 1 26  ? 31.652 55.938 0.836   1.00  37.44 ? 20   ASN A O     1 
ATOM   180  C  CB    . ASN A 1 26  ? 33.265 56.760 2.909   1.00  36.32 ? 20   ASN A CB    1 
ATOM   181  C  CG    . ASN A 1 26  ? 34.117 57.230 1.748   1.00  37.98 ? 20   ASN A CG    1 
ATOM   182  O  OD1   . ASN A 1 26  ? 35.288 56.873 1.645   1.00  37.07 ? 20   ASN A OD1   1 
ATOM   183  N  ND2   . ASN A 1 26  ? 33.532 58.036 0.865   1.00  40.29 ? 20   ASN A ND2   1 
ATOM   184  N  N     . PRO A 1 27  ? 30.114 57.557 1.106   1.00  36.95 ? 21   PRO A N     1 
ATOM   185  C  CA    . PRO A 1 27  ? 29.415 57.230 -0.139  1.00  35.83 ? 21   PRO A CA    1 
ATOM   186  C  C     . PRO A 1 27  ? 30.236 57.153 -1.412  1.00  36.04 ? 21   PRO A C     1 
ATOM   187  O  O     . PRO A 1 27  ? 29.803 56.543 -2.384  1.00  37.33 ? 21   PRO A O     1 
ATOM   188  C  CB    . PRO A 1 27  ? 28.291 58.270 -0.194  1.00  34.31 ? 21   PRO A CB    1 
ATOM   189  C  CG    . PRO A 1 27  ? 28.794 59.398 0.607   1.00  35.62 ? 21   PRO A CG    1 
ATOM   190  C  CD    . PRO A 1 27  ? 29.525 58.743 1.750   1.00  35.82 ? 21   PRO A CD    1 
ATOM   191  N  N     . SER A 1 28  ? 31.422 57.747 -1.419  1.00  36.35 ? 22   SER A N     1 
ATOM   192  C  CA    . SER A 1 28  ? 32.261 57.695 -2.619  1.00  37.18 ? 22   SER A CA    1 
ATOM   193  C  C     . SER A 1 28  ? 32.550 56.241 -2.998  1.00  37.25 ? 22   SER A C     1 
ATOM   194  O  O     . SER A 1 28  ? 32.829 55.935 -4.157  1.00  38.45 ? 22   SER A O     1 
ATOM   195  C  CB    . SER A 1 28  ? 33.586 58.415 -2.388  1.00  37.15 ? 22   SER A CB    1 
ATOM   196  O  OG    . SER A 1 28  ? 34.400 57.673 -1.501  1.00  38.65 ? 22   SER A OG    1 
ATOM   197  N  N     . LEU A 1 29  ? 32.494 55.355 -2.007  1.00  36.56 ? 23   LEU A N     1 
ATOM   198  C  CA    . LEU A 1 29  ? 32.736 53.934 -2.214  1.00  35.82 ? 23   LEU A CA    1 
ATOM   199  C  C     . LEU A 1 29  ? 31.622 53.290 -3.042  1.00  37.29 ? 23   LEU A C     1 
ATOM   200  O  O     . LEU A 1 29  ? 31.864 52.309 -3.758  1.00  36.08 ? 23   LEU A O     1 
ATOM   201  C  CB    . LEU A 1 29  ? 32.805 53.217 -0.871  1.00  34.74 ? 23   LEU A CB    1 
ATOM   202  C  CG    . LEU A 1 29  ? 33.869 53.599 0.148   1.00  35.46 ? 23   LEU A CG    1 
ATOM   203  C  CD1   . LEU A 1 29  ? 33.515 52.960 1.480   1.00  34.91 ? 23   LEU A CD1   1 
ATOM   204  C  CD2   . LEU A 1 29  ? 35.223 53.125 -0.316  1.00  34.19 ? 23   LEU A CD2   1 
ATOM   205  N  N     . LYS A 1 30  ? 30.404 53.824 -2.922  1.00  38.96 ? 24   LYS A N     1 
ATOM   206  C  CA    . LYS A 1 30  ? 29.254 53.282 -3.646  1.00  41.65 ? 24   LYS A CA    1 
ATOM   207  C  C     . LYS A 1 30  ? 29.590 53.099 -5.114  1.00  41.10 ? 24   LYS A C     1 
ATOM   208  O  O     . LYS A 1 30  ? 30.147 53.991 -5.750  1.00  42.53 ? 24   LYS A O     1 
ATOM   209  C  CB    . LYS A 1 30  ? 28.029 54.190 -3.485  1.00  43.55 ? 24   LYS A CB    1 
ATOM   210  C  CG    . LYS A 1 30  ? 27.626 54.424 -2.029  1.00  47.98 ? 24   LYS A CG    1 
ATOM   211  C  CD    . LYS A 1 30  ? 26.194 54.914 -1.923  1.00  50.56 ? 24   LYS A CD    1 
ATOM   212  C  CE    . LYS A 1 30  ? 26.140 56.234 -1.184  1.00  53.09 ? 24   LYS A CE    1 
ATOM   213  N  NZ    . LYS A 1 30  ? 24.826 56.941 -1.523  1.00  55.09 ? 24   LYS A NZ    1 
ATOM   214  N  N     . GLY A 1 31  ? 29.266 51.926 -5.640  1.00  40.30 ? 25   GLY A N     1 
ATOM   215  C  CA    . GLY A 1 31  ? 29.562 51.638 -7.025  1.00  39.82 ? 25   GLY A CA    1 
ATOM   216  C  C     . GLY A 1 31  ? 30.816 50.807 -7.171  1.00  39.50 ? 25   GLY A C     1 
ATOM   217  O  O     . GLY A 1 31  ? 30.975 50.091 -8.149  1.00  39.64 ? 25   GLY A O     1 
ATOM   218  N  N     . LYS A 1 32  ? 31.708 50.892 -6.193  1.00  40.55 ? 26   LYS A N     1 
ATOM   219  C  CA    . LYS A 1 32  ? 32.953 50.128 -6.239  1.00  41.80 ? 26   LYS A CA    1 
ATOM   220  C  C     . LYS A 1 32  ? 32.817 48.825 -5.456  1.00  42.06 ? 26   LYS A C     1 
ATOM   221  O  O     . LYS A 1 32  ? 31.938 48.691 -4.592  1.00  43.68 ? 26   LYS A O     1 
ATOM   222  C  CB    . LYS A 1 32  ? 34.111 50.946 -5.638  1.00  41.22 ? 26   LYS A CB    1 
ATOM   223  C  CG    . LYS A 1 32  ? 34.332 52.278 -6.325  1.00  41.88 ? 26   LYS A CG    1 
ATOM   224  C  CD    . LYS A 1 32  ? 35.383 53.149 -5.631  1.00  41.20 ? 26   LYS A CD    1 
ATOM   225  C  CE    . LYS A 1 32  ? 35.374 54.542 -6.275  1.00  43.66 ? 26   LYS A CE    1 
ATOM   226  N  NZ    . LYS A 1 32  ? 36.301 55.556 -5.705  1.00  44.21 ? 26   LYS A NZ    1 
ATOM   227  N  N     . PRO A 1 33  ? 33.655 47.826 -5.781  1.00  40.66 ? 27   PRO A N     1 
ATOM   228  C  CA    . PRO A 1 33  ? 33.542 46.579 -5.016  1.00  38.45 ? 27   PRO A CA    1 
ATOM   229  C  C     . PRO A 1 33  ? 34.209 46.856 -3.657  1.00  36.80 ? 27   PRO A C     1 
ATOM   230  O  O     . PRO A 1 33  ? 35.298 47.427 -3.597  1.00  37.27 ? 27   PRO A O     1 
ATOM   231  C  CB    . PRO A 1 33  ? 34.311 45.572 -5.878  1.00  39.02 ? 27   PRO A CB    1 
ATOM   232  C  CG    . PRO A 1 33  ? 35.359 46.430 -6.550  1.00  39.56 ? 27   PRO A CG    1 
ATOM   233  C  CD    . PRO A 1 33  ? 34.575 47.678 -6.926  1.00  38.37 ? 27   PRO A CD    1 
ATOM   234  N  N     . VAL A 1 34  ? 33.552 46.484 -2.568  1.00  34.94 ? 28   VAL A N     1 
ATOM   235  C  CA    . VAL A 1 34  ? 34.116 46.730 -1.243  1.00  33.82 ? 28   VAL A CA    1 
ATOM   236  C  C     . VAL A 1 34  ? 34.188 45.457 -0.416  1.00  32.98 ? 28   VAL A C     1 
ATOM   237  O  O     . VAL A 1 34  ? 33.213 44.713 -0.314  1.00  32.82 ? 28   VAL A O     1 
ATOM   238  C  CB    . VAL A 1 34  ? 33.273 47.764 -0.451  1.00  35.30 ? 28   VAL A CB    1 
ATOM   239  C  CG1   . VAL A 1 34  ? 34.023 48.195 0.815   1.00  33.21 ? 28   VAL A CG1   1 
ATOM   240  C  CG2   . VAL A 1 34  ? 32.928 48.961 -1.345  1.00  32.66 ? 28   VAL A CG2   1 
ATOM   241  N  N     . VAL A 1 35  ? 35.347 45.233 0.191   1.00  30.74 ? 29   VAL A N     1 
ATOM   242  C  CA    . VAL A 1 35  ? 35.588 44.048 1.016   1.00  29.65 ? 29   VAL A CA    1 
ATOM   243  C  C     . VAL A 1 35  ? 35.989 44.453 2.457   1.00  29.25 ? 29   VAL A C     1 
ATOM   244  O  O     . VAL A 1 35  ? 36.983 45.163 2.660   1.00  28.41 ? 29   VAL A O     1 
ATOM   245  C  CB    . VAL A 1 35  ? 36.744 43.183 0.409   1.00  29.43 ? 29   VAL A CB    1 
ATOM   246  C  CG1   . VAL A 1 35  ? 36.802 41.806 1.079   1.00  29.54 ? 29   VAL A CG1   1 
ATOM   247  C  CG2   . VAL A 1 35  ? 36.569 43.056 -1.095  1.00  27.69 ? 29   VAL A CG2   1 
ATOM   248  N  N     . VAL A 1 36  ? 35.210 44.019 3.445   1.00  27.68 ? 30   VAL A N     1 
ATOM   249  C  CA    . VAL A 1 36  ? 35.518 44.322 4.837   1.00  28.32 ? 30   VAL A CA    1 
ATOM   250  C  C     . VAL A 1 36  ? 36.350 43.148 5.332   1.00  29.50 ? 30   VAL A C     1 
ATOM   251  O  O     . VAL A 1 36  ? 35.907 42.000 5.258   1.00  29.74 ? 30   VAL A O     1 
ATOM   252  C  CB    . VAL A 1 36  ? 34.255 44.397 5.703   1.00  28.84 ? 30   VAL A CB    1 
ATOM   253  C  CG1   . VAL A 1 36  ? 34.634 44.842 7.115   1.00  27.86 ? 30   VAL A CG1   1 
ATOM   254  C  CG2   . VAL A 1 36  ? 33.248 45.334 5.078   1.00  27.40 ? 30   VAL A CG2   1 
ATOM   255  N  N     . CYS A 1 37  ? 37.542 43.418 5.852   1.00  29.89 ? 31   CYS A N     1 
ATOM   256  C  CA    . CYS A 1 37  ? 38.400 42.324 6.283   1.00  30.01 ? 31   CYS A CA    1 
ATOM   257  C  C     . CYS A 1 37  ? 38.788 42.248 7.742   1.00  29.68 ? 31   CYS A C     1 
ATOM   258  O  O     . CYS A 1 37  ? 38.856 43.246 8.445   1.00  29.46 ? 31   CYS A O     1 
ATOM   259  C  CB    . CYS A 1 37  ? 39.692 42.311 5.452   1.00  31.63 ? 31   CYS A CB    1 
ATOM   260  S  SG    . CYS A 1 37  ? 39.502 42.809 3.749   1.00  30.96 ? 31   CYS A SG    1 
ATOM   261  N  N     . VAL A 1 38  ? 39.082 41.021 8.149   1.00  28.68 ? 32   VAL A N     1 
ATOM   262  C  CA    . VAL A 1 38  ? 39.510 40.684 9.486   1.00  29.00 ? 32   VAL A CA    1 
ATOM   263  C  C     . VAL A 1 38  ? 40.964 40.256 9.302   1.00  30.49 ? 32   VAL A C     1 
ATOM   264  O  O     . VAL A 1 38  ? 41.240 39.085 9.034   1.00  31.04 ? 32   VAL A O     1 
ATOM   265  C  CB    . VAL A 1 38  ? 38.676 39.503 10.021  1.00  30.52 ? 32   VAL A CB    1 
ATOM   266  C  CG1   . VAL A 1 38  ? 39.103 39.134 11.424  1.00  29.20 ? 32   VAL A CG1   1 
ATOM   267  C  CG2   . VAL A 1 38  ? 37.217 39.863 10.004  1.00  30.23 ? 32   VAL A CG2   1 
ATOM   268  N  N     . PHE A 1 39  ? 41.887 41.208 9.426   1.00  30.21 ? 33   PHE A N     1 
ATOM   269  C  CA    . PHE A 1 39  ? 43.309 40.919 9.256   1.00  31.83 ? 33   PHE A CA    1 
ATOM   270  C  C     . PHE A 1 39  ? 43.924 40.208 10.462  1.00  33.71 ? 33   PHE A C     1 
ATOM   271  O  O     . PHE A 1 39  ? 44.203 40.840 11.478  1.00  34.23 ? 33   PHE A O     1 
ATOM   272  C  CB    . PHE A 1 39  ? 44.070 42.217 8.970   1.00  29.04 ? 33   PHE A CB    1 
ATOM   273  C  CG    . PHE A 1 39  ? 43.582 42.944 7.753   1.00  29.23 ? 33   PHE A CG    1 
ATOM   274  C  CD1   . PHE A 1 39  ? 42.478 43.796 7.830   1.00  28.82 ? 33   PHE A CD1   1 
ATOM   275  C  CD2   . PHE A 1 39  ? 44.198 42.745 6.514   1.00  27.46 ? 33   PHE A CD2   1 
ATOM   276  C  CE1   . PHE A 1 39  ? 41.989 44.441 6.689   1.00  28.20 ? 33   PHE A CE1   1 
ATOM   277  C  CE2   . PHE A 1 39  ? 43.720 43.384 5.364   1.00  28.49 ? 33   PHE A CE2   1 
ATOM   278  C  CZ    . PHE A 1 39  ? 42.610 44.234 5.453   1.00  28.50 ? 33   PHE A CZ    1 
ATOM   279  N  N     . SER A 1 40  ? 44.159 38.901 10.334  1.00  35.07 ? 34   SER A N     1 
ATOM   280  C  CA    . SER A 1 40  ? 44.716 38.102 11.426  1.00  37.68 ? 34   SER A CA    1 
ATOM   281  C  C     . SER A 1 40  ? 46.107 38.523 11.913  1.00  38.96 ? 34   SER A C     1 
ATOM   282  O  O     . SER A 1 40  ? 46.516 38.152 13.015  1.00  39.38 ? 34   SER A O     1 
ATOM   283  C  CB    . SER A 1 40  ? 44.730 36.616 11.045  1.00  39.28 ? 34   SER A CB    1 
ATOM   284  O  OG    . SER A 1 40  ? 45.622 36.357 9.974   1.00  43.80 ? 34   SER A OG    1 
ATOM   285  N  N     . GLY A 1 41  ? 46.838 39.276 11.097  1.00  40.20 ? 35   GLY A N     1 
ATOM   286  C  CA    . GLY A 1 41  ? 48.153 39.739 11.507  1.00  41.53 ? 35   GLY A CA    1 
ATOM   287  C  C     . GLY A 1 41  ? 49.371 38.850 11.283  1.00  43.86 ? 35   GLY A C     1 
ATOM   288  O  O     . GLY A 1 41  ? 50.496 39.314 11.458  1.00  45.12 ? 35   GLY A O     1 
ATOM   289  N  N     . ARG A 1 42  ? 49.186 37.589 10.906  1.00  44.42 ? 36   ARG A N     1 
ATOM   290  C  CA    . ARG A 1 42  ? 50.339 36.717 10.687  1.00  46.42 ? 36   ARG A CA    1 
ATOM   291  C  C     . ARG A 1 42  ? 51.231 37.237 9.544   1.00  48.59 ? 36   ARG A C     1 
ATOM   292  O  O     . ARG A 1 42  ? 52.442 37.016 9.544   1.00  49.24 ? 36   ARG A O     1 
ATOM   293  C  CB    . ARG A 1 42  ? 49.878 35.281 10.390  1.00  45.75 ? 36   ARG A CB    1 
ATOM   294  C  CG    . ARG A 1 42  ? 49.204 34.599 11.568  1.00  46.38 ? 36   ARG A CG    1 
ATOM   295  C  CD    . ARG A 1 42  ? 48.521 33.292 11.181  1.00  46.96 ? 36   ARG A CD    1 
ATOM   296  N  NE    . ARG A 1 42  ? 49.416 32.137 11.178  1.00  48.20 ? 36   ARG A NE    1 
ATOM   297  C  CZ    . ARG A 1 42  ? 49.942 31.587 12.272  1.00  48.37 ? 36   ARG A CZ    1 
ATOM   298  N  NH1   . ARG A 1 42  ? 49.667 32.085 13.472  1.00  48.52 ? 36   ARG A NH1   1 
ATOM   299  N  NH2   . ARG A 1 42  ? 50.741 30.531 12.168  1.00  49.56 ? 36   ARG A NH2   1 
ATOM   300  N  N     . PHE A 1 43  ? 50.632 37.931 8.577   1.00  48.83 ? 37   PHE A N     1 
ATOM   301  C  CA    . PHE A 1 43  ? 51.378 38.482 7.445   1.00  49.18 ? 37   PHE A CA    1 
ATOM   302  C  C     . PHE A 1 43  ? 50.514 39.390 6.559   1.00  51.90 ? 37   PHE A C     1 
ATOM   303  O  O     . PHE A 1 43  ? 49.281 39.285 6.548   1.00  52.57 ? 37   PHE A O     1 
ATOM   304  C  CB    . PHE A 1 43  ? 52.001 37.344 6.610   1.00  43.49 ? 37   PHE A CB    1 
ATOM   305  C  CG    . PHE A 1 43  ? 51.004 36.354 6.060   1.00  40.19 ? 37   PHE A CG    1 
ATOM   306  C  CD1   . PHE A 1 43  ? 50.248 36.650 4.923   1.00  39.28 ? 37   PHE A CD1   1 
ATOM   307  C  CD2   . PHE A 1 43  ? 50.817 35.121 6.682   1.00  39.31 ? 37   PHE A CD2   1 
ATOM   308  C  CE1   . PHE A 1 43  ? 49.322 35.734 4.412   1.00  37.24 ? 37   PHE A CE1   1 
ATOM   309  C  CE2   . PHE A 1 43  ? 49.895 34.200 6.179   1.00  38.10 ? 37   PHE A CE2   1 
ATOM   310  C  CZ    . PHE A 1 43  ? 49.146 34.507 5.042   1.00  37.36 ? 37   PHE A CZ    1 
ATOM   311  N  N     . GLU A 1 44  ? 51.183 40.279 5.825   1.00  53.82 ? 38   GLU A N     1 
ATOM   312  C  CA    . GLU A 1 44  ? 50.536 41.238 4.925   1.00  55.17 ? 38   GLU A CA    1 
ATOM   313  C  C     . GLU A 1 44  ? 49.013 41.305 4.989   1.00  53.53 ? 38   GLU A C     1 
ATOM   314  O  O     . GLU A 1 44  ? 48.428 42.171 5.661   1.00  54.07 ? 38   GLU A O     1 
ATOM   315  C  CB    . GLU A 1 44  ? 50.947 40.966 3.473   1.00  58.24 ? 38   GLU A CB    1 
ATOM   316  C  CG    . GLU A 1 44  ? 52.148 41.782 2.974   1.00  63.40 ? 38   GLU A CG    1 
ATOM   317  C  CD    . GLU A 1 44  ? 51.912 43.297 2.991   1.00  65.48 ? 38   GLU A CD    1 
ATOM   318  O  OE1   . GLU A 1 44  ? 50.831 43.748 2.551   1.00  66.57 ? 38   GLU A OE1   1 
ATOM   319  O  OE2   . GLU A 1 44  ? 52.818 44.044 3.430   1.00  66.97 ? 38   GLU A OE2   1 
ATOM   320  N  N     . ASP A 1 45  ? 48.375 40.388 4.271   1.00  50.13 ? 39   ASP A N     1 
ATOM   321  C  CA    . ASP A 1 45  ? 46.924 40.351 4.221   1.00  46.81 ? 39   ASP A CA    1 
ATOM   322  C  C     . ASP A 1 45  ? 46.379 39.041 4.768   1.00  43.53 ? 39   ASP A C     1 
ATOM   323  O  O     . ASP A 1 45  ? 45.414 38.477 4.228   1.00  43.56 ? 39   ASP A O     1 
ATOM   324  C  CB    . ASP A 1 45  ? 46.452 40.522 2.779   1.00  48.09 ? 39   ASP A CB    1 
ATOM   325  C  CG    . ASP A 1 45  ? 47.023 41.762 2.119   1.00  49.48 ? 39   ASP A CG    1 
ATOM   326  O  OD1   . ASP A 1 45  ? 46.683 42.890 2.556   1.00  48.77 ? 39   ASP A OD1   1 
ATOM   327  O  OD2   . ASP A 1 45  ? 47.821 41.600 1.166   1.00  49.09 ? 39   ASP A OD2   1 
ATOM   328  N  N     . SER A 1 46  ? 46.998 38.529 5.822   1.00  38.31 ? 40   SER A N     1 
ATOM   329  C  CA    . SER A 1 46  ? 46.499 37.288 6.396   1.00  34.90 ? 40   SER A CA    1 
ATOM   330  C  C     . SER A 1 46  ? 45.125 37.591 6.993   1.00  32.42 ? 40   SER A C     1 
ATOM   331  O  O     . SER A 1 46  ? 44.892 38.684 7.509   1.00  29.49 ? 40   SER A O     1 
ATOM   332  C  CB    . SER A 1 46  ? 47.451 36.781 7.480   1.00  34.82 ? 40   SER A CB    1 
ATOM   333  O  OG    . SER A 1 46  ? 47.551 37.697 8.552   1.00  36.15 ? 40   SER A OG    1 
ATOM   334  N  N     . GLY A 1 47  ? 44.211 36.634 6.913   1.00  31.21 ? 41   GLY A N     1 
ATOM   335  C  CA    . GLY A 1 47  ? 42.887 36.863 7.466   1.00  29.83 ? 41   GLY A CA    1 
ATOM   336  C  C     . GLY A 1 47  ? 41.766 36.558 6.485   1.00  28.55 ? 41   GLY A C     1 
ATOM   337  O  O     . GLY A 1 47  ? 42.030 36.201 5.325   1.00  28.63 ? 41   GLY A O     1 
ATOM   338  N  N     . ALA A 1 48  ? 40.519 36.707 6.930   1.00  25.51 ? 42   ALA A N     1 
ATOM   339  C  CA    . ALA A 1 48  ? 39.387 36.418 6.061   1.00  24.65 ? 42   ALA A CA    1 
ATOM   340  C  C     . ALA A 1 48  ? 38.443 37.594 5.796   1.00  24.81 ? 42   ALA A C     1 
ATOM   341  O  O     . ALA A 1 48  ? 38.561 38.656 6.391   1.00  25.74 ? 42   ALA A O     1 
ATOM   342  C  CB    . ALA A 1 48  ? 38.612 35.237 6.614   1.00  23.04 ? 42   ALA A CB    1 
ATOM   343  N  N     . VAL A 1 49  ? 37.493 37.384 4.895   1.00  24.52 ? 43   VAL A N     1 
ATOM   344  C  CA    . VAL A 1 49  ? 36.544 38.424 4.520   1.00  25.36 ? 43   VAL A CA    1 
ATOM   345  C  C     . VAL A 1 49  ? 35.265 38.378 5.354   1.00  27.19 ? 43   VAL A C     1 
ATOM   346  O  O     . VAL A 1 49  ? 34.519 37.396 5.300   1.00  29.19 ? 43   VAL A O     1 
ATOM   347  C  CB    . VAL A 1 49  ? 36.149 38.303 3.022   1.00  22.86 ? 43   VAL A CB    1 
ATOM   348  C  CG1   . VAL A 1 49  ? 35.077 39.332 2.688   1.00  21.52 ? 43   VAL A CG1   1 
ATOM   349  C  CG2   . VAL A 1 49  ? 37.382 38.475 2.129   1.00  20.25 ? 43   VAL A CG2   1 
ATOM   350  N  N     . ALA A 1 50  ? 35.014 39.431 6.129   1.00  26.46 ? 44   ALA A N     1 
ATOM   351  C  CA    . ALA A 1 50  ? 33.794 39.480 6.928   1.00  27.45 ? 44   ALA A CA    1 
ATOM   352  C  C     . ALA A 1 50  ? 32.633 39.453 5.931   1.00  27.42 ? 44   ALA A C     1 
ATOM   353  O  O     . ALA A 1 50  ? 31.705 38.663 6.050   1.00  26.12 ? 44   ALA A O     1 
ATOM   354  C  CB    . ALA A 1 50  ? 33.752 40.742 7.749   1.00  28.40 ? 44   ALA A CB    1 
ATOM   355  N  N     . THR A 1 51  ? 32.703 40.314 4.927   1.00  26.75 ? 45   THR A N     1 
ATOM   356  C  CA    . THR A 1 51  ? 31.675 40.357 3.896   1.00  26.27 ? 45   THR A CA    1 
ATOM   357  C  C     . THR A 1 51  ? 32.030 41.367 2.812   1.00  25.31 ? 45   THR A C     1 
ATOM   358  O  O     . THR A 1 51  ? 32.904 42.226 2.992   1.00  25.55 ? 45   THR A O     1 
ATOM   359  C  CB    . THR A 1 51  ? 30.305 40.732 4.459   1.00  27.33 ? 45   THR A CB    1 
ATOM   360  O  OG1   . THR A 1 51  ? 29.321 40.482 3.452   1.00  25.64 ? 45   THR A OG1   1 
ATOM   361  C  CG2   . THR A 1 51  ? 30.267 42.226 4.857   1.00  25.85 ? 45   THR A CG2   1 
ATOM   362  N  N     . ALA A 1 52  ? 31.355 41.264 1.683   1.00  22.82 ? 46   ALA A N     1 
ATOM   363  C  CA    . ALA A 1 52  ? 31.635 42.168 0.589   1.00  24.63 ? 46   ALA A CA    1 
ATOM   364  C  C     . ALA A 1 52  ? 30.322 42.657 0.044   1.00  26.23 ? 46   ALA A C     1 
ATOM   365  O  O     . ALA A 1 52  ? 29.295 42.019 0.267   1.00  27.42 ? 46   ALA A O     1 
ATOM   366  C  CB    . ALA A 1 52  ? 32.417 41.440 -0.514  1.00  25.18 ? 46   ALA A CB    1 
ATOM   367  N  N     . ASN A 1 53  ? 30.338 43.787 -0.654  1.00  26.42 ? 47   ASN A N     1 
ATOM   368  C  CA    . ASN A 1 53  ? 29.104 44.281 -1.236  1.00  27.65 ? 47   ASN A CA    1 
ATOM   369  C  C     . ASN A 1 53  ? 28.875 43.481 -2.510  1.00  29.06 ? 47   ASN A C     1 
ATOM   370  O  O     . ASN A 1 53  ? 29.781 42.785 -2.976  1.00  27.28 ? 47   ASN A O     1 
ATOM   371  C  CB    . ASN A 1 53  ? 29.196 45.764 -1.548  1.00  27.43 ? 47   ASN A CB    1 
ATOM   372  C  CG    . ASN A 1 53  ? 30.239 46.074 -2.588  1.00  26.58 ? 47   ASN A CG    1 
ATOM   373  O  OD1   . ASN A 1 53  ? 30.776 45.174 -3.217  1.00  27.12 ? 47   ASN A OD1   1 
ATOM   374  N  ND2   . ASN A 1 53  ? 30.520 47.360 -2.787  1.00  26.70 ? 47   ASN A ND2   1 
ATOM   375  N  N     . TYR A 1 54  ? 27.674 43.580 -3.070  1.00  31.80 ? 48   TYR A N     1 
ATOM   376  C  CA    . TYR A 1 54  ? 27.327 42.806 -4.253  1.00  34.07 ? 48   TYR A CA    1 
ATOM   377  C  C     . TYR A 1 54  ? 28.236 42.970 -5.460  1.00  35.67 ? 48   TYR A C     1 
ATOM   378  O  O     . TYR A 1 54  ? 28.469 42.002 -6.187  1.00  35.91 ? 48   TYR A O     1 
ATOM   379  C  CB    . TYR A 1 54  ? 25.870 43.058 -4.629  1.00  35.14 ? 48   TYR A CB    1 
ATOM   380  C  CG    . TYR A 1 54  ? 24.905 42.454 -3.635  1.00  40.41 ? 48   TYR A CG    1 
ATOM   381  C  CD1   . TYR A 1 54  ? 24.416 43.200 -2.572  1.00  43.35 ? 48   TYR A CD1   1 
ATOM   382  C  CD2   . TYR A 1 54  ? 24.508 41.116 -3.738  1.00  43.38 ? 48   TYR A CD2   1 
ATOM   383  C  CE1   . TYR A 1 54  ? 23.552 42.628 -1.628  1.00  45.57 ? 48   TYR A CE1   1 
ATOM   384  C  CE2   . TYR A 1 54  ? 23.648 40.538 -2.812  1.00  45.37 ? 48   TYR A CE2   1 
ATOM   385  C  CZ    . TYR A 1 54  ? 23.172 41.302 -1.758  1.00  47.24 ? 48   TYR A CZ    1 
ATOM   386  O  OH    . TYR A 1 54  ? 22.292 40.759 -0.847  1.00  48.46 ? 48   TYR A OH    1 
ATOM   387  N  N     . GLU A 1 55  ? 28.756 44.172 -5.684  1.00  36.10 ? 49   GLU A N     1 
ATOM   388  C  CA    . GLU A 1 55  ? 29.654 44.373 -6.815  1.00  37.34 ? 49   GLU A CA    1 
ATOM   389  C  C     . GLU A 1 55  ? 30.769 43.319 -6.767  1.00  35.54 ? 49   GLU A C     1 
ATOM   390  O  O     . GLU A 1 55  ? 31.022 42.612 -7.748  1.00  36.65 ? 49   GLU A O     1 
ATOM   391  C  CB    . GLU A 1 55  ? 30.271 45.777 -6.779  1.00  41.47 ? 49   GLU A CB    1 
ATOM   392  C  CG    . GLU A 1 55  ? 29.330 46.902 -7.206  1.00  47.21 ? 49   GLU A CG    1 
ATOM   393  C  CD    . GLU A 1 55  ? 28.099 47.029 -6.306  1.00  51.74 ? 49   GLU A CD    1 
ATOM   394  O  OE1   . GLU A 1 55  ? 28.247 47.365 -5.102  1.00  52.18 ? 49   GLU A OE1   1 
ATOM   395  O  OE2   . GLU A 1 55  ? 26.980 46.790 -6.816  1.00  53.77 ? 49   GLU A OE2   1 
ATOM   396  N  N     . ALA A 1 56  ? 31.420 43.212 -5.614  1.00  31.40 ? 50   ALA A N     1 
ATOM   397  C  CA    . ALA A 1 56  ? 32.501 42.264 -5.422  1.00  28.88 ? 50   ALA A CA    1 
ATOM   398  C  C     . ALA A 1 56  ? 32.013 40.830 -5.274  1.00  29.58 ? 50   ALA A C     1 
ATOM   399  O  O     . ALA A 1 56  ? 32.611 39.896 -5.803  1.00  31.43 ? 50   ALA A O     1 
ATOM   400  C  CB    . ALA A 1 56  ? 33.312 42.657 -4.211  1.00  27.01 ? 50   ALA A CB    1 
ATOM   401  N  N     . ARG A 1 57  ? 30.925 40.643 -4.552  1.00  29.59 ? 51   ARG A N     1 
ATOM   402  C  CA    . ARG A 1 57  ? 30.401 39.304 -4.360  1.00  30.74 ? 51   ARG A CA    1 
ATOM   403  C  C     . ARG A 1 57  ? 30.164 38.602 -5.712  1.00  32.88 ? 51   ARG A C     1 
ATOM   404  O  O     . ARG A 1 57  ? 30.053 37.379 -5.785  1.00  33.22 ? 51   ARG A O     1 
ATOM   405  C  CB    . ARG A 1 57  ? 29.107 39.389 -3.541  1.00  30.28 ? 51   ARG A CB    1 
ATOM   406  C  CG    . ARG A 1 57  ? 28.731 38.106 -2.836  1.00  30.47 ? 51   ARG A CG    1 
ATOM   407  C  CD    . ARG A 1 57  ? 27.488 38.289 -2.023  1.00  29.83 ? 51   ARG A CD    1 
ATOM   408  N  NE    . ARG A 1 57  ? 27.692 39.205 -0.907  1.00  32.09 ? 51   ARG A NE    1 
ATOM   409  C  CZ    . ARG A 1 57  ? 26.804 39.352 0.062   1.00  31.58 ? 51   ARG A CZ    1 
ATOM   410  N  NH1   . ARG A 1 57  ? 25.705 38.637 -0.007  1.00  30.22 ? 51   ARG A NH1   1 
ATOM   411  N  NH2   . ARG A 1 57  ? 27.016 40.174 1.078   1.00  28.95 ? 51   ARG A NH2   1 
ATOM   412  N  N     . LYS A 1 58  ? 30.106 39.395 -6.779  1.00  35.42 ? 52   LYS A N     1 
ATOM   413  C  CA    . LYS A 1 58  ? 29.878 38.906 -8.139  1.00  36.01 ? 52   LYS A CA    1 
ATOM   414  C  C     . LYS A 1 58  ? 31.011 38.053 -8.703  1.00  36.12 ? 52   LYS A C     1 
ATOM   415  O  O     . LYS A 1 58  ? 30.788 37.205 -9.569  1.00  36.96 ? 52   LYS A O     1 
ATOM   416  C  CB    . LYS A 1 58  ? 29.655 40.092 -9.075  1.00  38.50 ? 52   LYS A CB    1 
ATOM   417  C  CG    . LYS A 1 58  ? 28.202 40.429 -9.373  1.00  40.56 ? 52   LYS A CG    1 
ATOM   418  C  CD    . LYS A 1 58  ? 28.059 41.924 -9.651  1.00  42.68 ? 52   LYS A CD    1 
ATOM   419  C  CE    . LYS A 1 58  ? 29.173 42.449 -10.562 1.00  44.39 ? 52   LYS A CE    1 
ATOM   420  N  NZ    . LYS A 1 58  ? 29.315 43.936 -10.525 1.00  46.36 ? 52   LYS A NZ    1 
ATOM   421  N  N     . PHE A 1 59  ? 32.231 38.282 -8.248  1.00  34.25 ? 53   PHE A N     1 
ATOM   422  C  CA    . PHE A 1 59  ? 33.333 37.497 -8.769  1.00  33.26 ? 53   PHE A CA    1 
ATOM   423  C  C     . PHE A 1 59  ? 33.824 36.468 -7.773  1.00  34.45 ? 53   PHE A C     1 
ATOM   424  O  O     . PHE A 1 59  ? 34.995 36.063 -7.804  1.00  33.96 ? 53   PHE A O     1 
ATOM   425  C  CB    . PHE A 1 59  ? 34.474 38.410 -9.189  1.00  32.79 ? 53   PHE A CB    1 
ATOM   426  C  CG    . PHE A 1 59  ? 34.043 39.528 -10.092 1.00  32.65 ? 53   PHE A CG    1 
ATOM   427  C  CD1   . PHE A 1 59  ? 33.516 40.700 -9.562  1.00  32.09 ? 53   PHE A CD1   1 
ATOM   428  C  CD2   . PHE A 1 59  ? 34.141 39.402 -11.474 1.00  31.84 ? 53   PHE A CD2   1 
ATOM   429  C  CE1   . PHE A 1 59  ? 33.097 41.731 -10.390 1.00  32.91 ? 53   PHE A CE1   1 
ATOM   430  C  CE2   . PHE A 1 59  ? 33.722 40.429 -12.310 1.00  32.80 ? 53   PHE A CE2   1 
ATOM   431  C  CZ    . PHE A 1 59  ? 33.198 41.594 -11.769 1.00  32.14 ? 53   PHE A CZ    1 
ATOM   432  N  N     . GLY A 1 60  ? 32.927 36.050 -6.881  1.00  33.72 ? 54   GLY A N     1 
ATOM   433  C  CA    . GLY A 1 60  ? 33.293 35.051 -5.897  1.00  33.88 ? 54   GLY A CA    1 
ATOM   434  C  C     . GLY A 1 60  ? 33.853 35.581 -4.589  1.00  35.23 ? 54   GLY A C     1 
ATOM   435  O  O     . GLY A 1 60  ? 34.115 34.801 -3.661  1.00  36.25 ? 54   GLY A O     1 
ATOM   436  N  N     . VAL A 1 61  ? 34.048 36.895 -4.496  1.00  35.17 ? 55   VAL A N     1 
ATOM   437  C  CA    . VAL A 1 61  ? 34.576 37.464 -3.256  1.00  33.21 ? 55   VAL A CA    1 
ATOM   438  C  C     . VAL A 1 61  ? 33.467 37.510 -2.225  1.00  32.29 ? 55   VAL A C     1 
ATOM   439  O  O     . VAL A 1 61  ? 32.480 38.209 -2.407  1.00  30.45 ? 55   VAL A O     1 
ATOM   440  C  CB    . VAL A 1 61  ? 35.126 38.874 -3.471  1.00  32.96 ? 55   VAL A CB    1 
ATOM   441  C  CG1   . VAL A 1 61  ? 35.499 39.491 -2.131  1.00  33.52 ? 55   VAL A CG1   1 
ATOM   442  C  CG2   . VAL A 1 61  ? 36.352 38.807 -4.400  1.00  32.98 ? 55   VAL A CG2   1 
ATOM   443  N  N     . LYS A 1 62  ? 33.632 36.758 -1.142  1.00  33.63 ? 56   LYS A N     1 
ATOM   444  C  CA    . LYS A 1 62  ? 32.611 36.695 -0.107  1.00  33.65 ? 56   LYS A CA    1 
ATOM   445  C  C     . LYS A 1 62  ? 33.114 36.285 1.274   1.00  33.81 ? 56   LYS A C     1 
ATOM   446  O  O     . LYS A 1 62  ? 34.292 35.936 1.464   1.00  33.72 ? 56   LYS A O     1 
ATOM   447  C  CB    . LYS A 1 62  ? 31.521 35.729 -0.548  1.00  34.96 ? 56   LYS A CB    1 
ATOM   448  C  CG    . LYS A 1 62  ? 32.050 34.360 -0.895  1.00  37.72 ? 56   LYS A CG    1 
ATOM   449  C  CD    . LYS A 1 62  ? 30.974 33.494 -1.518  1.00  39.97 ? 56   LYS A CD    1 
ATOM   450  C  CE    . LYS A 1 62  ? 31.442 32.050 -1.680  1.00  42.55 ? 56   LYS A CE    1 
ATOM   451  N  NZ    . LYS A 1 62  ? 32.731 31.947 -2.426  1.00  46.03 ? 56   LYS A NZ    1 
ATOM   452  N  N     . ALA A 1 63  ? 32.189 36.332 2.230   1.00  32.87 ? 57   ALA A N     1 
ATOM   453  C  CA    . ALA A 1 63  ? 32.456 35.994 3.615   1.00  31.49 ? 57   ALA A CA    1 
ATOM   454  C  C     . ALA A 1 63  ? 33.125 34.644 3.744   1.00  31.26 ? 57   ALA A C     1 
ATOM   455  O  O     . ALA A 1 63  ? 32.648 33.653 3.203   1.00  31.02 ? 57   ALA A O     1 
ATOM   456  C  CB    . ALA A 1 63  ? 31.165 36.004 4.389   1.00  30.01 ? 57   ALA A CB    1 
ATOM   457  N  N     . GLY A 1 64  ? 34.247 34.611 4.449   1.00  31.62 ? 58   GLY A N     1 
ATOM   458  C  CA    . GLY A 1 64  ? 34.935 33.350 4.648   1.00  31.47 ? 58   GLY A CA    1 
ATOM   459  C  C     . GLY A 1 64  ? 36.186 33.080 3.834   1.00  32.52 ? 58   GLY A C     1 
ATOM   460  O  O     . GLY A 1 64  ? 37.063 32.353 4.314   1.00  33.70 ? 58   GLY A O     1 
ATOM   461  N  N     . ILE A 1 65  ? 36.299 33.622 2.618   1.00  31.64 ? 59   ILE A N     1 
ATOM   462  C  CA    . ILE A 1 65  ? 37.510 33.350 1.839   1.00  31.50 ? 59   ILE A CA    1 
ATOM   463  C  C     . ILE A 1 65  ? 38.661 34.191 2.352   1.00  30.54 ? 59   ILE A C     1 
ATOM   464  O  O     . ILE A 1 65  ? 38.458 35.240 2.951   1.00  29.72 ? 59   ILE A O     1 
ATOM   465  C  CB    . ILE A 1 65  ? 37.345 33.626 0.333   1.00  31.88 ? 59   ILE A CB    1 
ATOM   466  C  CG1   . ILE A 1 65  ? 37.524 35.111 0.046   1.00  31.67 ? 59   ILE A CG1   1 
ATOM   467  C  CG2   . ILE A 1 65  ? 35.980 33.143 -0.137  1.00  33.17 ? 59   ILE A CG2   1 
ATOM   468  C  CD1   . ILE A 1 65  ? 37.500 35.436 -1.431  1.00  33.57 ? 59   ILE A CD1   1 
ATOM   469  N  N     . PRO A 1 66  ? 39.895 33.728 2.133   1.00  30.52 ? 60   PRO A N     1 
ATOM   470  C  CA    . PRO A 1 66  ? 41.079 34.458 2.586   1.00  30.24 ? 60   PRO A CA    1 
ATOM   471  C  C     . PRO A 1 66  ? 41.185 35.775 1.843   1.00  30.54 ? 60   PRO A C     1 
ATOM   472  O  O     . PRO A 1 66  ? 40.880 35.837 0.655   1.00  31.04 ? 60   PRO A O     1 
ATOM   473  C  CB    . PRO A 1 66  ? 42.223 33.510 2.242   1.00  28.80 ? 60   PRO A CB    1 
ATOM   474  C  CG    . PRO A 1 66  ? 41.577 32.161 2.339   1.00  29.25 ? 60   PRO A CG    1 
ATOM   475  C  CD    . PRO A 1 66  ? 40.272 32.402 1.621   1.00  29.45 ? 60   PRO A CD    1 
ATOM   476  N  N     . ILE A 1 67  ? 41.605 36.822 2.544   1.00  29.53 ? 61   ILE A N     1 
ATOM   477  C  CA    . ILE A 1 67  ? 41.743 38.128 1.931   1.00  29.99 ? 61   ILE A CA    1 
ATOM   478  C  C     . ILE A 1 67  ? 42.640 38.000 0.708   1.00  32.68 ? 61   ILE A C     1 
ATOM   479  O  O     . ILE A 1 67  ? 42.316 38.490 -0.378  1.00  33.48 ? 61   ILE A O     1 
ATOM   480  C  CB    . ILE A 1 67  ? 42.337 39.114 2.935   1.00  29.09 ? 61   ILE A CB    1 
ATOM   481  C  CG1   . ILE A 1 67  ? 41.486 39.080 4.213   1.00  28.02 ? 61   ILE A CG1   1 
ATOM   482  C  CG2   . ILE A 1 67  ? 42.396 40.507 2.342   1.00  25.35 ? 61   ILE A CG2   1 
ATOM   483  C  CD1   . ILE A 1 67  ? 41.982 39.966 5.308   1.00  25.80 ? 61   ILE A CD1   1 
ATOM   484  N  N     . VAL A 1 68  ? 43.756 37.303 0.884   1.00  33.29 ? 62   VAL A N     1 
ATOM   485  C  CA    . VAL A 1 68  ? 44.714 37.090 -0.194  1.00  33.04 ? 62   VAL A CA    1 
ATOM   486  C  C     . VAL A 1 68  ? 44.070 36.537 -1.456  1.00  33.08 ? 62   VAL A C     1 
ATOM   487  O  O     . VAL A 1 68  ? 44.478 36.880 -2.565  1.00  32.82 ? 62   VAL A O     1 
ATOM   488  C  CB    . VAL A 1 68  ? 45.828 36.131 0.250   1.00  32.38 ? 62   VAL A CB    1 
ATOM   489  C  CG1   . VAL A 1 68  ? 46.689 35.763 -0.931  1.00  33.47 ? 62   VAL A CG1   1 
ATOM   490  C  CG2   . VAL A 1 68  ? 46.672 36.791 1.330   1.00  32.70 ? 62   VAL A CG2   1 
ATOM   491  N  N     . GLU A 1 69  ? 43.071 35.680 -1.284  1.00  33.19 ? 63   GLU A N     1 
ATOM   492  C  CA    . GLU A 1 69  ? 42.390 35.096 -2.423  1.00  34.74 ? 63   GLU A CA    1 
ATOM   493  C  C     . GLU A 1 69  ? 41.494 36.131 -3.099  1.00  35.05 ? 63   GLU A C     1 
ATOM   494  O  O     . GLU A 1 69  ? 41.387 36.175 -4.325  1.00  35.91 ? 63   GLU A O     1 
ATOM   495  C  CB    . GLU A 1 69  ? 41.576 33.890 -1.974  1.00  38.34 ? 63   GLU A CB    1 
ATOM   496  C  CG    . GLU A 1 69  ? 42.440 32.773 -1.427  1.00  45.66 ? 63   GLU A CG    1 
ATOM   497  C  CD    . GLU A 1 69  ? 43.459 32.279 -2.444  1.00  49.77 ? 63   GLU A CD    1 
ATOM   498  O  OE1   . GLU A 1 69  ? 44.416 31.577 -2.033  1.00  51.38 ? 63   GLU A OE1   1 
ATOM   499  O  OE2   . GLU A 1 69  ? 43.297 32.587 -3.651  1.00  51.99 ? 63   GLU A OE2   1 
ATOM   500  N  N     . ALA A 1 70  ? 40.865 36.977 -2.292  1.00  33.77 ? 64   ALA A N     1 
ATOM   501  C  CA    . ALA A 1 70  ? 40.003 38.009 -2.823  1.00  32.24 ? 64   ALA A CA    1 
ATOM   502  C  C     . ALA A 1 70  ? 40.886 38.986 -3.580  1.00  32.25 ? 64   ALA A C     1 
ATOM   503  O  O     . ALA A 1 70  ? 40.532 39.439 -4.663  1.00  31.87 ? 64   ALA A O     1 
ATOM   504  C  CB    . ALA A 1 70  ? 39.276 38.718 -1.696  1.00  32.71 ? 64   ALA A CB    1 
ATOM   505  N  N     . LYS A 1 71  ? 42.039 39.299 -2.997  1.00  32.65 ? 65   LYS A N     1 
ATOM   506  C  CA    . LYS A 1 71  ? 42.986 40.213 -3.614  1.00  33.63 ? 65   LYS A CA    1 
ATOM   507  C  C     . LYS A 1 71  ? 43.385 39.735 -5.012  1.00  35.13 ? 65   LYS A C     1 
ATOM   508  O  O     . LYS A 1 71  ? 43.532 40.539 -5.938  1.00  34.98 ? 65   LYS A O     1 
ATOM   509  C  CB    . LYS A 1 71  ? 44.243 40.345 -2.752  1.00  33.21 ? 65   LYS A CB    1 
ATOM   510  C  CG    . LYS A 1 71  ? 44.465 41.752 -2.171  1.00  35.98 ? 65   LYS A CG    1 
ATOM   511  C  CD    . LYS A 1 71  ? 43.918 41.890 -0.744  1.00  38.43 ? 65   LYS A CD    1 
ATOM   512  C  CE    . LYS A 1 71  ? 44.105 43.304 -0.182  1.00  37.57 ? 65   LYS A CE    1 
ATOM   513  N  NZ    . LYS A 1 71  ? 45.529 43.725 -0.089  1.00  34.05 ? 65   LYS A NZ    1 
ATOM   514  N  N     . LYS A 1 72  ? 43.557 38.426 -5.166  1.00  35.40 ? 66   LYS A N     1 
ATOM   515  C  CA    . LYS A 1 72  ? 43.953 37.871 -6.451  1.00  36.97 ? 66   LYS A CA    1 
ATOM   516  C  C     . LYS A 1 72  ? 42.888 38.092 -7.526  1.00  36.13 ? 66   LYS A C     1 
ATOM   517  O  O     . LYS A 1 72  ? 43.207 38.378 -8.681  1.00  36.31 ? 66   LYS A O     1 
ATOM   518  C  CB    . LYS A 1 72  ? 44.269 36.378 -6.297  1.00  39.26 ? 66   LYS A CB    1 
ATOM   519  C  CG    . LYS A 1 72  ? 45.689 36.097 -5.769  1.00  43.89 ? 66   LYS A CG    1 
ATOM   520  C  CD    . LYS A 1 72  ? 45.902 34.614 -5.449  1.00  47.07 ? 66   LYS A CD    1 
ATOM   521  C  CE    . LYS A 1 72  ? 47.384 34.240 -5.395  1.00  49.33 ? 66   LYS A CE    1 
ATOM   522  N  NZ    . LYS A 1 72  ? 48.014 34.136 -6.761  1.00  49.16 ? 66   LYS A NZ    1 
ATOM   523  N  N     . ILE A 1 73  ? 41.628 37.975 -7.122  1.00  33.96 ? 67   ILE A N     1 
ATOM   524  C  CA    . ILE A 1 73  ? 40.478 38.142 -8.007  1.00  32.80 ? 67   ILE A CA    1 
ATOM   525  C  C     . ILE A 1 73  ? 40.166 39.620 -8.291  1.00  33.95 ? 67   ILE A C     1 
ATOM   526  O  O     . ILE A 1 73  ? 39.960 40.027 -9.435  1.00  32.53 ? 67   ILE A O     1 
ATOM   527  C  CB    . ILE A 1 73  ? 39.237 37.491 -7.370  1.00  30.73 ? 67   ILE A CB    1 
ATOM   528  C  CG1   . ILE A 1 73  ? 39.450 35.986 -7.259  1.00  28.26 ? 67   ILE A CG1   1 
ATOM   529  C  CG2   . ILE A 1 73  ? 38.002 37.827 -8.161  1.00  30.28 ? 67   ILE A CG2   1 
ATOM   530  C  CD1   . ILE A 1 73  ? 38.482 35.301 -6.345  1.00  23.44 ? 67   ILE A CD1   1 
ATOM   531  N  N     . LEU A 1 74  ? 40.136 40.419 -7.235  1.00  33.95 ? 68   LEU A N     1 
ATOM   532  C  CA    . LEU A 1 74  ? 39.833 41.834 -7.355  1.00  34.42 ? 68   LEU A CA    1 
ATOM   533  C  C     . LEU A 1 74  ? 40.955 42.712 -6.807  1.00  34.44 ? 68   LEU A C     1 
ATOM   534  O  O     . LEU A 1 74  ? 40.762 43.451 -5.846  1.00  35.45 ? 68   LEU A O     1 
ATOM   535  C  CB    . LEU A 1 74  ? 38.539 42.139 -6.600  1.00  34.30 ? 68   LEU A CB    1 
ATOM   536  C  CG    . LEU A 1 74  ? 37.282 41.480 -7.170  1.00  34.33 ? 68   LEU A CG    1 
ATOM   537  C  CD1   . LEU A 1 74  ? 36.091 41.774 -6.269  1.00  34.26 ? 68   LEU A CD1   1 
ATOM   538  C  CD2   . LEU A 1 74  ? 37.040 41.994 -8.594  1.00  32.96 ? 68   LEU A CD2   1 
ATOM   539  N  N     . PRO A 1 75  ? 42.135 42.660 -7.429  1.00  34.91 ? 69   PRO A N     1 
ATOM   540  C  CA    . PRO A 1 75  ? 43.271 43.463 -6.974  1.00  34.77 ? 69   PRO A CA    1 
ATOM   541  C  C     . PRO A 1 75  ? 42.987 44.940 -6.714  1.00  35.61 ? 69   PRO A C     1 
ATOM   542  O  O     . PRO A 1 75  ? 43.603 45.543 -5.843  1.00  36.62 ? 69   PRO A O     1 
ATOM   543  C  CB    . PRO A 1 75  ? 44.290 43.266 -8.083  1.00  35.40 ? 69   PRO A CB    1 
ATOM   544  C  CG    . PRO A 1 75  ? 43.416 43.044 -9.294  1.00  35.84 ? 69   PRO A CG    1 
ATOM   545  C  CD    . PRO A 1 75  ? 42.412 42.073 -8.750  1.00  34.27 ? 69   PRO A CD    1 
ATOM   546  N  N     . ASN A 1 76  ? 42.054 45.534 -7.448  1.00  36.31 ? 70   ASN A N     1 
ATOM   547  C  CA    . ASN A 1 76  ? 41.773 46.957 -7.247  1.00  36.84 ? 70   ASN A CA    1 
ATOM   548  C  C     . ASN A 1 76  ? 40.500 47.318 -6.493  1.00  36.60 ? 70   ASN A C     1 
ATOM   549  O  O     . ASN A 1 76  ? 39.996 48.436 -6.606  1.00  36.88 ? 70   ASN A O     1 
ATOM   550  C  CB    . ASN A 1 76  ? 41.793 47.672 -8.589  1.00  37.96 ? 70   ASN A CB    1 
ATOM   551  C  CG    . ASN A 1 76  ? 43.172 47.707 -9.188  1.00  40.58 ? 70   ASN A CG    1 
ATOM   552  O  OD1   . ASN A 1 76  ? 44.064 48.386 -8.673  1.00  42.64 ? 70   ASN A OD1   1 
ATOM   553  N  ND2   . ASN A 1 76  ? 43.369 46.960 -10.270 1.00  39.73 ? 70   ASN A ND2   1 
ATOM   554  N  N     . ALA A 1 77  ? 39.981 46.381 -5.713  1.00  35.29 ? 71   ALA A N     1 
ATOM   555  C  CA    . ALA A 1 77  ? 38.784 46.654 -4.938  1.00  35.61 ? 71   ALA A CA    1 
ATOM   556  C  C     . ALA A 1 77  ? 39.209 47.437 -3.695  1.00  35.30 ? 71   ALA A C     1 
ATOM   557  O  O     . ALA A 1 77  ? 40.402 47.571 -3.414  1.00  36.07 ? 71   ALA A O     1 
ATOM   558  C  CB    . ALA A 1 77  ? 38.115 45.350 -4.547  1.00  33.88 ? 71   ALA A CB    1 
ATOM   559  N  N     . VAL A 1 78  ? 38.251 47.977 -2.959  1.00  33.33 ? 72   VAL A N     1 
ATOM   560  C  CA    . VAL A 1 78  ? 38.613 48.697 -1.757  1.00  31.86 ? 72   VAL A CA    1 
ATOM   561  C  C     . VAL A 1 78  ? 38.524 47.724 -0.579  1.00  33.56 ? 72   VAL A C     1 
ATOM   562  O  O     . VAL A 1 78  ? 37.476 47.090 -0.353  1.00  33.30 ? 72   VAL A O     1 
ATOM   563  C  CB    . VAL A 1 78  ? 37.670 49.848 -1.506  1.00  31.32 ? 72   VAL A CB    1 
ATOM   564  C  CG1   . VAL A 1 78  ? 38.151 50.641 -0.312  1.00  30.57 ? 72   VAL A CG1   1 
ATOM   565  C  CG2   . VAL A 1 78  ? 37.569 50.706 -2.740  1.00  29.66 ? 72   VAL A CG2   1 
ATOM   566  N  N     . TYR A 1 79  ? 39.625 47.591 0.161   1.00  33.44 ? 73   TYR A N     1 
ATOM   567  C  CA    . TYR A 1 79  ? 39.666 46.697 1.316   1.00  32.92 ? 73   TYR A CA    1 
ATOM   568  C  C     . TYR A 1 79  ? 39.679 47.463 2.641   1.00  32.69 ? 73   TYR A C     1 
ATOM   569  O  O     . TYR A 1 79  ? 40.598 48.240 2.927   1.00  33.12 ? 73   TYR A O     1 
ATOM   570  C  CB    . TYR A 1 79  ? 40.885 45.788 1.222   1.00  31.79 ? 73   TYR A CB    1 
ATOM   571  C  CG    . TYR A 1 79  ? 40.837 44.864 0.026   1.00  33.69 ? 73   TYR A CG    1 
ATOM   572  C  CD1   . TYR A 1 79  ? 41.116 45.335 -1.258  1.00  34.68 ? 73   TYR A CD1   1 
ATOM   573  C  CD2   . TYR A 1 79  ? 40.473 43.519 0.170   1.00  34.07 ? 73   TYR A CD2   1 
ATOM   574  C  CE1   . TYR A 1 79  ? 41.032 44.494 -2.367  1.00  34.05 ? 73   TYR A CE1   1 
ATOM   575  C  CE2   . TYR A 1 79  ? 40.386 42.670 -0.933  1.00  33.46 ? 73   TYR A CE2   1 
ATOM   576  C  CZ    . TYR A 1 79  ? 40.667 43.167 -2.192  1.00  33.71 ? 73   TYR A CZ    1 
ATOM   577  O  OH    . TYR A 1 79  ? 40.575 42.333 -3.274  1.00  35.11 ? 73   TYR A OH    1 
ATOM   578  N  N     . LEU A 1 80  ? 38.656 47.235 3.454   1.00  31.37 ? 74   LEU A N     1 
ATOM   579  C  CA    . LEU A 1 80  ? 38.554 47.923 4.733   1.00  31.29 ? 74   LEU A CA    1 
ATOM   580  C  C     . LEU A 1 80  ? 38.579 46.976 5.915   1.00  30.74 ? 74   LEU A C     1 
ATOM   581  O  O     . LEU A 1 80  ? 38.038 45.873 5.846   1.00  31.14 ? 74   LEU A O     1 
ATOM   582  C  CB    . LEU A 1 80  ? 37.271 48.738 4.783   1.00  31.64 ? 74   LEU A CB    1 
ATOM   583  C  CG    . LEU A 1 80  ? 37.056 49.640 3.569   1.00  33.27 ? 74   LEU A CG    1 
ATOM   584  C  CD1   . LEU A 1 80  ? 35.749 50.412 3.758   1.00  33.02 ? 74   LEU A CD1   1 
ATOM   585  C  CD2   . LEU A 1 80  ? 38.228 50.586 3.413   1.00  29.91 ? 74   LEU A CD2   1 
ATOM   586  N  N     . PRO A 1 81  ? 39.206 47.398 7.024   1.00  30.18 ? 75   PRO A N     1 
ATOM   587  C  CA    . PRO A 1 81  ? 39.266 46.534 8.209   1.00  28.62 ? 75   PRO A CA    1 
ATOM   588  C  C     . PRO A 1 81  ? 37.892 46.485 8.881   1.00  29.09 ? 75   PRO A C     1 
ATOM   589  O  O     . PRO A 1 81  ? 37.182 47.492 8.940   1.00  27.87 ? 75   PRO A O     1 
ATOM   590  C  CB    . PRO A 1 81  ? 40.293 47.237 9.082   1.00  26.35 ? 75   PRO A CB    1 
ATOM   591  C  CG    . PRO A 1 81  ? 40.006 48.675 8.810   1.00  27.77 ? 75   PRO A CG    1 
ATOM   592  C  CD    . PRO A 1 81  ? 39.807 48.719 7.304   1.00  29.26 ? 75   PRO A CD    1 
ATOM   593  N  N     . MET A 1 82  ? 37.496 45.331 9.391   1.00  29.71 ? 76   MET A N     1 
ATOM   594  C  CA    . MET A 1 82  ? 36.199 45.278 10.047  1.00  29.94 ? 76   MET A CA    1 
ATOM   595  C  C     . MET A 1 82  ? 36.167 46.220 11.257  1.00  30.38 ? 76   MET A C     1 
ATOM   596  O  O     . MET A 1 82  ? 37.092 46.208 12.074  1.00  29.41 ? 76   MET A O     1 
ATOM   597  C  CB    . MET A 1 82  ? 35.919 43.859 10.504  1.00  29.70 ? 76   MET A CB    1 
ATOM   598  C  CG    . MET A 1 82  ? 34.543 43.642 11.053  1.00  29.99 ? 76   MET A CG    1 
ATOM   599  S  SD    . MET A 1 82  ? 34.402 42.006 11.706  1.00  33.37 ? 76   MET A SD    1 
ATOM   600  C  CE    . MET A 1 82  ? 35.391 42.169 13.195  1.00  30.69 ? 76   MET A CE    1 
ATOM   601  N  N     . ARG A 1 83  ? 35.113 47.033 11.366  1.00  31.43 ? 77   ARG A N     1 
ATOM   602  C  CA    . ARG A 1 83  ? 34.941 47.960 12.493  1.00  31.25 ? 77   ARG A CA    1 
ATOM   603  C  C     . ARG A 1 83  ? 33.605 47.643 13.142  1.00  31.38 ? 77   ARG A C     1 
ATOM   604  O  O     . ARG A 1 83  ? 32.674 48.450 13.087  1.00  30.02 ? 77   ARG A O     1 
ATOM   605  C  CB    . ARG A 1 83  ? 34.924 49.405 12.013  1.00  31.48 ? 77   ARG A CB    1 
ATOM   606  C  CG    . ARG A 1 83  ? 36.169 49.818 11.274  1.00  34.74 ? 77   ARG A CG    1 
ATOM   607  C  CD    . ARG A 1 83  ? 36.183 51.328 11.071  1.00  36.92 ? 77   ARG A CD    1 
ATOM   608  N  NE    . ARG A 1 83  ? 35.266 51.776 10.028  1.00  40.16 ? 77   ARG A NE    1 
ATOM   609  C  CZ    . ARG A 1 83  ? 34.966 53.056 9.821   1.00  41.05 ? 77   ARG A CZ    1 
ATOM   610  N  NH1   . ARG A 1 83  ? 35.506 53.993 10.600  1.00  38.39 ? 77   ARG A NH1   1 
ATOM   611  N  NH2   . ARG A 1 83  ? 34.157 53.401 8.822   1.00  39.91 ? 77   ARG A NH2   1 
ATOM   612  N  N     . LYS A 1 84  ? 33.527 46.469 13.769  1.00  32.59 ? 78   LYS A N     1 
ATOM   613  C  CA    . LYS A 1 84  ? 32.289 46.005 14.408  1.00  34.16 ? 78   LYS A CA    1 
ATOM   614  C  C     . LYS A 1 84  ? 31.574 47.001 15.332  1.00  33.81 ? 78   LYS A C     1 
ATOM   615  O  O     . LYS A 1 84  ? 30.346 46.998 15.386  1.00  32.08 ? 78   LYS A O     1 
ATOM   616  C  CB    . LYS A 1 84  ? 32.529 44.687 15.165  1.00  34.55 ? 78   LYS A CB    1 
ATOM   617  C  CG    . LYS A 1 84  ? 31.307 43.770 15.175  1.00  36.49 ? 78   LYS A CG    1 
ATOM   618  C  CD    . LYS A 1 84  ? 31.577 42.442 15.876  1.00  37.80 ? 78   LYS A CD    1 
ATOM   619  C  CE    . LYS A 1 84  ? 30.395 41.481 15.722  1.00  37.49 ? 78   LYS A CE    1 
ATOM   620  N  NZ    . LYS A 1 84  ? 30.560 40.198 16.459  1.00  33.48 ? 78   LYS A NZ    1 
ATOM   621  N  N     . GLU A 1 85  ? 32.319 47.846 16.047  1.00  35.07 ? 79   GLU A N     1 
ATOM   622  C  CA    . GLU A 1 85  ? 31.697 48.824 16.945  1.00  35.72 ? 79   GLU A CA    1 
ATOM   623  C  C     . GLU A 1 85  ? 30.783 49.789 16.209  1.00  35.43 ? 79   GLU A C     1 
ATOM   624  O  O     . GLU A 1 85  ? 29.651 50.040 16.629  1.00  35.03 ? 79   GLU A O     1 
ATOM   625  C  CB    . GLU A 1 85  ? 32.750 49.644 17.677  1.00  37.73 ? 79   GLU A CB    1 
ATOM   626  C  CG    . GLU A 1 85  ? 32.736 49.418 19.159  1.00  42.77 ? 79   GLU A CG    1 
ATOM   627  C  CD    . GLU A 1 85  ? 33.352 48.089 19.513  1.00  46.88 ? 79   GLU A CD    1 
ATOM   628  O  OE1   . GLU A 1 85  ? 33.056 47.550 20.609  1.00  48.68 ? 79   GLU A OE1   1 
ATOM   629  O  OE2   . GLU A 1 85  ? 34.148 47.592 18.684  1.00  48.07 ? 79   GLU A OE2   1 
ATOM   630  N  N     . VAL A 1 86  ? 31.304 50.355 15.125  1.00  34.01 ? 80   VAL A N     1 
ATOM   631  C  CA    . VAL A 1 86  ? 30.554 51.300 14.316  1.00  32.37 ? 80   VAL A CA    1 
ATOM   632  C  C     . VAL A 1 86  ? 29.288 50.651 13.781  1.00  33.06 ? 80   VAL A C     1 
ATOM   633  O  O     . VAL A 1 86  ? 28.199 51.232 13.873  1.00  33.36 ? 80   VAL A O     1 
ATOM   634  C  CB    . VAL A 1 86  ? 31.379 51.792 13.130  1.00  31.93 ? 80   VAL A CB    1 
ATOM   635  C  CG1   . VAL A 1 86  ? 30.601 52.814 12.358  1.00  28.75 ? 80   VAL A CG1   1 
ATOM   636  C  CG2   . VAL A 1 86  ? 32.703 52.354 13.624  1.00  31.78 ? 80   VAL A CG2   1 
ATOM   637  N  N     . TYR A 1 87  ? 29.417 49.438 13.242  1.00  32.61 ? 81   TYR A N     1 
ATOM   638  C  CA    . TYR A 1 87  ? 28.244 48.754 12.695  1.00  33.08 ? 81   TYR A CA    1 
ATOM   639  C  C     . TYR A 1 87  ? 27.259 48.403 13.795  1.00  33.54 ? 81   TYR A C     1 
ATOM   640  O  O     . TYR A 1 87  ? 26.048 48.427 13.576  1.00  34.52 ? 81   TYR A O     1 
ATOM   641  C  CB    . TYR A 1 87  ? 28.608 47.452 11.962  1.00  31.19 ? 81   TYR A CB    1 
ATOM   642  C  CG    . TYR A 1 87  ? 29.854 47.515 11.114  1.00  31.32 ? 81   TYR A CG    1 
ATOM   643  C  CD1   . TYR A 1 87  ? 30.094 48.593 10.260  1.00  30.24 ? 81   TYR A CD1   1 
ATOM   644  C  CD2   . TYR A 1 87  ? 30.810 46.507 11.191  1.00  29.22 ? 81   TYR A CD2   1 
ATOM   645  C  CE1   . TYR A 1 87  ? 31.262 48.664 9.515   1.00  30.93 ? 81   TYR A CE1   1 
ATOM   646  C  CE2   . TYR A 1 87  ? 31.971 46.568 10.451  1.00  30.11 ? 81   TYR A CE2   1 
ATOM   647  C  CZ    . TYR A 1 87  ? 32.200 47.647 9.620   1.00  30.57 ? 81   TYR A CZ    1 
ATOM   648  O  OH    . TYR A 1 87  ? 33.384 47.736 8.929   1.00  30.94 ? 81   TYR A OH    1 
ATOM   649  N  N     . GLN A 1 88  ? 27.780 48.058 14.968  1.00  33.47 ? 82   GLN A N     1 
ATOM   650  C  CA    . GLN A 1 88  ? 26.928 47.685 16.077  1.00  34.39 ? 82   GLN A CA    1 
ATOM   651  C  C     . GLN A 1 88  ? 25.970 48.811 16.457  1.00  35.47 ? 82   GLN A C     1 
ATOM   652  O  O     . GLN A 1 88  ? 24.793 48.572 16.700  1.00  35.12 ? 82   GLN A O     1 
ATOM   653  C  CB    . GLN A 1 88  ? 27.782 47.277 17.271  1.00  35.74 ? 82   GLN A CB    1 
ATOM   654  C  CG    . GLN A 1 88  ? 26.979 46.917 18.502  1.00  37.93 ? 82   GLN A CG    1 
ATOM   655  C  CD    . GLN A 1 88  ? 25.770 46.070 18.171  1.00  39.96 ? 82   GLN A CD    1 
ATOM   656  O  OE1   . GLN A 1 88  ? 25.886 45.020 17.550  1.00  41.43 ? 82   GLN A OE1   1 
ATOM   657  N  NE2   . GLN A 1 88  ? 24.601 46.528 18.578  1.00  40.24 ? 82   GLN A NE2   1 
ATOM   658  N  N     . GLN A 1 89  ? 26.462 50.042 16.486  1.00  35.99 ? 83   GLN A N     1 
ATOM   659  C  CA    . GLN A 1 89  ? 25.600 51.160 16.833  1.00  37.46 ? 83   GLN A CA    1 
ATOM   660  C  C     . GLN A 1 89  ? 24.574 51.433 15.741  1.00  37.34 ? 83   GLN A C     1 
ATOM   661  O  O     . GLN A 1 89  ? 23.397 51.681 16.028  1.00  38.59 ? 83   GLN A O     1 
ATOM   662  C  CB    . GLN A 1 89  ? 26.439 52.405 17.109  1.00  38.45 ? 83   GLN A CB    1 
ATOM   663  C  CG    . GLN A 1 89  ? 27.238 52.284 18.384  1.00  43.42 ? 83   GLN A CG    1 
ATOM   664  C  CD    . GLN A 1 89  ? 27.836 53.602 18.822  1.00  46.79 ? 83   GLN A CD    1 
ATOM   665  O  OE1   . GLN A 1 89  ? 27.171 54.641 18.785  1.00  50.62 ? 83   GLN A OE1   1 
ATOM   666  N  NE2   . GLN A 1 89  ? 29.089 53.568 19.264  1.00  47.56 ? 83   GLN A NE2   1 
ATOM   667  N  N     . VAL A 1 90  ? 25.009 51.387 14.487  1.00  35.13 ? 84   VAL A N     1 
ATOM   668  C  CA    . VAL A 1 90  ? 24.084 51.623 13.396  1.00  34.18 ? 84   VAL A CA    1 
ATOM   669  C  C     . VAL A 1 90  ? 23.006 50.545 13.454  1.00  36.06 ? 84   VAL A C     1 
ATOM   670  O  O     . VAL A 1 90  ? 21.863 50.756 13.051  1.00  37.29 ? 84   VAL A O     1 
ATOM   671  C  CB    . VAL A 1 90  ? 24.797 51.564 12.044  1.00  32.10 ? 84   VAL A CB    1 
ATOM   672  C  CG1   . VAL A 1 90  ? 23.819 51.840 10.932  1.00  27.60 ? 84   VAL A CG1   1 
ATOM   673  C  CG2   . VAL A 1 90  ? 25.930 52.570 12.032  1.00  32.76 ? 84   VAL A CG2   1 
ATOM   674  N  N     . SER A 1 91  ? 23.377 49.383 13.978  1.00  36.16 ? 85   SER A N     1 
ATOM   675  C  CA    . SER A 1 91  ? 22.442 48.270 14.094  1.00  34.93 ? 85   SER A CA    1 
ATOM   676  C  C     . SER A 1 91  ? 21.398 48.570 15.164  1.00  35.14 ? 85   SER A C     1 
ATOM   677  O  O     . SER A 1 91  ? 20.196 48.413 14.925  1.00  35.22 ? 85   SER A O     1 
ATOM   678  C  CB    . SER A 1 91  ? 23.182 46.988 14.459  1.00  34.88 ? 85   SER A CB    1 
ATOM   679  O  OG    . SER A 1 91  ? 22.283 45.904 14.446  1.00  35.45 ? 85   SER A OG    1 
ATOM   680  N  N     . SER A 1 92  ? 21.866 49.002 16.337  1.00  33.90 ? 86   SER A N     1 
ATOM   681  C  CA    . SER A 1 92  ? 20.987 49.338 17.449  1.00  34.69 ? 86   SER A CA    1 
ATOM   682  C  C     . SER A 1 92  ? 19.959 50.369 17.030  1.00  34.15 ? 86   SER A C     1 
ATOM   683  O  O     . SER A 1 92  ? 18.778 50.253 17.361  1.00  34.83 ? 86   SER A O     1 
ATOM   684  C  CB    . SER A 1 92  ? 21.783 49.891 18.625  1.00  35.27 ? 86   SER A CB    1 
ATOM   685  O  OG    . SER A 1 92  ? 22.556 48.871 19.222  1.00  40.02 ? 86   SER A OG    1 
ATOM   686  N  N     . ARG A 1 93  ? 20.403 51.387 16.309  1.00  33.10 ? 87   ARG A N     1 
ATOM   687  C  CA    . ARG A 1 93  ? 19.474 52.400 15.866  1.00  32.50 ? 87   ARG A CA    1 
ATOM   688  C  C     . ARG A 1 93  ? 18.367 51.786 15.028  1.00  33.06 ? 87   ARG A C     1 
ATOM   689  O  O     . ARG A 1 93  ? 17.181 52.033 15.268  1.00  34.19 ? 87   ARG A O     1 
ATOM   690  C  CB    . ARG A 1 93  ? 20.201 53.475 15.073  1.00  33.24 ? 87   ARG A CB    1 
ATOM   691  C  CG    . ARG A 1 93  ? 21.040 54.391 15.951  1.00  33.00 ? 87   ARG A CG    1 
ATOM   692  C  CD    . ARG A 1 93  ? 21.201 55.723 15.284  1.00  32.64 ? 87   ARG A CD    1 
ATOM   693  N  NE    . ARG A 1 93  ? 22.048 55.665 14.101  1.00  32.00 ? 87   ARG A NE    1 
ATOM   694  C  CZ    . ARG A 1 93  ? 23.372 55.607 14.147  1.00  29.57 ? 87   ARG A CZ    1 
ATOM   695  N  NH1   . ARG A 1 93  ? 23.985 55.594 15.321  1.00  26.54 ? 87   ARG A NH1   1 
ATOM   696  N  NH2   . ARG A 1 93  ? 24.075 55.591 13.022  1.00  28.67 ? 87   ARG A NH2   1 
ATOM   697  N  N     . ILE A 1 94  ? 18.749 50.963 14.058  1.00  33.56 ? 88   ILE A N     1 
ATOM   698  C  CA    . ILE A 1 94  ? 17.759 50.349 13.197  1.00  33.33 ? 88   ILE A CA    1 
ATOM   699  C  C     . ILE A 1 94  ? 16.839 49.439 13.991  1.00  35.62 ? 88   ILE A C     1 
ATOM   700  O  O     . ILE A 1 94  ? 15.650 49.298 13.663  1.00  36.59 ? 88   ILE A O     1 
ATOM   701  C  CB    . ILE A 1 94  ? 18.421 49.577 12.057  1.00  32.39 ? 88   ILE A CB    1 
ATOM   702  C  CG1   . ILE A 1 94  ? 19.202 50.561 11.174  1.00  31.26 ? 88   ILE A CG1   1 
ATOM   703  C  CG2   . ILE A 1 94  ? 17.360 48.850 11.228  1.00  30.74 ? 88   ILE A CG2   1 
ATOM   704  C  CD1   . ILE A 1 94  ? 19.921 49.918 10.013  1.00  30.93 ? 88   ILE A CD1   1 
ATOM   705  N  N     . MET A 1 95  ? 17.372 48.825 15.042  1.00  36.92 ? 89   MET A N     1 
ATOM   706  C  CA    . MET A 1 95  ? 16.549 47.947 15.863  1.00  37.22 ? 89   MET A CA    1 
ATOM   707  C  C     . MET A 1 95  ? 15.531 48.787 16.619  1.00  39.33 ? 89   MET A C     1 
ATOM   708  O  O     . MET A 1 95  ? 14.392 48.366 16.820  1.00  40.20 ? 89   MET A O     1 
ATOM   709  C  CB    . MET A 1 95  ? 17.405 47.144 16.842  1.00  34.88 ? 89   MET A CB    1 
ATOM   710  C  CG    . MET A 1 95  ? 18.332 46.144 16.173  1.00  35.16 ? 89   MET A CG    1 
ATOM   711  S  SD    . MET A 1 95  ? 17.494 45.038 14.977  1.00  32.68 ? 89   MET A SD    1 
ATOM   712  C  CE    . MET A 1 95  ? 18.962 44.272 14.191  1.00  34.98 ? 89   MET A CE    1 
ATOM   713  N  N     . ASN A 1 96  ? 15.934 49.985 17.031  1.00  40.50 ? 90   ASN A N     1 
ATOM   714  C  CA    . ASN A 1 96  ? 15.010 50.856 17.744  1.00  41.31 ? 90   ASN A CA    1 
ATOM   715  C  C     . ASN A 1 96  ? 13.847 51.277 16.844  1.00  42.95 ? 90   ASN A C     1 
ATOM   716  O  O     . ASN A 1 96  ? 12.737 51.472 17.325  1.00  44.72 ? 90   ASN A O     1 
ATOM   717  C  CB    . ASN A 1 96  ? 15.737 52.077 18.309  1.00  39.49 ? 90   ASN A CB    1 
ATOM   718  C  CG    . ASN A 1 96  ? 16.616 51.722 19.489  1.00  40.85 ? 90   ASN A CG    1 
ATOM   719  O  OD1   . ASN A 1 96  ? 16.304 50.799 20.246  1.00  40.59 ? 90   ASN A OD1   1 
ATOM   720  N  ND2   . ASN A 1 96  ? 17.708 52.461 19.668  1.00  39.58 ? 90   ASN A ND2   1 
ATOM   721  N  N     . LEU A 1 97  ? 14.080 51.393 15.537  1.00  43.30 ? 91   LEU A N     1 
ATOM   722  C  CA    . LEU A 1 97  ? 12.997 51.766 14.625  1.00  43.19 ? 91   LEU A CA    1 
ATOM   723  C  C     . LEU A 1 97  ? 11.974 50.630 14.533  1.00  43.34 ? 91   LEU A C     1 
ATOM   724  O  O     . LEU A 1 97  ? 10.779 50.847 14.683  1.00  43.66 ? 91   LEU A O     1 
ATOM   725  C  CB    . LEU A 1 97  ? 13.512 52.052 13.204  1.00  43.42 ? 91   LEU A CB    1 
ATOM   726  C  CG    . LEU A 1 97  ? 14.639 53.027 12.835  1.00  44.66 ? 91   LEU A CG    1 
ATOM   727  C  CD1   . LEU A 1 97  ? 14.684 53.136 11.313  1.00  43.15 ? 91   LEU A CD1   1 
ATOM   728  C  CD2   . LEU A 1 97  ? 14.415 54.416 13.435  1.00  46.72 ? 91   LEU A CD2   1 
ATOM   729  N  N     . LEU A 1 98  ? 12.447 49.415 14.278  1.00  43.45 ? 92   LEU A N     1 
ATOM   730  C  CA    . LEU A 1 98  ? 11.554 48.266 14.145  1.00  43.84 ? 92   LEU A CA    1 
ATOM   731  C  C     . LEU A 1 98  ? 10.639 48.113 15.362  1.00  45.49 ? 92   LEU A C     1 
ATOM   732  O  O     . LEU A 1 98  ? 9.521  47.599 15.252  1.00  44.52 ? 92   LEU A O     1 
ATOM   733  C  CB    . LEU A 1 98  ? 12.368 46.983 13.930  1.00  40.82 ? 92   LEU A CB    1 
ATOM   734  C  CG    . LEU A 1 98  ? 13.425 47.016 12.816  1.00  39.34 ? 92   LEU A CG    1 
ATOM   735  C  CD1   . LEU A 1 98  ? 14.170 45.684 12.769  1.00  38.18 ? 92   LEU A CD1   1 
ATOM   736  C  CD2   . LEU A 1 98  ? 12.777 47.303 11.490  1.00  35.97 ? 92   LEU A CD2   1 
ATOM   737  N  N     . ARG A 1 99  ? 11.115 48.563 16.519  1.00  46.39 ? 93   ARG A N     1 
ATOM   738  C  CA    . ARG A 1 99  ? 10.325 48.482 17.742  1.00  48.42 ? 93   ARG A CA    1 
ATOM   739  C  C     . ARG A 1 99  ? 9.052  49.310 17.621  1.00  48.23 ? 93   ARG A C     1 
ATOM   740  O  O     . ARG A 1 99  ? 8.068  49.043 18.297  1.00  48.55 ? 93   ARG A O     1 
ATOM   741  C  CB    . ARG A 1 99  ? 11.141 48.984 18.933  1.00  49.67 ? 93   ARG A CB    1 
ATOM   742  C  CG    . ARG A 1 99  ? 12.340 48.127 19.251  1.00  53.33 ? 93   ARG A CG    1 
ATOM   743  C  CD    . ARG A 1 99  ? 13.261 48.816 20.241  1.00  55.97 ? 93   ARG A CD    1 
ATOM   744  N  NE    . ARG A 1 99  ? 14.422 47.994 20.552  1.00  56.88 ? 93   ARG A NE    1 
ATOM   745  C  CZ    . ARG A 1 99  ? 14.341 46.751 21.004  1.00  57.95 ? 93   ARG A CZ    1 
ATOM   746  N  NH1   . ARG A 1 99  ? 13.150 46.201 21.190  1.00  59.50 ? 93   ARG A NH1   1 
ATOM   747  N  NH2   . ARG A 1 99  ? 15.442 46.064 21.276  1.00  58.52 ? 93   ARG A NH2   1 
ATOM   748  N  N     . GLU A 1 100 ? 9.084  50.317 16.755  1.00  48.71 ? 94   GLU A N     1 
ATOM   749  C  CA    . GLU A 1 100 ? 7.940  51.196 16.553  1.00  49.02 ? 94   GLU A CA    1 
ATOM   750  C  C     . GLU A 1 100 ? 6.849  50.469 15.771  0.83  50.39 ? 94   GLU A C     1 
ATOM   751  O  O     . GLU A 1 100 ? 5.753  50.997 15.587  1.00  52.08 ? 94   GLU A O     1 
ATOM   752  C  CB    . GLU A 1 100 ? 8.361  52.469 15.793  1.00  48.01 ? 94   GLU A CB    1 
ATOM   753  C  CG    . GLU A 1 100 ? 9.515  53.263 16.415  0.92  47.50 ? 94   GLU A CG    1 
ATOM   754  C  CD    . GLU A 1 100 ? 9.200  53.807 17.799  0.26  48.24 ? 94   GLU A CD    1 
ATOM   755  O  OE1   . GLU A 1 100 ? 8.999  52.999 18.729  0.49  47.77 ? 94   GLU A OE1   1 
ATOM   756  O  OE2   . GLU A 1 100 ? 9.158  55.046 17.956  0.36  48.43 ? 94   GLU A OE2   1 
ATOM   757  N  N     . TYR A 1 101 ? 7.143  49.255 15.316  1.00  50.56 ? 95   TYR A N     1 
ATOM   758  C  CA    . TYR A 1 101 ? 6.169  48.492 14.546  1.00  50.87 ? 95   TYR A CA    1 
ATOM   759  C  C     . TYR A 1 101 ? 5.702  47.256 15.292  1.00  52.55 ? 95   TYR A C     1 
ATOM   760  O  O     . TYR A 1 101 ? 4.762  46.590 14.869  1.00  53.11 ? 95   TYR A O     1 
ATOM   761  C  CB    . TYR A 1 101 ? 6.754  48.094 13.187  1.00  49.81 ? 95   TYR A CB    1 
ATOM   762  C  CG    . TYR A 1 101 ? 7.163  49.282 12.356  1.00  48.35 ? 95   TYR A CG    1 
ATOM   763  C  CD1   . TYR A 1 101 ? 8.168  50.143 12.785  1.00  48.87 ? 95   TYR A CD1   1 
ATOM   764  C  CD2   . TYR A 1 101 ? 6.523  49.569 11.162  1.00  47.62 ? 95   TYR A CD2   1 
ATOM   765  C  CE1   . TYR A 1 101 ? 8.519  51.259 12.044  1.00  48.60 ? 95   TYR A CE1   1 
ATOM   766  C  CE2   . TYR A 1 101 ? 6.870  50.686 10.412  1.00  47.28 ? 95   TYR A CE2   1 
ATOM   767  C  CZ    . TYR A 1 101 ? 7.863  51.520 10.858  1.00  47.16 ? 95   TYR A CZ    1 
ATOM   768  O  OH    . TYR A 1 101 ? 8.201  52.616 10.116  1.00  48.64 ? 95   TYR A OH    1 
ATOM   769  N  N     . SER A 1 102 ? 6.366  46.950 16.400  1.00  53.29 ? 96   SER A N     1 
ATOM   770  C  CA    . SER A 1 102 ? 5.994  45.798 17.208  1.00  54.96 ? 96   SER A CA    1 
ATOM   771  C  C     . SER A 1 102 ? 6.835  45.686 18.472  1.00  56.20 ? 96   SER A C     1 
ATOM   772  O  O     . SER A 1 102 ? 8.050  45.895 18.447  1.00  56.56 ? 96   SER A O     1 
ATOM   773  C  CB    . SER A 1 102 ? 6.126  44.506 16.400  1.00  54.10 ? 96   SER A CB    1 
ATOM   774  O  OG    . SER A 1 102 ? 5.698  43.398 17.168  1.00  54.66 ? 96   SER A OG    1 
ATOM   775  N  N     . GLU A 1 103 ? 6.172  45.369 19.580  1.00  57.65 ? 97   GLU A N     1 
ATOM   776  C  CA    . GLU A 1 103 ? 6.859  45.192 20.852  1.00  59.12 ? 97   GLU A CA    1 
ATOM   777  C  C     . GLU A 1 103 ? 7.370  43.761 20.847  1.00  58.12 ? 97   GLU A C     1 
ATOM   778  O  O     . GLU A 1 103 ? 8.368  43.443 21.493  1.00  58.56 ? 97   GLU A O     1 
ATOM   779  C  CB    . GLU A 1 103 ? 5.903  45.400 22.036  1.00  60.86 ? 97   GLU A CB    1 
ATOM   780  C  CG    . GLU A 1 103 ? 5.201  46.753 22.035  1.00  63.43 ? 97   GLU A CG    1 
ATOM   781  C  CD    . GLU A 1 103 ? 3.903  46.745 21.240  1.00  64.78 ? 97   GLU A CD    1 
ATOM   782  O  OE1   . GLU A 1 103 ? 3.757  45.901 20.329  1.00  65.42 ? 97   GLU A OE1   1 
ATOM   783  O  OE2   . GLU A 1 103 ? 3.033  47.596 21.526  1.00  65.34 ? 97   GLU A OE2   1 
ATOM   784  N  N     . LYS A 1 104 ? 6.669  42.902 20.111  1.00  56.51 ? 98   LYS A N     1 
ATOM   785  C  CA    . LYS A 1 104 ? 7.065  41.508 19.994  1.00  54.84 ? 98   LYS A CA    1 
ATOM   786  C  C     . LYS A 1 104 ? 8.180  41.459 18.951  1.00  52.65 ? 98   LYS A C     1 
ATOM   787  O  O     . LYS A 1 104 ? 7.929  41.286 17.758  1.00  52.15 ? 98   LYS A O     1 
ATOM   788  C  CB    . LYS A 1 104 ? 5.878  40.640 19.556  1.00  56.89 ? 98   LYS A CB    1 
ATOM   789  C  CG    . LYS A 1 104 ? 4.749  40.535 20.581  1.00  57.80 ? 98   LYS A CG    1 
ATOM   790  C  CD    . LYS A 1 104 ? 3.849  39.327 20.295  1.00  58.61 ? 98   LYS A CD    1 
ATOM   791  C  CE    . LYS A 1 104 ? 2.694  39.220 21.285  1.00  58.42 ? 98   LYS A CE    1 
ATOM   792  N  NZ    . LYS A 1 104 ? 1.729  40.348 21.121  1.00  59.63 ? 98   LYS A NZ    1 
ATOM   793  N  N     . ILE A 1 105 ? 9.415  41.618 19.421  1.00  49.79 ? 99   ILE A N     1 
ATOM   794  C  CA    . ILE A 1 105 ? 10.587 41.636 18.558  1.00  46.68 ? 99   ILE A CA    1 
ATOM   795  C  C     . ILE A 1 105 ? 11.709 40.736 19.050  1.00  45.37 ? 99   ILE A C     1 
ATOM   796  O  O     . ILE A 1 105 ? 12.054 40.742 20.223  1.00  45.75 ? 99   ILE A O     1 
ATOM   797  C  CB    . ILE A 1 105 ? 11.118 43.071 18.439  1.00  46.43 ? 99   ILE A CB    1 
ATOM   798  C  CG1   . ILE A 1 105 ? 12.343 43.113 17.538  1.00  46.87 ? 99   ILE A CG1   1 
ATOM   799  C  CG2   . ILE A 1 105 ? 11.471 43.610 19.815  1.00  45.58 ? 99   ILE A CG2   1 
ATOM   800  C  CD1   . ILE A 1 105 ? 12.887 44.529 17.333  1.00  48.26 ? 99   ILE A CD1   1 
ATOM   801  N  N     . GLU A 1 106 ? 12.271 39.960 18.130  1.00  44.11 ? 100  GLU A N     1 
ATOM   802  C  CA    . GLU A 1 106 ? 13.375 39.045 18.419  1.00  42.60 ? 100  GLU A CA    1 
ATOM   803  C  C     . GLU A 1 106 ? 14.577 39.490 17.568  1.00  41.94 ? 100  GLU A C     1 
ATOM   804  O  O     . GLU A 1 106 ? 14.546 39.399 16.330  1.00  41.54 ? 100  GLU A O     1 
ATOM   805  C  CB    . GLU A 1 106 ? 12.980 37.598 18.055  1.00  41.65 ? 100  GLU A CB    1 
ATOM   806  C  CG    . GLU A 1 106 ? 14.085 36.542 18.280  1.00  40.83 ? 100  GLU A CG    1 
ATOM   807  C  CD    . GLU A 1 106 ? 13.595 35.105 18.078  1.00  41.06 ? 100  GLU A CD    1 
ATOM   808  O  OE1   . GLU A 1 106 ? 14.425 34.177 18.059  1.00  40.66 ? 100  GLU A OE1   1 
ATOM   809  O  OE2   . GLU A 1 106 ? 12.376 34.887 17.944  1.00  41.17 ? 100  GLU A OE2   1 
ATOM   810  N  N     . ILE A 1 107 ? 15.624 39.991 18.217  1.00  39.80 ? 101  ILE A N     1 
ATOM   811  C  CA    . ILE A 1 107 ? 16.801 40.421 17.477  1.00  37.97 ? 101  ILE A CA    1 
ATOM   812  C  C     . ILE A 1 107 ? 17.729 39.214 17.375  1.00  36.33 ? 101  ILE A C     1 
ATOM   813  O  O     . ILE A 1 107 ? 18.441 38.864 18.311  1.00  35.51 ? 101  ILE A O     1 
ATOM   814  C  CB    . ILE A 1 107 ? 17.480 41.629 18.171  1.00  38.96 ? 101  ILE A CB    1 
ATOM   815  C  CG1   . ILE A 1 107 ? 16.524 42.821 18.129  1.00  38.16 ? 101  ILE A CG1   1 
ATOM   816  C  CG2   . ILE A 1 107 ? 18.784 42.011 17.469  1.00  37.88 ? 101  ILE A CG2   1 
ATOM   817  C  CD1   . ILE A 1 107 ? 17.028 44.040 18.849  1.00  39.36 ? 101  ILE A CD1   1 
ATOM   818  N  N     . ALA A 1 108 ? 17.676 38.570 16.216  1.00  35.29 ? 102  ALA A N     1 
ATOM   819  C  CA    . ALA A 1 108 ? 18.463 37.377 15.925  1.00  34.28 ? 102  ALA A CA    1 
ATOM   820  C  C     . ALA A 1 108 ? 19.968 37.632 15.928  1.00  33.73 ? 102  ALA A C     1 
ATOM   821  O  O     . ALA A 1 108 ? 20.711 37.011 16.679  1.00  33.36 ? 102  ALA A O     1 
ATOM   822  C  CB    . ALA A 1 108 ? 18.037 36.796 14.575  1.00  31.33 ? 102  ALA A CB    1 
ATOM   823  N  N     . SER A 1 109 ? 20.414 38.546 15.077  1.00  33.33 ? 103  SER A N     1 
ATOM   824  C  CA    . SER A 1 109 ? 21.831 38.869 14.978  1.00  32.32 ? 103  SER A CA    1 
ATOM   825  C  C     . SER A 1 109 ? 22.007 40.365 14.950  1.00  31.89 ? 103  SER A C     1 
ATOM   826  O  O     . SER A 1 109 ? 21.076 41.123 15.250  1.00  32.48 ? 103  SER A O     1 
ATOM   827  C  CB    . SER A 1 109 ? 22.435 38.306 13.685  1.00  32.91 ? 103  SER A CB    1 
ATOM   828  O  OG    . SER A 1 109 ? 22.011 39.000 12.516  1.00  34.94 ? 103  SER A OG    1 
ATOM   829  N  N     . ILE A 1 110 ? 23.208 40.778 14.553  1.00  29.70 ? 104  ILE A N     1 
ATOM   830  C  CA    . ILE A 1 110 ? 23.545 42.184 14.433  1.00  26.90 ? 104  ILE A CA    1 
ATOM   831  C  C     . ILE A 1 110 ? 22.891 42.766 13.185  1.00  27.67 ? 104  ILE A C     1 
ATOM   832  O  O     . ILE A 1 110 ? 22.938 43.967 12.953  1.00  27.72 ? 104  ILE A O     1 
ATOM   833  C  CB    . ILE A 1 110 ? 25.064 42.363 14.295  1.00  26.58 ? 104  ILE A CB    1 
ATOM   834  C  CG1   . ILE A 1 110 ? 25.441 43.856 14.259  1.00  26.84 ? 104  ILE A CG1   1 
ATOM   835  C  CG2   . ILE A 1 110 ? 25.552 41.684 13.019  1.00  23.03 ? 104  ILE A CG2   1 
ATOM   836  C  CD1   . ILE A 1 110 ? 26.954 44.091 14.175  1.00  25.46 ? 104  ILE A CD1   1 
ATOM   837  N  N     . ASP A 1 111 ? 22.278 41.916 12.373  1.00  27.79 ? 105  ASP A N     1 
ATOM   838  C  CA    . ASP A 1 111 ? 21.674 42.411 11.147  1.00  28.08 ? 105  ASP A CA    1 
ATOM   839  C  C     . ASP A 1 111 ? 20.322 41.818 10.764  1.00  27.99 ? 105  ASP A C     1 
ATOM   840  O  O     . ASP A 1 111 ? 19.815 42.060 9.670   1.00  27.43 ? 105  ASP A O     1 
ATOM   841  C  CB    . ASP A 1 111 ? 22.684 42.239 10.008  1.00  29.18 ? 105  ASP A CB    1 
ATOM   842  C  CG    . ASP A 1 111 ? 22.355 41.096 9.099   1.00  29.23 ? 105  ASP A CG    1 
ATOM   843  O  OD1   . ASP A 1 111 ? 22.123 39.976 9.602   1.00  32.48 ? 105  ASP A OD1   1 
ATOM   844  O  OD2   . ASP A 1 111 ? 22.340 41.337 7.877   1.00  30.06 ? 105  ASP A OD2   1 
ATOM   845  N  N     . GLU A 1 112 ? 19.736 41.032 11.654  1.00  29.49 ? 106  GLU A N     1 
ATOM   846  C  CA    . GLU A 1 112 ? 18.437 40.466 11.352  1.00  30.95 ? 106  GLU A CA    1 
ATOM   847  C  C     . GLU A 1 112 ? 17.618 40.341 12.615  1.00  29.95 ? 106  GLU A C     1 
ATOM   848  O  O     . GLU A 1 112 ? 18.148 40.020 13.682  1.00  30.52 ? 106  GLU A O     1 
ATOM   849  C  CB    . GLU A 1 112 ? 18.562 39.108 10.632  1.00  31.40 ? 106  GLU A CB    1 
ATOM   850  C  CG    . GLU A 1 112 ? 19.159 37.958 11.430  1.00  32.99 ? 106  GLU A CG    1 
ATOM   851  C  CD    . GLU A 1 112 ? 19.093 36.648 10.661  1.00  37.02 ? 106  GLU A CD    1 
ATOM   852  O  OE1   . GLU A 1 112 ? 19.720 36.589 9.584   1.00  37.03 ? 106  GLU A OE1   1 
ATOM   853  O  OE2   . GLU A 1 112 ? 18.414 35.691 11.124  1.00  37.46 ? 106  GLU A OE2   1 
ATOM   854  N  N     . ALA A 1 113 ? 16.329 40.633 12.480  1.00  28.33 ? 107  ALA A N     1 
ATOM   855  C  CA    . ALA A 1 113 ? 15.399 40.567 13.592  1.00  30.60 ? 107  ALA A CA    1 
ATOM   856  C  C     . ALA A 1 113 ? 14.041 40.112 13.100  1.00  31.51 ? 107  ALA A C     1 
ATOM   857  O  O     . ALA A 1 113 ? 13.696 40.314 11.925  1.00  31.99 ? 107  ALA A O     1 
ATOM   858  C  CB    . ALA A 1 113 ? 15.276 41.932 14.254  1.00  29.61 ? 107  ALA A CB    1 
ATOM   859  N  N     . TYR A 1 114 ? 13.283 39.471 13.984  1.00  32.11 ? 108  TYR A N     1 
ATOM   860  C  CA    . TYR A 1 114 ? 11.934 39.028 13.635  1.00  33.89 ? 108  TYR A CA    1 
ATOM   861  C  C     . TYR A 1 114 ? 10.942 39.905 14.412  1.00  35.05 ? 108  TYR A C     1 
ATOM   862  O  O     . TYR A 1 114 ? 11.235 40.361 15.515  1.00  34.91 ? 108  TYR A O     1 
ATOM   863  C  CB    . TYR A 1 114 ? 11.701 37.559 14.006  1.00  32.14 ? 108  TYR A CB    1 
ATOM   864  C  CG    . TYR A 1 114 ? 12.647 36.572 13.365  1.00  31.13 ? 108  TYR A CG    1 
ATOM   865  C  CD1   . TYR A 1 114 ? 13.925 36.382 13.877  1.00  29.78 ? 108  TYR A CD1   1 
ATOM   866  C  CD2   . TYR A 1 114 ? 12.268 35.836 12.234  1.00  30.75 ? 108  TYR A CD2   1 
ATOM   867  C  CE1   . TYR A 1 114 ? 14.805 35.490 13.284  1.00  29.67 ? 108  TYR A CE1   1 
ATOM   868  C  CE2   . TYR A 1 114 ? 13.142 34.938 11.630  1.00  29.04 ? 108  TYR A CE2   1 
ATOM   869  C  CZ    . TYR A 1 114 ? 14.413 34.777 12.162  1.00  29.64 ? 108  TYR A CZ    1 
ATOM   870  O  OH    . TYR A 1 114 ? 15.325 33.943 11.567  1.00  29.84 ? 108  TYR A OH    1 
ATOM   871  N  N     . LEU A 1 115 ? 9.787  40.168 13.814  1.00  36.88 ? 109  LEU A N     1 
ATOM   872  C  CA    . LEU A 1 115 ? 8.748  40.974 14.452  1.00  38.07 ? 109  LEU A CA    1 
ATOM   873  C  C     . LEU A 1 115 ? 7.429  40.219 14.353  1.00  39.42 ? 109  LEU A C     1 
ATOM   874  O  O     . LEU A 1 115 ? 7.092  39.685 13.292  1.00  40.12 ? 109  LEU A O     1 
ATOM   875  C  CB    . LEU A 1 115 ? 8.569  42.318 13.745  1.00  36.34 ? 109  LEU A CB    1 
ATOM   876  C  CG    . LEU A 1 115 ? 9.705  43.321 13.575  1.00  37.26 ? 109  LEU A CG    1 
ATOM   877  C  CD1   . LEU A 1 115 ? 9.129  44.613 13.003  1.00  35.67 ? 109  LEU A CD1   1 
ATOM   878  C  CD2   . LEU A 1 115 ? 10.361 43.599 14.899  1.00  38.01 ? 109  LEU A CD2   1 
ATOM   879  N  N     . ASP A 1 116 ? 6.688  40.150 15.453  1.00  41.47 ? 110  ASP A N     1 
ATOM   880  C  CA    . ASP A 1 116 ? 5.383  39.491 15.420  1.00  43.68 ? 110  ASP A CA    1 
ATOM   881  C  C     . ASP A 1 116 ? 4.374  40.603 15.209  1.00  43.41 ? 110  ASP A C     1 
ATOM   882  O  O     . ASP A 1 116 ? 4.047  41.342 16.139  1.00  43.45 ? 110  ASP A O     1 
ATOM   883  C  CB    . ASP A 1 116 ? 5.062  38.757 16.737  1.00  46.89 ? 110  ASP A CB    1 
ATOM   884  C  CG    . ASP A 1 116 ? 3.652  38.148 16.742  1.00  49.25 ? 110  ASP A CG    1 
ATOM   885  O  OD1   . ASP A 1 116 ? 2.685  38.864 16.405  1.00  50.57 ? 110  ASP A OD1   1 
ATOM   886  O  OD2   . ASP A 1 116 ? 3.509  36.959 17.085  1.00  49.91 ? 110  ASP A OD2   1 
ATOM   887  N  N     . ILE A 1 117 ? 3.900  40.733 13.977  1.00  44.03 ? 111  ILE A N     1 
ATOM   888  C  CA    . ILE A 1 117 ? 2.914  41.757 13.647  1.00  45.85 ? 111  ILE A CA    1 
ATOM   889  C  C     . ILE A 1 117 ? 1.517  41.143 13.567  1.00  48.07 ? 111  ILE A C     1 
ATOM   890  O  O     . ILE A 1 117 ? 0.634  41.688 12.904  1.00  49.21 ? 111  ILE A O     1 
ATOM   891  C  CB    . ILE A 1 117 ? 3.217  42.432 12.291  1.00  42.86 ? 111  ILE A CB    1 
ATOM   892  C  CG1   . ILE A 1 117 ? 3.219  41.384 11.171  1.00  41.29 ? 111  ILE A CG1   1 
ATOM   893  C  CG2   . ILE A 1 117 ? 4.528  43.173 12.373  1.00  43.51 ? 111  ILE A CG2   1 
ATOM   894  C  CD1   . ILE A 1 117 ? 3.470  41.957 9.786   1.00  38.31 ? 111  ILE A CD1   1 
ATOM   895  N  N     . SER A 1 118 ? 1.323  40.012 14.243  1.00  50.33 ? 112  SER A N     1 
ATOM   896  C  CA    . SER A 1 118 ? 0.034  39.333 14.227  1.00  52.46 ? 112  SER A CA    1 
ATOM   897  C  C     . SER A 1 118 ? -1.116 40.261 14.635  1.00  53.65 ? 112  SER A C     1 
ATOM   898  O  O     . SER A 1 118 ? -1.969 40.588 13.809  1.00  53.55 ? 112  SER A O     1 
ATOM   899  C  CB    . SER A 1 118 ? 0.080  38.094 15.127  1.00  52.42 ? 112  SER A CB    1 
ATOM   900  O  OG    . SER A 1 118 ? 1.040  37.162 14.649  1.00  52.72 ? 112  SER A OG    1 
ATOM   901  N  N     . ASP A 1 119 ? -1.141 40.697 15.889  0.97  54.62 ? 113  ASP A N     1 
ATOM   902  C  CA    . ASP A 1 119 ? -2.208 41.590 16.341  1.00  56.29 ? 113  ASP A CA    1 
ATOM   903  C  C     . ASP A 1 119 ? -1.922 43.051 15.990  1.00  56.47 ? 113  ASP A C     1 
ATOM   904  O  O     . ASP A 1 119 ? -2.255 43.961 16.747  0.37  56.33 ? 113  ASP A O     1 
ATOM   905  C  CB    . ASP A 1 119 ? -2.416 41.466 17.862  1.00  57.09 ? 113  ASP A CB    1 
ATOM   906  C  CG    . ASP A 1 119 ? -1.217 41.958 18.668  1.00  57.89 ? 113  ASP A CG    1 
ATOM   907  O  OD1   . ASP A 1 119 ? -0.790 43.118 18.468  0.75  57.73 ? 113  ASP A OD1   1 
ATOM   908  O  OD2   . ASP A 1 119 ? -0.711 41.182 19.509  0.39  57.51 ? 113  ASP A OD2   1 
ATOM   909  N  N     . LYS A 1 120 ? -1.313 43.268 14.832  1.00  57.83 ? 114  LYS A N     1 
ATOM   910  C  CA    . LYS A 1 120 ? -0.965 44.617 14.389  1.00  58.96 ? 114  LYS A CA    1 
ATOM   911  C  C     . LYS A 1 120 ? -1.453 44.839 12.965  1.00  58.93 ? 114  LYS A C     1 
ATOM   912  O  O     . LYS A 1 120 ? -1.718 45.964 12.554  1.00  58.99 ? 114  LYS A O     1 
ATOM   913  C  CB    . LYS A 1 120 ? 0.555  44.800 14.437  1.00  59.29 ? 114  LYS A CB    1 
ATOM   914  C  CG    . LYS A 1 120 ? 1.016  46.242 14.419  1.00  60.49 ? 114  LYS A CG    1 
ATOM   915  C  CD    . LYS A 1 120 ? 0.789  46.925 15.771  1.00  62.57 ? 114  LYS A CD    1 
ATOM   916  C  CE    . LYS A 1 120 ? 1.744  46.424 16.863  1.00  63.35 ? 114  LYS A CE    1 
ATOM   917  N  NZ    . LYS A 1 120 ? 1.578  44.975 17.212  1.00  64.72 ? 114  LYS A NZ    1 
ATOM   918  N  N     . VAL A 1 121 ? -1.567 43.749 12.221  1.00  59.74 ? 115  VAL A N     1 
ATOM   919  C  CA    . VAL A 1 121 ? -2.007 43.793 10.842  1.00  60.94 ? 115  VAL A CA    1 
ATOM   920  C  C     . VAL A 1 121 ? -3.004 42.643 10.668  1.00  62.55 ? 115  VAL A C     1 
ATOM   921  O  O     . VAL A 1 121 ? -3.218 41.857 11.590  1.00  63.22 ? 115  VAL A O     1 
ATOM   922  C  CB    . VAL A 1 121 ? -0.797 43.613 9.884   1.00  60.94 ? 115  VAL A CB    1 
ATOM   923  C  CG1   . VAL A 1 121 ? -0.577 42.135 9.571   1.00  60.97 ? 115  VAL A CG1   1 
ATOM   924  C  CG2   . VAL A 1 121 ? -1.002 44.412 8.636   1.00  61.33 ? 115  VAL A CG2   1 
ATOM   925  N  N     . ARG A 1 122 ? -3.611 42.543 9.492   1.00  64.11 ? 116  ARG A N     1 
ATOM   926  C  CA    . ARG A 1 122 ? -4.582 41.485 9.228   1.00  65.64 ? 116  ARG A CA    1 
ATOM   927  C  C     . ARG A 1 122 ? -4.516 41.103 7.762   1.00  65.69 ? 116  ARG A C     1 
ATOM   928  O  O     . ARG A 1 122 ? -4.791 41.927 6.890   1.00  66.60 ? 116  ARG A O     1 
ATOM   929  C  CB    . ARG A 1 122 ? -5.991 41.970 9.593   1.00  67.27 ? 116  ARG A CB    1 
ATOM   930  C  CG    . ARG A 1 122 ? -6.323 43.346 9.037   1.00  69.04 ? 116  ARG A CG    1 
ATOM   931  C  CD    . ARG A 1 122 ? -7.297 44.087 9.937   1.00  71.01 ? 116  ARG A CD    1 
ATOM   932  N  NE    . ARG A 1 122 ? -7.272 45.535 9.705   1.00  72.54 ? 116  ARG A NE    1 
ATOM   933  C  CZ    . ARG A 1 122 ? -6.204 46.313 9.900   1.00  72.63 ? 116  ARG A CZ    1 
ATOM   934  N  NH1   . ARG A 1 122 ? -5.057 45.790 10.332  1.00  72.11 ? 116  ARG A NH1   1 
ATOM   935  N  NH2   . ARG A 1 122 ? -6.283 47.621 9.671   1.00  72.18 ? 116  ARG A NH2   1 
ATOM   936  N  N     . ASP A 1 123 ? -4.148 39.854 7.494   1.00  64.88 ? 117  ASP A N     1 
ATOM   937  C  CA    . ASP A 1 123 ? -4.021 39.369 6.123   1.00  64.37 ? 117  ASP A CA    1 
ATOM   938  C  C     . ASP A 1 123 ? -2.689 39.891 5.543   1.00  62.87 ? 117  ASP A C     1 
ATOM   939  O  O     . ASP A 1 123 ? -2.204 40.959 5.933   1.00  62.58 ? 117  ASP A O     1 
ATOM   940  C  CB    . ASP A 1 123 ? -5.236 39.831 5.297   1.00  66.68 ? 117  ASP A CB    1 
ATOM   941  C  CG    . ASP A 1 123 ? -4.851 40.663 4.087   1.00  69.94 ? 117  ASP A CG    1 
ATOM   942  O  OD1   . ASP A 1 123 ? -4.446 40.068 3.057   1.00  73.02 ? 117  ASP A OD1   1 
ATOM   943  O  OD2   . ASP A 1 123 ? -4.949 41.913 4.170   1.00  70.26 ? 117  ASP A OD2   1 
ATOM   944  N  N     . TYR A 1 124 ? -2.100 39.129 4.623   1.00  60.61 ? 118  TYR A N     1 
ATOM   945  C  CA    . TYR A 1 124 ? -0.817 39.481 4.026   1.00  58.55 ? 118  TYR A CA    1 
ATOM   946  C  C     . TYR A 1 124 ? -0.754 40.762 3.223   1.00  58.26 ? 118  TYR A C     1 
ATOM   947  O  O     . TYR A 1 124 ? 0.289  41.413 3.205   1.00  58.07 ? 118  TYR A O     1 
ATOM   948  C  CB    . TYR A 1 124 ? -0.294 38.331 3.156   1.00  57.26 ? 118  TYR A CB    1 
ATOM   949  C  CG    . TYR A 1 124 ? 0.098  37.098 3.946   1.00  56.82 ? 118  TYR A CG    1 
ATOM   950  C  CD1   . TYR A 1 124 ? 0.943  37.198 5.065   1.00  56.47 ? 118  TYR A CD1   1 
ATOM   951  C  CD2   . TYR A 1 124 ? -0.362 35.828 3.577   1.00  55.86 ? 118  TYR A CD2   1 
ATOM   952  C  CE1   . TYR A 1 124 ? 1.314  36.070 5.788   1.00  55.93 ? 118  TYR A CE1   1 
ATOM   953  C  CE2   . TYR A 1 124 ? 0.005  34.693 4.296   1.00  55.73 ? 118  TYR A CE2   1 
ATOM   954  C  CZ    . TYR A 1 124 ? 0.844  34.824 5.399   1.00  56.55 ? 118  TYR A CZ    1 
ATOM   955  O  OH    . TYR A 1 124 ? 1.226  33.703 6.106   1.00  58.14 ? 118  TYR A OH    1 
ATOM   956  N  N     . ARG A 1 125 ? -1.839 41.129 2.546   0.83  57.85 ? 119  ARG A N     1 
ATOM   957  C  CA    . ARG A 1 125 ? -1.801 42.353 1.758   1.00  57.79 ? 119  ARG A CA    1 
ATOM   958  C  C     . ARG A 1 125 ? -1.412 43.522 2.639   1.00  57.87 ? 119  ARG A C     1 
ATOM   959  O  O     . ARG A 1 125 ? -0.695 44.414 2.204   1.00  58.77 ? 119  ARG A O     1 
ATOM   960  C  CB    . ARG A 1 125 ? -3.144 42.670 1.107   0.80  58.16 ? 119  ARG A CB    1 
ATOM   961  C  CG    . ARG A 1 125 ? -3.052 43.897 0.193   0.99  58.60 ? 119  ARG A CG    1 
ATOM   962  C  CD    . ARG A 1 125 ? -4.420 44.426 -0.202  0.84  58.24 ? 119  ARG A CD    1 
ATOM   963  N  NE    . ARG A 1 125 ? -5.155 44.942 0.953   0.52  57.63 ? 119  ARG A NE    1 
ATOM   964  C  CZ    . ARG A 1 125 ? -4.802 46.017 1.654   0.46  56.87 ? 119  ARG A CZ    1 
ATOM   965  N  NH1   . ARG A 1 125 ? -3.715 46.700 1.319   0.59  56.87 ? 119  ARG A NH1   1 
ATOM   966  N  NH2   . ARG A 1 125 ? -5.543 46.414 2.686   0.96  54.75 ? 119  ARG A NH2   1 
ATOM   967  N  N     . GLU A 1 126 ? -1.882 43.517 3.881   1.00  57.81 ? 120  GLU A N     1 
ATOM   968  C  CA    . GLU A 1 126 ? -1.569 44.602 4.805   1.00  57.58 ? 120  GLU A CA    1 
ATOM   969  C  C     . GLU A 1 126 ? -0.165 44.431 5.345   1.00  55.69 ? 120  GLU A C     1 
ATOM   970  O  O     . GLU A 1 126 ? 0.561  45.406 5.517   1.00  54.80 ? 120  GLU A O     1 
ATOM   971  C  CB    . GLU A 1 126 ? -2.566 44.625 5.959   1.00  59.10 ? 120  GLU A CB    1 
ATOM   972  C  CG    . GLU A 1 126 ? -4.004 44.594 5.505   1.00  62.79 ? 120  GLU A CG    1 
ATOM   973  C  CD    . GLU A 1 126 ? -4.954 45.221 6.512   1.00  64.59 ? 120  GLU A CD    1 
ATOM   974  O  OE1   . GLU A 1 126 ? -6.174 45.222 6.233   1.00  66.09 ? 120  GLU A OE1   1 
ATOM   975  O  OE2   . GLU A 1 126 ? -4.487 45.713 7.568   1.00  63.89 ? 120  GLU A OE2   1 
ATOM   976  N  N     . ALA A 1 127 ? 0.205  43.182 5.617   1.00  53.91 ? 121  ALA A N     1 
ATOM   977  C  CA    . ALA A 1 127 ? 1.533  42.866 6.130   1.00  53.04 ? 121  ALA A CA    1 
ATOM   978  C  C     . ALA A 1 127 ? 2.578  43.379 5.133   1.00  51.69 ? 121  ALA A C     1 
ATOM   979  O  O     . ALA A 1 127 ? 3.557  44.031 5.505   1.00  50.54 ? 121  ALA A O     1 
ATOM   980  C  CB    . ALA A 1 127 ? 1.670  41.356 6.317   1.00  52.98 ? 121  ALA A CB    1 
ATOM   981  N  N     . TYR A 1 128 ? 2.346  43.083 3.859   1.00  49.88 ? 122  TYR A N     1 
ATOM   982  C  CA    . TYR A 1 128 ? 3.235  43.507 2.785   1.00  48.74 ? 122  TYR A CA    1 
ATOM   983  C  C     . TYR A 1 128 ? 3.409  45.030 2.794   1.00  48.78 ? 122  TYR A C     1 
ATOM   984  O  O     . TYR A 1 128 ? 4.503  45.529 2.534   1.00  48.67 ? 122  TYR A O     1 
ATOM   985  C  CB    . TYR A 1 128 ? 2.663  43.060 1.441   1.00  48.46 ? 122  TYR A CB    1 
ATOM   986  C  CG    . TYR A 1 128 ? 3.548  43.350 0.258   1.00  48.08 ? 122  TYR A CG    1 
ATOM   987  C  CD1   . TYR A 1 128 ? 4.357  42.356 -0.282  1.00  48.90 ? 122  TYR A CD1   1 
ATOM   988  C  CD2   . TYR A 1 128 ? 3.554  44.607 -0.349  1.00  47.24 ? 122  TYR A CD2   1 
ATOM   989  C  CE1   . TYR A 1 128 ? 5.149  42.596 -1.407  1.00  49.13 ? 122  TYR A CE1   1 
ATOM   990  C  CE2   . TYR A 1 128 ? 4.346  44.863 -1.475  1.00  47.93 ? 122  TYR A CE2   1 
ATOM   991  C  CZ    . TYR A 1 128 ? 5.138  43.850 -2.005  1.00  48.81 ? 122  TYR A CZ    1 
ATOM   992  O  OH    . TYR A 1 128 ? 5.887  44.072 -3.147  1.00  46.12 ? 122  TYR A OH    1 
ATOM   993  N  N     . ASN A 1 129 ? 2.331  45.765 3.078   1.00  48.56 ? 123  ASN A N     1 
ATOM   994  C  CA    . ASN A 1 129 ? 2.395  47.226 3.126   1.00  47.72 ? 123  ASN A CA    1 
ATOM   995  C  C     . ASN A 1 129 ? 3.283  47.685 4.256   1.00  46.50 ? 123  ASN A C     1 
ATOM   996  O  O     . ASN A 1 129 ? 4.106  48.582 4.080   1.00  46.53 ? 123  ASN A O     1 
ATOM   997  C  CB    . ASN A 1 129 ? 1.016  47.846 3.332   1.00  50.23 ? 123  ASN A CB    1 
ATOM   998  C  CG    . ASN A 1 129 ? 0.182  47.842 2.074   1.00  52.83 ? 123  ASN A CG    1 
ATOM   999  O  OD1   . ASN A 1 129 ? 0.672  48.177 0.992   1.00  51.53 ? 123  ASN A OD1   1 
ATOM   1000 N  ND2   . ASN A 1 129 ? -1.098 47.479 2.208   1.00  53.98 ? 123  ASN A ND2   1 
ATOM   1001 N  N     . LEU A 1 130 ? 3.098  47.077 5.424   1.00  44.76 ? 124  LEU A N     1 
ATOM   1002 C  CA    . LEU A 1 130 ? 3.903  47.421 6.584   1.00  42.79 ? 124  LEU A CA    1 
ATOM   1003 C  C     . LEU A 1 130 ? 5.359  47.147 6.229   1.00  42.48 ? 124  LEU A C     1 
ATOM   1004 O  O     . LEU A 1 130 ? 6.272  47.821 6.710   1.00  41.11 ? 124  LEU A O     1 
ATOM   1005 C  CB    . LEU A 1 130 ? 3.490  46.584 7.792   1.00  40.71 ? 124  LEU A CB    1 
ATOM   1006 C  CG    . LEU A 1 130 ? 4.153  46.995 9.105   1.00  39.35 ? 124  LEU A CG    1 
ATOM   1007 C  CD1   . LEU A 1 130 ? 4.005  48.487 9.305   1.00  38.52 ? 124  LEU A CD1   1 
ATOM   1008 C  CD2   . LEU A 1 130 ? 3.527  46.249 10.246  1.00  37.45 ? 124  LEU A CD2   1 
ATOM   1009 N  N     . GLY A 1 131 ? 5.563  46.158 5.365   1.00  41.65 ? 125  GLY A N     1 
ATOM   1010 C  CA    . GLY A 1 131 ? 6.906  45.831 4.943   1.00  43.10 ? 125  GLY A CA    1 
ATOM   1011 C  C     . GLY A 1 131 ? 7.525  47.011 4.220   1.00  43.37 ? 125  GLY A C     1 
ATOM   1012 O  O     . GLY A 1 131 ? 8.611  47.478 4.580   1.00  42.96 ? 125  GLY A O     1 
ATOM   1013 N  N     . LEU A 1 132 ? 6.820  47.505 3.207   1.00  43.52 ? 126  LEU A N     1 
ATOM   1014 C  CA    . LEU A 1 132 ? 7.298  48.639 2.422   1.00  43.36 ? 126  LEU A CA    1 
ATOM   1015 C  C     . LEU A 1 132 ? 7.518  49.870 3.292   1.00  42.73 ? 126  LEU A C     1 
ATOM   1016 O  O     . LEU A 1 132 ? 8.546  50.526 3.171   1.00  41.90 ? 126  LEU A O     1 
ATOM   1017 C  CB    . LEU A 1 132 ? 6.317  48.951 1.299   1.00  44.25 ? 126  LEU A CB    1 
ATOM   1018 C  CG    . LEU A 1 132 ? 6.025  47.742 0.409   1.00  45.00 ? 126  LEU A CG    1 
ATOM   1019 C  CD1   . LEU A 1 132 ? 5.093  48.143 -0.711  1.00  45.18 ? 126  LEU A CD1   1 
ATOM   1020 C  CD2   . LEU A 1 132 ? 7.320  47.199 -0.160  1.00  46.01 ? 126  LEU A CD2   1 
ATOM   1021 N  N     . GLU A 1 133 ? 6.573  50.186 4.172   1.00  41.53 ? 127  GLU A N     1 
ATOM   1022 C  CA    . GLU A 1 133 ? 6.766  51.337 5.047   1.00  42.05 ? 127  GLU A CA    1 
ATOM   1023 C  C     . GLU A 1 133 ? 8.114  51.135 5.739   0.94  42.91 ? 127  GLU A C     1 
ATOM   1024 O  O     . GLU A 1 133 ? 9.005  51.993 5.666   1.00  45.07 ? 127  GLU A O     1 
ATOM   1025 C  CB    . GLU A 1 133 ? 5.695  51.424 6.140   1.00  41.64 ? 127  GLU A CB    1 
ATOM   1026 C  CG    . GLU A 1 133 ? 4.256  51.518 5.693   1.00  42.53 ? 127  GLU A CG    1 
ATOM   1027 C  CD    . GLU A 1 133 ? 3.301  51.707 6.880   0.010 41.81 ? 127  GLU A CD    1 
ATOM   1028 O  OE1   . GLU A 1 133 ? 2.090  51.405 6.756   0.92  42.51 ? 127  GLU A OE1   1 
ATOM   1029 O  OE2   . GLU A 1 133 ? 3.759  52.175 7.947   0.71  40.47 ? 127  GLU A OE2   1 
ATOM   1030 N  N     . ILE A 1 134 ? 8.248  49.988 6.406   1.00  41.76 ? 128  ILE A N     1 
ATOM   1031 C  CA    . ILE A 1 134 ? 9.455  49.642 7.141   1.00  40.70 ? 128  ILE A CA    1 
ATOM   1032 C  C     . ILE A 1 134 ? 10.723 49.796 6.313   1.00  40.31 ? 128  ILE A C     1 
ATOM   1033 O  O     . ILE A 1 134 ? 11.724 50.308 6.802   1.00  39.07 ? 128  ILE A O     1 
ATOM   1034 C  CB    . ILE A 1 134 ? 9.347  48.209 7.718   1.00  41.30 ? 128  ILE A CB    1 
ATOM   1035 C  CG1   . ILE A 1 134 ? 8.381  48.225 8.906   1.00  40.93 ? 128  ILE A CG1   1 
ATOM   1036 C  CG2   . ILE A 1 134 ? 10.718 47.699 8.156   1.00  41.30 ? 128  ILE A CG2   1 
ATOM   1037 C  CD1   . ILE A 1 134 ? 8.154  46.883 9.575   1.00  40.39 ? 128  ILE A CD1   1 
ATOM   1038 N  N     . LYS A 1 135 ? 10.693 49.357 5.063   1.00  39.99 ? 129  LYS A N     1 
ATOM   1039 C  CA    . LYS A 1 135 ? 11.870 49.509 4.227   1.00  40.90 ? 129  LYS A CA    1 
ATOM   1040 C  C     . LYS A 1 135 ? 12.105 51.003 3.983   1.00  41.89 ? 129  LYS A C     1 
ATOM   1041 O  O     . LYS A 1 135 ? 13.179 51.532 4.295   1.00  42.86 ? 129  LYS A O     1 
ATOM   1042 C  CB    . LYS A 1 135 ? 11.704 48.776 2.877   1.00  39.86 ? 129  LYS A CB    1 
ATOM   1043 C  CG    . LYS A 1 135 ? 11.834 47.254 2.939   1.00  38.79 ? 129  LYS A CG    1 
ATOM   1044 C  CD    . LYS A 1 135 ? 11.565 46.582 1.591   1.00  39.06 ? 129  LYS A CD    1 
ATOM   1045 C  CE    . LYS A 1 135 ? 12.819 46.347 0.752   1.00  39.51 ? 129  LYS A CE    1 
ATOM   1046 N  NZ    . LYS A 1 135 ? 13.413 47.578 0.156   1.00  42.16 ? 129  LYS A NZ    1 
ATOM   1047 N  N     . ASN A 1 136 ? 11.097 51.693 3.450   1.00  42.47 ? 130  ASN A N     1 
ATOM   1048 C  CA    . ASN A 1 136 ? 11.260 53.109 3.154   1.00  41.86 ? 130  ASN A CA    1 
ATOM   1049 C  C     . ASN A 1 136 ? 11.645 53.892 4.382   1.00  41.54 ? 130  ASN A C     1 
ATOM   1050 O  O     . ASN A 1 136 ? 12.363 54.876 4.287   1.00  41.42 ? 130  ASN A O     1 
ATOM   1051 C  CB    . ASN A 1 136 ? 9.995  53.711 2.557   1.00  43.13 ? 130  ASN A CB    1 
ATOM   1052 C  CG    . ASN A 1 136 ? 10.230 55.115 2.015   1.00  47.57 ? 130  ASN A CG    1 
ATOM   1053 O  OD1   . ASN A 1 136 ? 11.027 55.307 1.087   1.00  48.19 ? 130  ASN A OD1   1 
ATOM   1054 N  ND2   . ASN A 1 136 ? 9.549  56.107 2.598   1.00  46.01 ? 130  ASN A ND2   1 
ATOM   1055 N  N     . LYS A 1 137 ? 11.175 53.456 5.542   1.00  41.44 ? 131  LYS A N     1 
ATOM   1056 C  CA    . LYS A 1 137 ? 11.497 54.162 6.776   1.00  42.60 ? 131  LYS A CA    1 
ATOM   1057 C  C     . LYS A 1 137 ? 12.994 54.098 7.048   1.00  42.54 ? 131  LYS A C     1 
ATOM   1058 O  O     . LYS A 1 137 ? 13.669 55.121 7.141   1.00  42.94 ? 131  LYS A O     1 
ATOM   1059 C  CB    . LYS A 1 137 ? 10.749 53.552 7.964   1.00  44.57 ? 131  LYS A CB    1 
ATOM   1060 C  CG    . LYS A 1 137 ? 10.756 54.439 9.209   1.00  46.44 ? 131  LYS A CG    1 
ATOM   1061 C  CD    . LYS A 1 137 ? 9.927  55.711 8.981   1.00  48.64 ? 131  LYS A CD    1 
ATOM   1062 C  CE    . LYS A 1 137 ? 9.796  56.555 10.250  1.00  50.45 ? 131  LYS A CE    1 
ATOM   1063 N  NZ    . LYS A 1 137 ? 9.143  55.813 11.375  1.00  51.04 ? 131  LYS A NZ    1 
ATOM   1064 N  N     . ILE A 1 138 ? 13.510 52.879 7.168   1.00  41.73 ? 132  ILE A N     1 
ATOM   1065 C  CA    . ILE A 1 138 ? 14.921 52.670 7.446   1.00  39.34 ? 132  ILE A CA    1 
ATOM   1066 C  C     . ILE A 1 138 ? 15.765 53.334 6.368   1.00  38.49 ? 132  ILE A C     1 
ATOM   1067 O  O     . ILE A 1 138 ? 16.781 53.952 6.664   1.00  37.54 ? 132  ILE A O     1 
ATOM   1068 C  CB    . ILE A 1 138 ? 15.249 51.156 7.517   1.00  39.61 ? 132  ILE A CB    1 
ATOM   1069 C  CG1   . ILE A 1 138 ? 14.320 50.462 8.523   1.00  39.54 ? 132  ILE A CG1   1 
ATOM   1070 C  CG2   . ILE A 1 138 ? 16.683 50.954 7.939   1.00  38.33 ? 132  ILE A CG2   1 
ATOM   1071 C  CD1   . ILE A 1 138 ? 14.563 48.967 8.671   1.00  38.92 ? 132  ILE A CD1   1 
ATOM   1072 N  N     . LEU A 1 139 ? 15.339 53.218 5.115   1.00  38.19 ? 133  LEU A N     1 
ATOM   1073 C  CA    . LEU A 1 139 ? 16.093 53.828 4.028   1.00  39.62 ? 133  LEU A CA    1 
ATOM   1074 C  C     . LEU A 1 139 ? 16.195 55.333 4.226   1.00  40.83 ? 133  LEU A C     1 
ATOM   1075 O  O     . LEU A 1 139 ? 17.199 55.943 3.879   1.00  39.66 ? 133  LEU A O     1 
ATOM   1076 C  CB    . LEU A 1 139 ? 15.442 53.542 2.670   1.00  38.40 ? 133  LEU A CB    1 
ATOM   1077 C  CG    . LEU A 1 139 ? 16.237 54.145 1.506   1.00  38.03 ? 133  LEU A CG    1 
ATOM   1078 C  CD1   . LEU A 1 139 ? 17.691 53.740 1.643   1.00  36.45 ? 133  LEU A CD1   1 
ATOM   1079 C  CD2   . LEU A 1 139 ? 15.678 53.682 0.165   1.00  38.65 ? 133  LEU A CD2   1 
ATOM   1080 N  N     . GLU A 1 140 ? 15.148 55.922 4.794   1.00  42.76 ? 134  GLU A N     1 
ATOM   1081 C  CA    . GLU A 1 140 ? 15.095 57.358 5.037   1.00  43.61 ? 134  GLU A CA    1 
ATOM   1082 C  C     . GLU A 1 140 ? 15.997 57.792 6.181   1.00  43.40 ? 134  GLU A C     1 
ATOM   1083 O  O     . GLU A 1 140 ? 16.834 58.674 6.014   1.00  44.08 ? 134  GLU A O     1 
ATOM   1084 C  CB    . GLU A 1 140 ? 13.649 57.785 5.333   0.94  45.06 ? 134  GLU A CB    1 
ATOM   1085 C  CG    . GLU A 1 140 ? 13.475 59.265 5.624   0.85  46.58 ? 134  GLU A CG    1 
ATOM   1086 C  CD    . GLU A 1 140 ? 12.023 59.690 5.656   0.03  48.00 ? 134  GLU A CD    1 
ATOM   1087 O  OE1   . GLU A 1 140 ? 11.766 60.896 5.858   0.86  50.35 ? 134  GLU A OE1   1 
ATOM   1088 O  OE2   . GLU A 1 140 ? 11.143 58.821 5.478   0.60  48.88 ? 134  GLU A OE2   1 
ATOM   1089 N  N     . LYS A 1 141 ? 15.814 57.167 7.339   1.00  42.25 ? 135  LYS A N     1 
ATOM   1090 C  CA    . LYS A 1 141 ? 16.586 57.491 8.530   1.00  43.21 ? 135  LYS A CA    1 
ATOM   1091 C  C     . LYS A 1 141 ? 18.070 57.170 8.416   1.00  43.15 ? 135  LYS A C     1 
ATOM   1092 O  O     . LYS A 1 141 ? 18.913 58.057 8.508   1.00  42.90 ? 135  LYS A O     1 
ATOM   1093 C  CB    . LYS A 1 141 ? 16.025 56.740 9.735   1.00  43.98 ? 135  LYS A CB    1 
ATOM   1094 C  CG    . LYS A 1 141 ? 14.551 56.969 10.007  1.00  47.13 ? 135  LYS A CG    1 
ATOM   1095 C  CD    . LYS A 1 141 ? 14.268 58.369 10.539  1.00  48.15 ? 135  LYS A CD    1 
ATOM   1096 C  CE    . LYS A 1 141 ? 12.786 58.521 10.893  1.00  49.19 ? 135  LYS A CE    1 
ATOM   1097 N  NZ    . LYS A 1 141 ? 12.431 59.858 11.461  1.00  48.19 ? 135  LYS A NZ    1 
ATOM   1098 N  N     . GLU A 1 142 ? 18.373 55.888 8.222   1.00  43.00 ? 136  GLU A N     1 
ATOM   1099 C  CA    . GLU A 1 142 ? 19.746 55.401 8.137   1.00  42.51 ? 136  GLU A CA    1 
ATOM   1100 C  C     . GLU A 1 142 ? 20.356 55.267 6.753   1.00  42.19 ? 136  GLU A C     1 
ATOM   1101 O  O     . GLU A 1 142 ? 21.565 55.096 6.628   1.00  41.30 ? 136  GLU A O     1 
ATOM   1102 C  CB    . GLU A 1 142 ? 19.845 54.051 8.845   1.00  43.63 ? 136  GLU A CB    1 
ATOM   1103 C  CG    . GLU A 1 142 ? 19.643 54.124 10.343  1.00  45.19 ? 136  GLU A CG    1 
ATOM   1104 C  CD    . GLU A 1 142 ? 20.456 55.237 10.972  1.00  46.63 ? 136  GLU A CD    1 
ATOM   1105 O  OE1   . GLU A 1 142 ? 21.576 55.509 10.483  1.00  47.55 ? 136  GLU A OE1   1 
ATOM   1106 O  OE2   . GLU A 1 142 ? 19.978 55.838 11.960  1.00  47.64 ? 136  GLU A OE2   1 
ATOM   1107 N  N     . LYS A 1 143 ? 19.524 55.337 5.719   1.00  43.30 ? 137  LYS A N     1 
ATOM   1108 C  CA    . LYS A 1 143 ? 19.996 55.211 4.343   1.00  42.71 ? 137  LYS A CA    1 
ATOM   1109 C  C     . LYS A 1 143 ? 20.594 53.817 4.169   1.00  40.96 ? 137  LYS A C     1 
ATOM   1110 O  O     . LYS A 1 143 ? 21.592 53.618 3.466   1.00  40.57 ? 137  LYS A O     1 
ATOM   1111 C  CB    . LYS A 1 143 ? 21.023 56.309 4.039   1.00  43.72 ? 137  LYS A CB    1 
ATOM   1112 C  CG    . LYS A 1 143 ? 20.488 57.691 4.367   1.00  47.18 ? 137  LYS A CG    1 
ATOM   1113 C  CD    . LYS A 1 143 ? 21.447 58.811 4.001   1.00  52.80 ? 137  LYS A CD    1 
ATOM   1114 C  CE    . LYS A 1 143 ? 21.350 59.170 2.522   1.00  55.57 ? 137  LYS A CE    1 
ATOM   1115 N  NZ    . LYS A 1 143 ? 20.030 59.775 2.142   1.00  57.86 ? 137  LYS A NZ    1 
ATOM   1116 N  N     . ILE A 1 144 ? 19.955 52.855 4.832   1.00  39.04 ? 138  ILE A N     1 
ATOM   1117 C  CA    . ILE A 1 144 ? 20.364 51.452 4.786   1.00  38.10 ? 138  ILE A CA    1 
ATOM   1118 C  C     . ILE A 1 144 ? 19.257 50.605 4.154   1.00  38.49 ? 138  ILE A C     1 
ATOM   1119 O  O     . ILE A 1 144 ? 18.136 50.543 4.674   1.00  40.77 ? 138  ILE A O     1 
ATOM   1120 C  CB    . ILE A 1 144 ? 20.668 50.916 6.214   1.00  36.74 ? 138  ILE A CB    1 
ATOM   1121 C  CG1   . ILE A 1 144 ? 22.073 51.339 6.627   1.00  34.45 ? 138  ILE A CG1   1 
ATOM   1122 C  CG2   . ILE A 1 144 ? 20.529 49.404 6.264   1.00  34.05 ? 138  ILE A CG2   1 
ATOM   1123 C  CD1   . ILE A 1 144 ? 23.140 50.875 5.658   1.00  33.24 ? 138  ILE A CD1   1 
ATOM   1124 N  N     . THR A 1 145 ? 19.552 49.970 3.026   1.00  36.95 ? 139  THR A N     1 
ATOM   1125 C  CA    . THR A 1 145 ? 18.542 49.138 2.393   1.00  36.21 ? 139  THR A CA    1 
ATOM   1126 C  C     . THR A 1 145 ? 18.523 47.768 3.086   1.00  34.20 ? 139  THR A C     1 
ATOM   1127 O  O     . THR A 1 145 ? 19.558 47.276 3.547   1.00  34.49 ? 139  THR A O     1 
ATOM   1128 C  CB    . THR A 1 145 ? 18.800 48.967 0.862   1.00  37.52 ? 139  THR A CB    1 
ATOM   1129 O  OG1   . THR A 1 145 ? 19.548 47.772 0.617   1.00  38.53 ? 139  THR A OG1   1 
ATOM   1130 C  CG2   . THR A 1 145 ? 19.553 50.147 0.322   1.00  36.48 ? 139  THR A CG2   1 
ATOM   1131 N  N     . VAL A 1 146 ? 17.337 47.174 3.169   1.00  32.25 ? 140  VAL A N     1 
ATOM   1132 C  CA    . VAL A 1 146 ? 17.156 45.878 3.807   1.00  30.60 ? 140  VAL A CA    1 
ATOM   1133 C  C     . VAL A 1 146 ? 16.222 44.997 2.979   1.00  31.42 ? 140  VAL A C     1 
ATOM   1134 O  O     . VAL A 1 146 ? 15.625 45.453 2.006   1.00  32.97 ? 140  VAL A O     1 
ATOM   1135 C  CB    . VAL A 1 146 ? 16.539 46.036 5.212   1.00  28.89 ? 140  VAL A CB    1 
ATOM   1136 C  CG1   . VAL A 1 146 ? 17.175 47.216 5.928   1.00  27.80 ? 140  VAL A CG1   1 
ATOM   1137 C  CG2   . VAL A 1 146 ? 15.039 46.225 5.110   1.00  29.31 ? 140  VAL A CG2   1 
ATOM   1138 N  N     . THR A 1 147 ? 16.110 43.731 3.362   1.00  29.62 ? 141  THR A N     1 
ATOM   1139 C  CA    . THR A 1 147 ? 15.217 42.817 2.676   1.00  28.58 ? 141  THR A CA    1 
ATOM   1140 C  C     . THR A 1 147 ? 14.234 42.367 3.742   1.00  29.64 ? 141  THR A C     1 
ATOM   1141 O  O     . THR A 1 147 ? 14.591 42.264 4.913   1.00  29.47 ? 141  THR A O     1 
ATOM   1142 C  CB    . THR A 1 147 ? 15.952 41.591 2.118   1.00  26.09 ? 141  THR A CB    1 
ATOM   1143 O  OG1   . THR A 1 147 ? 16.869 42.000 1.102   1.00  25.71 ? 141  THR A OG1   1 
ATOM   1144 C  CG2   . THR A 1 147 ? 14.964 40.616 1.521   1.00  24.42 ? 141  THR A CG2   1 
ATOM   1145 N  N     . VAL A 1 148 ? 12.993 42.124 3.341   1.00  30.29 ? 142  VAL A N     1 
ATOM   1146 C  CA    . VAL A 1 148 ? 11.969 41.683 4.277   1.00  30.82 ? 142  VAL A CA    1 
ATOM   1147 C  C     . VAL A 1 148 ? 11.305 40.402 3.784   1.00  31.20 ? 142  VAL A C     1 
ATOM   1148 O  O     . VAL A 1 148 ? 11.061 40.248 2.590   1.00  32.17 ? 142  VAL A O     1 
ATOM   1149 C  CB    . VAL A 1 148 ? 10.882 42.763 4.478   1.00  32.21 ? 142  VAL A CB    1 
ATOM   1150 C  CG1   . VAL A 1 148 ? 9.719  42.189 5.282   1.00  32.93 ? 142  VAL A CG1   1 
ATOM   1151 C  CG2   . VAL A 1 148 ? 11.478 43.974 5.201   1.00  32.05 ? 142  VAL A CG2   1 
ATOM   1152 N  N     . GLY A 1 149 ? 11.036 39.486 4.712   1.00  30.63 ? 143  GLY A N     1 
ATOM   1153 C  CA    . GLY A 1 149 ? 10.387 38.230 4.383   1.00  30.46 ? 143  GLY A CA    1 
ATOM   1154 C  C     . GLY A 1 149 ? 9.209  38.088 5.328   1.00  32.81 ? 143  GLY A C     1 
ATOM   1155 O  O     . GLY A 1 149 ? 9.338  38.408 6.518   1.00  34.09 ? 143  GLY A O     1 
ATOM   1156 N  N     . ILE A 1 150 ? 8.066  37.619 4.816   1.00  34.48 ? 144  ILE A N     1 
ATOM   1157 C  CA    . ILE A 1 150 ? 6.838  37.468 5.620   1.00  35.41 ? 144  ILE A CA    1 
ATOM   1158 C  C     . ILE A 1 150 ? 6.189  36.111 5.444   1.00  35.87 ? 144  ILE A C     1 
ATOM   1159 O  O     . ILE A 1 150 ? 6.020  35.650 4.311   1.00  35.53 ? 144  ILE A O     1 
ATOM   1160 C  CB    . ILE A 1 150 ? 5.760  38.521 5.230   1.00  35.81 ? 144  ILE A CB    1 
ATOM   1161 C  CG1   . ILE A 1 150 ? 6.231  39.931 5.594   1.00  36.46 ? 144  ILE A CG1   1 
ATOM   1162 C  CG2   . ILE A 1 150 ? 4.448  38.211 5.925   1.00  35.49 ? 144  ILE A CG2   1 
ATOM   1163 C  CD1   . ILE A 1 150 ? 5.286  41.024 5.142   1.00  38.92 ? 144  ILE A CD1   1 
ATOM   1164 N  N     . SER A 1 151 ? 5.828  35.477 6.559   1.00  36.63 ? 145  SER A N     1 
ATOM   1165 C  CA    . SER A 1 151 ? 5.163  34.176 6.504   1.00  37.86 ? 145  SER A CA    1 
ATOM   1166 C  C     . SER A 1 151 ? 4.506  33.834 7.834   1.00  38.54 ? 145  SER A C     1 
ATOM   1167 O  O     . SER A 1 151 ? 4.427  34.696 8.713   1.00  39.23 ? 145  SER A O     1 
ATOM   1168 C  CB    . SER A 1 151 ? 6.152  33.082 6.100   1.00  37.68 ? 145  SER A CB    1 
ATOM   1169 O  OG    . SER A 1 151 ? 5.464  31.905 5.720   1.00  38.02 ? 145  SER A OG    1 
ATOM   1170 N  N     . LYS A 1 152 ? 4.043  32.588 7.978   1.00  38.60 ? 146  LYS A N     1 
ATOM   1171 C  CA    . LYS A 1 152 ? 3.355  32.139 9.197   1.00  38.96 ? 146  LYS A CA    1 
ATOM   1172 C  C     . LYS A 1 152 ? 4.218  31.850 10.435  1.00  37.96 ? 146  LYS A C     1 
ATOM   1173 O  O     . LYS A 1 152 ? 3.715  31.898 11.558  1.00  38.69 ? 146  LYS A O     1 
ATOM   1174 C  CB    . LYS A 1 152 ? 2.471  30.922 8.883   1.00  40.26 ? 146  LYS A CB    1 
ATOM   1175 C  CG    . LYS A 1 152 ? 3.215  29.750 8.258   1.00  42.62 ? 146  LYS A CG    1 
ATOM   1176 C  CD    . LYS A 1 152 ? 2.337  28.914 7.313   1.00  45.51 ? 146  LYS A CD    1 
ATOM   1177 C  CE    . LYS A 1 152 ? 1.183  28.206 8.031   1.00  46.37 ? 146  LYS A CE    1 
ATOM   1178 N  NZ    . LYS A 1 152 ? 0.456  27.265 7.113   1.00  49.20 ? 146  LYS A NZ    1 
ATOM   1179 N  N     . ASN A 1 153 ? 5.501  31.548 10.239  1.00  35.97 ? 147  ASN A N     1 
ATOM   1180 C  CA    . ASN A 1 153 ? 6.425  31.283 11.355  1.00  34.40 ? 147  ASN A CA    1 
ATOM   1181 C  C     . ASN A 1 153 ? 7.788  31.877 10.999  1.00  33.57 ? 147  ASN A C     1 
ATOM   1182 O  O     . ASN A 1 153 ? 8.029  32.224 9.850   1.00  34.91 ? 147  ASN A O     1 
ATOM   1183 C  CB    . ASN A 1 153 ? 6.568  29.775 11.617  1.00  32.17 ? 147  ASN A CB    1 
ATOM   1184 C  CG    . ASN A 1 153 ? 7.129  29.006 10.407  1.00  32.97 ? 147  ASN A CG    1 
ATOM   1185 O  OD1   . ASN A 1 153 ? 8.156  29.390 9.826   1.00  35.48 ? 147  ASN A OD1   1 
ATOM   1186 N  ND2   . ASN A 1 153 ? 6.463  27.911 10.036  1.00  29.28 ? 147  ASN A ND2   1 
ATOM   1187 N  N     . LYS A 1 154 ? 8.678  31.989 11.976  1.00  31.85 ? 148  LYS A N     1 
ATOM   1188 C  CA    . LYS A 1 154 ? 10.002 32.556 11.741  1.00  30.70 ? 148  LYS A CA    1 
ATOM   1189 C  C     . LYS A 1 154 ? 10.783 31.965 10.573  1.00  30.31 ? 148  LYS A C     1 
ATOM   1190 O  O     . LYS A 1 154 ? 11.213 32.696 9.673   1.00  28.68 ? 148  LYS A O     1 
ATOM   1191 C  CB    . LYS A 1 154 ? 10.856 32.433 12.999  1.00  31.94 ? 148  LYS A CB    1 
ATOM   1192 C  CG    . LYS A 1 154 ? 10.780 33.630 13.929  1.00  33.48 ? 148  LYS A CG    1 
ATOM   1193 C  CD    . LYS A 1 154 ? 11.666 33.412 15.144  1.00  36.82 ? 148  LYS A CD    1 
ATOM   1194 C  CE    . LYS A 1 154 ? 11.151 32.271 16.020  1.00  36.80 ? 148  LYS A CE    1 
ATOM   1195 N  NZ    . LYS A 1 154 ? 12.188 31.832 16.978  1.00  38.93 ? 148  LYS A NZ    1 
ATOM   1196 N  N     . VAL A 1 155 ? 10.976 30.647 10.605  1.00  28.40 ? 149  VAL A N     1 
ATOM   1197 C  CA    . VAL A 1 155 ? 11.734 29.952 9.570   1.00  27.53 ? 149  VAL A CA    1 
ATOM   1198 C  C     . VAL A 1 155 ? 11.341 30.356 8.170   1.00  28.32 ? 149  VAL A C     1 
ATOM   1199 O  O     . VAL A 1 155 ? 12.176 30.783 7.391   1.00  27.97 ? 149  VAL A O     1 
ATOM   1200 C  CB    . VAL A 1 155 ? 11.581 28.412 9.655   1.00  28.36 ? 149  VAL A CB    1 
ATOM   1201 C  CG1   . VAL A 1 155 ? 12.248 27.762 8.440   1.00  25.40 ? 149  VAL A CG1   1 
ATOM   1202 C  CG2   . VAL A 1 155 ? 12.183 27.891 10.936  1.00  23.86 ? 149  VAL A CG2   1 
ATOM   1203 N  N     . PHE A 1 156 ? 10.067 30.202 7.832   1.00  30.07 ? 150  PHE A N     1 
ATOM   1204 C  CA    . PHE A 1 156 ? 9.637  30.559 6.491   1.00  30.31 ? 150  PHE A CA    1 
ATOM   1205 C  C     . PHE A 1 156 ? 9.822  32.048 6.217   1.00  30.33 ? 150  PHE A C     1 
ATOM   1206 O  O     . PHE A 1 156 ? 10.224 32.418 5.117   1.00  30.68 ? 150  PHE A O     1 
ATOM   1207 C  CB    . PHE A 1 156 ? 8.201  30.082 6.252   1.00  31.30 ? 150  PHE A CB    1 
ATOM   1208 C  CG    . PHE A 1 156 ? 8.085  28.571 6.120   1.00  34.41 ? 150  PHE A CG    1 
ATOM   1209 C  CD1   . PHE A 1 156 ? 7.259  27.840 6.963   1.00  35.38 ? 150  PHE A CD1   1 
ATOM   1210 C  CD2   . PHE A 1 156 ? 8.827  27.882 5.159   1.00  34.87 ? 150  PHE A CD2   1 
ATOM   1211 C  CE1   . PHE A 1 156 ? 7.173  26.455 6.854   1.00  35.87 ? 150  PHE A CE1   1 
ATOM   1212 C  CE2   . PHE A 1 156 ? 8.749  26.497 5.043   1.00  33.64 ? 150  PHE A CE2   1 
ATOM   1213 C  CZ    . PHE A 1 156 ? 7.921  25.783 5.892   1.00  35.72 ? 150  PHE A CZ    1 
ATOM   1214 N  N     . ALA A 1 157 ? 9.582  32.898 7.213   1.00  29.75 ? 151  ALA A N     1 
ATOM   1215 C  CA    . ALA A 1 157 ? 9.789  34.342 7.030   1.00  30.59 ? 151  ALA A CA    1 
ATOM   1216 C  C     . ALA A 1 157 ? 11.222 34.527 6.528   1.00  29.92 ? 151  ALA A C     1 
ATOM   1217 O  O     . ALA A 1 157 ? 11.457 35.158 5.494   1.00  30.93 ? 151  ALA A O     1 
ATOM   1218 C  CB    . ALA A 1 157 ? 9.595  35.109 8.362   1.00  28.08 ? 151  ALA A CB    1 
ATOM   1219 N  N     . LYS A 1 158 ? 12.171 33.958 7.263   1.00  28.82 ? 152  LYS A N     1 
ATOM   1220 C  CA    . LYS A 1 158 ? 13.576 34.042 6.895   1.00  30.30 ? 152  LYS A CA    1 
ATOM   1221 C  C     . LYS A 1 158 ? 13.823 33.608 5.444   1.00  29.94 ? 152  LYS A C     1 
ATOM   1222 O  O     . LYS A 1 158 ? 14.423 34.348 4.672   1.00  30.07 ? 152  LYS A O     1 
ATOM   1223 C  CB    . LYS A 1 158 ? 14.406 33.178 7.847   1.00  31.95 ? 152  LYS A CB    1 
ATOM   1224 C  CG    . LYS A 1 158 ? 15.778 32.840 7.320   1.00  34.37 ? 152  LYS A CG    1 
ATOM   1225 C  CD    . LYS A 1 158 ? 16.745 33.949 7.555   1.00  38.35 ? 152  LYS A CD    1 
ATOM   1226 C  CE    . LYS A 1 158 ? 17.467 33.679 8.871   1.00  40.95 ? 152  LYS A CE    1 
ATOM   1227 N  NZ    . LYS A 1 158 ? 18.222 32.390 8.811   1.00  42.80 ? 152  LYS A NZ    1 
ATOM   1228 N  N     . ILE A 1 159 ? 13.362 32.411 5.080   1.00  29.86 ? 153  ILE A N     1 
ATOM   1229 C  CA    . ILE A 1 159 ? 13.549 31.884 3.728   1.00  29.74 ? 153  ILE A CA    1 
ATOM   1230 C  C     . ILE A 1 159 ? 13.004 32.807 2.632   1.00  31.49 ? 153  ILE A C     1 
ATOM   1231 O  O     . ILE A 1 159 ? 13.617 32.942 1.560   1.00  30.48 ? 153  ILE A O     1 
ATOM   1232 C  CB    . ILE A 1 159 ? 12.902 30.501 3.608   1.00  29.28 ? 153  ILE A CB    1 
ATOM   1233 C  CG1   . ILE A 1 159 ? 13.571 29.552 4.600   1.00  30.57 ? 153  ILE A CG1   1 
ATOM   1234 C  CG2   . ILE A 1 159 ? 13.027 29.974 2.197   1.00  26.56 ? 153  ILE A CG2   1 
ATOM   1235 C  CD1   . ILE A 1 159 ? 13.017 28.130 4.608   1.00  30.58 ? 153  ILE A CD1   1 
ATOM   1236 N  N     . ALA A 1 160 ? 11.858 33.440 2.896   1.00  31.94 ? 154  ALA A N     1 
ATOM   1237 C  CA    . ALA A 1 160 ? 11.257 34.362 1.931   1.00  32.02 ? 154  ALA A CA    1 
ATOM   1238 C  C     . ALA A 1 160 ? 12.236 35.510 1.679   1.00  31.67 ? 154  ALA A C     1 
ATOM   1239 O  O     . ALA A 1 160 ? 12.387 35.973 0.551   1.00  31.65 ? 154  ALA A O     1 
ATOM   1240 C  CB    . ALA A 1 160 ? 9.927  34.903 2.467   1.00  31.64 ? 154  ALA A CB    1 
ATOM   1241 N  N     . ALA A 1 161 ? 12.903 35.965 2.734   1.00  30.41 ? 155  ALA A N     1 
ATOM   1242 C  CA    . ALA A 1 161 ? 13.880 37.034 2.598   1.00  31.90 ? 155  ALA A CA    1 
ATOM   1243 C  C     . ALA A 1 161 ? 15.110 36.551 1.821   1.00  34.50 ? 155  ALA A C     1 
ATOM   1244 O  O     . ALA A 1 161 ? 15.614 37.267 0.953   1.00  33.84 ? 155  ALA A O     1 
ATOM   1245 C  CB    . ALA A 1 161 ? 14.296 37.535 3.958   1.00  32.35 ? 155  ALA A CB    1 
ATOM   1246 N  N     . ASP A 1 162 ? 15.603 35.349 2.128   1.00  35.93 ? 156  ASP A N     1 
ATOM   1247 C  CA    . ASP A 1 162 ? 16.767 34.833 1.410   1.00  39.10 ? 156  ASP A CA    1 
ATOM   1248 C  C     . ASP A 1 162 ? 16.413 34.828 -0.062  1.00  40.56 ? 156  ASP A C     1 
ATOM   1249 O  O     . ASP A 1 162 ? 17.245 35.124 -0.916  1.00  41.72 ? 156  ASP A O     1 
ATOM   1250 C  CB    . ASP A 1 162 ? 17.132 33.400 1.834   1.00  41.42 ? 156  ASP A CB    1 
ATOM   1251 C  CG    . ASP A 1 162 ? 18.009 33.353 3.082   1.00  46.49 ? 156  ASP A CG    1 
ATOM   1252 O  OD1   . ASP A 1 162 ? 18.836 34.283 3.266   1.00  47.03 ? 156  ASP A OD1   1 
ATOM   1253 O  OD2   . ASP A 1 162 ? 17.880 32.374 3.863   1.00  47.20 ? 156  ASP A OD2   1 
ATOM   1254 N  N     . MET A 1 163 ? 15.161 34.500 -0.354  1.00  42.22 ? 157  MET A N     1 
ATOM   1255 C  CA    . MET A 1 163 ? 14.712 34.452 -1.732  1.00  43.38 ? 157  MET A CA    1 
ATOM   1256 C  C     . MET A 1 163 ? 14.579 35.826 -2.364  1.00  43.39 ? 157  MET A C     1 
ATOM   1257 O  O     . MET A 1 163 ? 14.764 35.977 -3.573  1.00  43.76 ? 157  MET A O     1 
ATOM   1258 C  CB    . MET A 1 163 ? 13.372 33.732 -1.816  1.00  44.85 ? 157  MET A CB    1 
ATOM   1259 C  CG    . MET A 1 163 ? 13.472 32.224 -1.702  1.00  46.16 ? 157  MET A CG    1 
ATOM   1260 S  SD    . MET A 1 163 ? 11.843 31.505 -1.556  1.00  48.03 ? 157  MET A SD    1 
ATOM   1261 C  CE    . MET A 1 163 ? 11.186 31.700 -3.204  1.00  48.47 ? 157  MET A CE    1 
ATOM   1262 N  N     . ALA A 1 164 ? 14.265 36.821 -1.538  1.00  42.53 ? 158  ALA A N     1 
ATOM   1263 C  CA    . ALA A 1 164 ? 14.061 38.186 -2.005  1.00  41.64 ? 158  ALA A CA    1 
ATOM   1264 C  C     . ALA A 1 164 ? 15.299 39.070 -2.049  1.00  42.27 ? 158  ALA A C     1 
ATOM   1265 O  O     . ALA A 1 164 ? 15.273 40.134 -2.663  1.00  41.43 ? 158  ALA A O     1 
ATOM   1266 C  CB    . ALA A 1 164 ? 12.999 38.852 -1.152  1.00  39.79 ? 158  ALA A CB    1 
ATOM   1267 N  N     . LYS A 1 165 ? 16.387 38.647 -1.417  1.00  44.44 ? 159  LYS A N     1 
ATOM   1268 C  CA    . LYS A 1 165 ? 17.576 39.496 -1.417  1.00  47.47 ? 159  LYS A CA    1 
ATOM   1269 C  C     . LYS A 1 165 ? 18.148 39.709 -2.830  1.00  46.43 ? 159  LYS A C     1 
ATOM   1270 O  O     . LYS A 1 165 ? 18.073 38.823 -3.688  1.00  46.00 ? 159  LYS A O     1 
ATOM   1271 C  CB    . LYS A 1 165 ? 18.637 38.946 -0.444  1.00  49.40 ? 159  LYS A CB    1 
ATOM   1272 C  CG    . LYS A 1 165 ? 18.307 39.031 1.037   1.00  56.08 ? 159  LYS A CG    1 
ATOM   1273 C  CD    . LYS A 1 165 ? 19.479 38.478 1.873   1.00  60.09 ? 159  LYS A CD    1 
ATOM   1274 C  CE    . LYS A 1 165 ? 19.013 37.803 3.171   1.00  63.56 ? 159  LYS A CE    1 
ATOM   1275 N  NZ    . LYS A 1 165 ? 18.281 36.525 2.911   1.00  66.82 ? 159  LYS A NZ    1 
ATOM   1276 N  N     . PRO A 1 166 ? 18.727 40.901 -3.089  1.00  46.34 ? 160  PRO A N     1 
ATOM   1277 C  CA    . PRO A 1 166 ? 18.875 42.029 -2.158  1.00  45.37 ? 160  PRO A CA    1 
ATOM   1278 C  C     . PRO A 1 166 ? 17.812 43.116 -2.322  1.00  43.79 ? 160  PRO A C     1 
ATOM   1279 O  O     . PRO A 1 166 ? 17.155 43.216 -3.347  1.00  41.61 ? 160  PRO A O     1 
ATOM   1280 C  CB    . PRO A 1 166 ? 20.250 42.558 -2.507  1.00  45.59 ? 160  PRO A CB    1 
ATOM   1281 C  CG    . PRO A 1 166 ? 20.185 42.504 -4.028  1.00  46.04 ? 160  PRO A CG    1 
ATOM   1282 C  CD    . PRO A 1 166 ? 19.483 41.166 -4.331  1.00  45.74 ? 160  PRO A CD    1 
ATOM   1283 N  N     . ASN A 1 167 ? 17.669 43.937 -1.293  1.00  43.53 ? 161  ASN A N     1 
ATOM   1284 C  CA    . ASN A 1 167 ? 16.719 45.035 -1.302  1.00  42.65 ? 161  ASN A CA    1 
ATOM   1285 C  C     . ASN A 1 167 ? 15.332 44.610 -1.744  1.00  40.91 ? 161  ASN A C     1 
ATOM   1286 O  O     . ASN A 1 167 ? 14.650 45.344 -2.455  1.00  41.27 ? 161  ASN A O     1 
ATOM   1287 C  CB    . ASN A 1 167 ? 17.241 46.152 -2.208  1.00  43.53 ? 161  ASN A CB    1 
ATOM   1288 C  CG    . ASN A 1 167 ? 16.381 47.409 -2.148  1.00  44.75 ? 161  ASN A CG    1 
ATOM   1289 O  OD1   . ASN A 1 167 ? 15.680 47.664 -1.153  1.00  44.71 ? 161  ASN A OD1   1 
ATOM   1290 N  ND2   . ASN A 1 167 ? 16.441 48.210 -3.207  1.00  44.12 ? 161  ASN A ND2   1 
ATOM   1291 N  N     . GLY A 1 168 ? 14.906 43.433 -1.312  1.00  39.37 ? 162  GLY A N     1 
ATOM   1292 C  CA    . GLY A 1 168 ? 13.602 42.972 -1.720  1.00  37.34 ? 162  GLY A CA    1 
ATOM   1293 C  C     . GLY A 1 168 ? 12.640 42.814 -0.575  1.00  37.40 ? 162  GLY A C     1 
ATOM   1294 O  O     . GLY A 1 168 ? 12.934 43.198 0.554   1.00  37.07 ? 162  GLY A O     1 
ATOM   1295 N  N     . ILE A 1 169 ? 11.474 42.265 -0.893  1.00  37.46 ? 163  ILE A N     1 
ATOM   1296 C  CA    . ILE A 1 169 ? 10.431 41.988 0.081   1.00  37.65 ? 163  ILE A CA    1 
ATOM   1297 C  C     . ILE A 1 169 ? 9.610  40.868 -0.536  1.00  38.18 ? 163  ILE A C     1 
ATOM   1298 O  O     . ILE A 1 169 ? 9.300  40.894 -1.730  1.00  38.08 ? 163  ILE A O     1 
ATOM   1299 C  CB    . ILE A 1 169 ? 9.548  43.212 0.343   1.00  37.29 ? 163  ILE A CB    1 
ATOM   1300 C  CG1   . ILE A 1 169 ? 8.440  42.832 1.311   1.00  36.56 ? 163  ILE A CG1   1 
ATOM   1301 C  CG2   . ILE A 1 169 ? 8.955  43.733 -0.946  1.00  37.03 ? 163  ILE A CG2   1 
ATOM   1302 C  CD1   . ILE A 1 169 ? 7.529  43.981 1.650   1.00  37.52 ? 163  ILE A CD1   1 
ATOM   1303 N  N     . LYS A 1 170 ? 9.275  39.867 0.262   1.00  38.41 ? 164  LYS A N     1 
ATOM   1304 C  CA    . LYS A 1 170 ? 8.522  38.745 -0.272  1.00  39.76 ? 164  LYS A CA    1 
ATOM   1305 C  C     . LYS A 1 170 ? 7.606  38.127 0.749   1.00  39.92 ? 164  LYS A C     1 
ATOM   1306 O  O     . LYS A 1 170 ? 7.918  38.082 1.937   1.00  38.79 ? 164  LYS A O     1 
ATOM   1307 C  CB    . LYS A 1 170 ? 9.483  37.681 -0.806  1.00  40.17 ? 164  LYS A CB    1 
ATOM   1308 C  CG    . LYS A 1 170 ? 8.822  36.398 -1.237  1.00  43.05 ? 164  LYS A CG    1 
ATOM   1309 C  CD    . LYS A 1 170 ? 9.826  35.463 -1.907  1.00  47.22 ? 164  LYS A CD    1 
ATOM   1310 C  CE    . LYS A 1 170 ? 9.172  34.143 -2.312  1.00  49.68 ? 164  LYS A CE    1 
ATOM   1311 N  NZ    . LYS A 1 170 ? 7.963  34.365 -3.167  1.00  51.05 ? 164  LYS A NZ    1 
ATOM   1312 N  N     . VAL A 1 171 ? 6.462  37.655 0.272   1.00  40.34 ? 165  VAL A N     1 
ATOM   1313 C  CA    . VAL A 1 171 ? 5.487  37.007 1.136   1.00  40.12 ? 165  VAL A CA    1 
ATOM   1314 C  C     . VAL A 1 171 ? 5.350  35.545 0.738   1.00  40.59 ? 165  VAL A C     1 
ATOM   1315 O  O     . VAL A 1 171 ? 5.160  35.245 -0.436  1.00  42.19 ? 165  VAL A O     1 
ATOM   1316 C  CB    . VAL A 1 171 ? 4.100  37.678 1.015   1.00  39.84 ? 165  VAL A CB    1 
ATOM   1317 C  CG1   . VAL A 1 171 ? 3.008  36.724 1.499   1.00  38.43 ? 165  VAL A CG1   1 
ATOM   1318 C  CG2   . VAL A 1 171 ? 4.079  38.976 1.828   1.00  38.71 ? 165  VAL A CG2   1 
ATOM   1319 N  N     . ILE A 1 172 ? 5.493  34.634 1.693   1.00  40.41 ? 166  ILE A N     1 
ATOM   1320 C  CA    . ILE A 1 172 ? 5.299  33.226 1.385   1.00  41.45 ? 166  ILE A CA    1 
ATOM   1321 C  C     . ILE A 1 172 ? 3.998  32.861 2.100   1.00  43.74 ? 166  ILE A C     1 
ATOM   1322 O  O     . ILE A 1 172 ? 3.990  32.673 3.322   1.00  43.54 ? 166  ILE A O     1 
ATOM   1323 C  CB    . ILE A 1 172 ? 6.450  32.345 1.898   1.00  39.87 ? 166  ILE A CB    1 
ATOM   1324 C  CG1   . ILE A 1 172 ? 7.704  32.573 1.044   1.00  39.26 ? 166  ILE A CG1   1 
ATOM   1325 C  CG2   . ILE A 1 172 ? 6.052  30.877 1.818   1.00  38.23 ? 166  ILE A CG2   1 
ATOM   1326 C  CD1   . ILE A 1 172 ? 8.926  31.748 1.479   1.00  36.55 ? 166  ILE A CD1   1 
ATOM   1327 N  N     . ASP A 1 173 ? 2.899  32.799 1.336   1.00  45.23 ? 167  ASP A N     1 
ATOM   1328 C  CA    . ASP A 1 173 ? 1.584  32.487 1.900   1.00  46.58 ? 167  ASP A CA    1 
ATOM   1329 C  C     . ASP A 1 173 ? 1.397  31.000 2.144   1.00  47.73 ? 167  ASP A C     1 
ATOM   1330 O  O     . ASP A 1 173 ? 2.190  30.182 1.687   1.00  47.12 ? 167  ASP A O     1 
ATOM   1331 C  CB    . ASP A 1 173 ? 0.455  33.022 1.002   1.00  47.39 ? 167  ASP A CB    1 
ATOM   1332 C  CG    . ASP A 1 173 ? 0.472  32.429 -0.403  1.00  49.16 ? 167  ASP A CG    1 
ATOM   1333 O  OD1   . ASP A 1 173 ? 0.587  31.198 -0.543  1.00  49.90 ? 167  ASP A OD1   1 
ATOM   1334 O  OD2   . ASP A 1 173 ? 0.349  33.197 -1.376  1.00  49.89 ? 167  ASP A OD2   1 
ATOM   1335 N  N     . ASP A 1 174 ? 0.336  30.656 2.863   1.00  49.00 ? 168  ASP A N     1 
ATOM   1336 C  CA    . ASP A 1 174 ? 0.053  29.267 3.194   1.00  49.62 ? 168  ASP A CA    1 
ATOM   1337 C  C     . ASP A 1 174 ? 0.091  28.290 2.020   1.00  49.06 ? 168  ASP A C     1 
ATOM   1338 O  O     . ASP A 1 174 ? 0.486  27.142 2.189   1.00  50.22 ? 168  ASP A O     1 
ATOM   1339 C  CB    . ASP A 1 174 ? -1.288 29.172 3.919   1.00  51.48 ? 168  ASP A CB    1 
ATOM   1340 C  CG    . ASP A 1 174 ? -1.325 30.022 5.180   1.00  54.74 ? 168  ASP A CG    1 
ATOM   1341 O  OD1   . ASP A 1 174 ? -2.274 29.879 5.980   1.00  56.40 ? 168  ASP A OD1   1 
ATOM   1342 O  OD2   . ASP A 1 174 ? -0.403 30.843 5.374   1.00  57.35 ? 168  ASP A OD2   1 
ATOM   1343 N  N     . GLU A 1 175 ? -0.307 28.728 0.836   0.72  48.30 ? 169  GLU A N     1 
ATOM   1344 C  CA    . GLU A 1 175 ? -0.280 27.831 -0.311  1.00  47.88 ? 169  GLU A CA    1 
ATOM   1345 C  C     . GLU A 1 175 ? 1.160  27.545 -0.716  1.00  47.78 ? 169  GLU A C     1 
ATOM   1346 O  O     . GLU A 1 175 ? 1.514  26.413 -1.043  0.84  46.81 ? 169  GLU A O     1 
ATOM   1347 C  CB    . GLU A 1 175 ? -1.020 28.451 -1.495  1.00  47.58 ? 169  GLU A CB    1 
ATOM   1348 C  CG    . GLU A 1 175 ? -1.114 27.537 -2.705  0.22  45.67 ? 169  GLU A CG    1 
ATOM   1349 C  CD    . GLU A 1 175 ? -1.551 28.266 -3.958  0.010 44.63 ? 169  GLU A CD    1 
ATOM   1350 O  OE1   . GLU A 1 175 ? -2.583 28.964 -3.917  0.44  43.37 ? 169  GLU A OE1   1 
ATOM   1351 O  OE2   . GLU A 1 175 ? -0.866 28.135 -4.991  0.62  42.99 ? 169  GLU A OE2   1 
ATOM   1352 N  N     . GLU A 1 176 ? 1.990  28.581 -0.692  1.00  49.24 ? 170  GLU A N     1 
ATOM   1353 C  CA    . GLU A 1 176 ? 3.388  28.437 -1.065  1.00  50.51 ? 170  GLU A CA    1 
ATOM   1354 C  C     . GLU A 1 176 ? 4.168  27.658 -0.006  1.00  50.21 ? 170  GLU A C     1 
ATOM   1355 O  O     . GLU A 1 176 ? 5.089  26.904 -0.347  1.00  51.09 ? 170  GLU A O     1 
ATOM   1356 C  CB    . GLU A 1 176 ? 4.014  29.819 -1.309  1.00  51.99 ? 170  GLU A CB    1 
ATOM   1357 C  CG    . GLU A 1 176 ? 5.478  29.794 -1.743  1.00  54.22 ? 170  GLU A CG    1 
ATOM   1358 C  CD    . GLU A 1 176 ? 5.886  31.047 -2.517  1.00  56.33 ? 170  GLU A CD    1 
ATOM   1359 O  OE1   . GLU A 1 176 ? 5.427  32.154 -2.152  1.00  56.65 ? 170  GLU A OE1   1 
ATOM   1360 O  OE2   . GLU A 1 176 ? 6.672  30.922 -3.486  1.00  55.46 ? 170  GLU A OE2   1 
ATOM   1361 N  N     . VAL A 1 177 ? 3.802  27.823 1.267   1.00  48.93 ? 171  VAL A N     1 
ATOM   1362 C  CA    . VAL A 1 177 ? 4.493  27.100 2.330   1.00  49.32 ? 171  VAL A CA    1 
ATOM   1363 C  C     . VAL A 1 177 ? 4.402  25.614 2.006   1.00  50.22 ? 171  VAL A C     1 
ATOM   1364 O  O     . VAL A 1 177 ? 5.401  24.890 2.050   1.00  50.90 ? 171  VAL A O     1 
ATOM   1365 C  CB    . VAL A 1 177 ? 3.866  27.375 3.723   1.00  48.32 ? 171  VAL A CB    1 
ATOM   1366 C  CG1   . VAL A 1 177 ? 4.291  26.303 4.719   1.00  48.83 ? 171  VAL A CG1   1 
ATOM   1367 C  CG2   . VAL A 1 177 ? 4.330  28.725 4.238   1.00  46.87 ? 171  VAL A CG2   1 
ATOM   1368 N  N     . LYS A 1 178 ? 3.198  25.178 1.646   1.00  50.52 ? 172  LYS A N     1 
ATOM   1369 C  CA    . LYS A 1 178 ? 2.944  23.782 1.294   1.00  51.99 ? 172  LYS A CA    1 
ATOM   1370 C  C     . LYS A 1 178 ? 3.733  23.356 0.057   1.00  51.72 ? 172  LYS A C     1 
ATOM   1371 O  O     . LYS A 1 178 ? 4.249  22.241 0.000   1.00  52.62 ? 172  LYS A O     1 
ATOM   1372 C  CB    . LYS A 1 178 ? 1.442  23.547 1.075   1.00  53.33 ? 172  LYS A CB    1 
ATOM   1373 C  CG    . LYS A 1 178 ? 0.566  23.867 2.298   1.00  54.99 ? 172  LYS A CG    1 
ATOM   1374 C  CD    . LYS A 1 178 ? -0.849 23.332 2.101   1.00  57.68 ? 172  LYS A CD    1 
ATOM   1375 C  CE    . LYS A 1 178 ? -1.779 23.689 3.250   1.00  58.76 ? 172  LYS A CE    1 
ATOM   1376 N  NZ    . LYS A 1 178 ? -2.363 25.050 3.116   1.00  60.46 ? 172  LYS A NZ    1 
ATOM   1377 N  N     . ARG A 1 179 ? 3.827  24.236 -0.932  1.00  51.35 ? 173  ARG A N     1 
ATOM   1378 C  CA    . ARG A 1 179 ? 4.599  23.928 -2.133  1.00  52.05 ? 173  ARG A CA    1 
ATOM   1379 C  C     . ARG A 1 179 ? 6.082  23.824 -1.776  0.78  51.16 ? 173  ARG A C     1 
ATOM   1380 O  O     . ARG A 1 179 ? 6.744  22.856 -2.140  1.00  50.73 ? 173  ARG A O     1 
ATOM   1381 C  CB    . ARG A 1 179 ? 4.418  25.018 -3.193  1.00  54.25 ? 173  ARG A CB    1 
ATOM   1382 C  CG    . ARG A 1 179 ? 5.384  24.906 -4.369  1.00  55.96 ? 173  ARG A CG    1 
ATOM   1383 C  CD    . ARG A 1 179 ? 5.297  26.149 -5.251  1.00  57.98 ? 173  ARG A CD    1 
ATOM   1384 N  NE    . ARG A 1 179 ? 3.908  26.496 -5.560  0.63  57.85 ? 173  ARG A NE    1 
ATOM   1385 C  CZ    . ARG A 1 179 ? 3.079  25.730 -6.261  0.010 57.66 ? 173  ARG A CZ    1 
ATOM   1386 N  NH1   . ARG A 1 179 ? 1.835  26.132 -6.484  0.15  57.34 ? 173  ARG A NH1   1 
ATOM   1387 N  NH2   . ARG A 1 179 ? 3.495  24.569 -6.750  0.08  57.51 ? 173  ARG A NH2   1 
ATOM   1388 N  N     . LEU A 1 180 ? 6.591  24.833 -1.070  1.00  51.08 ? 174  LEU A N     1 
ATOM   1389 C  CA    . LEU A 1 180 ? 7.996  24.878 -0.650  1.00  50.49 ? 174  LEU A CA    1 
ATOM   1390 C  C     . LEU A 1 180 ? 8.403  23.639 0.143   1.00  49.45 ? 174  LEU A C     1 
ATOM   1391 O  O     . LEU A 1 180 ? 9.503  23.104 -0.033  1.00  48.80 ? 174  LEU A O     1 
ATOM   1392 C  CB    . LEU A 1 180 ? 8.261  26.123 0.207   1.00  50.03 ? 174  LEU A CB    1 
ATOM   1393 C  CG    . LEU A 1 180 ? 8.428  27.496 -0.455  1.00  49.91 ? 174  LEU A CG    1 
ATOM   1394 C  CD1   . LEU A 1 180 ? 8.548  28.574 0.619   1.00  49.91 ? 174  LEU A CD1   1 
ATOM   1395 C  CD2   . LEU A 1 180 ? 9.667  27.503 -1.334  1.00  49.71 ? 174  LEU A CD2   1 
ATOM   1396 N  N     . ILE A 1 181 ? 7.521  23.197 1.033   1.00  48.25 ? 175  ILE A N     1 
ATOM   1397 C  CA    . ILE A 1 181 ? 7.799  22.017 1.839   1.00  48.72 ? 175  ILE A CA    1 
ATOM   1398 C  C     . ILE A 1 181 ? 8.227  20.845 0.957   1.00  50.86 ? 175  ILE A C     1 
ATOM   1399 O  O     . ILE A 1 181 ? 9.075  20.036 1.350   1.00  50.54 ? 175  ILE A O     1 
ATOM   1400 C  CB    . ILE A 1 181 ? 6.564  21.606 2.650   1.00  47.02 ? 175  ILE A CB    1 
ATOM   1401 C  CG1   . ILE A 1 181 ? 6.314  22.632 3.758   1.00  47.40 ? 175  ILE A CG1   1 
ATOM   1402 C  CG2   . ILE A 1 181 ? 6.751  20.215 3.224   1.00  46.88 ? 175  ILE A CG2   1 
ATOM   1403 C  CD1   . ILE A 1 181 ? 5.112  22.328 4.640   1.00  45.98 ? 175  ILE A CD1   1 
ATOM   1404 N  N     . ARG A 1 182 ? 7.633  20.762 -0.232  1.00  53.32 ? 176  ARG A N     1 
ATOM   1405 C  CA    . ARG A 1 182 ? 7.929  19.695 -1.186  1.00  55.00 ? 176  ARG A CA    1 
ATOM   1406 C  C     . ARG A 1 182 ? 9.048  20.061 -2.159  1.00  54.63 ? 176  ARG A C     1 
ATOM   1407 O  O     . ARG A 1 182 ? 9.749  19.179 -2.653  1.00  53.49 ? 176  ARG A O     1 
ATOM   1408 C  CB    . ARG A 1 182 ? 6.658  19.339 -1.994  1.00  57.85 ? 176  ARG A CB    1 
ATOM   1409 C  CG    . ARG A 1 182 ? 5.924  18.074 -1.592  1.00  61.33 ? 176  ARG A CG    1 
ATOM   1410 C  CD    . ARG A 1 182 ? 4.726  17.632 -2.445  1.00  62.47 ? 176  ARG A CD    1 
ATOM   1411 N  NE    . ARG A 1 182 ? 4.667  16.225 -2.069  1.00  64.54 ? 176  ARG A NE    1 
ATOM   1412 C  CZ    . ARG A 1 182 ? 3.842  15.734 -1.138  1.00  65.81 ? 176  ARG A CZ    1 
ATOM   1413 N  NH1   . ARG A 1 182 ? 3.779  14.416 -0.922  1.00  66.05 ? 176  ARG A NH1   1 
ATOM   1414 N  NH2   . ARG A 1 182 ? 3.057  16.548 -0.420  1.00  64.73 ? 176  ARG A NH2   1 
ATOM   1415 N  N     . GLU A 1 183 ? 9.207  21.357 -2.424  1.00  55.42 ? 177  GLU A N     1 
ATOM   1416 C  CA    . GLU A 1 183 ? 10.217 21.840 -3.362  1.00  56.44 ? 177  GLU A CA    1 
ATOM   1417 C  C     . GLU A 1 183 ? 11.539 22.298 -2.745  1.00  55.95 ? 177  GLU A C     1 
ATOM   1418 O  O     . GLU A 1 183 ? 12.618 21.993 -3.278  1.00  55.14 ? 177  GLU A O     1 
ATOM   1419 C  CB    . GLU A 1 183 ? 9.657  22.999 -4.178  1.00  59.00 ? 177  GLU A CB    1 
ATOM   1420 C  CG    . GLU A 1 183 ? 9.539  22.712 -5.654  1.00  63.47 ? 177  GLU A CG    1 
ATOM   1421 C  CD    . GLU A 1 183 ? 8.153  22.240 -6.037  1.00  65.74 ? 177  GLU A CD    1 
ATOM   1422 O  OE1   . GLU A 1 183 ? 7.237  23.095 -6.159  1.00  66.20 ? 177  GLU A OE1   1 
ATOM   1423 O  OE2   . GLU A 1 183 ? 7.985  21.012 -6.203  1.00  66.77 ? 177  GLU A OE2   1 
ATOM   1424 N  N     . LEU A 1 184 ? 11.452 23.047 -1.644  1.00  54.68 ? 178  LEU A N     1 
ATOM   1425 C  CA    . LEU A 1 184 ? 12.639 23.564 -0.981  1.00  51.99 ? 178  LEU A CA    1 
ATOM   1426 C  C     . LEU A 1 184 ? 13.675 22.498 -0.672  1.00  50.90 ? 178  LEU A C     1 
ATOM   1427 O  O     . LEU A 1 184 ? 13.371 21.444 -0.108  1.00  51.44 ? 178  LEU A O     1 
ATOM   1428 C  CB    . LEU A 1 184 ? 12.266 24.285 0.306   1.00  51.60 ? 178  LEU A CB    1 
ATOM   1429 C  CG    . LEU A 1 184 ? 13.455 25.024 0.914   1.00  51.96 ? 178  LEU A CG    1 
ATOM   1430 C  CD1   . LEU A 1 184 ? 14.124 25.909 -0.153  1.00  51.91 ? 178  LEU A CD1   1 
ATOM   1431 C  CD2   . LEU A 1 184 ? 12.980 25.860 2.093   1.00  52.20 ? 178  LEU A CD2   1 
ATOM   1432 N  N     . ASP A 1 185 ? 14.911 22.782 -1.051  1.00  49.71 ? 179  ASP A N     1 
ATOM   1433 C  CA    . ASP A 1 185 ? 15.995 21.857 -0.817  1.00  48.13 ? 179  ASP A CA    1 
ATOM   1434 C  C     . ASP A 1 185 ? 16.322 21.867 0.674   1.00  46.43 ? 179  ASP A C     1 
ATOM   1435 O  O     . ASP A 1 185 ? 16.624 22.913 1.242   1.00  45.27 ? 179  ASP A O     1 
ATOM   1436 C  CB    . ASP A 1 185 ? 17.190 22.285 -1.641  1.00  51.02 ? 179  ASP A CB    1 
ATOM   1437 C  CG    . ASP A 1 185 ? 18.133 21.151 -1.901  1.00  55.71 ? 179  ASP A CG    1 
ATOM   1438 O  OD1   . ASP A 1 185 ? 18.874 20.766 -0.963  1.00  56.42 ? 179  ASP A OD1   1 
ATOM   1439 O  OD2   . ASP A 1 185 ? 18.119 20.630 -3.043  1.00  58.44 ? 179  ASP A OD2   1 
ATOM   1440 N  N     . ILE A 1 186 ? 16.250 20.700 1.305   1.00  45.30 ? 180  ILE A N     1 
ATOM   1441 C  CA    . ILE A 1 186 ? 16.505 20.567 2.741   1.00  44.83 ? 180  ILE A CA    1 
ATOM   1442 C  C     . ILE A 1 186 ? 17.699 21.375 3.288   1.00  44.90 ? 180  ILE A C     1 
ATOM   1443 O  O     . ILE A 1 186 ? 17.645 21.883 4.411   1.00  44.55 ? 180  ILE A O     1 
ATOM   1444 C  CB    . ILE A 1 186 ? 16.690 19.082 3.125   1.00  44.25 ? 180  ILE A CB    1 
ATOM   1445 C  CG1   . ILE A 1 186 ? 16.420 18.876 4.613   1.00  44.35 ? 180  ILE A CG1   1 
ATOM   1446 C  CG2   . ILE A 1 186 ? 18.097 18.641 2.821   1.00  44.90 ? 180  ILE A CG2   1 
ATOM   1447 C  CD1   . ILE A 1 186 ? 14.997 19.176 5.030   1.00  44.47 ? 180  ILE A CD1   1 
ATOM   1448 N  N     . ALA A 1 187 ? 18.767 21.504 2.506   1.00  43.94 ? 181  ALA A N     1 
ATOM   1449 C  CA    . ALA A 1 187 ? 19.933 22.253 2.959   1.00  42.79 ? 181  ALA A CA    1 
ATOM   1450 C  C     . ALA A 1 187 ? 19.714 23.755 2.886   1.00  41.79 ? 181  ALA A C     1 
ATOM   1451 O  O     . ALA A 1 187 ? 20.529 24.524 3.379   1.00  42.14 ? 181  ALA A O     1 
ATOM   1452 C  CB    . ALA A 1 187 ? 21.158 21.866 2.153   1.00  42.78 ? 181  ALA A CB    1 
ATOM   1453 N  N     . ASP A 1 188 ? 18.626 24.182 2.258   1.00  41.63 ? 182  ASP A N     1 
ATOM   1454 C  CA    . ASP A 1 188 ? 18.335 25.606 2.185   1.00  41.11 ? 182  ASP A CA    1 
ATOM   1455 C  C     . ASP A 1 188 ? 17.470 26.006 3.370   1.00  38.77 ? 182  ASP A C     1 
ATOM   1456 O  O     . ASP A 1 188 ? 16.963 27.119 3.446   1.00  39.40 ? 182  ASP A O     1 
ATOM   1457 C  CB    . ASP A 1 188 ? 17.643 25.957 0.876   1.00  44.09 ? 182  ASP A CB    1 
ATOM   1458 C  CG    . ASP A 1 188 ? 18.602 25.969 -0.290  1.00  46.80 ? 182  ASP A CG    1 
ATOM   1459 O  OD1   . ASP A 1 188 ? 19.739 26.464 -0.105  1.00  49.78 ? 182  ASP A OD1   1 
ATOM   1460 O  OD2   . ASP A 1 188 ? 18.220 25.502 -1.387  1.00  49.54 ? 182  ASP A OD2   1 
ATOM   1461 N  N     . VAL A 1 189 ? 17.321 25.075 4.303   1.00  35.88 ? 183  VAL A N     1 
ATOM   1462 C  CA    . VAL A 1 189 ? 16.561 25.301 5.523   1.00  33.92 ? 183  VAL A CA    1 
ATOM   1463 C  C     . VAL A 1 189 ? 17.506 25.779 6.628   1.00  32.93 ? 183  VAL A C     1 
ATOM   1464 O  O     . VAL A 1 189 ? 18.546 25.170 6.865   1.00  32.16 ? 183  VAL A O     1 
ATOM   1465 C  CB    . VAL A 1 189 ? 15.907 24.003 5.977   1.00  32.98 ? 183  VAL A CB    1 
ATOM   1466 C  CG1   . VAL A 1 189 ? 15.146 24.215 7.268   1.00  30.57 ? 183  VAL A CG1   1 
ATOM   1467 C  CG2   . VAL A 1 189 ? 15.000 23.502 4.867   1.00  36.55 ? 183  VAL A CG2   1 
ATOM   1468 N  N     . PRO A 1 190 ? 17.163 26.878 7.314   1.00  31.91 ? 184  PRO A N     1 
ATOM   1469 C  CA    . PRO A 1 190 ? 18.044 27.363 8.383   1.00  30.72 ? 184  PRO A CA    1 
ATOM   1470 C  C     . PRO A 1 190 ? 18.360 26.266 9.409   1.00  31.02 ? 184  PRO A C     1 
ATOM   1471 O  O     . PRO A 1 190 ? 17.493 25.445 9.756   1.00  31.07 ? 184  PRO A O     1 
ATOM   1472 C  CB    . PRO A 1 190 ? 17.246 28.509 8.996   1.00  29.62 ? 184  PRO A CB    1 
ATOM   1473 C  CG    . PRO A 1 190 ? 16.445 29.007 7.852   1.00  31.28 ? 184  PRO A CG    1 
ATOM   1474 C  CD    . PRO A 1 190 ? 15.982 27.745 7.173   1.00  32.16 ? 184  PRO A CD    1 
ATOM   1475 N  N     . GLY A 1 191 ? 19.602 26.256 9.891   1.00  30.09 ? 185  GLY A N     1 
ATOM   1476 C  CA    . GLY A 1 191 ? 20.008 25.262 10.865  1.00  28.92 ? 185  GLY A CA    1 
ATOM   1477 C  C     . GLY A 1 191 ? 20.474 23.973 10.220  1.00  30.07 ? 185  GLY A C     1 
ATOM   1478 O  O     . GLY A 1 191 ? 20.662 22.952 10.902  1.00  29.28 ? 185  GLY A O     1 
ATOM   1479 N  N     . ILE A 1 192 ? 20.655 24.005 8.901   1.00  29.67 ? 186  ILE A N     1 
ATOM   1480 C  CA    . ILE A 1 192 ? 21.115 22.821 8.196   1.00  29.65 ? 186  ILE A CA    1 
ATOM   1481 C  C     . ILE A 1 192 ? 22.362 23.108 7.395   1.00  30.69 ? 186  ILE A C     1 
ATOM   1482 O  O     . ILE A 1 192 ? 22.303 23.610 6.271   1.00  29.28 ? 186  ILE A O     1 
ATOM   1483 C  CB    . ILE A 1 192 ? 20.051 22.262 7.257   1.00  29.78 ? 186  ILE A CB    1 
ATOM   1484 C  CG1   . ILE A 1 192 ? 18.751 22.029 8.026   1.00  29.47 ? 186  ILE A CG1   1 
ATOM   1485 C  CG2   . ILE A 1 192 ? 20.539 20.956 6.665   1.00  28.73 ? 186  ILE A CG2   1 
ATOM   1486 C  CD1   . ILE A 1 192 ? 18.852 20.982 9.116   1.00  28.83 ? 186  ILE A CD1   1 
ATOM   1487 N  N     . GLY A 1 193 ? 23.493 22.773 8.003   1.00  32.03 ? 187  GLY A N     1 
ATOM   1488 C  CA    . GLY A 1 193 ? 24.784 22.978 7.381   1.00  33.85 ? 187  GLY A CA    1 
ATOM   1489 C  C     . GLY A 1 193 ? 25.176 21.737 6.613   1.00  36.16 ? 187  GLY A C     1 
ATOM   1490 O  O     . GLY A 1 193 ? 24.360 20.821 6.435   1.00  36.02 ? 187  GLY A O     1 
ATOM   1491 N  N     . ASN A 1 194 ? 26.427 21.693 6.170   1.00  38.40 ? 188  ASN A N     1 
ATOM   1492 C  CA    . ASN A 1 194 ? 26.913 20.562 5.387   1.00  39.95 ? 188  ASN A CA    1 
ATOM   1493 C  C     . ASN A 1 194 ? 26.855 19.265 6.171   1.00  39.14 ? 188  ASN A C     1 
ATOM   1494 O  O     . ASN A 1 194 ? 26.291 18.290 5.686   1.00  38.70 ? 188  ASN A O     1 
ATOM   1495 C  CB    . ASN A 1 194 ? 28.332 20.841 4.919   1.00  43.57 ? 188  ASN A CB    1 
ATOM   1496 C  CG    . ASN A 1 194 ? 28.541 22.309 4.568   1.00  47.82 ? 188  ASN A CG    1 
ATOM   1497 O  OD1   . ASN A 1 194 ? 28.433 23.191 5.435   1.00  51.25 ? 188  ASN A OD1   1 
ATOM   1498 N  ND2   . ASN A 1 194 ? 28.833 22.581 3.300   1.00  48.47 ? 188  ASN A ND2   1 
ATOM   1499 N  N     . ILE A 1 195 ? 27.416 19.263 7.382   1.00  38.39 ? 189  ILE A N     1 
ATOM   1500 C  CA    . ILE A 1 195 ? 27.415 18.068 8.219   1.00  38.05 ? 189  ILE A CA    1 
ATOM   1501 C  C     . ILE A 1 195 ? 26.023 17.423 8.232   1.00  37.66 ? 189  ILE A C     1 
ATOM   1502 O  O     . ILE A 1 195 ? 25.865 16.246 7.890   1.00  36.62 ? 189  ILE A O     1 
ATOM   1503 C  CB    . ILE A 1 195 ? 27.783 18.386 9.683   1.00  40.44 ? 189  ILE A CB    1 
ATOM   1504 C  CG1   . ILE A 1 195 ? 29.202 18.958 9.782   1.00  40.23 ? 189  ILE A CG1   1 
ATOM   1505 C  CG2   . ILE A 1 195 ? 27.643 17.115 10.531  1.00  39.19 ? 189  ILE A CG2   1 
ATOM   1506 C  CD1   . ILE A 1 195 ? 30.308 17.913 9.734   1.00  41.59 ? 189  ILE A CD1   1 
ATOM   1507 N  N     . THR A 1 196 ? 25.013 18.196 8.617   1.00  37.74 ? 190  THR A N     1 
ATOM   1508 C  CA    . THR A 1 196 ? 23.658 17.668 8.682   1.00  38.22 ? 190  THR A CA    1 
ATOM   1509 C  C     . THR A 1 196 ? 23.094 17.300 7.305   1.00  39.08 ? 190  THR A C     1 
ATOM   1510 O  O     . THR A 1 196 ? 22.474 16.247 7.163   1.00  39.15 ? 190  THR A O     1 
ATOM   1511 C  CB    . THR A 1 196 ? 22.711 18.659 9.381   1.00  37.05 ? 190  THR A CB    1 
ATOM   1512 O  OG1   . THR A 1 196 ? 23.270 19.041 10.645  1.00  36.08 ? 190  THR A OG1   1 
ATOM   1513 C  CG2   . THR A 1 196 ? 21.354 18.011 9.637   1.00  35.73 ? 190  THR A CG2   1 
ATOM   1514 N  N     . ALA A 1 197 ? 23.322 18.139 6.293   1.00  40.76 ? 191  ALA A N     1 
ATOM   1515 C  CA    . ALA A 1 197 ? 22.810 17.854 4.947   1.00  42.58 ? 191  ALA A CA    1 
ATOM   1516 C  C     . ALA A 1 197 ? 23.289 16.496 4.434   1.00  43.80 ? 191  ALA A C     1 
ATOM   1517 O  O     . ALA A 1 197 ? 22.496 15.692 3.925   1.00  43.44 ? 191  ALA A O     1 
ATOM   1518 C  CB    . ALA A 1 197 ? 23.232 18.955 3.977   1.00  39.60 ? 191  ALA A CB    1 
ATOM   1519 N  N     . GLU A 1 198 ? 24.591 16.260 4.573   1.00  45.67 ? 192  GLU A N     1 
ATOM   1520 C  CA    . GLU A 1 198 ? 25.212 15.023 4.136   1.00  47.84 ? 192  GLU A CA    1 
ATOM   1521 C  C     . GLU A 1 198 ? 24.532 13.834 4.812   1.00  47.47 ? 192  GLU A C     1 
ATOM   1522 O  O     . GLU A 1 198 ? 24.100 12.877 4.147   1.00  48.43 ? 192  GLU A O     1 
ATOM   1523 C  CB    . GLU A 1 198 ? 26.704 15.033 4.481   1.00  49.93 ? 192  GLU A CB    1 
ATOM   1524 C  CG    . GLU A 1 198 ? 27.571 14.363 3.428   1.00  56.57 ? 192  GLU A CG    1 
ATOM   1525 C  CD    . GLU A 1 198 ? 27.560 15.131 2.095   1.00  60.56 ? 192  GLU A CD    1 
ATOM   1526 O  OE1   . GLU A 1 198 ? 26.442 15.299 1.514   1.00  61.84 ? 192  GLU A OE1   1 
ATOM   1527 O  OE2   . GLU A 1 198 ? 28.668 15.565 1.645   1.00  62.57 ? 192  GLU A OE2   1 
ATOM   1528 N  N     . LYS A 1 199 ? 24.434 13.889 6.135   1.00  45.35 ? 193  LYS A N     1 
ATOM   1529 C  CA    . LYS A 1 199 ? 23.801 12.807 6.864   1.00  45.16 ? 193  LYS A CA    1 
ATOM   1530 C  C     . LYS A 1 199 ? 22.389 12.635 6.340   1.00  45.72 ? 193  LYS A C     1 
ATOM   1531 O  O     . LYS A 1 199 ? 21.873 11.522 6.262   1.00  46.16 ? 193  LYS A O     1 
ATOM   1532 C  CB    . LYS A 1 199 ? 23.719 13.120 8.355   1.00  44.09 ? 193  LYS A CB    1 
ATOM   1533 C  CG    . LYS A 1 199 ? 25.041 13.295 9.072   1.00  43.75 ? 193  LYS A CG    1 
ATOM   1534 C  CD    . LYS A 1 199 ? 24.766 13.750 10.491  1.00  44.46 ? 193  LYS A CD    1 
ATOM   1535 C  CE    . LYS A 1 199 ? 26.030 14.110 11.236  1.00  46.22 ? 193  LYS A CE    1 
ATOM   1536 N  NZ    . LYS A 1 199 ? 25.743 14.779 12.550  1.00  46.19 ? 193  LYS A NZ    1 
ATOM   1537 N  N     . LEU A 1 200 ? 21.761 13.752 5.994   1.00  46.52 ? 194  LEU A N     1 
ATOM   1538 C  CA    . LEU A 1 200 ? 20.394 13.724 5.501   1.00  47.77 ? 194  LEU A CA    1 
ATOM   1539 C  C     . LEU A 1 200 ? 20.248 12.982 4.179   1.00  49.98 ? 194  LEU A C     1 
ATOM   1540 O  O     . LEU A 1 200 ? 19.284 12.229 3.985   1.00  50.23 ? 194  LEU A O     1 
ATOM   1541 C  CB    . LEU A 1 200 ? 19.851 15.146 5.369   1.00  45.73 ? 194  LEU A CB    1 
ATOM   1542 C  CG    . LEU A 1 200 ? 19.377 15.749 6.688   1.00  43.82 ? 194  LEU A CG    1 
ATOM   1543 C  CD1   . LEU A 1 200 ? 18.983 17.198 6.491   1.00  42.71 ? 194  LEU A CD1   1 
ATOM   1544 C  CD2   . LEU A 1 200 ? 18.220 14.930 7.210   1.00  41.46 ? 194  LEU A CD2   1 
ATOM   1545 N  N     . LYS A 1 201 ? 21.204 13.179 3.277   1.00  50.33 ? 195  LYS A N     1 
ATOM   1546 C  CA    . LYS A 1 201 ? 21.143 12.512 1.994   1.00  51.40 ? 195  LYS A CA    1 
ATOM   1547 C  C     . LYS A 1 201 ? 21.250 11.003 2.164   1.00  52.25 ? 195  LYS A C     1 
ATOM   1548 O  O     . LYS A 1 201 ? 20.622 10.236 1.428   1.00  52.67 ? 195  LYS A O     1 
ATOM   1549 C  CB    . LYS A 1 201 ? 22.248 13.029 1.090   1.00  51.65 ? 195  LYS A CB    1 
ATOM   1550 C  CG    . LYS A 1 201 ? 21.998 14.448 0.620   1.00  54.81 ? 195  LYS A CG    1 
ATOM   1551 C  CD    . LYS A 1 201 ? 23.090 14.912 -0.325  1.00  58.02 ? 195  LYS A CD    1 
ATOM   1552 C  CE    . LYS A 1 201 ? 22.820 16.306 -0.859  1.00  61.13 ? 195  LYS A CE    1 
ATOM   1553 N  NZ    . LYS A 1 201 ? 23.934 16.755 -1.758  1.00  62.86 ? 195  LYS A NZ    1 
ATOM   1554 N  N     . LYS A 1 202 ? 22.027 10.572 3.151   1.00  52.33 ? 196  LYS A N     1 
ATOM   1555 C  CA    . LYS A 1 202 ? 22.193 9.145  3.402   1.00  52.36 ? 196  LYS A CA    1 
ATOM   1556 C  C     . LYS A 1 202 ? 20.885 8.457  3.774   1.00  51.93 ? 196  LYS A C     1 
ATOM   1557 O  O     . LYS A 1 202 ? 20.798 7.229  3.756   1.00  53.26 ? 196  LYS A O     1 
ATOM   1558 C  CB    . LYS A 1 202 ? 23.218 8.901  4.513   1.00  52.81 ? 196  LYS A CB    1 
ATOM   1559 C  CG    . LYS A 1 202 ? 24.637 9.154  4.100   1.00  54.36 ? 196  LYS A CG    1 
ATOM   1560 C  CD    . LYS A 1 202 ? 25.588 8.860  5.243   1.00  57.49 ? 196  LYS A CD    1 
ATOM   1561 C  CE    . LYS A 1 202 ? 27.025 9.065  4.808   1.00  59.09 ? 196  LYS A CE    1 
ATOM   1562 N  NZ    . LYS A 1 202 ? 27.195 10.403 4.161   1.00  59.65 ? 196  LYS A NZ    1 
ATOM   1563 N  N     . LEU A 1 203 ? 19.876 9.240  4.127   1.00  50.82 ? 197  LEU A N     1 
ATOM   1564 C  CA    . LEU A 1 203 ? 18.595 8.667  4.486   1.00  50.00 ? 197  LEU A CA    1 
ATOM   1565 C  C     . LEU A 1 203 ? 17.666 8.991  3.328   1.00  49.42 ? 197  LEU A C     1 
ATOM   1566 O  O     . LEU A 1 203 ? 16.463 8.744  3.383   1.00  50.17 ? 197  LEU A O     1 
ATOM   1567 C  CB    . LEU A 1 203 ? 18.071 9.301  5.778   1.00  50.92 ? 197  LEU A CB    1 
ATOM   1568 C  CG    . LEU A 1 203 ? 19.020 9.517  6.970   1.00  52.35 ? 197  LEU A CG    1 
ATOM   1569 C  CD1   . LEU A 1 203 ? 18.229 10.079 8.141   1.00  50.62 ? 197  LEU A CD1   1 
ATOM   1570 C  CD2   . LEU A 1 203 ? 19.683 8.207  7.385   1.00  51.25 ? 197  LEU A CD2   1 
ATOM   1571 N  N     . GLY A 1 204 ? 18.244 9.554  2.275   1.00  48.31 ? 198  GLY A N     1 
ATOM   1572 C  CA    . GLY A 1 204 ? 17.463 9.912  1.112   1.00  49.66 ? 198  GLY A CA    1 
ATOM   1573 C  C     . GLY A 1 204 ? 16.413 10.965 1.412   1.00  51.31 ? 198  GLY A C     1 
ATOM   1574 O  O     . GLY A 1 204 ? 15.261 10.839 0.990   1.00  52.65 ? 198  GLY A O     1 
ATOM   1575 N  N     . ILE A 1 205 ? 16.805 12.003 2.145   1.00  52.12 ? 199  ILE A N     1 
ATOM   1576 C  CA    . ILE A 1 205 ? 15.901 13.092 2.491   1.00  52.10 ? 199  ILE A CA    1 
ATOM   1577 C  C     . ILE A 1 205 ? 16.439 14.379 1.857   1.00  52.96 ? 199  ILE A C     1 
ATOM   1578 O  O     . ILE A 1 205 ? 17.104 15.172 2.525   1.00  54.32 ? 199  ILE A O     1 
ATOM   1579 C  CB    . ILE A 1 205 ? 15.840 13.305 4.012   1.00  51.42 ? 199  ILE A CB    1 
ATOM   1580 C  CG1   . ILE A 1 205 ? 15.706 11.966 4.730   1.00  50.41 ? 199  ILE A CG1   1 
ATOM   1581 C  CG2   . ILE A 1 205 ? 14.664 14.194 4.360   1.00  51.43 ? 199  ILE A CG2   1 
ATOM   1582 C  CD1   . ILE A 1 205 ? 15.500 12.108 6.229   1.00  50.22 ? 199  ILE A CD1   1 
ATOM   1583 N  N     . ASN A 1 206 ? 16.153 14.582 0.573   1.00  53.23 ? 200  ASN A N     1 
ATOM   1584 C  CA    . ASN A 1 206 ? 16.631 15.764 -0.139  1.00  52.80 ? 200  ASN A CA    1 
ATOM   1585 C  C     . ASN A 1 206 ? 15.637 16.927 -0.112  1.00  51.50 ? 200  ASN A C     1 
ATOM   1586 O  O     . ASN A 1 206 ? 15.926 18.015 -0.627  1.00  50.74 ? 200  ASN A O     1 
ATOM   1587 C  CB    . ASN A 1 206 ? 16.976 15.393 -1.587  1.00  55.15 ? 200  ASN A CB    1 
ATOM   1588 C  CG    . ASN A 1 206 ? 18.103 14.359 -1.678  1.00  58.31 ? 200  ASN A CG    1 
ATOM   1589 O  OD1   . ASN A 1 206 ? 17.902 13.168 -1.404  1.00  60.37 ? 200  ASN A OD1   1 
ATOM   1590 N  ND2   . ASN A 1 206 ? 19.300 14.817 -2.057  1.00  59.46 ? 200  ASN A ND2   1 
ATOM   1591 N  N     . LYS A 1 207 ? 14.475 16.693 0.497   1.00  49.48 ? 201  LYS A N     1 
ATOM   1592 C  CA    . LYS A 1 207 ? 13.436 17.712 0.616   1.00  48.45 ? 201  LYS A CA    1 
ATOM   1593 C  C     . LYS A 1 207 ? 12.782 17.612 1.991   1.00  47.52 ? 201  LYS A C     1 
ATOM   1594 O  O     . LYS A 1 207 ? 12.793 16.553 2.610   1.00  47.03 ? 201  LYS A O     1 
ATOM   1595 C  CB    . LYS A 1 207 ? 12.359 17.506 -0.449  1.00  49.24 ? 201  LYS A CB    1 
ATOM   1596 C  CG    . LYS A 1 207 ? 12.865 17.405 -1.877  1.00  48.58 ? 201  LYS A CG    1 
ATOM   1597 C  CD    . LYS A 1 207 ? 13.451 18.712 -2.391  1.00  49.32 ? 201  LYS A CD    1 
ATOM   1598 C  CE    . LYS A 1 207 ? 13.939 18.537 -3.825  1.00  49.83 ? 201  LYS A CE    1 
ATOM   1599 N  NZ    . LYS A 1 207 ? 14.644 19.737 -4.362  1.00  51.15 ? 201  LYS A NZ    1 
ATOM   1600 N  N     . LEU A 1 208 ? 12.199 18.709 2.461   1.00  47.10 ? 202  LEU A N     1 
ATOM   1601 C  CA    . LEU A 1 208 ? 11.546 18.715 3.765   1.00  47.06 ? 202  LEU A CA    1 
ATOM   1602 C  C     . LEU A 1 208 ? 10.531 17.592 3.919   1.00  48.28 ? 202  LEU A C     1 
ATOM   1603 O  O     . LEU A 1 208 ? 10.541 16.865 4.913   1.00  47.89 ? 202  LEU A O     1 
ATOM   1604 C  CB    . LEU A 1 208 ? 10.847 20.055 3.991   1.00  45.44 ? 202  LEU A CB    1 
ATOM   1605 C  CG    . LEU A 1 208 ? 11.557 21.027 4.921   1.00  44.30 ? 202  LEU A CG    1 
ATOM   1606 C  CD1   . LEU A 1 208 ? 10.802 22.336 4.985   1.00  42.67 ? 202  LEU A CD1   1 
ATOM   1607 C  CD2   . LEU A 1 208 ? 11.657 20.396 6.284   1.00  42.87 ? 202  LEU A CD2   1 
ATOM   1608 N  N     . VAL A 1 209 ? 9.659  17.461 2.923   1.00  49.80 ? 203  VAL A N     1 
ATOM   1609 C  CA    . VAL A 1 209 ? 8.604  16.451 2.939   1.00  49.70 ? 203  VAL A CA    1 
ATOM   1610 C  C     . VAL A 1 209 ? 9.132  15.031 3.122   1.00  49.82 ? 203  VAL A C     1 
ATOM   1611 O  O     . VAL A 1 209 ? 8.484  14.203 3.766   1.00  50.66 ? 203  VAL A O     1 
ATOM   1612 C  CB    . VAL A 1 209 ? 7.760  16.514 1.646   1.00  49.90 ? 203  VAL A CB    1 
ATOM   1613 C  CG1   . VAL A 1 209 ? 8.650  16.270 0.435   1.00  50.75 ? 203  VAL A CG1   1 
ATOM   1614 C  CG2   . VAL A 1 209 ? 6.644  15.487 1.704   1.00  48.59 ? 203  VAL A CG2   1 
ATOM   1615 N  N     . ASP A 1 210 ? 10.305 14.756 2.559   1.00  49.82 ? 204  ASP A N     1 
ATOM   1616 C  CA    . ASP A 1 210 ? 10.935 13.436 2.656   1.00  50.47 ? 204  ASP A CA    1 
ATOM   1617 C  C     . ASP A 1 210 ? 11.124 12.968 4.102   1.00  50.54 ? 204  ASP A C     1 
ATOM   1618 O  O     . ASP A 1 210 ? 11.293 11.779 4.359   1.00  49.97 ? 204  ASP A O     1 
ATOM   1619 C  CB    . ASP A 1 210 ? 12.308 13.452 1.968   1.00  52.07 ? 204  ASP A CB    1 
ATOM   1620 C  CG    . ASP A 1 210 ? 12.216 13.579 0.457   1.00  55.13 ? 204  ASP A CG    1 
ATOM   1621 O  OD1   . ASP A 1 210 ? 11.165 14.041 -0.046  1.00  57.70 ? 204  ASP A OD1   1 
ATOM   1622 O  OD2   . ASP A 1 210 ? 13.207 13.223 -0.227  1.00  56.42 ? 204  ASP A OD2   1 
ATOM   1623 N  N     . THR A 1 211 ? 11.110 13.899 5.050   1.00  51.47 ? 205  THR A N     1 
ATOM   1624 C  CA    . THR A 1 211 ? 11.305 13.533 6.445   1.00  51.79 ? 205  THR A CA    1 
ATOM   1625 C  C     . THR A 1 211 ? 10.046 12.917 7.016   1.00  52.47 ? 205  THR A C     1 
ATOM   1626 O  O     . THR A 1 211 ? 10.103 12.170 7.983   1.00  52.70 ? 205  THR A O     1 
ATOM   1627 C  CB    . THR A 1 211 ? 11.726 14.761 7.314   1.00  51.73 ? 205  THR A CB    1 
ATOM   1628 O  OG1   . THR A 1 211 ? 10.570 15.476 7.770   1.00  52.43 ? 205  THR A OG1   1 
ATOM   1629 C  CG2   . THR A 1 211 ? 12.580 15.706 6.498   1.00  51.98 ? 205  THR A CG2   1 
ATOM   1630 N  N     . LEU A 1 212 ? 8.904  13.220 6.415   1.00  54.66 ? 206  LEU A N     1 
ATOM   1631 C  CA    . LEU A 1 212 ? 7.651  12.662 6.904   1.00  57.79 ? 206  LEU A CA    1 
ATOM   1632 C  C     . LEU A 1 212 ? 7.541  11.162 6.620   1.00  59.27 ? 206  LEU A C     1 
ATOM   1633 O  O     . LEU A 1 212 ? 6.575  10.518 7.030   1.00  59.41 ? 206  LEU A O     1 
ATOM   1634 C  CB    . LEU A 1 212 ? 6.467  13.396 6.278   1.00  59.05 ? 206  LEU A CB    1 
ATOM   1635 C  CG    . LEU A 1 212 ? 6.412  14.900 6.564   1.00  59.93 ? 206  LEU A CG    1 
ATOM   1636 C  CD1   . LEU A 1 212 ? 5.136  15.475 5.967   1.00  60.23 ? 206  LEU A CD1   1 
ATOM   1637 C  CD2   . LEU A 1 212 ? 6.455  15.153 8.073   1.00  60.27 ? 206  LEU A CD2   1 
ATOM   1638 N  N     . SER A 1 213 ? 8.532  10.606 5.925   1.00  60.80 ? 207  SER A N     1 
ATOM   1639 C  CA    . SER A 1 213 ? 8.533  9.180  5.607   1.00  60.98 ? 207  SER A CA    1 
ATOM   1640 C  C     . SER A 1 213 ? 9.827  8.497  6.050   1.00  61.40 ? 207  SER A C     1 
ATOM   1641 O  O     . SER A 1 213 ? 10.577 7.946  5.243   1.00  61.14 ? 207  SER A O     1 
ATOM   1642 C  CB    . SER A 1 213 ? 8.295  8.967  4.106   1.00  61.56 ? 207  SER A CB    1 
ATOM   1643 O  OG    . SER A 1 213 ? 9.255  9.652  3.314   1.00  63.21 ? 207  SER A OG    1 
ATOM   1644 N  N     . ILE A 1 214 ? 10.076 8.557  7.352   1.00  61.69 ? 208  ILE A N     1 
ATOM   1645 C  CA    . ILE A 1 214 ? 11.239 7.946  7.974   1.00  62.45 ? 208  ILE A CA    1 
ATOM   1646 C  C     . ILE A 1 214 ? 10.850 7.748  9.425   1.00  62.67 ? 208  ILE A C     1 
ATOM   1647 O  O     . ILE A 1 214 ? 10.280 8.653  10.038  1.00  62.67 ? 208  ILE A O     1 
ATOM   1648 C  CB    . ILE A 1 214 ? 12.478 8.878  7.932   1.00  63.45 ? 208  ILE A CB    1 
ATOM   1649 C  CG1   . ILE A 1 214 ? 12.901 9.135  6.482   1.00  65.14 ? 208  ILE A CG1   1 
ATOM   1650 C  CG2   . ILE A 1 214 ? 13.643 8.246  8.700   1.00  61.77 ? 208  ILE A CG2   1 
ATOM   1651 C  CD1   . ILE A 1 214 ? 13.404 7.890  5.747   1.00  66.80 ? 208  ILE A CD1   1 
ATOM   1652 N  N     . GLU A 1 215 ? 11.124 6.567  9.970   1.00  62.92 ? 209  GLU A N     1 
ATOM   1653 C  CA    . GLU A 1 215 ? 10.815 6.324  11.376  1.00  64.06 ? 209  GLU A CA    1 
ATOM   1654 C  C     . GLU A 1 215 ? 11.497 7.409  12.172  1.00  62.36 ? 209  GLU A C     1 
ATOM   1655 O  O     . GLU A 1 215 ? 12.667 7.692  11.950  1.00  61.82 ? 209  GLU A O     1 
ATOM   1656 C  CB    . GLU A 1 215 ? 11.298 4.932  11.847  1.00  67.00 ? 209  GLU A CB    1 
ATOM   1657 C  CG    . GLU A 1 215 ? 10.588 3.755  11.170  1.00  71.53 ? 209  GLU A CG    1 
ATOM   1658 C  CD    . GLU A 1 215 ? 9.094  4.027  10.938  1.00  74.78 ? 209  GLU A CD    1 
ATOM   1659 O  OE1   . GLU A 1 215 ? 8.690  5.215  10.847  1.00  76.12 ? 209  GLU A OE1   1 
ATOM   1660 O  OE2   . GLU A 1 215 ? 8.317  3.054  10.802  1.00  76.29 ? 209  GLU A OE2   1 
ATOM   1661 N  N     . PHE A 1 216 ? 10.762 8.043  13.074  1.00  61.09 ? 210  PHE A N     1 
ATOM   1662 C  CA    . PHE A 1 216 ? 11.351 9.102  13.879  1.00  59.57 ? 210  PHE A CA    1 
ATOM   1663 C  C     . PHE A 1 216 ? 12.608 8.609  14.591  1.00  59.57 ? 210  PHE A C     1 
ATOM   1664 O  O     . PHE A 1 216 ? 13.590 9.335  14.722  1.00  59.10 ? 210  PHE A O     1 
ATOM   1665 C  CB    . PHE A 1 216 ? 10.363 9.598  14.920  1.00  57.63 ? 210  PHE A CB    1 
ATOM   1666 C  CG    . PHE A 1 216 ? 10.947 10.603 15.853  1.00  56.19 ? 210  PHE A CG    1 
ATOM   1667 C  CD1   . PHE A 1 216 ? 11.288 11.870 15.395  1.00  55.49 ? 210  PHE A CD1   1 
ATOM   1668 C  CD2   . PHE A 1 216 ? 11.199 10.273 17.180  1.00  55.25 ? 210  PHE A CD2   1 
ATOM   1669 C  CE1   . PHE A 1 216 ? 11.873 12.795 16.240  1.00  54.25 ? 210  PHE A CE1   1 
ATOM   1670 C  CE2   . PHE A 1 216 ? 11.788 11.192 18.042  1.00  54.18 ? 210  PHE A CE2   1 
ATOM   1671 C  CZ    . PHE A 1 216 ? 12.126 12.458 17.568  1.00  54.89 ? 210  PHE A CZ    1 
ATOM   1672 N  N     . ASP A 1 217 ? 12.557 7.369  15.062  1.00  59.64 ? 211  ASP A N     1 
ATOM   1673 C  CA    . ASP A 1 217 ? 13.680 6.755  15.760  1.00  59.31 ? 211  ASP A CA    1 
ATOM   1674 C  C     . ASP A 1 217 ? 14.927 6.775  14.905  1.00  56.95 ? 211  ASP A C     1 
ATOM   1675 O  O     . ASP A 1 217 ? 16.031 6.932  15.417  1.00  56.63 ? 211  ASP A O     1 
ATOM   1676 C  CB    . ASP A 1 217 ? 13.364 5.302  16.110  1.00  62.32 ? 211  ASP A CB    1 
ATOM   1677 C  CG    . ASP A 1 217 ? 13.144 5.100  17.580  1.00  64.90 ? 211  ASP A CG    1 
ATOM   1678 O  OD1   . ASP A 1 217 ? 13.399 3.974  18.053  1.00  67.45 ? 211  ASP A OD1   1 
ATOM   1679 O  OD2   . ASP A 1 217 ? 12.716 6.061  18.259  1.00  65.67 ? 211  ASP A OD2   1 
ATOM   1680 N  N     . LYS A 1 218 ? 14.744 6.594  13.600  1.00  55.22 ? 212  LYS A N     1 
ATOM   1681 C  CA    . LYS A 1 218 ? 15.861 6.573  12.661  1.00  53.27 ? 212  LYS A CA    1 
ATOM   1682 C  C     . LYS A 1 218 ? 16.442 7.981  12.593  1.00  51.66 ? 212  LYS A C     1 
ATOM   1683 O  O     . LYS A 1 218 ? 17.653 8.167  12.745  1.00  50.36 ? 212  LYS A O     1 
ATOM   1684 C  CB    . LYS A 1 218 ? 15.382 6.122  11.274  1.00  53.86 ? 212  LYS A CB    1 
ATOM   1685 C  CG    . LYS A 1 218 ? 16.432 5.419  10.409  1.00  53.94 ? 212  LYS A CG    1 
ATOM   1686 C  CD    . LYS A 1 218 ? 15.874 5.155  9.005   1.00  54.82 ? 212  LYS A CD    1 
ATOM   1687 C  CE    . LYS A 1 218 ? 16.504 3.934  8.340   1.00  56.36 ? 212  LYS A CE    1 
ATOM   1688 N  NZ    . LYS A 1 218 ? 17.995 3.956  8.350   1.00  56.31 ? 212  LYS A NZ    1 
ATOM   1689 N  N     . LEU A 1 219 ? 15.574 8.969  12.380  1.00  49.51 ? 213  LEU A N     1 
ATOM   1690 C  CA    . LEU A 1 219 ? 16.014 10.357 12.317  1.00  48.25 ? 213  LEU A CA    1 
ATOM   1691 C  C     . LEU A 1 219 ? 16.793 10.717 13.583  1.00  48.19 ? 213  LEU A C     1 
ATOM   1692 O  O     . LEU A 1 219 ? 17.973 11.069 13.517  1.00  47.49 ? 213  LEU A O     1 
ATOM   1693 C  CB    . LEU A 1 219 ? 14.818 11.302 12.181  1.00  46.37 ? 213  LEU A CB    1 
ATOM   1694 C  CG    . LEU A 1 219 ? 14.614 12.058 10.870  1.00  43.74 ? 213  LEU A CG    1 
ATOM   1695 C  CD1   . LEU A 1 219 ? 13.820 13.297 11.185  1.00  42.96 ? 213  LEU A CD1   1 
ATOM   1696 C  CD2   . LEU A 1 219 ? 15.949 12.456 10.240  1.00  42.91 ? 213  LEU A CD2   1 
ATOM   1697 N  N     . LYS A 1 220 ? 16.118 10.632 14.728  1.00  48.53 ? 214  LYS A N     1 
ATOM   1698 C  CA    . LYS A 1 220 ? 16.737 10.939 16.011  1.00  49.58 ? 214  LYS A CA    1 
ATOM   1699 C  C     . LYS A 1 220 ? 18.137 10.353 16.079  1.00  49.08 ? 214  LYS A C     1 
ATOM   1700 O  O     . LYS A 1 220 ? 19.110 11.053 16.357  1.00  48.14 ? 214  LYS A O     1 
ATOM   1701 C  CB    . LYS A 1 220 ? 15.901 10.366 17.155  1.00  52.22 ? 214  LYS A CB    1 
ATOM   1702 C  CG    . LYS A 1 220 ? 16.578 10.439 18.523  1.00  55.66 ? 214  LYS A CG    1 
ATOM   1703 C  CD    . LYS A 1 220 ? 15.574 10.137 19.639  1.00  57.37 ? 214  LYS A CD    1 
ATOM   1704 C  CE    . LYS A 1 220 ? 16.197 10.295 21.021  1.00  57.36 ? 214  LYS A CE    1 
ATOM   1705 N  NZ    . LYS A 1 220 ? 15.202 10.128 22.115  1.00  56.83 ? 214  LYS A NZ    1 
ATOM   1706 N  N     . GLY A 1 221 ? 18.232 9.059  15.809  1.00  49.40 ? 215  GLY A N     1 
ATOM   1707 C  CA    . GLY A 1 221 ? 19.521 8.399  15.856  1.00  49.96 ? 215  GLY A CA    1 
ATOM   1708 C  C     . GLY A 1 221 ? 20.573 9.013  14.955  1.00  48.75 ? 215  GLY A C     1 
ATOM   1709 O  O     . GLY A 1 221 ? 21.735 9.096  15.336  1.00  50.17 ? 215  GLY A O     1 
ATOM   1710 N  N     . MET A 1 222 ? 20.175 9.458  13.771  1.00  48.15 ? 216  MET A N     1 
ATOM   1711 C  CA    . MET A 1 222 ? 21.128 10.027 12.827  1.00  48.17 ? 216  MET A CA    1 
ATOM   1712 C  C     . MET A 1 222 ? 21.497 11.478 13.092  1.00  46.10 ? 216  MET A C     1 
ATOM   1713 O  O     . MET A 1 222 ? 22.675 11.828 13.049  1.00  46.44 ? 216  MET A O     1 
ATOM   1714 C  CB    . MET A 1 222 ? 20.586 9.904  11.400  1.00  51.76 ? 216  MET A CB    1 
ATOM   1715 C  CG    . MET A 1 222 ? 21.494 10.479 10.319  1.00  55.33 ? 216  MET A CG    1 
ATOM   1716 S  SD    . MET A 1 222 ? 22.897 9.396  9.908   1.00  61.43 ? 216  MET A SD    1 
ATOM   1717 C  CE    . MET A 1 222 ? 24.302 10.397 10.485  1.00  61.61 ? 216  MET A CE    1 
ATOM   1718 N  N     . ILE A 1 223 ? 20.508 12.327 13.365  1.00  43.88 ? 217  ILE A N     1 
ATOM   1719 C  CA    . ILE A 1 223 ? 20.795 13.738 13.580  1.00  41.11 ? 217  ILE A CA    1 
ATOM   1720 C  C     . ILE A 1 223 ? 20.402 14.345 14.911  1.00  39.18 ? 217  ILE A C     1 
ATOM   1721 O  O     . ILE A 1 223 ? 20.549 15.544 15.100  1.00  38.10 ? 217  ILE A O     1 
ATOM   1722 C  CB    . ILE A 1 223 ? 20.179 14.583 12.474  1.00  40.52 ? 217  ILE A CB    1 
ATOM   1723 C  CG1   . ILE A 1 223 ? 18.668 14.359 12.424  1.00  42.43 ? 217  ILE A CG1   1 
ATOM   1724 C  CG2   . ILE A 1 223 ? 20.797 14.199 11.138  1.00  41.75 ? 217  ILE A CG2   1 
ATOM   1725 C  CD1   . ILE A 1 223 ? 17.959 15.173 11.347  1.00  40.83 ? 217  ILE A CD1   1 
ATOM   1726 N  N     . GLY A 1 224 ? 19.918 13.529 15.837  1.00  38.57 ? 218  GLY A N     1 
ATOM   1727 C  CA    . GLY A 1 224 ? 19.553 14.052 17.144  1.00  38.80 ? 218  GLY A CA    1 
ATOM   1728 C  C     . GLY A 1 224 ? 18.080 14.380 17.250  1.00  38.29 ? 218  GLY A C     1 
ATOM   1729 O  O     . GLY A 1 224 ? 17.449 14.750 16.259  1.00  38.73 ? 218  GLY A O     1 
ATOM   1730 N  N     . GLU A 1 225 ? 17.536 14.248 18.456  1.00  39.13 ? 219  GLU A N     1 
ATOM   1731 C  CA    . GLU A 1 225 ? 16.121 14.508 18.710  1.00  39.21 ? 219  GLU A CA    1 
ATOM   1732 C  C     . GLU A 1 225 ? 15.743 15.938 18.326  1.00  38.34 ? 219  GLU A C     1 
ATOM   1733 O  O     . GLU A 1 225 ? 14.810 16.162 17.542  1.00  38.33 ? 219  GLU A O     1 
ATOM   1734 C  CB    . GLU A 1 225 ? 15.817 14.254 20.194  1.00  41.89 ? 219  GLU A CB    1 
ATOM   1735 C  CG    . GLU A 1 225 ? 14.336 14.179 20.549  1.00  48.84 ? 219  GLU A CG    1 
ATOM   1736 C  CD    . GLU A 1 225 ? 14.081 13.537 21.917  1.00  51.50 ? 219  GLU A CD    1 
ATOM   1737 O  OE1   . GLU A 1 225 ? 14.477 14.122 22.950  1.00  52.62 ? 219  GLU A OE1   1 
ATOM   1738 O  OE2   . GLU A 1 225 ? 13.482 12.438 21.955  1.00  52.70 ? 219  GLU A OE2   1 
ATOM   1739 N  N     . ALA A 1 226 ? 16.478 16.902 18.868  1.00  36.38 ? 220  ALA A N     1 
ATOM   1740 C  CA    . ALA A 1 226 ? 16.209 18.306 18.601  1.00  34.94 ? 220  ALA A CA    1 
ATOM   1741 C  C     . ALA A 1 226 ? 16.054 18.604 17.113  1.00  34.82 ? 220  ALA A C     1 
ATOM   1742 O  O     . ALA A 1 226 ? 15.025 19.108 16.672  1.00  35.11 ? 220  ALA A O     1 
ATOM   1743 C  CB    . ALA A 1 226 ? 17.317 19.154 19.182  1.00  35.94 ? 220  ALA A CB    1 
ATOM   1744 N  N     . LYS A 1 227 ? 17.083 18.288 16.337  1.00  34.24 ? 221  LYS A N     1 
ATOM   1745 C  CA    . LYS A 1 227 ? 17.072 18.545 14.907  1.00  33.29 ? 221  LYS A CA    1 
ATOM   1746 C  C     . LYS A 1 227 ? 15.948 17.792 14.169  1.00  33.67 ? 221  LYS A C     1 
ATOM   1747 O  O     . LYS A 1 227 ? 15.410 18.291 13.172  1.00  32.92 ? 221  LYS A O     1 
ATOM   1748 C  CB    . LYS A 1 227 ? 18.433 18.164 14.316  1.00  32.84 ? 221  LYS A CB    1 
ATOM   1749 C  CG    . LYS A 1 227 ? 18.745 18.801 12.976  1.00  34.12 ? 221  LYS A CG    1 
ATOM   1750 C  CD    . LYS A 1 227 ? 19.106 20.267 13.112  1.00  35.00 ? 221  LYS A CD    1 
ATOM   1751 C  CE    . LYS A 1 227 ? 20.515 20.447 13.664  1.00  35.20 ? 221  LYS A CE    1 
ATOM   1752 N  NZ    . LYS A 1 227 ? 20.922 21.895 13.700  1.00  36.41 ? 221  LYS A NZ    1 
ATOM   1753 N  N     . ALA A 1 228 ? 15.599 16.599 14.652  1.00  32.17 ? 222  ALA A N     1 
ATOM   1754 C  CA    . ALA A 1 228 ? 14.554 15.796 14.025  1.00  31.69 ? 222  ALA A CA    1 
ATOM   1755 C  C     . ALA A 1 228 ? 13.171 16.378 14.297  1.00  32.09 ? 222  ALA A C     1 
ATOM   1756 O  O     . ALA A 1 228 ? 12.352 16.507 13.377  1.00  30.26 ? 222  ALA A O     1 
ATOM   1757 C  CB    . ALA A 1 228 ? 14.622 14.368 14.525  1.00  31.77 ? 222  ALA A CB    1 
ATOM   1758 N  N     . LYS A 1 229 ? 12.902 16.713 15.558  1.00  32.27 ? 223  LYS A N     1 
ATOM   1759 C  CA    . LYS A 1 229 ? 11.608 17.287 15.900  1.00  32.78 ? 223  LYS A CA    1 
ATOM   1760 C  C     . LYS A 1 229 ? 11.452 18.564 15.110  1.00  33.33 ? 223  LYS A C     1 
ATOM   1761 O  O     . LYS A 1 229 ? 10.410 18.799 14.492  1.00  35.42 ? 223  LYS A O     1 
ATOM   1762 C  CB    . LYS A 1 229 ? 11.508 17.563 17.396  1.00  32.15 ? 223  LYS A CB    1 
ATOM   1763 C  CG    . LYS A 1 229 ? 11.234 16.311 18.202  1.00  33.49 ? 223  LYS A CG    1 
ATOM   1764 C  CD    . LYS A 1 229 ? 11.178 16.606 19.681  1.00  36.84 ? 223  LYS A CD    1 
ATOM   1765 C  CE    . LYS A 1 229 ? 10.993 15.326 20.467  1.00  39.25 ? 223  LYS A CE    1 
ATOM   1766 N  NZ    . LYS A 1 229 ? 10.929 15.593 21.936  1.00  40.50 ? 223  LYS A NZ    1 
ATOM   1767 N  N     . TYR A 1 230 ? 12.497 19.380 15.122  1.00  32.78 ? 224  TYR A N     1 
ATOM   1768 C  CA    . TYR A 1 230 ? 12.498 20.622 14.370  1.00  32.66 ? 224  TYR A CA    1 
ATOM   1769 C  C     . TYR A 1 230 ? 12.027 20.362 12.940  1.00  32.32 ? 224  TYR A C     1 
ATOM   1770 O  O     . TYR A 1 230 ? 10.986 20.861 12.528  1.00  33.01 ? 224  TYR A O     1 
ATOM   1771 C  CB    . TYR A 1 230 ? 13.906 21.201 14.335  1.00  32.25 ? 224  TYR A CB    1 
ATOM   1772 C  CG    . TYR A 1 230 ? 14.093 22.372 13.385  1.00  33.45 ? 224  TYR A CG    1 
ATOM   1773 C  CD1   . TYR A 1 230 ? 13.494 23.613 13.633  1.00  34.33 ? 224  TYR A CD1   1 
ATOM   1774 C  CD2   . TYR A 1 230 ? 14.931 22.259 12.276  1.00  33.60 ? 224  TYR A CD2   1 
ATOM   1775 C  CE1   . TYR A 1 230 ? 13.743 24.711 12.803  1.00  34.85 ? 224  TYR A CE1   1 
ATOM   1776 C  CE2   . TYR A 1 230 ? 15.180 23.343 11.448  1.00  34.06 ? 224  TYR A CE2   1 
ATOM   1777 C  CZ    . TYR A 1 230 ? 14.591 24.561 11.720  1.00  35.49 ? 224  TYR A CZ    1 
ATOM   1778 O  OH    . TYR A 1 230 ? 14.893 25.637 10.926  1.00  37.08 ? 224  TYR A OH    1 
ATOM   1779 N  N     . LEU A 1 231 ? 12.793 19.563 12.200  1.00  31.77 ? 225  LEU A N     1 
ATOM   1780 C  CA    . LEU A 1 231 ? 12.490 19.230 10.800  1.00  32.67 ? 225  LEU A CA    1 
ATOM   1781 C  C     . LEU A 1 231 ? 11.112 18.630 10.517  1.00  33.22 ? 225  LEU A C     1 
ATOM   1782 O  O     . LEU A 1 231 ? 10.407 19.098 9.618   1.00  31.69 ? 225  LEU A O     1 
ATOM   1783 C  CB    . LEU A 1 231 ? 13.560 18.289 10.239  1.00  31.51 ? 225  LEU A CB    1 
ATOM   1784 C  CG    . LEU A 1 231 ? 14.943 18.911 10.042  1.00  31.70 ? 225  LEU A CG    1 
ATOM   1785 C  CD1   . LEU A 1 231 ? 15.842 17.907 9.316   1.00  30.45 ? 225  LEU A CD1   1 
ATOM   1786 C  CD2   . LEU A 1 231 ? 14.820 20.194 9.226   1.00  28.91 ? 225  LEU A CD2   1 
ATOM   1787 N  N     . ILE A 1 232 ? 10.740 17.584 11.258  1.00  34.29 ? 226  ILE A N     1 
ATOM   1788 C  CA    . ILE A 1 232 ? 9.436  16.957 11.070  1.00  35.12 ? 226  ILE A CA    1 
ATOM   1789 C  C     . ILE A 1 232 ? 8.386  18.029 11.295  1.00  37.23 ? 226  ILE A C     1 
ATOM   1790 O  O     . ILE A 1 232 ? 7.417  18.130 10.547  1.00  36.75 ? 226  ILE A O     1 
ATOM   1791 C  CB    . ILE A 1 232 ? 9.210  15.804 12.075  1.00  34.65 ? 226  ILE A CB    1 
ATOM   1792 C  CG1   . ILE A 1 232 ? 10.011 14.574 11.646  1.00  34.93 ? 226  ILE A CG1   1 
ATOM   1793 C  CG2   . ILE A 1 232 ? 7.738  15.489 12.185  1.00  32.26 ? 226  ILE A CG2   1 
ATOM   1794 C  CD1   . ILE A 1 232 ? 10.151 13.521 12.735  1.00  35.74 ? 226  ILE A CD1   1 
ATOM   1795 N  N     . SER A 1 233 ? 8.607  18.840 12.323  1.00  38.05 ? 227  SER A N     1 
ATOM   1796 C  CA    . SER A 1 233 ? 7.694  19.920 12.664  1.00  41.05 ? 227  SER A CA    1 
ATOM   1797 C  C     . SER A 1 233 ? 7.389  20.822 11.471  1.00  42.63 ? 227  SER A C     1 
ATOM   1798 O  O     . SER A 1 233 ? 6.225  21.101 11.173  1.00  43.03 ? 227  SER A O     1 
ATOM   1799 C  CB    . SER A 1 233 ? 8.278  20.764 13.789  1.00  41.04 ? 227  SER A CB    1 
ATOM   1800 O  OG    . SER A 1 233 ? 7.331  21.732 14.169  1.00  44.87 ? 227  SER A OG    1 
ATOM   1801 N  N     . LEU A 1 234 ? 8.444  21.295 10.811  1.00  43.76 ? 228  LEU A N     1 
ATOM   1802 C  CA    . LEU A 1 234 ? 8.315  22.164 9.644   1.00  45.21 ? 228  LEU A CA    1 
ATOM   1803 C  C     . LEU A 1 234 ? 7.580  21.438 8.542   1.00  46.81 ? 228  LEU A C     1 
ATOM   1804 O  O     . LEU A 1 234 ? 6.585  21.932 8.016   1.00  47.41 ? 228  LEU A O     1 
ATOM   1805 C  CB    . LEU A 1 234 ? 9.687  22.555 9.108   1.00  43.40 ? 228  LEU A CB    1 
ATOM   1806 C  CG    . LEU A 1 234 ? 10.442 23.688 9.780   1.00  43.26 ? 228  LEU A CG    1 
ATOM   1807 C  CD1   . LEU A 1 234 ? 11.888 23.641 9.324   1.00  42.56 ? 228  LEU A CD1   1 
ATOM   1808 C  CD2   . LEU A 1 234 ? 9.788  25.022 9.426   1.00  43.80 ? 228  LEU A CD2   1 
ATOM   1809 N  N     . ALA A 1 235 ? 8.107  20.274 8.174   1.00  47.94 ? 229  ALA A N     1 
ATOM   1810 C  CA    . ALA A 1 235 ? 7.511  19.455 7.127   1.00  49.21 ? 229  ALA A CA    1 
ATOM   1811 C  C     . ALA A 1 235 ? 6.019  19.339 7.399   1.00  50.28 ? 229  ALA A C     1 
ATOM   1812 O  O     . ALA A 1 235 ? 5.204  19.556 6.507   1.00  50.99 ? 229  ALA A O     1 
ATOM   1813 C  CB    . ALA A 1 235 ? 8.146  18.073 7.109   1.00  48.93 ? 229  ALA A CB    1 
ATOM   1814 N  N     . ARG A 1 236 ? 5.670  19.020 8.643   1.00  50.86 ? 230  ARG A N     1 
ATOM   1815 C  CA    . ARG A 1 236 ? 4.278  18.869 9.027   1.00  51.62 ? 230  ARG A CA    1 
ATOM   1816 C  C     . ARG A 1 236 ? 3.477  20.151 8.991   1.00  52.44 ? 230  ARG A C     1 
ATOM   1817 O  O     . ARG A 1 236 ? 2.305  20.133 9.342   1.00  53.55 ? 230  ARG A O     1 
ATOM   1818 C  CB    . ARG A 1 236 ? 4.169  18.265 10.424  1.00  52.64 ? 230  ARG A CB    1 
ATOM   1819 C  CG    . ARG A 1 236 ? 4.060  16.750 10.447  1.00  53.32 ? 230  ARG A CG    1 
ATOM   1820 C  CD    . ARG A 1 236 ? 3.968  16.259 11.888  1.00  53.63 ? 230  ARG A CD    1 
ATOM   1821 N  NE    . ARG A 1 236 ? 3.794  14.810 11.960  1.00  55.78 ? 230  ARG A NE    1 
ATOM   1822 C  CZ    . ARG A 1 236 ? 3.986  14.089 13.059  1.00  56.57 ? 230  ARG A CZ    1 
ATOM   1823 N  NH1   . ARG A 1 236 ? 4.364  14.691 14.178  1.00  55.11 ? 230  ARG A NH1   1 
ATOM   1824 N  NH2   . ARG A 1 236 ? 3.795  12.776 13.038  1.00  56.99 ? 230  ARG A NH2   1 
ATOM   1825 N  N     . ASP A 1 237 ? 4.086  21.258 8.565   1.00  52.44 ? 231  ASP A N     1 
ATOM   1826 C  CA    . ASP A 1 237 ? 3.370  22.541 8.512   1.00  51.52 ? 231  ASP A CA    1 
ATOM   1827 C  C     . ASP A 1 237 ? 2.894  22.871 9.938   1.00  49.99 ? 231  ASP A C     1 
ATOM   1828 O  O     . ASP A 1 237 ? 1.798  23.390 10.137  1.00  49.61 ? 231  ASP A O     1 
ATOM   1829 C  CB    . ASP A 1 237 ? 2.146  22.415 7.585   1.00  53.71 ? 231  ASP A CB    1 
ATOM   1830 C  CG    . ASP A 1 237 ? 1.683  23.751 7.002   1.00  55.57 ? 231  ASP A CG    1 
ATOM   1831 O  OD1   . ASP A 1 237 ? 1.806  24.803 7.672   1.00  56.88 ? 231  ASP A OD1   1 
ATOM   1832 O  OD2   . ASP A 1 237 ? 1.172  23.737 5.860   1.00  57.15 ? 231  ASP A OD2   1 
ATOM   1833 N  N     . GLU A 1 238 ? 3.711  22.562 10.935  1.00  49.19 ? 232  GLU A N     1 
ATOM   1834 C  CA    . GLU A 1 238 ? 3.312  22.822 12.308  1.00  49.34 ? 232  GLU A CA    1 
ATOM   1835 C  C     . GLU A 1 238 ? 4.325  23.615 13.147  1.00  48.40 ? 232  GLU A C     1 
ATOM   1836 O  O     . GLU A 1 238 ? 4.040  23.957 14.295  1.00  47.39 ? 232  GLU A O     1 
ATOM   1837 C  CB    . GLU A 1 238 ? 3.004  21.494 12.998  1.00  51.66 ? 232  GLU A CB    1 
ATOM   1838 C  CG    . GLU A 1 238 ? 1.947  20.660 12.303  1.00  54.21 ? 232  GLU A CG    1 
ATOM   1839 C  CD    . GLU A 1 238 ? 1.648  19.370 13.054  1.00  56.25 ? 232  GLU A CD    1 
ATOM   1840 O  OE1   . GLU A 1 238 ? 1.276  19.454 14.252  1.00  58.32 ? 232  GLU A OE1   1 
ATOM   1841 O  OE2   . GLU A 1 238 ? 1.786  18.279 12.447  1.00  56.05 ? 232  GLU A OE2   1 
ATOM   1842 N  N     . TYR A 1 239 ? 5.505  23.889 12.587  1.00  47.26 ? 233  TYR A N     1 
ATOM   1843 C  CA    . TYR A 1 239 ? 6.536  24.657 13.297  1.00  46.09 ? 233  TYR A CA    1 
ATOM   1844 C  C     . TYR A 1 239 ? 5.946  25.997 13.733  1.00  46.25 ? 233  TYR A C     1 
ATOM   1845 O  O     . TYR A 1 239 ? 5.349  26.713 12.921  1.00  45.17 ? 233  TYR A O     1 
ATOM   1846 C  CB    . TYR A 1 239 ? 7.755  24.920 12.398  1.00  43.63 ? 233  TYR A CB    1 
ATOM   1847 C  CG    . TYR A 1 239 ? 8.744  25.868 13.042  1.00  42.32 ? 233  TYR A CG    1 
ATOM   1848 C  CD1   . TYR A 1 239 ? 9.642  25.422 14.011  1.00  40.90 ? 233  TYR A CD1   1 
ATOM   1849 C  CD2   . TYR A 1 239 ? 8.733  27.229 12.731  1.00  41.03 ? 233  TYR A CD2   1 
ATOM   1850 C  CE1   . TYR A 1 239 ? 10.510 26.312 14.660  1.00  40.11 ? 233  TYR A CE1   1 
ATOM   1851 C  CE2   . TYR A 1 239 ? 9.584  28.126 13.372  1.00  39.77 ? 233  TYR A CE2   1 
ATOM   1852 C  CZ    . TYR A 1 239 ? 10.472 27.668 14.336  1.00  40.58 ? 233  TYR A CZ    1 
ATOM   1853 O  OH    . TYR A 1 239 ? 11.302 28.569 14.983  1.00  39.42 ? 233  TYR A OH    1 
ATOM   1854 N  N     . ASN A 1 240 ? 6.132  26.362 14.997  1.00  45.99 ? 234  ASN A N     1 
ATOM   1855 C  CA    . ASN A 1 240 ? 5.544  27.608 15.451  1.00  46.21 ? 234  ASN A CA    1 
ATOM   1856 C  C     . ASN A 1 240 ? 6.244  28.303 16.605  1.00  45.38 ? 234  ASN A C     1 
ATOM   1857 O  O     . ASN A 1 240 ? 5.589  28.944 17.412  1.00  44.36 ? 234  ASN A O     1 
ATOM   1858 C  CB    . ASN A 1 240 ? 4.086  27.343 15.832  1.00  48.54 ? 234  ASN A CB    1 
ATOM   1859 C  CG    . ASN A 1 240 ? 3.116  28.219 15.072  1.00  51.97 ? 234  ASN A CG    1 
ATOM   1860 O  OD1   . ASN A 1 240 ? 3.043  29.424 15.306  1.00  53.50 ? 234  ASN A OD1   1 
ATOM   1861 N  ND2   . ASN A 1 240 ? 2.367  27.620 14.146  1.00  54.50 ? 234  ASN A ND2   1 
ATOM   1862 N  N     . GLU A 1 241 ? 7.566  28.205 16.690  1.00  46.19 ? 235  GLU A N     1 
ATOM   1863 C  CA    . GLU A 1 241 ? 8.257  28.849 17.801  1.00  46.03 ? 235  GLU A CA    1 
ATOM   1864 C  C     . GLU A 1 241 ? 7.915  30.311 17.907  1.00  43.99 ? 235  GLU A C     1 
ATOM   1865 O  O     . GLU A 1 241 ? 7.894  31.039 16.918  1.00  43.99 ? 235  GLU A O     1 
ATOM   1866 C  CB    . GLU A 1 241 ? 9.774  28.670 17.710  1.00  49.08 ? 235  GLU A CB    1 
ATOM   1867 C  CG    . GLU A 1 241 ? 10.221 27.222 17.960  1.00  54.90 ? 235  GLU A CG    1 
ATOM   1868 C  CD    . GLU A 1 241 ? 9.522  26.570 19.167  1.00  57.99 ? 235  GLU A CD    1 
ATOM   1869 O  OE1   . GLU A 1 241 ? 9.714  27.051 20.311  1.00  59.37 ? 235  GLU A OE1   1 
ATOM   1870 O  OE2   . GLU A 1 241 ? 8.779  25.575 18.966  1.00  58.74 ? 235  GLU A OE2   1 
ATOM   1871 N  N     . PRO A 1 242 ? 7.626  30.758 19.127  1.00  43.26 ? 236  PRO A N     1 
ATOM   1872 C  CA    . PRO A 1 242 ? 7.270  32.148 19.394  1.00  42.69 ? 236  PRO A CA    1 
ATOM   1873 C  C     . PRO A 1 242 ? 8.448  33.102 19.199  1.00  42.83 ? 236  PRO A C     1 
ATOM   1874 O  O     . PRO A 1 242 ? 9.610  32.703 19.204  1.00  42.72 ? 236  PRO A O     1 
ATOM   1875 C  CB    . PRO A 1 242 ? 6.776  32.098 20.837  1.00  42.42 ? 236  PRO A CB    1 
ATOM   1876 C  CG    . PRO A 1 242 ? 7.653  31.047 21.450  1.00  41.33 ? 236  PRO A CG    1 
ATOM   1877 C  CD    . PRO A 1 242 ? 7.699  29.977 20.378  1.00  42.66 ? 236  PRO A CD    1 
ATOM   1878 N  N     . ILE A 1 243 ? 8.128  34.371 19.023  1.00  43.23 ? 237  ILE A N     1 
ATOM   1879 C  CA    . ILE A 1 243 ? 9.138  35.393 18.817  1.00  43.26 ? 237  ILE A CA    1 
ATOM   1880 C  C     . ILE A 1 243 ? 9.490  36.060 20.144  1.00  43.72 ? 237  ILE A C     1 
ATOM   1881 O  O     . ILE A 1 243 ? 8.731  36.878 20.654  1.00  43.67 ? 237  ILE A O     1 
ATOM   1882 C  CB    . ILE A 1 243 ? 8.604  36.407 17.810  1.00  42.38 ? 237  ILE A CB    1 
ATOM   1883 C  CG1   . ILE A 1 243 ? 8.332  35.674 16.489  1.00  41.40 ? 237  ILE A CG1   1 
ATOM   1884 C  CG2   . ILE A 1 243 ? 9.555  37.566 17.675  1.00  43.15 ? 237  ILE A CG2   1 
ATOM   1885 C  CD1   . ILE A 1 243 ? 7.883  36.547 15.349  1.00  41.58 ? 237  ILE A CD1   1 
ATOM   1886 N  N     . ARG A 1 244 ? 10.631 35.690 20.715  0.72  45.89 ? 238  ARG A N     1 
ATOM   1887 C  CA    . ARG A 1 244 ? 11.054 36.251 21.995  1.00  48.53 ? 238  ARG A CA    1 
ATOM   1888 C  C     . ARG A 1 244 ? 12.417 36.913 21.912  1.00  49.01 ? 238  ARG A C     1 
ATOM   1889 O  O     . ARG A 1 244 ? 13.266 36.503 21.129  1.00  48.48 ? 238  ARG A O     1 
ATOM   1890 C  CB    . ARG A 1 244 ? 11.084 35.155 23.067  0.91  50.12 ? 238  ARG A CB    1 
ATOM   1891 C  CG    . ARG A 1 244 ? 9.726  34.506 23.311  0.91  52.66 ? 238  ARG A CG    1 
ATOM   1892 C  CD    . ARG A 1 244 ? 9.728  33.513 24.475  0.14  53.74 ? 238  ARG A CD    1 
ATOM   1893 N  NE    . ARG A 1 244 ? 8.446  32.817 24.575  0.55  55.22 ? 238  ARG A NE    1 
ATOM   1894 C  CZ    . ARG A 1 244 ? 8.144  31.911 25.502  1.00  56.90 ? 238  ARG A CZ    1 
ATOM   1895 N  NH1   . ARG A 1 244 ? 9.030  31.575 26.433  0.49  57.03 ? 238  ARG A NH1   1 
ATOM   1896 N  NH2   . ARG A 1 244 ? 6.954  31.331 25.490  0.57  56.23 ? 238  ARG A NH2   1 
ATOM   1897 N  N     . THR A 1 245 ? 12.617 37.953 22.712  1.00  50.23 ? 239  THR A N     1 
ATOM   1898 C  CA    . THR A 1 245 ? 13.900 38.656 22.735  1.00  51.67 ? 239  THR A CA    1 
ATOM   1899 C  C     . THR A 1 245 ? 14.947 37.672 23.226  1.00  51.53 ? 239  THR A C     1 
ATOM   1900 O  O     . THR A 1 245 ? 14.705 36.928 24.176  1.00  51.37 ? 239  THR A O     1 
ATOM   1901 C  CB    . THR A 1 245 ? 13.877 39.872 23.703  1.00  51.44 ? 239  THR A CB    1 
ATOM   1902 O  OG1   . THR A 1 245 ? 13.071 39.561 24.843  1.00  49.76 ? 239  THR A OG1   1 
ATOM   1903 C  CG2   . THR A 1 245 ? 13.321 41.112 23.012  1.00  52.14 ? 239  THR A CG2   1 
ATOM   1904 N  N     . ARG A 1 246 ? 16.100 37.642 22.571  1.00  52.47 ? 240  ARG A N     1 
ATOM   1905 C  CA    . ARG A 1 246 ? 17.153 36.730 23.002  1.00  53.00 ? 240  ARG A CA    1 
ATOM   1906 C  C     . ARG A 1 246 ? 17.980 37.472 24.031  1.00  52.18 ? 240  ARG A C     1 
ATOM   1907 O  O     . ARG A 1 246 ? 18.123 38.694 23.957  1.00  51.60 ? 240  ARG A O     1 
ATOM   1908 C  CB    . ARG A 1 246 ? 18.011 36.296 21.814  1.00  54.51 ? 240  ARG A CB    1 
ATOM   1909 C  CG    . ARG A 1 246 ? 17.258 35.392 20.842  1.00  54.82 ? 240  ARG A CG    1 
ATOM   1910 C  CD    . ARG A 1 246 ? 18.026 35.167 19.559  1.00  53.81 ? 240  ARG A CD    1 
ATOM   1911 N  NE    . ARG A 1 246 ? 17.224 34.438 18.582  1.00  54.67 ? 240  ARG A NE    1 
ATOM   1912 C  CZ    . ARG A 1 246 ? 17.682 34.015 17.408  1.00  54.98 ? 240  ARG A CZ    1 
ATOM   1913 N  NH1   . ARG A 1 246 ? 18.943 34.251 17.074  1.00  55.45 ? 240  ARG A NH1   1 
ATOM   1914 N  NH2   . ARG A 1 246 ? 16.888 33.360 16.565  1.00  52.89 ? 240  ARG A NH2   1 
ATOM   1915 N  N     . VAL A 1 247 ? 18.509 36.738 25.001  1.00  51.94 ? 241  VAL A N     1 
ATOM   1916 C  CA    . VAL A 1 247 ? 19.296 37.347 26.066  1.00  50.89 ? 241  VAL A CA    1 
ATOM   1917 C  C     . VAL A 1 247 ? 20.737 36.842 26.051  1.00  49.29 ? 241  VAL A C     1 
ATOM   1918 O  O     . VAL A 1 247 ? 20.983 35.641 26.011  1.00  48.61 ? 241  VAL A O     1 
ATOM   1919 C  CB    . VAL A 1 247 ? 18.625 37.052 27.426  1.00  51.75 ? 241  VAL A CB    1 
ATOM   1920 C  CG1   . VAL A 1 247 ? 18.636 35.541 27.701  1.00  51.70 ? 241  VAL A CG1   1 
ATOM   1921 C  CG2   . VAL A 1 247 ? 19.289 37.841 28.525  1.00  51.48 ? 241  VAL A CG2   1 
ATOM   1922 N  N     . ARG A 1 248 ? 21.688 37.769 26.066  1.00  49.83 ? 242  ARG A N     1 
ATOM   1923 C  CA    . ARG A 1 248 ? 23.110 37.411 26.044  1.00  50.34 ? 242  ARG A CA    1 
ATOM   1924 C  C     . ARG A 1 248 ? 23.478 36.447 27.182  1.00  49.58 ? 242  ARG A C     1 
ATOM   1925 O  O     . ARG A 1 248 ? 23.186 36.716 28.358  1.00  50.84 ? 242  ARG A O     1 
ATOM   1926 C  CB    . ARG A 1 248 ? 23.977 38.663 26.165  1.00  52.90 ? 242  ARG A CB    1 
ATOM   1927 C  CG    . ARG A 1 248 ? 25.428 38.432 25.751  1.00  58.06 ? 242  ARG A CG    1 
ATOM   1928 C  CD    . ARG A 1 248 ? 25.612 38.541 24.232  1.00  60.57 ? 242  ARG A CD    1 
ATOM   1929 N  NE    . ARG A 1 248 ? 26.096 39.872 23.854  1.00  65.13 ? 242  ARG A NE    1 
ATOM   1930 C  CZ    . ARG A 1 248 ? 25.451 41.018 24.096  1.00  67.19 ? 242  ARG A CZ    1 
ATOM   1931 N  NH1   . ARG A 1 248 ? 24.271 41.017 24.720  1.00  67.56 ? 242  ARG A NH1   1 
ATOM   1932 N  NH2   . ARG A 1 248 ? 25.991 42.177 23.720  1.00  66.79 ? 242  ARG A NH2   1 
ATOM   1933 N  N     . LYS A 1 249 ? 24.132 35.337 26.838  1.00  48.08 ? 243  LYS A N     1 
ATOM   1934 C  CA    . LYS A 1 249 ? 24.519 34.341 27.832  1.00  46.11 ? 243  LYS A CA    1 
ATOM   1935 C  C     . LYS A 1 249 ? 26.029 34.134 27.935  1.00  44.90 ? 243  LYS A C     1 
ATOM   1936 O  O     . LYS A 1 249 ? 26.523 33.609 28.932  1.00  44.74 ? 243  LYS A O     1 
ATOM   1937 C  CB    . LYS A 1 249 ? 23.834 33.013 27.521  1.00  44.76 ? 243  LYS A CB    1 
ATOM   1938 C  CG    . LYS A 1 249 ? 22.322 33.085 27.627  1.00  46.83 ? 243  LYS A CG    1 
ATOM   1939 C  CD    . LYS A 1 249 ? 21.645 31.766 27.259  1.00  48.53 ? 243  LYS A CD    1 
ATOM   1940 C  CE    . LYS A 1 249 ? 20.132 31.901 27.346  1.00  49.02 ? 243  LYS A CE    1 
ATOM   1941 N  NZ    . LYS A 1 249 ? 19.406 30.690 26.867  1.00  49.27 ? 243  LYS A NZ    1 
ATOM   1942 N  N     . SER A 1 250 ? 26.760 34.543 26.904  1.00  43.50 ? 244  SER A N     1 
ATOM   1943 C  CA    . SER A 1 250 ? 28.216 34.402 26.888  1.00  42.77 ? 244  SER A CA    1 
ATOM   1944 C  C     . SER A 1 250 ? 28.871 35.658 26.334  1.00  41.51 ? 244  SER A C     1 
ATOM   1945 O  O     . SER A 1 250 ? 28.283 36.371 25.527  1.00  42.63 ? 244  SER A O     1 
ATOM   1946 C  CB    . SER A 1 250 ? 28.643 33.231 26.003  1.00  42.77 ? 244  SER A CB    1 
ATOM   1947 O  OG    . SER A 1 250 ? 28.242 31.979 26.526  1.00  49.77 ? 244  SER A OG    1 
ATOM   1948 N  N     . ILE A 1 251 ? 30.092 35.924 26.766  1.00  38.50 ? 245  ILE A N     1 
ATOM   1949 C  CA    . ILE A 1 251 ? 30.830 37.074 26.280  1.00  37.34 ? 245  ILE A CA    1 
ATOM   1950 C  C     . ILE A 1 251 ? 32.264 36.628 26.196  1.00  36.64 ? 245  ILE A C     1 
ATOM   1951 O  O     . ILE A 1 251 ? 32.782 36.049 27.146  1.00  36.58 ? 245  ILE A O     1 
ATOM   1952 C  CB    . ILE A 1 251 ? 30.734 38.284 27.240  1.00  38.46 ? 245  ILE A CB    1 
ATOM   1953 C  CG1   . ILE A 1 251 ? 29.330 38.894 27.175  1.00  37.82 ? 245  ILE A CG1   1 
ATOM   1954 C  CG2   . ILE A 1 251 ? 31.806 39.318 26.891  1.00  36.77 ? 245  ILE A CG2   1 
ATOM   1955 C  CD1   . ILE A 1 251 ? 28.917 39.317 25.777  1.00  38.92 ? 245  ILE A CD1   1 
ATOM   1956 N  N     . GLY A 1 252 ? 32.911 36.875 25.066  1.00  35.75 ? 246  GLY A N     1 
ATOM   1957 C  CA    . GLY A 1 252 ? 34.286 36.443 24.961  1.00  32.53 ? 246  GLY A CA    1 
ATOM   1958 C  C     . GLY A 1 252 ? 35.026 36.988 23.783  1.00  32.15 ? 246  GLY A C     1 
ATOM   1959 O  O     . GLY A 1 252 ? 34.456 37.659 22.952  1.00  32.84 ? 246  GLY A O     1 
ATOM   1960 N  N     A ARG A 1 253 ? 36.312 36.675 23.717  0.50  31.43 ? 247  ARG A N     1 
ATOM   1961 N  N     B ARG A 1 253 ? 36.310 36.673 23.713  0.50  31.83 ? 247  ARG A N     1 
ATOM   1962 C  CA    A ARG A 1 253 ? 37.179 37.131 22.643  0.50  30.94 ? 247  ARG A CA    1 
ATOM   1963 C  CA    B ARG A 1 253 ? 37.176 37.133 22.640  0.50  31.69 ? 247  ARG A CA    1 
ATOM   1964 C  C     A ARG A 1 253 ? 38.324 36.141 22.504  0.50  31.94 ? 247  ARG A C     1 
ATOM   1965 C  C     B ARG A 1 253 ? 38.322 36.141 22.503  0.50  32.39 ? 247  ARG A C     1 
ATOM   1966 O  O     A ARG A 1 253 ? 38.846 35.638 23.505  0.50  32.39 ? 247  ARG A O     1 
ATOM   1967 O  O     B ARG A 1 253 ? 38.845 35.638 23.505  0.50  32.80 ? 247  ARG A O     1 
ATOM   1968 C  CB    A ARG A 1 253 ? 37.724 38.524 22.969  0.50  29.43 ? 247  ARG A CB    1 
ATOM   1969 C  CB    B ARG A 1 253 ? 37.712 38.525 22.982  0.50  31.00 ? 247  ARG A CB    1 
ATOM   1970 C  CG    A ARG A 1 253 ? 37.084 39.664 22.195  0.50  27.79 ? 247  ARG A CG    1 
ATOM   1971 C  CG    B ARG A 1 253 ? 38.983 38.948 22.254  0.50  31.02 ? 247  ARG A CG    1 
ATOM   1972 C  CD    A ARG A 1 253 ? 35.592 39.583 22.225  0.50  27.56 ? 247  ARG A CD    1 
ATOM   1973 C  CD    B ARG A 1 253 ? 38.796 40.181 21.409  0.50  30.86 ? 247  ARG A CD    1 
ATOM   1974 N  NE    A ARG A 1 253 ? 34.923 40.844 21.959  0.50  24.53 ? 247  ARG A NE    1 
ATOM   1975 N  NE    B ARG A 1 253 ? 39.486 40.100 20.135  0.50  31.10 ? 247  ARG A NE    1 
ATOM   1976 C  CZ    A ARG A 1 253 ? 33.609 41.017 21.986  0.50  23.57 ? 247  ARG A CZ    1 
ATOM   1977 C  CZ    B ARG A 1 253 ? 39.557 38.957 19.435  0.50  32.34 ? 247  ARG A CZ    1 
ATOM   1978 N  NH1   A ARG A 1 253 ? 32.793 40.012 22.260  0.50  22.69 ? 247  ARG A NH1   1 
ATOM   1979 N  NH1   B ARG A 1 253 ? 39.525 37.777 20.042  0.50  33.87 ? 247  ARG A NH1   1 
ATOM   1980 N  NH2   A ARG A 1 253 ? 33.117 42.217 21.750  0.50  24.25 ? 247  ARG A NH2   1 
ATOM   1981 N  NH2   B ARG A 1 253 ? 39.545 38.980 18.123  0.50  30.63 ? 247  ARG A NH2   1 
ATOM   1982 N  N     . ILE A 1 254 ? 38.699 35.851 21.264  1.00  32.49 ? 248  ILE A N     1 
ATOM   1983 C  CA    . ILE A 1 254 ? 39.774 34.921 21.005  1.00  33.31 ? 248  ILE A CA    1 
ATOM   1984 C  C     . ILE A 1 254 ? 40.573 35.397 19.796  1.00  33.77 ? 248  ILE A C     1 
ATOM   1985 O  O     . ILE A 1 254 ? 40.073 35.395 18.677  1.00  33.86 ? 248  ILE A O     1 
ATOM   1986 C  CB    . ILE A 1 254 ? 39.191 33.491 20.838  1.00  34.04 ? 248  ILE A CB    1 
ATOM   1987 C  CG1   . ILE A 1 254 ? 40.274 32.532 20.384  1.00  37.21 ? 248  ILE A CG1   1 
ATOM   1988 C  CG2   . ILE A 1 254 ? 38.026 33.503 19.890  1.00  34.37 ? 248  ILE A CG2   1 
ATOM   1989 C  CD1   . ILE A 1 254 ? 39.854 31.076 20.490  1.00  40.81 ? 248  ILE A CD1   1 
ATOM   1990 N  N     . VAL A 1 255 ? 41.806 35.837 20.054  1.00  33.85 ? 249  VAL A N     1 
ATOM   1991 C  CA    . VAL A 1 255 ? 42.709 36.363 19.033  1.00  34.94 ? 249  VAL A CA    1 
ATOM   1992 C  C     . VAL A 1 255 ? 43.723 35.389 18.428  1.00  37.13 ? 249  VAL A C     1 
ATOM   1993 O  O     . VAL A 1 255 ? 43.967 34.297 18.951  1.00  37.13 ? 249  VAL A O     1 
ATOM   1994 C  CB    . VAL A 1 255 ? 43.512 37.538 19.582  1.00  34.67 ? 249  VAL A CB    1 
ATOM   1995 C  CG1   . VAL A 1 255 ? 42.572 38.572 20.180  1.00  32.50 ? 249  VAL A CG1   1 
ATOM   1996 C  CG2   . VAL A 1 255 ? 44.512 37.040 20.632  1.00  31.79 ? 249  VAL A CG2   1 
ATOM   1997 N  N     . THR A 1 256 ? 44.330 35.826 17.324  1.00  39.37 ? 250  THR A N     1 
ATOM   1998 C  CA    . THR A 1 256 ? 45.332 35.034 16.587  1.00  40.27 ? 250  THR A CA    1 
ATOM   1999 C  C     . THR A 1 256 ? 46.738 35.537 16.900  1.00  38.54 ? 250  THR A C     1 
ATOM   2000 O  O     . THR A 1 256 ? 46.967 36.743 16.948  1.00  37.58 ? 250  THR A O     1 
ATOM   2001 C  CB    . THR A 1 256 ? 45.105 35.138 15.047  1.00  41.35 ? 250  THR A CB    1 
ATOM   2002 O  OG1   . THR A 1 256 ? 43.759 34.746 14.735  1.00  40.41 ? 250  THR A OG1   1 
ATOM   2003 C  CG2   . THR A 1 256 ? 46.102 34.259 14.290  1.00  40.43 ? 250  THR A CG2   1 
ATOM   2004 N  N     . MET A 1 257 ? 47.669 34.608 17.105  1.00  38.16 ? 251  MET A N     1 
ATOM   2005 C  CA    . MET A 1 257 ? 49.056 34.951 17.421  1.00  38.34 ? 251  MET A CA    1 
ATOM   2006 C  C     . MET A 1 257 ? 49.890 35.071 16.152  1.00  38.89 ? 251  MET A C     1 
ATOM   2007 O  O     . MET A 1 257 ? 49.606 34.388 15.161  1.00  36.58 ? 251  MET A O     1 
ATOM   2008 C  CB    . MET A 1 257 ? 49.673 33.870 18.308  1.00  37.75 ? 251  MET A CB    1 
ATOM   2009 C  CG    . MET A 1 257 ? 48.756 33.356 19.387  1.00  36.83 ? 251  MET A CG    1 
ATOM   2010 S  SD    . MET A 1 257 ? 49.661 32.404 20.593  1.00  36.68 ? 251  MET A SD    1 
ATOM   2011 C  CE    . MET A 1 257 ? 49.078 30.742 20.248  1.00  34.13 ? 251  MET A CE    1 
ATOM   2012 N  N     . LYS A 1 258 ? 50.922 35.919 16.187  1.00  39.70 ? 252  LYS A N     1 
ATOM   2013 C  CA    . LYS A 1 258 ? 51.791 36.097 15.023  1.00  41.03 ? 252  LYS A CA    1 
ATOM   2014 C  C     . LYS A 1 258 ? 52.247 34.739 14.535  1.00  40.34 ? 252  LYS A C     1 
ATOM   2015 O  O     . LYS A 1 258 ? 52.178 34.438 13.344  1.00  41.37 ? 252  LYS A O     1 
ATOM   2016 C  CB    . LYS A 1 258 ? 53.031 36.935 15.360  1.00  42.73 ? 252  LYS A CB    1 
ATOM   2017 C  CG    . LYS A 1 258 ? 52.769 38.432 15.534  1.00  46.60 ? 252  LYS A CG    1 
ATOM   2018 C  CD    . LYS A 1 258 ? 52.229 39.071 14.258  1.00  49.32 ? 252  LYS A CD    1 
ATOM   2019 C  CE    . LYS A 1 258 ? 51.795 40.511 14.514  1.00  50.09 ? 252  LYS A CE    1 
ATOM   2020 N  NZ    . LYS A 1 258 ? 51.073 41.102 13.348  1.00  51.19 ? 252  LYS A NZ    1 
ATOM   2021 N  N     . ARG A 1 259 ? 52.702 33.915 15.465  0.70  39.34 ? 253  ARG A N     1 
ATOM   2022 C  CA    . ARG A 1 259 ? 53.183 32.599 15.109  0.77  39.83 ? 253  ARG A CA    1 
ATOM   2023 C  C     . ARG A 1 259 ? 52.660 31.578 16.086  1.00  39.10 ? 253  ARG A C     1 
ATOM   2024 O  O     . ARG A 1 259 ? 52.483 31.879 17.263  1.00  39.02 ? 253  ARG A O     1 
ATOM   2025 C  CB    . ARG A 1 259 ? 54.713 32.605 15.107  1.00  42.28 ? 253  ARG A CB    1 
ATOM   2026 C  CG    . ARG A 1 259 ? 55.313 33.165 16.398  1.00  44.68 ? 253  ARG A CG    1 
ATOM   2027 C  CD    . ARG A 1 259 ? 56.562 34.008 16.139  0.010 44.94 ? 253  ARG A CD    1 
ATOM   2028 N  NE    . ARG A 1 259 ? 57.723 33.225 15.722  0.58  46.23 ? 253  ARG A NE    1 
ATOM   2029 C  CZ    . ARG A 1 259 ? 58.451 32.458 16.531  0.53  46.00 ? 253  ARG A CZ    1 
ATOM   2030 N  NH1   . ARG A 1 259 ? 59.486 31.787 16.049  0.87  46.05 ? 253  ARG A NH1   1 
ATOM   2031 N  NH2   . ARG A 1 259 ? 58.151 32.366 17.818  0.93  44.75 ? 253  ARG A NH2   1 
ATOM   2032 N  N     . ASN A 1 260 ? 52.397 30.374 15.582  1.00  39.28 ? 254  ASN A N     1 
ATOM   2033 C  CA    . ASN A 1 260 ? 51.902 29.284 16.413  1.00  40.25 ? 254  ASN A CA    1 
ATOM   2034 C  C     . ASN A 1 260 ? 52.882 29.097 17.562  1.00  41.04 ? 254  ASN A C     1 
ATOM   2035 O  O     . ASN A 1 260 ? 54.043 29.485 17.451  1.00  41.28 ? 254  ASN A O     1 
ATOM   2036 C  CB    . ASN A 1 260 ? 51.783 28.001 15.593  1.00  40.76 ? 254  ASN A CB    1 
ATOM   2037 C  CG    . ASN A 1 260 ? 50.706 28.089 14.531  1.00  43.65 ? 254  ASN A CG    1 
ATOM   2038 O  OD1   . ASN A 1 260 ? 50.139 29.153 14.285  1.00  46.20 ? 254  ASN A OD1   1 
ATOM   2039 N  ND2   . ASN A 1 260 ? 50.419 26.966 13.890  1.00  44.85 ? 254  ASN A ND2   1 
ATOM   2040 N  N     . SER A 1 261 ? 52.424 28.515 18.666  1.00  41.24 ? 255  SER A N     1 
ATOM   2041 C  CA    . SER A 1 261 ? 53.297 28.336 19.815  1.00  41.02 ? 255  SER A CA    1 
ATOM   2042 C  C     . SER A 1 261 ? 52.722 27.373 20.819  1.00  41.37 ? 255  SER A C     1 
ATOM   2043 O  O     . SER A 1 261 ? 51.556 27.001 20.725  1.00  42.54 ? 255  SER A O     1 
ATOM   2044 C  CB    . SER A 1 261 ? 53.536 29.683 20.496  1.00  42.26 ? 255  SER A CB    1 
ATOM   2045 O  OG    . SER A 1 261 ? 54.408 29.550 21.600  1.00  43.53 ? 255  SER A OG    1 
ATOM   2046 N  N     . ARG A 1 262 ? 53.561 26.963 21.769  1.00  41.26 ? 256  ARG A N     1 
ATOM   2047 C  CA    . ARG A 1 262 ? 53.187 26.043 22.846  1.00  42.85 ? 256  ARG A CA    1 
ATOM   2048 C  C     . ARG A 1 262 ? 53.929 26.570 24.051  1.00  42.66 ? 256  ARG A C     1 
ATOM   2049 O  O     . ARG A 1 262 ? 53.980 25.943 25.102  1.00  43.70 ? 256  ARG A O     1 
ATOM   2050 C  CB    . ARG A 1 262 ? 53.649 24.606 22.569  1.00  42.54 ? 256  ARG A CB    1 
ATOM   2051 C  CG    . ARG A 1 262 ? 53.185 24.064 21.245  1.00  47.36 ? 256  ARG A CG    1 
ATOM   2052 C  CD    . ARG A 1 262 ? 53.307 22.559 21.155  1.00  50.72 ? 256  ARG A CD    1 
ATOM   2053 N  NE    . ARG A 1 262 ? 52.265 21.880 21.925  1.00  53.89 ? 256  ARG A NE    1 
ATOM   2054 C  CZ    . ARG A 1 262 ? 52.383 21.520 23.201  1.00  55.08 ? 256  ARG A CZ    1 
ATOM   2055 N  NH1   . ARG A 1 262 ? 53.511 21.772 23.864  1.00  55.86 ? 256  ARG A NH1   1 
ATOM   2056 N  NH2   . ARG A 1 262 ? 51.371 20.912 23.818  1.00  54.21 ? 256  ARG A NH2   1 
ATOM   2057 N  N     . ASN A 1 263 ? 54.514 27.742 23.870  1.00  42.38 ? 257  ASN A N     1 
ATOM   2058 C  CA    . ASN A 1 263 ? 55.278 28.403 24.912  1.00  43.13 ? 257  ASN A CA    1 
ATOM   2059 C  C     . ASN A 1 263 ? 54.353 29.283 25.730  1.00  42.91 ? 257  ASN A C     1 
ATOM   2060 O  O     . ASN A 1 263 ? 53.762 30.220 25.216  1.00  43.02 ? 257  ASN A O     1 
ATOM   2061 C  CB    . ASN A 1 263 ? 56.377 29.246 24.268  1.00  44.69 ? 257  ASN A CB    1 
ATOM   2062 C  CG    . ASN A 1 263 ? 57.221 29.976 25.281  1.00  46.37 ? 257  ASN A CG    1 
ATOM   2063 O  OD1   . ASN A 1 263 ? 56.706 30.732 26.115  1.00  45.56 ? 257  ASN A OD1   1 
ATOM   2064 N  ND2   . ASN A 1 263 ? 58.533 29.765 25.209  1.00  47.77 ? 257  ASN A ND2   1 
ATOM   2065 N  N     . LEU A 1 264 ? 54.237 28.984 27.012  1.00  42.30 ? 258  LEU A N     1 
ATOM   2066 C  CA    . LEU A 1 264 ? 53.358 29.745 27.894  1.00  42.70 ? 258  LEU A CA    1 
ATOM   2067 C  C     . LEU A 1 264 ? 53.621 31.258 27.942  1.00  41.78 ? 258  LEU A C     1 
ATOM   2068 O  O     . LEU A 1 264 ? 52.690 32.057 27.846  1.00  41.84 ? 258  LEU A O     1 
ATOM   2069 C  CB    . LEU A 1 264 ? 53.430 29.156 29.302  1.00  44.33 ? 258  LEU A CB    1 
ATOM   2070 C  CG    . LEU A 1 264 ? 52.420 29.682 30.322  1.00  46.80 ? 258  LEU A CG    1 
ATOM   2071 C  CD1   . LEU A 1 264 ? 51.015 29.393 29.837  1.00  46.14 ? 258  LEU A CD1   1 
ATOM   2072 C  CD2   . LEU A 1 264 ? 52.657 29.015 31.672  1.00  47.50 ? 258  LEU A CD2   1 
ATOM   2073 N  N     . GLU A 1 265 ? 54.882 31.653 28.085  1.00  40.44 ? 259  GLU A N     1 
ATOM   2074 C  CA    . GLU A 1 265 ? 55.214 33.070 28.142  1.00  39.69 ? 259  GLU A CA    1 
ATOM   2075 C  C     . GLU A 1 265 ? 55.001 33.764 26.807  1.00  39.41 ? 259  GLU A C     1 
ATOM   2076 O  O     . GLU A 1 265 ? 55.060 34.991 26.716  1.00  38.08 ? 259  GLU A O     1 
ATOM   2077 C  CB    . GLU A 1 265 ? 56.661 33.262 28.597  1.00  39.71 ? 259  GLU A CB    1 
ATOM   2078 C  CG    . GLU A 1 265 ? 56.878 32.919 30.056  1.00  43.57 ? 259  GLU A CG    1 
ATOM   2079 C  CD    . GLU A 1 265 ? 55.985 33.735 30.991  1.00  45.08 ? 259  GLU A CD    1 
ATOM   2080 O  OE1   . GLU A 1 265 ? 56.048 34.985 30.952  1.00  45.51 ? 259  GLU A OE1   1 
ATOM   2081 O  OE2   . GLU A 1 265 ? 55.220 33.123 31.765  1.00  44.21 ? 259  GLU A OE2   1 
ATOM   2082 N  N     . GLU A 1 266 ? 54.749 32.980 25.769  1.00  38.87 ? 260  GLU A N     1 
ATOM   2083 C  CA    . GLU A 1 266 ? 54.531 33.547 24.448  1.00  39.58 ? 260  GLU A CA    1 
ATOM   2084 C  C     . GLU A 1 266 ? 53.026 33.740 24.243  1.00  38.90 ? 260  GLU A C     1 
ATOM   2085 O  O     . GLU A 1 266 ? 52.577 34.742 23.685  1.00  37.72 ? 260  GLU A O     1 
ATOM   2086 C  CB    . GLU A 1 266 ? 55.078 32.599 23.380  1.00  42.30 ? 260  GLU A CB    1 
ATOM   2087 C  CG    . GLU A 1 266 ? 55.657 33.298 22.172  1.00  46.56 ? 260  GLU A CG    1 
ATOM   2088 C  CD    . GLU A 1 266 ? 56.164 32.321 21.126  1.00  51.05 ? 260  GLU A CD    1 
ATOM   2089 O  OE1   . GLU A 1 266 ? 56.829 31.320 21.500  1.00  52.61 ? 260  GLU A OE1   1 
ATOM   2090 O  OE2   . GLU A 1 266 ? 55.901 32.566 19.926  1.00  52.89 ? 260  GLU A OE2   1 
ATOM   2091 N  N     . ILE A 1 267 ? 52.260 32.773 24.730  1.00  37.77 ? 261  ILE A N     1 
ATOM   2092 C  CA    . ILE A 1 267 ? 50.824 32.784 24.596  1.00  35.97 ? 261  ILE A CA    1 
ATOM   2093 C  C     . ILE A 1 267 ? 50.143 33.733 25.585  1.00  37.21 ? 261  ILE A C     1 
ATOM   2094 O  O     . ILE A 1 267 ? 49.262 34.512 25.198  1.00  36.22 ? 261  ILE A O     1 
ATOM   2095 C  CB    . ILE A 1 267 ? 50.296 31.364 24.767  1.00  33.72 ? 261  ILE A CB    1 
ATOM   2096 C  CG1   . ILE A 1 267 ? 51.114 30.420 23.881  1.00  33.75 ? 261  ILE A CG1   1 
ATOM   2097 C  CG2   . ILE A 1 267 ? 48.839 31.295 24.353  1.00  36.77 ? 261  ILE A CG2   1 
ATOM   2098 C  CD1   . ILE A 1 267 ? 50.756 28.947 24.005  1.00  30.97 ? 261  ILE A CD1   1 
ATOM   2099 N  N     . LYS A 1 268 ? 50.559 33.677 26.852  1.00  38.05 ? 262  LYS A N     1 
ATOM   2100 C  CA    . LYS A 1 268 ? 49.988 34.522 27.914  1.00  39.19 ? 262  LYS A CA    1 
ATOM   2101 C  C     . LYS A 1 268 ? 49.499 35.920 27.512  1.00  38.73 ? 262  LYS A C     1 
ATOM   2102 O  O     . LYS A 1 268 ? 48.362 36.297 27.816  1.00  38.26 ? 262  LYS A O     1 
ATOM   2103 C  CB    . LYS A 1 268 ? 50.985 34.716 29.053  1.00  41.23 ? 262  LYS A CB    1 
ATOM   2104 C  CG    . LYS A 1 268 ? 51.151 33.574 30.011  1.00  44.76 ? 262  LYS A CG    1 
ATOM   2105 C  CD    . LYS A 1 268 ? 52.162 34.016 31.069  1.00  45.99 ? 262  LYS A CD    1 
ATOM   2106 C  CE    . LYS A 1 268 ? 52.249 33.075 32.251  1.00  46.04 ? 262  LYS A CE    1 
ATOM   2107 N  NZ    . LYS A 1 268 ? 53.041 33.744 33.320  1.00  45.80 ? 262  LYS A NZ    1 
ATOM   2108 N  N     . PRO A 1 269 ? 50.362 36.716 26.852  1.00  38.10 ? 263  PRO A N     1 
ATOM   2109 C  CA    . PRO A 1 269 ? 50.024 38.080 26.416  1.00  37.73 ? 263  PRO A CA    1 
ATOM   2110 C  C     . PRO A 1 269 ? 48.761 38.204 25.561  1.00  37.81 ? 263  PRO A C     1 
ATOM   2111 O  O     . PRO A 1 269 ? 47.950 39.111 25.767  1.00  38.93 ? 263  PRO A O     1 
ATOM   2112 C  CB    . PRO A 1 269 ? 51.275 38.523 25.667  1.00  37.98 ? 263  PRO A CB    1 
ATOM   2113 C  CG    . PRO A 1 269 ? 52.364 37.728 26.337  1.00  37.41 ? 263  PRO A CG    1 
ATOM   2114 C  CD    . PRO A 1 269 ? 51.742 36.374 26.464  1.00  37.07 ? 263  PRO A CD    1 
ATOM   2115 N  N     . TYR A 1 270 ? 48.597 37.311 24.592  1.00  36.88 ? 264  TYR A N     1 
ATOM   2116 C  CA    . TYR A 1 270 ? 47.404 37.339 23.751  1.00  35.50 ? 264  TYR A CA    1 
ATOM   2117 C  C     . TYR A 1 270 ? 46.205 36.986 24.643  1.00  35.26 ? 264  TYR A C     1 
ATOM   2118 O  O     . TYR A 1 270 ? 45.140 37.596 24.536  1.00  35.02 ? 264  TYR A O     1 
ATOM   2119 C  CB    . TYR A 1 270 ? 47.534 36.314 22.630  1.00  36.24 ? 264  TYR A CB    1 
ATOM   2120 C  CG    . TYR A 1 270 ? 48.653 36.580 21.653  1.00  38.16 ? 264  TYR A CG    1 
ATOM   2121 C  CD1   . TYR A 1 270 ? 48.539 37.586 20.691  1.00  38.87 ? 264  TYR A CD1   1 
ATOM   2122 C  CD2   . TYR A 1 270 ? 49.808 35.798 21.657  1.00  38.66 ? 264  TYR A CD2   1 
ATOM   2123 C  CE1   . TYR A 1 270 ? 49.541 37.804 19.749  1.00  39.64 ? 264  TYR A CE1   1 
ATOM   2124 C  CE2   . TYR A 1 270 ? 50.819 36.004 20.721  1.00  40.41 ? 264  TYR A CE2   1 
ATOM   2125 C  CZ    . TYR A 1 270 ? 50.681 37.009 19.763  1.00  41.48 ? 264  TYR A CZ    1 
ATOM   2126 O  OH    . TYR A 1 270 ? 51.666 37.196 18.807  1.00  40.72 ? 264  TYR A OH    1 
ATOM   2127 N  N     . LEU A 1 271 ? 46.401 36.007 25.530  1.00  34.72 ? 265  LEU A N     1 
ATOM   2128 C  CA    . LEU A 1 271 ? 45.369 35.564 26.458  1.00  34.05 ? 265  LEU A CA    1 
ATOM   2129 C  C     . LEU A 1 271 ? 44.947 36.693 27.386  1.00  34.95 ? 265  LEU A C     1 
ATOM   2130 O  O     . LEU A 1 271 ? 43.757 36.950 27.545  1.00  36.78 ? 265  LEU A O     1 
ATOM   2131 C  CB    . LEU A 1 271 ? 45.867 34.380 27.288  1.00  30.97 ? 265  LEU A CB    1 
ATOM   2132 C  CG    . LEU A 1 271 ? 44.963 33.898 28.434  1.00  29.84 ? 265  LEU A CG    1 
ATOM   2133 C  CD1   . LEU A 1 271 ? 43.649 33.369 27.884  1.00  29.78 ? 265  LEU A CD1   1 
ATOM   2134 C  CD2   . LEU A 1 271 ? 45.676 32.793 29.225  1.00  30.54 ? 265  LEU A CD2   1 
ATOM   2135 N  N     . PHE A 1 272 ? 45.912 37.377 27.989  1.00  34.92 ? 266  PHE A N     1 
ATOM   2136 C  CA    . PHE A 1 272 ? 45.575 38.466 28.897  1.00  36.10 ? 266  PHE A CA    1 
ATOM   2137 C  C     . PHE A 1 272 ? 44.884 39.587 28.150  1.00  36.92 ? 266  PHE A C     1 
ATOM   2138 O  O     . PHE A 1 272 ? 44.007 40.261 28.697  1.00  37.98 ? 266  PHE A O     1 
ATOM   2139 C  CB    . PHE A 1 272 ? 46.817 38.997 29.609  1.00  36.44 ? 266  PHE A CB    1 
ATOM   2140 C  CG    . PHE A 1 272 ? 47.481 37.981 30.483  1.00  37.23 ? 266  PHE A CG    1 
ATOM   2141 C  CD1   . PHE A 1 272 ? 46.737 36.957 31.063  1.00  37.01 ? 266  PHE A CD1   1 
ATOM   2142 C  CD2   . PHE A 1 272 ? 48.843 38.045 30.740  1.00  37.05 ? 266  PHE A CD2   1 
ATOM   2143 C  CE1   . PHE A 1 272 ? 47.341 36.007 31.892  1.00  37.70 ? 266  PHE A CE1   1 
ATOM   2144 C  CE2   . PHE A 1 272 ? 49.459 37.101 31.564  1.00  37.79 ? 266  PHE A CE2   1 
ATOM   2145 C  CZ    . PHE A 1 272 ? 48.701 36.077 32.141  1.00  36.98 ? 266  PHE A CZ    1 
ATOM   2146 N  N     . ARG A 1 273 ? 45.276 39.768 26.892  1.00  37.28 ? 267  ARG A N     1 
ATOM   2147 C  CA    . ARG A 1 273 ? 44.699 40.794 26.024  1.00  35.79 ? 267  ARG A CA    1 
ATOM   2148 C  C     . ARG A 1 273 ? 43.235 40.401 25.812  1.00  34.81 ? 267  ARG A C     1 
ATOM   2149 O  O     . ARG A 1 273 ? 42.334 41.242 25.867  1.00  33.89 ? 267  ARG A O     1 
ATOM   2150 C  CB    . ARG A 1 273 ? 45.437 40.800 24.682  1.00  39.11 ? 267  ARG A CB    1 
ATOM   2151 C  CG    . ARG A 1 273 ? 45.206 42.010 23.799  1.00  44.12 ? 267  ARG A CG    1 
ATOM   2152 C  CD    . ARG A 1 273 ? 45.559 41.735 22.314  1.00  48.08 ? 267  ARG A CD    1 
ATOM   2153 N  NE    . ARG A 1 273 ? 46.811 40.993 22.102  1.00  51.87 ? 267  ARG A NE    1 
ATOM   2154 C  CZ    . ARG A 1 273 ? 48.022 41.391 22.497  1.00  53.15 ? 267  ARG A CZ    1 
ATOM   2155 N  NH1   . ARG A 1 273 ? 48.174 42.544 23.137  1.00  54.83 ? 267  ARG A NH1   1 
ATOM   2156 N  NH2   . ARG A 1 273 ? 49.087 40.627 22.259  1.00  52.65 ? 267  ARG A NH2   1 
ATOM   2157 N  N     . ALA A 1 274 ? 43.016 39.105 25.595  1.00  32.75 ? 268  ALA A N     1 
ATOM   2158 C  CA    . ALA A 1 274 ? 41.687 38.572 25.372  1.00  32.02 ? 268  ALA A CA    1 
ATOM   2159 C  C     . ALA A 1 274 ? 40.818 38.755 26.606  1.00  33.15 ? 268  ALA A C     1 
ATOM   2160 O  O     . ALA A 1 274 ? 39.636 39.104 26.486  1.00  34.02 ? 268  ALA A O     1 
ATOM   2161 C  CB    . ALA A 1 274 ? 41.765 37.109 24.996  1.00  31.32 ? 268  ALA A CB    1 
ATOM   2162 N  N     . ILE A 1 275 ? 41.390 38.533 27.789  1.00  31.93 ? 269  ILE A N     1 
ATOM   2163 C  CA    . ILE A 1 275 ? 40.628 38.700 29.019  1.00  32.13 ? 269  ILE A CA    1 
ATOM   2164 C  C     . ILE A 1 275 ? 40.226 40.161 29.211  1.00  33.94 ? 269  ILE A C     1 
ATOM   2165 O  O     . ILE A 1 275 ? 39.100 40.453 29.599  1.00  33.72 ? 269  ILE A O     1 
ATOM   2166 C  CB    . ILE A 1 275 ? 41.421 38.232 30.232  1.00  30.80 ? 269  ILE A CB    1 
ATOM   2167 C  CG1   . ILE A 1 275 ? 41.751 36.745 30.085  1.00  29.64 ? 269  ILE A CG1   1 
ATOM   2168 C  CG2   . ILE A 1 275 ? 40.610 38.465 31.485  1.00  31.55 ? 269  ILE A CG2   1 
ATOM   2169 C  CD1   . ILE A 1 275 ? 42.426 36.132 31.283  1.00  28.96 ? 269  ILE A CD1   1 
ATOM   2170 N  N     . GLU A 1 276 ? 41.145 41.075 28.915  1.00  35.18 ? 270  GLU A N     1 
ATOM   2171 C  CA    . GLU A 1 276 ? 40.881 42.504 29.036  1.00  37.00 ? 270  GLU A CA    1 
ATOM   2172 C  C     . GLU A 1 276 ? 39.696 42.984 28.190  1.00  37.32 ? 270  GLU A C     1 
ATOM   2173 O  O     . GLU A 1 276 ? 38.791 43.639 28.692  1.00  36.18 ? 270  GLU A O     1 
ATOM   2174 C  CB    . GLU A 1 276 ? 42.137 43.308 28.666  1.00  39.19 ? 270  GLU A CB    1 
ATOM   2175 C  CG    . GLU A 1 276 ? 43.251 43.231 29.709  1.00  42.35 ? 270  GLU A CG    1 
ATOM   2176 C  CD    . GLU A 1 276 ? 42.824 43.772 31.082  1.00  46.20 ? 270  GLU A CD    1 
ATOM   2177 O  OE1   . GLU A 1 276 ? 43.550 43.529 32.076  1.00  48.76 ? 270  GLU A OE1   1 
ATOM   2178 O  OE2   . GLU A 1 276 ? 41.768 44.446 31.172  1.00  47.03 ? 270  GLU A OE2   1 
ATOM   2179 N  N     . GLU A 1 277 ? 39.703 42.668 26.904  1.00  38.62 ? 271  GLU A N     1 
ATOM   2180 C  CA    . GLU A 1 277 ? 38.610 43.089 26.042  1.00  40.52 ? 271  GLU A CA    1 
ATOM   2181 C  C     . GLU A 1 277 ? 37.314 42.416 26.493  1.00  39.98 ? 271  GLU A C     1 
ATOM   2182 O  O     . GLU A 1 277 ? 36.231 43.014 26.448  1.00  40.42 ? 271  GLU A O     1 
ATOM   2183 C  CB    . GLU A 1 277 ? 38.917 42.752 24.573  1.00  42.35 ? 271  GLU A CB    1 
ATOM   2184 C  CG    . GLU A 1 277 ? 40.074 43.567 24.001  1.00  48.83 ? 271  GLU A CG    1 
ATOM   2185 C  CD    . GLU A 1 277 ? 40.543 43.105 22.623  1.00  52.90 ? 271  GLU A CD    1 
ATOM   2186 O  OE1   . GLU A 1 277 ? 41.637 43.551 22.195  1.00  53.87 ? 271  GLU A OE1   1 
ATOM   2187 O  OE2   . GLU A 1 277 ? 39.823 42.313 21.967  1.00  54.05 ? 271  GLU A OE2   1 
ATOM   2188 N  N     . SER A 1 278 ? 37.421 41.169 26.933  1.00  39.03 ? 272  SER A N     1 
ATOM   2189 C  CA    . SER A 1 278 ? 36.237 40.454 27.392  1.00  38.38 ? 272  SER A CA    1 
ATOM   2190 C  C     . SER A 1 278 ? 35.580 41.156 28.585  1.00  39.16 ? 272  SER A C     1 
ATOM   2191 O  O     . SER A 1 278 ? 34.357 41.144 28.711  1.00  38.98 ? 272  SER A O     1 
ATOM   2192 C  CB    . SER A 1 278 ? 36.588 39.014 27.773  1.00  35.66 ? 272  SER A CB    1 
ATOM   2193 O  OG    . SER A 1 278 ? 36.721 38.209 26.628  1.00  35.08 ? 272  SER A OG    1 
ATOM   2194 N  N     . TYR A 1 279 ? 36.386 41.767 29.454  1.00  40.01 ? 273  TYR A N     1 
ATOM   2195 C  CA    . TYR A 1 279 ? 35.854 42.456 30.628  1.00  40.03 ? 273  TYR A CA    1 
ATOM   2196 C  C     . TYR A 1 279 ? 35.270 43.817 30.322  1.00  40.78 ? 273  TYR A C     1 
ATOM   2197 O  O     . TYR A 1 279 ? 34.250 44.188 30.907  1.00  42.64 ? 273  TYR A O     1 
ATOM   2198 C  CB    . TYR A 1 279 ? 36.920 42.581 31.714  1.00  39.83 ? 273  TYR A CB    1 
ATOM   2199 C  CG    . TYR A 1 279 ? 36.831 41.484 32.729  1.00  39.44 ? 273  TYR A CG    1 
ATOM   2200 C  CD1   . TYR A 1 279 ? 36.273 41.710 33.981  1.00  39.49 ? 273  TYR A CD1   1 
ATOM   2201 C  CD2   . TYR A 1 279 ? 37.242 40.199 32.411  1.00  40.25 ? 273  TYR A CD2   1 
ATOM   2202 C  CE1   . TYR A 1 279 ? 36.120 40.678 34.896  1.00  41.38 ? 273  TYR A CE1   1 
ATOM   2203 C  CE2   . TYR A 1 279 ? 37.092 39.156 33.307  1.00  41.69 ? 273  TYR A CE2   1 
ATOM   2204 C  CZ    . TYR A 1 279 ? 36.530 39.397 34.550  1.00  41.78 ? 273  TYR A CZ    1 
ATOM   2205 O  OH    . TYR A 1 279 ? 36.365 38.341 35.419  1.00  43.00 ? 273  TYR A OH    1 
ATOM   2206 N  N     . TYR A 1 280 ? 35.902 44.572 29.426  1.00  40.51 ? 274  TYR A N     1 
ATOM   2207 C  CA    . TYR A 1 280 ? 35.356 45.870 29.072  1.00  42.42 ? 274  TYR A CA    1 
ATOM   2208 C  C     . TYR A 1 280 ? 34.030 45.623 28.364  1.00  44.24 ? 274  TYR A C     1 
ATOM   2209 O  O     . TYR A 1 280 ? 33.174 46.493 28.323  0.97  46.15 ? 274  TYR A O     1 
ATOM   2210 C  CB    . TYR A 1 280 ? 36.286 46.630 28.134  1.00  42.49 ? 274  TYR A CB    1 
ATOM   2211 C  CG    . TYR A 1 280 ? 35.787 48.018 27.779  0.91  43.07 ? 274  TYR A CG    1 
ATOM   2212 C  CD1   . TYR A 1 280 ? 35.916 49.078 28.676  0.39  43.12 ? 274  TYR A CD1   1 
ATOM   2213 C  CD2   . TYR A 1 280 ? 35.184 48.270 26.545  0.70  44.10 ? 274  TYR A CD2   1 
ATOM   2214 C  CE1   . TYR A 1 280 ? 35.462 50.356 28.353  0.12  44.34 ? 274  TYR A CE1   1 
ATOM   2215 C  CE2   . TYR A 1 280 ? 34.724 49.548 26.212  0.91  45.13 ? 274  TYR A CE2   1 
ATOM   2216 C  CZ    . TYR A 1 280 ? 34.868 50.584 27.120  1.00  45.72 ? 274  TYR A CZ    1 
ATOM   2217 O  OH    . TYR A 1 280 ? 34.427 51.846 26.797  0.12  45.08 ? 274  TYR A OH    1 
ATOM   2218 N  N     . LYS A 1 281 ? 33.867 44.428 27.803  1.00  44.98 ? 275  LYS A N     1 
ATOM   2219 C  CA    . LYS A 1 281 ? 32.633 44.081 27.106  1.00  45.65 ? 275  LYS A CA    1 
ATOM   2220 C  C     . LYS A 1 281 ? 31.593 43.513 28.069  1.00  46.01 ? 275  LYS A C     1 
ATOM   2221 O  O     . LYS A 1 281 ? 30.392 43.646 27.842  1.00  45.50 ? 275  LYS A O     1 
ATOM   2222 C  CB    . LYS A 1 281 ? 32.910 43.078 25.977  1.00  46.67 ? 275  LYS A CB    1 
ATOM   2223 C  CG    . LYS A 1 281 ? 33.289 43.704 24.609  1.00  50.42 ? 275  LYS A CG    1 
ATOM   2224 C  CD    . LYS A 1 281 ? 33.015 45.231 24.573  1.00  53.69 ? 275  LYS A CD    1 
ATOM   2225 C  CE    . LYS A 1 281 ? 32.668 45.762 23.162  1.00  55.23 ? 275  LYS A CE    1 
ATOM   2226 N  NZ    . LYS A 1 281 ? 32.257 47.218 23.184  1.00  56.08 ? 275  LYS A NZ    1 
ATOM   2227 N  N     . LEU A 1 282 ? 32.049 42.888 29.149  1.00  45.72 ? 276  LEU A N     1 
ATOM   2228 C  CA    . LEU A 1 282 ? 31.123 42.340 30.133  1.00  47.01 ? 276  LEU A CA    1 
ATOM   2229 C  C     . LEU A 1 282 ? 30.318 43.486 30.702  1.00  48.74 ? 276  LEU A C     1 
ATOM   2230 O  O     . LEU A 1 282 ? 29.145 43.322 31.062  1.00  48.13 ? 276  LEU A O     1 
ATOM   2231 C  CB    . LEU A 1 282 ? 31.868 41.662 31.282  1.00  45.75 ? 276  LEU A CB    1 
ATOM   2232 C  CG    . LEU A 1 282 ? 32.324 40.217 31.117  1.00  44.97 ? 276  LEU A CG    1 
ATOM   2233 C  CD1   . LEU A 1 282 ? 33.306 39.884 32.227  1.00  45.92 ? 276  LEU A CD1   1 
ATOM   2234 C  CD2   . LEU A 1 282 ? 31.142 39.296 31.142  1.00  44.20 ? 276  LEU A CD2   1 
ATOM   2235 N  N     . ASP A 1 283 ? 30.971 44.645 30.762  1.00  51.15 ? 277  ASP A N     1 
ATOM   2236 C  CA    . ASP A 1 283 ? 30.389 45.863 31.307  1.00  52.85 ? 277  ASP A CA    1 
ATOM   2237 C  C     . ASP A 1 283 ? 30.117 45.641 32.793  1.00  52.65 ? 277  ASP A C     1 
ATOM   2238 O  O     . ASP A 1 283 ? 31.049 45.391 33.566  1.00  53.47 ? 277  ASP A O     1 
ATOM   2239 C  CB    . ASP A 1 283 ? 29.100 46.231 30.576  1.00  56.54 ? 277  ASP A CB    1 
ATOM   2240 C  CG    . ASP A 1 283 ? 28.718 47.686 30.779  1.00  60.88 ? 277  ASP A CG    1 
ATOM   2241 O  OD1   . ASP A 1 283 ? 29.619 48.550 30.673  1.00  61.07 ? 277  ASP A OD1   1 
ATOM   2242 O  OD2   . ASP A 1 283 ? 27.525 47.969 31.033  1.00  64.19 ? 277  ASP A OD2   1 
ATOM   2243 N  N     . LYS A 1 284 ? 28.854 45.705 33.198  1.00  51.07 ? 278  LYS A N     1 
ATOM   2244 C  CA    . LYS A 1 284 ? 28.527 45.511 34.603  1.00  49.72 ? 278  LYS A CA    1 
ATOM   2245 C  C     . LYS A 1 284 ? 28.155 44.069 34.947  1.00  47.16 ? 278  LYS A C     1 
ATOM   2246 O  O     . LYS A 1 284 ? 27.737 43.791 36.070  1.00  46.40 ? 278  LYS A O     1 
ATOM   2247 C  CB    . LYS A 1 284 ? 27.379 46.446 35.006  1.00  52.74 ? 278  LYS A CB    1 
ATOM   2248 C  CG    . LYS A 1 284 ? 27.701 47.937 34.906  1.00  55.60 ? 278  LYS A CG    1 
ATOM   2249 C  CD    . LYS A 1 284 ? 28.690 48.384 35.987  1.00  57.97 ? 278  LYS A CD    1 
ATOM   2250 C  CE    . LYS A 1 284 ? 28.948 49.903 35.951  1.00  59.00 ? 278  LYS A CE    1 
ATOM   2251 N  NZ    . LYS A 1 284 ? 29.661 50.367 34.716  1.00  59.05 ? 278  LYS A NZ    1 
ATOM   2252 N  N     . ARG A 1 285 ? 28.310 43.151 33.998  1.00  44.26 ? 279  ARG A N     1 
ATOM   2253 C  CA    . ARG A 1 285 ? 27.954 41.754 34.237  1.00  41.73 ? 279  ARG A CA    1 
ATOM   2254 C  C     . ARG A 1 285 ? 29.048 40.945 34.894  1.00  39.49 ? 279  ARG A C     1 
ATOM   2255 O  O     . ARG A 1 285 ? 30.223 41.130 34.585  1.00  39.85 ? 279  ARG A O     1 
ATOM   2256 C  CB    . ARG A 1 285 ? 27.554 41.086 32.932  1.00  44.07 ? 279  ARG A CB    1 
ATOM   2257 C  CG    . ARG A 1 285 ? 26.080 41.193 32.640  1.00  46.61 ? 279  ARG A CG    1 
ATOM   2258 C  CD    . ARG A 1 285 ? 25.777 40.782 31.213  1.00  48.84 ? 279  ARG A CD    1 
ATOM   2259 N  NE    . ARG A 1 285 ? 26.490 41.632 30.268  1.00  50.91 ? 279  ARG A NE    1 
ATOM   2260 C  CZ    . ARG A 1 285 ? 26.200 41.717 28.975  1.00  51.51 ? 279  ARG A CZ    1 
ATOM   2261 N  NH1   . ARG A 1 285 ? 25.200 40.999 28.471  1.00  52.06 ? 279  ARG A NH1   1 
ATOM   2262 N  NH2   . ARG A 1 285 ? 26.916 42.516 28.188  1.00  51.37 ? 279  ARG A NH2   1 
ATOM   2263 N  N     . ILE A 1 286 ? 28.654 40.026 35.776  1.00  36.15 ? 280  ILE A N     1 
ATOM   2264 C  CA    . ILE A 1 286 ? 29.603 39.181 36.505  1.00  34.91 ? 280  ILE A CA    1 
ATOM   2265 C  C     . ILE A 1 286 ? 29.419 37.687 36.186  1.00  33.80 ? 280  ILE A C     1 
ATOM   2266 O  O     . ILE A 1 286 ? 28.380 37.104 36.492  1.00  34.72 ? 280  ILE A O     1 
ATOM   2267 C  CB    . ILE A 1 286 ? 29.441 39.382 38.030  1.00  36.42 ? 280  ILE A CB    1 
ATOM   2268 C  CG1   . ILE A 1 286 ? 29.601 40.869 38.396  1.00  36.30 ? 280  ILE A CG1   1 
ATOM   2269 C  CG2   . ILE A 1 286 ? 30.438 38.509 38.773  1.00  38.56 ? 280  ILE A CG2   1 
ATOM   2270 C  CD1   . ILE A 1 286 ? 30.894 41.528 37.896  1.00  34.83 ? 280  ILE A CD1   1 
ATOM   2271 N  N     . PRO A 1 287 ? 30.435 37.046 35.583  1.00  31.17 ? 281  PRO A N     1 
ATOM   2272 C  CA    . PRO A 1 287 ? 30.392 35.629 35.213  1.00  30.58 ? 281  PRO A CA    1 
ATOM   2273 C  C     . PRO A 1 287 ? 30.914 34.694 36.294  1.00  30.83 ? 281  PRO A C     1 
ATOM   2274 O  O     . PRO A 1 287 ? 31.857 35.032 37.005  1.00  32.63 ? 281  PRO A O     1 
ATOM   2275 C  CB    . PRO A 1 287 ? 31.272 35.589 33.976  1.00  30.33 ? 281  PRO A CB    1 
ATOM   2276 C  CG    . PRO A 1 287 ? 32.389 36.495 34.397  1.00  32.17 ? 281  PRO A CG    1 
ATOM   2277 C  CD    . PRO A 1 287 ? 31.674 37.667 35.091  1.00  31.10 ? 281  PRO A CD    1 
ATOM   2278 N  N     . LYS A 1 288 ? 30.309 33.514 36.397  1.00  29.71 ? 282  LYS A N     1 
ATOM   2279 C  CA    . LYS A 1 288 ? 30.730 32.518 37.373  1.00  30.15 ? 282  LYS A CA    1 
ATOM   2280 C  C     . LYS A 1 288 ? 31.461 31.379 36.666  1.00  30.82 ? 282  LYS A C     1 
ATOM   2281 O  O     . LYS A 1 288 ? 32.050 30.495 37.300  1.00  31.16 ? 282  LYS A O     1 
ATOM   2282 C  CB    . LYS A 1 288 ? 29.520 31.964 38.119  1.00  29.90 ? 282  LYS A CB    1 
ATOM   2283 C  CG    . LYS A 1 288 ? 28.693 33.031 38.814  1.00  30.45 ? 282  LYS A CG    1 
ATOM   2284 C  CD    . LYS A 1 288 ? 27.745 32.425 39.844  1.00  32.02 ? 282  LYS A CD    1 
ATOM   2285 C  CE    . LYS A 1 288 ? 26.708 31.506 39.201  1.00  33.88 ? 282  LYS A CE    1 
ATOM   2286 N  NZ    . LYS A 1 288 ? 25.767 32.270 38.332  1.00  34.81 ? 282  LYS A NZ    1 
ATOM   2287 N  N     . ALA A 1 289 ? 31.422 31.412 35.339  1.00  30.52 ? 283  ALA A N     1 
ATOM   2288 C  CA    . ALA A 1 289 ? 32.071 30.388 34.529  1.00  29.42 ? 283  ALA A CA    1 
ATOM   2289 C  C     . ALA A 1 289 ? 33.062 31.028 33.564  1.00  28.22 ? 283  ALA A C     1 
ATOM   2290 O  O     . ALA A 1 289 ? 32.812 32.120 33.027  1.00  26.44 ? 283  ALA A O     1 
ATOM   2291 C  CB    . ALA A 1 289 ? 31.015 29.584 33.756  1.00  29.78 ? 283  ALA A CB    1 
ATOM   2292 N  N     . ILE A 1 290 ? 34.180 30.336 33.349  1.00  27.84 ? 284  ILE A N     1 
ATOM   2293 C  CA    . ILE A 1 290 ? 35.226 30.813 32.457  1.00  27.98 ? 284  ILE A CA    1 
ATOM   2294 C  C     . ILE A 1 290 ? 35.726 29.656 31.632  1.00  29.02 ? 284  ILE A C     1 
ATOM   2295 O  O     . ILE A 1 290 ? 35.878 28.551 32.132  1.00  28.92 ? 284  ILE A O     1 
ATOM   2296 C  CB    . ILE A 1 290 ? 36.418 31.423 33.249  1.00  27.73 ? 284  ILE A CB    1 
ATOM   2297 C  CG1   . ILE A 1 290 ? 37.575 31.720 32.300  1.00  25.86 ? 284  ILE A CG1   1 
ATOM   2298 C  CG2   . ILE A 1 290 ? 36.864 30.469 34.352  1.00  27.03 ? 284  ILE A CG2   1 
ATOM   2299 C  CD1   . ILE A 1 290 ? 38.781 32.367 32.971  1.00  24.94 ? 284  ILE A CD1   1 
ATOM   2300 N  N     . HIS A 1 291 ? 35.967 29.909 30.357  1.00  29.84 ? 285  HIS A N     1 
ATOM   2301 C  CA    . HIS A 1 291 ? 36.462 28.878 29.477  1.00  30.00 ? 285  HIS A CA    1 
ATOM   2302 C  C     . HIS A 1 291 ? 37.625 29.402 28.654  1.00  29.38 ? 285  HIS A C     1 
ATOM   2303 O  O     . HIS A 1 291 ? 37.523 30.473 28.047  1.00  30.78 ? 285  HIS A O     1 
ATOM   2304 C  CB    . HIS A 1 291 ? 35.347 28.399 28.545  1.00  32.14 ? 285  HIS A CB    1 
ATOM   2305 C  CG    . HIS A 1 291 ? 34.397 27.443 29.192  1.00  35.73 ? 285  HIS A CG    1 
ATOM   2306 N  ND1   . HIS A 1 291 ? 33.284 27.863 29.886  1.00  37.58 ? 285  HIS A ND1   1 
ATOM   2307 C  CD2   . HIS A 1 291 ? 34.409 26.091 29.285  1.00  37.52 ? 285  HIS A CD2   1 
ATOM   2308 C  CE1   . HIS A 1 291 ? 32.647 26.814 30.376  1.00  38.79 ? 285  HIS A CE1   1 
ATOM   2309 N  NE2   . HIS A 1 291 ? 33.309 25.725 30.026  1.00  37.50 ? 285  HIS A NE2   1 
ATOM   2310 N  N     . VAL A 1 292 ? 38.734 28.670 28.646  1.00  26.86 ? 286  VAL A N     1 
ATOM   2311 C  CA    . VAL A 1 292 ? 39.856 29.078 27.830  1.00  26.27 ? 286  VAL A CA    1 
ATOM   2312 C  C     . VAL A 1 292 ? 39.725 28.224 26.585  1.00  25.29 ? 286  VAL A C     1 
ATOM   2313 O  O     . VAL A 1 292 ? 39.548 27.012 26.666  1.00  25.13 ? 286  VAL A O     1 
ATOM   2314 C  CB    . VAL A 1 292 ? 41.196 28.841 28.529  1.00  25.49 ? 286  VAL A CB    1 
ATOM   2315 C  CG1   . VAL A 1 292 ? 42.333 29.098 27.574  1.00  24.60 ? 286  VAL A CG1   1 
ATOM   2316 C  CG2   . VAL A 1 292 ? 41.319 29.789 29.693  1.00  26.65 ? 286  VAL A CG2   1 
ATOM   2317 N  N     . VAL A 1 293 ? 39.774 28.873 25.432  1.00  24.55 ? 287  VAL A N     1 
ATOM   2318 C  CA    . VAL A 1 293 ? 39.626 28.181 24.162  1.00  24.07 ? 287  VAL A CA    1 
ATOM   2319 C  C     . VAL A 1 293 ? 40.862 28.350 23.299  1.00  23.19 ? 287  VAL A C     1 
ATOM   2320 O  O     . VAL A 1 293 ? 41.450 29.421 23.256  1.00  24.91 ? 287  VAL A O     1 
ATOM   2321 C  CB    . VAL A 1 293 ? 38.423 28.741 23.406  1.00  23.82 ? 287  VAL A CB    1 
ATOM   2322 C  CG1   . VAL A 1 293 ? 38.042 27.809 22.268  1.00  23.10 ? 287  VAL A CG1   1 
ATOM   2323 C  CG2   . VAL A 1 293 ? 37.270 28.955 24.381  1.00  22.16 ? 287  VAL A CG2   1 
ATOM   2324 N  N     . ALA A 1 294 ? 41.264 27.291 22.619  1.00  23.67 ? 288  ALA A N     1 
ATOM   2325 C  CA    . ALA A 1 294 ? 42.435 27.369 21.753  1.00  25.71 ? 288  ALA A CA    1 
ATOM   2326 C  C     . ALA A 1 294 ? 42.170 26.689 20.428  1.00  27.98 ? 288  ALA A C     1 
ATOM   2327 O  O     . ALA A 1 294 ? 41.517 25.642 20.354  1.00  28.01 ? 288  ALA A O     1 
ATOM   2328 C  CB    . ALA A 1 294 ? 43.649 26.724 22.418  1.00  23.41 ? 288  ALA A CB    1 
ATOM   2329 N  N     . VAL A 1 295 ? 42.672 27.310 19.376  1.00  30.96 ? 289  VAL A N     1 
ATOM   2330 C  CA    . VAL A 1 295 ? 42.550 26.758 18.047  1.00  33.61 ? 289  VAL A CA    1 
ATOM   2331 C  C     . VAL A 1 295 ? 43.955 26.263 17.731  1.00  35.58 ? 289  VAL A C     1 
ATOM   2332 O  O     . VAL A 1 295 ? 44.873 27.060 17.531  1.00  35.33 ? 289  VAL A O     1 
ATOM   2333 C  CB    . VAL A 1 295 ? 42.124 27.843 17.012  1.00  33.70 ? 289  VAL A CB    1 
ATOM   2334 C  CG1   . VAL A 1 295 ? 42.100 27.248 15.615  1.00  30.92 ? 289  VAL A CG1   1 
ATOM   2335 C  CG2   . VAL A 1 295 ? 40.756 28.406 17.370  1.00  31.83 ? 289  VAL A CG2   1 
ATOM   2336 N  N     . THR A 1 296 ? 44.120 24.946 17.725  1.00  37.88 ? 290  THR A N     1 
ATOM   2337 C  CA    . THR A 1 296 ? 45.409 24.334 17.426  1.00  41.97 ? 290  THR A CA    1 
ATOM   2338 C  C     . THR A 1 296 ? 45.898 24.687 16.023  1.00  43.64 ? 290  THR A C     1 
ATOM   2339 O  O     . THR A 1 296 ? 45.139 25.195 15.195  1.00  42.59 ? 290  THR A O     1 
ATOM   2340 C  CB    . THR A 1 296 ? 45.327 22.810 17.517  1.00  42.38 ? 290  THR A CB    1 
ATOM   2341 O  OG1   . THR A 1 296 ? 44.265 22.347 16.675  1.00  42.62 ? 290  THR A OG1   1 
ATOM   2342 C  CG2   . THR A 1 296 ? 45.079 22.372 18.951  1.00  42.75 ? 290  THR A CG2   1 
ATOM   2343 N  N     . GLU A 1 297 ? 47.169 24.409 15.759  1.00  46.78 ? 291  GLU A N     1 
ATOM   2344 C  CA    . GLU A 1 297 ? 47.749 24.697 14.453  1.00  50.15 ? 291  GLU A CA    1 
ATOM   2345 C  C     . GLU A 1 297 ? 46.932 24.038 13.342  1.00  51.48 ? 291  GLU A C     1 
ATOM   2346 O  O     . GLU A 1 297 ? 46.829 24.581 12.240  1.00  52.98 ? 291  GLU A O     1 
ATOM   2347 C  CB    . GLU A 1 297 ? 49.202 24.213 14.393  1.00  51.21 ? 291  GLU A CB    1 
ATOM   2348 C  CG    . GLU A 1 297 ? 49.369 22.698 14.547  1.00  54.53 ? 291  GLU A CG    1 
ATOM   2349 C  CD    . GLU A 1 297 ? 50.792 22.274 14.911  1.00  56.30 ? 291  GLU A CD    1 
ATOM   2350 O  OE1   . GLU A 1 297 ? 51.741 22.801 14.329  1.00  59.74 ? 291  GLU A OE1   1 
ATOM   2351 O  OE2   . GLU A 1 297 ? 50.990 21.397 15.771  1.00  54.25 ? 291  GLU A OE2   1 
ATOM   2352 N  N     . ASP A 1 298 ? 46.340 22.880 13.620  1.00  51.96 ? 292  ASP A N     1 
ATOM   2353 C  CA    . ASP A 1 298 ? 45.541 22.215 12.601  1.00  53.16 ? 292  ASP A CA    1 
ATOM   2354 C  C     . ASP A 1 298 ? 44.073 22.643 12.654  1.00  52.46 ? 292  ASP A C     1 
ATOM   2355 O  O     . ASP A 1 298 ? 43.165 21.847 12.412  1.00  52.37 ? 292  ASP A O     1 
ATOM   2356 C  CB    . ASP A 1 298 ? 45.671 20.689 12.725  1.00  55.80 ? 292  ASP A CB    1 
ATOM   2357 C  CG    . ASP A 1 298 ? 45.129 20.142 14.050  1.00  58.95 ? 292  ASP A CG    1 
ATOM   2358 O  OD1   . ASP A 1 298 ? 45.583 20.606 15.121  1.00  61.01 ? 292  ASP A OD1   1 
ATOM   2359 O  OD2   . ASP A 1 298 ? 44.259 19.235 14.016  1.00  59.98 ? 292  ASP A OD2   1 
ATOM   2360 N  N     . LEU A 1 299 ? 43.863 23.920 12.962  1.00  51.77 ? 293  LEU A N     1 
ATOM   2361 C  CA    . LEU A 1 299 ? 42.541 24.529 13.051  1.00  50.35 ? 293  LEU A CA    1 
ATOM   2362 C  C     . LEU A 1 299 ? 41.477 23.747 13.820  1.00  49.13 ? 293  LEU A C     1 
ATOM   2363 O  O     . LEU A 1 299 ? 40.286 23.872 13.552  1.00  48.25 ? 293  LEU A O     1 
ATOM   2364 C  CB    . LEU A 1 299 ? 42.033 24.875 11.648  1.00  51.85 ? 293  LEU A CB    1 
ATOM   2365 C  CG    . LEU A 1 299 ? 42.677 26.105 10.989  1.00  53.54 ? 293  LEU A CG    1 
ATOM   2366 C  CD1   . LEU A 1 299 ? 44.178 25.894 10.770  1.00  53.36 ? 293  LEU A CD1   1 
ATOM   2367 C  CD2   . LEU A 1 299 ? 41.980 26.371 9.669   1.00  53.67 ? 293  LEU A CD2   1 
ATOM   2368 N  N     . ASP A 1 300 ? 41.918 22.948 14.784  1.00  48.28 ? 294  ASP A N     1 
ATOM   2369 C  CA    . ASP A 1 300 ? 41.017 22.170 15.624  1.00  47.41 ? 294  ASP A CA    1 
ATOM   2370 C  C     . ASP A 1 300 ? 40.708 23.106 16.783  1.00  46.18 ? 294  ASP A C     1 
ATOM   2371 O  O     . ASP A 1 300 ? 41.469 24.041 17.024  1.00  45.56 ? 294  ASP A O     1 
ATOM   2372 C  CB    . ASP A 1 300 ? 41.726 20.928 16.152  1.00  49.53 ? 294  ASP A CB    1 
ATOM   2373 C  CG    . ASP A 1 300 ? 40.852 19.701 16.115  1.00  52.09 ? 294  ASP A CG    1 
ATOM   2374 O  OD1   . ASP A 1 300 ? 39.627 19.829 16.358  1.00  52.99 ? 294  ASP A OD1   1 
ATOM   2375 O  OD2   . ASP A 1 300 ? 41.400 18.606 15.853  1.00  54.31 ? 294  ASP A OD2   1 
ATOM   2376 N  N     . ILE A 1 301 ? 39.619 22.861 17.508  1.00  44.75 ? 295  ILE A N     1 
ATOM   2377 C  CA    . ILE A 1 301 ? 39.244 23.739 18.620  1.00  42.82 ? 295  ILE A CA    1 
ATOM   2378 C  C     . ILE A 1 301 ? 39.118 23.005 19.943  1.00  40.81 ? 295  ILE A C     1 
ATOM   2379 O  O     . ILE A 1 301 ? 38.213 22.194 20.119  1.00  41.65 ? 295  ILE A O     1 
ATOM   2380 C  CB    . ILE A 1 301 ? 37.905 24.437 18.339  1.00  44.15 ? 295  ILE A CB    1 
ATOM   2381 C  CG1   . ILE A 1 301 ? 37.935 25.093 16.957  1.00  45.84 ? 295  ILE A CG1   1 
ATOM   2382 C  CG2   . ILE A 1 301 ? 37.658 25.499 19.383  1.00  44.26 ? 295  ILE A CG2   1 
ATOM   2383 C  CD1   . ILE A 1 301 ? 36.603 25.667 16.519  1.00  47.94 ? 295  ILE A CD1   1 
ATOM   2384 N  N     . VAL A 1 302 ? 40.015 23.308 20.878  1.00  39.09 ? 296  VAL A N     1 
ATOM   2385 C  CA    . VAL A 1 302 ? 40.019 22.658 22.189  1.00  37.67 ? 296  VAL A CA    1 
ATOM   2386 C  C     . VAL A 1 302 ? 39.702 23.647 23.318  1.00  37.04 ? 296  VAL A C     1 
ATOM   2387 O  O     . VAL A 1 302 ? 40.062 24.827 23.237  1.00  37.18 ? 296  VAL A O     1 
ATOM   2388 C  CB    . VAL A 1 302 ? 41.404 22.009 22.466  1.00  37.75 ? 296  VAL A CB    1 
ATOM   2389 C  CG1   . VAL A 1 302 ? 42.436 23.088 22.780  1.00  37.68 ? 296  VAL A CG1   1 
ATOM   2390 C  CG2   . VAL A 1 302 ? 41.300 21.009 23.604  1.00  38.87 ? 296  VAL A CG2   1 
ATOM   2391 N  N     . SER A 1 303 ? 39.043 23.181 24.375  1.00  33.91 ? 297  SER A N     1 
ATOM   2392 C  CA    . SER A 1 303 ? 38.728 24.098 25.456  1.00  33.80 ? 297  SER A CA    1 
ATOM   2393 C  C     . SER A 1 303 ? 38.721 23.495 26.856  1.00  34.17 ? 297  SER A C     1 
ATOM   2394 O  O     . SER A 1 303 ? 38.456 22.315 27.049  1.00  34.13 ? 297  SER A O     1 
ATOM   2395 C  CB    . SER A 1 303 ? 37.376 24.779 25.185  1.00  32.88 ? 297  SER A CB    1 
ATOM   2396 O  OG    . SER A 1 303 ? 36.300 23.938 25.557  1.00  32.36 ? 297  SER A OG    1 
ATOM   2397 N  N     . ARG A 1 304 ? 39.002 24.344 27.834  1.00  34.28 ? 298  ARG A N     1 
ATOM   2398 C  CA    . ARG A 1 304 ? 39.023 23.944 29.227  1.00  34.47 ? 298  ARG A CA    1 
ATOM   2399 C  C     . ARG A 1 304 ? 38.397 25.064 30.044  1.00  35.00 ? 298  ARG A C     1 
ATOM   2400 O  O     . ARG A 1 304 ? 38.634 26.240 29.784  1.00  37.42 ? 298  ARG A O     1 
ATOM   2401 C  CB    . ARG A 1 304 ? 40.457 23.690 29.668  1.00  33.32 ? 298  ARG A CB    1 
ATOM   2402 C  CG    . ARG A 1 304 ? 41.102 22.524 28.947  1.00  32.55 ? 298  ARG A CG    1 
ATOM   2403 C  CD    . ARG A 1 304 ? 40.346 21.253 29.244  1.00  32.48 ? 298  ARG A CD    1 
ATOM   2404 N  NE    . ARG A 1 304 ? 41.039 20.051 28.789  1.00  34.46 ? 298  ARG A NE    1 
ATOM   2405 C  CZ    . ARG A 1 304 ? 41.087 19.627 27.530  1.00  36.99 ? 298  ARG A CZ    1 
ATOM   2406 N  NH1   . ARG A 1 304 ? 40.484 20.301 26.561  1.00  38.52 ? 298  ARG A NH1   1 
ATOM   2407 N  NH2   . ARG A 1 304 ? 41.731 18.505 27.236  1.00  38.51 ? 298  ARG A NH2   1 
ATOM   2408 N  N     . GLY A 1 305 ? 37.582 24.706 31.023  1.00  34.40 ? 299  GLY A N     1 
ATOM   2409 C  CA    . GLY A 1 305 ? 36.938 25.729 31.812  1.00  34.94 ? 299  GLY A CA    1 
ATOM   2410 C  C     . GLY A 1 305 ? 36.599 25.310 33.224  1.00  35.92 ? 299  GLY A C     1 
ATOM   2411 O  O     . GLY A 1 305 ? 36.876 24.184 33.653  1.00  35.56 ? 299  GLY A O     1 
ATOM   2412 N  N     . ARG A 1 306 ? 35.955 26.229 33.933  1.00  36.64 ? 300  ARG A N     1 
ATOM   2413 C  CA    . ARG A 1 306 ? 35.597 26.010 35.310  1.00  37.39 ? 300  ARG A CA    1 
ATOM   2414 C  C     . ARG A 1 306 ? 34.454 26.924 35.759  1.00  36.83 ? 300  ARG A C     1 
ATOM   2415 O  O     . ARG A 1 306 ? 34.360 28.088 35.348  1.00  34.77 ? 300  ARG A O     1 
ATOM   2416 C  CB    . ARG A 1 306 ? 36.849 26.238 36.160  1.00  39.84 ? 300  ARG A CB    1 
ATOM   2417 C  CG    . ARG A 1 306 ? 36.681 25.985 37.639  1.00  44.69 ? 300  ARG A CG    1 
ATOM   2418 C  CD    . ARG A 1 306 ? 38.006 26.159 38.332  1.00  47.64 ? 300  ARG A CD    1 
ATOM   2419 N  NE    . ARG A 1 306 ? 37.855 26.086 39.776  1.00  51.39 ? 300  ARG A NE    1 
ATOM   2420 C  CZ    . ARG A 1 306 ? 38.792 26.465 40.637  1.00  53.53 ? 300  ARG A CZ    1 
ATOM   2421 N  NH1   . ARG A 1 306 ? 39.953 26.944 40.194  1.00  54.78 ? 300  ARG A NH1   1 
ATOM   2422 N  NH2   . ARG A 1 306 ? 38.567 26.375 41.941  1.00  53.63 ? 300  ARG A NH2   1 
ATOM   2423 N  N     . THR A 1 307 ? 33.581 26.377 36.599  1.00  36.90 ? 301  THR A N     1 
ATOM   2424 C  CA    . THR A 1 307 ? 32.452 27.129 37.126  1.00  37.83 ? 301  THR A CA    1 
ATOM   2425 C  C     . THR A 1 307 ? 32.612 27.298 38.623  1.00  37.90 ? 301  THR A C     1 
ATOM   2426 O  O     . THR A 1 307 ? 32.666 26.317 39.354  1.00  38.66 ? 301  THR A O     1 
ATOM   2427 C  CB    . THR A 1 307 ? 31.130 26.402 36.880  1.00  38.50 ? 301  THR A CB    1 
ATOM   2428 O  OG1   . THR A 1 307 ? 31.005 26.103 35.483  1.00  39.58 ? 301  THR A OG1   1 
ATOM   2429 C  CG2   . THR A 1 307 ? 29.964 27.267 37.330  1.00  36.29 ? 301  THR A CG2   1 
ATOM   2430 N  N     . PHE A 1 308 ? 32.688 28.541 39.073  1.00  37.75 ? 302  PHE A N     1 
ATOM   2431 C  CA    . PHE A 1 308 ? 32.835 28.806 40.487  1.00  37.92 ? 302  PHE A CA    1 
ATOM   2432 C  C     . PHE A 1 308 ? 31.479 29.028 41.140  1.00  38.51 ? 302  PHE A C     1 
ATOM   2433 O  O     . PHE A 1 308 ? 30.495 29.381 40.475  1.00  36.94 ? 302  PHE A O     1 
ATOM   2434 C  CB    . PHE A 1 308 ? 33.712 30.037 40.712  1.00  38.30 ? 302  PHE A CB    1 
ATOM   2435 C  CG    . PHE A 1 308 ? 35.085 29.918 40.123  1.00  38.63 ? 302  PHE A CG    1 
ATOM   2436 C  CD1   . PHE A 1 308 ? 35.279 30.019 38.747  1.00  40.10 ? 302  PHE A CD1   1 
ATOM   2437 C  CD2   . PHE A 1 308 ? 36.180 29.670 40.934  1.00  35.98 ? 302  PHE A CD2   1 
ATOM   2438 C  CE1   . PHE A 1 308 ? 36.550 29.870 38.184  1.00  38.36 ? 302  PHE A CE1   1 
ATOM   2439 C  CE2   . PHE A 1 308 ? 37.444 29.519 40.383  1.00  38.83 ? 302  PHE A CE2   1 
ATOM   2440 C  CZ    . PHE A 1 308 ? 37.627 29.620 38.997  1.00  39.21 ? 302  PHE A CZ    1 
ATOM   2441 N  N     . PRO A 1 309 ? 31.409 28.804 42.460  1.00  39.59 ? 303  PRO A N     1 
ATOM   2442 C  CA    . PRO A 1 309 ? 30.175 28.986 43.222  1.00  38.43 ? 303  PRO A CA    1 
ATOM   2443 C  C     . PRO A 1 309 ? 29.903 30.465 43.456  1.00  38.23 ? 303  PRO A C     1 
ATOM   2444 O  O     . PRO A 1 309 ? 29.002 30.822 44.205  1.00  40.67 ? 303  PRO A O     1 
ATOM   2445 C  CB    . PRO A 1 309 ? 30.461 28.237 44.519  1.00  37.16 ? 303  PRO A CB    1 
ATOM   2446 C  CG    . PRO A 1 309 ? 31.913 28.443 44.697  1.00  38.13 ? 303  PRO A CG    1 
ATOM   2447 C  CD    . PRO A 1 309 ? 32.453 28.199 43.307  1.00  38.35 ? 303  PRO A CD    1 
ATOM   2448 N  N     . HIS A 1 310 ? 30.675 31.319 42.799  1.00  36.76 ? 304  HIS A N     1 
ATOM   2449 C  CA    . HIS A 1 310 ? 30.517 32.758 42.949  1.00  37.41 ? 304  HIS A CA    1 
ATOM   2450 C  C     . HIS A 1 310 ? 31.008 33.451 41.688  1.00  37.94 ? 304  HIS A C     1 
ATOM   2451 O  O     . HIS A 1 310 ? 31.617 32.812 40.824  1.00  38.86 ? 304  HIS A O     1 
ATOM   2452 C  CB    . HIS A 1 310 ? 31.339 33.237 44.144  1.00  38.41 ? 304  HIS A CB    1 
ATOM   2453 C  CG    . HIS A 1 310 ? 32.777 32.805 44.097  1.00  39.84 ? 304  HIS A CG    1 
ATOM   2454 N  ND1   . HIS A 1 310 ? 33.675 33.291 43.169  1.00  38.64 ? 304  HIS A ND1   1 
ATOM   2455 C  CD2   . HIS A 1 310 ? 33.461 31.898 44.838  1.00  40.19 ? 304  HIS A CD2   1 
ATOM   2456 C  CE1   . HIS A 1 310 ? 34.847 32.700 43.338  1.00  38.14 ? 304  HIS A CE1   1 
ATOM   2457 N  NE2   . HIS A 1 310 ? 34.744 31.850 44.345  1.00  38.28 ? 304  HIS A NE2   1 
ATOM   2458 N  N     . GLY A 1 311 ? 30.762 34.756 41.592  1.00  37.20 ? 305  GLY A N     1 
ATOM   2459 C  CA    . GLY A 1 311 ? 31.204 35.516 40.430  1.00  35.91 ? 305  GLY A CA    1 
ATOM   2460 C  C     . GLY A 1 311 ? 32.721 35.550 40.347  1.00  35.08 ? 305  GLY A C     1 
ATOM   2461 O  O     . GLY A 1 311 ? 33.391 35.311 41.348  1.00  34.04 ? 305  GLY A O     1 
ATOM   2462 N  N     . ILE A 1 312 ? 33.261 35.857 39.168  1.00  33.71 ? 306  ILE A N     1 
ATOM   2463 C  CA    . ILE A 1 312 ? 34.716 35.889 38.954  1.00  34.40 ? 306  ILE A CA    1 
ATOM   2464 C  C     . ILE A 1 312 ? 35.338 37.289 38.790  1.00  33.58 ? 306  ILE A C     1 
ATOM   2465 O  O     . ILE A 1 312 ? 34.965 38.037 37.904  1.00  34.98 ? 306  ILE A O     1 
ATOM   2466 C  CB    . ILE A 1 312 ? 35.101 35.091 37.688  1.00  35.23 ? 306  ILE A CB    1 
ATOM   2467 C  CG1   . ILE A 1 312 ? 34.577 33.660 37.775  1.00  37.21 ? 306  ILE A CG1   1 
ATOM   2468 C  CG2   . ILE A 1 312 ? 36.609 35.070 37.521  1.00  34.11 ? 306  ILE A CG2   1 
ATOM   2469 C  CD1   . ILE A 1 312 ? 34.692 32.886 36.457  1.00  37.28 ? 306  ILE A CD1   1 
ATOM   2470 N  N     . SER A 1 313 ? 36.306 37.633 39.627  1.00  32.54 ? 307  SER A N     1 
ATOM   2471 C  CA    . SER A 1 313 ? 36.973 38.933 39.517  1.00  32.84 ? 307  SER A CA    1 
ATOM   2472 C  C     . SER A 1 313 ? 38.085 38.841 38.460  1.00  33.14 ? 307  SER A C     1 
ATOM   2473 O  O     . SER A 1 313 ? 38.601 37.752 38.182  1.00  32.46 ? 307  SER A O     1 
ATOM   2474 C  CB    . SER A 1 313 ? 37.608 39.314 40.855  1.00  33.80 ? 307  SER A CB    1 
ATOM   2475 O  OG    . SER A 1 313 ? 38.789 38.557 41.077  1.00  33.13 ? 307  SER A OG    1 
ATOM   2476 N  N     . LYS A 1 314 ? 38.485 39.969 37.888  1.00  32.93 ? 308  LYS A N     1 
ATOM   2477 C  CA    . LYS A 1 314 ? 39.535 39.911 36.875  1.00  34.49 ? 308  LYS A CA    1 
ATOM   2478 C  C     . LYS A 1 314 ? 40.760 39.144 37.392  1.00  34.48 ? 308  LYS A C     1 
ATOM   2479 O  O     . LYS A 1 314 ? 41.340 38.331 36.670  1.00  34.64 ? 308  LYS A O     1 
ATOM   2480 C  CB    . LYS A 1 314 ? 39.927 41.321 36.427  1.00  36.64 ? 308  LYS A CB    1 
ATOM   2481 C  CG    . LYS A 1 314 ? 40.817 41.364 35.197  1.00  38.20 ? 308  LYS A CG    1 
ATOM   2482 C  CD    . LYS A 1 314 ? 41.198 42.801 34.818  1.00  39.16 ? 308  LYS A CD    1 
ATOM   2483 C  CE    . LYS A 1 314 ? 39.980 43.600 34.398  1.00  40.64 ? 308  LYS A CE    1 
ATOM   2484 N  NZ    . LYS A 1 314 ? 40.323 45.042 34.189  1.00  42.71 ? 308  LYS A NZ    1 
ATOM   2485 N  N     . GLU A 1 315 ? 41.140 39.379 38.644  1.00  33.43 ? 309  GLU A N     1 
ATOM   2486 C  CA    . GLU A 1 315 ? 42.289 38.679 39.216  1.00  34.86 ? 309  GLU A CA    1 
ATOM   2487 C  C     . GLU A 1 315 ? 42.118 37.169 39.129  1.00  34.27 ? 309  GLU A C     1 
ATOM   2488 O  O     . GLU A 1 315 ? 43.029 36.426 38.721  1.00  33.83 ? 309  GLU A O     1 
ATOM   2489 C  CB    . GLU A 1 315 ? 42.473 39.083 40.675  1.00  36.85 ? 309  GLU A CB    1 
ATOM   2490 C  CG    . GLU A 1 315 ? 42.940 40.490 40.809  1.00  40.91 ? 309  GLU A CG    1 
ATOM   2491 C  CD    . GLU A 1 315 ? 44.255 40.679 40.103  1.00  44.07 ? 309  GLU A CD    1 
ATOM   2492 O  OE1   . GLU A 1 315 ? 44.617 41.842 39.814  1.00  47.00 ? 309  GLU A OE1   1 
ATOM   2493 O  OE2   . GLU A 1 315 ? 44.926 39.654 39.840  1.00  44.59 ? 309  GLU A OE2   1 
ATOM   2494 N  N     . THR A 1 316 ? 40.933 36.725 39.519  1.00  31.83 ? 310  THR A N     1 
ATOM   2495 C  CA    . THR A 1 316 ? 40.632 35.317 39.504  1.00  30.17 ? 310  THR A CA    1 
ATOM   2496 C  C     . THR A 1 316 ? 40.665 34.790 38.078  1.00  29.57 ? 310  THR A C     1 
ATOM   2497 O  O     . THR A 1 316 ? 41.166 33.697 37.824  1.00  29.14 ? 310  THR A O     1 
ATOM   2498 C  CB    . THR A 1 316 ? 39.261 35.053 40.161  1.00  29.15 ? 310  THR A CB    1 
ATOM   2499 O  OG1   . THR A 1 316 ? 39.327 35.402 41.552  1.00  27.25 ? 310  THR A OG1   1 
ATOM   2500 C  CG2   . THR A 1 316 ? 38.884 33.590 40.043  1.00  27.09 ? 310  THR A CG2   1 
ATOM   2501 N  N     . ALA A 1 317 ? 40.148 35.580 37.146  1.00  29.46 ? 311  ALA A N     1 
ATOM   2502 C  CA    . ALA A 1 317 ? 40.128 35.169 35.748  1.00  29.78 ? 311  ALA A CA    1 
ATOM   2503 C  C     . ALA A 1 317 ? 41.544 35.111 35.202  1.00  30.40 ? 311  ALA A C     1 
ATOM   2504 O  O     . ALA A 1 317 ? 41.913 34.177 34.495  1.00  29.54 ? 311  ALA A O     1 
ATOM   2505 C  CB    . ALA A 1 317 ? 39.290 36.138 34.921  1.00  30.54 ? 311  ALA A CB    1 
ATOM   2506 N  N     . TYR A 1 318 ? 42.343 36.117 35.521  1.00  31.63 ? 312  TYR A N     1 
ATOM   2507 C  CA    . TYR A 1 318 ? 43.711 36.119 35.041  1.00  34.61 ? 312  TYR A CA    1 
ATOM   2508 C  C     . TYR A 1 318 ? 44.400 34.841 35.491  1.00  35.51 ? 312  TYR A C     1 
ATOM   2509 O  O     . TYR A 1 318 ? 44.949 34.087 34.685  1.00  34.71 ? 312  TYR A O     1 
ATOM   2510 C  CB    . TYR A 1 318 ? 44.452 37.328 35.589  1.00  35.39 ? 312  TYR A CB    1 
ATOM   2511 C  CG    . TYR A 1 318 ? 44.548 38.462 34.600  1.00  40.41 ? 312  TYR A CG    1 
ATOM   2512 C  CD1   . TYR A 1 318 ? 45.664 38.596 33.779  1.00  42.72 ? 312  TYR A CD1   1 
ATOM   2513 C  CD2   . TYR A 1 318 ? 43.517 39.396 34.468  1.00  39.98 ? 312  TYR A CD2   1 
ATOM   2514 C  CE1   . TYR A 1 318 ? 45.756 39.625 32.860  1.00  42.93 ? 312  TYR A CE1   1 
ATOM   2515 C  CE2   . TYR A 1 318 ? 43.602 40.429 33.545  1.00  41.10 ? 312  TYR A CE2   1 
ATOM   2516 C  CZ    . TYR A 1 318 ? 44.727 40.536 32.744  1.00  42.73 ? 312  TYR A CZ    1 
ATOM   2517 O  OH    . TYR A 1 318 ? 44.848 41.546 31.818  1.00  45.10 ? 312  TYR A OH    1 
ATOM   2518 N  N     . SER A 1 319 ? 44.338 34.594 36.792  1.00  36.92 ? 313  SER A N     1 
ATOM   2519 C  CA    . SER A 1 319 ? 44.974 33.429 37.384  1.00  37.34 ? 313  SER A CA    1 
ATOM   2520 C  C     . SER A 1 319 ? 44.412 32.097 36.899  1.00  37.35 ? 313  SER A C     1 
ATOM   2521 O  O     . SER A 1 319 ? 45.155 31.200 36.515  1.00  36.72 ? 313  SER A O     1 
ATOM   2522 C  CB    . SER A 1 319 ? 44.857 33.504 38.901  1.00  36.95 ? 313  SER A CB    1 
ATOM   2523 O  OG    . SER A 1 319 ? 45.542 32.421 39.499  1.00  41.26 ? 313  SER A OG    1 
ATOM   2524 N  N     . GLU A 1 320 ? 43.095 31.968 36.924  1.00  37.26 ? 314  GLU A N     1 
ATOM   2525 C  CA    . GLU A 1 320 ? 42.456 30.734 36.506  1.00  36.82 ? 314  GLU A CA    1 
ATOM   2526 C  C     . GLU A 1 320 ? 42.657 30.397 35.030  1.00  36.15 ? 314  GLU A C     1 
ATOM   2527 O  O     . GLU A 1 320 ? 42.724 29.215 34.669  1.00  35.54 ? 314  GLU A O     1 
ATOM   2528 C  CB    . GLU A 1 320 ? 40.965 30.797 36.813  1.00  38.50 ? 314  GLU A CB    1 
ATOM   2529 C  CG    . GLU A 1 320 ? 40.262 29.474 36.711  1.00  42.90 ? 314  GLU A CG    1 
ATOM   2530 C  CD    . GLU A 1 320 ? 40.901 28.391 37.584  1.00  48.36 ? 314  GLU A CD    1 
ATOM   2531 O  OE1   . GLU A 1 320 ? 41.454 28.711 38.672  1.00  49.06 ? 314  GLU A OE1   1 
ATOM   2532 O  OE2   . GLU A 1 320 ? 40.833 27.205 37.185  1.00  51.47 ? 314  GLU A OE2   1 
ATOM   2533 N  N     . SER A 1 321 ? 42.757 31.412 34.171  1.00  34.69 ? 315  SER A N     1 
ATOM   2534 C  CA    . SER A 1 321 ? 42.934 31.138 32.744  1.00  35.47 ? 315  SER A CA    1 
ATOM   2535 C  C     . SER A 1 321 ? 44.288 30.509 32.471  1.00  34.67 ? 315  SER A C     1 
ATOM   2536 O  O     . SER A 1 321 ? 44.403 29.663 31.588  1.00  34.42 ? 315  SER A O     1 
ATOM   2537 C  CB    . SER A 1 321 ? 42.782 32.407 31.902  1.00  34.47 ? 315  SER A CB    1 
ATOM   2538 O  OG    . SER A 1 321 ? 43.850 33.300 32.130  1.00  33.87 ? 315  SER A OG    1 
ATOM   2539 N  N     . VAL A 1 322 ? 45.302 30.921 33.226  1.00  33.16 ? 316  VAL A N     1 
ATOM   2540 C  CA    . VAL A 1 322 ? 46.632 30.369 33.045  1.00  33.31 ? 316  VAL A CA    1 
ATOM   2541 C  C     . VAL A 1 322 ? 46.580 28.870 33.341  1.00  33.37 ? 316  VAL A C     1 
ATOM   2542 O  O     . VAL A 1 322 ? 47.092 28.051 32.567  1.00  32.52 ? 316  VAL A O     1 
ATOM   2543 C  CB    . VAL A 1 322 ? 47.656 31.044 33.976  1.00  34.67 ? 316  VAL A CB    1 
ATOM   2544 C  CG1   . VAL A 1 322 ? 49.045 30.483 33.709  1.00  33.90 ? 316  VAL A CG1   1 
ATOM   2545 C  CG2   . VAL A 1 322 ? 47.636 32.557 33.765  1.00  34.44 ? 316  VAL A CG2   1 
ATOM   2546 N  N     . LYS A 1 323 ? 45.947 28.504 34.450  1.00  33.40 ? 317  LYS A N     1 
ATOM   2547 C  CA    . LYS A 1 323 ? 45.833 27.088 34.799  1.00  35.09 ? 317  LYS A CA    1 
ATOM   2548 C  C     . LYS A 1 323 ? 45.156 26.317 33.660  1.00  33.86 ? 317  LYS A C     1 
ATOM   2549 O  O     . LYS A 1 323 ? 45.663 25.280 33.217  1.00  34.53 ? 317  LYS A O     1 
ATOM   2550 C  CB    . LYS A 1 323 ? 45.016 26.894 36.083  1.00  37.20 ? 317  LYS A CB    1 
ATOM   2551 C  CG    . LYS A 1 323 ? 45.678 27.407 37.345  1.00  39.39 ? 317  LYS A CG    1 
ATOM   2552 C  CD    . LYS A 1 323 ? 44.787 27.126 38.535  1.00  43.76 ? 317  LYS A CD    1 
ATOM   2553 C  CE    . LYS A 1 323 ? 45.350 27.739 39.809  1.00  44.88 ? 317  LYS A CE    1 
ATOM   2554 N  NZ    . LYS A 1 323 ? 45.484 29.221 39.690  1.00  47.45 ? 317  LYS A NZ    1 
ATOM   2555 N  N     . LEU A 1 324 ? 44.013 26.821 33.195  1.00  32.55 ? 318  LEU A N     1 
ATOM   2556 C  CA    . LEU A 1 324 ? 43.290 26.170 32.112  1.00  31.83 ? 318  LEU A CA    1 
ATOM   2557 C  C     . LEU A 1 324 ? 44.165 26.078 30.866  1.00  30.90 ? 318  LEU A C     1 
ATOM   2558 O  O     . LEU A 1 324 ? 44.147 25.065 30.161  1.00  29.23 ? 318  LEU A O     1 
ATOM   2559 C  CB    . LEU A 1 324 ? 42.001 26.932 31.805  1.00  29.80 ? 318  LEU A CB    1 
ATOM   2560 C  CG    . LEU A 1 324 ? 41.012 26.953 32.970  1.00  30.34 ? 318  LEU A CG    1 
ATOM   2561 C  CD1   . LEU A 1 324 ? 39.890 27.910 32.685  1.00  29.75 ? 318  LEU A CD1   1 
ATOM   2562 C  CD2   . LEU A 1 324 ? 40.472 25.567 33.207  1.00  30.26 ? 318  LEU A CD2   1 
ATOM   2563 N  N     . LEU A 1 325 ? 44.930 27.133 30.598  1.00  30.29 ? 319  LEU A N     1 
ATOM   2564 C  CA    . LEU A 1 325 ? 45.819 27.145 29.445  1.00  30.79 ? 319  LEU A CA    1 
ATOM   2565 C  C     . LEU A 1 325 ? 46.902 26.094 29.612  1.00  31.24 ? 319  LEU A C     1 
ATOM   2566 O  O     . LEU A 1 325 ? 47.346 25.502 28.639  1.00  31.78 ? 319  LEU A O     1 
ATOM   2567 C  CB    . LEU A 1 325 ? 46.486 28.509 29.265  1.00  30.97 ? 319  LEU A CB    1 
ATOM   2568 C  CG    . LEU A 1 325 ? 47.571 28.476 28.175  1.00  32.43 ? 319  LEU A CG    1 
ATOM   2569 C  CD1   . LEU A 1 325 ? 46.932 28.137 26.826  1.00  30.79 ? 319  LEU A CD1   1 
ATOM   2570 C  CD2   . LEU A 1 325 ? 48.300 29.809 28.097  1.00  30.37 ? 319  LEU A CD2   1 
ATOM   2571 N  N     . GLN A 1 326 ? 47.331 25.871 30.848  1.00  32.62 ? 320  GLN A N     1 
ATOM   2572 C  CA    . GLN A 1 326 ? 48.365 24.885 31.135  1.00  33.81 ? 320  GLN A CA    1 
ATOM   2573 C  C     . GLN A 1 326 ? 47.793 23.488 30.996  1.00  35.21 ? 320  GLN A C     1 
ATOM   2574 O  O     . GLN A 1 326 ? 48.485 22.548 30.601  1.00  35.45 ? 320  GLN A O     1 
ATOM   2575 C  CB    . GLN A 1 326 ? 48.891 25.074 32.550  1.00  35.41 ? 320  GLN A CB    1 
ATOM   2576 C  CG    . GLN A 1 326 ? 49.541 26.431 32.785  1.00  39.27 ? 320  GLN A CG    1 
ATOM   2577 C  CD    . GLN A 1 326 ? 50.015 26.615 34.205  1.00  39.40 ? 320  GLN A CD    1 
ATOM   2578 O  OE1   . GLN A 1 326 ? 49.235 26.515 35.156  1.00  40.30 ? 320  GLN A OE1   1 
ATOM   2579 N  NE2   . GLN A 1 326 ? 51.302 26.891 34.360  1.00  40.06 ? 320  GLN A NE2   1 
ATOM   2580 N  N     . LYS A 1 327 ? 46.518 23.361 31.334  1.00  35.14 ? 321  LYS A N     1 
ATOM   2581 C  CA    . LYS A 1 327 ? 45.827 22.095 31.247  1.00  36.80 ? 321  LYS A CA    1 
ATOM   2582 C  C     . LYS A 1 327 ? 45.801 21.708 29.770  1.00  37.53 ? 321  LYS A C     1 
ATOM   2583 O  O     . LYS A 1 327 ? 46.140 20.586 29.401  1.00  37.63 ? 321  LYS A O     1 
ATOM   2584 C  CB    . LYS A 1 327 ? 44.417 22.276 31.796  1.00  39.73 ? 321  LYS A CB    1 
ATOM   2585 C  CG    . LYS A 1 327 ? 43.743 21.018 32.289  1.00  41.60 ? 321  LYS A CG    1 
ATOM   2586 C  CD    . LYS A 1 327 ? 42.529 21.391 33.116  1.00  43.80 ? 321  LYS A CD    1 
ATOM   2587 C  CE    . LYS A 1 327 ? 41.890 20.165 33.716  1.00  46.12 ? 321  LYS A CE    1 
ATOM   2588 N  NZ    . LYS A 1 327 ? 41.622 19.170 32.650  1.00  50.23 ? 321  LYS A NZ    1 
ATOM   2589 N  N     . ILE A 1 328 ? 45.424 22.663 28.925  1.00  37.19 ? 322  ILE A N     1 
ATOM   2590 C  CA    . ILE A 1 328 ? 45.351 22.436 27.487  1.00  37.64 ? 322  ILE A CA    1 
ATOM   2591 C  C     . ILE A 1 328 ? 46.698 21.996 26.897  1.00  38.64 ? 322  ILE A C     1 
ATOM   2592 O  O     . ILE A 1 328 ? 46.790 20.943 26.261  1.00  38.59 ? 322  ILE A O     1 
ATOM   2593 C  CB    . ILE A 1 328 ? 44.864 23.707 26.746  1.00  36.57 ? 322  ILE A CB    1 
ATOM   2594 C  CG1   . ILE A 1 328 ? 43.431 24.045 27.174  1.00  36.20 ? 322  ILE A CG1   1 
ATOM   2595 C  CG2   . ILE A 1 328 ? 44.928 23.486 25.233  1.00  33.88 ? 322  ILE A CG2   1 
ATOM   2596 C  CD1   . ILE A 1 328 ? 42.842 25.268 26.468  1.00  36.62 ? 322  ILE A CD1   1 
ATOM   2597 N  N     . LEU A 1 329 ? 47.742 22.798 27.078  1.00  39.28 ? 323  LEU A N     1 
ATOM   2598 C  CA    . LEU A 1 329 ? 49.049 22.410 26.552  1.00  41.02 ? 323  LEU A CA    1 
ATOM   2599 C  C     . LEU A 1 329 ? 49.398 21.017 27.102  1.00  41.93 ? 323  LEU A C     1 
ATOM   2600 O  O     . LEU A 1 329 ? 49.789 20.122 26.368  1.00  41.88 ? 323  LEU A O     1 
ATOM   2601 C  CB    . LEU A 1 329 ? 50.117 23.441 26.946  1.00  37.30 ? 323  LEU A CB    1 
ATOM   2602 C  CG    . LEU A 1 329 ? 50.010 24.807 26.254  1.00  35.70 ? 323  LEU A CG    1 
ATOM   2603 C  CD1   . LEU A 1 329 ? 51.046 25.751 26.819  1.00  34.08 ? 323  LEU A CD1   1 
ATOM   2604 C  CD2   . LEU A 1 329 ? 50.221 24.657 24.765  1.00  32.56 ? 323  LEU A CD2   1 
ATOM   2605 N  N     . GLU A 1 330 ? 49.216 20.837 28.399  0.76  44.34 ? 324  GLU A N     1 
ATOM   2606 C  CA    . GLU A 1 330 ? 49.492 19.561 29.034  1.00  46.50 ? 324  GLU A CA    1 
ATOM   2607 C  C     . GLU A 1 330 ? 48.726 18.426 28.356  1.00  47.88 ? 324  GLU A C     1 
ATOM   2608 O  O     . GLU A 1 330 ? 49.305 17.405 28.017  1.00  48.39 ? 324  GLU A O     1 
ATOM   2609 C  CB    . GLU A 1 330 ? 49.106 19.638 30.519  0.99  47.67 ? 324  GLU A CB    1 
ATOM   2610 C  CG    . GLU A 1 330 ? 49.020 18.311 31.246  0.61  47.97 ? 324  GLU A CG    1 
ATOM   2611 C  CD    . GLU A 1 330 ? 48.424 18.467 32.639  0.53  49.15 ? 324  GLU A CD    1 
ATOM   2612 O  OE1   . GLU A 1 330 ? 49.036 19.171 33.473  0.010 48.94 ? 324  GLU A OE1   1 
ATOM   2613 O  OE2   . GLU A 1 330 ? 47.338 17.899 32.898  0.65  49.73 ? 324  GLU A OE2   1 
ATOM   2614 N  N     . GLU A 1 331 ? 47.426 18.612 28.145  1.00  49.25 ? 325  GLU A N     1 
ATOM   2615 C  CA    . GLU A 1 331 ? 46.595 17.566 27.558  1.00  49.13 ? 325  GLU A CA    1 
ATOM   2616 C  C     . GLU A 1 331 ? 46.538 17.467 26.044  1.00  49.70 ? 325  GLU A C     1 
ATOM   2617 O  O     . GLU A 1 331 ? 45.994 16.508 25.514  1.00  51.20 ? 325  GLU A O     1 
ATOM   2618 C  CB    . GLU A 1 331 ? 45.168 17.661 28.118  1.00  48.96 ? 325  GLU A CB    1 
ATOM   2619 C  CG    . GLU A 1 331 ? 45.018 17.094 29.521  1.00  48.46 ? 325  GLU A CG    1 
ATOM   2620 C  CD    . GLU A 1 331 ? 43.650 17.354 30.121  1.00  50.16 ? 325  GLU A CD    1 
ATOM   2621 O  OE1   . GLU A 1 331 ? 42.637 17.125 29.423  1.00  50.47 ? 325  GLU A OE1   1 
ATOM   2622 O  OE2   . GLU A 1 331 ? 43.588 17.782 31.297  1.00  50.05 ? 325  GLU A OE2   1 
ATOM   2623 N  N     . ASP A 1 332 ? 47.084 18.442 25.334  1.00  50.82 ? 326  ASP A N     1 
ATOM   2624 C  CA    . ASP A 1 332 ? 47.068 18.381 23.873  1.00  51.55 ? 326  ASP A CA    1 
ATOM   2625 C  C     . ASP A 1 332 ? 48.467 18.669 23.338  1.00  51.45 ? 326  ASP A C     1 
ATOM   2626 O  O     . ASP A 1 332 ? 49.044 19.724 23.611  1.00  52.28 ? 326  ASP A O     1 
ATOM   2627 C  CB    . ASP A 1 332 ? 46.072 19.394 23.295  1.00  53.56 ? 326  ASP A CB    1 
ATOM   2628 C  CG    . ASP A 1 332 ? 45.822 19.183 21.809  1.00  54.89 ? 326  ASP A CG    1 
ATOM   2629 O  OD1   . ASP A 1 332 ? 44.914 18.390 21.466  1.00  55.56 ? 326  ASP A OD1   1 
ATOM   2630 O  OD2   . ASP A 1 332 ? 46.545 19.796 20.987  1.00  55.36 ? 326  ASP A OD2   1 
ATOM   2631 N  N     . GLU A 1 333 ? 49.003 17.737 22.562  1.00  50.66 ? 327  GLU A N     1 
ATOM   2632 C  CA    . GLU A 1 333 ? 50.346 17.873 22.021  1.00  49.86 ? 327  GLU A CA    1 
ATOM   2633 C  C     . GLU A 1 333 ? 50.593 18.971 20.971  1.00  49.72 ? 327  GLU A C     1 
ATOM   2634 O  O     . GLU A 1 333 ? 51.694 19.532 20.904  1.00  50.07 ? 327  GLU A O     1 
ATOM   2635 C  CB    . GLU A 1 333 ? 50.784 16.528 21.451  0.80  50.01 ? 327  GLU A CB    1 
ATOM   2636 C  CG    . GLU A 1 333 ? 50.630 15.384 22.430  0.73  50.41 ? 327  GLU A CG    1 
ATOM   2637 C  CD    . GLU A 1 333 ? 51.151 14.073 21.880  0.91  51.15 ? 327  GLU A CD    1 
ATOM   2638 O  OE1   . GLU A 1 333 ? 52.365 13.989 21.597  0.35  50.10 ? 327  GLU A OE1   1 
ATOM   2639 O  OE2   . GLU A 1 333 ? 50.345 13.129 21.731  0.19  50.70 ? 327  GLU A OE2   1 
ATOM   2640 N  N     . ARG A 1 334 ? 49.585 19.278 20.159  1.00  48.27 ? 328  ARG A N     1 
ATOM   2641 C  CA    . ARG A 1 334 ? 49.723 20.271 19.091  1.00  47.42 ? 328  ARG A CA    1 
ATOM   2642 C  C     . ARG A 1 334 ? 50.054 21.700 19.519  1.00  47.36 ? 328  ARG A C     1 
ATOM   2643 O  O     . ARG A 1 334 ? 49.914 22.062 20.695  1.00  47.08 ? 328  ARG A O     1 
ATOM   2644 C  CB    . ARG A 1 334 ? 48.445 20.286 18.249  1.00  47.79 ? 328  ARG A CB    1 
ATOM   2645 C  CG    . ARG A 1 334 ? 48.173 18.986 17.512  1.00  47.64 ? 328  ARG A CG    1 
ATOM   2646 C  CD    . ARG A 1 334 ? 46.738 18.913 17.027  1.00  45.38 ? 328  ARG A CD    1 
ATOM   2647 N  NE    . ARG A 1 334 ? 45.804 18.920 18.147  1.00  45.46 ? 328  ARG A NE    1 
ATOM   2648 C  CZ    . ARG A 1 334 ? 44.485 18.775 18.033  1.00  47.15 ? 328  ARG A CZ    1 
ATOM   2649 N  NH1   . ARG A 1 334 ? 43.920 18.614 16.836  1.00  46.60 ? 328  ARG A NH1   1 
ATOM   2650 N  NH2   . ARG A 1 334 ? 43.727 18.771 19.124  1.00  47.10 ? 328  ARG A NH2   1 
ATOM   2651 N  N     . LYS A 1 335 ? 50.508 22.506 18.554  1.00  47.27 ? 329  LYS A N     1 
ATOM   2652 C  CA    . LYS A 1 335 ? 50.821 23.910 18.817  1.00  47.01 ? 329  LYS A CA    1 
ATOM   2653 C  C     . LYS A 1 335 ? 49.503 24.667 18.843  1.00  46.74 ? 329  LYS A C     1 
ATOM   2654 O  O     . LYS A 1 335 ? 48.494 24.191 18.320  1.00  47.24 ? 329  LYS A O     1 
ATOM   2655 C  CB    . LYS A 1 335 ? 51.701 24.526 17.719  1.00  48.11 ? 329  LYS A CB    1 
ATOM   2656 C  CG    . LYS A 1 335 ? 53.145 24.032 17.644  1.00  48.96 ? 329  LYS A CG    1 
ATOM   2657 C  CD    . LYS A 1 335 ? 54.024 25.065 16.927  1.00  51.38 ? 329  LYS A CD    1 
ATOM   2658 C  CE    . LYS A 1 335 ? 55.221 24.436 16.216  1.00  53.02 ? 329  LYS A CE    1 
ATOM   2659 N  NZ    . LYS A 1 335 ? 56.022 23.520 17.089  1.00  54.41 ? 329  LYS A NZ    1 
ATOM   2660 N  N     . ILE A 1 336 ? 49.515 25.847 19.451  1.00  45.03 ? 330  ILE A N     1 
ATOM   2661 C  CA    . ILE A 1 336 ? 48.321 26.672 19.536  1.00  42.41 ? 330  ILE A CA    1 
ATOM   2662 C  C     . ILE A 1 336 ? 48.392 27.770 18.483  1.00  42.39 ? 330  ILE A C     1 
ATOM   2663 O  O     . ILE A 1 336 ? 49.427 28.413 18.333  1.00  43.05 ? 330  ILE A O     1 
ATOM   2664 C  CB    . ILE A 1 336 ? 48.214 27.340 20.910  1.00  41.44 ? 330  ILE A CB    1 
ATOM   2665 C  CG1   . ILE A 1 336 ? 48.233 26.287 22.010  1.00  39.65 ? 330  ILE A CG1   1 
ATOM   2666 C  CG2   . ILE A 1 336 ? 46.948 28.168 20.980  1.00  42.44 ? 330  ILE A CG2   1 
ATOM   2667 C  CD1   . ILE A 1 336 ? 47.160 25.273 21.899  1.00  40.49 ? 330  ILE A CD1   1 
ATOM   2668 N  N     . ARG A 1 337 ? 47.304 27.985 17.751  1.00  41.39 ? 331  ARG A N     1 
ATOM   2669 C  CA    . ARG A 1 337 ? 47.292 29.030 16.737  1.00  39.26 ? 331  ARG A CA    1 
ATOM   2670 C  C     . ARG A 1 337 ? 46.497 30.250 17.192  1.00  37.76 ? 331  ARG A C     1 
ATOM   2671 O  O     . ARG A 1 337 ? 46.955 31.382 17.068  1.00  36.68 ? 331  ARG A O     1 
ATOM   2672 C  CB    . ARG A 1 337 ? 46.714 28.518 15.414  1.00  41.29 ? 331  ARG A CB    1 
ATOM   2673 C  CG    . ARG A 1 337 ? 46.674 29.610 14.367  1.00  44.62 ? 331  ARG A CG    1 
ATOM   2674 C  CD    . ARG A 1 337 ? 46.314 29.144 12.981  1.00  48.18 ? 331  ARG A CD    1 
ATOM   2675 N  NE    . ARG A 1 337 ? 46.561 30.229 12.030  1.00  52.34 ? 331  ARG A NE    1 
ATOM   2676 C  CZ    . ARG A 1 337 ? 46.364 30.156 10.717  1.00  53.45 ? 331  ARG A CZ    1 
ATOM   2677 N  NH1   . ARG A 1 337 ? 45.906 29.040 10.163  1.00  56.77 ? 331  ARG A NH1   1 
ATOM   2678 N  NH2   . ARG A 1 337 ? 46.634 31.207 9.956   1.00  54.66 ? 331  ARG A NH2   1 
ATOM   2679 N  N     . ARG A 1 338 ? 45.297 30.021 17.714  1.00  36.59 ? 332  ARG A N     1 
ATOM   2680 C  CA    . ARG A 1 338 ? 44.457 31.125 18.176  1.00  35.12 ? 332  ARG A CA    1 
ATOM   2681 C  C     . ARG A 1 338 ? 44.105 30.867 19.637  1.00  33.06 ? 332  ARG A C     1 
ATOM   2682 O  O     . ARG A 1 338 ? 43.708 29.762 19.995  1.00  35.50 ? 332  ARG A O     1 
ATOM   2683 C  CB    . ARG A 1 338 ? 43.182 31.228 17.318  1.00  36.85 ? 332  ARG A CB    1 
ATOM   2684 C  CG    . ARG A 1 338 ? 43.459 31.283 15.818  1.00  39.67 ? 332  ARG A CG    1 
ATOM   2685 C  CD    . ARG A 1 338 ? 42.306 31.882 14.996  1.00  42.36 ? 332  ARG A CD    1 
ATOM   2686 N  NE    . ARG A 1 338 ? 41.079 31.078 14.973  1.00  44.79 ? 332  ARG A NE    1 
ATOM   2687 C  CZ    . ARG A 1 338 ? 40.529 30.555 13.872  1.00  45.39 ? 332  ARG A CZ    1 
ATOM   2688 N  NH1   . ARG A 1 338 ? 41.090 30.731 12.684  1.00  44.00 ? 332  ARG A NH1   1 
ATOM   2689 N  NH2   . ARG A 1 338 ? 39.389 29.878 13.949  1.00  46.61 ? 332  ARG A NH2   1 
ATOM   2690 N  N     . ILE A 1 339 ? 44.264 31.868 20.495  1.00  29.44 ? 333  ILE A N     1 
ATOM   2691 C  CA    . ILE A 1 339 ? 43.948 31.663 21.903  1.00  26.52 ? 333  ILE A CA    1 
ATOM   2692 C  C     . ILE A 1 339 ? 42.963 32.705 22.416  1.00  26.65 ? 333  ILE A C     1 
ATOM   2693 O  O     . ILE A 1 339 ? 42.992 33.850 21.966  1.00  24.57 ? 333  ILE A O     1 
ATOM   2694 C  CB    . ILE A 1 339 ? 45.232 31.686 22.774  1.00  24.43 ? 333  ILE A CB    1 
ATOM   2695 C  CG1   . ILE A 1 339 ? 44.895 31.186 24.172  1.00  23.52 ? 333  ILE A CG1   1 
ATOM   2696 C  CG2   . ILE A 1 339 ? 45.823 33.080 22.849  1.00  21.76 ? 333  ILE A CG2   1 
ATOM   2697 C  CD1   . ILE A 1 339 ? 44.475 29.731 24.197  1.00  26.25 ? 333  ILE A CD1   1 
ATOM   2698 N  N     . GLY A 1 340 ? 42.105 32.303 23.357  1.00  25.64 ? 334  GLY A N     1 
ATOM   2699 C  CA    . GLY A 1 340 ? 41.117 33.220 23.908  1.00  26.83 ? 334  GLY A CA    1 
ATOM   2700 C  C     . GLY A 1 340 ? 40.346 32.724 25.126  1.00  27.54 ? 334  GLY A C     1 
ATOM   2701 O  O     . GLY A 1 340 ? 40.599 31.627 25.652  1.00  26.99 ? 334  GLY A O     1 
ATOM   2702 N  N     . VAL A 1 341 ? 39.390 33.542 25.570  1.00  26.94 ? 335  VAL A N     1 
ATOM   2703 C  CA    . VAL A 1 341 ? 38.561 33.216 26.733  1.00  27.59 ? 335  VAL A CA    1 
ATOM   2704 C  C     . VAL A 1 341 ? 37.056 33.441 26.506  1.00  27.96 ? 335  VAL A C     1 
ATOM   2705 O  O     . VAL A 1 341 ? 36.638 34.279 25.704  1.00  25.12 ? 335  VAL A O     1 
ATOM   2706 C  CB    . VAL A 1 341 ? 38.972 34.053 27.975  1.00  27.64 ? 335  VAL A CB    1 
ATOM   2707 C  CG1   . VAL A 1 341 ? 40.300 33.595 28.490  1.00  31.51 ? 335  VAL A CG1   1 
ATOM   2708 C  CG2   . VAL A 1 341 ? 39.031 35.518 27.614  1.00  26.31 ? 335  VAL A CG2   1 
ATOM   2709 N  N     . ARG A 1 342 ? 36.246 32.699 27.252  1.00  29.98 ? 336  ARG A N     1 
ATOM   2710 C  CA    . ARG A 1 342 ? 34.805 32.816 27.156  1.00  32.06 ? 336  ARG A CA    1 
ATOM   2711 C  C     . ARG A 1 342 ? 34.227 32.792 28.559  1.00  32.09 ? 336  ARG A C     1 
ATOM   2712 O  O     . ARG A 1 342 ? 34.403 31.811 29.288  1.00  32.83 ? 336  ARG A O     1 
ATOM   2713 C  CB    . ARG A 1 342 ? 34.228 31.650 26.366  1.00  35.57 ? 336  ARG A CB    1 
ATOM   2714 C  CG    . ARG A 1 342 ? 33.030 32.025 25.498  1.00  40.44 ? 336  ARG A CG    1 
ATOM   2715 C  CD    . ARG A 1 342 ? 33.477 32.222 24.024  1.00  45.91 ? 336  ARG A CD    1 
ATOM   2716 N  NE    . ARG A 1 342 ? 32.952 33.453 23.437  1.00  47.27 ? 336  ARG A NE    1 
ATOM   2717 C  CZ    . ARG A 1 342 ? 31.690 33.850 23.557  1.00  48.88 ? 336  ARG A CZ    1 
ATOM   2718 N  NH1   . ARG A 1 342 ? 31.306 34.984 22.989  1.00  49.98 ? 336  ARG A NH1   1 
ATOM   2719 N  NH2   . ARG A 1 342 ? 30.818 33.112 24.246  1.00  50.83 ? 336  ARG A NH2   1 
ATOM   2720 N  N     . PHE A 1 343 ? 33.519 33.862 28.916  1.00  32.30 ? 337  PHE A N     1 
ATOM   2721 C  CA    . PHE A 1 343 ? 32.898 34.007 30.234  1.00  31.05 ? 337  PHE A CA    1 
ATOM   2722 C  C     . PHE A 1 343 ? 31.403 33.770 30.124  1.00  31.60 ? 337  PHE A C     1 
ATOM   2723 O  O     . PHE A 1 343 ? 30.770 34.236 29.176  1.00  32.12 ? 337  PHE A O     1 
ATOM   2724 C  CB    . PHE A 1 343 ? 33.141 35.414 30.782  1.00  29.93 ? 337  PHE A CB    1 
ATOM   2725 C  CG    . PHE A 1 343 ? 34.570 35.688 31.146  1.00  29.14 ? 337  PHE A CG    1 
ATOM   2726 C  CD1   . PHE A 1 343 ? 35.077 35.265 32.362  1.00  27.90 ? 337  PHE A CD1   1 
ATOM   2727 C  CD2   . PHE A 1 343 ? 35.403 36.394 30.281  1.00  30.67 ? 337  PHE A CD2   1 
ATOM   2728 C  CE1   . PHE A 1 343 ? 36.392 35.542 32.724  1.00  27.99 ? 337  PHE A CE1   1 
ATOM   2729 C  CE2   . PHE A 1 343 ? 36.727 36.679 30.632  1.00  32.17 ? 337  PHE A CE2   1 
ATOM   2730 C  CZ    . PHE A 1 343 ? 37.220 36.252 31.859  1.00  29.72 ? 337  PHE A CZ    1 
ATOM   2731 N  N     . SER A 1 344 ? 30.841 33.064 31.103  1.00  32.78 ? 338  SER A N     1 
ATOM   2732 C  CA    . SER A 1 344 ? 29.413 32.756 31.098  1.00  32.44 ? 338  SER A CA    1 
ATOM   2733 C  C     . SER A 1 344 ? 28.783 32.557 32.487  1.00  32.99 ? 338  SER A C     1 
ATOM   2734 O  O     . SER A 1 344 ? 29.462 32.691 33.515  1.00  30.17 ? 338  SER A O     1 
ATOM   2735 C  CB    . SER A 1 344 ? 29.174 31.515 30.227  1.00  32.17 ? 338  SER A CB    1 
ATOM   2736 O  OG    . SER A 1 344 ? 29.982 30.418 30.639  1.00  29.33 ? 338  SER A OG    1 
ATOM   2737 N  N     . LYS A 1 345 ? 27.484 32.237 32.490  1.00  34.19 ? 339  LYS A N     1 
ATOM   2738 C  CA    . LYS A 1 345 ? 26.699 32.022 33.712  1.00  35.37 ? 339  LYS A CA    1 
ATOM   2739 C  C     . LYS A 1 345 ? 26.736 33.278 34.578  1.00  36.78 ? 339  LYS A C     1 
ATOM   2740 O  O     . LYS A 1 345 ? 27.217 33.267 35.720  1.00  37.38 ? 339  LYS A O     1 
ATOM   2741 C  CB    . LYS A 1 345 ? 27.228 30.818 34.492  1.00  34.83 ? 339  LYS A CB    1 
ATOM   2742 C  CG    . LYS A 1 345 ? 27.134 29.518 33.714  1.00  36.12 ? 339  LYS A CG    1 
ATOM   2743 C  CD    . LYS A 1 345 ? 27.635 28.327 34.539  1.00  38.31 ? 339  LYS A CD    1 
ATOM   2744 C  CE    . LYS A 1 345 ? 27.555 27.013 33.750  1.00  38.11 ? 339  LYS A CE    1 
ATOM   2745 N  NZ    . LYS A 1 345 ? 27.953 25.832 34.562  1.00  38.86 ? 339  LYS A NZ    1 
ATOM   2746 N  N     . PHE A 1 346 ? 26.225 34.364 34.011  1.00  37.55 ? 340  PHE A N     1 
ATOM   2747 C  CA    . PHE A 1 346 ? 26.208 35.642 34.693  1.00  38.70 ? 340  PHE A CA    1 
ATOM   2748 C  C     . PHE A 1 346 ? 25.254 35.589 35.854  1.00  39.97 ? 340  PHE A C     1 
ATOM   2749 O  O     . PHE A 1 346 ? 24.388 34.717 35.905  1.00  39.73 ? 340  PHE A O     1 
ATOM   2750 C  CB    . PHE A 1 346 ? 25.779 36.744 33.732  1.00  38.68 ? 340  PHE A CB    1 
ATOM   2751 C  CG    . PHE A 1 346 ? 26.527 36.739 32.436  1.00  40.13 ? 340  PHE A CG    1 
ATOM   2752 C  CD1   . PHE A 1 346 ? 27.918 36.691 32.418  1.00  40.90 ? 340  PHE A CD1   1 
ATOM   2753 C  CD2   . PHE A 1 346 ? 25.844 36.827 31.229  1.00  40.89 ? 340  PHE A CD2   1 
ATOM   2754 C  CE1   . PHE A 1 346 ? 28.619 36.738 31.218  1.00  41.27 ? 340  PHE A CE1   1 
ATOM   2755 C  CE2   . PHE A 1 346 ? 26.531 36.876 30.024  1.00  41.65 ? 340  PHE A CE2   1 
ATOM   2756 C  CZ    . PHE A 1 346 ? 27.929 36.831 30.019  1.00  42.40 ? 340  PHE A CZ    1 
ATOM   2757 N  N     . ILE A 1 347 ? 25.410 36.531 36.777  1.00  40.93 ? 341  ILE A N     1 
ATOM   2758 C  CA    . ILE A 1 347 ? 24.555 36.591 37.941  1.00  42.62 ? 341  ILE A CA    1 
ATOM   2759 C  C     . ILE A 1 347 ? 23.353 37.447 37.633  1.00  43.02 ? 341  ILE A C     1 
ATOM   2760 O  O     . ILE A 1 347 ? 23.431 38.364 36.780  1.00  42.09 ? 341  ILE A O     1 
ATOM   2761 C  CB    . ILE A 1 347 ? 25.331 37.161 39.141  1.00  42.50 ? 341  ILE A CB    1 
ATOM   2762 C  CG1   . ILE A 1 347 ? 26.521 36.247 39.430  1.00  41.20 ? 341  ILE A CG1   1 
ATOM   2763 C  CG2   . ILE A 1 347 ? 24.435 37.286 40.364  1.00  43.22 ? 341  ILE A CG2   1 
ATOM   2764 C  CD1   . ILE A 1 347 ? 27.526 36.833 40.380  1.00  40.58 ? 341  ILE A CD1   1 
ATOM   2765 N  N     . GLU A 1 348 ? 22.348 37.140 38.285  1.00  44.91 ? 342  GLU A N     1 
ATOM   2766 O  "O5'" . DG  B 2 1   ? 15.417 0.749  34.014  1.00  53.15 ? 1    DG  P "O5'" 1 
ATOM   2767 C  "C5'" . DG  B 2 1   ? 16.042 1.170  35.235  1.00  50.62 ? 1    DG  P "C5'" 1 
ATOM   2768 C  "C4'" . DG  B 2 1   ? 15.426 2.460  35.721  1.00  49.09 ? 1    DG  P "C4'" 1 
ATOM   2769 O  "O4'" . DG  B 2 1   ? 16.018 2.843  36.985  1.00  46.88 ? 1    DG  P "O4'" 1 
ATOM   2770 C  "C3'" . DG  B 2 1   ? 15.619 3.649  34.781  1.00  48.53 ? 1    DG  P "C3'" 1 
ATOM   2771 O  "O3'" . DG  B 2 1   ? 14.438 4.452  34.814  1.00  51.64 ? 1    DG  P "O3'" 1 
ATOM   2772 C  "C2'" . DG  B 2 1   ? 16.800 4.382  35.390  1.00  46.57 ? 1    DG  P "C2'" 1 
ATOM   2773 C  "C1'" . DG  B 2 1   ? 16.599 4.134  36.878  1.00  45.23 ? 1    DG  P "C1'" 1 
ATOM   2774 N  N9    . DG  B 2 1   ? 17.827 4.136  37.668  1.00  42.30 ? 1    DG  P N9    1 
ATOM   2775 C  C8    . DG  B 2 1   ? 18.988 3.447  37.403  1.00  40.62 ? 1    DG  P C8    1 
ATOM   2776 N  N7    . DG  B 2 1   ? 19.919 3.649  38.295  1.00  39.47 ? 1    DG  P N7    1 
ATOM   2777 C  C5    . DG  B 2 1   ? 19.339 4.524  39.207  1.00  40.17 ? 1    DG  P C5    1 
ATOM   2778 C  C6    . DG  B 2 1   ? 19.866 5.104  40.402  1.00  39.66 ? 1    DG  P C6    1 
ATOM   2779 O  O6    . DG  B 2 1   ? 20.981 4.948  40.909  1.00  37.84 ? 1    DG  P O6    1 
ATOM   2780 N  N1    . DG  B 2 1   ? 18.938 5.940  41.019  1.00  38.00 ? 1    DG  P N1    1 
ATOM   2781 C  C2    . DG  B 2 1   ? 17.670 6.190  40.556  1.00  38.62 ? 1    DG  P C2    1 
ATOM   2782 N  N2    . DG  B 2 1   ? 16.936 7.050  41.283  1.00  39.06 ? 1    DG  P N2    1 
ATOM   2783 N  N3    . DG  B 2 1   ? 17.160 5.646  39.457  1.00  39.43 ? 1    DG  P N3    1 
ATOM   2784 C  C4    . DG  B 2 1   ? 18.046 4.834  38.835  1.00  40.60 ? 1    DG  P C4    1 
ATOM   2785 P  P     . DG  B 2 2   ? 14.182 5.557  33.676  1.00  54.15 ? 2    DG  P P     1 
ATOM   2786 O  OP1   . DG  B 2 2   ? 12.719 5.618  33.430  1.00  53.22 ? 2    DG  P OP1   1 
ATOM   2787 O  OP2   . DG  B 2 2   ? 15.109 5.319  32.541  1.00  53.96 ? 2    DG  P OP2   1 
ATOM   2788 O  "O5'" . DG  B 2 2   ? 14.604 6.907  34.396  1.00  52.28 ? 2    DG  P "O5'" 1 
ATOM   2789 C  "C5'" . DG  B 2 2   ? 13.961 7.317  35.594  1.00  53.31 ? 2    DG  P "C5'" 1 
ATOM   2790 C  "C4'" . DG  B 2 2   ? 14.705 8.482  36.193  1.00  55.26 ? 2    DG  P "C4'" 1 
ATOM   2791 O  "O4'" . DG  B 2 2   ? 15.897 8.031  36.880  1.00  53.87 ? 2    DG  P "O4'" 1 
ATOM   2792 C  "C3'" . DG  B 2 2   ? 15.183 9.479  35.138  1.00  57.82 ? 2    DG  P "C3'" 1 
ATOM   2793 O  "O3'" . DG  B 2 2   ? 15.086 10.795 35.667  1.00  63.57 ? 2    DG  P "O3'" 1 
ATOM   2794 C  "C2'" . DG  B 2 2   ? 16.650 9.129  34.981  1.00  55.12 ? 2    DG  P "C2'" 1 
ATOM   2795 C  "C1'" . DG  B 2 2   ? 16.979 8.821  36.420  1.00  52.54 ? 2    DG  P "C1'" 1 
ATOM   2796 N  N9    . DG  B 2 2   ? 18.227 8.104  36.656  1.00  48.59 ? 2    DG  P N9    1 
ATOM   2797 C  C8    . DG  B 2 2   ? 18.839 7.186  35.837  1.00  48.06 ? 2    DG  P C8    1 
ATOM   2798 N  N7    . DG  B 2 2   ? 19.977 6.757  36.313  1.00  46.02 ? 2    DG  P N7    1 
ATOM   2799 C  C5    . DG  B 2 2   ? 20.120 7.426  37.521  1.00  44.20 ? 2    DG  P C5    1 
ATOM   2800 C  C6    . DG  B 2 2   ? 21.162 7.379  38.481  1.00  43.06 ? 2    DG  P C6    1 
ATOM   2801 O  O6    . DG  B 2 2   ? 22.201 6.720  38.454  1.00  42.44 ? 2    DG  P O6    1 
ATOM   2802 N  N1    . DG  B 2 2   ? 20.903 8.217  39.559  1.00  43.05 ? 2    DG  P N1    1 
ATOM   2803 C  C2    . DG  B 2 2   ? 19.785 9.006  39.697  1.00  43.28 ? 2    DG  P C2    1 
ATOM   2804 N  N2    . DG  B 2 2   ? 19.712 9.746  40.812  1.00  42.25 ? 2    DG  P N2    1 
ATOM   2805 N  N3    . DG  B 2 2   ? 18.810 9.064  38.806  1.00  43.63 ? 2    DG  P N3    1 
ATOM   2806 C  C4    . DG  B 2 2   ? 19.042 8.253  37.751  1.00  45.28 ? 2    DG  P C4    1 
ATOM   2807 P  P     . DG  B 2 3   ? 14.425 11.958 34.786  1.00  68.15 ? 3    DG  P P     1 
ATOM   2808 O  OP1   . DG  B 2 3   ? 12.977 11.643 34.675  1.00  67.04 ? 3    DG  P OP1   1 
ATOM   2809 O  OP2   . DG  B 2 3   ? 15.225 12.178 33.550  1.00  66.11 ? 3    DG  P OP2   1 
ATOM   2810 O  "O5'" . DG  B 2 3   ? 14.586 13.225 35.731  1.00  67.25 ? 3    DG  P "O5'" 1 
ATOM   2811 C  "C5'" . DG  B 2 3   ? 14.017 13.233 37.037  1.00  67.32 ? 3    DG  P "C5'" 1 
ATOM   2812 C  "C4'" . DG  B 2 3   ? 14.853 14.098 37.945  1.00  67.42 ? 3    DG  P "C4'" 1 
ATOM   2813 O  "O4'" . DG  B 2 3   ? 16.033 13.366 38.360  1.00  65.59 ? 3    DG  P "O4'" 1 
ATOM   2814 C  "C3'" . DG  B 2 3   ? 15.354 15.352 37.229  1.00  68.76 ? 3    DG  P "C3'" 1 
ATOM   2815 O  "O3'" . DG  B 2 3   ? 15.321 16.485 38.097  1.00  71.54 ? 3    DG  P "O3'" 1 
ATOM   2816 C  "C2'" . DG  B 2 3   ? 16.779 14.995 36.849  1.00  66.38 ? 3    DG  P "C2'" 1 
ATOM   2817 C  "C1'" . DG  B 2 3   ? 17.201 14.084 37.988  1.00  63.42 ? 3    DG  P "C1'" 1 
ATOM   2818 N  N9    . DG  B 2 3   ? 18.227 13.119 37.606  1.00  58.84 ? 3    DG  P N9    1 
ATOM   2819 C  C8    . DG  B 2 3   ? 18.206 12.287 36.514  1.00  57.09 ? 3    DG  P C8    1 
ATOM   2820 N  N7    . DG  B 2 3   ? 19.273 11.541 36.417  1.00  54.79 ? 3    DG  P N7    1 
ATOM   2821 C  C5    . DG  B 2 3   ? 20.045 11.897 37.514  1.00  53.70 ? 3    DG  P C5    1 
ATOM   2822 C  C6    . DG  B 2 3   ? 21.316 11.427 37.935  1.00  52.11 ? 3    DG  P C6    1 
ATOM   2823 O  O6    . DG  B 2 3   ? 22.040 10.582 37.404  1.00  51.22 ? 3    DG  P O6    1 
ATOM   2824 N  N1    . DG  B 2 3   ? 21.731 12.054 39.101  1.00  51.93 ? 3    DG  P N1    1 
ATOM   2825 C  C2    . DG  B 2 3   ? 21.025 13.015 39.776  1.00  52.26 ? 3    DG  P C2    1 
ATOM   2826 N  N2    . DG  B 2 3   ? 21.606 13.494 40.884  1.00  50.55 ? 3    DG  P N2    1 
ATOM   2827 N  N3    . DG  B 2 3   ? 19.842 13.470 39.392  1.00  53.05 ? 3    DG  P N3    1 
ATOM   2828 C  C4    . DG  B 2 3   ? 19.414 12.869 38.262  1.00  55.25 ? 3    DG  P C4    1 
ATOM   2829 P  P     . DG  B 2 4   ? 15.646 17.948 37.511  1.00  74.23 ? 4    DG  P P     1 
ATOM   2830 O  OP1   . DG  B 2 4   ? 14.353 18.671 37.376  1.00  72.74 ? 4    DG  P OP1   1 
ATOM   2831 O  OP2   . DG  B 2 4   ? 16.533 17.808 36.318  1.00  72.26 ? 4    DG  P OP2   1 
ATOM   2832 O  "O5'" . DG  B 2 4   ? 16.493 18.600 38.692  1.00  73.32 ? 4    DG  P "O5'" 1 
ATOM   2833 C  "C5'" . DG  B 2 4   ? 17.495 17.831 39.359  1.00  73.23 ? 4    DG  P "C5'" 1 
ATOM   2834 C  "C4'" . DG  B 2 4   ? 18.836 18.519 39.264  1.00  72.44 ? 4    DG  P "C4'" 1 
ATOM   2835 O  "O4'" . DG  B 2 4   ? 19.851 17.503 39.045  1.00  72.17 ? 4    DG  P "O4'" 1 
ATOM   2836 C  "C3'" . DG  B 2 4   ? 18.951 19.489 38.086  1.00  72.44 ? 4    DG  P "C3'" 1 
ATOM   2837 O  "O3'" . DG  B 2 4   ? 19.713 20.639 38.457  1.00  72.71 ? 4    DG  P "O3'" 1 
ATOM   2838 C  "C2'" . DG  B 2 4   ? 19.681 18.689 37.028  1.00  71.70 ? 4    DG  P "C2'" 1 
ATOM   2839 C  "C1'" . DG  B 2 4   ? 20.578 17.792 37.858  1.00  70.83 ? 4    DG  P "C1'" 1 
ATOM   2840 N  N9    . DG  B 2 4   ? 20.892 16.540 37.175  1.00  68.22 ? 4    DG  P N9    1 
ATOM   2841 C  C8    . DG  B 2 4   ? 20.131 15.925 36.211  1.00  67.49 ? 4    DG  P C8    1 
ATOM   2842 N  N7    . DG  B 2 4   ? 20.699 14.864 35.708  1.00  66.32 ? 4    DG  P N7    1 
ATOM   2843 C  C5    . DG  B 2 4   ? 21.900 14.760 36.394  1.00  64.65 ? 4    DG  P C5    1 
ATOM   2844 C  C6    . DG  B 2 4   ? 22.943 13.813 36.268  1.00  62.66 ? 4    DG  P C6    1 
ATOM   2845 O  O6    . DG  B 2 4   ? 23.024 12.858 35.486  1.00  59.79 ? 4    DG  P O6    1 
ATOM   2846 N  N1    . DG  B 2 4   ? 23.972 14.066 37.168  1.00  61.88 ? 4    DG  P N1    1 
ATOM   2847 C  C2    . DG  B 2 4   ? 23.995 15.103 38.068  1.00  63.53 ? 4    DG  P C2    1 
ATOM   2848 N  N2    . DG  B 2 4   ? 25.065 15.174 38.861  1.00  62.47 ? 4    DG  P N2    1 
ATOM   2849 N  N3    . DG  B 2 4   ? 23.036 16.004 38.183  1.00  65.10 ? 4    DG  P N3    1 
ATOM   2850 C  C4    . DG  B 2 4   ? 22.024 15.773 37.321  1.00  65.96 ? 4    DG  P C4    1 
ATOM   2851 P  P     . DG  B 2 5   ? 20.082 21.745 37.347  1.00  73.43 ? 5    DG  P P     1 
ATOM   2852 O  OP1   . DG  B 2 5   ? 19.567 23.041 37.860  1.00  73.89 ? 5    DG  P OP1   1 
ATOM   2853 O  OP2   . DG  B 2 5   ? 19.697 21.286 35.981  1.00  71.80 ? 5    DG  P OP2   1 
ATOM   2854 O  "O5'" . DG  B 2 5   ? 21.667 21.768 37.406  1.00  70.17 ? 5    DG  P "O5'" 1 
ATOM   2855 C  "C5'" . DG  B 2 5   ? 22.343 21.409 38.606  1.00  66.41 ? 5    DG  P "C5'" 1 
ATOM   2856 C  "C4'" . DG  B 2 5   ? 23.777 21.041 38.307  1.00  63.31 ? 5    DG  P "C4'" 1 
ATOM   2857 O  "O4'" . DG  B 2 5   ? 23.880 19.695 37.781  1.00  61.42 ? 5    DG  P "O4'" 1 
ATOM   2858 C  "C3'" . DG  B 2 5   ? 24.454 21.951 37.287  1.00  62.07 ? 5    DG  P "C3'" 1 
ATOM   2859 O  "O3'" . DG  B 2 5   ? 25.764 22.268 37.729  1.00  62.64 ? 5    DG  P "O3'" 1 
ATOM   2860 C  "C2'" . DG  B 2 5   ? 24.533 21.094 36.038  1.00  60.61 ? 5    DG  P "C2'" 1 
ATOM   2861 C  "C1'" . DG  B 2 5   ? 24.691 19.707 36.622  1.00  58.62 ? 5    DG  P "C1'" 1 
ATOM   2862 N  N9    . DG  B 2 5   ? 24.241 18.631 35.747  1.00  56.01 ? 5    DG  P N9    1 
ATOM   2863 C  C8    . DG  B 2 5   ? 23.028 18.523 35.107  1.00  54.46 ? 5    DG  P C8    1 
ATOM   2864 N  N7    . DG  B 2 5   ? 22.930 17.447 34.372  1.00  53.00 ? 5    DG  P N7    1 
ATOM   2865 C  C5    . DG  B 2 5   ? 24.151 16.805 34.541  1.00  52.11 ? 5    DG  P C5    1 
ATOM   2866 C  C6    . DG  B 2 5   ? 24.639 15.590 33.990  1.00  50.12 ? 5    DG  P C6    1 
ATOM   2867 O  O6    . DG  B 2 5   ? 24.066 14.798 33.231  1.00  50.15 ? 5    DG  P O6    1 
ATOM   2868 N  N1    . DG  B 2 5   ? 25.933 15.325 34.416  1.00  48.87 ? 5    DG  P N1    1 
ATOM   2869 C  C2    . DG  B 2 5   ? 26.664 16.113 35.271  1.00  49.25 ? 5    DG  P C2    1 
ATOM   2870 N  N2    . DG  B 2 5   ? 27.898 15.685 35.559  1.00  48.86 ? 5    DG  P N2    1 
ATOM   2871 N  N3    . DG  B 2 5   ? 26.221 17.235 35.801  1.00  50.70 ? 5    DG  P N3    1 
ATOM   2872 C  C4    . DG  B 2 5   ? 24.968 17.523 35.392  1.00  53.53 ? 5    DG  P C4    1 
ATOM   2873 P  P     . DA  B 2 6   ? 26.405 23.687 37.352  1.00  64.12 ? 6    DA  P P     1 
ATOM   2874 O  OP1   . DA  B 2 6   ? 26.456 24.518 38.586  1.00  61.55 ? 6    DA  P OP1   1 
ATOM   2875 O  OP2   . DA  B 2 6   ? 25.701 24.199 36.140  1.00  64.29 ? 6    DA  P OP2   1 
ATOM   2876 O  "O5'" . DA  B 2 6   ? 27.892 23.295 36.964  1.00  59.31 ? 6    DA  P "O5'" 1 
ATOM   2877 C  "C5'" . DA  B 2 6   ? 28.599 22.349 37.743  1.00  53.74 ? 6    DA  P "C5'" 1 
ATOM   2878 C  "C4'" . DA  B 2 6   ? 29.492 21.517 36.860  1.00  51.35 ? 6    DA  P "C4'" 1 
ATOM   2879 O  "O4'" . DA  B 2 6   ? 28.727 20.526 36.128  1.00  50.11 ? 6    DA  P "O4'" 1 
ATOM   2880 C  "C3'" . DA  B 2 6   ? 30.261 22.324 35.815  1.00  51.18 ? 6    DA  P "C3'" 1 
ATOM   2881 O  "O3'" . DA  B 2 6   ? 31.637 21.954 35.847  1.00  50.05 ? 6    DA  P "O3'" 1 
ATOM   2882 C  "C2'" . DA  B 2 6   ? 29.624 21.902 34.498  1.00  50.99 ? 6    DA  P "C2'" 1 
ATOM   2883 C  "C1'" . DA  B 2 6   ? 29.208 20.478 34.799  1.00  48.42 ? 6    DA  P "C1'" 1 
ATOM   2884 N  N9    . DA  B 2 6   ? 28.159 19.915 33.943  1.00  46.07 ? 6    DA  P N9    1 
ATOM   2885 C  C8    . DA  B 2 6   ? 26.924 20.440 33.650  1.00  45.78 ? 6    DA  P C8    1 
ATOM   2886 N  N7    . DA  B 2 6   ? 26.193 19.677 32.867  1.00  43.90 ? 6    DA  P N7    1 
ATOM   2887 C  C5    . DA  B 2 6   ? 27.000 18.577 32.624  1.00  42.85 ? 6    DA  P C5    1 
ATOM   2888 C  C6    . DA  B 2 6   ? 26.798 17.395 31.877  1.00  41.03 ? 6    DA  P C6    1 
ATOM   2889 N  N6    . DA  B 2 6   ? 25.666 17.097 31.241  1.00  37.03 ? 6    DA  P N6    1 
ATOM   2890 N  N1    . DA  B 2 6   ? 27.812 16.508 31.820  1.00  41.39 ? 6    DA  P N1    1 
ATOM   2891 C  C2    . DA  B 2 6   ? 28.940 16.782 32.487  1.00  42.32 ? 6    DA  P C2    1 
ATOM   2892 N  N3    . DA  B 2 6   ? 29.244 17.843 33.244  1.00  43.38 ? 6    DA  P N3    1 
ATOM   2893 C  C4    . DA  B 2 6   ? 28.221 18.715 33.270  1.00  44.31 ? 6    DA  P C4    1 
ATOM   2894 P  P     . DA  B 2 7   ? 32.737 22.935 35.222  1.00  50.74 ? 7    DA  P P     1 
ATOM   2895 O  OP1   . DA  B 2 7   ? 33.790 23.117 36.255  1.00  50.57 ? 7    DA  P OP1   1 
ATOM   2896 O  OP2   . DA  B 2 7   ? 32.091 24.127 34.613  1.00  49.57 ? 7    DA  P OP2   1 
ATOM   2897 O  "O5'" . DA  B 2 7   ? 33.349 22.053 34.056  1.00  47.41 ? 7    DA  P "O5'" 1 
ATOM   2898 C  "C5'" . DA  B 2 7   ? 33.840 20.758 34.344  1.00  46.40 ? 7    DA  P "C5'" 1 
ATOM   2899 C  "C4'" . DA  B 2 7   ? 34.001 19.961 33.074  1.00  44.27 ? 7    DA  P "C4'" 1 
ATOM   2900 O  "O4'" . DA  B 2 7   ? 32.723 19.487 32.590  1.00  42.36 ? 7    DA  P "O4'" 1 
ATOM   2901 C  "C3'" . DA  B 2 7   ? 34.644 20.722 31.919  1.00  42.48 ? 7    DA  P "C3'" 1 
ATOM   2902 O  "O3'" . DA  B 2 7   ? 35.606 19.877 31.310  1.00  43.26 ? 7    DA  P "O3'" 1 
ATOM   2903 C  "C2'" . DA  B 2 7   ? 33.486 20.955 30.965  1.00  41.59 ? 7    DA  P "C2'" 1 
ATOM   2904 C  "C1'" . DA  B 2 7   ? 32.647 19.716 31.200  1.00  40.12 ? 7    DA  P "C1'" 1 
ATOM   2905 N  N9    . DA  B 2 7   ? 31.232 19.816 30.837  1.00  38.45 ? 7    DA  P N9    1 
ATOM   2906 C  C8    . DA  B 2 7   ? 30.316 20.766 31.227  1.00  38.41 ? 7    DA  P C8    1 
ATOM   2907 N  N7    . DA  B 2 7   ? 29.111 20.567 30.748  1.00  36.72 ? 7    DA  P N7    1 
ATOM   2908 C  C5    . DA  B 2 7   ? 29.242 19.413 29.986  1.00  35.54 ? 7    DA  P C5    1 
ATOM   2909 C  C6    . DA  B 2 7   ? 28.323 18.678 29.217  1.00  34.32 ? 7    DA  P C6    1 
ATOM   2910 N  N6    . DA  B 2 7   ? 27.040 19.009 29.084  1.00  30.68 ? 7    DA  P N6    1 
ATOM   2911 N  N1    . DA  B 2 7   ? 28.776 17.574 28.580  1.00  34.77 ? 7    DA  P N1    1 
ATOM   2912 C  C2    . DA  B 2 7   ? 30.063 17.236 28.715  1.00  33.91 ? 7    DA  P C2    1 
ATOM   2913 N  N3    . DA  B 2 7   ? 31.022 17.841 29.412  1.00  36.18 ? 7    DA  P N3    1 
ATOM   2914 C  C4    . DA  B 2 7   ? 30.543 18.940 30.029  1.00  36.82 ? 7    DA  P C4    1 
ATOM   2915 P  P     . DG  B 2 8   ? 36.869 20.516 30.565  1.00  45.48 ? 8    DG  P P     1 
ATOM   2916 O  OP1   . DG  B 2 8   ? 38.079 19.898 31.173  1.00  47.04 ? 8    DG  P OP1   1 
ATOM   2917 O  OP2   . DG  B 2 8   ? 36.740 21.991 30.527  1.00  46.78 ? 8    DG  P OP2   1 
ATOM   2918 O  "O5'" . DG  B 2 8   ? 36.712 19.960 29.092  1.00  46.06 ? 8    DG  P "O5'" 1 
ATOM   2919 C  "C5'" . DG  B 2 8   ? 36.719 18.563 28.861  1.00  46.76 ? 8    DG  P "C5'" 1 
ATOM   2920 C  "C4'" . DG  B 2 8   ? 36.246 18.271 27.460  1.00  45.73 ? 8    DG  P "C4'" 1 
ATOM   2921 O  "O4'" . DG  B 2 8   ? 34.805 18.364 27.397  1.00  45.73 ? 8    DG  P "O4'" 1 
ATOM   2922 C  "C3'" . DG  B 2 8   ? 36.788 19.238 26.409  1.00  45.13 ? 8    DG  P "C3'" 1 
ATOM   2923 O  "O3'" . DG  B 2 8   ? 37.265 18.498 25.291  1.00  44.10 ? 8    DG  P "O3'" 1 
ATOM   2924 C  "C2'" . DG  B 2 8   ? 35.583 20.089 26.044  1.00  45.86 ? 8    DG  P "C2'" 1 
ATOM   2925 C  "C1'" . DG  B 2 8   ? 34.431 19.133 26.272  1.00  45.81 ? 8    DG  P "C1'" 1 
ATOM   2926 N  N9    . DG  B 2 8   ? 33.158 19.779 26.572  1.00  45.51 ? 8    DG  P N9    1 
ATOM   2927 C  C8    . DG  B 2 8   ? 32.960 20.908 27.330  1.00  47.56 ? 8    DG  P C8    1 
ATOM   2928 N  N7    . DG  B 2 8   ? 31.707 21.273 27.393  1.00  47.32 ? 8    DG  P N7    1 
ATOM   2929 C  C5    . DG  B 2 8   ? 31.038 20.325 26.633  1.00  45.96 ? 8    DG  P C5    1 
ATOM   2930 C  C6    . DG  B 2 8   ? 29.659 20.207 26.319  1.00  44.99 ? 8    DG  P C6    1 
ATOM   2931 O  O6    . DG  B 2 8   ? 28.730 20.954 26.645  1.00  44.15 ? 8    DG  P O6    1 
ATOM   2932 N  N1    . DG  B 2 8   ? 29.408 19.086 25.535  1.00  43.73 ? 8    DG  P N1    1 
ATOM   2933 C  C2    . DG  B 2 8   ? 30.362 18.199 25.101  1.00  45.97 ? 8    DG  P C2    1 
ATOM   2934 N  N2    . DG  B 2 8   ? 29.916 17.171 24.371  1.00  46.78 ? 8    DG  P N2    1 
ATOM   2935 N  N3    . DG  B 2 8   ? 31.655 18.309 25.367  1.00  45.49 ? 8    DG  P N3    1 
ATOM   2936 C  C4    . DG  B 2 8   ? 31.919 19.387 26.133  1.00  45.39 ? 8    DG  P C4    1 
ATOM   2937 P  P     . DG  B 2 9   ? 37.792 19.268 23.990  1.00  46.22 ? 9    DG  P P     1 
ATOM   2938 O  OP1   . DG  B 2 9   ? 39.079 18.615 23.629  1.00  46.86 ? 9    DG  P OP1   1 
ATOM   2939 O  OP2   . DG  B 2 9   ? 37.736 20.751 24.154  1.00  44.51 ? 9    DG  P OP2   1 
ATOM   2940 O  "O5'" . DG  B 2 9   ? 36.700 18.857 22.920  1.00  45.58 ? 9    DG  P "O5'" 1 
ATOM   2941 C  "C5'" . DG  B 2 9   ? 36.031 17.620 23.056  1.00  46.04 ? 9    DG  P "C5'" 1 
ATOM   2942 C  "C4'" . DG  B 2 9   ? 34.773 17.617 22.226  1.00  47.25 ? 9    DG  P "C4'" 1 
ATOM   2943 O  "O4'" . DG  B 2 9   ? 33.677 18.309 22.877  1.00  47.32 ? 9    DG  P "O4'" 1 
ATOM   2944 C  "C3'" . DG  B 2 9   ? 34.926 18.262 20.851  1.00  47.78 ? 9    DG  P "C3'" 1 
ATOM   2945 O  "O3'" . DG  B 2 9   ? 34.313 17.400 19.905  1.00  49.71 ? 9    DG  P "O3'" 1 
ATOM   2946 C  "C2'" . DG  B 2 9   ? 34.121 19.546 20.971  1.00  45.98 ? 9    DG  P "C2'" 1 
ATOM   2947 C  "C1'" . DG  B 2 9   ? 33.018 19.087 21.897  1.00  45.36 ? 9    DG  P "C1'" 1 
ATOM   2948 N  N9    . DG  B 2 9   ? 32.251 20.134 22.563  1.00  43.20 ? 9    DG  P N9    1 
ATOM   2949 C  C8    . DG  B 2 9   ? 32.720 21.129 23.388  1.00  44.08 ? 9    DG  P C8    1 
ATOM   2950 N  N7    . DG  B 2 9   ? 31.777 21.925 23.821  1.00  42.14 ? 9    DG  P N7    1 
ATOM   2951 C  C5    . DG  B 2 9   ? 30.618 21.422 23.252  1.00  41.49 ? 9    DG  P C5    1 
ATOM   2952 C  C6    . DG  B 2 9   ? 29.284 21.860 23.368  1.00  41.84 ? 9    DG  P C6    1 
ATOM   2953 O  O6    . DG  B 2 9   ? 28.840 22.818 24.017  1.00  42.09 ? 9    DG  P O6    1 
ATOM   2954 N  N1    . DG  B 2 9   ? 28.417 21.057 22.630  1.00  42.24 ? 9    DG  P N1    1 
ATOM   2955 C  C2    . DG  B 2 9   ? 28.788 19.975 21.873  1.00  42.38 ? 9    DG  P C2    1 
ATOM   2956 N  N2    . DG  B 2 9   ? 27.803 19.343 21.225  1.00  43.32 ? 9    DG  P N2    1 
ATOM   2957 N  N3    . DG  B 2 9   ? 30.034 19.551 21.758  1.00  42.09 ? 9    DG  P N3    1 
ATOM   2958 C  C4    . DG  B 2 9   ? 30.893 20.317 22.472  1.00  42.35 ? 9    DG  P C4    1 
ATOM   2959 P  P     . DA  B 2 10  ? 34.779 17.434 18.372  1.00  50.52 ? 10   DA  P P     1 
ATOM   2960 O  OP1   . DA  B 2 10  ? 35.410 16.108 18.107  1.00  48.66 ? 10   DA  P OP1   1 
ATOM   2961 O  OP2   . DA  B 2 10  ? 35.541 18.689 18.099  1.00  49.24 ? 10   DA  P OP2   1 
ATOM   2962 O  "O5'" . DA  B 2 10  ? 33.382 17.493 17.624  1.00  48.21 ? 10   DA  P "O5'" 1 
ATOM   2963 C  "C5'" . DA  B 2 10  ? 32.324 16.665 18.077  1.00  46.80 ? 10   DA  P "C5'" 1 
ATOM   2964 C  "C4'" . DA  B 2 10  ? 30.999 17.146 17.539  1.00  47.25 ? 10   DA  P "C4'" 1 
ATOM   2965 O  "O4'" . DA  B 2 10  ? 30.430 18.202 18.351  1.00  46.61 ? 10   DA  P "O4'" 1 
ATOM   2966 C  "C3'" . DA  B 2 10  ? 31.025 17.656 16.101  1.00  46.27 ? 10   DA  P "C3'" 1 
ATOM   2967 O  "O3'" . DA  B 2 10  ? 29.926 17.077 15.405  1.00  46.18 ? 10   DA  P "O3'" 1 
ATOM   2968 C  "C2'" . DA  B 2 10  ? 30.862 19.160 16.256  1.00  45.25 ? 10   DA  P "C2'" 1 
ATOM   2969 C  "C1'" . DA  B 2 10  ? 30.022 19.277 17.522  1.00  44.00 ? 10   DA  P "C1'" 1 
ATOM   2970 N  N9    . DA  B 2 10  ? 30.225 20.506 18.283  1.00  41.88 ? 10   DA  P N9    1 
ATOM   2971 C  C8    . DA  B 2 10  ? 31.426 21.038 18.677  1.00  42.88 ? 10   DA  P C8    1 
ATOM   2972 N  N7    . DA  B 2 10  ? 31.314 22.136 19.382  1.00  41.50 ? 10   DA  P N7    1 
ATOM   2973 C  C5    . DA  B 2 10  ? 29.945 22.347 19.451  1.00  39.46 ? 10   DA  P C5    1 
ATOM   2974 C  C6    . DA  B 2 10  ? 29.176 23.356 20.059  1.00  38.30 ? 10   DA  P C6    1 
ATOM   2975 N  N6    . DA  B 2 10  ? 29.702 24.375 20.746  1.00  37.03 ? 10   DA  P N6    1 
ATOM   2976 N  N1    . DA  B 2 10  ? 27.833 23.281 19.936  1.00  39.61 ? 10   DA  P N1    1 
ATOM   2977 C  C2    . DA  B 2 10  ? 27.311 22.257 19.244  1.00  39.08 ? 10   DA  P C2    1 
ATOM   2978 N  N3    . DA  B 2 10  ? 27.930 21.250 18.628  1.00  39.49 ? 10   DA  P N3    1 
ATOM   2979 C  C4    . DA  B 2 10  ? 29.262 21.355 18.772  1.00  39.94 ? 10   DA  P C4    1 
ATOM   2980 P  P     . DT  B 2 11  ? 29.763 17.315 13.830  1.00  46.77 ? 11   DT  P P     1 
ATOM   2981 O  OP1   . DT  B 2 11  ? 28.928 16.195 13.321  1.00  44.84 ? 11   DT  P OP1   1 
ATOM   2982 O  OP2   . DT  B 2 11  ? 31.080 17.606 13.210  1.00  43.47 ? 11   DT  P OP2   1 
ATOM   2983 O  "O5'" . DT  B 2 11  ? 28.863 18.619 13.772  1.00  45.13 ? 11   DT  P "O5'" 1 
ATOM   2984 C  "C5'" . DT  B 2 11  ? 27.560 18.591 14.327  1.00  40.82 ? 11   DT  P "C5'" 1 
ATOM   2985 C  "C4'" . DT  B 2 11  ? 26.843 19.878 14.018  1.00  37.52 ? 11   DT  P "C4'" 1 
ATOM   2986 O  "O4'" . DT  B 2 11  ? 27.171 20.881 15.003  1.00  36.50 ? 11   DT  P "O4'" 1 
ATOM   2987 C  "C3'" . DT  B 2 11  ? 27.173 20.479 12.651  1.00  36.17 ? 11   DT  P "C3'" 1 
ATOM   2988 O  "O3'" . DT  B 2 11  ? 25.948 20.790 11.998  1.00  33.62 ? 11   DT  P "O3'" 1 
ATOM   2989 C  "C2'" . DT  B 2 11  ? 27.973 21.733 12.983  1.00  35.24 ? 11   DT  P "C2'" 1 
ATOM   2990 C  "C1'" . DT  B 2 11  ? 27.415 22.107 14.344  1.00  35.87 ? 11   DT  P "C1'" 1 
ATOM   2991 N  N1    . DT  B 2 11  ? 28.253 22.947 15.233  1.00  34.94 ? 11   DT  P N1    1 
ATOM   2992 C  C2    . DT  B 2 11  ? 27.596 23.906 15.975  1.00  33.73 ? 11   DT  P C2    1 
ATOM   2993 O  O2    . DT  B 2 11  ? 26.394 24.055 15.953  1.00  35.37 ? 11   DT  P O2    1 
ATOM   2994 N  N3    . DT  B 2 11  ? 28.398 24.679 16.755  1.00  32.60 ? 11   DT  P N3    1 
ATOM   2995 C  C4    . DT  B 2 11  ? 29.761 24.594 16.887  1.00  31.58 ? 11   DT  P C4    1 
ATOM   2996 O  O4    . DT  B 2 11  ? 30.341 25.379 17.621  1.00  30.74 ? 11   DT  P O4    1 
ATOM   2997 C  C5    . DT  B 2 11  ? 30.397 23.548 16.108  1.00  31.49 ? 11   DT  P C5    1 
ATOM   2998 C  C7    . DT  B 2 11  ? 31.878 23.360 16.222  1.00  30.66 ? 11   DT  P C7    1 
ATOM   2999 C  C6    . DT  B 2 11  ? 29.622 22.788 15.323  1.00  32.43 ? 11   DT  P C6    1 
ATOM   3000 P  P     . DT  B 2 12  ? 25.958 21.466 10.548  1.00  33.99 ? 12   DT  P P     1 
ATOM   3001 O  OP1   . DT  B 2 12  ? 24.879 20.796 9.781   1.00  36.13 ? 12   DT  P OP1   1 
ATOM   3002 O  OP2   . DT  B 2 12  ? 27.334 21.518 9.989   1.00  34.49 ? 12   DT  P OP2   1 
ATOM   3003 O  "O5'" . DT  B 2 12  ? 25.469 22.940 10.871  1.00  33.58 ? 12   DT  P "O5'" 1 
ATOM   3004 C  "C5'" . DT  B 2 12  ? 24.353 23.136 11.737  1.00  33.22 ? 12   DT  P "C5'" 1 
ATOM   3005 C  "C4'" . DT  B 2 12  ? 24.110 24.607 11.970  1.00  32.46 ? 12   DT  P "C4'" 1 
ATOM   3006 O  "O4'" . DT  B 2 12  ? 24.976 25.102 13.022  1.00  31.12 ? 12   DT  P "O4'" 1 
ATOM   3007 C  "C3'" . DT  B 2 12  ? 24.389 25.463 10.734  1.00  31.51 ? 12   DT  P "C3'" 1 
ATOM   3008 O  "O3'" . DT  B 2 12  ? 23.286 26.298 10.394  1.00  31.97 ? 12   DT  P "O3'" 1 
ATOM   3009 C  "C2'" . DT  B 2 12  ? 25.587 26.312 11.122  1.00  32.32 ? 12   DT  P "C2'" 1 
ATOM   3010 C  "C1'" . DT  B 2 12  ? 25.523 26.345 12.634  1.00  32.37 ? 12   DT  P "C1'" 1 
ATOM   3011 N  N1    . DT  B 2 12  ? 26.840 26.494 13.299  1.00  32.60 ? 12   DT  P N1    1 
ATOM   3012 C  C2    . DT  B 2 12  ? 26.939 27.414 14.318  1.00  32.20 ? 12   DT  P C2    1 
ATOM   3013 O  O2    . DT  B 2 12  ? 25.992 28.059 14.736  1.00  34.47 ? 12   DT  P O2    1 
ATOM   3014 N  N3    . DT  B 2 12  ? 28.190 27.548 14.844  1.00  32.72 ? 12   DT  P N3    1 
ATOM   3015 C  C4    . DT  B 2 12  ? 29.325 26.866 14.484  1.00  32.13 ? 12   DT  P C4    1 
ATOM   3016 O  O4    . DT  B 2 12  ? 30.379 27.116 15.046  1.00  33.25 ? 12   DT  P O4    1 
ATOM   3017 C  C5    . DT  B 2 12  ? 29.153 25.892 13.436  1.00  32.41 ? 12   DT  P C5    1 
ATOM   3018 C  C7    . DT  B 2 12  ? 30.332 25.087 12.993  1.00  28.46 ? 12   DT  P C7    1 
ATOM   3019 C  C6    . DT  B 2 12  ? 27.932 25.753 12.901  1.00  33.22 ? 12   DT  P C6    1 
ATOM   3020 P  P     . DC  B 2 13  ? 23.168 26.873 8.897   1.00  31.94 ? 13   DC  P P     1 
ATOM   3021 O  OP1   . DC  B 2 13  ? 21.737 26.870 8.480   1.00  31.34 ? 13   DC  P OP1   1 
ATOM   3022 O  OP2   . DC  B 2 13  ? 24.165 26.119 8.101   1.00  31.08 ? 13   DC  P OP2   1 
ATOM   3023 O  "O5'" . DC  B 2 13  ? 23.667 28.375 9.054   1.00  31.78 ? 13   DC  P "O5'" 1 
ATOM   3024 C  "C5'" . DC  B 2 13  ? 22.989 29.292 9.907   1.00  33.64 ? 13   DC  P "C5'" 1 
ATOM   3025 C  "C4'" . DC  B 2 13  ? 23.775 30.579 9.990   1.00  36.60 ? 13   DC  P "C4'" 1 
ATOM   3026 O  "O4'" . DC  B 2 13  ? 24.812 30.536 10.996  1.00  37.68 ? 13   DC  P "O4'" 1 
ATOM   3027 C  "C3'" . DC  B 2 13  ? 24.492 30.922 8.681   1.00  39.59 ? 13   DC  P "C3'" 1 
ATOM   3028 O  "O3'" . DC  B 2 13  ? 24.409 32.299 8.469   1.00  42.01 ? 13   DC  P "O3'" 1 
ATOM   3029 C  "C2'" . DC  B 2 13  ? 25.931 30.640 8.952   1.00  39.70 ? 13   DC  P "C2'" 1 
ATOM   3030 C  "C1'" . DC  B 2 13  ? 26.005 31.028 10.405  1.00  37.90 ? 13   DC  P "C1'" 1 
ATOM   3031 N  N1    . DC  B 2 13  ? 27.158 30.444 11.079  1.00  37.03 ? 13   DC  P N1    1 
ATOM   3032 C  C2    . DC  B 2 13  ? 27.732 31.134 12.149  1.00  37.90 ? 13   DC  P C2    1 
ATOM   3033 O  O2    . DC  B 2 13  ? 27.199 32.189 12.542  1.00  38.68 ? 13   DC  P O2    1 
ATOM   3034 N  N3    . DC  B 2 13  ? 28.849 30.640 12.723  1.00  36.96 ? 13   DC  P N3    1 
ATOM   3035 C  C4    . DC  B 2 13  ? 29.385 29.500 12.268  1.00  37.03 ? 13   DC  P C4    1 
ATOM   3036 N  N4    . DC  B 2 13  ? 30.518 29.065 12.837  1.00  34.99 ? 13   DC  P N4    1 
ATOM   3037 C  C5    . DC  B 2 13  ? 28.792 28.761 11.204  1.00  35.23 ? 13   DC  P C5    1 
ATOM   3038 C  C6    . DC  B 2 13  ? 27.691 29.263 10.648  1.00  35.83 ? 13   DC  P C6    1 
HETATM 3039 N  N1    . DOC B 2 14  ? 21.690 32.078 14.139  1.00  63.33 ? 14   DOC P N1    1 
HETATM 3040 C  C2    . DOC B 2 14  ? 21.115 31.474 15.230  1.00  64.84 ? 14   DOC P C2    1 
HETATM 3041 N  N3    . DOC B 2 14  ? 21.716 30.398 15.803  1.00  65.50 ? 14   DOC P N3    1 
HETATM 3042 C  C4    . DOC B 2 14  ? 22.865 29.926 15.302  1.00  64.10 ? 14   DOC P C4    1 
HETATM 3043 C  C5    . DOC B 2 14  ? 23.489 30.536 14.163  1.00  64.27 ? 14   DOC P C5    1 
HETATM 3044 C  C6    . DOC B 2 14  ? 22.871 31.605 13.613  1.00  64.08 ? 14   DOC P C6    1 
HETATM 3045 O  O2    . DOC B 2 14  ? 20.048 31.928 15.671  1.00  66.62 ? 14   DOC P O2    1 
HETATM 3046 N  N4    . DOC B 2 14  ? 23.424 28.870 15.881  1.00  62.04 ? 14   DOC P N4    1 
HETATM 3047 C  "C1'" . DOC B 2 14  ? 20.979 33.264 13.538  1.00  61.68 ? 14   DOC P "C1'" 1 
HETATM 3048 C  "C2'" . DOC B 2 14  ? 21.932 34.454 13.391  1.00  60.57 ? 14   DOC P "C2'" 1 
HETATM 3049 C  "C3'" . DOC B 2 14  ? 22.392 34.222 12.005  1.00  58.91 ? 14   DOC P "C3'" 1 
HETATM 3050 C  "C4'" . DOC B 2 14  ? 21.136 33.925 11.120  1.00  56.82 ? 14   DOC P "C4'" 1 
HETATM 3051 O  "O4'" . DOC B 2 14  ? 20.575 32.873 12.225  1.00  59.99 ? 14   DOC P "O4'" 1 
HETATM 3052 C  "C5'" . DOC B 2 14  ? 21.613 32.789 10.124  1.00  54.54 ? 14   DOC P "C5'" 1 
HETATM 3053 O  "O5'" . DOC B 2 14  ? 22.344 33.667 9.110   1.00  48.70 ? 14   DOC P "O5'" 1 
HETATM 3054 P  P     . DOC B 2 14  ? 23.005 32.776 7.927   1.00  44.67 ? 14   DOC P P     1 
HETATM 3055 O  OP1   . DOC B 2 14  ? 22.261 31.552 7.696   1.00  46.10 ? 14   DOC P OP1   1 
HETATM 3056 O  OP2   . DOC B 2 14  ? 23.221 33.722 6.808   1.00  45.48 ? 14   DOC P OP2   1 
ATOM   3057 O  "O5'" . DA  C 3 3   ? 44.899 32.906 5.962   1.00  84.43 ? 3    DA  T "O5'" 1 
ATOM   3058 C  "C5'" . DA  C 3 3   ? 43.963 31.904 5.533   0.010 85.78 ? 3    DA  T "C5'" 1 
ATOM   3059 C  "C4'" . DA  C 3 3   ? 42.752 31.838 6.430   1.00  86.08 ? 3    DA  T "C4'" 1 
ATOM   3060 O  "O4'" . DA  C 3 3   ? 41.872 30.764 6.029   0.010 88.18 ? 3    DA  T "O4'" 1 
ATOM   3061 C  "C3'" . DA  C 3 3   ? 43.113 31.568 7.889   1.00  84.99 ? 3    DA  T "C3'" 1 
ATOM   3062 O  "O3'" . DA  C 3 3   ? 42.342 32.408 8.733   0.85  77.01 ? 3    DA  T "O3'" 1 
ATOM   3063 C  "C2'" . DA  C 3 3   ? 42.713 30.122 8.096   0.83  87.59 ? 3    DA  T "C2'" 1 
ATOM   3064 C  "C1'" . DA  C 3 3   ? 41.513 30.019 7.182   1.00  90.54 ? 3    DA  T "C1'" 1 
ATOM   3065 N  N9    . DA  C 3 3   ? 41.159 28.656 6.778   0.14  93.78 ? 3    DA  T N9    1 
ATOM   3066 C  C8    . DA  C 3 3   ? 39.945 28.025 6.941   1.00  96.10 ? 3    DA  T C8    1 
ATOM   3067 N  N7    . DA  C 3 3   ? 39.937 26.782 6.519   0.32  96.18 ? 3    DA  T N7    1 
ATOM   3068 C  C5    . DA  C 3 3   ? 41.225 26.581 6.034   0.03  96.77 ? 3    DA  T C5    1 
ATOM   3069 C  C6    . DA  C 3 3   ? 41.858 25.461 5.454   1.00  97.99 ? 3    DA  T C6    1 
ATOM   3070 N  N6    . DA  C 3 3   ? 41.261 24.282 5.267   0.79  98.18 ? 3    DA  T N6    1 
ATOM   3071 N  N1    . DA  C 3 3   ? 43.148 25.598 5.070   1.00  98.23 ? 3    DA  T N1    1 
ATOM   3072 C  C2    . DA  C 3 3   ? 43.751 26.778 5.264   0.61  97.82 ? 3    DA  T C2    1 
ATOM   3073 N  N3    . DA  C 3 3   ? 43.267 27.897 5.804   1.00  97.80 ? 3    DA  T N3    1 
ATOM   3074 C  C4    . DA  C 3 3   ? 41.982 27.733 6.174   0.010 95.93 ? 3    DA  T C4    1 
ATOM   3075 P  P     . DC  C 3 4   ? 42.932 32.833 10.154  1.00  72.30 ? 4    DC  T P     1 
ATOM   3076 O  OP1   . DC  C 3 4   ? 44.170 33.614 9.898   1.00  70.47 ? 4    DC  T OP1   1 
ATOM   3077 O  OP2   . DC  C 3 4   ? 42.982 31.639 11.006  1.00  72.62 ? 4    DC  T OP2   1 
ATOM   3078 O  "O5'" . DC  C 3 4   ? 41.822 33.811 10.727  1.00  67.53 ? 4    DC  T "O5'" 1 
ATOM   3079 C  "C5'" . DC  C 3 4   ? 41.717 35.129 10.238  1.00  59.20 ? 4    DC  T "C5'" 1 
ATOM   3080 C  "C4'" . DC  C 3 4   ? 40.662 35.888 11.011  1.00  52.65 ? 4    DC  T "C4'" 1 
ATOM   3081 O  "O4'" . DC  C 3 4   ? 39.384 35.842 10.336  1.00  48.60 ? 4    DC  T "O4'" 1 
ATOM   3082 C  "C3'" . DC  C 3 4   ? 40.382 35.421 12.441  1.00  49.22 ? 4    DC  T "C3'" 1 
ATOM   3083 O  "O3'" . DC  C 3 4   ? 40.115 36.579 13.228  1.00  46.10 ? 4    DC  T "O3'" 1 
ATOM   3084 C  "C2'" . DC  C 3 4   ? 39.125 34.579 12.278  1.00  46.61 ? 4    DC  T "C2'" 1 
ATOM   3085 C  "C1'" . DC  C 3 4   ? 38.388 35.400 11.240  1.00  44.85 ? 4    DC  T "C1'" 1 
ATOM   3086 N  N1    . DC  C 3 4   ? 37.339 34.735 10.452  1.00  41.38 ? 4    DC  T N1    1 
ATOM   3087 C  C2    . DC  C 3 4   ? 36.105 35.387 10.302  1.00  39.18 ? 4    DC  T C2    1 
ATOM   3088 O  O2    . DC  C 3 4   ? 35.939 36.513 10.823  1.00  39.19 ? 4    DC  T O2    1 
ATOM   3089 N  N3    . DC  C 3 4   ? 35.130 34.787 9.588   1.00  35.02 ? 4    DC  T N3    1 
ATOM   3090 C  C4    . DC  C 3 4   ? 35.346 33.596 9.027   1.00  36.37 ? 4    DC  T C4    1 
ATOM   3091 N  N4    . DC  C 3 4   ? 34.355 33.036 8.341   1.00  36.05 ? 4    DC  T N4    1 
ATOM   3092 C  C5    . DC  C 3 4   ? 36.588 32.922 9.148   1.00  38.25 ? 4    DC  T C5    1 
ATOM   3093 C  C6    . DC  C 3 4   ? 37.551 33.518 9.866   1.00  39.66 ? 4    DC  T C6    1 
HETATM 3094 P  P     . O2G C 3 5   ? 40.644 36.667 14.712  1.00  43.70 ? 5    O2G T P     1 
HETATM 3095 O  OP1   . O2G C 3 5   ? 41.258 37.981 14.982  1.00  40.56 ? 5    O2G T OP1   1 
HETATM 3096 O  OP2   . O2G C 3 5   ? 41.373 35.438 15.139  1.00  45.96 ? 5    O2G T OP2   1 
HETATM 3097 O  "O5'" . O2G C 3 5   ? 39.230 36.720 15.420  1.00  44.28 ? 5    O2G T "O5'" 1 
HETATM 3098 C  "C5'" . O2G C 3 5   ? 38.189 37.572 14.927  1.00  42.08 ? 5    O2G T "C5'" 1 
HETATM 3099 C  "C4'" . O2G C 3 5   ? 36.838 36.851 15.017  1.00  42.49 ? 5    O2G T "C4'" 1 
HETATM 3100 O  "O4'" . O2G C 3 5   ? 36.608 35.909 13.949  1.00  41.50 ? 5    O2G T "O4'" 1 
HETATM 3101 C  "C3'" . O2G C 3 5   ? 36.793 36.032 16.312  1.00  43.23 ? 5    O2G T "C3'" 1 
HETATM 3102 O  "O3'" . O2G C 3 5   ? 35.652 36.314 17.123  1.00  43.84 ? 5    O2G T "O3'" 1 
HETATM 3103 C  "C2'" . O2G C 3 5   ? 36.676 34.588 15.825  1.00  41.79 ? 5    O2G T "C2'" 1 
HETATM 3104 C  "C1'" . O2G C 3 5   ? 35.854 34.855 14.567  1.00  39.40 ? 5    O2G T "C1'" 1 
HETATM 3105 N  N9    . O2G C 3 5   ? 35.720 33.688 13.670  1.00  36.25 ? 5    O2G T N9    1 
HETATM 3106 C  C8    . O2G C 3 5   ? 36.628 32.739 13.459  1.00  35.76 ? 5    O2G T C8    1 
HETATM 3107 N  N7    . O2G C 3 5   ? 36.130 31.829 12.623  1.00  34.12 ? 5    O2G T N7    1 
HETATM 3108 C  C5    . O2G C 3 5   ? 34.897 32.199 12.294  1.00  32.60 ? 5    O2G T C5    1 
HETATM 3109 C  C6    . O2G C 3 5   ? 33.929 31.650 11.467  1.00  31.76 ? 5    O2G T C6    1 
HETATM 3110 O  O6    . O2G C 3 5   ? 34.142 30.576 10.902  1.00  31.29 ? 5    O2G T O6    1 
HETATM 3111 N  N1    . O2G C 3 5   ? 32.711 32.324 11.320  1.00  31.01 ? 5    O2G T N1    1 
HETATM 3112 C  C2    . O2G C 3 5   ? 32.497 33.522 12.013  1.00  31.28 ? 5    O2G T C2    1 
HETATM 3113 N  N2    . O2G C 3 5   ? 31.341 34.167 11.910  1.00  30.17 ? 5    O2G T N2    1 
HETATM 3114 N  N3    . O2G C 3 5   ? 33.462 34.019 12.809  1.00  33.65 ? 5    O2G T N3    1 
HETATM 3115 C  C4    . O2G C 3 5   ? 34.630 33.393 12.958  1.00  35.08 ? 5    O2G T C4    1 
HETATM 3116 C  CM1   . O2G C 3 5   ? 31.104 35.400 12.675  1.00  31.14 ? 5    O2G T CM1   1 
HETATM 3117 C  CM2   . O2G C 3 5   ? 30.273 33.625 11.057  1.00  30.49 ? 5    O2G T CM2   1 
ATOM   3118 P  P     . DG  C 3 6   ? 35.916 37.170 18.452  1.00  42.15 ? 6    DG  T P     1 
ATOM   3119 O  OP1   . DG  C 3 6   ? 36.466 38.537 18.202  1.00  40.66 ? 6    DG  T OP1   1 
ATOM   3120 O  OP2   . DG  C 3 6   ? 36.643 36.230 19.340  1.00  40.22 ? 6    DG  T OP2   1 
ATOM   3121 O  "O5'" . DG  C 3 6   ? 34.437 37.358 18.982  1.00  39.27 ? 6    DG  T "O5'" 1 
ATOM   3122 C  "C5'" . DG  C 3 6   ? 33.641 38.442 18.537  1.00  36.86 ? 6    DG  T "C5'" 1 
ATOM   3123 C  "C4'" . DG  C 3 6   ? 32.182 38.097 18.692  1.00  36.22 ? 6    DG  T "C4'" 1 
ATOM   3124 O  "O4'" . DG  C 3 6   ? 31.809 37.126 17.691  1.00  37.11 ? 6    DG  T "O4'" 1 
ATOM   3125 C  "C3'" . DG  C 3 6   ? 31.856 37.473 20.044  1.00  37.64 ? 6    DG  T "C3'" 1 
ATOM   3126 O  "O3'" . DG  C 3 6   ? 30.633 38.009 20.535  1.00  37.18 ? 6    DG  T "O3'" 1 
ATOM   3127 C  "C2'" . DG  C 3 6   ? 31.763 35.985 19.751  1.00  36.84 ? 6    DG  T "C2'" 1 
ATOM   3128 C  "C1'" . DG  C 3 6   ? 31.302 35.950 18.297  1.00  37.43 ? 6    DG  T "C1'" 1 
ATOM   3129 N  N9    . DG  C 3 6   ? 31.791 34.819 17.510  1.00  36.12 ? 6    DG  T N9    1 
ATOM   3130 C  C8    . DG  C 3 6   ? 33.075 34.329 17.472  1.00  35.67 ? 6    DG  T C8    1 
ATOM   3131 N  N7    . DG  C 3 6   ? 33.216 33.318 16.659  1.00  35.35 ? 6    DG  T N7    1 
ATOM   3132 C  C5    . DG  C 3 6   ? 31.953 33.128 16.125  1.00  34.72 ? 6    DG  T C5    1 
ATOM   3133 C  C6    . DG  C 3 6   ? 31.498 32.194 15.162  1.00  34.15 ? 6    DG  T C6    1 
ATOM   3134 O  O6    . DG  C 3 6   ? 32.141 31.328 14.567  1.00  36.07 ? 6    DG  T O6    1 
ATOM   3135 N  N1    . DG  C 3 6   ? 30.144 32.355 14.899  1.00  33.22 ? 6    DG  T N1    1 
ATOM   3136 C  C2    . DG  C 3 6   ? 29.333 33.310 15.480  1.00  33.80 ? 6    DG  T C2    1 
ATOM   3137 N  N2    . DG  C 3 6   ? 28.055 33.312 15.093  1.00  30.51 ? 6    DG  T N2    1 
ATOM   3138 N  N3    . DG  C 3 6   ? 29.749 34.195 16.372  1.00  32.38 ? 6    DG  T N3    1 
ATOM   3139 C  C4    . DG  C 3 6   ? 31.058 34.047 16.647  1.00  34.83 ? 6    DG  T C4    1 
ATOM   3140 P  P     . DA  C 3 7   ? 30.177 37.683 22.030  1.00  36.72 ? 7    DA  T P     1 
ATOM   3141 O  OP1   . DA  C 3 7   ? 29.379 38.825 22.546  1.00  37.53 ? 7    DA  T OP1   1 
ATOM   3142 O  OP2   . DA  C 3 7   ? 31.372 37.212 22.781  1.00  37.68 ? 7    DA  T OP2   1 
ATOM   3143 O  "O5'" . DA  C 3 7   ? 29.176 36.471 21.826  1.00  37.64 ? 7    DA  T "O5'" 1 
ATOM   3144 C  "C5'" . DA  C 3 7   ? 28.034 36.644 21.009  1.00  35.80 ? 7    DA  T "C5'" 1 
ATOM   3145 C  "C4'" . DA  C 3 7   ? 27.305 35.335 20.839  1.00  35.13 ? 7    DA  T "C4'" 1 
ATOM   3146 O  "O4'" . DA  C 3 7   ? 27.944 34.496 19.849  1.00  32.10 ? 7    DA  T "O4'" 1 
ATOM   3147 C  "C3'" . DA  C 3 7   ? 27.186 34.492 22.107  1.00  36.11 ? 7    DA  T "C3'" 1 
ATOM   3148 O  "O3'" . DA  C 3 7   ? 25.860 33.999 22.207  1.00  36.12 ? 7    DA  T "O3'" 1 
ATOM   3149 C  "C2'" . DA  C 3 7   ? 28.101 33.317 21.824  1.00  35.43 ? 7    DA  T "C2'" 1 
ATOM   3150 C  "C1'" . DA  C 3 7   ? 27.919 33.178 20.331  1.00  33.40 ? 7    DA  T "C1'" 1 
ATOM   3151 N  N9    . DA  C 3 7   ? 28.956 32.411 19.651  1.00  33.18 ? 7    DA  T N9    1 
ATOM   3152 C  C8    . DA  C 3 7   ? 30.304 32.389 19.897  1.00  33.18 ? 7    DA  T C8    1 
ATOM   3153 N  N7    . DA  C 3 7   ? 30.960 31.531 19.157  1.00  32.33 ? 7    DA  T N7    1 
ATOM   3154 C  C5    . DA  C 3 7   ? 29.979 30.959 18.359  1.00  31.02 ? 7    DA  T C5    1 
ATOM   3155 C  C6    . DA  C 3 7   ? 30.023 29.965 17.367  1.00  31.03 ? 7    DA  T C6    1 
ATOM   3156 N  N6    . DA  C 3 7   ? 31.132 29.320 17.014  1.00  30.35 ? 7    DA  T N6    1 
ATOM   3157 N  N1    . DA  C 3 7   ? 28.869 29.644 16.748  1.00  30.75 ? 7    DA  T N1    1 
ATOM   3158 C  C2    . DA  C 3 7   ? 27.750 30.272 17.118  1.00  30.96 ? 7    DA  T C2    1 
ATOM   3159 N  N3    . DA  C 3 7   ? 27.578 31.209 18.042  1.00  30.53 ? 7    DA  T N3    1 
ATOM   3160 C  C4    . DA  C 3 7   ? 28.745 31.510 18.635  1.00  31.55 ? 7    DA  T C4    1 
ATOM   3161 P  P     . DA  C 3 8   ? 25.314 33.449 23.608  1.00  38.91 ? 8    DA  T P     1 
ATOM   3162 O  OP1   . DA  C 3 8   ? 24.925 34.633 24.421  1.00  36.93 ? 8    DA  T OP1   1 
ATOM   3163 O  OP2   . DA  C 3 8   ? 26.260 32.445 24.159  1.00  34.93 ? 8    DA  T OP2   1 
ATOM   3164 O  "O5'" . DA  C 3 8   ? 23.990 32.699 23.157  1.00  37.96 ? 8    DA  T "O5'" 1 
ATOM   3165 C  "C5'" . DA  C 3 8   ? 23.279 33.159 22.020  1.00  36.44 ? 8    DA  T "C5'" 1 
ATOM   3166 C  "C4'" . DA  C 3 8   ? 22.629 31.994 21.321  1.00  38.01 ? 8    DA  T "C4'" 1 
ATOM   3167 O  "O4'" . DA  C 3 8   ? 23.556 31.306 20.443  1.00  37.24 ? 8    DA  T "O4'" 1 
ATOM   3168 C  "C3'" . DA  C 3 8   ? 22.138 30.963 22.323  1.00  39.39 ? 8    DA  T "C3'" 1 
ATOM   3169 O  "O3'" . DA  C 3 8   ? 20.827 30.536 22.005  1.00  41.56 ? 8    DA  T "O3'" 1 
ATOM   3170 C  "C2'" . DA  C 3 8   ? 23.132 29.824 22.202  1.00  39.32 ? 8    DA  T "C2'" 1 
ATOM   3171 C  "C1'" . DA  C 3 8   ? 23.632 29.930 20.773  1.00  36.21 ? 8    DA  T "C1'" 1 
ATOM   3172 N  N9    . DA  C 3 8   ? 25.032 29.513 20.642  1.00  34.51 ? 8    DA  T N9    1 
ATOM   3173 C  C8    . DA  C 3 8   ? 26.100 30.009 21.348  1.00  31.91 ? 8    DA  T C8    1 
ATOM   3174 N  N7    . DA  C 3 8   ? 27.241 29.437 21.053  1.00  29.12 ? 8    DA  T N7    1 
ATOM   3175 C  C5    . DA  C 3 8   ? 26.909 28.510 20.078  1.00  29.36 ? 8    DA  T C5    1 
ATOM   3176 C  C6    . DA  C 3 8   ? 27.684 27.589 19.343  1.00  28.23 ? 8    DA  T C6    1 
ATOM   3177 N  N6    . DA  C 3 8   ? 29.002 27.456 19.476  1.00  24.46 ? 8    DA  T N6    1 
ATOM   3178 N  N1    . DA  C 3 8   ? 27.047 26.805 18.449  1.00  29.20 ? 8    DA  T N1    1 
ATOM   3179 C  C2    . DA  C 3 8   ? 25.727 26.951 18.301  1.00  31.98 ? 8    DA  T C2    1 
ATOM   3180 N  N3    . DA  C 3 8   ? 24.891 27.785 18.922  1.00  32.16 ? 8    DA  T N3    1 
ATOM   3181 C  C4    . DA  C 3 8   ? 25.552 28.546 19.812  1.00  31.61 ? 8    DA  T C4    1 
ATOM   3182 P  P     . DT  C 3 9   ? 20.097 29.487 22.964  1.00  44.75 ? 9    DT  T P     1 
ATOM   3183 O  OP1   . DT  C 3 9   ? 18.649 29.813 22.880  1.00  44.36 ? 9    DT  T OP1   1 
ATOM   3184 O  OP2   . DT  C 3 9   ? 20.773 29.448 24.283  1.00  43.18 ? 9    DT  T OP2   1 
ATOM   3185 O  "O5'" . DT  C 3 9   ? 20.379 28.122 22.211  1.00  44.79 ? 9    DT  T "O5'" 1 
ATOM   3186 C  "C5'" . DT  C 3 9   ? 20.150 28.043 20.813  1.00  46.72 ? 9    DT  T "C5'" 1 
ATOM   3187 C  "C4'" . DT  C 3 9   ? 20.255 26.613 20.361  1.00  46.91 ? 9    DT  T "C4'" 1 
ATOM   3188 O  "O4'" . DT  C 3 9   ? 21.644 26.267 20.182  1.00  47.23 ? 9    DT  T "O4'" 1 
ATOM   3189 C  "C3'" . DT  C 3 9   ? 19.690 25.635 21.384  1.00  48.19 ? 9    DT  T "C3'" 1 
ATOM   3190 O  "O3'" . DT  C 3 9   ? 18.941 24.625 20.694  1.00  50.49 ? 9    DT  T "O3'" 1 
ATOM   3191 C  "C2'" . DT  C 3 9   ? 20.931 25.099 22.085  1.00  46.16 ? 9    DT  T "C2'" 1 
ATOM   3192 C  "C1'" . DT  C 3 9   ? 21.977 25.154 20.982  1.00  45.35 ? 9    DT  T "C1'" 1 
ATOM   3193 N  N1    . DT  C 3 9   ? 23.373 25.332 21.404  1.00  44.24 ? 9    DT  T N1    1 
ATOM   3194 C  C2    . DT  C 3 9   ? 24.329 24.626 20.719  1.00  43.89 ? 9    DT  T C2    1 
ATOM   3195 O  O2    . DT  C 3 9   ? 24.059 23.852 19.820  1.00  43.93 ? 9    DT  T O2    1 
ATOM   3196 N  N3    . DT  C 3 9   ? 25.619 24.857 21.125  1.00  42.80 ? 9    DT  T N3    1 
ATOM   3197 C  C4    . DT  C 3 9   ? 26.034 25.702 22.128  1.00  42.92 ? 9    DT  T C4    1 
ATOM   3198 O  O4    . DT  C 3 9   ? 27.227 25.816 22.374  1.00  42.03 ? 9    DT  T O4    1 
ATOM   3199 C  C5    . DT  C 3 9   ? 24.978 26.398 22.821  1.00  43.32 ? 9    DT  T C5    1 
ATOM   3200 C  C7    . DT  C 3 9   ? 25.339 27.319 23.944  1.00  44.70 ? 9    DT  T C7    1 
ATOM   3201 C  C6    . DT  C 3 9   ? 23.714 26.185 22.428  1.00  43.30 ? 9    DT  T C6    1 
ATOM   3202 P  P     . DC  C 3 10  ? 18.129 23.515 21.526  1.00  51.34 ? 10   DC  T P     1 
ATOM   3203 O  OP1   . DC  C 3 10  ? 16.781 23.390 20.913  1.00  48.79 ? 10   DC  T OP1   1 
ATOM   3204 O  OP2   . DC  C 3 10  ? 18.262 23.811 22.979  1.00  50.92 ? 10   DC  T OP2   1 
ATOM   3205 O  "O5'" . DC  C 3 10  ? 18.953 22.196 21.209  1.00  50.19 ? 10   DC  T "O5'" 1 
ATOM   3206 C  "C5'" . DC  C 3 10  ? 19.493 22.006 19.909  1.00  48.91 ? 10   DC  T "C5'" 1 
ATOM   3207 C  "C4'" . DC  C 3 10  ? 20.603 20.988 19.950  1.00  47.44 ? 10   DC  T "C4'" 1 
ATOM   3208 O  "O4'" . DC  C 3 10  ? 21.858 21.570 20.385  1.00  46.28 ? 10   DC  T "O4'" 1 
ATOM   3209 C  "C3'" . DC  C 3 10  ? 20.323 19.815 20.888  1.00  47.53 ? 10   DC  T "C3'" 1 
ATOM   3210 O  "O3'" . DC  C 3 10  ? 20.624 18.610 20.208  1.00  47.19 ? 10   DC  T "O3'" 1 
ATOM   3211 C  "C2'" . DC  C 3 10  ? 21.320 20.013 22.017  1.00  46.65 ? 10   DC  T "C2'" 1 
ATOM   3212 C  "C1'" . DC  C 3 10  ? 22.472 20.675 21.291  1.00  44.84 ? 10   DC  T "C1'" 1 
ATOM   3213 N  N1    . DC  C 3 10  ? 23.403 21.434 22.143  1.00  42.18 ? 10   DC  T N1    1 
ATOM   3214 C  C2    . DC  C 3 10  ? 24.773 21.203 22.003  1.00  42.32 ? 10   DC  T C2    1 
ATOM   3215 O  O2    . DC  C 3 10  ? 25.164 20.409 21.128  1.00  42.43 ? 10   DC  T O2    1 
ATOM   3216 N  N3    . DC  C 3 10  ? 25.639 21.853 22.813  1.00  41.08 ? 10   DC  T N3    1 
ATOM   3217 C  C4    . DC  C 3 10  ? 25.185 22.715 23.723  1.00  39.74 ? 10   DC  T C4    1 
ATOM   3218 N  N4    . DC  C 3 10  ? 26.081 23.321 24.503  1.00  38.05 ? 10   DC  T N4    1 
ATOM   3219 C  C5    . DC  C 3 10  ? 23.797 22.992 23.871  1.00  39.56 ? 10   DC  T C5    1 
ATOM   3220 C  C6    . DC  C 3 10  ? 22.947 22.335 23.067  1.00  40.94 ? 10   DC  T C6    1 
ATOM   3221 P  P     . DC  C 3 11  ? 20.003 17.226 20.721  1.00  45.30 ? 11   DC  T P     1 
ATOM   3222 O  OP1   . DC  C 3 11  ? 19.224 16.694 19.559  1.00  45.06 ? 11   DC  T OP1   1 
ATOM   3223 O  OP2   . DC  C 3 11  ? 19.330 17.416 22.033  1.00  44.50 ? 11   DC  T OP2   1 
ATOM   3224 O  "O5'" . DC  C 3 11  ? 21.317 16.351 20.912  1.00  45.24 ? 11   DC  T "O5'" 1 
ATOM   3225 C  "C5'" . DC  C 3 11  ? 22.256 16.261 19.843  1.00  47.46 ? 11   DC  T "C5'" 1 
ATOM   3226 C  "C4'" . DC  C 3 11  ? 23.527 15.600 20.310  1.00  49.16 ? 11   DC  T "C4'" 1 
ATOM   3227 O  "O4'" . DC  C 3 11  ? 24.390 16.548 20.985  1.00  48.94 ? 11   DC  T "O4'" 1 
ATOM   3228 C  "C3'" . DC  C 3 11  ? 23.271 14.466 21.295  1.00  50.19 ? 11   DC  T "C3'" 1 
ATOM   3229 O  "O3'" . DC  C 3 11  ? 24.070 13.345 20.961  1.00  53.66 ? 11   DC  T "O3'" 1 
ATOM   3230 C  "C2'" . DC  C 3 11  ? 23.718 15.037 22.626  1.00  48.61 ? 11   DC  T "C2'" 1 
ATOM   3231 C  "C1'" . DC  C 3 11  ? 24.820 15.992 22.213  1.00  47.10 ? 11   DC  T "C1'" 1 
ATOM   3232 N  N1    . DC  C 3 11  ? 25.044 17.091 23.163  1.00  43.78 ? 11   DC  T N1    1 
ATOM   3233 C  C2    . DC  C 3 11  ? 26.345 17.324 23.627  1.00  42.44 ? 11   DC  T C2    1 
ATOM   3234 O  O2    . DC  C 3 11  ? 27.264 16.619 23.211  1.00  43.24 ? 11   DC  T O2    1 
ATOM   3235 N  N3    . DC  C 3 11  ? 26.562 18.311 24.516  1.00  41.71 ? 11   DC  T N3    1 
ATOM   3236 C  C4    . DC  C 3 11  ? 25.540 19.050 24.952  1.00  41.01 ? 11   DC  T C4    1 
ATOM   3237 N  N4    . DC  C 3 11  ? 25.800 19.999 25.848  1.00  40.53 ? 11   DC  T N4    1 
ATOM   3238 C  C5    . DC  C 3 11  ? 24.204 18.842 24.490  1.00  41.26 ? 11   DC  T C5    1 
ATOM   3239 C  C6    . DC  C 3 11  ? 24.005 17.863 23.601  1.00  42.10 ? 11   DC  T C6    1 
ATOM   3240 P  P     . DT  C 3 12  ? 23.799 11.946 21.688  1.00  56.27 ? 12   DT  T P     1 
ATOM   3241 O  OP1   . DT  C 3 12  ? 23.402 10.983 20.630  1.00  56.26 ? 12   DT  T OP1   1 
ATOM   3242 O  OP2   . DT  C 3 12  ? 22.913 12.164 22.855  1.00  54.79 ? 12   DT  T OP2   1 
ATOM   3243 O  "O5'" . DT  C 3 12  ? 25.234 11.565 22.246  1.00  55.18 ? 12   DT  T "O5'" 1 
ATOM   3244 C  "C5'" . DT  C 3 12  ? 26.406 11.983 21.562  1.00  54.72 ? 12   DT  T "C5'" 1 
ATOM   3245 C  "C4'" . DT  C 3 12  ? 27.595 11.832 22.474  1.00  55.97 ? 12   DT  T "C4'" 1 
ATOM   3246 O  "O4'" . DT  C 3 12  ? 27.780 13.023 23.279  1.00  54.56 ? 12   DT  T "O4'" 1 
ATOM   3247 C  "C3'" . DT  C 3 12  ? 27.402 10.673 23.448  1.00  56.57 ? 12   DT  T "C3'" 1 
ATOM   3248 O  "O3'" . DT  C 3 12  ? 28.582 9.882  23.543  1.00  59.58 ? 12   DT  T "O3'" 1 
ATOM   3249 C  "C2'" . DT  C 3 12  ? 27.083 11.356 24.765  1.00  55.55 ? 12   DT  T "C2'" 1 
ATOM   3250 C  "C1'" . DT  C 3 12  ? 27.830 12.672 24.651  1.00  54.48 ? 12   DT  T "C1'" 1 
ATOM   3251 N  N1    . DT  C 3 12  ? 27.227 13.774 25.434  1.00  53.13 ? 12   DT  T N1    1 
ATOM   3252 C  C2    . DT  C 3 12  ? 28.048 14.563 26.203  1.00  52.96 ? 12   DT  T C2    1 
ATOM   3253 O  O2    . DT  C 3 12  ? 29.244 14.422 26.259  1.00  54.39 ? 12   DT  T O2    1 
ATOM   3254 N  N3    . DT  C 3 12  ? 27.409 15.536 26.913  1.00  52.96 ? 12   DT  T N3    1 
ATOM   3255 C  C4    . DT  C 3 12  ? 26.064 15.807 26.931  1.00  53.21 ? 12   DT  T C4    1 
ATOM   3256 O  O4    . DT  C 3 12  ? 25.636 16.723 27.624  1.00  51.72 ? 12   DT  T O4    1 
ATOM   3257 C  C5    . DT  C 3 12  ? 25.258 14.953 26.098  1.00  54.45 ? 12   DT  T C5    1 
ATOM   3258 C  C7    . DT  C 3 12  ? 23.781 15.175 26.054  1.00  54.73 ? 12   DT  T C7    1 
ATOM   3259 C  C6    . DT  C 3 12  ? 25.872 13.992 25.396  1.00  54.22 ? 12   DT  T C6    1 
ATOM   3260 P  P     . DT  C 3 13  ? 28.608 8.607  24.522  1.00  62.79 ? 13   DT  T P     1 
ATOM   3261 O  OP1   . DT  C 3 13  ? 29.453 7.570  23.864  1.00  61.07 ? 13   DT  T OP1   1 
ATOM   3262 O  OP2   . DT  C 3 13  ? 27.224 8.268  24.966  1.00  61.27 ? 13   DT  T OP2   1 
ATOM   3263 O  "O5'" . DT  C 3 13  ? 29.398 9.170  25.778  1.00  61.33 ? 13   DT  T "O5'" 1 
ATOM   3264 C  "C5'" . DT  C 3 13  ? 30.586 9.918  25.577  1.00  58.69 ? 13   DT  T "C5'" 1 
ATOM   3265 C  "C4'" . DT  C 3 13  ? 31.145 10.368 26.901  1.00  56.85 ? 13   DT  T "C4'" 1 
ATOM   3266 O  "O4'" . DT  C 3 13  ? 30.426 11.531 27.377  1.00  54.42 ? 13   DT  T "O4'" 1 
ATOM   3267 C  "C3'" . DT  C 3 13  ? 31.056 9.315  28.004  1.00  56.33 ? 13   DT  T "C3'" 1 
ATOM   3268 O  "O3'" . DT  C 3 13  ? 32.328 9.191  28.636  1.00  58.24 ? 13   DT  T "O3'" 1 
ATOM   3269 C  "C2'" . DT  C 3 13  ? 29.997 9.866  28.946  1.00  54.10 ? 13   DT  T "C2'" 1 
ATOM   3270 C  "C1'" . DT  C 3 13  ? 30.120 11.364 28.744  1.00  52.60 ? 13   DT  T "C1'" 1 
ATOM   3271 N  N1    . DT  C 3 13  ? 28.914 12.171 29.043  1.00  49.53 ? 13   DT  T N1    1 
ATOM   3272 C  C2    . DT  C 3 13  ? 29.086 13.325 29.777  1.00  47.75 ? 13   DT  T C2    1 
ATOM   3273 O  O2    . DT  C 3 13  ? 30.173 13.699 30.184  1.00  49.51 ? 13   DT  T O2    1 
ATOM   3274 N  N3    . DT  C 3 13  ? 27.937 14.029 30.020  1.00  44.64 ? 13   DT  T N3    1 
ATOM   3275 C  C4    . DT  C 3 13  ? 26.657 13.703 29.621  1.00  45.53 ? 13   DT  T C4    1 
ATOM   3276 O  O4    . DT  C 3 13  ? 25.716 14.436 29.923  1.00  41.93 ? 13   DT  T O4    1 
ATOM   3277 C  C5    . DT  C 3 13  ? 26.543 12.478 28.856  1.00  46.60 ? 13   DT  T C5    1 
ATOM   3278 C  C7    . DT  C 3 13  ? 25.192 12.039 28.386  1.00  45.91 ? 13   DT  T C7    1 
ATOM   3279 C  C6    . DT  C 3 13  ? 27.665 11.784 28.605  1.00  47.88 ? 13   DT  T C6    1 
ATOM   3280 P  P     . DC  C 3 14  ? 32.528 8.153  29.843  1.00  60.31 ? 14   DC  T P     1 
ATOM   3281 O  OP1   . DC  C 3 14  ? 33.926 7.649  29.757  1.00  58.56 ? 14   DC  T OP1   1 
ATOM   3282 O  OP2   . DC  C 3 14  ? 31.397 7.193  29.900  1.00  57.91 ? 14   DC  T OP2   1 
ATOM   3283 O  "O5'" . DC  C 3 14  ? 32.429 9.110  31.104  1.00  59.00 ? 14   DC  T "O5'" 1 
ATOM   3284 C  "C5'" . DC  C 3 14  ? 33.165 10.321 31.119  1.00  57.99 ? 14   DC  T "C5'" 1 
ATOM   3285 C  "C4'" . DC  C 3 14  ? 32.981 11.015 32.441  1.00  58.08 ? 14   DC  T "C4'" 1 
ATOM   3286 O  "O4'" . DC  C 3 14  ? 31.766 11.799 32.432  1.00  57.40 ? 14   DC  T "O4'" 1 
ATOM   3287 C  "C3'" . DC  C 3 14  ? 32.870 10.049 33.619  1.00  58.06 ? 14   DC  T "C3'" 1 
ATOM   3288 O  "O3'" . DC  C 3 14  ? 33.698 10.524 34.676  1.00  61.54 ? 14   DC  T "O3'" 1 
ATOM   3289 C  "C2'" . DC  C 3 14  ? 31.396 10.100 33.983  1.00  56.22 ? 14   DC  T "C2'" 1 
ATOM   3290 C  "C1'" . DC  C 3 14  ? 31.026 11.523 33.605  1.00  54.15 ? 14   DC  T "C1'" 1 
ATOM   3291 N  N1    . DC  C 3 14  ? 29.603 11.764 33.310  1.00  50.40 ? 14   DC  T N1    1 
ATOM   3292 C  C2    . DC  C 3 14  ? 28.979 12.906 33.854  1.00  49.65 ? 14   DC  T C2    1 
ATOM   3293 O  O2    . DC  C 3 14  ? 29.639 13.675 34.575  1.00  48.45 ? 14   DC  T O2    1 
ATOM   3294 N  N3    . DC  C 3 14  ? 27.673 13.139 33.583  1.00  46.67 ? 14   DC  T N3    1 
ATOM   3295 C  C4    . DC  C 3 14  ? 26.991 12.290 32.815  1.00  45.58 ? 14   DC  T C4    1 
ATOM   3296 N  N4    . DC  C 3 14  ? 25.710 12.558 32.588  1.00  44.26 ? 14   DC  T N4    1 
ATOM   3297 C  C5    . DC  C 3 14  ? 27.596 11.126 32.250  1.00  45.50 ? 14   DC  T C5    1 
ATOM   3298 C  C6    . DC  C 3 14  ? 28.892 10.905 32.521  1.00  48.21 ? 14   DC  T C6    1 
ATOM   3299 P  P     . DC  C 3 15  ? 33.882 9.648  36.006  1.00  64.47 ? 15   DC  T P     1 
ATOM   3300 O  OP1   . DC  C 3 15  ? 35.339 9.543  36.279  1.00  64.70 ? 15   DC  T OP1   1 
ATOM   3301 O  OP2   . DC  C 3 15  ? 33.059 8.416  35.905  1.00  62.93 ? 15   DC  T OP2   1 
ATOM   3302 O  "O5'" . DC  C 3 15  ? 33.236 10.600 37.095  1.00  63.71 ? 15   DC  T "O5'" 1 
ATOM   3303 C  "C5'" . DC  C 3 15  ? 32.119 11.396 36.738  1.00  63.59 ? 15   DC  T "C5'" 1 
ATOM   3304 C  "C4'" . DC  C 3 15  ? 31.698 12.244 37.905  1.00  62.92 ? 15   DC  T "C4'" 1 
ATOM   3305 O  "O4'" . DC  C 3 15  ? 30.436 12.854 37.550  1.00  62.81 ? 15   DC  T "O4'" 1 
ATOM   3306 C  "C3'" . DC  C 3 15  ? 31.443 11.409 39.152  1.00  63.39 ? 15   DC  T "C3'" 1 
ATOM   3307 O  "O3'" . DC  C 3 15  ? 31.931 12.089 40.303  1.00  66.06 ? 15   DC  T "O3'" 1 
ATOM   3308 C  "C2'" . DC  C 3 15  ? 29.938 11.218 39.174  1.00  61.99 ? 15   DC  T "C2'" 1 
ATOM   3309 C  "C1'" . DC  C 3 15  ? 29.396 12.416 38.408  1.00  60.45 ? 15   DC  T "C1'" 1 
ATOM   3310 N  N1    . DC  C 3 15  ? 28.242 12.071 37.563  1.00  56.32 ? 15   DC  T N1    1 
ATOM   3311 C  C2    . DC  C 3 15  ? 27.056 12.804 37.691  1.00  54.77 ? 15   DC  T C2    1 
ATOM   3312 O  O2    . DC  C 3 15  ? 27.025 13.768 38.473  1.00  54.26 ? 15   DC  T O2    1 
ATOM   3313 N  N3    . DC  C 3 15  ? 25.979 12.448 36.954  1.00  53.22 ? 15   DC  T N3    1 
ATOM   3314 C  C4    . DC  C 3 15  ? 26.064 11.420 36.104  1.00  52.91 ? 15   DC  T C4    1 
ATOM   3315 N  N4    . DC  C 3 15  ? 24.981 11.092 35.402  1.00  51.54 ? 15   DC  T N4    1 
ATOM   3316 C  C5    . DC  C 3 15  ? 27.266 10.679 35.937  1.00  52.88 ? 15   DC  T C5    1 
ATOM   3317 C  C6    . DC  C 3 15  ? 28.321 11.035 36.678  1.00  53.41 ? 15   DC  T C6    1 
ATOM   3318 P  P     . DC  C 3 16  ? 31.863 11.372 41.737  1.00  68.43 ? 16   DC  T P     1 
ATOM   3319 O  OP1   . DC  C 3 16  ? 32.991 11.904 42.549  1.00  66.67 ? 16   DC  T OP1   1 
ATOM   3320 O  OP2   . DC  C 3 16  ? 31.722 9.903  41.551  1.00  66.75 ? 16   DC  T OP2   1 
ATOM   3321 O  "O5'" . DC  C 3 16  ? 30.501 11.937 42.331  1.00  66.50 ? 16   DC  T "O5'" 1 
ATOM   3322 C  "C5'" . DC  C 3 16  ? 30.298 13.339 42.456  1.00  64.98 ? 16   DC  T "C5'" 1 
ATOM   3323 C  "C4'" . DC  C 3 16  ? 29.024 13.597 43.219  1.00  64.72 ? 16   DC  T "C4'" 1 
ATOM   3324 O  "O4'" . DC  C 3 16  ? 27.888 13.476 42.329  1.00  63.48 ? 16   DC  T "O4'" 1 
ATOM   3325 C  "C3'" . DC  C 3 16  ? 28.808 12.576 44.332  1.00  64.81 ? 16   DC  T "C3'" 1 
ATOM   3326 O  "O3'" . DC  C 3 16  ? 28.328 13.213 45.515  1.00  66.94 ? 16   DC  T "O3'" 1 
ATOM   3327 C  "C2'" . DC  C 3 16  ? 27.792 11.611 43.744  1.00  62.56 ? 16   DC  T "C2'" 1 
ATOM   3328 C  "C1'" . DC  C 3 16  ? 26.984 12.498 42.814  1.00  61.20 ? 16   DC  T "C1'" 1 
ATOM   3329 N  N1    . DC  C 3 16  ? 26.406 11.800 41.650  1.00  57.61 ? 16   DC  T N1    1 
ATOM   3330 C  C2    . DC  C 3 16  ? 25.147 12.191 41.182  1.00  56.50 ? 16   DC  T C2    1 
ATOM   3331 O  O2    . DC  C 3 16  ? 24.559 13.132 41.740  1.00  57.04 ? 16   DC  T O2    1 
ATOM   3332 N  N3    . DC  C 3 16  ? 24.602 11.540 40.131  1.00  54.34 ? 16   DC  T N3    1 
ATOM   3333 C  C4    . DC  C 3 16  ? 25.266 10.545 39.547  1.00  53.40 ? 16   DC  T C4    1 
ATOM   3334 N  N4    . DC  C 3 16  ? 24.682 9.924  38.522  1.00  52.66 ? 16   DC  T N4    1 
ATOM   3335 C  C5    . DC  C 3 16  ? 26.555 10.138 39.990  1.00  53.65 ? 16   DC  T C5    1 
ATOM   3336 C  C6    . DC  C 3 16  ? 27.082 10.784 41.037  1.00  55.86 ? 16   DC  T C6    1 
ATOM   3337 P  P     . DC  C 3 17  ? 27.924 12.318 46.784  1.00  69.87 ? 17   DC  T P     1 
ATOM   3338 O  OP1   . DC  C 3 17  ? 28.066 13.180 47.974  1.00  69.72 ? 17   DC  T OP1   1 
ATOM   3339 O  OP2   . DC  C 3 17  ? 28.666 11.030 46.724  1.00  68.64 ? 17   DC  T OP2   1 
ATOM   3340 O  "O5'" . DC  C 3 17  ? 26.377 12.048 46.514  1.00  71.46 ? 17   DC  T "O5'" 1 
ATOM   3341 C  "C5'" . DC  C 3 17  ? 25.548 13.092 45.993  1.00  73.62 ? 17   DC  T "C5'" 1 
ATOM   3342 C  "C4'" . DC  C 3 17  ? 24.123 12.613 45.837  1.00  75.06 ? 17   DC  T "C4'" 1 
ATOM   3343 O  "O4'" . DC  C 3 17  ? 23.930 11.920 44.579  1.00  75.08 ? 17   DC  T "O4'" 1 
ATOM   3344 C  "C3'" . DC  C 3 17  ? 23.652 11.653 46.930  1.00  77.00 ? 17   DC  T "C3'" 1 
ATOM   3345 O  "O3'" . DC  C 3 17  ? 22.328 11.998 47.354  1.00  79.55 ? 17   DC  T "O3'" 1 
ATOM   3346 C  "C2'" . DC  C 3 17  ? 23.637 10.305 46.228  1.00  75.37 ? 17   DC  T "C2'" 1 
ATOM   3347 C  "C1'" . DC  C 3 17  ? 23.222 10.716 44.829  1.00  73.35 ? 17   DC  T "C1'" 1 
ATOM   3348 N  N1    . DC  C 3 17  ? 23.534 9.755  43.756  1.00  70.09 ? 17   DC  T N1    1 
ATOM   3349 C  C2    . DC  C 3 17  ? 22.685 9.700  42.643  1.00  67.89 ? 17   DC  T C2    1 
ATOM   3350 O  O2    . DC  C 3 17  ? 21.706 10.465 42.598  1.00  68.32 ? 17   DC  T O2    1 
ATOM   3351 N  N3    . DC  C 3 17  ? 22.949 8.819  41.649  1.00  65.77 ? 17   DC  T N3    1 
ATOM   3352 C  C4    . DC  C 3 17  ? 24.011 8.016  41.736  1.00  65.77 ? 17   DC  T C4    1 
ATOM   3353 N  N4    . DC  C 3 17  ? 24.237 7.166  40.732  1.00  64.27 ? 17   DC  T N4    1 
ATOM   3354 C  C5    . DC  C 3 17  ? 24.893 8.049  42.859  1.00  67.77 ? 17   DC  T C5    1 
ATOM   3355 C  C6    . DC  C 3 17  ? 24.620 8.928  43.837  1.00  69.52 ? 17   DC  T C6    1 
ATOM   3356 P  P     . DC  C 3 18  ? 21.819 11.548 48.812  1.00  82.30 ? 18   DC  T P     1 
ATOM   3357 O  OP1   . DC  C 3 18  ? 21.742 12.782 49.639  1.00  81.08 ? 18   DC  T OP1   1 
ATOM   3358 O  OP2   . DC  C 3 18  ? 22.648 10.400 49.279  1.00  81.48 ? 18   DC  T OP2   1 
ATOM   3359 O  "O5'" . DC  C 3 18  ? 20.340 11.019 48.543  1.00  78.47 ? 18   DC  T "O5'" 1 
ATOM   3360 C  "C5'" . DC  C 3 18  ? 19.351 11.892 48.015  1.00  73.90 ? 18   DC  T "C5'" 1 
ATOM   3361 C  "C4'" . DC  C 3 18  ? 18.211 11.096 47.431  1.00  71.37 ? 18   DC  T "C4'" 1 
ATOM   3362 O  "O4'" . DC  C 3 18  ? 18.664 10.413 46.237  1.00  69.05 ? 18   DC  T "O4'" 1 
ATOM   3363 C  "C3'" . DC  C 3 18  ? 17.669 10.009 48.359  1.00  70.95 ? 18   DC  T "C3'" 1 
ATOM   3364 O  "O3'" . DC  C 3 18  ? 16.282 9.793  48.055  1.00  73.56 ? 18   DC  T "O3'" 1 
ATOM   3365 C  "C2'" . DC  C 3 18  ? 18.405 8.776  47.874  1.00  68.85 ? 18   DC  T "C2'" 1 
ATOM   3366 C  "C1'" . DC  C 3 18  ? 18.408 9.029  46.377  1.00  66.08 ? 18   DC  T "C1'" 1 
ATOM   3367 N  N1    . DC  C 3 18  ? 19.418 8.294  45.606  1.00  61.69 ? 18   DC  T N1    1 
ATOM   3368 C  C2    . DC  C 3 18  ? 19.070 7.801  44.342  1.00  60.40 ? 18   DC  T C2    1 
ATOM   3369 O  O2    . DC  C 3 18  ? 17.918 7.998  43.912  1.00  59.44 ? 18   DC  T O2    1 
ATOM   3370 N  N3    . DC  C 3 18  ? 19.994 7.121  43.621  1.00  59.50 ? 18   DC  T N3    1 
ATOM   3371 C  C4    . DC  C 3 18  ? 21.215 6.922  44.121  1.00  58.07 ? 18   DC  T C4    1 
ATOM   3372 N  N4    . DC  C 3 18  ? 22.090 6.241  43.378  1.00  56.02 ? 18   DC  T N4    1 
ATOM   3373 C  C5    . DC  C 3 18  ? 21.591 7.411  45.405  1.00  58.60 ? 18   DC  T C5    1 
ATOM   3374 C  C6    . DC  C 3 18  ? 20.670 8.088  46.106  1.00  60.05 ? 18   DC  T C6    1 
HETATM 3375 P  PG    . DGT D 4 .   ? 23.513 39.945 2.481   1.00  36.74 ? 594  DGT A PG    1 
HETATM 3376 O  O1G   . DGT D 4 .   ? 23.123 41.116 1.459   1.00  40.17 ? 594  DGT A O1G   1 
HETATM 3377 O  O2G   . DGT D 4 .   ? 23.738 38.657 1.550   1.00  37.44 ? 594  DGT A O2G   1 
HETATM 3378 O  O3G   . DGT D 4 .   ? 22.476 39.687 3.501   1.00  35.20 ? 594  DGT A O3G   1 
HETATM 3379 O  O3B   . DGT D 4 .   ? 24.952 40.320 3.099   1.00  37.61 ? 594  DGT A O3B   1 
HETATM 3380 P  PB    . DGT D 4 .   ? 25.114 40.361 4.701   1.00  37.68 ? 594  DGT A PB    1 
HETATM 3381 O  O1B   . DGT D 4 .   ? 23.993 41.103 5.317   1.00  40.47 ? 594  DGT A O1B   1 
HETATM 3382 O  O2B   . DGT D 4 .   ? 26.521 40.651 5.062   1.00  35.03 ? 594  DGT A O2B   1 
HETATM 3383 O  O3A   . DGT D 4 .   ? 24.918 38.785 4.993   1.00  35.24 ? 594  DGT A O3A   1 
HETATM 3384 P  PA    . DGT D 4 .   ? 24.586 38.171 6.442   1.00  31.83 ? 594  DGT A PA    1 
HETATM 3385 O  O1A   . DGT D 4 .   ? 25.015 36.631 6.289   1.00  35.38 ? 594  DGT A O1A   1 
HETATM 3386 O  O2A   . DGT D 4 .   ? 23.176 38.332 6.852   1.00  32.12 ? 594  DGT A O2A   1 
HETATM 3387 O  "O5'" . DGT D 4 .   ? 25.629 38.755 7.513   1.00  33.30 ? 594  DGT A "O5'" 1 
HETATM 3388 C  "C5'" . DGT D 4 .   ? 25.339 39.894 8.323   1.00  31.41 ? 594  DGT A "C5'" 1 
HETATM 3389 C  "C4'" . DGT D 4 .   ? 26.688 40.438 8.784   1.00  32.02 ? 594  DGT A "C4'" 1 
HETATM 3390 O  "O4'" . DGT D 4 .   ? 27.404 39.309 9.287   1.00  32.90 ? 594  DGT A "O4'" 1 
HETATM 3391 C  "C3'" . DGT D 4 .   ? 27.380 40.781 7.466   1.00  33.19 ? 594  DGT A "C3'" 1 
HETATM 3392 O  "O3'" . DGT D 4 .   ? 27.310 42.189 7.238   1.00  36.22 ? 594  DGT A "O3'" 1 
HETATM 3393 C  "C2'" . DGT D 4 .   ? 28.838 40.395 7.697   1.00  33.72 ? 594  DGT A "C2'" 1 
HETATM 3394 C  "C1'" . DGT D 4 .   ? 28.781 39.518 8.950   1.00  33.57 ? 594  DGT A "C1'" 1 
HETATM 3395 N  N9    . DGT D 4 .   ? 29.417 38.204 8.730   1.00  35.28 ? 594  DGT A N9    1 
HETATM 3396 C  C8    . DGT D 4 .   ? 28.888 37.127 8.143   1.00  34.22 ? 594  DGT A C8    1 
HETATM 3397 N  N7    . DGT D 4 .   ? 29.771 36.134 8.167   1.00  36.80 ? 594  DGT A N7    1 
HETATM 3398 C  C5    . DGT D 4 .   ? 30.871 36.578 8.772   1.00  37.59 ? 594  DGT A C5    1 
HETATM 3399 C  C6    . DGT D 4 .   ? 32.087 35.991 9.101   1.00  38.94 ? 594  DGT A C6    1 
HETATM 3400 O  O6    . DGT D 4 .   ? 32.323 34.826 8.792   1.00  40.11 ? 594  DGT A O6    1 
HETATM 3401 N  N1    . DGT D 4 .   ? 33.047 36.750 9.785   1.00  40.04 ? 594  DGT A N1    1 
HETATM 3402 C  C2    . DGT D 4 .   ? 32.748 38.077 10.119  1.00  40.27 ? 594  DGT A C2    1 
HETATM 3403 N  N2    . DGT D 4 .   ? 33.640 38.807 10.789  1.00  43.22 ? 594  DGT A N2    1 
HETATM 3404 N  N3    . DGT D 4 .   ? 31.575 38.612 9.788   1.00  39.32 ? 594  DGT A N3    1 
HETATM 3405 C  C4    . DGT D 4 .   ? 30.638 37.894 9.123   1.00  36.32 ? 594  DGT A C4    1 
HETATM 3406 MG MG    . MG  E 5 .   ? 21.619 38.005 8.520   1.00  14.63 ? 1000 MG  A MG    1 
HETATM 3407 MG MG    . MG  F 5 .   ? 22.261 40.646 5.676   1.00  11.58 ? 1001 MG  A MG    1 
HETATM 3408 MG MG    . MG  G 5 .   ? 22.479 25.322 4.513   1.00  32.99 ? 1002 MG  A MG    1 
HETATM 3409 MG MG    . MG  H 5 .   ? 25.494 34.631 6.196   1.00  25.52 ? 1003 MG  A MG    1 
HETATM 3410 O  O     . HOH I 6 .   ? -5.244 34.135 14.598  1.00  55.82 ? 2001 HOH A O     1 
HETATM 3411 O  O     . HOH I 6 .   ? 31.091 39.897 12.265  1.00  30.63 ? 2002 HOH A O     1 
HETATM 3412 O  O     . HOH I 6 .   ? 27.584 38.157 13.958  1.00  50.08 ? 2003 HOH A O     1 
HETATM 3413 O  O     . HOH I 6 .   ? 24.761 52.721 -0.126  1.00  35.36 ? 2004 HOH A O     1 
HETATM 3414 O  O     . HOH I 6 .   ? 38.746 51.806 8.095   1.00  34.17 ? 2005 HOH A O     1 
HETATM 3415 O  O     . HOH I 6 .   ? 40.670 43.888 11.389  1.00  42.01 ? 2006 HOH A O     1 
HETATM 3416 O  O     . HOH I 6 .   ? 46.889 40.510 8.551   1.00  36.20 ? 2007 HOH A O     1 
HETATM 3417 O  O     . HOH I 6 .   ? 53.405 29.058 12.683  1.00  33.32 ? 2008 HOH A O     1 
HETATM 3418 O  O     . HOH I 6 .   ? 30.585 32.161 5.950   1.00  42.18 ? 2009 HOH A O     1 
HETATM 3419 O  O     . HOH I 6 .   ? 17.315 31.201 -0.468  1.00  50.51 ? 2010 HOH A O     1 
HETATM 3420 O  O     . HOH I 6 .   ? 40.210 44.328 -9.490  1.00  30.69 ? 2011 HOH A O     1 
HETATM 3421 O  O     . HOH I 6 .   ? 28.102 29.595 6.123   1.00  46.82 ? 2012 HOH A O     1 
HETATM 3422 O  O     . HOH I 6 .   ? 36.939 49.662 8.476   1.00  60.84 ? 2013 HOH A O     1 
HETATM 3423 O  O     . HOH I 6 .   ? 37.407 53.787 12.839  1.00  34.05 ? 2014 HOH A O     1 
HETATM 3424 O  O     . HOH I 6 .   ? 33.187 38.964 14.358  1.00  42.29 ? 2015 HOH A O     1 
HETATM 3425 O  O     . HOH I 6 .   ? 21.870 44.738 16.885  1.00  39.71 ? 2016 HOH A O     1 
HETATM 3426 O  O     . HOH I 6 .   ? 24.584 37.493 10.988  1.00  46.53 ? 2017 HOH A O     1 
HETATM 3427 O  O     . HOH I 6 .   ? 19.245 34.999 7.875   1.00  37.34 ? 2018 HOH A O     1 
HETATM 3428 O  O     . HOH I 6 .   ? 18.076 35.962 5.663   1.00  27.89 ? 2019 HOH A O     1 
HETATM 3429 O  O     . HOH I 6 .   ? 22.439 26.874 2.980   1.00  42.52 ? 2020 HOH A O     1 
HETATM 3430 O  O     . HOH I 6 .   ? 20.324 27.830 -2.370  1.00  37.17 ? 2021 HOH A O     1 
HETATM 3431 O  O     . HOH I 6 .   ? 16.960 29.744 2.643   1.00  42.91 ? 2022 HOH A O     1 
HETATM 3432 O  O     . HOH I 6 .   ? 20.958 26.223 5.805   1.00  37.11 ? 2023 HOH A O     1 
HETATM 3433 O  O     . HOH I 6 .   ? 20.534 28.249 12.802  1.00  42.80 ? 2024 HOH A O     1 
HETATM 3434 O  O     . HOH I 6 .   ? 27.729 25.123 8.011   1.00  40.85 ? 2025 HOH A O     1 
HETATM 3435 O  O     . HOH I 6 .   ? 10.003 5.407  15.865  1.00  38.61 ? 2026 HOH A O     1 
HETATM 3436 O  O     . HOH I 6 .   ? 16.164 27.759 14.225  1.00  33.96 ? 2027 HOH A O     1 
HETATM 3437 O  O     . HOH I 6 .   ? 1.735  14.943 11.069  1.00  38.56 ? 2028 HOH A O     1 
HETATM 3438 O  O     . HOH I 6 .   ? 32.453 29.901 29.725  1.00  30.67 ? 2029 HOH A O     1 
HETATM 3439 O  O     . HOH I 6 .   ? 52.322 24.549 13.111  1.00  42.24 ? 2030 HOH A O     1 
HETATM 3440 O  O     . HOH I 6 .   ? 30.815 25.103 41.383  1.00  35.54 ? 2031 HOH A O     1 
HETATM 3441 O  O     . HOH I 6 .   ? 27.374 28.603 40.491  1.00  39.87 ? 2032 HOH A O     1 
HETATM 3442 O  O     . HOH I 6 .   ? 36.978 43.107 39.711  1.00  34.09 ? 2033 HOH A O     1 
HETATM 3443 O  O     . HOH I 6 .   ? 41.576 34.158 42.567  1.00  36.35 ? 2034 HOH A O     1 
HETATM 3444 O  O     . HOH I 6 .   ? 41.840 24.665 37.107  1.00  29.58 ? 2035 HOH A O     1 
HETATM 3445 O  O     . HOH I 6 .   ? 42.429 30.542 40.805  1.00  49.21 ? 2036 HOH A O     1 
HETATM 3446 O  O     . HOH I 6 .   ? 20.699 38.657 38.295  1.00  35.30 ? 2037 HOH A O     1 
HETATM 3447 O  O     . HOH I 6 .   ? 24.973 36.560 2.421   1.00  27.45 ? 2038 HOH A O     1 
HETATM 3448 O  O     . HOH I 6 .   ? 25.841 35.035 8.521   1.00  27.65 ? 2039 HOH A O     1 
HETATM 3449 O  O     . HOH I 6 .   ? 21.693 36.471 7.005   1.00  20.19 ? 2040 HOH A O     1 
HETATM 3450 O  O     . HOH I 6 .   ? 27.551 33.548 7.633   1.00  44.16 ? 2041 HOH A O     1 
HETATM 3451 O  O     . HOH I 6 .   ? 27.486 35.407 5.624   1.00  40.34 ? 2042 HOH A O     1 
HETATM 3452 O  O     . HOH J 6 .   ? 14.275 5.439  40.089  1.00  38.19 ? 2001 HOH P O     1 
HETATM 3453 O  O     . HOH J 6 .   ? 30.598 19.669 39.219  1.00  52.45 ? 2002 HOH P O     1 
HETATM 3454 O  O     . HOH J 6 .   ? 28.996 23.360 27.576  1.00  33.36 ? 2003 HOH P O     1 
HETATM 3455 O  O     . HOH J 6 .   ? 30.819 24.939 25.479  1.00  30.41 ? 2004 HOH P O     1 
HETATM 3456 O  O     . HOH J 6 .   ? 33.002 15.103 23.993  1.00  46.33 ? 2005 HOH P O     1 
HETATM 3457 O  O     . HOH J 6 .   ? 24.400 25.950 5.802   1.00  40.50 ? 2006 HOH P O     1 
HETATM 3458 O  O     . HOH J 6 .   ? 25.105 34.416 13.071  1.00  38.97 ? 2007 HOH P O     1 
HETATM 3459 O  O     . HOH J 6 .   ? 20.907 29.979 9.543   1.00  70.72 ? 2008 HOH P O     1 
HETATM 3460 O  O     . HOH J 6 .   ? 23.357 36.082 8.638   1.00  52.95 ? 2009 HOH P O     1 
HETATM 3461 O  O     . HOH J 6 .   ? 23.164 29.188 5.569   1.00  60.77 ? 2010 HOH P O     1 
HETATM 3462 O  O     . HOH K 6 .   ? 45.620 27.788 6.973   1.00  61.21 ? 2001 HOH T O     1 
HETATM 3463 O  O     . HOH K 6 .   ? 23.138 24.914 27.034  1.00  42.03 ? 2002 HOH T O     1 
HETATM 3464 O  O     . HOH K 6 .   ? 24.510 28.880 27.300  1.00  33.61 ? 2003 HOH T O     1 
HETATM 3465 O  O     . HOH K 6 .   ? 41.317 27.866 2.618   1.00  47.11 ? 2004 HOH T O     1 
HETATM 3466 O  O     . HOH K 6 .   ? 40.276 33.736 16.290  1.00  33.96 ? 2005 HOH T O     1 
HETATM 3467 O  O     . HOH K 6 .   ? 37.009 29.598 11.769  1.00  43.69 ? 2006 HOH T O     1 
HETATM 3468 O  O     . HOH K 6 .   ? 44.158 38.935 16.114  1.00  35.57 ? 2007 HOH T O     1 
HETATM 3469 O  O     . HOH K 6 .   ? 35.116 30.283 15.472  1.00  51.04 ? 2008 HOH T O     1 
HETATM 3470 O  O     . HOH K 6 .   ? 35.002 34.395 20.985  1.00  36.53 ? 2009 HOH T O     1 
HETATM 3471 O  O     . HOH K 6 .   ? 36.205 39.962 16.498  1.00  39.53 ? 2010 HOH T O     1 
HETATM 3472 O  O     . HOH K 6 .   ? 22.232 27.028 25.158  1.00  47.72 ? 2011 HOH T O     1 
HETATM 3473 O  O     . HOH K 6 .   ? 31.387 13.880 26.435  1.00  35.93 ? 2012 HOH T O     1 
HETATM 3474 O  O     . HOH K 6 .   ? 22.219 7.977  22.802  1.00  41.99 ? 2013 HOH T O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   HIS 1   -5  ?   ?   ?   A . n 
A 1 2   HIS 2   -4  ?   ?   ?   A . n 
A 1 3   HIS 3   -3  ?   ?   ?   A . n 
A 1 4   HIS 4   -2  ?   ?   ?   A . n 
A 1 5   HIS 5   -1  ?   ?   ?   A . n 
A 1 6   HIS 6   0   0   HIS HIS A . n 
A 1 7   MET 7   1   1   MET MET A . n 
A 1 8   ILE 8   2   2   ILE ILE A . n 
A 1 9   VAL 9   3   3   VAL VAL A . n 
A 1 10  LEU 10  4   4   LEU LEU A . n 
A 1 11  PHE 11  5   5   PHE PHE A . n 
A 1 12  VAL 12  6   6   VAL VAL A . n 
A 1 13  ASP 13  7   7   ASP ASP A . n 
A 1 14  PHE 14  8   8   PHE PHE A . n 
A 1 15  ASP 15  9   9   ASP ASP A . n 
A 1 16  TYR 16  10  10  TYR TYR A . n 
A 1 17  PHE 17  11  11  PHE PHE A . n 
A 1 18  TYR 18  12  12  TYR TYR A . n 
A 1 19  ALA 19  13  13  ALA ALA A . n 
A 1 20  GLN 20  14  14  GLN GLN A . n 
A 1 21  VAL 21  15  15  VAL VAL A . n 
A 1 22  GLU 22  16  16  GLU GLU A . n 
A 1 23  GLU 23  17  17  GLU GLU A . n 
A 1 24  VAL 24  18  18  VAL VAL A . n 
A 1 25  LEU 25  19  19  LEU LEU A . n 
A 1 26  ASN 26  20  20  ASN ASN A . n 
A 1 27  PRO 27  21  21  PRO PRO A . n 
A 1 28  SER 28  22  22  SER SER A . n 
A 1 29  LEU 29  23  23  LEU LEU A . n 
A 1 30  LYS 30  24  24  LYS LYS A . n 
A 1 31  GLY 31  25  25  GLY GLY A . n 
A 1 32  LYS 32  26  26  LYS LYS A . n 
A 1 33  PRO 33  27  27  PRO PRO A . n 
A 1 34  VAL 34  28  28  VAL VAL A . n 
A 1 35  VAL 35  29  29  VAL VAL A . n 
A 1 36  VAL 36  30  30  VAL VAL A . n 
A 1 37  CYS 37  31  31  CYS CYS A . n 
A 1 38  VAL 38  32  32  VAL VAL A . n 
A 1 39  PHE 39  33  33  PHE PHE A . n 
A 1 40  SER 40  34  34  SER SER A . n 
A 1 41  GLY 41  35  35  GLY GLY A . n 
A 1 42  ARG 42  36  36  ARG ARG A . n 
A 1 43  PHE 43  37  37  PHE PHE A . n 
A 1 44  GLU 44  38  38  GLU GLU A . n 
A 1 45  ASP 45  39  39  ASP ASP A . n 
A 1 46  SER 46  40  40  SER SER A . n 
A 1 47  GLY 47  41  41  GLY GLY A . n 
A 1 48  ALA 48  42  42  ALA ALA A . n 
A 1 49  VAL 49  43  43  VAL VAL A . n 
A 1 50  ALA 50  44  44  ALA ALA A . n 
A 1 51  THR 51  45  45  THR THR A . n 
A 1 52  ALA 52  46  46  ALA ALA A . n 
A 1 53  ASN 53  47  47  ASN ASN A . n 
A 1 54  TYR 54  48  48  TYR TYR A . n 
A 1 55  GLU 55  49  49  GLU GLU A . n 
A 1 56  ALA 56  50  50  ALA ALA A . n 
A 1 57  ARG 57  51  51  ARG ARG A . n 
A 1 58  LYS 58  52  52  LYS LYS A . n 
A 1 59  PHE 59  53  53  PHE PHE A . n 
A 1 60  GLY 60  54  54  GLY GLY A . n 
A 1 61  VAL 61  55  55  VAL VAL A . n 
A 1 62  LYS 62  56  56  LYS LYS A . n 
A 1 63  ALA 63  57  57  ALA ALA A . n 
A 1 64  GLY 64  58  58  GLY GLY A . n 
A 1 65  ILE 65  59  59  ILE ILE A . n 
A 1 66  PRO 66  60  60  PRO PRO A . n 
A 1 67  ILE 67  61  61  ILE ILE A . n 
A 1 68  VAL 68  62  62  VAL VAL A . n 
A 1 69  GLU 69  63  63  GLU GLU A . n 
A 1 70  ALA 70  64  64  ALA ALA A . n 
A 1 71  LYS 71  65  65  LYS LYS A . n 
A 1 72  LYS 72  66  66  LYS LYS A . n 
A 1 73  ILE 73  67  67  ILE ILE A . n 
A 1 74  LEU 74  68  68  LEU LEU A . n 
A 1 75  PRO 75  69  69  PRO PRO A . n 
A 1 76  ASN 76  70  70  ASN ASN A . n 
A 1 77  ALA 77  71  71  ALA ALA A . n 
A 1 78  VAL 78  72  72  VAL VAL A . n 
A 1 79  TYR 79  73  73  TYR TYR A . n 
A 1 80  LEU 80  74  74  LEU LEU A . n 
A 1 81  PRO 81  75  75  PRO PRO A . n 
A 1 82  MET 82  76  76  MET MET A . n 
A 1 83  ARG 83  77  77  ARG ARG A . n 
A 1 84  LYS 84  78  78  LYS LYS A . n 
A 1 85  GLU 85  79  79  GLU GLU A . n 
A 1 86  VAL 86  80  80  VAL VAL A . n 
A 1 87  TYR 87  81  81  TYR TYR A . n 
A 1 88  GLN 88  82  82  GLN GLN A . n 
A 1 89  GLN 89  83  83  GLN GLN A . n 
A 1 90  VAL 90  84  84  VAL VAL A . n 
A 1 91  SER 91  85  85  SER SER A . n 
A 1 92  SER 92  86  86  SER SER A . n 
A 1 93  ARG 93  87  87  ARG ARG A . n 
A 1 94  ILE 94  88  88  ILE ILE A . n 
A 1 95  MET 95  89  89  MET MET A . n 
A 1 96  ASN 96  90  90  ASN ASN A . n 
A 1 97  LEU 97  91  91  LEU LEU A . n 
A 1 98  LEU 98  92  92  LEU LEU A . n 
A 1 99  ARG 99  93  93  ARG ARG A . n 
A 1 100 GLU 100 94  94  GLU GLU A . n 
A 1 101 TYR 101 95  95  TYR TYR A . n 
A 1 102 SER 102 96  96  SER SER A . n 
A 1 103 GLU 103 97  97  GLU GLU A . n 
A 1 104 LYS 104 98  98  LYS LYS A . n 
A 1 105 ILE 105 99  99  ILE ILE A . n 
A 1 106 GLU 106 100 100 GLU GLU A . n 
A 1 107 ILE 107 101 101 ILE ILE A . n 
A 1 108 ALA 108 102 102 ALA ALA A . n 
A 1 109 SER 109 103 103 SER SER A . n 
A 1 110 ILE 110 104 104 ILE ILE A . n 
A 1 111 ASP 111 105 105 ASP ASP A . n 
A 1 112 GLU 112 106 106 GLU GLU A . n 
A 1 113 ALA 113 107 107 ALA ALA A . n 
A 1 114 TYR 114 108 108 TYR TYR A . n 
A 1 115 LEU 115 109 109 LEU LEU A . n 
A 1 116 ASP 116 110 110 ASP ASP A . n 
A 1 117 ILE 117 111 111 ILE ILE A . n 
A 1 118 SER 118 112 112 SER SER A . n 
A 1 119 ASP 119 113 113 ASP ASP A . n 
A 1 120 LYS 120 114 114 LYS LYS A . n 
A 1 121 VAL 121 115 115 VAL VAL A . n 
A 1 122 ARG 122 116 116 ARG ARG A . n 
A 1 123 ASP 123 117 117 ASP ASP A . n 
A 1 124 TYR 124 118 118 TYR TYR A . n 
A 1 125 ARG 125 119 119 ARG ARG A . n 
A 1 126 GLU 126 120 120 GLU GLU A . n 
A 1 127 ALA 127 121 121 ALA ALA A . n 
A 1 128 TYR 128 122 122 TYR TYR A . n 
A 1 129 ASN 129 123 123 ASN ASN A . n 
A 1 130 LEU 130 124 124 LEU LEU A . n 
A 1 131 GLY 131 125 125 GLY GLY A . n 
A 1 132 LEU 132 126 126 LEU LEU A . n 
A 1 133 GLU 133 127 127 GLU GLU A . n 
A 1 134 ILE 134 128 128 ILE ILE A . n 
A 1 135 LYS 135 129 129 LYS LYS A . n 
A 1 136 ASN 136 130 130 ASN ASN A . n 
A 1 137 LYS 137 131 131 LYS LYS A . n 
A 1 138 ILE 138 132 132 ILE ILE A . n 
A 1 139 LEU 139 133 133 LEU LEU A . n 
A 1 140 GLU 140 134 134 GLU GLU A . n 
A 1 141 LYS 141 135 135 LYS LYS A . n 
A 1 142 GLU 142 136 136 GLU GLU A . n 
A 1 143 LYS 143 137 137 LYS LYS A . n 
A 1 144 ILE 144 138 138 ILE ILE A . n 
A 1 145 THR 145 139 139 THR THR A . n 
A 1 146 VAL 146 140 140 VAL VAL A . n 
A 1 147 THR 147 141 141 THR THR A . n 
A 1 148 VAL 148 142 142 VAL VAL A . n 
A 1 149 GLY 149 143 143 GLY GLY A . n 
A 1 150 ILE 150 144 144 ILE ILE A . n 
A 1 151 SER 151 145 145 SER SER A . n 
A 1 152 LYS 152 146 146 LYS LYS A . n 
A 1 153 ASN 153 147 147 ASN ASN A . n 
A 1 154 LYS 154 148 148 LYS LYS A . n 
A 1 155 VAL 155 149 149 VAL VAL A . n 
A 1 156 PHE 156 150 150 PHE PHE A . n 
A 1 157 ALA 157 151 151 ALA ALA A . n 
A 1 158 LYS 158 152 152 LYS LYS A . n 
A 1 159 ILE 159 153 153 ILE ILE A . n 
A 1 160 ALA 160 154 154 ALA ALA A . n 
A 1 161 ALA 161 155 155 ALA ALA A . n 
A 1 162 ASP 162 156 156 ASP ASP A . n 
A 1 163 MET 163 157 157 MET MET A . n 
A 1 164 ALA 164 158 158 ALA ALA A . n 
A 1 165 LYS 165 159 159 LYS LYS A . n 
A 1 166 PRO 166 160 160 PRO PRO A . n 
A 1 167 ASN 167 161 161 ASN ASN A . n 
A 1 168 GLY 168 162 162 GLY GLY A . n 
A 1 169 ILE 169 163 163 ILE ILE A . n 
A 1 170 LYS 170 164 164 LYS LYS A . n 
A 1 171 VAL 171 165 165 VAL VAL A . n 
A 1 172 ILE 172 166 166 ILE ILE A . n 
A 1 173 ASP 173 167 167 ASP ASP A . n 
A 1 174 ASP 174 168 168 ASP ASP A . n 
A 1 175 GLU 175 169 169 GLU GLU A . n 
A 1 176 GLU 176 170 170 GLU GLU A . n 
A 1 177 VAL 177 171 171 VAL VAL A . n 
A 1 178 LYS 178 172 172 LYS LYS A . n 
A 1 179 ARG 179 173 173 ARG ARG A . n 
A 1 180 LEU 180 174 174 LEU LEU A . n 
A 1 181 ILE 181 175 175 ILE ILE A . n 
A 1 182 ARG 182 176 176 ARG ARG A . n 
A 1 183 GLU 183 177 177 GLU GLU A . n 
A 1 184 LEU 184 178 178 LEU LEU A . n 
A 1 185 ASP 185 179 179 ASP ASP A . n 
A 1 186 ILE 186 180 180 ILE ILE A . n 
A 1 187 ALA 187 181 181 ALA ALA A . n 
A 1 188 ASP 188 182 182 ASP ASP A . n 
A 1 189 VAL 189 183 183 VAL VAL A . n 
A 1 190 PRO 190 184 184 PRO PRO A . n 
A 1 191 GLY 191 185 185 GLY GLY A . n 
A 1 192 ILE 192 186 186 ILE ILE A . n 
A 1 193 GLY 193 187 187 GLY GLY A . n 
A 1 194 ASN 194 188 188 ASN ASN A . n 
A 1 195 ILE 195 189 189 ILE ILE A . n 
A 1 196 THR 196 190 190 THR THR A . n 
A 1 197 ALA 197 191 191 ALA ALA A . n 
A 1 198 GLU 198 192 192 GLU GLU A . n 
A 1 199 LYS 199 193 193 LYS LYS A . n 
A 1 200 LEU 200 194 194 LEU LEU A . n 
A 1 201 LYS 201 195 195 LYS LYS A . n 
A 1 202 LYS 202 196 196 LYS LYS A . n 
A 1 203 LEU 203 197 197 LEU LEU A . n 
A 1 204 GLY 204 198 198 GLY GLY A . n 
A 1 205 ILE 205 199 199 ILE ILE A . n 
A 1 206 ASN 206 200 200 ASN ASN A . n 
A 1 207 LYS 207 201 201 LYS LYS A . n 
A 1 208 LEU 208 202 202 LEU LEU A . n 
A 1 209 VAL 209 203 203 VAL VAL A . n 
A 1 210 ASP 210 204 204 ASP ASP A . n 
A 1 211 THR 211 205 205 THR THR A . n 
A 1 212 LEU 212 206 206 LEU LEU A . n 
A 1 213 SER 213 207 207 SER SER A . n 
A 1 214 ILE 214 208 208 ILE ILE A . n 
A 1 215 GLU 215 209 209 GLU GLU A . n 
A 1 216 PHE 216 210 210 PHE PHE A . n 
A 1 217 ASP 217 211 211 ASP ASP A . n 
A 1 218 LYS 218 212 212 LYS LYS A . n 
A 1 219 LEU 219 213 213 LEU LEU A . n 
A 1 220 LYS 220 214 214 LYS LYS A . n 
A 1 221 GLY 221 215 215 GLY GLY A . n 
A 1 222 MET 222 216 216 MET MET A . n 
A 1 223 ILE 223 217 217 ILE ILE A . n 
A 1 224 GLY 224 218 218 GLY GLY A . n 
A 1 225 GLU 225 219 219 GLU GLU A . n 
A 1 226 ALA 226 220 220 ALA ALA A . n 
A 1 227 LYS 227 221 221 LYS LYS A . n 
A 1 228 ALA 228 222 222 ALA ALA A . n 
A 1 229 LYS 229 223 223 LYS LYS A . n 
A 1 230 TYR 230 224 224 TYR TYR A . n 
A 1 231 LEU 231 225 225 LEU LEU A . n 
A 1 232 ILE 232 226 226 ILE ILE A . n 
A 1 233 SER 233 227 227 SER SER A . n 
A 1 234 LEU 234 228 228 LEU LEU A . n 
A 1 235 ALA 235 229 229 ALA ALA A . n 
A 1 236 ARG 236 230 230 ARG ARG A . n 
A 1 237 ASP 237 231 231 ASP ASP A . n 
A 1 238 GLU 238 232 232 GLU GLU A . n 
A 1 239 TYR 239 233 233 TYR TYR A . n 
A 1 240 ASN 240 234 234 ASN ASN A . n 
A 1 241 GLU 241 235 235 GLU GLU A . n 
A 1 242 PRO 242 236 236 PRO PRO A . n 
A 1 243 ILE 243 237 237 ILE ILE A . n 
A 1 244 ARG 244 238 238 ARG ARG A . n 
A 1 245 THR 245 239 239 THR THR A . n 
A 1 246 ARG 246 240 240 ARG ARG A . n 
A 1 247 VAL 247 241 241 VAL VAL A . n 
A 1 248 ARG 248 242 242 ARG ARG A . n 
A 1 249 LYS 249 243 243 LYS LYS A . n 
A 1 250 SER 250 244 244 SER SER A . n 
A 1 251 ILE 251 245 245 ILE ILE A . n 
A 1 252 GLY 252 246 246 GLY GLY A . n 
A 1 253 ARG 253 247 247 ARG ARG A . n 
A 1 254 ILE 254 248 248 ILE ILE A . n 
A 1 255 VAL 255 249 249 VAL VAL A . n 
A 1 256 THR 256 250 250 THR THR A . n 
A 1 257 MET 257 251 251 MET MET A . n 
A 1 258 LYS 258 252 252 LYS LYS A . n 
A 1 259 ARG 259 253 253 ARG ARG A . n 
A 1 260 ASN 260 254 254 ASN ASN A . n 
A 1 261 SER 261 255 255 SER SER A . n 
A 1 262 ARG 262 256 256 ARG ARG A . n 
A 1 263 ASN 263 257 257 ASN ASN A . n 
A 1 264 LEU 264 258 258 LEU LEU A . n 
A 1 265 GLU 265 259 259 GLU GLU A . n 
A 1 266 GLU 266 260 260 GLU GLU A . n 
A 1 267 ILE 267 261 261 ILE ILE A . n 
A 1 268 LYS 268 262 262 LYS LYS A . n 
A 1 269 PRO 269 263 263 PRO PRO A . n 
A 1 270 TYR 270 264 264 TYR TYR A . n 
A 1 271 LEU 271 265 265 LEU LEU A . n 
A 1 272 PHE 272 266 266 PHE PHE A . n 
A 1 273 ARG 273 267 267 ARG ARG A . n 
A 1 274 ALA 274 268 268 ALA ALA A . n 
A 1 275 ILE 275 269 269 ILE ILE A . n 
A 1 276 GLU 276 270 270 GLU GLU A . n 
A 1 277 GLU 277 271 271 GLU GLU A . n 
A 1 278 SER 278 272 272 SER SER A . n 
A 1 279 TYR 279 273 273 TYR TYR A . n 
A 1 280 TYR 280 274 274 TYR TYR A . n 
A 1 281 LYS 281 275 275 LYS LYS A . n 
A 1 282 LEU 282 276 276 LEU LEU A . n 
A 1 283 ASP 283 277 277 ASP ASP A . n 
A 1 284 LYS 284 278 278 LYS LYS A . n 
A 1 285 ARG 285 279 279 ARG ARG A . n 
A 1 286 ILE 286 280 280 ILE ILE A . n 
A 1 287 PRO 287 281 281 PRO PRO A . n 
A 1 288 LYS 288 282 282 LYS LYS A . n 
A 1 289 ALA 289 283 283 ALA ALA A . n 
A 1 290 ILE 290 284 284 ILE ILE A . n 
A 1 291 HIS 291 285 285 HIS HIS A . n 
A 1 292 VAL 292 286 286 VAL VAL A . n 
A 1 293 VAL 293 287 287 VAL VAL A . n 
A 1 294 ALA 294 288 288 ALA ALA A . n 
A 1 295 VAL 295 289 289 VAL VAL A . n 
A 1 296 THR 296 290 290 THR THR A . n 
A 1 297 GLU 297 291 291 GLU GLU A . n 
A 1 298 ASP 298 292 292 ASP ASP A . n 
A 1 299 LEU 299 293 293 LEU LEU A . n 
A 1 300 ASP 300 294 294 ASP ASP A . n 
A 1 301 ILE 301 295 295 ILE ILE A . n 
A 1 302 VAL 302 296 296 VAL VAL A . n 
A 1 303 SER 303 297 297 SER SER A . n 
A 1 304 ARG 304 298 298 ARG ARG A . n 
A 1 305 GLY 305 299 299 GLY GLY A . n 
A 1 306 ARG 306 300 300 ARG ARG A . n 
A 1 307 THR 307 301 301 THR THR A . n 
A 1 308 PHE 308 302 302 PHE PHE A . n 
A 1 309 PRO 309 303 303 PRO PRO A . n 
A 1 310 HIS 310 304 304 HIS HIS A . n 
A 1 311 GLY 311 305 305 GLY GLY A . n 
A 1 312 ILE 312 306 306 ILE ILE A . n 
A 1 313 SER 313 307 307 SER SER A . n 
A 1 314 LYS 314 308 308 LYS LYS A . n 
A 1 315 GLU 315 309 309 GLU GLU A . n 
A 1 316 THR 316 310 310 THR THR A . n 
A 1 317 ALA 317 311 311 ALA ALA A . n 
A 1 318 TYR 318 312 312 TYR TYR A . n 
A 1 319 SER 319 313 313 SER SER A . n 
A 1 320 GLU 320 314 314 GLU GLU A . n 
A 1 321 SER 321 315 315 SER SER A . n 
A 1 322 VAL 322 316 316 VAL VAL A . n 
A 1 323 LYS 323 317 317 LYS LYS A . n 
A 1 324 LEU 324 318 318 LEU LEU A . n 
A 1 325 LEU 325 319 319 LEU LEU A . n 
A 1 326 GLN 326 320 320 GLN GLN A . n 
A 1 327 LYS 327 321 321 LYS LYS A . n 
A 1 328 ILE 328 322 322 ILE ILE A . n 
A 1 329 LEU 329 323 323 LEU LEU A . n 
A 1 330 GLU 330 324 324 GLU GLU A . n 
A 1 331 GLU 331 325 325 GLU GLU A . n 
A 1 332 ASP 332 326 326 ASP ASP A . n 
A 1 333 GLU 333 327 327 GLU GLU A . n 
A 1 334 ARG 334 328 328 ARG ARG A . n 
A 1 335 LYS 335 329 329 LYS LYS A . n 
A 1 336 ILE 336 330 330 ILE ILE A . n 
A 1 337 ARG 337 331 331 ARG ARG A . n 
A 1 338 ARG 338 332 332 ARG ARG A . n 
A 1 339 ILE 339 333 333 ILE ILE A . n 
A 1 340 GLY 340 334 334 GLY GLY A . n 
A 1 341 VAL 341 335 335 VAL VAL A . n 
A 1 342 ARG 342 336 336 ARG ARG A . n 
A 1 343 PHE 343 337 337 PHE PHE A . n 
A 1 344 SER 344 338 338 SER SER A . n 
A 1 345 LYS 345 339 339 LYS LYS A . n 
A 1 346 PHE 346 340 340 PHE PHE A . n 
A 1 347 ILE 347 341 341 ILE ILE A . n 
A 1 348 GLU 348 342 342 GLU GLU A . n 
A 1 349 ALA 349 343 ?   ?   ?   A . n 
A 1 350 ILE 350 344 ?   ?   ?   A . n 
A 1 351 GLY 351 345 ?   ?   ?   A . n 
A 1 352 LEU 352 346 ?   ?   ?   A . n 
A 1 353 ASP 353 347 ?   ?   ?   A . n 
A 1 354 LYS 354 348 ?   ?   ?   A . n 
A 1 355 PHE 355 349 ?   ?   ?   A . n 
A 1 356 PHE 356 350 ?   ?   ?   A . n 
A 1 357 ASP 357 351 ?   ?   ?   A . n 
A 1 358 THR 358 352 ?   ?   ?   A . n 
B 2 1   DG  1   1   1   DG  DG  P . n 
B 2 2   DG  2   2   2   DG  DG  P . n 
B 2 3   DG  3   3   3   DG  DG  P . n 
B 2 4   DG  4   4   4   DG  DG  P . n 
B 2 5   DG  5   5   5   DG  DG  P . n 
B 2 6   DA  6   6   6   DA  DA  P . n 
B 2 7   DA  7   7   7   DA  DA  P . n 
B 2 8   DG  8   8   8   DG  DG  P . n 
B 2 9   DG  9   9   9   DG  DG  P . n 
B 2 10  DA  10  10  10  DA  DA  P . n 
B 2 11  DT  11  11  11  DT  DT  P . n 
B 2 12  DT  12  12  12  DT  DT  P . n 
B 2 13  DC  13  13  13  DC  DC  P . n 
B 2 14  DOC 14  14  14  DOC DOC P . n 
C 3 1   DT  1   1   ?   ?   ?   T . n 
C 3 2   DC  2   2   ?   ?   ?   T . n 
C 3 3   DA  3   3   3   DA  DA  T . n 
C 3 4   DC  4   4   4   DC  DC  T . n 
C 3 5   O2G 5   5   5   O2G O2G T . n 
C 3 6   DG  6   6   6   DG  DG  T . n 
C 3 7   DA  7   7   7   DA  DA  T . n 
C 3 8   DA  8   8   8   DA  DA  T . n 
C 3 9   DT  9   9   9   DT  DT  T . n 
C 3 10  DC  10  10  10  DC  DC  T . n 
C 3 11  DC  11  11  11  DC  DC  T . n 
C 3 12  DT  12  12  12  DT  DT  T . n 
C 3 13  DT  13  13  13  DT  DT  T . n 
C 3 14  DC  14  14  14  DC  DC  T . n 
C 3 15  DC  15  15  15  DC  DC  T . n 
C 3 16  DC  16  16  16  DC  DC  T . n 
C 3 17  DC  17  17  17  DC  DC  T . n 
C 3 18  DC  18  18  18  DC  DC  T . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 DGT 1  594  594  DGT DGT A . 
E 5 MG  1  1000 1000 MG  MG  A . 
F 5 MG  1  1001 1001 MG  MG  A . 
G 5 MG  1  1002 1002 MG  MG  A . 
H 5 MG  1  1003 1003 MG  MG  A . 
I 6 HOH 1  2001 2001 HOH HOH A . 
I 6 HOH 2  2002 2002 HOH HOH A . 
I 6 HOH 3  2003 2003 HOH HOH A . 
I 6 HOH 4  2004 2004 HOH HOH A . 
I 6 HOH 5  2005 2005 HOH HOH A . 
I 6 HOH 6  2006 2006 HOH HOH A . 
I 6 HOH 7  2007 2007 HOH HOH A . 
I 6 HOH 8  2008 2008 HOH HOH A . 
I 6 HOH 9  2009 2009 HOH HOH A . 
I 6 HOH 10 2010 2010 HOH HOH A . 
I 6 HOH 11 2011 2011 HOH HOH A . 
I 6 HOH 12 2012 2012 HOH HOH A . 
I 6 HOH 13 2013 2013 HOH HOH A . 
I 6 HOH 14 2014 2014 HOH HOH A . 
I 6 HOH 15 2015 2015 HOH HOH A . 
I 6 HOH 16 2016 2016 HOH HOH A . 
I 6 HOH 17 2017 2017 HOH HOH A . 
I 6 HOH 18 2018 2018 HOH HOH A . 
I 6 HOH 19 2019 2019 HOH HOH A . 
I 6 HOH 20 2020 2020 HOH HOH A . 
I 6 HOH 21 2021 2021 HOH HOH A . 
I 6 HOH 22 2022 2022 HOH HOH A . 
I 6 HOH 23 2023 2023 HOH HOH A . 
I 6 HOH 24 2024 2024 HOH HOH A . 
I 6 HOH 25 2025 2025 HOH HOH A . 
I 6 HOH 26 2026 2026 HOH HOH A . 
I 6 HOH 27 2027 2027 HOH HOH A . 
I 6 HOH 28 2028 2028 HOH HOH A . 
I 6 HOH 29 2029 2029 HOH HOH A . 
I 6 HOH 30 2030 2030 HOH HOH A . 
I 6 HOH 31 2031 2031 HOH HOH A . 
I 6 HOH 32 2032 2032 HOH HOH A . 
I 6 HOH 33 2033 2033 HOH HOH A . 
I 6 HOH 34 2034 2034 HOH HOH A . 
I 6 HOH 35 2035 2035 HOH HOH A . 
I 6 HOH 36 2036 2036 HOH HOH A . 
I 6 HOH 37 2037 2037 HOH HOH A . 
I 6 HOH 38 2038 2038 HOH HOH A . 
I 6 HOH 39 2039 2039 HOH HOH A . 
I 6 HOH 40 2040 2040 HOH HOH A . 
I 6 HOH 41 2041 2041 HOH HOH A . 
I 6 HOH 42 2042 2042 HOH HOH A . 
J 6 HOH 1  2001 2001 HOH HOH P . 
J 6 HOH 2  2002 2002 HOH HOH P . 
J 6 HOH 3  2003 2003 HOH HOH P . 
J 6 HOH 4  2004 2004 HOH HOH P . 
J 6 HOH 5  2005 2005 HOH HOH P . 
J 6 HOH 6  2006 2006 HOH HOH P . 
J 6 HOH 7  2007 2007 HOH HOH P . 
J 6 HOH 8  2008 2008 HOH HOH P . 
J 6 HOH 9  2009 2009 HOH HOH P . 
J 6 HOH 10 2010 2010 HOH HOH P . 
K 6 HOH 1  2001 2001 HOH HOH T . 
K 6 HOH 2  2002 2002 HOH HOH T . 
K 6 HOH 3  2003 2003 HOH HOH T . 
K 6 HOH 4  2004 2004 HOH HOH T . 
K 6 HOH 5  2005 2005 HOH HOH T . 
K 6 HOH 6  2006 2006 HOH HOH T . 
K 6 HOH 7  2007 2007 HOH HOH T . 
K 6 HOH 8  2008 2008 HOH HOH T . 
K 6 HOH 9  2009 2009 HOH HOH T . 
K 6 HOH 10 2010 2010 HOH HOH T . 
K 6 HOH 11 2011 2011 HOH HOH T . 
K 6 HOH 12 2012 2012 HOH HOH T . 
K 6 HOH 13 2013 2013 HOH HOH T . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 B DOC 14 P DOC 14 ? DC "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE" 
2 C O2G 5  T O2G 5  ? G  ?                                        
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5780  ? 
1 MORE         -69   ? 
1 'SSA (A^2)'  20260 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? I HOH .   ? A HOH 2040 ? 1_555 MG ? E MG . ? A MG 1000 ? 1_555 OE1 ? A GLU 112 ? A GLU 106  ? 1_555 85.7  ? 
2  O   ? I HOH .   ? A HOH 2040 ? 1_555 MG ? E MG . ? A MG 1000 ? 1_555 O   ? J HOH .   ? P HOH 2009 ? 1_555 58.8  ? 
3  OE1 ? A GLU 112 ? A GLU 106  ? 1_555 MG ? E MG . ? A MG 1000 ? 1_555 O   ? J HOH .   ? P HOH 2009 ? 1_555 93.8  ? 
4  O   ? I HOH .   ? A HOH 2040 ? 1_555 MG ? E MG . ? A MG 1000 ? 1_555 OD1 ? A ASP 13  ? A ASP 7    ? 1_555 95.8  ? 
5  OE1 ? A GLU 112 ? A GLU 106  ? 1_555 MG ? E MG . ? A MG 1000 ? 1_555 OD1 ? A ASP 13  ? A ASP 7    ? 1_555 91.4  ? 
6  O   ? J HOH .   ? P HOH 2009 ? 1_555 MG ? E MG . ? A MG 1000 ? 1_555 OD1 ? A ASP 13  ? A ASP 7    ? 1_555 153.5 ? 
7  O   ? I HOH .   ? A HOH 2040 ? 1_555 MG ? E MG . ? A MG 1000 ? 1_555 O2A ? D DGT .   ? A DGT 594  ? 1_555 64.5  ? 
8  OE1 ? A GLU 112 ? A GLU 106  ? 1_555 MG ? E MG . ? A MG 1000 ? 1_555 O2A ? D DGT .   ? A DGT 594  ? 1_555 150.2 ? 
9  O   ? J HOH .   ? P HOH 2009 ? 1_555 MG ? E MG . ? A MG 1000 ? 1_555 O2A ? D DGT .   ? A DGT 594  ? 1_555 71.7  ? 
10 OD1 ? A ASP 13  ? A ASP 7    ? 1_555 MG ? E MG . ? A MG 1000 ? 1_555 O2A ? D DGT .   ? A DGT 594  ? 1_555 91.3  ? 
11 O   ? I HOH .   ? A HOH 2040 ? 1_555 MG ? E MG . ? A MG 1000 ? 1_555 OD1 ? A ASP 111 ? A ASP 105  ? 1_555 158.5 ? 
12 OE1 ? A GLU 112 ? A GLU 106  ? 1_555 MG ? E MG . ? A MG 1000 ? 1_555 OD1 ? A ASP 111 ? A ASP 105  ? 1_555 115.7 ? 
13 O   ? J HOH .   ? P HOH 2009 ? 1_555 MG ? E MG . ? A MG 1000 ? 1_555 OD1 ? A ASP 111 ? A ASP 105  ? 1_555 117.8 ? 
14 OD1 ? A ASP 13  ? A ASP 7    ? 1_555 MG ? E MG . ? A MG 1000 ? 1_555 OD1 ? A ASP 111 ? A ASP 105  ? 1_555 82.7  ? 
15 O2A ? D DGT .   ? A DGT 594  ? 1_555 MG ? E MG . ? A MG 1000 ? 1_555 OD1 ? A ASP 111 ? A ASP 105  ? 1_555 94.1  ? 
16 O2A ? D DGT .   ? A DGT 594  ? 1_555 MG ? F MG . ? A MG 1001 ? 1_555 O1B ? D DGT .   ? A DGT 594  ? 1_555 88.8  ? 
17 O2A ? D DGT .   ? A DGT 594  ? 1_555 MG ? F MG . ? A MG 1001 ? 1_555 O3G ? D DGT .   ? A DGT 594  ? 1_555 91.2  ? 
18 O1B ? D DGT .   ? A DGT 594  ? 1_555 MG ? F MG . ? A MG 1001 ? 1_555 O3G ? D DGT .   ? A DGT 594  ? 1_555 80.6  ? 
19 O2A ? D DGT .   ? A DGT 594  ? 1_555 MG ? F MG . ? A MG 1001 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 80.4  ? 
20 O1B ? D DGT .   ? A DGT 594  ? 1_555 MG ? F MG . ? A MG 1001 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 94.6  ? 
21 O3G ? D DGT .   ? A DGT 594  ? 1_555 MG ? F MG . ? A MG 1001 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 170.4 ? 
22 O2A ? D DGT .   ? A DGT 594  ? 1_555 MG ? F MG . ? A MG 1001 ? 1_555 O   ? A PHE 14  ? A PHE 8    ? 1_555 164.4 ? 
23 O1B ? D DGT .   ? A DGT 594  ? 1_555 MG ? F MG . ? A MG 1001 ? 1_555 O   ? A PHE 14  ? A PHE 8    ? 1_555 94.3  ? 
24 O3G ? D DGT .   ? A DGT 594  ? 1_555 MG ? F MG . ? A MG 1001 ? 1_555 O   ? A PHE 14  ? A PHE 8    ? 1_555 104.3 ? 
25 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 MG ? F MG . ? A MG 1001 ? 1_555 O   ? A PHE 14  ? A PHE 8    ? 1_555 84.2  ? 
26 O2A ? D DGT .   ? A DGT 594  ? 1_555 MG ? F MG . ? A MG 1001 ? 1_555 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 96.0  ? 
27 O1B ? D DGT .   ? A DGT 594  ? 1_555 MG ? F MG . ? A MG 1001 ? 1_555 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 163.2 ? 
28 O3G ? D DGT .   ? A DGT 594  ? 1_555 MG ? F MG . ? A MG 1001 ? 1_555 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 83.3  ? 
29 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 MG ? F MG . ? A MG 1001 ? 1_555 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 102.1 ? 
30 O   ? A PHE 14  ? A PHE 8    ? 1_555 MG ? F MG . ? A MG 1001 ? 1_555 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 85.4  ? 
31 O   ? A ALA 187 ? A ALA 181  ? 1_555 MG ? G MG . ? A MG 1002 ? 1_555 O   ? A ILE 192 ? A ILE 186  ? 1_555 92.8  ? 
32 O   ? A ALA 187 ? A ALA 181  ? 1_555 MG ? G MG . ? A MG 1002 ? 1_555 O   ? J HOH .   ? P HOH 2006 ? 1_555 174.5 ? 
33 O   ? A ILE 192 ? A ILE 186  ? 1_555 MG ? G MG . ? A MG 1002 ? 1_555 O   ? J HOH .   ? P HOH 2006 ? 1_555 81.7  ? 
34 O   ? A ALA 187 ? A ALA 181  ? 1_555 MG ? G MG . ? A MG 1002 ? 1_555 O   ? I HOH .   ? A HOH 2023 ? 1_555 81.4  ? 
35 O   ? A ILE 192 ? A ILE 186  ? 1_555 MG ? G MG . ? A MG 1002 ? 1_555 O   ? I HOH .   ? A HOH 2023 ? 1_555 79.3  ? 
36 O   ? J HOH .   ? P HOH 2006 ? 1_555 MG ? G MG . ? A MG 1002 ? 1_555 O   ? I HOH .   ? A HOH 2023 ? 1_555 97.6  ? 
37 O   ? A ALA 187 ? A ALA 181  ? 1_555 MG ? G MG . ? A MG 1002 ? 1_555 O   ? I HOH .   ? A HOH 2020 ? 1_555 83.6  ? 
38 O   ? A ILE 192 ? A ILE 186  ? 1_555 MG ? G MG . ? A MG 1002 ? 1_555 O   ? I HOH .   ? A HOH 2020 ? 1_555 174.7 ? 
39 O   ? J HOH .   ? P HOH 2006 ? 1_555 MG ? G MG . ? A MG 1002 ? 1_555 O   ? I HOH .   ? A HOH 2020 ? 1_555 101.9 ? 
40 O   ? I HOH .   ? A HOH 2023 ? 1_555 MG ? G MG . ? A MG 1002 ? 1_555 O   ? I HOH .   ? A HOH 2020 ? 1_555 96.3  ? 
41 O   ? I HOH .   ? A HOH 2042 ? 1_555 MG ? H MG . ? A MG 1003 ? 1_555 O   ? I HOH .   ? A HOH 2041 ? 1_555 66.3  ? 
42 O   ? I HOH .   ? A HOH 2042 ? 1_555 MG ? H MG . ? A MG 1003 ? 1_555 O   ? I HOH .   ? A HOH 2039 ? 1_555 93.5  ? 
43 O   ? I HOH .   ? A HOH 2041 ? 1_555 MG ? H MG . ? A MG 1003 ? 1_555 O   ? I HOH .   ? A HOH 2039 ? 1_555 56.3  ? 
44 O   ? I HOH .   ? A HOH 2042 ? 1_555 MG ? H MG . ? A MG 1003 ? 1_555 O1A ? D DGT .   ? A DGT 594  ? 1_555 83.1  ? 
45 O   ? I HOH .   ? A HOH 2041 ? 1_555 MG ? H MG . ? A MG 1003 ? 1_555 O1A ? D DGT .   ? A DGT 594  ? 1_555 122.4 ? 
46 O   ? I HOH .   ? A HOH 2039 ? 1_555 MG ? H MG . ? A MG 1003 ? 1_555 O1A ? D DGT .   ? A DGT 594  ? 1_555 79.9  ? 
47 O   ? I HOH .   ? A HOH 2042 ? 1_555 MG ? H MG . ? A MG 1003 ? 1_555 OP2 ? B DOC 14  ? P DOC 14   ? 1_555 178.9 ? 
48 O   ? I HOH .   ? A HOH 2041 ? 1_555 MG ? H MG . ? A MG 1003 ? 1_555 OP2 ? B DOC 14  ? P DOC 14   ? 1_555 114.1 ? 
49 O   ? I HOH .   ? A HOH 2039 ? 1_555 MG ? H MG . ? A MG 1003 ? 1_555 OP2 ? B DOC 14  ? P DOC 14   ? 1_555 87.5  ? 
50 O1A ? D DGT .   ? A DGT 594  ? 1_555 MG ? H MG . ? A MG 1003 ? 1_555 OP2 ? B DOC 14  ? P DOC 14   ? 1_555 97.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-05-12 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS    refinement       1.2 ? 1 
XDS    'data reduction' .   ? 2 
XDS    'data scaling'   .   ? 3 
MOLREP phasing          .   ? 4 
# 
_pdbx_entry_details.entry_id             2W9A 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;ENGINEERED HEXA-HISTIDINE TAG AND LAST 11 RESIDUES ARE
DISORDERED
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 MET A 1   ? ? 171.00  131.96  
2  1 TYR A 10  ? ? 29.39   43.17   
3  1 PHE A 11  ? ? -25.41  -65.93  
4  1 ASN A 20  ? ? -150.30 79.84   
5  1 GLU A 38  ? ? 7.66    -83.13  
6  1 SER A 96  ? ? -176.58 137.48  
7  1 ASP A 113 ? ? -83.05  36.14   
8  1 ASP A 117 ? ? 77.92   150.16  
9  1 ARG A 230 ? ? -67.01  2.91    
10 1 ASN A 234 ? ? -152.99 33.60   
11 1 ASP A 277 ? ? 64.44   -117.59 
12 1 ASP A 292 ? ? -90.36  36.42   
13 1 LEU A 293 ? ? 46.03   28.23   
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    ARG 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     247 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    A 
_pdbx_validate_planes.rmsd            0.163 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 342 ? CA  ? A GLU 348 CA  
2  1 Y 1 A GLU 342 ? C   ? A GLU 348 C   
3  1 Y 1 A GLU 342 ? O   ? A GLU 348 O   
4  1 Y 1 A GLU 342 ? CB  ? A GLU 348 CB  
5  1 Y 1 A GLU 342 ? CG  ? A GLU 348 CG  
6  1 Y 1 A GLU 342 ? CD  ? A GLU 348 CD  
7  1 Y 1 A GLU 342 ? OE1 ? A GLU 348 OE1 
8  1 Y 1 A GLU 342 ? OE2 ? A GLU 348 OE2 
9  1 Y 1 T DA  3   ? P   ? C DA  3   P   
10 1 Y 1 T DA  3   ? OP1 ? C DA  3   OP1 
11 1 Y 1 T DA  3   ? OP2 ? C DA  3   OP2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A HIS -5  ? A HIS 1   
2  1 Y 1 A HIS -4  ? A HIS 2   
3  1 Y 1 A HIS -3  ? A HIS 3   
4  1 Y 1 A HIS -2  ? A HIS 4   
5  1 Y 1 A HIS -1  ? A HIS 5   
6  1 Y 1 A ALA 343 ? A ALA 349 
7  1 Y 1 A ILE 344 ? A ILE 350 
8  1 Y 1 A GLY 345 ? A GLY 351 
9  1 Y 1 A LEU 346 ? A LEU 352 
10 1 Y 1 A ASP 347 ? A ASP 353 
11 1 Y 1 A LYS 348 ? A LYS 354 
12 1 Y 1 A PHE 349 ? A PHE 355 
13 1 Y 1 A PHE 350 ? A PHE 356 
14 1 Y 1 A ASP 351 ? A ASP 357 
15 1 Y 1 A THR 352 ? A THR 358 
16 1 Y 1 T DT  1   ? C DT  1   
17 1 Y 1 T DC  2   ? C DC  2   
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2W9A 'double helix'        
2W9A 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 1  1_555 C DC 18 1_555 -0.349 -0.015 -0.213 -7.572 3.065   -1.241 1  P_DG1:DC18_T P 1  ? T 18 ? 19 1 
1 B DG 2  1_555 C DC 17 1_555 0.033  -0.019 -0.507 -2.640 -5.332  3.306  2  P_DG2:DC17_T P 2  ? T 17 ? 19 1 
1 B DG 3  1_555 C DC 16 1_555 0.089  0.048  -0.222 2.465  -5.007  -3.219 3  P_DG3:DC16_T P 3  ? T 16 ? 19 1 
1 B DG 4  1_555 C DC 15 1_555 -0.249 -0.446 0.227  9.466  -2.235  0.521  4  P_DG4:DC15_T P 4  ? T 15 ? 19 1 
1 B DG 5  1_555 C DC 14 1_555 0.476  -0.085 0.018  4.059  -5.237  -1.309 5  P_DG5:DC14_T P 5  ? T 14 ? 19 1 
1 B DA 6  1_555 C DT 13 1_555 0.384  0.085  -0.168 2.088  -14.119 -4.027 6  P_DA6:DT13_T P 6  ? T 13 ? 20 1 
1 B DA 7  1_555 C DT 12 1_555 0.513  0.010  0.222  0.969  -8.019  -0.715 7  P_DA7:DT12_T P 7  ? T 12 ? 20 1 
1 B DG 8  1_555 C DC 11 1_555 0.112  0.142  0.185  4.340  -5.185  1.116  8  P_DG8:DC11_T P 8  ? T 11 ? 19 1 
1 B DG 9  1_555 C DC 10 1_555 -0.248 -0.169 -0.081 -4.129 -10.560 -1.349 9  P_DG9:DC10_T P 9  ? T 10 ? 19 1 
1 B DA 10 1_555 C DT 9  1_555 0.263  0.086  -0.028 -9.352 -13.094 5.153  10 P_DA10:DT9_T P 10 ? T 9  ? 20 1 
1 B DT 11 1_555 C DA 8  1_555 -0.103 0.083  0.069  -2.465 -3.266  -0.521 11 P_DT11:DA8_T P 11 ? T 8  ? 20 1 
1 B DT 12 1_555 C DA 7  1_555 -0.436 -0.041 -0.352 0.851  3.109   1.440  12 P_DT12:DA7_T P 12 ? T 7  ? 20 1 
1 B DC 13 1_555 C DG 6  1_555 0.178  0.082  -0.319 10.676 18.743  3.366  13 P_DC13:DG6_T P 13 ? T 6  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 1  1_555 C DC 18 1_555 B DG 2  1_555 C DC 17 1_555 0.819  0.226  3.261 2.704  12.119 31.321 -1.634 -0.963 3.186 21.423 
-4.781 33.635 1  PP_DG1DG2:DC17DC18_TT P 1  ? T 18 ? P 2  ? T 17 ? 
1 B DG 2  1_555 C DC 17 1_555 B DG 3  1_555 C DC 16 1_555 -1.795 0.072  3.217 -7.909 3.008  32.390 -0.396 1.747  3.537 5.282  
13.884 33.448 2  PP_DG2DG3:DC16DC17_TT P 2  ? T 17 ? P 3  ? T 16 ? 
1 B DG 3  1_555 C DC 16 1_555 B DG 4  1_555 C DC 15 1_555 0.345  -0.274 3.108 -3.523 8.489  29.459 -2.061 -1.290 2.860 16.203 
6.725  30.830 3  PP_DG3DG4:DC15DC16_TT P 3  ? T 16 ? P 4  ? T 15 ? 
1 B DG 4  1_555 C DC 15 1_555 B DG 5  1_555 C DC 14 1_555 -0.074 -0.863 3.505 1.370  7.750  32.204 -2.873 0.370  3.210 13.717 
-2.425 33.128 4  PP_DG4DG5:DC14DC15_TT P 4  ? T 15 ? P 5  ? T 14 ? 
1 B DG 5  1_555 C DC 14 1_555 B DA 6  1_555 C DT 13 1_555 -0.484 -0.385 3.369 0.972  4.093  32.990 -1.371 1.011  3.284 7.172  
-1.703 33.250 5  PP_DG5DA6:DT13DC14_TT P 5  ? T 14 ? P 6  ? T 13 ? 
1 B DA 6  1_555 C DT 13 1_555 B DA 7  1_555 C DT 12 1_555 -0.164 -0.541 3.197 -5.043 6.169  33.088 -1.878 -0.499 3.041 10.642 
8.698  34.008 6  PP_DA6DA7:DT12DT13_TT P 6  ? T 13 ? P 7  ? T 12 ? 
1 B DA 7  1_555 C DT 12 1_555 B DG 8  1_555 C DC 11 1_555 0.057  -0.222 3.354 1.196  1.465  33.579 -0.628 0.101  3.342 2.533  
-2.069 33.631 7  PP_DA7DG8:DC11DT12_TT P 7  ? T 12 ? P 8  ? T 11 ? 
1 B DG 8  1_555 C DC 11 1_555 B DG 9  1_555 C DC 10 1_555 0.441  -0.937 3.490 1.412  5.232  30.046 -2.869 -0.543 3.300 9.989  
-2.696 30.520 8  PP_DG8DG9:DC10DC11_TT P 8  ? T 11 ? P 9  ? T 10 ? 
1 B DG 9  1_555 C DC 10 1_555 B DA 10 1_555 C DT 9  1_555 -0.325 -0.274 3.443 1.534  -2.160 38.511 -0.134 0.691  3.438 -3.270 
-2.322 38.599 9  PP_DG9DA10:DT9DC10_TT P 9  ? T 10 ? P 10 ? T 9  ? 
1 B DA 10 1_555 C DT 9  1_555 B DT 11 1_555 C DA 8  1_555 0.083  -0.640 3.218 -1.227 4.539  27.152 -2.418 -0.465 3.066 9.576  
2.590  27.549 10 PP_DA10DT11:DA8DT9_TT P 10 ? T 9  ? P 11 ? T 8  ? 
1 B DT 11 1_555 C DA 8  1_555 B DT 12 1_555 C DA 7  1_555 0.892  -0.485 3.263 3.216  3.283  32.993 -1.396 -1.019 3.271 5.745  
-5.628 33.303 11 PP_DT11DT12:DA7DA8_TT P 11 ? T 8  ? P 12 ? T 7  ? 
1 B DT 12 1_555 C DA 7  1_555 B DC 13 1_555 C DG 6  1_555 0.023  -0.368 3.334 -0.653 14.085 23.260 -4.308 -0.212 2.674 31.495 
1.460  27.149 12 PP_DT12DC13:DG6DA7_TT P 12 ? T 7  ? P 13 ? T 6  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE" DGT 
5 'MAGNESIUM ION'                     MG  
6 water                               HOH 
#